data_1KCX
# 
_entry.id   1KCX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KCX         
RCSB  RCSB014822   
WWPDB D_1000014822 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          NYSGXRC-T45 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KCX 
_pdbx_database_status.recvd_initial_deposition_date   2001-11-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Deo, R.C.'                                                      1 
'Schmidt, E.F.'                                                  2 
'Strittmatter, S.M.'                                             3 
'Burley, S.K.'                                                   4 
'New York SGX Research Center for Structural Genomics (NYSGXRC)' 5 
# 
_citation.id                        primary 
_citation.title                     'Structural bases for CRMP function in plexin-dependent semaphorin3A signaling' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            23 
_citation.page_first                9 
_citation.page_last                 22 
_citation.year                      2004 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14685275 
_citation.pdbx_database_id_DOI      10.1038/sj.emboj.7600021 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Deo, R.C.'          1 
primary 'Schmidt, E.F.'      2 
primary 'Elhabazi, A.'       3 
primary 'Togashi, H.'        4 
primary 'Burley, S.K.'       5 
primary 'Strittmatter, S.M.' 6 
# 
_cell.entry_id           1KCX 
_cell.length_a           123.396 
_cell.length_b           152.111 
_cell.length_c           157.165 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KCX 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DIHYDROPYRIMIDINASE RELATED PROTEIN-1' 56371.977 2   ? ? 'RESIDUES 8-525' ? 
2 water   nat water                                   18.015    804 ? ? ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DRP-1, CRMP-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SIPHITSDRLLIRGGRIINDDQSFYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTSAD
DFFQGTKAALAGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVY
MAYKDLYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAIAIAGRIN
CPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQ
VTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDA
DVVIWDPDKMKTITAKSHKSTVEYNIFEGMECHGSPLVVISQGKIVFEDGNISVSKGMGRFIPRKPFPEHLYQRVRIRSK
VFGLHSVSRGMYDGPVYEVPATPKHAAPAPSAKSSPSK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SIPHITSDRLLIRGGRIINDDQSFYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTSAD
DFFQGTKAALAGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVY
MAYKDLYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAIAIAGRIN
CPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQ
VTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDA
DVVIWDPDKMKTITAKSHKSTVEYNIFEGMECHGSPLVVISQGKIVFEDGNISVSKGMGRFIPRKPFPEHLYQRVRIRSK
VFGLHSVSRGMYDGPVYEVPATPKHAAPAPSAKSSPSK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         NYSGXRC-T45 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ILE n 
1 3   PRO n 
1 4   HIS n 
1 5   ILE n 
1 6   THR n 
1 7   SER n 
1 8   ASP n 
1 9   ARG n 
1 10  LEU n 
1 11  LEU n 
1 12  ILE n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  ARG n 
1 17  ILE n 
1 18  ILE n 
1 19  ASN n 
1 20  ASP n 
1 21  ASP n 
1 22  GLN n 
1 23  SER n 
1 24  PHE n 
1 25  TYR n 
1 26  ALA n 
1 27  ASP n 
1 28  VAL n 
1 29  TYR n 
1 30  LEU n 
1 31  GLU n 
1 32  ASP n 
1 33  GLY n 
1 34  LEU n 
1 35  ILE n 
1 36  LYS n 
1 37  GLN n 
1 38  ILE n 
1 39  GLY n 
1 40  GLU n 
1 41  ASN n 
1 42  LEU n 
1 43  ILE n 
1 44  VAL n 
1 45  PRO n 
1 46  GLY n 
1 47  GLY n 
1 48  VAL n 
1 49  LYS n 
1 50  THR n 
1 51  ILE n 
1 52  GLU n 
1 53  ALA n 
1 54  ASN n 
1 55  GLY n 
1 56  ARG n 
1 57  MET n 
1 58  VAL n 
1 59  ILE n 
1 60  PRO n 
1 61  GLY n 
1 62  GLY n 
1 63  ILE n 
1 64  ASP n 
1 65  VAL n 
1 66  ASN n 
1 67  THR n 
1 68  TYR n 
1 69  LEU n 
1 70  GLN n 
1 71  LYS n 
1 72  PRO n 
1 73  SER n 
1 74  GLN n 
1 75  GLY n 
1 76  MET n 
1 77  THR n 
1 78  SER n 
1 79  ALA n 
1 80  ASP n 
1 81  ASP n 
1 82  PHE n 
1 83  PHE n 
1 84  GLN n 
1 85  GLY n 
1 86  THR n 
1 87  LYS n 
1 88  ALA n 
1 89  ALA n 
1 90  LEU n 
1 91  ALA n 
1 92  GLY n 
1 93  GLY n 
1 94  THR n 
1 95  THR n 
1 96  MET n 
1 97  ILE n 
1 98  ILE n 
1 99  ASP n 
1 100 HIS n 
1 101 VAL n 
1 102 VAL n 
1 103 PRO n 
1 104 GLU n 
1 105 PRO n 
1 106 GLY n 
1 107 SER n 
1 108 SER n 
1 109 LEU n 
1 110 LEU n 
1 111 THR n 
1 112 SER n 
1 113 PHE n 
1 114 GLU n 
1 115 LYS n 
1 116 TRP n 
1 117 HIS n 
1 118 GLU n 
1 119 ALA n 
1 120 ALA n 
1 121 ASP n 
1 122 THR n 
1 123 LYS n 
1 124 SER n 
1 125 CYS n 
1 126 CYS n 
1 127 ASP n 
1 128 TYR n 
1 129 SER n 
1 130 LEU n 
1 131 HIS n 
1 132 VAL n 
1 133 ASP n 
1 134 ILE n 
1 135 THR n 
1 136 SER n 
1 137 TRP n 
1 138 TYR n 
1 139 ASP n 
1 140 GLY n 
1 141 VAL n 
1 142 ARG n 
1 143 GLU n 
1 144 GLU n 
1 145 LEU n 
1 146 GLU n 
1 147 VAL n 
1 148 LEU n 
1 149 VAL n 
1 150 GLN n 
1 151 ASP n 
1 152 LYS n 
1 153 GLY n 
1 154 VAL n 
1 155 ASN n 
1 156 SER n 
1 157 PHE n 
1 158 GLN n 
1 159 VAL n 
1 160 TYR n 
1 161 MET n 
1 162 ALA n 
1 163 TYR n 
1 164 LYS n 
1 165 ASP n 
1 166 LEU n 
1 167 TYR n 
1 168 GLN n 
1 169 MET n 
1 170 SER n 
1 171 ASP n 
1 172 SER n 
1 173 GLN n 
1 174 LEU n 
1 175 TYR n 
1 176 GLU n 
1 177 ALA n 
1 178 PHE n 
1 179 THR n 
1 180 PHE n 
1 181 LEU n 
1 182 LYS n 
1 183 GLY n 
1 184 LEU n 
1 185 GLY n 
1 186 ALA n 
1 187 VAL n 
1 188 ILE n 
1 189 LEU n 
1 190 VAL n 
1 191 HIS n 
1 192 ALA n 
1 193 GLU n 
1 194 ASN n 
1 195 GLY n 
1 196 ASP n 
1 197 LEU n 
1 198 ILE n 
1 199 ALA n 
1 200 GLN n 
1 201 GLU n 
1 202 GLN n 
1 203 LYS n 
1 204 ARG n 
1 205 ILE n 
1 206 LEU n 
1 207 GLU n 
1 208 MET n 
1 209 GLY n 
1 210 ILE n 
1 211 THR n 
1 212 GLY n 
1 213 PRO n 
1 214 GLU n 
1 215 GLY n 
1 216 HIS n 
1 217 ALA n 
1 218 LEU n 
1 219 SER n 
1 220 ARG n 
1 221 PRO n 
1 222 GLU n 
1 223 GLU n 
1 224 LEU n 
1 225 GLU n 
1 226 ALA n 
1 227 GLU n 
1 228 ALA n 
1 229 VAL n 
1 230 PHE n 
1 231 ARG n 
1 232 ALA n 
1 233 ILE n 
1 234 ALA n 
1 235 ILE n 
1 236 ALA n 
1 237 GLY n 
1 238 ARG n 
1 239 ILE n 
1 240 ASN n 
1 241 CYS n 
1 242 PRO n 
1 243 VAL n 
1 244 TYR n 
1 245 ILE n 
1 246 THR n 
1 247 LYS n 
1 248 VAL n 
1 249 MET n 
1 250 SER n 
1 251 LYS n 
1 252 SER n 
1 253 ALA n 
1 254 ALA n 
1 255 ASP n 
1 256 ILE n 
1 257 ILE n 
1 258 ALA n 
1 259 LEU n 
1 260 ALA n 
1 261 ARG n 
1 262 LYS n 
1 263 LYS n 
1 264 GLY n 
1 265 PRO n 
1 266 LEU n 
1 267 VAL n 
1 268 PHE n 
1 269 GLY n 
1 270 GLU n 
1 271 PRO n 
1 272 ILE n 
1 273 ALA n 
1 274 ALA n 
1 275 SER n 
1 276 LEU n 
1 277 GLY n 
1 278 THR n 
1 279 ASP n 
1 280 GLY n 
1 281 THR n 
1 282 HIS n 
1 283 TYR n 
1 284 TRP n 
1 285 SER n 
1 286 LYS n 
1 287 ASN n 
1 288 TRP n 
1 289 ALA n 
1 290 LYS n 
1 291 ALA n 
1 292 ALA n 
1 293 ALA n 
1 294 PHE n 
1 295 VAL n 
1 296 THR n 
1 297 SER n 
1 298 PRO n 
1 299 PRO n 
1 300 LEU n 
1 301 SER n 
1 302 PRO n 
1 303 ASP n 
1 304 PRO n 
1 305 THR n 
1 306 THR n 
1 307 PRO n 
1 308 ASP n 
1 309 TYR n 
1 310 LEU n 
1 311 THR n 
1 312 SER n 
1 313 LEU n 
1 314 LEU n 
1 315 ALA n 
1 316 CYS n 
1 317 GLY n 
1 318 ASP n 
1 319 LEU n 
1 320 GLN n 
1 321 VAL n 
1 322 THR n 
1 323 GLY n 
1 324 SER n 
1 325 GLY n 
1 326 HIS n 
1 327 CYS n 
1 328 PRO n 
1 329 TYR n 
1 330 SER n 
1 331 THR n 
1 332 ALA n 
1 333 GLN n 
1 334 LYS n 
1 335 ALA n 
1 336 VAL n 
1 337 GLY n 
1 338 LYS n 
1 339 ASP n 
1 340 ASN n 
1 341 PHE n 
1 342 THR n 
1 343 LEU n 
1 344 ILE n 
1 345 PRO n 
1 346 GLU n 
1 347 GLY n 
1 348 VAL n 
1 349 ASN n 
1 350 GLY n 
1 351 ILE n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 MET n 
1 356 THR n 
1 357 VAL n 
1 358 VAL n 
1 359 TRP n 
1 360 ASP n 
1 361 LYS n 
1 362 ALA n 
1 363 VAL n 
1 364 ALA n 
1 365 THR n 
1 366 GLY n 
1 367 LYS n 
1 368 MET n 
1 369 ASP n 
1 370 GLU n 
1 371 ASN n 
1 372 GLN n 
1 373 PHE n 
1 374 VAL n 
1 375 ALA n 
1 376 VAL n 
1 377 THR n 
1 378 SER n 
1 379 THR n 
1 380 ASN n 
1 381 ALA n 
1 382 ALA n 
1 383 LYS n 
1 384 ILE n 
1 385 PHE n 
1 386 ASN n 
1 387 LEU n 
1 388 TYR n 
1 389 PRO n 
1 390 ARG n 
1 391 LYS n 
1 392 GLY n 
1 393 ARG n 
1 394 ILE n 
1 395 ALA n 
1 396 VAL n 
1 397 GLY n 
1 398 SER n 
1 399 ASP n 
1 400 ALA n 
1 401 ASP n 
1 402 VAL n 
1 403 VAL n 
1 404 ILE n 
1 405 TRP n 
1 406 ASP n 
1 407 PRO n 
1 408 ASP n 
1 409 LYS n 
1 410 MET n 
1 411 LYS n 
1 412 THR n 
1 413 ILE n 
1 414 THR n 
1 415 ALA n 
1 416 LYS n 
1 417 SER n 
1 418 HIS n 
1 419 LYS n 
1 420 SER n 
1 421 THR n 
1 422 VAL n 
1 423 GLU n 
1 424 TYR n 
1 425 ASN n 
1 426 ILE n 
1 427 PHE n 
1 428 GLU n 
1 429 GLY n 
1 430 MET n 
1 431 GLU n 
1 432 CYS n 
1 433 HIS n 
1 434 GLY n 
1 435 SER n 
1 436 PRO n 
1 437 LEU n 
1 438 VAL n 
1 439 VAL n 
1 440 ILE n 
1 441 SER n 
1 442 GLN n 
1 443 GLY n 
1 444 LYS n 
1 445 ILE n 
1 446 VAL n 
1 447 PHE n 
1 448 GLU n 
1 449 ASP n 
1 450 GLY n 
1 451 ASN n 
1 452 ILE n 
1 453 SER n 
1 454 VAL n 
1 455 SER n 
1 456 LYS n 
1 457 GLY n 
1 458 MET n 
1 459 GLY n 
1 460 ARG n 
1 461 PHE n 
1 462 ILE n 
1 463 PRO n 
1 464 ARG n 
1 465 LYS n 
1 466 PRO n 
1 467 PHE n 
1 468 PRO n 
1 469 GLU n 
1 470 HIS n 
1 471 LEU n 
1 472 TYR n 
1 473 GLN n 
1 474 ARG n 
1 475 VAL n 
1 476 ARG n 
1 477 ILE n 
1 478 ARG n 
1 479 SER n 
1 480 LYS n 
1 481 VAL n 
1 482 PHE n 
1 483 GLY n 
1 484 LEU n 
1 485 HIS n 
1 486 SER n 
1 487 VAL n 
1 488 SER n 
1 489 ARG n 
1 490 GLY n 
1 491 MET n 
1 492 TYR n 
1 493 ASP n 
1 494 GLY n 
1 495 PRO n 
1 496 VAL n 
1 497 TYR n 
1 498 GLU n 
1 499 VAL n 
1 500 PRO n 
1 501 ALA n 
1 502 THR n 
1 503 PRO n 
1 504 LYS n 
1 505 HIS n 
1 506 ALA n 
1 507 ALA n 
1 508 PRO n 
1 509 ALA n 
1 510 PRO n 
1 511 SER n 
1 512 ALA n 
1 513 LYS n 
1 514 SER n 
1 515 SER n 
1 516 PRO n 
1 517 SER n 
1 518 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 'crmp1 (8-525)' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ut5600 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pgex6p1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DPYL1_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SIPHITSDRLLIRGGRIINDDQSFYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTSAD
DFFQGTKAALAGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVY
MAYKDLYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAIAIAGRIN
CPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQ
VTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDA
DVVIWDPDKMKTITAKSHKSTVEYNIFEGMECHGSPLVVISQGKIVFEDGNISVSKGMGRFIPRKPFPEHLYQRVRIRSK
VFGLHSVSRGMYDGPVYEVPATPKHAAPAPSAKSSPSK
;
_struct_ref.pdbx_align_begin           8 
_struct_ref.pdbx_db_accession          P97427 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KCX A 1 ? 518 ? P97427 8 ? 525 ? 8 525 
2 1 1KCX B 1 ? 518 ? P97427 8 ? 525 ? 8 525 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1KCX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.27 
_exptl_crystal.density_percent_sol   62.39 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'isopropanol, tris, ammonium acetate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2000-10-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    silicon 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.984 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X9A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X9A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.984 
# 
_reflns.entry_id                     1KCX 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             24 
_reflns.d_resolution_high            2.12 
_reflns.number_obs                   78239 
_reflns.number_all                   78239 
_reflns.percent_possible_obs         93.4 
_reflns.pdbx_Rmerge_I_obs            0.063 
_reflns.pdbx_Rsym_value              0.063 
_reflns.pdbx_netI_over_sigmaI        15 
_reflns.B_iso_Wilson_estimate        23 
_reflns.pdbx_redundancy              10 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.12 
_reflns_shell.d_res_low              2.20 
_reflns_shell.percent_possible_all   76.8 
_reflns_shell.Rmerge_I_obs           0.313 
_reflns_shell.pdbx_Rsym_value        0.313 
_reflns_shell.meanI_over_sigI_obs    4 
_reflns_shell.pdbx_redundancy        4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6361 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1KCX 
_refine.ls_number_reflns_obs                     76527 
_refine.ls_number_reflns_all                     85030 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             20 
_refine.ls_d_res_high                            2.12 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.204 
_refine.ls_R_factor_R_free                       0.233 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  7653 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'engh & huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7286 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             804 
_refine_hist.number_atoms_total               8090 
_refine_hist.d_res_high                       2.12 
_refine_hist.d_res_low                        20 
# 
_struct.entry_id                  1KCX 
_struct.title                     'X-ray structure of NYSGRC target T-45' 
_struct.pdbx_descriptor           'DIHYDROPYRIMIDINASE RELATED PROTEIN-1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KCX 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;alpha/beta barrel, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 81  ? GLY A 92  ? ASP A 88  GLY A 99  1 ? 12 
HELX_P HELX_P2  2  SER A 108 ? SER A 124 ? SER A 115 SER A 131 1 ? 17 
HELX_P HELX_P3  3  GLY A 140 ? ASP A 151 ? GLY A 147 ASP A 158 1 ? 12 
HELX_P HELX_P4  4  SER A 170 ? LEU A 184 ? SER A 177 LEU A 191 1 ? 15 
HELX_P HELX_P5  5  ASN A 194 ? MET A 208 ? ASN A 201 MET A 215 1 ? 15 
HELX_P HELX_P6  6  PRO A 213 ? ARG A 220 ? PRO A 220 ARG A 227 1 ? 8  
HELX_P HELX_P7  7  GLU A 222 ? ASN A 240 ? GLU A 229 ASN A 247 1 ? 19 
HELX_P HELX_P8  8  SER A 250 ? GLY A 264 ? SER A 257 GLY A 271 1 ? 15 
HELX_P HELX_P9  9  ILE A 272 ? THR A 278 ? ILE A 279 THR A 285 1 ? 7  
HELX_P HELX_P10 10 ASP A 279 ? SER A 285 ? ASP A 286 SER A 292 5 ? 7  
HELX_P HELX_P11 11 ASN A 287 ? PHE A 294 ? ASN A 294 PHE A 301 1 ? 8  
HELX_P HELX_P12 12 THR A 305 ? CYS A 316 ? THR A 312 CYS A 323 1 ? 12 
HELX_P HELX_P13 13 SER A 330 ? ALA A 335 ? SER A 337 ALA A 342 1 ? 6  
HELX_P HELX_P14 15 ASN A 340 ? ILE A 344 ? ASN A 347 ILE A 351 5 ? 5  
HELX_P HELX_P15 16 GLU A 353 ? VAL A 363 ? GLU A 360 VAL A 370 1 ? 11 
HELX_P HELX_P16 17 ASP A 369 ? SER A 378 ? ASP A 376 SER A 385 1 ? 10 
HELX_P HELX_P17 18 SER A 378 ? PHE A 385 ? SER A 385 PHE A 392 1 ? 8  
HELX_P HELX_P18 19 PRO A 468 ? PHE A 482 ? PRO A 475 PHE A 489 1 ? 15 
HELX_P HELX_P19 20 ASP B 81  ? GLY B 92  ? ASP B 88  GLY B 99  1 ? 12 
HELX_P HELX_P20 21 SER B 108 ? SER B 124 ? SER B 115 SER B 131 1 ? 17 
HELX_P HELX_P21 22 GLY B 140 ? ASP B 151 ? GLY B 147 ASP B 158 1 ? 12 
HELX_P HELX_P22 23 SER B 170 ? LEU B 184 ? SER B 177 LEU B 191 1 ? 15 
HELX_P HELX_P23 24 ASN B 194 ? MET B 208 ? ASN B 201 MET B 215 1 ? 15 
HELX_P HELX_P24 25 PRO B 213 ? SER B 219 ? PRO B 220 SER B 226 1 ? 7  
HELX_P HELX_P25 26 PRO B 221 ? ASN B 240 ? PRO B 228 ASN B 247 1 ? 20 
HELX_P HELX_P26 27 SER B 250 ? GLY B 264 ? SER B 257 GLY B 271 1 ? 15 
HELX_P HELX_P27 28 ILE B 272 ? THR B 278 ? ILE B 279 THR B 285 1 ? 7  
HELX_P HELX_P28 29 ASP B 279 ? SER B 285 ? ASP B 286 SER B 292 5 ? 7  
HELX_P HELX_P29 30 ASN B 287 ? ALA B 293 ? ASN B 294 ALA B 300 1 ? 7  
HELX_P HELX_P30 31 THR B 305 ? CYS B 316 ? THR B 312 CYS B 323 1 ? 12 
HELX_P HELX_P31 32 SER B 330 ? ALA B 335 ? SER B 337 ALA B 342 1 ? 6  
HELX_P HELX_P32 34 ASN B 340 ? ILE B 344 ? ASN B 347 ILE B 351 5 ? 5  
HELX_P HELX_P33 35 GLU B 353 ? VAL B 363 ? GLU B 360 VAL B 370 1 ? 11 
HELX_P HELX_P34 36 ASP B 369 ? SER B 378 ? ASP B 376 SER B 385 1 ? 10 
HELX_P HELX_P35 37 SER B 378 ? PHE B 385 ? SER B 385 PHE B 392 1 ? 8  
HELX_P HELX_P36 38 PRO B 468 ? PHE B 482 ? PRO B 475 PHE B 489 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 297 A . ? SER 304 A PRO 298 A ? PRO 305 A 1 -0.69 
2 SER 297 B . ? SER 304 B PRO 298 B ? PRO 305 B 1 0.05  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 7 ? 
C ? 7 ? 
D ? 2 ? 
E ? 4 ? 
F ? 7 ? 
G ? 7 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? parallel      
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 34  ? GLY A 39  ? LEU A 41  GLY A 46  
A 2 ASP A 27  ? GLU A 31  ? ASP A 34  GLU A 38  
A 3 LEU A 10  ? ARG A 13  ? LEU A 17  ARG A 20  
A 4 LYS A 49  ? GLU A 52  ? LYS A 56  GLU A 59  
B 1 SER A 23  ? TYR A 25  ? SER A 30  TYR A 32  
B 2 ARG A 16  ? ILE A 18  ? ARG A 23  ILE A 25  
B 3 MET A 57  ? PRO A 60  ? MET A 64  PRO A 67  
B 4 VAL A 402 ? THR A 412 ? VAL A 409 THR A 419 
B 5 GLU A 431 ? SER A 441 ? GLU A 438 SER A 448 
B 6 LYS A 444 ? GLU A 448 ? LYS A 451 GLU A 455 
B 7 ASN A 451 ? ILE A 452 ? ASN A 458 ILE A 459 
C 1 GLY A 62  ? THR A 67  ? GLY A 69  THR A 74  
C 2 THR A 94  ? VAL A 101 ? THR A 101 VAL A 108 
C 3 ASP A 127 ? ILE A 134 ? ASP A 134 ILE A 141 
C 4 SER A 156 ? TYR A 160 ? SER A 163 TYR A 167 
C 5 VAL A 187 ? HIS A 191 ? VAL A 194 HIS A 198 
C 6 VAL A 243 ? VAL A 248 ? VAL A 250 VAL A 255 
C 7 VAL A 267 ? PRO A 271 ? VAL A 274 PRO A 278 
D 1 PRO A 72  ? SER A 73  ? PRO A 79  SER A 80  
D 2 MET A 76  ? THR A 77  ? MET A 83  THR A 84  
E 1 LEU B 34  ? GLY B 39  ? LEU B 41  GLY B 46  
E 2 ASP B 27  ? GLU B 31  ? ASP B 34  GLU B 38  
E 3 LEU B 10  ? ARG B 13  ? LEU B 17  ARG B 20  
E 4 LYS B 49  ? GLU B 52  ? LYS B 56  GLU B 59  
F 1 SER B 23  ? TYR B 25  ? SER B 30  TYR B 32  
F 2 ARG B 16  ? ILE B 18  ? ARG B 23  ILE B 25  
F 3 MET B 57  ? PRO B 60  ? MET B 64  PRO B 67  
F 4 VAL B 402 ? THR B 412 ? VAL B 409 THR B 419 
F 5 GLU B 431 ? SER B 441 ? GLU B 438 SER B 448 
F 6 LYS B 444 ? GLU B 448 ? LYS B 451 GLU B 455 
F 7 ASN B 451 ? ILE B 452 ? ASN B 458 ILE B 459 
G 1 GLY B 62  ? THR B 67  ? GLY B 69  THR B 74  
G 2 THR B 94  ? VAL B 101 ? THR B 101 VAL B 108 
G 3 ASP B 127 ? ILE B 134 ? ASP B 134 ILE B 141 
G 4 SER B 156 ? TYR B 160 ? SER B 163 TYR B 167 
G 5 VAL B 187 ? HIS B 191 ? VAL B 194 HIS B 198 
G 6 VAL B 243 ? VAL B 248 ? VAL B 250 VAL B 255 
G 7 VAL B 267 ? PRO B 271 ? VAL B 274 PRO B 278 
H 1 PRO B 72  ? SER B 73  ? PRO B 79  SER B 80  
H 2 MET B 76  ? THR B 77  ? MET B 83  THR B 84  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLN A 37  ? O GLN A 44  N TYR A 29  ? N TYR A 36  
A 2 3 O LEU A 30  ? O LEU A 37  N LEU A 10  ? N LEU A 17  
A 3 4 N ARG A 13  ? N ARG A 20  O ILE A 51  ? O ILE A 58  
B 1 2 O PHE A 24  ? O PHE A 31  N ILE A 17  ? N ILE A 24  
B 2 3 N ARG A 16  ? N ARG A 23  O VAL A 58  ? O VAL A 65  
B 3 4 N ILE A 59  ? N ILE A 66  O VAL A 403 ? O VAL A 410 
B 4 5 N VAL A 402 ? N VAL A 409 O ILE A 440 ? O ILE A 447 
B 5 6 N VAL A 439 ? N VAL A 446 O VAL A 446 ? O VAL A 453 
B 6 7 N GLU A 448 ? N GLU A 455 O ASN A 451 ? O ASN A 458 
C 1 2 N ASP A 64  ? N ASP A 71  O MET A 96  ? O MET A 103 
C 2 3 N ASP A 99  ? N ASP A 106 O HIS A 131 ? O HIS A 138 
C 3 4 N ILE A 134 ? N ILE A 141 O GLN A 158 ? O GLN A 165 
C 4 5 N PHE A 157 ? N PHE A 164 O LEU A 189 ? O LEU A 196 
C 5 6 N VAL A 190 ? N VAL A 197 O TYR A 244 ? O TYR A 251 
C 6 7 N ILE A 245 ? N ILE A 252 O PHE A 268 ? O PHE A 275 
D 1 2 N SER A 73  ? N SER A 80  O MET A 76  ? O MET A 83  
E 1 2 O GLN B 37  ? O GLN B 44  N TYR B 29  ? N TYR B 36  
E 2 3 O LEU B 30  ? O LEU B 37  N LEU B 10  ? N LEU B 17  
E 3 4 N ARG B 13  ? N ARG B 20  O ILE B 51  ? O ILE B 58  
F 1 2 O PHE B 24  ? O PHE B 31  N ILE B 17  ? N ILE B 24  
F 2 3 N ARG B 16  ? N ARG B 23  O VAL B 58  ? O VAL B 65  
F 3 4 N ILE B 59  ? N ILE B 66  O VAL B 403 ? O VAL B 410 
F 4 5 N VAL B 402 ? N VAL B 409 O ILE B 440 ? O ILE B 447 
F 5 6 N VAL B 439 ? N VAL B 446 O VAL B 446 ? O VAL B 453 
F 6 7 N GLU B 448 ? N GLU B 455 O ASN B 451 ? O ASN B 458 
G 1 2 N ASP B 64  ? N ASP B 71  O MET B 96  ? O MET B 103 
G 2 3 N ASP B 99  ? N ASP B 106 O HIS B 131 ? O HIS B 138 
G 3 4 N ILE B 134 ? N ILE B 141 O GLN B 158 ? O GLN B 165 
G 4 5 N PHE B 157 ? N PHE B 164 O LEU B 189 ? O LEU B 196 
G 5 6 N VAL B 190 ? N VAL B 197 O TYR B 244 ? O TYR B 251 
G 6 7 N ILE B 245 ? N ILE B 252 O PHE B 268 ? O PHE B 275 
H 1 2 N SER B 73  ? N SER B 80  O MET B 76  ? O MET B 83  
# 
_database_PDB_matrix.entry_id          1KCX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KCX 
_atom_sites.fract_transf_matrix[1][1]   0.008104 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006574 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006363 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 8   ? 58.255 47.767  20.216  1.00 41.46 ? 15  ASP A N   1 
ATOM   2    C CA  . ASP A 1 8   ? 59.034 48.627  19.269  1.00 43.51 ? 15  ASP A CA  1 
ATOM   3    C C   . ASP A 1 8   ? 58.540 48.455  17.843  1.00 40.46 ? 15  ASP A C   1 
ATOM   4    O O   . ASP A 1 8   ? 58.395 47.339  17.369  1.00 41.18 ? 15  ASP A O   1 
ATOM   5    C CB  . ASP A 1 8   ? 60.519 48.273  19.327  1.00 45.35 ? 15  ASP A CB  1 
ATOM   6    C CG  . ASP A 1 8   ? 61.314 49.244  20.178  1.00 48.56 ? 15  ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 8   ? 61.525 50.393  19.735  1.00 48.11 ? 15  ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 8   ? 61.722 48.859  21.296  1.00 52.73 ? 15  ASP A OD2 1 
ATOM   9    N N   . ARG A 1 9   ? 58.300 49.564  17.159  1.00 37.58 ? 16  ARG A N   1 
ATOM   10   C CA  . ARG A 1 9   ? 57.805 49.518  15.788  1.00 37.93 ? 16  ARG A CA  1 
ATOM   11   C C   . ARG A 1 9   ? 58.789 48.823  14.867  1.00 36.13 ? 16  ARG A C   1 
ATOM   12   O O   . ARG A 1 9   ? 59.996 49.065  14.929  1.00 35.46 ? 16  ARG A O   1 
ATOM   13   C CB  . ARG A 1 9   ? 57.553 50.932  15.275  1.00 41.36 ? 16  ARG A CB  1 
ATOM   14   C CG  . ARG A 1 9   ? 56.712 51.777  16.203  1.00 44.94 ? 16  ARG A CG  1 
ATOM   15   C CD  . ARG A 1 9   ? 56.613 53.190  15.660  1.00 46.29 ? 16  ARG A CD  1 
ATOM   16   N NE  . ARG A 1 9   ? 55.797 54.037  16.515  1.00 50.20 ? 16  ARG A NE  1 
ATOM   17   C CZ  . ARG A 1 9   ? 55.697 55.358  16.372  1.00 52.59 ? 16  ARG A CZ  1 
ATOM   18   N NH1 . ARG A 1 9   ? 56.366 55.977  15.402  1.00 50.67 ? 16  ARG A NH1 1 
ATOM   19   N NH2 . ARG A 1 9   ? 54.938 56.058  17.206  1.00 49.26 ? 16  ARG A NH2 1 
ATOM   20   N N   . LEU A 1 10  ? 58.272 47.971  13.993  1.00 32.35 ? 17  LEU A N   1 
ATOM   21   C CA  . LEU A 1 10  ? 59.129 47.247  13.073  1.00 29.85 ? 17  LEU A CA  1 
ATOM   22   C C   . LEU A 1 10  ? 58.431 47.045  11.744  1.00 30.48 ? 17  LEU A C   1 
ATOM   23   O O   . LEU A 1 10  ? 57.311 46.539  11.689  1.00 31.86 ? 17  LEU A O   1 
ATOM   24   C CB  . LEU A 1 10  ? 59.522 45.892  13.683  1.00 28.94 ? 17  LEU A CB  1 
ATOM   25   C CG  . LEU A 1 10  ? 60.482 44.992  12.905  1.00 28.82 ? 17  LEU A CG  1 
ATOM   26   C CD1 . LEU A 1 10  ? 61.716 45.773  12.487  1.00 32.70 ? 17  LEU A CD1 1 
ATOM   27   C CD2 . LEU A 1 10  ? 60.869 43.796  13.776  1.00 31.69 ? 17  LEU A CD2 1 
ATOM   28   N N   . LEU A 1 11  ? 59.101 47.438  10.669  1.00 27.53 ? 18  LEU A N   1 
ATOM   29   C CA  . LEU A 1 11  ? 58.536 47.297  9.343   1.00 28.58 ? 18  LEU A CA  1 
ATOM   30   C C   . LEU A 1 11  ? 59.272 46.257  8.512   1.00 29.13 ? 18  LEU A C   1 
ATOM   31   O O   . LEU A 1 11  ? 60.506 46.246  8.458   1.00 33.86 ? 18  LEU A O   1 
ATOM   32   C CB  . LEU A 1 11  ? 58.581 48.636  8.610   1.00 26.42 ? 18  LEU A CB  1 
ATOM   33   C CG  . LEU A 1 11  ? 58.082 48.595  7.163   1.00 27.74 ? 18  LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 11  ? 56.561 48.583  7.154   1.00 25.35 ? 18  LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 11  ? 58.609 49.811  6.407   1.00 28.91 ? 18  LEU A CD2 1 
ATOM   36   N N   . ILE A 1 12  ? 58.506 45.376  7.878   1.00 26.81 ? 19  ILE A N   1 
ATOM   37   C CA  . ILE A 1 12  ? 59.064 44.353  7.009   1.00 27.85 ? 19  ILE A CA  1 
ATOM   38   C C   . ILE A 1 12  ? 58.644 44.767  5.600   1.00 28.54 ? 19  ILE A C   1 
ATOM   39   O O   . ILE A 1 12  ? 57.454 44.785  5.278   1.00 28.52 ? 19  ILE A O   1 
ATOM   40   C CB  . ILE A 1 12  ? 58.497 42.953  7.325   1.00 23.88 ? 19  ILE A CB  1 
ATOM   41   C CG1 . ILE A 1 12  ? 58.782 42.590  8.784   1.00 24.03 ? 19  ILE A CG1 1 
ATOM   42   C CG2 . ILE A 1 12  ? 59.135 41.917  6.403   1.00 25.70 ? 19  ILE A CG2 1 
ATOM   43   C CD1 . ILE A 1 12  ? 58.223 41.239  9.200   1.00 21.21 ? 19  ILE A CD1 1 
ATOM   44   N N   . ARG A 1 13  ? 59.623 45.109  4.767   1.00 31.85 ? 20  ARG A N   1 
ATOM   45   C CA  . ARG A 1 13  ? 59.347 45.559  3.409   1.00 32.73 ? 20  ARG A CA  1 
ATOM   46   C C   . ARG A 1 13  ? 59.732 44.603  2.296   1.00 29.27 ? 20  ARG A C   1 
ATOM   47   O O   . ARG A 1 13  ? 60.672 43.825  2.426   1.00 28.84 ? 20  ARG A O   1 
ATOM   48   C CB  . ARG A 1 13  ? 60.060 46.882  3.143   1.00 39.63 ? 20  ARG A CB  1 
ATOM   49   C CG  . ARG A 1 13  ? 59.369 48.127  3.656   1.00 49.34 ? 20  ARG A CG  1 
ATOM   50   C CD  . ARG A 1 13  ? 60.116 49.331  3.108   1.00 54.89 ? 20  ARG A CD  1 
ATOM   51   N NE  . ARG A 1 13  ? 60.596 48.990  1.772   1.00 60.70 ? 20  ARG A NE  1 
ATOM   52   C CZ  . ARG A 1 13  ? 61.539 49.651  1.106   1.00 63.72 ? 20  ARG A CZ  1 
ATOM   53   N NH1 . ARG A 1 13  ? 62.125 50.722  1.644   1.00 63.47 ? 20  ARG A NH1 1 
ATOM   54   N NH2 . ARG A 1 13  ? 61.924 49.210  -0.089  1.00 63.99 ? 20  ARG A NH2 1 
ATOM   55   N N   . GLY A 1 14  ? 58.990 44.689  1.194   1.00 27.15 ? 21  GLY A N   1 
ATOM   56   C CA  . GLY A 1 14  ? 59.262 43.877  0.020   1.00 27.15 ? 21  GLY A CA  1 
ATOM   57   C C   . GLY A 1 14  ? 59.057 42.379  0.117   1.00 27.49 ? 21  GLY A C   1 
ATOM   58   O O   . GLY A 1 14  ? 59.492 41.630  -0.765  1.00 24.74 ? 21  GLY A O   1 
ATOM   59   N N   . GLY A 1 15  ? 58.384 41.925  1.164   1.00 24.64 ? 22  GLY A N   1 
ATOM   60   C CA  . GLY A 1 15  ? 58.188 40.498  1.301   1.00 21.31 ? 22  GLY A CA  1 
ATOM   61   C C   . GLY A 1 15  ? 56.971 39.930  0.596   1.00 23.02 ? 22  GLY A C   1 
ATOM   62   O O   . GLY A 1 15  ? 56.079 40.654  0.141   1.00 16.65 ? 22  GLY A O   1 
ATOM   63   N N   . ARG A 1 16  ? 56.960 38.607  0.491   1.00 17.88 ? 23  ARG A N   1 
ATOM   64   C CA  . ARG A 1 16  ? 55.851 37.895  -0.107  1.00 20.38 ? 23  ARG A CA  1 
ATOM   65   C C   . ARG A 1 16  ? 55.154 37.212  1.065   1.00 21.82 ? 23  ARG A C   1 
ATOM   66   O O   . ARG A 1 16  ? 55.708 36.298  1.677   1.00 24.26 ? 23  ARG A O   1 
ATOM   67   C CB  . ARG A 1 16  ? 56.362 36.854  -1.096  1.00 22.18 ? 23  ARG A CB  1 
ATOM   68   C CG  . ARG A 1 16  ? 55.280 35.997  -1.700  1.00 23.09 ? 23  ARG A CG  1 
ATOM   69   C CD  . ARG A 1 16  ? 55.850 35.170  -2.839  1.00 33.66 ? 23  ARG A CD  1 
ATOM   70   N NE  . ARG A 1 16  ? 54.806 34.443  -3.552  1.00 37.06 ? 23  ARG A NE  1 
ATOM   71   C CZ  . ARG A 1 16  ? 54.567 33.146  -3.408  1.00 37.64 ? 23  ARG A CZ  1 
ATOM   72   N NH1 . ARG A 1 16  ? 55.303 32.420  -2.578  1.00 40.15 ? 23  ARG A NH1 1 
ATOM   73   N NH2 . ARG A 1 16  ? 53.586 32.576  -4.092  1.00 36.04 ? 23  ARG A NH2 1 
ATOM   74   N N   . ILE A 1 17  ? 53.956 37.665  1.395   1.00 18.37 ? 24  ILE A N   1 
ATOM   75   C CA  . ILE A 1 17  ? 53.239 37.074  2.502   1.00 21.08 ? 24  ILE A CA  1 
ATOM   76   C C   . ILE A 1 17  ? 52.583 35.761  2.113   1.00 21.94 ? 24  ILE A C   1 
ATOM   77   O O   . ILE A 1 17  ? 51.831 35.702  1.145   1.00 24.96 ? 24  ILE A O   1 
ATOM   78   C CB  . ILE A 1 17  ? 52.159 38.014  3.027   1.00 23.95 ? 24  ILE A CB  1 
ATOM   79   C CG1 . ILE A 1 17  ? 52.800 39.322  3.471   1.00 23.80 ? 24  ILE A CG1 1 
ATOM   80   C CG2 . ILE A 1 17  ? 51.426 37.362  4.190   1.00 19.44 ? 24  ILE A CG2 1 
ATOM   81   C CD1 . ILE A 1 17  ? 51.811 40.355  3.928   1.00 28.39 ? 24  ILE A CD1 1 
ATOM   82   N N   . ILE A 1 18  ? 52.868 34.714  2.880   1.00 21.45 ? 25  ILE A N   1 
ATOM   83   C CA  . ILE A 1 18  ? 52.303 33.396  2.627   1.00 16.35 ? 25  ILE A CA  1 
ATOM   84   C C   . ILE A 1 18  ? 51.413 32.933  3.782   1.00 17.65 ? 25  ILE A C   1 
ATOM   85   O O   . ILE A 1 18  ? 51.911 32.590  4.859   1.00 14.18 ? 25  ILE A O   1 
ATOM   86   C CB  . ILE A 1 18  ? 53.405 32.323  2.465   1.00 17.39 ? 25  ILE A CB  1 
ATOM   87   C CG1 . ILE A 1 18  ? 54.507 32.817  1.522   1.00 19.68 ? 25  ILE A CG1 1 
ATOM   88   C CG2 . ILE A 1 18  ? 52.783 31.020  1.952   1.00 14.11 ? 25  ILE A CG2 1 
ATOM   89   C CD1 . ILE A 1 18  ? 54.083 32.965  0.077   1.00 13.81 ? 25  ILE A CD1 1 
ATOM   90   N N   . ASN A 1 19  ? 50.103 32.948  3.575   1.00 14.41 ? 26  ASN A N   1 
ATOM   91   C CA  . ASN A 1 19  ? 49.180 32.447  4.584   1.00 15.12 ? 26  ASN A CA  1 
ATOM   92   C C   . ASN A 1 19  ? 48.716 31.089  4.065   1.00 18.15 ? 26  ASN A C   1 
ATOM   93   O O   . ASN A 1 19  ? 49.141 30.659  2.989   1.00 18.58 ? 26  ASN A O   1 
ATOM   94   C CB  . ASN A 1 19  ? 47.988 33.386  4.785   1.00 13.73 ? 26  ASN A CB  1 
ATOM   95   C CG  . ASN A 1 19  ? 48.290 34.505  5.774   1.00 17.30 ? 26  ASN A CG  1 
ATOM   96   O OD1 . ASN A 1 19  ? 48.986 34.295  6.764   1.00 17.12 ? 26  ASN A OD1 1 
ATOM   97   N ND2 . ASN A 1 19  ? 47.757 35.689  5.516   1.00 15.67 ? 26  ASN A ND2 1 
ATOM   98   N N   . ASP A 1 20  ? 47.857 30.401  4.805   1.00 16.04 ? 27  ASP A N   1 
ATOM   99   C CA  . ASP A 1 20  ? 47.423 29.095  4.343   1.00 19.37 ? 27  ASP A CA  1 
ATOM   100  C C   . ASP A 1 20  ? 46.430 29.179  3.191   1.00 17.77 ? 27  ASP A C   1 
ATOM   101  O O   . ASP A 1 20  ? 46.342 28.261  2.379   1.00 17.94 ? 27  ASP A O   1 
ATOM   102  C CB  . ASP A 1 20  ? 46.836 28.282  5.504   1.00 18.67 ? 27  ASP A CB  1 
ATOM   103  C CG  . ASP A 1 20  ? 45.490 28.801  5.968   1.00 17.25 ? 27  ASP A CG  1 
ATOM   104  O OD1 . ASP A 1 20  ? 45.334 30.020  6.122   1.00 24.33 ? 27  ASP A OD1 1 
ATOM   105  O OD2 . ASP A 1 20  ? 44.581 27.980  6.188   1.00 22.84 ? 27  ASP A OD2 1 
ATOM   106  N N   . ASP A 1 21  ? 45.710 30.289  3.100   1.00 13.63 ? 28  ASP A N   1 
ATOM   107  C CA  . ASP A 1 21  ? 44.709 30.457  2.054   1.00 14.22 ? 28  ASP A CA  1 
ATOM   108  C C   . ASP A 1 21  ? 45.195 31.100  0.758   1.00 13.53 ? 28  ASP A C   1 
ATOM   109  O O   . ASP A 1 21  ? 44.569 30.912  -0.278  1.00 15.81 ? 28  ASP A O   1 
ATOM   110  C CB  . ASP A 1 21  ? 43.539 31.273  2.598   1.00 15.01 ? 28  ASP A CB  1 
ATOM   111  C CG  . ASP A 1 21  ? 43.944 32.694  2.970   1.00 17.91 ? 28  ASP A CG  1 
ATOM   112  O OD1 . ASP A 1 21  ? 45.077 32.882  3.450   1.00 13.89 ? 28  ASP A OD1 1 
ATOM   113  O OD2 . ASP A 1 21  ? 43.125 33.616  2.796   1.00 16.26 ? 28  ASP A OD2 1 
ATOM   114  N N   . GLN A 1 22  ? 46.295 31.850  0.815   1.00 16.07 ? 29  GLN A N   1 
ATOM   115  C CA  . GLN A 1 22  ? 46.847 32.535  -0.367  1.00 16.77 ? 29  GLN A CA  1 
ATOM   116  C C   . GLN A 1 22  ? 48.186 33.202  -0.054  1.00 19.77 ? 29  GLN A C   1 
ATOM   117  O O   . GLN A 1 22  ? 48.623 33.235  1.096   1.00 18.18 ? 29  GLN A O   1 
ATOM   118  C CB  . GLN A 1 22  ? 45.897 33.644  -0.837  1.00 21.74 ? 29  GLN A CB  1 
ATOM   119  C CG  . GLN A 1 22  ? 45.723 34.725  0.229   1.00 26.36 ? 29  GLN A CG  1 
ATOM   120  C CD  . GLN A 1 22  ? 45.038 35.993  -0.268  1.00 33.43 ? 29  GLN A CD  1 
ATOM   121  O OE1 . GLN A 1 22  ? 44.422 36.718  0.517   1.00 32.21 ? 29  GLN A OE1 1 
ATOM   122  N NE2 . GLN A 1 22  ? 45.152 36.273  -1.557  1.00 28.45 ? 29  GLN A NE2 1 
ATOM   123  N N   . SER A 1 23  ? 48.808 33.757  -1.093  1.00 20.09 ? 30  SER A N   1 
ATOM   124  C CA  . SER A 1 23  ? 50.077 34.470  -0.975  1.00 22.38 ? 30  SER A CA  1 
ATOM   125  C C   . SER A 1 23  ? 49.916 35.805  -1.698  1.00 24.78 ? 30  SER A C   1 
ATOM   126  O O   . SER A 1 23  ? 49.145 35.911  -2.649  1.00 24.21 ? 30  SER A O   1 
ATOM   127  C CB  . SER A 1 23  ? 51.214 33.687  -1.632  1.00 22.09 ? 30  SER A CB  1 
ATOM   128  O OG  . SER A 1 23  ? 51.376 32.416  -1.030  1.00 30.94 ? 30  SER A OG  1 
ATOM   129  N N   . PHE A 1 24  ? 50.633 36.822  -1.241  1.00 24.28 ? 31  PHE A N   1 
ATOM   130  C CA  . PHE A 1 24  ? 50.565 38.134  -1.865  1.00 23.71 ? 31  PHE A CA  1 
ATOM   131  C C   . PHE A 1 24  ? 51.693 39.032  -1.360  1.00 23.33 ? 31  PHE A C   1 
ATOM   132  O O   . PHE A 1 24  ? 52.215 38.843  -0.260  1.00 21.72 ? 31  PHE A O   1 
ATOM   133  C CB  . PHE A 1 24  ? 49.214 38.800  -1.586  1.00 25.77 ? 31  PHE A CB  1 
ATOM   134  C CG  . PHE A 1 24  ? 48.959 39.068  -0.130  1.00 25.53 ? 31  PHE A CG  1 
ATOM   135  C CD1 . PHE A 1 24  ? 48.577 38.040  0.722   1.00 23.70 ? 31  PHE A CD1 1 
ATOM   136  C CD2 . PHE A 1 24  ? 49.126 40.344  0.392   1.00 27.95 ? 31  PHE A CD2 1 
ATOM   137  C CE1 . PHE A 1 24  ? 48.368 38.277  2.074   1.00 24.09 ? 31  PHE A CE1 1 
ATOM   138  C CE2 . PHE A 1 24  ? 48.919 40.589  1.748   1.00 29.78 ? 31  PHE A CE2 1 
ATOM   139  C CZ  . PHE A 1 24  ? 48.537 39.547  2.590   1.00 26.14 ? 31  PHE A CZ  1 
ATOM   140  N N   . TYR A 1 25  ? 52.067 40.004  -2.180  1.00 24.82 ? 32  TYR A N   1 
ATOM   141  C CA  . TYR A 1 25  ? 53.126 40.942  -1.833  1.00 26.20 ? 32  TYR A CA  1 
ATOM   142  C C   . TYR A 1 25  ? 52.543 42.138  -1.117  1.00 26.05 ? 32  TYR A C   1 
ATOM   143  O O   . TYR A 1 25  ? 51.538 42.714  -1.542  1.00 27.58 ? 32  TYR A O   1 
ATOM   144  C CB  . TYR A 1 25  ? 53.852 41.418  -3.090  1.00 25.00 ? 32  TYR A CB  1 
ATOM   145  C CG  . TYR A 1 25  ? 54.657 40.346  -3.766  1.00 25.01 ? 32  TYR A CG  1 
ATOM   146  C CD1 . TYR A 1 25  ? 56.013 40.191  -3.493  1.00 23.98 ? 32  TYR A CD1 1 
ATOM   147  C CD2 . TYR A 1 25  ? 54.052 39.453  -4.656  1.00 28.63 ? 32  TYR A CD2 1 
ATOM   148  C CE1 . TYR A 1 25  ? 56.756 39.167  -4.088  1.00 27.15 ? 32  TYR A CE1 1 
ATOM   149  C CE2 . TYR A 1 25  ? 54.782 38.427  -5.255  1.00 30.85 ? 32  TYR A CE2 1 
ATOM   150  C CZ  . TYR A 1 25  ? 56.134 38.292  -4.961  1.00 28.71 ? 32  TYR A CZ  1 
ATOM   151  O OH  . TYR A 1 25  ? 56.844 37.262  -5.524  1.00 32.54 ? 32  TYR A OH  1 
ATOM   152  N N   . ALA A 1 26  ? 53.187 42.507  -0.024  1.00 22.55 ? 33  ALA A N   1 
ATOM   153  C CA  . ALA A 1 26  ? 52.769 43.644  0.769   1.00 23.60 ? 33  ALA A CA  1 
ATOM   154  C C   . ALA A 1 26  ? 53.798 43.772  1.875   1.00 24.52 ? 33  ALA A C   1 
ATOM   155  O O   . ALA A 1 26  ? 54.567 42.843  2.118   1.00 25.68 ? 33  ALA A O   1 
ATOM   156  C CB  . ALA A 1 26  ? 51.394 43.390  1.362   1.00 21.79 ? 33  ALA A CB  1 
ATOM   157  N N   . ASP A 1 27  ? 53.827 44.924  2.533   1.00 22.75 ? 34  ASP A N   1 
ATOM   158  C CA  . ASP A 1 27  ? 54.758 45.120  3.631   1.00 22.99 ? 34  ASP A CA  1 
ATOM   159  C C   . ASP A 1 27  ? 53.949 44.887  4.902   1.00 24.14 ? 34  ASP A C   1 
ATOM   160  O O   . ASP A 1 27  ? 52.719 44.993  4.893   1.00 19.65 ? 34  ASP A O   1 
ATOM   161  C CB  . ASP A 1 27  ? 55.328 46.544  3.621   1.00 24.05 ? 34  ASP A CB  1 
ATOM   162  C CG  . ASP A 1 27  ? 55.878 46.944  2.263   1.00 25.74 ? 34  ASP A CG  1 
ATOM   163  O OD1 . ASP A 1 27  ? 56.651 46.168  1.659   1.00 25.78 ? 34  ASP A OD1 1 
ATOM   164  O OD2 . ASP A 1 27  ? 55.533 48.045  1.800   1.00 29.17 ? 34  ASP A OD2 1 
ATOM   165  N N   . VAL A 1 28  ? 54.633 44.566  5.994   1.00 24.38 ? 35  VAL A N   1 
ATOM   166  C CA  . VAL A 1 28  ? 53.946 44.314  7.245   1.00 22.96 ? 35  VAL A CA  1 
ATOM   167  C C   . VAL A 1 28  ? 54.520 45.222  8.319   1.00 22.75 ? 35  VAL A C   1 
ATOM   168  O O   . VAL A 1 28  ? 55.736 45.320  8.473   1.00 23.94 ? 35  VAL A O   1 
ATOM   169  C CB  . VAL A 1 28  ? 54.100 42.830  7.641   1.00 23.35 ? 35  VAL A CB  1 
ATOM   170  C CG1 . VAL A 1 28  ? 53.264 42.516  8.865   1.00 21.87 ? 35  VAL A CG1 1 
ATOM   171  C CG2 . VAL A 1 28  ? 53.681 41.953  6.475   1.00 23.08 ? 35  VAL A CG2 1 
ATOM   172  N N   . TYR A 1 29  ? 53.637 45.895  9.049   1.00 23.86 ? 36  TYR A N   1 
ATOM   173  C CA  . TYR A 1 29  ? 54.045 46.812  10.107  1.00 24.46 ? 36  TYR A CA  1 
ATOM   174  C C   . TYR A 1 29  ? 53.653 46.273  11.476  1.00 25.02 ? 36  TYR A C   1 
ATOM   175  O O   . TYR A 1 29  ? 52.470 46.047  11.749  1.00 23.53 ? 36  TYR A O   1 
ATOM   176  C CB  . TYR A 1 29  ? 53.395 48.181  9.896   1.00 29.08 ? 36  TYR A CB  1 
ATOM   177  C CG  . TYR A 1 29  ? 53.802 49.202  10.930  1.00 35.79 ? 36  TYR A CG  1 
ATOM   178  C CD1 . TYR A 1 29  ? 55.148 49.460  11.183  1.00 39.54 ? 36  TYR A CD1 1 
ATOM   179  C CD2 . TYR A 1 29  ? 52.845 49.942  11.623  1.00 36.44 ? 36  TYR A CD2 1 
ATOM   180  C CE1 . TYR A 1 29  ? 55.532 50.434  12.096  1.00 42.47 ? 36  TYR A CE1 1 
ATOM   181  C CE2 . TYR A 1 29  ? 53.216 50.919  12.536  1.00 41.85 ? 36  TYR A CE2 1 
ATOM   182  C CZ  . TYR A 1 29  ? 54.564 51.160  12.767  1.00 42.97 ? 36  TYR A CZ  1 
ATOM   183  O OH  . TYR A 1 29  ? 54.949 52.126  13.666  1.00 46.28 ? 36  TYR A OH  1 
ATOM   184  N N   . LEU A 1 30  ? 54.652 46.092  12.336  1.00 24.40 ? 37  LEU A N   1 
ATOM   185  C CA  . LEU A 1 30  ? 54.439 45.553  13.673  1.00 24.91 ? 37  LEU A CA  1 
ATOM   186  C C   . LEU A 1 30  ? 54.676 46.570  14.781  1.00 23.63 ? 37  LEU A C   1 
ATOM   187  O O   . LEU A 1 30  ? 55.570 47.411  14.693  1.00 26.02 ? 37  LEU A O   1 
ATOM   188  C CB  . LEU A 1 30  ? 55.373 44.359  13.901  1.00 19.50 ? 37  LEU A CB  1 
ATOM   189  C CG  . LEU A 1 30  ? 55.415 43.330  12.772  1.00 20.06 ? 37  LEU A CG  1 
ATOM   190  C CD1 . LEU A 1 30  ? 56.489 42.293  13.057  1.00 15.26 ? 37  LEU A CD1 1 
ATOM   191  C CD2 . LEU A 1 30  ? 54.047 42.680  12.628  1.00 18.96 ? 37  LEU A CD2 1 
ATOM   192  N N   . GLU A 1 31  ? 53.874 46.481  15.832  1.00 22.32 ? 38  GLU A N   1 
ATOM   193  C CA  . GLU A 1 31  ? 54.030 47.365  16.974  1.00 24.72 ? 38  GLU A CA  1 
ATOM   194  C C   . GLU A 1 31  ? 53.337 46.746  18.180  1.00 22.74 ? 38  GLU A C   1 
ATOM   195  O O   . GLU A 1 31  ? 52.206 46.273  18.090  1.00 23.90 ? 38  GLU A O   1 
ATOM   196  C CB  . GLU A 1 31  ? 53.464 48.764  16.662  1.00 28.38 ? 38  GLU A CB  1 
ATOM   197  C CG  . GLU A 1 31  ? 53.430 49.704  17.871  1.00 29.90 ? 38  GLU A CG  1 
ATOM   198  C CD  . GLU A 1 31  ? 53.249 51.174  17.492  1.00 36.38 ? 38  GLU A CD  1 
ATOM   199  O OE1 . GLU A 1 31  ? 52.325 51.493  16.705  1.00 36.09 ? 38  GLU A OE1 1 
ATOM   200  O OE2 . GLU A 1 31  ? 54.034 52.018  17.994  1.00 33.41 ? 38  GLU A OE2 1 
ATOM   201  N N   . ASP A 1 32  ? 54.040 46.716  19.302  1.00 25.03 ? 39  ASP A N   1 
ATOM   202  C CA  . ASP A 1 32  ? 53.504 46.158  20.542  1.00 30.74 ? 39  ASP A CA  1 
ATOM   203  C C   . ASP A 1 32  ? 52.905 44.743  20.450  1.00 30.22 ? 39  ASP A C   1 
ATOM   204  O O   . ASP A 1 32  ? 51.770 44.511  20.883  1.00 28.93 ? 39  ASP A O   1 
ATOM   205  C CB  . ASP A 1 32  ? 52.464 47.112  21.133  1.00 33.55 ? 39  ASP A CB  1 
ATOM   206  C CG  . ASP A 1 32  ? 53.094 48.314  21.808  1.00 40.71 ? 39  ASP A CG  1 
ATOM   207  O OD1 . ASP A 1 32  ? 53.942 48.109  22.709  1.00 43.77 ? 39  ASP A OD1 1 
ATOM   208  O OD2 . ASP A 1 32  ? 52.741 49.462  21.444  1.00 40.80 ? 39  ASP A OD2 1 
ATOM   209  N N   . GLY A 1 33  ? 53.678 43.808  19.900  1.00 25.43 ? 40  GLY A N   1 
ATOM   210  C CA  . GLY A 1 33  ? 53.238 42.426  19.783  1.00 26.86 ? 40  GLY A CA  1 
ATOM   211  C C   . GLY A 1 33  ? 52.111 42.130  18.808  1.00 24.93 ? 40  GLY A C   1 
ATOM   212  O O   . GLY A 1 33  ? 51.627 40.998  18.751  1.00 25.60 ? 40  GLY A O   1 
ATOM   213  N N   . LEU A 1 34  ? 51.695 43.127  18.030  1.00 23.60 ? 41  LEU A N   1 
ATOM   214  C CA  . LEU A 1 34  ? 50.607 42.931  17.079  1.00 23.23 ? 41  LEU A CA  1 
ATOM   215  C C   . LEU A 1 34  ? 50.946 43.383  15.668  1.00 22.83 ? 41  LEU A C   1 
ATOM   216  O O   . LEU A 1 34  ? 51.811 44.239  15.461  1.00 21.01 ? 41  LEU A O   1 
ATOM   217  C CB  . LEU A 1 34  ? 49.355 43.690  17.539  1.00 24.59 ? 41  LEU A CB  1 
ATOM   218  C CG  . LEU A 1 34  ? 48.633 43.236  18.805  1.00 25.65 ? 41  LEU A CG  1 
ATOM   219  C CD1 . LEU A 1 34  ? 47.609 44.281  19.210  1.00 25.42 ? 41  LEU A CD1 1 
ATOM   220  C CD2 . LEU A 1 34  ? 47.958 41.887  18.551  1.00 25.75 ? 41  LEU A CD2 1 
ATOM   221  N N   . ILE A 1 35  ? 50.260 42.793  14.697  1.00 19.19 ? 42  ILE A N   1 
ATOM   222  C CA  . ILE A 1 35  ? 50.441 43.176  13.306  1.00 19.88 ? 42  ILE A CA  1 
ATOM   223  C C   . ILE A 1 35  ? 49.465 44.345  13.146  1.00 21.82 ? 42  ILE A C   1 
ATOM   224  O O   . ILE A 1 35  ? 48.248 44.163  13.219  1.00 16.68 ? 42  ILE A O   1 
ATOM   225  C CB  . ILE A 1 35  ? 50.066 42.022  12.338  1.00 18.43 ? 42  ILE A CB  1 
ATOM   226  C CG1 . ILE A 1 35  ? 50.952 40.803  12.622  1.00 20.54 ? 42  ILE A CG1 1 
ATOM   227  C CG2 . ILE A 1 35  ? 50.241 42.475  10.888  1.00 15.97 ? 42  ILE A CG2 1 
ATOM   228  C CD1 . ILE A 1 35  ? 50.672 39.600  11.747  1.00 16.87 ? 42  ILE A CD1 1 
ATOM   229  N N   . LYS A 1 36  ? 50.011 45.544  12.952  1.00 25.23 ? 43  LYS A N   1 
ATOM   230  C CA  . LYS A 1 36  ? 49.205 46.757  12.820  1.00 27.68 ? 43  LYS A CA  1 
ATOM   231  C C   . LYS A 1 36  ? 48.715 47.068  11.418  1.00 25.08 ? 43  LYS A C   1 
ATOM   232  O O   . LYS A 1 36  ? 47.612 47.571  11.245  1.00 28.47 ? 43  LYS A O   1 
ATOM   233  C CB  . LYS A 1 36  ? 49.996 47.957  13.346  1.00 31.77 ? 43  LYS A CB  1 
ATOM   234  C CG  . LYS A 1 36  ? 50.348 47.852  14.824  1.00 40.98 ? 43  LYS A CG  1 
ATOM   235  C CD  . LYS A 1 36  ? 49.116 48.069  15.703  1.00 45.36 ? 43  LYS A CD  1 
ATOM   236  C CE  . LYS A 1 36  ? 49.449 47.843  17.164  1.00 49.49 ? 43  LYS A CE  1 
ATOM   237  N NZ  . LYS A 1 36  ? 50.606 48.696  17.585  1.00 52.39 ? 43  LYS A NZ  1 
ATOM   238  N N   . GLN A 1 37  ? 49.531 46.787  10.412  1.00 26.33 ? 44  GLN A N   1 
ATOM   239  C CA  . GLN A 1 37  ? 49.128 47.074  9.045   1.00 25.16 ? 44  GLN A CA  1 
ATOM   240  C C   . GLN A 1 37  ? 49.780 46.172  8.020   1.00 24.71 ? 44  GLN A C   1 
ATOM   241  O O   . GLN A 1 37  ? 50.894 45.676  8.219   1.00 25.33 ? 44  GLN A O   1 
ATOM   242  C CB  . GLN A 1 37  ? 49.484 48.512  8.664   1.00 31.64 ? 44  GLN A CB  1 
ATOM   243  C CG  . GLN A 1 37  ? 48.843 49.606  9.479   1.00 33.61 ? 44  GLN A CG  1 
ATOM   244  C CD  . GLN A 1 37  ? 49.279 50.980  8.999   1.00 38.81 ? 44  GLN A CD  1 
ATOM   245  O OE1 . GLN A 1 37  ? 49.146 51.308  7.812   1.00 33.37 ? 44  GLN A OE1 1 
ATOM   246  N NE2 . GLN A 1 37  ? 49.811 51.791  9.917   1.00 36.42 ? 44  GLN A NE2 1 
ATOM   247  N N   . ILE A 1 38  ? 49.086 46.003  6.902   1.00 23.92 ? 45  ILE A N   1 
ATOM   248  C CA  . ILE A 1 38  ? 49.571 45.208  5.782   1.00 27.90 ? 45  ILE A CA  1 
ATOM   249  C C   . ILE A 1 38  ? 49.109 45.978  4.542   1.00 29.62 ? 45  ILE A C   1 
ATOM   250  O O   . ILE A 1 38  ? 47.938 46.346  4.444   1.00 28.76 ? 45  ILE A O   1 
ATOM   251  C CB  . ILE A 1 38  ? 48.956 43.789  5.793   1.00 22.56 ? 45  ILE A CB  1 
ATOM   252  C CG1 . ILE A 1 38  ? 49.402 43.047  7.058   1.00 26.35 ? 45  ILE A CG1 1 
ATOM   253  C CG2 . ILE A 1 38  ? 49.379 43.026  4.562   1.00 20.33 ? 45  ILE A CG2 1 
ATOM   254  C CD1 . ILE A 1 38  ? 48.661 41.736  7.302   1.00 26.84 ? 45  ILE A CD1 1 
ATOM   255  N N   . GLY A 1 39  ? 50.017 46.249  3.609   1.00 32.33 ? 46  GLY A N   1 
ATOM   256  C CA  . GLY A 1 39  ? 49.606 46.991  2.435   1.00 32.96 ? 46  GLY A CA  1 
ATOM   257  C C   . GLY A 1 39  ? 50.676 47.344  1.424   1.00 39.61 ? 46  GLY A C   1 
ATOM   258  O O   . GLY A 1 39  ? 51.882 47.336  1.720   1.00 37.47 ? 46  GLY A O   1 
ATOM   259  N N   . GLU A 1 40  ? 50.195 47.677  0.226   1.00 42.34 ? 47  GLU A N   1 
ATOM   260  C CA  . GLU A 1 40  ? 51.008 48.045  -0.930  1.00 45.26 ? 47  GLU A CA  1 
ATOM   261  C C   . GLU A 1 40  ? 52.279 48.821  -0.632  1.00 46.17 ? 47  GLU A C   1 
ATOM   262  O O   . GLU A 1 40  ? 53.340 48.459  -1.145  1.00 47.94 ? 47  GLU A O   1 
ATOM   263  C CB  . GLU A 1 40  ? 50.155 48.829  -1.934  1.00 48.22 ? 47  GLU A CB  1 
ATOM   264  N N   . ASN A 1 41  ? 52.201 49.884  0.171   1.00 46.51 ? 48  ASN A N   1 
ATOM   265  C CA  . ASN A 1 41  ? 53.423 50.638  0.452   1.00 47.75 ? 48  ASN A CA  1 
ATOM   266  C C   . ASN A 1 41  ? 53.337 51.748  1.504   1.00 49.06 ? 48  ASN A C   1 
ATOM   267  O O   . ASN A 1 41  ? 52.350 52.480  1.581   1.00 48.87 ? 48  ASN A O   1 
ATOM   268  C CB  . ASN A 1 41  ? 53.961 51.215  -0.863  1.00 47.67 ? 48  ASN A CB  1 
ATOM   269  N N   . LEU A 1 42  ? 54.396 51.866  2.309   1.00 52.45 ? 49  LEU A N   1 
ATOM   270  C CA  . LEU A 1 42  ? 54.513 52.900  3.349   1.00 51.65 ? 49  LEU A CA  1 
ATOM   271  C C   . LEU A 1 42  ? 53.347 53.012  4.327   1.00 51.72 ? 49  LEU A C   1 
ATOM   272  O O   . LEU A 1 42  ? 52.568 52.061  4.490   1.00 51.05 ? 49  LEU A O   1 
ATOM   273  C CB  . LEU A 1 42  ? 54.763 54.282  2.685   1.00 55.89 ? 49  LEU A CB  1 
ATOM   274  N N   . ILE A 1 43  ? 53.274 54.180  4.985   1.00 49.82 ? 50  ILE A N   1 
ATOM   275  C CA  . ILE A 1 43  ? 52.244 54.555  5.970   1.00 49.16 ? 50  ILE A CA  1 
ATOM   276  C C   . ILE A 1 43  ? 52.757 54.566  7.417   1.00 49.11 ? 50  ILE A C   1 
ATOM   277  O O   . ILE A 1 43  ? 51.984 54.727  8.369   1.00 47.29 ? 50  ILE A O   1 
ATOM   278  C CB  . ILE A 1 43  ? 50.972 53.635  5.870   1.00 50.75 ? 50  ILE A CB  1 
ATOM   279  C CG1 . ILE A 1 43  ? 50.324 53.785  4.488   1.00 48.00 ? 50  ILE A CG1 1 
ATOM   280  C CG2 . ILE A 1 43  ? 49.938 54.017  6.939   1.00 50.30 ? 50  ILE A CG2 1 
ATOM   281  C CD1 . ILE A 1 43  ? 49.017 53.033  4.341   1.00 49.08 ? 50  ILE A CD1 1 
ATOM   282  N N   . VAL A 1 44  ? 54.067 54.431  7.597   1.00 49.49 ? 51  VAL A N   1 
ATOM   283  C CA  . VAL A 1 44  ? 54.607 54.415  8.956   1.00 50.20 ? 51  VAL A CA  1 
ATOM   284  C C   . VAL A 1 44  ? 55.440 55.638  9.316   1.00 50.98 ? 51  VAL A C   1 
ATOM   285  O O   . VAL A 1 44  ? 56.014 56.295  8.446   1.00 50.17 ? 51  VAL A O   1 
ATOM   286  C CB  . VAL A 1 44  ? 55.438 53.151  9.169   1.00 48.13 ? 51  VAL A CB  1 
ATOM   287  N N   . PRO A 1 45  ? 55.514 55.959  10.619  1.00 52.31 ? 52  PRO A N   1 
ATOM   288  C CA  . PRO A 1 45  ? 56.285 57.103  11.116  1.00 53.00 ? 52  PRO A CA  1 
ATOM   289  C C   . PRO A 1 45  ? 57.720 57.080  10.578  1.00 55.29 ? 52  PRO A C   1 
ATOM   290  O O   . PRO A 1 45  ? 58.214 56.032  10.134  1.00 51.72 ? 52  PRO A O   1 
ATOM   291  C CB  . PRO A 1 45  ? 56.231 56.911  12.622  1.00 52.76 ? 52  PRO A CB  1 
ATOM   292  C CG  . PRO A 1 45  ? 54.836 56.377  12.810  1.00 53.17 ? 52  PRO A CG  1 
ATOM   293  C CD  . PRO A 1 45  ? 54.769 55.319  11.721  1.00 51.64 ? 52  PRO A CD  1 
ATOM   294  N N   . GLY A 1 46  ? 58.380 58.239  10.623  1.00 56.32 ? 53  GLY A N   1 
ATOM   295  C CA  . GLY A 1 46  ? 59.738 58.341  10.120  1.00 57.91 ? 53  GLY A CA  1 
ATOM   296  C C   . GLY A 1 46  ? 60.760 57.467  10.832  1.00 58.53 ? 53  GLY A C   1 
ATOM   297  O O   . GLY A 1 46  ? 61.689 56.938  10.202  1.00 57.87 ? 53  GLY A O   1 
ATOM   298  N N   . GLY A 1 47  ? 60.608 57.324  12.144  1.00 56.29 ? 54  GLY A N   1 
ATOM   299  C CA  . GLY A 1 47  ? 61.543 56.506  12.896  1.00 55.80 ? 54  GLY A CA  1 
ATOM   300  C C   . GLY A 1 47  ? 61.081 55.064  13.048  1.00 54.25 ? 54  GLY A C   1 
ATOM   301  O O   . GLY A 1 47  ? 60.396 54.730  14.030  1.00 56.60 ? 54  GLY A O   1 
ATOM   302  N N   . VAL A 1 48  ? 61.447 54.200  12.101  1.00 45.83 ? 55  VAL A N   1 
ATOM   303  C CA  . VAL A 1 48  ? 61.034 52.797  12.185  1.00 39.08 ? 55  VAL A CA  1 
ATOM   304  C C   . VAL A 1 48  ? 62.041 51.807  11.627  1.00 34.49 ? 55  VAL A C   1 
ATOM   305  O O   . VAL A 1 48  ? 62.313 51.786  10.424  1.00 31.53 ? 55  VAL A O   1 
ATOM   306  C CB  . VAL A 1 48  ? 59.694 52.547  11.454  1.00 35.97 ? 55  VAL A CB  1 
ATOM   307  C CG1 . VAL A 1 48  ? 59.267 51.093  11.648  1.00 33.49 ? 55  VAL A CG1 1 
ATOM   308  C CG2 . VAL A 1 48  ? 58.623 53.484  11.986  1.00 31.80 ? 55  VAL A CG2 1 
ATOM   309  N N   . LYS A 1 49  ? 62.587 50.981  12.511  1.00 33.10 ? 56  LYS A N   1 
ATOM   310  C CA  . LYS A 1 49  ? 63.548 49.967  12.110  1.00 31.58 ? 56  LYS A CA  1 
ATOM   311  C C   . LYS A 1 49  ? 62.905 49.241  10.927  1.00 30.38 ? 56  LYS A C   1 
ATOM   312  O O   . LYS A 1 49  ? 61.712 48.947  10.962  1.00 30.90 ? 56  LYS A O   1 
ATOM   313  C CB  . LYS A 1 49  ? 63.785 49.013  13.279  1.00 31.61 ? 56  LYS A CB  1 
ATOM   314  C CG  . LYS A 1 49  ? 64.891 48.016  13.066  1.00 35.77 ? 56  LYS A CG  1 
ATOM   315  C CD  . LYS A 1 49  ? 64.740 46.860  14.040  1.00 38.43 ? 56  LYS A CD  1 
ATOM   316  C CE  . LYS A 1 49  ? 65.799 45.796  13.811  1.00 41.07 ? 56  LYS A CE  1 
ATOM   317  N NZ  . LYS A 1 49  ? 67.114 46.193  14.371  1.00 40.32 ? 56  LYS A NZ  1 
ATOM   318  N N   . THR A 1 50  ? 63.680 48.971  9.880   1.00 27.24 ? 57  THR A N   1 
ATOM   319  C CA  . THR A 1 50  ? 63.144 48.322  8.689   1.00 27.17 ? 57  THR A CA  1 
ATOM   320  C C   . THR A 1 50  ? 63.958 47.144  8.189   1.00 30.18 ? 57  THR A C   1 
ATOM   321  O O   . THR A 1 50  ? 65.186 47.236  8.038   1.00 27.76 ? 57  THR A O   1 
ATOM   322  C CB  . THR A 1 50  ? 63.026 49.320  7.514   1.00 28.55 ? 57  THR A CB  1 
ATOM   323  O OG1 . THR A 1 50  ? 62.013 50.290  7.804   1.00 30.56 ? 57  THR A OG1 1 
ATOM   324  C CG2 . THR A 1 50  ? 62.658 48.596  6.228   1.00 28.25 ? 57  THR A CG2 1 
ATOM   325  N N   . ILE A 1 51  ? 63.256 46.044  7.911   1.00 28.33 ? 58  ILE A N   1 
ATOM   326  C CA  . ILE A 1 51  ? 63.876 44.831  7.382   1.00 27.73 ? 58  ILE A CA  1 
ATOM   327  C C   . ILE A 1 51  ? 63.480 44.698  5.910   1.00 27.47 ? 58  ILE A C   1 
ATOM   328  O O   . ILE A 1 51  ? 62.294 44.777  5.583   1.00 27.76 ? 58  ILE A O   1 
ATOM   329  C CB  . ILE A 1 51  ? 63.375 43.581  8.124   1.00 29.58 ? 58  ILE A CB  1 
ATOM   330  C CG1 . ILE A 1 51  ? 63.793 43.644  9.593   1.00 28.54 ? 58  ILE A CG1 1 
ATOM   331  C CG2 . ILE A 1 51  ? 63.923 42.327  7.454   1.00 26.52 ? 58  ILE A CG2 1 
ATOM   332  C CD1 . ILE A 1 51  ? 63.295 42.479  10.416  1.00 32.01 ? 58  ILE A CD1 1 
ATOM   333  N N   . GLU A 1 52  ? 64.459 44.509  5.027   1.00 26.54 ? 59  GLU A N   1 
ATOM   334  C CA  . GLU A 1 52  ? 64.178 44.358  3.599   1.00 29.02 ? 59  GLU A CA  1 
ATOM   335  C C   . GLU A 1 52  ? 64.038 42.882  3.254   1.00 32.37 ? 59  GLU A C   1 
ATOM   336  O O   . GLU A 1 52  ? 65.040 42.189  3.057   1.00 32.53 ? 59  GLU A O   1 
ATOM   337  C CB  . GLU A 1 52  ? 65.310 44.942  2.748   1.00 34.24 ? 59  GLU A CB  1 
ATOM   338  C CG  . GLU A 1 52  ? 65.517 46.445  2.844   1.00 36.58 ? 59  GLU A CG  1 
ATOM   339  C CD  . GLU A 1 52  ? 64.269 47.237  2.528   1.00 38.06 ? 59  GLU A CD  1 
ATOM   340  O OE1 . GLU A 1 52  ? 63.456 46.776  1.690   1.00 39.15 ? 59  GLU A OE1 1 
ATOM   341  O OE2 . GLU A 1 52  ? 64.111 48.330  3.110   1.00 38.98 ? 59  GLU A OE2 1 
ATOM   342  N N   . ALA A 1 53  ? 62.801 42.400  3.165   1.00 31.59 ? 60  ALA A N   1 
ATOM   343  C CA  . ALA A 1 53  ? 62.567 40.996  2.849   1.00 33.48 ? 60  ALA A CA  1 
ATOM   344  C C   . ALA A 1 53  ? 63.090 40.638  1.460   1.00 32.38 ? 60  ALA A C   1 
ATOM   345  O O   . ALA A 1 53  ? 63.462 39.487  1.203   1.00 30.95 ? 60  ALA A O   1 
ATOM   346  C CB  . ALA A 1 53  ? 61.078 40.686  2.941   1.00 26.51 ? 60  ALA A CB  1 
ATOM   347  N N   . ASN A 1 54  ? 63.113 41.634  0.579   1.00 36.10 ? 61  ASN A N   1 
ATOM   348  C CA  . ASN A 1 54  ? 63.577 41.472  -0.799  1.00 41.88 ? 61  ASN A CA  1 
ATOM   349  C C   . ASN A 1 54  ? 63.038 40.227  -1.490  1.00 39.33 ? 61  ASN A C   1 
ATOM   350  O O   . ASN A 1 54  ? 63.810 39.417  -2.013  1.00 40.39 ? 61  ASN A O   1 
ATOM   351  C CB  . ASN A 1 54  ? 65.112 41.447  -0.874  1.00 48.14 ? 61  ASN A CB  1 
ATOM   352  C CG  . ASN A 1 54  ? 65.735 42.776  -0.504  1.00 54.50 ? 61  ASN A CG  1 
ATOM   353  O OD1 . ASN A 1 54  ? 65.941 43.069  0.679   1.00 57.55 ? 61  ASN A OD1 1 
ATOM   354  N ND2 . ASN A 1 54  ? 66.030 43.601  -1.515  1.00 56.80 ? 61  ASN A ND2 1 
ATOM   355  N N   . GLY A 1 55  ? 61.719 40.072  -1.480  1.00 37.65 ? 62  GLY A N   1 
ATOM   356  C CA  . GLY A 1 55  ? 61.101 38.935  -2.141  1.00 37.35 ? 62  GLY A CA  1 
ATOM   357  C C   . GLY A 1 55  ? 60.978 37.647  -1.347  1.00 35.97 ? 62  GLY A C   1 
ATOM   358  O O   . GLY A 1 55  ? 60.269 36.728  -1.781  1.00 33.83 ? 62  GLY A O   1 
ATOM   359  N N   . ARG A 1 56  ? 61.666 37.559  -0.209  1.00 31.99 ? 63  ARG A N   1 
ATOM   360  C CA  . ARG A 1 56  ? 61.605 36.361  0.633   1.00 30.24 ? 63  ARG A CA  1 
ATOM   361  C C   . ARG A 1 56  ? 60.200 36.183  1.205   1.00 25.92 ? 63  ARG A C   1 
ATOM   362  O O   . ARG A 1 56  ? 59.442 37.148  1.321   1.00 22.11 ? 63  ARG A O   1 
ATOM   363  C CB  . ARG A 1 56  ? 62.611 36.468  1.786   1.00 37.65 ? 63  ARG A CB  1 
ATOM   364  C CG  . ARG A 1 56  ? 63.966 35.823  1.513   1.00 43.08 ? 63  ARG A CG  1 
ATOM   365  C CD  . ARG A 1 56  ? 64.551 36.290  0.189   1.00 48.42 ? 63  ARG A CD  1 
ATOM   366  N NE  . ARG A 1 56  ? 65.815 35.619  -0.094  1.00 54.46 ? 63  ARG A NE  1 
ATOM   367  C CZ  . ARG A 1 56  ? 66.977 35.936  0.474   1.00 57.07 ? 63  ARG A CZ  1 
ATOM   368  N NH1 . ARG A 1 56  ? 67.047 36.927  1.361   1.00 58.53 ? 63  ARG A NH1 1 
ATOM   369  N NH2 . ARG A 1 56  ? 68.071 35.259  0.156   1.00 59.38 ? 63  ARG A NH2 1 
ATOM   370  N N   . MET A 1 57  ? 59.869 34.949  1.576   1.00 22.41 ? 64  MET A N   1 
ATOM   371  C CA  . MET A 1 57  ? 58.556 34.631  2.132   1.00 21.02 ? 64  MET A CA  1 
ATOM   372  C C   . MET A 1 57  ? 58.406 35.130  3.569   1.00 20.11 ? 64  MET A C   1 
ATOM   373  O O   . MET A 1 57  ? 59.328 34.999  4.378   1.00 22.46 ? 64  MET A O   1 
ATOM   374  C CB  . MET A 1 57  ? 58.322 33.112  2.118   1.00 19.67 ? 64  MET A CB  1 
ATOM   375  C CG  . MET A 1 57  ? 58.680 32.400  0.811   1.00 20.93 ? 64  MET A CG  1 
ATOM   376  S SD  . MET A 1 57  ? 58.590 30.594  0.928   1.00 13.09 ? 64  MET A SD  1 
ATOM   377  C CE  . MET A 1 57  ? 57.273 30.271  -0.108  1.00 27.33 ? 64  MET A CE  1 
ATOM   378  N N   . VAL A 1 58  ? 57.245 35.713  3.870   1.00 17.37 ? 65  VAL A N   1 
ATOM   379  C CA  . VAL A 1 58  ? 56.932 36.191  5.214   1.00 16.22 ? 65  VAL A CA  1 
ATOM   380  C C   . VAL A 1 58  ? 55.748 35.325  5.641   1.00 19.85 ? 65  VAL A C   1 
ATOM   381  O O   . VAL A 1 58  ? 54.641 35.466  5.111   1.00 15.81 ? 65  VAL A O   1 
ATOM   382  C CB  . VAL A 1 58  ? 56.520 37.675  5.226   1.00 16.53 ? 65  VAL A CB  1 
ATOM   383  C CG1 . VAL A 1 58  ? 56.219 38.118  6.655   1.00 13.49 ? 65  VAL A CG1 1 
ATOM   384  C CG2 . VAL A 1 58  ? 57.638 38.527  4.635   1.00 15.48 ? 65  VAL A CG2 1 
ATOM   385  N N   . ILE A 1 59  ? 55.994 34.423  6.590   1.00 18.96 ? 66  ILE A N   1 
ATOM   386  C CA  . ILE A 1 59  ? 54.973 33.479  7.052   1.00 17.44 ? 66  ILE A CA  1 
ATOM   387  C C   . ILE A 1 59  ? 54.731 33.507  8.558   1.00 17.80 ? 66  ILE A C   1 
ATOM   388  O O   . ILE A 1 59  ? 55.542 34.032  9.317   1.00 15.92 ? 66  ILE A O   1 
ATOM   389  C CB  . ILE A 1 59  ? 55.377 32.029  6.703   1.00 17.70 ? 66  ILE A CB  1 
ATOM   390  C CG1 . ILE A 1 59  ? 56.621 31.640  7.515   1.00 21.19 ? 66  ILE A CG1 1 
ATOM   391  C CG2 . ILE A 1 59  ? 55.670 31.898  5.223   1.00 17.47 ? 66  ILE A CG2 1 
ATOM   392  C CD1 . ILE A 1 59  ? 57.043 30.191  7.371   1.00 16.45 ? 66  ILE A CD1 1 
ATOM   393  N N   . PRO A 1 60  ? 53.607 32.920  9.006   1.00 16.83 ? 67  PRO A N   1 
ATOM   394  C CA  . PRO A 1 60  ? 53.252 32.858  10.424  1.00 15.92 ? 67  PRO A CA  1 
ATOM   395  C C   . PRO A 1 60  ? 54.253 31.965  11.169  1.00 17.92 ? 67  PRO A C   1 
ATOM   396  O O   . PRO A 1 60  ? 54.723 30.968  10.627  1.00 11.13 ? 67  PRO A O   1 
ATOM   397  C CB  . PRO A 1 60  ? 51.856 32.230  10.404  1.00 15.34 ? 67  PRO A CB  1 
ATOM   398  C CG  . PRO A 1 60  ? 51.309 32.638  9.052   1.00 17.91 ? 67  PRO A CG  1 
ATOM   399  C CD  . PRO A 1 60  ? 52.503 32.412  8.171   1.00 17.74 ? 67  PRO A CD  1 
ATOM   400  N N   . GLY A 1 61  ? 54.585 32.324  12.403  1.00 17.62 ? 68  GLY A N   1 
ATOM   401  C CA  . GLY A 1 61  ? 55.506 31.496  13.162  1.00 18.39 ? 68  GLY A CA  1 
ATOM   402  C C   . GLY A 1 61  ? 54.914 30.113  13.384  1.00 18.56 ? 68  GLY A C   1 
ATOM   403  O O   . GLY A 1 61  ? 53.698 29.959  13.493  1.00 16.37 ? 68  GLY A O   1 
ATOM   404  N N   . GLY A 1 62  ? 55.766 29.098  13.451  1.00 13.62 ? 69  GLY A N   1 
ATOM   405  C CA  . GLY A 1 62  ? 55.268 27.751  13.650  1.00 15.20 ? 69  GLY A CA  1 
ATOM   406  C C   . GLY A 1 62  ? 54.703 27.481  15.035  1.00 14.76 ? 69  GLY A C   1 
ATOM   407  O O   . GLY A 1 62  ? 55.098 28.114  16.010  1.00 11.00 ? 69  GLY A O   1 
ATOM   408  N N   . ILE A 1 63  ? 53.761 26.543  15.110  1.00 11.44 ? 70  ILE A N   1 
ATOM   409  C CA  . ILE A 1 63  ? 53.156 26.142  16.380  1.00 15.46 ? 70  ILE A CA  1 
ATOM   410  C C   . ILE A 1 63  ? 53.455 24.660  16.552  1.00 14.50 ? 70  ILE A C   1 
ATOM   411  O O   . ILE A 1 63  ? 52.945 23.839  15.786  1.00 15.29 ? 70  ILE A O   1 
ATOM   412  C CB  . ILE A 1 63  ? 51.613 26.293  16.388  1.00 13.30 ? 70  ILE A CB  1 
ATOM   413  C CG1 . ILE A 1 63  ? 51.205 27.727  16.068  1.00 16.39 ? 70  ILE A CG1 1 
ATOM   414  C CG2 . ILE A 1 63  ? 51.066 25.898  17.759  1.00 14.14 ? 70  ILE A CG2 1 
ATOM   415  C CD1 . ILE A 1 63  ? 49.700 27.935  16.041  1.00 15.82 ? 70  ILE A CD1 1 
ATOM   416  N N   . ASP A 1 64  ? 54.281 24.314  17.535  1.00 14.21 ? 71  ASP A N   1 
ATOM   417  C CA  . ASP A 1 64  ? 54.615 22.913  17.776  1.00 14.72 ? 71  ASP A CA  1 
ATOM   418  C C   . ASP A 1 64  ? 53.593 22.355  18.756  1.00 13.60 ? 71  ASP A C   1 
ATOM   419  O O   . ASP A 1 64  ? 53.667 22.597  19.958  1.00 14.22 ? 71  ASP A O   1 
ATOM   420  C CB  . ASP A 1 64  ? 56.026 22.770  18.359  1.00 14.32 ? 71  ASP A CB  1 
ATOM   421  C CG  . ASP A 1 64  ? 56.532 21.327  18.334  1.00 17.22 ? 71  ASP A CG  1 
ATOM   422  O OD1 . ASP A 1 64  ? 55.709 20.385  18.377  1.00 16.60 ? 71  ASP A OD1 1 
ATOM   423  O OD2 . ASP A 1 64  ? 57.762 21.136  18.287  1.00 14.77 ? 71  ASP A OD2 1 
ATOM   424  N N   . VAL A 1 65  ? 52.637 21.607  18.223  1.00 14.36 ? 72  VAL A N   1 
ATOM   425  C CA  . VAL A 1 65  ? 51.574 21.016  19.021  1.00 11.53 ? 72  VAL A CA  1 
ATOM   426  C C   . VAL A 1 65  ? 52.009 19.900  19.972  1.00 12.93 ? 72  VAL A C   1 
ATOM   427  O O   . VAL A 1 65  ? 51.199 19.413  20.758  1.00 12.38 ? 72  VAL A O   1 
ATOM   428  C CB  . VAL A 1 65  ? 50.460 20.449  18.107  1.00 13.05 ? 72  VAL A CB  1 
ATOM   429  C CG1 . VAL A 1 65  ? 49.805 21.571  17.332  1.00 8.02  ? 72  VAL A CG1 1 
ATOM   430  C CG2 . VAL A 1 65  ? 51.042 19.415  17.166  1.00 13.38 ? 72  VAL A CG2 1 
ATOM   431  N N   . ASN A 1 66  ? 53.269 19.485  19.915  1.00 11.63 ? 73  ASN A N   1 
ATOM   432  C CA  . ASN A 1 66  ? 53.693 18.412  20.802  1.00 14.23 ? 73  ASN A CA  1 
ATOM   433  C C   . ASN A 1 66  ? 55.125 18.523  21.318  1.00 16.53 ? 73  ASN A C   1 
ATOM   434  O O   . ASN A 1 66  ? 56.077 18.196  20.610  1.00 17.02 ? 73  ASN A O   1 
ATOM   435  C CB  . ASN A 1 66  ? 53.515 17.060  20.101  1.00 15.41 ? 73  ASN A CB  1 
ATOM   436  C CG  . ASN A 1 66  ? 53.627 15.894  21.055  1.00 16.16 ? 73  ASN A CG  1 
ATOM   437  O OD1 . ASN A 1 66  ? 54.308 15.979  22.075  1.00 19.66 ? 73  ASN A OD1 1 
ATOM   438  N ND2 . ASN A 1 66  ? 52.968 14.788  20.724  1.00 16.77 ? 73  ASN A ND2 1 
ATOM   439  N N   . THR A 1 67  ? 55.268 18.992  22.555  1.00 14.48 ? 74  THR A N   1 
ATOM   440  C CA  . THR A 1 67  ? 56.574 19.096  23.183  1.00 14.39 ? 74  THR A CA  1 
ATOM   441  C C   . THR A 1 67  ? 56.505 18.490  24.583  1.00 15.10 ? 74  THR A C   1 
ATOM   442  O O   . THR A 1 67  ? 55.454 18.486  25.224  1.00 16.57 ? 74  THR A O   1 
ATOM   443  C CB  . THR A 1 67  ? 57.098 20.572  23.244  1.00 16.14 ? 74  THR A CB  1 
ATOM   444  O OG1 . THR A 1 67  ? 56.223 21.388  24.024  1.00 9.46  ? 74  THR A OG1 1 
ATOM   445  C CG2 . THR A 1 67  ? 57.214 21.152  21.831  1.00 15.50 ? 74  THR A CG2 1 
ATOM   446  N N   . TYR A 1 68  ? 57.626 17.946  25.035  1.00 16.40 ? 75  TYR A N   1 
ATOM   447  C CA  . TYR A 1 68  ? 57.718 17.316  26.347  1.00 15.26 ? 75  TYR A CA  1 
ATOM   448  C C   . TYR A 1 68  ? 58.993 17.814  27.003  1.00 16.25 ? 75  TYR A C   1 
ATOM   449  O O   . TYR A 1 68  ? 59.859 17.022  27.371  1.00 17.96 ? 75  TYR A O   1 
ATOM   450  C CB  . TYR A 1 68  ? 57.791 15.783  26.209  1.00 16.97 ? 75  TYR A CB  1 
ATOM   451  C CG  . TYR A 1 68  ? 56.451 15.068  26.141  1.00 16.07 ? 75  TYR A CG  1 
ATOM   452  C CD1 . TYR A 1 68  ? 55.762 14.934  24.936  1.00 17.72 ? 75  TYR A CD1 1 
ATOM   453  C CD2 . TYR A 1 68  ? 55.875 14.533  27.293  1.00 17.93 ? 75  TYR A CD2 1 
ATOM   454  C CE1 . TYR A 1 68  ? 54.522 14.277  24.877  1.00 15.99 ? 75  TYR A CE1 1 
ATOM   455  C CE2 . TYR A 1 68  ? 54.642 13.879  27.254  1.00 17.64 ? 75  TYR A CE2 1 
ATOM   456  C CZ  . TYR A 1 68  ? 53.967 13.758  26.042  1.00 21.74 ? 75  TYR A CZ  1 
ATOM   457  O OH  . TYR A 1 68  ? 52.721 13.163  26.019  1.00 17.22 ? 75  TYR A OH  1 
ATOM   458  N N   . LEU A 1 69  ? 59.106 19.124  27.169  1.00 16.35 ? 76  LEU A N   1 
ATOM   459  C CA  . LEU A 1 69  ? 60.325 19.685  27.741  1.00 19.64 ? 76  LEU A CA  1 
ATOM   460  C C   . LEU A 1 69  ? 60.721 19.242  29.147  1.00 22.97 ? 76  LEU A C   1 
ATOM   461  O O   . LEU A 1 69  ? 61.914 19.161  29.441  1.00 25.63 ? 76  LEU A O   1 
ATOM   462  C CB  . LEU A 1 69  ? 60.283 21.215  27.659  1.00 16.28 ? 76  LEU A CB  1 
ATOM   463  C CG  . LEU A 1 69  ? 60.121 21.708  26.218  1.00 18.04 ? 76  LEU A CG  1 
ATOM   464  C CD1 . LEU A 1 69  ? 60.352 23.207  26.163  1.00 20.22 ? 76  LEU A CD1 1 
ATOM   465  C CD2 . LEU A 1 69  ? 61.109 20.980  25.303  1.00 17.33 ? 76  LEU A CD2 1 
ATOM   466  N N   . GLN A 1 70  ? 59.756 18.958  30.016  1.00 17.26 ? 77  GLN A N   1 
ATOM   467  C CA  . GLN A 1 70  ? 60.097 18.528  31.374  1.00 23.24 ? 77  GLN A CA  1 
ATOM   468  C C   . GLN A 1 70  ? 59.578 17.132  31.670  1.00 21.94 ? 77  GLN A C   1 
ATOM   469  O O   . GLN A 1 70  ? 59.219 16.818  32.798  1.00 23.58 ? 77  GLN A O   1 
ATOM   470  C CB  . GLN A 1 70  ? 59.540 19.512  32.415  1.00 28.16 ? 77  GLN A CB  1 
ATOM   471  C CG  . GLN A 1 70  ? 60.487 20.667  32.729  1.00 42.19 ? 77  GLN A CG  1 
ATOM   472  C CD  . GLN A 1 70  ? 60.000 21.556  33.871  1.00 46.09 ? 77  GLN A CD  1 
ATOM   473  O OE1 . GLN A 1 70  ? 59.969 21.148  35.041  1.00 47.92 ? 77  GLN A OE1 1 
ATOM   474  N NE2 . GLN A 1 70  ? 59.612 22.774  33.531  1.00 49.11 ? 77  GLN A NE2 1 
ATOM   475  N N   . LYS A 1 71  ? 59.553 16.295  30.644  1.00 22.64 ? 78  LYS A N   1 
ATOM   476  C CA  . LYS A 1 71  ? 59.047 14.943  30.764  1.00 21.29 ? 78  LYS A CA  1 
ATOM   477  C C   . LYS A 1 71  ? 59.890 14.028  31.643  1.00 22.56 ? 78  LYS A C   1 
ATOM   478  O O   . LYS A 1 71  ? 61.119 14.012  31.554  1.00 18.82 ? 78  LYS A O   1 
ATOM   479  C CB  . LYS A 1 71  ? 58.923 14.324  29.368  1.00 21.08 ? 78  LYS A CB  1 
ATOM   480  C CG  . LYS A 1 71  ? 58.448 12.882  29.337  1.00 20.55 ? 78  LYS A CG  1 
ATOM   481  C CD  . LYS A 1 71  ? 58.736 12.270  27.956  1.00 23.25 ? 78  LYS A CD  1 
ATOM   482  C CE  . LYS A 1 71  ? 58.361 10.796  27.875  1.00 22.09 ? 78  LYS A CE  1 
ATOM   483  N NZ  . LYS A 1 71  ? 58.837 10.184  26.590  1.00 17.14 ? 78  LYS A NZ  1 
ATOM   484  N N   . PRO A 1 72  ? 59.230 13.263  32.521  1.00 19.35 ? 79  PRO A N   1 
ATOM   485  C CA  . PRO A 1 72  ? 59.918 12.328  33.412  1.00 21.57 ? 79  PRO A CA  1 
ATOM   486  C C   . PRO A 1 72  ? 60.018 10.969  32.708  1.00 23.04 ? 79  PRO A C   1 
ATOM   487  O O   . PRO A 1 72  ? 59.075 10.553  32.034  1.00 20.68 ? 79  PRO A O   1 
ATOM   488  C CB  . PRO A 1 72  ? 59.002 12.285  34.632  1.00 21.68 ? 79  PRO A CB  1 
ATOM   489  C CG  . PRO A 1 72  ? 57.644 12.408  34.017  1.00 19.67 ? 79  PRO A CG  1 
ATOM   490  C CD  . PRO A 1 72  ? 57.843 13.494  32.967  1.00 21.07 ? 79  PRO A CD  1 
ATOM   491  N N   . SER A 1 73  ? 61.162 10.296  32.841  1.00 24.23 ? 80  SER A N   1 
ATOM   492  C CA  . SER A 1 73  ? 61.360 8.981   32.229  1.00 23.13 ? 80  SER A CA  1 
ATOM   493  C C   . SER A 1 73  ? 62.469 8.226   32.950  1.00 26.11 ? 80  SER A C   1 
ATOM   494  O O   . SER A 1 73  ? 63.629 8.657   32.948  1.00 23.48 ? 80  SER A O   1 
ATOM   495  C CB  . SER A 1 73  ? 61.726 9.117   30.756  1.00 24.77 ? 80  SER A CB  1 
ATOM   496  O OG  . SER A 1 73  ? 61.759 7.842   30.133  1.00 24.12 ? 80  SER A OG  1 
ATOM   497  N N   . GLN A 1 74  ? 62.111 7.091   33.547  1.00 24.94 ? 81  GLN A N   1 
ATOM   498  C CA  . GLN A 1 74  ? 63.059 6.276   34.304  1.00 24.27 ? 81  GLN A CA  1 
ATOM   499  C C   . GLN A 1 74  ? 63.700 7.136   35.399  1.00 21.85 ? 81  GLN A C   1 
ATOM   500  O O   . GLN A 1 74  ? 64.887 7.007   35.681  1.00 23.29 ? 81  GLN A O   1 
ATOM   501  C CB  . GLN A 1 74  ? 64.153 5.697   33.385  1.00 26.50 ? 81  GLN A CB  1 
ATOM   502  C CG  . GLN A 1 74  ? 63.692 4.634   32.378  1.00 28.43 ? 81  GLN A CG  1 
ATOM   503  C CD  . GLN A 1 74  ? 63.044 3.418   33.043  1.00 33.06 ? 81  GLN A CD  1 
ATOM   504  O OE1 . GLN A 1 74  ? 63.536 2.909   34.050  1.00 34.41 ? 81  GLN A OE1 1 
ATOM   505  N NE2 . GLN A 1 74  ? 61.937 2.942   32.467  1.00 35.30 ? 81  GLN A NE2 1 
ATOM   506  N N   . GLY A 1 75  ? 62.909 8.025   35.997  1.00 20.66 ? 82  GLY A N   1 
ATOM   507  C CA  . GLY A 1 75  ? 63.406 8.886   37.060  1.00 18.02 ? 82  GLY A CA  1 
ATOM   508  C C   . GLY A 1 75  ? 64.275 10.069  36.644  1.00 20.01 ? 82  GLY A C   1 
ATOM   509  O O   . GLY A 1 75  ? 64.816 10.766  37.504  1.00 20.84 ? 82  GLY A O   1 
ATOM   510  N N   . MET A 1 76  ? 64.405 10.306  35.342  1.00 14.74 ? 83  MET A N   1 
ATOM   511  C CA  . MET A 1 76  ? 65.220 11.410  34.834  1.00 19.12 ? 83  MET A CA  1 
ATOM   512  C C   . MET A 1 76  ? 64.381 12.422  34.032  1.00 18.74 ? 83  MET A C   1 
ATOM   513  O O   . MET A 1 76  ? 63.463 12.041  33.316  1.00 21.31 ? 83  MET A O   1 
ATOM   514  C CB  . MET A 1 76  ? 66.344 10.856  33.948  1.00 17.29 ? 83  MET A CB  1 
ATOM   515  C CG  . MET A 1 76  ? 67.289 9.889   34.652  1.00 14.55 ? 83  MET A CG  1 
ATOM   516  S SD  . MET A 1 76  ? 68.520 9.172   33.554  1.00 5.23  ? 83  MET A SD  1 
ATOM   517  C CE  . MET A 1 76  ? 67.629 7.818   32.972  1.00 16.80 ? 83  MET A CE  1 
ATOM   518  N N   . THR A 1 77  ? 64.707 13.708  34.145  1.00 21.02 ? 84  THR A N   1 
ATOM   519  C CA  . THR A 1 77  ? 63.980 14.761  33.428  1.00 16.59 ? 84  THR A CA  1 
ATOM   520  C C   . THR A 1 77  ? 64.601 14.984  32.045  1.00 19.26 ? 84  THR A C   1 
ATOM   521  O O   . THR A 1 77  ? 65.819 14.904  31.888  1.00 19.74 ? 84  THR A O   1 
ATOM   522  C CB  . THR A 1 77  ? 64.028 16.103  34.214  1.00 21.96 ? 84  THR A CB  1 
ATOM   523  O OG1 . THR A 1 77  ? 63.637 15.879  35.573  1.00 17.30 ? 84  THR A OG1 1 
ATOM   524  C CG2 . THR A 1 77  ? 63.076 17.131  33.595  1.00 22.35 ? 84  THR A CG2 1 
ATOM   525  N N   . SER A 1 78  ? 63.765 15.258  31.046  1.00 17.67 ? 85  SER A N   1 
ATOM   526  C CA  . SER A 1 78  ? 64.247 15.507  29.685  1.00 18.27 ? 85  SER A CA  1 
ATOM   527  C C   . SER A 1 78  ? 65.336 16.601  29.695  1.00 18.20 ? 85  SER A C   1 
ATOM   528  O O   . SER A 1 78  ? 65.233 17.583  30.430  1.00 15.78 ? 85  SER A O   1 
ATOM   529  C CB  . SER A 1 78  ? 63.081 15.929  28.787  1.00 17.91 ? 85  SER A CB  1 
ATOM   530  O OG  . SER A 1 78  ? 63.483 15.956  27.436  1.00 26.34 ? 85  SER A OG  1 
ATOM   531  N N   . ALA A 1 79  ? 66.348 16.437  28.846  1.00 19.45 ? 86  ALA A N   1 
ATOM   532  C CA  . ALA A 1 79  ? 67.508 17.330  28.786  1.00 18.42 ? 86  ALA A CA  1 
ATOM   533  C C   . ALA A 1 79  ? 67.369 18.821  28.479  1.00 19.28 ? 86  ALA A C   1 
ATOM   534  O O   . ALA A 1 79  ? 68.187 19.611  28.949  1.00 19.04 ? 86  ALA A O   1 
ATOM   535  C CB  . ALA A 1 79  ? 68.558 16.722  27.853  1.00 21.32 ? 86  ALA A CB  1 
ATOM   536  N N   . ASP A 1 80  ? 66.379 19.217  27.689  1.00 14.09 ? 87  ASP A N   1 
ATOM   537  C CA  . ASP A 1 80  ? 66.216 20.634  27.369  1.00 16.26 ? 87  ASP A CA  1 
ATOM   538  C C   . ASP A 1 80  ? 65.051 21.229  28.155  1.00 18.14 ? 87  ASP A C   1 
ATOM   539  O O   . ASP A 1 80  ? 63.899 20.878  27.916  1.00 19.00 ? 87  ASP A O   1 
ATOM   540  C CB  . ASP A 1 80  ? 65.984 20.836  25.859  1.00 16.28 ? 87  ASP A CB  1 
ATOM   541  C CG  . ASP A 1 80  ? 67.125 20.287  25.009  1.00 20.27 ? 87  ASP A CG  1 
ATOM   542  O OD1 . ASP A 1 80  ? 68.290 20.427  25.416  1.00 17.86 ? 87  ASP A OD1 1 
ATOM   543  O OD2 . ASP A 1 80  ? 66.865 19.724  23.925  1.00 20.43 ? 87  ASP A OD2 1 
ATOM   544  N N   . ASP A 1 81  ? 65.357 22.124  29.096  1.00 17.06 ? 88  ASP A N   1 
ATOM   545  C CA  . ASP A 1 81  ? 64.323 22.748  29.912  1.00 18.83 ? 88  ASP A CA  1 
ATOM   546  C C   . ASP A 1 81  ? 63.567 23.810  29.129  1.00 16.42 ? 88  ASP A C   1 
ATOM   547  O O   . ASP A 1 81  ? 63.839 24.038  27.949  1.00 18.44 ? 88  ASP A O   1 
ATOM   548  C CB  . ASP A 1 81  ? 64.918 23.358  31.197  1.00 22.43 ? 88  ASP A CB  1 
ATOM   549  C CG  . ASP A 1 81  ? 65.836 24.535  30.925  1.00 27.43 ? 88  ASP A CG  1 
ATOM   550  O OD1 . ASP A 1 81  ? 65.913 24.986  29.760  1.00 26.53 ? 88  ASP A OD1 1 
ATOM   551  O OD2 . ASP A 1 81  ? 66.484 25.015  31.886  1.00 23.71 ? 88  ASP A OD2 1 
ATOM   552  N N   . PHE A 1 82  ? 62.616 24.459  29.787  1.00 18.39 ? 89  PHE A N   1 
ATOM   553  C CA  . PHE A 1 82  ? 61.808 25.474  29.130  1.00 18.52 ? 89  PHE A CA  1 
ATOM   554  C C   . PHE A 1 82  ? 62.606 26.582  28.478  1.00 17.10 ? 89  PHE A C   1 
ATOM   555  O O   . PHE A 1 82  ? 62.150 27.177  27.503  1.00 16.84 ? 89  PHE A O   1 
ATOM   556  C CB  . PHE A 1 82  ? 60.793 26.051  30.111  1.00 19.47 ? 89  PHE A CB  1 
ATOM   557  C CG  . PHE A 1 82  ? 59.472 25.339  30.081  1.00 22.99 ? 89  PHE A CG  1 
ATOM   558  C CD1 . PHE A 1 82  ? 58.652 25.430  28.957  1.00 21.97 ? 89  PHE A CD1 1 
ATOM   559  C CD2 . PHE A 1 82  ? 59.065 24.542  31.151  1.00 24.00 ? 89  PHE A CD2 1 
ATOM   560  C CE1 . PHE A 1 82  ? 57.445 24.733  28.893  1.00 22.86 ? 89  PHE A CE1 1 
ATOM   561  C CE2 . PHE A 1 82  ? 57.857 23.838  31.101  1.00 23.32 ? 89  PHE A CE2 1 
ATOM   562  C CZ  . PHE A 1 82  ? 57.046 23.935  29.964  1.00 25.35 ? 89  PHE A CZ  1 
ATOM   563  N N   . PHE A 1 83  ? 63.801 26.856  28.994  1.00 17.43 ? 90  PHE A N   1 
ATOM   564  C CA  . PHE A 1 83  ? 64.624 27.895  28.398  1.00 17.35 ? 90  PHE A CA  1 
ATOM   565  C C   . PHE A 1 83  ? 65.369 27.380  27.166  1.00 18.76 ? 90  PHE A C   1 
ATOM   566  O O   . PHE A 1 83  ? 65.192 27.903  26.064  1.00 16.51 ? 90  PHE A O   1 
ATOM   567  C CB  . PHE A 1 83  ? 65.634 28.453  29.401  1.00 18.52 ? 90  PHE A CB  1 
ATOM   568  C CG  . PHE A 1 83  ? 66.543 29.488  28.808  1.00 18.13 ? 90  PHE A CG  1 
ATOM   569  C CD1 . PHE A 1 83  ? 66.032 30.699  28.364  1.00 17.46 ? 90  PHE A CD1 1 
ATOM   570  C CD2 . PHE A 1 83  ? 67.898 29.228  28.649  1.00 20.33 ? 90  PHE A CD2 1 
ATOM   571  C CE1 . PHE A 1 83  ? 66.855 31.654  27.762  1.00 22.81 ? 90  PHE A CE1 1 
ATOM   572  C CE2 . PHE A 1 83  ? 68.740 30.168  28.050  1.00 26.55 ? 90  PHE A CE2 1 
ATOM   573  C CZ  . PHE A 1 83  ? 68.215 31.392  27.603  1.00 27.21 ? 90  PHE A CZ  1 
ATOM   574  N N   . GLN A 1 84  ? 66.208 26.362  27.357  1.00 20.56 ? 91  GLN A N   1 
ATOM   575  C CA  . GLN A 1 84  ? 66.969 25.787  26.247  1.00 21.40 ? 91  GLN A CA  1 
ATOM   576  C C   . GLN A 1 84  ? 66.018 25.336  25.152  1.00 17.13 ? 91  GLN A C   1 
ATOM   577  O O   . GLN A 1 84  ? 66.242 25.603  23.978  1.00 18.48 ? 91  GLN A O   1 
ATOM   578  C CB  . GLN A 1 84  ? 67.800 24.589  26.717  1.00 20.51 ? 91  GLN A CB  1 
ATOM   579  C CG  . GLN A 1 84  ? 69.009 24.947  27.575  1.00 31.66 ? 91  GLN A CG  1 
ATOM   580  C CD  . GLN A 1 84  ? 69.980 25.873  26.856  1.00 34.36 ? 91  GLN A CD  1 
ATOM   581  O OE1 . GLN A 1 84  ? 70.426 25.583  25.742  1.00 37.28 ? 91  GLN A OE1 1 
ATOM   582  N NE2 . GLN A 1 84  ? 70.316 26.995  27.495  1.00 37.69 ? 91  GLN A NE2 1 
ATOM   583  N N   . GLY A 1 85  ? 64.952 24.655  25.556  1.00 19.99 ? 92  GLY A N   1 
ATOM   584  C CA  . GLY A 1 85  ? 63.968 24.155  24.614  1.00 20.91 ? 92  GLY A CA  1 
ATOM   585  C C   . GLY A 1 85  ? 63.336 25.191  23.698  1.00 20.87 ? 92  GLY A C   1 
ATOM   586  O O   . GLY A 1 85  ? 63.296 24.986  22.486  1.00 18.53 ? 92  GLY A O   1 
ATOM   587  N N   . THR A 1 86  ? 62.834 26.290  24.265  1.00 20.02 ? 93  THR A N   1 
ATOM   588  C CA  . THR A 1 86  ? 62.195 27.334  23.466  1.00 19.31 ? 93  THR A CA  1 
ATOM   589  C C   . THR A 1 86  ? 63.221 28.133  22.679  1.00 19.94 ? 93  THR A C   1 
ATOM   590  O O   . THR A 1 86  ? 62.918 28.676  21.623  1.00 17.31 ? 93  THR A O   1 
ATOM   591  C CB  . THR A 1 86  ? 61.361 28.303  24.329  1.00 19.49 ? 93  THR A CB  1 
ATOM   592  O OG1 . THR A 1 86  ? 62.175 28.851  25.373  1.00 17.08 ? 93  THR A OG1 1 
ATOM   593  C CG2 . THR A 1 86  ? 60.156 27.579  24.919  1.00 16.89 ? 93  THR A CG2 1 
ATOM   594  N N   . LYS A 1 87  ? 64.437 28.217  23.199  1.00 19.78 ? 94  LYS A N   1 
ATOM   595  C CA  . LYS A 1 87  ? 65.478 28.914  22.471  1.00 19.19 ? 94  LYS A CA  1 
ATOM   596  C C   . LYS A 1 87  ? 65.692 28.115  21.171  1.00 19.65 ? 94  LYS A C   1 
ATOM   597  O O   . LYS A 1 87  ? 65.784 28.678  20.077  1.00 17.36 ? 94  LYS A O   1 
ATOM   598  C CB  . LYS A 1 87  ? 66.769 28.922  23.278  1.00 23.07 ? 94  LYS A CB  1 
ATOM   599  C CG  . LYS A 1 87  ? 67.912 29.616  22.568  1.00 27.80 ? 94  LYS A CG  1 
ATOM   600  C CD  . LYS A 1 87  ? 69.233 29.347  23.275  1.00 38.18 ? 94  LYS A CD  1 
ATOM   601  C CE  . LYS A 1 87  ? 69.191 29.807  24.712  1.00 39.43 ? 94  LYS A CE  1 
ATOM   602  N NZ  . LYS A 1 87  ? 70.377 29.305  25.468  1.00 44.54 ? 94  LYS A NZ  1 
ATOM   603  N N   . ALA A 1 88  ? 65.770 26.794  21.315  1.00 15.37 ? 95  ALA A N   1 
ATOM   604  C CA  . ALA A 1 88  ? 65.966 25.900  20.175  1.00 16.52 ? 95  ALA A CA  1 
ATOM   605  C C   . ALA A 1 88  ? 64.808 26.002  19.190  1.00 14.89 ? 95  ALA A C   1 
ATOM   606  O O   . ALA A 1 88  ? 65.011 25.968  17.986  1.00 16.86 ? 95  ALA A O   1 
ATOM   607  C CB  . ALA A 1 88  ? 66.105 24.476  20.654  1.00 11.32 ? 95  ALA A CB  1 
ATOM   608  N N   . ALA A 1 89  ? 63.596 26.123  19.719  1.00 17.12 ? 96  ALA A N   1 
ATOM   609  C CA  . ALA A 1 89  ? 62.384 26.244  18.910  1.00 17.12 ? 96  ALA A CA  1 
ATOM   610  C C   . ALA A 1 89  ? 62.425 27.516  18.063  1.00 15.19 ? 96  ALA A C   1 
ATOM   611  O O   . ALA A 1 89  ? 62.179 27.479  16.861  1.00 15.82 ? 96  ALA A O   1 
ATOM   612  C CB  . ALA A 1 89  ? 61.152 26.272  19.825  1.00 15.85 ? 96  ALA A CB  1 
ATOM   613  N N   . LEU A 1 90  ? 62.745 28.641  18.698  1.00 16.88 ? 97  LEU A N   1 
ATOM   614  C CA  . LEU A 1 90  ? 62.817 29.924  18.003  1.00 14.17 ? 97  LEU A CA  1 
ATOM   615  C C   . LEU A 1 90  ? 63.862 29.925  16.887  1.00 15.96 ? 97  LEU A C   1 
ATOM   616  O O   . LEU A 1 90  ? 63.633 30.487  15.812  1.00 17.63 ? 97  LEU A O   1 
ATOM   617  C CB  . LEU A 1 90  ? 63.122 31.056  18.997  1.00 16.06 ? 97  LEU A CB  1 
ATOM   618  C CG  . LEU A 1 90  ? 61.982 31.414  19.957  1.00 19.81 ? 97  LEU A CG  1 
ATOM   619  C CD1 . LEU A 1 90  ? 62.473 32.430  20.970  1.00 19.83 ? 97  LEU A CD1 1 
ATOM   620  C CD2 . LEU A 1 90  ? 60.794 31.968  19.176  1.00 16.03 ? 97  LEU A CD2 1 
ATOM   621  N N   . ALA A 1 91  ? 65.007 29.302  17.140  1.00 12.04 ? 98  ALA A N   1 
ATOM   622  C CA  . ALA A 1 91  ? 66.059 29.246  16.131  1.00 16.68 ? 98  ALA A CA  1 
ATOM   623  C C   . ALA A 1 91  ? 65.575 28.468  14.898  1.00 15.70 ? 98  ALA A C   1 
ATOM   624  O O   . ALA A 1 91  ? 65.993 28.740  13.769  1.00 15.69 ? 98  ALA A O   1 
ATOM   625  C CB  . ALA A 1 91  ? 67.312 28.600  16.717  1.00 16.79 ? 98  ALA A CB  1 
ATOM   626  N N   . GLY A 1 92  ? 64.683 27.507  15.127  1.00 15.07 ? 99  GLY A N   1 
ATOM   627  C CA  . GLY A 1 92  ? 64.147 26.709  14.036  1.00 14.07 ? 99  GLY A CA  1 
ATOM   628  C C   . GLY A 1 92  ? 62.875 27.273  13.423  1.00 15.14 ? 99  GLY A C   1 
ATOM   629  O O   . GLY A 1 92  ? 62.229 26.602  12.623  1.00 15.98 ? 99  GLY A O   1 
ATOM   630  N N   . GLY A 1 93  ? 62.502 28.495  13.790  1.00 14.12 ? 100 GLY A N   1 
ATOM   631  C CA  . GLY A 1 93  ? 61.299 29.088  13.229  1.00 14.01 ? 100 GLY A CA  1 
ATOM   632  C C   . GLY A 1 93  ? 59.975 28.824  13.943  1.00 16.57 ? 100 GLY A C   1 
ATOM   633  O O   . GLY A 1 93  ? 58.924 29.248  13.458  1.00 15.08 ? 100 GLY A O   1 
ATOM   634  N N   . THR A 1 94  ? 60.003 28.137  15.082  1.00 15.11 ? 101 THR A N   1 
ATOM   635  C CA  . THR A 1 94  ? 58.774 27.862  15.825  1.00 16.71 ? 101 THR A CA  1 
ATOM   636  C C   . THR A 1 94  ? 58.607 28.892  16.945  1.00 18.18 ? 101 THR A C   1 
ATOM   637  O O   . THR A 1 94  ? 59.462 29.013  17.833  1.00 17.27 ? 101 THR A O   1 
ATOM   638  C CB  . THR A 1 94  ? 58.783 26.418  16.399  1.00 13.31 ? 101 THR A CB  1 
ATOM   639  O OG1 . THR A 1 94  ? 58.576 25.491  15.329  1.00 11.29 ? 101 THR A OG1 1 
ATOM   640  C CG2 . THR A 1 94  ? 57.700 26.230  17.457  1.00 14.62 ? 101 THR A CG2 1 
ATOM   641  N N   . THR A 1 95  ? 57.501 29.632  16.888  1.00 16.11 ? 102 THR A N   1 
ATOM   642  C CA  . THR A 1 95  ? 57.222 30.680  17.860  1.00 18.15 ? 102 THR A CA  1 
ATOM   643  C C   . THR A 1 95  ? 56.225 30.341  18.961  1.00 18.92 ? 102 THR A C   1 
ATOM   644  O O   . THR A 1 95  ? 55.969 31.170  19.832  1.00 18.51 ? 102 THR A O   1 
ATOM   645  C CB  . THR A 1 95  ? 56.754 31.965  17.153  1.00 17.14 ? 102 THR A CB  1 
ATOM   646  O OG1 . THR A 1 95  ? 55.711 31.644  16.222  1.00 16.61 ? 102 THR A OG1 1 
ATOM   647  C CG2 . THR A 1 95  ? 57.929 32.617  16.409  1.00 19.89 ? 102 THR A CG2 1 
ATOM   648  N N   . MET A 1 96  ? 55.642 29.148  18.924  1.00 18.77 ? 103 MET A N   1 
ATOM   649  C CA  . MET A 1 96  ? 54.716 28.746  19.988  1.00 19.86 ? 103 MET A CA  1 
ATOM   650  C C   . MET A 1 96  ? 54.747 27.232  20.150  1.00 19.43 ? 103 MET A C   1 
ATOM   651  O O   . MET A 1 96  ? 54.869 26.500  19.164  1.00 16.98 ? 103 MET A O   1 
ATOM   652  C CB  . MET A 1 96  ? 53.277 29.197  19.697  1.00 17.60 ? 103 MET A CB  1 
ATOM   653  C CG  . MET A 1 96  ? 52.396 29.296  20.964  1.00 21.14 ? 103 MET A CG  1 
ATOM   654  S SD  . MET A 1 96  ? 50.622 29.281  20.605  1.00 20.21 ? 103 MET A SD  1 
ATOM   655  C CE  . MET A 1 96  ? 50.010 28.646  22.161  1.00 27.60 ? 103 MET A CE  1 
ATOM   656  N N   . ILE A 1 97  ? 54.665 26.777  21.400  1.00 17.06 ? 104 ILE A N   1 
ATOM   657  C CA  . ILE A 1 97  ? 54.655 25.351  21.718  1.00 13.83 ? 104 ILE A CA  1 
ATOM   658  C C   . ILE A 1 97  ? 53.507 25.053  22.675  1.00 13.59 ? 104 ILE A C   1 
ATOM   659  O O   . ILE A 1 97  ? 53.041 25.936  23.392  1.00 15.86 ? 104 ILE A O   1 
ATOM   660  C CB  . ILE A 1 97  ? 55.962 24.885  22.420  1.00 14.93 ? 104 ILE A CB  1 
ATOM   661  C CG1 . ILE A 1 97  ? 56.069 25.537  23.804  1.00 19.13 ? 104 ILE A CG1 1 
ATOM   662  C CG2 . ILE A 1 97  ? 57.174 25.238  21.568  1.00 12.95 ? 104 ILE A CG2 1 
ATOM   663  C CD1 . ILE A 1 97  ? 57.269 25.084  24.623  1.00 21.31 ? 104 ILE A CD1 1 
ATOM   664  N N   . ILE A 1 98  ? 53.040 23.811  22.661  1.00 12.44 ? 105 ILE A N   1 
ATOM   665  C CA  . ILE A 1 98  ? 51.983 23.373  23.561  1.00 13.81 ? 105 ILE A CA  1 
ATOM   666  C C   . ILE A 1 98  ? 52.654 22.186  24.236  1.00 15.49 ? 105 ILE A C   1 
ATOM   667  O O   . ILE A 1 98  ? 52.744 21.093  23.666  1.00 16.31 ? 105 ILE A O   1 
ATOM   668  C CB  . ILE A 1 98  ? 50.704 22.930  22.807  1.00 11.14 ? 105 ILE A CB  1 
ATOM   669  C CG1 . ILE A 1 98  ? 50.315 23.995  21.771  1.00 13.64 ? 105 ILE A CG1 1 
ATOM   670  C CG2 . ILE A 1 98  ? 49.564 22.739  23.808  1.00 13.14 ? 105 ILE A CG2 1 
ATOM   671  C CD1 . ILE A 1 98  ? 49.038 23.718  21.014  1.00 14.21 ? 105 ILE A CD1 1 
ATOM   672  N N   . ASP A 1 99  ? 53.167 22.433  25.434  1.00 11.73 ? 106 ASP A N   1 
ATOM   673  C CA  . ASP A 1 99  ? 53.894 21.430  26.194  1.00 11.45 ? 106 ASP A CA  1 
ATOM   674  C C   . ASP A 1 99  ? 53.014 20.548  27.076  1.00 12.45 ? 106 ASP A C   1 
ATOM   675  O O   . ASP A 1 99  ? 52.039 21.009  27.667  1.00 15.68 ? 106 ASP A O   1 
ATOM   676  C CB  . ASP A 1 99  ? 54.967 22.123  27.042  1.00 17.13 ? 106 ASP A CB  1 
ATOM   677  C CG  . ASP A 1 99  ? 56.023 21.160  27.553  1.00 17.54 ? 106 ASP A CG  1 
ATOM   678  O OD1 . ASP A 1 99  ? 56.874 20.725  26.748  1.00 16.56 ? 106 ASP A OD1 1 
ATOM   679  O OD2 . ASP A 1 99  ? 55.992 20.831  28.756  1.00 16.60 ? 106 ASP A OD2 1 
ATOM   680  N N   . HIS A 1 100 ? 53.386 19.275  27.159  1.00 14.91 ? 107 HIS A N   1 
ATOM   681  C CA  . HIS A 1 100 ? 52.669 18.276  27.944  1.00 15.58 ? 107 HIS A CA  1 
ATOM   682  C C   . HIS A 1 100 ? 53.017 18.251  29.432  1.00 17.07 ? 107 HIS A C   1 
ATOM   683  O O   . HIS A 1 100 ? 54.156 18.006  29.800  1.00 13.43 ? 107 HIS A O   1 
ATOM   684  C CB  . HIS A 1 100 ? 52.939 16.882  27.370  1.00 16.50 ? 107 HIS A CB  1 
ATOM   685  C CG  . HIS A 1 100 ? 52.155 16.568  26.140  1.00 18.11 ? 107 HIS A CG  1 
ATOM   686  N ND1 . HIS A 1 100 ? 50.914 15.971  26.178  1.00 15.55 ? 107 HIS A ND1 1 
ATOM   687  C CD2 . HIS A 1 100 ? 52.435 16.764  24.824  1.00 17.74 ? 107 HIS A CD2 1 
ATOM   688  C CE1 . HIS A 1 100 ? 50.464 15.807  24.948  1.00 16.55 ? 107 HIS A CE1 1 
ATOM   689  N NE2 . HIS A 1 100 ? 51.374 16.283  24.108  1.00 15.08 ? 107 HIS A NE2 1 
ATOM   690  N N   . VAL A 1 101 ? 52.030 18.496  30.285  1.00 17.62 ? 108 VAL A N   1 
ATOM   691  C CA  . VAL A 1 101 ? 52.257 18.437  31.724  1.00 17.60 ? 108 VAL A CA  1 
ATOM   692  C C   . VAL A 1 101 ? 52.117 16.963  32.102  1.00 18.48 ? 108 VAL A C   1 
ATOM   693  O O   . VAL A 1 101 ? 51.109 16.331  31.785  1.00 18.39 ? 108 VAL A O   1 
ATOM   694  C CB  . VAL A 1 101 ? 51.205 19.251  32.511  1.00 19.70 ? 108 VAL A CB  1 
ATOM   695  C CG1 . VAL A 1 101 ? 51.437 19.077  34.010  1.00 16.76 ? 108 VAL A CG1 1 
ATOM   696  C CG2 . VAL A 1 101 ? 51.282 20.721  32.138  1.00 14.70 ? 108 VAL A CG2 1 
ATOM   697  N N   . VAL A 1 102 ? 53.127 16.409  32.763  1.00 18.86 ? 109 VAL A N   1 
ATOM   698  C CA  . VAL A 1 102 ? 53.083 15.000  33.156  1.00 15.68 ? 109 VAL A CA  1 
ATOM   699  C C   . VAL A 1 102 ? 53.133 14.835  34.662  1.00 17.58 ? 109 VAL A C   1 
ATOM   700  O O   . VAL A 1 102 ? 54.192 14.932  35.265  1.00 16.65 ? 109 VAL A O   1 
ATOM   701  C CB  . VAL A 1 102 ? 54.258 14.193  32.545  1.00 16.98 ? 109 VAL A CB  1 
ATOM   702  C CG1 . VAL A 1 102 ? 54.227 12.756  33.057  1.00 16.26 ? 109 VAL A CG1 1 
ATOM   703  C CG2 . VAL A 1 102 ? 54.175 14.211  31.018  1.00 12.74 ? 109 VAL A CG2 1 
ATOM   704  N N   . PRO A 1 103 ? 51.982 14.571  35.289  1.00 19.65 ? 110 PRO A N   1 
ATOM   705  C CA  . PRO A 1 103 ? 51.903 14.390  36.746  1.00 21.28 ? 110 PRO A CA  1 
ATOM   706  C C   . PRO A 1 103 ? 52.832 13.305  37.319  1.00 22.86 ? 110 PRO A C   1 
ATOM   707  O O   . PRO A 1 103 ? 53.007 12.231  36.740  1.00 18.80 ? 110 PRO A O   1 
ATOM   708  C CB  . PRO A 1 103 ? 50.429 14.037  36.972  1.00 19.83 ? 110 PRO A CB  1 
ATOM   709  C CG  . PRO A 1 103 ? 49.735 14.751  35.848  1.00 17.95 ? 110 PRO A CG  1 
ATOM   710  C CD  . PRO A 1 103 ? 50.649 14.463  34.676  1.00 16.68 ? 110 PRO A CD  1 
ATOM   711  N N   . GLU A 1 104 ? 53.410 13.613  38.475  1.00 19.88 ? 111 GLU A N   1 
ATOM   712  C CA  . GLU A 1 104 ? 54.290 12.711  39.210  1.00 20.66 ? 111 GLU A CA  1 
ATOM   713  C C   . GLU A 1 104 ? 53.379 11.658  39.856  1.00 24.24 ? 111 GLU A C   1 
ATOM   714  O O   . GLU A 1 104 ? 52.178 11.884  40.040  1.00 17.92 ? 111 GLU A O   1 
ATOM   715  C CB  . GLU A 1 104 ? 54.978 13.502  40.329  1.00 23.87 ? 111 GLU A CB  1 
ATOM   716  C CG  . GLU A 1 104 ? 56.471 13.290  40.520  1.00 23.76 ? 111 GLU A CG  1 
ATOM   717  C CD  . GLU A 1 104 ? 57.043 14.233  41.579  1.00 21.57 ? 111 GLU A CD  1 
ATOM   718  O OE1 . GLU A 1 104 ? 56.514 14.250  42.710  1.00 13.42 ? 111 GLU A OE1 1 
ATOM   719  O OE2 . GLU A 1 104 ? 58.019 14.954  41.279  1.00 16.43 ? 111 GLU A OE2 1 
ATOM   720  N N   . PRO A 1 105 ? 53.932 10.487  40.194  1.00 23.92 ? 112 PRO A N   1 
ATOM   721  C CA  . PRO A 1 105 ? 53.090 9.472   40.828  1.00 21.72 ? 112 PRO A CA  1 
ATOM   722  C C   . PRO A 1 105 ? 52.516 10.036  42.134  1.00 22.98 ? 112 PRO A C   1 
ATOM   723  O O   . PRO A 1 105 ? 53.229 10.681  42.898  1.00 16.89 ? 112 PRO A O   1 
ATOM   724  C CB  . PRO A 1 105 ? 54.071 8.331   41.082  1.00 24.41 ? 112 PRO A CB  1 
ATOM   725  C CG  . PRO A 1 105 ? 54.974 8.425   39.902  1.00 24.21 ? 112 PRO A CG  1 
ATOM   726  C CD  . PRO A 1 105 ? 55.221 9.911   39.768  1.00 25.83 ? 112 PRO A CD  1 
ATOM   727  N N   . GLY A 1 106 ? 51.225 9.819   42.371  1.00 24.78 ? 113 GLY A N   1 
ATOM   728  C CA  . GLY A 1 106 ? 50.609 10.298  43.598  1.00 24.16 ? 113 GLY A CA  1 
ATOM   729  C C   . GLY A 1 106 ? 50.379 11.793  43.729  1.00 24.77 ? 113 GLY A C   1 
ATOM   730  O O   . GLY A 1 106 ? 50.101 12.280  44.821  1.00 22.14 ? 113 GLY A O   1 
ATOM   731  N N   . SER A 1 107 ? 50.487 12.526  42.628  1.00 21.85 ? 114 SER A N   1 
ATOM   732  C CA  . SER A 1 107 ? 50.269 13.966  42.646  1.00 23.43 ? 114 SER A CA  1 
ATOM   733  C C   . SER A 1 107 ? 48.988 14.251  41.882  1.00 20.98 ? 114 SER A C   1 
ATOM   734  O O   . SER A 1 107 ? 48.623 13.498  40.991  1.00 22.96 ? 114 SER A O   1 
ATOM   735  C CB  . SER A 1 107 ? 51.425 14.683  41.960  1.00 24.67 ? 114 SER A CB  1 
ATOM   736  O OG  . SER A 1 107 ? 51.480 14.304  40.593  1.00 35.19 ? 114 SER A OG  1 
ATOM   737  N N   . SER A 1 108 ? 48.306 15.333  42.233  1.00 22.39 ? 115 SER A N   1 
ATOM   738  C CA  . SER A 1 108 ? 47.060 15.697  41.555  1.00 23.77 ? 115 SER A CA  1 
ATOM   739  C C   . SER A 1 108 ? 47.364 16.466  40.263  1.00 22.73 ? 115 SER A C   1 
ATOM   740  O O   . SER A 1 108 ? 48.494 16.887  40.042  1.00 20.68 ? 115 SER A O   1 
ATOM   741  C CB  . SER A 1 108 ? 46.202 16.577  42.467  1.00 21.72 ? 115 SER A CB  1 
ATOM   742  O OG  . SER A 1 108 ? 46.675 17.909  42.450  1.00 19.70 ? 115 SER A OG  1 
ATOM   743  N N   . LEU A 1 109 ? 46.352 16.661  39.421  1.00 21.14 ? 116 LEU A N   1 
ATOM   744  C CA  . LEU A 1 109 ? 46.554 17.382  38.163  1.00 20.81 ? 116 LEU A CA  1 
ATOM   745  C C   . LEU A 1 109 ? 46.762 18.880  38.390  1.00 21.23 ? 116 LEU A C   1 
ATOM   746  O O   . LEU A 1 109 ? 47.591 19.506  37.722  1.00 23.73 ? 116 LEU A O   1 
ATOM   747  C CB  . LEU A 1 109 ? 45.357 17.186  37.223  1.00 17.33 ? 116 LEU A CB  1 
ATOM   748  C CG  . LEU A 1 109 ? 44.936 15.763  36.856  1.00 20.47 ? 116 LEU A CG  1 
ATOM   749  C CD1 . LEU A 1 109 ? 43.735 15.836  35.926  1.00 21.33 ? 116 LEU A CD1 1 
ATOM   750  C CD2 . LEU A 1 109 ? 46.082 15.026  36.183  1.00 15.78 ? 116 LEU A CD2 1 
ATOM   751  N N   . LEU A 1 110 ? 46.006 19.458  39.320  1.00 21.81 ? 117 LEU A N   1 
ATOM   752  C CA  . LEU A 1 110 ? 46.127 20.883  39.601  1.00 21.80 ? 117 LEU A CA  1 
ATOM   753  C C   . LEU A 1 110 ? 47.505 21.223  40.141  1.00 24.09 ? 117 LEU A C   1 
ATOM   754  O O   . LEU A 1 110 ? 48.072 22.263  39.802  1.00 25.98 ? 117 LEU A O   1 
ATOM   755  C CB  . LEU A 1 110 ? 45.053 21.331  40.593  1.00 20.74 ? 117 LEU A CB  1 
ATOM   756  C CG  . LEU A 1 110 ? 43.625 21.201  40.054  1.00 24.40 ? 117 LEU A CG  1 
ATOM   757  C CD1 . LEU A 1 110 ? 42.617 21.619  41.125  1.00 26.10 ? 117 LEU A CD1 1 
ATOM   758  C CD2 . LEU A 1 110 ? 43.474 22.054  38.803  1.00 24.14 ? 117 LEU A CD2 1 
ATOM   759  N N   . THR A 1 111 ? 48.052 20.348  40.974  1.00 22.49 ? 118 THR A N   1 
ATOM   760  C CA  . THR A 1 111 ? 49.370 20.603  41.528  1.00 25.97 ? 118 THR A CA  1 
ATOM   761  C C   . THR A 1 111 ? 50.430 20.556  40.425  1.00 25.38 ? 118 THR A C   1 
ATOM   762  O O   . THR A 1 111 ? 51.361 21.364  40.403  1.00 22.43 ? 118 THR A O   1 
ATOM   763  C CB  . THR A 1 111 ? 49.720 19.573  42.621  1.00 27.54 ? 118 THR A CB  1 
ATOM   764  O OG1 . THR A 1 111 ? 48.740 19.642  43.666  1.00 28.19 ? 118 THR A OG1 1 
ATOM   765  C CG2 . THR A 1 111 ? 51.081 19.873  43.211  1.00 28.80 ? 118 THR A CG2 1 
ATOM   766  N N   . SER A 1 112 ? 50.274 19.619  39.496  1.00 23.74 ? 119 SER A N   1 
ATOM   767  C CA  . SER A 1 112 ? 51.229 19.481  38.403  1.00 23.26 ? 119 SER A CA  1 
ATOM   768  C C   . SER A 1 112 ? 51.151 20.658  37.433  1.00 21.02 ? 119 SER A C   1 
ATOM   769  O O   . SER A 1 112 ? 52.178 21.134  36.945  1.00 19.49 ? 119 SER A O   1 
ATOM   770  C CB  . SER A 1 112 ? 50.985 18.164  37.667  1.00 23.53 ? 119 SER A CB  1 
ATOM   771  O OG  . SER A 1 112 ? 51.071 17.078  38.573  1.00 22.11 ? 119 SER A OG  1 
ATOM   772  N N   . PHE A 1 113 ? 49.933 21.120  37.153  1.00 21.23 ? 120 PHE A N   1 
ATOM   773  C CA  . PHE A 1 113 ? 49.743 22.257  36.256  1.00 18.69 ? 120 PHE A CA  1 
ATOM   774  C C   . PHE A 1 113 ? 50.447 23.467  36.862  1.00 18.31 ? 120 PHE A C   1 
ATOM   775  O O   . PHE A 1 113 ? 51.189 24.160  36.172  1.00 18.03 ? 120 PHE A O   1 
ATOM   776  C CB  . PHE A 1 113 ? 48.254 22.579  36.073  1.00 17.03 ? 120 PHE A CB  1 
ATOM   777  C CG  . PHE A 1 113 ? 48.002 23.859  35.321  1.00 20.82 ? 120 PHE A CG  1 
ATOM   778  C CD1 . PHE A 1 113 ? 48.283 23.952  33.957  1.00 20.24 ? 120 PHE A CD1 1 
ATOM   779  C CD2 . PHE A 1 113 ? 47.528 24.986  35.982  1.00 20.36 ? 120 PHE A CD2 1 
ATOM   780  C CE1 . PHE A 1 113 ? 48.091 25.151  33.264  1.00 16.76 ? 120 PHE A CE1 1 
ATOM   781  C CE2 . PHE A 1 113 ? 47.333 26.194  35.297  1.00 23.24 ? 120 PHE A CE2 1 
ATOM   782  C CZ  . PHE A 1 113 ? 47.618 26.275  33.934  1.00 19.57 ? 120 PHE A CZ  1 
ATOM   783  N N   . GLU A 1 114 ? 50.205 23.715  38.149  1.00 19.92 ? 121 GLU A N   1 
ATOM   784  C CA  . GLU A 1 114 ? 50.832 24.838  38.846  1.00 22.59 ? 121 GLU A CA  1 
ATOM   785  C C   . GLU A 1 114 ? 52.360 24.766  38.749  1.00 20.81 ? 121 GLU A C   1 
ATOM   786  O O   . GLU A 1 114 ? 53.006 25.780  38.532  1.00 18.86 ? 121 GLU A O   1 
ATOM   787  C CB  . GLU A 1 114 ? 50.415 24.875  40.326  1.00 24.79 ? 121 GLU A CB  1 
ATOM   788  C CG  . GLU A 1 114 ? 51.232 25.876  41.154  1.00 35.81 ? 121 GLU A CG  1 
ATOM   789  C CD  . GLU A 1 114 ? 50.906 25.867  42.655  1.00 44.14 ? 121 GLU A CD  1 
ATOM   790  O OE1 . GLU A 1 114 ? 50.979 24.784  43.292  1.00 45.50 ? 121 GLU A OE1 1 
ATOM   791  O OE2 . GLU A 1 114 ? 50.594 26.951  43.203  1.00 46.38 ? 121 GLU A OE2 1 
ATOM   792  N N   . LYS A 1 115 ? 52.926 23.568  38.910  1.00 20.60 ? 122 LYS A N   1 
ATOM   793  C CA  . LYS A 1 115 ? 54.375 23.374  38.820  1.00 24.32 ? 122 LYS A CA  1 
ATOM   794  C C   . LYS A 1 115 ? 54.882 23.745  37.425  1.00 22.05 ? 122 LYS A C   1 
ATOM   795  O O   . LYS A 1 115 ? 55.829 24.524  37.284  1.00 18.16 ? 122 LYS A O   1 
ATOM   796  C CB  . LYS A 1 115 ? 54.743 21.914  39.106  1.00 29.69 ? 122 LYS A CB  1 
ATOM   797  C CG  . LYS A 1 115 ? 56.229 21.688  39.407  1.00 40.90 ? 122 LYS A CG  1 
ATOM   798  C CD  . LYS A 1 115 ? 56.532 20.225  39.842  1.00 47.14 ? 122 LYS A CD  1 
ATOM   799  C CE  . LYS A 1 115 ? 56.594 19.265  38.652  1.00 49.54 ? 122 LYS A CE  1 
ATOM   800  N NZ  . LYS A 1 115 ? 56.891 17.844  39.045  1.00 48.61 ? 122 LYS A NZ  1 
ATOM   801  N N   . TRP A 1 116 ? 54.250 23.170  36.401  1.00 19.22 ? 123 TRP A N   1 
ATOM   802  C CA  . TRP A 1 116 ? 54.616 23.435  35.013  1.00 17.37 ? 123 TRP A CA  1 
ATOM   803  C C   . TRP A 1 116 ? 54.459 24.909  34.678  1.00 18.29 ? 123 TRP A C   1 
ATOM   804  O O   . TRP A 1 116 ? 55.360 25.520  34.105  1.00 18.96 ? 123 TRP A O   1 
ATOM   805  C CB  . TRP A 1 116 ? 53.734 22.628  34.056  1.00 17.25 ? 123 TRP A CB  1 
ATOM   806  C CG  . TRP A 1 116 ? 54.470 21.561  33.305  1.00 16.77 ? 123 TRP A CG  1 
ATOM   807  C CD1 . TRP A 1 116 ? 54.892 21.602  32.000  1.00 19.63 ? 123 TRP A CD1 1 
ATOM   808  C CD2 . TRP A 1 116 ? 54.879 20.295  33.818  1.00 16.23 ? 123 TRP A CD2 1 
ATOM   809  N NE1 . TRP A 1 116 ? 55.539 20.431  31.673  1.00 17.08 ? 123 TRP A NE1 1 
ATOM   810  C CE2 . TRP A 1 116 ? 55.546 19.611  32.774  1.00 15.76 ? 123 TRP A CE2 1 
ATOM   811  C CE3 . TRP A 1 116 ? 54.750 19.665  35.066  1.00 16.52 ? 123 TRP A CE3 1 
ATOM   812  C CZ2 . TRP A 1 116 ? 56.079 18.332  32.936  1.00 19.33 ? 123 TRP A CZ2 1 
ATOM   813  C CZ3 . TRP A 1 116 ? 55.277 18.391  35.230  1.00 21.60 ? 123 TRP A CZ3 1 
ATOM   814  C CH2 . TRP A 1 116 ? 55.937 17.737  34.169  1.00 21.55 ? 123 TRP A CH2 1 
ATOM   815  N N   . HIS A 1 117 ? 53.307 25.467  35.032  1.00 15.42 ? 124 HIS A N   1 
ATOM   816  C CA  . HIS A 1 117 ? 53.022 26.866  34.743  1.00 21.08 ? 124 HIS A CA  1 
ATOM   817  C C   . HIS A 1 117 ? 54.087 27.786  35.325  1.00 20.75 ? 124 HIS A C   1 
ATOM   818  O O   . HIS A 1 117 ? 54.619 28.648  34.634  1.00 20.30 ? 124 HIS A O   1 
ATOM   819  C CB  . HIS A 1 117 ? 51.633 27.254  35.275  1.00 23.11 ? 124 HIS A CB  1 
ATOM   820  C CG  . HIS A 1 117 ? 51.203 28.636  34.884  1.00 29.57 ? 124 HIS A CG  1 
ATOM   821  N ND1 . HIS A 1 117 ? 51.622 29.243  33.717  1.00 30.07 ? 124 HIS A ND1 1 
ATOM   822  C CD2 . HIS A 1 117 ? 50.370 29.513  35.485  1.00 32.17 ? 124 HIS A CD2 1 
ATOM   823  C CE1 . HIS A 1 117 ? 51.065 30.434  33.619  1.00 28.29 ? 124 HIS A CE1 1 
ATOM   824  N NE2 . HIS A 1 117 ? 50.300 30.626  34.675  1.00 34.31 ? 124 HIS A NE2 1 
ATOM   825  N N   . GLU A 1 118 ? 54.405 27.583  36.598  1.00 23.88 ? 125 GLU A N   1 
ATOM   826  C CA  . GLU A 1 118 ? 55.415 28.387  37.277  1.00 25.80 ? 125 GLU A CA  1 
ATOM   827  C C   . GLU A 1 118 ? 56.774 28.217  36.608  1.00 28.13 ? 125 GLU A C   1 
ATOM   828  O O   . GLU A 1 118 ? 57.521 29.185  36.436  1.00 28.07 ? 125 GLU A O   1 
ATOM   829  C CB  . GLU A 1 118 ? 55.497 27.969  38.741  1.00 32.56 ? 125 GLU A CB  1 
ATOM   830  C CG  . GLU A 1 118 ? 56.692 28.497  39.491  1.00 44.72 ? 125 GLU A CG  1 
ATOM   831  C CD  . GLU A 1 118 ? 56.624 28.152  40.969  1.00 52.50 ? 125 GLU A CD  1 
ATOM   832  O OE1 . GLU A 1 118 ? 56.418 26.959  41.303  1.00 54.75 ? 125 GLU A OE1 1 
ATOM   833  O OE2 . GLU A 1 118 ? 56.774 29.074  41.797  1.00 56.72 ? 125 GLU A OE2 1 
ATOM   834  N N   . ALA A 1 119 ? 57.090 26.979  36.232  1.00 27.02 ? 126 ALA A N   1 
ATOM   835  C CA  . ALA A 1 119 ? 58.355 26.682  35.573  1.00 25.72 ? 126 ALA A CA  1 
ATOM   836  C C   . ALA A 1 119 ? 58.459 27.420  34.243  1.00 23.86 ? 126 ALA A C   1 
ATOM   837  O O   . ALA A 1 119 ? 59.419 28.147  34.002  1.00 25.46 ? 126 ALA A O   1 
ATOM   838  C CB  . ALA A 1 119 ? 58.487 25.175  35.334  1.00 28.41 ? 126 ALA A CB  1 
ATOM   839  N N   . ALA A 1 120 ? 57.475 27.222  33.374  1.00 21.35 ? 127 ALA A N   1 
ATOM   840  C CA  . ALA A 1 120 ? 57.490 27.867  32.064  1.00 21.63 ? 127 ALA A CA  1 
ATOM   841  C C   . ALA A 1 120 ? 57.521 29.387  32.168  1.00 23.47 ? 127 ALA A C   1 
ATOM   842  O O   . ALA A 1 120 ? 58.280 30.045  31.457  1.00 23.86 ? 127 ALA A O   1 
ATOM   843  C CB  . ALA A 1 120 ? 56.284 27.432  31.258  1.00 20.84 ? 127 ALA A CB  1 
ATOM   844  N N   . ASP A 1 121 ? 56.694 29.948  33.046  1.00 21.69 ? 128 ASP A N   1 
ATOM   845  C CA  . ASP A 1 121 ? 56.656 31.396  33.204  1.00 28.72 ? 128 ASP A CA  1 
ATOM   846  C C   . ASP A 1 121 ? 58.006 32.022  33.524  1.00 25.72 ? 128 ASP A C   1 
ATOM   847  O O   . ASP A 1 121 ? 58.259 33.171  33.185  1.00 27.01 ? 128 ASP A O   1 
ATOM   848  C CB  . ASP A 1 121 ? 55.645 31.796  34.284  1.00 33.79 ? 128 ASP A CB  1 
ATOM   849  C CG  . ASP A 1 121 ? 54.309 32.214  33.699  1.00 43.39 ? 128 ASP A CG  1 
ATOM   850  O OD1 . ASP A 1 121 ? 54.209 32.316  32.449  1.00 42.75 ? 128 ASP A OD1 1 
ATOM   851  O OD2 . ASP A 1 121 ? 53.361 32.455  34.491  1.00 51.26 ? 128 ASP A OD2 1 
ATOM   852  N N   . THR A 1 122 ? 58.886 31.275  34.166  1.00 28.18 ? 129 THR A N   1 
ATOM   853  C CA  . THR A 1 122 ? 60.180 31.841  34.507  1.00 28.42 ? 129 THR A CA  1 
ATOM   854  C C   . THR A 1 122 ? 61.295 31.533  33.508  1.00 27.88 ? 129 THR A C   1 
ATOM   855  O O   . THR A 1 122 ? 62.369 32.134  33.589  1.00 25.17 ? 129 THR A O   1 
ATOM   856  C CB  . THR A 1 122 ? 60.609 31.381  35.914  1.00 32.06 ? 129 THR A CB  1 
ATOM   857  O OG1 . THR A 1 122 ? 60.585 29.949  35.973  1.00 33.88 ? 129 THR A OG1 1 
ATOM   858  C CG2 . THR A 1 122 ? 59.647 31.923  36.967  1.00 29.21 ? 129 THR A CG2 1 
ATOM   859  N N   . LYS A 1 123 ? 61.045 30.636  32.549  1.00 24.80 ? 130 LYS A N   1 
ATOM   860  C CA  . LYS A 1 123 ? 62.088 30.270  31.588  1.00 21.86 ? 130 LYS A CA  1 
ATOM   861  C C   . LYS A 1 123 ? 61.787 30.331  30.093  1.00 20.40 ? 130 LYS A C   1 
ATOM   862  O O   . LYS A 1 123 ? 62.701 30.520  29.293  1.00 18.79 ? 130 LYS A O   1 
ATOM   863  C CB  . LYS A 1 123 ? 62.608 28.864  31.905  1.00 24.93 ? 130 LYS A CB  1 
ATOM   864  C CG  . LYS A 1 123 ? 63.460 28.763  33.155  1.00 24.92 ? 130 LYS A CG  1 
ATOM   865  C CD  . LYS A 1 123 ? 63.965 27.331  33.355  1.00 29.13 ? 130 LYS A CD  1 
ATOM   866  C CE  . LYS A 1 123 ? 65.024 27.281  34.459  1.00 34.22 ? 130 LYS A CE  1 
ATOM   867  N NZ  . LYS A 1 123 ? 65.576 25.912  34.641  1.00 38.77 ? 130 LYS A NZ  1 
ATOM   868  N N   . SER A 1 124 ? 60.529 30.156  29.707  1.00 21.37 ? 131 SER A N   1 
ATOM   869  C CA  . SER A 1 124 ? 60.167 30.163  28.288  1.00 20.83 ? 131 SER A CA  1 
ATOM   870  C C   . SER A 1 124 ? 60.526 31.444  27.540  1.00 20.91 ? 131 SER A C   1 
ATOM   871  O O   . SER A 1 124 ? 60.239 32.547  28.001  1.00 21.00 ? 131 SER A O   1 
ATOM   872  C CB  . SER A 1 124 ? 58.668 29.890  28.131  1.00 25.06 ? 131 SER A CB  1 
ATOM   873  O OG  . SER A 1 124 ? 58.332 29.684  26.771  1.00 22.41 ? 131 SER A OG  1 
ATOM   874  N N   . CYS A 1 125 ? 61.154 31.287  26.377  1.00 16.05 ? 132 CYS A N   1 
ATOM   875  C CA  . CYS A 1 125 ? 61.546 32.422  25.551  1.00 18.61 ? 132 CYS A CA  1 
ATOM   876  C C   . CYS A 1 125 ? 60.433 32.873  24.607  1.00 16.34 ? 132 CYS A C   1 
ATOM   877  O O   . CYS A 1 125 ? 60.521 33.953  24.022  1.00 16.29 ? 132 CYS A O   1 
ATOM   878  C CB  . CYS A 1 125 ? 62.787 32.074  24.715  1.00 16.91 ? 132 CYS A CB  1 
ATOM   879  S SG  . CYS A 1 125 ? 64.240 31.595  25.676  1.00 25.00 ? 132 CYS A SG  1 
ATOM   880  N N   . CYS A 1 126 ? 59.396 32.046  24.457  1.00 17.79 ? 133 CYS A N   1 
ATOM   881  C CA  . CYS A 1 126 ? 58.274 32.343  23.554  1.00 17.11 ? 133 CYS A CA  1 
ATOM   882  C C   . CYS A 1 126 ? 56.921 32.005  24.178  1.00 16.30 ? 133 CYS A C   1 
ATOM   883  O O   . CYS A 1 126 ? 56.867 31.389  25.238  1.00 18.17 ? 133 CYS A O   1 
ATOM   884  C CB  . CYS A 1 126 ? 58.434 31.544  22.253  1.00 17.10 ? 133 CYS A CB  1 
ATOM   885  S SG  . CYS A 1 126 ? 58.324 29.723  22.468  1.00 20.78 ? 133 CYS A SG  1 
ATOM   886  N N   . ASP A 1 127 ? 55.832 32.397  23.515  1.00 15.63 ? 134 ASP A N   1 
ATOM   887  C CA  . ASP A 1 127 ? 54.487 32.108  24.022  1.00 17.37 ? 134 ASP A CA  1 
ATOM   888  C C   . ASP A 1 127 ? 54.271 30.600  24.098  1.00 18.40 ? 134 ASP A C   1 
ATOM   889  O O   . ASP A 1 127 ? 54.854 29.845  23.316  1.00 25.09 ? 134 ASP A O   1 
ATOM   890  C CB  . ASP A 1 127 ? 53.413 32.717  23.117  1.00 15.09 ? 134 ASP A CB  1 
ATOM   891  C CG  . ASP A 1 127 ? 53.339 34.236  23.216  1.00 16.44 ? 134 ASP A CG  1 
ATOM   892  O OD1 . ASP A 1 127 ? 53.730 34.802  24.253  1.00 14.87 ? 134 ASP A OD1 1 
ATOM   893  O OD2 . ASP A 1 127 ? 52.866 34.864  22.251  1.00 14.48 ? 134 ASP A OD2 1 
ATOM   894  N N   . TYR A 1 128 ? 53.427 30.154  25.023  1.00 18.68 ? 135 TYR A N   1 
ATOM   895  C CA  . TYR A 1 128 ? 53.182 28.721  25.163  1.00 17.25 ? 135 TYR A CA  1 
ATOM   896  C C   . TYR A 1 128 ? 51.809 28.389  25.745  1.00 18.62 ? 135 TYR A C   1 
ATOM   897  O O   . TYR A 1 128 ? 51.196 29.210  26.427  1.00 17.40 ? 135 TYR A O   1 
ATOM   898  C CB  . TYR A 1 128 ? 54.262 28.090  26.060  1.00 17.19 ? 135 TYR A CB  1 
ATOM   899  C CG  . TYR A 1 128 ? 54.232 28.604  27.491  1.00 22.64 ? 135 TYR A CG  1 
ATOM   900  C CD1 . TYR A 1 128 ? 54.748 29.858  27.818  1.00 20.18 ? 135 TYR A CD1 1 
ATOM   901  C CD2 . TYR A 1 128 ? 53.601 27.875  28.496  1.00 23.28 ? 135 TYR A CD2 1 
ATOM   902  C CE1 . TYR A 1 128 ? 54.628 30.375  29.110  1.00 23.44 ? 135 TYR A CE1 1 
ATOM   903  C CE2 . TYR A 1 128 ? 53.470 28.382  29.785  1.00 22.44 ? 135 TYR A CE2 1 
ATOM   904  C CZ  . TYR A 1 128 ? 53.983 29.631  30.084  1.00 23.73 ? 135 TYR A CZ  1 
ATOM   905  O OH  . TYR A 1 128 ? 53.815 30.146  31.344  1.00 28.02 ? 135 TYR A OH  1 
ATOM   906  N N   . SER A 1 129 ? 51.336 27.179  25.453  1.00 16.12 ? 136 SER A N   1 
ATOM   907  C CA  . SER A 1 129 ? 50.075 26.660  25.979  1.00 16.82 ? 136 SER A CA  1 
ATOM   908  C C   . SER A 1 129 ? 50.440 25.328  26.620  1.00 15.56 ? 136 SER A C   1 
ATOM   909  O O   . SER A 1 129 ? 51.548 24.826  26.409  1.00 16.22 ? 136 SER A O   1 
ATOM   910  C CB  . SER A 1 129 ? 49.037 26.435  24.870  1.00 14.29 ? 136 SER A CB  1 
ATOM   911  O OG  . SER A 1 129 ? 48.383 27.642  24.521  1.00 17.92 ? 136 SER A OG  1 
ATOM   912  N N   . LEU A 1 130 ? 49.519 24.748  27.385  1.00 15.83 ? 137 LEU A N   1 
ATOM   913  C CA  . LEU A 1 130 ? 49.796 23.483  28.061  1.00 15.72 ? 137 LEU A CA  1 
ATOM   914  C C   . LEU A 1 130 ? 48.730 22.408  27.883  1.00 16.83 ? 137 LEU A C   1 
ATOM   915  O O   . LEU A 1 130 ? 47.540 22.693  27.940  1.00 20.75 ? 137 LEU A O   1 
ATOM   916  C CB  . LEU A 1 130 ? 49.992 23.725  29.569  1.00 11.49 ? 137 LEU A CB  1 
ATOM   917  C CG  . LEU A 1 130 ? 51.149 24.613  30.055  1.00 15.86 ? 137 LEU A CG  1 
ATOM   918  C CD1 . LEU A 1 130 ? 51.025 24.832  31.563  1.00 16.09 ? 137 LEU A CD1 1 
ATOM   919  C CD2 . LEU A 1 130 ? 52.484 23.961  29.734  1.00 13.30 ? 137 LEU A CD2 1 
ATOM   920  N N   . HIS A 1 131 ? 49.174 21.176  27.662  1.00 14.84 ? 138 HIS A N   1 
ATOM   921  C CA  . HIS A 1 131 ? 48.273 20.032  27.555  1.00 15.93 ? 138 HIS A CA  1 
ATOM   922  C C   . HIS A 1 131 ? 48.422 19.445  28.947  1.00 15.47 ? 138 HIS A C   1 
ATOM   923  O O   . HIS A 1 131 ? 49.452 19.634  29.584  1.00 13.93 ? 138 HIS A O   1 
ATOM   924  C CB  . HIS A 1 131 ? 48.786 18.951  26.593  1.00 13.43 ? 138 HIS A CB  1 
ATOM   925  C CG  . HIS A 1 131 ? 48.798 19.335  25.149  1.00 13.26 ? 138 HIS A CG  1 
ATOM   926  N ND1 . HIS A 1 131 ? 49.947 19.328  24.391  1.00 17.43 ? 138 HIS A ND1 1 
ATOM   927  C CD2 . HIS A 1 131 ? 47.787 19.633  24.294  1.00 9.28  ? 138 HIS A CD2 1 
ATOM   928  C CE1 . HIS A 1 131 ? 49.649 19.600  23.131  1.00 10.96 ? 138 HIS A CE1 1 
ATOM   929  N NE2 . HIS A 1 131 ? 48.344 19.787  23.052  1.00 16.36 ? 138 HIS A NE2 1 
ATOM   930  N N   . VAL A 1 132 ? 47.410 18.740  29.425  1.00 16.12 ? 139 VAL A N   1 
ATOM   931  C CA  . VAL A 1 132 ? 47.524 18.092  30.715  1.00 13.29 ? 139 VAL A CA  1 
ATOM   932  C C   . VAL A 1 132 ? 47.344 16.602  30.465  1.00 16.64 ? 139 VAL A C   1 
ATOM   933  O O   . VAL A 1 132 ? 46.319 16.166  29.926  1.00 16.26 ? 139 VAL A O   1 
ATOM   934  C CB  . VAL A 1 132 ? 46.464 18.594  31.724  1.00 15.13 ? 139 VAL A CB  1 
ATOM   935  C CG1 . VAL A 1 132 ? 46.375 17.633  32.914  1.00 8.96  ? 139 VAL A CG1 1 
ATOM   936  C CG2 . VAL A 1 132 ? 46.839 19.993  32.217  1.00 12.14 ? 139 VAL A CG2 1 
ATOM   937  N N   . ASP A 1 133 ? 48.357 15.825  30.837  1.00 15.49 ? 140 ASP A N   1 
ATOM   938  C CA  . ASP A 1 133 ? 48.316 14.378  30.670  1.00 14.58 ? 140 ASP A CA  1 
ATOM   939  C C   . ASP A 1 133 ? 47.624 13.721  31.871  1.00 17.80 ? 140 ASP A C   1 
ATOM   940  O O   . ASP A 1 133 ? 48.107 13.810  33.002  1.00 17.80 ? 140 ASP A O   1 
ATOM   941  C CB  . ASP A 1 133 ? 49.735 13.825  30.527  1.00 16.06 ? 140 ASP A CB  1 
ATOM   942  C CG  . ASP A 1 133 ? 50.321 14.036  29.135  1.00 15.91 ? 140 ASP A CG  1 
ATOM   943  O OD1 . ASP A 1 133 ? 49.900 14.971  28.412  1.00 9.68  ? 140 ASP A OD1 1 
ATOM   944  O OD2 . ASP A 1 133 ? 51.226 13.260  28.773  1.00 16.77 ? 140 ASP A OD2 1 
ATOM   945  N N   . ILE A 1 134 ? 46.492 13.070  31.624  1.00 15.95 ? 141 ILE A N   1 
ATOM   946  C CA  . ILE A 1 134 ? 45.753 12.398  32.686  1.00 17.46 ? 141 ILE A CA  1 
ATOM   947  C C   . ILE A 1 134 ? 46.369 11.001  32.849  1.00 21.93 ? 141 ILE A C   1 
ATOM   948  O O   . ILE A 1 134 ? 46.008 10.066  32.131  1.00 21.29 ? 141 ILE A O   1 
ATOM   949  C CB  . ILE A 1 134 ? 44.240 12.286  32.325  1.00 15.87 ? 141 ILE A CB  1 
ATOM   950  C CG1 . ILE A 1 134 ? 43.677 13.676  32.011  1.00 16.57 ? 141 ILE A CG1 1 
ATOM   951  C CG2 . ILE A 1 134 ? 43.444 11.708  33.495  1.00 18.22 ? 141 ILE A CG2 1 
ATOM   952  C CD1 . ILE A 1 134 ? 42.227 13.667  31.541  1.00 13.11 ? 141 ILE A CD1 1 
ATOM   953  N N   . THR A 1 135 ? 47.305 10.866  33.787  1.00 19.52 ? 142 THR A N   1 
ATOM   954  C CA  . THR A 1 135 ? 47.972 9.589   34.006  1.00 23.11 ? 142 THR A CA  1 
ATOM   955  C C   . THR A 1 135 ? 47.164 8.531   34.759  1.00 22.64 ? 142 THR A C   1 
ATOM   956  O O   . THR A 1 135 ? 47.569 7.375   34.810  1.00 21.24 ? 142 THR A O   1 
ATOM   957  C CB  . THR A 1 135 ? 49.343 9.774   34.713  1.00 25.08 ? 142 THR A CB  1 
ATOM   958  O OG1 . THR A 1 135 ? 49.231 10.743  35.763  1.00 23.87 ? 142 THR A OG1 1 
ATOM   959  C CG2 . THR A 1 135 ? 50.389 10.225  33.704  1.00 26.38 ? 142 THR A CG2 1 
ATOM   960  N N   . SER A 1 136 ? 46.026 8.918   35.331  1.00 25.60 ? 143 SER A N   1 
ATOM   961  C CA  . SER A 1 136 ? 45.172 7.969   36.045  1.00 29.24 ? 143 SER A CA  1 
ATOM   962  C C   . SER A 1 136 ? 43.777 8.543   36.249  1.00 29.95 ? 143 SER A C   1 
ATOM   963  O O   . SER A 1 136 ? 43.621 9.745   36.524  1.00 31.80 ? 143 SER A O   1 
ATOM   964  C CB  . SER A 1 136 ? 45.767 7.615   37.405  1.00 28.51 ? 143 SER A CB  1 
ATOM   965  O OG  . SER A 1 136 ? 45.567 8.671   38.316  1.00 30.33 ? 143 SER A OG  1 
ATOM   966  N N   . TRP A 1 137 ? 42.759 7.693   36.125  1.00 28.16 ? 144 TRP A N   1 
ATOM   967  C CA  . TRP A 1 137 ? 41.369 8.132   36.310  1.00 31.46 ? 144 TRP A CA  1 
ATOM   968  C C   . TRP A 1 137 ? 40.974 7.899   37.770  1.00 31.08 ? 144 TRP A C   1 
ATOM   969  O O   . TRP A 1 137 ? 40.263 6.950   38.074  1.00 32.19 ? 144 TRP A O   1 
ATOM   970  C CB  . TRP A 1 137 ? 40.411 7.338   35.415  1.00 27.63 ? 144 TRP A CB  1 
ATOM   971  C CG  . TRP A 1 137 ? 39.145 8.094   35.073  1.00 31.14 ? 144 TRP A CG  1 
ATOM   972  C CD1 . TRP A 1 137 ? 37.846 7.724   35.334  1.00 32.47 ? 144 TRP A CD1 1 
ATOM   973  C CD2 . TRP A 1 137 ? 39.073 9.373   34.437  1.00 29.34 ? 144 TRP A CD2 1 
ATOM   974  N NE1 . TRP A 1 137 ? 36.979 8.709   34.900  1.00 33.49 ? 144 TRP A NE1 1 
ATOM   975  C CE2 . TRP A 1 137 ? 37.711 9.727   34.342  1.00 31.83 ? 144 TRP A CE2 1 
ATOM   976  C CE3 . TRP A 1 137 ? 40.038 10.248  33.930  1.00 25.34 ? 144 TRP A CE3 1 
ATOM   977  C CZ2 . TRP A 1 137 ? 37.294 10.925  33.774  1.00 27.29 ? 144 TRP A CZ2 1 
ATOM   978  C CZ3 . TRP A 1 137 ? 39.624 11.434  33.368  1.00 26.90 ? 144 TRP A CZ3 1 
ATOM   979  C CH2 . TRP A 1 137 ? 38.264 11.763  33.289  1.00 25.66 ? 144 TRP A CH2 1 
ATOM   980  N N   . TYR A 1 138 ? 41.433 8.764   38.670  1.00 35.05 ? 145 TYR A N   1 
ATOM   981  C CA  . TYR A 1 138 ? 41.129 8.613   40.096  1.00 36.48 ? 145 TYR A CA  1 
ATOM   982  C C   . TYR A 1 138 ? 39.892 9.369   40.585  1.00 37.71 ? 145 TYR A C   1 
ATOM   983  O O   . TYR A 1 138 ? 39.467 10.363  39.974  1.00 37.13 ? 145 TYR A O   1 
ATOM   984  C CB  . TYR A 1 138 ? 42.340 9.027   40.925  1.00 33.79 ? 145 TYR A CB  1 
ATOM   985  C CG  . TYR A 1 138 ? 42.794 10.459  40.726  1.00 33.43 ? 145 TYR A CG  1 
ATOM   986  C CD1 . TYR A 1 138 ? 42.174 11.512  41.392  1.00 28.64 ? 145 TYR A CD1 1 
ATOM   987  C CD2 . TYR A 1 138 ? 43.877 10.750  39.894  1.00 35.29 ? 145 TYR A CD2 1 
ATOM   988  C CE1 . TYR A 1 138 ? 42.622 12.820  41.242  1.00 32.74 ? 145 TYR A CE1 1 
ATOM   989  C CE2 . TYR A 1 138 ? 44.332 12.053  39.732  1.00 34.98 ? 145 TYR A CE2 1 
ATOM   990  C CZ  . TYR A 1 138 ? 43.707 13.083  40.409  1.00 35.14 ? 145 TYR A CZ  1 
ATOM   991  O OH  . TYR A 1 138 ? 44.191 14.365  40.277  1.00 32.98 ? 145 TYR A OH  1 
ATOM   992  N N   . ASP A 1 139 ? 39.316 8.896   41.691  1.00 37.89 ? 146 ASP A N   1 
ATOM   993  C CA  . ASP A 1 139 ? 38.124 9.517   42.273  1.00 37.50 ? 146 ASP A CA  1 
ATOM   994  C C   . ASP A 1 139 ? 38.373 10.996  42.560  1.00 32.66 ? 146 ASP A C   1 
ATOM   995  O O   . ASP A 1 139 ? 39.172 11.336  43.426  1.00 31.75 ? 146 ASP A O   1 
ATOM   996  C CB  . ASP A 1 139 ? 37.751 8.828   43.583  1.00 45.32 ? 146 ASP A CB  1 
ATOM   997  C CG  . ASP A 1 139 ? 36.270 8.565   43.698  1.00 53.77 ? 146 ASP A CG  1 
ATOM   998  O OD1 . ASP A 1 139 ? 35.820 7.543   43.116  1.00 58.34 ? 146 ASP A OD1 1 
ATOM   999  O OD2 . ASP A 1 139 ? 35.558 9.371   44.361  1.00 57.64 ? 146 ASP A OD2 1 
ATOM   1000 N N   . GLY A 1 140 ? 37.673 11.874  41.847  1.00 30.43 ? 147 GLY A N   1 
ATOM   1001 C CA  . GLY A 1 140 ? 37.845 13.300  42.059  1.00 26.52 ? 147 GLY A CA  1 
ATOM   1002 C C   . GLY A 1 140 ? 38.508 13.998  40.888  1.00 28.14 ? 147 GLY A C   1 
ATOM   1003 O O   . GLY A 1 140 ? 38.521 15.230  40.809  1.00 29.34 ? 147 GLY A O   1 
ATOM   1004 N N   . VAL A 1 141 ? 39.059 13.220  39.962  1.00 27.11 ? 148 VAL A N   1 
ATOM   1005 C CA  . VAL A 1 141 ? 39.733 13.812  38.808  1.00 25.87 ? 148 VAL A CA  1 
ATOM   1006 C C   . VAL A 1 141 ? 38.798 14.724  38.014  1.00 24.92 ? 148 VAL A C   1 
ATOM   1007 O O   . VAL A 1 141 ? 39.227 15.746  37.471  1.00 22.65 ? 148 VAL A O   1 
ATOM   1008 C CB  . VAL A 1 141 ? 40.316 12.715  37.877  1.00 24.38 ? 148 VAL A CB  1 
ATOM   1009 C CG1 . VAL A 1 141 ? 39.193 11.932  37.225  1.00 21.94 ? 148 VAL A CG1 1 
ATOM   1010 C CG2 . VAL A 1 141 ? 41.227 13.349  36.830  1.00 23.62 ? 148 VAL A CG2 1 
ATOM   1011 N N   . ARG A 1 142 ? 37.514 14.372  37.961  1.00 24.69 ? 149 ARG A N   1 
ATOM   1012 C CA  . ARG A 1 142 ? 36.550 15.174  37.216  1.00 23.37 ? 149 ARG A CA  1 
ATOM   1013 C C   . ARG A 1 142 ? 36.519 16.632  37.652  1.00 24.94 ? 149 ARG A C   1 
ATOM   1014 O O   . ARG A 1 142 ? 36.469 17.534  36.815  1.00 23.09 ? 149 ARG A O   1 
ATOM   1015 C CB  . ARG A 1 142 ? 35.151 14.579  37.345  1.00 22.53 ? 149 ARG A CB  1 
ATOM   1016 C CG  . ARG A 1 142 ? 35.041 13.189  36.779  1.00 28.15 ? 149 ARG A CG  1 
ATOM   1017 C CD  . ARG A 1 142 ? 33.618 12.661  36.849  1.00 27.59 ? 149 ARG A CD  1 
ATOM   1018 N NE  . ARG A 1 142 ? 33.597 11.275  36.401  1.00 37.49 ? 149 ARG A NE  1 
ATOM   1019 C CZ  . ARG A 1 142 ? 32.859 10.814  35.392  1.00 40.84 ? 149 ARG A CZ  1 
ATOM   1020 N NH1 . ARG A 1 142 ? 32.057 11.631  34.710  1.00 36.33 ? 149 ARG A NH1 1 
ATOM   1021 N NH2 . ARG A 1 142 ? 32.940 9.527   35.059  1.00 39.51 ? 149 ARG A NH2 1 
ATOM   1022 N N   . GLU A 1 143 ? 36.543 16.865  38.963  1.00 25.69 ? 150 GLU A N   1 
ATOM   1023 C CA  . GLU A 1 143 ? 36.503 18.229  39.491  1.00 26.50 ? 150 GLU A CA  1 
ATOM   1024 C C   . GLU A 1 143 ? 37.688 19.073  39.032  1.00 23.72 ? 150 GLU A C   1 
ATOM   1025 O O   . GLU A 1 143 ? 37.528 20.241  38.660  1.00 22.29 ? 150 GLU A O   1 
ATOM   1026 C CB  . GLU A 1 143 ? 36.476 18.208  41.021  1.00 27.20 ? 150 GLU A CB  1 
ATOM   1027 C CG  . GLU A 1 143 ? 35.177 17.702  41.641  1.00 36.86 ? 150 GLU A CG  1 
ATOM   1028 C CD  . GLU A 1 143 ? 34.867 16.245  41.327  1.00 41.28 ? 150 GLU A CD  1 
ATOM   1029 O OE1 . GLU A 1 143 ? 35.802 15.408  41.319  1.00 42.52 ? 150 GLU A OE1 1 
ATOM   1030 O OE2 . GLU A 1 143 ? 33.674 15.928  41.108  1.00 48.51 ? 150 GLU A OE2 1 
ATOM   1031 N N   . GLU A 1 144 ? 38.877 18.480  39.075  1.00 25.04 ? 151 GLU A N   1 
ATOM   1032 C CA  . GLU A 1 144 ? 40.090 19.175  38.676  1.00 22.46 ? 151 GLU A CA  1 
ATOM   1033 C C   . GLU A 1 144 ? 40.051 19.523  37.195  1.00 21.12 ? 151 GLU A C   1 
ATOM   1034 O O   . GLU A 1 144 ? 40.482 20.600  36.787  1.00 22.94 ? 151 GLU A O   1 
ATOM   1035 C CB  . GLU A 1 144 ? 41.306 18.303  38.953  1.00 25.62 ? 151 GLU A CB  1 
ATOM   1036 C CG  . GLU A 1 144 ? 41.478 17.911  40.407  1.00 31.23 ? 151 GLU A CG  1 
ATOM   1037 C CD  . GLU A 1 144 ? 42.728 17.075  40.630  1.00 33.19 ? 151 GLU A CD  1 
ATOM   1038 O OE1 . GLU A 1 144 ? 43.851 17.592  40.438  1.00 31.52 ? 151 GLU A OE1 1 
ATOM   1039 O OE2 . GLU A 1 144 ? 42.586 15.892  40.992  1.00 40.43 ? 151 GLU A OE2 1 
ATOM   1040 N N   . LEU A 1 145 ? 39.548 18.596  36.388  1.00 21.53 ? 152 LEU A N   1 
ATOM   1041 C CA  . LEU A 1 145 ? 39.465 18.821  34.956  1.00 18.19 ? 152 LEU A CA  1 
ATOM   1042 C C   . LEU A 1 145 ? 38.548 20.010  34.686  1.00 20.43 ? 152 LEU A C   1 
ATOM   1043 O O   . LEU A 1 145 ? 38.838 20.848  33.833  1.00 18.55 ? 152 LEU A O   1 
ATOM   1044 C CB  . LEU A 1 145 ? 38.944 17.565  34.250  1.00 15.55 ? 152 LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 145 ? 39.835 16.324  34.379  1.00 16.83 ? 152 LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 145 ? 39.144 15.138  33.732  1.00 13.14 ? 152 LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 145 ? 41.185 16.575  33.728  1.00 14.88 ? 152 LEU A CD2 1 
ATOM   1048 N N   . GLU A 1 146 ? 37.449 20.097  35.430  1.00 19.56 ? 153 GLU A N   1 
ATOM   1049 C CA  . GLU A 1 146 ? 36.519 21.203  35.248  1.00 20.11 ? 153 GLU A CA  1 
ATOM   1050 C C   . GLU A 1 146 ? 37.216 22.517  35.564  1.00 20.57 ? 153 GLU A C   1 
ATOM   1051 O O   . GLU A 1 146 ? 36.984 23.531  34.910  1.00 22.24 ? 153 GLU A O   1 
ATOM   1052 C CB  . GLU A 1 146 ? 35.298 21.021  36.151  1.00 20.08 ? 153 GLU A CB  1 
ATOM   1053 C CG  . GLU A 1 146 ? 34.649 19.665  35.965  1.00 28.32 ? 153 GLU A CG  1 
ATOM   1054 C CD  . GLU A 1 146 ? 33.378 19.496  36.766  1.00 33.68 ? 153 GLU A CD  1 
ATOM   1055 O OE1 . GLU A 1 146 ? 33.384 19.819  37.980  1.00 33.25 ? 153 GLU A OE1 1 
ATOM   1056 O OE2 . GLU A 1 146 ? 32.376 19.026  36.175  1.00 34.25 ? 153 GLU A OE2 1 
ATOM   1057 N N   . VAL A 1 147 ? 38.085 22.488  36.564  1.00 21.42 ? 154 VAL A N   1 
ATOM   1058 C CA  . VAL A 1 147 ? 38.817 23.677  36.969  1.00 22.86 ? 154 VAL A CA  1 
ATOM   1059 C C   . VAL A 1 147 ? 39.895 24.022  35.951  1.00 22.57 ? 154 VAL A C   1 
ATOM   1060 O O   . VAL A 1 147 ? 40.128 25.192  35.649  1.00 24.68 ? 154 VAL A O   1 
ATOM   1061 C CB  . VAL A 1 147 ? 39.469 23.471  38.349  1.00 22.27 ? 154 VAL A CB  1 
ATOM   1062 C CG1 . VAL A 1 147 ? 40.258 24.710  38.743  1.00 22.77 ? 154 VAL A CG1 1 
ATOM   1063 C CG2 . VAL A 1 147 ? 38.392 23.171  39.379  1.00 24.44 ? 154 VAL A CG2 1 
ATOM   1064 N N   . LEU A 1 148 ? 40.557 23.002  35.421  1.00 21.56 ? 155 LEU A N   1 
ATOM   1065 C CA  . LEU A 1 148 ? 41.603 23.236  34.429  1.00 21.14 ? 155 LEU A CA  1 
ATOM   1066 C C   . LEU A 1 148 ? 41.017 23.900  33.181  1.00 19.92 ? 155 LEU A C   1 
ATOM   1067 O O   . LEU A 1 148 ? 41.606 24.826  32.640  1.00 18.85 ? 155 LEU A O   1 
ATOM   1068 C CB  . LEU A 1 148 ? 42.297 21.917  34.063  1.00 15.28 ? 155 LEU A CB  1 
ATOM   1069 C CG  . LEU A 1 148 ? 43.236 21.353  35.137  1.00 16.12 ? 155 LEU A CG  1 
ATOM   1070 C CD1 . LEU A 1 148 ? 43.505 19.887  34.864  1.00 20.66 ? 155 LEU A CD1 1 
ATOM   1071 C CD2 . LEU A 1 148 ? 44.539 22.156  35.171  1.00 18.39 ? 155 LEU A CD2 1 
ATOM   1072 N N   . VAL A 1 149 ? 39.850 23.435  32.741  1.00 21.71 ? 156 VAL A N   1 
ATOM   1073 C CA  . VAL A 1 149 ? 39.190 23.989  31.556  1.00 23.11 ? 156 VAL A CA  1 
ATOM   1074 C C   . VAL A 1 149 ? 38.607 25.378  31.812  1.00 26.62 ? 156 VAL A C   1 
ATOM   1075 O O   . VAL A 1 149 ? 38.988 26.357  31.172  1.00 25.77 ? 156 VAL A O   1 
ATOM   1076 C CB  . VAL A 1 149 ? 38.039 23.062  31.070  1.00 23.45 ? 156 VAL A CB  1 
ATOM   1077 C CG1 . VAL A 1 149 ? 37.256 23.736  29.954  1.00 22.91 ? 156 VAL A CG1 1 
ATOM   1078 C CG2 . VAL A 1 149 ? 38.603 21.737  30.575  1.00 17.16 ? 156 VAL A CG2 1 
ATOM   1079 N N   . GLN A 1 150 ? 37.695 25.459  32.772  1.00 28.07 ? 157 GLN A N   1 
ATOM   1080 C CA  . GLN A 1 150 ? 37.029 26.711  33.097  1.00 29.42 ? 157 GLN A CA  1 
ATOM   1081 C C   . GLN A 1 150 ? 37.863 27.834  33.687  1.00 27.96 ? 157 GLN A C   1 
ATOM   1082 O O   . GLN A 1 150 ? 37.634 28.998  33.355  1.00 28.43 ? 157 GLN A O   1 
ATOM   1083 C CB  . GLN A 1 150 ? 35.853 26.452  34.036  1.00 32.24 ? 157 GLN A CB  1 
ATOM   1084 C CG  . GLN A 1 150 ? 35.231 27.735  34.562  1.00 42.08 ? 157 GLN A CG  1 
ATOM   1085 C CD  . GLN A 1 150 ? 34.277 27.490  35.711  1.00 48.05 ? 157 GLN A CD  1 
ATOM   1086 O OE1 . GLN A 1 150 ? 33.205 26.908  35.530  1.00 53.01 ? 157 GLN A OE1 1 
ATOM   1087 N NE2 . GLN A 1 150 ? 34.667 27.920  36.908  1.00 50.59 ? 157 GLN A NE2 1 
ATOM   1088 N N   . ASP A 1 151 ? 38.816 27.517  34.557  1.00 26.21 ? 158 ASP A N   1 
ATOM   1089 C CA  . ASP A 1 151 ? 39.601 28.581  35.178  1.00 26.82 ? 158 ASP A CA  1 
ATOM   1090 C C   . ASP A 1 151 ? 41.055 28.717  34.752  1.00 25.57 ? 158 ASP A C   1 
ATOM   1091 O O   . ASP A 1 151 ? 41.580 29.826  34.709  1.00 26.01 ? 158 ASP A O   1 
ATOM   1092 C CB  . ASP A 1 151 ? 39.563 28.446  36.702  1.00 33.25 ? 158 ASP A CB  1 
ATOM   1093 C CG  . ASP A 1 151 ? 38.151 28.283  37.244  1.00 38.84 ? 158 ASP A CG  1 
ATOM   1094 O OD1 . ASP A 1 151 ? 37.226 28.978  36.755  1.00 40.96 ? 158 ASP A OD1 1 
ATOM   1095 O OD2 . ASP A 1 151 ? 37.969 27.465  38.175  1.00 38.51 ? 158 ASP A OD2 1 
ATOM   1096 N N   . LYS A 1 152 ? 41.704 27.602  34.445  1.00 23.12 ? 159 LYS A N   1 
ATOM   1097 C CA  . LYS A 1 152 ? 43.116 27.624  34.066  1.00 24.57 ? 159 LYS A CA  1 
ATOM   1098 C C   . LYS A 1 152 ? 43.390 27.828  32.579  1.00 23.31 ? 159 LYS A C   1 
ATOM   1099 O O   . LYS A 1 152 ? 44.504 28.179  32.193  1.00 24.87 ? 159 LYS A O   1 
ATOM   1100 C CB  . LYS A 1 152 ? 43.802 26.338  34.543  1.00 20.66 ? 159 LYS A CB  1 
ATOM   1101 C CG  . LYS A 1 152 ? 43.669 26.101  36.040  1.00 23.35 ? 159 LYS A CG  1 
ATOM   1102 C CD  . LYS A 1 152 ? 44.260 27.268  36.812  1.00 24.13 ? 159 LYS A CD  1 
ATOM   1103 C CE  . LYS A 1 152 ? 44.217 27.041  38.314  1.00 29.13 ? 159 LYS A CE  1 
ATOM   1104 N NZ  . LYS A 1 152 ? 44.898 28.168  39.027  1.00 26.79 ? 159 LYS A NZ  1 
ATOM   1105 N N   . GLY A 1 153 ? 42.389 27.596  31.743  1.00 21.69 ? 160 GLY A N   1 
ATOM   1106 C CA  . GLY A 1 153 ? 42.586 27.794  30.320  1.00 23.15 ? 160 GLY A CA  1 
ATOM   1107 C C   . GLY A 1 153 ? 43.211 26.637  29.555  1.00 22.90 ? 160 GLY A C   1 
ATOM   1108 O O   . GLY A 1 153 ? 43.819 26.852  28.504  1.00 18.68 ? 160 GLY A O   1 
ATOM   1109 N N   . VAL A 1 154 ? 43.067 25.419  30.075  1.00 17.27 ? 161 VAL A N   1 
ATOM   1110 C CA  . VAL A 1 154 ? 43.594 24.232  29.414  1.00 17.56 ? 161 VAL A CA  1 
ATOM   1111 C C   . VAL A 1 154 ? 42.442 23.535  28.687  1.00 17.96 ? 161 VAL A C   1 
ATOM   1112 O O   . VAL A 1 154 ? 41.522 23.031  29.336  1.00 18.25 ? 161 VAL A O   1 
ATOM   1113 C CB  . VAL A 1 154 ? 44.194 23.233  30.437  1.00 17.64 ? 161 VAL A CB  1 
ATOM   1114 C CG1 . VAL A 1 154 ? 44.562 21.921  29.743  1.00 13.76 ? 161 VAL A CG1 1 
ATOM   1115 C CG2 . VAL A 1 154 ? 45.415 23.846  31.106  1.00 15.79 ? 161 VAL A CG2 1 
ATOM   1116 N N   . ASN A 1 155 ? 42.477 23.499  27.355  1.00 15.90 ? 162 ASN A N   1 
ATOM   1117 C CA  . ASN A 1 155 ? 41.399 22.836  26.619  1.00 17.36 ? 162 ASN A CA  1 
ATOM   1118 C C   . ASN A 1 155 ? 41.777 21.500  25.968  1.00 17.55 ? 162 ASN A C   1 
ATOM   1119 O O   . ASN A 1 155 ? 40.975 20.902  25.256  1.00 18.21 ? 162 ASN A O   1 
ATOM   1120 C CB  . ASN A 1 155 ? 40.778 23.786  25.569  1.00 16.52 ? 162 ASN A CB  1 
ATOM   1121 C CG  . ASN A 1 155 ? 41.705 24.076  24.395  1.00 17.32 ? 162 ASN A CG  1 
ATOM   1122 O OD1 . ASN A 1 155 ? 42.847 23.632  24.366  1.00 15.35 ? 162 ASN A OD1 1 
ATOM   1123 N ND2 . ASN A 1 155 ? 41.202 24.838  23.416  1.00 13.92 ? 162 ASN A ND2 1 
ATOM   1124 N N   . SER A 1 156 ? 42.989 21.017  26.220  1.00 16.80 ? 163 SER A N   1 
ATOM   1125 C CA  . SER A 1 156 ? 43.401 19.741  25.642  1.00 17.05 ? 163 SER A CA  1 
ATOM   1126 C C   . SER A 1 156 ? 43.998 18.788  26.683  1.00 15.66 ? 163 SER A C   1 
ATOM   1127 O O   . SER A 1 156 ? 44.750 19.201  27.557  1.00 18.00 ? 163 SER A O   1 
ATOM   1128 C CB  . SER A 1 156 ? 44.393 19.981  24.497  1.00 15.06 ? 163 SER A CB  1 
ATOM   1129 O OG  . SER A 1 156 ? 45.441 20.850  24.899  1.00 20.52 ? 163 SER A OG  1 
ATOM   1130 N N   . PHE A 1 157 ? 43.647 17.509  26.593  1.00 15.87 ? 164 PHE A N   1 
ATOM   1131 C CA  . PHE A 1 157 ? 44.150 16.508  27.538  1.00 13.86 ? 164 PHE A CA  1 
ATOM   1132 C C   . PHE A 1 157 ? 44.502 15.209  26.833  1.00 14.89 ? 164 PHE A C   1 
ATOM   1133 O O   . PHE A 1 157 ? 43.870 14.844  25.841  1.00 18.30 ? 164 PHE A O   1 
ATOM   1134 C CB  . PHE A 1 157 ? 43.113 16.215  28.629  1.00 10.58 ? 164 PHE A CB  1 
ATOM   1135 C CG  . PHE A 1 157 ? 42.685 17.430  29.401  1.00 17.73 ? 164 PHE A CG  1 
ATOM   1136 C CD1 . PHE A 1 157 ? 41.763 18.324  28.866  1.00 19.22 ? 164 PHE A CD1 1 
ATOM   1137 C CD2 . PHE A 1 157 ? 43.215 17.686  30.662  1.00 20.25 ? 164 PHE A CD2 1 
ATOM   1138 C CE1 . PHE A 1 157 ? 41.376 19.462  29.574  1.00 24.08 ? 164 PHE A CE1 1 
ATOM   1139 C CE2 . PHE A 1 157 ? 42.839 18.820  31.383  1.00 21.53 ? 164 PHE A CE2 1 
ATOM   1140 C CZ  . PHE A 1 157 ? 41.914 19.712  30.840  1.00 21.98 ? 164 PHE A CZ  1 
ATOM   1141 N N   . GLN A 1 158 ? 45.503 14.502  27.350  1.00 15.00 ? 165 GLN A N   1 
ATOM   1142 C CA  . GLN A 1 158 ? 45.909 13.236  26.752  1.00 13.70 ? 165 GLN A CA  1 
ATOM   1143 C C   . GLN A 1 158 ? 45.736 12.065  27.710  1.00 14.72 ? 165 GLN A C   1 
ATOM   1144 O O   . GLN A 1 158 ? 45.997 12.189  28.914  1.00 14.60 ? 165 GLN A O   1 
ATOM   1145 C CB  . GLN A 1 158 ? 47.372 13.308  26.304  1.00 12.47 ? 165 GLN A CB  1 
ATOM   1146 C CG  . GLN A 1 158 ? 47.883 12.036  25.648  1.00 13.95 ? 165 GLN A CG  1 
ATOM   1147 C CD  . GLN A 1 158 ? 49.342 12.130  25.236  1.00 15.00 ? 165 GLN A CD  1 
ATOM   1148 O OE1 . GLN A 1 158 ? 49.710 12.938  24.384  1.00 14.91 ? 165 GLN A OE1 1 
ATOM   1149 N NE2 . GLN A 1 158 ? 50.179 11.296  25.839  1.00 15.76 ? 165 GLN A NE2 1 
ATOM   1150 N N   . VAL A 1 159 ? 45.271 10.939  27.176  1.00 13.78 ? 166 VAL A N   1 
ATOM   1151 C CA  . VAL A 1 159 ? 45.118 9.715   27.960  1.00 15.05 ? 166 VAL A CA  1 
ATOM   1152 C C   . VAL A 1 159 ? 45.998 8.667   27.289  1.00 15.73 ? 166 VAL A C   1 
ATOM   1153 O O   . VAL A 1 159 ? 46.176 8.683   26.062  1.00 17.56 ? 166 VAL A O   1 
ATOM   1154 C CB  . VAL A 1 159 ? 43.657 9.192   27.991  1.00 16.07 ? 166 VAL A CB  1 
ATOM   1155 C CG1 . VAL A 1 159 ? 42.759 10.203  28.661  1.00 16.01 ? 166 VAL A CG1 1 
ATOM   1156 C CG2 . VAL A 1 159 ? 43.178 8.884   26.577  1.00 12.55 ? 166 VAL A CG2 1 
ATOM   1157 N N   . TYR A 1 160 ? 46.558 7.765   28.083  1.00 14.34 ? 167 TYR A N   1 
ATOM   1158 C CA  . TYR A 1 160 ? 47.422 6.730   27.546  1.00 14.09 ? 167 TYR A CA  1 
ATOM   1159 C C   . TYR A 1 160 ? 46.730 5.378   27.413  1.00 18.16 ? 167 TYR A C   1 
ATOM   1160 O O   . TYR A 1 160 ? 45.936 4.977   28.273  1.00 17.40 ? 167 TYR A O   1 
ATOM   1161 C CB  . TYR A 1 160 ? 48.656 6.547   28.428  1.00 14.46 ? 167 TYR A CB  1 
ATOM   1162 C CG  . TYR A 1 160 ? 49.576 7.742   28.520  1.00 19.27 ? 167 TYR A CG  1 
ATOM   1163 C CD1 . TYR A 1 160 ? 49.281 8.821   29.359  1.00 17.57 ? 167 TYR A CD1 1 
ATOM   1164 C CD2 . TYR A 1 160 ? 50.777 7.766   27.811  1.00 13.89 ? 167 TYR A CD2 1 
ATOM   1165 C CE1 . TYR A 1 160 ? 50.172 9.889   29.498  1.00 18.55 ? 167 TYR A CE1 1 
ATOM   1166 C CE2 . TYR A 1 160 ? 51.665 8.825   27.938  1.00 19.93 ? 167 TYR A CE2 1 
ATOM   1167 C CZ  . TYR A 1 160 ? 51.362 9.878   28.785  1.00 19.02 ? 167 TYR A CZ  1 
ATOM   1168 O OH  . TYR A 1 160 ? 52.274 10.893  28.933  1.00 16.49 ? 167 TYR A OH  1 
ATOM   1169 N N   . MET A 1 161 ? 47.066 4.674   26.337  1.00 16.08 ? 168 MET A N   1 
ATOM   1170 C CA  . MET A 1 161 ? 46.528 3.354   26.058  1.00 17.82 ? 168 MET A CA  1 
ATOM   1171 C C   . MET A 1 161 ? 47.668 2.358   26.276  1.00 20.84 ? 168 MET A C   1 
ATOM   1172 O O   . MET A 1 161 ? 47.467 1.143   26.266  1.00 17.04 ? 168 MET A O   1 
ATOM   1173 C CB  . MET A 1 161 ? 46.021 3.278   24.611  1.00 19.22 ? 168 MET A CB  1 
ATOM   1174 C CG  . MET A 1 161 ? 44.736 4.071   24.337  1.00 19.31 ? 168 MET A CG  1 
ATOM   1175 S SD  . MET A 1 161 ? 44.172 3.936   22.619  1.00 11.38 ? 168 MET A SD  1 
ATOM   1176 C CE  . MET A 1 161 ? 43.433 2.340   22.634  1.00 19.17 ? 168 MET A CE  1 
ATOM   1177 N N   . ALA A 1 162 ? 48.874 2.887   26.472  1.00 20.86 ? 169 ALA A N   1 
ATOM   1178 C CA  . ALA A 1 162 ? 50.046 2.049   26.711  1.00 20.30 ? 169 ALA A CA  1 
ATOM   1179 C C   . ALA A 1 162 ? 50.588 2.287   28.124  1.00 20.64 ? 169 ALA A C   1 
ATOM   1180 O O   . ALA A 1 162 ? 49.969 2.994   28.921  1.00 19.62 ? 169 ALA A O   1 
ATOM   1181 C CB  . ALA A 1 162 ? 51.127 2.342   25.666  1.00 21.37 ? 169 ALA A CB  1 
ATOM   1182 N N   . TYR A 1 163 ? 51.745 1.695   28.419  1.00 20.65 ? 170 TYR A N   1 
ATOM   1183 C CA  . TYR A 1 163 ? 52.394 1.805   29.729  1.00 22.21 ? 170 TYR A CA  1 
ATOM   1184 C C   . TYR A 1 163 ? 51.587 1.081   30.805  1.00 20.11 ? 170 TYR A C   1 
ATOM   1185 O O   . TYR A 1 163 ? 51.079 1.686   31.748  1.00 23.23 ? 170 TYR A O   1 
ATOM   1186 C CB  . TYR A 1 163 ? 52.616 3.279   30.092  1.00 20.08 ? 170 TYR A CB  1 
ATOM   1187 C CG  . TYR A 1 163 ? 53.505 3.966   29.076  1.00 24.49 ? 170 TYR A CG  1 
ATOM   1188 C CD1 . TYR A 1 163 ? 54.837 3.568   28.906  1.00 23.07 ? 170 TYR A CD1 1 
ATOM   1189 C CD2 . TYR A 1 163 ? 52.993 4.939   28.215  1.00 19.78 ? 170 TYR A CD2 1 
ATOM   1190 C CE1 . TYR A 1 163 ? 55.631 4.113   27.897  1.00 22.13 ? 170 TYR A CE1 1 
ATOM   1191 C CE2 . TYR A 1 163 ? 53.778 5.489   27.209  1.00 20.08 ? 170 TYR A CE2 1 
ATOM   1192 C CZ  . TYR A 1 163 ? 55.093 5.071   27.052  1.00 24.08 ? 170 TYR A CZ  1 
ATOM   1193 O OH  . TYR A 1 163 ? 55.861 5.605   26.042  1.00 23.72 ? 170 TYR A OH  1 
ATOM   1194 N N   . LYS A 1 164 ? 51.487 -0.233  30.630  1.00 21.41 ? 171 LYS A N   1 
ATOM   1195 C CA  . LYS A 1 164 ? 50.771 -1.132  31.527  1.00 21.21 ? 171 LYS A CA  1 
ATOM   1196 C C   . LYS A 1 164 ? 51.151 -0.910  32.992  1.00 20.22 ? 171 LYS A C   1 
ATOM   1197 O O   . LYS A 1 164 ? 52.322 -0.766  33.323  1.00 20.14 ? 171 LYS A O   1 
ATOM   1198 C CB  . LYS A 1 164 ? 51.075 -2.581  31.121  1.00 19.49 ? 171 LYS A CB  1 
ATOM   1199 C CG  . LYS A 1 164 ? 50.375 -3.630  31.952  1.00 26.99 ? 171 LYS A CG  1 
ATOM   1200 C CD  . LYS A 1 164 ? 50.865 -5.033  31.612  1.00 28.05 ? 171 LYS A CD  1 
ATOM   1201 C CE  . LYS A 1 164 ? 50.102 -6.085  32.391  1.00 29.68 ? 171 LYS A CE  1 
ATOM   1202 N NZ  . LYS A 1 164 ? 48.643 -5.993  32.085  1.00 32.06 ? 171 LYS A NZ  1 
ATOM   1203 N N   . ASP A 1 165 ? 50.149 -0.882  33.862  1.00 24.43 ? 172 ASP A N   1 
ATOM   1204 C CA  . ASP A 1 165 ? 50.361 -0.686  35.292  1.00 27.07 ? 172 ASP A CA  1 
ATOM   1205 C C   . ASP A 1 165 ? 51.025 0.638   35.664  1.00 29.20 ? 172 ASP A C   1 
ATOM   1206 O O   . ASP A 1 165 ? 51.419 0.819   36.816  1.00 30.73 ? 172 ASP A O   1 
ATOM   1207 C CB  . ASP A 1 165 ? 51.197 -1.831  35.880  1.00 27.50 ? 172 ASP A CB  1 
ATOM   1208 C CG  . ASP A 1 165 ? 50.479 -3.167  35.824  1.00 30.63 ? 172 ASP A CG  1 
ATOM   1209 O OD1 . ASP A 1 165 ? 49.253 -3.203  36.078  1.00 32.03 ? 172 ASP A OD1 1 
ATOM   1210 O OD2 . ASP A 1 165 ? 51.141 -4.186  35.535  1.00 32.93 ? 172 ASP A OD2 1 
ATOM   1211 N N   . LEU A 1 166 ? 51.153 1.559   34.709  1.00 28.07 ? 173 LEU A N   1 
ATOM   1212 C CA  . LEU A 1 166 ? 51.774 2.861   34.982  1.00 23.78 ? 173 LEU A CA  1 
ATOM   1213 C C   . LEU A 1 166 ? 50.832 4.005   34.611  1.00 22.28 ? 173 LEU A C   1 
ATOM   1214 O O   . LEU A 1 166 ? 50.374 4.732   35.486  1.00 21.78 ? 173 LEU A O   1 
ATOM   1215 C CB  . LEU A 1 166 ? 53.093 2.996   34.212  1.00 26.90 ? 173 LEU A CB  1 
ATOM   1216 C CG  . LEU A 1 166 ? 53.840 4.323   34.382  1.00 32.95 ? 173 LEU A CG  1 
ATOM   1217 C CD1 . LEU A 1 166 ? 54.419 4.411   35.798  1.00 35.88 ? 173 LEU A CD1 1 
ATOM   1218 C CD2 . LEU A 1 166 ? 54.951 4.429   33.346  1.00 33.75 ? 173 LEU A CD2 1 
ATOM   1219 N N   . TYR A 1 167 ? 50.548 4.161   33.315  1.00 22.81 ? 174 TYR A N   1 
ATOM   1220 C CA  . TYR A 1 167 ? 49.641 5.206   32.825  1.00 22.27 ? 174 TYR A CA  1 
ATOM   1221 C C   . TYR A 1 167 ? 48.441 4.617   32.089  1.00 22.81 ? 174 TYR A C   1 
ATOM   1222 O O   . TYR A 1 167 ? 47.414 5.278   31.918  1.00 21.05 ? 174 TYR A O   1 
ATOM   1223 C CB  . TYR A 1 167 ? 50.330 6.137   31.829  1.00 22.03 ? 174 TYR A CB  1 
ATOM   1224 C CG  . TYR A 1 167 ? 51.556 6.870   32.314  1.00 22.51 ? 174 TYR A CG  1 
ATOM   1225 C CD1 . TYR A 1 167 ? 51.730 7.199   33.664  1.00 24.26 ? 174 TYR A CD1 1 
ATOM   1226 C CD2 . TYR A 1 167 ? 52.515 7.294   31.401  1.00 20.18 ? 174 TYR A CD2 1 
ATOM   1227 C CE1 . TYR A 1 167 ? 52.835 7.940   34.080  1.00 22.10 ? 174 TYR A CE1 1 
ATOM   1228 C CE2 . TYR A 1 167 ? 53.608 8.031   31.801  1.00 26.76 ? 174 TYR A CE2 1 
ATOM   1229 C CZ  . TYR A 1 167 ? 53.769 8.350   33.135  1.00 22.71 ? 174 TYR A CZ  1 
ATOM   1230 O OH  . TYR A 1 167 ? 54.871 9.080   33.500  1.00 21.49 ? 174 TYR A OH  1 
ATOM   1231 N N   . GLN A 1 168 ? 48.592 3.384   31.625  1.00 21.87 ? 175 GLN A N   1 
ATOM   1232 C CA  . GLN A 1 168 ? 47.548 2.700   30.875  1.00 23.05 ? 175 GLN A CA  1 
ATOM   1233 C C   . GLN A 1 168 ? 46.140 2.829   31.465  1.00 23.56 ? 175 GLN A C   1 
ATOM   1234 O O   . GLN A 1 168 ? 45.937 2.675   32.666  1.00 22.50 ? 175 GLN A O   1 
ATOM   1235 C CB  . GLN A 1 168 ? 47.929 1.237   30.734  1.00 23.76 ? 175 GLN A CB  1 
ATOM   1236 C CG  . GLN A 1 168 ? 47.012 0.435   29.871  1.00 27.39 ? 175 GLN A CG  1 
ATOM   1237 C CD  . GLN A 1 168 ? 47.595 -0.922  29.581  1.00 29.32 ? 175 GLN A CD  1 
ATOM   1238 O OE1 . GLN A 1 168 ? 48.579 -1.037  28.850  1.00 36.21 ? 175 GLN A OE1 1 
ATOM   1239 N NE2 . GLN A 1 168 ? 47.017 -1.956  30.174  1.00 33.55 ? 175 GLN A NE2 1 
ATOM   1240 N N   . MET A 1 169 ? 45.181 3.106   30.588  1.00 22.83 ? 176 MET A N   1 
ATOM   1241 C CA  . MET A 1 169 ? 43.774 3.280   30.940  1.00 24.49 ? 176 MET A CA  1 
ATOM   1242 C C   . MET A 1 169 ? 43.022 2.105   30.255  1.00 25.51 ? 176 MET A C   1 
ATOM   1243 O O   . MET A 1 169 ? 43.312 1.802   29.098  1.00 23.38 ? 176 MET A O   1 
ATOM   1244 C CB  . MET A 1 169 ? 43.321 4.653   30.389  1.00 23.53 ? 176 MET A CB  1 
ATOM   1245 C CG  . MET A 1 169 ? 42.206 5.341   31.178  1.00 26.08 ? 176 MET A CG  1 
ATOM   1246 S SD  . MET A 1 169 ? 41.844 7.082   30.815  1.00 10.66 ? 176 MET A SD  1 
ATOM   1247 C CE  . MET A 1 169 ? 42.767 7.859   31.989  1.00 24.95 ? 176 MET A CE  1 
ATOM   1248 N N   . SER A 1 170 ? 42.099 1.427   30.950  1.00 24.27 ? 177 SER A N   1 
ATOM   1249 C CA  . SER A 1 170 ? 41.341 0.308   30.331  1.00 24.40 ? 177 SER A CA  1 
ATOM   1250 C C   . SER A 1 170 ? 40.250 0.892   29.430  1.00 24.82 ? 177 SER A C   1 
ATOM   1251 O O   . SER A 1 170 ? 39.918 2.077   29.559  1.00 22.74 ? 177 SER A O   1 
ATOM   1252 C CB  . SER A 1 170 ? 40.664 -0.568  31.393  1.00 24.58 ? 177 SER A CB  1 
ATOM   1253 O OG  . SER A 1 170 ? 39.491 0.057   31.886  1.00 22.26 ? 177 SER A OG  1 
ATOM   1254 N N   . ASP A 1 171 ? 39.689 0.071   28.535  1.00 25.48 ? 178 ASP A N   1 
ATOM   1255 C CA  . ASP A 1 171 ? 38.652 0.532   27.596  1.00 26.39 ? 178 ASP A CA  1 
ATOM   1256 C C   . ASP A 1 171 ? 37.476 1.190   28.301  1.00 24.31 ? 178 ASP A C   1 
ATOM   1257 O O   . ASP A 1 171 ? 36.908 2.163   27.805  1.00 23.21 ? 178 ASP A O   1 
ATOM   1258 C CB  . ASP A 1 171 ? 38.116 -0.622  26.726  1.00 25.06 ? 178 ASP A CB  1 
ATOM   1259 C CG  . ASP A 1 171 ? 39.160 -1.181  25.753  1.00 28.67 ? 178 ASP A CG  1 
ATOM   1260 O OD1 . ASP A 1 171 ? 40.147 -0.484  25.436  1.00 28.94 ? 178 ASP A OD1 1 
ATOM   1261 O OD2 . ASP A 1 171 ? 38.982 -2.330  25.285  1.00 26.42 ? 178 ASP A OD2 1 
ATOM   1262 N N   . SER A 1 172 ? 37.100 0.653   29.456  1.00 25.84 ? 179 SER A N   1 
ATOM   1263 C CA  . SER A 1 172 ? 35.985 1.211   30.210  1.00 25.11 ? 179 SER A CA  1 
ATOM   1264 C C   . SER A 1 172 ? 36.314 2.596   30.746  1.00 23.02 ? 179 SER A C   1 
ATOM   1265 O O   . SER A 1 172 ? 35.451 3.471   30.776  1.00 23.42 ? 179 SER A O   1 
ATOM   1266 C CB  . SER A 1 172 ? 35.603 0.286   31.364  1.00 28.80 ? 179 SER A CB  1 
ATOM   1267 O OG  . SER A 1 172 ? 35.057 -0.914  30.861  1.00 35.86 ? 179 SER A OG  1 
ATOM   1268 N N   . GLN A 1 173 ? 37.559 2.792   31.176  1.00 22.77 ? 180 GLN A N   1 
ATOM   1269 C CA  . GLN A 1 173 ? 37.990 4.092   31.690  1.00 24.78 ? 180 GLN A CA  1 
ATOM   1270 C C   . GLN A 1 173 ? 38.132 5.092   30.537  1.00 22.58 ? 180 GLN A C   1 
ATOM   1271 O O   . GLN A 1 173 ? 37.845 6.284   30.693  1.00 20.67 ? 180 GLN A O   1 
ATOM   1272 C CB  . GLN A 1 173 ? 39.329 3.970   32.431  1.00 24.90 ? 180 GLN A CB  1 
ATOM   1273 C CG  . GLN A 1 173 ? 39.277 3.141   33.705  1.00 26.06 ? 180 GLN A CG  1 
ATOM   1274 C CD  . GLN A 1 173 ? 40.611 3.116   34.433  1.00 28.70 ? 180 GLN A CD  1 
ATOM   1275 O OE1 . GLN A 1 173 ? 41.632 2.690   33.885  1.00 29.46 ? 180 GLN A OE1 1 
ATOM   1276 N NE2 . GLN A 1 173 ? 40.609 3.574   35.673  1.00 27.72 ? 180 GLN A NE2 1 
ATOM   1277 N N   . LEU A 1 174 ? 38.585 4.598   29.386  1.00 21.31 ? 181 LEU A N   1 
ATOM   1278 C CA  . LEU A 1 174 ? 38.752 5.436   28.202  1.00 20.18 ? 181 LEU A CA  1 
ATOM   1279 C C   . LEU A 1 174 ? 37.384 5.949   27.774  1.00 17.60 ? 181 LEU A C   1 
ATOM   1280 O O   . LEU A 1 174 ? 37.237 7.110   27.400  1.00 16.12 ? 181 LEU A O   1 
ATOM   1281 C CB  . LEU A 1 174 ? 39.384 4.636   27.051  1.00 19.13 ? 181 LEU A CB  1 
ATOM   1282 C CG  . LEU A 1 174 ? 40.863 4.221   27.130  1.00 19.81 ? 181 LEU A CG  1 
ATOM   1283 C CD1 . LEU A 1 174 ? 41.227 3.397   25.906  1.00 19.60 ? 181 LEU A CD1 1 
ATOM   1284 C CD2 . LEU A 1 174 ? 41.749 5.442   27.206  1.00 16.39 ? 181 LEU A CD2 1 
ATOM   1285 N N   . TYR A 1 175 ? 36.382 5.076   27.837  1.00 19.14 ? 182 TYR A N   1 
ATOM   1286 C CA  . TYR A 1 175 ? 35.022 5.449   27.455  1.00 19.16 ? 182 TYR A CA  1 
ATOM   1287 C C   . TYR A 1 175 ? 34.528 6.556   28.392  1.00 19.87 ? 182 TYR A C   1 
ATOM   1288 O O   . TYR A 1 175 ? 33.952 7.542   27.946  1.00 18.52 ? 182 TYR A O   1 
ATOM   1289 C CB  . TYR A 1 175 ? 34.104 4.209   27.512  1.00 16.62 ? 182 TYR A CB  1 
ATOM   1290 C CG  . TYR A 1 175 ? 32.641 4.438   27.162  1.00 14.78 ? 182 TYR A CG  1 
ATOM   1291 C CD1 . TYR A 1 175 ? 31.766 5.005   28.082  1.00 19.36 ? 182 TYR A CD1 1 
ATOM   1292 C CD2 . TYR A 1 175 ? 32.130 4.065   25.915  1.00 18.33 ? 182 TYR A CD2 1 
ATOM   1293 C CE1 . TYR A 1 175 ? 30.415 5.184   27.784  1.00 21.69 ? 182 TYR A CE1 1 
ATOM   1294 C CE2 . TYR A 1 175 ? 30.772 4.239   25.599  1.00 19.37 ? 182 TYR A CE2 1 
ATOM   1295 C CZ  . TYR A 1 175 ? 29.920 4.803   26.542  1.00 26.06 ? 182 TYR A CZ  1 
ATOM   1296 O OH  . TYR A 1 175 ? 28.572 4.962   26.271  1.00 26.50 ? 182 TYR A OH  1 
ATOM   1297 N N   . GLU A 1 176 ? 34.777 6.392   29.688  1.00 22.52 ? 183 GLU A N   1 
ATOM   1298 C CA  . GLU A 1 176 ? 34.368 7.369   30.702  1.00 20.49 ? 183 GLU A CA  1 
ATOM   1299 C C   . GLU A 1 176 ? 35.054 8.716   30.473  1.00 21.36 ? 183 GLU A C   1 
ATOM   1300 O O   . GLU A 1 176 ? 34.418 9.771   30.507  1.00 21.64 ? 183 GLU A O   1 
ATOM   1301 C CB  . GLU A 1 176 ? 34.740 6.845   32.092  1.00 24.93 ? 183 GLU A CB  1 
ATOM   1302 C CG  . GLU A 1 176 ? 33.649 6.952   33.141  1.00 33.73 ? 183 GLU A CG  1 
ATOM   1303 C CD  . GLU A 1 176 ? 33.960 6.115   34.382  1.00 37.03 ? 183 GLU A CD  1 
ATOM   1304 O OE1 . GLU A 1 176 ? 34.882 6.481   35.148  1.00 35.21 ? 183 GLU A OE1 1 
ATOM   1305 O OE2 . GLU A 1 176 ? 33.282 5.079   34.584  1.00 41.61 ? 183 GLU A OE2 1 
ATOM   1306 N N   . ALA A 1 177 ? 36.364 8.673   30.250  1.00 20.88 ? 184 ALA A N   1 
ATOM   1307 C CA  . ALA A 1 177 ? 37.145 9.890   30.025  1.00 20.79 ? 184 ALA A CA  1 
ATOM   1308 C C   . ALA A 1 177 ? 36.719 10.643  28.766  1.00 18.85 ? 184 ALA A C   1 
ATOM   1309 O O   . ALA A 1 177 ? 36.497 11.855  28.819  1.00 19.43 ? 184 ALA A O   1 
ATOM   1310 C CB  . ALA A 1 177 ? 38.639 9.558   29.960  1.00 16.02 ? 184 ALA A CB  1 
ATOM   1311 N N   . PHE A 1 178 ? 36.608 9.938   27.640  1.00 16.38 ? 185 PHE A N   1 
ATOM   1312 C CA  . PHE A 1 178 ? 36.196 10.578  26.389  1.00 17.60 ? 185 PHE A CA  1 
ATOM   1313 C C   . PHE A 1 178 ? 34.849 11.262  26.617  1.00 18.19 ? 185 PHE A C   1 
ATOM   1314 O O   . PHE A 1 178 ? 34.648 12.409  26.210  1.00 15.51 ? 185 PHE A O   1 
ATOM   1315 C CB  . PHE A 1 178 ? 36.044 9.547   25.252  1.00 14.39 ? 185 PHE A CB  1 
ATOM   1316 C CG  . PHE A 1 178 ? 37.348 9.116   24.610  1.00 16.17 ? 185 PHE A CG  1 
ATOM   1317 C CD1 . PHE A 1 178 ? 38.527 9.060   25.344  1.00 14.62 ? 185 PHE A CD1 1 
ATOM   1318 C CD2 . PHE A 1 178 ? 37.375 8.704   23.280  1.00 19.49 ? 185 PHE A CD2 1 
ATOM   1319 C CE1 . PHE A 1 178 ? 39.711 8.593   24.773  1.00 15.01 ? 185 PHE A CE1 1 
ATOM   1320 C CE2 . PHE A 1 178 ? 38.558 8.232   22.693  1.00 22.26 ? 185 PHE A CE2 1 
ATOM   1321 C CZ  . PHE A 1 178 ? 39.729 8.178   23.445  1.00 20.05 ? 185 PHE A CZ  1 
ATOM   1322 N N   . THR A 1 179 ? 33.935 10.544  27.273  1.00 19.28 ? 186 THR A N   1 
ATOM   1323 C CA  . THR A 1 179 ? 32.597 11.057  27.543  1.00 19.31 ? 186 THR A CA  1 
ATOM   1324 C C   . THR A 1 179 ? 32.630 12.323  28.390  1.00 21.13 ? 186 THR A C   1 
ATOM   1325 O O   . THR A 1 179 ? 32.024 13.331  28.029  1.00 20.26 ? 186 THR A O   1 
ATOM   1326 C CB  . THR A 1 179 ? 31.709 9.992   28.244  1.00 22.25 ? 186 THR A CB  1 
ATOM   1327 O OG1 . THR A 1 179 ? 31.571 8.844   27.392  1.00 19.34 ? 186 THR A OG1 1 
ATOM   1328 C CG2 . THR A 1 179 ? 30.320 10.561  28.531  1.00 15.27 ? 186 THR A CG2 1 
ATOM   1329 N N   . PHE A 1 180 ? 33.346 12.276  29.510  1.00 19.71 ? 187 PHE A N   1 
ATOM   1330 C CA  . PHE A 1 180 ? 33.442 13.446  30.382  1.00 20.42 ? 187 PHE A CA  1 
ATOM   1331 C C   . PHE A 1 180 ? 34.159 14.609  29.681  1.00 20.20 ? 187 PHE A C   1 
ATOM   1332 O O   . PHE A 1 180 ? 33.728 15.759  29.772  1.00 19.32 ? 187 PHE A O   1 
ATOM   1333 C CB  . PHE A 1 180 ? 34.197 13.091  31.666  1.00 22.40 ? 187 PHE A CB  1 
ATOM   1334 C CG  . PHE A 1 180 ? 34.211 14.195  32.682  1.00 23.95 ? 187 PHE A CG  1 
ATOM   1335 C CD1 . PHE A 1 180 ? 33.062 14.503  33.409  1.00 26.22 ? 187 PHE A CD1 1 
ATOM   1336 C CD2 . PHE A 1 180 ? 35.362 14.946  32.898  1.00 17.19 ? 187 PHE A CD2 1 
ATOM   1337 C CE1 . PHE A 1 180 ? 33.064 15.542  34.344  1.00 24.07 ? 187 PHE A CE1 1 
ATOM   1338 C CE2 . PHE A 1 180 ? 35.378 15.982  33.825  1.00 19.29 ? 187 PHE A CE2 1 
ATOM   1339 C CZ  . PHE A 1 180 ? 34.229 16.287  34.548  1.00 19.96 ? 187 PHE A CZ  1 
ATOM   1340 N N   . LEU A 1 181 ? 35.254 14.314  28.986  1.00 18.23 ? 188 LEU A N   1 
ATOM   1341 C CA  . LEU A 1 181 ? 36.010 15.360  28.299  1.00 18.66 ? 188 LEU A CA  1 
ATOM   1342 C C   . LEU A 1 181 ? 35.192 16.055  27.213  1.00 19.88 ? 188 LEU A C   1 
ATOM   1343 O O   . LEU A 1 181 ? 35.256 17.279  27.071  1.00 23.41 ? 188 LEU A O   1 
ATOM   1344 C CB  . LEU A 1 181 ? 37.305 14.778  27.720  1.00 16.60 ? 188 LEU A CB  1 
ATOM   1345 C CG  . LEU A 1 181 ? 38.334 14.451  28.806  1.00 12.96 ? 188 LEU A CG  1 
ATOM   1346 C CD1 . LEU A 1 181 ? 39.548 13.767  28.206  1.00 17.23 ? 188 LEU A CD1 1 
ATOM   1347 C CD2 . LEU A 1 181 ? 38.740 15.734  29.512  1.00 13.95 ? 188 LEU A CD2 1 
ATOM   1348 N N   . LYS A 1 182 ? 34.422 15.276  26.452  1.00 23.09 ? 189 LYS A N   1 
ATOM   1349 C CA  . LYS A 1 182 ? 33.574 15.830  25.402  1.00 20.21 ? 189 LYS A CA  1 
ATOM   1350 C C   . LYS A 1 182 ? 32.595 16.820  26.043  1.00 22.37 ? 189 LYS A C   1 
ATOM   1351 O O   . LYS A 1 182 ? 32.363 17.913  25.524  1.00 19.61 ? 189 LYS A O   1 
ATOM   1352 C CB  . LYS A 1 182 ? 32.796 14.713  24.704  1.00 20.60 ? 189 LYS A CB  1 
ATOM   1353 C CG  . LYS A 1 182 ? 31.612 15.218  23.887  1.00 21.04 ? 189 LYS A CG  1 
ATOM   1354 C CD  . LYS A 1 182 ? 30.809 14.076  23.292  1.00 23.38 ? 189 LYS A CD  1 
ATOM   1355 C CE  . LYS A 1 182 ? 29.414 14.532  22.904  1.00 24.26 ? 189 LYS A CE  1 
ATOM   1356 N NZ  . LYS A 1 182 ? 28.616 13.417  22.312  1.00 22.14 ? 189 LYS A NZ  1 
ATOM   1357 N N   . GLY A 1 183 ? 32.026 16.424  27.177  1.00 16.64 ? 190 GLY A N   1 
ATOM   1358 C CA  . GLY A 1 183 ? 31.097 17.284  27.883  1.00 18.56 ? 190 GLY A CA  1 
ATOM   1359 C C   . GLY A 1 183 ? 31.723 18.628  28.215  1.00 19.35 ? 190 GLY A C   1 
ATOM   1360 O O   . GLY A 1 183 ? 31.031 19.642  28.218  1.00 22.56 ? 190 GLY A O   1 
ATOM   1361 N N   . LEU A 1 184 ? 33.029 18.641  28.479  1.00 19.26 ? 191 LEU A N   1 
ATOM   1362 C CA  . LEU A 1 184 ? 33.736 19.884  28.795  1.00 20.92 ? 191 LEU A CA  1 
ATOM   1363 C C   . LEU A 1 184 ? 34.175 20.627  27.538  1.00 19.41 ? 191 LEU A C   1 
ATOM   1364 O O   . LEU A 1 184 ? 34.712 21.722  27.631  1.00 21.78 ? 191 LEU A O   1 
ATOM   1365 C CB  . LEU A 1 184 ? 34.982 19.616  29.650  1.00 20.34 ? 191 LEU A CB  1 
ATOM   1366 C CG  . LEU A 1 184 ? 34.827 18.986  31.036  1.00 25.79 ? 191 LEU A CG  1 
ATOM   1367 C CD1 . LEU A 1 184 ? 36.176 18.923  31.716  1.00 22.82 ? 191 LEU A CD1 1 
ATOM   1368 C CD2 . LEU A 1 184 ? 33.864 19.802  31.874  1.00 21.80 ? 191 LEU A CD2 1 
ATOM   1369 N N   . GLY A 1 185 ? 33.966 20.023  26.372  1.00 21.55 ? 192 GLY A N   1 
ATOM   1370 C CA  . GLY A 1 185 ? 34.356 20.655  25.119  1.00 18.72 ? 192 GLY A CA  1 
ATOM   1371 C C   . GLY A 1 185 ? 35.857 20.651  24.875  1.00 19.93 ? 192 GLY A C   1 
ATOM   1372 O O   . GLY A 1 185 ? 36.392 21.519  24.181  1.00 18.35 ? 192 GLY A O   1 
ATOM   1373 N N   . ALA A 1 186 ? 36.540 19.657  25.433  1.00 17.13 ? 193 ALA A N   1 
ATOM   1374 C CA  . ALA A 1 186 ? 37.984 19.551  25.300  1.00 16.29 ? 193 ALA A CA  1 
ATOM   1375 C C   . ALA A 1 186 ? 38.451 18.818  24.053  1.00 16.33 ? 193 ALA A C   1 
ATOM   1376 O O   . ALA A 1 186 ? 37.671 18.124  23.399  1.00 17.44 ? 193 ALA A O   1 
ATOM   1377 C CB  . ALA A 1 186 ? 38.550 18.861  26.532  1.00 17.83 ? 193 ALA A CB  1 
ATOM   1378 N N   . VAL A 1 187 ? 39.729 18.993  23.724  1.00 15.11 ? 194 VAL A N   1 
ATOM   1379 C CA  . VAL A 1 187 ? 40.345 18.299  22.599  1.00 12.48 ? 194 VAL A CA  1 
ATOM   1380 C C   . VAL A 1 187 ? 40.999 17.078  23.262  1.00 13.85 ? 194 VAL A C   1 
ATOM   1381 O O   . VAL A 1 187 ? 41.851 17.223  24.136  1.00 15.35 ? 194 VAL A O   1 
ATOM   1382 C CB  . VAL A 1 187 ? 41.444 19.154  21.907  1.00 16.24 ? 194 VAL A CB  1 
ATOM   1383 C CG1 . VAL A 1 187 ? 41.989 18.409  20.676  1.00 10.57 ? 194 VAL A CG1 1 
ATOM   1384 C CG2 . VAL A 1 187 ? 40.881 20.508  21.495  1.00 11.05 ? 194 VAL A CG2 1 
ATOM   1385 N N   . ILE A 1 188 ? 40.587 15.885  22.847  1.00 14.67 ? 195 ILE A N   1 
ATOM   1386 C CA  . ILE A 1 188 ? 41.076 14.620  23.410  1.00 16.53 ? 195 ILE A CA  1 
ATOM   1387 C C   . ILE A 1 188 ? 42.271 14.005  22.657  1.00 19.60 ? 195 ILE A C   1 
ATOM   1388 O O   . ILE A 1 188 ? 42.132 13.584  21.505  1.00 15.28 ? 195 ILE A O   1 
ATOM   1389 C CB  . ILE A 1 188 ? 39.905 13.595  23.446  1.00 20.13 ? 195 ILE A CB  1 
ATOM   1390 C CG1 . ILE A 1 188 ? 38.779 14.149  24.324  1.00 18.77 ? 195 ILE A CG1 1 
ATOM   1391 C CG2 . ILE A 1 188 ? 40.379 12.235  23.965  1.00 17.78 ? 195 ILE A CG2 1 
ATOM   1392 C CD1 . ILE A 1 188 ? 37.450 13.475  24.120  1.00 22.83 ? 195 ILE A CD1 1 
ATOM   1393 N N   . LEU A 1 189 ? 43.430 13.955  23.320  1.00 13.25 ? 196 LEU A N   1 
ATOM   1394 C CA  . LEU A 1 189 ? 44.658 13.393  22.744  1.00 16.42 ? 196 LEU A CA  1 
ATOM   1395 C C   . LEU A 1 189 ? 44.911 11.962  23.227  1.00 18.98 ? 196 LEU A C   1 
ATOM   1396 O O   . LEU A 1 189 ? 44.583 11.612  24.359  1.00 20.34 ? 196 LEU A O   1 
ATOM   1397 C CB  . LEU A 1 189 ? 45.871 14.259  23.097  1.00 15.40 ? 196 LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 189 ? 46.137 15.534  22.291  1.00 19.14 ? 196 LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 189 ? 45.012 16.525  22.516  1.00 21.84 ? 196 LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 189 ? 47.470 16.144  22.705  1.00 16.50 ? 196 LEU A CD2 1 
ATOM   1401 N N   . VAL A 1 190 ? 45.512 11.137  22.377  1.00 18.81 ? 197 VAL A N   1 
ATOM   1402 C CA  . VAL A 1 190 ? 45.769 9.752   22.754  1.00 17.18 ? 197 VAL A CA  1 
ATOM   1403 C C   . VAL A 1 190 ? 47.167 9.247   22.427  1.00 16.85 ? 197 VAL A C   1 
ATOM   1404 O O   . VAL A 1 190 ? 47.728 9.566   21.372  1.00 17.46 ? 197 VAL A O   1 
ATOM   1405 C CB  . VAL A 1 190 ? 44.776 8.792   22.053  1.00 18.53 ? 197 VAL A CB  1 
ATOM   1406 C CG1 . VAL A 1 190 ? 44.971 7.378   22.577  1.00 17.85 ? 197 VAL A CG1 1 
ATOM   1407 C CG2 . VAL A 1 190 ? 43.336 9.247   22.279  1.00 19.14 ? 197 VAL A CG2 1 
ATOM   1408 N N   . HIS A 1 191 ? 47.747 8.489   23.352  1.00 13.90 ? 198 HIS A N   1 
ATOM   1409 C CA  . HIS A 1 191 ? 49.036 7.854   23.095  1.00 16.60 ? 198 HIS A CA  1 
ATOM   1410 C C   . HIS A 1 191 ? 48.521 6.452   22.799  1.00 17.09 ? 198 HIS A C   1 
ATOM   1411 O O   . HIS A 1 191 ? 48.176 5.707   23.724  1.00 18.52 ? 198 HIS A O   1 
ATOM   1412 C CB  . HIS A 1 191 ? 49.926 7.826   24.336  1.00 17.94 ? 198 HIS A CB  1 
ATOM   1413 C CG  . HIS A 1 191 ? 51.283 7.250   24.082  1.00 19.12 ? 198 HIS A CG  1 
ATOM   1414 N ND1 . HIS A 1 191 ? 51.486 5.929   23.742  1.00 21.98 ? 198 HIS A ND1 1 
ATOM   1415 C CD2 . HIS A 1 191 ? 52.513 7.826   24.084  1.00 15.20 ? 198 HIS A CD2 1 
ATOM   1416 C CE1 . HIS A 1 191 ? 52.774 5.716   23.542  1.00 20.04 ? 198 HIS A CE1 1 
ATOM   1417 N NE2 . HIS A 1 191 ? 53.416 6.855   23.744  1.00 21.30 ? 198 HIS A NE2 1 
ATOM   1418 N N   . ALA A 1 192 ? 48.451 6.110   21.516  1.00 17.41 ? 199 ALA A N   1 
ATOM   1419 C CA  . ALA A 1 192 ? 47.899 4.831   21.081  1.00 17.24 ? 199 ALA A CA  1 
ATOM   1420 C C   . ALA A 1 192 ? 48.840 3.686   20.742  1.00 19.43 ? 199 ALA A C   1 
ATOM   1421 O O   . ALA A 1 192 ? 49.376 3.601   19.633  1.00 20.11 ? 199 ALA A O   1 
ATOM   1422 C CB  . ALA A 1 192 ? 46.958 5.067   19.907  1.00 17.82 ? 199 ALA A CB  1 
ATOM   1423 N N   . GLU A 1 193 ? 49.008 2.798   21.711  1.00 18.33 ? 200 GLU A N   1 
ATOM   1424 C CA  . GLU A 1 193 ? 49.814 1.593   21.571  1.00 17.46 ? 200 GLU A CA  1 
ATOM   1425 C C   . GLU A 1 193 ? 49.163 0.612   22.544  1.00 17.22 ? 200 GLU A C   1 
ATOM   1426 O O   . GLU A 1 193 ? 48.782 1.015   23.647  1.00 15.33 ? 200 GLU A O   1 
ATOM   1427 C CB  . GLU A 1 193 ? 51.262 1.838   21.996  1.00 17.54 ? 200 GLU A CB  1 
ATOM   1428 C CG  . GLU A 1 193 ? 52.179 2.410   20.932  1.00 17.05 ? 200 GLU A CG  1 
ATOM   1429 C CD  . GLU A 1 193 ? 53.638 2.406   21.391  1.00 22.87 ? 200 GLU A CD  1 
ATOM   1430 O OE1 . GLU A 1 193 ? 54.498 1.859   20.665  1.00 20.86 ? 200 GLU A OE1 1 
ATOM   1431 O OE2 . GLU A 1 193 ? 53.921 2.943   22.487  1.00 22.69 ? 200 GLU A OE2 1 
ATOM   1432 N N   . ASN A 1 194 ? 49.017 -0.652  22.151  1.00 15.26 ? 201 ASN A N   1 
ATOM   1433 C CA  . ASN A 1 194 ? 48.412 -1.642  23.051  1.00 18.96 ? 201 ASN A CA  1 
ATOM   1434 C C   . ASN A 1 194 ? 49.440 -2.023  24.116  1.00 15.07 ? 201 ASN A C   1 
ATOM   1435 O O   . ASN A 1 194 ? 50.361 -2.792  23.853  1.00 19.94 ? 201 ASN A O   1 
ATOM   1436 C CB  . ASN A 1 194 ? 47.981 -2.901  22.287  1.00 18.41 ? 201 ASN A CB  1 
ATOM   1437 C CG  . ASN A 1 194 ? 47.196 -3.884  23.168  1.00 25.44 ? 201 ASN A CG  1 
ATOM   1438 O OD1 . ASN A 1 194 ? 47.711 -4.398  24.171  1.00 21.75 ? 201 ASN A OD1 1 
ATOM   1439 N ND2 . ASN A 1 194 ? 45.938 -4.143  22.792  1.00 23.73 ? 201 ASN A ND2 1 
ATOM   1440 N N   . GLY A 1 195 ? 49.273 -1.479  25.316  1.00 20.70 ? 202 GLY A N   1 
ATOM   1441 C CA  . GLY A 1 195 ? 50.201 -1.746  26.399  1.00 17.75 ? 202 GLY A CA  1 
ATOM   1442 C C   . GLY A 1 195 ? 50.294 -3.181  26.877  1.00 19.40 ? 202 GLY A C   1 
ATOM   1443 O O   . GLY A 1 195 ? 51.384 -3.652  27.204  1.00 21.03 ? 202 GLY A O   1 
ATOM   1444 N N   . ASP A 1 196 ? 49.169 -3.886  26.930  1.00 20.91 ? 203 ASP A N   1 
ATOM   1445 C CA  . ASP A 1 196 ? 49.197 -5.272  27.391  1.00 21.69 ? 203 ASP A CA  1 
ATOM   1446 C C   . ASP A 1 196 ? 50.031 -6.157  26.479  1.00 21.06 ? 203 ASP A C   1 
ATOM   1447 O O   . ASP A 1 196 ? 50.868 -6.931  26.950  1.00 21.18 ? 203 ASP A O   1 
ATOM   1448 C CB  . ASP A 1 196 ? 47.773 -5.835  27.523  1.00 26.96 ? 203 ASP A CB  1 
ATOM   1449 C CG  . ASP A 1 196 ? 47.048 -5.274  28.729  1.00 27.89 ? 203 ASP A CG  1 
ATOM   1450 O OD1 . ASP A 1 196 ? 47.733 -4.987  29.726  1.00 34.04 ? 203 ASP A OD1 1 
ATOM   1451 O OD2 . ASP A 1 196 ? 45.811 -5.126  28.701  1.00 34.43 ? 203 ASP A OD2 1 
ATOM   1452 N N   . LEU A 1 197 ? 49.816 -6.030  25.174  1.00 19.70 ? 204 LEU A N   1 
ATOM   1453 C CA  . LEU A 1 197 ? 50.557 -6.831  24.209  1.00 17.21 ? 204 LEU A CA  1 
ATOM   1454 C C   . LEU A 1 197 ? 52.031 -6.424  24.171  1.00 20.92 ? 204 LEU A C   1 
ATOM   1455 O O   . LEU A 1 197 ? 52.915 -7.258  23.941  1.00 18.80 ? 204 LEU A O   1 
ATOM   1456 C CB  . LEU A 1 197 ? 49.917 -6.701  22.828  1.00 18.05 ? 204 LEU A CB  1 
ATOM   1457 C CG  . LEU A 1 197 ? 48.483 -7.242  22.762  1.00 23.17 ? 204 LEU A CG  1 
ATOM   1458 C CD1 . LEU A 1 197 ? 47.967 -7.147  21.333  1.00 24.03 ? 204 LEU A CD1 1 
ATOM   1459 C CD2 . LEU A 1 197 ? 48.454 -8.696  23.240  1.00 26.40 ? 204 LEU A CD2 1 
ATOM   1460 N N   . ILE A 1 198 ? 52.292 -5.138  24.391  1.00 20.80 ? 205 ILE A N   1 
ATOM   1461 C CA  . ILE A 1 198 ? 53.661 -4.642  24.416  1.00 20.45 ? 205 ILE A CA  1 
ATOM   1462 C C   . ILE A 1 198 ? 54.391 -5.247  25.618  1.00 21.26 ? 205 ILE A C   1 
ATOM   1463 O O   . ILE A 1 198 ? 55.563 -5.616  25.518  1.00 23.38 ? 205 ILE A O   1 
ATOM   1464 C CB  . ILE A 1 198 ? 53.699 -3.098  24.512  1.00 21.37 ? 205 ILE A CB  1 
ATOM   1465 C CG1 . ILE A 1 198 ? 53.410 -2.487  23.136  1.00 20.25 ? 205 ILE A CG1 1 
ATOM   1466 C CG2 . ILE A 1 198 ? 55.065 -2.634  25.033  1.00 19.01 ? 205 ILE A CG2 1 
ATOM   1467 C CD1 . ILE A 1 198 ? 53.290 -0.979  23.156  1.00 25.65 ? 205 ILE A CD1 1 
ATOM   1468 N N   . ALA A 1 199 ? 53.698 -5.361  26.750  1.00 19.22 ? 206 ALA A N   1 
ATOM   1469 C CA  . ALA A 1 199 ? 54.317 -5.932  27.948  1.00 22.21 ? 206 ALA A CA  1 
ATOM   1470 C C   . ALA A 1 199 ? 54.688 -7.389  27.669  1.00 23.74 ? 206 ALA A C   1 
ATOM   1471 O O   . ALA A 1 199 ? 55.765 -7.848  28.052  1.00 26.07 ? 206 ALA A O   1 
ATOM   1472 C CB  . ALA A 1 199 ? 53.359 -5.849  29.131  1.00 22.71 ? 206 ALA A CB  1 
ATOM   1473 N N   . GLN A 1 200 ? 53.788 -8.104  26.995  1.00 25.19 ? 207 GLN A N   1 
ATOM   1474 C CA  . GLN A 1 200 ? 54.020 -9.501  26.634  1.00 24.35 ? 207 GLN A CA  1 
ATOM   1475 C C   . GLN A 1 200 ? 55.230 -9.649  25.729  1.00 23.36 ? 207 GLN A C   1 
ATOM   1476 O O   . GLN A 1 200 ? 56.062 -10.527 25.938  1.00 24.01 ? 207 GLN A O   1 
ATOM   1477 C CB  . GLN A 1 200 ? 52.797 -10.088 25.928  1.00 24.88 ? 207 GLN A CB  1 
ATOM   1478 C CG  . GLN A 1 200 ? 51.577 -10.173 26.822  1.00 30.14 ? 207 GLN A CG  1 
ATOM   1479 C CD  . GLN A 1 200 ? 51.865 -10.942 28.089  1.00 35.66 ? 207 GLN A CD  1 
ATOM   1480 O OE1 . GLN A 1 200 ? 52.054 -12.160 28.059  1.00 39.15 ? 207 GLN A OE1 1 
ATOM   1481 N NE2 . GLN A 1 200 ? 51.920 -10.234 29.214  1.00 36.27 ? 207 GLN A NE2 1 
ATOM   1482 N N   . GLU A 1 201 ? 55.331 -8.786  24.724  1.00 24.39 ? 208 GLU A N   1 
ATOM   1483 C CA  . GLU A 1 201 ? 56.456 -8.847  23.795  1.00 24.37 ? 208 GLU A CA  1 
ATOM   1484 C C   . GLU A 1 201 ? 57.791 -8.419  24.407  1.00 25.28 ? 208 GLU A C   1 
ATOM   1485 O O   . GLU A 1 201 ? 58.842 -8.913  23.999  1.00 25.28 ? 208 GLU A O   1 
ATOM   1486 C CB  . GLU A 1 201 ? 56.149 -8.022  22.542  1.00 23.06 ? 208 GLU A CB  1 
ATOM   1487 C CG  . GLU A 1 201 ? 55.114 -8.686  21.645  1.00 28.82 ? 208 GLU A CG  1 
ATOM   1488 C CD  . GLU A 1 201 ? 55.611 -9.979  21.027  1.00 28.34 ? 208 GLU A CD  1 
ATOM   1489 O OE1 . GLU A 1 201 ? 56.356 -9.921  20.023  1.00 32.00 ? 208 GLU A OE1 1 
ATOM   1490 O OE2 . GLU A 1 201 ? 55.266 -11.059 21.550  1.00 34.46 ? 208 GLU A OE2 1 
ATOM   1491 N N   . GLN A 1 202 ? 57.758 -7.503  25.374  1.00 25.14 ? 209 GLN A N   1 
ATOM   1492 C CA  . GLN A 1 202 ? 58.988 -7.071  26.030  1.00 26.32 ? 209 GLN A CA  1 
ATOM   1493 C C   . GLN A 1 202 ? 59.617 -8.273  26.725  1.00 29.65 ? 209 GLN A C   1 
ATOM   1494 O O   . GLN A 1 202 ? 60.811 -8.531  26.575  1.00 29.62 ? 209 GLN A O   1 
ATOM   1495 C CB  . GLN A 1 202 ? 58.709 -5.986  27.072  1.00 24.88 ? 209 GLN A CB  1 
ATOM   1496 C CG  . GLN A 1 202 ? 58.590 -4.581  26.508  1.00 29.10 ? 209 GLN A CG  1 
ATOM   1497 C CD  . GLN A 1 202 ? 58.257 -3.563  27.577  1.00 31.55 ? 209 GLN A CD  1 
ATOM   1498 O OE1 . GLN A 1 202 ? 58.313 -2.358  27.345  1.00 32.59 ? 209 GLN A OE1 1 
ATOM   1499 N NE2 . GLN A 1 202 ? 57.902 -4.046  28.759  1.00 31.33 ? 209 GLN A NE2 1 
ATOM   1500 N N   . LYS A 1 203 ? 58.807 -9.002  27.493  1.00 31.23 ? 210 LYS A N   1 
ATOM   1501 C CA  . LYS A 1 203 ? 59.287 -10.187 28.204  1.00 35.30 ? 210 LYS A CA  1 
ATOM   1502 C C   . LYS A 1 203 ? 59.932 -11.174 27.242  1.00 33.90 ? 210 LYS A C   1 
ATOM   1503 O O   . LYS A 1 203 ? 61.066 -11.604 27.431  1.00 35.96 ? 210 LYS A O   1 
ATOM   1504 C CB  . LYS A 1 203 ? 58.132 -10.890 28.916  1.00 40.42 ? 210 LYS A CB  1 
ATOM   1505 C CG  . LYS A 1 203 ? 57.603 -10.162 30.130  1.00 47.73 ? 210 LYS A CG  1 
ATOM   1506 C CD  . LYS A 1 203 ? 56.312 -10.809 30.631  1.00 54.01 ? 210 LYS A CD  1 
ATOM   1507 C CE  . LYS A 1 203 ? 56.528 -12.268 30.982  1.00 55.45 ? 210 LYS A CE  1 
ATOM   1508 N NZ  . LYS A 1 203 ? 57.487 -12.414 32.121  1.00 58.98 ? 210 LYS A NZ  1 
ATOM   1509 N N   . ARG A 1 204 ? 59.189 -11.533 26.210  1.00 34.51 ? 211 ARG A N   1 
ATOM   1510 C CA  . ARG A 1 204 ? 59.669 -12.474 25.209  1.00 36.99 ? 211 ARG A CA  1 
ATOM   1511 C C   . ARG A 1 204 ? 60.969 -12.030 24.547  1.00 34.99 ? 211 ARG A C   1 
ATOM   1512 O O   . ARG A 1 204 ? 61.915 -12.811 24.454  1.00 36.72 ? 211 ARG A O   1 
ATOM   1513 C CB  . ARG A 1 204 ? 58.593 -12.676 24.144  1.00 36.41 ? 211 ARG A CB  1 
ATOM   1514 C CG  . ARG A 1 204 ? 58.869 -13.817 23.194  1.00 39.74 ? 211 ARG A CG  1 
ATOM   1515 C CD  . ARG A 1 204 ? 57.662 -14.046 22.293  1.00 43.12 ? 211 ARG A CD  1 
ATOM   1516 N NE  . ARG A 1 204 ? 57.557 -13.035 21.242  1.00 43.27 ? 211 ARG A NE  1 
ATOM   1517 C CZ  . ARG A 1 204 ? 58.404 -12.932 20.221  1.00 43.11 ? 211 ARG A CZ  1 
ATOM   1518 N NH1 . ARG A 1 204 ? 59.424 -13.780 20.116  1.00 42.19 ? 211 ARG A NH1 1 
ATOM   1519 N NH2 . ARG A 1 204 ? 58.230 -11.989 19.302  1.00 41.62 ? 211 ARG A NH2 1 
ATOM   1520 N N   . ILE A 1 205 ? 61.021 -10.781 24.086  1.00 35.73 ? 212 ILE A N   1 
ATOM   1521 C CA  . ILE A 1 205 ? 62.221 -10.264 23.433  1.00 32.19 ? 212 ILE A CA  1 
ATOM   1522 C C   . ILE A 1 205 ? 63.415 -10.315 24.397  1.00 32.93 ? 212 ILE A C   1 
ATOM   1523 O O   . ILE A 1 205 ? 64.506 -10.759 24.019  1.00 28.39 ? 212 ILE A O   1 
ATOM   1524 C CB  . ILE A 1 205 ? 62.015 -8.800  22.937  1.00 33.03 ? 212 ILE A CB  1 
ATOM   1525 C CG1 . ILE A 1 205 ? 60.849 -8.735  21.944  1.00 32.06 ? 212 ILE A CG1 1 
ATOM   1526 C CG2 . ILE A 1 205 ? 63.290 -8.278  22.260  1.00 27.67 ? 212 ILE A CG2 1 
ATOM   1527 C CD1 . ILE A 1 205 ? 61.133 -9.369  20.576  1.00 35.13 ? 212 ILE A CD1 1 
ATOM   1528 N N   . LEU A 1 206 ? 63.215 -9.869  25.637  1.00 32.30 ? 213 LEU A N   1 
ATOM   1529 C CA  . LEU A 1 206 ? 64.299 -9.887  26.625  1.00 35.16 ? 213 LEU A CA  1 
ATOM   1530 C C   . LEU A 1 206 ? 64.729 -11.319 26.927  1.00 40.00 ? 213 LEU A C   1 
ATOM   1531 O O   . LEU A 1 206 ? 65.874 -11.565 27.319  1.00 38.41 ? 213 LEU A O   1 
ATOM   1532 C CB  . LEU A 1 206 ? 63.876 -9.189  27.929  1.00 28.76 ? 213 LEU A CB  1 
ATOM   1533 C CG  . LEU A 1 206 ? 63.936 -7.657  27.923  1.00 27.44 ? 213 LEU A CG  1 
ATOM   1534 C CD1 . LEU A 1 206 ? 63.390 -7.111  29.223  1.00 27.92 ? 213 LEU A CD1 1 
ATOM   1535 C CD2 . LEU A 1 206 ? 65.380 -7.199  27.725  1.00 28.70 ? 213 LEU A CD2 1 
ATOM   1536 N N   . GLU A 1 207 ? 63.809 -12.264 26.732  1.00 44.58 ? 214 GLU A N   1 
ATOM   1537 C CA  . GLU A 1 207 ? 64.084 -13.683 26.972  1.00 47.89 ? 214 GLU A CA  1 
ATOM   1538 C C   . GLU A 1 207 ? 64.988 -14.278 25.900  1.00 46.01 ? 214 GLU A C   1 
ATOM   1539 O O   . GLU A 1 207 ? 65.788 -15.174 26.179  1.00 47.59 ? 214 GLU A O   1 
ATOM   1540 C CB  . GLU A 1 207 ? 62.771 -14.468 27.041  1.00 52.61 ? 214 GLU A CB  1 
ATOM   1541 C CG  . GLU A 1 207 ? 62.263 -14.658 28.462  1.00 59.83 ? 214 GLU A CG  1 
ATOM   1542 C CD  . GLU A 1 207 ? 60.879 -15.284 28.529  1.00 66.47 ? 214 GLU A CD  1 
ATOM   1543 O OE1 . GLU A 1 207 ? 60.521 -16.078 27.608  1.00 68.15 ? 214 GLU A OE1 1 
ATOM   1544 O OE2 . GLU A 1 207 ? 60.156 -14.989 29.519  1.00 65.21 ? 214 GLU A OE2 1 
ATOM   1545 N N   . MET A 1 208 ? 64.853 -13.783 24.673  1.00 43.54 ? 215 MET A N   1 
ATOM   1546 C CA  . MET A 1 208 ? 65.674 -14.249 23.556  1.00 40.26 ? 215 MET A CA  1 
ATOM   1547 C C   . MET A 1 208 ? 67.084 -13.698 23.736  1.00 38.37 ? 215 MET A C   1 
ATOM   1548 O O   . MET A 1 208 ? 67.964 -13.918 22.905  1.00 38.17 ? 215 MET A O   1 
ATOM   1549 C CB  . MET A 1 208 ? 65.095 -13.741 22.224  1.00 40.94 ? 215 MET A CB  1 
ATOM   1550 C CG  . MET A 1 208 ? 64.035 -14.635 21.626  1.00 38.31 ? 215 MET A CG  1 
ATOM   1551 S SD  . MET A 1 208 ? 62.877 -13.744 20.608  1.00 37.53 ? 215 MET A SD  1 
ATOM   1552 C CE  . MET A 1 208 ? 63.741 -13.648 19.018  1.00 33.65 ? 215 MET A CE  1 
ATOM   1553 N N   . GLY A 1 209 ? 67.285 -12.966 24.822  1.00 38.86 ? 216 GLY A N   1 
ATOM   1554 C CA  . GLY A 1 209 ? 68.587 -12.378 25.093  1.00 38.71 ? 216 GLY A CA  1 
ATOM   1555 C C   . GLY A 1 209 ? 68.846 -11.059 24.376  1.00 35.98 ? 216 GLY A C   1 
ATOM   1556 O O   . GLY A 1 209 ? 69.977 -10.562 24.374  1.00 34.65 ? 216 GLY A O   1 
ATOM   1557 N N   . ILE A 1 210 ? 67.810 -10.486 23.772  1.00 35.37 ? 217 ILE A N   1 
ATOM   1558 C CA  . ILE A 1 210 ? 67.955 -9.224  23.040  1.00 33.93 ? 217 ILE A CA  1 
ATOM   1559 C C   . ILE A 1 210 ? 67.857 -8.051  24.011  1.00 34.71 ? 217 ILE A C   1 
ATOM   1560 O O   . ILE A 1 210 ? 66.777 -7.761  24.539  1.00 36.35 ? 217 ILE A O   1 
ATOM   1561 C CB  . ILE A 1 210 ? 66.866 -9.112  21.947  1.00 33.09 ? 217 ILE A CB  1 
ATOM   1562 C CG1 . ILE A 1 210 ? 66.992 -10.305 20.996  1.00 35.45 ? 217 ILE A CG1 1 
ATOM   1563 C CG2 . ILE A 1 210 ? 67.010 -7.805  21.179  1.00 31.56 ? 217 ILE A CG2 1 
ATOM   1564 C CD1 . ILE A 1 210 ? 65.825 -10.480 20.038  1.00 32.65 ? 217 ILE A CD1 1 
ATOM   1565 N N   . THR A 1 211 ? 68.982 -7.375  24.245  1.00 29.10 ? 218 THR A N   1 
ATOM   1566 C CA  . THR A 1 211 ? 69.010 -6.260  25.189  1.00 31.62 ? 218 THR A CA  1 
ATOM   1567 C C   . THR A 1 211 ? 69.233 -4.879  24.583  1.00 28.94 ? 218 THR A C   1 
ATOM   1568 O O   . THR A 1 211 ? 68.915 -3.868  25.210  1.00 28.82 ? 218 THR A O   1 
ATOM   1569 C CB  . THR A 1 211 ? 70.106 -6.470  26.256  1.00 31.61 ? 218 THR A CB  1 
ATOM   1570 O OG1 . THR A 1 211 ? 71.315 -6.891  25.614  1.00 32.87 ? 218 THR A OG1 1 
ATOM   1571 C CG2 . THR A 1 211 ? 69.686 -7.509  27.277  1.00 31.72 ? 218 THR A CG2 1 
ATOM   1572 N N   . GLY A 1 212 ? 69.788 -4.837  23.378  1.00 28.72 ? 219 GLY A N   1 
ATOM   1573 C CA  . GLY A 1 212 ? 70.054 -3.568  22.723  1.00 26.61 ? 219 GLY A CA  1 
ATOM   1574 C C   . GLY A 1 212 ? 68.808 -2.798  22.322  1.00 27.57 ? 219 GLY A C   1 
ATOM   1575 O O   . GLY A 1 212 ? 67.696 -3.324  22.413  1.00 30.20 ? 219 GLY A O   1 
ATOM   1576 N N   . PRO A 1 213 ? 68.962 -1.549  21.852  1.00 26.19 ? 220 PRO A N   1 
ATOM   1577 C CA  . PRO A 1 213 ? 67.830 -0.707  21.436  1.00 26.53 ? 220 PRO A CA  1 
ATOM   1578 C C   . PRO A 1 213 ? 66.918 -1.344  20.384  1.00 26.45 ? 220 PRO A C   1 
ATOM   1579 O O   . PRO A 1 213 ? 65.706 -1.110  20.392  1.00 24.31 ? 220 PRO A O   1 
ATOM   1580 C CB  . PRO A 1 213 ? 68.510 0.558   20.912  1.00 26.07 ? 220 PRO A CB  1 
ATOM   1581 C CG  . PRO A 1 213 ? 69.778 0.623   21.712  1.00 30.34 ? 220 PRO A CG  1 
ATOM   1582 C CD  . PRO A 1 213 ? 70.234 -0.826  21.689  1.00 26.27 ? 220 PRO A CD  1 
ATOM   1583 N N   . GLU A 1 214 ? 67.483 -2.142  19.479  1.00 24.11 ? 221 GLU A N   1 
ATOM   1584 C CA  . GLU A 1 214 ? 66.654 -2.772  18.457  1.00 20.72 ? 221 GLU A CA  1 
ATOM   1585 C C   . GLU A 1 214 ? 65.499 -3.496  19.146  1.00 22.57 ? 221 GLU A C   1 
ATOM   1586 O O   . GLU A 1 214 ? 64.429 -3.688  18.559  1.00 26.88 ? 221 GLU A O   1 
ATOM   1587 C CB  . GLU A 1 214 ? 67.470 -3.753  17.596  1.00 21.70 ? 221 GLU A CB  1 
ATOM   1588 C CG  . GLU A 1 214 ? 67.947 -5.008  18.314  1.00 26.68 ? 221 GLU A CG  1 
ATOM   1589 C CD  . GLU A 1 214 ? 69.242 -4.809  19.098  1.00 30.39 ? 221 GLU A CD  1 
ATOM   1590 O OE1 . GLU A 1 214 ? 69.458 -3.708  19.652  1.00 28.10 ? 221 GLU A OE1 1 
ATOM   1591 O OE2 . GLU A 1 214 ? 70.040 -5.768  19.171  1.00 29.86 ? 221 GLU A OE2 1 
ATOM   1592 N N   . GLY A 1 215 ? 65.713 -3.876  20.404  1.00 23.28 ? 222 GLY A N   1 
ATOM   1593 C CA  . GLY A 1 215 ? 64.685 -4.568  21.160  1.00 20.89 ? 222 GLY A CA  1 
ATOM   1594 C C   . GLY A 1 215 ? 63.456 -3.703  21.383  1.00 23.12 ? 222 GLY A C   1 
ATOM   1595 O O   . GLY A 1 215 ? 62.339 -4.210  21.557  1.00 21.09 ? 222 GLY A O   1 
ATOM   1596 N N   . HIS A 1 216 ? 63.665 -2.392  21.380  1.00 22.88 ? 223 HIS A N   1 
ATOM   1597 C CA  . HIS A 1 216 ? 62.585 -1.434  21.576  1.00 22.77 ? 223 HIS A CA  1 
ATOM   1598 C C   . HIS A 1 216 ? 61.640 -1.492  20.383  1.00 22.65 ? 223 HIS A C   1 
ATOM   1599 O O   . HIS A 1 216 ? 60.422 -1.596  20.536  1.00 21.53 ? 223 HIS A O   1 
ATOM   1600 C CB  . HIS A 1 216 ? 63.151 -0.019  21.701  1.00 20.69 ? 223 HIS A CB  1 
ATOM   1601 C CG  . HIS A 1 216 ? 62.124 1.011   22.050  1.00 21.49 ? 223 HIS A CG  1 
ATOM   1602 N ND1 . HIS A 1 216 ? 61.443 1.002   23.249  1.00 18.00 ? 223 HIS A ND1 1 
ATOM   1603 C CD2 . HIS A 1 216 ? 61.671 2.087   21.366  1.00 19.52 ? 223 HIS A CD2 1 
ATOM   1604 C CE1 . HIS A 1 216 ? 60.617 2.034   23.288  1.00 21.09 ? 223 HIS A CE1 1 
ATOM   1605 N NE2 . HIS A 1 216 ? 60.735 2.709   22.161  1.00 20.54 ? 223 HIS A NE2 1 
ATOM   1606 N N   . ALA A 1 217 ? 62.219 -1.416  19.192  1.00 22.07 ? 224 ALA A N   1 
ATOM   1607 C CA  . ALA A 1 217 ? 61.454 -1.473  17.966  1.00 22.10 ? 224 ALA A CA  1 
ATOM   1608 C C   . ALA A 1 217 ? 60.751 -2.829  17.839  1.00 22.82 ? 224 ALA A C   1 
ATOM   1609 O O   . ALA A 1 217 ? 59.588 -2.899  17.439  1.00 21.23 ? 224 ALA A O   1 
ATOM   1610 C CB  . ALA A 1 217 ? 62.378 -1.258  16.785  1.00 23.42 ? 224 ALA A CB  1 
ATOM   1611 N N   . LEU A 1 218 ? 61.455 -3.901  18.197  1.00 23.41 ? 225 LEU A N   1 
ATOM   1612 C CA  . LEU A 1 218 ? 60.905 -5.254  18.080  1.00 20.74 ? 225 LEU A CA  1 
ATOM   1613 C C   . LEU A 1 218 ? 59.763 -5.571  19.047  1.00 19.05 ? 225 LEU A C   1 
ATOM   1614 O O   . LEU A 1 218 ? 58.909 -6.405  18.745  1.00 18.41 ? 225 LEU A O   1 
ATOM   1615 C CB  . LEU A 1 218 ? 62.022 -6.282  18.247  1.00 21.44 ? 225 LEU A CB  1 
ATOM   1616 C CG  . LEU A 1 218 ? 63.166 -6.220  17.233  1.00 20.14 ? 225 LEU A CG  1 
ATOM   1617 C CD1 . LEU A 1 218 ? 64.349 -6.978  17.792  1.00 19.24 ? 225 LEU A CD1 1 
ATOM   1618 C CD2 . LEU A 1 218 ? 62.729 -6.795  15.887  1.00 25.34 ? 225 LEU A CD2 1 
ATOM   1619 N N   . SER A 1 219 ? 59.737 -4.908  20.199  1.00 15.98 ? 226 SER A N   1 
ATOM   1620 C CA  . SER A 1 219 ? 58.680 -5.158  21.171  1.00 18.50 ? 226 SER A CA  1 
ATOM   1621 C C   . SER A 1 219 ? 57.448 -4.284  20.934  1.00 17.93 ? 226 SER A C   1 
ATOM   1622 O O   . SER A 1 219 ? 56.404 -4.495  21.541  1.00 13.14 ? 226 SER A O   1 
ATOM   1623 C CB  . SER A 1 219 ? 59.208 -4.955  22.598  1.00 18.28 ? 226 SER A CB  1 
ATOM   1624 O OG  . SER A 1 219 ? 59.713 -3.649  22.783  1.00 20.65 ? 226 SER A OG  1 
ATOM   1625 N N   . ARG A 1 220 ? 57.565 -3.313  20.034  1.00 20.51 ? 227 ARG A N   1 
ATOM   1626 C CA  . ARG A 1 220 ? 56.440 -2.428  19.741  1.00 21.94 ? 227 ARG A CA  1 
ATOM   1627 C C   . ARG A 1 220 ? 56.149 -2.320  18.248  1.00 23.24 ? 227 ARG A C   1 
ATOM   1628 O O   . ARG A 1 220 ? 56.062 -1.202  17.727  1.00 22.80 ? 227 ARG A O   1 
ATOM   1629 C CB  . ARG A 1 220 ? 56.723 -1.017  20.260  1.00 20.30 ? 227 ARG A CB  1 
ATOM   1630 C CG  . ARG A 1 220 ? 56.959 -0.914  21.737  1.00 22.35 ? 227 ARG A CG  1 
ATOM   1631 C CD  . ARG A 1 220 ? 57.495 0.454   22.091  1.00 17.75 ? 227 ARG A CD  1 
ATOM   1632 N NE  . ARG A 1 220 ? 57.777 0.493   23.515  1.00 30.37 ? 227 ARG A NE  1 
ATOM   1633 C CZ  . ARG A 1 220 ? 56.945 0.956   24.438  1.00 22.85 ? 227 ARG A CZ  1 
ATOM   1634 N NH1 . ARG A 1 220 ? 55.763 1.454   24.104  1.00 19.57 ? 227 ARG A NH1 1 
ATOM   1635 N NH2 . ARG A 1 220 ? 57.292 0.872   25.705  1.00 33.14 ? 227 ARG A NH2 1 
ATOM   1636 N N   . PRO A 1 221 ? 56.006 -3.463  17.540  1.00 21.87 ? 228 PRO A N   1 
ATOM   1637 C CA  . PRO A 1 221 ? 55.722 -3.468  16.093  1.00 21.42 ? 228 PRO A CA  1 
ATOM   1638 C C   . PRO A 1 221 ? 54.515 -2.587  15.758  1.00 23.39 ? 228 PRO A C   1 
ATOM   1639 O O   . PRO A 1 221 ? 53.577 -2.483  16.555  1.00 22.57 ? 228 PRO A O   1 
ATOM   1640 C CB  . PRO A 1 221 ? 55.468 -4.944  15.790  1.00 22.65 ? 228 PRO A CB  1 
ATOM   1641 C CG  . PRO A 1 221 ? 54.914 -5.471  17.078  1.00 21.61 ? 228 PRO A CG  1 
ATOM   1642 C CD  . PRO A 1 221 ? 55.825 -4.813  18.107  1.00 21.39 ? 228 PRO A CD  1 
ATOM   1643 N N   . GLU A 1 222 ? 54.530 -1.967  14.578  1.00 22.11 ? 229 GLU A N   1 
ATOM   1644 C CA  . GLU A 1 222 ? 53.448 -1.050  14.200  1.00 22.05 ? 229 GLU A CA  1 
ATOM   1645 C C   . GLU A 1 222 ? 52.036 -1.611  14.233  1.00 20.62 ? 229 GLU A C   1 
ATOM   1646 O O   . GLU A 1 222 ? 51.079 -0.850  14.358  1.00 22.33 ? 229 GLU A O   1 
ATOM   1647 C CB  . GLU A 1 222 ? 53.712 -0.421  12.828  1.00 20.89 ? 229 GLU A CB  1 
ATOM   1648 C CG  . GLU A 1 222 ? 53.707 -1.382  11.658  1.00 22.17 ? 229 GLU A CG  1 
ATOM   1649 C CD  . GLU A 1 222 ? 53.882 -0.658  10.333  1.00 23.11 ? 229 GLU A CD  1 
ATOM   1650 O OE1 . GLU A 1 222 ? 52.875 -0.143  9.799   1.00 19.48 ? 229 GLU A OE1 1 
ATOM   1651 O OE2 . GLU A 1 222 ? 55.030 -0.591  9.838   1.00 21.17 ? 229 GLU A OE2 1 
ATOM   1652 N N   . GLU A 1 223 ? 51.888 -2.928  14.120  1.00 20.77 ? 230 GLU A N   1 
ATOM   1653 C CA  . GLU A 1 223 ? 50.553 -3.512  14.165  1.00 23.61 ? 230 GLU A CA  1 
ATOM   1654 C C   . GLU A 1 223 ? 49.881 -3.189  15.504  1.00 22.74 ? 230 GLU A C   1 
ATOM   1655 O O   . GLU A 1 223 ? 48.663 -3.080  15.580  1.00 21.60 ? 230 GLU A O   1 
ATOM   1656 C CB  . GLU A 1 223 ? 50.611 -5.035  13.983  1.00 29.64 ? 230 GLU A CB  1 
ATOM   1657 C CG  . GLU A 1 223 ? 51.009 -5.516  12.584  1.00 34.68 ? 230 GLU A CG  1 
ATOM   1658 C CD  . GLU A 1 223 ? 52.467 -5.232  12.251  1.00 38.32 ? 230 GLU A CD  1 
ATOM   1659 O OE1 . GLU A 1 223 ? 53.307 -5.246  13.189  1.00 32.60 ? 230 GLU A OE1 1 
ATOM   1660 O OE2 . GLU A 1 223 ? 52.769 -5.010  11.048  1.00 39.77 ? 230 GLU A OE2 1 
ATOM   1661 N N   . LEU A 1 224 ? 50.686 -3.028  16.553  1.00 23.65 ? 231 LEU A N   1 
ATOM   1662 C CA  . LEU A 1 224 ? 50.173 -2.729  17.892  1.00 22.63 ? 231 LEU A CA  1 
ATOM   1663 C C   . LEU A 1 224 ? 49.800 -1.253  18.073  1.00 23.85 ? 231 LEU A C   1 
ATOM   1664 O O   . LEU A 1 224 ? 49.057 -0.903  18.995  1.00 24.10 ? 231 LEU A O   1 
ATOM   1665 C CB  . LEU A 1 224 ? 51.199 -3.142  18.955  1.00 22.05 ? 231 LEU A CB  1 
ATOM   1666 C CG  . LEU A 1 224 ? 51.593 -4.626  19.009  1.00 26.98 ? 231 LEU A CG  1 
ATOM   1667 C CD1 . LEU A 1 224 ? 52.553 -4.853  20.175  1.00 21.32 ? 231 LEU A CD1 1 
ATOM   1668 C CD2 . LEU A 1 224 ? 50.347 -5.504  19.158  1.00 20.52 ? 231 LEU A CD2 1 
ATOM   1669 N N   . GLU A 1 225 ? 50.339 -0.394  17.207  1.00 22.18 ? 232 GLU A N   1 
ATOM   1670 C CA  . GLU A 1 225 ? 50.033 1.039   17.226  1.00 18.00 ? 232 GLU A CA  1 
ATOM   1671 C C   . GLU A 1 225 ? 48.713 1.180   16.464  1.00 16.91 ? 232 GLU A C   1 
ATOM   1672 O O   . GLU A 1 225 ? 47.759 1.770   16.951  1.00 17.95 ? 232 GLU A O   1 
ATOM   1673 C CB  . GLU A 1 225 ? 51.136 1.847   16.510  1.00 17.57 ? 232 GLU A CB  1 
ATOM   1674 C CG  . GLU A 1 225 ? 50.795 3.331   16.298  1.00 18.70 ? 232 GLU A CG  1 
ATOM   1675 C CD  . GLU A 1 225 ? 51.769 4.059   15.367  1.00 20.31 ? 232 GLU A CD  1 
ATOM   1676 O OE1 . GLU A 1 225 ? 52.569 3.388   14.675  1.00 22.31 ? 232 GLU A OE1 1 
ATOM   1677 O OE2 . GLU A 1 225 ? 51.725 5.310   15.313  1.00 18.12 ? 232 GLU A OE2 1 
ATOM   1678 N N   . ALA A 1 226 ? 48.673 0.610   15.263  1.00 16.09 ? 233 ALA A N   1 
ATOM   1679 C CA  . ALA A 1 226 ? 47.482 0.652   14.424  1.00 19.26 ? 233 ALA A CA  1 
ATOM   1680 C C   . ALA A 1 226 ? 46.243 0.147   15.181  1.00 20.60 ? 233 ALA A C   1 
ATOM   1681 O O   . ALA A 1 226 ? 45.173 0.763   15.130  1.00 20.05 ? 233 ALA A O   1 
ATOM   1682 C CB  . ALA A 1 226 ? 47.714 -0.190  13.167  1.00 21.13 ? 233 ALA A CB  1 
ATOM   1683 N N   . GLU A 1 227 ? 46.395 -0.971  15.888  1.00 22.33 ? 234 GLU A N   1 
ATOM   1684 C CA  . GLU A 1 227 ? 45.298 -1.556  16.663  1.00 19.41 ? 234 GLU A CA  1 
ATOM   1685 C C   . GLU A 1 227 ? 44.769 -0.591  17.736  1.00 17.27 ? 234 GLU A C   1 
ATOM   1686 O O   . GLU A 1 227 ? 43.557 -0.423  17.886  1.00 16.46 ? 234 GLU A O   1 
ATOM   1687 C CB  . GLU A 1 227 ? 45.771 -2.873  17.296  1.00 23.36 ? 234 GLU A CB  1 
ATOM   1688 C CG  . GLU A 1 227 ? 44.685 -3.706  17.988  1.00 24.43 ? 234 GLU A CG  1 
ATOM   1689 C CD  . GLU A 1 227 ? 44.241 -3.128  19.316  1.00 22.78 ? 234 GLU A CD  1 
ATOM   1690 O OE1 . GLU A 1 227 ? 45.110 -2.804  20.168  1.00 27.04 ? 234 GLU A OE1 1 
ATOM   1691 O OE2 . GLU A 1 227 ? 43.017 -3.002  19.512  1.00 25.42 ? 234 GLU A OE2 1 
ATOM   1692 N N   . ALA A 1 228 ? 45.666 0.049   18.479  1.00 17.52 ? 235 ALA A N   1 
ATOM   1693 C CA  . ALA A 1 228 ? 45.243 1.003   19.504  1.00 15.18 ? 235 ALA A CA  1 
ATOM   1694 C C   . ALA A 1 228 ? 44.518 2.189   18.858  1.00 17.50 ? 235 ALA A C   1 
ATOM   1695 O O   . ALA A 1 228 ? 43.505 2.660   19.371  1.00 18.46 ? 235 ALA A O   1 
ATOM   1696 C CB  . ALA A 1 228 ? 46.448 1.496   20.301  1.00 12.54 ? 235 ALA A CB  1 
ATOM   1697 N N   . VAL A 1 229 ? 45.039 2.667   17.730  1.00 17.96 ? 236 VAL A N   1 
ATOM   1698 C CA  . VAL A 1 229 ? 44.426 3.787   17.020  1.00 15.72 ? 236 VAL A CA  1 
ATOM   1699 C C   . VAL A 1 229 ? 42.993 3.453   16.612  1.00 15.81 ? 236 VAL A C   1 
ATOM   1700 O O   . VAL A 1 229 ? 42.080 4.257   16.793  1.00 16.33 ? 236 VAL A O   1 
ATOM   1701 C CB  . VAL A 1 229 ? 45.227 4.141   15.754  1.00 16.03 ? 236 VAL A CB  1 
ATOM   1702 C CG1 . VAL A 1 229 ? 44.520 5.245   14.978  1.00 12.78 ? 236 VAL A CG1 1 
ATOM   1703 C CG2 . VAL A 1 229 ? 46.639 4.577   16.142  1.00 16.79 ? 236 VAL A CG2 1 
ATOM   1704 N N   . PHE A 1 230 ? 42.807 2.259   16.061  1.00 18.37 ? 237 PHE A N   1 
ATOM   1705 C CA  . PHE A 1 230 ? 41.494 1.804   15.626  1.00 18.95 ? 237 PHE A CA  1 
ATOM   1706 C C   . PHE A 1 230 ? 40.525 1.755   16.805  1.00 20.26 ? 237 PHE A C   1 
ATOM   1707 O O   . PHE A 1 230 ? 39.397 2.234   16.705  1.00 18.12 ? 237 PHE A O   1 
ATOM   1708 C CB  . PHE A 1 230 ? 41.596 0.411   15.002  1.00 19.07 ? 237 PHE A CB  1 
ATOM   1709 C CG  . PHE A 1 230 ? 40.403 0.029   14.163  1.00 24.89 ? 237 PHE A CG  1 
ATOM   1710 C CD1 . PHE A 1 230 ? 40.061 -1.307  13.989  1.00 29.03 ? 237 PHE A CD1 1 
ATOM   1711 C CD2 . PHE A 1 230 ? 39.636 1.001   13.529  1.00 31.31 ? 237 PHE A CD2 1 
ATOM   1712 C CE1 . PHE A 1 230 ? 38.976 -1.682  13.192  1.00 30.84 ? 237 PHE A CE1 1 
ATOM   1713 C CE2 . PHE A 1 230 ? 38.544 0.637   12.723  1.00 34.91 ? 237 PHE A CE2 1 
ATOM   1714 C CZ  . PHE A 1 230 ? 38.217 -0.714  12.561  1.00 32.67 ? 237 PHE A CZ  1 
ATOM   1715 N N   . ARG A 1 231 ? 40.976 1.178   17.919  1.00 17.44 ? 238 ARG A N   1 
ATOM   1716 C CA  . ARG A 1 231 ? 40.144 1.050   19.116  1.00 18.56 ? 238 ARG A CA  1 
ATOM   1717 C C   . ARG A 1 231 ? 39.737 2.429   19.653  1.00 20.13 ? 238 ARG A C   1 
ATOM   1718 O O   . ARG A 1 231 ? 38.589 2.632   20.039  1.00 14.95 ? 238 ARG A O   1 
ATOM   1719 C CB  . ARG A 1 231 ? 40.892 0.227   20.180  1.00 18.19 ? 238 ARG A CB  1 
ATOM   1720 C CG  . ARG A 1 231 ? 40.132 -0.040  21.492  1.00 18.56 ? 238 ARG A CG  1 
ATOM   1721 C CD  . ARG A 1 231 ? 40.580 -1.365  22.124  1.00 19.76 ? 238 ARG A CD  1 
ATOM   1722 N NE  . ARG A 1 231 ? 42.007 -1.593  21.902  1.00 22.46 ? 238 ARG A NE  1 
ATOM   1723 C CZ  . ARG A 1 231 ? 42.952 -1.417  22.818  1.00 25.59 ? 238 ARG A CZ  1 
ATOM   1724 N NH1 . ARG A 1 231 ? 42.636 -1.026  24.045  1.00 27.45 ? 238 ARG A NH1 1 
ATOM   1725 N NH2 . ARG A 1 231 ? 44.225 -1.583  22.490  1.00 32.38 ? 238 ARG A NH2 1 
ATOM   1726 N N   . ALA A 1 232 ? 40.674 3.378   19.656  1.00 22.25 ? 239 ALA A N   1 
ATOM   1727 C CA  . ALA A 1 232 ? 40.388 4.739   20.126  1.00 19.71 ? 239 ALA A CA  1 
ATOM   1728 C C   . ALA A 1 232 ? 39.363 5.406   19.205  1.00 17.70 ? 239 ALA A C   1 
ATOM   1729 O O   . ALA A 1 232 ? 38.492 6.149   19.662  1.00 19.68 ? 239 ALA A O   1 
ATOM   1730 C CB  . ALA A 1 232 ? 41.672 5.563   20.167  1.00 20.68 ? 239 ALA A CB  1 
ATOM   1731 N N   . ILE A 1 233 ? 39.462 5.133   17.906  1.00 17.13 ? 240 ILE A N   1 
ATOM   1732 C CA  . ILE A 1 233 ? 38.529 5.705   16.936  1.00 17.11 ? 240 ILE A CA  1 
ATOM   1733 C C   . ILE A 1 233 ? 37.149 5.068   17.092  1.00 17.46 ? 240 ILE A C   1 
ATOM   1734 O O   . ILE A 1 233 ? 36.129 5.724   16.889  1.00 19.47 ? 240 ILE A O   1 
ATOM   1735 C CB  . ILE A 1 233 ? 39.022 5.506   15.472  1.00 16.95 ? 240 ILE A CB  1 
ATOM   1736 C CG1 . ILE A 1 233 ? 40.262 6.374   15.219  1.00 16.12 ? 240 ILE A CG1 1 
ATOM   1737 C CG2 . ILE A 1 233 ? 37.916 5.902   14.480  1.00 20.10 ? 240 ILE A CG2 1 
ATOM   1738 C CD1 . ILE A 1 233 ? 40.894 6.189   13.851  1.00 13.55 ? 240 ILE A CD1 1 
ATOM   1739 N N   . ALA A 1 234 ? 37.115 3.793   17.462  1.00 17.13 ? 241 ALA A N   1 
ATOM   1740 C CA  . ALA A 1 234 ? 35.845 3.107   17.647  1.00 17.94 ? 241 ALA A CA  1 
ATOM   1741 C C   . ALA A 1 234 ? 35.116 3.740   18.822  1.00 19.22 ? 241 ALA A C   1 
ATOM   1742 O O   . ALA A 1 234 ? 33.911 3.990   18.758  1.00 19.23 ? 241 ALA A O   1 
ATOM   1743 C CB  . ALA A 1 234 ? 36.077 1.622   17.909  1.00 19.57 ? 241 ALA A CB  1 
ATOM   1744 N N   . ILE A 1 235 ? 35.857 4.006   19.896  1.00 18.04 ? 242 ILE A N   1 
ATOM   1745 C CA  . ILE A 1 235 ? 35.272 4.616   21.081  1.00 19.81 ? 242 ILE A CA  1 
ATOM   1746 C C   . ILE A 1 235 ? 34.739 6.005   20.748  1.00 19.19 ? 242 ILE A C   1 
ATOM   1747 O O   . ILE A 1 235 ? 33.583 6.320   21.026  1.00 24.83 ? 242 ILE A O   1 
ATOM   1748 C CB  . ILE A 1 235 ? 36.299 4.732   22.218  1.00 20.81 ? 242 ILE A CB  1 
ATOM   1749 C CG1 . ILE A 1 235 ? 36.775 3.335   22.631  1.00 20.70 ? 242 ILE A CG1 1 
ATOM   1750 C CG2 . ILE A 1 235 ? 35.669 5.444   23.415  1.00 18.85 ? 242 ILE A CG2 1 
ATOM   1751 C CD1 . ILE A 1 235 ? 37.759 3.347   23.803  1.00 23.99 ? 242 ILE A CD1 1 
ATOM   1752 N N   . ALA A 1 236 ? 35.588 6.829   20.148  1.00 18.32 ? 243 ALA A N   1 
ATOM   1753 C CA  . ALA A 1 236 ? 35.199 8.181   19.773  1.00 18.39 ? 243 ALA A CA  1 
ATOM   1754 C C   . ALA A 1 236 ? 33.922 8.150   18.927  1.00 23.27 ? 243 ALA A C   1 
ATOM   1755 O O   . ALA A 1 236 ? 33.025 8.976   19.117  1.00 21.39 ? 243 ALA A O   1 
ATOM   1756 C CB  . ALA A 1 236 ? 36.331 8.848   18.991  1.00 15.96 ? 243 ALA A CB  1 
ATOM   1757 N N   . GLY A 1 237 ? 33.850 7.188   18.003  1.00 22.68 ? 244 GLY A N   1 
ATOM   1758 C CA  . GLY A 1 237 ? 32.695 7.062   17.127  1.00 23.21 ? 244 GLY A CA  1 
ATOM   1759 C C   . GLY A 1 237 ? 31.391 6.733   17.835  1.00 25.60 ? 244 GLY A C   1 
ATOM   1760 O O   . GLY A 1 237 ? 30.329 7.204   17.430  1.00 26.62 ? 244 GLY A O   1 
ATOM   1761 N N   . ARG A 1 238 ? 31.462 5.928   18.890  1.00 23.95 ? 245 ARG A N   1 
ATOM   1762 C CA  . ARG A 1 238 ? 30.264 5.560   19.644  1.00 27.93 ? 245 ARG A CA  1 
ATOM   1763 C C   . ARG A 1 238 ? 29.804 6.723   20.504  1.00 27.01 ? 245 ARG A C   1 
ATOM   1764 O O   . ARG A 1 238 ? 28.607 6.934   20.713  1.00 28.48 ? 245 ARG A O   1 
ATOM   1765 C CB  . ARG A 1 238 ? 30.562 4.376   20.554  1.00 25.95 ? 245 ARG A CB  1 
ATOM   1766 C CG  . ARG A 1 238 ? 30.982 3.128   19.812  1.00 35.60 ? 245 ARG A CG  1 
ATOM   1767 C CD  . ARG A 1 238 ? 29.785 2.398   19.270  1.00 38.17 ? 245 ARG A CD  1 
ATOM   1768 N NE  . ARG A 1 238 ? 29.103 3.089   18.180  1.00 43.73 ? 245 ARG A NE  1 
ATOM   1769 C CZ  . ARG A 1 238 ? 27.779 3.241   18.112  1.00 39.07 ? 245 ARG A CZ  1 
ATOM   1770 N NH1 . ARG A 1 238 ? 26.994 2.767   19.077  1.00 45.35 ? 245 ARG A NH1 1 
ATOM   1771 N NH2 . ARG A 1 238 ? 27.233 3.820   17.059  1.00 41.70 ? 245 ARG A NH2 1 
ATOM   1772 N N   . ILE A 1 239 ? 30.778 7.471   21.000  1.00 26.21 ? 246 ILE A N   1 
ATOM   1773 C CA  . ILE A 1 239 ? 30.532 8.604   21.882  1.00 25.01 ? 246 ILE A CA  1 
ATOM   1774 C C   . ILE A 1 239 ? 30.234 9.906   21.143  1.00 24.39 ? 246 ILE A C   1 
ATOM   1775 O O   . ILE A 1 239 ? 29.674 10.834  21.721  1.00 22.55 ? 246 ILE A O   1 
ATOM   1776 C CB  . ILE A 1 239 ? 31.754 8.801   22.794  1.00 27.67 ? 246 ILE A CB  1 
ATOM   1777 C CG1 . ILE A 1 239 ? 31.892 7.586   23.714  1.00 27.30 ? 246 ILE A CG1 1 
ATOM   1778 C CG2 . ILE A 1 239 ? 31.636 10.086  23.590  1.00 29.34 ? 246 ILE A CG2 1 
ATOM   1779 C CD1 . ILE A 1 239 ? 33.207 7.545   24.479  1.00 35.03 ? 246 ILE A CD1 1 
ATOM   1780 N N   . ASN A 1 240 ? 30.582 9.948   19.860  1.00 24.03 ? 247 ASN A N   1 
ATOM   1781 C CA  . ASN A 1 240 ? 30.423 11.145  19.030  1.00 24.59 ? 247 ASN A CA  1 
ATOM   1782 C C   . ASN A 1 240 ? 31.205 12.299  19.641  1.00 22.60 ? 247 ASN A C   1 
ATOM   1783 O O   . ASN A 1 240 ? 30.629 13.289  20.099  1.00 20.11 ? 247 ASN A O   1 
ATOM   1784 C CB  . ASN A 1 240 ? 28.957 11.567  18.865  1.00 23.70 ? 247 ASN A CB  1 
ATOM   1785 C CG  . ASN A 1 240 ? 28.819 12.933  18.180  1.00 27.95 ? 247 ASN A CG  1 
ATOM   1786 O OD1 . ASN A 1 240 ? 29.449 13.196  17.145  1.00 24.68 ? 247 ASN A OD1 1 
ATOM   1787 N ND2 . ASN A 1 240 ? 27.998 13.807  18.758  1.00 26.60 ? 247 ASN A ND2 1 
ATOM   1788 N N   . CYS A 1 241 ? 32.523 12.143  19.668  1.00 19.30 ? 248 CYS A N   1 
ATOM   1789 C CA  . CYS A 1 241 ? 33.418 13.172  20.188  1.00 18.23 ? 248 CYS A CA  1 
ATOM   1790 C C   . CYS A 1 241 ? 34.644 13.148  19.294  1.00 20.94 ? 248 CYS A C   1 
ATOM   1791 O O   . CYS A 1 241 ? 34.944 12.130  18.671  1.00 19.03 ? 248 CYS A O   1 
ATOM   1792 C CB  . CYS A 1 241 ? 33.847 12.866  21.627  1.00 18.52 ? 248 CYS A CB  1 
ATOM   1793 S SG  . CYS A 1 241 ? 35.023 11.507  21.787  1.00 20.57 ? 248 CYS A SG  1 
ATOM   1794 N N   . PRO A 1 242 ? 35.363 14.273  19.212  1.00 18.94 ? 249 PRO A N   1 
ATOM   1795 C CA  . PRO A 1 242 ? 36.560 14.336  18.378  1.00 17.57 ? 249 PRO A CA  1 
ATOM   1796 C C   . PRO A 1 242 ? 37.648 13.523  19.056  1.00 15.53 ? 249 PRO A C   1 
ATOM   1797 O O   . PRO A 1 242 ? 37.593 13.306  20.264  1.00 18.12 ? 249 PRO A O   1 
ATOM   1798 C CB  . PRO A 1 242 ? 36.897 15.824  18.373  1.00 14.93 ? 249 PRO A CB  1 
ATOM   1799 C CG  . PRO A 1 242 ? 35.583 16.481  18.657  1.00 17.77 ? 249 PRO A CG  1 
ATOM   1800 C CD  . PRO A 1 242 ? 35.023 15.606  19.727  1.00 13.80 ? 249 PRO A CD  1 
ATOM   1801 N N   . VAL A 1 243 ? 38.624 13.057  18.292  1.00 17.45 ? 250 VAL A N   1 
ATOM   1802 C CA  . VAL A 1 243 ? 39.714 12.306  18.886  1.00 17.35 ? 250 VAL A CA  1 
ATOM   1803 C C   . VAL A 1 243 ? 40.965 12.660  18.095  1.00 19.08 ? 250 VAL A C   1 
ATOM   1804 O O   . VAL A 1 243 ? 40.933 12.719  16.865  1.00 19.53 ? 250 VAL A O   1 
ATOM   1805 C CB  . VAL A 1 243 ? 39.430 10.776  18.883  1.00 14.83 ? 250 VAL A CB  1 
ATOM   1806 C CG1 . VAL A 1 243 ? 39.333 10.242  17.455  1.00 15.74 ? 250 VAL A CG1 1 
ATOM   1807 C CG2 . VAL A 1 243 ? 40.512 10.054  19.667  1.00 12.94 ? 250 VAL A CG2 1 
ATOM   1808 N N   . TYR A 1 244 ? 42.054 12.916  18.813  1.00 17.19 ? 251 TYR A N   1 
ATOM   1809 C CA  . TYR A 1 244 ? 43.329 13.329  18.223  1.00 14.14 ? 251 TYR A CA  1 
ATOM   1810 C C   . TYR A 1 244 ? 44.412 12.279  18.492  1.00 15.70 ? 251 TYR A C   1 
ATOM   1811 O O   . TYR A 1 244 ? 44.689 11.943  19.649  1.00 11.49 ? 251 TYR A O   1 
ATOM   1812 C CB  . TYR A 1 244 ? 43.692 14.697  18.830  1.00 16.07 ? 251 TYR A CB  1 
ATOM   1813 C CG  . TYR A 1 244 ? 44.963 15.385  18.369  1.00 16.42 ? 251 TYR A CG  1 
ATOM   1814 C CD1 . TYR A 1 244 ? 46.220 14.877  18.702  1.00 19.58 ? 251 TYR A CD1 1 
ATOM   1815 C CD2 . TYR A 1 244 ? 44.909 16.624  17.717  1.00 17.37 ? 251 TYR A CD2 1 
ATOM   1816 C CE1 . TYR A 1 244 ? 47.388 15.585  18.410  1.00 19.26 ? 251 TYR A CE1 1 
ATOM   1817 C CE2 . TYR A 1 244 ? 46.074 17.344  17.420  1.00 15.71 ? 251 TYR A CE2 1 
ATOM   1818 C CZ  . TYR A 1 244 ? 47.309 16.821  17.778  1.00 16.61 ? 251 TYR A CZ  1 
ATOM   1819 O OH  . TYR A 1 244 ? 48.463 17.542  17.559  1.00 14.36 ? 251 TYR A OH  1 
ATOM   1820 N N   . ILE A 1 245 ? 45.002 11.746  17.423  1.00 12.77 ? 252 ILE A N   1 
ATOM   1821 C CA  . ILE A 1 245 ? 46.046 10.726  17.548  1.00 14.83 ? 252 ILE A CA  1 
ATOM   1822 C C   . ILE A 1 245 ? 47.444 11.345  17.535  1.00 13.96 ? 252 ILE A C   1 
ATOM   1823 O O   . ILE A 1 245 ? 47.932 11.780  16.493  1.00 14.20 ? 252 ILE A O   1 
ATOM   1824 C CB  . ILE A 1 245 ? 45.987 9.685   16.396  1.00 13.56 ? 252 ILE A CB  1 
ATOM   1825 C CG1 . ILE A 1 245 ? 44.612 9.010   16.346  1.00 17.80 ? 252 ILE A CG1 1 
ATOM   1826 C CG2 . ILE A 1 245 ? 47.077 8.637   16.600  1.00 14.00 ? 252 ILE A CG2 1 
ATOM   1827 C CD1 . ILE A 1 245 ? 44.216 8.338   17.640  1.00 22.37 ? 252 ILE A CD1 1 
ATOM   1828 N N   . THR A 1 246 ? 48.100 11.356  18.688  1.00 16.11 ? 253 THR A N   1 
ATOM   1829 C CA  . THR A 1 246 ? 49.435 11.935  18.785  1.00 16.12 ? 253 THR A CA  1 
ATOM   1830 C C   . THR A 1 246 ? 50.510 11.000  18.233  1.00 15.05 ? 253 THR A C   1 
ATOM   1831 O O   . THR A 1 246 ? 50.321 9.789   18.159  1.00 14.96 ? 253 THR A O   1 
ATOM   1832 C CB  . THR A 1 246 ? 49.802 12.252  20.255  1.00 17.93 ? 253 THR A CB  1 
ATOM   1833 O OG1 . THR A 1 246 ? 49.929 11.027  20.987  1.00 17.56 ? 253 THR A OG1 1 
ATOM   1834 C CG2 . THR A 1 246 ? 48.737 13.107  20.903  1.00 15.95 ? 253 THR A CG2 1 
ATOM   1835 N N   . LYS A 1 247 ? 51.631 11.586  17.834  1.00 11.46 ? 254 LYS A N   1 
ATOM   1836 C CA  . LYS A 1 247 ? 52.783 10.838  17.336  1.00 19.08 ? 254 LYS A CA  1 
ATOM   1837 C C   . LYS A 1 247 ? 52.556 9.656   16.379  1.00 19.05 ? 254 LYS A C   1 
ATOM   1838 O O   . LYS A 1 247 ? 52.962 8.520   16.654  1.00 17.32 ? 254 LYS A O   1 
ATOM   1839 C CB  . LYS A 1 247 ? 53.616 10.377  18.537  1.00 17.81 ? 254 LYS A CB  1 
ATOM   1840 C CG  . LYS A 1 247 ? 54.159 11.546  19.340  1.00 18.22 ? 254 LYS A CG  1 
ATOM   1841 C CD  . LYS A 1 247 ? 55.192 11.114  20.360  1.00 21.04 ? 254 LYS A CD  1 
ATOM   1842 C CE  . LYS A 1 247 ? 54.544 10.620  21.630  1.00 24.81 ? 254 LYS A CE  1 
ATOM   1843 N NZ  . LYS A 1 247 ? 55.570 10.320  22.669  1.00 24.56 ? 254 LYS A NZ  1 
ATOM   1844 N N   . VAL A 1 248 ? 51.914 9.934   15.250  1.00 18.16 ? 255 VAL A N   1 
ATOM   1845 C CA  . VAL A 1 248 ? 51.671 8.914   14.246  1.00 16.36 ? 255 VAL A CA  1 
ATOM   1846 C C   . VAL A 1 248 ? 53.031 8.565   13.638  1.00 14.72 ? 255 VAL A C   1 
ATOM   1847 O O   . VAL A 1 248 ? 53.674 9.415   13.016  1.00 15.49 ? 255 VAL A O   1 
ATOM   1848 C CB  . VAL A 1 248 ? 50.730 9.446   13.149  1.00 14.34 ? 255 VAL A CB  1 
ATOM   1849 C CG1 . VAL A 1 248 ? 50.488 8.380   12.105  1.00 14.64 ? 255 VAL A CG1 1 
ATOM   1850 C CG2 . VAL A 1 248 ? 49.412 9.880   13.774  1.00 14.97 ? 255 VAL A CG2 1 
ATOM   1851 N N   . MET A 1 249 ? 53.471 7.325   13.820  1.00 14.98 ? 256 MET A N   1 
ATOM   1852 C CA  . MET A 1 249 ? 54.771 6.900   13.305  1.00 15.74 ? 256 MET A CA  1 
ATOM   1853 C C   . MET A 1 249 ? 54.773 5.836   12.210  1.00 17.45 ? 256 MET A C   1 
ATOM   1854 O O   . MET A 1 249 ? 55.823 5.561   11.617  1.00 14.21 ? 256 MET A O   1 
ATOM   1855 C CB  . MET A 1 249 ? 55.645 6.390   14.455  1.00 18.19 ? 256 MET A CB  1 
ATOM   1856 C CG  . MET A 1 249 ? 56.866 7.276   14.746  1.00 28.17 ? 256 MET A CG  1 
ATOM   1857 S SD  . MET A 1 249 ? 56.488 8.633   15.829  1.00 5.13  ? 256 MET A SD  1 
ATOM   1858 C CE  . MET A 1 249 ? 55.622 9.525   14.935  1.00 18.22 ? 256 MET A CE  1 
ATOM   1859 N N   . SER A 1 250 ? 53.620 5.231   11.938  1.00 16.77 ? 257 SER A N   1 
ATOM   1860 C CA  . SER A 1 250 ? 53.585 4.172   10.938  1.00 16.82 ? 257 SER A CA  1 
ATOM   1861 C C   . SER A 1 250 ? 52.541 4.283   9.842   1.00 16.98 ? 257 SER A C   1 
ATOM   1862 O O   . SER A 1 250 ? 51.497 4.922   10.007  1.00 16.73 ? 257 SER A O   1 
ATOM   1863 C CB  . SER A 1 250 ? 53.419 2.811   11.623  1.00 18.25 ? 257 SER A CB  1 
ATOM   1864 O OG  . SER A 1 250 ? 52.137 2.670   12.207  1.00 14.82 ? 257 SER A OG  1 
ATOM   1865 N N   . LYS A 1 251 ? 52.841 3.622   8.727   1.00 16.39 ? 258 LYS A N   1 
ATOM   1866 C CA  . LYS A 1 251 ? 51.960 3.584   7.571   1.00 21.52 ? 258 LYS A CA  1 
ATOM   1867 C C   . LYS A 1 251 ? 50.627 2.952   7.962   1.00 19.23 ? 258 LYS A C   1 
ATOM   1868 O O   . LYS A 1 251 ? 49.571 3.410   7.522   1.00 19.63 ? 258 LYS A O   1 
ATOM   1869 C CB  . LYS A 1 251 ? 52.621 2.780   6.441   1.00 21.27 ? 258 LYS A CB  1 
ATOM   1870 C CG  . LYS A 1 251 ? 53.929 3.398   5.942   1.00 25.33 ? 258 LYS A CG  1 
ATOM   1871 C CD  . LYS A 1 251 ? 54.729 2.437   5.066   1.00 25.11 ? 258 LYS A CD  1 
ATOM   1872 C CE  . LYS A 1 251 ? 54.073 2.173   3.732   1.00 27.49 ? 258 LYS A CE  1 
ATOM   1873 N NZ  . LYS A 1 251 ? 54.937 1.272   2.884   1.00 30.86 ? 258 LYS A NZ  1 
ATOM   1874 N N   . SER A 1 252 ? 50.677 1.913   8.794   1.00 19.59 ? 259 SER A N   1 
ATOM   1875 C CA  . SER A 1 252 ? 49.460 1.224   9.245   1.00 22.27 ? 259 SER A CA  1 
ATOM   1876 C C   . SER A 1 252 ? 48.524 2.137   10.045  1.00 19.85 ? 259 SER A C   1 
ATOM   1877 O O   . SER A 1 252 ? 47.329 2.221   9.761   1.00 20.04 ? 259 SER A O   1 
ATOM   1878 C CB  . SER A 1 252 ? 49.820 0.008   10.105  1.00 24.08 ? 259 SER A CB  1 
ATOM   1879 O OG  . SER A 1 252 ? 50.426 -1.004  9.325   1.00 31.48 ? 259 SER A OG  1 
ATOM   1880 N N   . ALA A 1 253 ? 49.063 2.804   11.058  1.00 16.03 ? 260 ALA A N   1 
ATOM   1881 C CA  . ALA A 1 253 ? 48.244 3.697   11.870  1.00 17.15 ? 260 ALA A CA  1 
ATOM   1882 C C   . ALA A 1 253 ? 47.653 4.796   10.997  1.00 16.91 ? 260 ALA A C   1 
ATOM   1883 O O   . ALA A 1 253 ? 46.476 5.117   11.111  1.00 16.69 ? 260 ALA A O   1 
ATOM   1884 C CB  . ALA A 1 253 ? 49.074 4.304   12.983  1.00 12.56 ? 260 ALA A CB  1 
ATOM   1885 N N   . ALA A 1 254 ? 48.479 5.352   10.116  1.00 17.32 ? 261 ALA A N   1 
ATOM   1886 C CA  . ALA A 1 254 ? 48.056 6.419   9.218   1.00 19.78 ? 261 ALA A CA  1 
ATOM   1887 C C   . ALA A 1 254 ? 46.895 5.983   8.322   1.00 19.77 ? 261 ALA A C   1 
ATOM   1888 O O   . ALA A 1 254 ? 45.954 6.754   8.103   1.00 19.18 ? 261 ALA A O   1 
ATOM   1889 C CB  . ALA A 1 254 ? 49.232 6.880   8.368   1.00 21.19 ? 261 ALA A CB  1 
ATOM   1890 N N   . ASP A 1 255 ? 46.960 4.761   7.796   1.00 18.31 ? 262 ASP A N   1 
ATOM   1891 C CA  . ASP A 1 255 ? 45.880 4.255   6.944   1.00 21.24 ? 262 ASP A CA  1 
ATOM   1892 C C   . ASP A 1 255 ? 44.593 4.067   7.753   1.00 18.44 ? 262 ASP A C   1 
ATOM   1893 O O   . ASP A 1 255 ? 43.501 4.283   7.232   1.00 18.05 ? 262 ASP A O   1 
ATOM   1894 C CB  . ASP A 1 255 ? 46.265 2.927   6.280   1.00 17.54 ? 262 ASP A CB  1 
ATOM   1895 C CG  . ASP A 1 255 ? 47.241 3.108   5.141   1.00 20.85 ? 262 ASP A CG  1 
ATOM   1896 O OD1 . ASP A 1 255 ? 47.224 4.182   4.499   1.00 20.38 ? 262 ASP A OD1 1 
ATOM   1897 O OD2 . ASP A 1 255 ? 48.014 2.166   4.874   1.00 23.31 ? 262 ASP A OD2 1 
ATOM   1898 N N   . ILE A 1 256 ? 44.719 3.657   9.015   1.00 17.27 ? 263 ILE A N   1 
ATOM   1899 C CA  . ILE A 1 256 ? 43.543 3.491   9.873   1.00 15.28 ? 263 ILE A CA  1 
ATOM   1900 C C   . ILE A 1 256 ? 42.835 4.847   9.967   1.00 19.96 ? 263 ILE A C   1 
ATOM   1901 O O   . ILE A 1 256 ? 41.612 4.941   9.842   1.00 17.59 ? 263 ILE A O   1 
ATOM   1902 C CB  . ILE A 1 256 ? 43.926 3.053   11.308  1.00 16.85 ? 263 ILE A CB  1 
ATOM   1903 C CG1 . ILE A 1 256 ? 44.610 1.679   11.282  1.00 18.55 ? 263 ILE A CG1 1 
ATOM   1904 C CG2 . ILE A 1 256 ? 42.681 3.021   12.195  1.00 11.04 ? 263 ILE A CG2 1 
ATOM   1905 C CD1 . ILE A 1 256 ? 43.739 0.568   10.757  1.00 17.16 ? 263 ILE A CD1 1 
ATOM   1906 N N   . ILE A 1 257 ? 43.612 5.902   10.190  1.00 16.86 ? 264 ILE A N   1 
ATOM   1907 C CA  . ILE A 1 257 ? 43.038 7.237   10.299  1.00 18.40 ? 264 ILE A CA  1 
ATOM   1908 C C   . ILE A 1 257 ? 42.391 7.649   8.973   1.00 18.31 ? 264 ILE A C   1 
ATOM   1909 O O   . ILE A 1 257 ? 41.259 8.125   8.952   1.00 15.80 ? 264 ILE A O   1 
ATOM   1910 C CB  . ILE A 1 257 ? 44.121 8.280   10.697  1.00 20.74 ? 264 ILE A CB  1 
ATOM   1911 C CG1 . ILE A 1 257 ? 44.673 7.959   12.098  1.00 17.37 ? 264 ILE A CG1 1 
ATOM   1912 C CG2 . ILE A 1 257 ? 43.527 9.688   10.654  1.00 15.16 ? 264 ILE A CG2 1 
ATOM   1913 C CD1 . ILE A 1 257 ? 45.897 8.769   12.486  1.00 15.84 ? 264 ILE A CD1 1 
ATOM   1914 N N   . ALA A 1 258 ? 43.112 7.453   7.872   1.00 17.09 ? 265 ALA A N   1 
ATOM   1915 C CA  . ALA A 1 258 ? 42.601 7.814   6.550   1.00 20.80 ? 265 ALA A CA  1 
ATOM   1916 C C   . ALA A 1 258 ? 41.248 7.171   6.293   1.00 18.46 ? 265 ALA A C   1 
ATOM   1917 O O   . ALA A 1 258 ? 40.294 7.848   5.910   1.00 18.39 ? 265 ALA A O   1 
ATOM   1918 C CB  . ALA A 1 258 ? 43.590 7.399   5.462   1.00 20.94 ? 265 ALA A CB  1 
ATOM   1919 N N   . LEU A 1 259 ? 41.164 5.862   6.510   1.00 20.93 ? 266 LEU A N   1 
ATOM   1920 C CA  . LEU A 1 259 ? 39.914 5.147   6.295   1.00 22.17 ? 266 LEU A CA  1 
ATOM   1921 C C   . LEU A 1 259 ? 38.800 5.722   7.165   1.00 22.42 ? 266 LEU A C   1 
ATOM   1922 O O   . LEU A 1 259 ? 37.701 5.988   6.679   1.00 20.88 ? 266 LEU A O   1 
ATOM   1923 C CB  . LEU A 1 259 ? 40.096 3.656   6.590   1.00 28.04 ? 266 LEU A CB  1 
ATOM   1924 C CG  . LEU A 1 259 ? 38.799 2.842   6.725   1.00 33.75 ? 266 LEU A CG  1 
ATOM   1925 C CD1 . LEU A 1 259 ? 37.941 3.003   5.467   1.00 34.57 ? 266 LEU A CD1 1 
ATOM   1926 C CD2 . LEU A 1 259 ? 39.144 1.383   6.966   1.00 30.63 ? 266 LEU A CD2 1 
ATOM   1927 N N   . ALA A 1 260 ? 39.091 5.929   8.446   1.00 21.24 ? 267 ALA A N   1 
ATOM   1928 C CA  . ALA A 1 260 ? 38.105 6.471   9.378   1.00 19.11 ? 267 ALA A CA  1 
ATOM   1929 C C   . ALA A 1 260 ? 37.532 7.825   8.959   1.00 20.51 ? 267 ALA A C   1 
ATOM   1930 O O   . ALA A 1 260 ? 36.330 8.050   9.087   1.00 25.37 ? 267 ALA A O   1 
ATOM   1931 C CB  . ALA A 1 260 ? 38.713 6.579   10.773  1.00 21.83 ? 267 ALA A CB  1 
ATOM   1932 N N   . ARG A 1 261 ? 38.381 8.721   8.462   1.00 20.59 ? 268 ARG A N   1 
ATOM   1933 C CA  . ARG A 1 261 ? 37.949 10.060  8.040   1.00 23.65 ? 268 ARG A CA  1 
ATOM   1934 C C   . ARG A 1 261 ? 36.824 10.078  7.012   1.00 25.93 ? 268 ARG A C   1 
ATOM   1935 O O   . ARG A 1 261 ? 35.912 10.897  7.103   1.00 21.34 ? 268 ARG A O   1 
ATOM   1936 C CB  . ARG A 1 261 ? 39.119 10.861  7.454   1.00 24.14 ? 268 ARG A CB  1 
ATOM   1937 C CG  . ARG A 1 261 ? 40.217 11.228  8.434   1.00 23.30 ? 268 ARG A CG  1 
ATOM   1938 C CD  . ARG A 1 261 ? 41.198 12.218  7.795   1.00 22.12 ? 268 ARG A CD  1 
ATOM   1939 N NE  . ARG A 1 261 ? 40.537 13.472  7.439   1.00 17.05 ? 268 ARG A NE  1 
ATOM   1940 C CZ  . ARG A 1 261 ? 40.264 13.853  6.194   1.00 25.59 ? 268 ARG A CZ  1 
ATOM   1941 N NH1 . ARG A 1 261 ? 40.601 13.084  5.159   1.00 19.30 ? 268 ARG A NH1 1 
ATOM   1942 N NH2 . ARG A 1 261 ? 39.626 14.998  5.983   1.00 19.04 ? 268 ARG A NH2 1 
ATOM   1943 N N   . LYS A 1 262 ? 36.903 9.207   6.013   1.00 29.03 ? 269 LYS A N   1 
ATOM   1944 C CA  . LYS A 1 262 ? 35.868 9.178   4.980   1.00 34.19 ? 269 LYS A CA  1 
ATOM   1945 C C   . LYS A 1 262 ? 34.600 8.509   5.495   1.00 35.91 ? 269 LYS A C   1 
ATOM   1946 O O   . LYS A 1 262 ? 33.538 8.636   4.884   1.00 34.56 ? 269 LYS A O   1 
ATOM   1947 C CB  . LYS A 1 262 ? 36.373 8.443   3.727   1.00 41.35 ? 269 LYS A CB  1 
ATOM   1948 C CG  . LYS A 1 262 ? 36.602 6.955   3.916   1.00 43.44 ? 269 LYS A CG  1 
ATOM   1949 C CD  . LYS A 1 262 ? 37.325 6.332   2.723   1.00 49.46 ? 269 LYS A CD  1 
ATOM   1950 C CE  . LYS A 1 262 ? 36.482 6.365   1.460   1.00 51.47 ? 269 LYS A CE  1 
ATOM   1951 N NZ  . LYS A 1 262 ? 35.186 5.642   1.653   1.00 53.69 ? 269 LYS A NZ  1 
ATOM   1952 N N   . LYS A 1 263 ? 34.709 7.815   6.629   1.00 35.30 ? 270 LYS A N   1 
ATOM   1953 C CA  . LYS A 1 263 ? 33.567 7.125   7.208   1.00 38.95 ? 270 LYS A CA  1 
ATOM   1954 C C   . LYS A 1 263 ? 32.653 8.013   8.036   1.00 40.01 ? 270 LYS A C   1 
ATOM   1955 O O   . LYS A 1 263 ? 31.435 7.850   7.986   1.00 46.94 ? 270 LYS A O   1 
ATOM   1956 C CB  . LYS A 1 263 ? 34.033 5.946   8.063   1.00 40.93 ? 270 LYS A CB  1 
ATOM   1957 C CG  . LYS A 1 263 ? 34.632 4.814   7.254   1.00 44.36 ? 270 LYS A CG  1 
ATOM   1958 C CD  . LYS A 1 263 ? 34.847 3.596   8.127   1.00 47.55 ? 270 LYS A CD  1 
ATOM   1959 C CE  . LYS A 1 263 ? 35.220 2.386   7.288   1.00 48.99 ? 270 LYS A CE  1 
ATOM   1960 N NZ  . LYS A 1 263 ? 35.384 1.167   8.137   1.00 45.23 ? 270 LYS A NZ  1 
ATOM   1961 N N   . GLY A 1 264 ? 33.223 8.940   8.800   1.00 37.78 ? 271 GLY A N   1 
ATOM   1962 C CA  . GLY A 1 264 ? 32.404 9.817   9.614   1.00 35.10 ? 271 GLY A CA  1 
ATOM   1963 C C   . GLY A 1 264 ? 33.109 10.332  10.860  1.00 33.81 ? 271 GLY A C   1 
ATOM   1964 O O   . GLY A 1 264 ? 33.094 11.540  11.119  1.00 33.07 ? 271 GLY A O   1 
ATOM   1965 N N   . PRO A 1 265 ? 33.732 9.446   11.661  1.00 31.21 ? 272 PRO A N   1 
ATOM   1966 C CA  . PRO A 1 265 ? 34.445 9.829   12.893  1.00 28.04 ? 272 PRO A CA  1 
ATOM   1967 C C   . PRO A 1 265 ? 35.380 11.040  12.734  1.00 26.13 ? 272 PRO A C   1 
ATOM   1968 O O   . PRO A 1 265 ? 36.149 11.113  11.773  1.00 26.19 ? 272 PRO A O   1 
ATOM   1969 C CB  . PRO A 1 265 ? 35.210 8.557   13.245  1.00 27.14 ? 272 PRO A CB  1 
ATOM   1970 C CG  . PRO A 1 265 ? 34.256 7.482   12.810  1.00 29.91 ? 272 PRO A CG  1 
ATOM   1971 C CD  . PRO A 1 265 ? 33.774 7.985   11.462  1.00 26.87 ? 272 PRO A CD  1 
ATOM   1972 N N   . LEU A 1 266 ? 35.305 11.982  13.676  1.00 22.30 ? 273 LEU A N   1 
ATOM   1973 C CA  . LEU A 1 266 ? 36.151 13.181  13.654  1.00 23.00 ? 273 LEU A CA  1 
ATOM   1974 C C   . LEU A 1 266 ? 37.514 12.872  14.277  1.00 24.02 ? 273 LEU A C   1 
ATOM   1975 O O   . LEU A 1 266 ? 37.747 13.163  15.451  1.00 21.00 ? 273 LEU A O   1 
ATOM   1976 C CB  . LEU A 1 266 ? 35.487 14.310  14.442  1.00 19.69 ? 273 LEU A CB  1 
ATOM   1977 C CG  . LEU A 1 266 ? 34.078 14.699  13.996  1.00 26.61 ? 273 LEU A CG  1 
ATOM   1978 C CD1 . LEU A 1 266 ? 33.502 15.740  14.947  1.00 23.08 ? 273 LEU A CD1 1 
ATOM   1979 C CD2 . LEU A 1 266 ? 34.125 15.237  12.580  1.00 18.57 ? 273 LEU A CD2 1 
ATOM   1980 N N   . VAL A 1 267 ? 38.408 12.290  13.484  1.00 18.63 ? 274 VAL A N   1 
ATOM   1981 C CA  . VAL A 1 267 ? 39.731 11.915  13.952  1.00 17.39 ? 274 VAL A CA  1 
ATOM   1982 C C   . VAL A 1 267 ? 40.822 12.739  13.271  1.00 19.98 ? 274 VAL A C   1 
ATOM   1983 O O   . VAL A 1 267 ? 40.764 12.974  12.065  1.00 20.28 ? 274 VAL A O   1 
ATOM   1984 C CB  . VAL A 1 267 ? 39.963 10.403  13.695  1.00 22.78 ? 274 VAL A CB  1 
ATOM   1985 C CG1 . VAL A 1 267 ? 39.633 10.079  12.252  1.00 22.70 ? 274 VAL A CG1 1 
ATOM   1986 C CG2 . VAL A 1 267 ? 41.407 10.004  14.019  1.00 14.62 ? 274 VAL A CG2 1 
ATOM   1987 N N   . PHE A 1 268 ? 41.806 13.185  14.053  1.00 18.11 ? 275 PHE A N   1 
ATOM   1988 C CA  . PHE A 1 268 ? 42.927 13.967  13.537  1.00 19.67 ? 275 PHE A CA  1 
ATOM   1989 C C   . PHE A 1 268 ? 44.245 13.213  13.742  1.00 19.99 ? 275 PHE A C   1 
ATOM   1990 O O   . PHE A 1 268 ? 44.376 12.410  14.664  1.00 20.87 ? 275 PHE A O   1 
ATOM   1991 C CB  . PHE A 1 268 ? 43.001 15.330  14.232  1.00 20.10 ? 275 PHE A CB  1 
ATOM   1992 C CG  . PHE A 1 268 ? 41.770 16.162  14.058  1.00 20.23 ? 275 PHE A CG  1 
ATOM   1993 C CD1 . PHE A 1 268 ? 40.633 15.912  14.825  1.00 21.27 ? 275 PHE A CD1 1 
ATOM   1994 C CD2 . PHE A 1 268 ? 41.729 17.168  13.101  1.00 19.83 ? 275 PHE A CD2 1 
ATOM   1995 C CE1 . PHE A 1 268 ? 39.474 16.658  14.643  1.00 24.64 ? 275 PHE A CE1 1 
ATOM   1996 C CE2 . PHE A 1 268 ? 40.572 17.924  12.907  1.00 21.52 ? 275 PHE A CE2 1 
ATOM   1997 C CZ  . PHE A 1 268 ? 39.443 17.669  13.676  1.00 24.42 ? 275 PHE A CZ  1 
ATOM   1998 N N   . GLY A 1 269 ? 45.221 13.480  12.883  1.00 15.09 ? 276 GLY A N   1 
ATOM   1999 C CA  . GLY A 1 269 ? 46.492 12.791  12.987  1.00 16.27 ? 276 GLY A CA  1 
ATOM   2000 C C   . GLY A 1 269 ? 47.683 13.714  13.113  1.00 14.71 ? 276 GLY A C   1 
ATOM   2001 O O   . GLY A 1 269 ? 47.821 14.669  12.345  1.00 13.62 ? 276 GLY A O   1 
ATOM   2002 N N   . GLU A 1 270 ? 48.557 13.398  14.066  1.00 12.78 ? 277 GLU A N   1 
ATOM   2003 C CA  . GLU A 1 270 ? 49.746 14.195  14.343  1.00 12.90 ? 277 GLU A CA  1 
ATOM   2004 C C   . GLU A 1 270 ? 51.100 13.527  14.103  1.00 15.00 ? 277 GLU A C   1 
ATOM   2005 O O   . GLU A 1 270 ? 51.699 12.987  15.027  1.00 11.83 ? 277 GLU A O   1 
ATOM   2006 C CB  . GLU A 1 270 ? 49.718 14.684  15.805  1.00 16.09 ? 277 GLU A CB  1 
ATOM   2007 C CG  . GLU A 1 270 ? 50.949 15.526  16.230  1.00 16.89 ? 277 GLU A CG  1 
ATOM   2008 C CD  . GLU A 1 270 ? 51.192 15.516  17.746  1.00 17.41 ? 277 GLU A CD  1 
ATOM   2009 O OE1 . GLU A 1 270 ? 51.837 14.566  18.248  1.00 15.80 ? 277 GLU A OE1 1 
ATOM   2010 O OE2 . GLU A 1 270 ? 50.734 16.451  18.432  1.00 10.72 ? 277 GLU A OE2 1 
ATOM   2011 N N   . PRO A 1 271 ? 51.594 13.534  12.856  1.00 13.37 ? 278 PRO A N   1 
ATOM   2012 C CA  . PRO A 1 271 ? 52.905 12.917  12.639  1.00 14.04 ? 278 PRO A CA  1 
ATOM   2013 C C   . PRO A 1 271 ? 53.945 13.878  13.237  1.00 17.31 ? 278 PRO A C   1 
ATOM   2014 O O   . PRO A 1 271 ? 53.652 15.062  13.433  1.00 18.73 ? 278 PRO A O   1 
ATOM   2015 C CB  . PRO A 1 271 ? 53.005 12.852  11.114  1.00 14.29 ? 278 PRO A CB  1 
ATOM   2016 C CG  . PRO A 1 271 ? 52.181 14.025  10.669  1.00 6.62  ? 278 PRO A CG  1 
ATOM   2017 C CD  . PRO A 1 271 ? 50.979 13.926  11.577  1.00 11.51 ? 278 PRO A CD  1 
ATOM   2018 N N   . ILE A 1 272 ? 55.144 13.391  13.538  1.00 15.51 ? 279 ILE A N   1 
ATOM   2019 C CA  . ILE A 1 272 ? 56.164 14.278  14.084  1.00 13.98 ? 279 ILE A CA  1 
ATOM   2020 C C   . ILE A 1 272 ? 57.416 14.310  13.211  1.00 14.46 ? 279 ILE A C   1 
ATOM   2021 O O   . ILE A 1 272 ? 57.602 13.458  12.342  1.00 11.97 ? 279 ILE A O   1 
ATOM   2022 C CB  . ILE A 1 272 ? 56.560 13.885  15.522  1.00 16.09 ? 279 ILE A CB  1 
ATOM   2023 C CG1 . ILE A 1 272 ? 57.105 12.453  15.547  1.00 12.22 ? 279 ILE A CG1 1 
ATOM   2024 C CG2 . ILE A 1 272 ? 55.352 14.071  16.450  1.00 15.53 ? 279 ILE A CG2 1 
ATOM   2025 C CD1 . ILE A 1 272 ? 57.575 11.994  16.907  1.00 11.78 ? 279 ILE A CD1 1 
ATOM   2026 N N   . ALA A 1 273 ? 58.269 15.303  13.451  1.00 13.44 ? 280 ALA A N   1 
ATOM   2027 C CA  . ALA A 1 273 ? 59.492 15.466  12.679  1.00 15.85 ? 280 ALA A CA  1 
ATOM   2028 C C   . ALA A 1 273 ? 60.187 14.136  12.465  1.00 14.46 ? 280 ALA A C   1 
ATOM   2029 O O   . ALA A 1 273 ? 60.495 13.768  11.335  1.00 19.25 ? 280 ALA A O   1 
ATOM   2030 C CB  . ALA A 1 273 ? 60.442 16.455  13.377  1.00 15.29 ? 280 ALA A CB  1 
ATOM   2031 N N   . ALA A 1 274 ? 60.417 13.413  13.552  1.00 11.09 ? 281 ALA A N   1 
ATOM   2032 C CA  . ALA A 1 274 ? 61.085 12.120  13.483  1.00 12.89 ? 281 ALA A CA  1 
ATOM   2033 C C   . ALA A 1 274 ? 60.525 11.153  12.431  1.00 16.75 ? 281 ALA A C   1 
ATOM   2034 O O   . ALA A 1 274 ? 61.282 10.622  11.608  1.00 16.08 ? 281 ALA A O   1 
ATOM   2035 C CB  . ALA A 1 274 ? 61.066 11.458  14.853  1.00 10.26 ? 281 ALA A CB  1 
ATOM   2036 N N   . SER A 1 275 ? 59.211 10.930  12.449  1.00 14.02 ? 282 SER A N   1 
ATOM   2037 C CA  . SER A 1 275 ? 58.592 9.995   11.510  1.00 16.06 ? 282 SER A CA  1 
ATOM   2038 C C   . SER A 1 275 ? 58.448 10.547  10.098  1.00 15.15 ? 282 SER A C   1 
ATOM   2039 O O   . SER A 1 275 ? 58.130 9.810   9.171   1.00 15.22 ? 282 SER A O   1 
ATOM   2040 C CB  . SER A 1 275 ? 57.227 9.531   12.036  1.00 14.15 ? 282 SER A CB  1 
ATOM   2041 O OG  . SER A 1 275 ? 56.352 10.624  12.258  1.00 13.95 ? 282 SER A OG  1 
ATOM   2042 N N   . LEU A 1 276 ? 58.680 11.843  9.936   1.00 17.24 ? 283 LEU A N   1 
ATOM   2043 C CA  . LEU A 1 276 ? 58.592 12.461  8.620   1.00 19.13 ? 283 LEU A CA  1 
ATOM   2044 C C   . LEU A 1 276 ? 59.980 12.610  7.989   1.00 18.62 ? 283 LEU A C   1 
ATOM   2045 O O   . LEU A 1 276 ? 60.095 12.735  6.775   1.00 15.69 ? 283 LEU A O   1 
ATOM   2046 C CB  . LEU A 1 276 ? 57.933 13.847  8.707   1.00 17.53 ? 283 LEU A CB  1 
ATOM   2047 C CG  . LEU A 1 276 ? 56.444 14.010  9.048   1.00 21.75 ? 283 LEU A CG  1 
ATOM   2048 C CD1 . LEU A 1 276 ? 56.116 15.492  9.198   1.00 17.19 ? 283 LEU A CD1 1 
ATOM   2049 C CD2 . LEU A 1 276 ? 55.576 13.389  7.957   1.00 19.85 ? 283 LEU A CD2 1 
ATOM   2050 N N   . GLY A 1 277 ? 61.028 12.576  8.809   1.00 19.01 ? 284 GLY A N   1 
ATOM   2051 C CA  . GLY A 1 277 ? 62.373 12.766  8.289   1.00 19.05 ? 284 GLY A CA  1 
ATOM   2052 C C   . GLY A 1 277 ? 63.394 11.647  8.414   1.00 22.33 ? 284 GLY A C   1 
ATOM   2053 O O   . GLY A 1 277 ? 64.451 11.713  7.785   1.00 19.83 ? 284 GLY A O   1 
ATOM   2054 N N   . THR A 1 278 ? 63.117 10.628  9.219   1.00 21.46 ? 285 THR A N   1 
ATOM   2055 C CA  . THR A 1 278 ? 64.064 9.525   9.354   1.00 18.90 ? 285 THR A CA  1 
ATOM   2056 C C   . THR A 1 278 ? 63.311 8.238   9.653   1.00 15.98 ? 285 THR A C   1 
ATOM   2057 O O   . THR A 1 278 ? 62.081 8.222   9.588   1.00 16.32 ? 285 THR A O   1 
ATOM   2058 C CB  . THR A 1 278 ? 65.113 9.806   10.469  1.00 20.80 ? 285 THR A CB  1 
ATOM   2059 O OG1 . THR A 1 278 ? 66.174 8.847   10.380  1.00 19.25 ? 285 THR A OG1 1 
ATOM   2060 C CG2 . THR A 1 278 ? 64.473 9.729   11.851  1.00 18.76 ? 285 THR A CG2 1 
ATOM   2061 N N   . ASP A 1 279 ? 64.036 7.160   9.951   1.00 13.92 ? 286 ASP A N   1 
ATOM   2062 C CA  . ASP A 1 279 ? 63.395 5.882   10.253  1.00 16.86 ? 286 ASP A CA  1 
ATOM   2063 C C   . ASP A 1 279 ? 64.092 5.084   11.360  1.00 18.19 ? 286 ASP A C   1 
ATOM   2064 O O   . ASP A 1 279 ? 65.088 5.536   11.934  1.00 16.80 ? 286 ASP A O   1 
ATOM   2065 C CB  . ASP A 1 279 ? 63.267 5.024   8.981   1.00 18.76 ? 286 ASP A CB  1 
ATOM   2066 C CG  . ASP A 1 279 ? 64.616 4.681   8.350   1.00 25.02 ? 286 ASP A CG  1 
ATOM   2067 O OD1 . ASP A 1 279 ? 65.566 4.342   9.098   1.00 25.06 ? 286 ASP A OD1 1 
ATOM   2068 O OD2 . ASP A 1 279 ? 64.720 4.733   7.101   1.00 23.52 ? 286 ASP A OD2 1 
ATOM   2069 N N   . GLY A 1 280 ? 63.559 3.894   11.648  1.00 17.69 ? 287 GLY A N   1 
ATOM   2070 C CA  . GLY A 1 280 ? 64.108 3.050   12.696  1.00 17.04 ? 287 GLY A CA  1 
ATOM   2071 C C   . GLY A 1 280 ? 65.257 2.109   12.359  1.00 21.18 ? 287 GLY A C   1 
ATOM   2072 O O   . GLY A 1 280 ? 65.660 1.300   13.200  1.00 20.70 ? 287 GLY A O   1 
ATOM   2073 N N   . THR A 1 281 ? 65.805 2.191   11.152  1.00 22.36 ? 288 THR A N   1 
ATOM   2074 C CA  . THR A 1 281 ? 66.912 1.301   10.811  1.00 21.34 ? 288 THR A CA  1 
ATOM   2075 C C   . THR A 1 281 ? 68.114 1.596   11.706  1.00 21.34 ? 288 THR A C   1 
ATOM   2076 O O   . THR A 1 281 ? 69.017 0.769   11.855  1.00 21.86 ? 288 THR A O   1 
ATOM   2077 C CB  . THR A 1 281 ? 67.328 1.450   9.329   1.00 22.59 ? 288 THR A CB  1 
ATOM   2078 O OG1 . THR A 1 281 ? 67.684 2.812   9.049   1.00 19.85 ? 288 THR A OG1 1 
ATOM   2079 C CG2 . THR A 1 281 ? 66.186 1.020   8.420   1.00 19.42 ? 288 THR A CG2 1 
ATOM   2080 N N   . HIS A 1 282 ? 68.100 2.774   12.323  1.00 23.27 ? 289 HIS A N   1 
ATOM   2081 C CA  . HIS A 1 282 ? 69.187 3.215   13.195  1.00 22.56 ? 289 HIS A CA  1 
ATOM   2082 C C   . HIS A 1 282 ? 69.225 2.519   14.553  1.00 20.00 ? 289 HIS A C   1 
ATOM   2083 O O   . HIS A 1 282 ? 70.237 2.563   15.252  1.00 22.49 ? 289 HIS A O   1 
ATOM   2084 C CB  . HIS A 1 282 ? 69.104 4.732   13.346  1.00 22.51 ? 289 HIS A CB  1 
ATOM   2085 C CG  . HIS A 1 282 ? 69.088 5.450   12.027  1.00 24.44 ? 289 HIS A CG  1 
ATOM   2086 N ND1 . HIS A 1 282 ? 70.216 5.563   11.235  1.00 23.66 ? 289 HIS A ND1 1 
ATOM   2087 C CD2 . HIS A 1 282 ? 68.078 6.011   11.335  1.00 23.83 ? 289 HIS A CD2 1 
ATOM   2088 C CE1 . HIS A 1 282 ? 69.886 6.165   10.106  1.00 25.03 ? 289 HIS A CE1 1 
ATOM   2089 N NE2 . HIS A 1 282 ? 68.600 6.450   10.133  1.00 22.44 ? 289 HIS A NE2 1 
ATOM   2090 N N   . TYR A 1 283 ? 68.126 1.876   14.927  1.00 18.81 ? 290 TYR A N   1 
ATOM   2091 C CA  . TYR A 1 283 ? 68.084 1.131   16.180  1.00 21.71 ? 290 TYR A CA  1 
ATOM   2092 C C   . TYR A 1 283 ? 69.072 -0.039  16.060  1.00 23.17 ? 290 TYR A C   1 
ATOM   2093 O O   . TYR A 1 283 ? 69.425 -0.673  17.049  1.00 21.04 ? 290 TYR A O   1 
ATOM   2094 C CB  . TYR A 1 283 ? 66.681 0.568   16.432  1.00 20.10 ? 290 TYR A CB  1 
ATOM   2095 C CG  . TYR A 1 283 ? 65.631 1.594   16.790  1.00 23.06 ? 290 TYR A CG  1 
ATOM   2096 C CD1 . TYR A 1 283 ? 65.817 2.459   17.867  1.00 20.29 ? 290 TYR A CD1 1 
ATOM   2097 C CD2 . TYR A 1 283 ? 64.437 1.684   16.070  1.00 22.30 ? 290 TYR A CD2 1 
ATOM   2098 C CE1 . TYR A 1 283 ? 64.845 3.380   18.225  1.00 22.41 ? 290 TYR A CE1 1 
ATOM   2099 C CE2 . TYR A 1 283 ? 63.451 2.608   16.418  1.00 20.79 ? 290 TYR A CE2 1 
ATOM   2100 C CZ  . TYR A 1 283 ? 63.664 3.453   17.500  1.00 20.98 ? 290 TYR A CZ  1 
ATOM   2101 O OH  . TYR A 1 283 ? 62.702 4.366   17.870  1.00 15.49 ? 290 TYR A OH  1 
ATOM   2102 N N   . TRP A 1 284 ? 69.502 -0.332  14.837  1.00 23.47 ? 291 TRP A N   1 
ATOM   2103 C CA  . TRP A 1 284 ? 70.434 -1.429  14.615  1.00 24.00 ? 291 TRP A CA  1 
ATOM   2104 C C   . TRP A 1 284 ? 71.865 -0.958  14.430  1.00 25.09 ? 291 TRP A C   1 
ATOM   2105 O O   . TRP A 1 284 ? 72.713 -1.733  14.001  1.00 24.62 ? 291 TRP A O   1 
ATOM   2106 C CB  . TRP A 1 284 ? 70.008 -2.262  13.393  1.00 21.89 ? 291 TRP A CB  1 
ATOM   2107 C CG  . TRP A 1 284 ? 68.885 -3.224  13.660  1.00 22.39 ? 291 TRP A CG  1 
ATOM   2108 C CD1 . TRP A 1 284 ? 68.987 -4.581  13.833  1.00 20.76 ? 291 TRP A CD1 1 
ATOM   2109 C CD2 . TRP A 1 284 ? 67.488 -2.910  13.796  1.00 19.62 ? 291 TRP A CD2 1 
ATOM   2110 N NE1 . TRP A 1 284 ? 67.745 -5.125  14.069  1.00 20.63 ? 291 TRP A NE1 1 
ATOM   2111 C CE2 . TRP A 1 284 ? 66.811 -4.125  14.056  1.00 22.31 ? 291 TRP A CE2 1 
ATOM   2112 C CE3 . TRP A 1 284 ? 66.749 -1.721  13.731  1.00 21.52 ? 291 TRP A CE3 1 
ATOM   2113 C CZ2 . TRP A 1 284 ? 65.422 -4.183  14.242  1.00 22.02 ? 291 TRP A CZ2 1 
ATOM   2114 C CZ3 . TRP A 1 284 ? 65.364 -1.779  13.920  1.00 19.39 ? 291 TRP A CZ3 1 
ATOM   2115 C CH2 . TRP A 1 284 ? 64.718 -3.003  14.175  1.00 21.23 ? 291 TRP A CH2 1 
ATOM   2116 N N   . SER A 1 285 ? 72.145 0.305   14.744  1.00 23.37 ? 292 SER A N   1 
ATOM   2117 C CA  . SER A 1 285 ? 73.502 0.822   14.604  1.00 26.61 ? 292 SER A CA  1 
ATOM   2118 C C   . SER A 1 285 ? 74.450 0.077   15.539  1.00 29.80 ? 292 SER A C   1 
ATOM   2119 O O   . SER A 1 285 ? 74.047 -0.338  16.630  1.00 28.55 ? 292 SER A O   1 
ATOM   2120 C CB  . SER A 1 285 ? 73.548 2.312   14.939  1.00 28.14 ? 292 SER A CB  1 
ATOM   2121 O OG  . SER A 1 285 ? 74.869 2.813   14.823  1.00 28.43 ? 292 SER A OG  1 
ATOM   2122 N N   . LYS A 1 286 ? 75.702 -0.103  15.118  1.00 30.89 ? 293 LYS A N   1 
ATOM   2123 C CA  . LYS A 1 286 ? 76.684 -0.788  15.960  1.00 33.88 ? 293 LYS A CA  1 
ATOM   2124 C C   . LYS A 1 286 ? 76.921 0.049   17.218  1.00 31.73 ? 293 LYS A C   1 
ATOM   2125 O O   . LYS A 1 286 ? 77.169 -0.480  18.303  1.00 32.57 ? 293 LYS A O   1 
ATOM   2126 C CB  . LYS A 1 286 ? 78.020 -0.954  15.222  1.00 36.42 ? 293 LYS A CB  1 
ATOM   2127 C CG  . LYS A 1 286 ? 78.008 -1.948  14.067  1.00 46.03 ? 293 LYS A CG  1 
ATOM   2128 C CD  . LYS A 1 286 ? 77.757 -3.368  14.570  1.00 48.66 ? 293 LYS A CD  1 
ATOM   2129 C CE  . LYS A 1 286 ? 78.334 -4.386  13.600  1.00 49.74 ? 293 LYS A CE  1 
ATOM   2130 N NZ  . LYS A 1 286 ? 78.171 -5.776  14.116  1.00 54.05 ? 293 LYS A NZ  1 
ATOM   2131 N N   . ASN A 1 287 ? 76.845 1.365   17.047  1.00 31.12 ? 294 ASN A N   1 
ATOM   2132 C CA  . ASN A 1 287 ? 77.058 2.327   18.121  1.00 27.50 ? 294 ASN A CA  1 
ATOM   2133 C C   . ASN A 1 287 ? 75.861 2.380   19.057  1.00 26.47 ? 294 ASN A C   1 
ATOM   2134 O O   . ASN A 1 287 ? 74.850 3.003   18.732  1.00 27.15 ? 294 ASN A O   1 
ATOM   2135 C CB  . ASN A 1 287 ? 77.276 3.702   17.502  1.00 29.15 ? 294 ASN A CB  1 
ATOM   2136 C CG  . ASN A 1 287 ? 77.355 4.805   18.538  1.00 31.53 ? 294 ASN A CG  1 
ATOM   2137 O OD1 . ASN A 1 287 ? 76.910 4.641   19.681  1.00 34.36 ? 294 ASN A OD1 1 
ATOM   2138 N ND2 . ASN A 1 287 ? 77.907 5.944   18.138  1.00 26.50 ? 294 ASN A ND2 1 
ATOM   2139 N N   . TRP A 1 288 ? 75.976 1.752   20.222  1.00 24.65 ? 295 TRP A N   1 
ATOM   2140 C CA  . TRP A 1 288 ? 74.880 1.738   21.188  1.00 23.30 ? 295 TRP A CA  1 
ATOM   2141 C C   . TRP A 1 288 ? 74.284 3.130   21.451  1.00 22.77 ? 295 TRP A C   1 
ATOM   2142 O O   . TRP A 1 288 ? 73.066 3.276   21.503  1.00 22.75 ? 295 TRP A O   1 
ATOM   2143 C CB  . TRP A 1 288 ? 75.333 1.132   22.520  1.00 23.60 ? 295 TRP A CB  1 
ATOM   2144 C CG  . TRP A 1 288 ? 74.181 0.813   23.446  1.00 25.47 ? 295 TRP A CG  1 
ATOM   2145 C CD1 . TRP A 1 288 ? 73.476 -0.362  23.509  1.00 27.98 ? 295 TRP A CD1 1 
ATOM   2146 C CD2 . TRP A 1 288 ? 73.537 1.712   24.354  1.00 27.31 ? 295 TRP A CD2 1 
ATOM   2147 N NE1 . TRP A 1 288 ? 72.428 -0.244  24.397  1.00 25.98 ? 295 TRP A NE1 1 
ATOM   2148 C CE2 . TRP A 1 288 ? 72.439 1.028   24.931  1.00 27.04 ? 295 TRP A CE2 1 
ATOM   2149 C CE3 . TRP A 1 288 ? 73.767 3.044   24.742  1.00 26.62 ? 295 TRP A CE3 1 
ATOM   2150 C CZ2 . TRP A 1 288 ? 71.579 1.619   25.864  1.00 28.76 ? 295 TRP A CZ2 1 
ATOM   2151 C CZ3 . TRP A 1 288 ? 72.910 3.635   25.673  1.00 24.27 ? 295 TRP A CZ3 1 
ATOM   2152 C CH2 . TRP A 1 288 ? 71.830 2.921   26.218  1.00 25.72 ? 295 TRP A CH2 1 
ATOM   2153 N N   . ALA A 1 289 ? 75.142 4.142   21.608  1.00 20.35 ? 296 ALA A N   1 
ATOM   2154 C CA  . ALA A 1 289 ? 74.702 5.511   21.883  1.00 22.17 ? 296 ALA A CA  1 
ATOM   2155 C C   . ALA A 1 289 ? 73.850 6.123   20.763  1.00 22.86 ? 296 ALA A C   1 
ATOM   2156 O O   . ALA A 1 289 ? 72.882 6.850   21.031  1.00 20.23 ? 296 ALA A O   1 
ATOM   2157 C CB  . ALA A 1 289 ? 75.915 6.401   22.167  1.00 21.90 ? 296 ALA A CB  1 
ATOM   2158 N N   . LYS A 1 290 ? 74.210 5.844   19.514  1.00 18.59 ? 297 LYS A N   1 
ATOM   2159 C CA  . LYS A 1 290 ? 73.440 6.368   18.390  1.00 19.17 ? 297 LYS A CA  1 
ATOM   2160 C C   . LYS A 1 290 ? 72.078 5.671   18.384  1.00 18.44 ? 297 LYS A C   1 
ATOM   2161 O O   . LYS A 1 290 ? 71.045 6.313   18.278  1.00 20.85 ? 297 LYS A O   1 
ATOM   2162 C CB  . LYS A 1 290 ? 74.173 6.112   17.067  1.00 21.63 ? 297 LYS A CB  1 
ATOM   2163 C CG  . LYS A 1 290 ? 73.482 6.702   15.842  1.00 25.50 ? 297 LYS A CG  1 
ATOM   2164 C CD  . LYS A 1 290 ? 74.294 6.467   14.558  1.00 26.83 ? 297 LYS A CD  1 
ATOM   2165 C CE  . LYS A 1 290 ? 73.632 7.133   13.363  1.00 26.92 ? 297 LYS A CE  1 
ATOM   2166 N NZ  . LYS A 1 290 ? 74.290 6.815   12.063  1.00 25.29 ? 297 LYS A NZ  1 
ATOM   2167 N N   . ALA A 1 291 ? 72.085 4.353   18.522  1.00 19.84 ? 298 ALA A N   1 
ATOM   2168 C CA  . ALA A 1 291 ? 70.846 3.578   18.533  1.00 21.86 ? 298 ALA A CA  1 
ATOM   2169 C C   . ALA A 1 291 ? 69.890 4.021   19.646  1.00 21.14 ? 298 ALA A C   1 
ATOM   2170 O O   . ALA A 1 291 ? 68.702 4.226   19.410  1.00 19.69 ? 298 ALA A O   1 
ATOM   2171 C CB  . ALA A 1 291 ? 71.164 2.092   18.687  1.00 17.41 ? 298 ALA A CB  1 
ATOM   2172 N N   . ALA A 1 292 ? 70.419 4.165   20.857  1.00 21.13 ? 299 ALA A N   1 
ATOM   2173 C CA  . ALA A 1 292 ? 69.615 4.569   22.005  1.00 23.15 ? 299 ALA A CA  1 
ATOM   2174 C C   . ALA A 1 292 ? 68.989 5.960   21.844  1.00 21.14 ? 299 ALA A C   1 
ATOM   2175 O O   . ALA A 1 292 ? 67.935 6.239   22.415  1.00 22.96 ? 299 ALA A O   1 
ATOM   2176 C CB  . ALA A 1 292 ? 70.469 4.520   23.278  1.00 21.87 ? 299 ALA A CB  1 
ATOM   2177 N N   . ALA A 1 293 ? 69.638 6.823   21.067  1.00 21.83 ? 300 ALA A N   1 
ATOM   2178 C CA  . ALA A 1 293 ? 69.144 8.180   20.836  1.00 19.86 ? 300 ALA A CA  1 
ATOM   2179 C C   . ALA A 1 293 ? 67.861 8.193   20.008  1.00 21.41 ? 300 ALA A C   1 
ATOM   2180 O O   . ALA A 1 293 ? 67.138 9.191   19.984  1.00 20.21 ? 300 ALA A O   1 
ATOM   2181 C CB  . ALA A 1 293 ? 70.221 9.020   20.138  1.00 17.54 ? 300 ALA A CB  1 
ATOM   2182 N N   . PHE A 1 294 ? 67.576 7.090   19.326  1.00 20.15 ? 301 PHE A N   1 
ATOM   2183 C CA  . PHE A 1 294 ? 66.374 7.017   18.505  1.00 19.81 ? 301 PHE A CA  1 
ATOM   2184 C C   . PHE A 1 294 ? 65.207 6.423   19.269  1.00 17.98 ? 301 PHE A C   1 
ATOM   2185 O O   . PHE A 1 294 ? 64.101 6.328   18.746  1.00 19.39 ? 301 PHE A O   1 
ATOM   2186 C CB  . PHE A 1 294 ? 66.626 6.183   17.249  1.00 17.54 ? 301 PHE A CB  1 
ATOM   2187 C CG  . PHE A 1 294 ? 67.428 6.893   16.201  1.00 15.94 ? 301 PHE A CG  1 
ATOM   2188 C CD1 . PHE A 1 294 ? 68.805 7.024   16.327  1.00 16.85 ? 301 PHE A CD1 1 
ATOM   2189 C CD2 . PHE A 1 294 ? 66.801 7.422   15.077  1.00 14.82 ? 301 PHE A CD2 1 
ATOM   2190 C CE1 . PHE A 1 294 ? 69.554 7.680   15.347  1.00 18.43 ? 301 PHE A CE1 1 
ATOM   2191 C CE2 . PHE A 1 294 ? 67.535 8.077   14.093  1.00 19.84 ? 301 PHE A CE2 1 
ATOM   2192 C CZ  . PHE A 1 294 ? 68.916 8.205   14.227  1.00 17.31 ? 301 PHE A CZ  1 
ATOM   2193 N N   . VAL A 1 295 ? 65.450 6.029   20.513  1.00 19.33 ? 302 VAL A N   1 
ATOM   2194 C CA  . VAL A 1 295 ? 64.394 5.427   21.310  1.00 17.87 ? 302 VAL A CA  1 
ATOM   2195 C C   . VAL A 1 295 ? 63.324 6.433   21.714  1.00 18.46 ? 302 VAL A C   1 
ATOM   2196 O O   . VAL A 1 295 ? 63.592 7.407   22.421  1.00 15.14 ? 302 VAL A O   1 
ATOM   2197 C CB  . VAL A 1 295 ? 64.966 4.743   22.566  1.00 17.58 ? 302 VAL A CB  1 
ATOM   2198 C CG1 . VAL A 1 295 ? 63.838 4.203   23.425  1.00 15.15 ? 302 VAL A CG1 1 
ATOM   2199 C CG2 . VAL A 1 295 ? 65.893 3.604   22.152  1.00 20.54 ? 302 VAL A CG2 1 
ATOM   2200 N N   . THR A 1 296 ? 62.116 6.183   21.228  1.00 15.26 ? 303 THR A N   1 
ATOM   2201 C CA  . THR A 1 296 ? 60.946 7.007   21.498  1.00 18.14 ? 303 THR A CA  1 
ATOM   2202 C C   . THR A 1 296 ? 59.717 6.093   21.327  1.00 20.06 ? 303 THR A C   1 
ATOM   2203 O O   . THR A 1 296 ? 59.820 5.023   20.727  1.00 18.26 ? 303 THR A O   1 
ATOM   2204 C CB  . THR A 1 296 ? 60.872 8.215   20.514  1.00 17.10 ? 303 THR A CB  1 
ATOM   2205 O OG1 . THR A 1 296 ? 59.625 8.896   20.677  1.00 19.06 ? 303 THR A OG1 1 
ATOM   2206 C CG2 . THR A 1 296 ? 60.996 7.760   19.077  1.00 16.46 ? 303 THR A CG2 1 
ATOM   2207 N N   . SER A 1 297 ? 58.566 6.496   21.855  1.00 19.90 ? 304 SER A N   1 
ATOM   2208 C CA  . SER A 1 297 ? 57.367 5.668   21.734  1.00 21.43 ? 304 SER A CA  1 
ATOM   2209 C C   . SER A 1 297 ? 56.127 6.449   21.302  1.00 21.71 ? 304 SER A C   1 
ATOM   2210 O O   . SER A 1 297 ? 55.810 7.496   21.873  1.00 19.46 ? 304 SER A O   1 
ATOM   2211 C CB  . SER A 1 297 ? 57.074 4.952   23.061  1.00 22.11 ? 304 SER A CB  1 
ATOM   2212 O OG  . SER A 1 297 ? 58.071 3.992   23.370  1.00 18.69 ? 304 SER A OG  1 
ATOM   2213 N N   . PRO A 1 298 ? 55.433 5.966   20.257  1.00 18.02 ? 305 PRO A N   1 
ATOM   2214 C CA  . PRO A 1 298 ? 55.817 4.757   19.523  1.00 18.53 ? 305 PRO A CA  1 
ATOM   2215 C C   . PRO A 1 298 ? 57.157 4.939   18.804  1.00 15.32 ? 305 PRO A C   1 
ATOM   2216 O O   . PRO A 1 298 ? 57.594 6.056   18.550  1.00 13.92 ? 305 PRO A O   1 
ATOM   2217 C CB  . PRO A 1 298 ? 54.629 4.514   18.583  1.00 17.97 ? 305 PRO A CB  1 
ATOM   2218 C CG  . PRO A 1 298 ? 53.941 5.837   18.503  1.00 23.67 ? 305 PRO A CG  1 
ATOM   2219 C CD  . PRO A 1 298 ? 54.094 6.426   19.862  1.00 19.44 ? 305 PRO A CD  1 
ATOM   2220 N N   . PRO A 1 299 ? 57.828 3.830   18.472  1.00 17.42 ? 306 PRO A N   1 
ATOM   2221 C CA  . PRO A 1 299 ? 59.126 3.872   17.796  1.00 17.81 ? 306 PRO A CA  1 
ATOM   2222 C C   . PRO A 1 299 ? 59.132 4.198   16.310  1.00 19.25 ? 306 PRO A C   1 
ATOM   2223 O O   . PRO A 1 299 ? 58.121 4.052   15.614  1.00 19.80 ? 306 PRO A O   1 
ATOM   2224 C CB  . PRO A 1 299 ? 59.683 2.481   18.068  1.00 20.77 ? 306 PRO A CB  1 
ATOM   2225 C CG  . PRO A 1 299 ? 58.449 1.629   17.971  1.00 19.32 ? 306 PRO A CG  1 
ATOM   2226 C CD  . PRO A 1 299 ? 57.398 2.437   18.709  1.00 21.88 ? 306 PRO A CD  1 
ATOM   2227 N N   . LEU A 1 300 ? 60.288 4.654   15.837  1.00 15.58 ? 307 LEU A N   1 
ATOM   2228 C CA  . LEU A 1 300 ? 60.469 4.952   14.425  1.00 18.75 ? 307 LEU A CA  1 
ATOM   2229 C C   . LEU A 1 300 ? 60.333 3.623   13.692  1.00 16.55 ? 307 LEU A C   1 
ATOM   2230 O O   . LEU A 1 300 ? 60.934 2.622   14.090  1.00 15.12 ? 307 LEU A O   1 
ATOM   2231 C CB  . LEU A 1 300 ? 61.866 5.521   14.160  1.00 18.90 ? 307 LEU A CB  1 
ATOM   2232 C CG  . LEU A 1 300 ? 62.125 7.014   14.356  1.00 22.28 ? 307 LEU A CG  1 
ATOM   2233 C CD1 . LEU A 1 300 ? 61.240 7.808   13.396  1.00 25.25 ? 307 LEU A CD1 1 
ATOM   2234 C CD2 . LEU A 1 300 ? 61.858 7.398   15.780  1.00 21.22 ? 307 LEU A CD2 1 
ATOM   2235 N N   . SER A 1 301 ? 59.542 3.616   12.625  1.00 15.40 ? 308 SER A N   1 
ATOM   2236 C CA  . SER A 1 301 ? 59.333 2.406   11.848  1.00 13.38 ? 308 SER A CA  1 
ATOM   2237 C C   . SER A 1 301 ? 60.594 1.981   11.124  1.00 14.99 ? 308 SER A C   1 
ATOM   2238 O O   . SER A 1 301 ? 61.294 2.806   10.546  1.00 13.41 ? 308 SER A O   1 
ATOM   2239 C CB  . SER A 1 301 ? 58.221 2.610   10.813  1.00 14.65 ? 308 SER A CB  1 
ATOM   2240 O OG  . SER A 1 301 ? 58.260 1.566   9.853   1.00 12.61 ? 308 SER A OG  1 
ATOM   2241 N N   . PRO A 1 302 ? 60.908 0.679   11.164  1.00 17.29 ? 309 PRO A N   1 
ATOM   2242 C CA  . PRO A 1 302 ? 62.097 0.143   10.495  1.00 17.72 ? 309 PRO A CA  1 
ATOM   2243 C C   . PRO A 1 302 ? 61.932 0.103   8.976   1.00 18.35 ? 309 PRO A C   1 
ATOM   2244 O O   . PRO A 1 302 ? 62.904 -0.115  8.246   1.00 17.95 ? 309 PRO A O   1 
ATOM   2245 C CB  . PRO A 1 302 ? 62.233 -1.252  11.109  1.00 20.37 ? 309 PRO A CB  1 
ATOM   2246 C CG  . PRO A 1 302 ? 61.696 -1.050  12.487  1.00 19.85 ? 309 PRO A CG  1 
ATOM   2247 C CD  . PRO A 1 302 ? 60.445 -0.253  12.205  1.00 17.61 ? 309 PRO A CD  1 
ATOM   2248 N N   . ASP A 1 303 ? 60.701 0.309   8.507   1.00 18.40 ? 310 ASP A N   1 
ATOM   2249 C CA  . ASP A 1 303 ? 60.405 0.319   7.070   1.00 18.14 ? 310 ASP A CA  1 
ATOM   2250 C C   . ASP A 1 303 ? 60.776 1.691   6.501   1.00 17.71 ? 310 ASP A C   1 
ATOM   2251 O O   . ASP A 1 303 ? 60.103 2.688   6.765   1.00 19.79 ? 310 ASP A O   1 
ATOM   2252 C CB  . ASP A 1 303 ? 58.914 0.052   6.831   1.00 21.07 ? 310 ASP A CB  1 
ATOM   2253 C CG  . ASP A 1 303 ? 58.561 0.011   5.353   1.00 24.36 ? 310 ASP A CG  1 
ATOM   2254 O OD1 . ASP A 1 303 ? 59.279 0.645   4.547   1.00 26.34 ? 310 ASP A OD1 1 
ATOM   2255 O OD2 . ASP A 1 303 ? 57.561 -0.642  4.995   1.00 24.28 ? 310 ASP A OD2 1 
ATOM   2256 N N   . PRO A 1 304 ? 61.833 1.746   5.675   1.00 21.66 ? 311 PRO A N   1 
ATOM   2257 C CA  . PRO A 1 304 ? 62.355 2.963   5.038   1.00 17.44 ? 311 PRO A CA  1 
ATOM   2258 C C   . PRO A 1 304 ? 61.373 3.744   4.160   1.00 18.58 ? 311 PRO A C   1 
ATOM   2259 O O   . PRO A 1 304 ? 61.607 4.915   3.871   1.00 16.53 ? 311 PRO A O   1 
ATOM   2260 C CB  . PRO A 1 304 ? 63.543 2.455   4.220   1.00 26.14 ? 311 PRO A CB  1 
ATOM   2261 C CG  . PRO A 1 304 ? 63.822 1.068   4.773   1.00 28.59 ? 311 PRO A CG  1 
ATOM   2262 C CD  . PRO A 1 304 ? 62.466 0.552   5.096   1.00 19.98 ? 311 PRO A CD  1 
ATOM   2263 N N   . THR A 1 305 ? 60.293 3.104   3.718   1.00 17.70 ? 312 THR A N   1 
ATOM   2264 C CA  . THR A 1 305 ? 59.321 3.799   2.883   1.00 16.10 ? 312 THR A CA  1 
ATOM   2265 C C   . THR A 1 305 ? 58.368 4.670   3.713   1.00 17.25 ? 312 THR A C   1 
ATOM   2266 O O   . THR A 1 305 ? 57.655 5.493   3.156   1.00 16.78 ? 312 THR A O   1 
ATOM   2267 C CB  . THR A 1 305 ? 58.462 2.808   2.023   1.00 21.70 ? 312 THR A CB  1 
ATOM   2268 O OG1 . THR A 1 305 ? 57.570 2.064   2.869   1.00 20.02 ? 312 THR A OG1 1 
ATOM   2269 C CG2 . THR A 1 305 ? 59.360 1.838   1.249   1.00 21.31 ? 312 THR A CG2 1 
ATOM   2270 N N   . THR A 1 306 ? 58.378 4.504   5.037   1.00 17.59 ? 313 THR A N   1 
ATOM   2271 C CA  . THR A 1 306 ? 57.483 5.248   5.940   1.00 18.31 ? 313 THR A CA  1 
ATOM   2272 C C   . THR A 1 306 ? 57.509 6.789   5.899   1.00 17.93 ? 313 THR A C   1 
ATOM   2273 O O   . THR A 1 306 ? 56.460 7.425   5.760   1.00 19.25 ? 313 THR A O   1 
ATOM   2274 C CB  . THR A 1 306 ? 57.687 4.800   7.421   1.00 18.15 ? 313 THR A CB  1 
ATOM   2275 O OG1 . THR A 1 306 ? 57.522 3.378   7.522   1.00 20.99 ? 313 THR A OG1 1 
ATOM   2276 C CG2 . THR A 1 306 ? 56.664 5.472   8.341   1.00 18.79 ? 313 THR A CG2 1 
ATOM   2277 N N   . PRO A 1 307 ? 58.693 7.409   6.028   1.00 14.95 ? 314 PRO A N   1 
ATOM   2278 C CA  . PRO A 1 307 ? 58.740 8.878   5.996   1.00 18.12 ? 314 PRO A CA  1 
ATOM   2279 C C   . PRO A 1 307 ? 58.098 9.528   4.766   1.00 19.42 ? 314 PRO A C   1 
ATOM   2280 O O   . PRO A 1 307 ? 57.355 10.506  4.896   1.00 16.64 ? 314 PRO A O   1 
ATOM   2281 C CB  . PRO A 1 307 ? 60.234 9.188   6.124   1.00 16.35 ? 314 PRO A CB  1 
ATOM   2282 C CG  . PRO A 1 307 ? 60.902 7.944   5.566   1.00 16.02 ? 314 PRO A CG  1 
ATOM   2283 C CD  . PRO A 1 307 ? 60.046 6.838   6.135   1.00 13.58 ? 314 PRO A CD  1 
ATOM   2284 N N   . ASP A 1 308 ? 58.379 9.000   3.578   1.00 20.08 ? 315 ASP A N   1 
ATOM   2285 C CA  . ASP A 1 308 ? 57.785 9.562   2.364   1.00 22.66 ? 315 ASP A CA  1 
ATOM   2286 C C   . ASP A 1 308 ? 56.278 9.287   2.297   1.00 20.66 ? 315 ASP A C   1 
ATOM   2287 O O   . ASP A 1 308 ? 55.516 10.098  1.774   1.00 18.07 ? 315 ASP A O   1 
ATOM   2288 C CB  . ASP A 1 308 ? 58.481 9.005   1.115   1.00 34.44 ? 315 ASP A CB  1 
ATOM   2289 C CG  . ASP A 1 308 ? 57.868 9.524   -0.183  1.00 45.61 ? 315 ASP A CG  1 
ATOM   2290 O OD1 . ASP A 1 308 ? 56.987 8.841   -0.757  1.00 50.65 ? 315 ASP A OD1 1 
ATOM   2291 O OD2 . ASP A 1 308 ? 58.254 10.629  -0.635  1.00 56.13 ? 315 ASP A OD2 1 
ATOM   2292 N N   . TYR A 1 309 ? 55.848 8.150   2.841   1.00 17.83 ? 316 TYR A N   1 
ATOM   2293 C CA  . TYR A 1 309 ? 54.430 7.791   2.835   1.00 17.52 ? 316 TYR A CA  1 
ATOM   2294 C C   . TYR A 1 309 ? 53.610 8.695   3.753   1.00 19.15 ? 316 TYR A C   1 
ATOM   2295 O O   . TYR A 1 309 ? 52.554 9.206   3.366   1.00 19.85 ? 316 TYR A O   1 
ATOM   2296 C CB  . TYR A 1 309 ? 54.239 6.345   3.281   1.00 18.72 ? 316 TYR A CB  1 
ATOM   2297 C CG  . TYR A 1 309 ? 52.830 5.850   3.088   1.00 19.12 ? 316 TYR A CG  1 
ATOM   2298 C CD1 . TYR A 1 309 ? 52.354 5.537   1.818   1.00 25.76 ? 316 TYR A CD1 1 
ATOM   2299 C CD2 . TYR A 1 309 ? 51.975 5.687   4.170   1.00 16.21 ? 316 TYR A CD2 1 
ATOM   2300 C CE1 . TYR A 1 309 ? 51.055 5.066   1.634   1.00 28.69 ? 316 TYR A CE1 1 
ATOM   2301 C CE2 . TYR A 1 309 ? 50.681 5.222   4.003   1.00 17.70 ? 316 TYR A CE2 1 
ATOM   2302 C CZ  . TYR A 1 309 ? 50.226 4.910   2.737   1.00 25.27 ? 316 TYR A CZ  1 
ATOM   2303 O OH  . TYR A 1 309 ? 48.956 4.418   2.572   1.00 24.72 ? 316 TYR A OH  1 
ATOM   2304 N N   . LEU A 1 310 ? 54.088 8.885   4.975   1.00 15.14 ? 317 LEU A N   1 
ATOM   2305 C CA  . LEU A 1 310 ? 53.375 9.741   5.916   1.00 16.33 ? 317 LEU A CA  1 
ATOM   2306 C C   . LEU A 1 310 ? 53.299 11.172  5.373   1.00 13.95 ? 317 LEU A C   1 
ATOM   2307 O O   . LEU A 1 310 ? 52.279 11.842  5.521   1.00 17.47 ? 317 LEU A O   1 
ATOM   2308 C CB  . LEU A 1 310 ? 54.061 9.722   7.287   1.00 13.66 ? 317 LEU A CB  1 
ATOM   2309 C CG  . LEU A 1 310 ? 54.044 8.389   8.049   1.00 15.79 ? 317 LEU A CG  1 
ATOM   2310 C CD1 . LEU A 1 310 ? 54.746 8.553   9.395   1.00 16.85 ? 317 LEU A CD1 1 
ATOM   2311 C CD2 . LEU A 1 310 ? 52.605 7.923   8.254   1.00 15.31 ? 317 LEU A CD2 1 
ATOM   2312 N N   . THR A 1 311 ? 54.373 11.635  4.738   1.00 16.38 ? 318 THR A N   1 
ATOM   2313 C CA  . THR A 1 311 ? 54.396 12.981  4.179   1.00 14.08 ? 318 THR A CA  1 
ATOM   2314 C C   . THR A 1 311 ? 53.330 13.074  3.090   1.00 17.07 ? 318 THR A C   1 
ATOM   2315 O O   . THR A 1 311 ? 52.678 14.105  2.931   1.00 16.54 ? 318 THR A O   1 
ATOM   2316 C CB  . THR A 1 311 ? 55.778 13.330  3.564   1.00 16.15 ? 318 THR A CB  1 
ATOM   2317 O OG1 . THR A 1 311 ? 56.798 13.237  4.570   1.00 21.45 ? 318 THR A OG1 1 
ATOM   2318 C CG2 . THR A 1 311 ? 55.766 14.741  3.004   1.00 12.56 ? 318 THR A CG2 1 
ATOM   2319 N N   . SER A 1 312 ? 53.151 11.990  2.345   1.00 16.36 ? 319 SER A N   1 
ATOM   2320 C CA  . SER A 1 312 ? 52.145 11.975  1.287   1.00 17.60 ? 319 SER A CA  1 
ATOM   2321 C C   . SER A 1 312 ? 50.747 12.134  1.874   1.00 18.42 ? 319 SER A C   1 
ATOM   2322 O O   . SER A 1 312 ? 49.914 12.863  1.335   1.00 16.21 ? 319 SER A O   1 
ATOM   2323 C CB  . SER A 1 312 ? 52.217 10.670  0.491   1.00 20.14 ? 319 SER A CB  1 
ATOM   2324 O OG  . SER A 1 312 ? 53.410 10.620  -0.269  1.00 21.12 ? 319 SER A OG  1 
ATOM   2325 N N   . LEU A 1 313 ? 50.490 11.443  2.979   1.00 16.50 ? 320 LEU A N   1 
ATOM   2326 C CA  . LEU A 1 313 ? 49.180 11.534  3.614   1.00 19.68 ? 320 LEU A CA  1 
ATOM   2327 C C   . LEU A 1 313 ? 48.952 12.910  4.219   1.00 18.96 ? 320 LEU A C   1 
ATOM   2328 O O   . LEU A 1 313 ? 47.824 13.385  4.266   1.00 19.57 ? 320 LEU A O   1 
ATOM   2329 C CB  . LEU A 1 313 ? 49.014 10.449  4.678   1.00 19.86 ? 320 LEU A CB  1 
ATOM   2330 C CG  . LEU A 1 313 ? 48.260 9.216   4.158   1.00 24.61 ? 320 LEU A CG  1 
ATOM   2331 C CD1 . LEU A 1 313 ? 48.959 8.642   2.936   1.00 22.60 ? 320 LEU A CD1 1 
ATOM   2332 C CD2 . LEU A 1 313 ? 48.168 8.174   5.258   1.00 23.29 ? 320 LEU A CD2 1 
ATOM   2333 N N   . LEU A 1 314 ? 50.027 13.557  4.664   1.00 16.54 ? 321 LEU A N   1 
ATOM   2334 C CA  . LEU A 1 314 ? 49.911 14.886  5.247   1.00 16.13 ? 321 LEU A CA  1 
ATOM   2335 C C   . LEU A 1 314 ? 49.548 15.841  4.105   1.00 19.00 ? 321 LEU A C   1 
ATOM   2336 O O   . LEU A 1 314 ? 48.740 16.752  4.264   1.00 16.39 ? 321 LEU A O   1 
ATOM   2337 C CB  . LEU A 1 314 ? 51.241 15.302  5.888   1.00 15.97 ? 321 LEU A CB  1 
ATOM   2338 C CG  . LEU A 1 314 ? 51.306 16.656  6.607   1.00 17.72 ? 321 LEU A CG  1 
ATOM   2339 C CD1 . LEU A 1 314 ? 50.395 16.660  7.830   1.00 11.51 ? 321 LEU A CD1 1 
ATOM   2340 C CD2 . LEU A 1 314 ? 52.732 16.920  7.037   1.00 16.74 ? 321 LEU A CD2 1 
ATOM   2341 N N   . ALA A 1 315 ? 50.143 15.598  2.946   1.00 14.91 ? 322 ALA A N   1 
ATOM   2342 C CA  . ALA A 1 315 ? 49.901 16.426  1.778   1.00 20.93 ? 322 ALA A CA  1 
ATOM   2343 C C   . ALA A 1 315 ? 48.461 16.343  1.282   1.00 22.00 ? 322 ALA A C   1 
ATOM   2344 O O   . ALA A 1 315 ? 47.902 17.351  0.863   1.00 19.83 ? 322 ALA A O   1 
ATOM   2345 C CB  . ALA A 1 315 ? 50.871 16.047  0.651   1.00 16.51 ? 322 ALA A CB  1 
ATOM   2346 N N   . CYS A 1 316 ? 47.853 15.156  1.322   1.00 22.34 ? 323 CYS A N   1 
ATOM   2347 C CA  . CYS A 1 316 ? 46.477 15.033  0.843   1.00 20.93 ? 323 CYS A CA  1 
ATOM   2348 C C   . CYS A 1 316 ? 45.407 15.316  1.896   1.00 20.66 ? 323 CYS A C   1 
ATOM   2349 O O   . CYS A 1 316 ? 44.217 15.287  1.589   1.00 13.94 ? 323 CYS A O   1 
ATOM   2350 C CB  . CYS A 1 316 ? 46.233 13.656  0.215   1.00 24.48 ? 323 CYS A CB  1 
ATOM   2351 S SG  . CYS A 1 316 ? 46.311 12.259  1.340   1.00 23.86 ? 323 CYS A SG  1 
ATOM   2352 N N   . GLY A 1 317 ? 45.822 15.584  3.132   1.00 18.33 ? 324 GLY A N   1 
ATOM   2353 C CA  . GLY A 1 317 ? 44.852 15.902  4.167   1.00 13.41 ? 324 GLY A CA  1 
ATOM   2354 C C   . GLY A 1 317 ? 44.470 14.829  5.170   1.00 13.51 ? 324 GLY A C   1 
ATOM   2355 O O   . GLY A 1 317 ? 43.722 15.107  6.101   1.00 16.37 ? 324 GLY A O   1 
ATOM   2356 N N   . ASP A 1 318 ? 44.965 13.609  5.003   1.00 15.45 ? 325 ASP A N   1 
ATOM   2357 C CA  . ASP A 1 318 ? 44.631 12.555  5.949   1.00 15.03 ? 325 ASP A CA  1 
ATOM   2358 C C   . ASP A 1 318 ? 45.284 12.770  7.318   1.00 16.60 ? 325 ASP A C   1 
ATOM   2359 O O   . ASP A 1 318 ? 44.813 12.232  8.322   1.00 16.61 ? 325 ASP A O   1 
ATOM   2360 C CB  . ASP A 1 318 ? 44.991 11.182  5.370   1.00 21.52 ? 325 ASP A CB  1 
ATOM   2361 C CG  . ASP A 1 318 ? 44.018 10.739  4.273   1.00 26.79 ? 325 ASP A CG  1 
ATOM   2362 O OD1 . ASP A 1 318 ? 42.802 11.013  4.419   1.00 25.79 ? 325 ASP A OD1 1 
ATOM   2363 O OD2 . ASP A 1 318 ? 44.463 10.112  3.281   1.00 23.75 ? 325 ASP A OD2 1 
ATOM   2364 N N   . LEU A 1 319 ? 46.367 13.548  7.336   1.00 14.91 ? 326 LEU A N   1 
ATOM   2365 C CA  . LEU A 1 319 ? 47.092 13.933  8.557   1.00 14.05 ? 326 LEU A CA  1 
ATOM   2366 C C   . LEU A 1 319 ? 47.064 15.470  8.474   1.00 17.57 ? 326 LEU A C   1 
ATOM   2367 O O   . LEU A 1 319 ? 47.250 16.022  7.391   1.00 16.44 ? 326 LEU A O   1 
ATOM   2368 C CB  . LEU A 1 319 ? 48.530 13.389  8.523   1.00 15.53 ? 326 LEU A CB  1 
ATOM   2369 C CG  . LEU A 1 319 ? 48.596 11.852  8.454   1.00 14.58 ? 326 LEU A CG  1 
ATOM   2370 C CD1 . LEU A 1 319 ? 50.036 11.369  8.366   1.00 13.99 ? 326 LEU A CD1 1 
ATOM   2371 C CD2 . LEU A 1 319 ? 47.910 11.266  9.686   1.00 15.96 ? 326 LEU A CD2 1 
ATOM   2372 N N   . GLN A 1 320 ? 46.832 16.162  9.586   1.00 14.82 ? 327 GLN A N   1 
ATOM   2373 C CA  . GLN A 1 320 ? 46.705 17.615  9.525   1.00 14.25 ? 327 GLN A CA  1 
ATOM   2374 C C   . GLN A 1 320 ? 47.729 18.526  10.195  1.00 16.27 ? 327 GLN A C   1 
ATOM   2375 O O   . GLN A 1 320 ? 47.881 19.670  9.784   1.00 15.19 ? 327 GLN A O   1 
ATOM   2376 C CB  . GLN A 1 320 ? 45.325 18.026  10.037  1.00 17.12 ? 327 GLN A CB  1 
ATOM   2377 C CG  . GLN A 1 320 ? 44.164 17.234  9.463   1.00 15.76 ? 327 GLN A CG  1 
ATOM   2378 C CD  . GLN A 1 320 ? 44.225 15.772  9.857   1.00 18.67 ? 327 GLN A CD  1 
ATOM   2379 O OE1 . GLN A 1 320 ? 44.491 15.444  11.012  1.00 20.62 ? 327 GLN A OE1 1 
ATOM   2380 N NE2 . GLN A 1 320 ? 43.973 14.889  8.905   1.00 18.64 ? 327 GLN A NE2 1 
ATOM   2381 N N   . VAL A 1 321 ? 48.418 18.044  11.223  1.00 13.49 ? 328 VAL A N   1 
ATOM   2382 C CA  . VAL A 1 321 ? 49.382 18.880  11.930  1.00 15.59 ? 328 VAL A CA  1 
ATOM   2383 C C   . VAL A 1 321 ? 50.724 18.188  12.159  1.00 17.14 ? 328 VAL A C   1 
ATOM   2384 O O   . VAL A 1 321 ? 50.821 16.959  12.093  1.00 15.84 ? 328 VAL A O   1 
ATOM   2385 C CB  . VAL A 1 321 ? 48.814 19.303  13.301  1.00 16.32 ? 328 VAL A CB  1 
ATOM   2386 C CG1 . VAL A 1 321 ? 47.571 20.167  13.120  1.00 12.39 ? 328 VAL A CG1 1 
ATOM   2387 C CG2 . VAL A 1 321 ? 48.466 18.062  14.112  1.00 14.24 ? 328 VAL A CG2 1 
ATOM   2388 N N   . THR A 1 322 ? 51.757 18.985  12.426  1.00 16.38 ? 329 THR A N   1 
ATOM   2389 C CA  . THR A 1 322 ? 53.092 18.450  12.687  1.00 13.32 ? 329 THR A CA  1 
ATOM   2390 C C   . THR A 1 322 ? 53.618 18.889  14.053  1.00 17.25 ? 329 THR A C   1 
ATOM   2391 O O   . THR A 1 322 ? 53.452 20.043  14.465  1.00 14.49 ? 329 THR A O   1 
ATOM   2392 C CB  . THR A 1 322 ? 54.122 18.902  11.621  1.00 18.15 ? 329 THR A CB  1 
ATOM   2393 O OG1 . THR A 1 322 ? 54.258 20.330  11.652  1.00 16.57 ? 329 THR A OG1 1 
ATOM   2394 C CG2 . THR A 1 322 ? 53.701 18.440  10.229  1.00 15.42 ? 329 THR A CG2 1 
ATOM   2395 N N   . GLY A 1 323 ? 54.252 17.956  14.753  1.00 16.52 ? 330 GLY A N   1 
ATOM   2396 C CA  . GLY A 1 323 ? 54.825 18.252  16.052  1.00 10.35 ? 330 GLY A CA  1 
ATOM   2397 C C   . GLY A 1 323 ? 56.243 17.705  16.096  1.00 11.48 ? 330 GLY A C   1 
ATOM   2398 O O   . GLY A 1 323 ? 56.757 17.209  15.083  1.00 9.90  ? 330 GLY A O   1 
ATOM   2399 N N   . SER A 1 324 ? 56.887 17.797  17.257  1.00 10.44 ? 331 SER A N   1 
ATOM   2400 C CA  . SER A 1 324 ? 58.242 17.287  17.403  1.00 10.50 ? 331 SER A CA  1 
ATOM   2401 C C   . SER A 1 324 ? 58.315 16.146  18.411  1.00 12.22 ? 331 SER A C   1 
ATOM   2402 O O   . SER A 1 324 ? 59.137 15.249  18.274  1.00 10.46 ? 331 SER A O   1 
ATOM   2403 C CB  . SER A 1 324 ? 59.195 18.400  17.852  1.00 15.98 ? 331 SER A CB  1 
ATOM   2404 O OG  . SER A 1 324 ? 58.961 18.778  19.202  1.00 14.28 ? 331 SER A OG  1 
ATOM   2405 N N   . GLY A 1 325 ? 57.449 16.180  19.418  1.00 9.97  ? 332 GLY A N   1 
ATOM   2406 C CA  . GLY A 1 325 ? 57.490 15.166  20.454  1.00 12.96 ? 332 GLY A CA  1 
ATOM   2407 C C   . GLY A 1 325 ? 58.817 15.311  21.185  1.00 13.03 ? 332 GLY A C   1 
ATOM   2408 O O   . GLY A 1 325 ? 59.294 14.383  21.832  1.00 15.07 ? 332 GLY A O   1 
ATOM   2409 N N   . HIS A 1 326 ? 59.403 16.504  21.085  1.00 12.23 ? 333 HIS A N   1 
ATOM   2410 C CA  . HIS A 1 326 ? 60.703 16.810  21.684  1.00 14.88 ? 333 HIS A CA  1 
ATOM   2411 C C   . HIS A 1 326 ? 60.881 16.487  23.168  1.00 13.48 ? 333 HIS A C   1 
ATOM   2412 O O   . HIS A 1 326 ? 60.181 17.026  24.025  1.00 18.64 ? 333 HIS A O   1 
ATOM   2413 C CB  . HIS A 1 326 ? 61.038 18.288  21.465  1.00 15.92 ? 333 HIS A CB  1 
ATOM   2414 C CG  . HIS A 1 326 ? 62.450 18.638  21.794  1.00 14.58 ? 333 HIS A CG  1 
ATOM   2415 N ND1 . HIS A 1 326 ? 63.465 18.587  20.864  1.00 15.38 ? 333 HIS A ND1 1 
ATOM   2416 C CD2 . HIS A 1 326 ? 63.033 18.990  22.968  1.00 12.87 ? 333 HIS A CD2 1 
ATOM   2417 C CE1 . HIS A 1 326 ? 64.611 18.891  21.447  1.00 18.09 ? 333 HIS A CE1 1 
ATOM   2418 N NE2 . HIS A 1 326 ? 64.374 19.138  22.726  1.00 17.45 ? 333 HIS A NE2 1 
ATOM   2419 N N   . CYS A 1 327 ? 61.823 15.598  23.460  1.00 16.50 ? 334 CYS A N   1 
ATOM   2420 C CA  . CYS A 1 327 ? 62.158 15.226  24.837  1.00 17.17 ? 334 CYS A CA  1 
ATOM   2421 C C   . CYS A 1 327 ? 63.367 14.310  24.832  1.00 21.47 ? 334 CYS A C   1 
ATOM   2422 O O   . CYS A 1 327 ? 63.304 13.160  25.270  1.00 19.91 ? 334 CYS A O   1 
ATOM   2423 C CB  . CYS A 1 327 ? 60.981 14.554  25.553  1.00 18.84 ? 334 CYS A CB  1 
ATOM   2424 S SG  . CYS A 1 327 ? 60.235 13.164  24.704  1.00 15.35 ? 334 CYS A SG  1 
ATOM   2425 N N   . PRO A 1 328 ? 64.497 14.818  24.318  1.00 20.86 ? 335 PRO A N   1 
ATOM   2426 C CA  . PRO A 1 328 ? 65.725 14.028  24.258  1.00 20.87 ? 335 PRO A CA  1 
ATOM   2427 C C   . PRO A 1 328 ? 66.378 13.925  25.626  1.00 19.46 ? 335 PRO A C   1 
ATOM   2428 O O   . PRO A 1 328 ? 66.085 14.720  26.517  1.00 19.71 ? 335 PRO A O   1 
ATOM   2429 C CB  . PRO A 1 328 ? 66.579 14.813  23.273  1.00 22.41 ? 335 PRO A CB  1 
ATOM   2430 C CG  . PRO A 1 328 ? 66.224 16.235  23.620  1.00 20.81 ? 335 PRO A CG  1 
ATOM   2431 C CD  . PRO A 1 328 ? 64.711 16.168  23.755  1.00 19.58 ? 335 PRO A CD  1 
ATOM   2432 N N   . TYR A 1 329 ? 67.232 12.919  25.783  1.00 18.31 ? 336 TYR A N   1 
ATOM   2433 C CA  . TYR A 1 329 ? 67.995 12.698  27.010  1.00 17.66 ? 336 TYR A CA  1 
ATOM   2434 C C   . TYR A 1 329 ? 69.444 12.533  26.559  1.00 21.10 ? 336 TYR A C   1 
ATOM   2435 O O   . TYR A 1 329 ? 69.707 12.065  25.438  1.00 17.63 ? 336 TYR A O   1 
ATOM   2436 C CB  . TYR A 1 329 ? 67.531 11.437  27.755  1.00 17.31 ? 336 TYR A CB  1 
ATOM   2437 C CG  . TYR A 1 329 ? 66.140 11.544  28.344  1.00 17.47 ? 336 TYR A CG  1 
ATOM   2438 C CD1 . TYR A 1 329 ? 65.016 11.406  27.542  1.00 16.14 ? 336 TYR A CD1 1 
ATOM   2439 C CD2 . TYR A 1 329 ? 65.949 11.838  29.700  1.00 20.64 ? 336 TYR A CD2 1 
ATOM   2440 C CE1 . TYR A 1 329 ? 63.736 11.556  28.062  1.00 16.15 ? 336 TYR A CE1 1 
ATOM   2441 C CE2 . TYR A 1 329 ? 64.668 11.996  30.229  1.00 16.73 ? 336 TYR A CE2 1 
ATOM   2442 C CZ  . TYR A 1 329 ? 63.569 11.852  29.399  1.00 14.61 ? 336 TYR A CZ  1 
ATOM   2443 O OH  . TYR A 1 329 ? 62.302 12.004  29.895  1.00 16.74 ? 336 TYR A OH  1 
ATOM   2444 N N   . SER A 1 330 ? 70.384 12.929  27.411  1.00 16.59 ? 337 SER A N   1 
ATOM   2445 C CA  . SER A 1 330 ? 71.793 12.835  27.061  1.00 18.56 ? 337 SER A CA  1 
ATOM   2446 C C   . SER A 1 330 ? 72.254 11.389  27.026  1.00 16.63 ? 337 SER A C   1 
ATOM   2447 O O   . SER A 1 330 ? 71.582 10.498  27.536  1.00 15.40 ? 337 SER A O   1 
ATOM   2448 C CB  . SER A 1 330 ? 72.646 13.607  28.067  1.00 17.95 ? 337 SER A CB  1 
ATOM   2449 O OG  . SER A 1 330 ? 72.639 12.947  29.318  1.00 22.90 ? 337 SER A OG  1 
ATOM   2450 N N   . THR A 1 331 ? 73.405 11.162  26.408  1.00 20.60 ? 338 THR A N   1 
ATOM   2451 C CA  . THR A 1 331 ? 73.971 9.821   26.330  1.00 23.51 ? 338 THR A CA  1 
ATOM   2452 C C   . THR A 1 331 ? 74.127 9.263   27.748  1.00 21.76 ? 338 THR A C   1 
ATOM   2453 O O   . THR A 1 331 ? 73.878 8.081   27.992  1.00 23.68 ? 338 THR A O   1 
ATOM   2454 C CB  . THR A 1 331 ? 75.350 9.850   25.648  1.00 25.49 ? 338 THR A CB  1 
ATOM   2455 O OG1 . THR A 1 331 ? 75.221 10.414  24.338  1.00 23.61 ? 338 THR A OG1 1 
ATOM   2456 C CG2 . THR A 1 331 ? 75.921 8.436   25.540  1.00 28.28 ? 338 THR A CG2 1 
ATOM   2457 N N   . ALA A 1 332 ? 74.530 10.118  28.687  1.00 17.42 ? 339 ALA A N   1 
ATOM   2458 C CA  . ALA A 1 332 ? 74.706 9.686   30.073  1.00 19.18 ? 339 ALA A CA  1 
ATOM   2459 C C   . ALA A 1 332 ? 73.388 9.176   30.649  1.00 21.09 ? 339 ALA A C   1 
ATOM   2460 O O   . ALA A 1 332 ? 73.352 8.138   31.316  1.00 21.15 ? 339 ALA A O   1 
ATOM   2461 C CB  . ALA A 1 332 ? 75.245 10.834  30.920  1.00 19.13 ? 339 ALA A CB  1 
ATOM   2462 N N   . GLN A 1 333 ? 72.303 9.903   30.383  1.00 19.28 ? 340 GLN A N   1 
ATOM   2463 C CA  . GLN A 1 333 ? 70.985 9.509   30.873  1.00 16.08 ? 340 GLN A CA  1 
ATOM   2464 C C   . GLN A 1 333 ? 70.500 8.251   30.147  1.00 19.57 ? 340 GLN A C   1 
ATOM   2465 O O   . GLN A 1 333 ? 69.941 7.349   30.768  1.00 21.01 ? 340 GLN A O   1 
ATOM   2466 C CB  . GLN A 1 333 ? 69.973 10.638  30.659  1.00 18.60 ? 340 GLN A CB  1 
ATOM   2467 C CG  . GLN A 1 333 ? 70.287 11.942  31.388  1.00 17.65 ? 340 GLN A CG  1 
ATOM   2468 C CD  . GLN A 1 333 ? 69.247 13.005  31.102  1.00 18.40 ? 340 GLN A CD  1 
ATOM   2469 O OE1 . GLN A 1 333 ? 69.039 13.388  29.950  1.00 14.64 ? 340 GLN A OE1 1 
ATOM   2470 N NE2 . GLN A 1 333 ? 68.577 13.478  32.147  1.00 17.54 ? 340 GLN A NE2 1 
ATOM   2471 N N   . LYS A 1 334 ? 70.711 8.207   28.833  1.00 18.96 ? 341 LYS A N   1 
ATOM   2472 C CA  . LYS A 1 334 ? 70.297 7.063   28.021  1.00 23.98 ? 341 LYS A CA  1 
ATOM   2473 C C   . LYS A 1 334 ? 71.002 5.799   28.506  1.00 23.47 ? 341 LYS A C   1 
ATOM   2474 O O   . LYS A 1 334 ? 70.387 4.740   28.597  1.00 26.00 ? 341 LYS A O   1 
ATOM   2475 C CB  . LYS A 1 334 ? 70.646 7.283   26.536  1.00 19.68 ? 341 LYS A CB  1 
ATOM   2476 C CG  . LYS A 1 334 ? 69.781 8.299   25.791  1.00 25.34 ? 341 LYS A CG  1 
ATOM   2477 C CD  . LYS A 1 334 ? 68.377 7.776   25.508  1.00 22.37 ? 341 LYS A CD  1 
ATOM   2478 C CE  . LYS A 1 334 ? 67.576 8.794   24.696  1.00 24.79 ? 341 LYS A CE  1 
ATOM   2479 N NZ  . LYS A 1 334 ? 66.203 8.308   24.343  1.00 21.05 ? 341 LYS A NZ  1 
ATOM   2480 N N   . ALA A 1 335 ? 72.294 5.929   28.802  1.00 21.15 ? 342 ALA A N   1 
ATOM   2481 C CA  . ALA A 1 335 ? 73.118 4.818   29.261  1.00 24.41 ? 342 ALA A CA  1 
ATOM   2482 C C   . ALA A 1 335 ? 72.581 4.064   30.474  1.00 23.37 ? 342 ALA A C   1 
ATOM   2483 O O   . ALA A 1 335 ? 73.040 2.967   30.766  1.00 24.93 ? 342 ALA A O   1 
ATOM   2484 C CB  . ALA A 1 335 ? 74.539 5.313   29.547  1.00 21.20 ? 342 ALA A CB  1 
ATOM   2485 N N   . VAL A 1 336 ? 71.623 4.639   31.191  1.00 26.53 ? 343 VAL A N   1 
ATOM   2486 C CA  . VAL A 1 336 ? 71.064 3.956   32.362  1.00 27.15 ? 343 VAL A CA  1 
ATOM   2487 C C   . VAL A 1 336 ? 70.467 2.601   31.979  1.00 29.82 ? 343 VAL A C   1 
ATOM   2488 O O   . VAL A 1 336 ? 70.163 1.779   32.840  1.00 31.86 ? 343 VAL A O   1 
ATOM   2489 C CB  . VAL A 1 336 ? 70.007 4.816   33.022  1.00 29.79 ? 343 VAL A CB  1 
ATOM   2490 N N   . GLY A 1 337 ? 70.288 2.359   30.687  1.00 30.65 ? 344 GLY A N   1 
ATOM   2491 C CA  . GLY A 1 337 ? 69.740 1.079   30.275  1.00 30.11 ? 344 GLY A CA  1 
ATOM   2492 C C   . GLY A 1 337 ? 70.627 0.384   29.265  1.00 28.74 ? 344 GLY A C   1 
ATOM   2493 O O   . GLY A 1 337 ? 70.140 -0.384  28.442  1.00 25.59 ? 344 GLY A O   1 
ATOM   2494 N N   . LYS A 1 338 ? 71.927 0.652   29.338  1.00 26.54 ? 345 LYS A N   1 
ATOM   2495 C CA  . LYS A 1 338 ? 72.882 0.044   28.426  1.00 33.12 ? 345 LYS A CA  1 
ATOM   2496 C C   . LYS A 1 338 ? 72.716 -1.471  28.347  1.00 33.23 ? 345 LYS A C   1 
ATOM   2497 O O   . LYS A 1 338 ? 73.115 -2.095  27.363  1.00 32.90 ? 345 LYS A O   1 
ATOM   2498 C CB  . LYS A 1 338 ? 74.315 0.385   28.849  1.00 34.41 ? 345 LYS A CB  1 
ATOM   2499 C CG  . LYS A 1 338 ? 74.689 -0.019  30.275  1.00 36.30 ? 345 LYS A CG  1 
ATOM   2500 C CD  . LYS A 1 338 ? 76.149 0.364   30.573  1.00 39.47 ? 345 LYS A CD  1 
ATOM   2501 C CE  . LYS A 1 338 ? 76.670 -0.272  31.867  1.00 38.70 ? 345 LYS A CE  1 
ATOM   2502 N NZ  . LYS A 1 338 ? 76.012 0.245   33.096  1.00 42.16 ? 345 LYS A NZ  1 
ATOM   2503 N N   . ASP A 1 339 ? 72.118 -2.065  29.372  1.00 34.29 ? 346 ASP A N   1 
ATOM   2504 C CA  . ASP A 1 339 ? 71.927 -3.511  29.377  1.00 38.65 ? 346 ASP A CA  1 
ATOM   2505 C C   . ASP A 1 339 ? 70.500 -3.899  29.023  1.00 39.60 ? 346 ASP A C   1 
ATOM   2506 O O   . ASP A 1 339 ? 70.282 -4.723  28.151  1.00 47.35 ? 346 ASP A O   1 
ATOM   2507 C CB  . ASP A 1 339 ? 72.295 -4.087  30.743  1.00 38.84 ? 346 ASP A CB  1 
ATOM   2508 C CG  . ASP A 1 339 ? 73.732 -3.771  31.142  1.00 43.62 ? 346 ASP A CG  1 
ATOM   2509 O OD1 . ASP A 1 339 ? 74.641 -3.951  30.291  1.00 34.99 ? 346 ASP A OD1 1 
ATOM   2510 O OD2 . ASP A 1 339 ? 73.949 -3.351  32.313  1.00 43.85 ? 346 ASP A OD2 1 
ATOM   2511 N N   . ASN A 1 340 ? 69.528 -3.293  29.689  1.00 36.99 ? 347 ASN A N   1 
ATOM   2512 C CA  . ASN A 1 340 ? 68.123 -3.588  29.443  1.00 31.13 ? 347 ASN A CA  1 
ATOM   2513 C C   . ASN A 1 340 ? 67.512 -2.465  28.592  1.00 30.06 ? 347 ASN A C   1 
ATOM   2514 O O   . ASN A 1 340 ? 67.433 -1.327  29.044  1.00 29.94 ? 347 ASN A O   1 
ATOM   2515 C CB  . ASN A 1 340 ? 67.408 -3.678  30.790  1.00 32.85 ? 347 ASN A CB  1 
ATOM   2516 C CG  . ASN A 1 340 ? 66.004 -4.194  30.668  1.00 33.42 ? 347 ASN A CG  1 
ATOM   2517 O OD1 . ASN A 1 340 ? 65.302 -3.892  29.705  1.00 30.66 ? 347 ASN A OD1 1 
ATOM   2518 N ND2 . ASN A 1 340 ? 65.572 -4.972  31.662  1.00 34.78 ? 347 ASN A ND2 1 
ATOM   2519 N N   . PHE A 1 341 ? 67.067 -2.769  27.372  1.00 26.68 ? 348 PHE A N   1 
ATOM   2520 C CA  . PHE A 1 341 ? 66.492 -1.726  26.523  1.00 25.59 ? 348 PHE A CA  1 
ATOM   2521 C C   . PHE A 1 341 ? 65.219 -1.103  27.102  1.00 24.15 ? 348 PHE A C   1 
ATOM   2522 O O   . PHE A 1 341 ? 64.861 0.021   26.752  1.00 19.78 ? 348 PHE A O   1 
ATOM   2523 C CB  . PHE A 1 341 ? 66.230 -2.258  25.100  1.00 27.13 ? 348 PHE A CB  1 
ATOM   2524 C CG  . PHE A 1 341 ? 65.096 -3.257  25.002  1.00 26.61 ? 348 PHE A CG  1 
ATOM   2525 C CD1 . PHE A 1 341 ? 63.770 -2.830  24.994  1.00 21.53 ? 348 PHE A CD1 1 
ATOM   2526 C CD2 . PHE A 1 341 ? 65.365 -4.625  24.899  1.00 24.43 ? 348 PHE A CD2 1 
ATOM   2527 C CE1 . PHE A 1 341 ? 62.719 -3.753  24.880  1.00 22.99 ? 348 PHE A CE1 1 
ATOM   2528 C CE2 . PHE A 1 341 ? 64.326 -5.558  24.786  1.00 22.23 ? 348 PHE A CE2 1 
ATOM   2529 C CZ  . PHE A 1 341 ? 62.998 -5.120  24.777  1.00 24.09 ? 348 PHE A CZ  1 
ATOM   2530 N N   . THR A 1 342 ? 64.543 -1.817  27.999  1.00 22.33 ? 349 THR A N   1 
ATOM   2531 C CA  . THR A 1 342 ? 63.318 -1.297  28.594  1.00 22.84 ? 349 THR A CA  1 
ATOM   2532 C C   . THR A 1 342 ? 63.592 -0.279  29.691  1.00 23.18 ? 349 THR A C   1 
ATOM   2533 O O   . THR A 1 342 ? 62.664 0.274   30.269  1.00 22.77 ? 349 THR A O   1 
ATOM   2534 C CB  . THR A 1 342 ? 62.454 -2.414  29.196  1.00 26.81 ? 349 THR A CB  1 
ATOM   2535 O OG1 . THR A 1 342 ? 63.022 -2.851  30.439  1.00 29.32 ? 349 THR A OG1 1 
ATOM   2536 C CG2 . THR A 1 342 ? 62.378 -3.592  28.232  1.00 30.78 ? 349 THR A CG2 1 
ATOM   2537 N N   . LEU A 1 343 ? 64.864 -0.038  29.985  1.00 24.25 ? 350 LEU A N   1 
ATOM   2538 C CA  . LEU A 1 343 ? 65.225 0.925   31.015  1.00 22.10 ? 350 LEU A CA  1 
ATOM   2539 C C   . LEU A 1 343 ? 65.790 2.199   30.377  1.00 23.96 ? 350 LEU A C   1 
ATOM   2540 O O   . LEU A 1 343 ? 66.330 3.076   31.067  1.00 16.63 ? 350 LEU A O   1 
ATOM   2541 C CB  . LEU A 1 343 ? 66.254 0.310   31.969  1.00 23.85 ? 350 LEU A CB  1 
ATOM   2542 C CG  . LEU A 1 343 ? 65.824 -0.966  32.696  1.00 24.40 ? 350 LEU A CG  1 
ATOM   2543 C CD1 . LEU A 1 343 ? 66.984 -1.528  33.488  1.00 27.21 ? 350 LEU A CD1 1 
ATOM   2544 C CD2 . LEU A 1 343 ? 64.653 -0.666  33.610  1.00 22.87 ? 350 LEU A CD2 1 
ATOM   2545 N N   . ILE A 1 344 ? 65.688 2.287   29.052  1.00 23.07 ? 351 ILE A N   1 
ATOM   2546 C CA  . ILE A 1 344 ? 66.187 3.456   28.334  1.00 21.49 ? 351 ILE A CA  1 
ATOM   2547 C C   . ILE A 1 344 ? 65.136 4.562   28.356  1.00 21.70 ? 351 ILE A C   1 
ATOM   2548 O O   . ILE A 1 344 ? 63.988 4.335   27.993  1.00 24.10 ? 351 ILE A O   1 
ATOM   2549 C CB  . ILE A 1 344 ? 66.504 3.135   26.849  1.00 23.93 ? 351 ILE A CB  1 
ATOM   2550 C CG1 . ILE A 1 344 ? 67.578 2.050   26.750  1.00 21.73 ? 351 ILE A CG1 1 
ATOM   2551 C CG2 . ILE A 1 344 ? 66.996 4.400   26.136  1.00 20.40 ? 351 ILE A CG2 1 
ATOM   2552 C CD1 . ILE A 1 344 ? 67.958 1.709   25.311  1.00 23.06 ? 351 ILE A CD1 1 
ATOM   2553 N N   . PRO A 1 345 ? 65.515 5.778   28.783  1.00 22.58 ? 352 PRO A N   1 
ATOM   2554 C CA  . PRO A 1 345 ? 64.542 6.881   28.818  1.00 20.70 ? 352 PRO A CA  1 
ATOM   2555 C C   . PRO A 1 345 ? 64.056 7.142   27.385  1.00 20.72 ? 352 PRO A C   1 
ATOM   2556 O O   . PRO A 1 345 ? 64.861 7.169   26.455  1.00 17.19 ? 352 PRO A O   1 
ATOM   2557 C CB  . PRO A 1 345 ? 65.355 8.065   29.363  1.00 24.01 ? 352 PRO A CB  1 
ATOM   2558 C CG  . PRO A 1 345 ? 66.567 7.438   29.993  1.00 27.44 ? 352 PRO A CG  1 
ATOM   2559 C CD  . PRO A 1 345 ? 66.866 6.238   29.147  1.00 21.70 ? 352 PRO A CD  1 
ATOM   2560 N N   . GLU A 1 346 ? 62.750 7.337   27.216  1.00 18.71 ? 353 GLU A N   1 
ATOM   2561 C CA  . GLU A 1 346 ? 62.166 7.570   25.894  1.00 20.36 ? 353 GLU A CA  1 
ATOM   2562 C C   . GLU A 1 346 ? 62.136 9.043   25.477  1.00 19.73 ? 353 GLU A C   1 
ATOM   2563 O O   . GLU A 1 346 ? 61.708 9.910   26.246  1.00 17.23 ? 353 GLU A O   1 
ATOM   2564 C CB  . GLU A 1 346 ? 60.743 7.001   25.844  1.00 17.18 ? 353 GLU A CB  1 
ATOM   2565 C CG  . GLU A 1 346 ? 60.646 5.543   26.280  1.00 27.13 ? 353 GLU A CG  1 
ATOM   2566 C CD  . GLU A 1 346 ? 59.212 5.005   26.272  1.00 24.14 ? 353 GLU A CD  1 
ATOM   2567 O OE1 . GLU A 1 346 ? 58.276 5.765   26.606  1.00 24.24 ? 353 GLU A OE1 1 
ATOM   2568 O OE2 . GLU A 1 346 ? 59.027 3.812   25.948  1.00 25.75 ? 353 GLU A OE2 1 
ATOM   2569 N N   . GLY A 1 347 ? 62.596 9.314   24.255  1.00 16.87 ? 354 GLY A N   1 
ATOM   2570 C CA  . GLY A 1 347 ? 62.599 10.675  23.749  1.00 16.43 ? 354 GLY A CA  1 
ATOM   2571 C C   . GLY A 1 347 ? 63.675 10.957  22.718  1.00 20.29 ? 354 GLY A C   1 
ATOM   2572 O O   . GLY A 1 347 ? 64.800 10.461  22.826  1.00 18.33 ? 354 GLY A O   1 
ATOM   2573 N N   . VAL A 1 348 ? 63.319 11.763  21.718  1.00 18.41 ? 355 VAL A N   1 
ATOM   2574 C CA  . VAL A 1 348 ? 64.224 12.163  20.642  1.00 15.52 ? 355 VAL A CA  1 
ATOM   2575 C C   . VAL A 1 348 ? 64.071 13.673  20.457  1.00 18.59 ? 355 VAL A C   1 
ATOM   2576 O O   . VAL A 1 348 ? 63.134 14.276  20.983  1.00 14.69 ? 355 VAL A O   1 
ATOM   2577 C CB  . VAL A 1 348 ? 63.854 11.482  19.306  1.00 17.59 ? 355 VAL A CB  1 
ATOM   2578 C CG1 . VAL A 1 348 ? 64.083 9.973   19.393  1.00 17.44 ? 355 VAL A CG1 1 
ATOM   2579 C CG2 . VAL A 1 348 ? 62.391 11.780  18.975  1.00 17.53 ? 355 VAL A CG2 1 
ATOM   2580 N N   . ASN A 1 349 ? 64.985 14.278  19.704  1.00 14.91 ? 356 ASN A N   1 
ATOM   2581 C CA  . ASN A 1 349 ? 64.942 15.712  19.451  1.00 17.91 ? 356 ASN A CA  1 
ATOM   2582 C C   . ASN A 1 349 ? 64.086 16.017  18.227  1.00 19.27 ? 356 ASN A C   1 
ATOM   2583 O O   . ASN A 1 349 ? 63.646 15.108  17.516  1.00 16.99 ? 356 ASN A O   1 
ATOM   2584 C CB  . ASN A 1 349 ? 66.344 16.249  19.175  1.00 16.51 ? 356 ASN A CB  1 
ATOM   2585 C CG  . ASN A 1 349 ? 66.924 15.701  17.877  1.00 20.39 ? 356 ASN A CG  1 
ATOM   2586 O OD1 . ASN A 1 349 ? 67.344 14.548  17.810  1.00 8.94  ? 356 ASN A OD1 1 
ATOM   2587 N ND2 . ASN A 1 349 ? 66.927 16.527  16.833  1.00 15.04 ? 356 ASN A ND2 1 
ATOM   2588 N N   . GLY A 1 350 ? 63.878 17.307  17.978  1.00 20.45 ? 357 GLY A N   1 
ATOM   2589 C CA  . GLY A 1 350 ? 63.110 17.715  16.818  1.00 17.10 ? 357 GLY A CA  1 
ATOM   2590 C C   . GLY A 1 350 ? 62.447 19.077  16.894  1.00 15.98 ? 357 GLY A C   1 
ATOM   2591 O O   . GLY A 1 350 ? 61.973 19.587  15.876  1.00 17.57 ? 357 GLY A O   1 
ATOM   2592 N N   . ILE A 1 351 ? 62.417 19.682  18.078  1.00 13.62 ? 358 ILE A N   1 
ATOM   2593 C CA  . ILE A 1 351 ? 61.754 20.969  18.223  1.00 11.09 ? 358 ILE A CA  1 
ATOM   2594 C C   . ILE A 1 351 ? 62.388 22.047  17.351  1.00 15.69 ? 358 ILE A C   1 
ATOM   2595 O O   . ILE A 1 351 ? 61.688 22.890  16.803  1.00 15.52 ? 358 ILE A O   1 
ATOM   2596 C CB  . ILE A 1 351 ? 61.706 21.412  19.708  1.00 10.53 ? 358 ILE A CB  1 
ATOM   2597 C CG1 . ILE A 1 351 ? 60.741 22.587  19.867  1.00 9.06  ? 358 ILE A CG1 1 
ATOM   2598 C CG2 . ILE A 1 351 ? 63.095 21.785  20.209  1.00 9.91  ? 358 ILE A CG2 1 
ATOM   2599 C CD1 . ILE A 1 351 ? 60.527 23.005  21.316  1.00 14.28 ? 358 ILE A CD1 1 
ATOM   2600 N N   . GLU A 1 352 ? 63.708 22.003  17.200  1.00 15.42 ? 359 GLU A N   1 
ATOM   2601 C CA  . GLU A 1 352 ? 64.405 22.978  16.372  1.00 14.92 ? 359 GLU A CA  1 
ATOM   2602 C C   . GLU A 1 352 ? 64.287 22.626  14.884  1.00 15.84 ? 359 GLU A C   1 
ATOM   2603 O O   . GLU A 1 352 ? 64.089 23.498  14.037  1.00 15.61 ? 359 GLU A O   1 
ATOM   2604 C CB  . GLU A 1 352 ? 65.889 23.031  16.750  1.00 16.31 ? 359 GLU A CB  1 
ATOM   2605 C CG  . GLU A 1 352 ? 66.659 24.173  16.082  1.00 21.62 ? 359 GLU A CG  1 
ATOM   2606 C CD  . GLU A 1 352 ? 68.175 24.035  16.220  1.00 25.78 ? 359 GLU A CD  1 
ATOM   2607 O OE1 . GLU A 1 352 ? 68.665 23.649  17.307  1.00 25.22 ? 359 GLU A OE1 1 
ATOM   2608 O OE2 . GLU A 1 352 ? 68.879 24.326  15.236  1.00 29.88 ? 359 GLU A OE2 1 
ATOM   2609 N N   . GLU A 1 353 ? 64.393 21.339  14.573  1.00 15.65 ? 360 GLU A N   1 
ATOM   2610 C CA  . GLU A 1 353 ? 64.352 20.888  13.187  1.00 19.52 ? 360 GLU A CA  1 
ATOM   2611 C C   . GLU A 1 353 ? 62.981 20.763  12.485  1.00 17.36 ? 360 GLU A C   1 
ATOM   2612 O O   . GLU A 1 353 ? 62.918 20.760  11.256  1.00 19.21 ? 360 GLU A O   1 
ATOM   2613 C CB  . GLU A 1 353 ? 65.095 19.553  13.083  1.00 17.22 ? 360 GLU A CB  1 
ATOM   2614 C CG  . GLU A 1 353 ? 66.560 19.573  13.544  1.00 17.83 ? 360 GLU A CG  1 
ATOM   2615 C CD  . GLU A 1 353 ? 66.737 19.438  15.059  1.00 21.14 ? 360 GLU A CD  1 
ATOM   2616 O OE1 . GLU A 1 353 ? 65.798 18.972  15.750  1.00 17.74 ? 360 GLU A OE1 1 
ATOM   2617 O OE2 . GLU A 1 353 ? 67.829 19.785  15.562  1.00 17.31 ? 360 GLU A OE2 1 
ATOM   2618 N N   . ARG A 1 354 ? 61.894 20.684  13.246  1.00 15.84 ? 361 ARG A N   1 
ATOM   2619 C CA  . ARG A 1 354 ? 60.556 20.502  12.663  1.00 17.31 ? 361 ARG A CA  1 
ATOM   2620 C C   . ARG A 1 354 ? 60.209 21.199  11.335  1.00 15.01 ? 361 ARG A C   1 
ATOM   2621 O O   . ARG A 1 354 ? 60.011 20.542  10.317  1.00 13.20 ? 361 ARG A O   1 
ATOM   2622 C CB  . ARG A 1 354 ? 59.471 20.853  13.684  1.00 15.62 ? 361 ARG A CB  1 
ATOM   2623 C CG  . ARG A 1 354 ? 58.044 20.557  13.180  1.00 14.99 ? 361 ARG A CG  1 
ATOM   2624 C CD  . ARG A 1 354 ? 56.998 20.826  14.256  1.00 13.51 ? 361 ARG A CD  1 
ATOM   2625 N NE  . ARG A 1 354 ? 56.955 22.233  14.655  1.00 15.01 ? 361 ARG A NE  1 
ATOM   2626 C CZ  . ARG A 1 354 ? 56.056 23.111  14.223  1.00 20.62 ? 361 ARG A CZ  1 
ATOM   2627 N NH1 . ARG A 1 354 ? 55.106 22.738  13.369  1.00 14.79 ? 361 ARG A NH1 1 
ATOM   2628 N NH2 . ARG A 1 354 ? 56.103 24.364  14.650  1.00 18.93 ? 361 ARG A NH2 1 
ATOM   2629 N N   . MET A 1 355 ? 60.121 22.521  11.342  1.00 11.89 ? 362 MET A N   1 
ATOM   2630 C CA  . MET A 1 355 ? 59.745 23.228  10.123  1.00 17.35 ? 362 MET A CA  1 
ATOM   2631 C C   . MET A 1 355 ? 60.703 23.002  8.950   1.00 16.22 ? 362 MET A C   1 
ATOM   2632 O O   . MET A 1 355 ? 60.256 22.856  7.817   1.00 15.32 ? 362 MET A O   1 
ATOM   2633 C CB  . MET A 1 355 ? 59.551 24.722  10.414  1.00 18.82 ? 362 MET A CB  1 
ATOM   2634 C CG  . MET A 1 355 ? 58.232 25.027  11.145  1.00 12.81 ? 362 MET A CG  1 
ATOM   2635 S SD  . MET A 1 355 ? 58.101 26.740  11.656  1.00 17.10 ? 362 MET A SD  1 
ATOM   2636 C CE  . MET A 1 355 ? 57.179 27.397  10.302  1.00 18.06 ? 362 MET A CE  1 
ATOM   2637 N N   . THR A 1 356 ? 62.004 22.942  9.226   1.00 14.81 ? 363 THR A N   1 
ATOM   2638 C CA  . THR A 1 356 ? 62.998 22.704  8.174   1.00 16.35 ? 363 THR A CA  1 
ATOM   2639 C C   . THR A 1 356 ? 62.822 21.308  7.573   1.00 17.31 ? 363 THR A C   1 
ATOM   2640 O O   . THR A 1 356 ? 62.840 21.143  6.348   1.00 16.61 ? 363 THR A O   1 
ATOM   2641 C CB  . THR A 1 356 ? 64.436 22.835  8.718   1.00 17.46 ? 363 THR A CB  1 
ATOM   2642 O OG1 . THR A 1 356 ? 64.641 24.171  9.188   1.00 20.63 ? 363 THR A OG1 1 
ATOM   2643 C CG2 . THR A 1 356 ? 65.457 22.534  7.624   1.00 16.21 ? 363 THR A CG2 1 
ATOM   2644 N N   . VAL A 1 357 ? 62.649 20.308  8.439   1.00 16.49 ? 364 VAL A N   1 
ATOM   2645 C CA  . VAL A 1 357 ? 62.446 18.932  7.992   1.00 15.54 ? 364 VAL A CA  1 
ATOM   2646 C C   . VAL A 1 357 ? 61.166 18.822  7.164   1.00 16.00 ? 364 VAL A C   1 
ATOM   2647 O O   . VAL A 1 357 ? 61.159 18.215  6.092   1.00 16.83 ? 364 VAL A O   1 
ATOM   2648 C CB  . VAL A 1 357 ? 62.352 17.947  9.193   1.00 18.54 ? 364 VAL A CB  1 
ATOM   2649 C CG1 . VAL A 1 357 ? 61.764 16.613  8.742   1.00 16.92 ? 364 VAL A CG1 1 
ATOM   2650 C CG2 . VAL A 1 357 ? 63.727 17.731  9.791   1.00 13.72 ? 364 VAL A CG2 1 
ATOM   2651 N N   . VAL A 1 358 ? 60.082 19.409  7.652   1.00 15.30 ? 365 VAL A N   1 
ATOM   2652 C CA  . VAL A 1 358 ? 58.822 19.344  6.914   1.00 15.02 ? 365 VAL A CA  1 
ATOM   2653 C C   . VAL A 1 358 ? 58.956 20.018  5.542   1.00 17.32 ? 365 VAL A C   1 
ATOM   2654 O O   . VAL A 1 358 ? 58.451 19.515  4.535   1.00 14.56 ? 365 VAL A O   1 
ATOM   2655 C CB  . VAL A 1 358 ? 57.661 20.016  7.689   1.00 13.04 ? 365 VAL A CB  1 
ATOM   2656 C CG1 . VAL A 1 358 ? 56.422 20.097  6.799   1.00 13.36 ? 365 VAL A CG1 1 
ATOM   2657 C CG2 . VAL A 1 358 ? 57.343 19.230  8.949   1.00 12.34 ? 365 VAL A CG2 1 
ATOM   2658 N N   . TRP A 1 359 ? 59.632 21.161  5.503   1.00 15.57 ? 366 TRP A N   1 
ATOM   2659 C CA  . TRP A 1 359 ? 59.799 21.856  4.237   1.00 16.37 ? 366 TRP A CA  1 
ATOM   2660 C C   . TRP A 1 359 ? 60.574 20.997  3.237   1.00 17.72 ? 366 TRP A C   1 
ATOM   2661 O O   . TRP A 1 359 ? 60.202 20.889  2.065   1.00 16.50 ? 366 TRP A O   1 
ATOM   2662 C CB  . TRP A 1 359 ? 60.525 23.189  4.441   1.00 13.27 ? 366 TRP A CB  1 
ATOM   2663 C CG  . TRP A 1 359 ? 60.738 23.946  3.145   1.00 16.49 ? 366 TRP A CG  1 
ATOM   2664 C CD1 . TRP A 1 359 ? 61.743 23.756  2.231   1.00 20.90 ? 366 TRP A CD1 1 
ATOM   2665 C CD2 . TRP A 1 359 ? 59.884 24.959  2.594   1.00 12.49 ? 366 TRP A CD2 1 
ATOM   2666 N NE1 . TRP A 1 359 ? 61.557 24.584  1.144   1.00 18.31 ? 366 TRP A NE1 1 
ATOM   2667 C CE2 . TRP A 1 359 ? 60.422 25.327  1.341   1.00 17.24 ? 366 TRP A CE2 1 
ATOM   2668 C CE3 . TRP A 1 359 ? 58.705 25.579  3.033   1.00 14.87 ? 366 TRP A CE3 1 
ATOM   2669 C CZ2 . TRP A 1 359 ? 59.833 26.302  0.530   1.00 16.41 ? 366 TRP A CZ2 1 
ATOM   2670 C CZ3 . TRP A 1 359 ? 58.120 26.548  2.225   1.00 16.16 ? 366 TRP A CZ3 1 
ATOM   2671 C CH2 . TRP A 1 359 ? 58.683 26.894  0.983   1.00 15.48 ? 366 TRP A CH2 1 
ATOM   2672 N N   . ASP A 1 360 ? 61.645 20.368  3.697   1.00 17.48 ? 367 ASP A N   1 
ATOM   2673 C CA  . ASP A 1 360 ? 62.437 19.563  2.788   1.00 21.05 ? 367 ASP A CA  1 
ATOM   2674 C C   . ASP A 1 360 ? 61.713 18.342  2.240   1.00 18.52 ? 367 ASP A C   1 
ATOM   2675 O O   . ASP A 1 360 ? 61.769 18.069  1.042   1.00 16.71 ? 367 ASP A O   1 
ATOM   2676 C CB  . ASP A 1 360 ? 63.741 19.126  3.439   1.00 19.35 ? 367 ASP A CB  1 
ATOM   2677 C CG  . ASP A 1 360 ? 64.684 18.487  2.440   1.00 22.81 ? 367 ASP A CG  1 
ATOM   2678 O OD1 . ASP A 1 360 ? 64.879 17.260  2.511   1.00 23.07 ? 367 ASP A OD1 1 
ATOM   2679 O OD2 . ASP A 1 360 ? 65.210 19.215  1.576   1.00 16.85 ? 367 ASP A OD2 1 
ATOM   2680 N N   . LYS A 1 361 ? 61.014 17.628  3.112   1.00 18.62 ? 368 LYS A N   1 
ATOM   2681 C CA  . LYS A 1 361 ? 60.291 16.423  2.716   1.00 18.71 ? 368 LYS A CA  1 
ATOM   2682 C C   . LYS A 1 361 ? 58.946 16.651  2.040   1.00 18.54 ? 368 LYS A C   1 
ATOM   2683 O O   . LYS A 1 361 ? 58.475 15.781  1.316   1.00 18.20 ? 368 LYS A O   1 
ATOM   2684 C CB  . LYS A 1 361 ? 60.061 15.517  3.936   1.00 19.32 ? 368 LYS A CB  1 
ATOM   2685 C CG  . LYS A 1 361 ? 61.334 15.035  4.637   1.00 22.92 ? 368 LYS A CG  1 
ATOM   2686 C CD  . LYS A 1 361 ? 62.089 13.986  3.837   1.00 25.23 ? 368 LYS A CD  1 
ATOM   2687 C CE  . LYS A 1 361 ? 61.285 12.687  3.681   1.00 32.32 ? 368 LYS A CE  1 
ATOM   2688 N NZ  . LYS A 1 361 ? 62.175 11.548  3.264   1.00 32.38 ? 368 LYS A NZ  1 
ATOM   2689 N N   . ALA A 1 362 ? 58.317 17.799  2.272   1.00 16.96 ? 369 ALA A N   1 
ATOM   2690 C CA  . ALA A 1 362 ? 57.000 18.045  1.681   1.00 20.04 ? 369 ALA A CA  1 
ATOM   2691 C C   . ALA A 1 362 ? 56.952 19.098  0.585   1.00 18.42 ? 369 ALA A C   1 
ATOM   2692 O O   . ALA A 1 362 ? 56.253 18.920  -0.415  1.00 22.49 ? 369 ALA A O   1 
ATOM   2693 C CB  . ALA A 1 362 ? 55.988 18.402  2.780   1.00 19.70 ? 369 ALA A CB  1 
ATOM   2694 N N   . VAL A 1 363 ? 57.682 20.192  0.761   1.00 19.41 ? 370 VAL A N   1 
ATOM   2695 C CA  . VAL A 1 363 ? 57.664 21.247  -0.245  1.00 18.38 ? 370 VAL A CA  1 
ATOM   2696 C C   . VAL A 1 363 ? 58.729 21.080  -1.311  1.00 20.67 ? 370 VAL A C   1 
ATOM   2697 O O   . VAL A 1 363 ? 58.422 21.106  -2.503  1.00 22.04 ? 370 VAL A O   1 
ATOM   2698 C CB  . VAL A 1 363 ? 57.810 22.643  0.393   1.00 19.59 ? 370 VAL A CB  1 
ATOM   2699 C CG1 . VAL A 1 363 ? 57.551 23.726  -0.658  1.00 20.33 ? 370 VAL A CG1 1 
ATOM   2700 C CG2 . VAL A 1 363 ? 56.819 22.790  1.538   1.00 13.52 ? 370 VAL A CG2 1 
ATOM   2701 N N   . ALA A 1 364 ? 59.976 20.891  -0.892  1.00 21.25 ? 371 ALA A N   1 
ATOM   2702 C CA  . ALA A 1 364 ? 61.084 20.731  -1.834  1.00 20.67 ? 371 ALA A CA  1 
ATOM   2703 C C   . ALA A 1 364 ? 60.863 19.570  -2.819  1.00 21.96 ? 371 ALA A C   1 
ATOM   2704 O O   . ALA A 1 364 ? 61.404 19.571  -3.924  1.00 20.73 ? 371 ALA A O   1 
ATOM   2705 C CB  . ALA A 1 364 ? 62.392 20.532  -1.062  1.00 22.07 ? 371 ALA A CB  1 
ATOM   2706 N N   . THR A 1 365 ? 60.066 18.588  -2.404  1.00 20.14 ? 372 THR A N   1 
ATOM   2707 C CA  . THR A 1 365 ? 59.750 17.422  -3.225  1.00 22.23 ? 372 THR A CA  1 
ATOM   2708 C C   . THR A 1 365 ? 58.535 17.647  -4.124  1.00 20.47 ? 372 THR A C   1 
ATOM   2709 O O   . THR A 1 365 ? 58.273 16.848  -5.017  1.00 22.74 ? 372 THR A O   1 
ATOM   2710 C CB  . THR A 1 365 ? 59.437 16.190  -2.356  1.00 22.08 ? 372 THR A CB  1 
ATOM   2711 O OG1 . THR A 1 365 ? 58.378 16.519  -1.451  1.00 27.15 ? 372 THR A OG1 1 
ATOM   2712 C CG2 . THR A 1 365 ? 60.660 15.752  -1.558  1.00 23.13 ? 372 THR A CG2 1 
ATOM   2713 N N   . GLY A 1 366 ? 57.782 18.712  -3.867  1.00 21.12 ? 373 GLY A N   1 
ATOM   2714 C CA  . GLY A 1 366 ? 56.610 19.007  -4.673  1.00 22.35 ? 373 GLY A CA  1 
ATOM   2715 C C   . GLY A 1 366 ? 55.318 18.361  -4.196  1.00 22.32 ? 373 GLY A C   1 
ATOM   2716 O O   . GLY A 1 366 ? 54.276 18.480  -4.852  1.00 20.06 ? 373 GLY A O   1 
ATOM   2717 N N   . LYS A 1 367 ? 55.372 17.668  -3.063  1.00 18.33 ? 374 LYS A N   1 
ATOM   2718 C CA  . LYS A 1 367 ? 54.176 17.034  -2.536  1.00 17.24 ? 374 LYS A CA  1 
ATOM   2719 C C   . LYS A 1 367 ? 53.134 18.088  -2.168  1.00 17.83 ? 374 LYS A C   1 
ATOM   2720 O O   . LYS A 1 367 ? 51.948 17.900  -2.434  1.00 20.75 ? 374 LYS A O   1 
ATOM   2721 C CB  . LYS A 1 367 ? 54.522 16.170  -1.327  1.00 19.74 ? 374 LYS A CB  1 
ATOM   2722 C CG  . LYS A 1 367 ? 55.211 14.860  -1.685  1.00 22.23 ? 374 LYS A CG  1 
ATOM   2723 C CD  . LYS A 1 367 ? 55.460 14.032  -0.442  1.00 22.69 ? 374 LYS A CD  1 
ATOM   2724 C CE  . LYS A 1 367 ? 55.271 12.559  -0.717  1.00 22.83 ? 374 LYS A CE  1 
ATOM   2725 N NZ  . LYS A 1 367 ? 56.244 12.018  -1.670  1.00 24.97 ? 374 LYS A NZ  1 
ATOM   2726 N N   . MET A 1 368 ? 53.575 19.196  -1.571  1.00 18.00 ? 375 MET A N   1 
ATOM   2727 C CA  . MET A 1 368 ? 52.678 20.297  -1.192  1.00 16.75 ? 375 MET A CA  1 
ATOM   2728 C C   . MET A 1 368 ? 53.351 21.648  -1.466  1.00 18.66 ? 375 MET A C   1 
ATOM   2729 O O   . MET A 1 368 ? 54.575 21.728  -1.587  1.00 17.50 ? 375 MET A O   1 
ATOM   2730 C CB  . MET A 1 368 ? 52.298 20.216  0.296   1.00 17.14 ? 375 MET A CB  1 
ATOM   2731 C CG  . MET A 1 368 ? 53.421 20.565  1.294   1.00 13.90 ? 375 MET A CG  1 
ATOM   2732 S SD  . MET A 1 368 ? 52.874 20.644  3.057   1.00 9.85  ? 375 MET A SD  1 
ATOM   2733 C CE  . MET A 1 368 ? 52.217 18.990  3.248   1.00 5.57  ? 375 MET A CE  1 
ATOM   2734 N N   . ASP A 1 369 ? 52.558 22.709  -1.560  1.00 15.62 ? 376 ASP A N   1 
ATOM   2735 C CA  . ASP A 1 369 ? 53.120 24.029  -1.804  1.00 15.98 ? 376 ASP A CA  1 
ATOM   2736 C C   . ASP A 1 369 ? 53.314 24.825  -0.514  1.00 16.29 ? 376 ASP A C   1 
ATOM   2737 O O   . ASP A 1 369 ? 52.992 24.352  0.573   1.00 16.50 ? 376 ASP A O   1 
ATOM   2738 C CB  . ASP A 1 369 ? 52.246 24.825  -2.784  1.00 16.17 ? 376 ASP A CB  1 
ATOM   2739 C CG  . ASP A 1 369 ? 50.824 25.028  -2.284  1.00 18.64 ? 376 ASP A CG  1 
ATOM   2740 O OD1 . ASP A 1 369 ? 50.607 25.093  -1.052  1.00 17.38 ? 376 ASP A OD1 1 
ATOM   2741 O OD2 . ASP A 1 369 ? 49.921 25.150  -3.138  1.00 17.96 ? 376 ASP A OD2 1 
ATOM   2742 N N   . GLU A 1 370 ? 53.833 26.042  -0.646  1.00 14.32 ? 377 GLU A N   1 
ATOM   2743 C CA  . GLU A 1 370 ? 54.100 26.896  0.507   1.00 17.60 ? 377 GLU A CA  1 
ATOM   2744 C C   . GLU A 1 370 ? 52.880 27.208  1.386   1.00 17.07 ? 377 GLU A C   1 
ATOM   2745 O O   . GLU A 1 370 ? 52.993 27.333  2.614   1.00 18.48 ? 377 GLU A O   1 
ATOM   2746 C CB  . GLU A 1 370 ? 54.771 28.200  0.045   1.00 19.45 ? 377 GLU A CB  1 
ATOM   2747 C CG  . GLU A 1 370 ? 54.026 28.976  -1.041  1.00 21.42 ? 377 GLU A CG  1 
ATOM   2748 C CD  . GLU A 1 370 ? 54.498 28.636  -2.447  1.00 25.80 ? 377 GLU A CD  1 
ATOM   2749 O OE1 . GLU A 1 370 ? 54.555 27.437  -2.794  1.00 27.58 ? 377 GLU A OE1 1 
ATOM   2750 O OE2 . GLU A 1 370 ? 54.806 29.575  -3.216  1.00 28.32 ? 377 GLU A OE2 1 
ATOM   2751 N N   . ASN A 1 371 ? 51.715 27.327  0.763   1.00 14.32 ? 378 ASN A N   1 
ATOM   2752 C CA  . ASN A 1 371 ? 50.501 27.622  1.505   1.00 15.92 ? 378 ASN A CA  1 
ATOM   2753 C C   . ASN A 1 371 ? 50.129 26.424  2.380   1.00 15.99 ? 378 ASN A C   1 
ATOM   2754 O O   . ASN A 1 371 ? 49.728 26.584  3.536   1.00 14.16 ? 378 ASN A O   1 
ATOM   2755 C CB  . ASN A 1 371 ? 49.373 27.979  0.531   1.00 18.59 ? 378 ASN A CB  1 
ATOM   2756 C CG  . ASN A 1 371 ? 49.780 29.078  -0.443  1.00 17.94 ? 378 ASN A CG  1 
ATOM   2757 O OD1 . ASN A 1 371 ? 50.230 28.803  -1.554  1.00 20.46 ? 378 ASN A OD1 1 
ATOM   2758 N ND2 . ASN A 1 371 ? 49.652 30.326  -0.016  1.00 19.75 ? 378 ASN A ND2 1 
ATOM   2759 N N   . GLN A 1 372 ? 50.281 25.226  1.828   1.00 11.83 ? 379 GLN A N   1 
ATOM   2760 C CA  . GLN A 1 372 ? 49.990 24.012  2.576   1.00 14.79 ? 379 GLN A CA  1 
ATOM   2761 C C   . GLN A 1 372 ? 51.045 23.832  3.655   1.00 14.27 ? 379 GLN A C   1 
ATOM   2762 O O   . GLN A 1 372 ? 50.796 23.187  4.665   1.00 16.34 ? 379 GLN A O   1 
ATOM   2763 C CB  . GLN A 1 372 ? 49.998 22.799  1.659   1.00 19.70 ? 379 GLN A CB  1 
ATOM   2764 C CG  . GLN A 1 372 ? 48.848 22.772  0.690   1.00 20.86 ? 379 GLN A CG  1 
ATOM   2765 C CD  . GLN A 1 372 ? 49.004 21.679  -0.336  1.00 25.52 ? 379 GLN A CD  1 
ATOM   2766 O OE1 . GLN A 1 372 ? 49.752 21.827  -1.307  1.00 20.15 ? 379 GLN A OE1 1 
ATOM   2767 N NE2 . GLN A 1 372 ? 48.312 20.564  -0.121  1.00 19.92 ? 379 GLN A NE2 1 
ATOM   2768 N N   . PHE A 1 373 ? 52.225 24.403  3.435   1.00 15.28 ? 380 PHE A N   1 
ATOM   2769 C CA  . PHE A 1 373 ? 53.298 24.315  4.423   1.00 15.06 ? 380 PHE A CA  1 
ATOM   2770 C C   . PHE A 1 373 ? 52.875 25.113  5.656   1.00 14.73 ? 380 PHE A C   1 
ATOM   2771 O O   . PHE A 1 373 ? 53.061 24.666  6.780   1.00 19.21 ? 380 PHE A O   1 
ATOM   2772 C CB  . PHE A 1 373 ? 54.615 24.878  3.874   1.00 12.39 ? 380 PHE A CB  1 
ATOM   2773 C CG  . PHE A 1 373 ? 55.732 24.930  4.899   1.00 17.16 ? 380 PHE A CG  1 
ATOM   2774 C CD1 . PHE A 1 373 ? 56.294 23.758  5.401   1.00 11.96 ? 380 PHE A CD1 1 
ATOM   2775 C CD2 . PHE A 1 373 ? 56.211 26.149  5.368   1.00 13.74 ? 380 PHE A CD2 1 
ATOM   2776 C CE1 . PHE A 1 373 ? 57.318 23.799  6.350   1.00 14.85 ? 380 PHE A CE1 1 
ATOM   2777 C CE2 . PHE A 1 373 ? 57.236 26.204  6.320   1.00 13.79 ? 380 PHE A CE2 1 
ATOM   2778 C CZ  . PHE A 1 373 ? 57.791 25.024  6.811   1.00 14.48 ? 380 PHE A CZ  1 
ATOM   2779 N N   . VAL A 1 374 ? 52.291 26.286  5.443   1.00 16.76 ? 381 VAL A N   1 
ATOM   2780 C CA  . VAL A 1 374 ? 51.845 27.118  6.561   1.00 15.44 ? 381 VAL A CA  1 
ATOM   2781 C C   . VAL A 1 374 ? 50.761 26.396  7.370   1.00 14.50 ? 381 VAL A C   1 
ATOM   2782 O O   . VAL A 1 374 ? 50.792 26.392  8.596   1.00 12.50 ? 381 VAL A O   1 
ATOM   2783 C CB  . VAL A 1 374 ? 51.306 28.491  6.060   1.00 14.00 ? 381 VAL A CB  1 
ATOM   2784 C CG1 . VAL A 1 374 ? 50.787 29.320  7.234   1.00 12.97 ? 381 VAL A CG1 1 
ATOM   2785 C CG2 . VAL A 1 374 ? 52.414 29.255  5.354   1.00 13.60 ? 381 VAL A CG2 1 
ATOM   2786 N N   . ALA A 1 375 ? 49.817 25.769  6.672   1.00 15.39 ? 382 ALA A N   1 
ATOM   2787 C CA  . ALA A 1 375 ? 48.730 25.053  7.327   1.00 13.26 ? 382 ALA A CA  1 
ATOM   2788 C C   . ALA A 1 375 ? 49.201 23.929  8.248   1.00 13.04 ? 382 ALA A C   1 
ATOM   2789 O O   . ALA A 1 375 ? 48.737 23.819  9.374   1.00 12.55 ? 382 ALA A O   1 
ATOM   2790 C CB  . ALA A 1 375 ? 47.767 24.485  6.281   1.00 17.20 ? 382 ALA A CB  1 
ATOM   2791 N N   . VAL A 1 376 ? 50.118 23.094  7.773   1.00 16.26 ? 383 VAL A N   1 
ATOM   2792 C CA  . VAL A 1 376 ? 50.584 21.974  8.583   1.00 14.66 ? 383 VAL A CA  1 
ATOM   2793 C C   . VAL A 1 376 ? 51.617 22.316  9.659   1.00 15.97 ? 383 VAL A C   1 
ATOM   2794 O O   . VAL A 1 376 ? 51.957 21.465  10.486  1.00 11.90 ? 383 VAL A O   1 
ATOM   2795 C CB  . VAL A 1 376 ? 51.127 20.830  7.692   1.00 16.70 ? 383 VAL A CB  1 
ATOM   2796 C CG1 . VAL A 1 376 ? 50.042 20.374  6.735   1.00 12.62 ? 383 VAL A CG1 1 
ATOM   2797 C CG2 . VAL A 1 376 ? 52.358 21.282  6.939   1.00 10.85 ? 383 VAL A CG2 1 
ATOM   2798 N N   . THR A 1 377 ? 52.122 23.547  9.646   1.00 13.27 ? 384 THR A N   1 
ATOM   2799 C CA  . THR A 1 377 ? 53.079 23.944  10.665  1.00 12.48 ? 384 THR A CA  1 
ATOM   2800 C C   . THR A 1 377 ? 52.483 24.937  11.665  1.00 13.75 ? 384 THR A C   1 
ATOM   2801 O O   . THR A 1 377 ? 53.080 25.164  12.706  1.00 12.84 ? 384 THR A O   1 
ATOM   2802 C CB  . THR A 1 377 ? 54.390 24.548  10.071  1.00 11.24 ? 384 THR A CB  1 
ATOM   2803 O OG1 . THR A 1 377 ? 54.081 25.645  9.207   1.00 10.92 ? 384 THR A OG1 1 
ATOM   2804 C CG2 . THR A 1 377 ? 55.172 23.495  9.308   1.00 10.85 ? 384 THR A CG2 1 
ATOM   2805 N N   . SER A 1 378 ? 51.319 25.520  11.359  1.00 12.62 ? 385 SER A N   1 
ATOM   2806 C CA  . SER A 1 378 ? 50.686 26.461  12.290  1.00 13.62 ? 385 SER A CA  1 
ATOM   2807 C C   . SER A 1 378 ? 49.159 26.616  12.215  1.00 15.55 ? 385 SER A C   1 
ATOM   2808 O O   . SER A 1 378 ? 48.463 26.341  13.190  1.00 16.83 ? 385 SER A O   1 
ATOM   2809 C CB  . SER A 1 378 ? 51.316 27.861  12.169  1.00 13.25 ? 385 SER A CB  1 
ATOM   2810 O OG  . SER A 1 378 ? 50.904 28.520  10.981  1.00 17.58 ? 385 SER A OG  1 
ATOM   2811 N N   . THR A 1 379 ? 48.643 27.057  11.070  1.00 14.01 ? 386 THR A N   1 
ATOM   2812 C CA  . THR A 1 379 ? 47.211 27.303  10.930  1.00 14.21 ? 386 THR A CA  1 
ATOM   2813 C C   . THR A 1 379 ? 46.280 26.150  11.311  1.00 13.03 ? 386 THR A C   1 
ATOM   2814 O O   . THR A 1 379 ? 45.319 26.360  12.044  1.00 15.35 ? 386 THR A O   1 
ATOM   2815 C CB  . THR A 1 379 ? 46.857 27.782  9.505   1.00 13.87 ? 386 THR A CB  1 
ATOM   2816 O OG1 . THR A 1 379 ? 47.862 28.686  9.032   1.00 15.42 ? 386 THR A OG1 1 
ATOM   2817 C CG2 . THR A 1 379 ? 45.529 28.532  9.527   1.00 14.34 ? 386 THR A CG2 1 
ATOM   2818 N N   . ASN A 1 380 ? 46.544 24.939  10.832  1.00 13.26 ? 387 ASN A N   1 
ATOM   2819 C CA  . ASN A 1 380 ? 45.678 23.820  11.196  1.00 14.47 ? 387 ASN A CA  1 
ATOM   2820 C C   . ASN A 1 380 ? 45.737 23.633  12.713  1.00 15.54 ? 387 ASN A C   1 
ATOM   2821 O O   . ASN A 1 380 ? 44.719 23.398  13.370  1.00 15.87 ? 387 ASN A O   1 
ATOM   2822 C CB  . ASN A 1 380 ? 46.105 22.524  10.487  1.00 12.17 ? 387 ASN A CB  1 
ATOM   2823 C CG  . ASN A 1 380 ? 45.769 22.530  9.003   1.00 11.25 ? 387 ASN A CG  1 
ATOM   2824 O OD1 . ASN A 1 380 ? 44.997 23.355  8.540   1.00 10.66 ? 387 ASN A OD1 1 
ATOM   2825 N ND2 . ASN A 1 380 ? 46.341 21.593  8.259   1.00 11.04 ? 387 ASN A ND2 1 
ATOM   2826 N N   . ALA A 1 381 ? 46.934 23.764  13.271  1.00 13.92 ? 388 ALA A N   1 
ATOM   2827 C CA  . ALA A 1 381 ? 47.102 23.613  14.708  1.00 15.22 ? 388 ALA A CA  1 
ATOM   2828 C C   . ALA A 1 381 ? 46.286 24.675  15.443  1.00 15.23 ? 388 ALA A C   1 
ATOM   2829 O O   . ALA A 1 381 ? 45.637 24.379  16.445  1.00 14.71 ? 388 ALA A O   1 
ATOM   2830 C CB  . ALA A 1 381 ? 48.570 23.724  15.077  1.00 13.33 ? 388 ALA A CB  1 
ATOM   2831 N N   . ALA A 1 382 ? 46.303 25.903  14.928  1.00 11.67 ? 389 ALA A N   1 
ATOM   2832 C CA  . ALA A 1 382 ? 45.565 27.000  15.552  1.00 14.89 ? 389 ALA A CA  1 
ATOM   2833 C C   . ALA A 1 382 ? 44.044 26.783  15.550  1.00 15.01 ? 389 ALA A C   1 
ATOM   2834 O O   . ALA A 1 382 ? 43.370 27.062  16.538  1.00 11.41 ? 389 ALA A O   1 
ATOM   2835 C CB  . ALA A 1 382 ? 45.912 28.324  14.862  1.00 12.96 ? 389 ALA A CB  1 
ATOM   2836 N N   . LYS A 1 383 ? 43.512 26.288  14.439  1.00 13.63 ? 390 LYS A N   1 
ATOM   2837 C CA  . LYS A 1 383 ? 42.077 26.041  14.325  1.00 15.62 ? 390 LYS A CA  1 
ATOM   2838 C C   . LYS A 1 383 ? 41.600 24.904  15.239  1.00 16.11 ? 390 LYS A C   1 
ATOM   2839 O O   . LYS A 1 383 ? 40.506 24.961  15.801  1.00 15.56 ? 390 LYS A O   1 
ATOM   2840 C CB  . LYS A 1 383 ? 41.721 25.742  12.861  1.00 14.79 ? 390 LYS A CB  1 
ATOM   2841 C CG  . LYS A 1 383 ? 41.959 26.947  11.939  1.00 17.10 ? 390 LYS A CG  1 
ATOM   2842 C CD  . LYS A 1 383 ? 41.746 26.624  10.467  1.00 18.83 ? 390 LYS A CD  1 
ATOM   2843 C CE  . LYS A 1 383 ? 41.926 27.884  9.602   1.00 18.43 ? 390 LYS A CE  1 
ATOM   2844 N NZ  . LYS A 1 383 ? 41.979 27.592  8.141   1.00 12.84 ? 390 LYS A NZ  1 
ATOM   2845 N N   . ILE A 1 384 ? 42.435 23.884  15.392  1.00 14.03 ? 391 ILE A N   1 
ATOM   2846 C CA  . ILE A 1 384 ? 42.112 22.734  16.227  1.00 13.18 ? 391 ILE A CA  1 
ATOM   2847 C C   . ILE A 1 384 ? 42.168 23.047  17.724  1.00 17.75 ? 391 ILE A C   1 
ATOM   2848 O O   . ILE A 1 384 ? 41.334 22.570  18.499  1.00 12.68 ? 391 ILE A O   1 
ATOM   2849 C CB  . ILE A 1 384 ? 43.079 21.561  15.935  1.00 17.30 ? 391 ILE A CB  1 
ATOM   2850 C CG1 . ILE A 1 384 ? 42.857 21.047  14.504  1.00 18.59 ? 391 ILE A CG1 1 
ATOM   2851 C CG2 . ILE A 1 384 ? 42.894 20.450  16.970  1.00 14.16 ? 391 ILE A CG2 1 
ATOM   2852 C CD1 . ILE A 1 384 ? 43.875 20.023  14.068  1.00 16.52 ? 391 ILE A CD1 1 
ATOM   2853 N N   . PHE A 1 385 ? 43.142 23.854  18.130  1.00 14.91 ? 392 PHE A N   1 
ATOM   2854 C CA  . PHE A 1 385 ? 43.284 24.169  19.542  1.00 16.57 ? 392 PHE A CA  1 
ATOM   2855 C C   . PHE A 1 385 ? 42.705 25.501  20.007  1.00 19.41 ? 392 PHE A C   1 
ATOM   2856 O O   . PHE A 1 385 ? 42.934 25.919  21.140  1.00 19.87 ? 392 PHE A O   1 
ATOM   2857 C CB  . PHE A 1 385 ? 44.750 24.016  19.944  1.00 10.91 ? 392 PHE A CB  1 
ATOM   2858 C CG  . PHE A 1 385 ? 45.197 22.584  20.004  1.00 13.98 ? 392 PHE A CG  1 
ATOM   2859 C CD1 . PHE A 1 385 ? 44.694 21.726  20.987  1.00 17.50 ? 392 PHE A CD1 1 
ATOM   2860 C CD2 . PHE A 1 385 ? 46.076 22.069  19.054  1.00 15.39 ? 392 PHE A CD2 1 
ATOM   2861 C CE1 . PHE A 1 385 ? 45.063 20.368  21.019  1.00 17.66 ? 392 PHE A CE1 1 
ATOM   2862 C CE2 . PHE A 1 385 ? 46.449 20.715  19.077  1.00 16.00 ? 392 PHE A CE2 1 
ATOM   2863 C CZ  . PHE A 1 385 ? 45.941 19.867  20.057  1.00 13.87 ? 392 PHE A CZ  1 
ATOM   2864 N N   . ASN A 1 386 ? 41.946 26.147  19.121  1.00 20.61 ? 393 ASN A N   1 
ATOM   2865 C CA  . ASN A 1 386 ? 41.261 27.404  19.414  1.00 18.19 ? 393 ASN A CA  1 
ATOM   2866 C C   . ASN A 1 386 ? 42.136 28.650  19.584  1.00 19.26 ? 393 ASN A C   1 
ATOM   2867 O O   . ASN A 1 386 ? 41.917 29.460  20.488  1.00 16.80 ? 393 ASN A O   1 
ATOM   2868 C CB  . ASN A 1 386 ? 40.375 27.212  20.650  1.00 16.73 ? 393 ASN A CB  1 
ATOM   2869 C CG  . ASN A 1 386 ? 39.016 27.864  20.498  1.00 23.22 ? 393 ASN A CG  1 
ATOM   2870 O OD1 . ASN A 1 386 ? 38.749 28.533  19.504  1.00 17.80 ? 393 ASN A OD1 1 
ATOM   2871 N ND2 . ASN A 1 386 ? 38.147 27.671  21.489  1.00 16.52 ? 393 ASN A ND2 1 
ATOM   2872 N N   . LEU A 1 387 ? 43.107 28.812  18.692  1.00 20.09 ? 394 LEU A N   1 
ATOM   2873 C CA  . LEU A 1 387 ? 44.013 29.957  18.719  1.00 19.41 ? 394 LEU A CA  1 
ATOM   2874 C C   . LEU A 1 387 ? 44.088 30.589  17.330  1.00 21.84 ? 394 LEU A C   1 
ATOM   2875 O O   . LEU A 1 387 ? 44.908 31.483  17.095  1.00 17.07 ? 394 LEU A O   1 
ATOM   2876 C CB  . LEU A 1 387 ? 45.419 29.483  19.087  1.00 22.12 ? 394 LEU A CB  1 
ATOM   2877 C CG  . LEU A 1 387 ? 45.669 28.737  20.395  1.00 22.91 ? 394 LEU A CG  1 
ATOM   2878 C CD1 . LEU A 1 387 ? 46.827 27.783  20.203  1.00 25.02 ? 394 LEU A CD1 1 
ATOM   2879 C CD2 . LEU A 1 387 ? 45.966 29.727  21.510  1.00 21.60 ? 394 LEU A CD2 1 
ATOM   2880 N N   . TYR A 1 388 ? 43.216 30.159  16.423  1.00 20.94 ? 395 TYR A N   1 
ATOM   2881 C CA  . TYR A 1 388 ? 43.315 30.609  15.040  1.00 24.81 ? 395 TYR A CA  1 
ATOM   2882 C C   . TYR A 1 388 ? 43.714 32.017  14.638  1.00 32.49 ? 395 TYR A C   1 
ATOM   2883 O O   . TYR A 1 388 ? 44.910 32.308  14.552  1.00 42.04 ? 395 TYR A O   1 
ATOM   2884 C CB  . TYR A 1 388 ? 42.092 30.200  14.214  1.00 15.48 ? 395 TYR A CB  1 
ATOM   2885 C CG  . TYR A 1 388 ? 42.155 30.693  12.766  1.00 17.90 ? 395 TYR A CG  1 
ATOM   2886 C CD1 . TYR A 1 388 ? 43.331 30.593  12.016  1.00 17.65 ? 395 TYR A CD1 1 
ATOM   2887 C CD2 . TYR A 1 388 ? 41.046 31.276  12.160  1.00 19.62 ? 395 TYR A CD2 1 
ATOM   2888 C CE1 . TYR A 1 388 ? 43.393 31.059  10.693  1.00 16.92 ? 395 TYR A CE1 1 
ATOM   2889 C CE2 . TYR A 1 388 ? 41.097 31.741  10.843  1.00 19.22 ? 395 TYR A CE2 1 
ATOM   2890 C CZ  . TYR A 1 388 ? 42.274 31.636  10.120  1.00 21.51 ? 395 TYR A CZ  1 
ATOM   2891 O OH  . TYR A 1 388 ? 42.322 32.120  8.830   1.00 15.79 ? 395 TYR A OH  1 
ATOM   2892 N N   . PRO A 1 389 ? 42.751 32.927  14.419  1.00 29.53 ? 396 PRO A N   1 
ATOM   2893 C CA  . PRO A 1 389 ? 43.274 34.229  13.999  1.00 26.02 ? 396 PRO A CA  1 
ATOM   2894 C C   . PRO A 1 389 ? 44.515 34.756  14.737  1.00 27.17 ? 396 PRO A C   1 
ATOM   2895 O O   . PRO A 1 389 ? 45.490 35.179  14.102  1.00 20.32 ? 396 PRO A O   1 
ATOM   2896 C CB  . PRO A 1 389 ? 42.044 35.138  14.081  1.00 28.91 ? 396 PRO A CB  1 
ATOM   2897 C CG  . PRO A 1 389 ? 41.255 34.532  15.182  1.00 26.53 ? 396 PRO A CG  1 
ATOM   2898 C CD  . PRO A 1 389 ? 41.397 33.045  14.987  1.00 26.49 ? 396 PRO A CD  1 
ATOM   2899 N N   . ARG A 1 390 ? 44.495 34.696  16.064  1.00 23.25 ? 397 ARG A N   1 
ATOM   2900 C CA  . ARG A 1 390 ? 45.616 35.176  16.866  1.00 21.63 ? 397 ARG A CA  1 
ATOM   2901 C C   . ARG A 1 390 ? 46.961 34.609  16.398  1.00 19.30 ? 397 ARG A C   1 
ATOM   2902 O O   . ARG A 1 390 ? 47.933 35.356  16.236  1.00 20.30 ? 397 ARG A O   1 
ATOM   2903 C CB  . ARG A 1 390 ? 45.379 34.814  18.331  1.00 21.92 ? 397 ARG A CB  1 
ATOM   2904 C CG  . ARG A 1 390 ? 46.536 35.110  19.249  1.00 27.82 ? 397 ARG A CG  1 
ATOM   2905 C CD  . ARG A 1 390 ? 46.266 34.507  20.621  1.00 30.67 ? 397 ARG A CD  1 
ATOM   2906 N NE  . ARG A 1 390 ? 46.275 35.519  21.666  1.00 37.22 ? 397 ARG A NE  1 
ATOM   2907 C CZ  . ARG A 1 390 ? 45.852 35.305  22.908  1.00 44.16 ? 397 ARG A CZ  1 
ATOM   2908 N NH1 . ARG A 1 390 ? 45.383 34.108  23.259  1.00 47.91 ? 397 ARG A NH1 1 
ATOM   2909 N NH2 . ARG A 1 390 ? 45.896 36.284  23.800  1.00 45.02 ? 397 ARG A NH2 1 
ATOM   2910 N N   . LYS A 1 391 ? 47.001 33.293  16.177  1.00 17.57 ? 398 LYS A N   1 
ATOM   2911 C CA  . LYS A 1 391 ? 48.205 32.580  15.732  1.00 19.53 ? 398 LYS A CA  1 
ATOM   2912 C C   . LYS A 1 391 ? 47.998 31.915  14.360  1.00 17.31 ? 398 LYS A C   1 
ATOM   2913 O O   . LYS A 1 391 ? 46.875 31.665  13.947  1.00 17.78 ? 398 LYS A O   1 
ATOM   2914 C CB  . LYS A 1 391 ? 48.571 31.482  16.745  1.00 17.23 ? 398 LYS A CB  1 
ATOM   2915 C CG  . LYS A 1 391 ? 48.774 31.947  18.187  1.00 18.90 ? 398 LYS A CG  1 
ATOM   2916 C CD  . LYS A 1 391 ? 49.957 32.889  18.333  1.00 15.83 ? 398 LYS A CD  1 
ATOM   2917 C CE  . LYS A 1 391 ? 50.207 33.229  19.797  1.00 21.57 ? 398 LYS A CE  1 
ATOM   2918 N NZ  . LYS A 1 391 ? 51.299 34.225  19.975  1.00 10.78 ? 398 LYS A NZ  1 
ATOM   2919 N N   . GLY A 1 392 ? 49.083 31.623  13.654  1.00 17.10 ? 399 GLY A N   1 
ATOM   2920 C CA  . GLY A 1 392 ? 48.960 30.959  12.364  1.00 16.36 ? 399 GLY A CA  1 
ATOM   2921 C C   . GLY A 1 392 ? 48.416 31.741  11.179  1.00 19.36 ? 399 GLY A C   1 
ATOM   2922 O O   . GLY A 1 392 ? 47.950 31.140  10.196  1.00 14.09 ? 399 GLY A O   1 
ATOM   2923 N N   . ARG A 1 393 ? 48.472 33.070  11.256  1.00 18.06 ? 400 ARG A N   1 
ATOM   2924 C CA  . ARG A 1 393 ? 47.999 33.913  10.158  1.00 18.71 ? 400 ARG A CA  1 
ATOM   2925 C C   . ARG A 1 393 ? 48.563 35.332  10.176  1.00 20.60 ? 400 ARG A C   1 
ATOM   2926 O O   . ARG A 1 393 ? 48.529 36.024  11.204  1.00 20.40 ? 400 ARG A O   1 
ATOM   2927 C CB  . ARG A 1 393 ? 46.466 33.989  10.150  1.00 16.48 ? 400 ARG A CB  1 
ATOM   2928 C CG  . ARG A 1 393 ? 45.894 34.720  8.931   1.00 15.29 ? 400 ARG A CG  1 
ATOM   2929 C CD  . ARG A 1 393 ? 44.360 34.688  8.929   1.00 17.48 ? 400 ARG A CD  1 
ATOM   2930 N NE  . ARG A 1 393 ? 43.762 35.242  7.714   1.00 15.08 ? 400 ARG A NE  1 
ATOM   2931 C CZ  . ARG A 1 393 ? 43.776 34.651  6.517   1.00 18.27 ? 400 ARG A CZ  1 
ATOM   2932 N NH1 . ARG A 1 393 ? 44.366 33.473  6.350   1.00 14.36 ? 400 ARG A NH1 1 
ATOM   2933 N NH2 . ARG A 1 393 ? 43.173 35.228  5.485   1.00 12.90 ? 400 ARG A NH2 1 
ATOM   2934 N N   . ILE A 1 394 ? 49.100 35.757  9.038   1.00 18.08 ? 401 ILE A N   1 
ATOM   2935 C CA  . ILE A 1 394 ? 49.613 37.113  8.917   1.00 15.23 ? 401 ILE A CA  1 
ATOM   2936 C C   . ILE A 1 394 ? 48.398 37.968  8.550   1.00 17.66 ? 401 ILE A C   1 
ATOM   2937 O O   . ILE A 1 394 ? 47.927 37.945  7.409   1.00 15.38 ? 401 ILE A O   1 
ATOM   2938 C CB  . ILE A 1 394 ? 50.700 37.227  7.808   1.00 16.92 ? 401 ILE A CB  1 
ATOM   2939 C CG1 . ILE A 1 394 ? 51.876 36.298  8.136   1.00 17.33 ? 401 ILE A CG1 1 
ATOM   2940 C CG2 . ILE A 1 394 ? 51.188 38.667  7.688   1.00 13.57 ? 401 ILE A CG2 1 
ATOM   2941 C CD1 . ILE A 1 394 ? 52.476 36.499  9.516   1.00 16.75 ? 401 ILE A CD1 1 
ATOM   2942 N N   . ALA A 1 395 ? 47.881 38.690  9.540   1.00 16.72 ? 402 ALA A N   1 
ATOM   2943 C CA  . ALA A 1 395 ? 46.726 39.559  9.355   1.00 20.72 ? 402 ALA A CA  1 
ATOM   2944 C C   . ALA A 1 395 ? 46.673 40.631  10.445  1.00 21.91 ? 402 ALA A C   1 
ATOM   2945 O O   . ALA A 1 395 ? 47.080 40.396  11.588  1.00 19.80 ? 402 ALA A O   1 
ATOM   2946 C CB  . ALA A 1 395 ? 45.437 38.734  9.376   1.00 24.42 ? 402 ALA A CB  1 
ATOM   2947 N N   . VAL A 1 396 ? 46.171 41.807  10.080  1.00 19.92 ? 403 VAL A N   1 
ATOM   2948 C CA  . VAL A 1 396 ? 46.060 42.913  11.020  1.00 22.06 ? 403 VAL A CA  1 
ATOM   2949 C C   . VAL A 1 396 ? 45.341 42.423  12.267  1.00 22.12 ? 403 VAL A C   1 
ATOM   2950 O O   . VAL A 1 396 ? 44.286 41.801  12.178  1.00 24.04 ? 403 VAL A O   1 
ATOM   2951 C CB  . VAL A 1 396 ? 45.264 44.098  10.413  1.00 23.89 ? 403 VAL A CB  1 
ATOM   2952 C CG1 . VAL A 1 396 ? 45.045 45.172  11.462  1.00 21.04 ? 403 VAL A CG1 1 
ATOM   2953 C CG2 . VAL A 1 396 ? 46.016 44.676  9.219   1.00 22.09 ? 403 VAL A CG2 1 
ATOM   2954 N N   . GLY A 1 397 ? 45.922 42.682  13.429  1.00 19.60 ? 404 GLY A N   1 
ATOM   2955 C CA  . GLY A 1 397 ? 45.279 42.254  14.653  1.00 20.79 ? 404 GLY A CA  1 
ATOM   2956 C C   . GLY A 1 397 ? 45.810 40.968  15.257  1.00 20.77 ? 404 GLY A C   1 
ATOM   2957 O O   . GLY A 1 397 ? 45.638 40.738  16.446  1.00 19.46 ? 404 GLY A O   1 
ATOM   2958 N N   . SER A 1 398 ? 46.450 40.124  14.457  1.00 19.21 ? 405 SER A N   1 
ATOM   2959 C CA  . SER A 1 398 ? 46.987 38.873  14.988  1.00 20.92 ? 405 SER A CA  1 
ATOM   2960 C C   . SER A 1 398 ? 48.293 39.159  15.705  1.00 21.59 ? 405 SER A C   1 
ATOM   2961 O O   . SER A 1 398 ? 48.842 40.255  15.593  1.00 20.04 ? 405 SER A O   1 
ATOM   2962 C CB  . SER A 1 398 ? 47.241 37.867  13.859  1.00 20.09 ? 405 SER A CB  1 
ATOM   2963 O OG  . SER A 1 398 ? 46.048 37.575  13.145  1.00 22.94 ? 405 SER A OG  1 
ATOM   2964 N N   . ASP A 1 399 ? 48.787 38.175  16.448  1.00 22.24 ? 406 ASP A N   1 
ATOM   2965 C CA  . ASP A 1 399 ? 50.049 38.335  17.156  1.00 20.66 ? 406 ASP A CA  1 
ATOM   2966 C C   . ASP A 1 399 ? 51.181 38.416  16.143  1.00 22.28 ? 406 ASP A C   1 
ATOM   2967 O O   . ASP A 1 399 ? 51.144 37.761  15.093  1.00 20.57 ? 406 ASP A O   1 
ATOM   2968 C CB  . ASP A 1 399 ? 50.291 37.161  18.111  1.00 20.52 ? 406 ASP A CB  1 
ATOM   2969 C CG  . ASP A 1 399 ? 49.422 37.232  19.347  1.00 21.97 ? 406 ASP A CG  1 
ATOM   2970 O OD1 . ASP A 1 399 ? 48.638 38.193  19.456  1.00 22.85 ? 406 ASP A OD1 1 
ATOM   2971 O OD2 . ASP A 1 399 ? 49.521 36.333  20.208  1.00 21.55 ? 406 ASP A OD2 1 
ATOM   2972 N N   . ALA A 1 400 ? 52.181 39.230  16.461  1.00 21.63 ? 407 ALA A N   1 
ATOM   2973 C CA  . ALA A 1 400 ? 53.326 39.404  15.585  1.00 20.82 ? 407 ALA A CA  1 
ATOM   2974 C C   . ALA A 1 400 ? 54.379 38.301  15.741  1.00 22.87 ? 407 ALA A C   1 
ATOM   2975 O O   . ALA A 1 400 ? 55.520 38.571  16.141  1.00 23.71 ? 407 ALA A O   1 
ATOM   2976 C CB  . ALA A 1 400 ? 53.956 40.773  15.825  1.00 17.38 ? 407 ALA A CB  1 
ATOM   2977 N N   . ASP A 1 401 ? 53.988 37.056  15.469  1.00 21.19 ? 408 ASP A N   1 
ATOM   2978 C CA  . ASP A 1 401 ? 54.927 35.935  15.519  1.00 20.93 ? 408 ASP A CA  1 
ATOM   2979 C C   . ASP A 1 401 ? 55.146 35.669  14.042  1.00 22.84 ? 408 ASP A C   1 
ATOM   2980 O O   . ASP A 1 401 ? 54.326 35.033  13.386  1.00 23.10 ? 408 ASP A O   1 
ATOM   2981 C CB  . ASP A 1 401 ? 54.324 34.704  16.204  1.00 19.56 ? 408 ASP A CB  1 
ATOM   2982 C CG  . ASP A 1 401 ? 54.146 34.893  17.716  1.00 21.28 ? 408 ASP A CG  1 
ATOM   2983 O OD1 . ASP A 1 401 ? 54.810 35.777  18.298  1.00 16.97 ? 408 ASP A OD1 1 
ATOM   2984 O OD2 . ASP A 1 401 ? 53.346 34.144  18.324  1.00 17.76 ? 408 ASP A OD2 1 
ATOM   2985 N N   . VAL A 1 402 ? 56.254 36.188  13.521  1.00 23.66 ? 409 VAL A N   1 
ATOM   2986 C CA  . VAL A 1 402 ? 56.552 36.080  12.107  1.00 21.78 ? 409 VAL A CA  1 
ATOM   2987 C C   . VAL A 1 402 ? 57.940 35.527  11.786  1.00 19.62 ? 409 VAL A C   1 
ATOM   2988 O O   . VAL A 1 402 ? 58.905 35.740  12.523  1.00 19.85 ? 409 VAL A O   1 
ATOM   2989 C CB  . VAL A 1 402 ? 56.398 37.472  11.444  1.00 21.65 ? 409 VAL A CB  1 
ATOM   2990 C CG1 . VAL A 1 402 ? 56.463 37.354  9.932   1.00 26.56 ? 409 VAL A CG1 1 
ATOM   2991 C CG2 . VAL A 1 402 ? 55.091 38.097  11.875  1.00 23.30 ? 409 VAL A CG2 1 
ATOM   2992 N N   . VAL A 1 403 ? 58.022 34.829  10.659  1.00 16.02 ? 410 VAL A N   1 
ATOM   2993 C CA  . VAL A 1 403 ? 59.267 34.247  10.200  1.00 14.57 ? 410 VAL A CA  1 
ATOM   2994 C C   . VAL A 1 403 ? 59.494 34.592  8.737   1.00 19.15 ? 410 VAL A C   1 
ATOM   2995 O O   . VAL A 1 403 ? 58.568 34.550  7.928   1.00 18.47 ? 410 VAL A O   1 
ATOM   2996 C CB  . VAL A 1 403 ? 59.249 32.711  10.337  1.00 13.76 ? 410 VAL A CB  1 
ATOM   2997 C CG1 . VAL A 1 403 ? 60.483 32.112  9.680   1.00 15.45 ? 410 VAL A CG1 1 
ATOM   2998 C CG2 . VAL A 1 403 ? 59.201 32.321  11.804  1.00 16.57 ? 410 VAL A CG2 1 
ATOM   2999 N N   . ILE A 1 404 ? 60.723 34.966  8.405   1.00 20.38 ? 411 ILE A N   1 
ATOM   3000 C CA  . ILE A 1 404 ? 61.064 35.257  7.026   1.00 17.63 ? 411 ILE A CA  1 
ATOM   3001 C C   . ILE A 1 404 ? 61.845 34.030  6.591   1.00 18.94 ? 411 ILE A C   1 
ATOM   3002 O O   . ILE A 1 404 ? 62.977 33.795  7.021   1.00 19.20 ? 411 ILE A O   1 
ATOM   3003 C CB  . ILE A 1 404 ? 61.913 36.545  6.889   1.00 20.44 ? 411 ILE A CB  1 
ATOM   3004 C CG1 . ILE A 1 404 ? 61.079 37.758  7.326   1.00 21.20 ? 411 ILE A CG1 1 
ATOM   3005 C CG2 . ILE A 1 404 ? 62.362 36.716  5.448   1.00 20.93 ? 411 ILE A CG2 1 
ATOM   3006 C CD1 . ILE A 1 404 ? 61.771 39.100  7.184   1.00 25.96 ? 411 ILE A CD1 1 
ATOM   3007 N N   . TRP A 1 405 ? 61.204 33.236  5.745   1.00 19.50 ? 412 TRP A N   1 
ATOM   3008 C CA  . TRP A 1 405 ? 61.750 31.986  5.257   1.00 20.66 ? 412 TRP A CA  1 
ATOM   3009 C C   . TRP A 1 405 ? 62.383 32.142  3.887   1.00 23.10 ? 412 TRP A C   1 
ATOM   3010 O O   . TRP A 1 405 ? 61.846 32.827  3.016   1.00 24.13 ? 412 TRP A O   1 
ATOM   3011 C CB  . TRP A 1 405 ? 60.615 30.967  5.209   1.00 16.32 ? 412 TRP A CB  1 
ATOM   3012 C CG  . TRP A 1 405 ? 61.033 29.562  4.981   1.00 17.56 ? 412 TRP A CG  1 
ATOM   3013 C CD1 . TRP A 1 405 ? 61.208 28.938  3.779   1.00 18.88 ? 412 TRP A CD1 1 
ATOM   3014 C CD2 . TRP A 1 405 ? 61.284 28.576  5.986   1.00 18.22 ? 412 TRP A CD2 1 
ATOM   3015 N NE1 . TRP A 1 405 ? 61.547 27.620  3.976   1.00 19.94 ? 412 TRP A NE1 1 
ATOM   3016 C CE2 . TRP A 1 405 ? 61.601 27.372  5.324   1.00 16.57 ? 412 TRP A CE2 1 
ATOM   3017 C CE3 . TRP A 1 405 ? 61.272 28.593  7.386   1.00 17.92 ? 412 TRP A CE3 1 
ATOM   3018 C CZ2 . TRP A 1 405 ? 61.899 26.193  6.011   1.00 17.31 ? 412 TRP A CZ2 1 
ATOM   3019 C CZ3 . TRP A 1 405 ? 61.569 27.419  8.071   1.00 19.17 ? 412 TRP A CZ3 1 
ATOM   3020 C CH2 . TRP A 1 405 ? 61.879 26.236  7.380   1.00 19.69 ? 412 TRP A CH2 1 
ATOM   3021 N N   . ASP A 1 406 ? 63.525 31.502  3.703   1.00 23.79 ? 413 ASP A N   1 
ATOM   3022 C CA  . ASP A 1 406 ? 64.212 31.570  2.432   1.00 26.07 ? 413 ASP A CA  1 
ATOM   3023 C C   . ASP A 1 406 ? 64.231 30.155  1.863   1.00 26.01 ? 413 ASP A C   1 
ATOM   3024 O O   . ASP A 1 406 ? 64.936 29.267  2.359   1.00 22.35 ? 413 ASP A O   1 
ATOM   3025 C CB  . ASP A 1 406 ? 65.620 32.173  2.643   1.00 34.08 ? 413 ASP A CB  1 
ATOM   3026 C CG  . ASP A 1 406 ? 66.508 32.115  1.399   1.00 34.40 ? 413 ASP A CG  1 
ATOM   3027 O OD1 . ASP A 1 406 ? 66.147 31.475  0.391   1.00 36.08 ? 413 ASP A OD1 1 
ATOM   3028 O OD2 . ASP A 1 406 ? 67.605 32.711  1.451   1.00 40.80 ? 413 ASP A OD2 1 
ATOM   3029 N N   . PRO A 1 407 ? 63.406 29.923  0.854   1.00 27.23 ? 414 PRO A N   1 
ATOM   3030 C CA  . PRO A 1 407 ? 63.306 28.616  0.226   1.00 31.09 ? 414 PRO A CA  1 
ATOM   3031 C C   . PRO A 1 407 ? 64.548 28.175  -0.495  1.00 37.06 ? 414 PRO A C   1 
ATOM   3032 O O   . PRO A 1 407 ? 64.754 26.993  -0.779  1.00 34.39 ? 414 PRO A O   1 
ATOM   3033 C CB  . PRO A 1 407 ? 62.140 28.777  -0.730  1.00 32.39 ? 414 PRO A CB  1 
ATOM   3034 C CG  . PRO A 1 407 ? 62.348 30.236  -1.172  1.00 30.81 ? 414 PRO A CG  1 
ATOM   3035 C CD  . PRO A 1 407 ? 62.549 30.888  0.173   1.00 29.55 ? 414 PRO A CD  1 
ATOM   3036 N N   . ASP A 1 408 ? 65.428 29.120  -0.796  1.00 44.05 ? 415 ASP A N   1 
ATOM   3037 C CA  . ASP A 1 408 ? 66.631 28.727  -1.526  1.00 53.20 ? 415 ASP A CA  1 
ATOM   3038 C C   . ASP A 1 408 ? 67.977 28.279  -0.950  1.00 58.46 ? 415 ASP A C   1 
ATOM   3039 O O   . ASP A 1 408 ? 68.982 28.549  -1.618  1.00 64.12 ? 415 ASP A O   1 
ATOM   3040 C CB  . ASP A 1 408 ? 66.888 29.832  -2.531  1.00 51.54 ? 415 ASP A CB  1 
ATOM   3041 C CG  . ASP A 1 408 ? 66.059 29.662  -3.793  1.00 51.30 ? 415 ASP A CG  1 
ATOM   3042 O OD1 . ASP A 1 408 ? 65.785 28.487  -4.010  1.00 48.97 ? 415 ASP A OD1 1 
ATOM   3043 O OD2 . ASP A 1 408 ? 65.702 30.668  -4.479  1.00 53.45 ? 415 ASP A OD2 1 
ATOM   3044 N N   . LYS A 1 409 ? 68.007 27.552  0.169   1.00 61.54 ? 416 LYS A N   1 
ATOM   3045 C CA  . LYS A 1 409 ? 69.292 27.191  0.637   1.00 63.33 ? 416 LYS A CA  1 
ATOM   3046 C C   . LYS A 1 409 ? 69.431 26.448  1.921   1.00 62.90 ? 416 LYS A C   1 
ATOM   3047 O O   . LYS A 1 409 ? 68.490 25.836  2.499   1.00 62.93 ? 416 LYS A O   1 
ATOM   3048 C CB  . LYS A 1 409 ? 70.161 28.504  0.784   1.00 65.04 ? 416 LYS A CB  1 
ATOM   3049 C CG  . LYS A 1 409 ? 69.696 29.405  2.237   1.00 63.17 ? 416 LYS A CG  1 
ATOM   3050 C CD  . LYS A 1 409 ? 70.874 30.202  3.433   1.00 60.43 ? 416 LYS A CD  1 
ATOM   3051 C CE  . LYS A 1 409 ? 70.383 30.373  5.053   1.00 60.02 ? 416 LYS A CE  1 
ATOM   3052 N NZ  . LYS A 1 409 ? 71.055 31.195  6.219   1.00 63.89 ? 416 LYS A NZ  1 
ATOM   3053 N N   . MET A 1 410 ? 70.716 26.461  2.228   1.00 63.65 ? 417 MET A N   1 
ATOM   3054 C CA  . MET A 1 410 ? 71.336 26.017  3.505   1.00 64.26 ? 417 MET A CA  1 
ATOM   3055 C C   . MET A 1 410 ? 71.182 24.973  4.595   1.00 59.44 ? 417 MET A C   1 
ATOM   3056 O O   . MET A 1 410 ? 71.613 25.209  5.767   1.00 62.29 ? 417 MET A O   1 
ATOM   3057 C CB  . MET A 1 410 ? 71.391 27.297  4.307   1.00 72.32 ? 417 MET A CB  1 
ATOM   3058 C CG  . MET A 1 410 ? 69.997 27.644  5.017   1.00 81.87 ? 417 MET A CG  1 
ATOM   3059 S SD  . MET A 1 410 ? 68.035 27.614  4.101   1.00 91.49 ? 417 MET A SD  1 
ATOM   3060 C CE  . MET A 1 410 ? 66.879 29.546  4.264   1.00 92.21 ? 417 MET A CE  1 
ATOM   3061 N N   . LYS A 1 411 ? 70.687 23.760  4.438   1.00 53.56 ? 418 LYS A N   1 
ATOM   3062 C CA  . LYS A 1 411 ? 70.788 23.320  5.822   1.00 46.81 ? 418 LYS A CA  1 
ATOM   3063 C C   . LYS A 1 411 ? 71.119 21.979  6.225   1.00 42.41 ? 418 LYS A C   1 
ATOM   3064 O O   . LYS A 1 411 ? 70.315 21.085  6.191   1.00 40.93 ? 418 LYS A O   1 
ATOM   3065 C CB  . LYS A 1 411 ? 69.554 23.909  6.557   1.00 48.24 ? 418 LYS A CB  1 
ATOM   3066 C CG  . LYS A 1 411 ? 69.449 23.834  8.085   1.00 49.35 ? 418 LYS A CG  1 
ATOM   3067 C CD  . LYS A 1 411 ? 70.663 24.272  8.913   1.00 48.47 ? 418 LYS A CD  1 
ATOM   3068 C CE  . LYS A 1 411 ? 70.345 24.069  10.420  1.00 52.53 ? 418 LYS A CE  1 
ATOM   3069 N NZ  . LYS A 1 411 ? 71.573 23.995  11.269  1.00 48.39 ? 418 LYS A NZ  1 
ATOM   3070 N N   . THR A 1 412 ? 72.383 21.842  6.568   1.00 34.93 ? 419 THR A N   1 
ATOM   3071 C CA  . THR A 1 412 ? 72.786 20.550  6.961   1.00 31.88 ? 419 THR A CA  1 
ATOM   3072 C C   . THR A 1 412 ? 72.649 20.410  8.467   1.00 31.06 ? 419 THR A C   1 
ATOM   3073 O O   . THR A 1 412 ? 73.263 21.134  9.254   1.00 28.00 ? 419 THR A O   1 
ATOM   3074 C CB  . THR A 1 412 ? 74.170 20.204  6.413   1.00 31.46 ? 419 THR A CB  1 
ATOM   3075 O OG1 . THR A 1 412 ? 74.084 20.180  4.977   1.00 34.74 ? 419 THR A OG1 1 
ATOM   3076 C CG2 . THR A 1 412 ? 74.597 18.844  6.902   1.00 27.93 ? 419 THR A CG2 1 
ATOM   3077 N N   . ILE A 1 413 ? 71.768 19.499  8.859   1.00 26.99 ? 420 ILE A N   1 
ATOM   3078 C CA  . ILE A 1 413 ? 71.497 19.256  10.261  1.00 23.75 ? 420 ILE A CA  1 
ATOM   3079 C C   . ILE A 1 413 ? 72.611 18.470  10.914  1.00 20.18 ? 420 ILE A C   1 
ATOM   3080 O O   . ILE A 1 413 ? 72.934 17.365  10.485  1.00 25.50 ? 420 ILE A O   1 
ATOM   3081 C CB  . ILE A 1 413 ? 70.149 18.515  10.449  1.00 20.30 ? 420 ILE A CB  1 
ATOM   3082 C CG1 . ILE A 1 413 ? 69.019 19.385  9.897   1.00 17.00 ? 420 ILE A CG1 1 
ATOM   3083 C CG2 . ILE A 1 413 ? 69.911 18.238  11.929  1.00 20.79 ? 420 ILE A CG2 1 
ATOM   3084 C CD1 . ILE A 1 413 ? 67.642 18.742  9.924   1.00 14.91 ? 420 ILE A CD1 1 
ATOM   3085 N N   . THR A 1 414 ? 73.199 19.047  11.958  1.00 19.37 ? 421 THR A N   1 
ATOM   3086 C CA  . THR A 1 414 ? 74.281 18.386  12.679  1.00 21.40 ? 421 THR A CA  1 
ATOM   3087 C C   . THR A 1 414 ? 74.148 18.588  14.177  1.00 22.41 ? 421 THR A C   1 
ATOM   3088 O O   . THR A 1 414 ? 73.592 19.588  14.638  1.00 22.99 ? 421 THR A O   1 
ATOM   3089 C CB  . THR A 1 414 ? 75.656 18.938  12.276  1.00 21.05 ? 421 THR A CB  1 
ATOM   3090 O OG1 . THR A 1 414 ? 75.771 20.287  12.742  1.00 23.53 ? 421 THR A OG1 1 
ATOM   3091 C CG2 . THR A 1 414 ? 75.817 18.917  10.764  1.00 20.59 ? 421 THR A CG2 1 
ATOM   3092 N N   . ALA A 1 415 ? 74.676 17.633  14.934  1.00 23.01 ? 422 ALA A N   1 
ATOM   3093 C CA  . ALA A 1 415 ? 74.643 17.704  16.384  1.00 25.95 ? 422 ALA A CA  1 
ATOM   3094 C C   . ALA A 1 415 ? 75.619 18.781  16.873  1.00 26.26 ? 422 ALA A C   1 
ATOM   3095 O O   . ALA A 1 415 ? 75.417 19.381  17.927  1.00 26.85 ? 422 ALA A O   1 
ATOM   3096 C CB  . ALA A 1 415 ? 75.009 16.349  16.981  1.00 19.96 ? 422 ALA A CB  1 
ATOM   3097 N N   . LYS A 1 416 ? 76.670 19.034  16.103  1.00 27.22 ? 423 LYS A N   1 
ATOM   3098 C CA  . LYS A 1 416 ? 77.653 20.037  16.504  1.00 28.45 ? 423 LYS A CA  1 
ATOM   3099 C C   . LYS A 1 416 ? 77.144 21.467  16.372  1.00 25.82 ? 423 LYS A C   1 
ATOM   3100 O O   . LYS A 1 416 ? 77.691 22.382  16.985  1.00 27.75 ? 423 LYS A O   1 
ATOM   3101 C CB  . LYS A 1 416 ? 78.951 19.864  15.711  1.00 34.21 ? 423 LYS A CB  1 
ATOM   3102 C CG  . LYS A 1 416 ? 78.778 19.900  14.216  1.00 43.64 ? 423 LYS A CG  1 
ATOM   3103 C CD  . LYS A 1 416 ? 80.075 19.528  13.504  1.00 52.07 ? 423 LYS A CD  1 
ATOM   3104 C CE  . LYS A 1 416 ? 79.898 19.590  11.984  1.00 54.50 ? 423 LYS A CE  1 
ATOM   3105 N NZ  . LYS A 1 416 ? 78.755 18.733  11.563  1.00 56.04 ? 423 LYS A NZ  1 
ATOM   3106 N N   . SER A 1 417 ? 76.097 21.674  15.583  1.00 23.50 ? 424 SER A N   1 
ATOM   3107 C CA  . SER A 1 417 ? 75.566 23.018  15.445  1.00 23.84 ? 424 SER A CA  1 
ATOM   3108 C C   . SER A 1 417 ? 74.149 23.199  16.000  1.00 24.77 ? 424 SER A C   1 
ATOM   3109 O O   . SER A 1 417 ? 73.643 24.324  16.043  1.00 21.95 ? 424 SER A O   1 
ATOM   3110 C CB  . SER A 1 417 ? 75.612 23.465  13.978  1.00 25.99 ? 424 SER A CB  1 
ATOM   3111 O OG  . SER A 1 417 ? 74.748 22.692  13.164  1.00 28.52 ? 424 SER A OG  1 
ATOM   3112 N N   . HIS A 1 418 ? 73.501 22.122  16.442  1.00 23.34 ? 425 HIS A N   1 
ATOM   3113 C CA  . HIS A 1 418 ? 72.147 22.285  16.957  1.00 22.53 ? 425 HIS A CA  1 
ATOM   3114 C C   . HIS A 1 418 ? 72.110 22.978  18.307  1.00 20.59 ? 425 HIS A C   1 
ATOM   3115 O O   . HIS A 1 418 ? 73.121 23.085  18.995  1.00 18.76 ? 425 HIS A O   1 
ATOM   3116 C CB  . HIS A 1 418 ? 71.399 20.944  17.000  1.00 22.28 ? 425 HIS A CB  1 
ATOM   3117 C CG  . HIS A 1 418 ? 71.867 19.987  18.056  1.00 19.96 ? 425 HIS A CG  1 
ATOM   3118 N ND1 . HIS A 1 418 ? 71.513 18.657  18.047  1.00 13.31 ? 425 HIS A ND1 1 
ATOM   3119 C CD2 . HIS A 1 418 ? 72.608 20.170  19.178  1.00 22.56 ? 425 HIS A CD2 1 
ATOM   3120 C CE1 . HIS A 1 418 ? 72.009 18.061  19.114  1.00 23.34 ? 425 HIS A CE1 1 
ATOM   3121 N NE2 . HIS A 1 418 ? 72.677 18.958  19.821  1.00 21.45 ? 425 HIS A NE2 1 
ATOM   3122 N N   . LYS A 1 419 ? 70.932 23.456  18.681  1.00 21.76 ? 426 LYS A N   1 
ATOM   3123 C CA  . LYS A 1 419 ? 70.774 24.160  19.940  1.00 22.70 ? 426 LYS A CA  1 
ATOM   3124 C C   . LYS A 1 419 ? 70.538 23.233  21.123  1.00 24.19 ? 426 LYS A C   1 
ATOM   3125 O O   . LYS A 1 419 ? 70.713 23.643  22.269  1.00 23.10 ? 426 LYS A O   1 
ATOM   3126 C CB  . LYS A 1 419 ? 69.641 25.175  19.818  1.00 22.54 ? 426 LYS A CB  1 
ATOM   3127 C CG  . LYS A 1 419 ? 69.985 26.342  18.914  1.00 24.44 ? 426 LYS A CG  1 
ATOM   3128 C CD  . LYS A 1 419 ? 71.041 27.226  19.566  1.00 35.44 ? 426 LYS A CD  1 
ATOM   3129 C CE  . LYS A 1 419 ? 71.338 28.462  18.728  1.00 38.80 ? 426 LYS A CE  1 
ATOM   3130 N NZ  . LYS A 1 419 ? 72.042 28.077  17.478  1.00 35.33 ? 426 LYS A NZ  1 
ATOM   3131 N N   . SER A 1 420 ? 70.157 21.985  20.851  1.00 23.42 ? 427 SER A N   1 
ATOM   3132 C CA  . SER A 1 420 ? 69.923 21.023  21.930  1.00 23.54 ? 427 SER A CA  1 
ATOM   3133 C C   . SER A 1 420 ? 71.193 20.819  22.736  1.00 20.93 ? 427 SER A C   1 
ATOM   3134 O O   . SER A 1 420 ? 72.299 20.916  22.216  1.00 19.19 ? 427 SER A O   1 
ATOM   3135 C CB  . SER A 1 420 ? 69.471 19.664  21.385  1.00 26.91 ? 427 SER A CB  1 
ATOM   3136 O OG  . SER A 1 420 ? 69.132 18.781  22.451  1.00 26.29 ? 427 SER A OG  1 
ATOM   3137 N N   . THR A 1 421 ? 71.014 20.521  24.013  1.00 23.05 ? 428 THR A N   1 
ATOM   3138 C CA  . THR A 1 421 ? 72.133 20.298  24.908  1.00 22.76 ? 428 THR A CA  1 
ATOM   3139 C C   . THR A 1 421 ? 72.715 18.896  24.737  1.00 23.40 ? 428 THR A C   1 
ATOM   3140 O O   . THR A 1 421 ? 73.837 18.655  25.160  1.00 20.66 ? 428 THR A O   1 
ATOM   3141 C CB  . THR A 1 421 ? 71.699 20.454  26.375  1.00 25.79 ? 428 THR A CB  1 
ATOM   3142 O OG1 . THR A 1 421 ? 70.724 19.454  26.688  1.00 21.98 ? 428 THR A OG1 1 
ATOM   3143 C CG2 . THR A 1 421 ? 71.086 21.840  26.614  1.00 22.51 ? 428 THR A CG2 1 
ATOM   3144 N N   . VAL A 1 422 ? 71.957 17.987  24.115  1.00 19.43 ? 429 VAL A N   1 
ATOM   3145 C CA  . VAL A 1 422 ? 72.406 16.607  23.928  1.00 18.01 ? 429 VAL A CA  1 
ATOM   3146 C C   . VAL A 1 422 ? 73.451 16.397  22.835  1.00 19.17 ? 429 VAL A C   1 
ATOM   3147 O O   . VAL A 1 422 ? 73.627 17.236  21.956  1.00 19.89 ? 429 VAL A O   1 
ATOM   3148 C CB  . VAL A 1 422 ? 71.217 15.652  23.663  1.00 18.50 ? 429 VAL A CB  1 
ATOM   3149 C CG1 . VAL A 1 422 ? 70.226 15.746  24.808  1.00 12.83 ? 429 VAL A CG1 1 
ATOM   3150 C CG2 . VAL A 1 422 ? 70.556 15.978  22.322  1.00 17.05 ? 429 VAL A CG2 1 
ATOM   3151 N N   . GLU A 1 423 ? 74.123 15.251  22.903  1.00 17.57 ? 430 GLU A N   1 
ATOM   3152 C CA  . GLU A 1 423 ? 75.191 14.897  21.975  1.00 19.04 ? 430 GLU A CA  1 
ATOM   3153 C C   . GLU A 1 423 ? 74.772 14.409  20.590  1.00 20.58 ? 430 GLU A C   1 
ATOM   3154 O O   . GLU A 1 423 ? 75.438 14.704  19.598  1.00 14.87 ? 430 GLU A O   1 
ATOM   3155 C CB  . GLU A 1 423 ? 76.092 13.837  22.612  1.00 21.49 ? 430 GLU A CB  1 
ATOM   3156 C CG  . GLU A 1 423 ? 76.712 14.237  23.944  1.00 30.50 ? 430 GLU A CG  1 
ATOM   3157 C CD  . GLU A 1 423 ? 75.791 14.010  25.143  1.00 31.88 ? 430 GLU A CD  1 
ATOM   3158 O OE1 . GLU A 1 423 ? 74.622 13.595  24.960  1.00 31.87 ? 430 GLU A OE1 1 
ATOM   3159 O OE2 . GLU A 1 423 ? 76.253 14.252  26.282  1.00 35.93 ? 430 GLU A OE2 1 
ATOM   3160 N N   . TYR A 1 424 ? 73.690 13.643  20.515  1.00 19.16 ? 431 TYR A N   1 
ATOM   3161 C CA  . TYR A 1 424 ? 73.242 13.133  19.224  1.00 18.03 ? 431 TYR A CA  1 
ATOM   3162 C C   . TYR A 1 424 ? 72.053 13.872  18.623  1.00 17.58 ? 431 TYR A C   1 
ATOM   3163 O O   . TYR A 1 424 ? 71.355 14.621  19.305  1.00 13.44 ? 431 TYR A O   1 
ATOM   3164 C CB  . TYR A 1 424 ? 72.908 11.642  19.328  1.00 18.69 ? 431 TYR A CB  1 
ATOM   3165 C CG  . TYR A 1 424 ? 74.133 10.753  19.381  1.00 25.68 ? 431 TYR A CG  1 
ATOM   3166 C CD1 . TYR A 1 424 ? 74.798 10.506  20.582  1.00 26.74 ? 431 TYR A CD1 1 
ATOM   3167 C CD2 . TYR A 1 424 ? 74.651 10.194  18.215  1.00 22.24 ? 431 TYR A CD2 1 
ATOM   3168 C CE1 . TYR A 1 424 ? 75.959 9.724   20.616  1.00 28.57 ? 431 TYR A CE1 1 
ATOM   3169 C CE2 . TYR A 1 424 ? 75.799 9.419   18.237  1.00 26.99 ? 431 TYR A CE2 1 
ATOM   3170 C CZ  . TYR A 1 424 ? 76.448 9.187   19.435  1.00 28.28 ? 431 TYR A CZ  1 
ATOM   3171 O OH  . TYR A 1 424 ? 77.587 8.420   19.440  1.00 28.81 ? 431 TYR A OH  1 
ATOM   3172 N N   . ASN A 1 425 ? 71.832 13.635  17.335  1.00 16.01 ? 432 ASN A N   1 
ATOM   3173 C CA  . ASN A 1 425 ? 70.729 14.239  16.596  1.00 17.25 ? 432 ASN A CA  1 
ATOM   3174 C C   . ASN A 1 425 ? 70.217 13.231  15.560  1.00 18.31 ? 432 ASN A C   1 
ATOM   3175 O O   . ASN A 1 425 ? 70.943 12.861  14.644  1.00 18.81 ? 432 ASN A O   1 
ATOM   3176 C CB  . ASN A 1 425 ? 71.209 15.514  15.900  1.00 17.11 ? 432 ASN A CB  1 
ATOM   3177 C CG  . ASN A 1 425 ? 70.064 16.340  15.345  1.00 20.16 ? 432 ASN A CG  1 
ATOM   3178 O OD1 . ASN A 1 425 ? 69.994 17.553  15.572  1.00 23.27 ? 432 ASN A OD1 1 
ATOM   3179 N ND2 . ASN A 1 425 ? 69.163 15.692  14.609  1.00 15.88 ? 432 ASN A ND2 1 
ATOM   3180 N N   . ILE A 1 426 ? 68.967 12.800  15.695  1.00 18.79 ? 433 ILE A N   1 
ATOM   3181 C CA  . ILE A 1 426 ? 68.394 11.818  14.771  1.00 18.01 ? 433 ILE A CA  1 
ATOM   3182 C C   . ILE A 1 426 ? 68.323 12.234  13.293  1.00 19.47 ? 433 ILE A C   1 
ATOM   3183 O O   . ILE A 1 426 ? 67.986 11.423  12.433  1.00 19.25 ? 433 ILE A O   1 
ATOM   3184 C CB  . ILE A 1 426 ? 66.988 11.374  15.241  1.00 18.18 ? 433 ILE A CB  1 
ATOM   3185 C CG1 . ILE A 1 426 ? 66.013 12.552  15.196  1.00 18.60 ? 433 ILE A CG1 1 
ATOM   3186 C CG2 . ILE A 1 426 ? 67.069 10.830  16.664  1.00 12.32 ? 433 ILE A CG2 1 
ATOM   3187 C CD1 . ILE A 1 426 ? 64.597 12.184  15.563  1.00 16.65 ? 433 ILE A CD1 1 
ATOM   3188 N N   . PHE A 1 427 ? 68.646 13.485  12.992  1.00 16.04 ? 434 PHE A N   1 
ATOM   3189 C CA  . PHE A 1 427 ? 68.624 13.951  11.605  1.00 18.94 ? 434 PHE A CA  1 
ATOM   3190 C C   . PHE A 1 427 ? 70.047 14.266  11.136  1.00 18.00 ? 434 PHE A C   1 
ATOM   3191 O O   . PHE A 1 427 ? 70.246 14.942  10.129  1.00 16.36 ? 434 PHE A O   1 
ATOM   3192 C CB  . PHE A 1 427 ? 67.758 15.207  11.475  1.00 16.08 ? 434 PHE A CB  1 
ATOM   3193 C CG  . PHE A 1 427 ? 66.347 15.028  11.963  1.00 16.75 ? 434 PHE A CG  1 
ATOM   3194 C CD1 . PHE A 1 427 ? 65.472 14.148  11.317  1.00 20.68 ? 434 PHE A CD1 1 
ATOM   3195 C CD2 . PHE A 1 427 ? 65.885 15.749  13.059  1.00 13.90 ? 434 PHE A CD2 1 
ATOM   3196 C CE1 . PHE A 1 427 ? 64.156 13.989  11.763  1.00 11.81 ? 434 PHE A CE1 1 
ATOM   3197 C CE2 . PHE A 1 427 ? 64.579 15.604  13.515  1.00 17.58 ? 434 PHE A CE2 1 
ATOM   3198 C CZ  . PHE A 1 427 ? 63.707 14.720  12.865  1.00 17.75 ? 434 PHE A CZ  1 
ATOM   3199 N N   . GLU A 1 428 ? 71.031 13.762  11.877  1.00 18.61 ? 435 GLU A N   1 
ATOM   3200 C CA  . GLU A 1 428 ? 72.439 13.994  11.572  1.00 21.50 ? 435 GLU A CA  1 
ATOM   3201 C C   . GLU A 1 428 ? 72.787 13.814  10.100  1.00 23.14 ? 435 GLU A C   1 
ATOM   3202 O O   . GLU A 1 428 ? 72.532 12.762  9.512   1.00 24.22 ? 435 GLU A O   1 
ATOM   3203 C CB  . GLU A 1 428 ? 73.311 13.056  12.405  1.00 19.24 ? 435 GLU A CB  1 
ATOM   3204 C CG  . GLU A 1 428 ? 74.803 13.379  12.345  1.00 23.83 ? 435 GLU A CG  1 
ATOM   3205 C CD  . GLU A 1 428 ? 75.143 14.715  12.999  1.00 24.55 ? 435 GLU A CD  1 
ATOM   3206 O OE1 . GLU A 1 428 ? 74.830 14.903  14.198  1.00 24.20 ? 435 GLU A OE1 1 
ATOM   3207 O OE2 . GLU A 1 428 ? 75.730 15.580  12.312  1.00 27.45 ? 435 GLU A OE2 1 
ATOM   3208 N N   . GLY A 1 429 ? 73.377 14.840  9.501   1.00 27.28 ? 436 GLY A N   1 
ATOM   3209 C CA  . GLY A 1 429 ? 73.762 14.730  8.102   1.00 29.00 ? 436 GLY A CA  1 
ATOM   3210 C C   . GLY A 1 429 ? 72.739 15.190  7.077   1.00 30.70 ? 436 GLY A C   1 
ATOM   3211 O O   . GLY A 1 429 ? 73.117 15.603  5.984   1.00 31.13 ? 436 GLY A O   1 
ATOM   3212 N N   . MET A 1 430 ? 71.453 15.122  7.410   1.00 29.45 ? 437 MET A N   1 
ATOM   3213 C CA  . MET A 1 430 ? 70.392 15.532  6.486   1.00 29.80 ? 437 MET A CA  1 
ATOM   3214 C C   . MET A 1 430 ? 70.575 16.953  5.937   1.00 29.56 ? 437 MET A C   1 
ATOM   3215 O O   . MET A 1 430 ? 70.523 17.921  6.691   1.00 27.65 ? 437 MET A O   1 
ATOM   3216 C CB  . MET A 1 430 ? 69.025 15.442  7.187   1.00 26.77 ? 437 MET A CB  1 
ATOM   3217 C CG  . MET A 1 430 ? 67.825 15.825  6.308   1.00 25.89 ? 437 MET A CG  1 
ATOM   3218 S SD  . MET A 1 430 ? 66.241 15.818  7.218   1.00 16.54 ? 437 MET A SD  1 
ATOM   3219 C CE  . MET A 1 430 ? 65.859 14.164  7.151   1.00 19.11 ? 437 MET A CE  1 
ATOM   3220 N N   . GLU A 1 431 ? 70.782 17.083  4.628   1.00 32.14 ? 438 GLU A N   1 
ATOM   3221 C CA  . GLU A 1 431 ? 70.928 18.411  4.033   1.00 36.37 ? 438 GLU A CA  1 
ATOM   3222 C C   . GLU A 1 431 ? 69.562 18.837  3.490   1.00 35.30 ? 438 GLU A C   1 
ATOM   3223 O O   . GLU A 1 431 ? 68.958 18.128  2.684   1.00 35.00 ? 438 GLU A O   1 
ATOM   3224 C CB  . GLU A 1 431 ? 72.000 18.401  2.933   1.00 40.21 ? 438 GLU A CB  1 
ATOM   3225 C CG  . GLU A 1 431 ? 72.021 17.165  2.066   1.00 49.82 ? 438 GLU A CG  1 
ATOM   3226 C CD  . GLU A 1 431 ? 73.407 16.884  1.464   1.00 57.42 ? 438 GLU A CD  1 
ATOM   3227 O OE1 . GLU A 1 431 ? 73.973 17.781  0.789   1.00 59.68 ? 438 GLU A OE1 1 
ATOM   3228 O OE2 . GLU A 1 431 ? 73.928 15.756  1.666   1.00 60.24 ? 438 GLU A OE2 1 
ATOM   3229 N N   . CYS A 1 432 ? 69.084 19.995  3.950   1.00 34.67 ? 439 CYS A N   1 
ATOM   3230 C CA  . CYS A 1 432 ? 67.767 20.528  3.578   1.00 34.74 ? 439 CYS A CA  1 
ATOM   3231 C C   . CYS A 1 432 ? 67.845 21.819  2.752   1.00 34.01 ? 439 CYS A C   1 
ATOM   3232 O O   . CYS A 1 432 ? 68.760 22.626  2.934   1.00 33.98 ? 439 CYS A O   1 
ATOM   3233 C CB  . CYS A 1 432 ? 66.961 20.804  4.860   1.00 29.52 ? 439 CYS A CB  1 
ATOM   3234 S SG  . CYS A 1 432 ? 67.016 19.463  6.104   1.00 32.78 ? 439 CYS A SG  1 
ATOM   3235 N N   . HIS A 1 433 ? 66.878 22.023  1.857   1.00 34.87 ? 440 HIS A N   1 
ATOM   3236 C CA  . HIS A 1 433 ? 66.855 23.228  1.024   1.00 36.55 ? 440 HIS A CA  1 
ATOM   3237 C C   . HIS A 1 433 ? 65.655 24.067  1.406   1.00 32.89 ? 440 HIS A C   1 
ATOM   3238 O O   . HIS A 1 433 ? 64.549 23.828  0.922   1.00 33.96 ? 440 HIS A O   1 
ATOM   3239 C CB  . HIS A 1 433 ? 66.752 22.870  -0.462  1.00 48.20 ? 440 HIS A CB  1 
ATOM   3240 C CG  . HIS A 1 433 ? 67.329 21.529  -0.799  1.00 59.56 ? 440 HIS A CG  1 
ATOM   3241 N ND1 . HIS A 1 433 ? 66.750 20.349  -0.376  1.00 64.39 ? 440 HIS A ND1 1 
ATOM   3242 C CD2 . HIS A 1 433 ? 68.453 21.185  -1.471  1.00 63.11 ? 440 HIS A CD2 1 
ATOM   3243 C CE1 . HIS A 1 433 ? 67.496 19.331  -0.774  1.00 68.81 ? 440 HIS A CE1 1 
ATOM   3244 N NE2 . HIS A 1 433 ? 68.534 19.808  -1.439  1.00 69.87 ? 440 HIS A NE2 1 
ATOM   3245 N N   . GLY A 1 434 ? 65.890 25.054  2.262   1.00 31.31 ? 441 GLY A N   1 
ATOM   3246 C CA  . GLY A 1 434 ? 64.842 25.934  2.742   1.00 27.54 ? 441 GLY A CA  1 
ATOM   3247 C C   . GLY A 1 434 ? 64.972 26.029  4.252   1.00 25.72 ? 441 GLY A C   1 
ATOM   3248 O O   . GLY A 1 434 ? 64.980 25.007  4.930   1.00 27.31 ? 441 GLY A O   1 
ATOM   3249 N N   . SER A 1 435 ? 65.121 27.243  4.782   1.00 25.50 ? 442 SER A N   1 
ATOM   3250 C CA  . SER A 1 435 ? 65.226 27.444  6.229   1.00 21.28 ? 442 SER A CA  1 
ATOM   3251 C C   . SER A 1 435 ? 64.933 28.894  6.658   1.00 21.34 ? 442 SER A C   1 
ATOM   3252 O O   . SER A 1 435 ? 64.802 29.791  5.828   1.00 17.74 ? 442 SER A O   1 
ATOM   3253 C CB  . SER A 1 435 ? 66.609 27.008  6.733   1.00 26.46 ? 442 SER A CB  1 
ATOM   3254 O OG  . SER A 1 435 ? 67.628 27.795  6.160   1.00 23.58 ? 442 SER A OG  1 
ATOM   3255 N N   . PRO A 1 436 ? 64.812 29.131  7.969   1.00 20.78 ? 443 PRO A N   1 
ATOM   3256 C CA  . PRO A 1 436 ? 64.527 30.457  8.525   1.00 20.57 ? 443 PRO A CA  1 
ATOM   3257 C C   . PRO A 1 436 ? 65.671 31.449  8.367   1.00 20.96 ? 443 PRO A C   1 
ATOM   3258 O O   . PRO A 1 436 ? 66.832 31.098  8.564   1.00 18.31 ? 443 PRO A O   1 
ATOM   3259 C CB  . PRO A 1 436 ? 64.257 30.172  10.012  1.00 19.74 ? 443 PRO A CB  1 
ATOM   3260 C CG  . PRO A 1 436 ? 63.983 28.739  10.078  1.00 19.83 ? 443 PRO A CG  1 
ATOM   3261 C CD  . PRO A 1 436 ? 64.897 28.137  9.047   1.00 21.35 ? 443 PRO A CD  1 
ATOM   3262 N N   . LEU A 1 437 ? 65.334 32.687  8.017   1.00 21.59 ? 444 LEU A N   1 
ATOM   3263 C CA  . LEU A 1 437 ? 66.318 33.756  7.871   1.00 20.21 ? 444 LEU A CA  1 
ATOM   3264 C C   . LEU A 1 437 ? 66.162 34.675  9.061   1.00 19.82 ? 444 LEU A C   1 
ATOM   3265 O O   . LEU A 1 437 ? 67.138 35.068  9.698   1.00 20.78 ? 444 LEU A O   1 
ATOM   3266 C CB  . LEU A 1 437 ? 66.068 34.577  6.608   1.00 22.44 ? 444 LEU A CB  1 
ATOM   3267 C CG  . LEU A 1 437 ? 66.852 34.233  5.354   1.00 27.87 ? 444 LEU A CG  1 
ATOM   3268 C CD1 . LEU A 1 437 ? 66.546 35.287  4.307   1.00 30.57 ? 444 LEU A CD1 1 
ATOM   3269 C CD2 . LEU A 1 437 ? 68.345 34.191  5.664   1.00 29.29 ? 444 LEU A CD2 1 
ATOM   3270 N N   . VAL A 1 438 ? 64.915 35.022  9.347   1.00 18.77 ? 445 VAL A N   1 
ATOM   3271 C CA  . VAL A 1 438 ? 64.602 35.895  10.465  1.00 17.97 ? 445 VAL A CA  1 
ATOM   3272 C C   . VAL A 1 438 ? 63.411 35.351  11.256  1.00 18.88 ? 445 VAL A C   1 
ATOM   3273 O O   . VAL A 1 438 ? 62.424 34.905  10.673  1.00 18.48 ? 445 VAL A O   1 
ATOM   3274 C CB  . VAL A 1 438 ? 64.243 37.306  9.978   1.00 15.40 ? 445 VAL A CB  1 
ATOM   3275 C CG1 . VAL A 1 438 ? 63.804 38.164  11.162  1.00 16.73 ? 445 VAL A CG1 1 
ATOM   3276 C CG2 . VAL A 1 438 ? 65.435 37.928  9.257   1.00 17.15 ? 445 VAL A CG2 1 
ATOM   3277 N N   . VAL A 1 439 ? 63.515 35.384  12.581  1.00 17.36 ? 446 VAL A N   1 
ATOM   3278 C CA  . VAL A 1 439 ? 62.432 34.928  13.433  1.00 16.16 ? 446 VAL A CA  1 
ATOM   3279 C C   . VAL A 1 439 ? 62.019 36.050  14.375  1.00 17.02 ? 446 VAL A C   1 
ATOM   3280 O O   . VAL A 1 439 ? 62.849 36.642  15.069  1.00 18.46 ? 446 VAL A O   1 
ATOM   3281 C CB  . VAL A 1 439 ? 62.819 33.687  14.271  1.00 13.97 ? 446 VAL A CB  1 
ATOM   3282 C CG1 . VAL A 1 439 ? 61.647 33.297  15.164  1.00 10.96 ? 446 VAL A CG1 1 
ATOM   3283 C CG2 . VAL A 1 439 ? 63.198 32.519  13.350  1.00 10.49 ? 446 VAL A CG2 1 
ATOM   3284 N N   . ILE A 1 440 ? 60.726 36.339  14.386  1.00 17.04 ? 447 ILE A N   1 
ATOM   3285 C CA  . ILE A 1 440 ? 60.184 37.388  15.223  1.00 14.92 ? 447 ILE A CA  1 
ATOM   3286 C C   . ILE A 1 440 ? 59.097 36.831  16.132  1.00 18.80 ? 447 ILE A C   1 
ATOM   3287 O O   . ILE A 1 440 ? 58.177 36.141  15.682  1.00 16.44 ? 447 ILE A O   1 
ATOM   3288 C CB  . ILE A 1 440 ? 59.620 38.522  14.348  1.00 16.54 ? 447 ILE A CB  1 
ATOM   3289 C CG1 . ILE A 1 440 ? 60.772 39.182  13.577  1.00 20.95 ? 447 ILE A CG1 1 
ATOM   3290 C CG2 . ILE A 1 440 ? 58.873 39.529  15.206  1.00 14.98 ? 447 ILE A CG2 1 
ATOM   3291 C CD1 . ILE A 1 440 ? 60.335 40.008  12.383  1.00 16.80 ? 447 ILE A CD1 1 
ATOM   3292 N N   . SER A 1 441 ? 59.211 37.131  17.419  1.00 15.84 ? 448 SER A N   1 
ATOM   3293 C CA  . SER A 1 441 ? 58.240 36.665  18.394  1.00 18.88 ? 448 SER A CA  1 
ATOM   3294 C C   . SER A 1 441 ? 57.794 37.850  19.243  1.00 21.09 ? 448 SER A C   1 
ATOM   3295 O O   . SER A 1 441 ? 58.620 38.626  19.716  1.00 19.19 ? 448 SER A O   1 
ATOM   3296 C CB  . SER A 1 441 ? 58.869 35.577  19.269  1.00 19.02 ? 448 SER A CB  1 
ATOM   3297 O OG  . SER A 1 441 ? 57.988 35.168  20.296  1.00 22.06 ? 448 SER A OG  1 
ATOM   3298 N N   . GLN A 1 442 ? 56.484 37.983  19.430  1.00 20.27 ? 449 GLN A N   1 
ATOM   3299 C CA  . GLN A 1 442 ? 55.925 39.086  20.201  1.00 20.31 ? 449 GLN A CA  1 
ATOM   3300 C C   . GLN A 1 442 ? 56.422 40.428  19.650  1.00 22.62 ? 449 GLN A C   1 
ATOM   3301 O O   . GLN A 1 442 ? 56.663 41.370  20.404  1.00 20.77 ? 449 GLN A O   1 
ATOM   3302 C CB  . GLN A 1 442 ? 56.298 38.956  21.690  1.00 23.19 ? 449 GLN A CB  1 
ATOM   3303 C CG  . GLN A 1 442 ? 55.684 37.738  22.388  1.00 23.12 ? 449 GLN A CG  1 
ATOM   3304 C CD  . GLN A 1 442 ? 55.622 37.886  23.907  1.00 25.43 ? 449 GLN A CD  1 
ATOM   3305 O OE1 . GLN A 1 442 ? 56.280 37.150  24.647  1.00 21.11 ? 449 GLN A OE1 1 
ATOM   3306 N NE2 . GLN A 1 442 ? 54.820 38.842  24.376  1.00 27.98 ? 449 GLN A NE2 1 
ATOM   3307 N N   . GLY A 1 443 ? 56.574 40.501  18.332  1.00 20.45 ? 450 GLY A N   1 
ATOM   3308 C CA  . GLY A 1 443 ? 57.037 41.720  17.698  1.00 23.78 ? 450 GLY A CA  1 
ATOM   3309 C C   . GLY A 1 443 ? 58.522 42.023  17.860  1.00 26.09 ? 450 GLY A C   1 
ATOM   3310 O O   . GLY A 1 443 ? 58.968 43.081  17.433  1.00 28.24 ? 450 GLY A O   1 
ATOM   3311 N N   . LYS A 1 444 ? 59.286 41.111  18.462  1.00 24.64 ? 451 LYS A N   1 
ATOM   3312 C CA  . LYS A 1 444 ? 60.727 41.301  18.661  1.00 22.41 ? 451 LYS A CA  1 
ATOM   3313 C C   . LYS A 1 444 ? 61.578 40.316  17.858  1.00 23.26 ? 451 LYS A C   1 
ATOM   3314 O O   . LYS A 1 444 ? 61.249 39.137  17.760  1.00 21.11 ? 451 LYS A O   1 
ATOM   3315 C CB  . LYS A 1 444 ? 61.088 41.133  20.142  1.00 23.70 ? 451 LYS A CB  1 
ATOM   3316 C CG  . LYS A 1 444 ? 60.505 42.197  21.068  1.00 28.78 ? 451 LYS A CG  1 
ATOM   3317 C CD  . LYS A 1 444 ? 60.758 41.848  22.534  1.00 36.21 ? 451 LYS A CD  1 
ATOM   3318 C CE  . LYS A 1 444 ? 60.249 42.955  23.461  1.00 39.54 ? 451 LYS A CE  1 
ATOM   3319 N NZ  . LYS A 1 444 ? 60.390 42.588  24.911  1.00 43.24 ? 451 LYS A NZ  1 
ATOM   3320 N N   . ILE A 1 445 ? 62.683 40.796  17.298  1.00 19.81 ? 452 ILE A N   1 
ATOM   3321 C CA  . ILE A 1 445 ? 63.577 39.925  16.543  1.00 23.13 ? 452 ILE A CA  1 
ATOM   3322 C C   . ILE A 1 445 ? 64.337 39.016  17.521  1.00 22.89 ? 452 ILE A C   1 
ATOM   3323 O O   . ILE A 1 445 ? 65.011 39.507  18.436  1.00 21.18 ? 452 ILE A O   1 
ATOM   3324 C CB  . ILE A 1 445 ? 64.624 40.731  15.733  1.00 23.68 ? 452 ILE A CB  1 
ATOM   3325 C CG1 . ILE A 1 445 ? 63.932 41.563  14.644  1.00 26.65 ? 452 ILE A CG1 1 
ATOM   3326 C CG2 . ILE A 1 445 ? 65.629 39.778  15.098  1.00 21.64 ? 452 ILE A CG2 1 
ATOM   3327 C CD1 . ILE A 1 445 ? 64.895 42.404  13.798  1.00 21.37 ? 452 ILE A CD1 1 
ATOM   3328 N N   . VAL A 1 446 ? 64.217 37.704  17.340  1.00 15.57 ? 453 VAL A N   1 
ATOM   3329 C CA  . VAL A 1 446 ? 64.920 36.773  18.210  1.00 18.59 ? 453 VAL A CA  1 
ATOM   3330 C C   . VAL A 1 446 ? 65.967 35.968  17.446  1.00 17.43 ? 453 VAL A C   1 
ATOM   3331 O O   . VAL A 1 446 ? 66.829 35.339  18.052  1.00 24.29 ? 453 VAL A O   1 
ATOM   3332 C CB  . VAL A 1 446 ? 63.947 35.812  18.946  1.00 18.26 ? 453 VAL A CB  1 
ATOM   3333 C CG1 . VAL A 1 446 ? 63.091 36.605  19.929  1.00 23.08 ? 453 VAL A CG1 1 
ATOM   3334 C CG2 . VAL A 1 446 ? 63.074 35.072  17.950  1.00 15.87 ? 453 VAL A CG2 1 
ATOM   3335 N N   . PHE A 1 447 ? 65.896 35.993  16.120  1.00 17.14 ? 454 PHE A N   1 
ATOM   3336 C CA  . PHE A 1 447 ? 66.872 35.277  15.298  1.00 20.17 ? 454 PHE A CA  1 
ATOM   3337 C C   . PHE A 1 447 ? 67.142 36.029  13.998  1.00 19.22 ? 454 PHE A C   1 
ATOM   3338 O O   . PHE A 1 447 ? 66.222 36.300  13.227  1.00 18.52 ? 454 PHE A O   1 
ATOM   3339 C CB  . PHE A 1 447 ? 66.377 33.871  14.956  1.00 16.17 ? 454 PHE A CB  1 
ATOM   3340 C CG  . PHE A 1 447 ? 67.362 33.063  14.162  1.00 17.62 ? 454 PHE A CG  1 
ATOM   3341 C CD1 . PHE A 1 447 ? 68.410 32.403  14.793  1.00 18.74 ? 454 PHE A CD1 1 
ATOM   3342 C CD2 . PHE A 1 447 ? 67.248 32.966  12.780  1.00 18.21 ? 454 PHE A CD2 1 
ATOM   3343 C CE1 . PHE A 1 447 ? 69.336 31.657  14.054  1.00 17.87 ? 454 PHE A CE1 1 
ATOM   3344 C CE2 . PHE A 1 447 ? 68.170 32.223  12.031  1.00 19.50 ? 454 PHE A CE2 1 
ATOM   3345 C CZ  . PHE A 1 447 ? 69.212 31.569  12.669  1.00 17.63 ? 454 PHE A CZ  1 
ATOM   3346 N N   . GLU A 1 448 ? 68.404 36.368  13.762  1.00 18.82 ? 455 GLU A N   1 
ATOM   3347 C CA  . GLU A 1 448 ? 68.783 37.073  12.543  1.00 19.88 ? 455 GLU A CA  1 
ATOM   3348 C C   . GLU A 1 448 ? 70.283 36.942  12.321  1.00 19.42 ? 455 GLU A C   1 
ATOM   3349 O O   . GLU A 1 448 ? 71.042 36.751  13.264  1.00 20.86 ? 455 GLU A O   1 
ATOM   3350 C CB  . GLU A 1 448 ? 68.380 38.552  12.618  1.00 18.66 ? 455 GLU A CB  1 
ATOM   3351 C CG  . GLU A 1 448 ? 69.290 39.423  13.458  1.00 19.60 ? 455 GLU A CG  1 
ATOM   3352 C CD  . GLU A 1 448 ? 68.846 40.886  13.491  1.00 25.97 ? 455 GLU A CD  1 
ATOM   3353 O OE1 . GLU A 1 448 ? 68.318 41.396  12.476  1.00 24.75 ? 455 GLU A OE1 1 
ATOM   3354 O OE2 . GLU A 1 448 ? 69.037 41.534  14.540  1.00 28.54 ? 455 GLU A OE2 1 
ATOM   3355 N N   . ASP A 1 449 ? 70.700 37.021  11.064  1.00 20.13 ? 456 ASP A N   1 
ATOM   3356 C CA  . ASP A 1 449 ? 72.111 36.905  10.721  1.00 23.69 ? 456 ASP A CA  1 
ATOM   3357 C C   . ASP A 1 449 ? 72.710 35.622  11.300  1.00 25.75 ? 456 ASP A C   1 
ATOM   3358 O O   . ASP A 1 449 ? 73.861 35.609  11.750  1.00 24.60 ? 456 ASP A O   1 
ATOM   3359 C CB  . ASP A 1 449 ? 72.889 38.115  11.242  1.00 21.16 ? 456 ASP A CB  1 
ATOM   3360 C CG  . ASP A 1 449 ? 72.230 39.436  10.880  1.00 23.28 ? 456 ASP A CG  1 
ATOM   3361 O OD1 . ASP A 1 449 ? 71.650 39.545  9.779   1.00 24.43 ? 456 ASP A OD1 1 
ATOM   3362 O OD2 . ASP A 1 449 ? 72.302 40.377  11.698  1.00 21.71 ? 456 ASP A OD2 1 
ATOM   3363 N N   . GLY A 1 450 ? 71.913 34.556  11.300  1.00 24.42 ? 457 GLY A N   1 
ATOM   3364 C CA  . GLY A 1 450 ? 72.369 33.268  11.798  1.00 23.17 ? 457 GLY A CA  1 
ATOM   3365 C C   . GLY A 1 450 ? 72.520 33.150  13.300  1.00 23.69 ? 457 GLY A C   1 
ATOM   3366 O O   . GLY A 1 450 ? 72.983 32.122  13.799  1.00 24.63 ? 457 GLY A O   1 
ATOM   3367 N N   . ASN A 1 451 ? 72.114 34.177  14.035  1.00 23.30 ? 458 ASN A N   1 
ATOM   3368 C CA  . ASN A 1 451 ? 72.263 34.134  15.484  1.00 25.75 ? 458 ASN A CA  1 
ATOM   3369 C C   . ASN A 1 451 ? 71.006 34.375  16.290  1.00 25.92 ? 458 ASN A C   1 
ATOM   3370 O O   . ASN A 1 451 ? 70.134 35.152  15.898  1.00 23.54 ? 458 ASN A O   1 
ATOM   3371 C CB  . ASN A 1 451 ? 73.361 35.100  15.909  1.00 21.92 ? 458 ASN A CB  1 
ATOM   3372 C CG  . ASN A 1 451 ? 74.735 34.517  15.690  1.00 27.51 ? 458 ASN A CG  1 
ATOM   3373 O OD1 . ASN A 1 451 ? 75.277 33.834  16.565  1.00 28.09 ? 458 ASN A OD1 1 
ATOM   3374 N ND2 . ASN A 1 451 ? 75.298 34.751  14.508  1.00 21.62 ? 458 ASN A ND2 1 
ATOM   3375 N N   . ILE A 1 452 ? 70.937 33.689  17.428  1.00 27.34 ? 459 ILE A N   1 
ATOM   3376 C CA  . ILE A 1 452 ? 69.792 33.759  18.325  1.00 29.01 ? 459 ILE A CA  1 
ATOM   3377 C C   . ILE A 1 452 ? 69.951 34.891  19.341  1.00 30.86 ? 459 ILE A C   1 
ATOM   3378 O O   . ILE A 1 452 ? 71.069 35.227  19.759  1.00 29.85 ? 459 ILE A O   1 
ATOM   3379 C CB  . ILE A 1 452 ? 69.626 32.415  19.081  1.00 30.63 ? 459 ILE A CB  1 
ATOM   3380 C CG1 . ILE A 1 452 ? 68.238 32.330  19.720  1.00 31.56 ? 459 ILE A CG1 1 
ATOM   3381 C CG2 . ILE A 1 452 ? 70.712 32.274  20.140  1.00 32.15 ? 459 ILE A CG2 1 
ATOM   3382 C CD1 . ILE A 1 452 ? 67.128 32.047  18.708  1.00 29.57 ? 459 ILE A CD1 1 
ATOM   3383 N N   . SER A 1 453 ? 68.831 35.483  19.736  1.00 28.42 ? 460 SER A N   1 
ATOM   3384 C CA  . SER A 1 453 ? 68.853 36.559  20.715  1.00 27.48 ? 460 SER A CA  1 
ATOM   3385 C C   . SER A 1 453 ? 67.572 36.472  21.528  1.00 26.17 ? 460 SER A C   1 
ATOM   3386 O O   . SER A 1 453 ? 66.561 37.075  21.174  1.00 27.51 ? 460 SER A O   1 
ATOM   3387 C CB  . SER A 1 453 ? 68.939 37.906  20.005  1.00 32.94 ? 460 SER A CB  1 
ATOM   3388 O OG  . SER A 1 453 ? 69.146 38.939  20.942  1.00 39.24 ? 460 SER A OG  1 
ATOM   3389 N N   . VAL A 1 454 ? 67.614 35.722  22.622  1.00 24.81 ? 461 VAL A N   1 
ATOM   3390 C CA  . VAL A 1 454 ? 66.428 35.539  23.449  1.00 27.20 ? 461 VAL A CA  1 
ATOM   3391 C C   . VAL A 1 454 ? 66.509 36.153  24.838  1.00 29.23 ? 461 VAL A C   1 
ATOM   3392 O O   . VAL A 1 454 ? 67.564 36.628  25.270  1.00 26.89 ? 461 VAL A O   1 
ATOM   3393 C CB  . VAL A 1 454 ? 66.091 34.032  23.602  1.00 26.10 ? 461 VAL A CB  1 
ATOM   3394 C CG1 . VAL A 1 454 ? 65.615 33.463  22.272  1.00 24.49 ? 461 VAL A CG1 1 
ATOM   3395 C CG2 . VAL A 1 454 ? 67.321 33.270  24.063  1.00 21.30 ? 461 VAL A CG2 1 
ATOM   3396 N N   . SER A 1 455 ? 65.361 36.143  25.516  1.00 30.06 ? 462 SER A N   1 
ATOM   3397 C CA  . SER A 1 455 ? 65.214 36.660  26.868  1.00 31.47 ? 462 SER A CA  1 
ATOM   3398 C C   . SER A 1 455 ? 64.489 35.597  27.681  1.00 30.31 ? 462 SER A C   1 
ATOM   3399 O O   . SER A 1 455 ? 63.315 35.313  27.425  1.00 30.73 ? 462 SER A O   1 
ATOM   3400 C CB  . SER A 1 455 ? 64.376 37.945  26.863  1.00 34.14 ? 462 SER A CB  1 
ATOM   3401 O OG  . SER A 1 455 ? 65.175 39.089  27.129  1.00 42.49 ? 462 SER A OG  1 
ATOM   3402 N N   . LYS A 1 456 ? 65.177 35.009  28.654  1.00 27.61 ? 463 LYS A N   1 
ATOM   3403 C CA  . LYS A 1 456 ? 64.565 33.977  29.489  1.00 25.98 ? 463 LYS A CA  1 
ATOM   3404 C C   . LYS A 1 456 ? 63.334 34.518  30.211  1.00 23.12 ? 463 LYS A C   1 
ATOM   3405 O O   . LYS A 1 456 ? 63.390 35.565  30.833  1.00 23.92 ? 463 LYS A O   1 
ATOM   3406 C CB  . LYS A 1 456 ? 65.586 33.447  30.504  1.00 28.64 ? 463 LYS A CB  1 
ATOM   3407 C CG  . LYS A 1 456 ? 65.050 32.331  31.385  1.00 35.02 ? 463 LYS A CG  1 
ATOM   3408 C CD  . LYS A 1 456 ? 66.158 31.428  31.893  1.00 37.47 ? 463 LYS A CD  1 
ATOM   3409 C CE  . LYS A 1 456 ? 67.212 32.197  32.640  1.00 37.22 ? 463 LYS A CE  1 
ATOM   3410 N NZ  . LYS A 1 456 ? 66.575 32.966  33.724  1.00 41.68 ? 463 LYS A NZ  1 
ATOM   3411 N N   . GLY A 1 457 ? 62.215 33.809  30.109  1.00 23.51 ? 464 GLY A N   1 
ATOM   3412 C CA  . GLY A 1 457 ? 60.998 34.250  30.770  1.00 18.90 ? 464 GLY A CA  1 
ATOM   3413 C C   . GLY A 1 457 ? 60.133 35.250  30.020  1.00 17.68 ? 464 GLY A C   1 
ATOM   3414 O O   . GLY A 1 457 ? 59.124 35.708  30.546  1.00 18.60 ? 464 GLY A O   1 
ATOM   3415 N N   . MET A 1 458 ? 60.509 35.590  28.794  1.00 18.92 ? 465 MET A N   1 
ATOM   3416 C CA  . MET A 1 458 ? 59.738 36.552  28.006  1.00 22.86 ? 465 MET A CA  1 
ATOM   3417 C C   . MET A 1 458 ? 58.415 35.964  27.501  1.00 22.69 ? 465 MET A C   1 
ATOM   3418 O O   . MET A 1 458 ? 57.460 36.701  27.246  1.00 20.07 ? 465 MET A O   1 
ATOM   3419 C CB  . MET A 1 458 ? 60.567 37.030  26.811  1.00 28.90 ? 465 MET A CB  1 
ATOM   3420 C CG  . MET A 1 458 ? 59.915 38.131  25.987  1.00 36.75 ? 465 MET A CG  1 
ATOM   3421 S SD  . MET A 1 458 ? 59.728 39.690  26.909  1.00 40.16 ? 465 MET A SD  1 
ATOM   3422 C CE  . MET A 1 458 ? 61.370 39.790  27.725  1.00 35.73 ? 465 MET A CE  1 
ATOM   3423 N N   . GLY A 1 459 ? 58.373 34.641  27.360  1.00 17.29 ? 466 GLY A N   1 
ATOM   3424 C CA  . GLY A 1 459 ? 57.174 33.978  26.874  1.00 20.47 ? 466 GLY A CA  1 
ATOM   3425 C C   . GLY A 1 459 ? 55.946 34.101  27.765  1.00 20.95 ? 466 GLY A C   1 
ATOM   3426 O O   . GLY A 1 459 ? 56.052 34.079  28.995  1.00 23.08 ? 466 GLY A O   1 
ATOM   3427 N N   . ARG A 1 460 ? 54.776 34.225  27.146  1.00 18.25 ? 467 ARG A N   1 
ATOM   3428 C CA  . ARG A 1 460 ? 53.513 34.336  27.888  1.00 20.04 ? 467 ARG A CA  1 
ATOM   3429 C C   . ARG A 1 460 ? 52.739 33.017  27.799  1.00 22.11 ? 467 ARG A C   1 
ATOM   3430 O O   . ARG A 1 460 ? 52.850 32.298  26.803  1.00 21.24 ? 467 ARG A O   1 
ATOM   3431 C CB  . ARG A 1 460 ? 52.617 35.423  27.286  1.00 17.94 ? 467 ARG A CB  1 
ATOM   3432 C CG  . ARG A 1 460 ? 53.251 36.774  27.041  1.00 19.89 ? 467 ARG A CG  1 
ATOM   3433 C CD  . ARG A 1 460 ? 52.280 37.658  26.264  1.00 17.56 ? 467 ARG A CD  1 
ATOM   3434 N NE  . ARG A 1 460 ? 52.046 37.146  24.914  1.00 21.86 ? 467 ARG A NE  1 
ATOM   3435 C CZ  . ARG A 1 460 ? 51.138 37.623  24.068  1.00 21.42 ? 467 ARG A CZ  1 
ATOM   3436 N NH1 . ARG A 1 460 ? 50.356 38.636  24.427  1.00 22.62 ? 467 ARG A NH1 1 
ATOM   3437 N NH2 . ARG A 1 460 ? 51.014 37.091  22.857  1.00 17.05 ? 467 ARG A NH2 1 
ATOM   3438 N N   . PHE A 1 461 ? 51.951 32.707  28.825  1.00 20.28 ? 468 PHE A N   1 
ATOM   3439 C CA  . PHE A 1 461 ? 51.129 31.501  28.817  1.00 21.31 ? 468 PHE A CA  1 
ATOM   3440 C C   . PHE A 1 461 ? 49.881 31.901  28.049  1.00 21.52 ? 468 PHE A C   1 
ATOM   3441 O O   . PHE A 1 461 ? 49.325 32.961  28.295  1.00 22.61 ? 468 PHE A O   1 
ATOM   3442 C CB  . PHE A 1 461 ? 50.737 31.092  30.242  1.00 21.40 ? 468 PHE A CB  1 
ATOM   3443 C CG  . PHE A 1 461 ? 49.663 30.029  30.301  1.00 21.52 ? 468 PHE A CG  1 
ATOM   3444 C CD1 . PHE A 1 461 ? 49.948 28.700  29.987  1.00 23.68 ? 468 PHE A CD1 1 
ATOM   3445 C CD2 . PHE A 1 461 ? 48.353 30.364  30.643  1.00 24.39 ? 468 PHE A CD2 1 
ATOM   3446 C CE1 . PHE A 1 461 ? 48.943 27.723  30.010  1.00 20.72 ? 468 PHE A CE1 1 
ATOM   3447 C CE2 . PHE A 1 461 ? 47.340 29.392  30.670  1.00 18.99 ? 468 PHE A CE2 1 
ATOM   3448 C CZ  . PHE A 1 461 ? 47.634 28.075  30.353  1.00 21.14 ? 468 PHE A CZ  1 
ATOM   3449 N N   . ILE A 1 462 ? 49.439 31.075  27.113  1.00 21.68 ? 469 ILE A N   1 
ATOM   3450 C CA  . ILE A 1 462 ? 48.245 31.405  26.343  1.00 17.78 ? 469 ILE A CA  1 
ATOM   3451 C C   . ILE A 1 462 ? 47.088 30.491  26.722  1.00 20.38 ? 469 ILE A C   1 
ATOM   3452 O O   . ILE A 1 462 ? 47.069 29.315  26.352  1.00 19.09 ? 469 ILE A O   1 
ATOM   3453 C CB  . ILE A 1 462 ? 48.482 31.237  24.850  1.00 18.04 ? 469 ILE A CB  1 
ATOM   3454 C CG1 . ILE A 1 462 ? 49.729 32.017  24.419  1.00 19.34 ? 469 ILE A CG1 1 
ATOM   3455 C CG2 . ILE A 1 462 ? 47.246 31.686  24.093  1.00 18.13 ? 469 ILE A CG2 1 
ATOM   3456 C CD1 . ILE A 1 462 ? 49.611 33.526  24.546  1.00 25.08 ? 469 ILE A CD1 1 
ATOM   3457 N N   . PRO A 1 463 ? 46.102 31.013  27.466  1.00 20.14 ? 470 PRO A N   1 
ATOM   3458 C CA  . PRO A 1 463 ? 44.980 30.148  27.839  1.00 21.73 ? 470 PRO A CA  1 
ATOM   3459 C C   . PRO A 1 463 ? 44.082 29.968  26.625  1.00 21.82 ? 470 PRO A C   1 
ATOM   3460 O O   . PRO A 1 463 ? 44.010 30.858  25.778  1.00 20.44 ? 470 PRO A O   1 
ATOM   3461 C CB  . PRO A 1 463 ? 44.301 30.934  28.954  1.00 26.67 ? 470 PRO A CB  1 
ATOM   3462 C CG  . PRO A 1 463 ? 44.495 32.367  28.495  1.00 25.48 ? 470 PRO A CG  1 
ATOM   3463 C CD  . PRO A 1 463 ? 45.945 32.364  28.035  1.00 23.51 ? 470 PRO A CD  1 
ATOM   3464 N N   . ARG A 1 464 ? 43.416 28.818  26.538  1.00 21.55 ? 471 ARG A N   1 
ATOM   3465 C CA  . ARG A 1 464 ? 42.522 28.525  25.424  1.00 21.35 ? 471 ARG A CA  1 
ATOM   3466 C C   . ARG A 1 464 ? 41.115 28.133  25.893  1.00 20.73 ? 471 ARG A C   1 
ATOM   3467 O O   . ARG A 1 464 ? 40.956 27.411  26.888  1.00 19.42 ? 471 ARG A O   1 
ATOM   3468 C CB  . ARG A 1 464 ? 43.118 27.397  24.578  1.00 19.92 ? 471 ARG A CB  1 
ATOM   3469 C CG  . ARG A 1 464 ? 44.442 27.760  23.921  1.00 21.54 ? 471 ARG A CG  1 
ATOM   3470 C CD  . ARG A 1 464 ? 45.208 26.518  23.552  1.00 21.94 ? 471 ARG A CD  1 
ATOM   3471 N NE  . ARG A 1 464 ? 45.545 25.765  24.753  1.00 20.83 ? 471 ARG A NE  1 
ATOM   3472 C CZ  . ARG A 1 464 ? 45.687 24.447  24.800  1.00 20.79 ? 471 ARG A CZ  1 
ATOM   3473 N NH1 . ARG A 1 464 ? 45.516 23.719  23.703  1.00 20.16 ? 471 ARG A NH1 1 
ATOM   3474 N NH2 . ARG A 1 464 ? 46.001 23.858  25.947  1.00 17.50 ? 471 ARG A NH2 1 
ATOM   3475 N N   . LYS A 1 465 ? 40.101 28.619  25.179  1.00 19.01 ? 472 LYS A N   1 
ATOM   3476 C CA  . LYS A 1 465 ? 38.716 28.304  25.508  1.00 19.49 ? 472 LYS A CA  1 
ATOM   3477 C C   . LYS A 1 465 ? 38.330 26.923  24.965  1.00 21.48 ? 472 LYS A C   1 
ATOM   3478 O O   . LYS A 1 465 ? 38.898 26.441  23.974  1.00 17.67 ? 472 LYS A O   1 
ATOM   3479 C CB  . LYS A 1 465 ? 37.767 29.370  24.929  1.00 23.53 ? 472 LYS A CB  1 
ATOM   3480 C CG  . LYS A 1 465 ? 37.867 30.739  25.611  1.00 26.71 ? 472 LYS A CG  1 
ATOM   3481 C CD  . LYS A 1 465 ? 36.994 31.812  24.948  1.00 35.40 ? 472 LYS A CD  1 
ATOM   3482 C CE  . LYS A 1 465 ? 35.490 31.592  25.160  1.00 38.61 ? 472 LYS A CE  1 
ATOM   3483 N NZ  . LYS A 1 465 ? 34.852 30.717  24.109  1.00 40.07 ? 472 LYS A NZ  1 
ATOM   3484 N N   . PRO A 1 466 ? 37.365 26.259  25.620  1.00 20.37 ? 473 PRO A N   1 
ATOM   3485 C CA  . PRO A 1 466 ? 36.940 24.941  25.155  1.00 15.29 ? 473 PRO A CA  1 
ATOM   3486 C C   . PRO A 1 466 ? 35.993 25.096  23.967  1.00 17.09 ? 473 PRO A C   1 
ATOM   3487 O O   . PRO A 1 466 ? 35.709 26.220  23.531  1.00 16.85 ? 473 PRO A O   1 
ATOM   3488 C CB  . PRO A 1 466 ? 36.247 24.355  26.380  1.00 14.90 ? 473 PRO A CB  1 
ATOM   3489 C CG  . PRO A 1 466 ? 35.586 25.559  26.966  1.00 18.59 ? 473 PRO A CG  1 
ATOM   3490 C CD  . PRO A 1 466 ? 36.685 26.618  26.878  1.00 21.23 ? 473 PRO A CD  1 
ATOM   3491 N N   . PHE A 1 467 ? 35.528 23.964  23.447  1.00 11.44 ? 474 PHE A N   1 
ATOM   3492 C CA  . PHE A 1 467 ? 34.610 23.930  22.318  1.00 16.32 ? 474 PHE A CA  1 
ATOM   3493 C C   . PHE A 1 467 ? 35.102 24.571  21.018  1.00 15.91 ? 474 PHE A C   1 
ATOM   3494 O O   . PHE A 1 467 ? 34.404 25.396  20.434  1.00 15.00 ? 474 PHE A O   1 
ATOM   3495 C CB  . PHE A 1 467 ? 33.270 24.559  22.718  1.00 17.94 ? 474 PHE A CB  1 
ATOM   3496 C CG  . PHE A 1 467 ? 32.514 23.760  23.734  1.00 19.10 ? 474 PHE A CG  1 
ATOM   3497 C CD1 . PHE A 1 467 ? 31.836 22.603  23.363  1.00 20.84 ? 474 PHE A CD1 1 
ATOM   3498 C CD2 . PHE A 1 467 ? 32.509 24.139  25.073  1.00 20.02 ? 474 PHE A CD2 1 
ATOM   3499 C CE1 . PHE A 1 467 ? 31.171 21.830  24.307  1.00 22.10 ? 474 PHE A CE1 1 
ATOM   3500 C CE2 . PHE A 1 467 ? 31.845 23.370  26.027  1.00 18.05 ? 474 PHE A CE2 1 
ATOM   3501 C CZ  . PHE A 1 467 ? 31.173 22.215  25.640  1.00 18.55 ? 474 PHE A CZ  1 
ATOM   3502 N N   . PRO A 1 468 ? 36.309 24.203  20.551  1.00 20.16 ? 475 PRO A N   1 
ATOM   3503 C CA  . PRO A 1 468 ? 36.829 24.772  19.300  1.00 17.53 ? 475 PRO A CA  1 
ATOM   3504 C C   . PRO A 1 468 ? 35.783 24.489  18.213  1.00 19.00 ? 475 PRO A C   1 
ATOM   3505 O O   . PRO A 1 468 ? 35.355 23.343  18.051  1.00 15.20 ? 475 PRO A O   1 
ATOM   3506 C CB  . PRO A 1 468 ? 38.097 23.964  19.037  1.00 22.42 ? 475 PRO A CB  1 
ATOM   3507 C CG  . PRO A 1 468 ? 38.486 23.446  20.372  1.00 25.67 ? 475 PRO A CG  1 
ATOM   3508 C CD  . PRO A 1 468 ? 37.190 23.139  21.056  1.00 17.63 ? 475 PRO A CD  1 
ATOM   3509 N N   . GLU A 1 469 ? 35.374 25.526  17.490  1.00 17.53 ? 476 GLU A N   1 
ATOM   3510 C CA  . GLU A 1 469 ? 34.379 25.406  16.426  1.00 19.59 ? 476 GLU A CA  1 
ATOM   3511 C C   . GLU A 1 469 ? 34.737 24.361  15.365  1.00 19.84 ? 476 GLU A C   1 
ATOM   3512 O O   . GLU A 1 469 ? 33.887 23.565  14.952  1.00 15.11 ? 476 GLU A O   1 
ATOM   3513 C CB  . GLU A 1 469 ? 34.200 26.755  15.721  1.00 22.83 ? 476 GLU A CB  1 
ATOM   3514 C CG  . GLU A 1 469 ? 33.598 27.846  16.573  1.00 30.39 ? 476 GLU A CG  1 
ATOM   3515 C CD  . GLU A 1 469 ? 32.098 27.753  16.640  1.00 38.67 ? 476 GLU A CD  1 
ATOM   3516 O OE1 . GLU A 1 469 ? 31.598 26.727  17.140  1.00 44.38 ? 476 GLU A OE1 1 
ATOM   3517 O OE2 . GLU A 1 469 ? 31.417 28.705  16.183  1.00 42.50 ? 476 GLU A OE2 1 
ATOM   3518 N N   . HIS A 1 470 ? 35.989 24.391  14.909  1.00 16.72 ? 477 HIS A N   1 
ATOM   3519 C CA  . HIS A 1 470 ? 36.450 23.470  13.885  1.00 18.62 ? 477 HIS A CA  1 
ATOM   3520 C C   . HIS A 1 470 ? 36.107 22.031  14.281  1.00 20.38 ? 477 HIS A C   1 
ATOM   3521 O O   . HIS A 1 470 ? 35.874 21.173  13.428  1.00 19.66 ? 477 HIS A O   1 
ATOM   3522 C CB  . HIS A 1 470 ? 37.959 23.631  13.686  1.00 20.03 ? 477 HIS A CB  1 
ATOM   3523 C CG  . HIS A 1 470 ? 38.494 22.910  12.488  1.00 24.56 ? 477 HIS A CG  1 
ATOM   3524 N ND1 . HIS A 1 470 ? 39.552 22.027  12.561  1.00 25.68 ? 477 HIS A ND1 1 
ATOM   3525 C CD2 . HIS A 1 470 ? 38.118 22.940  11.188  1.00 27.05 ? 477 HIS A CD2 1 
ATOM   3526 C CE1 . HIS A 1 470 ? 39.804 21.542  11.359  1.00 20.86 ? 477 HIS A CE1 1 
ATOM   3527 N NE2 . HIS A 1 470 ? 38.948 22.080  10.507  1.00 30.90 ? 477 HIS A NE2 1 
ATOM   3528 N N   . LEU A 1 471 ? 36.060 21.776  15.582  1.00 18.03 ? 478 LEU A N   1 
ATOM   3529 C CA  . LEU A 1 471 ? 35.742 20.446  16.082  1.00 20.07 ? 478 LEU A CA  1 
ATOM   3530 C C   . LEU A 1 471 ? 34.296 20.242  16.508  1.00 18.23 ? 478 LEU A C   1 
ATOM   3531 O O   . LEU A 1 471 ? 33.630 19.323  16.036  1.00 17.08 ? 478 LEU A O   1 
ATOM   3532 C CB  . LEU A 1 471 ? 36.653 20.081  17.263  1.00 21.14 ? 478 LEU A CB  1 
ATOM   3533 C CG  . LEU A 1 471 ? 37.942 19.295  16.977  1.00 21.89 ? 478 LEU A CG  1 
ATOM   3534 C CD1 . LEU A 1 471 ? 38.915 20.150  16.176  1.00 20.69 ? 478 LEU A CD1 1 
ATOM   3535 C CD2 . LEU A 1 471 ? 38.579 18.868  18.299  1.00 21.39 ? 478 LEU A CD2 1 
ATOM   3536 N N   . TYR A 1 472 ? 33.797 21.104  17.384  1.00 16.50 ? 479 TYR A N   1 
ATOM   3537 C CA  . TYR A 1 472 ? 32.443 20.923  17.898  1.00 17.65 ? 479 TYR A CA  1 
ATOM   3538 C C   . TYR A 1 472 ? 31.199 21.284  17.084  1.00 20.34 ? 479 TYR A C   1 
ATOM   3539 O O   . TYR A 1 472 ? 30.099 20.873  17.453  1.00 22.74 ? 479 TYR A O   1 
ATOM   3540 C CB  . TYR A 1 472 ? 32.373 21.538  19.293  1.00 17.15 ? 479 TYR A CB  1 
ATOM   3541 C CG  . TYR A 1 472 ? 33.056 20.642  20.299  1.00 20.53 ? 479 TYR A CG  1 
ATOM   3542 C CD1 . TYR A 1 472 ? 32.362 19.594  20.910  1.00 20.77 ? 479 TYR A CD1 1 
ATOM   3543 C CD2 . TYR A 1 472 ? 34.413 20.783  20.580  1.00 19.50 ? 479 TYR A CD2 1 
ATOM   3544 C CE1 . TYR A 1 472 ? 33.005 18.706  21.777  1.00 19.66 ? 479 TYR A CE1 1 
ATOM   3545 C CE2 . TYR A 1 472 ? 35.065 19.900  21.442  1.00 21.57 ? 479 TYR A CE2 1 
ATOM   3546 C CZ  . TYR A 1 472 ? 34.353 18.862  22.036  1.00 19.84 ? 479 TYR A CZ  1 
ATOM   3547 O OH  . TYR A 1 472 ? 34.998 17.979  22.880  1.00 20.69 ? 479 TYR A OH  1 
ATOM   3548 N N   . GLN A 1 473 ? 31.342 22.023  15.986  1.00 17.58 ? 480 GLN A N   1 
ATOM   3549 C CA  . GLN A 1 473 ? 30.170 22.346  15.169  1.00 17.25 ? 480 GLN A CA  1 
ATOM   3550 C C   . GLN A 1 473 ? 29.554 21.031  14.643  1.00 16.99 ? 480 GLN A C   1 
ATOM   3551 O O   . GLN A 1 473 ? 28.352 20.807  14.759  1.00 13.69 ? 480 GLN A O   1 
ATOM   3552 C CB  . GLN A 1 473 ? 30.561 23.259  13.997  1.00 17.85 ? 480 GLN A CB  1 
ATOM   3553 C CG  . GLN A 1 473 ? 30.756 24.752  14.360  1.00 26.47 ? 480 GLN A CG  1 
ATOM   3554 C CD  . GLN A 1 473 ? 31.347 25.571  13.198  1.00 36.25 ? 480 GLN A CD  1 
ATOM   3555 O OE1 . GLN A 1 473 ? 30.962 26.726  12.964  1.00 37.69 ? 480 GLN A OE1 1 
ATOM   3556 N NE2 . GLN A 1 473 ? 32.298 24.976  12.477  1.00 38.16 ? 480 GLN A NE2 1 
ATOM   3557 N N   . ARG A 1 474 ? 30.392 20.159  14.080  1.00 17.23 ? 481 ARG A N   1 
ATOM   3558 C CA  . ARG A 1 474 ? 29.931 18.874  13.562  1.00 16.11 ? 481 ARG A CA  1 
ATOM   3559 C C   . ARG A 1 474 ? 29.425 17.983  14.694  1.00 21.32 ? 481 ARG A C   1 
ATOM   3560 O O   . ARG A 1 474 ? 28.421 17.282  14.545  1.00 17.00 ? 481 ARG A O   1 
ATOM   3561 C CB  . ARG A 1 474 ? 31.058 18.165  12.800  1.00 17.73 ? 481 ARG A CB  1 
ATOM   3562 C CG  . ARG A 1 474 ? 31.120 18.531  11.322  1.00 14.15 ? 481 ARG A CG  1 
ATOM   3563 C CD  . ARG A 1 474 ? 32.407 18.057  10.675  1.00 17.92 ? 481 ARG A CD  1 
ATOM   3564 N NE  . ARG A 1 474 ? 33.561 18.798  11.174  1.00 18.09 ? 481 ARG A NE  1 
ATOM   3565 C CZ  . ARG A 1 474 ? 34.802 18.653  10.726  1.00 23.64 ? 481 ARG A CZ  1 
ATOM   3566 N NH1 . ARG A 1 474 ? 35.072 17.787  9.761   1.00 17.93 ? 481 ARG A NH1 1 
ATOM   3567 N NH2 . ARG A 1 474 ? 35.779 19.391  11.237  1.00 24.66 ? 481 ARG A NH2 1 
ATOM   3568 N N   . VAL A 1 475 ? 30.123 18.015  15.826  1.00 19.83 ? 482 VAL A N   1 
ATOM   3569 C CA  . VAL A 1 475 ? 29.720 17.218  16.973  1.00 20.25 ? 482 VAL A CA  1 
ATOM   3570 C C   . VAL A 1 475 ? 28.312 17.608  17.414  1.00 20.95 ? 482 VAL A C   1 
ATOM   3571 O O   . VAL A 1 475 ? 27.467 16.742  17.640  1.00 22.40 ? 482 VAL A O   1 
ATOM   3572 C CB  . VAL A 1 475 ? 30.686 17.410  18.177  1.00 23.70 ? 482 VAL A CB  1 
ATOM   3573 C CG1 . VAL A 1 475 ? 30.064 16.825  19.442  1.00 20.10 ? 482 VAL A CG1 1 
ATOM   3574 C CG2 . VAL A 1 475 ? 32.021 16.730  17.896  1.00 16.30 ? 482 VAL A CG2 1 
ATOM   3575 N N   . ARG A 1 476 ? 28.064 18.912  17.519  1.00 17.35 ? 483 ARG A N   1 
ATOM   3576 C CA  . ARG A 1 476 ? 26.765 19.414  17.960  1.00 23.65 ? 483 ARG A CA  1 
ATOM   3577 C C   . ARG A 1 476 ? 25.614 18.977  17.059  1.00 25.90 ? 483 ARG A C   1 
ATOM   3578 O O   . ARG A 1 476 ? 24.556 18.568  17.543  1.00 24.64 ? 483 ARG A O   1 
ATOM   3579 C CB  . ARG A 1 476 ? 26.794 20.942  18.076  1.00 24.94 ? 483 ARG A CB  1 
ATOM   3580 C CG  . ARG A 1 476 ? 27.670 21.468  19.223  1.00 30.31 ? 483 ARG A CG  1 
ATOM   3581 C CD  . ARG A 1 476 ? 27.383 22.946  19.502  1.00 33.55 ? 483 ARG A CD  1 
ATOM   3582 N NE  . ARG A 1 476 ? 28.171 23.493  20.612  1.00 35.82 ? 483 ARG A NE  1 
ATOM   3583 C CZ  . ARG A 1 476 ? 29.368 24.060  20.481  1.00 33.09 ? 483 ARG A CZ  1 
ATOM   3584 N NH1 . ARG A 1 476 ? 29.931 24.165  19.285  1.00 33.28 ? 483 ARG A NH1 1 
ATOM   3585 N NH2 . ARG A 1 476 ? 30.001 24.532  21.548  1.00 32.38 ? 483 ARG A NH2 1 
ATOM   3586 N N   . ILE A 1 477 ? 25.817 19.067  15.749  1.00 25.34 ? 484 ILE A N   1 
ATOM   3587 C CA  . ILE A 1 477 ? 24.793 18.655  14.799  1.00 21.70 ? 484 ILE A CA  1 
ATOM   3588 C C   . ILE A 1 477 ? 24.501 17.169  14.979  1.00 23.66 ? 484 ILE A C   1 
ATOM   3589 O O   . ILE A 1 477 ? 23.353 16.768  15.145  1.00 22.85 ? 484 ILE A O   1 
ATOM   3590 C CB  . ILE A 1 477 ? 25.255 18.906  13.341  1.00 20.91 ? 484 ILE A CB  1 
ATOM   3591 C CG1 . ILE A 1 477 ? 25.540 20.397  13.137  1.00 18.67 ? 484 ILE A CG1 1 
ATOM   3592 C CG2 . ILE A 1 477 ? 24.184 18.446  12.356  1.00 17.78 ? 484 ILE A CG2 1 
ATOM   3593 C CD1 . ILE A 1 477 ? 26.180 20.719  11.788  1.00 25.74 ? 484 ILE A CD1 1 
ATOM   3594 N N   . ARG A 1 478 ? 25.545 16.351  14.966  1.00 24.67 ? 485 ARG A N   1 
ATOM   3595 C CA  . ARG A 1 478 ? 25.380 14.910  15.105  1.00 23.65 ? 485 ARG A CA  1 
ATOM   3596 C C   . ARG A 1 478 ? 24.611 14.485  16.353  1.00 26.85 ? 485 ARG A C   1 
ATOM   3597 O O   . ARG A 1 478 ? 23.820 13.538  16.306  1.00 24.75 ? 485 ARG A O   1 
ATOM   3598 C CB  . ARG A 1 478 ? 26.746 14.220  15.078  1.00 21.82 ? 485 ARG A CB  1 
ATOM   3599 C CG  . ARG A 1 478 ? 27.493 14.499  13.802  1.00 22.53 ? 485 ARG A CG  1 
ATOM   3600 C CD  . ARG A 1 478 ? 28.847 13.846  13.742  1.00 19.24 ? 485 ARG A CD  1 
ATOM   3601 N NE  . ARG A 1 478 ? 29.511 14.236  12.506  1.00 20.84 ? 485 ARG A NE  1 
ATOM   3602 C CZ  . ARG A 1 478 ? 30.683 13.766  12.096  1.00 24.76 ? 485 ARG A CZ  1 
ATOM   3603 N NH1 . ARG A 1 478 ? 31.339 12.877  12.826  1.00 21.48 ? 485 ARG A NH1 1 
ATOM   3604 N NH2 . ARG A 1 478 ? 31.199 14.185  10.945  1.00 23.04 ? 485 ARG A NH2 1 
ATOM   3605 N N   . SER A 1 479 ? 24.835 15.176  17.465  1.00 25.80 ? 486 SER A N   1 
ATOM   3606 C CA  . SER A 1 479 ? 24.147 14.824  18.701  1.00 30.15 ? 486 SER A CA  1 
ATOM   3607 C C   . SER A 1 479 ? 22.652 15.132  18.613  1.00 33.27 ? 486 SER A C   1 
ATOM   3608 O O   . SER A 1 479 ? 21.846 14.558  19.342  1.00 33.42 ? 486 SER A O   1 
ATOM   3609 C CB  . SER A 1 479 ? 24.771 15.573  19.883  1.00 29.04 ? 486 SER A CB  1 
ATOM   3610 O OG  . SER A 1 479 ? 26.148 15.235  20.012  1.00 33.64 ? 486 SER A OG  1 
ATOM   3611 N N   . LYS A 1 480 ? 22.282 16.020  17.702  1.00 36.29 ? 487 LYS A N   1 
ATOM   3612 C CA  . LYS A 1 480 ? 20.885 16.404  17.547  1.00 40.16 ? 487 LYS A CA  1 
ATOM   3613 C C   . LYS A 1 480 ? 20.211 15.676  16.401  1.00 39.88 ? 487 LYS A C   1 
ATOM   3614 O O   . LYS A 1 480 ? 18.982 15.689  16.287  1.00 43.79 ? 487 LYS A O   1 
ATOM   3615 C CB  . LYS A 1 480 ? 20.795 17.906  17.315  1.00 40.72 ? 487 LYS A CB  1 
ATOM   3616 C CG  . LYS A 1 480 ? 19.386 18.453  17.192  1.00 49.14 ? 487 LYS A CG  1 
ATOM   3617 C CD  . LYS A 1 480 ? 19.426 19.981  17.166  1.00 53.57 ? 487 LYS A CD  1 
ATOM   3618 C CE  . LYS A 1 480 ? 18.034 20.604  17.004  1.00 58.52 ? 487 LYS A CE  1 
ATOM   3619 N NZ  . LYS A 1 480 ? 17.167 20.490  18.234  1.00 58.65 ? 487 LYS A NZ  1 
ATOM   3620 N N   . VAL A 1 481 ? 21.009 15.032  15.559  1.00 38.91 ? 488 VAL A N   1 
ATOM   3621 C CA  . VAL A 1 481 ? 20.474 14.326  14.403  1.00 38.52 ? 488 VAL A CA  1 
ATOM   3622 C C   . VAL A 1 481 ? 20.444 12.815  14.553  1.00 40.41 ? 488 VAL A C   1 
ATOM   3623 O O   . VAL A 1 481 ? 19.645 12.131  13.909  1.00 41.65 ? 488 VAL A O   1 
ATOM   3624 C CB  . VAL A 1 481 ? 21.270 14.713  13.124  1.00 38.20 ? 488 VAL A CB  1 
ATOM   3625 C CG1 . VAL A 1 481 ? 21.255 13.590  12.099  1.00 36.44 ? 488 VAL A CG1 1 
ATOM   3626 C CG2 . VAL A 1 481 ? 20.654 15.963  12.511  1.00 36.23 ? 488 VAL A CG2 1 
ATOM   3627 N N   . PHE A 1 482 ? 21.289 12.276  15.416  1.00 42.84 ? 489 PHE A N   1 
ATOM   3628 C CA  . PHE A 1 482 ? 21.304 10.832  15.561  1.00 45.91 ? 489 PHE A CA  1 
ATOM   3629 C C   . PHE A 1 482 ? 20.871 10.304  16.927  1.00 45.14 ? 489 PHE A C   1 
ATOM   3630 O O   . PHE A 1 482 ? 21.124 9.141   17.260  1.00 43.25 ? 489 PHE A O   1 
ATOM   3631 C CB  . PHE A 1 482 ? 22.689 10.308  15.164  1.00 49.45 ? 489 PHE A CB  1 
ATOM   3632 C CG  . PHE A 1 482 ? 23.022 10.543  13.707  1.00 54.86 ? 489 PHE A CG  1 
ATOM   3633 C CD1 . PHE A 1 482 ? 22.272 9.921   12.700  1.00 57.50 ? 489 PHE A CD1 1 
ATOM   3634 C CD2 . PHE A 1 482 ? 24.044 11.419  13.337  1.00 55.64 ? 489 PHE A CD2 1 
ATOM   3635 C CE1 . PHE A 1 482 ? 22.538 10.161  11.346  1.00 58.24 ? 489 PHE A CE1 1 
ATOM   3636 C CE2 . PHE A 1 482 ? 24.323 11.671  11.987  1.00 56.50 ? 489 PHE A CE2 1 
ATOM   3637 C CZ  . PHE A 1 482 ? 23.564 11.045  10.986  1.00 57.83 ? 489 PHE A CZ  1 
ATOM   3638 N N   . GLY A 1 483 ? 20.193 11.148  17.702  1.00 43.67 ? 490 GLY A N   1 
ATOM   3639 C CA  . GLY A 1 483 ? 19.720 10.720  19.010  1.00 41.82 ? 490 GLY A CA  1 
ATOM   3640 C C   . GLY A 1 483 ? 19.006 9.381   18.893  1.00 41.50 ? 490 GLY A C   1 
ATOM   3641 O O   . GLY A 1 483 ? 19.336 8.449   19.672  1.00 40.40 ? 490 GLY A O   1 
ATOM   3642 N N   . ASP B 1 8   ? 25.361 51.585  -4.241  1.00 38.63 ? 15  ASP B N   1 
ATOM   3643 C CA  . ASP B 1 8   ? 24.356 52.086  -3.255  1.00 41.33 ? 15  ASP B CA  1 
ATOM   3644 C C   . ASP B 1 8   ? 24.671 51.528  -1.865  1.00 41.13 ? 15  ASP B C   1 
ATOM   3645 O O   . ASP B 1 8   ? 24.844 50.329  -1.691  1.00 39.02 ? 15  ASP B O   1 
ATOM   3646 C CB  . ASP B 1 8   ? 22.952 51.653  -3.672  1.00 49.57 ? 15  ASP B CB  1 
ATOM   3647 C CG  . ASP B 1 8   ? 21.902 52.719  -3.383  1.00 54.86 ? 15  ASP B CG  1 
ATOM   3648 O OD1 . ASP B 1 8   ? 21.904 53.758  -4.089  1.00 52.32 ? 15  ASP B OD1 1 
ATOM   3649 O OD2 . ASP B 1 8   ? 21.086 52.519  -2.451  1.00 55.18 ? 15  ASP B OD2 1 
ATOM   3650 N N   . ARG B 1 9   ? 24.732 52.406  -0.875  1.00 40.14 ? 16  ARG B N   1 
ATOM   3651 C CA  . ARG B 1 9   ? 25.057 52.010  0.491   1.00 42.10 ? 16  ARG B CA  1 
ATOM   3652 C C   . ARG B 1 9   ? 24.093 51.015  1.135   1.00 38.89 ? 16  ARG B C   1 
ATOM   3653 O O   . ARG B 1 9   ? 22.875 51.172  1.045   1.00 38.92 ? 16  ARG B O   1 
ATOM   3654 C CB  . ARG B 1 9   ? 25.147 53.259  1.371   1.00 46.10 ? 16  ARG B CB  1 
ATOM   3655 C CG  . ARG B 1 9   ? 26.261 54.214  0.981   1.00 53.12 ? 16  ARG B CG  1 
ATOM   3656 C CD  . ARG B 1 9   ? 26.238 55.447  1.883   1.00 58.73 ? 16  ARG B CD  1 
ATOM   3657 N NE  . ARG B 1 9   ? 27.553 56.070  1.977   1.00 62.79 ? 16  ARG B NE  1 
ATOM   3658 C CZ  . ARG B 1 9   ? 27.770 57.281  2.485   1.00 65.59 ? 16  ARG B CZ  1 
ATOM   3659 N NH1 . ARG B 1 9   ? 26.746 58.002  2.949   1.00 65.94 ? 16  ARG B NH1 1 
ATOM   3660 N NH2 . ARG B 1 9   ? 29.008 57.776  2.526   1.00 62.92 ? 16  ARG B NH2 1 
ATOM   3661 N N   . LEU B 1 10  ? 24.643 50.001  1.804   1.00 35.16 ? 17  LEU B N   1 
ATOM   3662 C CA  . LEU B 1 10  ? 23.818 48.999  2.472   1.00 30.81 ? 17  LEU B CA  1 
ATOM   3663 C C   . LEU B 1 10  ? 24.525 48.401  3.684   1.00 31.93 ? 17  LEU B C   1 
ATOM   3664 O O   . LEU B 1 10  ? 25.665 47.951  3.594   1.00 27.80 ? 17  LEU B O   1 
ATOM   3665 C CB  . LEU B 1 10  ? 23.445 47.888  1.484   1.00 32.55 ? 17  LEU B CB  1 
ATOM   3666 C CG  . LEU B 1 10  ? 22.572 46.765  2.046   1.00 28.90 ? 17  LEU B CG  1 
ATOM   3667 C CD1 . LEU B 1 10  ? 21.317 47.359  2.650   1.00 32.02 ? 17  LEU B CD1 1 
ATOM   3668 C CD2 . LEU B 1 10  ? 22.222 45.776  0.947   1.00 30.20 ? 17  LEU B CD2 1 
ATOM   3669 N N   . LEU B 1 11  ? 23.850 48.403  4.827   1.00 30.42 ? 18  LEU B N   1 
ATOM   3670 C CA  . LEU B 1 11  ? 24.438 47.847  6.040   1.00 29.98 ? 18  LEU B CA  1 
ATOM   3671 C C   . LEU B 1 11  ? 23.697 46.610  6.545   1.00 29.66 ? 18  LEU B C   1 
ATOM   3672 O O   . LEU B 1 11  ? 22.488 46.642  6.764   1.00 29.68 ? 18  LEU B O   1 
ATOM   3673 C CB  . LEU B 1 11  ? 24.472 48.905  7.150   1.00 31.24 ? 18  LEU B CB  1 
ATOM   3674 C CG  . LEU B 1 11  ? 24.969 48.451  8.528   1.00 31.34 ? 18  LEU B CG  1 
ATOM   3675 C CD1 . LEU B 1 11  ? 26.397 47.961  8.439   1.00 31.52 ? 18  LEU B CD1 1 
ATOM   3676 C CD2 . LEU B 1 11  ? 24.874 49.610  9.501   1.00 37.20 ? 18  LEU B CD2 1 
ATOM   3677 N N   . ILE B 1 12  ? 24.428 45.512  6.716   1.00 29.80 ? 19  ILE B N   1 
ATOM   3678 C CA  . ILE B 1 12  ? 23.843 44.279  7.236   1.00 28.31 ? 19  ILE B CA  1 
ATOM   3679 C C   . ILE B 1 12  ? 24.241 44.257  8.711   1.00 28.40 ? 19  ILE B C   1 
ATOM   3680 O O   . ILE B 1 12  ? 25.430 44.228  9.031   1.00 28.46 ? 19  ILE B O   1 
ATOM   3681 C CB  . ILE B 1 12  ? 24.427 43.035  6.525   1.00 23.71 ? 19  ILE B CB  1 
ATOM   3682 C CG1 . ILE B 1 12  ? 24.245 43.162  5.010   1.00 21.48 ? 19  ILE B CG1 1 
ATOM   3683 C CG2 . ILE B 1 12  ? 23.746 41.787  7.028   1.00 22.59 ? 19  ILE B CG2 1 
ATOM   3684 C CD1 . ILE B 1 12  ? 24.789 41.980  4.224   1.00 23.51 ? 19  ILE B CD1 1 
ATOM   3685 N N   . ARG B 1 13  ? 23.252 44.278  9.603   1.00 30.13 ? 20  ARG B N   1 
ATOM   3686 C CA  . ARG B 1 13  ? 23.506 44.295  11.043  1.00 31.05 ? 20  ARG B CA  1 
ATOM   3687 C C   . ARG B 1 13  ? 23.114 43.053  11.819  1.00 31.24 ? 20  ARG B C   1 
ATOM   3688 O O   . ARG B 1 13  ? 22.139 42.373  11.485  1.00 29.09 ? 20  ARG B O   1 
ATOM   3689 C CB  . ARG B 1 13  ? 22.772 45.459  11.700  1.00 38.43 ? 20  ARG B CB  1 
ATOM   3690 C CG  . ARG B 1 13  ? 23.486 46.782  11.701  1.00 48.35 ? 20  ARG B CG  1 
ATOM   3691 C CD  . ARG B 1 13  ? 22.738 47.738  12.622  1.00 53.87 ? 20  ARG B CD  1 
ATOM   3692 N NE  . ARG B 1 13  ? 22.671 47.222  13.993  1.00 57.68 ? 20  ARG B NE  1 
ATOM   3693 C CZ  . ARG B 1 13  ? 21.715 47.544  14.867  1.00 59.84 ? 20  ARG B CZ  1 
ATOM   3694 N NH1 . ARG B 1 13  ? 20.737 48.374  14.510  1.00 60.97 ? 20  ARG B NH1 1 
ATOM   3695 N NH2 . ARG B 1 13  ? 21.746 47.058  16.106  1.00 60.27 ? 20  ARG B NH2 1 
ATOM   3696 N N   . GLY B 1 14  ? 23.875 42.792  12.880  1.00 28.24 ? 21  GLY B N   1 
ATOM   3697 C CA  . GLY B 1 14  ? 23.603 41.667  13.756  1.00 31.61 ? 21  GLY B CA  1 
ATOM   3698 C C   . GLY B 1 14  ? 23.842 40.283  13.198  1.00 30.62 ? 21  GLY B C   1 
ATOM   3699 O O   . GLY B 1 14  ? 23.435 39.286  13.800  1.00 29.06 ? 21  GLY B O   1 
ATOM   3700 N N   . GLY B 1 15  ? 24.518 40.206  12.059  1.00 32.74 ? 22  GLY B N   1 
ATOM   3701 C CA  . GLY B 1 15  ? 24.754 38.906  11.464  1.00 31.14 ? 22  GLY B CA  1 
ATOM   3702 C C   . GLY B 1 15  ? 25.937 38.135  12.003  1.00 29.49 ? 22  GLY B C   1 
ATOM   3703 O O   . GLY B 1 15  ? 26.751 38.652  12.755  1.00 28.58 ? 22  GLY B O   1 
ATOM   3704 N N   . ARG B 1 16  ? 26.018 36.872  11.606  1.00 28.37 ? 23  ARG B N   1 
ATOM   3705 C CA  . ARG B 1 16  ? 27.112 36.014  12.008  1.00 24.78 ? 23  ARG B CA  1 
ATOM   3706 C C   . ARG B 1 16  ? 27.811 35.593  10.722  1.00 22.90 ? 23  ARG B C   1 
ATOM   3707 O O   . ARG B 1 16  ? 27.371 34.676  10.029  1.00 25.19 ? 23  ARG B O   1 
ATOM   3708 C CB  . ARG B 1 16  ? 26.586 34.799  12.757  1.00 25.66 ? 23  ARG B CB  1 
ATOM   3709 C CG  . ARG B 1 16  ? 27.677 33.891  13.252  1.00 27.46 ? 23  ARG B CG  1 
ATOM   3710 C CD  . ARG B 1 16  ? 27.103 32.762  14.078  1.00 33.63 ? 23  ARG B CD  1 
ATOM   3711 N NE  . ARG B 1 16  ? 28.146 31.819  14.457  1.00 37.05 ? 23  ARG B NE  1 
ATOM   3712 C CZ  . ARG B 1 16  ? 28.287 30.613  13.921  1.00 39.70 ? 23  ARG B CZ  1 
ATOM   3713 N NH1 . ARG B 1 16  ? 27.439 30.194  12.984  1.00 40.31 ? 23  ARG B NH1 1 
ATOM   3714 N NH2 . ARG B 1 16  ? 29.294 29.839  14.300  1.00 39.95 ? 23  ARG B NH2 1 
ATOM   3715 N N   . ILE B 1 17  ? 28.889 36.299  10.399  1.00 22.92 ? 24  ILE B N   1 
ATOM   3716 C CA  . ILE B 1 17  ? 29.672 36.044  9.194   1.00 22.06 ? 24  ILE B CA  1 
ATOM   3717 C C   . ILE B 1 17  ? 30.274 34.637  9.147   1.00 21.56 ? 24  ILE B C   1 
ATOM   3718 O O   . ILE B 1 17  ? 30.947 34.204  10.083  1.00 16.61 ? 24  ILE B O   1 
ATOM   3719 C CB  . ILE B 1 17  ? 30.808 37.073  9.075   1.00 22.04 ? 24  ILE B CB  1 
ATOM   3720 C CG1 . ILE B 1 17  ? 30.211 38.469  8.903   1.00 24.40 ? 24  ILE B CG1 1 
ATOM   3721 C CG2 . ILE B 1 17  ? 31.725 36.723  7.919   1.00 21.80 ? 24  ILE B CG2 1 
ATOM   3722 C CD1 . ILE B 1 17  ? 31.252 39.557  8.705   1.00 29.83 ? 24  ILE B CD1 1 
ATOM   3723 N N   . ILE B 1 18  ? 30.036 33.931  8.048   1.00 21.48 ? 25  ILE B N   1 
ATOM   3724 C CA  . ILE B 1 18  ? 30.567 32.583  7.905   1.00 20.06 ? 25  ILE B CA  1 
ATOM   3725 C C   . ILE B 1 18  ? 31.465 32.482  6.673   1.00 20.30 ? 25  ILE B C   1 
ATOM   3726 O O   . ILE B 1 18  ? 30.983 32.562  5.544   1.00 15.38 ? 25  ILE B O   1 
ATOM   3727 C CB  . ILE B 1 18  ? 29.437 31.537  7.747   1.00 21.24 ? 25  ILE B CB  1 
ATOM   3728 C CG1 . ILE B 1 18  ? 28.356 31.743  8.817   1.00 24.16 ? 25  ILE B CG1 1 
ATOM   3729 C CG2 . ILE B 1 18  ? 30.016 30.126  7.852   1.00 16.11 ? 25  ILE B CG2 1 
ATOM   3730 C CD1 . ILE B 1 18  ? 28.726 31.248  10.204  1.00 26.58 ? 25  ILE B CD1 1 
ATOM   3731 N N   . ASN B 1 19  ? 32.768 32.333  6.900   1.00 17.42 ? 26  ASN B N   1 
ATOM   3732 C CA  . ASN B 1 19  ? 33.726 32.161  5.813   1.00 19.06 ? 26  ASN B CA  1 
ATOM   3733 C C   . ASN B 1 19  ? 34.185 30.703  5.931   1.00 17.66 ? 26  ASN B C   1 
ATOM   3734 O O   . ASN B 1 19  ? 33.804 30.020  6.877   1.00 19.48 ? 26  ASN B O   1 
ATOM   3735 C CB  . ASN B 1 19  ? 34.920 33.117  5.959   1.00 15.94 ? 26  ASN B CB  1 
ATOM   3736 C CG  . ASN B 1 19  ? 34.620 34.517  5.437   1.00 20.90 ? 26  ASN B CG  1 
ATOM   3737 O OD1 . ASN B 1 19  ? 33.994 34.678  4.387   1.00 19.19 ? 26  ASN B OD1 1 
ATOM   3738 N ND2 . ASN B 1 19  ? 35.084 35.538  6.160   1.00 15.87 ? 26  ASN B ND2 1 
ATOM   3739 N N   . ASP B 1 20  ? 34.993 30.220  4.992   1.00 15.40 ? 27  ASP B N   1 
ATOM   3740 C CA  . ASP B 1 20  ? 35.438 28.834  5.061   1.00 18.88 ? 27  ASP B CA  1 
ATOM   3741 C C   . ASP B 1 20  ? 36.461 28.592  6.169   1.00 19.10 ? 27  ASP B C   1 
ATOM   3742 O O   . ASP B 1 20  ? 36.634 27.459  6.611   1.00 15.64 ? 27  ASP B O   1 
ATOM   3743 C CB  . ASP B 1 20  ? 36.024 28.380  3.715   1.00 19.45 ? 27  ASP B CB  1 
ATOM   3744 C CG  . ASP B 1 20  ? 37.393 28.978  3.435   1.00 20.99 ? 27  ASP B CG  1 
ATOM   3745 O OD1 . ASP B 1 20  ? 37.555 30.199  3.623   1.00 23.20 ? 27  ASP B OD1 1 
ATOM   3746 O OD2 . ASP B 1 20  ? 38.307 28.233  3.020   1.00 16.21 ? 27  ASP B OD2 1 
ATOM   3747 N N   . ASP B 1 21  ? 37.125 29.651  6.629   1.00 19.22 ? 28  ASP B N   1 
ATOM   3748 C CA  . ASP B 1 21  ? 38.145 29.502  7.666   1.00 17.74 ? 28  ASP B CA  1 
ATOM   3749 C C   . ASP B 1 21  ? 37.687 29.730  9.104   1.00 18.17 ? 28  ASP B C   1 
ATOM   3750 O O   . ASP B 1 21  ? 38.322 29.238  10.039  1.00 19.37 ? 28  ASP B O   1 
ATOM   3751 C CB  . ASP B 1 21  ? 39.348 30.406  7.352   1.00 15.39 ? 28  ASP B CB  1 
ATOM   3752 C CG  . ASP B 1 21  ? 39.022 31.892  7.449   1.00 19.17 ? 28  ASP B CG  1 
ATOM   3753 O OD1 . ASP B 1 21  ? 37.916 32.299  7.032   1.00 16.92 ? 28  ASP B OD1 1 
ATOM   3754 O OD2 . ASP B 1 21  ? 39.889 32.654  7.926   1.00 14.46 ? 28  ASP B OD2 1 
ATOM   3755 N N   . GLN B 1 22  ? 36.588 30.455  9.289   1.00 17.70 ? 29  GLN B N   1 
ATOM   3756 C CA  . GLN B 1 22  ? 36.076 30.740  10.633  1.00 20.46 ? 29  GLN B CA  1 
ATOM   3757 C C   . GLN B 1 22  ? 34.718 31.442  10.568  1.00 22.56 ? 29  GLN B C   1 
ATOM   3758 O O   . GLN B 1 22  ? 34.203 31.726  9.485   1.00 21.33 ? 29  GLN B O   1 
ATOM   3759 C CB  . GLN B 1 22  ? 37.046 31.660  11.378  1.00 19.17 ? 29  GLN B CB  1 
ATOM   3760 C CG  . GLN B 1 22  ? 37.257 32.956  10.626  1.00 23.31 ? 29  GLN B CG  1 
ATOM   3761 C CD  . GLN B 1 22  ? 37.876 34.063  11.453  1.00 28.40 ? 29  GLN B CD  1 
ATOM   3762 O OE1 . GLN B 1 22  ? 38.321 35.067  10.903  1.00 30.49 ? 29  GLN B OE1 1 
ATOM   3763 N NE2 . GLN B 1 22  ? 37.899 33.899  12.767  1.00 26.67 ? 29  GLN B NE2 1 
ATOM   3764 N N   . SER B 1 23  ? 34.153 31.722  11.738  1.00 20.89 ? 30  SER B N   1 
ATOM   3765 C CA  . SER B 1 23  ? 32.875 32.422  11.844  1.00 23.44 ? 30  SER B CA  1 
ATOM   3766 C C   . SER B 1 23  ? 32.995 33.491  12.927  1.00 25.82 ? 30  SER B C   1 
ATOM   3767 O O   . SER B 1 23  ? 33.706 33.299  13.905  1.00 22.85 ? 30  SER B O   1 
ATOM   3768 C CB  . SER B 1 23  ? 31.753 31.458  12.235  1.00 22.77 ? 30  SER B CB  1 
ATOM   3769 O OG  . SER B 1 23  ? 31.524 30.501  11.226  1.00 23.86 ? 30  SER B OG  1 
ATOM   3770 N N   . PHE B 1 24  ? 32.307 34.615  12.759  1.00 24.03 ? 31  PHE B N   1 
ATOM   3771 C CA  . PHE B 1 24  ? 32.357 35.662  13.771  1.00 23.62 ? 31  PHE B CA  1 
ATOM   3772 C C   . PHE B 1 24  ? 31.224 36.676  13.615  1.00 24.02 ? 31  PHE B C   1 
ATOM   3773 O O   . PHE B 1 24  ? 30.672 36.860  12.525  1.00 20.98 ? 31  PHE B O   1 
ATOM   3774 C CB  . PHE B 1 24  ? 33.717 36.387  13.754  1.00 24.44 ? 31  PHE B CB  1 
ATOM   3775 C CG  . PHE B 1 24  ? 34.025 37.089  12.466  1.00 25.53 ? 31  PHE B CG  1 
ATOM   3776 C CD1 . PHE B 1 24  ? 34.383 36.367  11.333  1.00 25.01 ? 31  PHE B CD1 1 
ATOM   3777 C CD2 . PHE B 1 24  ? 33.892 38.468  12.368  1.00 25.73 ? 31  PHE B CD2 1 
ATOM   3778 C CE1 . PHE B 1 24  ? 34.616 37.012  10.122  1.00 25.88 ? 31  PHE B CE1 1 
ATOM   3779 C CE2 . PHE B 1 24  ? 34.122 39.124  11.164  1.00 29.22 ? 31  PHE B CE2 1 
ATOM   3780 C CZ  . PHE B 1 24  ? 34.475 38.394  10.034  1.00 29.96 ? 31  PHE B CZ  1 
ATOM   3781 N N   . TYR B 1 25  ? 30.880 37.320  14.725  1.00 22.76 ? 32  TYR B N   1 
ATOM   3782 C CA  . TYR B 1 25  ? 29.823 38.319  14.752  1.00 22.49 ? 32  TYR B CA  1 
ATOM   3783 C C   . TYR B 1 25  ? 30.392 39.691  14.411  1.00 21.58 ? 32  TYR B C   1 
ATOM   3784 O O   . TYR B 1 25  ? 31.381 40.133  14.998  1.00 24.92 ? 32  TYR B O   1 
ATOM   3785 C CB  . TYR B 1 25  ? 29.170 38.334  16.140  1.00 22.75 ? 32  TYR B CB  1 
ATOM   3786 C CG  . TYR B 1 25  ? 28.293 37.130  16.402  1.00 24.17 ? 32  TYR B CG  1 
ATOM   3787 C CD1 . TYR B 1 25  ? 26.991 37.083  15.911  1.00 24.29 ? 32  TYR B CD1 1 
ATOM   3788 C CD2 . TYR B 1 25  ? 28.777 36.014  17.100  1.00 27.80 ? 32  TYR B CD2 1 
ATOM   3789 C CE1 . TYR B 1 25  ? 26.187 35.966  16.095  1.00 25.90 ? 32  TYR B CE1 1 
ATOM   3790 C CE2 . TYR B 1 25  ? 27.973 34.877  17.292  1.00 26.90 ? 32  TYR B CE2 1 
ATOM   3791 C CZ  . TYR B 1 25  ? 26.676 34.869  16.784  1.00 28.60 ? 32  TYR B CZ  1 
ATOM   3792 O OH  . TYR B 1 25  ? 25.851 33.779  16.957  1.00 28.55 ? 32  TYR B OH  1 
ATOM   3793 N N   . ALA B 1 26  ? 29.771 40.353  13.443  1.00 24.68 ? 33  ALA B N   1 
ATOM   3794 C CA  . ALA B 1 26  ? 30.203 41.676  13.007  1.00 24.64 ? 33  ALA B CA  1 
ATOM   3795 C C   . ALA B 1 26  ? 29.240 42.181  11.945  1.00 27.13 ? 33  ALA B C   1 
ATOM   3796 O O   . ALA B 1 26  ? 28.577 41.385  11.272  1.00 26.79 ? 33  ALA B O   1 
ATOM   3797 C CB  . ALA B 1 26  ? 31.609 41.607  12.426  1.00 24.64 ? 33  ALA B CB  1 
ATOM   3798 N N   . ASP B 1 27  ? 29.159 43.497  11.793  1.00 22.77 ? 34  ASP B N   1 
ATOM   3799 C CA  . ASP B 1 27  ? 28.282 44.063  10.785  1.00 24.10 ? 34  ASP B CA  1 
ATOM   3800 C C   . ASP B 1 27  ? 29.087 44.194  9.510   1.00 26.40 ? 34  ASP B C   1 
ATOM   3801 O O   . ASP B 1 27  ? 30.319 44.288  9.551   1.00 27.91 ? 34  ASP B O   1 
ATOM   3802 C CB  . ASP B 1 27  ? 27.764 45.442  11.198  1.00 23.58 ? 34  ASP B CB  1 
ATOM   3803 C CG  . ASP B 1 27  ? 26.934 45.405  12.462  1.00 28.08 ? 34  ASP B CG  1 
ATOM   3804 O OD1 . ASP B 1 27  ? 26.291 44.363  12.748  1.00 34.31 ? 34  ASP B OD1 1 
ATOM   3805 O OD2 . ASP B 1 27  ? 26.920 46.435  13.164  1.00 32.66 ? 34  ASP B OD2 1 
ATOM   3806 N N   . VAL B 1 28  ? 28.390 44.195  8.380   1.00 24.19 ? 35  VAL B N   1 
ATOM   3807 C CA  . VAL B 1 28  ? 29.030 44.319  7.077   1.00 26.10 ? 35  VAL B CA  1 
ATOM   3808 C C   . VAL B 1 28  ? 28.466 45.555  6.382   1.00 27.27 ? 35  VAL B C   1 
ATOM   3809 O O   . VAL B 1 28  ? 27.253 45.778  6.367   1.00 24.37 ? 35  VAL B O   1 
ATOM   3810 C CB  . VAL B 1 28  ? 28.750 43.070  6.211   1.00 23.70 ? 35  VAL B CB  1 
ATOM   3811 C CG1 . VAL B 1 28  ? 29.592 43.094  4.947   1.00 20.38 ? 35  VAL B CG1 1 
ATOM   3812 C CG2 . VAL B 1 28  ? 29.036 41.820  7.018   1.00 25.61 ? 35  VAL B CG2 1 
ATOM   3813 N N   . TYR B 1 29  ? 29.349 46.361  5.808   1.00 29.62 ? 36  TYR B N   1 
ATOM   3814 C CA  . TYR B 1 29  ? 28.925 47.572  5.127   1.00 29.52 ? 36  TYR B CA  1 
ATOM   3815 C C   . TYR B 1 29  ? 29.306 47.491  3.659   1.00 27.63 ? 36  TYR B C   1 
ATOM   3816 O O   . TYR B 1 29  ? 30.485 47.375  3.324   1.00 26.03 ? 36  TYR B O   1 
ATOM   3817 C CB  . TYR B 1 29  ? 29.588 48.787  5.780   1.00 36.41 ? 36  TYR B CB  1 
ATOM   3818 C CG  . TYR B 1 29  ? 29.178 50.096  5.161   1.00 43.04 ? 36  TYR B CG  1 
ATOM   3819 C CD1 . TYR B 1 29  ? 27.838 50.475  5.131   1.00 47.17 ? 36  TYR B CD1 1 
ATOM   3820 C CD2 . TYR B 1 29  ? 30.123 50.950  4.599   1.00 46.49 ? 36  TYR B CD2 1 
ATOM   3821 C CE1 . TYR B 1 29  ? 27.439 51.678  4.556   1.00 52.03 ? 36  TYR B CE1 1 
ATOM   3822 C CE2 . TYR B 1 29  ? 29.738 52.167  4.016   1.00 54.20 ? 36  TYR B CE2 1 
ATOM   3823 C CZ  . TYR B 1 29  ? 28.388 52.520  4.003   1.00 55.08 ? 36  TYR B CZ  1 
ATOM   3824 O OH  . TYR B 1 29  ? 27.980 53.723  3.457   1.00 59.99 ? 36  TYR B OH  1 
ATOM   3825 N N   . LEU B 1 30  ? 28.298 47.560  2.790   1.00 28.32 ? 37  LEU B N   1 
ATOM   3826 C CA  . LEU B 1 30  ? 28.491 47.469  1.345   1.00 27.42 ? 37  LEU B CA  1 
ATOM   3827 C C   . LEU B 1 30  ? 28.309 48.800  0.610   1.00 28.21 ? 37  LEU B C   1 
ATOM   3828 O O   . LEU B 1 30  ? 27.413 49.577  0.937   1.00 26.76 ? 37  LEU B O   1 
ATOM   3829 C CB  . LEU B 1 30  ? 27.501 46.457  0.766   1.00 22.60 ? 37  LEU B CB  1 
ATOM   3830 C CG  . LEU B 1 30  ? 27.471 45.095  1.459   1.00 25.24 ? 37  LEU B CG  1 
ATOM   3831 C CD1 . LEU B 1 30  ? 26.378 44.215  0.826   1.00 17.99 ? 37  LEU B CD1 1 
ATOM   3832 C CD2 . LEU B 1 30  ? 28.851 44.446  1.347   1.00 18.34 ? 37  LEU B CD2 1 
ATOM   3833 N N   . GLU B 1 31  ? 29.154 49.042  -0.395  1.00 28.31 ? 38  GLU B N   1 
ATOM   3834 C CA  . GLU B 1 31  ? 29.067 50.261  -1.194  1.00 30.24 ? 38  GLU B CA  1 
ATOM   3835 C C   . GLU B 1 31  ? 29.740 50.081  -2.554  1.00 28.56 ? 38  GLU B C   1 
ATOM   3836 O O   . GLU B 1 31  ? 30.897 49.654  -2.648  1.00 23.98 ? 38  GLU B O   1 
ATOM   3837 C CB  . GLU B 1 31  ? 29.690 51.444  -0.432  1.00 34.73 ? 38  GLU B CB  1 
ATOM   3838 C CG  . GLU B 1 31  ? 29.568 52.784  -1.156  1.00 39.45 ? 38  GLU B CG  1 
ATOM   3839 C CD  . GLU B 1 31  ? 30.087 53.970  -0.336  1.00 43.10 ? 38  GLU B CD  1 
ATOM   3840 O OE1 . GLU B 1 31  ? 31.226 53.897  0.184   1.00 39.67 ? 38  GLU B OE1 1 
ATOM   3841 O OE2 . GLU B 1 31  ? 29.356 54.987  -0.224  1.00 46.97 ? 38  GLU B OE2 1 
ATOM   3842 N N   . ASP B 1 32  ? 28.991 50.395  -3.607  1.00 28.09 ? 39  ASP B N   1 
ATOM   3843 C CA  . ASP B 1 32  ? 29.466 50.283  -4.981  1.00 29.91 ? 39  ASP B CA  1 
ATOM   3844 C C   . ASP B 1 32  ? 30.026 48.909  -5.365  1.00 28.85 ? 39  ASP B C   1 
ATOM   3845 O O   . ASP B 1 32  ? 31.134 48.795  -5.900  1.00 28.92 ? 39  ASP B O   1 
ATOM   3846 C CB  . ASP B 1 32  ? 30.509 51.362  -5.265  1.00 36.37 ? 39  ASP B CB  1 
ATOM   3847 C CG  . ASP B 1 32  ? 29.935 52.764  -5.159  1.00 40.03 ? 39  ASP B CG  1 
ATOM   3848 O OD1 . ASP B 1 32  ? 28.832 53.003  -5.706  1.00 41.44 ? 39  ASP B OD1 1 
ATOM   3849 O OD2 . ASP B 1 32  ? 30.589 53.630  -4.537  1.00 40.50 ? 39  ASP B OD2 1 
ATOM   3850 N N   . GLY B 1 33  ? 29.249 47.866  -5.094  1.00 27.89 ? 40  GLY B N   1 
ATOM   3851 C CA  . GLY B 1 33  ? 29.663 46.518  -5.441  1.00 23.08 ? 40  GLY B CA  1 
ATOM   3852 C C   . GLY B 1 33  ? 30.750 45.906  -4.578  1.00 19.82 ? 40  GLY B C   1 
ATOM   3853 O O   . GLY B 1 33  ? 31.135 44.758  -4.787  1.00 18.52 ? 40  GLY B O   1 
ATOM   3854 N N   . LEU B 1 34  ? 31.243 46.655  -3.604  1.00 17.66 ? 41  LEU B N   1 
ATOM   3855 C CA  . LEU B 1 34  ? 32.296 46.146  -2.744  1.00 23.40 ? 41  LEU B CA  1 
ATOM   3856 C C   . LEU B 1 34  ? 31.899 46.115  -1.286  1.00 25.51 ? 41  LEU B C   1 
ATOM   3857 O O   . LEU B 1 34  ? 30.992 46.831  -0.863  1.00 26.77 ? 41  LEU B O   1 
ATOM   3858 C CB  . LEU B 1 34  ? 33.545 47.011  -2.867  1.00 22.67 ? 41  LEU B CB  1 
ATOM   3859 C CG  . LEU B 1 34  ? 34.281 47.043  -4.198  1.00 27.99 ? 41  LEU B CG  1 
ATOM   3860 C CD1 . LEU B 1 34  ? 35.331 48.150  -4.147  1.00 28.43 ? 41  LEU B CD1 1 
ATOM   3861 C CD2 . LEU B 1 34  ? 34.926 45.687  -4.471  1.00 24.34 ? 41  LEU B CD2 1 
ATOM   3862 N N   . ILE B 1 35  ? 32.604 45.280  -0.529  1.00 25.39 ? 42  ILE B N   1 
ATOM   3863 C CA  . ILE B 1 35  ? 32.420 45.151  0.912   1.00 25.62 ? 42  ILE B CA  1 
ATOM   3864 C C   . ILE B 1 35  ? 33.409 46.186  1.449   1.00 24.92 ? 42  ILE B C   1 
ATOM   3865 O O   . ILE B 1 35  ? 34.621 45.984  1.356   1.00 24.61 ? 42  ILE B O   1 
ATOM   3866 C CB  . ILE B 1 35  ? 32.861 43.750  1.409   1.00 23.09 ? 42  ILE B CB  1 
ATOM   3867 C CG1 . ILE B 1 35  ? 32.037 42.664  0.714   1.00 25.17 ? 42  ILE B CG1 1 
ATOM   3868 C CG2 . ILE B 1 35  ? 32.711 43.660  2.913   1.00 20.99 ? 42  ILE B CG2 1 
ATOM   3869 C CD1 . ILE B 1 35  ? 32.412 41.242  1.113   1.00 25.83 ? 42  ILE B CD1 1 
ATOM   3870 N N   . LYS B 1 36  ? 32.909 47.291  1.991   1.00 25.53 ? 43  LYS B N   1 
ATOM   3871 C CA  . LYS B 1 36  ? 33.800 48.346  2.491   1.00 31.71 ? 43  LYS B CA  1 
ATOM   3872 C C   . LYS B 1 36  ? 34.270 48.215  3.939   1.00 29.66 ? 43  LYS B C   1 
ATOM   3873 O O   . LYS B 1 36  ? 35.410 48.551  4.250   1.00 30.36 ? 43  LYS B O   1 
ATOM   3874 C CB  . LYS B 1 36  ? 33.152 49.728  2.306   1.00 33.88 ? 43  LYS B CB  1 
ATOM   3875 C CG  . LYS B 1 36  ? 33.053 50.190  0.849   1.00 40.02 ? 43  LYS B CG  1 
ATOM   3876 C CD  . LYS B 1 36  ? 34.426 50.219  0.183   1.00 43.25 ? 43  LYS B CD  1 
ATOM   3877 C CE  . LYS B 1 36  ? 34.345 50.595  -1.295  1.00 43.74 ? 43  LYS B CE  1 
ATOM   3878 N NZ  . LYS B 1 36  ? 33.776 51.964  -1.505  1.00 44.63 ? 43  LYS B NZ  1 
ATOM   3879 N N   . GLN B 1 37  ? 33.401 47.742  4.825   1.00 27.86 ? 44  GLN B N   1 
ATOM   3880 C CA  . GLN B 1 37  ? 33.775 47.601  6.228   1.00 28.34 ? 44  GLN B CA  1 
ATOM   3881 C C   . GLN B 1 37  ? 33.131 46.397  6.905   1.00 27.75 ? 44  GLN B C   1 
ATOM   3882 O O   . GLN B 1 37  ? 32.017 46.004  6.571   1.00 26.51 ? 44  GLN B O   1 
ATOM   3883 C CB  . GLN B 1 37  ? 33.382 48.856  7.022   1.00 29.49 ? 44  GLN B CB  1 
ATOM   3884 C CG  . GLN B 1 37  ? 34.042 50.147  6.584   1.00 32.12 ? 44  GLN B CG  1 
ATOM   3885 C CD  . GLN B 1 37  ? 33.547 51.345  7.379   1.00 38.21 ? 44  GLN B CD  1 
ATOM   3886 O OE1 . GLN B 1 37  ? 33.654 51.380  8.608   1.00 38.23 ? 44  GLN B OE1 1 
ATOM   3887 N NE2 . GLN B 1 37  ? 32.998 52.338  6.677   1.00 40.27 ? 44  GLN B NE2 1 
ATOM   3888 N N   . ILE B 1 38  ? 33.848 45.846  7.879   1.00 28.22 ? 45  ILE B N   1 
ATOM   3889 C CA  . ILE B 1 38  ? 33.401 44.711  8.674   1.00 31.07 ? 45  ILE B CA  1 
ATOM   3890 C C   . ILE B 1 38  ? 33.814 45.029  10.115  1.00 31.90 ? 45  ILE B C   1 
ATOM   3891 O O   . ILE B 1 38  ? 34.984 45.315  10.369  1.00 32.09 ? 45  ILE B O   1 
ATOM   3892 C CB  . ILE B 1 38  ? 34.102 43.408  8.221   1.00 29.80 ? 45  ILE B CB  1 
ATOM   3893 C CG1 . ILE B 1 38  ? 33.687 43.061  6.788   1.00 28.45 ? 45  ILE B CG1 1 
ATOM   3894 C CG2 . ILE B 1 38  ? 33.781 42.285  9.180   1.00 27.44 ? 45  ILE B CG2 1 
ATOM   3895 C CD1 . ILE B 1 38  ? 34.453 41.882  6.187   1.00 28.37 ? 45  ILE B CD1 1 
ATOM   3896 N N   . GLY B 1 39  ? 32.867 44.996  11.050  1.00 33.15 ? 46  GLY B N   1 
ATOM   3897 C CA  . GLY B 1 39  ? 33.203 45.296  12.436  1.00 34.87 ? 46  GLY B CA  1 
ATOM   3898 C C   . GLY B 1 39  ? 32.044 45.353  13.425  1.00 36.35 ? 46  GLY B C   1 
ATOM   3899 O O   . GLY B 1 39  ? 30.875 45.460  13.041  1.00 33.76 ? 46  GLY B O   1 
ATOM   3900 N N   . GLU B 1 40  ? 32.392 45.293  14.709  1.00 40.36 ? 47  GLU B N   1 
ATOM   3901 C CA  . GLU B 1 40  ? 31.446 45.323  15.826  1.00 45.69 ? 47  GLU B CA  1 
ATOM   3902 C C   . GLU B 1 40  ? 30.350 46.377  15.700  1.00 48.65 ? 47  GLU B C   1 
ATOM   3903 O O   . GLU B 1 40  ? 29.209 46.152  16.128  1.00 51.03 ? 47  GLU B O   1 
ATOM   3904 C CB  . GLU B 1 40  ? 32.206 45.521  17.142  1.00 45.86 ? 47  GLU B CB  1 
ATOM   3905 N N   . ASN B 1 41  ? 30.676 47.532  15.136  1.00 49.89 ? 48  ASN B N   1 
ATOM   3906 C CA  . ASN B 1 41  ? 29.653 48.558  14.977  1.00 52.84 ? 48  ASN B CA  1 
ATOM   3907 C C   . ASN B 1 41  ? 30.227 49.904  14.618  1.00 54.74 ? 48  ASN B C   1 
ATOM   3908 O O   . ASN B 1 41  ? 31.440 50.067  14.488  1.00 56.29 ? 48  ASN B O   1 
ATOM   3909 C CB  . ASN B 1 41  ? 28.839 48.683  16.252  1.00 52.08 ? 48  ASN B CB  1 
ATOM   3910 N N   . LEU B 1 42  ? 29.332 50.869  14.448  1.00 57.95 ? 49  LEU B N   1 
ATOM   3911 C CA  . LEU B 1 42  ? 29.716 52.238  14.127  1.00 60.73 ? 49  LEU B CA  1 
ATOM   3912 C C   . LEU B 1 42  ? 30.344 52.417  12.758  1.00 61.07 ? 49  LEU B C   1 
ATOM   3913 O O   . LEU B 1 42  ? 30.671 51.435  12.068  1.00 61.82 ? 49  LEU B O   1 
ATOM   3914 C CB  . LEU B 1 42  ? 30.676 52.773  15.206  1.00 62.30 ? 49  LEU B CB  1 
ATOM   3915 N N   . ILE B 1 43  ? 30.500 53.692  12.386  1.00 61.21 ? 50  ILE B N   1 
ATOM   3916 C CA  . ILE B 1 43  ? 31.111 54.134  11.124  1.00 60.43 ? 50  ILE B CA  1 
ATOM   3917 C C   . ILE B 1 43  ? 30.169 54.097  9.917   1.00 59.22 ? 50  ILE B C   1 
ATOM   3918 O O   . ILE B 1 43  ? 30.526 53.535  8.874   1.00 61.05 ? 50  ILE B O   1 
ATOM   3919 C CB  . ILE B 1 43  ? 32.376 53.287  10.783  1.00 61.10 ? 50  ILE B CB  1 
ATOM   3920 C CG1 . ILE B 1 43  ? 33.217 53.043  12.044  1.00 62.17 ? 50  ILE B CG1 1 
ATOM   3921 C CG2 . ILE B 1 43  ? 33.247 54.037  9.774   1.00 61.76 ? 50  ILE B CG2 1 
ATOM   3922 C CD1 . ILE B 1 43  ? 34.235 51.915  11.884  1.00 59.01 ? 50  ILE B CD1 1 
ATOM   3923 N N   . VAL B 1 44  ? 28.979 54.690  10.039  1.00 55.55 ? 51  VAL B N   1 
ATOM   3924 C CA  . VAL B 1 44  ? 28.020 54.692  8.928   1.00 52.47 ? 51  VAL B CA  1 
ATOM   3925 C C   . VAL B 1 44  ? 27.141 55.944  8.856   1.00 52.60 ? 51  VAL B C   1 
ATOM   3926 O O   . VAL B 1 44  ? 26.595 56.392  9.869   1.00 50.05 ? 51  VAL B O   1 
ATOM   3927 C CB  . VAL B 1 44  ? 27.135 53.457  9.007   1.00 50.71 ? 51  VAL B CB  1 
ATOM   3928 N N   . PRO B 1 45  ? 26.990 56.522  7.646   1.00 51.98 ? 52  PRO B N   1 
ATOM   3929 C CA  . PRO B 1 45  ? 26.170 57.724  7.437   1.00 52.95 ? 52  PRO B CA  1 
ATOM   3930 C C   . PRO B 1 45  ? 24.685 57.481  7.741   1.00 54.15 ? 52  PRO B C   1 
ATOM   3931 O O   . PRO B 1 45  ? 24.156 56.384  7.510   1.00 54.36 ? 52  PRO B O   1 
ATOM   3932 C CB  . PRO B 1 45  ? 26.420 58.062  5.965   1.00 52.00 ? 52  PRO B CB  1 
ATOM   3933 C CG  . PRO B 1 45  ? 27.824 57.543  5.734   1.00 50.65 ? 52  PRO B CG  1 
ATOM   3934 C CD  . PRO B 1 45  ? 27.770 56.203  6.435   1.00 50.60 ? 52  PRO B CD  1 
ATOM   3935 N N   . GLY B 1 46  ? 24.019 58.519  8.245   1.00 54.41 ? 53  GLY B N   1 
ATOM   3936 C CA  . GLY B 1 46  ? 22.614 58.426  8.604   1.00 53.91 ? 53  GLY B CA  1 
ATOM   3937 C C   . GLY B 1 46  ? 21.627 57.885  7.589   1.00 54.99 ? 53  GLY B C   1 
ATOM   3938 O O   . GLY B 1 46  ? 20.795 57.025  7.923   1.00 57.37 ? 53  GLY B O   1 
ATOM   3939 N N   . GLY B 1 47  ? 21.684 58.375  6.354   1.00 53.27 ? 54  GLY B N   1 
ATOM   3940 C CA  . GLY B 1 47  ? 20.733 57.900  5.359   1.00 52.77 ? 54  GLY B CA  1 
ATOM   3941 C C   . GLY B 1 47  ? 21.092 56.601  4.660   1.00 51.37 ? 54  GLY B C   1 
ATOM   3942 O O   . GLY B 1 47  ? 20.947 56.512  3.436   1.00 53.59 ? 54  GLY B O   1 
ATOM   3943 N N   . VAL B 1 48  ? 21.531 55.587  5.409   1.00 47.62 ? 55  VAL B N   1 
ATOM   3944 C CA  . VAL B 1 48  ? 21.926 54.308  4.794   1.00 43.94 ? 55  VAL B CA  1 
ATOM   3945 C C   . VAL B 1 48  ? 21.000 53.122  5.086   1.00 41.26 ? 55  VAL B C   1 
ATOM   3946 O O   . VAL B 1 48  ? 20.808 52.749  6.239   1.00 39.64 ? 55  VAL B O   1 
ATOM   3947 C CB  . VAL B 1 48  ? 23.361 53.917  5.215   1.00 41.60 ? 55  VAL B CB  1 
ATOM   3948 C CG1 . VAL B 1 48  ? 23.759 52.594  4.568   1.00 40.32 ? 55  VAL B CG1 1 
ATOM   3949 C CG2 . VAL B 1 48  ? 24.330 55.001  4.802   1.00 43.40 ? 55  VAL B CG2 1 
ATOM   3950 N N   . LYS B 1 49  ? 20.460 52.517  4.025   1.00 39.99 ? 56  LYS B N   1 
ATOM   3951 C CA  . LYS B 1 49  ? 19.544 51.379  4.152   1.00 39.38 ? 56  LYS B CA  1 
ATOM   3952 C C   . LYS B 1 49  ? 20.204 50.237  4.926   1.00 38.66 ? 56  LYS B C   1 
ATOM   3953 O O   . LYS B 1 49  ? 21.297 49.780  4.569   1.00 34.85 ? 56  LYS B O   1 
ATOM   3954 C CB  . LYS B 1 49  ? 19.117 50.903  2.762   1.00 40.04 ? 56  LYS B CB  1 
ATOM   3955 C CG  . LYS B 1 49  ? 18.053 49.838  2.792   1.00 40.82 ? 56  LYS B CG  1 
ATOM   3956 C CD  . LYS B 1 49  ? 17.667 49.411  1.388   1.00 41.74 ? 56  LYS B CD  1 
ATOM   3957 C CE  . LYS B 1 49  ? 16.758 48.222  1.466   1.00 43.18 ? 56  LYS B CE  1 
ATOM   3958 N NZ  . LYS B 1 49  ? 17.358 47.261  2.437   1.00 43.44 ? 56  LYS B NZ  1 
ATOM   3959 N N   . THR B 1 50  ? 19.522 49.773  5.974   1.00 36.36 ? 57  THR B N   1 
ATOM   3960 C CA  . THR B 1 50  ? 20.046 48.734  6.850   1.00 36.67 ? 57  THR B CA  1 
ATOM   3961 C C   . THR B 1 50  ? 19.194 47.468  6.910   1.00 36.24 ? 57  THR B C   1 
ATOM   3962 O O   . THR B 1 50  ? 17.961 47.531  6.884   1.00 36.25 ? 57  THR B O   1 
ATOM   3963 C CB  . THR B 1 50  ? 20.192 49.294  8.288   1.00 38.12 ? 57  THR B CB  1 
ATOM   3964 O OG1 . THR B 1 50  ? 20.999 50.483  8.255   1.00 39.62 ? 57  THR B OG1 1 
ATOM   3965 C CG2 . THR B 1 50  ? 20.843 48.272  9.204   1.00 37.80 ? 57  THR B CG2 1 
ATOM   3966 N N   . ILE B 1 51  ? 19.862 46.316  6.983   1.00 33.26 ? 58  ILE B N   1 
ATOM   3967 C CA  . ILE B 1 51  ? 19.174 45.032  7.091   1.00 31.03 ? 58  ILE B CA  1 
ATOM   3968 C C   . ILE B 1 51  ? 19.570 44.412  8.422   1.00 33.97 ? 58  ILE B C   1 
ATOM   3969 O O   . ILE B 1 51  ? 20.759 44.336  8.743   1.00 33.58 ? 58  ILE B O   1 
ATOM   3970 C CB  . ILE B 1 51  ? 19.593 44.048  5.984   1.00 31.32 ? 58  ILE B CB  1 
ATOM   3971 C CG1 . ILE B 1 51  ? 19.243 44.618  4.610   1.00 27.93 ? 58  ILE B CG1 1 
ATOM   3972 C CG2 . ILE B 1 51  ? 18.898 42.705  6.206   1.00 27.83 ? 58  ILE B CG2 1 
ATOM   3973 C CD1 . ILE B 1 51  ? 19.762 43.791  3.453   1.00 30.56 ? 58  ILE B CD1 1 
ATOM   3974 N N   . GLU B 1 52  ? 18.578 43.973  9.192   1.00 33.97 ? 59  GLU B N   1 
ATOM   3975 C CA  . GLU B 1 52  ? 18.819 43.346  10.490  1.00 34.96 ? 59  GLU B CA  1 
ATOM   3976 C C   . GLU B 1 52  ? 18.921 41.837  10.333  1.00 35.60 ? 59  GLU B C   1 
ATOM   3977 O O   . GLU B 1 52  ? 17.907 41.166  10.169  1.00 38.02 ? 59  GLU B O   1 
ATOM   3978 C CB  . GLU B 1 52  ? 17.671 43.672  11.438  1.00 38.66 ? 59  GLU B CB  1 
ATOM   3979 C CG  . GLU B 1 52  ? 17.640 45.120  11.886  1.00 44.96 ? 59  GLU B CG  1 
ATOM   3980 C CD  . GLU B 1 52  ? 18.838 45.478  12.747  1.00 48.66 ? 59  GLU B CD  1 
ATOM   3981 O OE1 . GLU B 1 52  ? 19.228 44.640  13.595  1.00 49.87 ? 59  GLU B OE1 1 
ATOM   3982 O OE2 . GLU B 1 52  ? 19.380 46.595  12.588  1.00 50.54 ? 59  GLU B OE2 1 
ATOM   3983 N N   . ALA B 1 53  ? 20.133 41.294  10.394  1.00 32.81 ? 60  ALA B N   1 
ATOM   3984 C CA  . ALA B 1 53  ? 20.314 39.851  10.230  1.00 32.17 ? 60  ALA B CA  1 
ATOM   3985 C C   . ALA B 1 53  ? 19.744 39.007  11.374  1.00 31.82 ? 60  ALA B C   1 
ATOM   3986 O O   . ALA B 1 53  ? 19.429 37.830  11.187  1.00 30.15 ? 60  ALA B O   1 
ATOM   3987 C CB  . ALA B 1 53  ? 21.790 39.535  10.031  1.00 28.79 ? 60  ALA B CB  1 
ATOM   3988 N N   . ASN B 1 54  ? 19.634 39.589  12.563  1.00 36.45 ? 61  ASN B N   1 
ATOM   3989 C CA  . ASN B 1 54  ? 19.071 38.859  13.708  1.00 38.66 ? 61  ASN B CA  1 
ATOM   3990 C C   . ASN B 1 54  ? 19.734 37.504  13.968  1.00 37.90 ? 61  ASN B C   1 
ATOM   3991 O O   . ASN B 1 54  ? 19.059 36.460  14.028  1.00 37.02 ? 61  ASN B O   1 
ATOM   3992 C CB  . ASN B 1 54  ? 17.564 38.658  13.491  1.00 42.59 ? 61  ASN B CB  1 
ATOM   3993 C CG  . ASN B 1 54  ? 16.781 39.954  13.619  1.00 47.57 ? 61  ASN B CG  1 
ATOM   3994 O OD1 . ASN B 1 54  ? 15.734 40.135  12.981  1.00 46.98 ? 61  ASN B OD1 1 
ATOM   3995 N ND2 . ASN B 1 54  ? 17.280 40.863  14.458  1.00 46.80 ? 61  ASN B ND2 1 
ATOM   3996 N N   . GLY B 1 55  ? 21.053 37.516  14.117  1.00 35.92 ? 62  GLY B N   1 
ATOM   3997 C CA  . GLY B 1 55  ? 21.775 36.281  14.376  1.00 36.91 ? 62  GLY B CA  1 
ATOM   3998 C C   . GLY B 1 55  ? 21.879 35.280  13.232  1.00 35.19 ? 62  GLY B C   1 
ATOM   3999 O O   . GLY B 1 55  ? 22.557 34.260  13.373  1.00 36.49 ? 62  GLY B O   1 
ATOM   4000 N N   . ARG B 1 56  ? 21.214 35.539  12.110  1.00 32.98 ? 63  ARG B N   1 
ATOM   4001 C CA  . ARG B 1 56  ? 21.280 34.622  10.970  1.00 31.10 ? 63  ARG B CA  1 
ATOM   4002 C C   . ARG B 1 56  ? 22.680 34.624  10.323  1.00 28.07 ? 63  ARG B C   1 
ATOM   4003 O O   . ARG B 1 56  ? 23.474 35.539  10.553  1.00 26.05 ? 63  ARG B O   1 
ATOM   4004 C CB  . ARG B 1 56  ? 20.238 35.014  9.921   1.00 34.61 ? 63  ARG B CB  1 
ATOM   4005 C CG  . ARG B 1 56  ? 18.947 34.205  9.938   1.00 41.81 ? 63  ARG B CG  1 
ATOM   4006 C CD  . ARG B 1 56  ? 18.260 34.222  11.296  1.00 50.17 ? 63  ARG B CD  1 
ATOM   4007 N NE  . ARG B 1 56  ? 16.803 34.131  11.162  1.00 55.48 ? 63  ARG B NE  1 
ATOM   4008 C CZ  . ARG B 1 56  ? 16.031 35.135  10.737  1.00 57.11 ? 63  ARG B CZ  1 
ATOM   4009 N NH1 . ARG B 1 56  ? 16.574 36.305  10.411  1.00 56.87 ? 63  ARG B NH1 1 
ATOM   4010 N NH2 . ARG B 1 56  ? 14.715 34.976  10.632  1.00 57.39 ? 63  ARG B NH2 1 
ATOM   4011 N N   . MET B 1 57  ? 22.960 33.606  9.508   1.00 23.86 ? 64  MET B N   1 
ATOM   4012 C CA  . MET B 1 57  ? 24.247 33.461  8.824   1.00 21.39 ? 64  MET B CA  1 
ATOM   4013 C C   . MET B 1 57  ? 24.448 34.392  7.624   1.00 20.28 ? 64  MET B C   1 
ATOM   4014 O O   . MET B 1 57  ? 23.571 34.532  6.770   1.00 20.46 ? 64  MET B O   1 
ATOM   4015 C CB  . MET B 1 57  ? 24.431 32.014  8.348   1.00 22.22 ? 64  MET B CB  1 
ATOM   4016 C CG  . MET B 1 57  ? 24.639 30.974  9.447   1.00 16.96 ? 64  MET B CG  1 
ATOM   4017 S SD  . MET B 1 57  ? 24.613 29.286  8.785   1.00 11.74 ? 64  MET B SD  1 
ATOM   4018 C CE  . MET B 1 57  ? 23.036 28.973  8.891   1.00 20.16 ? 64  MET B CE  1 
ATOM   4019 N N   . VAL B 1 58  ? 25.618 35.018  7.567   1.00 19.30 ? 65  VAL B N   1 
ATOM   4020 C CA  . VAL B 1 58  ? 25.966 35.920  6.478   1.00 16.34 ? 65  VAL B CA  1 
ATOM   4021 C C   . VAL B 1 58  ? 27.126 35.249  5.766   1.00 17.48 ? 65  VAL B C   1 
ATOM   4022 O O   . VAL B 1 58  ? 28.243 35.204  6.282   1.00 15.14 ? 65  VAL B O   1 
ATOM   4023 C CB  . VAL B 1 58  ? 26.402 37.309  7.003   1.00 19.97 ? 65  VAL B CB  1 
ATOM   4024 C CG1 . VAL B 1 58  ? 26.736 38.220  5.834   1.00 15.57 ? 65  VAL B CG1 1 
ATOM   4025 C CG2 . VAL B 1 58  ? 25.285 37.922  7.859   1.00 20.91 ? 65  VAL B CG2 1 
ATOM   4026 N N   . ILE B 1 59  ? 26.854 34.731  4.573   1.00 16.35 ? 66  ILE B N   1 
ATOM   4027 C CA  . ILE B 1 59  ? 27.859 33.999  3.817   1.00 16.33 ? 66  ILE B CA  1 
ATOM   4028 C C   . ILE B 1 59  ? 28.141 34.522  2.413   1.00 16.69 ? 66  ILE B C   1 
ATOM   4029 O O   . ILE B 1 59  ? 27.395 35.343  1.871   1.00 17.53 ? 66  ILE B O   1 
ATOM   4030 C CB  . ILE B 1 59  ? 27.434 32.524  3.676   1.00 14.84 ? 66  ILE B CB  1 
ATOM   4031 C CG1 . ILE B 1 59  ? 26.287 32.413  2.661   1.00 18.88 ? 66  ILE B CG1 1 
ATOM   4032 C CG2 . ILE B 1 59  ? 26.990 31.980  5.022   1.00 13.60 ? 66  ILE B CG2 1 
ATOM   4033 C CD1 . ILE B 1 59  ? 25.782 30.982  2.429   1.00 19.82 ? 66  ILE B CD1 1 
ATOM   4034 N N   . PRO B 1 60  ? 29.236 34.041  1.807   1.00 14.73 ? 67  PRO B N   1 
ATOM   4035 C CA  . PRO B 1 60  ? 29.636 34.434  0.454   1.00 18.54 ? 67  PRO B CA  1 
ATOM   4036 C C   . PRO B 1 60  ? 28.640 33.811  -0.529  1.00 18.02 ? 67  PRO B C   1 
ATOM   4037 O O   . PRO B 1 60  ? 28.196 32.686  -0.317  1.00 12.82 ? 67  PRO B O   1 
ATOM   4038 C CB  . PRO B 1 60  ? 31.022 33.801  0.305   1.00 17.22 ? 67  PRO B CB  1 
ATOM   4039 C CG  . PRO B 1 60  ? 31.525 33.721  1.723   1.00 16.65 ? 67  PRO B CG  1 
ATOM   4040 C CD  . PRO B 1 60  ? 30.298 33.250  2.453   1.00 16.91 ? 67  PRO B CD  1 
ATOM   4041 N N   . GLY B 1 61  ? 28.283 34.537  -1.584  1.00 17.06 ? 68  GLY B N   1 
ATOM   4042 C CA  . GLY B 1 61  ? 27.361 33.984  -2.564  1.00 16.29 ? 68  GLY B CA  1 
ATOM   4043 C C   . GLY B 1 61  ? 27.960 32.736  -3.199  1.00 16.83 ? 68  GLY B C   1 
ATOM   4044 O O   . GLY B 1 61  ? 29.174 32.643  -3.365  1.00 15.26 ? 68  GLY B O   1 
ATOM   4045 N N   . GLY B 1 62  ? 27.125 31.770  -3.563  1.00 18.95 ? 69  GLY B N   1 
ATOM   4046 C CA  . GLY B 1 62  ? 27.649 30.552  -4.157  1.00 17.60 ? 69  GLY B CA  1 
ATOM   4047 C C   . GLY B 1 62  ? 28.222 30.734  -5.551  1.00 19.03 ? 69  GLY B C   1 
ATOM   4048 O O   . GLY B 1 62  ? 27.849 31.668  -6.262  1.00 19.81 ? 69  GLY B O   1 
ATOM   4049 N N   . ILE B 1 63  ? 29.148 29.856  -5.934  1.00 16.93 ? 70  ILE B N   1 
ATOM   4050 C CA  . ILE B 1 63  ? 29.741 29.893  -7.273  1.00 15.27 ? 70  ILE B CA  1 
ATOM   4051 C C   . ILE B 1 63  ? 29.426 28.560  -7.940  1.00 15.65 ? 70  ILE B C   1 
ATOM   4052 O O   . ILE B 1 63  ? 29.878 27.519  -7.475  1.00 14.89 ? 70  ILE B O   1 
ATOM   4053 C CB  . ILE B 1 63  ? 31.281 30.048  -7.235  1.00 17.76 ? 70  ILE B CB  1 
ATOM   4054 C CG1 . ILE B 1 63  ? 31.678 31.345  -6.523  1.00 18.57 ? 70  ILE B CG1 1 
ATOM   4055 C CG2 . ILE B 1 63  ? 31.829 30.059  -8.651  1.00 16.23 ? 70  ILE B CG2 1 
ATOM   4056 C CD1 . ILE B 1 63  ? 33.182 31.554  -6.441  1.00 14.55 ? 70  ILE B CD1 1 
ATOM   4057 N N   . ASP B 1 64  ? 28.639 28.583  -9.012  1.00 17.19 ? 71  ASP B N   1 
ATOM   4058 C CA  . ASP B 1 64  ? 28.287 27.347  -9.715  1.00 14.21 ? 71  ASP B CA  1 
ATOM   4059 C C   . ASP B 1 64  ? 29.321 27.114  -10.806 1.00 15.36 ? 71  ASP B C   1 
ATOM   4060 O O   . ASP B 1 64  ? 29.238 27.689  -11.886 1.00 14.23 ? 71  ASP B O   1 
ATOM   4061 C CB  . ASP B 1 64  ? 26.888 27.445  -10.342 1.00 13.59 ? 71  ASP B CB  1 
ATOM   4062 C CG  . ASP B 1 64  ? 26.355 26.091  -10.823 1.00 18.50 ? 71  ASP B CG  1 
ATOM   4063 O OD1 . ASP B 1 64  ? 27.160 25.217  -11.228 1.00 20.91 ? 71  ASP B OD1 1 
ATOM   4064 O OD2 . ASP B 1 64  ? 25.117 25.906  -10.812 1.00 16.60 ? 71  ASP B OD2 1 
ATOM   4065 N N   . VAL B 1 65  ? 30.300 26.268  -10.507 1.00 15.03 ? 72  VAL B N   1 
ATOM   4066 C CA  . VAL B 1 65  ? 31.371 25.957  -11.441 1.00 12.21 ? 72  VAL B CA  1 
ATOM   4067 C C   . VAL B 1 65  ? 30.916 25.255  -12.725 1.00 14.36 ? 72  VAL B C   1 
ATOM   4068 O O   . VAL B 1 65  ? 31.683 25.149  -13.676 1.00 15.55 ? 72  VAL B O   1 
ATOM   4069 C CB  . VAL B 1 65  ? 32.414 25.051  -10.775 1.00 15.01 ? 72  VAL B CB  1 
ATOM   4070 C CG1 . VAL B 1 65  ? 33.185 25.823  -9.713  1.00 12.84 ? 72  VAL B CG1 1 
ATOM   4071 C CG2 . VAL B 1 65  ? 31.708 23.845  -10.147 1.00 10.10 ? 72  VAL B CG2 1 
ATOM   4072 N N   . ASN B 1 66  ? 29.678 24.784  -12.771 1.00 12.92 ? 73  ASN B N   1 
ATOM   4073 C CA  . ASN B 1 66  ? 29.243 24.062  -13.956 1.00 16.09 ? 73  ASN B CA  1 
ATOM   4074 C C   . ASN B 1 66  ? 27.821 24.356  -14.446 1.00 15.48 ? 73  ASN B C   1 
ATOM   4075 O O   . ASN B 1 66  ? 26.850 23.842  -13.887 1.00 13.38 ? 73  ASN B O   1 
ATOM   4076 C CB  . ASN B 1 66  ? 29.386 22.551  -13.700 1.00 14.62 ? 73  ASN B CB  1 
ATOM   4077 C CG  . ASN B 1 66  ? 29.361 21.738  -14.972 1.00 18.83 ? 73  ASN B CG  1 
ATOM   4078 O OD1 . ASN B 1 66  ? 28.672 22.088  -15.931 1.00 18.74 ? 73  ASN B OD1 1 
ATOM   4079 N ND2 . ASN B 1 66  ? 30.110 20.636  -14.988 1.00 19.34 ? 73  ASN B ND2 1 
ATOM   4080 N N   . THR B 1 67  ? 27.709 25.178  -15.488 1.00 13.86 ? 74  THR B N   1 
ATOM   4081 C CA  . THR B 1 67  ? 26.404 25.493  -16.081 1.00 18.27 ? 74  THR B CA  1 
ATOM   4082 C C   . THR B 1 67  ? 26.481 25.369  -17.607 1.00 19.31 ? 74  THR B C   1 
ATOM   4083 O O   . THR B 1 67  ? 27.527 25.621  -18.205 1.00 22.05 ? 74  THR B O   1 
ATOM   4084 C CB  . THR B 1 67  ? 25.907 26.925  -15.700 1.00 16.31 ? 74  THR B CB  1 
ATOM   4085 O OG1 . THR B 1 67  ? 26.827 27.917  -16.179 1.00 11.94 ? 74  THR B OG1 1 
ATOM   4086 C CG2 . THR B 1 67  ? 25.749 27.043  -14.181 1.00 15.68 ? 74  THR B CG2 1 
ATOM   4087 N N   . TYR B 1 68  ? 25.381 24.951  -18.224 1.00 21.90 ? 75  TYR B N   1 
ATOM   4088 C CA  . TYR B 1 68  ? 25.304 24.784  -19.680 1.00 20.96 ? 75  TYR B CA  1 
ATOM   4089 C C   . TYR B 1 68  ? 24.025 25.471  -20.156 1.00 21.39 ? 75  TYR B C   1 
ATOM   4090 O O   . TYR B 1 68  ? 23.185 24.858  -20.822 1.00 19.24 ? 75  TYR B O   1 
ATOM   4091 C CB  . TYR B 1 68  ? 25.238 23.299  -20.057 1.00 18.29 ? 75  TYR B CB  1 
ATOM   4092 C CG  . TYR B 1 68  ? 26.577 22.618  -20.214 1.00 23.40 ? 75  TYR B CG  1 
ATOM   4093 C CD1 . TYR B 1 68  ? 27.279 22.139  -19.106 1.00 19.40 ? 75  TYR B CD1 1 
ATOM   4094 C CD2 . TYR B 1 68  ? 27.145 22.451  -21.481 1.00 17.44 ? 75  TYR B CD2 1 
ATOM   4095 C CE1 . TYR B 1 68  ? 28.523 21.503  -19.261 1.00 26.67 ? 75  TYR B CE1 1 
ATOM   4096 C CE2 . TYR B 1 68  ? 28.376 21.830  -21.647 1.00 19.31 ? 75  TYR B CE2 1 
ATOM   4097 C CZ  . TYR B 1 68  ? 29.063 21.354  -20.541 1.00 23.41 ? 75  TYR B CZ  1 
ATOM   4098 O OH  . TYR B 1 68  ? 30.283 20.742  -20.711 1.00 17.80 ? 75  TYR B OH  1 
ATOM   4099 N N   . LEU B 1 69  ? 23.899 26.748  -19.813 1.00 21.77 ? 76  LEU B N   1 
ATOM   4100 C CA  . LEU B 1 69  ? 22.709 27.526  -20.129 1.00 24.86 ? 76  LEU B CA  1 
ATOM   4101 C C   . LEU B 1 69  ? 22.305 27.660  -21.594 1.00 25.96 ? 76  LEU B C   1 
ATOM   4102 O O   . LEU B 1 69  ? 21.123 27.830  -21.883 1.00 27.79 ? 76  LEU B O   1 
ATOM   4103 C CB  . LEU B 1 69  ? 22.818 28.910  -19.486 1.00 22.50 ? 76  LEU B CB  1 
ATOM   4104 C CG  . LEU B 1 69  ? 22.915 28.889  -17.954 1.00 23.33 ? 76  LEU B CG  1 
ATOM   4105 C CD1 . LEU B 1 69  ? 22.684 30.291  -17.412 1.00 19.76 ? 76  LEU B CD1 1 
ATOM   4106 C CD2 . LEU B 1 69  ? 21.885 27.927  -17.373 1.00 18.19 ? 76  LEU B CD2 1 
ATOM   4107 N N   . GLN B 1 70  ? 23.266 27.595  -22.512 1.00 25.28 ? 77  GLN B N   1 
ATOM   4108 C CA  . GLN B 1 70  ? 22.957 27.691  -23.937 1.00 28.12 ? 77  GLN B CA  1 
ATOM   4109 C C   . GLN B 1 70  ? 23.508 26.473  -24.669 1.00 28.87 ? 77  GLN B C   1 
ATOM   4110 O O   . GLN B 1 70  ? 24.003 26.577  -25.789 1.00 26.75 ? 77  GLN B O   1 
ATOM   4111 C CB  . GLN B 1 70  ? 23.551 28.970  -24.537 1.00 31.48 ? 77  GLN B CB  1 
ATOM   4112 C CG  . GLN B 1 70  ? 22.665 30.189  -24.366 1.00 44.78 ? 77  GLN B CG  1 
ATOM   4113 C CD  . GLN B 1 70  ? 23.187 31.419  -25.097 1.00 52.78 ? 77  GLN B CD  1 
ATOM   4114 O OE1 . GLN B 1 70  ? 23.592 31.346  -26.270 1.00 55.97 ? 77  GLN B OE1 1 
ATOM   4115 N NE2 . GLN B 1 70  ? 23.163 32.568  -24.415 1.00 56.79 ? 77  GLN B NE2 1 
ATOM   4116 N N   . LYS B 1 71  ? 23.405 25.313  -24.026 1.00 25.16 ? 78  LYS B N   1 
ATOM   4117 C CA  . LYS B 1 71  ? 23.914 24.067  -24.592 1.00 23.99 ? 78  LYS B CA  1 
ATOM   4118 C C   . LYS B 1 71  ? 23.140 23.512  -25.780 1.00 25.39 ? 78  LYS B C   1 
ATOM   4119 O O   . LYS B 1 71  ? 21.910 23.435  -25.759 1.00 23.48 ? 78  LYS B O   1 
ATOM   4120 C CB  . LYS B 1 71  ? 23.956 22.993  -23.507 1.00 24.52 ? 78  LYS B CB  1 
ATOM   4121 C CG  . LYS B 1 71  ? 24.340 21.614  -24.001 1.00 26.96 ? 78  LYS B CG  1 
ATOM   4122 C CD  . LYS B 1 71  ? 24.248 20.595  -22.876 1.00 28.65 ? 78  LYS B CD  1 
ATOM   4123 C CE  . LYS B 1 71  ? 24.395 19.180  -23.408 1.00 30.55 ? 78  LYS B CE  1 
ATOM   4124 N NZ  . LYS B 1 71  ? 24.259 18.156  -22.334 1.00 23.02 ? 78  LYS B NZ  1 
ATOM   4125 N N   . PRO B 1 72  ? 23.859 23.123  -26.844 1.00 24.26 ? 79  PRO B N   1 
ATOM   4126 C CA  . PRO B 1 72  ? 23.207 22.555  -28.028 1.00 25.38 ? 79  PRO B CA  1 
ATOM   4127 C C   . PRO B 1 72  ? 23.200 21.037  -27.830 1.00 27.96 ? 79  PRO B C   1 
ATOM   4128 O O   . PRO B 1 72  ? 24.179 20.461  -27.351 1.00 25.80 ? 79  PRO B O   1 
ATOM   4129 C CB  . PRO B 1 72  ? 24.129 22.978  -29.158 1.00 24.33 ? 79  PRO B CB  1 
ATOM   4130 C CG  . PRO B 1 72  ? 25.476 22.856  -28.518 1.00 27.45 ? 79  PRO B CG  1 
ATOM   4131 C CD  . PRO B 1 72  ? 25.256 23.489  -27.146 1.00 25.44 ? 79  PRO B CD  1 
ATOM   4132 N N   . SER B 1 73  ? 22.097 20.388  -28.170 1.00 28.03 ? 80  SER B N   1 
ATOM   4133 C CA  . SER B 1 73  ? 22.014 18.942  -28.017 1.00 32.64 ? 80  SER B CA  1 
ATOM   4134 C C   . SER B 1 73  ? 20.905 18.443  -28.920 1.00 33.97 ? 80  SER B C   1 
ATOM   4135 O O   . SER B 1 73  ? 19.759 18.888  -28.797 1.00 33.10 ? 80  SER B O   1 
ATOM   4136 C CB  . SER B 1 73  ? 21.715 18.567  -26.560 1.00 29.24 ? 80  SER B CB  1 
ATOM   4137 O OG  . SER B 1 73  ? 21.750 17.155  -26.380 1.00 35.14 ? 80  SER B OG  1 
ATOM   4138 N N   . GLN B 1 74  ? 21.254 17.522  -29.820 1.00 34.43 ? 81  GLN B N   1 
ATOM   4139 C CA  . GLN B 1 74  ? 20.303 16.966  -30.780 1.00 36.45 ? 81  GLN B CA  1 
ATOM   4140 C C   . GLN B 1 74  ? 19.680 18.093  -31.601 1.00 35.74 ? 81  GLN B C   1 
ATOM   4141 O O   . GLN B 1 74  ? 18.502 18.037  -31.953 1.00 38.38 ? 81  GLN B O   1 
ATOM   4142 C CB  . GLN B 1 74  ? 19.192 16.181  -30.065 1.00 36.95 ? 81  GLN B CB  1 
ATOM   4143 C CG  . GLN B 1 74  ? 19.641 14.922  -29.333 1.00 37.05 ? 81  GLN B CG  1 
ATOM   4144 C CD  . GLN B 1 74  ? 20.385 13.950  -30.233 1.00 41.56 ? 81  GLN B CD  1 
ATOM   4145 O OE1 . GLN B 1 74  ? 20.061 13.798  -31.418 1.00 39.79 ? 81  GLN B OE1 1 
ATOM   4146 N NE2 . GLN B 1 74  ? 21.386 13.273  -29.671 1.00 39.50 ? 81  GLN B NE2 1 
ATOM   4147 N N   . GLY B 1 75  ? 20.468 19.128  -31.881 1.00 34.41 ? 82  GLY B N   1 
ATOM   4148 C CA  . GLY B 1 75  ? 19.980 20.247  -32.670 1.00 30.89 ? 82  GLY B CA  1 
ATOM   4149 C C   . GLY B 1 75  ? 19.079 21.243  -31.960 1.00 32.26 ? 82  GLY B C   1 
ATOM   4150 O O   . GLY B 1 75  ? 18.508 22.123  -32.615 1.00 32.25 ? 82  GLY B O   1 
ATOM   4151 N N   . MET B 1 76  ? 18.941 21.117  -30.638 1.00 30.52 ? 83  MET B N   1 
ATOM   4152 C CA  . MET B 1 76  ? 18.098 22.025  -29.850 1.00 29.06 ? 83  MET B CA  1 
ATOM   4153 C C   . MET B 1 76  ? 18.921 22.723  -28.766 1.00 30.29 ? 83  MET B C   1 
ATOM   4154 O O   . MET B 1 76  ? 19.991 22.246  -28.389 1.00 32.21 ? 83  MET B O   1 
ATOM   4155 C CB  . MET B 1 76  ? 16.941 21.252  -29.195 1.00 25.94 ? 83  MET B CB  1 
ATOM   4156 C CG  . MET B 1 76  ? 15.966 20.603  -30.185 1.00 23.82 ? 83  MET B CG  1 
ATOM   4157 S SD  . MET B 1 76  ? 14.725 19.557  -29.403 1.00 16.92 ? 83  MET B SD  1 
ATOM   4158 C CE  . MET B 1 76  ? 15.672 18.124  -29.123 1.00 21.84 ? 83  MET B CE  1 
ATOM   4159 N N   . THR B 1 77  ? 18.424 23.854  -28.271 1.00 28.71 ? 84  THR B N   1 
ATOM   4160 C CA  . THR B 1 77  ? 19.110 24.597  -27.226 1.00 27.62 ? 84  THR B CA  1 
ATOM   4161 C C   . THR B 1 77  ? 18.454 24.340  -25.862 1.00 29.55 ? 84  THR B C   1 
ATOM   4162 O O   . THR B 1 77  ? 17.252 24.068  -25.773 1.00 24.91 ? 84  THR B O   1 
ATOM   4163 C CB  . THR B 1 77  ? 19.106 26.116  -27.530 1.00 29.61 ? 84  THR B CB  1 
ATOM   4164 O OG1 . THR B 1 77  ? 19.853 26.357  -28.727 1.00 30.62 ? 84  THR B OG1 1 
ATOM   4165 C CG2 . THR B 1 77  ? 19.762 26.904  -26.396 1.00 28.06 ? 84  THR B CG2 1 
ATOM   4166 N N   . SER B 1 78  ? 19.259 24.415  -24.806 1.00 30.41 ? 85  SER B N   1 
ATOM   4167 C CA  . SER B 1 78  ? 18.789 24.190  -23.441 1.00 32.53 ? 85  SER B CA  1 
ATOM   4168 C C   . SER B 1 78  ? 17.615 25.120  -23.089 1.00 29.90 ? 85  SER B C   1 
ATOM   4169 O O   . SER B 1 78  ? 17.537 26.241  -23.581 1.00 30.32 ? 85  SER B O   1 
ATOM   4170 C CB  . SER B 1 78  ? 19.944 24.403  -22.461 1.00 31.34 ? 85  SER B CB  1 
ATOM   4171 O OG  . SER B 1 78  ? 19.707 23.663  -21.282 1.00 41.26 ? 85  SER B OG  1 
ATOM   4172 N N   . ALA B 1 79  ? 16.727 24.652  -22.215 1.00 30.92 ? 86  ALA B N   1 
ATOM   4173 C CA  . ALA B 1 79  ? 15.525 25.389  -21.819 1.00 29.06 ? 86  ALA B CA  1 
ATOM   4174 C C   . ALA B 1 79  ? 15.646 26.731  -21.086 1.00 28.99 ? 86  ALA B C   1 
ATOM   4175 O O   . ALA B 1 79  ? 14.850 27.633  -21.335 1.00 25.61 ? 86  ALA B O   1 
ATOM   4176 C CB  . ALA B 1 79  ? 14.611 24.463  -21.018 1.00 30.34 ? 86  ALA B CB  1 
ATOM   4177 N N   . ASP B 1 80  ? 16.604 26.866  -20.175 1.00 26.60 ? 87  ASP B N   1 
ATOM   4178 C CA  . ASP B 1 80  ? 16.769 28.114  -19.436 1.00 23.14 ? 87  ASP B CA  1 
ATOM   4179 C C   . ASP B 1 80  ? 17.983 28.910  -19.933 1.00 25.52 ? 87  ASP B C   1 
ATOM   4180 O O   . ASP B 1 80  ? 19.136 28.495  -19.736 1.00 24.48 ? 87  ASP B O   1 
ATOM   4181 C CB  . ASP B 1 80  ? 16.906 27.820  -17.936 1.00 20.20 ? 87  ASP B CB  1 
ATOM   4182 C CG  . ASP B 1 80  ? 15.765 26.957  -17.399 1.00 27.99 ? 87  ASP B CG  1 
ATOM   4183 O OD1 . ASP B 1 80  ? 14.603 27.160  -17.821 1.00 24.60 ? 87  ASP B OD1 1 
ATOM   4184 O OD2 . ASP B 1 80  ? 16.023 26.081  -16.542 1.00 22.72 ? 87  ASP B OD2 1 
ATOM   4185 N N   . ASP B 1 81  ? 17.714 30.056  -20.565 1.00 22.40 ? 88  ASP B N   1 
ATOM   4186 C CA  . ASP B 1 81  ? 18.761 30.915  -21.117 1.00 22.32 ? 88  ASP B CA  1 
ATOM   4187 C C   . ASP B 1 81  ? 19.498 31.735  -20.055 1.00 22.88 ? 88  ASP B C   1 
ATOM   4188 O O   . ASP B 1 81  ? 19.264 31.567  -18.855 1.00 21.50 ? 88  ASP B O   1 
ATOM   4189 C CB  . ASP B 1 81  ? 18.175 31.854  -22.182 1.00 23.27 ? 88  ASP B CB  1 
ATOM   4190 C CG  . ASP B 1 81  ? 17.139 32.829  -21.619 1.00 25.27 ? 88  ASP B CG  1 
ATOM   4191 O OD1 . ASP B 1 81  ? 17.230 33.243  -20.441 1.00 21.88 ? 88  ASP B OD1 1 
ATOM   4192 O OD2 . ASP B 1 81  ? 16.233 33.209  -22.383 1.00 32.39 ? 88  ASP B OD2 1 
ATOM   4193 N N   . PHE B 1 82  ? 20.381 32.628  -20.493 1.00 18.82 ? 89  PHE B N   1 
ATOM   4194 C CA  . PHE B 1 82  ? 21.154 33.431  -19.545 1.00 23.34 ? 89  PHE B CA  1 
ATOM   4195 C C   . PHE B 1 82  ? 20.347 34.293  -18.575 1.00 23.87 ? 89  PHE B C   1 
ATOM   4196 O O   . PHE B 1 82  ? 20.825 34.605  -17.482 1.00 25.48 ? 89  PHE B O   1 
ATOM   4197 C CB  . PHE B 1 82  ? 22.200 34.275  -20.282 1.00 22.26 ? 89  PHE B CB  1 
ATOM   4198 C CG  . PHE B 1 82  ? 23.504 33.555  -20.498 1.00 25.75 ? 89  PHE B CG  1 
ATOM   4199 C CD1 . PHE B 1 82  ? 24.250 33.104  -19.408 1.00 27.32 ? 89  PHE B CD1 1 
ATOM   4200 C CD2 . PHE B 1 82  ? 23.963 33.268  -21.785 1.00 29.59 ? 89  PHE B CD2 1 
ATOM   4201 C CE1 . PHE B 1 82  ? 25.435 32.378  -19.593 1.00 21.01 ? 89  PHE B CE1 1 
ATOM   4202 C CE2 . PHE B 1 82  ? 25.148 32.542  -21.983 1.00 26.71 ? 89  PHE B CE2 1 
ATOM   4203 C CZ  . PHE B 1 82  ? 25.879 32.093  -20.879 1.00 24.55 ? 89  PHE B CZ  1 
ATOM   4204 N N   . PHE B 1 83  ? 19.130 34.669  -18.957 1.00 22.43 ? 90  PHE B N   1 
ATOM   4205 C CA  . PHE B 1 83  ? 18.285 35.455  -18.068 1.00 20.64 ? 90  PHE B CA  1 
ATOM   4206 C C   . PHE B 1 83  ? 17.578 34.523  -17.082 1.00 20.31 ? 90  PHE B C   1 
ATOM   4207 O O   . PHE B 1 83  ? 17.768 34.633  -15.873 1.00 17.32 ? 90  PHE B O   1 
ATOM   4208 C CB  . PHE B 1 83  ? 17.231 36.236  -18.852 1.00 23.43 ? 90  PHE B CB  1 
ATOM   4209 C CG  . PHE B 1 83  ? 16.222 36.930  -17.977 1.00 19.53 ? 90  PHE B CG  1 
ATOM   4210 C CD1 . PHE B 1 83  ? 16.611 37.959  -17.128 1.00 22.00 ? 90  PHE B CD1 1 
ATOM   4211 C CD2 . PHE B 1 83  ? 14.891 36.527  -17.974 1.00 24.93 ? 90  PHE B CD2 1 
ATOM   4212 C CE1 . PHE B 1 83  ? 15.686 38.581  -16.284 1.00 24.46 ? 90  PHE B CE1 1 
ATOM   4213 C CE2 . PHE B 1 83  ? 13.956 37.140  -17.138 1.00 23.04 ? 90  PHE B CE2 1 
ATOM   4214 C CZ  . PHE B 1 83  ? 14.355 38.167  -16.289 1.00 22.70 ? 90  PHE B CZ  1 
ATOM   4215 N N   . GLN B 1 84  ? 16.763 33.610  -17.601 1.00 17.09 ? 91  GLN B N   1 
ATOM   4216 C CA  . GLN B 1 84  ? 16.033 32.671  -16.749 1.00 21.84 ? 91  GLN B CA  1 
ATOM   4217 C C   . GLN B 1 84  ? 16.971 31.878  -15.839 1.00 20.08 ? 91  GLN B C   1 
ATOM   4218 O O   . GLN B 1 84  ? 16.719 31.740  -14.644 1.00 17.30 ? 91  GLN B O   1 
ATOM   4219 C CB  . GLN B 1 84  ? 15.197 31.698  -17.597 1.00 23.08 ? 91  GLN B CB  1 
ATOM   4220 C CG  . GLN B 1 84  ? 13.940 32.315  -18.222 1.00 34.87 ? 91  GLN B CG  1 
ATOM   4221 C CD  . GLN B 1 84  ? 12.925 32.803  -17.178 1.00 42.29 ? 91  GLN B CD  1 
ATOM   4222 O OE1 . GLN B 1 84  ? 12.483 32.042  -16.309 1.00 43.47 ? 91  GLN B OE1 1 
ATOM   4223 N NE2 . GLN B 1 84  ? 12.549 34.081  -17.269 1.00 46.10 ? 91  GLN B NE2 1 
ATOM   4224 N N   . GLY B 1 85  ? 18.061 31.374  -16.407 1.00 20.16 ? 92  GLY B N   1 
ATOM   4225 C CA  . GLY B 1 85  ? 19.010 30.602  -15.629 1.00 20.13 ? 92  GLY B CA  1 
ATOM   4226 C C   . GLY B 1 85  ? 19.641 31.323  -14.452 1.00 18.00 ? 92  GLY B C   1 
ATOM   4227 O O   . GLY B 1 85  ? 19.679 30.786  -13.344 1.00 19.14 ? 92  GLY B O   1 
ATOM   4228 N N   . THR B 1 86  ? 20.145 32.532  -14.683 1.00 17.68 ? 93  THR B N   1 
ATOM   4229 C CA  . THR B 1 86  ? 20.781 33.299  -13.616 1.00 17.95 ? 93  THR B CA  1 
ATOM   4230 C C   . THR B 1 86  ? 19.747 33.812  -12.610 1.00 21.13 ? 93  THR B C   1 
ATOM   4231 O O   . THR B 1 86  ? 20.053 34.006  -11.429 1.00 18.60 ? 93  THR B O   1 
ATOM   4232 C CB  . THR B 1 86  ? 21.651 34.481  -14.188 1.00 16.68 ? 93  THR B CB  1 
ATOM   4233 O OG1 . THR B 1 86  ? 20.843 35.377  -14.960 1.00 18.63 ? 93  THR B OG1 1 
ATOM   4234 C CG2 . THR B 1 86  ? 22.764 33.934  -15.081 1.00 15.20 ? 93  THR B CG2 1 
ATOM   4235 N N   . LYS B 1 87  ? 18.516 34.014  -13.070 1.00 19.90 ? 94  LYS B N   1 
ATOM   4236 C CA  . LYS B 1 87  ? 17.461 34.463  -12.180 1.00 19.85 ? 94  LYS B CA  1 
ATOM   4237 C C   . LYS B 1 87  ? 17.237 33.357  -11.151 1.00 19.13 ? 94  LYS B C   1 
ATOM   4238 O O   . LYS B 1 87  ? 17.188 33.605  -9.942  1.00 17.73 ? 94  LYS B O   1 
ATOM   4239 C CB  . LYS B 1 87  ? 16.155 34.695  -12.948 1.00 23.64 ? 94  LYS B CB  1 
ATOM   4240 C CG  . LYS B 1 87  ? 15.098 35.398  -12.112 1.00 23.58 ? 94  LYS B CG  1 
ATOM   4241 C CD  . LYS B 1 87  ? 13.681 35.011  -12.486 1.00 24.74 ? 94  LYS B CD  1 
ATOM   4242 C CE  . LYS B 1 87  ? 13.312 35.492  -13.871 1.00 26.39 ? 94  LYS B CE  1 
ATOM   4243 N NZ  . LYS B 1 87  ? 11.897 35.127  -14.163 1.00 32.67 ? 94  LYS B NZ  1 
ATOM   4244 N N   . ALA B 1 88  ? 17.104 32.133  -11.653 1.00 15.89 ? 95  ALA B N   1 
ATOM   4245 C CA  . ALA B 1 88  ? 16.881 30.966  -10.805 1.00 18.23 ? 95  ALA B CA  1 
ATOM   4246 C C   . ALA B 1 88  ? 18.074 30.703  -9.878  1.00 16.68 ? 95  ALA B C   1 
ATOM   4247 O O   . ALA B 1 88  ? 17.894 30.256  -8.750  1.00 19.64 ? 95  ALA B O   1 
ATOM   4248 C CB  . ALA B 1 88  ? 16.596 29.740  -11.666 1.00 11.01 ? 95  ALA B CB  1 
ATOM   4249 N N   . ALA B 1 89  ? 19.282 30.988  -10.353 1.00 18.58 ? 96  ALA B N   1 
ATOM   4250 C CA  . ALA B 1 89  ? 20.485 30.794  -9.545  1.00 19.96 ? 96  ALA B CA  1 
ATOM   4251 C C   . ALA B 1 89  ? 20.470 31.756  -8.356  1.00 20.32 ? 96  ALA B C   1 
ATOM   4252 O O   . ALA B 1 89  ? 20.736 31.360  -7.216  1.00 19.58 ? 96  ALA B O   1 
ATOM   4253 C CB  . ALA B 1 89  ? 21.721 31.040  -10.382 1.00 13.40 ? 96  ALA B CB  1 
ATOM   4254 N N   . LEU B 1 90  ? 20.162 33.021  -8.637  1.00 16.77 ? 97  LEU B N   1 
ATOM   4255 C CA  . LEU B 1 90  ? 20.117 34.043  -7.600  1.00 20.14 ? 97  LEU B CA  1 
ATOM   4256 C C   . LEU B 1 90  ? 19.072 33.703  -6.559  1.00 17.69 ? 97  LEU B C   1 
ATOM   4257 O O   . LEU B 1 90  ? 19.275 33.934  -5.368  1.00 18.40 ? 97  LEU B O   1 
ATOM   4258 C CB  . LEU B 1 90  ? 19.812 35.411  -8.206  1.00 19.23 ? 97  LEU B CB  1 
ATOM   4259 C CG  . LEU B 1 90  ? 20.937 36.034  -9.036  1.00 22.67 ? 97  LEU B CG  1 
ATOM   4260 C CD1 . LEU B 1 90  ? 20.421 37.292  -9.724  1.00 15.69 ? 97  LEU B CD1 1 
ATOM   4261 C CD2 . LEU B 1 90  ? 22.137 36.343  -8.140  1.00 20.07 ? 97  LEU B CD2 1 
ATOM   4262 N N   . ALA B 1 91  ? 17.950 33.159  -7.009  1.00 16.75 ? 98  ALA B N   1 
ATOM   4263 C CA  . ALA B 1 91  ? 16.885 32.788  -6.090  1.00 16.29 ? 98  ALA B CA  1 
ATOM   4264 C C   . ALA B 1 91  ? 17.357 31.667  -5.172  1.00 18.03 ? 98  ALA B C   1 
ATOM   4265 O O   . ALA B 1 91  ? 16.866 31.531  -4.058  1.00 18.68 ? 98  ALA B O   1 
ATOM   4266 C CB  . ALA B 1 91  ? 15.644 32.356  -6.862  1.00 16.48 ? 98  ALA B CB  1 
ATOM   4267 N N   . GLY B 1 92  ? 18.326 30.880  -5.635  1.00 17.57 ? 99  GLY B N   1 
ATOM   4268 C CA  . GLY B 1 92  ? 18.840 29.777  -4.832  1.00 15.82 ? 99  GLY B CA  1 
ATOM   4269 C C   . GLY B 1 92  ? 20.083 30.107  -4.021  1.00 17.03 ? 99  GLY B C   1 
ATOM   4270 O O   . GLY B 1 92  ? 20.664 29.235  -3.376  1.00 14.24 ? 99  GLY B O   1 
ATOM   4271 N N   . GLY B 1 93  ? 20.494 31.370  -4.042  1.00 18.56 ? 100 GLY B N   1 
ATOM   4272 C CA  . GLY B 1 93  ? 21.671 31.764  -3.284  1.00 18.60 ? 100 GLY B CA  1 
ATOM   4273 C C   . GLY B 1 93  ? 22.977 31.766  -4.061  1.00 16.83 ? 100 GLY B C   1 
ATOM   4274 O O   . GLY B 1 93  ? 24.037 32.064  -3.497  1.00 20.85 ? 100 GLY B O   1 
ATOM   4275 N N   . THR B 1 94  ? 22.916 31.429  -5.348  1.00 15.90 ? 101 THR B N   1 
ATOM   4276 C CA  . THR B 1 94  ? 24.110 31.420  -6.180  1.00 15.88 ? 101 THR B CA  1 
ATOM   4277 C C   . THR B 1 94  ? 24.251 32.770  -6.870  1.00 18.20 ? 101 THR B C   1 
ATOM   4278 O O   . THR B 1 94  ? 23.352 33.200  -7.600  1.00 18.12 ? 101 THR B O   1 
ATOM   4279 C CB  . THR B 1 94  ? 24.054 30.295  -7.223  1.00 17.10 ? 101 THR B CB  1 
ATOM   4280 O OG1 . THR B 1 94  ? 24.160 29.035  -6.552  1.00 16.89 ? 101 THR B OG1 1 
ATOM   4281 C CG2 . THR B 1 94  ? 25.197 30.426  -8.226  1.00 13.37 ? 101 THR B CG2 1 
ATOM   4282 N N   . THR B 1 95  ? 25.384 33.430  -6.625  1.00 17.41 ? 102 THR B N   1 
ATOM   4283 C CA  . THR B 1 95  ? 25.668 34.753  -7.183  1.00 18.22 ? 102 THR B CA  1 
ATOM   4284 C C   . THR B 1 95  ? 26.675 34.792  -8.331  1.00 19.61 ? 102 THR B C   1 
ATOM   4285 O O   . THR B 1 95  ? 27.029 35.871  -8.806  1.00 18.21 ? 102 THR B O   1 
ATOM   4286 C CB  . THR B 1 95  ? 26.156 35.731  -6.081  1.00 20.06 ? 102 THR B CB  1 
ATOM   4287 O OG1 . THR B 1 95  ? 27.241 35.138  -5.352  1.00 17.19 ? 102 THR B OG1 1 
ATOM   4288 C CG2 . THR B 1 95  ? 25.005 36.079  -5.127  1.00 15.60 ? 102 THR B CG2 1 
ATOM   4289 N N   . MET B 1 96  ? 27.157 33.626  -8.759  1.00 17.05 ? 103 MET B N   1 
ATOM   4290 C CA  . MET B 1 96  ? 28.079 33.562  -9.888  1.00 17.12 ? 103 MET B CA  1 
ATOM   4291 C C   . MET B 1 96  ? 28.070 32.189  -10.555 1.00 19.69 ? 103 MET B C   1 
ATOM   4292 O O   . MET B 1 96  ? 27.946 31.154  -9.894  1.00 20.43 ? 103 MET B O   1 
ATOM   4293 C CB  . MET B 1 96  ? 29.512 33.907  -9.473  1.00 18.64 ? 103 MET B CB  1 
ATOM   4294 C CG  . MET B 1 96  ? 30.354 34.424  -10.647 1.00 23.85 ? 103 MET B CG  1 
ATOM   4295 S SD  . MET B 1 96  ? 32.137 34.349  -10.418 1.00 25.11 ? 103 MET B SD  1 
ATOM   4296 C CE  . MET B 1 96  ? 32.629 34.668  -12.095 1.00 24.85 ? 103 MET B CE  1 
ATOM   4297 N N   . ILE B 1 97  ? 28.195 32.190  -11.875 1.00 18.72 ? 104 ILE B N   1 
ATOM   4298 C CA  . ILE B 1 97  ? 28.221 30.950  -12.634 1.00 15.99 ? 104 ILE B CA  1 
ATOM   4299 C C   . ILE B 1 97  ? 29.401 31.000  -13.593 1.00 14.53 ? 104 ILE B C   1 
ATOM   4300 O O   . ILE B 1 97  ? 29.899 32.080  -13.917 1.00 19.49 ? 104 ILE B O   1 
ATOM   4301 C CB  . ILE B 1 97  ? 26.924 30.762  -13.466 1.00 17.50 ? 104 ILE B CB  1 
ATOM   4302 C CG1 . ILE B 1 97  ? 26.809 31.870  -14.519 1.00 15.55 ? 104 ILE B CG1 1 
ATOM   4303 C CG2 . ILE B 1 97  ? 25.699 30.804  -12.554 1.00 18.84 ? 104 ILE B CG2 1 
ATOM   4304 C CD1 . ILE B 1 97  ? 25.712 31.621  -15.552 1.00 13.00 ? 104 ILE B CD1 1 
ATOM   4305 N N   . ILE B 1 98  ? 29.872 29.829  -14.002 1.00 15.52 ? 105 ILE B N   1 
ATOM   4306 C CA  . ILE B 1 98  ? 30.949 29.717  -14.980 1.00 15.99 ? 105 ILE B CA  1 
ATOM   4307 C C   . ILE B 1 98  ? 30.316 28.782  -16.013 1.00 17.08 ? 105 ILE B C   1 
ATOM   4308 O O   . ILE B 1 98  ? 30.250 27.563  -15.817 1.00 15.65 ? 105 ILE B O   1 
ATOM   4309 C CB  . ILE B 1 98  ? 32.224 29.071  -14.397 1.00 15.58 ? 105 ILE B CB  1 
ATOM   4310 C CG1 . ILE B 1 98  ? 32.653 29.805  -13.127 1.00 16.15 ? 105 ILE B CG1 1 
ATOM   4311 C CG2 . ILE B 1 98  ? 33.358 29.150  -15.422 1.00 15.92 ? 105 ILE B CG2 1 
ATOM   4312 C CD1 . ILE B 1 98  ? 33.911 29.238  -12.491 1.00 21.18 ? 105 ILE B CD1 1 
ATOM   4313 N N   . ASP B 1 99  ? 29.827 29.376  -17.096 1.00 17.10 ? 106 ASP B N   1 
ATOM   4314 C CA  . ASP B 1 99  ? 29.132 28.644  -18.152 1.00 18.27 ? 106 ASP B CA  1 
ATOM   4315 C C   . ASP B 1 99  ? 30.032 28.073  -19.246 1.00 18.40 ? 106 ASP B C   1 
ATOM   4316 O O   . ASP B 1 99  ? 31.065 28.647  -19.594 1.00 17.37 ? 106 ASP B O   1 
ATOM   4317 C CB  . ASP B 1 99  ? 28.076 29.555  -18.786 1.00 18.09 ? 106 ASP B CB  1 
ATOM   4318 C CG  . ASP B 1 99  ? 27.020 28.783  -19.547 1.00 18.98 ? 106 ASP B CG  1 
ATOM   4319 O OD1 . ASP B 1 99  ? 26.125 28.202  -18.902 1.00 13.02 ? 106 ASP B OD1 1 
ATOM   4320 O OD2 . ASP B 1 99  ? 27.097 28.755  -20.795 1.00 19.54 ? 106 ASP B OD2 1 
ATOM   4321 N N   . HIS B 1 100 ? 29.599 26.941  -19.793 1.00 19.39 ? 107 HIS B N   1 
ATOM   4322 C CA  . HIS B 1 100 ? 30.317 26.229  -20.843 1.00 19.81 ? 107 HIS B CA  1 
ATOM   4323 C C   . HIS B 1 100 ? 29.928 26.659  -22.259 1.00 20.53 ? 107 HIS B C   1 
ATOM   4324 O O   . HIS B 1 100 ? 28.782 26.486  -22.668 1.00 18.17 ? 107 HIS B O   1 
ATOM   4325 C CB  . HIS B 1 100 ? 30.049 24.722  -20.727 1.00 17.26 ? 107 HIS B CB  1 
ATOM   4326 C CG  . HIS B 1 100 ? 30.799 24.043  -19.623 1.00 19.40 ? 107 HIS B CG  1 
ATOM   4327 N ND1 . HIS B 1 100 ? 32.029 23.450  -19.817 1.00 16.37 ? 107 HIS B ND1 1 
ATOM   4328 C CD2 . HIS B 1 100 ? 30.478 23.830  -18.325 1.00 18.51 ? 107 HIS B CD2 1 
ATOM   4329 C CE1 . HIS B 1 100 ? 32.430 22.896  -18.686 1.00 20.37 ? 107 HIS B CE1 1 
ATOM   4330 N NE2 . HIS B 1 100 ? 31.508 23.111  -17.766 1.00 17.64 ? 107 HIS B NE2 1 
ATOM   4331 N N   . VAL B 1 101 ? 30.889 27.198  -23.002 1.00 24.14 ? 108 VAL B N   1 
ATOM   4332 C CA  . VAL B 1 101 ? 30.667 27.590  -24.395 1.00 23.85 ? 108 VAL B CA  1 
ATOM   4333 C C   . VAL B 1 101 ? 30.905 26.315  -25.206 1.00 23.98 ? 108 VAL B C   1 
ATOM   4334 O O   . VAL B 1 101 ? 31.976 25.703  -25.117 1.00 24.47 ? 108 VAL B O   1 
ATOM   4335 C CB  . VAL B 1 101 ? 31.681 28.653  -24.860 1.00 26.03 ? 108 VAL B CB  1 
ATOM   4336 C CG1 . VAL B 1 101 ? 31.541 28.880  -26.365 1.00 25.66 ? 108 VAL B CG1 1 
ATOM   4337 C CG2 . VAL B 1 101 ? 31.458 29.953  -24.105 1.00 22.67 ? 108 VAL B CG2 1 
ATOM   4338 N N   . VAL B 1 102 ? 29.914 25.917  -25.992 1.00 24.53 ? 109 VAL B N   1 
ATOM   4339 C CA  . VAL B 1 102 ? 30.005 24.693  -26.787 1.00 23.69 ? 109 VAL B CA  1 
ATOM   4340 C C   . VAL B 1 102 ? 30.080 24.959  -28.292 1.00 27.30 ? 109 VAL B C   1 
ATOM   4341 O O   . VAL B 1 102 ? 29.056 25.168  -28.940 1.00 26.57 ? 109 VAL B O   1 
ATOM   4342 C CB  . VAL B 1 102 ? 28.795 23.799  -26.488 1.00 19.67 ? 109 VAL B CB  1 
ATOM   4343 C CG1 . VAL B 1 102 ? 28.909 22.463  -27.228 1.00 20.15 ? 109 VAL B CG1 1 
ATOM   4344 C CG2 . VAL B 1 102 ? 28.693 23.593  -24.983 1.00 16.03 ? 109 VAL B CG2 1 
ATOM   4345 N N   . PRO B 1 103 ? 31.297 24.933  -28.868 1.00 29.41 ? 110 PRO B N   1 
ATOM   4346 C CA  . PRO B 1 103 ? 31.492 25.179  -30.304 1.00 31.84 ? 110 PRO B CA  1 
ATOM   4347 C C   . PRO B 1 103 ? 31.036 24.061  -31.227 1.00 36.00 ? 110 PRO B C   1 
ATOM   4348 O O   . PRO B 1 103 ? 31.129 22.875  -30.900 1.00 33.68 ? 110 PRO B O   1 
ATOM   4349 C CB  . PRO B 1 103 ? 32.995 25.435  -30.424 1.00 30.96 ? 110 PRO B CB  1 
ATOM   4350 C CG  . PRO B 1 103 ? 33.405 25.846  -29.024 1.00 28.52 ? 110 PRO B CG  1 
ATOM   4351 C CD  . PRO B 1 103 ? 32.592 24.917  -28.170 1.00 27.49 ? 110 PRO B CD  1 
ATOM   4352 N N   . GLU B 1 104 ? 30.561 24.490  -32.393 1.00 41.57 ? 111 GLU B N   1 
ATOM   4353 C CA  . GLU B 1 104 ? 30.036 23.659  -33.478 1.00 48.55 ? 111 GLU B CA  1 
ATOM   4354 C C   . GLU B 1 104 ? 31.033 22.633  -34.032 1.00 51.53 ? 111 GLU B C   1 
ATOM   4355 O O   . GLU B 1 104 ? 32.052 22.310  -33.403 1.00 45.90 ? 111 GLU B O   1 
ATOM   4356 C CB  . GLU B 1 104 ? 29.605 24.571  -34.649 1.00 54.87 ? 111 GLU B CB  1 
ATOM   4357 C CG  . GLU B 1 104 ? 28.768 25.829  -34.303 1.00 63.55 ? 111 GLU B CG  1 
ATOM   4358 C CD  . GLU B 1 104 ? 28.403 26.637  -35.565 1.00 67.89 ? 111 GLU B CD  1 
ATOM   4359 O OE1 . GLU B 1 104 ? 29.332 27.022  -36.311 1.00 68.02 ? 111 GLU B OE1 1 
ATOM   4360 O OE2 . GLU B 1 104 ? 27.192 26.888  -35.816 1.00 71.74 ? 111 GLU B OE2 1 
ATOM   4361 N N   . PRO B 1 105 ? 30.732 22.093  -35.236 1.00 55.23 ? 112 PRO B N   1 
ATOM   4362 C CA  . PRO B 1 105 ? 31.593 21.103  -35.906 1.00 55.21 ? 112 PRO B CA  1 
ATOM   4363 C C   . PRO B 1 105 ? 32.938 21.696  -36.345 1.00 53.05 ? 112 PRO B C   1 
ATOM   4364 O O   . PRO B 1 105 ? 33.050 22.250  -37.456 1.00 55.60 ? 112 PRO B O   1 
ATOM   4365 C CB  . PRO B 1 105 ? 30.740 20.663  -37.103 1.00 56.55 ? 112 PRO B CB  1 
ATOM   4366 C CG  . PRO B 1 105 ? 29.352 20.709  -36.533 1.00 58.07 ? 112 PRO B CG  1 
ATOM   4367 C CD  . PRO B 1 105 ? 29.362 22.042  -35.797 1.00 55.87 ? 112 PRO B CD  1 
ATOM   4368 N N   . GLY B 1 106 ? 33.950 21.591  -35.480 1.00 46.96 ? 113 GLY B N   1 
ATOM   4369 C CA  . GLY B 1 106 ? 35.266 22.125  -35.805 1.00 42.38 ? 113 GLY B CA  1 
ATOM   4370 C C   . GLY B 1 106 ? 35.315 23.605  -36.176 1.00 41.03 ? 113 GLY B C   1 
ATOM   4371 O O   . GLY B 1 106 ? 36.216 24.045  -36.904 1.00 38.52 ? 113 GLY B O   1 
ATOM   4372 N N   . SER B 1 107 ? 34.353 24.381  -35.684 1.00 38.31 ? 114 SER B N   1 
ATOM   4373 C CA  . SER B 1 107 ? 34.299 25.813  -35.960 1.00 36.67 ? 114 SER B CA  1 
ATOM   4374 C C   . SER B 1 107 ? 35.286 26.601  -35.089 1.00 33.03 ? 114 SER B C   1 
ATOM   4375 O O   . SER B 1 107 ? 36.093 26.015  -34.362 1.00 33.18 ? 114 SER B O   1 
ATOM   4376 C CB  . SER B 1 107 ? 32.874 26.317  -35.739 1.00 36.11 ? 114 SER B CB  1 
ATOM   4377 O OG  . SER B 1 107 ? 32.310 25.718  -34.581 1.00 41.54 ? 114 SER B OG  1 
ATOM   4378 N N   . SER B 1 108 ? 35.217 27.926  -35.162 1.00 28.75 ? 115 SER B N   1 
ATOM   4379 C CA  . SER B 1 108 ? 36.115 28.795  -34.404 1.00 26.48 ? 115 SER B CA  1 
ATOM   4380 C C   . SER B 1 108 ? 35.760 28.916  -32.928 1.00 28.56 ? 115 SER B C   1 
ATOM   4381 O O   . SER B 1 108 ? 34.624 29.249  -32.587 1.00 26.94 ? 115 SER B O   1 
ATOM   4382 C CB  . SER B 1 108 ? 36.129 30.192  -35.015 1.00 28.13 ? 115 SER B CB  1 
ATOM   4383 O OG  . SER B 1 108 ? 36.818 31.107  -34.174 1.00 29.96 ? 115 SER B OG  1 
ATOM   4384 N N   . LEU B 1 109 ? 36.741 28.654  -32.060 1.00 27.28 ? 116 LEU B N   1 
ATOM   4385 C CA  . LEU B 1 109 ? 36.544 28.758  -30.614 1.00 26.13 ? 116 LEU B CA  1 
ATOM   4386 C C   . LEU B 1 109 ? 36.243 30.207  -30.272 1.00 26.91 ? 116 LEU B C   1 
ATOM   4387 O O   . LEU B 1 109 ? 35.359 30.507  -29.455 1.00 28.39 ? 116 LEU B O   1 
ATOM   4388 C CB  . LEU B 1 109 ? 37.808 28.341  -29.849 1.00 24.03 ? 116 LEU B CB  1 
ATOM   4389 C CG  . LEU B 1 109 ? 38.302 26.893  -29.863 1.00 22.59 ? 116 LEU B CG  1 
ATOM   4390 C CD1 . LEU B 1 109 ? 39.449 26.758  -28.864 1.00 21.26 ? 116 LEU B CD1 1 
ATOM   4391 C CD2 . LEU B 1 109 ? 37.174 25.945  -29.485 1.00 19.67 ? 116 LEU B CD2 1 
ATOM   4392 N N   . LEU B 1 110 ? 37.000 31.102  -30.901 1.00 27.55 ? 117 LEU B N   1 
ATOM   4393 C CA  . LEU B 1 110 ? 36.856 32.533  -30.690 1.00 26.82 ? 117 LEU B CA  1 
ATOM   4394 C C   . LEU B 1 110 ? 35.477 33.013  -31.075 1.00 28.42 ? 117 LEU B C   1 
ATOM   4395 O O   . LEU B 1 110 ? 34.879 33.805  -30.363 1.00 31.36 ? 117 LEU B O   1 
ATOM   4396 C CB  . LEU B 1 110 ? 37.913 33.290  -31.495 1.00 29.53 ? 117 LEU B CB  1 
ATOM   4397 C CG  . LEU B 1 110 ? 39.315 33.264  -30.891 1.00 29.89 ? 117 LEU B CG  1 
ATOM   4398 C CD1 . LEU B 1 110 ? 40.323 33.907  -31.844 1.00 31.19 ? 117 LEU B CD1 1 
ATOM   4399 C CD2 . LEU B 1 110 ? 39.278 34.006  -29.555 1.00 25.97 ? 117 LEU B CD2 1 
ATOM   4400 N N   . THR B 1 111 ? 34.964 32.522  -32.197 1.00 30.32 ? 118 THR B N   1 
ATOM   4401 C CA  . THR B 1 111 ? 33.644 32.927  -32.657 1.00 30.94 ? 118 THR B CA  1 
ATOM   4402 C C   . THR B 1 111 ? 32.551 32.491  -31.677 1.00 30.48 ? 118 THR B C   1 
ATOM   4403 O O   . THR B 1 111 ? 31.666 33.286  -31.349 1.00 32.78 ? 118 THR B O   1 
ATOM   4404 C CB  . THR B 1 111 ? 33.372 32.382  -34.087 1.00 31.83 ? 118 THR B CB  1 
ATOM   4405 O OG1 . THR B 1 111 ? 34.317 32.966  -34.990 1.00 35.88 ? 118 THR B OG1 1 
ATOM   4406 C CG2 . THR B 1 111 ? 31.977 32.739  -34.570 1.00 30.64 ? 118 THR B CG2 1 
ATOM   4407 N N   . SER B 1 112 ? 32.608 31.247  -31.200 1.00 27.28 ? 119 SER B N   1 
ATOM   4408 C CA  . SER B 1 112 ? 31.614 30.760  -30.240 1.00 23.56 ? 119 SER B CA  1 
ATOM   4409 C C   . SER B 1 112 ? 31.728 31.538  -28.936 1.00 22.31 ? 119 SER B C   1 
ATOM   4410 O O   . SER B 1 112 ? 30.719 31.838  -28.293 1.00 25.69 ? 119 SER B O   1 
ATOM   4411 C CB  . SER B 1 112 ? 31.800 29.267  -29.954 1.00 23.77 ? 119 SER B CB  1 
ATOM   4412 O OG  . SER B 1 112 ? 31.233 28.469  -30.981 1.00 28.05 ? 119 SER B OG  1 
ATOM   4413 N N   . PHE B 1 113 ? 32.956 31.856  -28.541 1.00 19.14 ? 120 PHE B N   1 
ATOM   4414 C CA  . PHE B 1 113 ? 33.175 32.632  -27.325 1.00 22.79 ? 120 PHE B CA  1 
ATOM   4415 C C   . PHE B 1 113 ? 32.414 33.948  -27.458 1.00 24.59 ? 120 PHE B C   1 
ATOM   4416 O O   . PHE B 1 113 ? 31.626 34.328  -26.583 1.00 25.03 ? 120 PHE B O   1 
ATOM   4417 C CB  . PHE B 1 113 ? 34.663 32.942  -27.131 1.00 18.97 ? 120 PHE B CB  1 
ATOM   4418 C CG  . PHE B 1 113 ? 34.937 33.897  -26.006 1.00 21.11 ? 120 PHE B CG  1 
ATOM   4419 C CD1 . PHE B 1 113 ? 34.865 33.473  -24.684 1.00 22.76 ? 120 PHE B CD1 1 
ATOM   4420 C CD2 . PHE B 1 113 ? 35.206 35.236  -26.267 1.00 24.42 ? 120 PHE B CD2 1 
ATOM   4421 C CE1 . PHE B 1 113 ? 35.058 34.371  -23.633 1.00 22.53 ? 120 PHE B CE1 1 
ATOM   4422 C CE2 . PHE B 1 113 ? 35.401 36.150  -25.221 1.00 28.28 ? 120 PHE B CE2 1 
ATOM   4423 C CZ  . PHE B 1 113 ? 35.324 35.712  -23.899 1.00 24.97 ? 120 PHE B CZ  1 
ATOM   4424 N N   . GLU B 1 114 ? 32.671 34.635  -28.565 1.00 23.53 ? 121 GLU B N   1 
ATOM   4425 C CA  . GLU B 1 114 ? 32.044 35.915  -28.878 1.00 30.21 ? 121 GLU B CA  1 
ATOM   4426 C C   . GLU B 1 114 ? 30.510 35.842  -28.778 1.00 27.06 ? 121 GLU B C   1 
ATOM   4427 O O   . GLU B 1 114 ? 29.884 36.719  -28.186 1.00 27.54 ? 121 GLU B O   1 
ATOM   4428 C CB  . GLU B 1 114 ? 32.514 36.353  -30.285 1.00 36.27 ? 121 GLU B CB  1 
ATOM   4429 C CG  . GLU B 1 114 ? 31.536 37.200  -31.120 1.00 52.59 ? 121 GLU B CG  1 
ATOM   4430 C CD  . GLU B 1 114 ? 32.051 37.483  -32.546 1.00 60.08 ? 121 GLU B CD  1 
ATOM   4431 O OE1 . GLU B 1 114 ? 32.312 36.515  -33.307 1.00 63.60 ? 121 GLU B OE1 1 
ATOM   4432 O OE2 . GLU B 1 114 ? 32.198 38.678  -32.912 1.00 63.63 ? 121 GLU B OE2 1 
ATOM   4433 N N   . LYS B 1 115 ? 29.917 34.786  -29.329 1.00 26.04 ? 122 LYS B N   1 
ATOM   4434 C CA  . LYS B 1 115 ? 28.462 34.605  -29.319 1.00 27.69 ? 122 LYS B CA  1 
ATOM   4435 C C   . LYS B 1 115 ? 27.912 34.410  -27.901 1.00 28.14 ? 122 LYS B C   1 
ATOM   4436 O O   . LYS B 1 115 ? 26.912 35.029  -27.513 1.00 28.46 ? 122 LYS B O   1 
ATOM   4437 C CB  . LYS B 1 115 ? 28.081 33.396  -30.187 1.00 27.08 ? 122 LYS B CB  1 
ATOM   4438 C CG  . LYS B 1 115 ? 26.611 33.344  -30.595 1.00 36.09 ? 122 LYS B CG  1 
ATOM   4439 C CD  . LYS B 1 115 ? 26.258 32.072  -31.397 1.00 39.21 ? 122 LYS B CD  1 
ATOM   4440 C CE  . LYS B 1 115 ? 26.078 30.862  -30.474 1.00 42.78 ? 122 LYS B CE  1 
ATOM   4441 N NZ  . LYS B 1 115 ? 25.922 29.527  -31.176 1.00 44.14 ? 122 LYS B NZ  1 
ATOM   4442 N N   . TRP B 1 116 ? 28.561 33.540  -27.131 1.00 25.35 ? 123 TRP B N   1 
ATOM   4443 C CA  . TRP B 1 116 ? 28.137 33.268  -25.760 1.00 25.23 ? 123 TRP B CA  1 
ATOM   4444 C C   . TRP B 1 116 ? 28.297 34.528  -24.909 1.00 23.39 ? 123 TRP B C   1 
ATOM   4445 O O   . TRP B 1 116 ? 27.441 34.852  -24.092 1.00 20.13 ? 123 TRP B O   1 
ATOM   4446 C CB  . TRP B 1 116 ? 28.976 32.118  -25.173 1.00 24.71 ? 123 TRP B CB  1 
ATOM   4447 C CG  . TRP B 1 116 ? 28.241 30.800  -24.996 1.00 24.00 ? 123 TRP B CG  1 
ATOM   4448 C CD1 . TRP B 1 116 ? 27.711 30.307  -23.834 1.00 25.04 ? 123 TRP B CD1 1 
ATOM   4449 C CD2 . TRP B 1 116 ? 27.984 29.811  -26.001 1.00 23.98 ? 123 TRP B CD2 1 
ATOM   4450 N NE1 . TRP B 1 116 ? 27.147 29.071  -24.053 1.00 21.95 ? 123 TRP B NE1 1 
ATOM   4451 C CE2 . TRP B 1 116 ? 27.300 28.740  -25.376 1.00 24.92 ? 123 TRP B CE2 1 
ATOM   4452 C CE3 . TRP B 1 116 ? 28.267 29.718  -27.373 1.00 24.85 ? 123 TRP B CE3 1 
ATOM   4453 C CZ2 . TRP B 1 116 ? 26.891 27.594  -26.068 1.00 27.66 ? 123 TRP B CZ2 1 
ATOM   4454 C CZ3 . TRP B 1 116 ? 27.861 28.575  -28.067 1.00 29.87 ? 123 TRP B CZ3 1 
ATOM   4455 C CH2 . TRP B 1 116 ? 27.180 27.526  -27.408 1.00 27.82 ? 123 TRP B CH2 1 
ATOM   4456 N N   . HIS B 1 117 ? 29.397 35.241  -25.123 1.00 25.65 ? 124 HIS B N   1 
ATOM   4457 C CA  . HIS B 1 117 ? 29.688 36.454  -24.374 1.00 28.72 ? 124 HIS B CA  1 
ATOM   4458 C C   . HIS B 1 117 ? 28.648 37.540  -24.639 1.00 30.60 ? 124 HIS B C   1 
ATOM   4459 O O   . HIS B 1 117 ? 28.195 38.217  -23.717 1.00 28.45 ? 124 HIS B O   1 
ATOM   4460 C CB  . HIS B 1 117 ? 31.093 36.958  -24.732 1.00 29.32 ? 124 HIS B CB  1 
ATOM   4461 C CG  . HIS B 1 117 ? 31.470 38.233  -24.048 1.00 34.22 ? 124 HIS B CG  1 
ATOM   4462 N ND1 . HIS B 1 117 ? 31.345 38.414  -22.685 1.00 39.18 ? 124 HIS B ND1 1 
ATOM   4463 C CD2 . HIS B 1 117 ? 31.958 39.399  -24.531 1.00 40.39 ? 124 HIS B CD2 1 
ATOM   4464 C CE1 . HIS B 1 117 ? 31.735 39.631  -22.362 1.00 33.24 ? 124 HIS B CE1 1 
ATOM   4465 N NE2 . HIS B 1 117 ? 32.113 40.252  -23.463 1.00 38.15 ? 124 HIS B NE2 1 
ATOM   4466 N N   . GLU B 1 118 ? 28.273 37.700  -25.903 1.00 31.17 ? 125 GLU B N   1 
ATOM   4467 C CA  . GLU B 1 118 ? 27.280 38.699  -26.279 1.00 34.64 ? 125 GLU B CA  1 
ATOM   4468 C C   . GLU B 1 118 ? 25.917 38.418  -25.644 1.00 31.78 ? 125 GLU B C   1 
ATOM   4469 O O   . GLU B 1 118 ? 25.236 39.339  -25.203 1.00 31.68 ? 125 GLU B O   1 
ATOM   4470 C CB  . GLU B 1 118 ? 27.127 38.736  -27.799 1.00 39.63 ? 125 GLU B CB  1 
ATOM   4471 C CG  . GLU B 1 118 ? 26.064 39.705  -28.298 1.00 52.72 ? 125 GLU B CG  1 
ATOM   4472 C CD  . GLU B 1 118 ? 25.895 39.640  -29.812 1.00 61.08 ? 125 GLU B CD  1 
ATOM   4473 O OE1 . GLU B 1 118 ? 25.771 38.504  -30.354 1.00 64.03 ? 125 GLU B OE1 1 
ATOM   4474 O OE2 . GLU B 1 118 ? 25.883 40.721  -30.454 1.00 64.17 ? 125 GLU B OE2 1 
ATOM   4475 N N   . ALA B 1 119 ? 25.525 37.149  -25.603 1.00 27.36 ? 126 ALA B N   1 
ATOM   4476 C CA  . ALA B 1 119 ? 24.239 36.761  -25.031 1.00 24.91 ? 126 ALA B CA  1 
ATOM   4477 C C   . ALA B 1 119 ? 24.208 36.976  -23.525 1.00 24.48 ? 126 ALA B C   1 
ATOM   4478 O O   . ALA B 1 119 ? 23.259 37.555  -22.993 1.00 23.52 ? 126 ALA B O   1 
ATOM   4479 C CB  . ALA B 1 119 ? 23.935 35.301  -25.360 1.00 21.12 ? 126 ALA B CB  1 
ATOM   4480 N N   . ALA B 1 120 ? 25.247 36.510  -22.837 1.00 24.28 ? 127 ALA B N   1 
ATOM   4481 C CA  . ALA B 1 120 ? 25.326 36.667  -21.386 1.00 26.00 ? 127 ALA B CA  1 
ATOM   4482 C C   . ALA B 1 120 ? 25.341 38.141  -20.957 1.00 25.97 ? 127 ALA B C   1 
ATOM   4483 O O   . ALA B 1 120 ? 24.657 38.520  -20.001 1.00 25.55 ? 127 ALA B O   1 
ATOM   4484 C CB  . ALA B 1 120 ? 26.565 35.951  -20.849 1.00 26.72 ? 127 ALA B CB  1 
ATOM   4485 N N   . ASP B 1 121 ? 26.110 38.975  -21.652 1.00 26.73 ? 128 ASP B N   1 
ATOM   4486 C CA  . ASP B 1 121 ? 26.166 40.388  -21.285 1.00 30.08 ? 128 ASP B CA  1 
ATOM   4487 C C   . ASP B 1 121 ? 24.852 41.112  -21.498 1.00 28.47 ? 128 ASP B C   1 
ATOM   4488 O O   . ASP B 1 121 ? 24.636 42.182  -20.937 1.00 29.92 ? 128 ASP B O   1 
ATOM   4489 C CB  . ASP B 1 121 ? 27.236 41.136  -22.074 1.00 37.72 ? 128 ASP B CB  1 
ATOM   4490 C CG  . ASP B 1 121 ? 28.559 41.206  -21.344 1.00 47.33 ? 128 ASP B CG  1 
ATOM   4491 O OD1 . ASP B 1 121 ? 28.567 41.227  -20.080 1.00 47.35 ? 128 ASP B OD1 1 
ATOM   4492 O OD2 . ASP B 1 121 ? 29.593 41.258  -22.048 1.00 50.42 ? 128 ASP B OD2 1 
ATOM   4493 N N   . THR B 1 122 ? 23.981 40.545  -22.320 1.00 26.81 ? 129 THR B N   1 
ATOM   4494 C CA  . THR B 1 122 ? 22.700 41.178  -22.590 1.00 30.43 ? 129 THR B CA  1 
ATOM   4495 C C   . THR B 1 122 ? 21.595 40.600  -21.711 1.00 28.65 ? 129 THR B C   1 
ATOM   4496 O O   . THR B 1 122 ? 20.606 41.277  -21.410 1.00 30.87 ? 129 THR B O   1 
ATOM   4497 C CB  . THR B 1 122 ? 22.299 41.000  -24.068 1.00 31.32 ? 129 THR B CB  1 
ATOM   4498 O OG1 . THR B 1 122 ? 22.295 39.604  -24.394 1.00 40.28 ? 129 THR B OG1 1 
ATOM   4499 C CG2 . THR B 1 122 ? 23.283 41.711  -24.986 1.00 36.16 ? 129 THR B CG2 1 
ATOM   4500 N N   . LYS B 1 123 ? 21.776 39.361  -21.270 1.00 26.22 ? 130 LYS B N   1 
ATOM   4501 C CA  . LYS B 1 123 ? 20.761 38.708  -20.460 1.00 23.99 ? 130 LYS B CA  1 
ATOM   4502 C C   . LYS B 1 123 ? 21.072 38.381  -19.003 1.00 24.46 ? 130 LYS B C   1 
ATOM   4503 O O   . LYS B 1 123 ? 20.178 38.432  -18.160 1.00 24.03 ? 130 LYS B O   1 
ATOM   4504 C CB  . LYS B 1 123 ? 20.315 37.428  -21.164 1.00 24.68 ? 130 LYS B CB  1 
ATOM   4505 C CG  . LYS B 1 123 ? 19.642 37.671  -22.502 1.00 25.15 ? 130 LYS B CG  1 
ATOM   4506 C CD  . LYS B 1 123 ? 19.001 36.392  -23.029 1.00 31.58 ? 130 LYS B CD  1 
ATOM   4507 C CE  . LYS B 1 123 ? 18.050 36.703  -24.180 1.00 35.80 ? 130 LYS B CE  1 
ATOM   4508 N NZ  . LYS B 1 123 ? 17.273 35.514  -24.623 1.00 39.35 ? 130 LYS B NZ  1 
ATOM   4509 N N   . SER B 1 124 ? 22.321 38.043  -18.696 1.00 22.10 ? 131 SER B N   1 
ATOM   4510 C CA  . SER B 1 124 ? 22.685 37.662  -17.325 1.00 20.93 ? 131 SER B CA  1 
ATOM   4511 C C   . SER B 1 124 ? 22.304 38.620  -16.185 1.00 21.52 ? 131 SER B C   1 
ATOM   4512 O O   . SER B 1 124 ? 22.496 39.834  -16.289 1.00 22.11 ? 131 SER B O   1 
ATOM   4513 C CB  . SER B 1 124 ? 24.188 37.374  -17.244 1.00 21.53 ? 131 SER B CB  1 
ATOM   4514 O OG  . SER B 1 124 ? 24.524 36.839  -15.969 1.00 21.43 ? 131 SER B OG  1 
ATOM   4515 N N   . CYS B 1 125 ? 21.786 38.050  -15.093 1.00 15.23 ? 132 CYS B N   1 
ATOM   4516 C CA  . CYS B 1 125 ? 21.389 38.807  -13.903 1.00 18.07 ? 132 CYS B CA  1 
ATOM   4517 C C   . CYS B 1 125 ? 22.516 38.925  -12.865 1.00 20.56 ? 132 CYS B C   1 
ATOM   4518 O O   . CYS B 1 125 ? 22.414 39.730  -11.932 1.00 20.22 ? 132 CYS B O   1 
ATOM   4519 C CB  . CYS B 1 125 ? 20.198 38.141  -13.206 1.00 18.27 ? 132 CYS B CB  1 
ATOM   4520 S SG  . CYS B 1 125 ? 18.722 37.869  -14.220 1.00 21.85 ? 132 CYS B SG  1 
ATOM   4521 N N   . CYS B 1 126 ? 23.569 38.118  -13.018 1.00 17.92 ? 133 CYS B N   1 
ATOM   4522 C CA  . CYS B 1 126 ? 24.700 38.109  -12.079 1.00 19.38 ? 133 CYS B CA  1 
ATOM   4523 C C   . CYS B 1 126 ? 26.043 37.990  -12.794 1.00 17.58 ? 133 CYS B C   1 
ATOM   4524 O O   . CYS B 1 126 ? 26.084 37.710  -13.987 1.00 15.15 ? 133 CYS B O   1 
ATOM   4525 C CB  . CYS B 1 126 ? 24.568 36.928  -11.121 1.00 20.91 ? 133 CYS B CB  1 
ATOM   4526 S SG  . CYS B 1 126 ? 24.644 35.332  -11.969 1.00 22.34 ? 133 CYS B SG  1 
ATOM   4527 N N   . ASP B 1 127 ? 27.143 38.198  -12.063 1.00 20.60 ? 134 ASP B N   1 
ATOM   4528 C CA  . ASP B 1 127 ? 28.474 38.082  -12.668 1.00 21.22 ? 134 ASP B CA  1 
ATOM   4529 C C   . ASP B 1 127 ? 28.671 36.655  -13.177 1.00 21.99 ? 134 ASP B C   1 
ATOM   4530 O O   . ASP B 1 127 ? 28.087 35.704  -12.641 1.00 18.91 ? 134 ASP B O   1 
ATOM   4531 C CB  . ASP B 1 127 ? 29.589 38.409  -11.666 1.00 19.28 ? 134 ASP B CB  1 
ATOM   4532 C CG  . ASP B 1 127 ? 29.624 39.881  -11.274 1.00 21.96 ? 134 ASP B CG  1 
ATOM   4533 O OD1 . ASP B 1 127 ? 29.042 40.723  -11.996 1.00 18.75 ? 134 ASP B OD1 1 
ATOM   4534 O OD2 . ASP B 1 127 ? 30.249 40.192  -10.243 1.00 17.84 ? 134 ASP B OD2 1 
ATOM   4535 N N   . TYR B 1 128 ? 29.510 36.513  -14.201 1.00 22.23 ? 135 TYR B N   1 
ATOM   4536 C CA  . TYR B 1 128 ? 29.776 35.208  -14.791 1.00 20.66 ? 135 TYR B CA  1 
ATOM   4537 C C   . TYR B 1 128 ? 31.139 35.134  -15.465 1.00 20.35 ? 135 TYR B C   1 
ATOM   4538 O O   . TYR B 1 128 ? 31.718 36.146  -15.842 1.00 21.80 ? 135 TYR B O   1 
ATOM   4539 C CB  . TYR B 1 128 ? 28.723 34.886  -15.852 1.00 16.64 ? 135 TYR B CB  1 
ATOM   4540 C CG  . TYR B 1 128 ? 28.750 35.869  -17.011 1.00 22.58 ? 135 TYR B CG  1 
ATOM   4541 C CD1 . TYR B 1 128 ? 28.187 37.142  -16.884 1.00 23.66 ? 135 TYR B CD1 1 
ATOM   4542 C CD2 . TYR B 1 128 ? 29.388 35.552  -18.212 1.00 19.54 ? 135 TYR B CD2 1 
ATOM   4543 C CE1 . TYR B 1 128 ? 28.262 38.072  -17.920 1.00 28.33 ? 135 TYR B CE1 1 
ATOM   4544 C CE2 . TYR B 1 128 ? 29.473 36.479  -19.252 1.00 22.46 ? 135 TYR B CE2 1 
ATOM   4545 C CZ  . TYR B 1 128 ? 28.908 37.733  -19.099 1.00 28.62 ? 135 TYR B CZ  1 
ATOM   4546 O OH  . TYR B 1 128 ? 28.998 38.664  -20.113 1.00 31.77 ? 135 TYR B OH  1 
ATOM   4547 N N   . SER B 1 129 ? 31.630 33.909  -15.614 1.00 17.68 ? 136 SER B N   1 
ATOM   4548 C CA  . SER B 1 129 ? 32.885 33.635  -16.288 1.00 17.07 ? 136 SER B CA  1 
ATOM   4549 C C   . SER B 1 129 ? 32.517 32.582  -17.311 1.00 16.12 ? 136 SER B C   1 
ATOM   4550 O O   . SER B 1 129 ? 31.408 32.050  -17.291 1.00 17.15 ? 136 SER B O   1 
ATOM   4551 C CB  . SER B 1 129 ? 33.936 33.075  -15.331 1.00 17.13 ? 136 SER B CB  1 
ATOM   4552 O OG  . SER B 1 129 ? 34.714 34.114  -14.763 1.00 23.11 ? 136 SER B OG  1 
ATOM   4553 N N   . LEU B 1 130 ? 33.444 32.264  -18.198 1.00 16.89 ? 137 LEU B N   1 
ATOM   4554 C CA  . LEU B 1 130 ? 33.148 31.281  -19.217 1.00 20.38 ? 137 LEU B CA  1 
ATOM   4555 C C   . LEU B 1 130 ? 34.224 30.218  -19.392 1.00 19.48 ? 137 LEU B C   1 
ATOM   4556 O O   . LEU B 1 130 ? 35.418 30.521  -19.380 1.00 20.27 ? 137 LEU B O   1 
ATOM   4557 C CB  . LEU B 1 130 ? 32.910 31.996  -20.556 1.00 19.18 ? 137 LEU B CB  1 
ATOM   4558 C CG  . LEU B 1 130 ? 31.767 33.025  -20.626 1.00 21.51 ? 137 LEU B CG  1 
ATOM   4559 C CD1 . LEU B 1 130 ? 31.844 33.815  -21.934 1.00 15.27 ? 137 LEU B CD1 1 
ATOM   4560 C CD2 . LEU B 1 130 ? 30.433 32.311  -20.520 1.00 10.74 ? 137 LEU B CD2 1 
ATOM   4561 N N   . HIS B 1 131 ? 33.770 28.974  -19.535 1.00 19.29 ? 138 HIS B N   1 
ATOM   4562 C CA  . HIS B 1 131 ? 34.624 27.824  -19.804 1.00 20.44 ? 138 HIS B CA  1 
ATOM   4563 C C   . HIS B 1 131 ? 34.536 27.721  -21.323 1.00 20.60 ? 138 HIS B C   1 
ATOM   4564 O O   . HIS B 1 131 ? 33.544 28.148  -21.909 1.00 20.73 ? 138 HIS B O   1 
ATOM   4565 C CB  . HIS B 1 131 ? 34.020 26.520  -19.255 1.00 19.71 ? 138 HIS B CB  1 
ATOM   4566 C CG  . HIS B 1 131 ? 34.069 26.385  -17.767 1.00 17.85 ? 138 HIS B CG  1 
ATOM   4567 N ND1 . HIS B 1 131 ? 33.000 25.916  -17.031 1.00 15.37 ? 138 HIS B ND1 1 
ATOM   4568 C CD2 . HIS B 1 131 ? 35.071 26.588  -16.882 1.00 14.38 ? 138 HIS B CD2 1 
ATOM   4569 C CE1 . HIS B 1 131 ? 33.341 25.836  -15.762 1.00 13.46 ? 138 HIS B CE1 1 
ATOM   4570 N NE2 . HIS B 1 131 ? 34.595 26.236  -15.642 1.00 22.97 ? 138 HIS B NE2 1 
ATOM   4571 N N   . VAL B 1 132 ? 35.559 27.166  -21.962 1.00 21.42 ? 139 VAL B N   1 
ATOM   4572 C CA  . VAL B 1 132 ? 35.505 26.958  -23.405 1.00 18.73 ? 139 VAL B CA  1 
ATOM   4573 C C   . VAL B 1 132 ? 35.691 25.461  -23.632 1.00 20.06 ? 139 VAL B C   1 
ATOM   4574 O O   . VAL B 1 132 ? 36.743 24.903  -23.314 1.00 20.95 ? 139 VAL B O   1 
ATOM   4575 C CB  . VAL B 1 132 ? 36.615 27.725  -24.177 1.00 23.60 ? 139 VAL B CB  1 
ATOM   4576 C CG1 . VAL B 1 132 ? 36.554 27.357  -25.658 1.00 19.40 ? 139 VAL B CG1 1 
ATOM   4577 C CG2 . VAL B 1 132 ? 36.427 29.222  -24.023 1.00 19.38 ? 139 VAL B CG2 1 
ATOM   4578 N N   . ASP B 1 133 ? 34.654 24.806  -24.148 1.00 18.06 ? 140 ASP B N   1 
ATOM   4579 C CA  . ASP B 1 133 ? 34.707 23.369  -24.421 1.00 20.85 ? 140 ASP B CA  1 
ATOM   4580 C C   . ASP B 1 133 ? 35.370 23.100  -25.765 1.00 23.26 ? 140 ASP B C   1 
ATOM   4581 O O   . ASP B 1 133 ? 34.916 23.619  -26.786 1.00 20.33 ? 140 ASP B O   1 
ATOM   4582 C CB  . ASP B 1 133 ? 33.296 22.781  -24.455 1.00 18.95 ? 140 ASP B CB  1 
ATOM   4583 C CG  . ASP B 1 133 ? 32.701 22.621  -23.079 1.00 19.44 ? 140 ASP B CG  1 
ATOM   4584 O OD1 . ASP B 1 133 ? 33.194 23.282  -22.143 1.00 20.90 ? 140 ASP B OD1 1 
ATOM   4585 O OD2 . ASP B 1 133 ? 31.737 21.842  -22.935 1.00 17.67 ? 140 ASP B OD2 1 
ATOM   4586 N N   . ILE B 1 134 ? 36.425 22.282  -25.764 1.00 21.38 ? 141 ILE B N   1 
ATOM   4587 C CA  . ILE B 1 134 ? 37.134 21.943  -26.994 1.00 23.32 ? 141 ILE B CA  1 
ATOM   4588 C C   . ILE B 1 134 ? 36.520 20.689  -27.620 1.00 24.92 ? 141 ILE B C   1 
ATOM   4589 O O   . ILE B 1 134 ? 36.899 19.556  -27.305 1.00 26.03 ? 141 ILE B O   1 
ATOM   4590 C CB  . ILE B 1 134 ? 38.629 21.717  -26.724 1.00 22.84 ? 141 ILE B CB  1 
ATOM   4591 C CG1 . ILE B 1 134 ? 39.212 22.952  -26.027 1.00 25.06 ? 141 ILE B CG1 1 
ATOM   4592 C CG2 . ILE B 1 134 ? 39.361 21.477  -28.043 1.00 26.07 ? 141 ILE B CG2 1 
ATOM   4593 C CD1 . ILE B 1 134 ? 40.668 22.821  -25.628 1.00 25.51 ? 141 ILE B CD1 1 
ATOM   4594 N N   . THR B 1 135 ? 35.576 20.904  -28.527 1.00 24.79 ? 142 THR B N   1 
ATOM   4595 C CA  . THR B 1 135 ? 34.874 19.803  -29.173 1.00 23.47 ? 142 THR B CA  1 
ATOM   4596 C C   . THR B 1 135 ? 35.667 18.980  -30.204 1.00 23.14 ? 142 THR B C   1 
ATOM   4597 O O   . THR B 1 135 ? 35.217 17.916  -30.631 1.00 26.71 ? 142 THR B O   1 
ATOM   4598 C CB  . THR B 1 135 ? 33.549 20.324  -29.770 1.00 22.47 ? 142 THR B CB  1 
ATOM   4599 O OG1 . THR B 1 135 ? 33.809 21.424  -30.641 1.00 23.96 ? 142 THR B OG1 1 
ATOM   4600 C CG2 . THR B 1 135 ? 32.641 20.820  -28.655 1.00 19.99 ? 142 THR B CG2 1 
ATOM   4601 N N   . SER B 1 136 ? 36.846 19.460  -30.584 1.00 24.86 ? 143 SER B N   1 
ATOM   4602 C CA  . SER B 1 136 ? 37.718 18.749  -31.518 1.00 23.98 ? 143 SER B CA  1 
ATOM   4603 C C   . SER B 1 136 ? 39.049 19.492  -31.615 1.00 24.35 ? 143 SER B C   1 
ATOM   4604 O O   . SER B 1 136 ? 39.084 20.721  -31.520 1.00 27.31 ? 143 SER B O   1 
ATOM   4605 C CB  . SER B 1 136 ? 37.073 18.641  -32.907 1.00 25.14 ? 143 SER B CB  1 
ATOM   4606 O OG  . SER B 1 136 ? 37.164 19.859  -33.627 1.00 25.51 ? 143 SER B OG  1 
ATOM   4607 N N   . TRP B 1 137 ? 40.143 18.749  -31.787 1.00 27.38 ? 144 TRP B N   1 
ATOM   4608 C CA  . TRP B 1 137 ? 41.471 19.350  -31.895 1.00 28.72 ? 144 TRP B CA  1 
ATOM   4609 C C   . TRP B 1 137 ? 41.771 19.625  -33.371 1.00 31.61 ? 144 TRP B C   1 
ATOM   4610 O O   . TRP B 1 137 ? 42.625 18.967  -33.962 1.00 29.40 ? 144 TRP B O   1 
ATOM   4611 C CB  . TRP B 1 137 ? 42.544 18.403  -31.314 1.00 31.05 ? 144 TRP B CB  1 
ATOM   4612 C CG  . TRP B 1 137 ? 43.707 19.128  -30.654 1.00 32.81 ? 144 TRP B CG  1 
ATOM   4613 C CD1 . TRP B 1 137 ? 45.020 19.144  -31.051 1.00 33.95 ? 144 TRP B CD1 1 
ATOM   4614 C CD2 . TRP B 1 137 ? 43.622 20.004  -29.531 1.00 34.09 ? 144 TRP B CD2 1 
ATOM   4615 N NE1 . TRP B 1 137 ? 45.752 19.985  -30.239 1.00 34.81 ? 144 TRP B NE1 1 
ATOM   4616 C CE2 . TRP B 1 137 ? 44.916 20.519  -29.288 1.00 35.00 ? 144 TRP B CE2 1 
ATOM   4617 C CE3 . TRP B 1 137 ? 42.573 20.390  -28.687 1.00 37.36 ? 144 TRP B CE3 1 
ATOM   4618 C CZ2 . TRP B 1 137 ? 45.185 21.427  -28.259 1.00 31.80 ? 144 TRP B CZ2 1 
ATOM   4619 C CZ3 . TRP B 1 137 ? 42.837 21.286  -27.668 1.00 42.03 ? 144 TRP B CZ3 1 
ATOM   4620 C CH2 . TRP B 1 137 ? 44.138 21.788  -27.455 1.00 38.40 ? 144 TRP B CH2 1 
ATOM   4621 N N   . TYR B 1 138 ? 41.055 20.582  -33.963 1.00 33.55 ? 145 TYR B N   1 
ATOM   4622 C CA  . TYR B 1 138 ? 41.247 20.942  -35.374 1.00 35.86 ? 145 TYR B CA  1 
ATOM   4623 C C   . TYR B 1 138 ? 42.513 21.776  -35.531 1.00 35.69 ? 145 TYR B C   1 
ATOM   4624 O O   . TYR B 1 138 ? 42.897 22.499  -34.611 1.00 33.90 ? 145 TYR B O   1 
ATOM   4625 C CB  . TYR B 1 138 ? 40.037 21.738  -35.890 1.00 34.25 ? 145 TYR B CB  1 
ATOM   4626 C CG  . TYR B 1 138 ? 39.799 23.065  -35.186 1.00 29.21 ? 145 TYR B CG  1 
ATOM   4627 C CD1 . TYR B 1 138 ? 40.485 24.217  -35.572 1.00 28.00 ? 145 TYR B CD1 1 
ATOM   4628 C CD2 . TYR B 1 138 ? 38.887 23.163  -34.129 1.00 29.77 ? 145 TYR B CD2 1 
ATOM   4629 C CE1 . TYR B 1 138 ? 40.269 25.439  -34.926 1.00 26.97 ? 145 TYR B CE1 1 
ATOM   4630 C CE2 . TYR B 1 138 ? 38.664 24.380  -33.474 1.00 28.76 ? 145 TYR B CE2 1 
ATOM   4631 C CZ  . TYR B 1 138 ? 39.362 25.515  -33.882 1.00 29.07 ? 145 TYR B CZ  1 
ATOM   4632 O OH  . TYR B 1 138 ? 39.154 26.729  -33.252 1.00 31.07 ? 145 TYR B OH  1 
ATOM   4633 N N   . ASP B 1 139 ? 43.159 21.700  -36.693 1.00 38.60 ? 146 ASP B N   1 
ATOM   4634 C CA  . ASP B 1 139 ? 44.386 22.467  -36.876 1.00 39.82 ? 146 ASP B CA  1 
ATOM   4635 C C   . ASP B 1 139 ? 44.131 23.964  -36.755 1.00 37.37 ? 146 ASP B C   1 
ATOM   4636 O O   . ASP B 1 139 ? 43.249 24.515  -37.421 1.00 36.00 ? 146 ASP B O   1 
ATOM   4637 C CB  . ASP B 1 139 ? 45.033 22.175  -38.228 1.00 46.96 ? 146 ASP B CB  1 
ATOM   4638 C CG  . ASP B 1 139 ? 46.483 22.629  -38.269 1.00 53.47 ? 146 ASP B CG  1 
ATOM   4639 O OD1 . ASP B 1 139 ? 47.330 21.981  -37.596 1.00 57.05 ? 146 ASP B OD1 1 
ATOM   4640 O OD2 . ASP B 1 139 ? 46.775 23.644  -38.946 1.00 56.68 ? 146 ASP B OD2 1 
ATOM   4641 N N   . GLY B 1 140 ? 44.912 24.617  -35.901 1.00 35.65 ? 147 GLY B N   1 
ATOM   4642 C CA  . GLY B 1 140 ? 44.767 26.045  -35.685 1.00 32.43 ? 147 GLY B CA  1 
ATOM   4643 C C   . GLY B 1 140 ? 44.080 26.308  -34.356 1.00 31.08 ? 147 GLY B C   1 
ATOM   4644 O O   . GLY B 1 140 ? 43.878 27.456  -33.968 1.00 30.39 ? 147 GLY B O   1 
ATOM   4645 N N   . VAL B 1 141 ? 43.716 25.241  -33.651 1.00 29.15 ? 148 VAL B N   1 
ATOM   4646 C CA  . VAL B 1 141 ? 43.038 25.395  -32.370 1.00 29.16 ? 148 VAL B CA  1 
ATOM   4647 C C   . VAL B 1 141 ? 43.991 26.000  -31.347 1.00 28.33 ? 148 VAL B C   1 
ATOM   4648 O O   . VAL B 1 141 ? 43.579 26.782  -30.493 1.00 28.69 ? 148 VAL B O   1 
ATOM   4649 C CB  . VAL B 1 141 ? 42.477 24.031  -31.846 1.00 30.38 ? 148 VAL B CB  1 
ATOM   4650 C CG1 . VAL B 1 141 ? 43.614 23.092  -31.464 1.00 28.56 ? 148 VAL B CG1 1 
ATOM   4651 C CG2 . VAL B 1 141 ? 41.556 24.268  -30.650 1.00 31.16 ? 148 VAL B CG2 1 
ATOM   4652 N N   . ARG B 1 142 ? 45.272 25.657  -31.449 1.00 30.40 ? 149 ARG B N   1 
ATOM   4653 C CA  . ARG B 1 142 ? 46.274 26.176  -30.523 1.00 32.77 ? 149 ARG B CA  1 
ATOM   4654 C C   . ARG B 1 142 ? 46.275 27.701  -30.509 1.00 31.06 ? 149 ARG B C   1 
ATOM   4655 O O   . ARG B 1 142 ? 46.199 28.333  -29.449 1.00 28.10 ? 149 ARG B O   1 
ATOM   4656 C CB  . ARG B 1 142 ? 47.672 25.703  -30.922 1.00 34.83 ? 149 ARG B CB  1 
ATOM   4657 C CG  . ARG B 1 142 ? 47.935 24.232  -30.761 1.00 36.49 ? 149 ARG B CG  1 
ATOM   4658 C CD  . ARG B 1 142 ? 49.266 23.897  -31.408 1.00 38.87 ? 149 ARG B CD  1 
ATOM   4659 N NE  . ARG B 1 142 ? 49.720 22.564  -31.043 1.00 41.18 ? 149 ARG B NE  1 
ATOM   4660 C CZ  . ARG B 1 142 ? 50.641 22.323  -30.115 1.00 46.00 ? 149 ARG B CZ  1 
ATOM   4661 N NH1 . ARG B 1 142 ? 51.211 23.329  -29.465 1.00 47.28 ? 149 ARG B NH1 1 
ATOM   4662 N NH2 . ARG B 1 142 ? 50.992 21.073  -29.832 1.00 50.67 ? 149 ARG B NH2 1 
ATOM   4663 N N   . GLU B 1 143 ? 46.381 28.283  -31.697 1.00 28.55 ? 150 GLU B N   1 
ATOM   4664 C CA  . GLU B 1 143 ? 46.407 29.727  -31.836 1.00 30.31 ? 150 GLU B CA  1 
ATOM   4665 C C   . GLU B 1 143 ? 45.220 30.396  -31.152 1.00 27.66 ? 150 GLU B C   1 
ATOM   4666 O O   . GLU B 1 143 ? 45.388 31.373  -30.418 1.00 25.60 ? 150 GLU B O   1 
ATOM   4667 C CB  . GLU B 1 143 ? 46.436 30.108  -33.322 1.00 35.35 ? 150 GLU B CB  1 
ATOM   4668 C CG  . GLU B 1 143 ? 47.773 29.877  -34.034 1.00 43.87 ? 150 GLU B CG  1 
ATOM   4669 C CD  . GLU B 1 143 ? 48.212 28.411  -34.083 1.00 50.80 ? 150 GLU B CD  1 
ATOM   4670 O OE1 . GLU B 1 143 ? 47.341 27.513  -34.218 1.00 51.15 ? 150 GLU B OE1 1 
ATOM   4671 O OE2 . GLU B 1 143 ? 49.445 28.161  -34.006 1.00 55.90 ? 150 GLU B OE2 1 
ATOM   4672 N N   . GLU B 1 144 ? 44.020 29.874  -31.389 1.00 27.84 ? 151 GLU B N   1 
ATOM   4673 C CA  . GLU B 1 144 ? 42.819 30.448  -30.792 1.00 28.81 ? 151 GLU B CA  1 
ATOM   4674 C C   . GLU B 1 144 ? 42.830 30.295  -29.272 1.00 28.11 ? 151 GLU B C   1 
ATOM   4675 O O   . GLU B 1 144 ? 42.395 31.191  -28.544 1.00 30.47 ? 151 GLU B O   1 
ATOM   4676 C CB  . GLU B 1 144 ? 41.564 29.806  -31.400 1.00 27.96 ? 151 GLU B CB  1 
ATOM   4677 C CG  . GLU B 1 144 ? 41.397 30.126  -32.885 1.00 33.05 ? 151 GLU B CG  1 
ATOM   4678 C CD  . GLU B 1 144 ? 39.995 29.854  -33.419 1.00 34.28 ? 151 GLU B CD  1 
ATOM   4679 O OE1 . GLU B 1 144 ? 39.033 30.503  -32.950 1.00 32.21 ? 151 GLU B OE1 1 
ATOM   4680 O OE2 . GLU B 1 144 ? 39.857 28.991  -34.317 1.00 38.14 ? 151 GLU B OE2 1 
ATOM   4681 N N   . LEU B 1 145 ? 43.340 29.166  -28.795 1.00 26.76 ? 152 LEU B N   1 
ATOM   4682 C CA  . LEU B 1 145 ? 43.423 28.926  -27.356 1.00 26.93 ? 152 LEU B CA  1 
ATOM   4683 C C   . LEU B 1 145 ? 44.314 29.968  -26.700 1.00 24.61 ? 152 LEU B C   1 
ATOM   4684 O O   . LEU B 1 145 ? 43.968 30.530  -25.664 1.00 29.44 ? 152 LEU B O   1 
ATOM   4685 C CB  . LEU B 1 145 ? 43.968 27.518  -27.083 1.00 22.01 ? 152 LEU B CB  1 
ATOM   4686 C CG  . LEU B 1 145 ? 42.968 26.406  -27.411 1.00 19.94 ? 152 LEU B CG  1 
ATOM   4687 C CD1 . LEU B 1 145 ? 43.654 25.067  -27.383 1.00 22.06 ? 152 LEU B CD1 1 
ATOM   4688 C CD2 . LEU B 1 145 ? 41.814 26.447  -26.425 1.00 16.11 ? 152 LEU B CD2 1 
ATOM   4689 N N   . GLU B 1 146 ? 45.463 30.234  -27.307 1.00 27.41 ? 153 GLU B N   1 
ATOM   4690 C CA  . GLU B 1 146 ? 46.385 31.223  -26.765 1.00 26.24 ? 153 GLU B CA  1 
ATOM   4691 C C   . GLU B 1 146 ? 45.719 32.576  -26.612 1.00 25.89 ? 153 GLU B C   1 
ATOM   4692 O O   . GLU B 1 146 ? 45.957 33.275  -25.632 1.00 25.17 ? 153 GLU B O   1 
ATOM   4693 C CB  . GLU B 1 146 ? 47.606 31.367  -27.670 1.00 28.61 ? 153 GLU B CB  1 
ATOM   4694 C CG  . GLU B 1 146 ? 48.455 30.126  -27.736 1.00 38.16 ? 153 GLU B CG  1 
ATOM   4695 C CD  . GLU B 1 146 ? 49.691 30.320  -28.586 1.00 42.84 ? 153 GLU B CD  1 
ATOM   4696 O OE1 . GLU B 1 146 ? 49.549 30.609  -29.798 1.00 41.80 ? 153 GLU B OE1 1 
ATOM   4697 O OE2 . GLU B 1 146 ? 50.809 30.185  -28.040 1.00 51.78 ? 153 GLU B OE2 1 
ATOM   4698 N N   . VAL B 1 147 ? 44.888 32.951  -27.582 1.00 27.81 ? 154 VAL B N   1 
ATOM   4699 C CA  . VAL B 1 147 ? 44.193 34.237  -27.537 1.00 26.60 ? 154 VAL B CA  1 
ATOM   4700 C C   . VAL B 1 147 ? 43.133 34.273  -26.435 1.00 28.13 ? 154 VAL B C   1 
ATOM   4701 O O   . VAL B 1 147 ? 43.021 35.254  -25.695 1.00 28.24 ? 154 VAL B O   1 
ATOM   4702 C CB  . VAL B 1 147 ? 43.514 34.556  -28.895 1.00 28.44 ? 154 VAL B CB  1 
ATOM   4703 C CG1 . VAL B 1 147 ? 42.650 35.816  -28.770 1.00 27.97 ? 154 VAL B CG1 1 
ATOM   4704 C CG2 . VAL B 1 147 ? 44.582 34.762  -29.968 1.00 24.62 ? 154 VAL B CG2 1 
ATOM   4705 N N   . LEU B 1 148 ? 42.355 33.204  -26.332 1.00 25.09 ? 155 LEU B N   1 
ATOM   4706 C CA  . LEU B 1 148 ? 41.321 33.127  -25.307 1.00 26.61 ? 155 LEU B CA  1 
ATOM   4707 C C   . LEU B 1 148 ? 41.919 33.321  -23.907 1.00 25.02 ? 155 LEU B C   1 
ATOM   4708 O O   . LEU B 1 148 ? 41.362 34.044  -23.081 1.00 25.09 ? 155 LEU B O   1 
ATOM   4709 C CB  . LEU B 1 148 ? 40.602 31.778  -25.404 1.00 19.32 ? 155 LEU B CB  1 
ATOM   4710 C CG  . LEU B 1 148 ? 39.629 31.681  -26.576 1.00 19.57 ? 155 LEU B CG  1 
ATOM   4711 C CD1 . LEU B 1 148 ? 39.350 30.241  -26.904 1.00 17.80 ? 155 LEU B CD1 1 
ATOM   4712 C CD2 . LEU B 1 148 ? 38.341 32.424  -26.226 1.00 22.08 ? 155 LEU B CD2 1 
ATOM   4713 N N   . VAL B 1 149 ? 43.067 32.685  -23.669 1.00 26.49 ? 156 VAL B N   1 
ATOM   4714 C CA  . VAL B 1 149 ? 43.770 32.757  -22.390 1.00 25.47 ? 156 VAL B CA  1 
ATOM   4715 C C   . VAL B 1 149 ? 44.446 34.095  -22.096 1.00 27.31 ? 156 VAL B C   1 
ATOM   4716 O O   . VAL B 1 149 ? 44.247 34.677  -21.033 1.00 24.71 ? 156 VAL B O   1 
ATOM   4717 C CB  . VAL B 1 149 ? 44.858 31.644  -22.283 1.00 26.59 ? 156 VAL B CB  1 
ATOM   4718 C CG1 . VAL B 1 149 ? 45.827 31.948  -21.129 1.00 23.59 ? 156 VAL B CG1 1 
ATOM   4719 C CG2 . VAL B 1 149 ? 44.198 30.285  -22.046 1.00 21.66 ? 156 VAL B CG2 1 
ATOM   4720 N N   . GLN B 1 150 ? 45.251 34.579  -23.033 1.00 29.41 ? 157 GLN B N   1 
ATOM   4721 C CA  . GLN B 1 150 ? 45.970 35.830  -22.833 1.00 32.25 ? 157 GLN B CA  1 
ATOM   4722 C C   . GLN B 1 150 ? 45.133 37.089  -23.027 1.00 33.34 ? 157 GLN B C   1 
ATOM   4723 O O   . GLN B 1 150 ? 45.269 38.052  -22.268 1.00 32.26 ? 157 GLN B O   1 
ATOM   4724 C CB  . GLN B 1 150 ? 47.178 35.895  -23.767 1.00 36.14 ? 157 GLN B CB  1 
ATOM   4725 C CG  . GLN B 1 150 ? 47.945 37.212  -23.667 1.00 44.31 ? 157 GLN B CG  1 
ATOM   4726 C CD  . GLN B 1 150 ? 48.723 37.524  -24.930 1.00 51.77 ? 157 GLN B CD  1 
ATOM   4727 O OE1 . GLN B 1 150 ? 49.703 36.838  -25.264 1.00 52.22 ? 157 GLN B OE1 1 
ATOM   4728 N NE2 . GLN B 1 150 ? 48.282 38.560  -25.657 1.00 51.47 ? 157 GLN B NE2 1 
ATOM   4729 N N   . ASP B 1 151 ? 44.270 37.084  -24.038 1.00 32.20 ? 158 ASP B N   1 
ATOM   4730 C CA  . ASP B 1 151 ? 43.438 38.248  -24.334 1.00 34.39 ? 158 ASP B CA  1 
ATOM   4731 C C   . ASP B 1 151 ? 42.006 38.259  -23.799 1.00 34.12 ? 158 ASP B C   1 
ATOM   4732 O O   . ASP B 1 151 ? 41.543 39.286  -23.313 1.00 37.37 ? 158 ASP B O   1 
ATOM   4733 C CB  . ASP B 1 151 ? 43.371 38.472  -25.849 1.00 36.69 ? 158 ASP B CB  1 
ATOM   4734 C CG  . ASP B 1 151 ? 44.733 38.708  -26.463 1.00 39.92 ? 158 ASP B CG  1 
ATOM   4735 O OD1 . ASP B 1 151 ? 45.537 39.425  -25.835 1.00 43.89 ? 158 ASP B OD1 1 
ATOM   4736 O OD2 . ASP B 1 151 ? 45.000 38.192  -27.572 1.00 41.67 ? 158 ASP B OD2 1 
ATOM   4737 N N   . LYS B 1 152 ? 41.297 37.141  -23.895 1.00 29.96 ? 159 LYS B N   1 
ATOM   4738 C CA  . LYS B 1 152 ? 39.899 37.112  -23.461 1.00 28.01 ? 159 LYS B CA  1 
ATOM   4739 C C   . LYS B 1 152 ? 39.637 36.788  -21.995 1.00 28.10 ? 159 LYS B C   1 
ATOM   4740 O O   . LYS B 1 152 ? 38.506 36.905  -21.528 1.00 26.81 ? 159 LYS B O   1 
ATOM   4741 C CB  . LYS B 1 152 ? 39.115 36.143  -24.339 1.00 26.89 ? 159 LYS B CB  1 
ATOM   4742 C CG  . LYS B 1 152 ? 39.309 36.377  -25.831 1.00 31.96 ? 159 LYS B CG  1 
ATOM   4743 C CD  . LYS B 1 152 ? 38.829 37.767  -26.234 1.00 36.31 ? 159 LYS B CD  1 
ATOM   4744 C CE  . LYS B 1 152 ? 38.934 37.969  -27.744 1.00 40.59 ? 159 LYS B CE  1 
ATOM   4745 N NZ  . LYS B 1 152 ? 38.317 39.267  -28.167 1.00 43.27 ? 159 LYS B NZ  1 
ATOM   4746 N N   . GLY B 1 153 ? 40.670 36.373  -21.271 1.00 26.16 ? 160 GLY B N   1 
ATOM   4747 C CA  . GLY B 1 153 ? 40.489 36.054  -19.865 1.00 26.31 ? 160 GLY B CA  1 
ATOM   4748 C C   . GLY B 1 153 ? 39.805 34.728  -19.567 1.00 27.04 ? 160 GLY B C   1 
ATOM   4749 O O   . GLY B 1 153 ? 39.059 34.622  -18.592 1.00 29.91 ? 160 GLY B O   1 
ATOM   4750 N N   . VAL B 1 154 ? 40.046 33.720  -20.400 1.00 22.02 ? 161 VAL B N   1 
ATOM   4751 C CA  . VAL B 1 154 ? 39.468 32.394  -20.199 1.00 23.41 ? 161 VAL B CA  1 
ATOM   4752 C C   . VAL B 1 154 ? 40.606 31.493  -19.749 1.00 23.30 ? 161 VAL B C   1 
ATOM   4753 O O   . VAL B 1 154 ? 41.567 31.310  -20.491 1.00 24.22 ? 161 VAL B O   1 
ATOM   4754 C CB  . VAL B 1 154 ? 38.891 31.817  -21.509 1.00 21.08 ? 161 VAL B CB  1 
ATOM   4755 C CG1 . VAL B 1 154 ? 38.338 30.431  -21.268 1.00 19.86 ? 161 VAL B CG1 1 
ATOM   4756 C CG2 . VAL B 1 154 ? 37.816 32.742  -22.051 1.00 20.76 ? 161 VAL B CG2 1 
ATOM   4757 N N   . ASN B 1 155 ? 40.513 30.944  -18.539 1.00 21.68 ? 162 ASN B N   1 
ATOM   4758 C CA  . ASN B 1 155 ? 41.577 30.074  -18.040 1.00 20.23 ? 162 ASN B CA  1 
ATOM   4759 C C   . ASN B 1 155 ? 41.160 28.620  -17.834 1.00 22.35 ? 162 ASN B C   1 
ATOM   4760 O O   . ASN B 1 155 ? 41.915 27.827  -17.259 1.00 19.16 ? 162 ASN B O   1 
ATOM   4761 C CB  . ASN B 1 155 ? 42.170 30.637  -16.736 1.00 21.49 ? 162 ASN B CB  1 
ATOM   4762 C CG  . ASN B 1 155 ? 41.240 30.483  -15.537 1.00 17.41 ? 162 ASN B CG  1 
ATOM   4763 O OD1 . ASN B 1 155 ? 40.142 29.946  -15.648 1.00 17.92 ? 162 ASN B OD1 1 
ATOM   4764 N ND2 . ASN B 1 155 ? 41.690 30.960  -14.380 1.00 13.41 ? 162 ASN B ND2 1 
ATOM   4765 N N   . SER B 1 156 ? 39.968 28.260  -18.304 1.00 18.87 ? 163 SER B N   1 
ATOM   4766 C CA  . SER B 1 156 ? 39.500 26.883  -18.154 1.00 18.61 ? 163 SER B CA  1 
ATOM   4767 C C   . SER B 1 156 ? 38.917 26.315  -19.442 1.00 18.60 ? 163 SER B C   1 
ATOM   4768 O O   . SER B 1 156 ? 38.115 26.959  -20.126 1.00 17.84 ? 163 SER B O   1 
ATOM   4769 C CB  . SER B 1 156 ? 38.479 26.781  -17.015 1.00 20.48 ? 163 SER B CB  1 
ATOM   4770 O OG  . SER B 1 156 ? 37.460 27.758  -17.133 1.00 23.33 ? 163 SER B OG  1 
ATOM   4771 N N   . PHE B 1 157 ? 39.336 25.099  -19.774 1.00 17.34 ? 164 PHE B N   1 
ATOM   4772 C CA  . PHE B 1 157 ? 38.879 24.446  -20.996 1.00 17.60 ? 164 PHE B CA  1 
ATOM   4773 C C   . PHE B 1 157 ? 38.543 22.988  -20.729 1.00 17.63 ? 164 PHE B C   1 
ATOM   4774 O O   . PHE B 1 157 ? 39.230 22.322  -19.953 1.00 16.41 ? 164 PHE B O   1 
ATOM   4775 C CB  . PHE B 1 157 ? 39.958 24.556  -22.073 1.00 16.26 ? 164 PHE B CB  1 
ATOM   4776 C CG  . PHE B 1 157 ? 40.445 25.957  -22.283 1.00 17.62 ? 164 PHE B CG  1 
ATOM   4777 C CD1 . PHE B 1 157 ? 41.338 26.538  -21.389 1.00 19.04 ? 164 PHE B CD1 1 
ATOM   4778 C CD2 . PHE B 1 157 ? 39.951 26.727  -23.335 1.00 22.78 ? 164 PHE B CD2 1 
ATOM   4779 C CE1 . PHE B 1 157 ? 41.734 27.871  -21.539 1.00 21.32 ? 164 PHE B CE1 1 
ATOM   4780 C CE2 . PHE B 1 157 ? 40.340 28.061  -23.492 1.00 24.12 ? 164 PHE B CE2 1 
ATOM   4781 C CZ  . PHE B 1 157 ? 41.231 28.634  -22.592 1.00 23.79 ? 164 PHE B CZ  1 
ATOM   4782 N N   . GLN B 1 158 ? 37.483 22.498  -21.370 1.00 15.33 ? 165 GLN B N   1 
ATOM   4783 C CA  . GLN B 1 158 ? 37.061 21.119  -21.181 1.00 14.77 ? 165 GLN B CA  1 
ATOM   4784 C C   . GLN B 1 158 ? 37.243 20.271  -22.431 1.00 19.87 ? 165 GLN B C   1 
ATOM   4785 O O   . GLN B 1 158 ? 36.987 20.733  -23.548 1.00 18.71 ? 165 GLN B O   1 
ATOM   4786 C CB  . GLN B 1 158 ? 35.594 21.064  -20.754 1.00 15.60 ? 165 GLN B CB  1 
ATOM   4787 C CG  . GLN B 1 158 ? 35.112 19.636  -20.524 1.00 21.13 ? 165 GLN B CG  1 
ATOM   4788 C CD  . GLN B 1 158 ? 33.636 19.546  -20.200 1.00 22.28 ? 165 GLN B CD  1 
ATOM   4789 O OE1 . GLN B 1 158 ? 33.185 20.027  -19.157 1.00 19.89 ? 165 GLN B OE1 1 
ATOM   4790 N NE2 . GLN B 1 158 ? 32.869 18.929  -21.102 1.00 18.68 ? 165 GLN B NE2 1 
ATOM   4791 N N   . VAL B 1 159 ? 37.696 19.032  -22.236 1.00 19.14 ? 166 VAL B N   1 
ATOM   4792 C CA  . VAL B 1 159 ? 37.884 18.087  -23.336 1.00 18.74 ? 166 VAL B CA  1 
ATOM   4793 C C   . VAL B 1 159 ? 37.004 16.857  -23.085 1.00 18.56 ? 166 VAL B C   1 
ATOM   4794 O O   . VAL B 1 159 ? 36.767 16.491  -21.926 1.00 16.94 ? 166 VAL B O   1 
ATOM   4795 C CB  . VAL B 1 159 ? 39.363 17.656  -23.455 1.00 20.34 ? 166 VAL B CB  1 
ATOM   4796 C CG1 . VAL B 1 159 ? 40.217 18.859  -23.797 1.00 21.88 ? 166 VAL B CG1 1 
ATOM   4797 C CG2 . VAL B 1 159 ? 39.837 17.019  -22.158 1.00 19.07 ? 166 VAL B CG2 1 
ATOM   4798 N N   . TYR B 1 160 ? 36.526 16.219  -24.152 1.00 12.21 ? 167 TYR B N   1 
ATOM   4799 C CA  . TYR B 1 160 ? 35.658 15.046  -24.005 1.00 20.38 ? 167 TYR B CA  1 
ATOM   4800 C C   . TYR B 1 160 ? 36.305 13.700  -24.292 1.00 19.00 ? 167 TYR B C   1 
ATOM   4801 O O   . TYR B 1 160 ? 37.127 13.568  -25.196 1.00 20.76 ? 167 TYR B O   1 
ATOM   4802 C CB  . TYR B 1 160 ? 34.428 15.151  -24.913 1.00 18.45 ? 167 TYR B CB  1 
ATOM   4803 C CG  . TYR B 1 160 ? 33.570 16.359  -24.676 1.00 20.15 ? 167 TYR B CG  1 
ATOM   4804 C CD1 . TYR B 1 160 ? 33.925 17.603  -25.195 1.00 19.99 ? 167 TYR B CD1 1 
ATOM   4805 C CD2 . TYR B 1 160 ? 32.390 16.263  -23.940 1.00 20.81 ? 167 TYR B CD2 1 
ATOM   4806 C CE1 . TYR B 1 160 ? 33.121 18.720  -24.989 1.00 22.21 ? 167 TYR B CE1 1 
ATOM   4807 C CE2 . TYR B 1 160 ? 31.581 17.370  -23.731 1.00 20.45 ? 167 TYR B CE2 1 
ATOM   4808 C CZ  . TYR B 1 160 ? 31.951 18.596  -24.258 1.00 21.74 ? 167 TYR B CZ  1 
ATOM   4809 O OH  . TYR B 1 160 ? 31.143 19.695  -24.065 1.00 22.71 ? 167 TYR B OH  1 
ATOM   4810 N N   . MET B 1 161 ? 35.895 12.692  -23.532 1.00 21.27 ? 168 MET B N   1 
ATOM   4811 C CA  . MET B 1 161 ? 36.403 11.342  -23.717 1.00 20.99 ? 168 MET B CA  1 
ATOM   4812 C C   . MET B 1 161 ? 35.265 10.477  -24.259 1.00 24.30 ? 168 MET B C   1 
ATOM   4813 O O   . MET B 1 161 ? 35.479 9.345   -24.705 1.00 24.12 ? 168 MET B O   1 
ATOM   4814 C CB  . MET B 1 161 ? 36.945 10.778  -22.392 1.00 19.58 ? 168 MET B CB  1 
ATOM   4815 C CG  . MET B 1 161 ? 38.238 11.452  -21.919 1.00 19.31 ? 168 MET B CG  1 
ATOM   4816 S SD  . MET B 1 161 ? 38.869 10.908  -20.303 1.00 10.99 ? 168 MET B SD  1 
ATOM   4817 C CE  . MET B 1 161 ? 39.462 9.309   -20.700 1.00 15.53 ? 168 MET B CE  1 
ATOM   4818 N N   . ALA B 1 162 ? 34.047 11.010  -24.221 1.00 20.83 ? 169 ALA B N   1 
ATOM   4819 C CA  . ALA B 1 162 ? 32.899 10.272  -24.742 1.00 23.97 ? 169 ALA B CA  1 
ATOM   4820 C C   . ALA B 1 162 ? 32.400 10.959  -26.017 1.00 21.90 ? 169 ALA B C   1 
ATOM   4821 O O   . ALA B 1 162 ? 33.017 11.913  -26.494 1.00 20.70 ? 169 ALA B O   1 
ATOM   4822 C CB  . ALA B 1 162 ? 31.780 10.209  -23.695 1.00 22.80 ? 169 ALA B CB  1 
ATOM   4823 N N   . TYR B 1 163 ? 31.282 10.476  -26.554 1.00 22.21 ? 170 TYR B N   1 
ATOM   4824 C CA  . TYR B 1 163 ? 30.697 11.041  -27.766 1.00 24.51 ? 170 TYR B CA  1 
ATOM   4825 C C   . TYR B 1 163 ? 31.521 10.731  -29.007 1.00 21.99 ? 170 TYR B C   1 
ATOM   4826 O O   . TYR B 1 163 ? 31.961 11.633  -29.723 1.00 24.81 ? 170 TYR B O   1 
ATOM   4827 C CB  . TYR B 1 163 ? 30.526 12.550  -27.598 1.00 23.23 ? 170 TYR B CB  1 
ATOM   4828 C CG  . TYR B 1 163 ? 29.676 12.877  -26.398 1.00 26.75 ? 170 TYR B CG  1 
ATOM   4829 C CD1 . TYR B 1 163 ? 28.336 12.504  -26.360 1.00 26.38 ? 170 TYR B CD1 1 
ATOM   4830 C CD2 . TYR B 1 163 ? 30.221 13.504  -25.275 1.00 23.87 ? 170 TYR B CD2 1 
ATOM   4831 C CE1 . TYR B 1 163 ? 27.559 12.736  -25.244 1.00 25.29 ? 170 TYR B CE1 1 
ATOM   4832 C CE2 . TYR B 1 163 ? 29.447 13.744  -24.145 1.00 21.73 ? 170 TYR B CE2 1 
ATOM   4833 C CZ  . TYR B 1 163 ? 28.117 13.353  -24.141 1.00 27.63 ? 170 TYR B CZ  1 
ATOM   4834 O OH  . TYR B 1 163 ? 27.335 13.559  -23.039 1.00 24.15 ? 170 TYR B OH  1 
ATOM   4835 N N   . LYS B 1 164 ? 31.724 9.440   -29.244 1.00 25.79 ? 171 LYS B N   1 
ATOM   4836 C CA  . LYS B 1 164 ? 32.488 8.956   -30.388 1.00 26.61 ? 171 LYS B CA  1 
ATOM   4837 C C   . LYS B 1 164 ? 31.999 9.575   -31.693 1.00 29.19 ? 171 LYS B C   1 
ATOM   4838 O O   . LYS B 1 164 ? 30.794 9.644   -31.953 1.00 28.71 ? 171 LYS B O   1 
ATOM   4839 C CB  . LYS B 1 164 ? 32.383 7.437   -30.469 1.00 30.27 ? 171 LYS B CB  1 
ATOM   4840 C CG  . LYS B 1 164 ? 33.170 6.809   -31.623 1.00 30.47 ? 171 LYS B CG  1 
ATOM   4841 C CD  . LYS B 1 164 ? 33.063 5.289   -31.557 1.00 34.27 ? 171 LYS B CD  1 
ATOM   4842 C CE  . LYS B 1 164 ? 33.691 4.620   -32.775 1.00 38.01 ? 171 LYS B CE  1 
ATOM   4843 N NZ  . LYS B 1 164 ? 35.093 5.089   -32.984 1.00 34.95 ? 171 LYS B NZ  1 
ATOM   4844 N N   . ASP B 1 165 ? 32.955 10.031  -32.497 1.00 32.04 ? 172 ASP B N   1 
ATOM   4845 C CA  . ASP B 1 165 ? 32.694 10.658  -33.786 1.00 31.82 ? 172 ASP B CA  1 
ATOM   4846 C C   . ASP B 1 165 ? 31.998 12.001  -33.661 1.00 32.85 ? 172 ASP B C   1 
ATOM   4847 O O   . ASP B 1 165 ? 31.613 12.605  -34.661 1.00 33.51 ? 172 ASP B O   1 
ATOM   4848 C CB  . ASP B 1 165 ? 31.881 9.725   -34.678 1.00 33.99 ? 172 ASP B CB  1 
ATOM   4849 C CG  . ASP B 1 165 ? 32.630 8.447   -35.006 1.00 37.29 ? 172 ASP B CG  1 
ATOM   4850 O OD1 . ASP B 1 165 ? 33.852 8.530   -35.267 1.00 35.40 ? 172 ASP B OD1 1 
ATOM   4851 O OD2 . ASP B 1 165 ? 32.005 7.361   -35.010 1.00 44.45 ? 172 ASP B OD2 1 
ATOM   4852 N N   . LEU B 1 166 ? 31.843 12.477  -32.430 1.00 31.41 ? 173 LEU B N   1 
ATOM   4853 C CA  . LEU B 1 166 ? 31.209 13.765  -32.213 1.00 28.36 ? 173 LEU B CA  1 
ATOM   4854 C C   . LEU B 1 166 ? 32.182 14.734  -31.561 1.00 27.26 ? 173 LEU B C   1 
ATOM   4855 O O   . LEU B 1 166 ? 32.637 15.678  -32.205 1.00 28.31 ? 173 LEU B O   1 
ATOM   4856 C CB  . LEU B 1 166 ? 29.959 13.606  -31.353 1.00 27.05 ? 173 LEU B CB  1 
ATOM   4857 C CG  . LEU B 1 166 ? 29.136 14.891  -31.186 1.00 27.61 ? 173 LEU B CG  1 
ATOM   4858 C CD1 . LEU B 1 166 ? 28.938 15.555  -32.546 1.00 28.66 ? 173 LEU B CD1 1 
ATOM   4859 C CD2 . LEU B 1 166 ? 27.786 14.571  -30.558 1.00 23.67 ? 173 LEU B CD2 1 
ATOM   4860 N N   . TYR B 1 167 ? 32.497 14.498  -30.286 1.00 26.06 ? 174 TYR B N   1 
ATOM   4861 C CA  . TYR B 1 167 ? 33.425 15.342  -29.527 1.00 25.79 ? 174 TYR B CA  1 
ATOM   4862 C C   . TYR B 1 167 ? 34.645 14.554  -29.044 1.00 25.51 ? 174 TYR B C   1 
ATOM   4863 O O   . TYR B 1 167 ? 35.678 15.136  -28.696 1.00 21.77 ? 174 TYR B O   1 
ATOM   4864 C CB  . TYR B 1 167 ? 32.765 15.912  -28.268 1.00 27.67 ? 174 TYR B CB  1 
ATOM   4865 C CG  . TYR B 1 167 ? 31.520 16.744  -28.462 1.00 28.95 ? 174 TYR B CG  1 
ATOM   4866 C CD1 . TYR B 1 167 ? 31.361 17.561  -29.579 1.00 29.25 ? 174 TYR B CD1 1 
ATOM   4867 C CD2 . TYR B 1 167 ? 30.525 16.759  -27.483 1.00 31.14 ? 174 TYR B CD2 1 
ATOM   4868 C CE1 . TYR B 1 167 ? 30.241 18.378  -29.716 1.00 33.16 ? 174 TYR B CE1 1 
ATOM   4869 C CE2 . TYR B 1 167 ? 29.408 17.568  -27.601 1.00 30.92 ? 174 TYR B CE2 1 
ATOM   4870 C CZ  . TYR B 1 167 ? 29.268 18.376  -28.721 1.00 33.53 ? 174 TYR B CZ  1 
ATOM   4871 O OH  . TYR B 1 167 ? 28.153 19.170  -28.848 1.00 31.10 ? 174 TYR B OH  1 
ATOM   4872 N N   . GLN B 1 168 ? 34.504 13.235  -29.000 1.00 23.81 ? 175 GLN B N   1 
ATOM   4873 C CA  . GLN B 1 168 ? 35.558 12.346  -28.509 1.00 24.38 ? 175 GLN B CA  1 
ATOM   4874 C C   . GLN B 1 168 ? 36.970 12.562  -29.054 1.00 25.05 ? 175 GLN B C   1 
ATOM   4875 O O   . GLN B 1 168 ? 37.177 12.662  -30.259 1.00 24.50 ? 175 GLN B O   1 
ATOM   4876 C CB  . GLN B 1 168 ? 35.151 10.896  -28.751 1.00 27.47 ? 175 GLN B CB  1 
ATOM   4877 C CG  . GLN B 1 168 ? 36.086 9.885   -28.112 1.00 28.19 ? 175 GLN B CG  1 
ATOM   4878 C CD  . GLN B 1 168 ? 35.538 8.487   -28.191 1.00 33.23 ? 175 GLN B CD  1 
ATOM   4879 O OE1 . GLN B 1 168 ? 34.382 8.245   -27.831 1.00 37.08 ? 175 GLN B OE1 1 
ATOM   4880 N NE2 . GLN B 1 168 ? 36.357 7.549   -28.658 1.00 33.51 ? 175 GLN B NE2 1 
ATOM   4881 N N   . MET B 1 169 ? 37.942 12.630  -28.150 1.00 23.74 ? 176 MET B N   1 
ATOM   4882 C CA  . MET B 1 169 ? 39.352 12.788  -28.529 1.00 25.99 ? 176 MET B CA  1 
ATOM   4883 C C   . MET B 1 169 ? 40.105 11.496  -28.187 1.00 28.17 ? 176 MET B C   1 
ATOM   4884 O O   . MET B 1 169 ? 39.822 10.857  -27.163 1.00 27.26 ? 176 MET B O   1 
ATOM   4885 C CB  . MET B 1 169 ? 40.018 13.925  -27.738 1.00 26.74 ? 176 MET B CB  1 
ATOM   4886 C CG  . MET B 1 169 ? 40.310 15.262  -28.458 1.00 28.22 ? 176 MET B CG  1 
ATOM   4887 S SD  . MET B 1 169 ? 41.221 16.247  -27.224 1.00 17.03 ? 176 MET B SD  1 
ATOM   4888 C CE  . MET B 1 169 ? 39.918 16.559  -26.158 1.00 42.27 ? 176 MET B CE  1 
ATOM   4889 N N   . SER B 1 170 ? 41.086 11.134  -29.013 1.00 25.26 ? 177 SER B N   1 
ATOM   4890 C CA  . SER B 1 170 ? 41.893 9.928   -28.773 1.00 26.03 ? 177 SER B CA  1 
ATOM   4891 C C   . SER B 1 170 ? 42.905 10.179  -27.653 1.00 25.00 ? 177 SER B C   1 
ATOM   4892 O O   . SER B 1 170 ? 43.104 11.323  -27.237 1.00 21.37 ? 177 SER B O   1 
ATOM   4893 C CB  . SER B 1 170 ? 42.670 9.555   -30.033 1.00 23.79 ? 177 SER B CB  1 
ATOM   4894 O OG  . SER B 1 170 ? 43.711 10.494  -30.260 1.00 23.60 ? 177 SER B OG  1 
ATOM   4895 N N   . ASP B 1 171 ? 43.561 9.117   -27.181 1.00 25.07 ? 178 ASP B N   1 
ATOM   4896 C CA  . ASP B 1 171 ? 44.554 9.272   -26.113 1.00 28.43 ? 178 ASP B CA  1 
ATOM   4897 C C   . ASP B 1 171 ? 45.722 10.113  -26.612 1.00 27.30 ? 178 ASP B C   1 
ATOM   4898 O O   . ASP B 1 171 ? 46.305 10.894  -25.861 1.00 25.12 ? 178 ASP B O   1 
ATOM   4899 C CB  . ASP B 1 171 ? 45.079 7.915   -25.624 1.00 30.42 ? 178 ASP B CB  1 
ATOM   4900 C CG  . ASP B 1 171 ? 44.048 7.134   -24.840 1.00 31.03 ? 178 ASP B CG  1 
ATOM   4901 O OD1 . ASP B 1 171 ? 43.142 7.757   -24.240 1.00 35.74 ? 178 ASP B OD1 1 
ATOM   4902 O OD2 . ASP B 1 171 ? 44.151 5.894   -24.805 1.00 30.80 ? 178 ASP B OD2 1 
ATOM   4903 N N   . SER B 1 172 ? 46.066 9.952   -27.885 1.00 27.09 ? 179 SER B N   1 
ATOM   4904 C CA  . SER B 1 172 ? 47.158 10.734  -28.451 1.00 27.98 ? 179 SER B CA  1 
ATOM   4905 C C   . SER B 1 172 ? 46.802 12.214  -28.378 1.00 22.90 ? 179 SER B C   1 
ATOM   4906 O O   . SER B 1 172 ? 47.620 13.043  -27.997 1.00 23.50 ? 179 SER B O   1 
ATOM   4907 C CB  . SER B 1 172 ? 47.403 10.335  -29.910 1.00 32.90 ? 179 SER B CB  1 
ATOM   4908 O OG  . SER B 1 172 ? 47.861 8.994   -30.016 1.00 32.48 ? 179 SER B OG  1 
ATOM   4909 N N   . GLN B 1 173 ? 45.566 12.539  -28.742 1.00 26.83 ? 180 GLN B N   1 
ATOM   4910 C CA  . GLN B 1 173 ? 45.101 13.923  -28.729 1.00 23.87 ? 180 GLN B CA  1 
ATOM   4911 C C   . GLN B 1 173 ? 44.958 14.469  -27.311 1.00 19.91 ? 180 GLN B C   1 
ATOM   4912 O O   . GLN B 1 173 ? 45.273 15.625  -27.049 1.00 20.72 ? 180 GLN B O   1 
ATOM   4913 C CB  . GLN B 1 173 ? 43.761 14.029  -29.465 1.00 25.82 ? 180 GLN B CB  1 
ATOM   4914 C CG  . GLN B 1 173 ? 43.872 13.836  -30.962 1.00 30.43 ? 180 GLN B CG  1 
ATOM   4915 C CD  . GLN B 1 173 ? 42.545 14.005  -31.670 1.00 33.15 ? 180 GLN B CD  1 
ATOM   4916 O OE1 . GLN B 1 173 ? 41.661 13.163  -31.565 1.00 35.47 ? 180 GLN B OE1 1 
ATOM   4917 N NE2 . GLN B 1 173 ? 42.398 15.103  -32.389 1.00 35.15 ? 180 GLN B NE2 1 
ATOM   4918 N N   . LEU B 1 174 ? 44.469 13.635  -26.401 1.00 21.99 ? 181 LEU B N   1 
ATOM   4919 C CA  . LEU B 1 174 ? 44.298 14.042  -25.011 1.00 21.03 ? 181 LEU B CA  1 
ATOM   4920 C C   . LEU B 1 174 ? 45.648 14.449  -24.443 1.00 21.55 ? 181 LEU B C   1 
ATOM   4921 O O   . LEU B 1 174 ? 45.780 15.483  -23.781 1.00 21.13 ? 181 LEU B O   1 
ATOM   4922 C CB  . LEU B 1 174 ? 43.722 12.884  -24.200 1.00 18.07 ? 181 LEU B CB  1 
ATOM   4923 C CG  . LEU B 1 174 ? 42.240 12.610  -24.440 1.00 19.16 ? 181 LEU B CG  1 
ATOM   4924 C CD1 . LEU B 1 174 ? 41.834 11.298  -23.784 1.00 19.62 ? 181 LEU B CD1 1 
ATOM   4925 C CD2 . LEU B 1 174 ? 41.427 13.778  -23.892 1.00 18.07 ? 181 LEU B CD2 1 
ATOM   4926 N N   . TYR B 1 175 ? 46.649 13.618  -24.715 1.00 22.79 ? 182 TYR B N   1 
ATOM   4927 C CA  . TYR B 1 175 ? 48.006 13.853  -24.251 1.00 24.23 ? 182 TYR B CA  1 
ATOM   4928 C C   . TYR B 1 175 ? 48.490 15.184  -24.813 1.00 24.33 ? 182 TYR B C   1 
ATOM   4929 O O   . TYR B 1 175 ? 49.042 16.023  -24.104 1.00 21.57 ? 182 TYR B O   1 
ATOM   4930 C CB  . TYR B 1 175 ? 48.910 12.709  -24.730 1.00 25.57 ? 182 TYR B CB  1 
ATOM   4931 C CG  . TYR B 1 175 ? 50.354 12.819  -24.297 1.00 23.53 ? 182 TYR B CG  1 
ATOM   4932 C CD1 . TYR B 1 175 ? 51.231 13.673  -24.953 1.00 24.68 ? 182 TYR B CD1 1 
ATOM   4933 C CD2 . TYR B 1 175 ? 50.846 12.057  -23.236 1.00 24.29 ? 182 TYR B CD2 1 
ATOM   4934 C CE1 . TYR B 1 175 ? 52.565 13.769  -24.570 1.00 26.05 ? 182 TYR B CE1 1 
ATOM   4935 C CE2 . TYR B 1 175 ? 52.178 12.145  -22.844 1.00 22.23 ? 182 TYR B CE2 1 
ATOM   4936 C CZ  . TYR B 1 175 ? 53.033 13.001  -23.517 1.00 26.63 ? 182 TYR B CZ  1 
ATOM   4937 O OH  . TYR B 1 175 ? 54.363 13.079  -23.162 1.00 28.42 ? 182 TYR B OH  1 
ATOM   4938 N N   . GLU B 1 176 ? 48.262 15.372  -26.102 1.00 24.66 ? 183 GLU B N   1 
ATOM   4939 C CA  . GLU B 1 176 ? 48.678 16.588  -26.773 1.00 25.88 ? 183 GLU B CA  1 
ATOM   4940 C C   . GLU B 1 176 ? 47.967 17.816  -26.201 1.00 24.22 ? 183 GLU B C   1 
ATOM   4941 O O   . GLU B 1 176 ? 48.576 18.868  -26.008 1.00 23.91 ? 183 GLU B O   1 
ATOM   4942 C CB  . GLU B 1 176 ? 48.396 16.427  -28.262 1.00 29.80 ? 183 GLU B CB  1 
ATOM   4943 C CG  . GLU B 1 176 ? 48.700 17.632  -29.113 1.00 39.78 ? 183 GLU B CG  1 
ATOM   4944 C CD  . GLU B 1 176 ? 48.729 17.264  -30.581 1.00 45.67 ? 183 GLU B CD  1 
ATOM   4945 O OE1 . GLU B 1 176 ? 48.607 18.174  -31.429 1.00 45.45 ? 183 GLU B OE1 1 
ATOM   4946 O OE2 . GLU B 1 176 ? 48.878 16.055  -30.881 1.00 46.01 ? 183 GLU B OE2 1 
ATOM   4947 N N   . ALA B 1 177 ? 46.676 17.676  -25.918 1.00 22.69 ? 184 ALA B N   1 
ATOM   4948 C CA  . ALA B 1 177 ? 45.894 18.786  -25.378 1.00 22.36 ? 184 ALA B CA  1 
ATOM   4949 C C   . ALA B 1 177 ? 46.290 19.143  -23.932 1.00 23.40 ? 184 ALA B C   1 
ATOM   4950 O O   . ALA B 1 177 ? 46.418 20.323  -23.587 1.00 18.38 ? 184 ALA B O   1 
ATOM   4951 C CB  . ALA B 1 177 ? 44.401 18.446  -25.457 1.00 22.27 ? 184 ALA B CB  1 
ATOM   4952 N N   . PHE B 1 178 ? 46.480 18.126  -23.092 1.00 21.80 ? 185 PHE B N   1 
ATOM   4953 C CA  . PHE B 1 178 ? 46.862 18.353  -21.697 1.00 18.46 ? 185 PHE B CA  1 
ATOM   4954 C C   . PHE B 1 178 ? 48.195 19.098  -21.693 1.00 19.15 ? 185 PHE B C   1 
ATOM   4955 O O   . PHE B 1 178 ? 48.387 20.064  -20.949 1.00 19.61 ? 185 PHE B O   1 
ATOM   4956 C CB  . PHE B 1 178 ? 47.027 17.016  -20.956 1.00 16.44 ? 185 PHE B CB  1 
ATOM   4957 C CG  . PHE B 1 178 ? 45.730 16.373  -20.511 1.00 17.51 ? 185 PHE B CG  1 
ATOM   4958 C CD1 . PHE B 1 178 ? 44.536 16.615  -21.180 1.00 20.26 ? 185 PHE B CD1 1 
ATOM   4959 C CD2 . PHE B 1 178 ? 45.721 15.487  -19.435 1.00 20.21 ? 185 PHE B CD2 1 
ATOM   4960 C CE1 . PHE B 1 178 ? 43.354 15.985  -20.790 1.00 17.51 ? 185 PHE B CE1 1 
ATOM   4961 C CE2 . PHE B 1 178 ? 44.541 14.846  -19.033 1.00 16.23 ? 185 PHE B CE2 1 
ATOM   4962 C CZ  . PHE B 1 178 ? 43.357 15.094  -19.711 1.00 19.99 ? 185 PHE B CZ  1 
ATOM   4963 N N   . THR B 1 179 ? 49.115 18.639  -22.536 1.00 20.41 ? 186 THR B N   1 
ATOM   4964 C CA  . THR B 1 179 ? 50.434 19.247  -22.637 1.00 20.79 ? 186 THR B CA  1 
ATOM   4965 C C   . THR B 1 179 ? 50.377 20.710  -23.054 1.00 22.38 ? 186 THR B C   1 
ATOM   4966 O O   . THR B 1 179 ? 51.047 21.553  -22.457 1.00 25.42 ? 186 THR B O   1 
ATOM   4967 C CB  . THR B 1 179 ? 51.321 18.499  -23.646 1.00 20.90 ? 186 THR B CB  1 
ATOM   4968 O OG1 . THR B 1 179 ? 51.574 17.168  -23.172 1.00 22.37 ? 186 THR B OG1 1 
ATOM   4969 C CG2 . THR B 1 179 ? 52.640 19.241  -23.836 1.00 20.42 ? 186 THR B CG2 1 
ATOM   4970 N N   . PHE B 1 180 ? 49.582 21.013  -24.078 1.00 24.24 ? 187 PHE B N   1 
ATOM   4971 C CA  . PHE B 1 180 ? 49.469 22.393  -24.558 1.00 23.34 ? 187 PHE B CA  1 
ATOM   4972 C C   . PHE B 1 180 ? 48.786 23.284  -23.531 1.00 21.64 ? 187 PHE B C   1 
ATOM   4973 O O   . PHE B 1 180 ? 49.256 24.385  -23.240 1.00 22.65 ? 187 PHE B O   1 
ATOM   4974 C CB  . PHE B 1 180 ? 48.672 22.456  -25.859 1.00 25.17 ? 187 PHE B CB  1 
ATOM   4975 C CG  . PHE B 1 180 ? 48.665 23.816  -26.491 1.00 25.16 ? 187 PHE B CG  1 
ATOM   4976 C CD1 . PHE B 1 180 ? 49.837 24.354  -27.016 1.00 25.35 ? 187 PHE B CD1 1 
ATOM   4977 C CD2 . PHE B 1 180 ? 47.504 24.581  -26.517 1.00 24.48 ? 187 PHE B CD2 1 
ATOM   4978 C CE1 . PHE B 1 180 ? 49.855 25.635  -27.564 1.00 24.40 ? 187 PHE B CE1 1 
ATOM   4979 C CE2 . PHE B 1 180 ? 47.509 25.861  -27.061 1.00 24.15 ? 187 PHE B CE2 1 
ATOM   4980 C CZ  . PHE B 1 180 ? 48.692 26.394  -27.582 1.00 27.04 ? 187 PHE B CZ  1 
ATOM   4981 N N   . LEU B 1 181 ? 47.664 22.808  -22.996 1.00 18.46 ? 188 LEU B N   1 
ATOM   4982 C CA  . LEU B 1 181 ? 46.910 23.572  -22.004 1.00 19.12 ? 188 LEU B CA  1 
ATOM   4983 C C   . LEU B 1 181 ? 47.753 23.856  -20.760 1.00 18.29 ? 188 LEU B C   1 
ATOM   4984 O O   . LEU B 1 181 ? 47.640 24.926  -20.161 1.00 19.03 ? 188 LEU B O   1 
ATOM   4985 C CB  . LEU B 1 181 ? 45.612 22.829  -21.651 1.00 18.33 ? 188 LEU B CB  1 
ATOM   4986 C CG  . LEU B 1 181 ? 44.631 22.837  -22.835 1.00 16.32 ? 188 LEU B CG  1 
ATOM   4987 C CD1 . LEU B 1 181 ? 43.447 21.909  -22.593 1.00 15.78 ? 188 LEU B CD1 1 
ATOM   4988 C CD2 . LEU B 1 181 ? 44.159 24.274  -23.055 1.00 17.78 ? 188 LEU B CD2 1 
ATOM   4989 N N   . LYS B 1 182 ? 48.604 22.904  -20.386 1.00 15.71 ? 189 LYS B N   1 
ATOM   4990 C CA  . LYS B 1 182 ? 49.493 23.082  -19.240 1.00 21.06 ? 189 LYS B CA  1 
ATOM   4991 C C   . LYS B 1 182 ? 50.436 24.232  -19.569 1.00 21.21 ? 189 LYS B C   1 
ATOM   4992 O O   . LYS B 1 182 ? 50.723 25.081  -18.722 1.00 21.41 ? 189 LYS B O   1 
ATOM   4993 C CB  . LYS B 1 182 ? 50.313 21.813  -18.995 1.00 22.90 ? 189 LYS B CB  1 
ATOM   4994 C CG  . LYS B 1 182 ? 51.427 21.972  -17.959 1.00 20.71 ? 189 LYS B CG  1 
ATOM   4995 C CD  . LYS B 1 182 ? 52.290 20.719  -17.896 1.00 19.05 ? 189 LYS B CD  1 
ATOM   4996 C CE  . LYS B 1 182 ? 53.521 20.934  -17.027 1.00 24.65 ? 189 LYS B CE  1 
ATOM   4997 N NZ  . LYS B 1 182 ? 54.394 19.726  -16.985 1.00 26.08 ? 189 LYS B NZ  1 
ATOM   4998 N N   . GLY B 1 183 ? 50.910 24.244  -20.813 1.00 22.87 ? 190 GLY B N   1 
ATOM   4999 C CA  . GLY B 1 183 ? 51.812 25.293  -21.267 1.00 23.37 ? 190 GLY B CA  1 
ATOM   5000 C C   . GLY B 1 183 ? 51.202 26.672  -21.091 1.00 20.07 ? 190 GLY B C   1 
ATOM   5001 O O   . GLY B 1 183 ? 51.897 27.614  -20.735 1.00 23.30 ? 190 GLY B O   1 
ATOM   5002 N N   . LEU B 1 184 ? 49.897 26.784  -21.327 1.00 22.97 ? 191 LEU B N   1 
ATOM   5003 C CA  . LEU B 1 184 ? 49.179 28.057  -21.183 1.00 22.41 ? 191 LEU B CA  1 
ATOM   5004 C C   . LEU B 1 184 ? 48.741 28.322  -19.735 1.00 23.70 ? 191 LEU B C   1 
ATOM   5005 O O   . LEU B 1 184 ? 48.203 29.389  -19.431 1.00 23.44 ? 191 LEU B O   1 
ATOM   5006 C CB  . LEU B 1 184 ? 47.937 28.066  -22.088 1.00 25.47 ? 191 LEU B CB  1 
ATOM   5007 C CG  . LEU B 1 184 ? 48.107 27.813  -23.594 1.00 26.03 ? 191 LEU B CG  1 
ATOM   5008 C CD1 . LEU B 1 184 ? 46.745 27.747  -24.271 1.00 22.56 ? 191 LEU B CD1 1 
ATOM   5009 C CD2 . LEU B 1 184 ? 48.956 28.905  -24.206 1.00 24.09 ? 191 LEU B CD2 1 
ATOM   5010 N N   . GLY B 1 185 ? 48.959 27.348  -18.850 1.00 23.51 ? 192 GLY B N   1 
ATOM   5011 C CA  . GLY B 1 185 ? 48.573 27.494  -17.450 1.00 19.71 ? 192 GLY B CA  1 
ATOM   5012 C C   . GLY B 1 185 ? 47.071 27.475  -17.203 1.00 18.47 ? 192 GLY B C   1 
ATOM   5013 O O   . GLY B 1 185 ? 46.572 28.145  -16.301 1.00 20.60 ? 192 GLY B O   1 
ATOM   5014 N N   . ALA B 1 186 ? 46.345 26.689  -17.990 1.00 17.64 ? 193 ALA B N   1 
ATOM   5015 C CA  . ALA B 1 186 ? 44.894 26.611  -17.861 1.00 18.94 ? 193 ALA B CA  1 
ATOM   5016 C C   . ALA B 1 186 ? 44.424 25.528  -16.892 1.00 20.71 ? 193 ALA B C   1 
ATOM   5017 O O   . ALA B 1 186 ? 45.206 24.672  -16.484 1.00 20.18 ? 193 ALA B O   1 
ATOM   5018 C CB  . ALA B 1 186 ? 44.284 26.363  -19.227 1.00 20.00 ? 193 ALA B CB  1 
ATOM   5019 N N   . VAL B 1 187 ? 43.150 25.584  -16.510 1.00 17.42 ? 194 VAL B N   1 
ATOM   5020 C CA  . VAL B 1 187 ? 42.568 24.567  -15.641 1.00 15.81 ? 194 VAL B CA  1 
ATOM   5021 C C   . VAL B 1 187 ? 41.955 23.572  -16.630 1.00 19.09 ? 194 VAL B C   1 
ATOM   5022 O O   . VAL B 1 187 ? 41.056 23.926  -17.392 1.00 17.15 ? 194 VAL B O   1 
ATOM   5023 C CB  . VAL B 1 187 ? 41.442 25.129  -14.744 1.00 15.29 ? 194 VAL B CB  1 
ATOM   5024 C CG1 . VAL B 1 187 ? 40.954 24.046  -13.796 1.00 14.03 ? 194 VAL B CG1 1 
ATOM   5025 C CG2 . VAL B 1 187 ? 41.936 26.330  -13.967 1.00 16.30 ? 194 VAL B CG2 1 
ATOM   5026 N N   . ILE B 1 188 ? 42.449 22.339  -16.626 1.00 18.91 ? 195 ILE B N   1 
ATOM   5027 C CA  . ILE B 1 188 ? 41.979 21.317  -17.560 1.00 18.40 ? 195 ILE B CA  1 
ATOM   5028 C C   . ILE B 1 188 ? 40.788 20.481  -17.067 1.00 20.68 ? 195 ILE B C   1 
ATOM   5029 O O   . ILE B 1 188 ? 40.927 19.671  -16.148 1.00 18.85 ? 195 ILE B O   1 
ATOM   5030 C CB  . ILE B 1 188 ? 43.155 20.357  -17.938 1.00 16.90 ? 195 ILE B CB  1 
ATOM   5031 C CG1 . ILE B 1 188 ? 44.321 21.166  -18.514 1.00 13.90 ? 195 ILE B CG1 1 
ATOM   5032 C CG2 . ILE B 1 188 ? 42.691 19.316  -18.950 1.00 13.91 ? 195 ILE B CG2 1 
ATOM   5033 C CD1 . ILE B 1 188 ? 45.612 20.375  -18.666 1.00 17.48 ? 195 ILE B CD1 1 
ATOM   5034 N N   . LEU B 1 189 ? 39.626 20.673  -17.692 1.00 17.17 ? 196 LEU B N   1 
ATOM   5035 C CA  . LEU B 1 189 ? 38.418 19.925  -17.336 1.00 17.71 ? 196 LEU B CA  1 
ATOM   5036 C C   . LEU B 1 189 ? 38.219 18.749  -18.279 1.00 15.87 ? 196 LEU B C   1 
ATOM   5037 O O   . LEU B 1 189 ? 38.522 18.836  -19.465 1.00 18.34 ? 196 LEU B O   1 
ATOM   5038 C CB  . LEU B 1 189 ? 37.176 20.826  -17.384 1.00 16.16 ? 196 LEU B CB  1 
ATOM   5039 C CG  . LEU B 1 189 ? 36.909 21.742  -16.184 1.00 19.41 ? 196 LEU B CG  1 
ATOM   5040 C CD1 . LEU B 1 189 ? 38.030 22.753  -16.039 1.00 21.00 ? 196 LEU B CD1 1 
ATOM   5041 C CD2 . LEU B 1 189 ? 35.569 22.462  -16.377 1.00 15.63 ? 196 LEU B CD2 1 
ATOM   5042 N N   . VAL B 1 190 ? 37.686 17.654  -17.754 1.00 16.97 ? 197 VAL B N   1 
ATOM   5043 C CA  . VAL B 1 190 ? 37.470 16.471  -18.568 1.00 15.74 ? 197 VAL B CA  1 
ATOM   5044 C C   . VAL B 1 190 ? 36.091 15.873  -18.393 1.00 16.72 ? 197 VAL B C   1 
ATOM   5045 O O   . VAL B 1 190 ? 35.582 15.778  -17.280 1.00 17.41 ? 197 VAL B O   1 
ATOM   5046 C CB  . VAL B 1 190 ? 38.480 15.346  -18.213 1.00 21.46 ? 197 VAL B CB  1 
ATOM   5047 C CG1 . VAL B 1 190 ? 38.299 14.155  -19.169 1.00 20.25 ? 197 VAL B CG1 1 
ATOM   5048 C CG2 . VAL B 1 190 ? 39.900 15.873  -18.248 1.00 14.43 ? 197 VAL B CG2 1 
ATOM   5049 N N   . HIS B 1 191 ? 35.480 15.485  -19.506 1.00 16.53 ? 198 HIS B N   1 
ATOM   5050 C CA  . HIS B 1 191 ? 34.199 14.799  -19.460 1.00 17.96 ? 198 HIS B CA  1 
ATOM   5051 C C   . HIS B 1 191 ? 34.686 13.365  -19.636 1.00 18.83 ? 198 HIS B C   1 
ATOM   5052 O O   . HIS B 1 191 ? 35.062 12.964  -20.743 1.00 18.32 ? 198 HIS B O   1 
ATOM   5053 C CB  . HIS B 1 191 ? 33.314 15.214  -20.629 1.00 18.65 ? 198 HIS B CB  1 
ATOM   5054 C CG  . HIS B 1 191 ? 31.979 14.545  -20.630 1.00 16.40 ? 198 HIS B CG  1 
ATOM   5055 N ND1 . HIS B 1 191 ? 31.838 13.177  -20.627 1.00 22.86 ? 198 HIS B ND1 1 
ATOM   5056 C CD2 . HIS B 1 191 ? 30.726 15.054  -20.629 1.00 18.18 ? 198 HIS B CD2 1 
ATOM   5057 C CE1 . HIS B 1 191 ? 30.554 12.867  -20.621 1.00 15.36 ? 198 HIS B CE1 1 
ATOM   5058 N NE2 . HIS B 1 191 ? 29.859 13.992  -20.621 1.00 18.97 ? 198 HIS B NE2 1 
ATOM   5059 N N   . ALA B 1 192 ? 34.702 12.607  -18.541 1.00 19.29 ? 199 ALA B N   1 
ATOM   5060 C CA  . ALA B 1 192 ? 35.221 11.247  -18.560 1.00 19.75 ? 199 ALA B CA  1 
ATOM   5061 C C   . ALA B 1 192 ? 34.261 10.047  -18.547 1.00 20.47 ? 199 ALA B C   1 
ATOM   5062 O O   . ALA B 1 192 ? 33.667 9.705   -17.521 1.00 19.51 ? 199 ALA B O   1 
ATOM   5063 C CB  . ALA B 1 192 ? 36.247 11.096  -17.434 1.00 19.25 ? 199 ALA B CB  1 
ATOM   5064 N N   . GLU B 1 193 ? 34.141 9.418   -19.713 1.00 17.56 ? 200 GLU B N   1 
ATOM   5065 C CA  . GLU B 1 193 ? 33.344 8.212   -19.944 1.00 18.35 ? 200 GLU B CA  1 
ATOM   5066 C C   . GLU B 1 193 ? 33.999 7.624   -21.182 1.00 19.45 ? 200 GLU B C   1 
ATOM   5067 O O   . GLU B 1 193 ? 34.462 8.376   -22.030 1.00 18.33 ? 200 GLU B O   1 
ATOM   5068 C CB  . GLU B 1 193 ? 31.889 8.527   -20.283 1.00 16.07 ? 200 GLU B CB  1 
ATOM   5069 C CG  . GLU B 1 193 ? 31.083 9.178   -19.195 1.00 17.13 ? 200 GLU B CG  1 
ATOM   5070 C CD  . GLU B 1 193 ? 29.638 9.313   -19.604 1.00 20.02 ? 200 GLU B CD  1 
ATOM   5071 O OE1 . GLU B 1 193 ? 28.819 8.459   -19.207 1.00 18.41 ? 200 GLU B OE1 1 
ATOM   5072 O OE2 . GLU B 1 193 ? 29.326 10.263  -20.352 1.00 19.01 ? 200 GLU B OE2 1 
ATOM   5073 N N   . ASN B 1 194 ? 34.044 6.300   -21.296 1.00 19.08 ? 201 ASN B N   1 
ATOM   5074 C CA  . ASN B 1 194 ? 34.664 5.674   -22.460 1.00 23.05 ? 201 ASN B CA  1 
ATOM   5075 C C   . ASN B 1 194 ? 33.653 5.645   -23.596 1.00 21.59 ? 201 ASN B C   1 
ATOM   5076 O O   . ASN B 1 194 ? 32.719 4.834   -23.600 1.00 22.40 ? 201 ASN B O   1 
ATOM   5077 C CB  . ASN B 1 194 ? 35.128 4.249   -22.137 1.00 22.76 ? 201 ASN B CB  1 
ATOM   5078 C CG  . ASN B 1 194 ? 35.968 3.639   -23.257 1.00 30.20 ? 201 ASN B CG  1 
ATOM   5079 O OD1 . ASN B 1 194 ? 35.494 3.452   -24.381 1.00 26.37 ? 201 ASN B OD1 1 
ATOM   5080 N ND2 . ASN B 1 194 ? 37.225 3.328   -22.949 1.00 26.93 ? 201 ASN B ND2 1 
ATOM   5081 N N   . GLY B 1 195 ? 33.861 6.534   -24.558 1.00 19.87 ? 202 GLY B N   1 
ATOM   5082 C CA  . GLY B 1 195 ? 32.963 6.643   -25.693 1.00 23.78 ? 202 GLY B CA  1 
ATOM   5083 C C   . GLY B 1 195 ? 32.871 5.445   -26.618 1.00 21.61 ? 202 GLY B C   1 
ATOM   5084 O O   . GLY B 1 195 ? 31.801 5.179   -27.154 1.00 20.06 ? 202 GLY B O   1 
ATOM   5085 N N   . ASP B 1 196 ? 33.974 4.725   -26.823 1.00 22.36 ? 203 ASP B N   1 
ATOM   5086 C CA  . ASP B 1 196 ? 33.937 3.565   -27.716 1.00 22.87 ? 203 ASP B CA  1 
ATOM   5087 C C   . ASP B 1 196 ? 33.077 2.457   -27.124 1.00 20.99 ? 203 ASP B C   1 
ATOM   5088 O O   . ASP B 1 196 ? 32.228 1.875   -27.808 1.00 18.48 ? 203 ASP B O   1 
ATOM   5089 C CB  . ASP B 1 196 ? 35.353 3.029   -27.997 1.00 27.27 ? 203 ASP B CB  1 
ATOM   5090 C CG  . ASP B 1 196 ? 36.183 3.977   -28.841 1.00 29.90 ? 203 ASP B CG  1 
ATOM   5091 O OD1 . ASP B 1 196 ? 35.603 4.825   -29.549 1.00 36.22 ? 203 ASP B OD1 1 
ATOM   5092 O OD2 . ASP B 1 196 ? 37.426 3.874   -28.813 1.00 38.98 ? 203 ASP B OD2 1 
ATOM   5093 N N   . LEU B 1 197 ? 33.285 2.174   -25.845 1.00 20.52 ? 204 LEU B N   1 
ATOM   5094 C CA  . LEU B 1 197 ? 32.518 1.135   -25.180 1.00 20.20 ? 204 LEU B CA  1 
ATOM   5095 C C   . LEU B 1 197 ? 31.054 1.552   -24.994 1.00 20.63 ? 204 LEU B C   1 
ATOM   5096 O O   . LEU B 1 197 ? 30.159 0.701   -24.970 1.00 20.61 ? 204 LEU B O   1 
ATOM   5097 C CB  . LEU B 1 197 ? 33.168 0.787   -23.834 1.00 21.60 ? 204 LEU B CB  1 
ATOM   5098 C CG  . LEU B 1 197 ? 34.596 0.214   -23.927 1.00 28.95 ? 204 LEU B CG  1 
ATOM   5099 C CD1 . LEU B 1 197 ? 35.180 0.013   -22.529 1.00 29.77 ? 204 LEU B CD1 1 
ATOM   5100 C CD2 . LEU B 1 197 ? 34.572 -1.105  -24.677 1.00 26.98 ? 204 LEU B CD2 1 
ATOM   5101 N N   . ILE B 1 198 ? 30.799 2.854   -24.870 1.00 22.00 ? 205 ILE B N   1 
ATOM   5102 C CA  . ILE B 1 198 ? 29.418 3.313   -24.704 1.00 20.60 ? 205 ILE B CA  1 
ATOM   5103 C C   . ILE B 1 198 ? 28.676 3.135   -26.026 1.00 20.72 ? 205 ILE B C   1 
ATOM   5104 O O   . ILE B 1 198 ? 27.527 2.685   -26.058 1.00 18.86 ? 205 ILE B O   1 
ATOM   5105 C CB  . ILE B 1 198 ? 29.341 4.797   -24.270 1.00 21.58 ? 205 ILE B CB  1 
ATOM   5106 C CG1 . ILE B 1 198 ? 29.792 4.935   -22.812 1.00 24.32 ? 205 ILE B CG1 1 
ATOM   5107 C CG2 . ILE B 1 198 ? 27.901 5.315   -24.417 1.00 18.91 ? 205 ILE B CG2 1 
ATOM   5108 C CD1 . ILE B 1 198 ? 29.794 6.375   -22.285 1.00 22.85 ? 205 ILE B CD1 1 
ATOM   5109 N N   . ALA B 1 199 ? 29.354 3.473   -27.118 1.00 22.47 ? 206 ALA B N   1 
ATOM   5110 C CA  . ALA B 1 199 ? 28.786 3.336   -28.452 1.00 23.57 ? 206 ALA B CA  1 
ATOM   5111 C C   . ALA B 1 199 ? 28.437 1.870   -28.724 1.00 25.39 ? 206 ALA B C   1 
ATOM   5112 O O   . ALA B 1 199 ? 27.404 1.569   -29.336 1.00 28.16 ? 206 ALA B O   1 
ATOM   5113 C CB  . ALA B 1 199 ? 29.782 3.845   -29.498 1.00 21.56 ? 206 ALA B CB  1 
ATOM   5114 N N   . GLN B 1 200 ? 29.294 0.962   -28.258 1.00 26.54 ? 207 GLN B N   1 
ATOM   5115 C CA  . GLN B 1 200 ? 29.078 -0.476  -28.446 1.00 25.87 ? 207 GLN B CA  1 
ATOM   5116 C C   . GLN B 1 200 ? 27.879 -0.943  -27.639 1.00 25.70 ? 207 GLN B C   1 
ATOM   5117 O O   . GLN B 1 200 ? 27.028 -1.681  -28.137 1.00 28.33 ? 207 GLN B O   1 
ATOM   5118 C CB  . GLN B 1 200 ? 30.304 -1.287  -27.996 1.00 26.87 ? 207 GLN B CB  1 
ATOM   5119 C CG  . GLN B 1 200 ? 31.573 -1.074  -28.815 1.00 30.07 ? 207 GLN B CG  1 
ATOM   5120 C CD  . GLN B 1 200 ? 31.404 -1.490  -30.258 1.00 35.99 ? 207 GLN B CD  1 
ATOM   5121 O OE1 . GLN B 1 200 ? 31.045 -2.637  -30.553 1.00 36.50 ? 207 GLN B OE1 1 
ATOM   5122 N NE2 . GLN B 1 200 ? 31.661 -0.559  -31.172 1.00 39.34 ? 207 GLN B NE2 1 
ATOM   5123 N N   . GLU B 1 201 ? 27.821 -0.527  -26.379 1.00 23.61 ? 208 GLU B N   1 
ATOM   5124 C CA  . GLU B 1 201 ? 26.722 -0.931  -25.524 1.00 23.51 ? 208 GLU B CA  1 
ATOM   5125 C C   . GLU B 1 201 ? 25.396 -0.314  -25.963 1.00 24.26 ? 208 GLU B C   1 
ATOM   5126 O O   . GLU B 1 201 ? 24.356 -0.954  -25.846 1.00 23.58 ? 208 GLU B O   1 
ATOM   5127 C CB  . GLU B 1 201 ? 27.043 -0.602  -24.062 1.00 24.93 ? 208 GLU B CB  1 
ATOM   5128 C CG  . GLU B 1 201 ? 28.041 -1.588  -23.426 1.00 27.90 ? 208 GLU B CG  1 
ATOM   5129 C CD  . GLU B 1 201 ? 27.452 -2.982  -23.225 1.00 31.56 ? 208 GLU B CD  1 
ATOM   5130 O OE1 . GLU B 1 201 ? 26.568 -3.143  -22.361 1.00 34.30 ? 208 GLU B OE1 1 
ATOM   5131 O OE2 . GLU B 1 201 ? 27.856 -3.927  -23.934 1.00 33.41 ? 208 GLU B OE2 1 
ATOM   5132 N N   . GLN B 1 202 ? 25.425 0.916   -26.473 1.00 22.49 ? 209 GLN B N   1 
ATOM   5133 C CA  . GLN B 1 202 ? 24.194 1.549   -26.948 1.00 26.09 ? 209 GLN B CA  1 
ATOM   5134 C C   . GLN B 1 202 ? 23.581 0.669   -28.035 1.00 26.53 ? 209 GLN B C   1 
ATOM   5135 O O   . GLN B 1 202 ? 22.402 0.317   -27.980 1.00 23.12 ? 209 GLN B O   1 
ATOM   5136 C CB  . GLN B 1 202 ? 24.477 2.939   -27.523 1.00 21.71 ? 209 GLN B CB  1 
ATOM   5137 C CG  . GLN B 1 202 ? 24.519 4.037   -26.479 1.00 25.37 ? 209 GLN B CG  1 
ATOM   5138 C CD  . GLN B 1 202 ? 24.980 5.370   -27.046 1.00 28.60 ? 209 GLN B CD  1 
ATOM   5139 O OE1 . GLN B 1 202 ? 24.755 6.424   -26.442 1.00 28.76 ? 209 GLN B OE1 1 
ATOM   5140 N NE2 . GLN B 1 202 ? 25.636 5.331   -28.202 1.00 20.33 ? 209 GLN B NE2 1 
ATOM   5141 N N   . LYS B 1 203 ? 24.388 0.325   -29.032 1.00 26.85 ? 210 LYS B N   1 
ATOM   5142 C CA  . LYS B 1 203 ? 23.907 -0.534  -30.104 1.00 30.81 ? 210 LYS B CA  1 
ATOM   5143 C C   . LYS B 1 203 ? 23.314 -1.795  -29.503 1.00 30.48 ? 210 LYS B C   1 
ATOM   5144 O O   . LYS B 1 203 ? 22.146 -2.092  -29.711 1.00 31.60 ? 210 LYS B O   1 
ATOM   5145 C CB  . LYS B 1 203 ? 25.044 -0.914  -31.056 1.00 34.84 ? 210 LYS B CB  1 
ATOM   5146 C CG  . LYS B 1 203 ? 25.420 0.181   -32.063 1.00 43.32 ? 210 LYS B CG  1 
ATOM   5147 C CD  . LYS B 1 203 ? 26.365 -0.370  -33.148 1.00 49.24 ? 210 LYS B CD  1 
ATOM   5148 C CE  . LYS B 1 203 ? 25.798 -1.657  -33.758 1.00 49.57 ? 210 LYS B CE  1 
ATOM   5149 N NZ  . LYS B 1 203 ? 26.700 -2.301  -34.774 1.00 49.11 ? 210 LYS B NZ  1 
ATOM   5150 N N   . ARG B 1 204 ? 24.113 -2.521  -28.730 1.00 30.92 ? 211 ARG B N   1 
ATOM   5151 C CA  . ARG B 1 204 ? 23.648 -3.760  -28.128 1.00 32.00 ? 211 ARG B CA  1 
ATOM   5152 C C   . ARG B 1 204 ? 22.335 -3.620  -27.370 1.00 30.01 ? 211 ARG B C   1 
ATOM   5153 O O   . ARG B 1 204 ? 21.460 -4.472  -27.506 1.00 31.38 ? 211 ARG B O   1 
ATOM   5154 C CB  . ARG B 1 204 ? 24.725 -4.344  -27.199 1.00 33.56 ? 211 ARG B CB  1 
ATOM   5155 C CG  . ARG B 1 204 ? 24.349 -5.696  -26.578 1.00 34.87 ? 211 ARG B CG  1 
ATOM   5156 C CD  . ARG B 1 204 ? 25.489 -6.302  -25.743 1.00 36.64 ? 211 ARG B CD  1 
ATOM   5157 N NE  . ARG B 1 204 ? 25.529 -5.804  -24.369 1.00 36.16 ? 211 ARG B NE  1 
ATOM   5158 C CZ  . ARG B 1 204 ? 24.610 -6.075  -23.440 1.00 39.21 ? 211 ARG B CZ  1 
ATOM   5159 N NH1 . ARG B 1 204 ? 23.567 -6.847  -23.736 1.00 37.47 ? 211 ARG B NH1 1 
ATOM   5160 N NH2 . ARG B 1 204 ? 24.730 -5.570  -22.210 1.00 36.64 ? 211 ARG B NH2 1 
ATOM   5161 N N   . ILE B 1 205 ? 22.192 -2.565  -26.565 1.00 30.17 ? 212 ILE B N   1 
ATOM   5162 C CA  . ILE B 1 205 ? 20.963 -2.370  -25.797 1.00 29.96 ? 212 ILE B CA  1 
ATOM   5163 C C   . ILE B 1 205 ? 19.760 -2.084  -26.711 1.00 32.41 ? 212 ILE B C   1 
ATOM   5164 O O   . ILE B 1 205 ? 18.651 -2.572  -26.459 1.00 28.22 ? 212 ILE B O   1 
ATOM   5165 C CB  . ILE B 1 205 ? 21.100 -1.215  -24.770 1.00 29.16 ? 212 ILE B CB  1 
ATOM   5166 C CG1 . ILE B 1 205 ? 22.241 -1.503  -23.789 1.00 30.49 ? 212 ILE B CG1 1 
ATOM   5167 C CG2 . ILE B 1 205 ? 19.818 -1.083  -23.957 1.00 26.74 ? 212 ILE B CG2 1 
ATOM   5168 C CD1 . ILE B 1 205 ? 22.014 -2.721  -22.922 1.00 27.68 ? 212 ILE B CD1 1 
ATOM   5169 N N   . LEU B 1 206 ? 19.976 -1.298  -27.767 1.00 32.91 ? 213 LEU B N   1 
ATOM   5170 C CA  . LEU B 1 206 ? 18.892 -0.980  -28.702 1.00 37.30 ? 213 LEU B CA  1 
ATOM   5171 C C   . LEU B 1 206 ? 18.474 -2.210  -29.497 1.00 39.38 ? 213 LEU B C   1 
ATOM   5172 O O   . LEU B 1 206 ? 17.284 -2.416  -29.758 1.00 40.72 ? 213 LEU B O   1 
ATOM   5173 C CB  . LEU B 1 206 ? 19.319 0.117   -29.676 1.00 33.42 ? 213 LEU B CB  1 
ATOM   5174 C CG  . LEU B 1 206 ? 19.402 1.544   -29.134 1.00 33.60 ? 213 LEU B CG  1 
ATOM   5175 C CD1 . LEU B 1 206 ? 19.887 2.468   -30.250 1.00 26.61 ? 213 LEU B CD1 1 
ATOM   5176 C CD2 . LEU B 1 206 ? 18.031 1.990   -28.606 1.00 31.77 ? 213 LEU B CD2 1 
ATOM   5177 N N   . GLU B 1 207 ? 19.455 -3.027  -29.879 1.00 40.60 ? 214 GLU B N   1 
ATOM   5178 C CA  . GLU B 1 207 ? 19.202 -4.252  -30.650 1.00 42.54 ? 214 GLU B CA  1 
ATOM   5179 C C   . GLU B 1 207 ? 18.225 -5.150  -29.894 1.00 40.87 ? 214 GLU B C   1 
ATOM   5180 O O   . GLU B 1 207 ? 17.446 -5.897  -30.499 1.00 40.50 ? 214 GLU B O   1 
ATOM   5181 C CB  . GLU B 1 207 ? 20.512 -5.022  -30.870 1.00 47.63 ? 214 GLU B CB  1 
ATOM   5182 C CG  . GLU B 1 207 ? 21.700 -4.164  -31.333 1.00 54.06 ? 214 GLU B CG  1 
ATOM   5183 C CD  . GLU B 1 207 ? 22.036 -4.327  -32.811 1.00 57.79 ? 214 GLU B CD  1 
ATOM   5184 O OE1 . GLU B 1 207 ? 22.350 -5.466  -33.220 1.00 61.09 ? 214 GLU B OE1 1 
ATOM   5185 O OE2 . GLU B 1 207 ? 21.999 -3.322  -33.563 1.00 56.31 ? 214 GLU B OE2 1 
ATOM   5186 N N   . MET B 1 208 ? 18.280 -5.075  -28.567 1.00 37.70 ? 215 MET B N   1 
ATOM   5187 C CA  . MET B 1 208 ? 17.424 -5.877  -27.706 1.00 37.40 ? 215 MET B CA  1 
ATOM   5188 C C   . MET B 1 208 ? 15.995 -5.343  -27.617 1.00 38.42 ? 215 MET B C   1 
ATOM   5189 O O   . MET B 1 208 ? 15.098 -6.034  -27.126 1.00 38.64 ? 215 MET B O   1 
ATOM   5190 C CB  . MET B 1 208 ? 18.013 -5.940  -26.300 1.00 35.97 ? 215 MET B CB  1 
ATOM   5191 C CG  . MET B 1 208 ? 19.399 -6.541  -26.221 1.00 37.72 ? 215 MET B CG  1 
ATOM   5192 S SD  . MET B 1 208 ? 19.988 -6.578  -24.508 1.00 30.96 ? 215 MET B SD  1 
ATOM   5193 C CE  . MET B 1 208 ? 19.577 -8.226  -24.035 1.00 34.05 ? 215 MET B CE  1 
ATOM   5194 N N   . GLY B 1 209 ? 15.782 -4.111  -28.068 1.00 39.23 ? 216 GLY B N   1 
ATOM   5195 C CA  . GLY B 1 209 ? 14.441 -3.555  -28.010 1.00 38.48 ? 216 GLY B CA  1 
ATOM   5196 C C   . GLY B 1 209 ? 14.206 -2.615  -26.840 1.00 39.61 ? 216 GLY B C   1 
ATOM   5197 O O   . GLY B 1 209 ? 13.087 -2.147  -26.639 1.00 40.73 ? 216 GLY B O   1 
ATOM   5198 N N   . ILE B 1 210 ? 15.250 -2.339  -26.065 1.00 37.28 ? 217 ILE B N   1 
ATOM   5199 C CA  . ILE B 1 210 ? 15.141 -1.420  -24.933 1.00 34.01 ? 217 ILE B CA  1 
ATOM   5200 C C   . ILE B 1 210 ? 15.398 -0.009  -25.463 1.00 33.07 ? 217 ILE B C   1 
ATOM   5201 O O   . ILE B 1 210 ? 16.548 0.356   -25.719 1.00 31.07 ? 217 ILE B O   1 
ATOM   5202 C CB  . ILE B 1 210 ? 16.185 -1.761  -23.850 1.00 35.23 ? 217 ILE B CB  1 
ATOM   5203 C CG1 . ILE B 1 210 ? 15.984 -3.204  -23.391 1.00 33.63 ? 217 ILE B CG1 1 
ATOM   5204 C CG2 . ILE B 1 210 ? 16.055 -0.811  -22.666 1.00 32.30 ? 217 ILE B CG2 1 
ATOM   5205 C CD1 . ILE B 1 210 ? 16.877 -3.607  -22.236 1.00 38.02 ? 217 ILE B CD1 1 
ATOM   5206 N N   . THR B 1 211 ? 14.334 0.779   -25.632 1.00 29.18 ? 218 THR B N   1 
ATOM   5207 C CA  . THR B 1 211 ? 14.470 2.137   -26.169 1.00 27.18 ? 218 THR B CA  1 
ATOM   5208 C C   . THR B 1 211 ? 14.151 3.248   -25.176 1.00 25.02 ? 218 THR B C   1 
ATOM   5209 O O   . THR B 1 211 ? 14.384 4.425   -25.465 1.00 24.65 ? 218 THR B O   1 
ATOM   5210 C CB  . THR B 1 211 ? 13.560 2.353   -27.400 1.00 28.81 ? 218 THR B CB  1 
ATOM   5211 O OG1 . THR B 1 211 ? 12.188 2.199   -27.007 1.00 29.35 ? 218 THR B OG1 1 
ATOM   5212 C CG2 . THR B 1 211 ? 13.890 1.342   -28.503 1.00 30.16 ? 218 THR B CG2 1 
ATOM   5213 N N   . GLY B 1 212 ? 13.613 2.872   -24.019 1.00 26.63 ? 219 GLY B N   1 
ATOM   5214 C CA  . GLY B 1 212 ? 13.272 3.845   -23.001 1.00 23.01 ? 219 GLY B CA  1 
ATOM   5215 C C   . GLY B 1 212 ? 14.483 4.406   -22.272 1.00 25.01 ? 219 GLY B C   1 
ATOM   5216 O O   . GLY B 1 212 ? 15.605 3.939   -22.462 1.00 28.97 ? 219 GLY B O   1 
ATOM   5217 N N   . PRO B 1 213 ? 14.281 5.421   -21.423 1.00 25.46 ? 220 PRO B N   1 
ATOM   5218 C CA  . PRO B 1 213 ? 15.364 6.047   -20.664 1.00 24.96 ? 220 PRO B CA  1 
ATOM   5219 C C   . PRO B 1 213 ? 16.240 5.095   -19.849 1.00 23.27 ? 220 PRO B C   1 
ATOM   5220 O O   . PRO B 1 213 ? 17.396 5.410   -19.586 1.00 21.40 ? 220 PRO B O   1 
ATOM   5221 C CB  . PRO B 1 213 ? 14.622 7.061   -19.793 1.00 24.67 ? 220 PRO B CB  1 
ATOM   5222 C CG  . PRO B 1 213 ? 13.517 7.507   -20.706 1.00 25.98 ? 220 PRO B CG  1 
ATOM   5223 C CD  . PRO B 1 213 ? 13.024 6.171   -21.245 1.00 24.00 ? 220 PRO B CD  1 
ATOM   5224 N N   . GLU B 1 214 ? 15.696 3.947   -19.444 1.00 23.13 ? 221 GLU B N   1 
ATOM   5225 C CA  . GLU B 1 214 ? 16.475 2.983   -18.663 1.00 23.87 ? 221 GLU B CA  1 
ATOM   5226 C C   . GLU B 1 214 ? 17.673 2.525   -19.484 1.00 24.31 ? 221 GLU B C   1 
ATOM   5227 O O   . GLU B 1 214 ? 18.696 2.112   -18.935 1.00 26.52 ? 221 GLU B O   1 
ATOM   5228 C CB  . GLU B 1 214 ? 15.626 1.766   -18.263 1.00 19.79 ? 221 GLU B CB  1 
ATOM   5229 C CG  . GLU B 1 214 ? 15.141 0.915   -19.425 1.00 27.74 ? 221 GLU B CG  1 
ATOM   5230 C CD  . GLU B 1 214 ? 13.793 1.367   -19.983 1.00 32.25 ? 221 GLU B CD  1 
ATOM   5231 O OE1 . GLU B 1 214 ? 13.577 2.590   -20.130 1.00 33.36 ? 221 GLU B OE1 1 
ATOM   5232 O OE2 . GLU B 1 214 ? 12.949 0.494   -20.285 1.00 34.08 ? 221 GLU B OE2 1 
ATOM   5233 N N   . GLY B 1 215 ? 17.541 2.613   -20.803 1.00 22.62 ? 222 GLY B N   1 
ATOM   5234 C CA  . GLY B 1 215 ? 18.617 2.221   -21.690 1.00 22.67 ? 222 GLY B CA  1 
ATOM   5235 C C   . GLY B 1 215 ? 19.787 3.188   -21.662 1.00 22.17 ? 222 GLY B C   1 
ATOM   5236 O O   . GLY B 1 215 ? 20.903 2.822   -22.013 1.00 23.68 ? 222 GLY B O   1 
ATOM   5237 N N   . HIS B 1 216 ? 19.535 4.432   -21.267 1.00 22.85 ? 223 HIS B N   1 
ATOM   5238 C CA  . HIS B 1 216 ? 20.596 5.431   -21.190 1.00 23.07 ? 223 HIS B CA  1 
ATOM   5239 C C   . HIS B 1 216 ? 21.519 5.042   -20.049 1.00 23.60 ? 223 HIS B C   1 
ATOM   5240 O O   . HIS B 1 216 ? 22.736 5.088   -20.183 1.00 24.59 ? 223 HIS B O   1 
ATOM   5241 C CB  . HIS B 1 216 ? 20.004 6.818   -20.925 1.00 25.63 ? 223 HIS B CB  1 
ATOM   5242 C CG  . HIS B 1 216 ? 21.026 7.902   -20.808 1.00 22.42 ? 223 HIS B CG  1 
ATOM   5243 N ND1 . HIS B 1 216 ? 21.742 8.374   -21.888 1.00 23.22 ? 223 HIS B ND1 1 
ATOM   5244 C CD2 . HIS B 1 216 ? 21.449 8.621   -19.737 1.00 19.03 ? 223 HIS B CD2 1 
ATOM   5245 C CE1 . HIS B 1 216 ? 22.557 9.334   -21.493 1.00 22.80 ? 223 HIS B CE1 1 
ATOM   5246 N NE2 . HIS B 1 216 ? 22.397 9.503   -20.189 1.00 20.58 ? 223 HIS B NE2 1 
ATOM   5247 N N   . ALA B 1 217 ? 20.928 4.659   -18.922 1.00 22.67 ? 224 ALA B N   1 
ATOM   5248 C CA  . ALA B 1 217 ? 21.698 4.243   -17.759 1.00 23.04 ? 224 ALA B CA  1 
ATOM   5249 C C   . ALA B 1 217 ? 22.414 2.918   -18.034 1.00 23.71 ? 224 ALA B C   1 
ATOM   5250 O O   . ALA B 1 217 ? 23.606 2.774   -17.755 1.00 19.99 ? 224 ALA B O   1 
ATOM   5251 C CB  . ALA B 1 217 ? 20.776 4.087   -16.559 1.00 22.19 ? 224 ALA B CB  1 
ATOM   5252 N N   . LEU B 1 218 ? 21.678 1.954   -18.587 1.00 24.40 ? 225 LEU B N   1 
ATOM   5253 C CA  . LEU B 1 218 ? 22.232 0.629   -18.882 1.00 24.41 ? 225 LEU B CA  1 
ATOM   5254 C C   . LEU B 1 218 ? 23.382 0.642   -19.890 1.00 23.17 ? 225 LEU B C   1 
ATOM   5255 O O   . LEU B 1 218 ? 24.253 -0.229  -19.863 1.00 22.06 ? 225 LEU B O   1 
ATOM   5256 C CB  . LEU B 1 218 ? 21.121 -0.306  -19.387 1.00 25.35 ? 225 LEU B CB  1 
ATOM   5257 C CG  . LEU B 1 218 ? 19.997 -0.601  -18.386 1.00 25.64 ? 225 LEU B CG  1 
ATOM   5258 C CD1 . LEU B 1 218 ? 18.915 -1.424  -19.069 1.00 26.95 ? 225 LEU B CD1 1 
ATOM   5259 C CD2 . LEU B 1 218 ? 20.561 -1.332  -17.165 1.00 25.07 ? 225 LEU B CD2 1 
ATOM   5260 N N   . SER B 1 219 ? 23.393 1.633   -20.772 1.00 21.29 ? 226 SER B N   1 
ATOM   5261 C CA  . SER B 1 219 ? 24.440 1.711   -21.785 1.00 22.40 ? 226 SER B CA  1 
ATOM   5262 C C   . SER B 1 219 ? 25.652 2.509   -21.330 1.00 22.98 ? 226 SER B C   1 
ATOM   5263 O O   . SER B 1 219 ? 26.634 2.617   -22.060 1.00 19.78 ? 226 SER B O   1 
ATOM   5264 C CB  . SER B 1 219 ? 23.876 2.324   -23.063 1.00 20.04 ? 226 SER B CB  1 
ATOM   5265 O OG  . SER B 1 219 ? 23.270 3.573   -22.788 1.00 24.74 ? 226 SER B OG  1 
ATOM   5266 N N   . ARG B 1 220 ? 25.581 3.063   -20.125 1.00 20.79 ? 227 ARG B N   1 
ATOM   5267 C CA  . ARG B 1 220 ? 26.681 3.858   -19.590 1.00 25.12 ? 227 ARG B CA  1 
ATOM   5268 C C   . ARG B 1 220 ? 26.959 3.511   -18.127 1.00 24.67 ? 227 ARG B C   1 
ATOM   5269 O O   . ARG B 1 220 ? 26.929 4.392   -17.269 1.00 24.11 ? 227 ARG B O   1 
ATOM   5270 C CB  . ARG B 1 220 ? 26.345 5.349   -19.675 1.00 22.41 ? 227 ARG B CB  1 
ATOM   5271 C CG  . ARG B 1 220 ? 26.265 5.926   -21.068 1.00 31.31 ? 227 ARG B CG  1 
ATOM   5272 C CD  . ARG B 1 220 ? 25.504 7.239   -21.022 1.00 30.06 ? 227 ARG B CD  1 
ATOM   5273 N NE  . ARG B 1 220 ? 25.738 8.079   -22.191 1.00 39.30 ? 227 ARG B NE  1 
ATOM   5274 C CZ  . ARG B 1 220 ? 26.818 8.828   -22.349 1.00 34.29 ? 227 ARG B CZ  1 
ATOM   5275 N NH1 . ARG B 1 220 ? 27.740 8.821   -21.414 1.00 42.89 ? 227 ARG B NH1 1 
ATOM   5276 N NH2 . ARG B 1 220 ? 26.965 9.601   -23.411 1.00 34.73 ? 227 ARG B NH2 1 
ATOM   5277 N N   . PRO B 1 221 ? 27.240 2.232   -17.824 1.00 23.43 ? 228 PRO B N   1 
ATOM   5278 C CA  . PRO B 1 221 ? 27.517 1.823   -16.442 1.00 24.17 ? 228 PRO B CA  1 
ATOM   5279 C C   . PRO B 1 221 ? 28.679 2.606   -15.817 1.00 19.59 ? 228 PRO B C   1 
ATOM   5280 O O   . PRO B 1 221 ? 29.583 3.063   -16.526 1.00 19.32 ? 228 PRO B O   1 
ATOM   5281 C CB  . PRO B 1 221 ? 27.810 0.328   -16.583 1.00 24.76 ? 228 PRO B CB  1 
ATOM   5282 C CG  . PRO B 1 221 ? 28.414 0.242   -17.946 1.00 25.76 ? 228 PRO B CG  1 
ATOM   5283 C CD  . PRO B 1 221 ? 27.500 1.124   -18.757 1.00 23.15 ? 228 PRO B CD  1 
ATOM   5284 N N   . GLU B 1 222 ? 28.670 2.745   -14.494 1.00 18.24 ? 229 GLU B N   1 
ATOM   5285 C CA  . GLU B 1 222 ? 29.721 3.512   -13.834 1.00 19.70 ? 229 GLU B CA  1 
ATOM   5286 C C   . GLU B 1 222 ? 31.136 2.986   -14.056 1.00 21.05 ? 229 GLU B C   1 
ATOM   5287 O O   . GLU B 1 222 ? 32.109 3.735   -13.905 1.00 19.24 ? 229 GLU B O   1 
ATOM   5288 C CB  . GLU B 1 222 ? 29.437 3.668   -12.335 1.00 17.08 ? 229 GLU B CB  1 
ATOM   5289 C CG  . GLU B 1 222 ? 29.303 2.391   -11.525 1.00 19.81 ? 229 GLU B CG  1 
ATOM   5290 C CD  . GLU B 1 222 ? 29.210 2.685   -10.031 1.00 21.24 ? 229 GLU B CD  1 
ATOM   5291 O OE1 . GLU B 1 222 ? 30.235 3.063   -9.428  1.00 21.47 ? 229 GLU B OE1 1 
ATOM   5292 O OE2 . GLU B 1 222 ? 28.108 2.560   -9.454  1.00 20.87 ? 229 GLU B OE2 1 
ATOM   5293 N N   . GLU B 1 223 ? 31.256 1.716   -14.434 1.00 21.04 ? 230 GLU B N   1 
ATOM   5294 C CA  . GLU B 1 223 ? 32.566 1.136   -14.695 1.00 22.30 ? 230 GLU B CA  1 
ATOM   5295 C C   . GLU B 1 223 ? 33.221 1.895   -15.851 1.00 21.34 ? 230 GLU B C   1 
ATOM   5296 O O   . GLU B 1 223 ? 34.447 2.004   -15.923 1.00 22.77 ? 230 GLU B O   1 
ATOM   5297 C CB  . GLU B 1 223 ? 32.441 -0.347  -15.065 1.00 28.91 ? 230 GLU B CB  1 
ATOM   5298 C CG  . GLU B 1 223 ? 32.101 -1.314  -13.909 1.00 31.34 ? 230 GLU B CG  1 
ATOM   5299 C CD  . GLU B 1 223 ? 30.650 -1.230  -13.433 1.00 32.56 ? 230 GLU B CD  1 
ATOM   5300 O OE1 . GLU B 1 223 ? 29.811 -0.628  -14.134 1.00 31.62 ? 230 GLU B OE1 1 
ATOM   5301 O OE2 . GLU B 1 223 ? 30.345 -1.781  -12.352 1.00 32.71 ? 230 GLU B OE2 1 
ATOM   5302 N N   . LEU B 1 224 ? 32.394 2.420   -16.755 1.00 23.20 ? 231 LEU B N   1 
ATOM   5303 C CA  . LEU B 1 224 ? 32.886 3.172   -17.917 1.00 24.09 ? 231 LEU B CA  1 
ATOM   5304 C C   . LEU B 1 224 ? 33.279 4.614   -17.573 1.00 22.06 ? 231 LEU B C   1 
ATOM   5305 O O   . LEU B 1 224 ? 34.087 5.222   -18.271 1.00 23.70 ? 231 LEU B O   1 
ATOM   5306 C CB  . LEU B 1 224 ? 31.837 3.187   -19.039 1.00 24.46 ? 231 LEU B CB  1 
ATOM   5307 C CG  . LEU B 1 224 ? 31.391 1.828   -19.580 1.00 27.16 ? 231 LEU B CG  1 
ATOM   5308 C CD1 . LEU B 1 224 ? 30.648 2.035   -20.906 1.00 23.72 ? 231 LEU B CD1 1 
ATOM   5309 C CD2 . LEU B 1 224 ? 32.615 0.925   -19.787 1.00 25.31 ? 231 LEU B CD2 1 
ATOM   5310 N N   . GLU B 1 225 ? 32.695 5.162   -16.511 1.00 19.31 ? 232 GLU B N   1 
ATOM   5311 C CA  . GLU B 1 225 ? 33.037 6.514   -16.077 1.00 16.57 ? 232 GLU B CA  1 
ATOM   5312 C C   . GLU B 1 225 ? 34.349 6.392   -15.298 1.00 15.53 ? 232 GLU B C   1 
ATOM   5313 O O   . GLU B 1 225 ? 35.268 7.187   -15.480 1.00 18.89 ? 232 GLU B O   1 
ATOM   5314 C CB  . GLU B 1 225 ? 31.943 7.089   -15.165 1.00 15.55 ? 232 GLU B CB  1 
ATOM   5315 C CG  . GLU B 1 225 ? 32.307 8.429   -14.524 1.00 21.92 ? 232 GLU B CG  1 
ATOM   5316 C CD  . GLU B 1 225 ? 31.316 8.876   -13.452 1.00 19.17 ? 232 GLU B CD  1 
ATOM   5317 O OE1 . GLU B 1 225 ? 30.469 8.067   -13.028 1.00 23.56 ? 232 GLU B OE1 1 
ATOM   5318 O OE2 . GLU B 1 225 ? 31.395 10.040  -13.020 1.00 21.91 ? 232 GLU B OE2 1 
ATOM   5319 N N   . ALA B 1 226 ? 34.419 5.380   -14.434 1.00 17.06 ? 233 ALA B N   1 
ATOM   5320 C CA  . ALA B 1 226 ? 35.600 5.119   -13.608 1.00 18.99 ? 233 ALA B CA  1 
ATOM   5321 C C   . ALA B 1 226 ? 36.866 4.897   -14.451 1.00 19.47 ? 233 ALA B C   1 
ATOM   5322 O O   . ALA B 1 226 ? 37.903 5.500   -14.187 1.00 19.11 ? 233 ALA B O   1 
ATOM   5323 C CB  . ALA B 1 226 ? 35.342 3.900   -12.708 1.00 16.33 ? 233 ALA B CB  1 
ATOM   5324 N N   . GLU B 1 227 ? 36.778 4.032   -15.458 1.00 21.75 ? 234 GLU B N   1 
ATOM   5325 C CA  . GLU B 1 227 ? 37.926 3.751   -16.338 1.00 22.09 ? 234 GLU B CA  1 
ATOM   5326 C C   . GLU B 1 227 ? 38.400 5.025   -17.033 1.00 20.69 ? 234 GLU B C   1 
ATOM   5327 O O   . GLU B 1 227 ? 39.602 5.290   -17.104 1.00 22.51 ? 234 GLU B O   1 
ATOM   5328 C CB  . GLU B 1 227 ? 37.556 2.682   -17.384 1.00 20.63 ? 234 GLU B CB  1 
ATOM   5329 C CG  . GLU B 1 227 ? 38.674 2.307   -18.392 1.00 21.12 ? 234 GLU B CG  1 
ATOM   5330 C CD  . GLU B 1 227 ? 38.867 3.333   -19.498 1.00 22.64 ? 234 GLU B CD  1 
ATOM   5331 O OE1 . GLU B 1 227 ? 37.861 3.769   -20.105 1.00 30.45 ? 234 GLU B OE1 1 
ATOM   5332 O OE2 . GLU B 1 227 ? 40.022 3.703   -19.776 1.00 24.99 ? 234 GLU B OE2 1 
ATOM   5333 N N   . ALA B 1 228 ? 37.458 5.819   -17.541 1.00 23.77 ? 235 ALA B N   1 
ATOM   5334 C CA  . ALA B 1 228 ? 37.797 7.069   -18.221 1.00 19.42 ? 235 ALA B CA  1 
ATOM   5335 C C   . ALA B 1 228 ? 38.474 8.023   -17.244 1.00 20.47 ? 235 ALA B C   1 
ATOM   5336 O O   . ALA B 1 228 ? 39.439 8.703   -17.591 1.00 19.84 ? 235 ALA B O   1 
ATOM   5337 C CB  . ALA B 1 228 ? 36.547 7.711   -18.793 1.00 19.54 ? 235 ALA B CB  1 
ATOM   5338 N N   . VAL B 1 229 ? 37.955 8.080   -16.021 1.00 20.77 ? 236 VAL B N   1 
ATOM   5339 C CA  . VAL B 1 229 ? 38.531 8.941   -14.991 1.00 20.30 ? 236 VAL B CA  1 
ATOM   5340 C C   . VAL B 1 229 ? 39.957 8.492   -14.666 1.00 16.18 ? 236 VAL B C   1 
ATOM   5341 O O   . VAL B 1 229 ? 40.861 9.309   -14.545 1.00 15.83 ? 236 VAL B O   1 
ATOM   5342 C CB  . VAL B 1 229 ? 37.677 8.914   -13.704 1.00 19.68 ? 236 VAL B CB  1 
ATOM   5343 C CG1 . VAL B 1 229 ? 38.412 9.604   -12.567 1.00 16.33 ? 236 VAL B CG1 1 
ATOM   5344 C CG2 . VAL B 1 229 ? 36.348 9.618   -13.957 1.00 23.30 ? 236 VAL B CG2 1 
ATOM   5345 N N   . PHE B 1 230 ? 40.149 7.186   -14.537 1.00 17.38 ? 237 PHE B N   1 
ATOM   5346 C CA  . PHE B 1 230 ? 41.466 6.620   -14.239 1.00 20.00 ? 237 PHE B CA  1 
ATOM   5347 C C   . PHE B 1 230 ? 42.440 6.966   -15.365 1.00 16.34 ? 237 PHE B C   1 
ATOM   5348 O O   . PHE B 1 230 ? 43.569 7.385   -15.119 1.00 16.30 ? 237 PHE B O   1 
ATOM   5349 C CB  . PHE B 1 230 ? 41.362 5.095   -14.109 1.00 20.45 ? 237 PHE B CB  1 
ATOM   5350 C CG  . PHE B 1 230 ? 42.588 4.434   -13.520 1.00 27.13 ? 237 PHE B CG  1 
ATOM   5351 C CD1 . PHE B 1 230 ? 42.786 3.065   -13.667 1.00 30.79 ? 237 PHE B CD1 1 
ATOM   5352 C CD2 . PHE B 1 230 ? 43.520 5.163   -12.790 1.00 30.96 ? 237 PHE B CD2 1 
ATOM   5353 C CE1 . PHE B 1 230 ? 43.901 2.420   -13.087 1.00 35.27 ? 237 PHE B CE1 1 
ATOM   5354 C CE2 . PHE B 1 230 ? 44.641 4.528   -12.204 1.00 37.95 ? 237 PHE B CE2 1 
ATOM   5355 C CZ  . PHE B 1 230 ? 44.825 3.158   -12.357 1.00 32.86 ? 237 PHE B CZ  1 
ATOM   5356 N N   . ARG B 1 231 ? 42.001 6.810   -16.605 1.00 14.80 ? 238 ARG B N   1 
ATOM   5357 C CA  . ARG B 1 231 ? 42.880 7.105   -17.735 1.00 20.43 ? 238 ARG B CA  1 
ATOM   5358 C C   . ARG B 1 231 ? 43.225 8.589   -17.805 1.00 19.19 ? 238 ARG B C   1 
ATOM   5359 O O   . ARG B 1 231 ? 44.342 8.944   -18.164 1.00 22.64 ? 238 ARG B O   1 
ATOM   5360 C CB  . ARG B 1 231 ? 42.242 6.613   -19.047 1.00 18.94 ? 238 ARG B CB  1 
ATOM   5361 C CG  . ARG B 1 231 ? 43.040 6.907   -20.325 1.00 23.01 ? 238 ARG B CG  1 
ATOM   5362 C CD  . ARG B 1 231 ? 42.672 5.910   -21.422 1.00 22.80 ? 238 ARG B CD  1 
ATOM   5363 N NE  . ARG B 1 231 ? 41.269 5.522   -21.305 1.00 26.55 ? 238 ARG B NE  1 
ATOM   5364 C CZ  . ARG B 1 231 ? 40.274 6.100   -21.965 1.00 30.85 ? 238 ARG B CZ  1 
ATOM   5365 N NH1 . ARG B 1 231 ? 40.525 7.090   -22.814 1.00 24.49 ? 238 ARG B NH1 1 
ATOM   5366 N NH2 . ARG B 1 231 ? 39.024 5.710   -21.745 1.00 27.79 ? 238 ARG B NH2 1 
ATOM   5367 N N   . ALA B 1 232 ? 42.276 9.451   -17.443 1.00 21.56 ? 239 ALA B N   1 
ATOM   5368 C CA  . ALA B 1 232 ? 42.505 10.896  -17.464 1.00 19.66 ? 239 ALA B CA  1 
ATOM   5369 C C   . ALA B 1 232 ? 43.645 11.237  -16.510 1.00 21.21 ? 239 ALA B C   1 
ATOM   5370 O O   . ALA B 1 232 ? 44.581 11.953  -16.875 1.00 20.68 ? 239 ALA B O   1 
ATOM   5371 C CB  . ALA B 1 232 ? 41.235 11.641  -17.048 1.00 22.13 ? 239 ALA B CB  1 
ATOM   5372 N N   . ILE B 1 233 ? 43.550 10.712  -15.290 1.00 17.22 ? 240 ILE B N   1 
ATOM   5373 C CA  . ILE B 1 233 ? 44.558 10.926  -14.251 1.00 20.34 ? 240 ILE B CA  1 
ATOM   5374 C C   . ILE B 1 233 ? 45.931 10.356  -14.657 1.00 20.48 ? 240 ILE B C   1 
ATOM   5375 O O   . ILE B 1 233 ? 46.976 10.930  -14.341 1.00 21.98 ? 240 ILE B O   1 
ATOM   5376 C CB  . ILE B 1 233 ? 44.112 10.259  -12.917 1.00 17.27 ? 240 ILE B CB  1 
ATOM   5377 C CG1 . ILE B 1 233 ? 42.834 10.932  -12.407 1.00 17.99 ? 240 ILE B CG1 1 
ATOM   5378 C CG2 . ILE B 1 233 ? 45.226 10.345  -11.875 1.00 13.64 ? 240 ILE B CG2 1 
ATOM   5379 C CD1 . ILE B 1 233 ? 42.171 10.198  -11.243 1.00 19.20 ? 240 ILE B CD1 1 
ATOM   5380 N N   . ALA B 1 234 ? 45.920 9.225   -15.352 1.00 18.99 ? 241 ALA B N   1 
ATOM   5381 C CA  . ALA B 1 234 ? 47.153 8.593   -15.783 1.00 18.63 ? 241 ALA B CA  1 
ATOM   5382 C C   . ALA B 1 234 ? 47.911 9.533   -16.721 1.00 18.99 ? 241 ALA B C   1 
ATOM   5383 O O   . ALA B 1 234 ? 49.116 9.742   -16.578 1.00 18.88 ? 241 ALA B O   1 
ATOM   5384 C CB  . ALA B 1 234 ? 46.831 7.289   -16.481 1.00 21.60 ? 241 ALA B CB  1 
ATOM   5385 N N   . ILE B 1 235 ? 47.191 10.107  -17.676 1.00 18.86 ? 242 ILE B N   1 
ATOM   5386 C CA  . ILE B 1 235 ? 47.787 11.030  -18.631 1.00 17.30 ? 242 ILE B CA  1 
ATOM   5387 C C   . ILE B 1 235 ? 48.322 12.251  -17.897 1.00 20.05 ? 242 ILE B C   1 
ATOM   5388 O O   . ILE B 1 235 ? 49.432 12.711  -18.156 1.00 21.74 ? 242 ILE B O   1 
ATOM   5389 C CB  . ILE B 1 235 ? 46.743 11.480  -19.676 1.00 21.53 ? 242 ILE B CB  1 
ATOM   5390 C CG1 . ILE B 1 235 ? 46.318 10.269  -20.516 1.00 20.81 ? 242 ILE B CG1 1 
ATOM   5391 C CG2 . ILE B 1 235 ? 47.302 12.608  -20.525 1.00 17.09 ? 242 ILE B CG2 1 
ATOM   5392 C CD1 . ILE B 1 235 ? 45.224 10.550  -21.511 1.00 21.32 ? 242 ILE B CD1 1 
ATOM   5393 N N   . ALA B 1 236 ? 47.531 12.768  -16.966 1.00 20.42 ? 243 ALA B N   1 
ATOM   5394 C CA  . ALA B 1 236 ? 47.936 13.943  -16.207 1.00 19.53 ? 243 ALA B CA  1 
ATOM   5395 C C   . ALA B 1 236 ? 49.205 13.673  -15.383 1.00 22.30 ? 243 ALA B C   1 
ATOM   5396 O O   . ALA B 1 236 ? 50.063 14.549  -15.236 1.00 19.69 ? 243 ALA B O   1 
ATOM   5397 C CB  . ALA B 1 236 ? 46.795 14.385  -15.300 1.00 18.40 ? 243 ALA B CB  1 
ATOM   5398 N N   . GLY B 1 237 ? 49.315 12.463  -14.840 1.00 21.94 ? 244 GLY B N   1 
ATOM   5399 C CA  . GLY B 1 237 ? 50.486 12.109  -14.058 1.00 26.69 ? 244 GLY B CA  1 
ATOM   5400 C C   . GLY B 1 237 ? 51.758 12.131  -14.894 1.00 26.91 ? 244 GLY B C   1 
ATOM   5401 O O   . GLY B 1 237 ? 52.765 12.709  -14.484 1.00 28.88 ? 244 GLY B O   1 
ATOM   5402 N N   . ARG B 1 238 ? 51.722 11.509  -16.070 1.00 26.86 ? 245 ARG B N   1 
ATOM   5403 C CA  . ARG B 1 238 ? 52.889 11.479  -16.946 1.00 28.18 ? 245 ARG B CA  1 
ATOM   5404 C C   . ARG B 1 238 ? 53.308 12.885  -17.327 1.00 28.36 ? 245 ARG B C   1 
ATOM   5405 O O   . ARG B 1 238 ? 54.489 13.225  -17.300 1.00 29.62 ? 245 ARG B O   1 
ATOM   5406 C CB  . ARG B 1 238 ? 52.583 10.698  -18.219 1.00 34.27 ? 245 ARG B CB  1 
ATOM   5407 C CG  . ARG B 1 238 ? 52.173 9.248   -17.995 1.00 43.65 ? 245 ARG B CG  1 
ATOM   5408 C CD  . ARG B 1 238 ? 53.310 8.450   -17.384 1.00 48.50 ? 245 ARG B CD  1 
ATOM   5409 N NE  . ARG B 1 238 ? 53.644 8.894   -16.031 1.00 52.21 ? 245 ARG B NE  1 
ATOM   5410 C CZ  . ARG B 1 238 ? 54.891 9.017   -15.579 1.00 53.40 ? 245 ARG B CZ  1 
ATOM   5411 N NH1 . ARG B 1 238 ? 55.913 8.738   -16.376 1.00 49.77 ? 245 ARG B NH1 1 
ATOM   5412 N NH2 . ARG B 1 238 ? 55.121 9.410   -14.328 1.00 55.65 ? 245 ARG B NH2 1 
ATOM   5413 N N   . ILE B 1 239 ? 52.327 13.706  -17.678 1.00 28.50 ? 246 ILE B N   1 
ATOM   5414 C CA  . ILE B 1 239 ? 52.582 15.079  -18.084 1.00 24.71 ? 246 ILE B CA  1 
ATOM   5415 C C   . ILE B 1 239 ? 52.899 15.989  -16.906 1.00 21.96 ? 246 ILE B C   1 
ATOM   5416 O O   . ILE B 1 239 ? 53.646 16.965  -17.043 1.00 23.67 ? 246 ILE B O   1 
ATOM   5417 C CB  . ILE B 1 239 ? 51.351 15.655  -18.842 1.00 28.22 ? 246 ILE B CB  1 
ATOM   5418 C CG1 . ILE B 1 239 ? 51.160 14.896  -20.160 1.00 29.00 ? 246 ILE B CG1 1 
ATOM   5419 C CG2 . ILE B 1 239 ? 51.528 17.155  -19.089 1.00 22.51 ? 246 ILE B CG2 1 
ATOM   5420 C CD1 . ILE B 1 239 ? 49.854 15.206  -20.874 1.00 31.51 ? 246 ILE B CD1 1 
ATOM   5421 N N   . ASN B 1 240 ? 52.342 15.652  -15.748 1.00 23.08 ? 247 ASN B N   1 
ATOM   5422 C CA  . ASN B 1 240 ? 52.496 16.459  -14.538 1.00 22.40 ? 247 ASN B CA  1 
ATOM   5423 C C   . ASN B 1 240 ? 51.740 17.781  -14.714 1.00 23.10 ? 247 ASN B C   1 
ATOM   5424 O O   . ASN B 1 240 ? 52.334 18.860  -14.808 1.00 21.12 ? 247 ASN B O   1 
ATOM   5425 C CB  . ASN B 1 240 ? 53.970 16.748  -14.213 1.00 19.67 ? 247 ASN B CB  1 
ATOM   5426 C CG  . ASN B 1 240 ? 54.128 17.874  -13.190 1.00 23.55 ? 247 ASN B CG  1 
ATOM   5427 O OD1 . ASN B 1 240 ? 53.491 17.863  -12.137 1.00 25.36 ? 247 ASN B OD1 1 
ATOM   5428 N ND2 . ASN B 1 240 ? 54.963 18.850  -13.505 1.00 18.73 ? 247 ASN B ND2 1 
ATOM   5429 N N   . CYS B 1 241 ? 50.421 17.679  -14.787 1.00 21.18 ? 248 CYS B N   1 
ATOM   5430 C CA  . CYS B 1 241 ? 49.569 18.855  -14.927 1.00 21.75 ? 248 CYS B CA  1 
ATOM   5431 C C   . CYS B 1 241 ? 48.328 18.628  -14.082 1.00 19.80 ? 248 CYS B C   1 
ATOM   5432 O O   . CYS B 1 241 ? 47.978 17.489  -13.772 1.00 15.17 ? 248 CYS B O   1 
ATOM   5433 C CB  . CYS B 1 241 ? 49.156 19.070  -16.396 1.00 21.85 ? 248 CYS B CB  1 
ATOM   5434 S SG  . CYS B 1 241 ? 48.181 17.718  -17.134 1.00 24.96 ? 248 CYS B SG  1 
ATOM   5435 N N   . PRO B 1 242 ? 47.662 19.712  -13.668 1.00 20.16 ? 249 PRO B N   1 
ATOM   5436 C CA  . PRO B 1 242 ? 46.453 19.543  -12.861 1.00 19.01 ? 249 PRO B CA  1 
ATOM   5437 C C   . PRO B 1 242 ? 45.383 18.973  -13.772 1.00 16.78 ? 249 PRO B C   1 
ATOM   5438 O O   . PRO B 1 242 ? 45.461 19.129  -14.991 1.00 15.40 ? 249 PRO B O   1 
ATOM   5439 C CB  . PRO B 1 242 ? 46.103 20.971  -12.440 1.00 15.50 ? 249 PRO B CB  1 
ATOM   5440 C CG  . PRO B 1 242 ? 47.417 21.688  -12.493 1.00 21.03 ? 249 PRO B CG  1 
ATOM   5441 C CD  . PRO B 1 242 ? 48.047 21.131  -13.745 1.00 19.58 ? 249 PRO B CD  1 
ATOM   5442 N N   . VAL B 1 243 ? 44.403 18.300  -13.183 1.00 17.23 ? 250 VAL B N   1 
ATOM   5443 C CA  . VAL B 1 243 ? 43.293 17.759  -13.950 1.00 17.95 ? 250 VAL B CA  1 
ATOM   5444 C C   . VAL B 1 243 ? 42.036 17.837  -13.085 1.00 19.49 ? 250 VAL B C   1 
ATOM   5445 O O   . VAL B 1 243 ? 42.061 17.514  -11.893 1.00 19.58 ? 250 VAL B O   1 
ATOM   5446 C CB  . VAL B 1 243 ? 43.562 16.319  -14.418 1.00 20.03 ? 250 VAL B CB  1 
ATOM   5447 C CG1 . VAL B 1 243 ? 43.677 15.374  -13.230 1.00 21.60 ? 250 VAL B CG1 1 
ATOM   5448 C CG2 . VAL B 1 243 ? 42.475 15.893  -15.375 1.00 16.75 ? 250 VAL B CG2 1 
ATOM   5449 N N   . TYR B 1 244 ? 40.949 18.286  -13.701 1.00 15.97 ? 251 TYR B N   1 
ATOM   5450 C CA  . TYR B 1 244 ? 39.668 18.486  -13.034 1.00 17.28 ? 251 TYR B CA  1 
ATOM   5451 C C   . TYR B 1 244 ? 38.582 17.594  -13.647 1.00 18.66 ? 251 TYR B C   1 
ATOM   5452 O O   . TYR B 1 244 ? 38.287 17.683  -14.846 1.00 18.08 ? 251 TYR B O   1 
ATOM   5453 C CB  . TYR B 1 244 ? 39.328 19.971  -13.168 1.00 16.40 ? 251 TYR B CB  1 
ATOM   5454 C CG  . TYR B 1 244 ? 38.042 20.469  -12.563 1.00 13.47 ? 251 TYR B CG  1 
ATOM   5455 C CD1 . TYR B 1 244 ? 36.807 20.114  -13.097 1.00 13.44 ? 251 TYR B CD1 1 
ATOM   5456 C CD2 . TYR B 1 244 ? 38.068 21.389  -11.519 1.00 15.83 ? 251 TYR B CD2 1 
ATOM   5457 C CE1 . TYR B 1 244 ? 35.620 20.675  -12.605 1.00 18.99 ? 251 TYR B CE1 1 
ATOM   5458 C CE2 . TYR B 1 244 ? 36.901 21.952  -11.024 1.00 20.34 ? 251 TYR B CE2 1 
ATOM   5459 C CZ  . TYR B 1 244 ? 35.677 21.598  -11.571 1.00 18.12 ? 251 TYR B CZ  1 
ATOM   5460 O OH  . TYR B 1 244 ? 34.526 22.186  -11.088 1.00 15.92 ? 251 TYR B OH  1 
ATOM   5461 N N   . ILE B 1 245 ? 37.997 16.731  -12.821 1.00 13.77 ? 252 ILE B N   1 
ATOM   5462 C CA  . ILE B 1 245 ? 36.954 15.814  -13.271 1.00 14.72 ? 252 ILE B CA  1 
ATOM   5463 C C   . ILE B 1 245 ? 35.566 16.419  -13.066 1.00 16.30 ? 252 ILE B C   1 
ATOM   5464 O O   . ILE B 1 245 ? 35.109 16.554  -11.932 1.00 17.94 ? 252 ILE B O   1 
ATOM   5465 C CB  . ILE B 1 245 ? 37.016 14.474  -12.504 1.00 14.46 ? 252 ILE B CB  1 
ATOM   5466 C CG1 . ILE B 1 245 ? 38.430 13.887  -12.583 1.00 15.76 ? 252 ILE B CG1 1 
ATOM   5467 C CG2 . ILE B 1 245 ? 35.998 13.496  -13.083 1.00 13.61 ? 252 ILE B CG2 1 
ATOM   5468 C CD1 . ILE B 1 245 ? 38.929 13.651  -13.999 1.00 15.13 ? 252 ILE B CD1 1 
ATOM   5469 N N   . THR B 1 246 ? 34.897 16.786  -14.160 1.00 16.55 ? 253 THR B N   1 
ATOM   5470 C CA  . THR B 1 246 ? 33.562 17.375  -14.069 1.00 15.15 ? 253 THR B CA  1 
ATOM   5471 C C   . THR B 1 246 ? 32.512 16.290  -13.819 1.00 15.49 ? 253 THR B C   1 
ATOM   5472 O O   . THR B 1 246 ? 32.732 15.116  -14.113 1.00 15.03 ? 253 THR B O   1 
ATOM   5473 C CB  . THR B 1 246 ? 33.157 18.143  -15.388 1.00 17.20 ? 253 THR B CB  1 
ATOM   5474 O OG1 . THR B 1 246 ? 33.078 17.224  -16.482 1.00 15.32 ? 253 THR B OG1 1 
ATOM   5475 C CG2 . THR B 1 246 ? 34.171 19.218  -15.738 1.00 12.09 ? 253 THR B CG2 1 
ATOM   5476 N N   . LYS B 1 247 ? 31.383 16.700  -13.254 1.00 13.78 ? 254 LYS B N   1 
ATOM   5477 C CA  . LYS B 1 247 ? 30.248 15.821  -12.987 1.00 17.61 ? 254 LYS B CA  1 
ATOM   5478 C C   . LYS B 1 247 ? 30.488 14.407  -12.458 1.00 19.14 ? 254 LYS B C   1 
ATOM   5479 O O   . LYS B 1 247 ? 30.078 13.427  -13.083 1.00 16.12 ? 254 LYS B O   1 
ATOM   5480 C CB  . LYS B 1 247 ? 29.381 15.723  -14.248 1.00 20.57 ? 254 LYS B CB  1 
ATOM   5481 C CG  . LYS B 1 247 ? 28.885 17.064  -14.745 1.00 24.04 ? 254 LYS B CG  1 
ATOM   5482 C CD  . LYS B 1 247 ? 27.887 16.913  -15.887 1.00 28.85 ? 254 LYS B CD  1 
ATOM   5483 C CE  . LYS B 1 247 ? 28.569 16.559  -17.194 1.00 32.17 ? 254 LYS B CE  1 
ATOM   5484 N NZ  . LYS B 1 247 ? 27.602 16.655  -18.345 1.00 30.82 ? 254 LYS B NZ  1 
ATOM   5485 N N   . VAL B 1 248 ? 31.136 14.293  -11.306 1.00 20.30 ? 255 VAL B N   1 
ATOM   5486 C CA  . VAL B 1 248 ? 31.366 12.985  -10.710 1.00 19.12 ? 255 VAL B CA  1 
ATOM   5487 C C   . VAL B 1 248 ? 29.994 12.435  -10.298 1.00 18.81 ? 255 VAL B C   1 
ATOM   5488 O O   . VAL B 1 248 ? 29.307 13.017  -9.459  1.00 19.23 ? 255 VAL B O   1 
ATOM   5489 C CB  . VAL B 1 248 ? 32.269 13.096  -9.469  1.00 16.32 ? 255 VAL B CB  1 
ATOM   5490 C CG1 . VAL B 1 248 ? 32.387 11.738  -8.791  1.00 19.53 ? 255 VAL B CG1 1 
ATOM   5491 C CG2 . VAL B 1 248 ? 33.637 13.612  -9.873  1.00 15.03 ? 255 VAL B CG2 1 
ATOM   5492 N N   . MET B 1 249 ? 29.590 11.322  -10.892 1.00 16.22 ? 256 MET B N   1 
ATOM   5493 C CA  . MET B 1 249 ? 28.289 10.754  -10.573 1.00 18.82 ? 256 MET B CA  1 
ATOM   5494 C C   . MET B 1 249 ? 28.288 9.412   -9.848  1.00 19.98 ? 256 MET B C   1 
ATOM   5495 O O   . MET B 1 249 ? 27.240 8.981   -9.364  1.00 23.80 ? 256 MET B O   1 
ATOM   5496 C CB  . MET B 1 249 ? 27.446 10.633  -11.851 1.00 18.71 ? 256 MET B CB  1 
ATOM   5497 C CG  . MET B 1 249 ? 26.225 11.580  -11.874 1.00 27.96 ? 256 MET B CG  1 
ATOM   5498 S SD  . MET B 1 249 ? 26.534 13.271  -12.401 1.00 5.17  ? 256 MET B SD  1 
ATOM   5499 C CE  . MET B 1 249 ? 27.411 13.837  -11.296 1.00 19.81 ? 256 MET B CE  1 
ATOM   5500 N N   . SER B 1 250 ? 29.439 8.752   -9.749  1.00 15.14 ? 257 SER B N   1 
ATOM   5501 C CA  . SER B 1 250 ? 29.465 7.442   -9.106  1.00 18.37 ? 257 SER B CA  1 
ATOM   5502 C C   . SER B 1 250 ? 30.483 7.216   -7.991  1.00 19.40 ? 257 SER B C   1 
ATOM   5503 O O   . SER B 1 250 ? 31.497 7.908   -7.893  1.00 17.54 ? 257 SER B O   1 
ATOM   5504 C CB  . SER B 1 250 ? 29.655 6.356   -10.169 1.00 19.19 ? 257 SER B CB  1 
ATOM   5505 O OG  . SER B 1 250 ? 30.947 6.415   -10.744 1.00 14.79 ? 257 SER B OG  1 
ATOM   5506 N N   . LYS B 1 251 ? 30.184 6.228   -7.151  1.00 19.10 ? 258 LYS B N   1 
ATOM   5507 C CA  . LYS B 1 251 ? 31.045 5.852   -6.046  1.00 18.91 ? 258 LYS B CA  1 
ATOM   5508 C C   . LYS B 1 251 ? 32.362 5.337   -6.618  1.00 20.25 ? 258 LYS B C   1 
ATOM   5509 O O   . LYS B 1 251 ? 33.430 5.634   -6.085  1.00 18.42 ? 258 LYS B O   1 
ATOM   5510 C CB  . LYS B 1 251 ? 30.364 4.772   -5.203  1.00 17.28 ? 258 LYS B CB  1 
ATOM   5511 C CG  . LYS B 1 251 ? 29.134 5.279   -4.472  1.00 21.29 ? 258 LYS B CG  1 
ATOM   5512 C CD  . LYS B 1 251 ? 28.273 4.151   -3.943  1.00 25.62 ? 258 LYS B CD  1 
ATOM   5513 C CE  . LYS B 1 251 ? 29.006 3.268   -2.969  1.00 23.81 ? 258 LYS B CE  1 
ATOM   5514 N NZ  . LYS B 1 251 ? 28.113 2.151   -2.510  1.00 22.98 ? 258 LYS B NZ  1 
ATOM   5515 N N   . SER B 1 252 ? 32.273 4.583   -7.715  1.00 18.98 ? 259 SER B N   1 
ATOM   5516 C CA  . SER B 1 252 ? 33.453 4.034   -8.395  1.00 19.70 ? 259 SER B CA  1 
ATOM   5517 C C   . SER B 1 252 ? 34.385 5.135   -8.868  1.00 18.74 ? 259 SER B C   1 
ATOM   5518 O O   . SER B 1 252 ? 35.589 5.075   -8.647  1.00 18.49 ? 259 SER B O   1 
ATOM   5519 C CB  . SER B 1 252 ? 33.042 3.208   -9.618  1.00 19.00 ? 259 SER B CB  1 
ATOM   5520 O OG  . SER B 1 252 ? 32.584 1.936   -9.225  1.00 27.05 ? 259 SER B OG  1 
ATOM   5521 N N   . ALA B 1 253 ? 33.818 6.129   -9.544  1.00 17.91 ? 260 ALA B N   1 
ATOM   5522 C CA  . ALA B 1 253 ? 34.601 7.234   -10.055 1.00 18.27 ? 260 ALA B CA  1 
ATOM   5523 C C   . ALA B 1 253 ? 35.182 8.054   -8.907  1.00 15.03 ? 260 ALA B C   1 
ATOM   5524 O O   . ALA B 1 253 ? 36.317 8.485   -8.979  1.00 16.13 ? 260 ALA B O   1 
ATOM   5525 C CB  . ALA B 1 253 ? 33.741 8.116   -10.964 1.00 20.10 ? 260 ALA B CB  1 
ATOM   5526 N N   . ALA B 1 254 ? 34.402 8.257   -7.849  1.00 17.84 ? 261 ALA B N   1 
ATOM   5527 C CA  . ALA B 1 254 ? 34.866 9.022   -6.694  1.00 18.36 ? 261 ALA B CA  1 
ATOM   5528 C C   . ALA B 1 254 ? 36.040 8.311   -6.003  1.00 18.76 ? 261 ALA B C   1 
ATOM   5529 O O   . ALA B 1 254 ? 36.992 8.959   -5.558  1.00 20.70 ? 261 ALA B O   1 
ATOM   5530 C CB  . ALA B 1 254 ? 33.720 9.240   -5.712  1.00 9.62  ? 261 ALA B CB  1 
ATOM   5531 N N   . ASP B 1 255 ? 35.979 6.983   -5.928  1.00 19.95 ? 262 ASP B N   1 
ATOM   5532 C CA  . ASP B 1 255 ? 37.052 6.207   -5.303  1.00 20.18 ? 262 ASP B CA  1 
ATOM   5533 C C   . ASP B 1 255 ? 38.351 6.277   -6.101  1.00 17.45 ? 262 ASP B C   1 
ATOM   5534 O O   . ASP B 1 255 ? 39.435 6.252   -5.522  1.00 17.07 ? 262 ASP B O   1 
ATOM   5535 C CB  . ASP B 1 255 ? 36.633 4.739   -5.125  1.00 21.95 ? 262 ASP B CB  1 
ATOM   5536 C CG  . ASP B 1 255 ? 35.675 4.541   -3.957  1.00 18.08 ? 262 ASP B CG  1 
ATOM   5537 O OD1 . ASP B 1 255 ? 35.738 5.344   -3.009  1.00 18.86 ? 262 ASP B OD1 1 
ATOM   5538 O OD2 . ASP B 1 255 ? 34.875 3.579   -3.978  1.00 21.17 ? 262 ASP B OD2 1 
ATOM   5539 N N   . ILE B 1 256 ? 38.251 6.363   -7.426  1.00 16.03 ? 263 ILE B N   1 
ATOM   5540 C CA  . ILE B 1 256 ? 39.447 6.460   -8.268  1.00 15.96 ? 263 ILE B CA  1 
ATOM   5541 C C   . ILE B 1 256 ? 40.187 7.762   -7.916  1.00 17.42 ? 263 ILE B C   1 
ATOM   5542 O O   . ILE B 1 256 ? 41.389 7.763   -7.646  1.00 16.15 ? 263 ILE B O   1 
ATOM   5543 C CB  . ILE B 1 256 ? 39.082 6.472   -9.782  1.00 19.85 ? 263 ILE B CB  1 
ATOM   5544 C CG1 . ILE B 1 256 ? 38.451 5.139   -10.189 1.00 20.18 ? 263 ILE B CG1 1 
ATOM   5545 C CG2 . ILE B 1 256 ? 40.339 6.703   -10.628 1.00 17.45 ? 263 ILE B CG2 1 
ATOM   5546 C CD1 . ILE B 1 256 ? 39.428 3.972   -10.173 1.00 23.38 ? 263 ILE B CD1 1 
ATOM   5547 N N   . ILE B 1 257 ? 39.451 8.871   -7.908  1.00 20.92 ? 264 ILE B N   1 
ATOM   5548 C CA  . ILE B 1 257 ? 40.018 10.179  -7.580  1.00 12.82 ? 264 ILE B CA  1 
ATOM   5549 C C   . ILE B 1 257 ? 40.648 10.155  -6.184  1.00 16.03 ? 264 ILE B C   1 
ATOM   5550 O O   . ILE B 1 257 ? 41.774 10.611  -5.998  1.00 15.55 ? 264 ILE B O   1 
ATOM   5551 C CB  . ILE B 1 257 ? 38.914 11.269  -7.640  1.00 14.04 ? 264 ILE B CB  1 
ATOM   5552 C CG1 . ILE B 1 257 ? 38.348 11.338  -9.061  1.00 15.07 ? 264 ILE B CG1 1 
ATOM   5553 C CG2 . ILE B 1 257 ? 39.467 12.620  -7.194  1.00 11.13 ? 264 ILE B CG2 1 
ATOM   5554 C CD1 . ILE B 1 257 ? 37.219 12.323  -9.238  1.00 12.89 ? 264 ILE B CD1 1 
ATOM   5555 N N   . ALA B 1 258 ? 39.918 9.606   -5.216  1.00 17.09 ? 265 ALA B N   1 
ATOM   5556 C CA  . ALA B 1 258 ? 40.387 9.510   -3.831  1.00 19.25 ? 265 ALA B CA  1 
ATOM   5557 C C   . ALA B 1 258 ? 41.733 8.791   -3.717  1.00 20.23 ? 265 ALA B C   1 
ATOM   5558 O O   . ALA B 1 258 ? 42.644 9.263   -3.031  1.00 19.79 ? 265 ALA B O   1 
ATOM   5559 C CB  . ALA B 1 258 ? 39.338 8.788   -2.975  1.00 18.22 ? 265 ALA B CB  1 
ATOM   5560 N N   . LEU B 1 259 ? 41.853 7.641   -4.375  1.00 19.03 ? 266 LEU B N   1 
ATOM   5561 C CA  . LEU B 1 259 ? 43.102 6.876   -4.348  1.00 21.82 ? 266 LEU B CA  1 
ATOM   5562 C C   . LEU B 1 259 ? 44.245 7.679   -4.982  1.00 20.47 ? 266 LEU B C   1 
ATOM   5563 O O   . LEU B 1 259 ? 45.367 7.692   -4.462  1.00 21.81 ? 266 LEU B O   1 
ATOM   5564 C CB  . LEU B 1 259 ? 42.928 5.537   -5.087  1.00 21.42 ? 266 LEU B CB  1 
ATOM   5565 C CG  . LEU B 1 259 ? 44.182 4.646   -5.211  1.00 31.71 ? 266 LEU B CG  1 
ATOM   5566 C CD1 . LEU B 1 259 ? 44.697 4.258   -3.826  1.00 27.20 ? 266 LEU B CD1 1 
ATOM   5567 C CD2 . LEU B 1 259 ? 43.853 3.396   -6.024  1.00 29.62 ? 266 LEU B CD2 1 
ATOM   5568 N N   . ALA B 1 260 ? 43.943 8.371   -6.085  1.00 20.31 ? 267 ALA B N   1 
ATOM   5569 C CA  . ALA B 1 260 ? 44.936 9.166   -6.806  1.00 16.78 ? 267 ALA B CA  1 
ATOM   5570 C C   . ALA B 1 260 ? 45.458 10.365  -6.025  1.00 18.74 ? 267 ALA B C   1 
ATOM   5571 O O   . ALA B 1 260 ? 46.615 10.766  -6.196  1.00 16.29 ? 267 ALA B O   1 
ATOM   5572 C CB  . ALA B 1 260 ? 44.365 9.637   -8.139  1.00 14.89 ? 267 ALA B CB  1 
ATOM   5573 N N   . ARG B 1 261 ? 44.610 10.948  -5.182  1.00 16.56 ? 268 ARG B N   1 
ATOM   5574 C CA  . ARG B 1 261 ? 45.021 12.100  -4.387  1.00 18.47 ? 268 ARG B CA  1 
ATOM   5575 C C   . ARG B 1 261 ? 46.130 11.727  -3.401  1.00 21.17 ? 268 ARG B C   1 
ATOM   5576 O O   . ARG B 1 261 ? 47.058 12.504  -3.171  1.00 19.96 ? 268 ARG B O   1 
ATOM   5577 C CB  . ARG B 1 261 ? 43.824 12.689  -3.629  1.00 16.91 ? 268 ARG B CB  1 
ATOM   5578 C CG  . ARG B 1 261 ? 42.753 13.308  -4.523  1.00 18.16 ? 268 ARG B CG  1 
ATOM   5579 C CD  . ARG B 1 261 ? 41.743 14.147  -3.730  1.00 18.47 ? 268 ARG B CD  1 
ATOM   5580 N NE  . ARG B 1 261 ? 42.393 15.223  -2.984  1.00 16.24 ? 268 ARG B NE  1 
ATOM   5581 C CZ  . ARG B 1 261 ? 42.609 15.205  -1.670  1.00 25.20 ? 268 ARG B CZ  1 
ATOM   5582 N NH1 . ARG B 1 261 ? 42.215 14.163  -0.941  1.00 19.94 ? 268 ARG B NH1 1 
ATOM   5583 N NH2 . ARG B 1 261 ? 43.235 16.221  -1.083  1.00 18.97 ? 268 ARG B NH2 1 
ATOM   5584 N N   . LYS B 1 262 ? 46.036 10.534  -2.822  1.00 22.72 ? 269 LYS B N   1 
ATOM   5585 C CA  . LYS B 1 262 ? 47.045 10.090  -1.871  1.00 28.28 ? 269 LYS B CA  1 
ATOM   5586 C C   . LYS B 1 262 ? 48.349 9.744   -2.584  1.00 29.27 ? 269 LYS B C   1 
ATOM   5587 O O   . LYS B 1 262 ? 49.417 9.776   -1.978  1.00 28.02 ? 269 LYS B O   1 
ATOM   5588 C CB  . LYS B 1 262 ? 46.534 8.874   -1.075  1.00 33.24 ? 269 LYS B CB  1 
ATOM   5589 C CG  . LYS B 1 262 ? 45.168 9.110   -0.430  1.00 40.04 ? 269 LYS B CG  1 
ATOM   5590 C CD  . LYS B 1 262 ? 44.922 8.247   0.806   1.00 51.42 ? 269 LYS B CD  1 
ATOM   5591 C CE  . LYS B 1 262 ? 44.954 6.757   0.495   1.00 57.84 ? 269 LYS B CE  1 
ATOM   5592 N NZ  . LYS B 1 262 ? 46.317 6.270   0.073   1.00 62.37 ? 269 LYS B NZ  1 
ATOM   5593 N N   . LYS B 1 263 ? 48.262 9.440   -3.877  1.00 30.75 ? 270 LYS B N   1 
ATOM   5594 C CA  . LYS B 1 263 ? 49.440 9.075   -4.649  1.00 33.42 ? 270 LYS B CA  1 
ATOM   5595 C C   . LYS B 1 263 ? 50.248 10.236  -5.215  1.00 33.99 ? 270 LYS B C   1 
ATOM   5596 O O   . LYS B 1 263 ? 51.390 10.040  -5.633  1.00 36.54 ? 270 LYS B O   1 
ATOM   5597 C CB  . LYS B 1 263 ? 49.053 8.128   -5.786  1.00 36.25 ? 270 LYS B CB  1 
ATOM   5598 C CG  . LYS B 1 263 ? 48.575 6.758   -5.310  1.00 39.56 ? 270 LYS B CG  1 
ATOM   5599 C CD  . LYS B 1 263 ? 48.279 5.854   -6.504  1.00 45.03 ? 270 LYS B CD  1 
ATOM   5600 C CE  . LYS B 1 263 ? 47.834 4.473   -6.067  1.00 43.43 ? 270 LYS B CE  1 
ATOM   5601 N NZ  . LYS B 1 263 ? 47.765 3.565   -7.242  1.00 44.14 ? 270 LYS B NZ  1 
ATOM   5602 N N   . GLY B 1 264 ? 49.674 11.435  -5.253  1.00 33.98 ? 271 GLY B N   1 
ATOM   5603 C CA  . GLY B 1 264 ? 50.434 12.563  -5.771  1.00 32.78 ? 271 GLY B CA  1 
ATOM   5604 C C   . GLY B 1 264 ? 49.771 13.412  -6.843  1.00 30.35 ? 271 GLY B C   1 
ATOM   5605 O O   . GLY B 1 264 ? 49.688 14.633  -6.682  1.00 33.19 ? 271 GLY B O   1 
ATOM   5606 N N   . PRO B 1 265 ? 49.298 12.811  -7.947  1.00 28.61 ? 272 PRO B N   1 
ATOM   5607 C CA  . PRO B 1 265 ? 48.642 13.540  -9.045  1.00 27.32 ? 272 PRO B CA  1 
ATOM   5608 C C   . PRO B 1 265 ? 47.648 14.601  -8.560  1.00 25.59 ? 272 PRO B C   1 
ATOM   5609 O O   . PRO B 1 265 ? 46.854 14.353  -7.643  1.00 25.13 ? 272 PRO B O   1 
ATOM   5610 C CB  . PRO B 1 265 ? 47.962 12.424  -9.832  1.00 26.67 ? 272 PRO B CB  1 
ATOM   5611 C CG  . PRO B 1 265 ? 48.940 11.290  -9.659  1.00 28.02 ? 272 PRO B CG  1 
ATOM   5612 C CD  . PRO B 1 265 ? 49.252 11.359  -8.187  1.00 25.99 ? 272 PRO B CD  1 
ATOM   5613 N N   . LEU B 1 266 ? 47.699 15.777  -9.180  1.00 21.18 ? 273 LEU B N   1 
ATOM   5614 C CA  . LEU B 1 266 ? 46.820 16.882  -8.814  1.00 21.85 ? 273 LEU B CA  1 
ATOM   5615 C C   . LEU B 1 266 ? 45.447 16.753  -9.474  1.00 20.71 ? 273 LEU B C   1 
ATOM   5616 O O   . LEU B 1 266 ? 45.185 17.365  -10.511 1.00 21.25 ? 273 LEU B O   1 
ATOM   5617 C CB  . LEU B 1 266 ? 47.467 18.205  -9.222  1.00 20.40 ? 273 LEU B CB  1 
ATOM   5618 C CG  . LEU B 1 266 ? 48.900 18.430  -8.732  1.00 29.22 ? 273 LEU B CG  1 
ATOM   5619 C CD1 . LEU B 1 266 ? 49.475 19.666  -9.397  1.00 29.07 ? 273 LEU B CD1 1 
ATOM   5620 C CD2 . LEU B 1 266 ? 48.927 18.577  -7.218  1.00 24.90 ? 273 LEU B CD2 1 
ATOM   5621 N N   . VAL B 1 267 ? 44.564 15.973  -8.859  1.00 18.89 ? 274 VAL B N   1 
ATOM   5622 C CA  . VAL B 1 267 ? 43.231 15.760  -9.410  1.00 21.13 ? 274 VAL B CA  1 
ATOM   5623 C C   . VAL B 1 267 ? 42.123 16.377  -8.561  1.00 22.50 ? 274 VAL B C   1 
ATOM   5624 O O   . VAL B 1 267 ? 42.103 16.208  -7.345  1.00 21.66 ? 274 VAL B O   1 
ATOM   5625 C CB  . VAL B 1 267 ? 42.947 14.256  -9.556  1.00 23.11 ? 274 VAL B CB  1 
ATOM   5626 C CG1 . VAL B 1 267 ? 43.217 13.564  -8.244  1.00 21.94 ? 274 VAL B CG1 1 
ATOM   5627 C CG2 . VAL B 1 267 ? 41.507 14.028  -9.991  1.00 17.70 ? 274 VAL B CG2 1 
ATOM   5628 N N   . PHE B 1 268 ? 41.200 17.081  -9.213  1.00 19.92 ? 275 PHE B N   1 
ATOM   5629 C CA  . PHE B 1 268 ? 40.069 17.700  -8.521  1.00 19.71 ? 275 PHE B CA  1 
ATOM   5630 C C   . PHE B 1 268 ? 38.769 17.064  -9.001  1.00 18.19 ? 275 PHE B C   1 
ATOM   5631 O O   . PHE B 1 268 ? 38.627 16.756  -10.187 1.00 16.81 ? 275 PHE B O   1 
ATOM   5632 C CB  . PHE B 1 268 ? 40.032 19.207  -8.783  1.00 18.16 ? 275 PHE B CB  1 
ATOM   5633 C CG  . PHE B 1 268 ? 41.254 19.930  -8.309  1.00 21.13 ? 275 PHE B CG  1 
ATOM   5634 C CD1 . PHE B 1 268 ? 42.446 19.859  -9.026  1.00 22.45 ? 275 PHE B CD1 1 
ATOM   5635 C CD2 . PHE B 1 268 ? 41.226 20.665  -7.130  1.00 20.36 ? 275 PHE B CD2 1 
ATOM   5636 C CE1 . PHE B 1 268 ? 43.594 20.516  -8.571  1.00 25.21 ? 275 PHE B CE1 1 
ATOM   5637 C CE2 . PHE B 1 268 ? 42.362 21.318  -6.671  1.00 23.08 ? 275 PHE B CE2 1 
ATOM   5638 C CZ  . PHE B 1 268 ? 43.551 21.245  -7.392  1.00 22.51 ? 275 PHE B CZ  1 
ATOM   5639 N N   . GLY B 1 269 ? 37.826 16.873  -8.078  1.00 14.76 ? 276 GLY B N   1 
ATOM   5640 C CA  . GLY B 1 269 ? 36.555 16.258  -8.413  1.00 13.25 ? 276 GLY B CA  1 
ATOM   5641 C C   . GLY B 1 269 ? 35.361 17.180  -8.252  1.00 15.71 ? 276 GLY B C   1 
ATOM   5642 O O   . GLY B 1 269 ? 35.240 17.887  -7.246  1.00 16.18 ? 276 GLY B O   1 
ATOM   5643 N N   . GLU B 1 270 ? 34.454 17.140  -9.227  1.00 14.09 ? 277 GLU B N   1 
ATOM   5644 C CA  . GLU B 1 270 ? 33.276 18.001  -9.219  1.00 14.36 ? 277 GLU B CA  1 
ATOM   5645 C C   . GLU B 1 270 ? 31.900 17.312  -9.198  1.00 18.33 ? 277 GLU B C   1 
ATOM   5646 O O   . GLU B 1 270 ? 31.293 17.080  -10.243 1.00 13.95 ? 277 GLU B O   1 
ATOM   5647 C CB  . GLU B 1 270 ? 33.330 18.926  -10.437 1.00 16.77 ? 277 GLU B CB  1 
ATOM   5648 C CG  . GLU B 1 270 ? 32.182 19.916  -10.558 1.00 17.75 ? 277 GLU B CG  1 
ATOM   5649 C CD  . GLU B 1 270 ? 31.946 20.355  -11.998 1.00 15.17 ? 277 GLU B CD  1 
ATOM   5650 O OE1 . GLU B 1 270 ? 31.214 19.644  -12.724 1.00 13.81 ? 277 GLU B OE1 1 
ATOM   5651 O OE2 . GLU B 1 270 ? 32.504 21.401  -12.395 1.00 10.86 ? 277 GLU B OE2 1 
ATOM   5652 N N   . PRO B 1 271 ? 31.402 16.951  -8.010  1.00 15.57 ? 278 PRO B N   1 
ATOM   5653 C CA  . PRO B 1 271 ? 30.081 16.318  -8.014  1.00 16.00 ? 278 PRO B CA  1 
ATOM   5654 C C   . PRO B 1 271 ? 29.065 17.443  -8.240  1.00 15.44 ? 278 PRO B C   1 
ATOM   5655 O O   . PRO B 1 271 ? 29.378 18.605  -7.983  1.00 16.17 ? 278 PRO B O   1 
ATOM   5656 C CB  . PRO B 1 271 ? 29.979 15.727  -6.614  1.00 16.22 ? 278 PRO B CB  1 
ATOM   5657 C CG  . PRO B 1 271 ? 30.824 16.679  -5.784  1.00 20.55 ? 278 PRO B CG  1 
ATOM   5658 C CD  . PRO B 1 271 ? 32.023 16.884  -6.677  1.00 18.53 ? 278 PRO B CD  1 
ATOM   5659 N N   . ILE B 1 272 ? 27.878 17.118  -8.742  1.00 13.56 ? 279 ILE B N   1 
ATOM   5660 C CA  . ILE B 1 272 ? 26.856 18.141  -8.951  1.00 16.26 ? 279 ILE B CA  1 
ATOM   5661 C C   . ILE B 1 272 ? 25.644 17.857  -8.074  1.00 17.55 ? 279 ILE B C   1 
ATOM   5662 O O   . ILE B 1 272 ? 25.547 16.787  -7.464  1.00 17.37 ? 279 ILE B O   1 
ATOM   5663 C CB  . ILE B 1 272 ? 26.393 18.239  -10.432 1.00 17.49 ? 279 ILE B CB  1 
ATOM   5664 C CG1 . ILE B 1 272 ? 25.944 16.865  -10.942 1.00 14.00 ? 279 ILE B CG1 1 
ATOM   5665 C CG2 . ILE B 1 272 ? 27.508 18.844  -11.280 1.00 14.59 ? 279 ILE B CG2 1 
ATOM   5666 C CD1 . ILE B 1 272 ? 25.419 16.875  -12.353 1.00 13.32 ? 279 ILE B CD1 1 
ATOM   5667 N N   . ALA B 1 273 ? 24.731 18.824  -8.009  1.00 17.09 ? 280 ALA B N   1 
ATOM   5668 C CA  . ALA B 1 273 ? 23.529 18.695  -7.196  1.00 17.14 ? 280 ALA B CA  1 
ATOM   5669 C C   . ALA B 1 273 ? 22.820 17.373  -7.443  1.00 16.09 ? 280 ALA B C   1 
ATOM   5670 O O   . ALA B 1 273 ? 22.454 16.676  -6.502  1.00 16.61 ? 280 ALA B O   1 
ATOM   5671 C CB  . ALA B 1 273 ? 22.581 19.849  -7.475  1.00 14.93 ? 280 ALA B CB  1 
ATOM   5672 N N   . ALA B 1 274 ? 22.637 17.040  -8.716  1.00 15.88 ? 281 ALA B N   1 
ATOM   5673 C CA  . ALA B 1 274 ? 21.974 15.803  -9.113  1.00 20.13 ? 281 ALA B CA  1 
ATOM   5674 C C   . ALA B 1 274 ? 22.525 14.551  -8.427  1.00 19.30 ? 281 ALA B C   1 
ATOM   5675 O O   . ALA B 1 274 ? 21.766 13.806  -7.806  1.00 21.72 ? 281 ALA B O   1 
ATOM   5676 C CB  . ALA B 1 274 ? 22.054 15.634  -10.628 1.00 22.05 ? 281 ALA B CB  1 
ATOM   5677 N N   . SER B 1 275 ? 23.834 14.318  -8.539  1.00 21.22 ? 282 SER B N   1 
ATOM   5678 C CA  . SER B 1 275 ? 24.435 13.129  -7.932  1.00 18.59 ? 282 SER B CA  1 
ATOM   5679 C C   . SER B 1 275 ? 24.486 13.187  -6.409  1.00 20.19 ? 282 SER B C   1 
ATOM   5680 O O   . SER B 1 275 ? 24.544 12.150  -5.749  1.00 21.70 ? 282 SER B O   1 
ATOM   5681 C CB  . SER B 1 275 ? 25.840 12.858  -8.508  1.00 16.76 ? 282 SER B CB  1 
ATOM   5682 O OG  . SER B 1 275 ? 26.765 13.902  -8.248  1.00 15.62 ? 282 SER B OG  1 
ATOM   5683 N N   . LEU B 1 276 ? 24.444 14.391  -5.847  1.00 18.37 ? 283 LEU B N   1 
ATOM   5684 C CA  . LEU B 1 276 ? 24.464 14.548  -4.397  1.00 19.33 ? 283 LEU B CA  1 
ATOM   5685 C C   . LEU B 1 276 ? 23.075 14.442  -3.757  1.00 18.83 ? 283 LEU B C   1 
ATOM   5686 O O   . LEU B 1 276 ? 22.960 14.101  -2.581  1.00 17.20 ? 283 LEU B O   1 
ATOM   5687 C CB  . LEU B 1 276 ? 25.067 15.905  -4.015  1.00 14.46 ? 283 LEU B CB  1 
ATOM   5688 C CG  . LEU B 1 276 ? 26.524 16.124  -4.403  1.00 16.38 ? 283 LEU B CG  1 
ATOM   5689 C CD1 . LEU B 1 276 ? 26.941 17.575  -4.159  1.00 21.02 ? 283 LEU B CD1 1 
ATOM   5690 C CD2 . LEU B 1 276 ? 27.375 15.175  -3.599  1.00 18.42 ? 283 LEU B CD2 1 
ATOM   5691 N N   . GLY B 1 277 ? 22.029 14.729  -4.528  1.00 17.40 ? 284 GLY B N   1 
ATOM   5692 C CA  . GLY B 1 277 ? 20.687 14.706  -3.970  1.00 19.37 ? 284 GLY B CA  1 
ATOM   5693 C C   . GLY B 1 277 ? 19.647 13.715  -4.467  1.00 22.37 ? 284 GLY B C   1 
ATOM   5694 O O   . GLY B 1 277 ? 18.535 13.690  -3.952  1.00 22.08 ? 284 GLY B O   1 
ATOM   5695 N N   . THR B 1 278 ? 19.975 12.906  -5.464  1.00 20.79 ? 285 THR B N   1 
ATOM   5696 C CA  . THR B 1 278 ? 19.020 11.927  -5.964  1.00 19.76 ? 285 THR B CA  1 
ATOM   5697 C C   . THR B 1 278 ? 19.788 10.775  -6.607  1.00 19.25 ? 285 THR B C   1 
ATOM   5698 O O   . THR B 1 278 ? 21.014 10.701  -6.480  1.00 17.79 ? 285 THR B O   1 
ATOM   5699 C CB  . THR B 1 278 ? 18.032 12.572  -6.985  1.00 21.13 ? 285 THR B CB  1 
ATOM   5700 O OG1 . THR B 1 278 ? 16.946 11.672  -7.234  1.00 23.00 ? 285 THR B OG1 1 
ATOM   5701 C CG2 . THR B 1 278 ? 18.719 12.882  -8.296  1.00 19.57 ? 285 THR B CG2 1 
ATOM   5702 N N   . ASP B 1 279 ? 19.075 9.869   -7.269  1.00 18.27 ? 286 ASP B N   1 
ATOM   5703 C CA  . ASP B 1 279 ? 19.717 8.738   -7.932  1.00 20.51 ? 286 ASP B CA  1 
ATOM   5704 C C   . ASP B 1 279 ? 19.002 8.369   -9.231  1.00 22.08 ? 286 ASP B C   1 
ATOM   5705 O O   . ASP B 1 279 ? 17.974 8.960   -9.574  1.00 18.89 ? 286 ASP B O   1 
ATOM   5706 C CB  . ASP B 1 279 ? 19.787 7.519   -7.001  1.00 19.39 ? 286 ASP B CB  1 
ATOM   5707 C CG  . ASP B 1 279 ? 18.422 7.010   -6.592  1.00 20.35 ? 286 ASP B CG  1 
ATOM   5708 O OD1 . ASP B 1 279 ? 17.551 6.834   -7.473  1.00 23.20 ? 286 ASP B OD1 1 
ATOM   5709 O OD2 . ASP B 1 279 ? 18.220 6.773   -5.384  1.00 22.27 ? 286 ASP B OD2 1 
ATOM   5710 N N   . GLY B 1 280 ? 19.546 7.378   -9.937  1.00 22.17 ? 287 GLY B N   1 
ATOM   5711 C CA  . GLY B 1 280 ? 18.988 6.966   -11.212 1.00 21.91 ? 287 GLY B CA  1 
ATOM   5712 C C   . GLY B 1 280 ? 17.881 5.932   -11.228 1.00 21.79 ? 287 GLY B C   1 
ATOM   5713 O O   . GLY B 1 280 ? 17.545 5.409   -12.292 1.00 22.93 ? 287 GLY B O   1 
ATOM   5714 N N   . THR B 1 281 ? 17.303 5.621   -10.079 1.00 19.51 ? 288 THR B N   1 
ATOM   5715 C CA  . THR B 1 281 ? 16.230 4.648   -10.068 1.00 21.32 ? 288 THR B CA  1 
ATOM   5716 C C   . THR B 1 281 ? 15.050 5.153   -10.907 1.00 24.46 ? 288 THR B C   1 
ATOM   5717 O O   . THR B 1 281 ? 14.251 4.361   -11.409 1.00 23.73 ? 288 THR B O   1 
ATOM   5718 C CB  . THR B 1 281 ? 15.739 4.369   -8.637  1.00 23.20 ? 288 THR B CB  1 
ATOM   5719 O OG1 . THR B 1 281 ? 15.423 5.609   -7.986  1.00 23.04 ? 288 THR B OG1 1 
ATOM   5720 C CG2 . THR B 1 281 ? 16.813 3.625   -7.836  1.00 25.82 ? 288 THR B CG2 1 
ATOM   5721 N N   . HIS B 1 282 ? 14.965 6.470   -11.076 1.00 24.04 ? 289 HIS B N   1 
ATOM   5722 C CA  . HIS B 1 282 ? 13.874 7.086   -11.818 1.00 24.65 ? 289 HIS B CA  1 
ATOM   5723 C C   . HIS B 1 282 ? 13.867 6.845   -13.324 1.00 25.00 ? 289 HIS B C   1 
ATOM   5724 O O   . HIS B 1 282 ? 12.863 7.114   -13.996 1.00 23.08 ? 289 HIS B O   1 
ATOM   5725 C CB  . HIS B 1 282 ? 13.843 8.575   -11.492 1.00 24.43 ? 289 HIS B CB  1 
ATOM   5726 C CG  . HIS B 1 282 ? 13.745 8.845   -10.024 1.00 24.40 ? 289 HIS B CG  1 
ATOM   5727 N ND1 . HIS B 1 282 ? 12.584 8.637   -9.306  1.00 26.16 ? 289 HIS B ND1 1 
ATOM   5728 C CD2 . HIS B 1 282 ? 14.688 9.202   -9.118  1.00 22.78 ? 289 HIS B CD2 1 
ATOM   5729 C CE1 . HIS B 1 282 ? 12.818 8.850   -8.023  1.00 23.69 ? 289 HIS B CE1 1 
ATOM   5730 N NE2 . HIS B 1 282 ? 14.087 9.193   -7.882  1.00 22.51 ? 289 HIS B NE2 1 
ATOM   5731 N N   . TYR B 1 283 ? 14.976 6.329   -13.849 1.00 23.60 ? 290 TYR B N   1 
ATOM   5732 C CA  . TYR B 1 283 ? 15.068 6.006   -15.272 1.00 24.07 ? 290 TYR B CA  1 
ATOM   5733 C C   . TYR B 1 283 ? 14.094 4.858   -15.552 1.00 27.01 ? 290 TYR B C   1 
ATOM   5734 O O   . TYR B 1 283 ? 13.677 4.641   -16.692 1.00 22.41 ? 290 TYR B O   1 
ATOM   5735 C CB  . TYR B 1 283 ? 16.490 5.553   -15.642 1.00 25.23 ? 290 TYR B CB  1 
ATOM   5736 C CG  . TYR B 1 283 ? 17.528 6.657   -15.664 1.00 21.91 ? 290 TYR B CG  1 
ATOM   5737 C CD1 . TYR B 1 283 ? 17.373 7.761   -16.498 1.00 22.12 ? 290 TYR B CD1 1 
ATOM   5738 C CD2 . TYR B 1 283 ? 18.668 6.591   -14.862 1.00 22.59 ? 290 TYR B CD2 1 
ATOM   5739 C CE1 . TYR B 1 283 ? 18.318 8.774   -16.540 1.00 17.35 ? 290 TYR B CE1 1 
ATOM   5740 C CE2 . TYR B 1 283 ? 19.631 7.605   -14.893 1.00 15.69 ? 290 TYR B CE2 1 
ATOM   5741 C CZ  . TYR B 1 283 ? 19.446 8.693   -15.733 1.00 20.05 ? 290 TYR B CZ  1 
ATOM   5742 O OH  . TYR B 1 283 ? 20.375 9.710   -15.769 1.00 17.63 ? 290 TYR B OH  1 
ATOM   5743 N N   . TRP B 1 284 ? 13.733 4.129   -14.498 1.00 25.89 ? 291 TRP B N   1 
ATOM   5744 C CA  . TRP B 1 284 ? 12.819 2.998   -14.624 1.00 28.86 ? 291 TRP B CA  1 
ATOM   5745 C C   . TRP B 1 284 ? 11.379 3.386   -14.293 1.00 30.56 ? 291 TRP B C   1 
ATOM   5746 O O   . TRP B 1 284 ? 10.541 2.522   -14.016 1.00 31.18 ? 291 TRP B O   1 
ATOM   5747 C CB  . TRP B 1 284 ? 13.287 1.845   -13.718 1.00 25.99 ? 291 TRP B CB  1 
ATOM   5748 C CG  . TRP B 1 284 ? 14.465 1.079   -14.295 1.00 28.85 ? 291 TRP B CG  1 
ATOM   5749 C CD1 . TRP B 1 284 ? 14.414 -0.071  -15.041 1.00 25.80 ? 291 TRP B CD1 1 
ATOM   5750 C CD2 . TRP B 1 284 ? 15.858 1.453   -14.242 1.00 24.84 ? 291 TRP B CD2 1 
ATOM   5751 N NE1 . TRP B 1 284 ? 15.675 -0.429  -15.452 1.00 27.32 ? 291 TRP B NE1 1 
ATOM   5752 C CE2 . TRP B 1 284 ? 16.575 0.481   -14.972 1.00 28.01 ? 291 TRP B CE2 1 
ATOM   5753 C CE3 . TRP B 1 284 ? 16.552 2.508   -13.639 1.00 23.61 ? 291 TRP B CE3 1 
ATOM   5754 C CZ2 . TRP B 1 284 ? 17.973 0.543   -15.126 1.00 27.38 ? 291 TRP B CZ2 1 
ATOM   5755 C CZ3 . TRP B 1 284 ? 17.941 2.566   -13.794 1.00 20.77 ? 291 TRP B CZ3 1 
ATOM   5756 C CH2 . TRP B 1 284 ? 18.634 1.585   -14.527 1.00 23.99 ? 291 TRP B CH2 1 
ATOM   5757 N N   . SER B 1 285 ? 11.096 4.686   -14.332 1.00 28.28 ? 292 SER B N   1 
ATOM   5758 C CA  . SER B 1 285 ? 9.757  5.188   -14.047 1.00 30.97 ? 292 SER B CA  1 
ATOM   5759 C C   . SER B 1 285 ? 8.763  4.826   -15.159 1.00 31.60 ? 292 SER B C   1 
ATOM   5760 O O   . SER B 1 285 ? 9.113  4.844   -16.343 1.00 26.90 ? 292 SER B O   1 
ATOM   5761 C CB  . SER B 1 285 ? 9.796  6.706   -13.886 1.00 28.90 ? 292 SER B CB  1 
ATOM   5762 O OG  . SER B 1 285 ? 8.485  7.228   -13.774 1.00 31.09 ? 292 SER B OG  1 
ATOM   5763 N N   . LYS B 1 286 ? 7.527  4.500   -14.772 1.00 31.89 ? 293 LYS B N   1 
ATOM   5764 C CA  . LYS B 1 286 ? 6.480  4.152   -15.744 1.00 35.18 ? 293 LYS B CA  1 
ATOM   5765 C C   . LYS B 1 286 ? 6.276  5.341   -16.665 1.00 32.11 ? 293 LYS B C   1 
ATOM   5766 O O   . LYS B 1 286 ? 6.108  5.191   -17.880 1.00 35.76 ? 293 LYS B O   1 
ATOM   5767 C CB  . LYS B 1 286 ? 5.153  3.849   -15.032 1.00 40.12 ? 293 LYS B CB  1 
ATOM   5768 C CG  . LYS B 1 286 ? 5.163  2.597   -14.171 1.00 47.26 ? 293 LYS B CG  1 
ATOM   5769 C CD  . LYS B 1 286 ? 5.150  1.338   -15.033 1.00 52.06 ? 293 LYS B CD  1 
ATOM   5770 C CE  . LYS B 1 286 ? 5.228  0.087   -14.172 1.00 54.56 ? 293 LYS B CE  1 
ATOM   5771 N NZ  . LYS B 1 286 ? 5.425  -1.139  -15.010 1.00 57.28 ? 293 LYS B NZ  1 
ATOM   5772 N N   . ASN B 1 287 ? 6.286  6.523   -16.063 1.00 25.81 ? 294 ASN B N   1 
ATOM   5773 C CA  . ASN B 1 287 ? 6.114  7.786   -16.766 1.00 25.84 ? 294 ASN B CA  1 
ATOM   5774 C C   . ASN B 1 287 ? 7.339  8.067   -17.640 1.00 23.65 ? 294 ASN B C   1 
ATOM   5775 O O   . ASN B 1 287 ? 8.391  8.441   -17.128 1.00 23.21 ? 294 ASN B O   1 
ATOM   5776 C CB  . ASN B 1 287 ? 5.954  8.901   -15.730 1.00 27.79 ? 294 ASN B CB  1 
ATOM   5777 C CG  . ASN B 1 287 ? 5.620  10.242  -16.348 1.00 29.62 ? 294 ASN B CG  1 
ATOM   5778 O OD1 . ASN B 1 287 ? 5.914  10.501  -17.516 1.00 31.08 ? 294 ASN B OD1 1 
ATOM   5779 N ND2 . ASN B 1 287 ? 5.019  11.117  -15.550 1.00 31.88 ? 294 ASN B ND2 1 
ATOM   5780 N N   . TRP B 1 288 ? 7.213  7.896   -18.953 1.00 20.80 ? 295 TRP B N   1 
ATOM   5781 C CA  . TRP B 1 288 ? 8.347  8.146   -19.835 1.00 22.70 ? 295 TRP B CA  1 
ATOM   5782 C C   . TRP B 1 288 ? 8.907  9.551   -19.620 1.00 25.80 ? 295 TRP B C   1 
ATOM   5783 O O   . TRP B 1 288 ? 10.115 9.739   -19.455 1.00 28.26 ? 295 TRP B O   1 
ATOM   5784 C CB  . TRP B 1 288 ? 7.940  7.996   -21.301 1.00 25.81 ? 295 TRP B CB  1 
ATOM   5785 C CG  . TRP B 1 288 ? 9.103  8.155   -22.259 1.00 26.61 ? 295 TRP B CG  1 
ATOM   5786 C CD1 . TRP B 1 288 ? 9.908  7.156   -22.752 1.00 27.59 ? 295 TRP B CD1 1 
ATOM   5787 C CD2 . TRP B 1 288 ? 9.644  9.384   -22.775 1.00 28.11 ? 295 TRP B CD2 1 
ATOM   5788 N NE1 . TRP B 1 288 ? 10.913 7.692   -23.533 1.00 29.46 ? 295 TRP B NE1 1 
ATOM   5789 C CE2 . TRP B 1 288 ? 10.771 9.063   -23.560 1.00 27.30 ? 295 TRP B CE2 1 
ATOM   5790 C CE3 . TRP B 1 288 ? 9.281  10.735  -22.639 1.00 26.25 ? 295 TRP B CE3 1 
ATOM   5791 C CZ2 . TRP B 1 288 ? 11.543 10.030  -24.212 1.00 27.76 ? 295 TRP B CZ2 1 
ATOM   5792 C CZ3 . TRP B 1 288 ? 10.049 11.702  -23.287 1.00 27.30 ? 295 TRP B CZ3 1 
ATOM   5793 C CH2 . TRP B 1 288 ? 11.166 11.343  -24.061 1.00 27.28 ? 295 TRP B CH2 1 
ATOM   5794 N N   . ALA B 1 289 ? 8.019  10.538  -19.628 1.00 25.86 ? 296 ALA B N   1 
ATOM   5795 C CA  . ALA B 1 289 ? 8.407  11.932  -19.453 1.00 24.75 ? 296 ALA B CA  1 
ATOM   5796 C C   . ALA B 1 289 ? 9.253  12.166  -18.198 1.00 24.31 ? 296 ALA B C   1 
ATOM   5797 O O   . ALA B 1 289 ? 10.263 12.870  -18.243 1.00 23.12 ? 296 ALA B O   1 
ATOM   5798 C CB  . ALA B 1 289 ? 7.152  12.814  -19.416 1.00 24.47 ? 296 ALA B CB  1 
ATOM   5799 N N   . LYS B 1 290 ? 8.835  11.584  -17.079 1.00 23.98 ? 297 LYS B N   1 
ATOM   5800 C CA  . LYS B 1 290 ? 9.570  11.754  -15.826 1.00 23.31 ? 297 LYS B CA  1 
ATOM   5801 C C   . LYS B 1 290 ? 10.958 11.137  -15.912 1.00 25.73 ? 297 LYS B C   1 
ATOM   5802 O O   . LYS B 1 290 ? 11.959 11.763  -15.537 1.00 28.40 ? 297 LYS B O   1 
ATOM   5803 C CB  . LYS B 1 290 ? 8.810  11.114  -14.665 1.00 21.71 ? 297 LYS B CB  1 
ATOM   5804 C CG  . LYS B 1 290 ? 9.583  11.154  -13.356 1.00 24.04 ? 297 LYS B CG  1 
ATOM   5805 C CD  . LYS B 1 290 ? 8.845  10.458  -12.248 1.00 21.45 ? 297 LYS B CD  1 
ATOM   5806 C CE  . LYS B 1 290 ? 9.577  10.635  -10.932 1.00 20.67 ? 297 LYS B CE  1 
ATOM   5807 N NZ  . LYS B 1 290 ? 8.882  9.905   -9.845  1.00 23.33 ? 297 LYS B NZ  1 
ATOM   5808 N N   . ALA B 1 291 ? 11.008 9.903   -16.404 1.00 24.70 ? 298 ALA B N   1 
ATOM   5809 C CA  . ALA B 1 291 ? 12.254 9.170   -16.550 1.00 23.64 ? 298 ALA B CA  1 
ATOM   5810 C C   . ALA B 1 291 ? 13.189 9.864   -17.526 1.00 23.74 ? 298 ALA B C   1 
ATOM   5811 O O   . ALA B 1 291 ? 14.394 9.946   -17.295 1.00 20.59 ? 298 ALA B O   1 
ATOM   5812 C CB  . ALA B 1 291 ? 11.967 7.744   -17.020 1.00 26.35 ? 298 ALA B CB  1 
ATOM   5813 N N   . ALA B 1 292 ? 12.639 10.373  -18.620 1.00 22.09 ? 299 ALA B N   1 
ATOM   5814 C CA  . ALA B 1 292 ? 13.470 11.051  -19.601 1.00 21.15 ? 299 ALA B CA  1 
ATOM   5815 C C   . ALA B 1 292 ? 14.008 12.373  -19.059 1.00 21.02 ? 299 ALA B C   1 
ATOM   5816 O O   . ALA B 1 292 ? 14.981 12.913  -19.582 1.00 22.05 ? 299 ALA B O   1 
ATOM   5817 C CB  . ALA B 1 292 ? 12.685 11.288  -20.869 1.00 23.97 ? 299 ALA B CB  1 
ATOM   5818 N N   . ALA B 1 293 ? 13.375 12.890  -18.009 1.00 19.74 ? 300 ALA B N   1 
ATOM   5819 C CA  . ALA B 1 293 ? 13.810 14.143  -17.407 1.00 19.75 ? 300 ALA B CA  1 
ATOM   5820 C C   . ALA B 1 293 ? 15.125 13.955  -16.651 1.00 20.49 ? 300 ALA B C   1 
ATOM   5821 O O   . ALA B 1 293 ? 15.842 14.917  -16.397 1.00 20.25 ? 300 ALA B O   1 
ATOM   5822 C CB  . ALA B 1 293 ? 12.734 14.677  -16.465 1.00 19.81 ? 300 ALA B CB  1 
ATOM   5823 N N   . PHE B 1 294 ? 15.452 12.715  -16.305 1.00 19.97 ? 301 PHE B N   1 
ATOM   5824 C CA  . PHE B 1 294 ? 16.689 12.454  -15.582 1.00 20.76 ? 301 PHE B CA  1 
ATOM   5825 C C   . PHE B 1 294 ? 17.883 12.193  -16.491 1.00 20.36 ? 301 PHE B C   1 
ATOM   5826 O O   . PHE B 1 294 ? 19.006 12.066  -16.019 1.00 21.89 ? 301 PHE B O   1 
ATOM   5827 C CB  . PHE B 1 294 ? 16.507 11.266  -14.632 1.00 15.99 ? 301 PHE B CB  1 
ATOM   5828 C CG  . PHE B 1 294 ? 15.702 11.591  -13.408 1.00 15.96 ? 301 PHE B CG  1 
ATOM   5829 C CD1 . PHE B 1 294 ? 14.346 11.870  -13.504 1.00 12.88 ? 301 PHE B CD1 1 
ATOM   5830 C CD2 . PHE B 1 294 ? 16.307 11.621  -12.153 1.00 19.17 ? 301 PHE B CD2 1 
ATOM   5831 C CE1 . PHE B 1 294 ? 13.601 12.177  -12.372 1.00 17.49 ? 301 PHE B CE1 1 
ATOM   5832 C CE2 . PHE B 1 294 ? 15.572 11.929  -11.012 1.00 17.83 ? 301 PHE B CE2 1 
ATOM   5833 C CZ  . PHE B 1 294 ? 14.211 12.206  -11.124 1.00 19.74 ? 301 PHE B CZ  1 
ATOM   5834 N N   . VAL B 1 295 ? 17.647 12.127  -17.794 1.00 18.37 ? 302 VAL B N   1 
ATOM   5835 C CA  . VAL B 1 295 ? 18.724 11.851  -18.733 1.00 22.41 ? 302 VAL B CA  1 
ATOM   5836 C C   . VAL B 1 295 ? 19.805 12.928  -18.827 1.00 24.73 ? 302 VAL B C   1 
ATOM   5837 O O   . VAL B 1 295 ? 19.574 14.028  -19.346 1.00 22.18 ? 302 VAL B O   1 
ATOM   5838 C CB  . VAL B 1 295 ? 18.167 11.577  -20.150 1.00 23.36 ? 302 VAL B CB  1 
ATOM   5839 C CG1 . VAL B 1 295 ? 19.310 11.450  -21.155 1.00 24.50 ? 302 VAL B CG1 1 
ATOM   5840 C CG2 . VAL B 1 295 ? 17.333 10.303  -20.133 1.00 20.99 ? 302 VAL B CG2 1 
ATOM   5841 N N   . THR B 1 296 ? 20.980 12.590  -18.302 1.00 20.39 ? 303 THR B N   1 
ATOM   5842 C CA  . THR B 1 296 ? 22.158 13.456  -18.319 1.00 18.58 ? 303 THR B CA  1 
ATOM   5843 C C   . THR B 1 296 ? 23.352 12.506  -18.356 1.00 20.46 ? 303 THR B C   1 
ATOM   5844 O O   . THR B 1 296 ? 23.226 11.331  -17.994 1.00 18.68 ? 303 THR B O   1 
ATOM   5845 C CB  . THR B 1 296 ? 22.248 14.363  -17.043 1.00 20.11 ? 303 THR B CB  1 
ATOM   5846 O OG1 . THR B 1 296 ? 23.482 15.098  -17.058 1.00 16.21 ? 303 THR B OG1 1 
ATOM   5847 C CG2 . THR B 1 296 ? 22.176 13.523  -15.755 1.00 16.27 ? 303 THR B CG2 1 
ATOM   5848 N N   . SER B 1 297 ? 24.498 12.996  -18.811 1.00 20.93 ? 304 SER B N   1 
ATOM   5849 C CA  . SER B 1 297 ? 25.683 12.158  -18.871 1.00 20.71 ? 304 SER B CA  1 
ATOM   5850 C C   . SER B 1 297 ? 26.881 12.823  -18.195 1.00 22.23 ? 304 SER B C   1 
ATOM   5851 O O   . SER B 1 297 ? 27.158 14.004  -18.414 1.00 19.92 ? 304 SER B O   1 
ATOM   5852 C CB  . SER B 1 297 ? 26.032 11.819  -20.327 1.00 24.69 ? 304 SER B CB  1 
ATOM   5853 O OG  . SER B 1 297 ? 25.006 11.063  -20.960 1.00 21.07 ? 304 SER B OG  1 
ATOM   5854 N N   . PRO B 1 298 ? 27.575 12.080  -17.316 1.00 21.63 ? 305 PRO B N   1 
ATOM   5855 C CA  . PRO B 1 298 ? 27.219 10.692  -17.004 1.00 21.60 ? 305 PRO B CA  1 
ATOM   5856 C C   . PRO B 1 298 ? 25.875 10.639  -16.262 1.00 20.65 ? 305 PRO B C   1 
ATOM   5857 O O   . PRO B 1 298 ? 25.488 11.591  -15.585 1.00 20.87 ? 305 PRO B O   1 
ATOM   5858 C CB  . PRO B 1 298 ? 28.413 10.192  -16.177 1.00 20.06 ? 305 PRO B CB  1 
ATOM   5859 C CG  . PRO B 1 298 ? 29.029 11.446  -15.623 1.00 26.61 ? 305 PRO B CG  1 
ATOM   5860 C CD  . PRO B 1 298 ? 28.869 12.454  -16.721 1.00 23.02 ? 305 PRO B CD  1 
ATOM   5861 N N   . PRO B 1 299 ? 25.152 9.518   -16.384 1.00 20.50 ? 306 PRO B N   1 
ATOM   5862 C CA  . PRO B 1 299 ? 23.846 9.330   -15.749 1.00 21.42 ? 306 PRO B CA  1 
ATOM   5863 C C   . PRO B 1 299 ? 23.832 9.236   -14.229 1.00 22.59 ? 306 PRO B C   1 
ATOM   5864 O O   . PRO B 1 299 ? 24.857 8.981   -13.606 1.00 21.53 ? 306 PRO B O   1 
ATOM   5865 C CB  . PRO B 1 299 ? 23.348 8.040   -16.390 1.00 21.48 ? 306 PRO B CB  1 
ATOM   5866 C CG  . PRO B 1 299 ? 24.614 7.249   -16.511 1.00 23.28 ? 306 PRO B CG  1 
ATOM   5867 C CD  . PRO B 1 299 ? 25.600 8.274   -17.041 1.00 20.42 ? 306 PRO B CD  1 
ATOM   5868 N N   . LEU B 1 300 ? 22.665 9.469   -13.634 1.00 18.49 ? 307 LEU B N   1 
ATOM   5869 C CA  . LEU B 1 300 ? 22.532 9.321   -12.191 1.00 17.87 ? 307 LEU B CA  1 
ATOM   5870 C C   . LEU B 1 300 ? 22.715 7.825   -11.950 1.00 19.45 ? 307 LEU B C   1 
ATOM   5871 O O   . LEU B 1 300 ? 22.245 7.008   -12.748 1.00 14.63 ? 307 LEU B O   1 
ATOM   5872 C CB  . LEU B 1 300 ? 21.131 9.725   -11.716 1.00 20.94 ? 307 LEU B CB  1 
ATOM   5873 C CG  . LEU B 1 300 ? 20.798 11.188  -11.406 1.00 23.93 ? 307 LEU B CG  1 
ATOM   5874 C CD1 . LEU B 1 300 ? 21.749 11.675  -10.319 1.00 31.92 ? 307 LEU B CD1 1 
ATOM   5875 C CD2 . LEU B 1 300 ? 20.913 12.042  -12.643 1.00 25.68 ? 307 LEU B CD2 1 
ATOM   5876 N N   . SER B 1 301 ? 23.379 7.461   -10.856 1.00 17.58 ? 308 SER B N   1 
ATOM   5877 C CA  . SER B 1 301 ? 23.595 6.054   -10.552 1.00 18.87 ? 308 SER B CA  1 
ATOM   5878 C C   . SER B 1 301 ? 22.364 5.359   -9.986  1.00 20.40 ? 308 SER B C   1 
ATOM   5879 O O   . SER B 1 301 ? 21.675 5.890   -9.115  1.00 18.47 ? 308 SER B O   1 
ATOM   5880 C CB  . SER B 1 301 ? 24.740 5.881   -9.559  1.00 19.46 ? 308 SER B CB  1 
ATOM   5881 O OG  . SER B 1 301 ? 24.722 4.562   -9.048  1.00 17.36 ? 308 SER B OG  1 
ATOM   5882 N N   . PRO B 1 302 ? 22.072 4.149   -10.478 1.00 20.90 ? 309 PRO B N   1 
ATOM   5883 C CA  . PRO B 1 302 ? 20.911 3.392   -9.996  1.00 22.23 ? 309 PRO B CA  1 
ATOM   5884 C C   . PRO B 1 302 ? 21.111 2.908   -8.558  1.00 22.72 ? 309 PRO B C   1 
ATOM   5885 O O   . PRO B 1 302 ? 20.160 2.494   -7.900  1.00 24.70 ? 309 PRO B O   1 
ATOM   5886 C CB  . PRO B 1 302 ? 20.818 2.233   -10.989 1.00 22.30 ? 309 PRO B CB  1 
ATOM   5887 C CG  . PRO B 1 302 ? 21.408 2.822   -12.252 1.00 21.57 ? 309 PRO B CG  1 
ATOM   5888 C CD  . PRO B 1 302 ? 22.607 3.556   -11.717 1.00 18.44 ? 309 PRO B CD  1 
ATOM   5889 N N   . ASP B 1 303 ? 22.353 2.960   -8.082  1.00 23.33 ? 310 ASP B N   1 
ATOM   5890 C CA  . ASP B 1 303 ? 22.680 2.538   -6.720  1.00 20.56 ? 310 ASP B CA  1 
ATOM   5891 C C   . ASP B 1 303 ? 22.260 3.627   -5.727  1.00 24.16 ? 310 ASP B C   1 
ATOM   5892 O O   . ASP B 1 303 ? 22.844 4.720   -5.698  1.00 21.84 ? 310 ASP B O   1 
ATOM   5893 C CB  . ASP B 1 303 ? 24.186 2.277   -6.595  1.00 22.74 ? 310 ASP B CB  1 
ATOM   5894 C CG  . ASP B 1 303 ? 24.577 1.731   -5.225  1.00 23.85 ? 310 ASP B CG  1 
ATOM   5895 O OD1 . ASP B 1 303 ? 23.874 2.019   -4.228  1.00 24.40 ? 310 ASP B OD1 1 
ATOM   5896 O OD2 . ASP B 1 303 ? 25.603 1.021   -5.144  1.00 24.36 ? 310 ASP B OD2 1 
ATOM   5897 N N   . PRO B 1 304 ? 21.245 3.333   -4.896  1.00 23.43 ? 311 PRO B N   1 
ATOM   5898 C CA  . PRO B 1 304 ? 20.647 4.184   -3.862  1.00 23.24 ? 311 PRO B CA  1 
ATOM   5899 C C   . PRO B 1 304 ? 21.632 4.754   -2.842  1.00 24.49 ? 311 PRO B C   1 
ATOM   5900 O O   . PRO B 1 304 ? 21.373 5.794   -2.231  1.00 19.80 ? 311 PRO B O   1 
ATOM   5901 C CB  . PRO B 1 304 ? 19.648 3.250   -3.181  1.00 29.46 ? 311 PRO B CB  1 
ATOM   5902 C CG  . PRO B 1 304 ? 19.274 2.300   -4.253  1.00 31.75 ? 311 PRO B CG  1 
ATOM   5903 C CD  . PRO B 1 304 ? 20.588 2.016   -4.923  1.00 25.64 ? 311 PRO B CD  1 
ATOM   5904 N N   . THR B 1 305 ? 22.754 4.066   -2.648  1.00 23.20 ? 312 THR B N   1 
ATOM   5905 C CA  . THR B 1 305 ? 23.747 4.499   -1.667  1.00 22.31 ? 312 THR B CA  1 
ATOM   5906 C C   . THR B 1 305 ? 24.678 5.591   -2.180  1.00 19.17 ? 312 THR B C   1 
ATOM   5907 O O   . THR B 1 305 ? 25.387 6.219   -1.397  1.00 19.02 ? 312 THR B O   1 
ATOM   5908 C CB  . THR B 1 305 ? 24.616 3.312   -1.207  1.00 23.34 ? 312 THR B CB  1 
ATOM   5909 O OG1 . THR B 1 305 ? 25.373 2.827   -2.322  1.00 24.21 ? 312 THR B OG1 1 
ATOM   5910 C CG2 . THR B 1 305 ? 23.734 2.180   -0.660  1.00 25.80 ? 312 THR B CG2 1 
ATOM   5911 N N   . THR B 1 306 ? 24.665 5.818   -3.489  1.00 18.24 ? 313 THR B N   1 
ATOM   5912 C CA  . THR B 1 306 ? 25.532 6.809   -4.119  1.00 19.41 ? 313 THR B CA  1 
ATOM   5913 C C   . THR B 1 306 ? 25.512 8.247   -3.566  1.00 18.55 ? 313 THR B C   1 
ATOM   5914 O O   . THR B 1 306 ? 26.561 8.791   -3.236  1.00 18.57 ? 313 THR B O   1 
ATOM   5915 C CB  . THR B 1 306 ? 25.264 6.862   -5.651  1.00 21.88 ? 313 THR B CB  1 
ATOM   5916 O OG1 . THR B 1 306 ? 25.357 5.537   -6.196  1.00 20.50 ? 313 THR B OG1 1 
ATOM   5917 C CG2 . THR B 1 306 ? 26.288 7.753   -6.349  1.00 19.20 ? 313 THR B CG2 1 
ATOM   5918 N N   . PRO B 1 307 ? 24.330 8.887   -3.472  1.00 18.11 ? 314 PRO B N   1 
ATOM   5919 C CA  . PRO B 1 307 ? 24.311 10.263  -2.954  1.00 18.16 ? 314 PRO B CA  1 
ATOM   5920 C C   . PRO B 1 307 ? 24.986 10.474  -1.599  1.00 20.60 ? 314 PRO B C   1 
ATOM   5921 O O   . PRO B 1 307 ? 25.786 11.400  -1.449  1.00 18.34 ? 314 PRO B O   1 
ATOM   5922 C CB  . PRO B 1 307 ? 22.820 10.623  -2.951  1.00 20.24 ? 314 PRO B CB  1 
ATOM   5923 C CG  . PRO B 1 307 ? 22.126 9.295   -2.894  1.00 17.83 ? 314 PRO B CG  1 
ATOM   5924 C CD  . PRO B 1 307 ? 22.970 8.433   -3.801  1.00 16.66 ? 314 PRO B CD  1 
ATOM   5925 N N   . ASP B 1 308 ? 24.680 9.619   -0.624  1.00 22.62 ? 315 ASP B N   1 
ATOM   5926 C CA  . ASP B 1 308 ? 25.287 9.721   0.706   1.00 24.69 ? 315 ASP B CA  1 
ATOM   5927 C C   . ASP B 1 308 ? 26.800 9.525   0.640   1.00 23.76 ? 315 ASP B C   1 
ATOM   5928 O O   . ASP B 1 308 ? 27.559 10.209  1.337   1.00 20.63 ? 315 ASP B O   1 
ATOM   5929 C CB  . ASP B 1 308 ? 24.691 8.672   1.649   1.00 32.55 ? 315 ASP B CB  1 
ATOM   5930 C CG  . ASP B 1 308 ? 25.398 8.623   3.003   1.00 41.84 ? 315 ASP B CG  1 
ATOM   5931 O OD1 . ASP B 1 308 ? 26.405 7.885   3.153   1.00 46.74 ? 315 ASP B OD1 1 
ATOM   5932 O OD2 . ASP B 1 308 ? 24.950 9.335   3.929   1.00 46.56 ? 315 ASP B OD2 1 
ATOM   5933 N N   . TYR B 1 309 ? 27.234 8.593   -0.205  1.00 19.00 ? 316 TYR B N   1 
ATOM   5934 C CA  . TYR B 1 309 ? 28.657 8.306   -0.349  1.00 19.60 ? 316 TYR B CA  1 
ATOM   5935 C C   . TYR B 1 309 ? 29.437 9.501   -0.896  1.00 14.91 ? 316 TYR B C   1 
ATOM   5936 O O   . TYR B 1 309 ? 30.447 9.913   -0.323  1.00 14.99 ? 316 TYR B O   1 
ATOM   5937 C CB  . TYR B 1 309 ? 28.865 7.104   -1.270  1.00 20.61 ? 316 TYR B CB  1 
ATOM   5938 C CG  . TYR B 1 309 ? 30.268 6.554   -1.219  1.00 21.06 ? 316 TYR B CG  1 
ATOM   5939 C CD1 . TYR B 1 309 ? 30.738 5.901   -0.080  1.00 26.60 ? 316 TYR B CD1 1 
ATOM   5940 C CD2 . TYR B 1 309 ? 31.131 6.688   -2.303  1.00 22.55 ? 316 TYR B CD2 1 
ATOM   5941 C CE1 . TYR B 1 309 ? 32.042 5.386   -0.023  1.00 28.50 ? 316 TYR B CE1 1 
ATOM   5942 C CE2 . TYR B 1 309 ? 32.435 6.175   -2.258  1.00 24.45 ? 316 TYR B CE2 1 
ATOM   5943 C CZ  . TYR B 1 309 ? 32.881 5.527   -1.117  1.00 26.58 ? 316 TYR B CZ  1 
ATOM   5944 O OH  . TYR B 1 309 ? 34.154 5.008   -1.075  1.00 24.73 ? 316 TYR B OH  1 
ATOM   5945 N N   . LEU B 1 310 ? 28.964 10.052  -2.007  1.00 15.62 ? 317 LEU B N   1 
ATOM   5946 C CA  . LEU B 1 310 ? 29.623 11.192  -2.630  1.00 14.69 ? 317 LEU B CA  1 
ATOM   5947 C C   . LEU B 1 310 ? 29.684 12.372  -1.663  1.00 15.90 ? 317 LEU B C   1 
ATOM   5948 O O   . LEU B 1 310 ? 30.683 13.084  -1.609  1.00 16.26 ? 317 LEU B O   1 
ATOM   5949 C CB  . LEU B 1 310 ? 28.893 11.601  -3.920  1.00 13.75 ? 317 LEU B CB  1 
ATOM   5950 C CG  . LEU B 1 310 ? 28.886 10.605  -5.091  1.00 16.63 ? 317 LEU B CG  1 
ATOM   5951 C CD1 . LEU B 1 310 ? 28.020 11.128  -6.212  1.00 16.21 ? 317 LEU B CD1 1 
ATOM   5952 C CD2 . LEU B 1 310 ? 30.302 10.385  -5.595  1.00 17.86 ? 317 LEU B CD2 1 
ATOM   5953 N N   . THR B 1 311 ? 28.617 12.582  -0.902  1.00 16.12 ? 318 THR B N   1 
ATOM   5954 C CA  . THR B 1 311 ? 28.596 13.679  0.057   1.00 13.51 ? 318 THR B CA  1 
ATOM   5955 C C   . THR B 1 311 ? 29.709 13.484  1.095   1.00 16.69 ? 318 THR B C   1 
ATOM   5956 O O   . THR B 1 311 ? 30.396 14.431  1.472   1.00 15.40 ? 318 THR B O   1 
ATOM   5957 C CB  . THR B 1 311 ? 27.228 13.771  0.775   1.00 17.87 ? 318 THR B CB  1 
ATOM   5958 O OG1 . THR B 1 311 ? 26.193 14.076  -0.180  1.00 20.80 ? 318 THR B OG1 1 
ATOM   5959 C CG2 . THR B 1 311 ? 27.267 14.862  1.845   1.00 18.02 ? 318 THR B CG2 1 
ATOM   5960 N N   . SER B 1 312 ? 29.885 12.247  1.544   1.00 16.78 ? 319 SER B N   1 
ATOM   5961 C CA  . SER B 1 312 ? 30.909 11.928  2.531   1.00 16.89 ? 319 SER B CA  1 
ATOM   5962 C C   . SER B 1 312 ? 32.315 12.186  2.002   1.00 16.73 ? 319 SER B C   1 
ATOM   5963 O O   . SER B 1 312 ? 33.187 12.623  2.749   1.00 17.52 ? 319 SER B O   1 
ATOM   5964 C CB  . SER B 1 312 ? 30.790 10.464  2.963   1.00 21.98 ? 319 SER B CB  1 
ATOM   5965 O OG  . SER B 1 312 ? 29.542 10.215  3.602   1.00 28.37 ? 319 SER B OG  1 
ATOM   5966 N N   . LEU B 1 313 ? 32.557 11.908  0.725   1.00 16.80 ? 320 LEU B N   1 
ATOM   5967 C CA  . LEU B 1 313 ? 33.891 12.153  0.190   1.00 18.23 ? 320 LEU B CA  1 
ATOM   5968 C C   . LEU B 1 313 ? 34.101 13.653  -0.028  1.00 19.48 ? 320 LEU B C   1 
ATOM   5969 O O   . LEU B 1 313 ? 35.233 14.139  -0.068  1.00 19.45 ? 320 LEU B O   1 
ATOM   5970 C CB  . LEU B 1 313 ? 34.119 11.374  -1.112  1.00 18.20 ? 320 LEU B CB  1 
ATOM   5971 C CG  . LEU B 1 313 ? 34.832 10.018  -0.945  1.00 22.21 ? 320 LEU B CG  1 
ATOM   5972 C CD1 . LEU B 1 313 ? 33.979 9.068   -0.118  1.00 20.71 ? 320 LEU B CD1 1 
ATOM   5973 C CD2 . LEU B 1 313 ? 35.119 9.402   -2.312  1.00 23.06 ? 320 LEU B CD2 1 
ATOM   5974 N N   . LEU B 1 314 ? 33.007 14.390  -0.162  1.00 17.58 ? 321 LEU B N   1 
ATOM   5975 C CA  . LEU B 1 314 ? 33.103 15.835  -0.347  1.00 19.94 ? 321 LEU B CA  1 
ATOM   5976 C C   . LEU B 1 314 ? 33.485 16.421  1.005   1.00 19.35 ? 321 LEU B C   1 
ATOM   5977 O O   . LEU B 1 314 ? 34.287 17.354  1.093   1.00 15.16 ? 321 LEU B O   1 
ATOM   5978 C CB  . LEU B 1 314 ? 31.760 16.415  -0.802  1.00 15.88 ? 321 LEU B CB  1 
ATOM   5979 C CG  . LEU B 1 314 ? 31.663 17.935  -1.009  1.00 21.54 ? 321 LEU B CG  1 
ATOM   5980 C CD1 . LEU B 1 314 ? 32.633 18.397  -2.094  1.00 15.12 ? 321 LEU B CD1 1 
ATOM   5981 C CD2 . LEU B 1 314 ? 30.231 18.284  -1.411  1.00 16.65 ? 321 LEU B CD2 1 
ATOM   5982 N N   . ALA B 1 315 ? 32.908 15.848  2.056   1.00 16.11 ? 322 ALA B N   1 
ATOM   5983 C CA  . ALA B 1 315 ? 33.164 16.293  3.417   1.00 19.63 ? 322 ALA B CA  1 
ATOM   5984 C C   . ALA B 1 315 ? 34.579 15.969  3.904   1.00 20.66 ? 322 ALA B C   1 
ATOM   5985 O O   . ALA B 1 315 ? 35.136 16.709  4.721   1.00 19.50 ? 322 ALA B O   1 
ATOM   5986 C CB  . ALA B 1 315 ? 32.133 15.681  4.363   1.00 18.14 ? 322 ALA B CB  1 
ATOM   5987 N N   . CYS B 1 316 ? 35.164 14.870  3.424   1.00 20.03 ? 323 CYS B N   1 
ATOM   5988 C CA  . CYS B 1 316 ? 36.514 14.526  3.856   1.00 19.65 ? 323 CYS B CA  1 
ATOM   5989 C C   . CYS B 1 316 ? 37.599 15.113  2.938   1.00 21.16 ? 323 CYS B C   1 
ATOM   5990 O O   . CYS B 1 316 ? 38.787 14.926  3.175   1.00 17.38 ? 323 CYS B O   1 
ATOM   5991 C CB  . CYS B 1 316 ? 36.676 13.004  3.987   1.00 20.65 ? 323 CYS B CB  1 
ATOM   5992 S SG  . CYS B 1 316 ? 36.737 12.107  2.441   1.00 21.52 ? 323 CYS B SG  1 
ATOM   5993 N N   . GLY B 1 317 ? 37.189 15.829  1.893   1.00 21.15 ? 324 GLY B N   1 
ATOM   5994 C CA  . GLY B 1 317 ? 38.163 16.448  1.005   1.00 18.19 ? 324 GLY B CA  1 
ATOM   5995 C C   . GLY B 1 317 ? 38.574 15.745  -0.280  1.00 18.97 ? 324 GLY B C   1 
ATOM   5996 O O   . GLY B 1 317 ? 39.408 16.263  -1.023  1.00 19.73 ? 324 GLY B O   1 
ATOM   5997 N N   . ASP B 1 318 ? 38.015 14.573  -0.558  1.00 17.53 ? 325 ASP B N   1 
ATOM   5998 C CA  . ASP B 1 318 ? 38.365 13.877  -1.786  1.00 18.27 ? 325 ASP B CA  1 
ATOM   5999 C C   . ASP B 1 318 ? 37.703 14.502  -3.025  1.00 16.72 ? 325 ASP B C   1 
ATOM   6000 O O   . ASP B 1 318 ? 38.182 14.331  -4.145  1.00 19.02 ? 325 ASP B O   1 
ATOM   6001 C CB  . ASP B 1 318 ? 38.056 12.384  -1.645  1.00 15.10 ? 325 ASP B CB  1 
ATOM   6002 C CG  . ASP B 1 318 ? 39.053 11.680  -0.721  1.00 23.79 ? 325 ASP B CG  1 
ATOM   6003 O OD1 . ASP B 1 318 ? 40.267 11.951  -0.863  1.00 21.20 ? 325 ASP B OD1 1 
ATOM   6004 O OD2 . ASP B 1 318 ? 38.641 10.870  0.139   1.00 22.11 ? 325 ASP B OD2 1 
ATOM   6005 N N   . LEU B 1 319 ? 36.610 15.228  -2.808  1.00 16.48 ? 326 LEU B N   1 
ATOM   6006 C CA  . LEU B 1 319 ? 35.893 15.959  -3.861  1.00 17.39 ? 326 LEU B CA  1 
ATOM   6007 C C   . LEU B 1 319 ? 35.890 17.373  -3.270  1.00 17.59 ? 326 LEU B C   1 
ATOM   6008 O O   . LEU B 1 319 ? 35.615 17.530  -2.083  1.00 15.95 ? 326 LEU B O   1 
ATOM   6009 C CB  . LEU B 1 319 ? 34.472 15.412  -4.023  1.00 13.95 ? 326 LEU B CB  1 
ATOM   6010 C CG  . LEU B 1 319 ? 34.409 13.945  -4.473  1.00 19.42 ? 326 LEU B CG  1 
ATOM   6011 C CD1 . LEU B 1 319 ? 32.980 13.431  -4.409  1.00 17.35 ? 326 LEU B CD1 1 
ATOM   6012 C CD2 . LEU B 1 319 ? 34.965 13.812  -5.874  1.00 14.72 ? 326 LEU B CD2 1 
ATOM   6013 N N   . GLN B 1 320 ? 36.191 18.397  -4.067  1.00 13.53 ? 327 GLN B N   1 
ATOM   6014 C CA  . GLN B 1 320 ? 36.292 19.753  -3.514  1.00 16.71 ? 327 GLN B CA  1 
ATOM   6015 C C   . GLN B 1 320 ? 35.233 20.794  -3.867  1.00 18.26 ? 327 GLN B C   1 
ATOM   6016 O O   . GLN B 1 320 ? 35.023 21.742  -3.109  1.00 16.96 ? 327 GLN B O   1 
ATOM   6017 C CB  . GLN B 1 320 ? 37.659 20.364  -3.869  1.00 21.10 ? 327 GLN B CB  1 
ATOM   6018 C CG  . GLN B 1 320 ? 38.878 19.472  -3.626  1.00 18.90 ? 327 GLN B CG  1 
ATOM   6019 C CD  . GLN B 1 320 ? 38.858 18.196  -4.452  1.00 20.80 ? 327 GLN B CD  1 
ATOM   6020 O OE1 . GLN B 1 320 ? 38.525 18.216  -5.637  1.00 20.88 ? 327 GLN B OE1 1 
ATOM   6021 N NE2 . GLN B 1 320 ? 39.220 17.081  -3.831  1.00 17.05 ? 327 GLN B NE2 1 
ATOM   6022 N N   . VAL B 1 321 ? 34.576 20.645  -5.009  1.00 14.65 ? 328 VAL B N   1 
ATOM   6023 C CA  . VAL B 1 321 ? 33.592 21.639  -5.404  1.00 17.03 ? 328 VAL B CA  1 
ATOM   6024 C C   . VAL B 1 321 ? 32.252 21.073  -5.847  1.00 19.08 ? 328 VAL B C   1 
ATOM   6025 O O   . VAL B 1 321 ? 32.111 19.869  -6.073  1.00 17.68 ? 328 VAL B O   1 
ATOM   6026 C CB  . VAL B 1 321 ? 34.142 22.506  -6.537  1.00 16.83 ? 328 VAL B CB  1 
ATOM   6027 C CG1 . VAL B 1 321 ? 35.457 23.139  -6.109  1.00 17.90 ? 328 VAL B CG1 1 
ATOM   6028 C CG2 . VAL B 1 321 ? 34.345 21.659  -7.773  1.00 15.16 ? 328 VAL B CG2 1 
ATOM   6029 N N   . THR B 1 322 ? 31.267 21.960  -5.970  1.00 17.62 ? 329 THR B N   1 
ATOM   6030 C CA  . THR B 1 322 ? 29.936 21.562  -6.392  1.00 17.47 ? 329 THR B CA  1 
ATOM   6031 C C   . THR B 1 322 ? 29.390 22.465  -7.494  1.00 19.73 ? 329 THR B C   1 
ATOM   6032 O O   . THR B 1 322 ? 29.526 23.692  -7.440  1.00 15.49 ? 329 THR B O   1 
ATOM   6033 C CB  . THR B 1 322 ? 28.939 21.592  -5.216  1.00 21.09 ? 329 THR B CB  1 
ATOM   6034 O OG1 . THR B 1 322 ? 28.843 22.929  -4.700  1.00 16.48 ? 329 THR B OG1 1 
ATOM   6035 C CG2 . THR B 1 322 ? 29.393 20.644  -4.108  1.00 21.45 ? 329 THR B CG2 1 
ATOM   6036 N N   . GLY B 1 323 ? 28.785 21.840  -8.497  1.00 18.70 ? 330 GLY B N   1 
ATOM   6037 C CA  . GLY B 1 323 ? 28.179 22.575  -9.590  1.00 19.42 ? 330 GLY B CA  1 
ATOM   6038 C C   . GLY B 1 323 ? 26.777 22.014  -9.761  1.00 19.47 ? 330 GLY B C   1 
ATOM   6039 O O   . GLY B 1 323 ? 26.316 21.224  -8.933  1.00 15.25 ? 330 GLY B O   1 
ATOM   6040 N N   . SER B 1 324 ? 26.094 22.402  -10.831 1.00 16.38 ? 331 SER B N   1 
ATOM   6041 C CA  . SER B 1 324 ? 24.749 21.892  -11.070 1.00 17.16 ? 331 SER B CA  1 
ATOM   6042 C C   . SER B 1 324 ? 24.690 21.166  -12.403 1.00 19.43 ? 331 SER B C   1 
ATOM   6043 O O   . SER B 1 324 ? 23.947 20.199  -12.557 1.00 16.78 ? 331 SER B O   1 
ATOM   6044 C CB  . SER B 1 324 ? 23.724 23.035  -11.073 1.00 18.26 ? 331 SER B CB  1 
ATOM   6045 O OG  . SER B 1 324 ? 24.031 23.986  -12.075 1.00 21.34 ? 331 SER B OG  1 
ATOM   6046 N N   . GLY B 1 325 ? 25.492 21.622  -13.360 1.00 19.07 ? 332 GLY B N   1 
ATOM   6047 C CA  . GLY B 1 325 ? 25.466 21.011  -14.676 1.00 19.31 ? 332 GLY B CA  1 
ATOM   6048 C C   . GLY B 1 325 ? 24.117 21.308  -15.320 1.00 17.84 ? 332 GLY B C   1 
ATOM   6049 O O   . GLY B 1 325 ? 23.673 20.587  -16.208 1.00 18.28 ? 332 GLY B O   1 
ATOM   6050 N N   . HIS B 1 326 ? 23.478 22.383  -14.855 1.00 15.03 ? 333 HIS B N   1 
ATOM   6051 C CA  . HIS B 1 326 ? 22.166 22.832  -15.334 1.00 18.02 ? 333 HIS B CA  1 
ATOM   6052 C C   . HIS B 1 326 ? 22.049 22.984  -16.858 1.00 13.99 ? 333 HIS B C   1 
ATOM   6053 O O   . HIS B 1 326 ? 22.799 23.736  -17.480 1.00 15.50 ? 333 HIS B O   1 
ATOM   6054 C CB  . HIS B 1 326 ? 21.812 24.180  -14.683 1.00 14.88 ? 333 HIS B CB  1 
ATOM   6055 C CG  . HIS B 1 326 ? 20.371 24.570  -14.826 1.00 16.26 ? 333 HIS B CG  1 
ATOM   6056 N ND1 . HIS B 1 326 ? 19.403 24.191  -13.922 1.00 18.70 ? 333 HIS B ND1 1 
ATOM   6057 C CD2 . HIS B 1 326 ? 19.731 25.289  -15.782 1.00 19.15 ? 333 HIS B CD2 1 
ATOM   6058 C CE1 . HIS B 1 326 ? 18.228 24.657  -14.314 1.00 18.94 ? 333 HIS B CE1 1 
ATOM   6059 N NE2 . HIS B 1 326 ? 18.400 25.325  -15.440 1.00 14.09 ? 333 HIS B NE2 1 
ATOM   6060 N N   . CYS B 1 327 ? 21.104 22.261  -17.444 1.00 15.45 ? 334 CYS B N   1 
ATOM   6061 C CA  . CYS B 1 327 ? 20.838 22.338  -18.880 1.00 18.70 ? 334 CYS B CA  1 
ATOM   6062 C C   . CYS B 1 327 ? 19.690 21.416  -19.257 1.00 20.38 ? 334 CYS B C   1 
ATOM   6063 O O   . CYS B 1 327 ? 19.825 20.553  -20.124 1.00 19.04 ? 334 CYS B O   1 
ATOM   6064 C CB  . CYS B 1 327 ? 22.088 22.002  -19.713 1.00 20.25 ? 334 CYS B CB  1 
ATOM   6065 S SG  . CYS B 1 327 ? 22.868 20.416  -19.397 1.00 19.91 ? 334 CYS B SG  1 
ATOM   6066 N N   . PRO B 1 328 ? 18.532 21.597  -18.601 1.00 16.75 ? 335 PRO B N   1 
ATOM   6067 C CA  . PRO B 1 328 ? 17.349 20.781  -18.866 1.00 18.65 ? 335 PRO B CA  1 
ATOM   6068 C C   . PRO B 1 328 ? 16.734 21.149  -20.210 1.00 16.34 ? 335 PRO B C   1 
ATOM   6069 O O   . PRO B 1 328 ? 17.079 22.165  -20.802 1.00 20.41 ? 335 PRO B O   1 
ATOM   6070 C CB  . PRO B 1 328 ? 16.424 21.149  -17.713 1.00 17.84 ? 335 PRO B CB  1 
ATOM   6071 C CG  . PRO B 1 328 ? 16.693 22.612  -17.567 1.00 17.92 ? 335 PRO B CG  1 
ATOM   6072 C CD  . PRO B 1 328 ? 18.219 22.651  -17.618 1.00 18.70 ? 335 PRO B CD  1 
ATOM   6073 N N   . TYR B 1 329 ? 15.835 20.301  -20.688 1.00 17.81 ? 336 TYR B N   1 
ATOM   6074 C CA  . TYR B 1 329 ? 15.122 20.548  -21.937 1.00 21.30 ? 336 TYR B CA  1 
ATOM   6075 C C   . TYR B 1 329 ? 13.673 20.245  -21.587 1.00 23.50 ? 336 TYR B C   1 
ATOM   6076 O O   . TYR B 1 329 ? 13.415 19.434  -20.698 1.00 20.03 ? 336 TYR B O   1 
ATOM   6077 C CB  . TYR B 1 329 ? 15.625 19.630  -23.065 1.00 19.79 ? 336 TYR B CB  1 
ATOM   6078 C CG  . TYR B 1 329 ? 17.015 19.981  -23.561 1.00 21.87 ? 336 TYR B CG  1 
ATOM   6079 C CD1 . TYR B 1 329 ? 18.148 19.645  -22.818 1.00 22.64 ? 336 TYR B CD1 1 
ATOM   6080 C CD2 . TYR B 1 329 ? 17.198 20.680  -24.754 1.00 21.36 ? 336 TYR B CD2 1 
ATOM   6081 C CE1 . TYR B 1 329 ? 19.427 19.997  -23.247 1.00 21.93 ? 336 TYR B CE1 1 
ATOM   6082 C CE2 . TYR B 1 329 ? 18.483 21.038  -25.198 1.00 17.77 ? 336 TYR B CE2 1 
ATOM   6083 C CZ  . TYR B 1 329 ? 19.591 20.689  -24.430 1.00 24.33 ? 336 TYR B CZ  1 
ATOM   6084 O OH  . TYR B 1 329 ? 20.859 21.029  -24.837 1.00 17.61 ? 336 TYR B OH  1 
ATOM   6085 N N   . SER B 1 330 ? 12.728 20.909  -22.247 1.00 22.67 ? 337 SER B N   1 
ATOM   6086 C CA  . SER B 1 330 ? 11.322 20.675  -21.951 1.00 22.52 ? 337 SER B CA  1 
ATOM   6087 C C   . SER B 1 330 ? 10.988 19.244  -22.324 1.00 24.56 ? 337 SER B C   1 
ATOM   6088 O O   . SER B 1 330 ? 11.784 18.575  -22.982 1.00 26.03 ? 337 SER B O   1 
ATOM   6089 C CB  . SER B 1 330 ? 10.435 21.631  -22.750 1.00 23.53 ? 337 SER B CB  1 
ATOM   6090 O OG  . SER B 1 330 ? 10.587 21.398  -24.134 1.00 23.56 ? 337 SER B OG  1 
ATOM   6091 N N   . THR B 1 331 ? 9.817  18.771  -21.909 1.00 24.02 ? 338 THR B N   1 
ATOM   6092 C CA  . THR B 1 331 ? 9.431  17.409  -22.224 1.00 27.67 ? 338 THR B CA  1 
ATOM   6093 C C   . THR B 1 331 ? 9.279  17.215  -23.725 1.00 28.83 ? 338 THR B C   1 
ATOM   6094 O O   . THR B 1 331 ? 9.698  16.187  -24.271 1.00 29.72 ? 338 THR B O   1 
ATOM   6095 C CB  . THR B 1 331 ? 8.110  17.017  -21.531 1.00 30.09 ? 338 THR B CB  1 
ATOM   6096 O OG1 . THR B 1 331 ? 8.295  17.028  -20.113 1.00 25.28 ? 338 THR B OG1 1 
ATOM   6097 C CG2 . THR B 1 331 ? 7.690  15.609  -21.945 1.00 30.29 ? 338 THR B CG2 1 
ATOM   6098 N N   . ALA B 1 332 ? 8.692  18.205  -24.394 1.00 28.63 ? 339 ALA B N   1 
ATOM   6099 C CA  . ALA B 1 332 ? 8.486  18.128  -25.838 1.00 27.94 ? 339 ALA B CA  1 
ATOM   6100 C C   . ALA B 1 332 ? 9.833  17.978  -26.538 1.00 25.81 ? 339 ALA B C   1 
ATOM   6101 O O   . ALA B 1 332 ? 9.955  17.252  -27.526 1.00 22.76 ? 339 ALA B O   1 
ATOM   6102 C CB  . ALA B 1 332 ? 7.749  19.375  -26.332 1.00 30.67 ? 339 ALA B CB  1 
ATOM   6103 N N   . GLN B 1 333 ? 10.851 18.657  -26.016 1.00 26.72 ? 340 GLN B N   1 
ATOM   6104 C CA  . GLN B 1 333 ? 12.191 18.558  -26.587 1.00 25.45 ? 340 GLN B CA  1 
ATOM   6105 C C   . GLN B 1 333 ? 12.761 17.176  -26.310 1.00 24.67 ? 340 GLN B C   1 
ATOM   6106 O O   . GLN B 1 333 ? 13.316 16.533  -27.199 1.00 24.63 ? 340 GLN B O   1 
ATOM   6107 C CB  . GLN B 1 333 ? 13.116 19.604  -25.981 1.00 27.18 ? 340 GLN B CB  1 
ATOM   6108 C CG  . GLN B 1 333 ? 12.828 21.024  -26.416 1.00 26.71 ? 340 GLN B CG  1 
ATOM   6109 C CD  . GLN B 1 333 ? 13.738 22.016  -25.735 1.00 26.20 ? 340 GLN B CD  1 
ATOM   6110 O OE1 . GLN B 1 333 ? 13.789 22.077  -24.508 1.00 27.40 ? 340 GLN B OE1 1 
ATOM   6111 N NE2 . GLN B 1 333 ? 14.468 22.802  -26.526 1.00 23.08 ? 340 GLN B NE2 1 
ATOM   6112 N N   . LYS B 1 334 ? 12.634 16.725  -25.067 1.00 23.06 ? 341 LYS B N   1 
ATOM   6113 C CA  . LYS B 1 334 ? 13.139 15.409  -24.692 1.00 23.23 ? 341 LYS B CA  1 
ATOM   6114 C C   . LYS B 1 334 ? 12.503 14.353  -25.585 1.00 24.57 ? 341 LYS B C   1 
ATOM   6115 O O   . LYS B 1 334 ? 13.193 13.477  -26.128 1.00 26.50 ? 341 LYS B O   1 
ATOM   6116 C CB  . LYS B 1 334 ? 12.799 15.098  -23.232 1.00 21.41 ? 341 LYS B CB  1 
ATOM   6117 C CG  . LYS B 1 334 ? 13.588 15.895  -22.188 1.00 23.23 ? 341 LYS B CG  1 
ATOM   6118 C CD  . LYS B 1 334 ? 14.982 15.312  -21.931 1.00 22.44 ? 341 LYS B CD  1 
ATOM   6119 C CE  . LYS B 1 334 ? 15.667 16.039  -20.768 1.00 24.90 ? 341 LYS B CE  1 
ATOM   6120 N NZ  . LYS B 1 334 ? 17.005 15.460  -20.405 1.00 22.30 ? 341 LYS B NZ  1 
ATOM   6121 N N   . ALA B 1 335 ? 11.182 14.451  -25.730 1.00 25.16 ? 342 ALA B N   1 
ATOM   6122 C CA  . ALA B 1 335 ? 10.397 13.513  -26.527 1.00 26.13 ? 342 ALA B CA  1 
ATOM   6123 C C   . ALA B 1 335 ? 10.893 13.298  -27.954 1.00 24.79 ? 342 ALA B C   1 
ATOM   6124 O O   . ALA B 1 335 ? 10.391 12.420  -28.650 1.00 24.08 ? 342 ALA B O   1 
ATOM   6125 C CB  . ALA B 1 335 ? 8.936  13.947  -26.545 1.00 27.06 ? 342 ALA B CB  1 
ATOM   6126 N N   . VAL B 1 336 ? 11.874 14.083  -28.394 1.00 25.82 ? 343 VAL B N   1 
ATOM   6127 C CA  . VAL B 1 336 ? 12.410 13.915  -29.742 1.00 28.23 ? 343 VAL B CA  1 
ATOM   6128 C C   . VAL B 1 336 ? 13.046 12.522  -29.839 1.00 31.50 ? 343 VAL B C   1 
ATOM   6129 O O   . VAL B 1 336 ? 13.578 12.133  -30.882 1.00 33.51 ? 343 VAL B O   1 
ATOM   6130 C CB  . VAL B 1 336 ? 13.444 14.990  -30.042 1.00 24.76 ? 343 VAL B CB  1 
ATOM   6131 N N   . GLY B 1 337 ? 12.969 11.766  -28.748 1.00 30.79 ? 344 GLY B N   1 
ATOM   6132 C CA  . GLY B 1 337 ? 13.541 10.436  -28.719 1.00 31.13 ? 344 GLY B CA  1 
ATOM   6133 C C   . GLY B 1 337 ? 12.762 9.477   -27.847 1.00 30.08 ? 344 GLY B C   1 
ATOM   6134 O O   . GLY B 1 337 ? 13.351 8.632   -27.161 1.00 27.74 ? 344 GLY B O   1 
ATOM   6135 N N   . LYS B 1 338 ? 11.439 9.596   -27.871 1.00 29.79 ? 345 LYS B N   1 
ATOM   6136 C CA  . LYS B 1 338 ? 10.625 8.704   -27.069 1.00 30.58 ? 345 LYS B CA  1 
ATOM   6137 C C   . LYS B 1 338 ? 10.654 7.284   -27.636 1.00 31.01 ? 345 LYS B C   1 
ATOM   6138 O O   . LYS B 1 338 ? 10.131 6.358   -27.017 1.00 30.59 ? 345 LYS B O   1 
ATOM   6139 C CB  . LYS B 1 338 ? 9.184  9.207   -26.992 1.00 35.94 ? 345 LYS B CB  1 
ATOM   6140 C CG  . LYS B 1 338 ? 8.325  8.945   -28.234 1.00 41.97 ? 345 LYS B CG  1 
ATOM   6141 C CD  . LYS B 1 338 ? 8.661  9.883   -29.388 1.00 45.42 ? 345 LYS B CD  1 
ATOM   6142 C CE  . LYS B 1 338 ? 7.510  9.931   -30.400 1.00 46.71 ? 345 LYS B CE  1 
ATOM   6143 N NZ  . LYS B 1 338 ? 7.775  10.923  -31.489 1.00 47.24 ? 345 LYS B NZ  1 
ATOM   6144 N N   . ASP B 1 339 ? 11.262 7.116   -28.810 1.00 32.07 ? 346 ASP B N   1 
ATOM   6145 C CA  . ASP B 1 339 ? 11.359 5.797   -29.437 1.00 33.16 ? 346 ASP B CA  1 
ATOM   6146 C C   . ASP B 1 339 ? 12.806 5.330   -29.594 1.00 32.18 ? 346 ASP B C   1 
ATOM   6147 O O   . ASP B 1 339 ? 13.069 4.307   -30.226 1.00 33.10 ? 346 ASP B O   1 
ATOM   6148 C CB  . ASP B 1 339 ? 10.679 5.805   -30.813 1.00 35.20 ? 346 ASP B CB  1 
ATOM   6149 C CG  . ASP B 1 339 ? 9.160  5.933   -30.716 1.00 37.73 ? 346 ASP B CG  1 
ATOM   6150 O OD1 . ASP B 1 339 ? 8.534  5.109   -30.016 1.00 38.96 ? 346 ASP B OD1 1 
ATOM   6151 O OD2 . ASP B 1 339 ? 8.589  6.853   -31.338 1.00 38.32 ? 346 ASP B OD2 1 
ATOM   6152 N N   . ASN B 1 340 ? 13.732 6.075   -28.999 1.00 30.12 ? 347 ASN B N   1 
ATOM   6153 C CA  . ASN B 1 340 ? 15.157 5.767   -29.081 1.00 29.82 ? 347 ASN B CA  1 
ATOM   6154 C C   . ASN B 1 340 ? 15.871 6.645   -28.055 1.00 27.12 ? 347 ASN B C   1 
ATOM   6155 O O   . ASN B 1 340 ? 16.130 7.816   -28.322 1.00 25.83 ? 347 ASN B O   1 
ATOM   6156 C CB  . ASN B 1 340 ? 15.675 6.098   -30.491 1.00 28.20 ? 347 ASN B CB  1 
ATOM   6157 C CG  . ASN B 1 340 ? 17.136 5.717   -30.688 1.00 31.51 ? 347 ASN B CG  1 
ATOM   6158 O OD1 . ASN B 1 340 ? 17.909 5.660   -29.730 1.00 32.12 ? 347 ASN B OD1 1 
ATOM   6159 N ND2 . ASN B 1 340 ? 17.525 5.470   -31.933 1.00 24.87 ? 347 ASN B ND2 1 
ATOM   6160 N N   . PHE B 1 341 ? 16.191 6.088   -26.890 1.00 25.21 ? 348 PHE B N   1 
ATOM   6161 C CA  . PHE B 1 341 ? 16.858 6.864   -25.848 1.00 23.76 ? 348 PHE B CA  1 
ATOM   6162 C C   . PHE B 1 341 ? 18.121 7.595   -26.320 1.00 24.87 ? 348 PHE B C   1 
ATOM   6163 O O   . PHE B 1 341 ? 18.484 8.621   -25.753 1.00 21.44 ? 348 PHE B O   1 
ATOM   6164 C CB  . PHE B 1 341 ? 17.174 5.969   -24.634 1.00 22.87 ? 348 PHE B CB  1 
ATOM   6165 C CG  . PHE B 1 341 ? 18.257 4.946   -24.876 1.00 24.55 ? 348 PHE B CG  1 
ATOM   6166 C CD1 . PHE B 1 341 ? 19.603 5.310   -24.849 1.00 27.06 ? 348 PHE B CD1 1 
ATOM   6167 C CD2 . PHE B 1 341 ? 17.930 3.613   -25.125 1.00 25.91 ? 348 PHE B CD2 1 
ATOM   6168 C CE1 . PHE B 1 341 ? 20.611 4.360   -25.064 1.00 26.05 ? 348 PHE B CE1 1 
ATOM   6169 C CE2 . PHE B 1 341 ? 18.930 2.659   -25.340 1.00 26.52 ? 348 PHE B CE2 1 
ATOM   6170 C CZ  . PHE B 1 341 ? 20.269 3.034   -25.311 1.00 20.90 ? 348 PHE B CZ  1 
ATOM   6171 N N   . THR B 1 342 ? 18.788 7.088   -27.351 1.00 22.41 ? 349 THR B N   1 
ATOM   6172 C CA  . THR B 1 342 ? 20.000 7.745   -27.837 1.00 24.78 ? 349 THR B CA  1 
ATOM   6173 C C   . THR B 1 342 ? 19.742 9.102   -28.504 1.00 27.79 ? 349 THR B C   1 
ATOM   6174 O O   . THR B 1 342 ? 20.683 9.813   -28.861 1.00 24.78 ? 349 THR B O   1 
ATOM   6175 C CB  . THR B 1 342 ? 20.766 6.857   -28.842 1.00 29.42 ? 349 THR B CB  1 
ATOM   6176 O OG1 . THR B 1 342 ? 19.974 6.664   -30.027 1.00 29.90 ? 349 THR B OG1 1 
ATOM   6177 C CG2 . THR B 1 342 ? 21.091 5.501   -28.210 1.00 29.12 ? 349 THR B CG2 1 
ATOM   6178 N N   . LEU B 1 343 ? 18.475 9.473   -28.670 1.00 26.79 ? 350 LEU B N   1 
ATOM   6179 C CA  . LEU B 1 343 ? 18.169 10.753  -29.297 1.00 27.31 ? 350 LEU B CA  1 
ATOM   6180 C C   . LEU B 1 343 ? 17.548 11.745  -28.317 1.00 27.35 ? 350 LEU B C   1 
ATOM   6181 O O   . LEU B 1 343 ? 17.020 12.774  -28.730 1.00 26.85 ? 350 LEU B O   1 
ATOM   6182 C CB  . LEU B 1 343 ? 17.226 10.555  -30.491 1.00 30.63 ? 350 LEU B CB  1 
ATOM   6183 C CG  . LEU B 1 343 ? 17.663 9.573   -31.578 1.00 30.40 ? 350 LEU B CG  1 
ATOM   6184 C CD1 . LEU B 1 343 ? 16.610 9.526   -32.668 1.00 29.02 ? 350 LEU B CD1 1 
ATOM   6185 C CD2 . LEU B 1 343 ? 19.010 10.000  -32.147 1.00 29.89 ? 350 LEU B CD2 1 
ATOM   6186 N N   . ILE B 1 344 ? 17.596 11.428  -27.024 1.00 27.61 ? 351 ILE B N   1 
ATOM   6187 C CA  . ILE B 1 344 ? 17.042 12.315  -25.996 1.00 26.60 ? 351 ILE B CA  1 
ATOM   6188 C C   . ILE B 1 344 ? 18.062 13.388  -25.617 1.00 25.84 ? 351 ILE B C   1 
ATOM   6189 O O   . ILE B 1 344 ? 19.200 13.075  -25.273 1.00 29.83 ? 351 ILE B O   1 
ATOM   6190 C CB  . ILE B 1 344 ? 16.670 11.544  -24.703 1.00 24.00 ? 351 ILE B CB  1 
ATOM   6191 C CG1 . ILE B 1 344 ? 15.730 10.385  -25.021 1.00 25.35 ? 351 ILE B CG1 1 
ATOM   6192 C CG2 . ILE B 1 344 ? 15.977 12.485  -23.718 1.00 23.42 ? 351 ILE B CG2 1 
ATOM   6193 C CD1 . ILE B 1 344 ? 15.319 9.569   -23.792 1.00 22.74 ? 351 ILE B CD1 1 
ATOM   6194 N N   . PRO B 1 345 ? 17.676 14.672  -25.703 1.00 27.39 ? 352 PRO B N   1 
ATOM   6195 C CA  . PRO B 1 345 ? 18.570 15.785  -25.356 1.00 24.93 ? 352 PRO B CA  1 
ATOM   6196 C C   . PRO B 1 345 ? 19.114 15.592  -23.935 1.00 20.75 ? 352 PRO B C   1 
ATOM   6197 O O   . PRO B 1 345 ? 18.343 15.387  -23.003 1.00 19.57 ? 352 PRO B O   1 
ATOM   6198 C CB  . PRO B 1 345 ? 17.652 17.005  -25.448 1.00 24.44 ? 352 PRO B CB  1 
ATOM   6199 C CG  . PRO B 1 345 ? 16.704 16.630  -26.505 1.00 26.10 ? 352 PRO B CG  1 
ATOM   6200 C CD  . PRO B 1 345 ? 16.384 15.174  -26.206 1.00 27.77 ? 352 PRO B CD  1 
ATOM   6201 N N   . GLU B 1 346 ? 20.430 15.666  -23.772 1.00 18.18 ? 353 GLU B N   1 
ATOM   6202 C CA  . GLU B 1 346 ? 21.043 15.470  -22.458 1.00 21.57 ? 353 GLU B CA  1 
ATOM   6203 C C   . GLU B 1 346 ? 21.058 16.713  -21.565 1.00 20.10 ? 353 GLU B C   1 
ATOM   6204 O O   . GLU B 1 346 ? 21.484 17.793  -21.988 1.00 22.41 ? 353 GLU B O   1 
ATOM   6205 C CB  . GLU B 1 346 ? 22.481 14.965  -22.609 1.00 20.23 ? 353 GLU B CB  1 
ATOM   6206 C CG  . GLU B 1 346 ? 22.634 13.707  -23.458 1.00 27.08 ? 353 GLU B CG  1 
ATOM   6207 C CD  . GLU B 1 346 ? 24.032 13.124  -23.354 1.00 28.48 ? 353 GLU B CD  1 
ATOM   6208 O OE1 . GLU B 1 346 ? 24.992 13.913  -23.192 1.00 29.44 ? 353 GLU B OE1 1 
ATOM   6209 O OE2 . GLU B 1 346 ? 24.177 11.884  -23.438 1.00 29.14 ? 353 GLU B OE2 1 
ATOM   6210 N N   . GLY B 1 347 ? 20.605 16.555  -20.326 1.00 17.71 ? 354 GLY B N   1 
ATOM   6211 C CA  . GLY B 1 347 ? 20.609 17.678  -19.409 1.00 18.72 ? 354 GLY B CA  1 
ATOM   6212 C C   . GLY B 1 347 ? 19.522 17.641  -18.360 1.00 16.55 ? 354 GLY B C   1 
ATOM   6213 O O   . GLY B 1 347 ? 18.378 17.288  -18.652 1.00 17.19 ? 354 GLY B O   1 
ATOM   6214 N N   . VAL B 1 348 ? 19.887 18.006  -17.134 1.00 15.51 ? 355 VAL B N   1 
ATOM   6215 C CA  . VAL B 1 348 ? 18.952 18.040  -16.008 1.00 17.16 ? 355 VAL B CA  1 
ATOM   6216 C C   . VAL B 1 348 ? 19.014 19.405  -15.310 1.00 17.44 ? 355 VAL B C   1 
ATOM   6217 O O   . VAL B 1 348 ? 19.900 20.214  -15.606 1.00 17.33 ? 355 VAL B O   1 
ATOM   6218 C CB  . VAL B 1 348 ? 19.281 16.934  -14.966 1.00 17.15 ? 355 VAL B CB  1 
ATOM   6219 C CG1 . VAL B 1 348 ? 19.126 15.560  -15.597 1.00 17.27 ? 355 VAL B CG1 1 
ATOM   6220 C CG2 . VAL B 1 348 ? 20.697 17.119  -14.432 1.00 19.28 ? 355 VAL B CG2 1 
ATOM   6221 N N   . ASN B 1 349 ? 18.072 19.652  -14.392 1.00 17.96 ? 356 ASN B N   1 
ATOM   6222 C CA  . ASN B 1 349 ? 18.024 20.909  -13.634 1.00 20.60 ? 356 ASN B CA  1 
ATOM   6223 C C   . ASN B 1 349 ? 18.863 20.806  -12.359 1.00 20.39 ? 356 ASN B C   1 
ATOM   6224 O O   . ASN B 1 349 ? 19.273 19.713  -11.973 1.00 22.13 ? 356 ASN B O   1 
ATOM   6225 C CB  . ASN B 1 349 ? 16.584 21.267  -13.232 1.00 17.34 ? 356 ASN B CB  1 
ATOM   6226 C CG  . ASN B 1 349 ? 16.043 20.375  -12.121 1.00 19.92 ? 356 ASN B CG  1 
ATOM   6227 O OD1 . ASN B 1 349 ? 15.541 19.285  -12.379 1.00 16.86 ? 356 ASN B OD1 1 
ATOM   6228 N ND2 . ASN B 1 349 ? 16.156 20.836  -10.871 1.00 16.33 ? 356 ASN B ND2 1 
ATOM   6229 N N   . GLY B 1 350 ? 19.099 21.946  -11.709 1.00 18.32 ? 357 GLY B N   1 
ATOM   6230 C CA  . GLY B 1 350 ? 19.868 21.957  -10.480 1.00 16.54 ? 357 GLY B CA  1 
ATOM   6231 C C   . GLY B 1 350 ? 20.483 23.287  -10.075 1.00 17.42 ? 357 GLY B C   1 
ATOM   6232 O O   . GLY B 1 350 ? 20.895 23.456  -8.921  1.00 18.21 ? 357 GLY B O   1 
ATOM   6233 N N   . ILE B 1 351 ? 20.543 24.242  -10.998 1.00 16.18 ? 358 ILE B N   1 
ATOM   6234 C CA  . ILE B 1 351 ? 21.158 25.526  -10.690 1.00 13.94 ? 358 ILE B CA  1 
ATOM   6235 C C   . ILE B 1 351 ? 20.506 26.264  -9.526  1.00 19.89 ? 358 ILE B C   1 
ATOM   6236 O O   . ILE B 1 351 ? 21.193 26.889  -8.718  1.00 15.87 ? 358 ILE B O   1 
ATOM   6237 C CB  . ILE B 1 351 ? 21.191 26.457  -11.930 1.00 15.92 ? 358 ILE B CB  1 
ATOM   6238 C CG1 . ILE B 1 351 ? 22.155 27.615  -11.665 1.00 16.70 ? 358 ILE B CG1 1 
ATOM   6239 C CG2 . ILE B 1 351 ? 19.795 27.007  -12.236 1.00 16.11 ? 358 ILE B CG2 1 
ATOM   6240 C CD1 . ILE B 1 351 ? 22.316 28.567  -12.824 1.00 17.79 ? 358 ILE B CD1 1 
ATOM   6241 N N   . GLU B 1 352 ? 19.185 26.185  -9.433  1.00 16.83 ? 359 GLU B N   1 
ATOM   6242 C CA  . GLU B 1 352 ? 18.471 26.869  -8.365  1.00 19.51 ? 359 GLU B CA  1 
ATOM   6243 C C   . GLU B 1 352 ? 18.525 26.093  -7.059  1.00 19.68 ? 359 GLU B C   1 
ATOM   6244 O O   . GLU B 1 352 ? 18.538 26.683  -5.979  1.00 14.84 ? 359 GLU B O   1 
ATOM   6245 C CB  . GLU B 1 352 ? 17.007 27.067  -8.744  1.00 17.31 ? 359 GLU B CB  1 
ATOM   6246 C CG  . GLU B 1 352 ? 16.241 27.921  -7.749  1.00 21.60 ? 359 GLU B CG  1 
ATOM   6247 C CD  . GLU B 1 352 ? 14.741 27.791  -7.901  1.00 20.59 ? 359 GLU B CD  1 
ATOM   6248 O OE1 . GLU B 1 352 ? 14.274 27.591  -9.039  1.00 23.97 ? 359 GLU B OE1 1 
ATOM   6249 O OE2 . GLU B 1 352 ? 14.031 27.900  -6.885  1.00 21.66 ? 359 GLU B OE2 1 
ATOM   6250 N N   . GLU B 1 353 ? 18.565 24.769  -7.173  1.00 18.18 ? 360 GLU B N   1 
ATOM   6251 C CA  . GLU B 1 353 ? 18.570 23.885  -6.015  1.00 16.23 ? 360 GLU B CA  1 
ATOM   6252 C C   . GLU B 1 353 ? 19.920 23.583  -5.360  1.00 17.37 ? 360 GLU B C   1 
ATOM   6253 O O   . GLU B 1 353 ? 19.966 23.198  -4.186  1.00 18.05 ? 360 GLU B O   1 
ATOM   6254 C CB  . GLU B 1 353 ? 17.915 22.544  -6.387  1.00 18.31 ? 360 GLU B CB  1 
ATOM   6255 C CG  . GLU B 1 353 ? 16.435 22.598  -6.795  1.00 19.17 ? 360 GLU B CG  1 
ATOM   6256 C CD  . GLU B 1 353 ? 16.224 23.081  -8.212  1.00 21.48 ? 360 GLU B CD  1 
ATOM   6257 O OE1 . GLU B 1 353 ? 17.141 22.895  -9.044  1.00 21.36 ? 360 GLU B OE1 1 
ATOM   6258 O OE2 . GLU B 1 353 ? 15.138 23.631  -8.499  1.00 20.53 ? 360 GLU B OE2 1 
ATOM   6259 N N   . ARG B 1 354 ? 21.006 23.751  -6.106  1.00 15.34 ? 361 ARG B N   1 
ATOM   6260 C CA  . ARG B 1 354 ? 22.345 23.426  -5.615  1.00 13.80 ? 361 ARG B CA  1 
ATOM   6261 C C   . ARG B 1 354 ? 22.659 23.683  -4.149  1.00 15.99 ? 361 ARG B C   1 
ATOM   6262 O O   . ARG B 1 354 ? 22.949 22.754  -3.403  1.00 16.82 ? 361 ARG B O   1 
ATOM   6263 C CB  . ARG B 1 354 ? 23.416 24.116  -6.462  1.00 13.51 ? 361 ARG B CB  1 
ATOM   6264 C CG  . ARG B 1 354 ? 24.845 23.648  -6.132  1.00 15.82 ? 361 ARG B CG  1 
ATOM   6265 C CD  . ARG B 1 354 ? 25.876 24.289  -7.045  1.00 11.37 ? 361 ARG B CD  1 
ATOM   6266 N NE  . ARG B 1 354 ? 25.949 25.737  -6.859  1.00 15.56 ? 361 ARG B NE  1 
ATOM   6267 C CZ  . ARG B 1 354 ? 26.847 26.364  -6.099  1.00 19.87 ? 361 ARG B CZ  1 
ATOM   6268 N NH1 . ARG B 1 354 ? 27.775 25.679  -5.440  1.00 12.41 ? 361 ARG B NH1 1 
ATOM   6269 N NH2 . ARG B 1 354 ? 26.816 27.690  -6.000  1.00 17.70 ? 361 ARG B NH2 1 
ATOM   6270 N N   . MET B 1 355 ? 22.613 24.937  -3.725  1.00 14.73 ? 362 MET B N   1 
ATOM   6271 C CA  . MET B 1 355 ? 22.960 25.228  -2.350  1.00 16.70 ? 362 MET B CA  1 
ATOM   6272 C C   . MET B 1 355 ? 22.032 24.634  -1.297  1.00 16.47 ? 362 MET B C   1 
ATOM   6273 O O   . MET B 1 355 ? 22.505 24.208  -0.245  1.00 14.45 ? 362 MET B O   1 
ATOM   6274 C CB  . MET B 1 355 ? 23.140 26.736  -2.173  1.00 17.97 ? 362 MET B CB  1 
ATOM   6275 C CG  . MET B 1 355 ? 24.446 27.229  -2.813  1.00 17.62 ? 362 MET B CG  1 
ATOM   6276 S SD  . MET B 1 355 ? 24.755 28.948  -2.526  1.00 17.64 ? 362 MET B SD  1 
ATOM   6277 C CE  . MET B 1 355 ? 25.479 28.852  -0.906  1.00 20.42 ? 362 MET B CE  1 
ATOM   6278 N N   . THR B 1 356 ? 20.731 24.581  -1.574  1.00 13.27 ? 363 THR B N   1 
ATOM   6279 C CA  . THR B 1 356 ? 19.787 24.004  -0.617  1.00 17.55 ? 363 THR B CA  1 
ATOM   6280 C C   . THR B 1 356 ? 20.027 22.496  -0.519  1.00 15.79 ? 363 THR B C   1 
ATOM   6281 O O   . THR B 1 356 ? 20.052 21.938  0.572   1.00 18.14 ? 363 THR B O   1 
ATOM   6282 C CB  . THR B 1 356 ? 18.315 24.267  -1.024  1.00 19.24 ? 363 THR B CB  1 
ATOM   6283 O OG1 . THR B 1 356 ? 18.080 25.678  -1.046  1.00 21.37 ? 363 THR B OG1 1 
ATOM   6284 C CG2 . THR B 1 356 ? 17.353 23.648  -0.012  1.00 17.84 ? 363 THR B CG2 1 
ATOM   6285 N N   . VAL B 1 357 ? 20.231 21.848  -1.662  1.00 15.80 ? 364 VAL B N   1 
ATOM   6286 C CA  . VAL B 1 357 ? 20.490 20.418  -1.683  1.00 16.26 ? 364 VAL B CA  1 
ATOM   6287 C C   . VAL B 1 357 ? 21.783 20.078  -0.939  1.00 16.68 ? 364 VAL B C   1 
ATOM   6288 O O   . VAL B 1 357 ? 21.803 19.175  -0.108  1.00 15.14 ? 364 VAL B O   1 
ATOM   6289 C CB  . VAL B 1 357 ? 20.588 19.881  -3.129  1.00 19.27 ? 364 VAL B CB  1 
ATOM   6290 C CG1 . VAL B 1 357 ? 21.140 18.470  -3.121  1.00 18.39 ? 364 VAL B CG1 1 
ATOM   6291 C CG2 . VAL B 1 357 ? 19.208 19.900  -3.789  1.00 16.87 ? 364 VAL B CG2 1 
ATOM   6292 N N   . VAL B 1 358 ? 22.856 20.808  -1.230  1.00 18.69 ? 365 VAL B N   1 
ATOM   6293 C CA  . VAL B 1 358 ? 24.126 20.539  -0.569  1.00 17.82 ? 365 VAL B CA  1 
ATOM   6294 C C   . VAL B 1 358 ? 24.003 20.745  0.939   1.00 20.21 ? 365 VAL B C   1 
ATOM   6295 O O   . VAL B 1 358 ? 24.529 19.953  1.716   1.00 18.24 ? 365 VAL B O   1 
ATOM   6296 C CB  . VAL B 1 358 ? 25.274 21.424  -1.124  1.00 15.90 ? 365 VAL B CB  1 
ATOM   6297 C CG1 . VAL B 1 358 ? 26.519 21.244  -0.270  1.00 16.17 ? 365 VAL B CG1 1 
ATOM   6298 C CG2 . VAL B 1 358 ? 25.590 21.035  -2.560  1.00 10.12 ? 365 VAL B CG2 1 
ATOM   6299 N N   . TRP B 1 359 ? 23.293 21.790  1.357   1.00 18.61 ? 366 TRP B N   1 
ATOM   6300 C CA  . TRP B 1 359 ? 23.129 22.043  2.788   1.00 20.34 ? 366 TRP B CA  1 
ATOM   6301 C C   . TRP B 1 359 ? 22.384 20.898  3.473   1.00 19.93 ? 366 TRP B C   1 
ATOM   6302 O O   . TRP B 1 359 ? 22.781 20.440  4.546   1.00 20.10 ? 366 TRP B O   1 
ATOM   6303 C CB  . TRP B 1 359 ? 22.388 23.367  3.025   1.00 17.64 ? 366 TRP B CB  1 
ATOM   6304 C CG  . TRP B 1 359 ? 22.161 23.668  4.478   1.00 17.02 ? 366 TRP B CG  1 
ATOM   6305 C CD1 . TRP B 1 359 ? 21.127 23.228  5.258   1.00 15.66 ? 366 TRP B CD1 1 
ATOM   6306 C CD2 . TRP B 1 359 ? 23.008 24.444  5.340   1.00 19.76 ? 366 TRP B CD2 1 
ATOM   6307 N NE1 . TRP B 1 359 ? 21.278 23.680  6.551   1.00 17.71 ? 366 TRP B NE1 1 
ATOM   6308 C CE2 . TRP B 1 359 ? 22.427 24.430  6.630   1.00 19.82 ? 366 TRP B CE2 1 
ATOM   6309 C CE3 . TRP B 1 359 ? 24.207 25.150  5.147   1.00 17.52 ? 366 TRP B CE3 1 
ATOM   6310 C CZ2 . TRP B 1 359 ? 22.997 25.094  7.724   1.00 21.71 ? 366 TRP B CZ2 1 
ATOM   6311 C CZ3 . TRP B 1 359 ? 24.778 25.812  6.236   1.00 22.40 ? 366 TRP B CZ3 1 
ATOM   6312 C CH2 . TRP B 1 359 ? 24.170 25.777  7.508   1.00 21.29 ? 366 TRP B CH2 1 
ATOM   6313 N N   . ASP B 1 360 ? 21.310 20.434  2.844   1.00 18.88 ? 367 ASP B N   1 
ATOM   6314 C CA  . ASP B 1 360 ? 20.513 19.341  3.390   1.00 19.61 ? 367 ASP B CA  1 
ATOM   6315 C C   . ASP B 1 360 ? 21.271 18.011  3.504   1.00 17.45 ? 367 ASP B C   1 
ATOM   6316 O O   . ASP B 1 360 ? 21.151 17.319  4.511   1.00 20.34 ? 367 ASP B O   1 
ATOM   6317 C CB  . ASP B 1 360 ? 19.249 19.144  2.543   1.00 22.14 ? 367 ASP B CB  1 
ATOM   6318 C CG  . ASP B 1 360 ? 18.335 18.065  3.096   1.00 29.60 ? 367 ASP B CG  1 
ATOM   6319 O OD1 . ASP B 1 360 ? 18.369 16.918  2.582   1.00 29.85 ? 367 ASP B OD1 1 
ATOM   6320 O OD2 . ASP B 1 360 ? 17.584 18.367  4.053   1.00 29.08 ? 367 ASP B OD2 1 
ATOM   6321 N N   . LYS B 1 361 ? 22.055 17.656  2.489   1.00 15.86 ? 368 LYS B N   1 
ATOM   6322 C CA  . LYS B 1 361 ? 22.798 16.388  2.508   1.00 18.27 ? 368 LYS B CA  1 
ATOM   6323 C C   . LYS B 1 361 ? 24.128 16.420  3.266   1.00 18.33 ? 368 LYS B C   1 
ATOM   6324 O O   . LYS B 1 361 ? 24.573 15.398  3.782   1.00 19.15 ? 368 LYS B O   1 
ATOM   6325 C CB  . LYS B 1 361 ? 23.072 15.911  1.077   1.00 15.60 ? 368 LYS B CB  1 
ATOM   6326 C CG  . LYS B 1 361 ? 21.830 15.782  0.206   1.00 21.76 ? 368 LYS B CG  1 
ATOM   6327 C CD  . LYS B 1 361 ? 20.994 14.564  0.576   1.00 24.00 ? 368 LYS B CD  1 
ATOM   6328 C CE  . LYS B 1 361 ? 21.766 13.271  0.325   1.00 24.89 ? 368 LYS B CE  1 
ATOM   6329 N NZ  . LYS B 1 361 ? 20.915 12.086  0.635   1.00 28.59 ? 368 LYS B NZ  1 
ATOM   6330 N N   . ALA B 1 362 ? 24.756 17.589  3.343   1.00 17.25 ? 369 ALA B N   1 
ATOM   6331 C CA  . ALA B 1 362 ? 26.051 17.710  3.997   1.00 17.46 ? 369 ALA B CA  1 
ATOM   6332 C C   . ALA B 1 362 ? 26.051 18.276  5.414   1.00 16.08 ? 369 ALA B C   1 
ATOM   6333 O O   . ALA B 1 362 ? 26.670 17.698  6.309   1.00 18.50 ? 369 ALA B O   1 
ATOM   6334 C CB  . ALA B 1 362 ? 26.991 18.534  3.108   1.00 15.66 ? 369 ALA B CB  1 
ATOM   6335 N N   . VAL B 1 363 ? 25.366 19.400  5.618   1.00 18.00 ? 370 VAL B N   1 
ATOM   6336 C CA  . VAL B 1 363 ? 25.342 20.042  6.929   1.00 20.38 ? 370 VAL B CA  1 
ATOM   6337 C C   . VAL B 1 363 ? 24.234 19.543  7.855   1.00 21.80 ? 370 VAL B C   1 
ATOM   6338 O O   . VAL B 1 363 ? 24.496 19.204  9.004   1.00 20.18 ? 370 VAL B O   1 
ATOM   6339 C CB  . VAL B 1 363 ? 25.231 21.584  6.792   1.00 20.66 ? 370 VAL B CB  1 
ATOM   6340 C CG1 . VAL B 1 363 ? 25.353 22.253  8.161   1.00 22.27 ? 370 VAL B CG1 1 
ATOM   6341 C CG2 . VAL B 1 363 ? 26.317 22.097  5.872   1.00 18.77 ? 370 VAL B CG2 1 
ATOM   6342 N N   . ALA B 1 364 ? 22.999 19.487  7.361   1.00 22.01 ? 371 ALA B N   1 
ATOM   6343 C CA  . ALA B 1 364 ? 21.886 19.028  8.190   1.00 20.75 ? 371 ALA B CA  1 
ATOM   6344 C C   . ALA B 1 364 ? 22.093 17.602  8.727   1.00 21.85 ? 371 ALA B C   1 
ATOM   6345 O O   . ALA B 1 364 ? 21.507 17.218  9.738   1.00 20.07 ? 371 ALA B O   1 
ATOM   6346 C CB  . ALA B 1 364 ? 20.580 19.118  7.403   1.00 21.23 ? 371 ALA B CB  1 
ATOM   6347 N N   . THR B 1 365 ? 22.936 16.826  8.056   1.00 19.58 ? 372 THR B N   1 
ATOM   6348 C CA  . THR B 1 365 ? 23.217 15.459  8.477   1.00 21.19 ? 372 THR B CA  1 
ATOM   6349 C C   . THR B 1 365 ? 24.404 15.411  9.418   1.00 22.18 ? 372 THR B C   1 
ATOM   6350 O O   . THR B 1 365 ? 24.668 14.385  10.030  1.00 22.91 ? 372 THR B O   1 
ATOM   6351 C CB  . THR B 1 365 ? 23.568 14.572  7.292   1.00 21.40 ? 372 THR B CB  1 
ATOM   6352 O OG1 . THR B 1 365 ? 24.629 15.194  6.553   1.00 20.87 ? 372 THR B OG1 1 
ATOM   6353 C CG2 . THR B 1 365 ? 22.361 14.364  6.391   1.00 23.73 ? 372 THR B CG2 1 
ATOM   6354 N N   . GLY B 1 366 ? 25.138 16.513  9.505   1.00 21.97 ? 373 GLY B N   1 
ATOM   6355 C CA  . GLY B 1 366 ? 26.297 16.566  10.378  1.00 21.17 ? 373 GLY B CA  1 
ATOM   6356 C C   . GLY B 1 366 ? 27.614 16.123  9.750   1.00 21.09 ? 373 GLY B C   1 
ATOM   6357 O O   . GLY B 1 366 ? 28.642 16.084  10.435  1.00 18.91 ? 373 GLY B O   1 
ATOM   6358 N N   . LYS B 1 367 ? 27.594 15.787  8.462   1.00 21.36 ? 374 LYS B N   1 
ATOM   6359 C CA  . LYS B 1 367 ? 28.811 15.363  7.767   1.00 19.79 ? 374 LYS B CA  1 
ATOM   6360 C C   . LYS B 1 367 ? 29.841 16.502  7.703   1.00 18.17 ? 374 LYS B C   1 
ATOM   6361 O O   . LYS B 1 367 ? 31.037 16.263  7.863   1.00 20.62 ? 374 LYS B O   1 
ATOM   6362 C CB  . LYS B 1 367 ? 28.479 14.871  6.358   1.00 21.65 ? 374 LYS B CB  1 
ATOM   6363 C CG  . LYS B 1 367 ? 27.818 13.495  6.299   1.00 18.37 ? 374 LYS B CG  1 
ATOM   6364 C CD  . LYS B 1 367 ? 27.409 13.164  4.861   1.00 23.06 ? 374 LYS B CD  1 
ATOM   6365 C CE  . LYS B 1 367 ? 26.825 11.772  4.751   1.00 24.80 ? 374 LYS B CE  1 
ATOM   6366 N NZ  . LYS B 1 367 ? 27.798 10.751  5.230   1.00 27.89 ? 374 LYS B NZ  1 
ATOM   6367 N N   . MET B 1 368 ? 29.380 17.727  7.461   1.00 16.59 ? 375 MET B N   1 
ATOM   6368 C CA  . MET B 1 368 ? 30.266 18.898  7.438   1.00 20.07 ? 375 MET B CA  1 
ATOM   6369 C C   . MET B 1 368 ? 29.575 20.055  8.166   1.00 16.18 ? 375 MET B C   1 
ATOM   6370 O O   . MET B 1 368 ? 28.360 20.013  8.368   1.00 18.96 ? 375 MET B O   1 
ATOM   6371 C CB  . MET B 1 368 ? 30.641 19.311  5.991   1.00 15.99 ? 375 MET B CB  1 
ATOM   6372 C CG  . MET B 1 368 ? 29.547 19.975  5.144   1.00 21.30 ? 375 MET B CG  1 
ATOM   6373 S SD  . MET B 1 368 ? 30.116 20.589  3.487   1.00 10.95 ? 375 MET B SD  1 
ATOM   6374 C CE  . MET B 1 368 ? 30.844 19.124  2.785   1.00 5.13  ? 375 MET B CE  1 
ATOM   6375 N N   . ASP B 1 369 ? 30.337 21.066  8.591   1.00 17.34 ? 376 ASP B N   1 
ATOM   6376 C CA  . ASP B 1 369 ? 29.741 22.219  9.278   1.00 17.82 ? 376 ASP B CA  1 
ATOM   6377 C C   . ASP B 1 369 ? 29.578 23.419  8.330   1.00 17.70 ? 376 ASP B C   1 
ATOM   6378 O O   . ASP B 1 369 ? 29.958 23.338  7.162   1.00 17.31 ? 376 ASP B O   1 
ATOM   6379 C CB  . ASP B 1 369 ? 30.553 22.619  10.526  1.00 15.31 ? 376 ASP B CB  1 
ATOM   6380 C CG  . ASP B 1 369 ? 32.002 23.008  10.212  1.00 20.98 ? 376 ASP B CG  1 
ATOM   6381 O OD1 . ASP B 1 369 ? 32.249 23.657  9.173   1.00 20.41 ? 376 ASP B OD1 1 
ATOM   6382 O OD2 . ASP B 1 369 ? 32.892 22.682  11.029  1.00 15.51 ? 376 ASP B OD2 1 
ATOM   6383 N N   . GLU B 1 370 ? 29.024 24.527  8.826   1.00 17.13 ? 377 GLU B N   1 
ATOM   6384 C CA  . GLU B 1 370 ? 28.788 25.695  7.969   1.00 16.93 ? 377 GLU B CA  1 
ATOM   6385 C C   . GLU B 1 370 ? 29.997 26.280  7.250   1.00 14.80 ? 377 GLU B C   1 
ATOM   6386 O O   . GLU B 1 370 ? 29.859 26.836  6.161   1.00 17.55 ? 377 GLU B O   1 
ATOM   6387 C CB  . GLU B 1 370 ? 28.087 26.819  8.744   1.00 19.75 ? 377 GLU B CB  1 
ATOM   6388 C CG  . GLU B 1 370 ? 28.776 27.247  10.019  1.00 23.09 ? 377 GLU B CG  1 
ATOM   6389 C CD  . GLU B 1 370 ? 28.140 26.601  11.222  1.00 33.87 ? 377 GLU B CD  1 
ATOM   6390 O OE1 . GLU B 1 370 ? 27.984 25.355  11.211  1.00 30.82 ? 377 GLU B OE1 1 
ATOM   6391 O OE2 . GLU B 1 370 ? 27.795 27.340  12.172  1.00 34.95 ? 377 GLU B OE2 1 
ATOM   6392 N N   . ASN B 1 371 ? 31.175 26.170  7.848   1.00 15.57 ? 378 ASN B N   1 
ATOM   6393 C CA  . ASN B 1 371 ? 32.371 26.705  7.210   1.00 18.26 ? 378 ASN B CA  1 
ATOM   6394 C C   . ASN B 1 371 ? 32.765 25.842  6.010   1.00 17.28 ? 378 ASN B C   1 
ATOM   6395 O O   . ASN B 1 371 ? 33.150 26.370  4.974   1.00 17.74 ? 378 ASN B O   1 
ATOM   6396 C CB  . ASN B 1 371 ? 33.530 26.775  8.202   1.00 15.56 ? 378 ASN B CB  1 
ATOM   6397 C CG  . ASN B 1 371 ? 33.173 27.550  9.454   1.00 18.82 ? 378 ASN B CG  1 
ATOM   6398 O OD1 . ASN B 1 371 ? 32.919 26.964  10.504  1.00 19.37 ? 378 ASN B OD1 1 
ATOM   6399 N ND2 . ASN B 1 371 ? 33.138 28.873  9.345   1.00 19.84 ? 378 ASN B ND2 1 
ATOM   6400 N N   . GLN B 1 372 ? 32.686 24.520  6.157   1.00 16.58 ? 379 GLN B N   1 
ATOM   6401 C CA  . GLN B 1 372 ? 33.009 23.622  5.046   1.00 16.87 ? 379 GLN B CA  1 
ATOM   6402 C C   . GLN B 1 372 ? 31.963 23.835  3.949   1.00 14.79 ? 379 GLN B C   1 
ATOM   6403 O O   . GLN B 1 372 ? 32.262 23.715  2.761   1.00 16.31 ? 379 GLN B O   1 
ATOM   6404 C CB  . GLN B 1 372 ? 32.994 22.163  5.504   1.00 19.55 ? 379 GLN B CB  1 
ATOM   6405 C CG  . GLN B 1 372 ? 34.110 21.810  6.478   1.00 22.44 ? 379 GLN B CG  1 
ATOM   6406 C CD  . GLN B 1 372 ? 33.928 20.434  7.099   1.00 23.33 ? 379 GLN B CD  1 
ATOM   6407 O OE1 . GLN B 1 372 ? 33.135 20.252  8.030   1.00 19.65 ? 379 GLN B OE1 1 
ATOM   6408 N NE2 . GLN B 1 372 ? 34.657 19.455  6.578   1.00 20.37 ? 379 GLN B NE2 1 
ATOM   6409 N N   . PHE B 1 373 ? 30.736 24.151  4.357   1.00 13.29 ? 380 PHE B N   1 
ATOM   6410 C CA  . PHE B 1 373 ? 29.657 24.421  3.408   1.00 13.60 ? 380 PHE B CA  1 
ATOM   6411 C C   . PHE B 1 373 ? 30.096 25.570  2.496   1.00 14.85 ? 380 PHE B C   1 
ATOM   6412 O O   . PHE B 1 373 ? 29.965 25.488  1.272   1.00 17.51 ? 380 PHE B O   1 
ATOM   6413 C CB  . PHE B 1 373 ? 28.382 24.833  4.146   1.00 11.80 ? 380 PHE B CB  1 
ATOM   6414 C CG  . PHE B 1 373 ? 27.269 25.303  3.240   1.00 12.37 ? 380 PHE B CG  1 
ATOM   6415 C CD1 . PHE B 1 373 ? 26.615 24.411  2.389   1.00 13.62 ? 380 PHE B CD1 1 
ATOM   6416 C CD2 . PHE B 1 373 ? 26.868 26.634  3.243   1.00 14.03 ? 380 PHE B CD2 1 
ATOM   6417 C CE1 . PHE B 1 373 ? 25.568 24.833  1.563   1.00 13.40 ? 380 PHE B CE1 1 
ATOM   6418 C CE2 . PHE B 1 373 ? 25.817 27.071  2.416   1.00 19.28 ? 380 PHE B CE2 1 
ATOM   6419 C CZ  . PHE B 1 373 ? 25.171 26.161  1.571   1.00 14.60 ? 380 PHE B CZ  1 
ATOM   6420 N N   . VAL B 1 374 ? 30.613 26.639  3.097   1.00 13.43 ? 381 VAL B N   1 
ATOM   6421 C CA  . VAL B 1 374 ? 31.062 27.792  2.326   1.00 17.60 ? 381 VAL B CA  1 
ATOM   6422 C C   . VAL B 1 374 ? 32.166 27.389  1.354   1.00 17.70 ? 381 VAL B C   1 
ATOM   6423 O O   . VAL B 1 374 ? 32.174 27.821  0.208   1.00 17.66 ? 381 VAL B O   1 
ATOM   6424 C CB  . VAL B 1 374 ? 31.592 28.928  3.235   1.00 16.82 ? 381 VAL B CB  1 
ATOM   6425 C CG1 . VAL B 1 374 ? 32.123 30.065  2.378   1.00 12.75 ? 381 VAL B CG1 1 
ATOM   6426 C CG2 . VAL B 1 374 ? 30.483 29.439  4.135   1.00 16.68 ? 381 VAL B CG2 1 
ATOM   6427 N N   . ALA B 1 375 ? 33.090 26.552  1.821   1.00 16.53 ? 382 ALA B N   1 
ATOM   6428 C CA  . ALA B 1 375 ? 34.197 26.082  0.997   1.00 13.84 ? 382 ALA B CA  1 
ATOM   6429 C C   . ALA B 1 375 ? 33.745 25.304  -0.236  1.00 14.58 ? 382 ALA B C   1 
ATOM   6430 O O   . ALA B 1 375 ? 34.235 25.553  -1.341  1.00 13.71 ? 382 ALA B O   1 
ATOM   6431 C CB  . ALA B 1 375 ? 35.137 25.214  1.834   1.00 13.83 ? 382 ALA B CB  1 
ATOM   6432 N N   . VAL B 1 376 ? 32.823 24.360  -0.052  1.00 11.84 ? 383 VAL B N   1 
ATOM   6433 C CA  . VAL B 1 376 ? 32.348 23.550  -1.168  1.00 12.64 ? 383 VAL B CA  1 
ATOM   6434 C C   . VAL B 1 376 ? 31.326 24.228  -2.085  1.00 15.17 ? 383 VAL B C   1 
ATOM   6435 O O   . VAL B 1 376 ? 30.998 23.678  -3.135  1.00 14.30 ? 383 VAL B O   1 
ATOM   6436 C CB  . VAL B 1 376 ? 31.756 22.198  -0.686  1.00 13.78 ? 383 VAL B CB  1 
ATOM   6437 C CG1 . VAL B 1 376 ? 32.855 21.334  -0.082  1.00 10.49 ? 383 VAL B CG1 1 
ATOM   6438 C CG2 . VAL B 1 376 ? 30.652 22.434  0.319   1.00 10.97 ? 383 VAL B CG2 1 
ATOM   6439 N N   . THR B 1 377 ? 30.822 25.403  -1.700  1.00 12.84 ? 384 THR B N   1 
ATOM   6440 C CA  . THR B 1 377 ? 29.861 26.117  -2.545  1.00 13.67 ? 384 THR B CA  1 
ATOM   6441 C C   . THR B 1 377 ? 30.431 27.392  -3.188  1.00 16.44 ? 384 THR B C   1 
ATOM   6442 O O   . THR B 1 377 ? 29.816 27.954  -4.103  1.00 17.48 ? 384 THR B O   1 
ATOM   6443 C CB  . THR B 1 377 ? 28.560 26.489  -1.785  1.00 10.82 ? 384 THR B CB  1 
ATOM   6444 O OG1 . THR B 1 377 ? 28.879 27.203  -0.584  1.00 13.23 ? 384 THR B OG1 1 
ATOM   6445 C CG2 . THR B 1 377 ? 27.757 25.242  -1.452  1.00 11.97 ? 384 THR B CG2 1 
ATOM   6446 N N   . SER B 1 378 ? 31.592 27.851  -2.716  1.00 16.83 ? 385 SER B N   1 
ATOM   6447 C CA  . SER B 1 378 ? 32.221 29.035  -3.305  1.00 14.21 ? 385 SER B CA  1 
ATOM   6448 C C   . SER B 1 378 ? 33.752 29.143  -3.205  1.00 15.51 ? 385 SER B C   1 
ATOM   6449 O O   . SER B 1 378 ? 34.433 29.195  -4.222  1.00 19.15 ? 385 SER B O   1 
ATOM   6450 C CB  . SER B 1 378 ? 31.588 30.322  -2.745  1.00 11.02 ? 385 SER B CB  1 
ATOM   6451 O OG  . SER B 1 378 ? 32.075 30.637  -1.454  1.00 13.74 ? 385 SER B OG  1 
ATOM   6452 N N   . THR B 1 379 ? 34.294 29.169  -1.991  1.00 17.17 ? 386 THR B N   1 
ATOM   6453 C CA  . THR B 1 379 ? 35.730 29.329  -1.797  1.00 15.64 ? 386 THR B CA  1 
ATOM   6454 C C   . THR B 1 379 ? 36.662 28.355  -2.539  1.00 17.07 ? 386 THR B C   1 
ATOM   6455 O O   . THR B 1 379 ? 37.623 28.788  -3.168  1.00 17.98 ? 386 THR B O   1 
ATOM   6456 C CB  . THR B 1 379 ? 36.081 29.320  -0.283  1.00 18.77 ? 386 THR B CB  1 
ATOM   6457 O OG1 . THR B 1 379 ? 35.113 30.090  0.440   1.00 12.72 ? 386 THR B OG1 1 
ATOM   6458 C CG2 . THR B 1 379 ? 37.446 29.945  -0.052  1.00 13.58 ? 386 THR B CG2 1 
ATOM   6459 N N   . ASN B 1 380 ? 36.406 27.050  -2.469  1.00 18.05 ? 387 ASN B N   1 
ATOM   6460 C CA  . ASN B 1 380 ? 37.278 26.104  -3.167  1.00 16.55 ? 387 ASN B CA  1 
ATOM   6461 C C   . ASN B 1 380 ? 37.264 26.472  -4.651  1.00 17.00 ? 387 ASN B C   1 
ATOM   6462 O O   . ASN B 1 380 ? 38.318 26.629  -5.275  1.00 16.00 ? 387 ASN B O   1 
ATOM   6463 C CB  . ASN B 1 380 ? 36.812 24.644  -2.963  1.00 17.06 ? 387 ASN B CB  1 
ATOM   6464 C CG  . ASN B 1 380 ? 37.063 24.131  -1.542  1.00 15.75 ? 387 ASN B CG  1 
ATOM   6465 O OD1 . ASN B 1 380 ? 37.704 24.795  -0.739  1.00 16.55 ? 387 ASN B OD1 1 
ATOM   6466 N ND2 . ASN B 1 380 ? 36.557 22.934  -1.239  1.00 16.53 ? 387 ASN B ND2 1 
ATOM   6467 N N   . ALA B 1 381 ? 36.063 26.640  -5.196  1.00 14.14 ? 388 ALA B N   1 
ATOM   6468 C CA  . ALA B 1 381 ? 35.888 27.013  -6.593  1.00 15.94 ? 388 ALA B CA  1 
ATOM   6469 C C   . ALA B 1 381 ? 36.701 28.279  -6.902  1.00 17.78 ? 388 ALA B C   1 
ATOM   6470 O O   . ALA B 1 381 ? 37.392 28.356  -7.920  1.00 17.40 ? 388 ALA B O   1 
ATOM   6471 C CB  . ALA B 1 381 ? 34.412 27.250  -6.882  1.00 12.55 ? 388 ALA B CB  1 
ATOM   6472 N N   . ALA B 1 382 ? 36.626 29.261  -6.009  1.00 15.08 ? 389 ALA B N   1 
ATOM   6473 C CA  . ALA B 1 382 ? 37.355 30.515  -6.185  1.00 15.94 ? 389 ALA B CA  1 
ATOM   6474 C C   . ALA B 1 382 ? 38.870 30.304  -6.304  1.00 14.84 ? 389 ALA B C   1 
ATOM   6475 O O   . ALA B 1 382 ? 39.513 30.887  -7.171  1.00 13.26 ? 389 ALA B O   1 
ATOM   6476 C CB  . ALA B 1 382 ? 37.048 31.466  -5.023  1.00 14.83 ? 389 ALA B CB  1 
ATOM   6477 N N   . LYS B 1 383 ? 39.437 29.473  -5.436  1.00 14.26 ? 390 LYS B N   1 
ATOM   6478 C CA  . LYS B 1 383 ? 40.877 29.214  -5.466  1.00 16.01 ? 390 LYS B CA  1 
ATOM   6479 C C   . LYS B 1 383 ? 41.337 28.452  -6.714  1.00 17.03 ? 390 LYS B C   1 
ATOM   6480 O O   . LYS B 1 383 ? 42.379 28.758  -7.292  1.00 17.85 ? 390 LYS B O   1 
ATOM   6481 C CB  . LYS B 1 383 ? 41.297 28.473  -4.187  1.00 13.28 ? 390 LYS B CB  1 
ATOM   6482 C CG  . LYS B 1 383 ? 41.140 29.335  -2.937  1.00 13.88 ? 390 LYS B CG  1 
ATOM   6483 C CD  . LYS B 1 383 ? 41.233 28.556  -1.624  1.00 15.93 ? 390 LYS B CD  1 
ATOM   6484 C CE  . LYS B 1 383 ? 41.160 29.520  -0.429  1.00 12.30 ? 390 LYS B CE  1 
ATOM   6485 N NZ  . LYS B 1 383 ? 41.000 28.829  0.879   1.00 13.68 ? 390 LYS B NZ  1 
ATOM   6486 N N   . ILE B 1 384 ? 40.552 27.477  -7.142  1.00 15.03 ? 391 ILE B N   1 
ATOM   6487 C CA  . ILE B 1 384 ? 40.905 26.691  -8.316  1.00 16.49 ? 391 ILE B CA  1 
ATOM   6488 C C   . ILE B 1 384 ? 40.819 27.492  -9.610  1.00 19.17 ? 391 ILE B C   1 
ATOM   6489 O O   . ILE B 1 384 ? 41.641 27.321  -10.509 1.00 18.05 ? 391 ILE B O   1 
ATOM   6490 C CB  . ILE B 1 384 ? 39.978 25.466  -8.452  1.00 19.70 ? 391 ILE B CB  1 
ATOM   6491 C CG1 . ILE B 1 384 ? 40.194 24.514  -7.278  1.00 17.92 ? 391 ILE B CG1 1 
ATOM   6492 C CG2 . ILE B 1 384 ? 40.229 24.753  -9.773  1.00 18.44 ? 391 ILE B CG2 1 
ATOM   6493 C CD1 . ILE B 1 384 ? 39.091 23.498  -7.139  1.00 20.60 ? 391 ILE B CD1 1 
ATOM   6494 N N   . PHE B 1 385 ? 39.831 28.376  -9.703  1.00 18.64 ? 392 PHE B N   1 
ATOM   6495 C CA  . PHE B 1 385 ? 39.640 29.152  -10.920 1.00 21.37 ? 392 PHE B CA  1 
ATOM   6496 C C   . PHE B 1 385 ? 40.202 30.557  -10.911 1.00 21.46 ? 392 PHE B C   1 
ATOM   6497 O O   . PHE B 1 385 ? 39.903 31.354  -11.788 1.00 20.43 ? 392 PHE B O   1 
ATOM   6498 C CB  . PHE B 1 385 ? 38.157 29.161  -11.288 1.00 19.20 ? 392 PHE B CB  1 
ATOM   6499 C CG  . PHE B 1 385 ? 37.667 27.833  -11.775 1.00 16.26 ? 392 PHE B CG  1 
ATOM   6500 C CD1 . PHE B 1 385 ? 38.176 27.286  -12.955 1.00 17.83 ? 392 PHE B CD1 1 
ATOM   6501 C CD2 . PHE B 1 385 ? 36.737 27.104  -11.044 1.00 12.62 ? 392 PHE B CD2 1 
ATOM   6502 C CE1 . PHE B 1 385 ? 37.773 26.035  -13.391 1.00 20.69 ? 392 PHE B CE1 1 
ATOM   6503 C CE2 . PHE B 1 385 ? 36.327 25.847  -11.473 1.00 12.80 ? 392 PHE B CE2 1 
ATOM   6504 C CZ  . PHE B 1 385 ? 36.841 25.311  -12.645 1.00 16.66 ? 392 PHE B CZ  1 
ATOM   6505 N N   . ASN B 1 386 ? 41.028 30.842  -9.913  1.00 20.68 ? 393 ASN B N   1 
ATOM   6506 C CA  . ASN B 1 386 ? 41.677 32.128  -9.780  1.00 20.10 ? 393 ASN B CA  1 
ATOM   6507 C C   . ASN B 1 386 ? 40.766 33.328  -9.548  1.00 22.44 ? 393 ASN B C   1 
ATOM   6508 O O   . ASN B 1 386 ? 41.042 34.424  -10.020 1.00 23.61 ? 393 ASN B O   1 
ATOM   6509 C CB  . ASN B 1 386 ? 42.568 32.381  -10.993 1.00 14.96 ? 393 ASN B CB  1 
ATOM   6510 C CG  . ASN B 1 386 ? 43.925 32.898  -10.590 1.00 21.22 ? 393 ASN B CG  1 
ATOM   6511 O OD1 . ASN B 1 386 ? 44.180 33.089  -9.406  1.00 15.89 ? 393 ASN B OD1 1 
ATOM   6512 N ND2 . ASN B 1 386 ? 44.807 33.121  -11.564 1.00 19.98 ? 393 ASN B ND2 1 
ATOM   6513 N N   . LEU B 1 387 ? 39.698 33.122  -8.792  1.00 24.33 ? 394 LEU B N   1 
ATOM   6514 C CA  . LEU B 1 387 ? 38.750 34.185  -8.472  1.00 23.45 ? 394 LEU B CA  1 
ATOM   6515 C C   . LEU B 1 387 ? 38.725 34.361  -6.957  1.00 26.81 ? 394 LEU B C   1 
ATOM   6516 O O   . LEU B 1 387 ? 37.955 35.170  -6.429  1.00 22.99 ? 394 LEU B O   1 
ATOM   6517 C CB  . LEU B 1 387 ? 37.344 33.772  -8.917  1.00 23.78 ? 394 LEU B CB  1 
ATOM   6518 C CG  . LEU B 1 387 ? 37.018 33.571  -10.399 1.00 27.41 ? 394 LEU B CG  1 
ATOM   6519 C CD1 . LEU B 1 387 ? 35.805 32.668  -10.533 1.00 22.96 ? 394 LEU B CD1 1 
ATOM   6520 C CD2 . LEU B 1 387 ? 36.769 34.925  -11.058 1.00 20.56 ? 394 LEU B CD2 1 
ATOM   6521 N N   . TYR B 1 388 ? 39.596 33.629  -6.264  1.00 28.57 ? 395 TYR B N   1 
ATOM   6522 C CA  . TYR B 1 388 ? 39.563 33.610  -4.803  1.00 31.89 ? 395 TYR B CA  1 
ATOM   6523 C C   . TYR B 1 388 ? 39.242 34.793  -3.917  1.00 37.39 ? 395 TYR B C   1 
ATOM   6524 O O   . TYR B 1 388 ? 38.073 34.999  -3.579  1.00 47.47 ? 395 TYR B O   1 
ATOM   6525 C CB  . TYR B 1 388 ? 40.795 32.930  -4.196  1.00 25.28 ? 395 TYR B CB  1 
ATOM   6526 C CG  . TYR B 1 388 ? 40.774 33.005  -2.665  1.00 23.07 ? 395 TYR B CG  1 
ATOM   6527 C CD1 . TYR B 1 388 ? 39.613 32.695  -1.942  1.00 22.74 ? 395 TYR B CD1 1 
ATOM   6528 C CD2 . TYR B 1 388 ? 41.904 33.393  -1.945  1.00 21.74 ? 395 TYR B CD2 1 
ATOM   6529 C CE1 . TYR B 1 388 ? 39.582 32.776  -0.542  1.00 17.91 ? 395 TYR B CE1 1 
ATOM   6530 C CE2 . TYR B 1 388 ? 41.882 33.472  -0.544  1.00 18.26 ? 395 TYR B CE2 1 
ATOM   6531 C CZ  . TYR B 1 388 ? 40.719 33.160  0.144   1.00 17.97 ? 395 TYR B CZ  1 
ATOM   6532 O OH  . TYR B 1 388 ? 40.694 33.239  1.514   1.00 15.12 ? 395 TYR B OH  1 
ATOM   6533 N N   . PRO B 1 389 ? 40.240 35.602  -3.530  1.00 32.03 ? 396 PRO B N   1 
ATOM   6534 C CA  . PRO B 1 389 ? 39.761 36.665  -2.648  1.00 28.32 ? 396 PRO B CA  1 
ATOM   6535 C C   . PRO B 1 389 ? 38.545 37.491  -3.091  1.00 26.72 ? 396 PRO B C   1 
ATOM   6536 O O   . PRO B 1 389 ? 37.651 37.749  -2.279  1.00 24.93 ? 396 PRO B O   1 
ATOM   6537 C CB  . PRO B 1 389 ? 41.028 37.482  -2.370  1.00 28.20 ? 396 PRO B CB  1 
ATOM   6538 C CG  . PRO B 1 389 ? 41.800 37.336  -3.605  1.00 31.29 ? 396 PRO B CG  1 
ATOM   6539 C CD  . PRO B 1 389 ? 41.572 35.906  -4.080  1.00 27.43 ? 396 PRO B CD  1 
ATOM   6540 N N   . ARG B 1 390 ? 38.466 37.880  -4.360  1.00 26.57 ? 397 ARG B N   1 
ATOM   6541 C CA  . ARG B 1 390 ? 37.316 38.684  -4.778  1.00 25.58 ? 397 ARG B CA  1 
ATOM   6542 C C   . ARG B 1 390 ? 35.967 37.995  -4.573  1.00 22.84 ? 397 ARG B C   1 
ATOM   6543 O O   . ARG B 1 390 ? 35.009 38.650  -4.173  1.00 20.55 ? 397 ARG B O   1 
ATOM   6544 C CB  . ARG B 1 390 ? 37.456 39.146  -6.228  1.00 27.84 ? 397 ARG B CB  1 
ATOM   6545 C CG  . ARG B 1 390 ? 37.271 38.089  -7.266  1.00 37.35 ? 397 ARG B CG  1 
ATOM   6546 C CD  . ARG B 1 390 ? 37.506 38.687  -8.650  1.00 44.88 ? 397 ARG B CD  1 
ATOM   6547 N NE  . ARG B 1 390 ? 36.745 39.919  -8.867  1.00 39.80 ? 397 ARG B NE  1 
ATOM   6548 C CZ  . ARG B 1 390 ? 36.802 40.629  -9.992  1.00 46.04 ? 397 ARG B CZ  1 
ATOM   6549 N NH1 . ARG B 1 390 ? 37.582 40.229  -10.993 1.00 48.27 ? 397 ARG B NH1 1 
ATOM   6550 N NH2 . ARG B 1 390 ? 36.075 41.730  -10.129 1.00 42.97 ? 397 ARG B NH2 1 
ATOM   6551 N N   . LYS B 1 391 ? 35.896 36.690  -4.843  1.00 20.58 ? 398 LYS B N   1 
ATOM   6552 C CA  . LYS B 1 391 ? 34.666 35.903  -4.661  1.00 21.21 ? 398 LYS B CA  1 
ATOM   6553 C C   . LYS B 1 391 ? 34.868 34.864  -3.548  1.00 20.42 ? 398 LYS B C   1 
ATOM   6554 O O   . LYS B 1 391 ? 35.991 34.566  -3.168  1.00 17.89 ? 398 LYS B O   1 
ATOM   6555 C CB  . LYS B 1 391 ? 34.297 35.144  -5.946  1.00 18.08 ? 398 LYS B CB  1 
ATOM   6556 C CG  . LYS B 1 391 ? 34.120 35.984  -7.210  1.00 22.70 ? 398 LYS B CG  1 
ATOM   6557 C CD  . LYS B 1 391 ? 33.008 37.012  -7.076  1.00 21.43 ? 398 LYS B CD  1 
ATOM   6558 C CE  . LYS B 1 391 ? 32.740 37.719  -8.393  1.00 20.38 ? 398 LYS B CE  1 
ATOM   6559 N NZ  . LYS B 1 391 ? 31.720 38.795  -8.229  1.00 17.28 ? 398 LYS B NZ  1 
ATOM   6560 N N   . GLY B 1 392 ? 33.777 34.312  -3.029  1.00 15.69 ? 399 GLY B N   1 
ATOM   6561 C CA  . GLY B 1 392 ? 33.887 33.297  -1.998  1.00 15.72 ? 399 GLY B CA  1 
ATOM   6562 C C   . GLY B 1 392 ? 34.448 33.715  -0.649  1.00 18.43 ? 399 GLY B C   1 
ATOM   6563 O O   . GLY B 1 392 ? 34.964 32.872  0.083   1.00 13.05 ? 399 GLY B O   1 
ATOM   6564 N N   . ARG B 1 393 ? 34.357 34.999  -0.306  1.00 18.44 ? 400 ARG B N   1 
ATOM   6565 C CA  . ARG B 1 393 ? 34.857 35.442  0.988   1.00 16.80 ? 400 ARG B CA  1 
ATOM   6566 C C   . ARG B 1 393 ? 34.316 36.789  1.467   1.00 20.10 ? 400 ARG B C   1 
ATOM   6567 O O   . ARG B 1 393 ? 34.322 37.782  0.729   1.00 21.00 ? 400 ARG B O   1 
ATOM   6568 C CB  . ARG B 1 393 ? 36.390 35.502  0.986   1.00 16.81 ? 400 ARG B CB  1 
ATOM   6569 C CG  . ARG B 1 393 ? 36.990 35.751  2.382   1.00 14.29 ? 400 ARG B CG  1 
ATOM   6570 C CD  . ARG B 1 393 ? 38.510 35.790  2.326   1.00 18.62 ? 400 ARG B CD  1 
ATOM   6571 N NE  . ARG B 1 393 ? 39.147 35.839  3.644   1.00 19.81 ? 400 ARG B NE  1 
ATOM   6572 C CZ  . ARG B 1 393 ? 39.148 34.839  4.528   1.00 26.29 ? 400 ARG B CZ  1 
ATOM   6573 N NH1 . ARG B 1 393 ? 38.536 33.691  4.256   1.00 23.02 ? 400 ARG B NH1 1 
ATOM   6574 N NH2 . ARG B 1 393 ? 39.789 34.976  5.683   1.00 20.91 ? 400 ARG B NH2 1 
ATOM   6575 N N   . ILE B 1 394 ? 33.853 36.820  2.712   1.00 16.24 ? 401 ILE B N   1 
ATOM   6576 C CA  . ILE B 1 394 ? 33.357 38.057  3.290   1.00 17.86 ? 401 ILE B CA  1 
ATOM   6577 C C   . ILE B 1 394 ? 34.552 38.760  3.924   1.00 20.27 ? 401 ILE B C   1 
ATOM   6578 O O   . ILE B 1 394 ? 34.909 38.471  5.068   1.00 22.22 ? 401 ILE B O   1 
ATOM   6579 C CB  . ILE B 1 394 ? 32.293 37.811  4.389   1.00 15.71 ? 401 ILE B CB  1 
ATOM   6580 C CG1 . ILE B 1 394 ? 31.111 37.026  3.817   1.00 19.01 ? 401 ILE B CG1 1 
ATOM   6581 C CG2 . ILE B 1 394 ? 31.802 39.142  4.936   1.00 19.92 ? 401 ILE B CG2 1 
ATOM   6582 C CD1 . ILE B 1 394 ? 30.434 37.696  2.647   1.00 18.16 ? 401 ILE B CD1 1 
ATOM   6583 N N   . ALA B 1 395 ? 35.174 39.663  3.171   1.00 19.64 ? 402 ALA B N   1 
ATOM   6584 C CA  . ALA B 1 395 ? 36.330 40.420  3.650   1.00 21.03 ? 402 ALA B CA  1 
ATOM   6585 C C   . ALA B 1 395 ? 36.373 41.774  2.947   1.00 21.64 ? 402 ALA B C   1 
ATOM   6586 O O   . ALA B 1 395 ? 35.865 41.916  1.837   1.00 22.88 ? 402 ALA B O   1 
ATOM   6587 C CB  . ALA B 1 395 ? 37.620 39.648  3.380   1.00 23.50 ? 402 ALA B CB  1 
ATOM   6588 N N   . VAL B 1 396 ? 36.972 42.766  3.600   1.00 21.50 ? 403 VAL B N   1 
ATOM   6589 C CA  . VAL B 1 396 ? 37.061 44.107  3.027   1.00 22.10 ? 403 VAL B CA  1 
ATOM   6590 C C   . VAL B 1 396 ? 37.794 44.068  1.692   1.00 20.13 ? 403 VAL B C   1 
ATOM   6591 O O   . VAL B 1 396 ? 38.887 43.517  1.590   1.00 20.47 ? 403 VAL B O   1 
ATOM   6592 C CB  . VAL B 1 396 ? 37.803 45.087  3.976   1.00 23.77 ? 403 VAL B CB  1 
ATOM   6593 C CG1 . VAL B 1 396 ? 37.961 46.450  3.294   1.00 26.69 ? 403 VAL B CG1 1 
ATOM   6594 C CG2 . VAL B 1 396 ? 37.035 45.245  5.281   1.00 21.04 ? 403 VAL B CG2 1 
ATOM   6595 N N   . GLY B 1 397 ? 37.191 44.651  0.663   1.00 23.05 ? 404 GLY B N   1 
ATOM   6596 C CA  . GLY B 1 397 ? 37.833 44.651  -0.639  1.00 22.75 ? 404 GLY B CA  1 
ATOM   6597 C C   . GLY B 1 397 ? 37.249 43.631  -1.601  1.00 24.06 ? 404 GLY B C   1 
ATOM   6598 O O   . GLY B 1 397 ? 37.430 43.748  -2.815  1.00 22.15 ? 404 GLY B O   1 
ATOM   6599 N N   . SER B 1 398 ? 36.554 42.629  -1.067  1.00 23.10 ? 405 SER B N   1 
ATOM   6600 C CA  . SER B 1 398 ? 35.938 41.599  -1.903  1.00 24.46 ? 405 SER B CA  1 
ATOM   6601 C C   . SER B 1 398 ? 34.634 42.130  -2.474  1.00 23.25 ? 405 SER B C   1 
ATOM   6602 O O   . SER B 1 398 ? 34.030 43.030  -1.899  1.00 25.83 ? 405 SER B O   1 
ATOM   6603 C CB  . SER B 1 398 ? 35.634 40.339  -1.082  1.00 19.75 ? 405 SER B CB  1 
ATOM   6604 O OG  . SER B 1 398 ? 36.804 39.773  -0.523  1.00 24.79 ? 405 SER B OG  1 
ATOM   6605 N N   . ASP B 1 399 ? 34.202 41.566  -3.596  1.00 20.52 ? 406 ASP B N   1 
ATOM   6606 C CA  . ASP B 1 399 ? 32.952 41.976  -4.223  1.00 20.23 ? 406 ASP B CA  1 
ATOM   6607 C C   . ASP B 1 399 ? 31.807 41.728  -3.256  1.00 24.18 ? 406 ASP B C   1 
ATOM   6608 O O   . ASP B 1 399 ? 31.862 40.802  -2.443  1.00 27.24 ? 406 ASP B O   1 
ATOM   6609 C CB  . ASP B 1 399 ? 32.701 41.181  -5.512  1.00 19.22 ? 406 ASP B CB  1 
ATOM   6610 C CG  . ASP B 1 399 ? 33.652 41.564  -6.631  1.00 17.80 ? 406 ASP B CG  1 
ATOM   6611 O OD1 . ASP B 1 399 ? 34.513 42.441  -6.411  1.00 20.95 ? 406 ASP B OD1 1 
ATOM   6612 O OD2 . ASP B 1 399 ? 33.533 40.990  -7.736  1.00 20.48 ? 406 ASP B OD2 1 
ATOM   6613 N N   . ALA B 1 400 ? 30.761 42.545  -3.359  1.00 25.08 ? 407 ALA B N   1 
ATOM   6614 C CA  . ALA B 1 400 ? 29.603 42.422  -2.488  1.00 20.80 ? 407 ALA B CA  1 
ATOM   6615 C C   . ALA B 1 400 ? 28.581 41.411  -2.996  1.00 23.73 ? 407 ALA B C   1 
ATOM   6616 O O   . ALA B 1 400 ? 27.500 41.775  -3.474  1.00 24.90 ? 407 ALA B O   1 
ATOM   6617 C CB  . ALA B 1 400 ? 28.940 43.786  -2.298  1.00 22.80 ? 407 ALA B CB  1 
ATOM   6618 N N   . ASP B 1 401 ? 28.935 40.136  -2.907  1.00 21.88 ? 408 ASP B N   1 
ATOM   6619 C CA  . ASP B 1 401 ? 28.033 39.068  -3.306  1.00 20.02 ? 408 ASP B CA  1 
ATOM   6620 C C   . ASP B 1 401 ? 27.766 38.371  -1.977  1.00 21.09 ? 408 ASP B C   1 
ATOM   6621 O O   . ASP B 1 401 ? 28.601 37.606  -1.491  1.00 20.73 ? 408 ASP B O   1 
ATOM   6622 C CB  . ASP B 1 401 ? 28.710 38.124  -4.307  1.00 19.68 ? 408 ASP B CB  1 
ATOM   6623 C CG  . ASP B 1 401 ? 28.866 38.746  -5.694  1.00 21.17 ? 408 ASP B CG  1 
ATOM   6624 O OD1 . ASP B 1 401 ? 28.281 39.818  -5.934  1.00 20.15 ? 408 ASP B OD1 1 
ATOM   6625 O OD2 . ASP B 1 401 ? 29.562 38.156  -6.551  1.00 20.75 ? 408 ASP B OD2 1 
ATOM   6626 N N   . VAL B 1 402 ? 26.608 38.655  -1.383  1.00 22.28 ? 409 VAL B N   1 
ATOM   6627 C CA  . VAL B 1 402 ? 26.274 38.109  -0.072  1.00 19.99 ? 409 VAL B CA  1 
ATOM   6628 C C   . VAL B 1 402 ? 24.905 37.447  0.042   1.00 21.60 ? 409 VAL B C   1 
ATOM   6629 O O   . VAL B 1 402 ? 23.963 37.796  -0.673  1.00 21.93 ? 409 VAL B O   1 
ATOM   6630 C CB  . VAL B 1 402 ? 26.379 39.230  0.988   1.00 19.66 ? 409 VAL B CB  1 
ATOM   6631 C CG1 . VAL B 1 402 ? 26.137 38.679  2.384   1.00 23.59 ? 409 VAL B CG1 1 
ATOM   6632 C CG2 . VAL B 1 402 ? 27.741 39.877  0.898   1.00 23.22 ? 409 VAL B CG2 1 
ATOM   6633 N N   . VAL B 1 403 ? 24.808 36.482  0.953   1.00 20.74 ? 410 VAL B N   1 
ATOM   6634 C CA  . VAL B 1 403 ? 23.564 35.770  1.191   1.00 15.28 ? 410 VAL B CA  1 
ATOM   6635 C C   . VAL B 1 403 ? 23.281 35.581  2.674   1.00 18.82 ? 410 VAL B C   1 
ATOM   6636 O O   . VAL B 1 403 ? 24.146 35.137  3.420   1.00 18.89 ? 410 VAL B O   1 
ATOM   6637 C CB  . VAL B 1 403 ? 23.572 34.363  0.541   1.00 17.71 ? 410 VAL B CB  1 
ATOM   6638 C CG1 . VAL B 1 403 ? 22.384 33.551  1.050   1.00 12.89 ? 410 VAL B CG1 1 
ATOM   6639 C CG2 . VAL B 1 403 ? 23.511 34.480  -0.979  1.00 12.69 ? 410 VAL B CG2 1 
ATOM   6640 N N   . ILE B 1 404 ? 22.075 35.938  3.108   1.00 17.54 ? 411 ILE B N   1 
ATOM   6641 C CA  . ILE B 1 404 ? 21.703 35.713  4.493   1.00 17.80 ? 411 ILE B CA  1 
ATOM   6642 C C   . ILE B 1 404 ? 20.989 34.358  4.451   1.00 18.92 ? 411 ILE B C   1 
ATOM   6643 O O   . ILE B 1 404 ? 19.934 34.204  3.833   1.00 18.45 ? 411 ILE B O   1 
ATOM   6644 C CB  . ILE B 1 404 ? 20.779 36.822  5.033   1.00 21.39 ? 411 ILE B CB  1 
ATOM   6645 C CG1 . ILE B 1 404 ? 21.533 38.157  5.037   1.00 22.93 ? 411 ILE B CG1 1 
ATOM   6646 C CG2 . ILE B 1 404 ? 20.326 36.471  6.448   1.00 15.88 ? 411 ILE B CG2 1 
ATOM   6647 C CD1 . ILE B 1 404 ? 20.755 39.318  5.623   1.00 22.29 ? 411 ILE B CD1 1 
ATOM   6648 N N   . TRP B 1 405 ? 21.602 33.372  5.092   1.00 18.16 ? 412 TRP B N   1 
ATOM   6649 C CA  . TRP B 1 405 ? 21.098 31.999  5.103   1.00 20.16 ? 412 TRP B CA  1 
ATOM   6650 C C   . TRP B 1 405 ? 20.435 31.599  6.416   1.00 21.37 ? 412 TRP B C   1 
ATOM   6651 O O   . TRP B 1 405 ? 20.967 31.863  7.495   1.00 23.00 ? 412 TRP B O   1 
ATOM   6652 C CB  . TRP B 1 405 ? 22.273 31.055  4.804   1.00 19.10 ? 412 TRP B CB  1 
ATOM   6653 C CG  . TRP B 1 405 ? 21.910 29.617  4.623   1.00 24.44 ? 412 TRP B CG  1 
ATOM   6654 C CD1 . TRP B 1 405 ? 21.754 28.668  5.601   1.00 17.30 ? 412 TRP B CD1 1 
ATOM   6655 C CD2 . TRP B 1 405 ? 21.663 28.956  3.379   1.00 23.17 ? 412 TRP B CD2 1 
ATOM   6656 N NE1 . TRP B 1 405 ? 21.432 27.457  5.034   1.00 21.31 ? 412 TRP B NE1 1 
ATOM   6657 C CE2 . TRP B 1 405 ? 21.369 27.606  3.674   1.00 19.50 ? 412 TRP B CE2 1 
ATOM   6658 C CE3 . TRP B 1 405 ? 21.666 29.376  2.041   1.00 27.53 ? 412 TRP B CE3 1 
ATOM   6659 C CZ2 . TRP B 1 405 ? 21.079 26.668  2.673   1.00 23.84 ? 412 TRP B CZ2 1 
ATOM   6660 C CZ3 . TRP B 1 405 ? 21.379 28.439  1.044   1.00 28.07 ? 412 TRP B CZ3 1 
ATOM   6661 C CH2 . TRP B 1 405 ? 21.090 27.101  1.370   1.00 25.71 ? 412 TRP B CH2 1 
ATOM   6662 N N   . ASP B 1 406 ? 19.274 30.960  6.306   1.00 23.72 ? 413 ASP B N   1 
ATOM   6663 C CA  . ASP B 1 406 ? 18.556 30.511  7.477   1.00 24.39 ? 413 ASP B CA  1 
ATOM   6664 C C   . ASP B 1 406 ? 18.692 29.010  7.527   1.00 24.98 ? 413 ASP B C   1 
ATOM   6665 O O   . ASP B 1 406 ? 18.156 28.294  6.680   1.00 25.97 ? 413 ASP B O   1 
ATOM   6666 C CB  . ASP B 1 406 ? 17.062 30.868  7.408   1.00 28.42 ? 413 ASP B CB  1 
ATOM   6667 C CG  . ASP B 1 406 ? 16.363 30.717  8.756   1.00 30.30 ? 413 ASP B CG  1 
ATOM   6668 O OD1 . ASP B 1 406 ? 16.688 29.787  9.521   1.00 28.95 ? 413 ASP B OD1 1 
ATOM   6669 O OD2 . ASP B 1 406 ? 15.475 31.540  9.048   1.00 36.35 ? 413 ASP B OD2 1 
ATOM   6670 N N   . PRO B 1 407 ? 19.406 28.513  8.527   1.00 25.97 ? 414 PRO B N   1 
ATOM   6671 C CA  . PRO B 1 407 ? 19.593 27.078  8.668   1.00 30.46 ? 414 PRO B CA  1 
ATOM   6672 C C   . PRO B 1 407 ? 18.324 26.278  9.030   1.00 34.54 ? 414 PRO B C   1 
ATOM   6673 O O   . PRO B 1 407 ? 18.264 25.096  8.757   1.00 36.16 ? 414 PRO B O   1 
ATOM   6674 C CB  . PRO B 1 407 ? 20.677 27.002  9.751   1.00 30.96 ? 414 PRO B CB  1 
ATOM   6675 C CG  . PRO B 1 407 ? 20.286 28.137  10.655  1.00 30.41 ? 414 PRO B CG  1 
ATOM   6676 C CD  . PRO B 1 407 ? 20.025 29.241  9.649   1.00 26.55 ? 414 PRO B CD  1 
ATOM   6677 N N   . ASP B 1 408 ? 17.323 26.934  9.607   1.00 36.50 ? 415 ASP B N   1 
ATOM   6678 C CA  . ASP B 1 408 ? 16.110 26.252  10.043  1.00 41.99 ? 415 ASP B CA  1 
ATOM   6679 C C   . ASP B 1 408 ? 14.827 26.742  9.390   1.00 45.49 ? 415 ASP B C   1 
ATOM   6680 O O   . ASP B 1 408 ? 13.893 27.239  10.077  1.00 49.33 ? 415 ASP B O   1 
ATOM   6681 C CB  . ASP B 1 408 ? 15.957 26.415  11.554  1.00 44.41 ? 415 ASP B CB  1 
ATOM   6682 C CG  . ASP B 1 408 ? 17.225 26.173  12.329  1.00 45.06 ? 415 ASP B CG  1 
ATOM   6683 O OD1 . ASP B 1 408 ? 17.744 25.043  12.265  1.00 47.55 ? 415 ASP B OD1 1 
ATOM   6684 O OD2 . ASP B 1 408 ? 17.734 27.121  12.946  1.00 42.91 ? 415 ASP B OD2 1 
ATOM   6685 N N   . LYS B 1 409 ? 14.682 26.456  8.097   1.00 44.22 ? 416 LYS B N   1 
ATOM   6686 C CA  . LYS B 1 409 ? 13.527 26.930  7.413   1.00 44.60 ? 416 LYS B CA  1 
ATOM   6687 C C   . LYS B 1 409 ? 13.337 25.992  6.230   1.00 42.34 ? 416 LYS B C   1 
ATOM   6688 O O   . LYS B 1 409 ? 14.116 26.045  5.279   1.00 39.58 ? 416 LYS B O   1 
ATOM   6689 C CB  . LYS B 1 409 ? 13.800 28.396  7.010   1.00 45.84 ? 416 LYS B CB  1 
ATOM   6690 C CG  . LYS B 1 409 ? 14.043 28.650  5.533   1.00 45.66 ? 416 LYS B CG  1 
ATOM   6691 C CD  . LYS B 1 409 ? 12.790 29.301  4.904   1.00 41.75 ? 416 LYS B CD  1 
ATOM   6692 C CE  . LYS B 1 409 ? 12.985 30.807  4.641   1.00 42.93 ? 416 LYS B CE  1 
ATOM   6693 N NZ  . LYS B 1 409 ? 11.856 31.384  3.822   1.00 44.21 ? 416 LYS B NZ  1 
ATOM   6694 N N   . MET B 1 410 ? 12.316 25.136  6.311   1.00 44.74 ? 417 MET B N   1 
ATOM   6695 C CA  . MET B 1 410 ? 12.059 24.141  5.279   1.00 47.35 ? 417 MET B CA  1 
ATOM   6696 C C   . MET B 1 410 ? 11.783 24.695  3.903   1.00 44.27 ? 417 MET B C   1 
ATOM   6697 O O   . MET B 1 410 ? 11.333 25.838  3.745   1.00 42.41 ? 417 MET B O   1 
ATOM   6698 C CB  . MET B 1 410 ? 10.909 23.260  5.717   1.00 56.03 ? 417 MET B CB  1 
ATOM   6699 C CG  . MET B 1 410 ? 10.972 22.986  7.196   1.00 66.52 ? 417 MET B CG  1 
ATOM   6700 S SD  . MET B 1 410 ? 9.370  22.496  7.815   1.00 79.88 ? 417 MET B SD  1 
ATOM   6701 C CE  . MET B 1 410 ? 8.442  24.088  7.658   1.00 79.26 ? 417 MET B CE  1 
ATOM   6702 N N   . LYS B 1 411 ? 12.057 23.868  2.904   1.00 42.64 ? 418 LYS B N   1 
ATOM   6703 C CA  . LYS B 1 411 ? 11.844 24.228  1.518   1.00 40.36 ? 418 LYS B CA  1 
ATOM   6704 C C   . LYS B 1 411 ? 11.659 22.881  0.846   1.00 37.45 ? 418 LYS B C   1 
ATOM   6705 O O   . LYS B 1 411 ? 12.578 22.050  0.864   1.00 34.37 ? 418 LYS B O   1 
ATOM   6706 C CB  . LYS B 1 411 ? 13.079 24.957  0.981   1.00 42.31 ? 418 LYS B CB  1 
ATOM   6707 C CG  . LYS B 1 411 ? 13.134 25.083  -0.541  1.00 46.92 ? 418 LYS B CG  1 
ATOM   6708 C CD  . LYS B 1 411 ? 11.920 25.794  -1.114  1.00 49.74 ? 418 LYS B CD  1 
ATOM   6709 C CE  . LYS B 1 411 ? 12.098 25.981  -2.621  1.00 51.50 ? 418 LYS B CE  1 
ATOM   6710 N NZ  . LYS B 1 411 ? 10.791 26.113  -3.344  1.00 54.85 ? 418 LYS B NZ  1 
ATOM   6711 N N   . THR B 1 412 ? 10.457 22.665  0.303   1.00 31.65 ? 419 THR B N   1 
ATOM   6712 C CA  . THR B 1 412 ? 10.131 21.437  -0.401  1.00 29.96 ? 419 THR B CA  1 
ATOM   6713 C C   . THR B 1 412 ? 10.204 21.820  -1.863  1.00 27.35 ? 419 THR B C   1 
ATOM   6714 O O   . THR B 1 412 ? 9.471  22.706  -2.308  1.00 28.25 ? 419 THR B O   1 
ATOM   6715 C CB  . THR B 1 412 ? 8.696  20.942  -0.065  1.00 29.67 ? 419 THR B CB  1 
ATOM   6716 O OG1 . THR B 1 412 ? 8.632  20.546  1.312   1.00 35.40 ? 419 THR B OG1 1 
ATOM   6717 C CG2 . THR B 1 412 ? 8.311  19.764  -0.942  1.00 24.80 ? 419 THR B CG2 1 
ATOM   6718 N N   . ILE B 1 413 ? 11.099 21.163  -2.603  1.00 25.49 ? 420 ILE B N   1 
ATOM   6719 C CA  . ILE B 1 413 ? 11.292 21.430  -4.028  1.00 21.75 ? 420 ILE B CA  1 
ATOM   6720 C C   . ILE B 1 413 ? 10.196 20.781  -4.873  1.00 24.04 ? 420 ILE B C   1 
ATOM   6721 O O   . ILE B 1 413 ? 9.937  19.578  -4.759  1.00 22.57 ? 420 ILE B O   1 
ATOM   6722 C CB  . ILE B 1 413 ? 12.654 20.894  -4.507  1.00 23.32 ? 420 ILE B CB  1 
ATOM   6723 C CG1 . ILE B 1 413 ? 13.787 21.531  -3.692  1.00 22.86 ? 420 ILE B CG1 1 
ATOM   6724 C CG2 . ILE B 1 413 ? 12.831 21.183  -5.990  1.00 17.35 ? 420 ILE B CG2 1 
ATOM   6725 C CD1 . ILE B 1 413 ? 15.139 20.847  -3.857  1.00 20.59 ? 420 ILE B CD1 1 
ATOM   6726 N N   . THR B 1 414 ? 9.567  21.584  -5.721  1.00 21.76 ? 421 THR B N   1 
ATOM   6727 C CA  . THR B 1 414 ? 8.496  21.117  -6.597  1.00 23.75 ? 421 THR B CA  1 
ATOM   6728 C C   . THR B 1 414 ? 8.601  21.831  -7.933  1.00 20.89 ? 421 THR B C   1 
ATOM   6729 O O   . THR B 1 414 ? 9.015  22.984  -7.996  1.00 20.52 ? 421 THR B O   1 
ATOM   6730 C CB  . THR B 1 414 ? 7.101  21.416  -5.993  1.00 26.70 ? 421 THR B CB  1 
ATOM   6731 O OG1 . THR B 1 414 ? 7.042  22.792  -5.586  1.00 26.83 ? 421 THR B OG1 1 
ATOM   6732 C CG2 . THR B 1 414 ? 6.842  20.531  -4.775  1.00 30.14 ? 421 THR B CG2 1 
ATOM   6733 N N   . ALA B 1 415 ? 8.233  21.140  -9.001  1.00 21.29 ? 422 ALA B N   1 
ATOM   6734 C CA  . ALA B 1 415 ? 8.275  21.736  -10.326 1.00 22.47 ? 422 ALA B CA  1 
ATOM   6735 C C   . ALA B 1 415 ? 7.178  22.780  -10.452 1.00 24.68 ? 422 ALA B C   1 
ATOM   6736 O O   . ALA B 1 415 ? 7.305  23.735  -11.210 1.00 26.04 ? 422 ALA B O   1 
ATOM   6737 C CB  . ALA B 1 415 ? 8.088  20.671  -11.388 1.00 25.74 ? 422 ALA B CB  1 
ATOM   6738 N N   . LYS B 1 416 ? 6.105  22.615  -9.696  1.00 24.84 ? 423 LYS B N   1 
ATOM   6739 C CA  . LYS B 1 416 ? 5.001  23.561  -9.795  1.00 32.22 ? 423 LYS B CA  1 
ATOM   6740 C C   . LYS B 1 416 ? 5.394  24.971  -9.356  1.00 31.07 ? 423 LYS B C   1 
ATOM   6741 O O   . LYS B 1 416 ? 4.710  25.941  -9.678  1.00 29.34 ? 423 LYS B O   1 
ATOM   6742 C CB  . LYS B 1 416 ? 3.794  23.059  -8.989  1.00 30.37 ? 423 LYS B CB  1 
ATOM   6743 C CG  . LYS B 1 416 ? 3.759  23.520  -7.549  1.00 36.68 ? 423 LYS B CG  1 
ATOM   6744 C CD  . LYS B 1 416 ? 2.523  22.964  -6.841  1.00 44.98 ? 423 LYS B CD  1 
ATOM   6745 C CE  . LYS B 1 416 ? 2.356  23.578  -5.441  1.00 50.57 ? 423 LYS B CE  1 
ATOM   6746 N NZ  . LYS B 1 416 ? 3.591  23.458  -4.595  1.00 54.15 ? 423 LYS B NZ  1 
ATOM   6747 N N   . SER B 1 417 ? 6.514  25.089  -8.651  1.00 32.29 ? 424 SER B N   1 
ATOM   6748 C CA  . SER B 1 417 ? 6.953  26.395  -8.177  1.00 30.78 ? 424 SER B CA  1 
ATOM   6749 C C   . SER B 1 417 ? 8.402  26.752  -8.487  1.00 27.82 ? 424 SER B C   1 
ATOM   6750 O O   . SER B 1 417 ? 8.827  27.860  -8.202  1.00 28.91 ? 424 SER B O   1 
ATOM   6751 C CB  . SER B 1 417 ? 6.737  26.494  -6.668  1.00 34.53 ? 424 SER B CB  1 
ATOM   6752 O OG  . SER B 1 417 ? 7.587  25.582  -5.979  1.00 40.90 ? 424 SER B OG  1 
ATOM   6753 N N   . HIS B 1 418 ? 9.164  25.842  -9.079  1.00 26.24 ? 425 HIS B N   1 
ATOM   6754 C CA  . HIS B 1 418 ? 10.561 26.155  -9.366  1.00 22.59 ? 425 HIS B CA  1 
ATOM   6755 C C   . HIS B 1 418 ? 10.712 27.271  -10.395 1.00 23.95 ? 425 HIS B C   1 
ATOM   6756 O O   . HIS B 1 418 ? 9.770  27.596  -11.121 1.00 24.96 ? 425 HIS B O   1 
ATOM   6757 C CB  . HIS B 1 418 ? 11.329 24.891  -9.796  1.00 23.03 ? 425 HIS B CB  1 
ATOM   6758 C CG  . HIS B 1 418 ? 10.939 24.336  -11.132 1.00 19.35 ? 425 HIS B CG  1 
ATOM   6759 N ND1 . HIS B 1 418 ? 11.352 23.093  -11.565 1.00 17.59 ? 425 HIS B ND1 1 
ATOM   6760 C CD2 . HIS B 1 418 ? 10.233 24.875  -12.161 1.00 18.10 ? 425 HIS B CD2 1 
ATOM   6761 C CE1 . HIS B 1 418 ? 10.925 22.894  -12.798 1.00 20.41 ? 425 HIS B CE1 1 
ATOM   6762 N NE2 . HIS B 1 418 ? 10.249 23.951  -13.186 1.00 20.51 ? 425 HIS B NE2 1 
ATOM   6763 N N   . LYS B 1 419 ? 11.897 27.867  -10.456 1.00 17.95 ? 426 LYS B N   1 
ATOM   6764 C CA  . LYS B 1 419 ? 12.123 28.954  -11.390 1.00 19.18 ? 426 LYS B CA  1 
ATOM   6765 C C   . LYS B 1 419 ? 12.536 28.505  -12.789 1.00 20.79 ? 426 LYS B C   1 
ATOM   6766 O O   . LYS B 1 419 ? 12.581 29.316  -13.708 1.00 19.83 ? 426 LYS B O   1 
ATOM   6767 C CB  . LYS B 1 419 ? 13.150 29.942  -10.817 1.00 19.16 ? 426 LYS B CB  1 
ATOM   6768 C CG  . LYS B 1 419 ? 12.622 30.753  -9.626  1.00 23.90 ? 426 LYS B CG  1 
ATOM   6769 C CD  . LYS B 1 419 ? 11.278 31.394  -9.962  1.00 33.32 ? 426 LYS B CD  1 
ATOM   6770 C CE  . LYS B 1 419 ? 10.878 32.525  -8.998  1.00 46.08 ? 426 LYS B CE  1 
ATOM   6771 N NZ  . LYS B 1 419 ? 10.595 32.105  -7.569  1.00 48.69 ? 426 LYS B NZ  1 
ATOM   6772 N N   . SER B 1 420 ? 12.837 27.223  -12.966 1.00 18.54 ? 427 SER B N   1 
ATOM   6773 C CA  . SER B 1 420 ? 13.209 26.754  -14.295 1.00 19.33 ? 427 SER B CA  1 
ATOM   6774 C C   . SER B 1 420 ? 11.957 26.785  -15.161 1.00 19.32 ? 427 SER B C   1 
ATOM   6775 O O   . SER B 1 420 ? 10.853 26.872  -14.641 1.00 20.82 ? 427 SER B O   1 
ATOM   6776 C CB  . SER B 1 420 ? 13.756 25.331  -14.237 1.00 20.77 ? 427 SER B CB  1 
ATOM   6777 O OG  . SER B 1 420 ? 14.016 24.851  -15.546 1.00 23.38 ? 427 SER B OG  1 
ATOM   6778 N N   . THR B 1 421 ? 12.122 26.700  -16.476 1.00 22.25 ? 428 THR B N   1 
ATOM   6779 C CA  . THR B 1 421 ? 10.971 26.729  -17.376 1.00 23.78 ? 428 THR B CA  1 
ATOM   6780 C C   . THR B 1 421 ? 10.410 25.346  -17.676 1.00 24.08 ? 428 THR B C   1 
ATOM   6781 O O   . THR B 1 421 ? 9.268  25.227  -18.115 1.00 27.42 ? 428 THR B O   1 
ATOM   6782 C CB  . THR B 1 421 ? 11.318 27.346  -18.743 1.00 25.32 ? 428 THR B CB  1 
ATOM   6783 O OG1 . THR B 1 421 ? 12.161 26.437  -19.460 1.00 21.24 ? 428 THR B OG1 1 
ATOM   6784 C CG2 . THR B 1 421 ? 12.033 28.689  -18.578 1.00 26.20 ? 428 THR B CG2 1 
ATOM   6785 N N   . VAL B 1 422 ? 11.204 24.302  -17.458 1.00 22.72 ? 429 VAL B N   1 
ATOM   6786 C CA  . VAL B 1 422 ? 10.755 22.941  -17.762 1.00 20.10 ? 429 VAL B CA  1 
ATOM   6787 C C   . VAL B 1 422 ? 9.659  22.411  -16.836 1.00 22.67 ? 429 VAL B C   1 
ATOM   6788 O O   . VAL B 1 422 ? 9.459  22.919  -15.733 1.00 22.28 ? 429 VAL B O   1 
ATOM   6789 C CB  . VAL B 1 422 ? 11.939 21.953  -17.761 1.00 19.92 ? 429 VAL B CB  1 
ATOM   6790 C CG1 . VAL B 1 422 ? 13.054 22.496  -18.639 1.00 15.81 ? 429 VAL B CG1 1 
ATOM   6791 C CG2 . VAL B 1 422 ? 12.424 21.703  -16.337 1.00 16.38 ? 429 VAL B CG2 1 
ATOM   6792 N N   . GLU B 1 423 ? 8.967  21.370  -17.289 1.00 18.25 ? 430 GLU B N   1 
ATOM   6793 C CA  . GLU B 1 423 ? 7.869  20.784  -16.537 1.00 21.15 ? 430 GLU B CA  1 
ATOM   6794 C C   . GLU B 1 423 ? 8.235  19.848  -15.378 1.00 23.27 ? 430 GLU B C   1 
ATOM   6795 O O   . GLU B 1 423 ? 7.464  19.709  -14.427 1.00 24.29 ? 430 GLU B O   1 
ATOM   6796 C CB  . GLU B 1 423 ? 6.921  20.064  -17.500 1.00 23.06 ? 430 GLU B CB  1 
ATOM   6797 C CG  . GLU B 1 423 ? 6.359  20.962  -18.605 1.00 28.07 ? 430 GLU B CG  1 
ATOM   6798 C CD  . GLU B 1 423 ? 7.147  20.888  -19.912 1.00 33.82 ? 430 GLU B CD  1 
ATOM   6799 O OE1 . GLU B 1 423 ? 8.389  20.708  -19.871 1.00 30.09 ? 430 GLU B OE1 1 
ATOM   6800 O OE2 . GLU B 1 423 ? 6.520  21.032  -20.992 1.00 36.40 ? 430 GLU B OE2 1 
ATOM   6801 N N   . TYR B 1 424 ? 9.395  19.206  -15.443 1.00 20.38 ? 431 TYR B N   1 
ATOM   6802 C CA  . TYR B 1 424 ? 9.804  18.301  -14.371 1.00 20.67 ? 431 TYR B CA  1 
ATOM   6803 C C   . TYR B 1 424 ? 10.993 18.826  -13.578 1.00 20.18 ? 431 TYR B C   1 
ATOM   6804 O O   . TYR B 1 424 ? 11.727 19.695  -14.056 1.00 19.59 ? 431 TYR B O   1 
ATOM   6805 C CB  . TYR B 1 424 ? 10.162 16.928  -14.940 1.00 20.98 ? 431 TYR B CB  1 
ATOM   6806 C CG  . TYR B 1 424 ? 8.966  16.086  -15.279 1.00 25.34 ? 431 TYR B CG  1 
ATOM   6807 C CD1 . TYR B 1 424 ? 8.304  16.230  -16.495 1.00 27.18 ? 431 TYR B CD1 1 
ATOM   6808 C CD2 . TYR B 1 424 ? 8.455  15.185  -14.352 1.00 21.30 ? 431 TYR B CD2 1 
ATOM   6809 C CE1 . TYR B 1 424 ? 7.153  15.498  -16.773 1.00 26.39 ? 431 TYR B CE1 1 
ATOM   6810 C CE2 . TYR B 1 424 ? 7.314  14.454  -14.619 1.00 23.76 ? 431 TYR B CE2 1 
ATOM   6811 C CZ  . TYR B 1 424 ? 6.666  14.617  -15.828 1.00 23.34 ? 431 TYR B CZ  1 
ATOM   6812 O OH  . TYR B 1 424 ? 5.517  13.908  -16.072 1.00 23.72 ? 431 TYR B OH  1 
ATOM   6813 N N   . ASN B 1 425 ? 11.166 18.292  -12.369 1.00 18.54 ? 432 ASN B N   1 
ATOM   6814 C CA  . ASN B 1 425 ? 12.277 18.655  -11.482 1.00 19.99 ? 432 ASN B CA  1 
ATOM   6815 C C   . ASN B 1 425 ? 12.802 17.373  -10.819 1.00 19.70 ? 432 ASN B C   1 
ATOM   6816 O O   . ASN B 1 425 ? 12.074 16.698  -10.090 1.00 17.52 ? 432 ASN B O   1 
ATOM   6817 C CB  . ASN B 1 425 ? 11.816 19.649  -10.411 1.00 19.37 ? 432 ASN B CB  1 
ATOM   6818 C CG  . ASN B 1 425 ? 12.978 20.258  -9.644  1.00 19.55 ? 432 ASN B CG  1 
ATOM   6819 O OD1 . ASN B 1 425 ? 13.049 21.474  -9.471  1.00 23.74 ? 432 ASN B OD1 1 
ATOM   6820 N ND2 . ASN B 1 425 ? 13.893 19.416  -9.181  1.00 15.79 ? 432 ASN B ND2 1 
ATOM   6821 N N   . ILE B 1 426 ? 14.067 17.044  -11.060 1.00 17.70 ? 433 ILE B N   1 
ATOM   6822 C CA  . ILE B 1 426 ? 14.634 15.818  -10.509 1.00 19.51 ? 433 ILE B CA  1 
ATOM   6823 C C   . ILE B 1 426 ? 14.653 15.726  -8.988  1.00 20.66 ? 433 ILE B C   1 
ATOM   6824 O O   . ILE B 1 426 ? 14.965 14.671  -8.437  1.00 19.27 ? 433 ILE B O   1 
ATOM   6825 C CB  . ILE B 1 426 ? 16.063 15.576  -11.031 1.00 18.96 ? 433 ILE B CB  1 
ATOM   6826 C CG1 . ILE B 1 426 ? 16.973 16.732  -10.605 1.00 18.97 ? 433 ILE B CG1 1 
ATOM   6827 C CG2 . ILE B 1 426 ? 16.037 15.406  -12.548 1.00 15.21 ? 433 ILE B CG2 1 
ATOM   6828 C CD1 . ILE B 1 426 ? 18.375 16.634  -11.145 1.00 18.29 ? 433 ILE B CD1 1 
ATOM   6829 N N   . PHE B 1 427 ? 14.316 16.817  -8.310  1.00 20.10 ? 434 PHE B N   1 
ATOM   6830 C CA  . PHE B 1 427 ? 14.304 16.814  -6.852  1.00 20.10 ? 434 PHE B CA  1 
ATOM   6831 C C   . PHE B 1 427 ? 12.873 16.908  -6.296  1.00 20.03 ? 434 PHE B C   1 
ATOM   6832 O O   . PHE B 1 427 ? 12.670 17.139  -5.102  1.00 18.48 ? 434 PHE B O   1 
ATOM   6833 C CB  . PHE B 1 427 ? 15.159 17.971  -6.323  1.00 18.55 ? 434 PHE B CB  1 
ATOM   6834 C CG  . PHE B 1 427 ? 16.588 17.939  -6.803  1.00 18.87 ? 434 PHE B CG  1 
ATOM   6835 C CD1 . PHE B 1 427 ? 17.421 16.860  -6.499  1.00 19.87 ? 434 PHE B CD1 1 
ATOM   6836 C CD2 . PHE B 1 427 ? 17.111 18.996  -7.543  1.00 15.56 ? 434 PHE B CD2 1 
ATOM   6837 C CE1 . PHE B 1 427 ? 18.759 16.837  -6.926  1.00 19.18 ? 434 PHE B CE1 1 
ATOM   6838 C CE2 . PHE B 1 427 ? 18.448 18.983  -7.975  1.00 17.91 ? 434 PHE B CE2 1 
ATOM   6839 C CZ  . PHE B 1 427 ? 19.269 17.900  -7.664  1.00 20.80 ? 434 PHE B CZ  1 
ATOM   6840 N N   . GLU B 1 428 ? 11.892 16.707  -7.173  1.00 18.87 ? 435 GLU B N   1 
ATOM   6841 C CA  . GLU B 1 428 ? 10.471 16.775  -6.806  1.00 20.20 ? 435 GLU B CA  1 
ATOM   6842 C C   . GLU B 1 428 ? 10.165 16.144  -5.447  1.00 21.26 ? 435 GLU B C   1 
ATOM   6843 O O   . GLU B 1 428 ? 10.569 15.018  -5.167  1.00 24.17 ? 435 GLU B O   1 
ATOM   6844 C CB  . GLU B 1 428 ? 9.623  16.081  -7.885  1.00 20.11 ? 435 GLU B CB  1 
ATOM   6845 C CG  . GLU B 1 428 ? 8.109  16.249  -7.733  1.00 21.26 ? 435 GLU B CG  1 
ATOM   6846 C CD  . GLU B 1 428 ? 7.668  17.702  -7.859  1.00 21.51 ? 435 GLU B CD  1 
ATOM   6847 O OE1 . GLU B 1 428 ? 8.113  18.384  -8.800  1.00 21.99 ? 435 GLU B OE1 1 
ATOM   6848 O OE2 . GLU B 1 428 ? 6.868  18.161  -7.019  1.00 24.48 ? 435 GLU B OE2 1 
ATOM   6849 N N   . GLY B 1 429 ? 9.455  16.880  -4.601  1.00 22.24 ? 436 GLY B N   1 
ATOM   6850 C CA  . GLY B 1 429 ? 9.083  16.351  -3.300  1.00 25.13 ? 436 GLY B CA  1 
ATOM   6851 C C   . GLY B 1 429 ? 10.116 16.387  -2.184  1.00 30.60 ? 436 GLY B C   1 
ATOM   6852 O O   . GLY B 1 429 ? 9.747  16.190  -1.021  1.00 28.67 ? 436 GLY B O   1 
ATOM   6853 N N   . MET B 1 430 ? 11.388 16.636  -2.509  1.00 27.46 ? 437 MET B N   1 
ATOM   6854 C CA  . MET B 1 430 ? 12.452 16.674  -1.498  1.00 29.26 ? 437 MET B CA  1 
ATOM   6855 C C   . MET B 1 430 ? 12.266 17.831  -0.521  1.00 28.04 ? 437 MET B C   1 
ATOM   6856 O O   . MET B 1 430 ? 12.167 18.980  -0.945  1.00 32.07 ? 437 MET B O   1 
ATOM   6857 C CB  . MET B 1 430 ? 13.837 16.815  -2.175  1.00 27.59 ? 437 MET B CB  1 
ATOM   6858 C CG  . MET B 1 430 ? 15.042 16.825  -1.207  1.00 29.81 ? 437 MET B CG  1 
ATOM   6859 S SD  . MET B 1 430 ? 16.676 17.183  -1.959  1.00 20.08 ? 437 MET B SD  1 
ATOM   6860 C CE  . MET B 1 430 ? 16.875 15.816  -2.891  1.00 23.81 ? 437 MET B CE  1 
ATOM   6861 N N   . GLU B 1 431 ? 12.195 17.554  0.778   1.00 29.06 ? 438 GLU B N   1 
ATOM   6862 C CA  . GLU B 1 431 ? 12.078 18.667  1.713   1.00 36.57 ? 438 GLU B CA  1 
ATOM   6863 C C   . GLU B 1 431 ? 13.400 18.905  2.431   1.00 35.75 ? 438 GLU B C   1 
ATOM   6864 O O   . GLU B 1 431 ? 13.873 18.078  3.217   1.00 35.27 ? 438 GLU B O   1 
ATOM   6865 C CB  . GLU B 1 431 ? 10.922 18.486  2.709   1.00 38.87 ? 438 GLU B CB  1 
ATOM   6866 C CG  . GLU B 1 431 ? 10.918 17.263  3.552   1.00 46.79 ? 438 GLU B CG  1 
ATOM   6867 C CD  . GLU B 1 431 ? 9.607  17.142  4.332   1.00 54.96 ? 438 GLU B CD  1 
ATOM   6868 O OE1 . GLU B 1 431 ? 9.413  17.890  5.329   1.00 56.58 ? 438 GLU B OE1 1 
ATOM   6869 O OE2 . GLU B 1 431 ? 8.759  16.308  3.929   1.00 56.38 ? 438 GLU B OE2 1 
ATOM   6870 N N   . CYS B 1 432 ? 13.997 20.050  2.114   1.00 35.32 ? 439 CYS B N   1 
ATOM   6871 C CA  . CYS B 1 432 ? 15.282 20.449  2.668   1.00 35.71 ? 439 CYS B CA  1 
ATOM   6872 C C   . CYS B 1 432 ? 15.096 21.450  3.787   1.00 36.20 ? 439 CYS B C   1 
ATOM   6873 O O   . CYS B 1 432 ? 14.129 22.221  3.793   1.00 36.50 ? 439 CYS B O   1 
ATOM   6874 C CB  . CYS B 1 432 ? 16.135 21.069  1.572   1.00 30.82 ? 439 CYS B CB  1 
ATOM   6875 S SG  . CYS B 1 432 ? 16.030 20.195  0.011   1.00 33.90 ? 439 CYS B SG  1 
ATOM   6876 N N   . HIS B 1 433 ? 16.030 21.442  4.732   1.00 38.27 ? 440 HIS B N   1 
ATOM   6877 C CA  . HIS B 1 433 ? 15.954 22.356  5.862   1.00 43.85 ? 440 HIS B CA  1 
ATOM   6878 C C   . HIS B 1 433 ? 17.128 23.325  5.830   1.00 41.35 ? 440 HIS B C   1 
ATOM   6879 O O   . HIS B 1 433 ? 18.126 23.119  6.525   1.00 39.87 ? 440 HIS B O   1 
ATOM   6880 C CB  . HIS B 1 433 ? 15.959 21.569  7.182   1.00 54.14 ? 440 HIS B CB  1 
ATOM   6881 C CG  . HIS B 1 433 ? 15.583 20.124  7.028   1.00 65.28 ? 440 HIS B CG  1 
ATOM   6882 N ND1 . HIS B 1 433 ? 16.476 19.166  6.585   1.00 69.91 ? 440 HIS B ND1 1 
ATOM   6883 C CD2 . HIS B 1 433 ? 14.408 19.482  7.230   1.00 69.23 ? 440 HIS B CD2 1 
ATOM   6884 C CE1 . HIS B 1 433 ? 15.864 17.994  6.523   1.00 71.81 ? 440 HIS B CE1 1 
ATOM   6885 N NE2 . HIS B 1 433 ? 14.610 18.155  6.908   1.00 73.23 ? 440 HIS B NE2 1 
ATOM   6886 N N   . GLY B 1 434 ? 17.008 24.378  5.019   1.00 38.46 ? 441 GLY B N   1 
ATOM   6887 C CA  . GLY B 1 434 ? 18.067 25.368  4.912   1.00 35.36 ? 441 GLY B CA  1 
ATOM   6888 C C   . GLY B 1 434 ? 17.996 26.063  3.571   1.00 34.96 ? 441 GLY B C   1 
ATOM   6889 O O   . GLY B 1 434 ? 18.276 25.448  2.543   1.00 39.06 ? 441 GLY B O   1 
ATOM   6890 N N   . SER B 1 435 ? 17.625 27.342  3.574   1.00 32.73 ? 442 SER B N   1 
ATOM   6891 C CA  . SER B 1 435 ? 17.494 28.110  2.340   1.00 30.46 ? 442 SER B CA  1 
ATOM   6892 C C   . SER B 1 435 ? 17.869 29.573  2.553   1.00 29.65 ? 442 SER B C   1 
ATOM   6893 O O   . SER B 1 435 ? 18.048 30.016  3.691   1.00 26.74 ? 442 SER B O   1 
ATOM   6894 C CB  . SER B 1 435 ? 16.058 28.018  1.832   1.00 34.10 ? 442 SER B CB  1 
ATOM   6895 O OG  . SER B 1 435 ? 15.161 28.401  2.859   1.00 35.23 ? 442 SER B OG  1 
ATOM   6896 N N   . PRO B 1 436 ? 18.005 30.341  1.457   1.00 27.67 ? 443 PRO B N   1 
ATOM   6897 C CA  . PRO B 1 436 ? 18.365 31.758  1.543   1.00 27.38 ? 443 PRO B CA  1 
ATOM   6898 C C   . PRO B 1 436 ? 17.201 32.621  2.016   1.00 26.11 ? 443 PRO B C   1 
ATOM   6899 O O   . PRO B 1 436 ? 16.042 32.320  1.734   1.00 22.24 ? 443 PRO B O   1 
ATOM   6900 C CB  . PRO B 1 436 ? 18.759 32.111  0.106   1.00 28.54 ? 443 PRO B CB  1 
ATOM   6901 C CG  . PRO B 1 436 ? 19.108 30.797  -0.511  1.00 31.22 ? 443 PRO B CG  1 
ATOM   6902 C CD  . PRO B 1 436 ? 18.048 29.890  0.058   1.00 27.92 ? 443 PRO B CD  1 
ATOM   6903 N N   . LEU B 1 437 ? 17.526 33.684  2.743   1.00 21.50 ? 444 LEU B N   1 
ATOM   6904 C CA  . LEU B 1 437 ? 16.533 34.626  3.230   1.00 24.77 ? 444 LEU B CA  1 
ATOM   6905 C C   . LEU B 1 437 ? 16.688 35.894  2.411   1.00 24.99 ? 444 LEU B C   1 
ATOM   6906 O O   . LEU B 1 437 ? 15.698 36.499  1.987   1.00 27.12 ? 444 LEU B O   1 
ATOM   6907 C CB  . LEU B 1 437 ? 16.759 34.963  4.699   1.00 28.15 ? 444 LEU B CB  1 
ATOM   6908 C CG  . LEU B 1 437 ? 15.657 34.517  5.651   1.00 33.30 ? 444 LEU B CG  1 
ATOM   6909 C CD1 . LEU B 1 437 ? 15.903 35.144  7.019   1.00 27.40 ? 444 LEU B CD1 1 
ATOM   6910 C CD2 . LEU B 1 437 ? 14.299 34.953  5.107   1.00 35.81 ? 444 LEU B CD2 1 
ATOM   6911 N N   . VAL B 1 438 ? 17.943 36.292  2.205   1.00 22.38 ? 445 VAL B N   1 
ATOM   6912 C CA  . VAL B 1 438 ? 18.266 37.480  1.427   1.00 19.79 ? 445 VAL B CA  1 
ATOM   6913 C C   . VAL B 1 438 ? 19.474 37.192  0.534   1.00 23.56 ? 445 VAL B C   1 
ATOM   6914 O O   . VAL B 1 438 ? 20.426 36.521  0.948   1.00 21.72 ? 445 VAL B O   1 
ATOM   6915 C CB  . VAL B 1 438 ? 18.577 38.683  2.349   1.00 19.63 ? 445 VAL B CB  1 
ATOM   6916 C CG1 . VAL B 1 438 ? 18.945 39.906  1.517   1.00 19.32 ? 445 VAL B CG1 1 
ATOM   6917 C CG2 . VAL B 1 438 ? 17.361 39.001  3.209   1.00 22.29 ? 445 VAL B CG2 1 
ATOM   6918 N N   . VAL B 1 439 ? 19.424 37.680  -0.701  1.00 19.94 ? 446 VAL B N   1 
ATOM   6919 C CA  . VAL B 1 439 ? 20.519 37.481  -1.639  1.00 21.96 ? 446 VAL B CA  1 
ATOM   6920 C C   . VAL B 1 439 ? 20.927 38.832  -2.211  1.00 23.05 ? 446 VAL B C   1 
ATOM   6921 O O   . VAL B 1 439 ? 20.086 39.610  -2.668  1.00 22.89 ? 446 VAL B O   1 
ATOM   6922 C CB  . VAL B 1 439 ? 20.120 36.519  -2.791  1.00 18.57 ? 446 VAL B CB  1 
ATOM   6923 C CG1 . VAL B 1 439 ? 21.277 36.370  -3.771  1.00 13.93 ? 446 VAL B CG1 1 
ATOM   6924 C CG2 . VAL B 1 439 ? 19.727 35.157  -2.217  1.00 16.31 ? 446 VAL B CG2 1 
ATOM   6925 N N   . ILE B 1 440 ? 22.228 39.102  -2.174  1.00 23.19 ? 447 ILE B N   1 
ATOM   6926 C CA  . ILE B 1 440 ? 22.778 40.360  -2.657  1.00 22.16 ? 447 ILE B CA  1 
ATOM   6927 C C   . ILE B 1 440 ? 23.858 40.108  -3.718  1.00 23.00 ? 447 ILE B C   1 
ATOM   6928 O O   . ILE B 1 440 ? 24.825 39.375  -3.484  1.00 19.40 ? 447 ILE B O   1 
ATOM   6929 C CB  . ILE B 1 440 ? 23.363 41.167  -1.460  1.00 26.22 ? 447 ILE B CB  1 
ATOM   6930 C CG1 . ILE B 1 440 ? 22.266 41.414  -0.410  1.00 24.90 ? 447 ILE B CG1 1 
ATOM   6931 C CG2 . ILE B 1 440 ? 23.941 42.489  -1.938  1.00 29.83 ? 447 ILE B CG2 1 
ATOM   6932 C CD1 . ILE B 1 440 ? 22.774 41.968  0.920   1.00 20.98 ? 447 ILE B CD1 1 
ATOM   6933 N N   . SER B 1 441 ? 23.664 40.699  -4.892  1.00 20.40 ? 448 SER B N   1 
ATOM   6934 C CA  . SER B 1 441 ? 24.599 40.575  -6.003  1.00 19.24 ? 448 SER B CA  1 
ATOM   6935 C C   . SER B 1 441 ? 25.103 41.972  -6.342  1.00 25.65 ? 448 SER B C   1 
ATOM   6936 O O   . SER B 1 441 ? 24.308 42.894  -6.553  1.00 25.24 ? 448 SER B O   1 
ATOM   6937 C CB  . SER B 1 441 ? 23.899 39.966  -7.219  1.00 19.47 ? 448 SER B CB  1 
ATOM   6938 O OG  . SER B 1 441 ? 24.758 39.921  -8.348  1.00 19.83 ? 448 SER B OG  1 
ATOM   6939 N N   . GLN B 1 442 ? 26.420 42.141  -6.386  1.00 24.46 ? 449 GLN B N   1 
ATOM   6940 C CA  . GLN B 1 442 ? 26.983 43.450  -6.689  1.00 28.60 ? 449 GLN B CA  1 
ATOM   6941 C C   . GLN B 1 442 ? 26.479 44.504  -5.697  1.00 28.97 ? 449 GLN B C   1 
ATOM   6942 O O   . GLN B 1 442 ? 26.227 45.645  -6.073  1.00 29.95 ? 449 GLN B O   1 
ATOM   6943 C CB  . GLN B 1 442 ? 26.604 43.871  -8.116  1.00 29.29 ? 449 GLN B CB  1 
ATOM   6944 C CG  . GLN B 1 442 ? 27.214 42.996  -9.189  1.00 35.31 ? 449 GLN B CG  1 
ATOM   6945 C CD  . GLN B 1 442 ? 27.036 43.557  -10.587 1.00 36.28 ? 449 GLN B CD  1 
ATOM   6946 O OE1 . GLN B 1 442 ? 26.044 43.284  -11.259 1.00 40.08 ? 449 GLN B OE1 1 
ATOM   6947 N NE2 . GLN B 1 442 ? 28.005 44.354  -11.030 1.00 36.80 ? 449 GLN B NE2 1 
ATOM   6948 N N   . GLY B 1 443 ? 26.318 44.123  -4.437  1.00 26.90 ? 450 GLY B N   1 
ATOM   6949 C CA  . GLY B 1 443 ? 25.854 45.078  -3.448  1.00 28.42 ? 450 GLY B CA  1 
ATOM   6950 C C   . GLY B 1 443 ? 24.390 45.466  -3.566  1.00 30.32 ? 450 GLY B C   1 
ATOM   6951 O O   . GLY B 1 443 ? 23.913 46.317  -2.815  1.00 28.38 ? 450 GLY B O   1 
ATOM   6952 N N   . LYS B 1 444 ? 23.677 44.852  -4.505  1.00 28.70 ? 451 LYS B N   1 
ATOM   6953 C CA  . LYS B 1 444 ? 22.256 45.131  -4.699  1.00 28.36 ? 451 LYS B CA  1 
ATOM   6954 C C   . LYS B 1 444 ? 21.411 43.939  -4.257  1.00 28.23 ? 451 LYS B C   1 
ATOM   6955 O O   . LYS B 1 444 ? 21.740 42.786  -4.553  1.00 22.81 ? 451 LYS B O   1 
ATOM   6956 C CB  . LYS B 1 444 ? 21.965 45.426  -6.174  1.00 29.94 ? 451 LYS B CB  1 
ATOM   6957 C CG  . LYS B 1 444 ? 22.535 46.747  -6.685  1.00 31.29 ? 451 LYS B CG  1 
ATOM   6958 C CD  . LYS B 1 444 ? 22.080 47.010  -8.124  1.00 36.37 ? 451 LYS B CD  1 
ATOM   6959 C CE  . LYS B 1 444 ? 22.036 48.512  -8.418  1.00 38.34 ? 451 LYS B CE  1 
ATOM   6960 N NZ  . LYS B 1 444 ? 21.564 48.803  -9.804  1.00 41.45 ? 451 LYS B NZ  1 
ATOM   6961 N N   . ILE B 1 445 ? 20.325 44.218  -3.549  1.00 25.66 ? 452 ILE B N   1 
ATOM   6962 C CA  . ILE B 1 445 ? 19.432 43.164  -3.089  1.00 25.75 ? 452 ILE B CA  1 
ATOM   6963 C C   . ILE B 1 445 ? 18.643 42.647  -4.287  1.00 27.50 ? 452 ILE B C   1 
ATOM   6964 O O   . ILE B 1 445 ? 17.979 43.423  -4.977  1.00 25.96 ? 452 ILE B O   1 
ATOM   6965 C CB  . ILE B 1 445 ? 18.437 43.695  -2.040  1.00 25.55 ? 452 ILE B CB  1 
ATOM   6966 C CG1 . ILE B 1 445 ? 19.203 44.207  -0.822  1.00 23.55 ? 452 ILE B CG1 1 
ATOM   6967 C CG2 . ILE B 1 445 ? 17.453 42.599  -1.652  1.00 19.84 ? 452 ILE B CG2 1 
ATOM   6968 C CD1 . ILE B 1 445 ? 18.351 44.976  0.160   1.00 28.93 ? 452 ILE B CD1 1 
ATOM   6969 N N   . VAL B 1 446 ? 18.730 41.346  -4.543  1.00 24.34 ? 453 VAL B N   1 
ATOM   6970 C CA  . VAL B 1 446 ? 18.013 40.746  -5.660  1.00 23.05 ? 453 VAL B CA  1 
ATOM   6971 C C   . VAL B 1 446 ? 16.998 39.738  -5.149  1.00 22.72 ? 453 VAL B C   1 
ATOM   6972 O O   . VAL B 1 446 ? 16.181 39.233  -5.913  1.00 23.38 ? 453 VAL B O   1 
ATOM   6973 C CB  . VAL B 1 446 ? 18.973 40.044  -6.653  1.00 24.21 ? 453 VAL B CB  1 
ATOM   6974 C CG1 . VAL B 1 446 ? 19.857 41.083  -7.341  1.00 21.02 ? 453 VAL B CG1 1 
ATOM   6975 C CG2 . VAL B 1 446 ? 19.819 39.011  -5.927  1.00 19.92 ? 453 VAL B CG2 1 
ATOM   6976 N N   . PHE B 1 447 ? 17.065 39.445  -3.852  1.00 21.99 ? 454 PHE B N   1 
ATOM   6977 C CA  . PHE B 1 447 ? 16.134 38.517  -3.216  1.00 25.99 ? 454 PHE B CA  1 
ATOM   6978 C C   . PHE B 1 447 ? 15.927 38.927  -1.767  1.00 28.44 ? 454 PHE B C   1 
ATOM   6979 O O   . PHE B 1 447 ? 16.885 39.062  -1.003  1.00 24.00 ? 454 PHE B O   1 
ATOM   6980 C CB  . PHE B 1 447 ? 16.665 37.083  -3.249  1.00 22.26 ? 454 PHE B CB  1 
ATOM   6981 C CG  . PHE B 1 447 ? 15.646 36.049  -2.856  1.00 21.92 ? 454 PHE B CG  1 
ATOM   6982 C CD1 . PHE B 1 447 ? 14.575 35.752  -3.697  1.00 23.41 ? 454 PHE B CD1 1 
ATOM   6983 C CD2 . PHE B 1 447 ? 15.748 35.378  -1.640  1.00 25.09 ? 454 PHE B CD2 1 
ATOM   6984 C CE1 . PHE B 1 447 ? 13.619 34.803  -3.336  1.00 23.83 ? 454 PHE B CE1 1 
ATOM   6985 C CE2 . PHE B 1 447 ? 14.801 34.427  -1.262  1.00 24.44 ? 454 PHE B CE2 1 
ATOM   6986 C CZ  . PHE B 1 447 ? 13.731 34.135  -2.112  1.00 28.08 ? 454 PHE B CZ  1 
ATOM   6987 N N   . GLU B 1 448 ? 14.671 39.146  -1.396  1.00 32.08 ? 455 GLU B N   1 
ATOM   6988 C CA  . GLU B 1 448 ? 14.330 39.513  -0.025  1.00 33.45 ? 455 GLU B CA  1 
ATOM   6989 C C   . GLU B 1 448 ? 12.822 39.370  0.129   1.00 34.19 ? 455 GLU B C   1 
ATOM   6990 O O   . GLU B 1 448 ? 12.071 39.638  -0.818  1.00 32.73 ? 455 GLU B O   1 
ATOM   6991 C CB  . GLU B 1 448 ? 14.774 40.949  0.292   1.00 34.20 ? 455 GLU B CB  1 
ATOM   6992 C CG  . GLU B 1 448 ? 13.962 42.069  -0.365  1.00 39.90 ? 455 GLU B CG  1 
ATOM   6993 C CD  . GLU B 1 448 ? 14.388 43.451  0.133   1.00 41.64 ? 455 GLU B CD  1 
ATOM   6994 O OE1 . GLU B 1 448 ? 14.689 43.585  1.341   1.00 41.49 ? 455 GLU B OE1 1 
ATOM   6995 O OE2 . GLU B 1 448 ? 14.413 44.405  -0.676  1.00 43.27 ? 455 GLU B OE2 1 
ATOM   6996 N N   . ASP B 1 449 ? 12.388 38.938  1.313   1.00 33.54 ? 456 ASP B N   1 
ATOM   6997 C CA  . ASP B 1 449 ? 10.968 38.730  1.609   1.00 36.82 ? 456 ASP B CA  1 
ATOM   6998 C C   . ASP B 1 449 ? 10.337 37.740  0.635   1.00 34.79 ? 456 ASP B C   1 
ATOM   6999 O O   . ASP B 1 449 ? 9.156  37.860  0.318   1.00 35.54 ? 456 ASP B O   1 
ATOM   7000 C CB  . ASP B 1 449 ? 10.166 40.038  1.509   1.00 41.45 ? 456 ASP B CB  1 
ATOM   7001 C CG  . ASP B 1 449 ? 10.786 41.177  2.278   1.00 46.91 ? 456 ASP B CG  1 
ATOM   7002 O OD1 . ASP B 1 449 ? 11.294 40.947  3.405   1.00 49.42 ? 456 ASP B OD1 1 
ATOM   7003 O OD2 . ASP B 1 449 ? 10.744 42.319  1.751   1.00 48.89 ? 456 ASP B OD2 1 
ATOM   7004 N N   . GLY B 1 450 ? 11.116 36.787  0.140   1.00 33.23 ? 457 GLY B N   1 
ATOM   7005 C CA  . GLY B 1 450 ? 10.574 35.813  -0.791  1.00 32.86 ? 457 GLY B CA  1 
ATOM   7006 C C   . GLY B 1 450 ? 10.360 36.302  -2.217  1.00 33.09 ? 457 GLY B C   1 
ATOM   7007 O O   . GLY B 1 450 ? 9.910  35.538  -3.072  1.00 31.13 ? 457 GLY B O   1 
ATOM   7008 N N   . ASN B 1 451 ? 10.679 37.563  -2.496  1.00 28.69 ? 458 ASN B N   1 
ATOM   7009 C CA  . ASN B 1 451 ? 10.496 38.082  -3.847  1.00 27.53 ? 458 ASN B CA  1 
ATOM   7010 C C   . ASN B 1 451 ? 11.806 38.364  -4.547  1.00 25.84 ? 458 ASN B C   1 
ATOM   7011 O O   . ASN B 1 451 ? 12.758 38.865  -3.945  1.00 23.38 ? 458 ASN B O   1 
ATOM   7012 C CB  . ASN B 1 451 ? 9.680  39.380  -3.842  1.00 30.16 ? 458 ASN B CB  1 
ATOM   7013 C CG  . ASN B 1 451 ? 8.322  39.207  -3.221  1.00 26.40 ? 458 ASN B CG  1 
ATOM   7014 O OD1 . ASN B 1 451 ? 7.621  38.243  -3.501  1.00 36.56 ? 458 ASN B OD1 1 
ATOM   7015 N ND2 . ASN B 1 451 ? 7.939  40.146  -2.375  1.00 33.15 ? 458 ASN B ND2 1 
ATOM   7016 N N   . ILE B 1 452 ? 11.860 38.054  -5.831  1.00 24.18 ? 459 ILE B N   1 
ATOM   7017 C CA  . ILE B 1 452 ? 13.075 38.337  -6.546  1.00 24.13 ? 459 ILE B CA  1 
ATOM   7018 C C   . ILE B 1 452 ? 12.886 39.565  -7.424  1.00 24.21 ? 459 ILE B C   1 
ATOM   7019 O O   . ILE B 1 452 ? 11.809 39.800  -7.995  1.00 23.99 ? 459 ILE B O   1 
ATOM   7020 C CB  . ILE B 1 452 ? 13.550 37.128  -7.373  1.00 24.49 ? 459 ILE B CB  1 
ATOM   7021 C CG1 . ILE B 1 452 ? 13.634 37.505  -8.842  1.00 25.93 ? 459 ILE B CG1 1 
ATOM   7022 C CG2 . ILE B 1 452 ? 12.653 35.922  -7.122  1.00 25.85 ? 459 ILE B CG2 1 
ATOM   7023 C CD1 . ILE B 1 452 ? 14.895 37.019  -9.485  1.00 30.81 ? 459 ILE B CD1 1 
ATOM   7024 N N   . SER B 1 453 ? 13.950 40.350  -7.504  1.00 18.79 ? 460 SER B N   1 
ATOM   7025 C CA  . SER B 1 453 ? 13.965 41.572  -8.280  1.00 22.68 ? 460 SER B CA  1 
ATOM   7026 C C   . SER B 1 453 ? 15.323 41.663  -8.972  1.00 23.05 ? 460 SER B C   1 
ATOM   7027 O O   . SER B 1 453 ? 16.311 42.046  -8.352  1.00 23.39 ? 460 SER B O   1 
ATOM   7028 C CB  . SER B 1 453 ? 13.763 42.762  -7.339  1.00 23.15 ? 460 SER B CB  1 
ATOM   7029 O OG  . SER B 1 453 ? 13.942 43.990  -8.017  1.00 41.54 ? 460 SER B OG  1 
ATOM   7030 N N   . VAL B 1 454 ? 15.372 41.301  -10.252 1.00 23.06 ? 461 VAL B N   1 
ATOM   7031 C CA  . VAL B 1 454 ? 16.628 41.335  -10.999 1.00 24.16 ? 461 VAL B CA  1 
ATOM   7032 C C   . VAL B 1 454 ? 16.573 42.184  -12.258 1.00 26.77 ? 461 VAL B C   1 
ATOM   7033 O O   . VAL B 1 454 ? 15.498 42.444  -12.799 1.00 27.69 ? 461 VAL B O   1 
ATOM   7034 C CB  . VAL B 1 454 ? 17.075 39.913  -11.411 1.00 24.18 ? 461 VAL B CB  1 
ATOM   7035 C CG1 . VAL B 1 454 ? 17.311 39.066  -10.173 1.00 17.23 ? 461 VAL B CG1 1 
ATOM   7036 C CG2 . VAL B 1 454 ? 16.027 39.278  -12.309 1.00 22.19 ? 461 VAL B CG2 1 
ATOM   7037 N N   . SER B 1 455 ? 17.747 42.609  -12.719 1.00 27.60 ? 462 SER B N   1 
ATOM   7038 C CA  . SER B 1 455 ? 17.871 43.421  -13.922 1.00 29.95 ? 462 SER B CA  1 
ATOM   7039 C C   . SER B 1 455 ? 18.542 42.596  -15.004 1.00 31.05 ? 462 SER B C   1 
ATOM   7040 O O   . SER B 1 455 ? 19.664 42.110  -14.831 1.00 30.41 ? 462 SER B O   1 
ATOM   7041 C CB  . SER B 1 455 ? 18.721 44.671  -13.660 1.00 34.98 ? 462 SER B CB  1 
ATOM   7042 O OG  . SER B 1 455 ? 18.114 45.514  -12.691 1.00 41.58 ? 462 SER B OG  1 
ATOM   7043 N N   . LYS B 1 456 ? 17.853 42.455  -16.127 1.00 30.37 ? 463 LYS B N   1 
ATOM   7044 C CA  . LYS B 1 456 ? 18.367 41.701  -17.252 1.00 30.91 ? 463 LYS B CA  1 
ATOM   7045 C C   . LYS B 1 456 ? 19.631 42.375  -17.780 1.00 28.08 ? 463 LYS B C   1 
ATOM   7046 O O   . LYS B 1 456 ? 19.635 43.574  -18.046 1.00 27.17 ? 463 LYS B O   1 
ATOM   7047 C CB  . LYS B 1 456 ? 17.295 41.643  -18.345 1.00 34.01 ? 463 LYS B CB  1 
ATOM   7048 C CG  . LYS B 1 456 ? 17.412 40.460  -19.277 1.00 38.59 ? 463 LYS B CG  1 
ATOM   7049 C CD  . LYS B 1 456 ? 16.235 40.411  -20.244 1.00 44.34 ? 463 LYS B CD  1 
ATOM   7050 C CE  . LYS B 1 456 ? 16.326 41.520  -21.275 1.00 47.13 ? 463 LYS B CE  1 
ATOM   7051 N NZ  . LYS B 1 456 ? 17.534 41.371  -22.161 1.00 52.69 ? 463 LYS B NZ  1 
ATOM   7052 N N   . GLY B 1 457 ? 20.710 41.611  -17.909 1.00 25.58 ? 464 GLY B N   1 
ATOM   7053 C CA  . GLY B 1 457 ? 21.946 42.170  -18.428 1.00 22.23 ? 464 GLY B CA  1 
ATOM   7054 C C   . GLY B 1 457 ? 22.813 42.939  -17.449 1.00 21.24 ? 464 GLY B C   1 
ATOM   7055 O O   . GLY B 1 457 ? 23.783 43.576  -17.848 1.00 21.12 ? 464 GLY B O   1 
ATOM   7056 N N   . MET B 1 458 ? 22.479 42.880  -16.165 1.00 21.52 ? 465 MET B N   1 
ATOM   7057 C CA  . MET B 1 458 ? 23.251 43.575  -15.142 1.00 22.00 ? 465 MET B CA  1 
ATOM   7058 C C   . MET B 1 458 ? 24.584 42.873  -14.815 1.00 22.94 ? 465 MET B C   1 
ATOM   7059 O O   . MET B 1 458 ? 25.544 43.509  -14.379 1.00 19.89 ? 465 MET B O   1 
ATOM   7060 C CB  . MET B 1 458 ? 22.414 43.683  -13.866 1.00 25.75 ? 465 MET B CB  1 
ATOM   7061 C CG  . MET B 1 458 ? 23.105 44.405  -12.730 1.00 33.03 ? 465 MET B CG  1 
ATOM   7062 S SD  . MET B 1 458 ? 23.024 46.194  -12.908 1.00 34.28 ? 465 MET B SD  1 
ATOM   7063 C CE  . MET B 1 458 ? 21.538 46.493  -11.920 1.00 37.58 ? 465 MET B CE  1 
ATOM   7064 N N   . GLY B 1 459 ? 24.639 41.561  -15.026 1.00 23.44 ? 466 GLY B N   1 
ATOM   7065 C CA  . GLY B 1 459 ? 25.843 40.807  -14.717 1.00 22.41 ? 466 GLY B CA  1 
ATOM   7066 C C   . GLY B 1 459 ? 27.060 41.158  -15.546 1.00 23.97 ? 466 GLY B C   1 
ATOM   7067 O O   . GLY B 1 459 ? 26.951 41.437  -16.740 1.00 24.24 ? 466 GLY B O   1 
ATOM   7068 N N   . ARG B 1 460 ? 28.228 41.141  -14.913 1.00 21.09 ? 467 ARG B N   1 
ATOM   7069 C CA  . ARG B 1 460 ? 29.479 41.446  -15.598 1.00 21.41 ? 467 ARG B CA  1 
ATOM   7070 C C   . ARG B 1 460 ? 30.257 40.173  -15.915 1.00 23.46 ? 467 ARG B C   1 
ATOM   7071 O O   . ARG B 1 460 ? 30.202 39.204  -15.156 1.00 21.01 ? 467 ARG B O   1 
ATOM   7072 C CB  . ARG B 1 460 ? 30.375 42.306  -14.715 1.00 18.29 ? 467 ARG B CB  1 
ATOM   7073 C CG  . ARG B 1 460 ? 29.736 43.542  -14.129 1.00 24.97 ? 467 ARG B CG  1 
ATOM   7074 C CD  . ARG B 1 460 ? 30.670 44.112  -13.065 1.00 25.18 ? 467 ARG B CD  1 
ATOM   7075 N NE  . ARG B 1 460 ? 30.878 43.153  -11.981 1.00 27.54 ? 467 ARG B NE  1 
ATOM   7076 C CZ  . ARG B 1 460 ? 31.771 43.300  -11.007 1.00 28.65 ? 467 ARG B CZ  1 
ATOM   7077 N NH1 . ARG B 1 460 ? 32.555 44.373  -10.980 1.00 27.46 ? 467 ARG B NH1 1 
ATOM   7078 N NH2 . ARG B 1 460 ? 31.874 42.381  -10.054 1.00 21.68 ? 467 ARG B NH2 1 
ATOM   7079 N N   . PHE B 1 461 ? 30.996 40.183  -17.021 1.00 22.75 ? 468 PHE B N   1 
ATOM   7080 C CA  . PHE B 1 461 ? 31.826 39.033  -17.379 1.00 25.37 ? 468 PHE B CA  1 
ATOM   7081 C C   . PHE B 1 461 ? 33.067 39.140  -16.495 1.00 26.55 ? 468 PHE B C   1 
ATOM   7082 O O   . PHE B 1 461 ? 33.684 40.200  -16.425 1.00 26.65 ? 468 PHE B O   1 
ATOM   7083 C CB  . PHE B 1 461 ? 32.248 39.090  -18.854 1.00 24.91 ? 468 PHE B CB  1 
ATOM   7084 C CG  . PHE B 1 461 ? 33.388 38.157  -19.195 1.00 23.87 ? 468 PHE B CG  1 
ATOM   7085 C CD1 . PHE B 1 461 ? 33.202 36.778  -19.209 1.00 23.13 ? 468 PHE B CD1 1 
ATOM   7086 C CD2 . PHE B 1 461 ? 34.658 38.663  -19.473 1.00 22.04 ? 468 PHE B CD2 1 
ATOM   7087 C CE1 . PHE B 1 461 ? 34.267 35.916  -19.490 1.00 24.15 ? 468 PHE B CE1 1 
ATOM   7088 C CE2 . PHE B 1 461 ? 35.729 37.812  -19.755 1.00 24.00 ? 468 PHE B CE2 1 
ATOM   7089 C CZ  . PHE B 1 461 ? 35.532 36.434  -19.765 1.00 20.73 ? 468 PHE B CZ  1 
ATOM   7090 N N   . ILE B 1 462 ? 33.430 38.062  -15.806 1.00 25.76 ? 469 ILE B N   1 
ATOM   7091 C CA  . ILE B 1 462 ? 34.610 38.106  -14.943 1.00 23.68 ? 469 ILE B CA  1 
ATOM   7092 C C   . ILE B 1 462 ? 35.789 37.355  -15.567 1.00 23.17 ? 469 ILE B C   1 
ATOM   7093 O O   . ILE B 1 462 ? 35.833 36.126  -15.549 1.00 23.18 ? 469 ILE B O   1 
ATOM   7094 C CB  . ILE B 1 462 ? 34.321 37.493  -13.557 1.00 25.25 ? 469 ILE B CB  1 
ATOM   7095 C CG1 . ILE B 1 462 ? 33.060 38.115  -12.955 1.00 21.17 ? 469 ILE B CG1 1 
ATOM   7096 C CG2 . ILE B 1 462 ? 35.503 37.749  -12.625 1.00 21.12 ? 469 ILE B CG2 1 
ATOM   7097 C CD1 . ILE B 1 462 ? 33.225 39.574  -12.551 1.00 24.21 ? 469 ILE B CD1 1 
ATOM   7098 N N   . PRO B 1 463 ? 36.761 38.090  -16.130 1.00 25.47 ? 470 PRO B N   1 
ATOM   7099 C CA  . PRO B 1 463 ? 37.937 37.475  -16.753 1.00 23.74 ? 470 PRO B CA  1 
ATOM   7100 C C   . PRO B 1 463 ? 38.869 36.889  -15.699 1.00 22.73 ? 470 PRO B C   1 
ATOM   7101 O O   . PRO B 1 463 ? 39.006 37.444  -14.609 1.00 19.04 ? 470 PRO B O   1 
ATOM   7102 C CB  . PRO B 1 463 ? 38.565 38.640  -17.511 1.00 24.27 ? 470 PRO B CB  1 
ATOM   7103 C CG  . PRO B 1 463 ? 38.267 39.796  -16.625 1.00 26.36 ? 470 PRO B CG  1 
ATOM   7104 C CD  . PRO B 1 463 ? 36.816 39.557  -16.254 1.00 27.46 ? 470 PRO B CD  1 
ATOM   7105 N N   . ARG B 1 464 ? 39.511 35.771  -16.032 1.00 24.94 ? 471 ARG B N   1 
ATOM   7106 C CA  . ARG B 1 464 ? 40.415 35.096  -15.104 1.00 23.57 ? 471 ARG B CA  1 
ATOM   7107 C C   . ARG B 1 464 ? 41.794 34.824  -15.697 1.00 24.94 ? 471 ARG B C   1 
ATOM   7108 O O   . ARG B 1 464 ? 41.917 34.339  -16.823 1.00 24.61 ? 471 ARG B O   1 
ATOM   7109 C CB  . ARG B 1 464 ? 39.802 33.770  -14.663 1.00 22.47 ? 471 ARG B CB  1 
ATOM   7110 C CG  . ARG B 1 464 ? 38.424 33.881  -14.034 1.00 23.95 ? 471 ARG B CG  1 
ATOM   7111 C CD  . ARG B 1 464 ? 37.738 32.524  -14.077 1.00 26.56 ? 471 ARG B CD  1 
ATOM   7112 N NE  . ARG B 1 464 ? 37.446 32.149  -15.457 1.00 19.58 ? 471 ARG B NE  1 
ATOM   7113 C CZ  . ARG B 1 464 ? 37.281 30.905  -15.884 1.00 20.54 ? 471 ARG B CZ  1 
ATOM   7114 N NH1 . ARG B 1 464 ? 37.389 29.889  -15.040 1.00 20.32 ? 471 ARG B NH1 1 
ATOM   7115 N NH2 . ARG B 1 464 ? 36.986 30.680  -17.161 1.00 22.42 ? 471 ARG B NH2 1 
ATOM   7116 N N   . LYS B 1 465 ? 42.827 35.121  -14.915 1.00 25.78 ? 472 LYS B N   1 
ATOM   7117 C CA  . LYS B 1 465 ? 44.213 34.921  -15.326 1.00 24.18 ? 472 LYS B CA  1 
ATOM   7118 C C   . LYS B 1 465 ? 44.632 33.454  -15.223 1.00 23.85 ? 472 LYS B C   1 
ATOM   7119 O O   . LYS B 1 465 ? 44.122 32.702  -14.384 1.00 23.30 ? 472 LYS B O   1 
ATOM   7120 C CB  . LYS B 1 465 ? 45.142 35.744  -14.432 1.00 25.80 ? 472 LYS B CB  1 
ATOM   7121 C CG  . LYS B 1 465 ? 44.925 37.245  -14.480 1.00 28.90 ? 472 LYS B CG  1 
ATOM   7122 C CD  . LYS B 1 465 ? 45.405 37.907  -13.175 1.00 37.00 ? 472 LYS B CD  1 
ATOM   7123 C CE  . LYS B 1 465 ? 46.870 37.601  -12.864 1.00 39.73 ? 472 LYS B CE  1 
ATOM   7124 N NZ  . LYS B 1 465 ? 47.282 38.002  -11.479 1.00 43.02 ? 472 LYS B NZ  1 
ATOM   7125 N N   . PRO B 1 466 ? 45.576 33.029  -16.076 1.00 21.46 ? 473 PRO B N   1 
ATOM   7126 C CA  . PRO B 1 466 ? 46.058 31.651  -16.058 1.00 21.31 ? 473 PRO B CA  1 
ATOM   7127 C C   . PRO B 1 466 ? 46.945 31.433  -14.838 1.00 19.35 ? 473 PRO B C   1 
ATOM   7128 O O   . PRO B 1 466 ? 47.153 32.346  -14.044 1.00 16.97 ? 473 PRO B O   1 
ATOM   7129 C CB  . PRO B 1 466 ? 46.852 31.550  -17.352 1.00 20.99 ? 473 PRO B CB  1 
ATOM   7130 C CG  . PRO B 1 466 ? 47.440 32.926  -17.468 1.00 18.61 ? 473 PRO B CG  1 
ATOM   7131 C CD  . PRO B 1 466 ? 46.246 33.801  -17.140 1.00 22.17 ? 473 PRO B CD  1 
ATOM   7132 N N   . PHE B 1 467 ? 47.465 30.219  -14.707 1.00 19.47 ? 474 PHE B N   1 
ATOM   7133 C CA  . PHE B 1 467 ? 48.349 29.846  -13.602 1.00 23.46 ? 474 PHE B CA  1 
ATOM   7134 C C   . PHE B 1 467 ? 47.835 30.087  -12.177 1.00 21.37 ? 474 PHE B C   1 
ATOM   7135 O O   . PHE B 1 467 ? 48.493 30.756  -11.384 1.00 22.63 ? 474 PHE B O   1 
ATOM   7136 C CB  . PHE B 1 467 ? 49.720 30.528  -13.770 1.00 25.32 ? 474 PHE B CB  1 
ATOM   7137 C CG  . PHE B 1 467 ? 50.466 30.088  -15.007 1.00 24.86 ? 474 PHE B CG  1 
ATOM   7138 C CD1 . PHE B 1 467 ? 50.995 28.801  -15.098 1.00 22.97 ? 474 PHE B CD1 1 
ATOM   7139 C CD2 . PHE B 1 467 ? 50.607 30.952  -16.093 1.00 23.94 ? 474 PHE B CD2 1 
ATOM   7140 C CE1 . PHE B 1 467 ? 51.652 28.369  -16.257 1.00 25.66 ? 474 PHE B CE1 1 
ATOM   7141 C CE2 . PHE B 1 467 ? 51.260 30.537  -17.258 1.00 26.76 ? 474 PHE B CE2 1 
ATOM   7142 C CZ  . PHE B 1 467 ? 51.787 29.240  -17.341 1.00 25.89 ? 474 PHE B CZ  1 
ATOM   7143 N N   . PRO B 1 468 ? 46.656 29.543  -11.832 1.00 20.74 ? 475 PRO B N   1 
ATOM   7144 C CA  . PRO B 1 468 ? 46.145 29.743  -10.468 1.00 21.74 ? 475 PRO B CA  1 
ATOM   7145 C C   . PRO B 1 468 ? 47.175 29.111  -9.516  1.00 20.76 ? 475 PRO B C   1 
ATOM   7146 O O   . PRO B 1 468 ? 47.511 27.935  -9.668  1.00 21.74 ? 475 PRO B O   1 
ATOM   7147 C CB  . PRO B 1 468 ? 44.832 28.955  -10.461 1.00 23.54 ? 475 PRO B CB  1 
ATOM   7148 C CG  . PRO B 1 468 ? 44.453 28.847  -11.904 1.00 24.52 ? 475 PRO B CG  1 
ATOM   7149 C CD  . PRO B 1 468 ? 45.762 28.675  -12.615 1.00 21.16 ? 475 PRO B CD  1 
ATOM   7150 N N   . GLU B 1 469 ? 47.685 29.889  -8.564  1.00 18.41 ? 476 GLU B N   1 
ATOM   7151 C CA  . GLU B 1 469 ? 48.681 29.414  -7.598  1.00 20.51 ? 476 GLU B CA  1 
ATOM   7152 C C   . GLU B 1 469 ? 48.301 28.079  -6.960  1.00 20.61 ? 476 GLU B C   1 
ATOM   7153 O O   . GLU B 1 469 ? 49.124 27.165  -6.838  1.00 15.79 ? 476 GLU B O   1 
ATOM   7154 C CB  . GLU B 1 469 ? 48.845 30.422  -6.458  1.00 23.59 ? 476 GLU B CB  1 
ATOM   7155 C CG  . GLU B 1 469 ? 49.247 31.822  -6.855  1.00 38.25 ? 476 GLU B CG  1 
ATOM   7156 C CD  . GLU B 1 469 ? 50.744 31.995  -6.936  1.00 44.61 ? 476 GLU B CD  1 
ATOM   7157 O OE1 . GLU B 1 469 ? 51.377 31.290  -7.752  1.00 50.75 ? 476 GLU B OE1 1 
ATOM   7158 O OE2 . GLU B 1 469 ? 51.289 32.837  -6.184  1.00 47.44 ? 476 GLU B OE2 1 
ATOM   7159 N N   . HIS B 1 470 ? 47.047 27.994  -6.527  1.00 20.88 ? 477 HIS B N   1 
ATOM   7160 C CA  . HIS B 1 470 ? 46.541 26.803  -5.868  1.00 20.99 ? 477 HIS B CA  1 
ATOM   7161 C C   . HIS B 1 470 ? 46.877 25.539  -6.645  1.00 20.76 ? 477 HIS B C   1 
ATOM   7162 O O   . HIS B 1 470 ? 47.167 24.494  -6.062  1.00 19.06 ? 477 HIS B O   1 
ATOM   7163 C CB  . HIS B 1 470 ? 45.031 26.912  -5.685  1.00 21.21 ? 477 HIS B CB  1 
ATOM   7164 C CG  . HIS B 1 470 ? 44.457 25.842  -4.812  1.00 23.99 ? 477 HIS B CG  1 
ATOM   7165 N ND1 . HIS B 1 470 ? 43.340 25.117  -5.164  1.00 22.79 ? 477 HIS B ND1 1 
ATOM   7166 C CD2 . HIS B 1 470 ? 44.876 25.343  -3.629  1.00 24.08 ? 477 HIS B CD2 1 
ATOM   7167 C CE1 . HIS B 1 470 ? 43.097 24.208  -4.237  1.00 22.68 ? 477 HIS B CE1 1 
ATOM   7168 N NE2 . HIS B 1 470 ? 44.016 24.324  -3.294  1.00 31.39 ? 477 HIS B NE2 1 
ATOM   7169 N N   . LEU B 1 471 ? 46.842 25.637  -7.966  1.00 18.94 ? 478 LEU B N   1 
ATOM   7170 C CA  . LEU B 1 471 ? 47.143 24.490  -8.799  1.00 19.28 ? 478 LEU B CA  1 
ATOM   7171 C C   . LEU B 1 471 ? 48.596 24.417  -9.272  1.00 18.22 ? 478 LEU B C   1 
ATOM   7172 O O   . LEU B 1 471 ? 49.248 23.378  -9.126  1.00 17.74 ? 478 LEU B O   1 
ATOM   7173 C CB  . LEU B 1 471 ? 46.210 24.463  -10.019 1.00 16.90 ? 478 LEU B CB  1 
ATOM   7174 C CG  . LEU B 1 471 ? 44.867 23.727  -9.906  1.00 23.18 ? 478 LEU B CG  1 
ATOM   7175 C CD1 . LEU B 1 471 ? 43.999 24.358  -8.829  1.00 20.39 ? 478 LEU B CD1 1 
ATOM   7176 C CD2 . LEU B 1 471 ? 44.155 23.765  -11.253 1.00 17.39 ? 478 LEU B CD2 1 
ATOM   7177 N N   . TYR B 1 472 ? 49.114 25.521  -9.800  1.00 18.74 ? 479 TYR B N   1 
ATOM   7178 C CA  . TYR B 1 472 ? 50.461 25.531  -10.359 1.00 19.94 ? 479 TYR B CA  1 
ATOM   7179 C C   . TYR B 1 472 ? 51.709 25.661  -9.494  1.00 22.00 ? 479 TYR B C   1 
ATOM   7180 O O   . TYR B 1 472 ? 52.808 25.425  -9.990  1.00 21.68 ? 479 TYR B O   1 
ATOM   7181 C CB  . TYR B 1 472 ? 50.510 26.552  -11.494 1.00 19.30 ? 479 TYR B CB  1 
ATOM   7182 C CG  . TYR B 1 472 ? 49.810 26.030  -12.728 1.00 21.53 ? 479 TYR B CG  1 
ATOM   7183 C CD1 . TYR B 1 472 ? 50.513 25.323  -13.706 1.00 18.21 ? 479 TYR B CD1 1 
ATOM   7184 C CD2 . TYR B 1 472 ? 48.427 26.169  -12.877 1.00 18.68 ? 479 TYR B CD2 1 
ATOM   7185 C CE1 . TYR B 1 472 ? 49.860 24.762  -14.803 1.00 18.44 ? 479 TYR B CE1 1 
ATOM   7186 C CE2 . TYR B 1 472 ? 47.765 25.613  -13.965 1.00 19.18 ? 479 TYR B CE2 1 
ATOM   7187 C CZ  . TYR B 1 472 ? 48.490 24.907  -14.924 1.00 19.93 ? 479 TYR B CZ  1 
ATOM   7188 O OH  . TYR B 1 472 ? 47.832 24.334  -15.991 1.00 20.39 ? 479 TYR B OH  1 
ATOM   7189 N N   . GLN B 1 473 ? 51.573 26.037  -8.225  1.00 21.38 ? 480 GLN B N   1 
ATOM   7190 C CA  . GLN B 1 473 ? 52.753 26.131  -7.371  1.00 18.20 ? 480 GLN B CA  1 
ATOM   7191 C C   . GLN B 1 473 ? 53.378 24.738  -7.266  1.00 17.93 ? 480 GLN B C   1 
ATOM   7192 O O   . GLN B 1 473 ? 54.598 24.577  -7.386  1.00 16.86 ? 480 GLN B O   1 
ATOM   7193 C CB  . GLN B 1 473 ? 52.375 26.667  -5.981  1.00 19.32 ? 480 GLN B CB  1 
ATOM   7194 C CG  . GLN B 1 473 ? 52.367 28.199  -5.901  1.00 26.47 ? 480 GLN B CG  1 
ATOM   7195 C CD  . GLN B 1 473 ? 51.683 28.731  -4.653  1.00 34.92 ? 480 GLN B CD  1 
ATOM   7196 O OE1 . GLN B 1 473 ? 52.016 29.820  -4.153  1.00 39.33 ? 480 GLN B OE1 1 
ATOM   7197 N NE2 . GLN B 1 473 ? 50.706 27.982  -4.148  1.00 40.16 ? 480 GLN B NE2 1 
ATOM   7198 N N   . ARG B 1 474 ? 52.534 23.729  -7.066  1.00 15.38 ? 481 ARG B N   1 
ATOM   7199 C CA  . ARG B 1 474 ? 53.000 22.352  -6.965  1.00 16.68 ? 481 ARG B CA  1 
ATOM   7200 C C   . ARG B 1 474 ? 53.540 21.871  -8.313  1.00 18.64 ? 481 ARG B C   1 
ATOM   7201 O O   . ARG B 1 474 ? 54.581 21.222  -8.368  1.00 18.14 ? 481 ARG B O   1 
ATOM   7202 C CB  . ARG B 1 474 ? 51.864 21.443  -6.470  1.00 12.55 ? 481 ARG B CB  1 
ATOM   7203 C CG  . ARG B 1 474 ? 51.747 21.397  -4.934  1.00 18.86 ? 481 ARG B CG  1 
ATOM   7204 C CD  . ARG B 1 474 ? 50.493 20.677  -4.439  1.00 14.87 ? 481 ARG B CD  1 
ATOM   7205 N NE  . ARG B 1 474 ? 49.305 21.482  -4.700  1.00 16.20 ? 481 ARG B NE  1 
ATOM   7206 C CZ  . ARG B 1 474 ? 48.067 21.131  -4.373  1.00 18.08 ? 481 ARG B CZ  1 
ATOM   7207 N NH1 . ARG B 1 474 ? 47.833 19.974  -3.765  1.00 11.80 ? 481 ARG B NH1 1 
ATOM   7208 N NH2 . ARG B 1 474 ? 47.060 21.953  -4.640  1.00 20.49 ? 481 ARG B NH2 1 
ATOM   7209 N N   . VAL B 1 475 ? 52.846 22.209  -9.397  1.00 19.08 ? 482 VAL B N   1 
ATOM   7210 C CA  . VAL B 1 475 ? 53.281 21.806  -10.730 1.00 20.01 ? 482 VAL B CA  1 
ATOM   7211 C C   . VAL B 1 475 ? 54.684 22.327  -11.014 1.00 20.35 ? 482 VAL B C   1 
ATOM   7212 O O   . VAL B 1 475 ? 55.530 21.589  -11.504 1.00 20.48 ? 482 VAL B O   1 
ATOM   7213 C CB  . VAL B 1 475 ? 52.315 22.340  -11.830 1.00 24.60 ? 482 VAL B CB  1 
ATOM   7214 C CG1 . VAL B 1 475 ? 52.919 22.126  -13.223 1.00 19.69 ? 482 VAL B CG1 1 
ATOM   7215 C CG2 . VAL B 1 475 ? 50.976 21.618  -11.739 1.00 24.36 ? 482 VAL B CG2 1 
ATOM   7216 N N   . ARG B 1 476 ? 54.928 23.597  -10.689 1.00 19.96 ? 483 ARG B N   1 
ATOM   7217 C CA  . ARG B 1 476 ? 56.232 24.209  -10.927 1.00 24.56 ? 483 ARG B CA  1 
ATOM   7218 C C   . ARG B 1 476 ? 57.350 23.505  -10.173 1.00 26.46 ? 483 ARG B C   1 
ATOM   7219 O O   . ARG B 1 476 ? 58.426 23.267  -10.729 1.00 24.51 ? 483 ARG B O   1 
ATOM   7220 C CB  . ARG B 1 476 ? 56.209 25.686  -10.542 1.00 27.01 ? 483 ARG B CB  1 
ATOM   7221 C CG  . ARG B 1 476 ? 55.361 26.538  -11.467 1.00 33.71 ? 483 ARG B CG  1 
ATOM   7222 C CD  . ARG B 1 476 ? 55.474 27.989  -11.111 1.00 36.45 ? 483 ARG B CD  1 
ATOM   7223 N NE  . ARG B 1 476 ? 54.711 28.836  -12.020 1.00 44.04 ? 483 ARG B NE  1 
ATOM   7224 C CZ  . ARG B 1 476 ? 53.528 29.376  -11.733 1.00 47.86 ? 483 ARG B CZ  1 
ATOM   7225 N NH1 . ARG B 1 476 ? 52.957 29.155  -10.549 1.00 47.08 ? 483 ARG B NH1 1 
ATOM   7226 N NH2 . ARG B 1 476 ? 52.931 30.163  -12.623 1.00 45.56 ? 483 ARG B NH2 1 
ATOM   7227 N N   . ILE B 1 477 ? 57.094 23.168  -8.911  1.00 24.22 ? 484 ILE B N   1 
ATOM   7228 C CA  . ILE B 1 477 ? 58.092 22.476  -8.110  1.00 23.91 ? 484 ILE B CA  1 
ATOM   7229 C C   . ILE B 1 477 ? 58.409 21.127  -8.734  1.00 25.81 ? 484 ILE B C   1 
ATOM   7230 O O   . ILE B 1 477 ? 59.569 20.800  -8.953  1.00 25.23 ? 484 ILE B O   1 
ATOM   7231 C CB  . ILE B 1 477 ? 57.608 22.230  -6.678  1.00 20.99 ? 484 ILE B CB  1 
ATOM   7232 C CG1 . ILE B 1 477 ? 57.442 23.563  -5.950  1.00 22.24 ? 484 ILE B CG1 1 
ATOM   7233 C CG2 . ILE B 1 477 ? 58.609 21.331  -5.941  1.00 20.45 ? 484 ILE B CG2 1 
ATOM   7234 C CD1 . ILE B 1 477 ? 56.842 23.411  -4.553  1.00 30.07 ? 484 ILE B CD1 1 
ATOM   7235 N N   . ARG B 1 478 ? 57.366 20.358  -9.028  1.00 23.69 ? 485 ARG B N   1 
ATOM   7236 C CA  . ARG B 1 478 ? 57.530 19.038  -9.613  1.00 26.23 ? 485 ARG B CA  1 
ATOM   7237 C C   . ARG B 1 478 ? 58.330 19.033  -10.919 1.00 32.15 ? 485 ARG B C   1 
ATOM   7238 O O   . ARG B 1 478 ? 59.188 18.166  -11.122 1.00 29.23 ? 485 ARG B O   1 
ATOM   7239 C CB  . ARG B 1 478 ? 56.152 18.406  -9.808  1.00 25.84 ? 485 ARG B CB  1 
ATOM   7240 C CG  . ARG B 1 478 ? 55.418 18.257  -8.486  1.00 22.76 ? 485 ARG B CG  1 
ATOM   7241 C CD  . ARG B 1 478 ? 54.044 17.649  -8.632  1.00 24.49 ? 485 ARG B CD  1 
ATOM   7242 N NE  . ARG B 1 478 ? 53.376 17.595  -7.335  1.00 21.54 ? 485 ARG B NE  1 
ATOM   7243 C CZ  . ARG B 1 478 ? 52.288 16.876  -7.076  1.00 21.19 ? 485 ARG B CZ  1 
ATOM   7244 N NH1 . ARG B 1 478 ? 51.735 16.140  -8.029  1.00 16.61 ? 485 ARG B NH1 1 
ATOM   7245 N NH2 . ARG B 1 478 ? 51.755 16.890  -5.857  1.00 15.98 ? 485 ARG B NH2 1 
ATOM   7246 N N   . SER B 1 479 ? 58.065 20.007  -11.788 1.00 32.63 ? 486 SER B N   1 
ATOM   7247 C CA  . SER B 1 479 ? 58.768 20.116  -13.064 1.00 38.51 ? 486 SER B CA  1 
ATOM   7248 C C   . SER B 1 479 ? 60.268 20.319  -12.861 1.00 40.57 ? 486 SER B C   1 
ATOM   7249 O O   . SER B 1 479 ? 61.093 19.823  -13.641 1.00 39.53 ? 486 SER B O   1 
ATOM   7250 C CB  . SER B 1 479 ? 58.214 21.293  -13.875 1.00 39.65 ? 486 SER B CB  1 
ATOM   7251 O OG  . SER B 1 479 ? 56.809 21.153  -14.094 1.00 41.99 ? 486 SER B OG  1 
ATOM   7252 N N   . LYS B 1 480 ? 60.610 21.028  -11.792 1.00 43.33 ? 487 LYS B N   1 
ATOM   7253 C CA  . LYS B 1 480 ? 61.996 21.357  -11.471 1.00 46.75 ? 487 LYS B CA  1 
ATOM   7254 C C   . LYS B 1 480 ? 62.713 20.311  -10.624 1.00 47.02 ? 487 LYS B C   1 
ATOM   7255 O O   . LYS B 1 480 ? 63.936 20.377  -10.454 1.00 46.56 ? 487 LYS B O   1 
ATOM   7256 C CB  . LYS B 1 480 ? 62.023 22.702  -10.742 1.00 47.86 ? 487 LYS B CB  1 
ATOM   7257 C CG  . LYS B 1 480 ? 63.396 23.361  -10.604 1.00 53.60 ? 487 LYS B CG  1 
ATOM   7258 C CD  . LYS B 1 480 ? 63.249 24.761  -9.997  1.00 56.72 ? 487 LYS B CD  1 
ATOM   7259 C CE  . LYS B 1 480 ? 64.611 25.434  -9.836  1.00 60.15 ? 487 LYS B CE  1 
ATOM   7260 N NZ  . LYS B 1 480 ? 65.410 25.382  -11.117 1.00 60.21 ? 487 LYS B NZ  1 
ATOM   7261 N N   . VAL B 1 481 ? 61.966 19.341  -10.109 1.00 47.33 ? 488 VAL B N   1 
ATOM   7262 C CA  . VAL B 1 481 ? 62.553 18.316  -9.255  1.00 50.14 ? 488 VAL B CA  1 
ATOM   7263 C C   . VAL B 1 481 ? 62.594 16.910  -9.868  1.00 51.65 ? 488 VAL B C   1 
ATOM   7264 O O   . VAL B 1 481 ? 63.429 16.091  -9.482  1.00 51.65 ? 488 VAL B O   1 
ATOM   7265 C CB  . VAL B 1 481 ? 61.803 18.281  -7.875  1.00 47.38 ? 488 VAL B CB  1 
ATOM   7266 C CG1 . VAL B 1 481 ? 62.112 17.000  -7.118  1.00 47.17 ? 488 VAL B CG1 1 
ATOM   7267 C CG2 . VAL B 1 481 ? 62.230 19.480  -7.035  1.00 45.60 ? 488 VAL B CG2 1 
ATOM   7268 N N   . PHE B 1 482 ? 61.720 16.633  -10.835 1.00 54.72 ? 489 PHE B N   1 
ATOM   7269 C CA  . PHE B 1 482 ? 61.671 15.298  -11.446 1.00 58.85 ? 489 PHE B CA  1 
ATOM   7270 C C   . PHE B 1 482 ? 62.043 15.184  -12.925 1.00 57.86 ? 489 PHE B C   1 
ATOM   7271 O O   . PHE B 1 482 ? 61.677 14.203  -13.589 1.00 55.03 ? 489 PHE B O   1 
ATOM   7272 C CB  . PHE B 1 482 ? 60.282 14.689  -11.216 1.00 65.23 ? 489 PHE B CB  1 
ATOM   7273 C CG  . PHE B 1 482 ? 59.998 14.398  -9.771  1.00 72.13 ? 489 PHE B CG  1 
ATOM   7274 C CD1 . PHE B 1 482 ? 60.676 13.368  -9.115  1.00 74.72 ? 489 PHE B CD1 1 
ATOM   7275 C CD2 . PHE B 1 482 ? 59.139 15.216  -9.033  1.00 74.14 ? 489 PHE B CD2 1 
ATOM   7276 C CE1 . PHE B 1 482 ? 60.508 13.162  -7.739  1.00 76.68 ? 489 PHE B CE1 1 
ATOM   7277 C CE2 . PHE B 1 482 ? 58.963 15.022  -7.654  1.00 74.60 ? 489 PHE B CE2 1 
ATOM   7278 C CZ  . PHE B 1 482 ? 59.646 14.000  -7.007  1.00 76.03 ? 489 PHE B CZ  1 
ATOM   7279 N N   . GLY B 1 483 ? 62.779 16.169  -13.438 1.00 56.62 ? 490 GLY B N   1 
ATOM   7280 C CA  . GLY B 1 483 ? 63.181 16.119  -14.833 1.00 56.54 ? 490 GLY B CA  1 
ATOM   7281 C C   . GLY B 1 483 ? 63.943 14.839  -15.147 1.00 56.18 ? 490 GLY B C   1 
ATOM   7282 O O   . GLY B 1 483 ? 63.466 14.055  -16.002 1.00 54.18 ? 490 GLY B O   1 
HETATM 7283 O O   . HOH C 2 .   ? 51.609 22.344  13.700  1.00 13.08 ? 526 HOH A O   1 
HETATM 7284 O O   . HOH C 2 .   ? 63.153 24.315  11.557  1.00 12.30 ? 527 HOH A O   1 
HETATM 7285 O O   . HOH C 2 .   ? 49.466 23.135  11.971  1.00 13.11 ? 528 HOH A O   1 
HETATM 7286 O O   . HOH C 2 .   ? 57.032 11.645  24.990  1.00 14.55 ? 529 HOH A O   1 
HETATM 7287 O O   . HOH C 2 .   ? 52.000 12.175  22.790  1.00 12.38 ? 530 HOH A O   1 
HETATM 7288 O O   . HOH C 2 .   ? 46.315 7.592   30.830  1.00 13.22 ? 531 HOH A O   1 
HETATM 7289 O O   . HOH C 2 .   ? 60.559 7.057   2.479   1.00 17.64 ? 532 HOH A O   1 
HETATM 7290 O O   . HOH C 2 .   ? 58.942 22.737  16.499  1.00 8.33  ? 533 HOH A O   1 
HETATM 7291 O O   . HOH C 2 .   ? 53.536 16.309  39.531  1.00 17.64 ? 534 HOH A O   1 
HETATM 7292 O O   . HOH C 2 .   ? 45.709 35.594  3.547   1.00 20.85 ? 535 HOH A O   1 
HETATM 7293 O O   . HOH C 2 .   ? 44.270 25.942  8.195   1.00 20.84 ? 536 HOH A O   1 
HETATM 7294 O O   . HOH C 2 .   ? 58.488 6.266   12.105  1.00 16.40 ? 537 HOH A O   1 
HETATM 7295 O O   . HOH C 2 .   ? 70.490 23.724  -0.573  1.00 25.37 ? 538 HOH A O   1 
HETATM 7296 O O   . HOH C 2 .   ? 69.078 13.158  34.833  1.00 15.50 ? 539 HOH A O   1 
HETATM 7297 O O   . HOH C 2 .   ? 38.088 26.270  16.080  1.00 17.74 ? 540 HOH A O   1 
HETATM 7298 O O   . HOH C 2 .   ? 49.905 6.838   17.094  1.00 18.09 ? 541 HOH A O   1 
HETATM 7299 O O   . HOH C 2 .   ? 64.420 22.497  4.076   1.00 17.20 ? 542 HOH A O   1 
HETATM 7300 O O   . HOH C 2 .   ? 69.786 34.158  9.569   1.00 20.96 ? 543 HOH A O   1 
HETATM 7301 O O   . HOH C 2 .   ? 40.504 30.501  22.889  1.00 21.65 ? 544 HOH A O   1 
HETATM 7302 O O   . HOH C 2 .   ? 51.765 31.575  14.601  1.00 14.21 ? 545 HOH A O   1 
HETATM 7303 O O   . HOH C 2 .   ? 50.401 -8.158  29.627  1.00 22.51 ? 546 HOH A O   1 
HETATM 7304 O O   . HOH C 2 .   ? 60.835 24.356  13.896  1.00 16.33 ? 547 HOH A O   1 
HETATM 7305 O O   . HOH C 2 .   ? 53.352 28.379  9.633   1.00 21.58 ? 548 HOH A O   1 
HETATM 7306 O O   . HOH C 2 .   ? 57.220 8.687   19.074  1.00 17.20 ? 549 HOH A O   1 
HETATM 7307 O O   . HOH C 2 .   ? 51.790 34.182  13.653  1.00 16.52 ? 550 HOH A O   1 
HETATM 7308 O O   . HOH C 2 .   ? 49.222 18.287  -2.005  1.00 20.03 ? 551 HOH A O   1 
HETATM 7309 O O   . HOH C 2 .   ? 46.580 31.731  7.742   1.00 15.88 ? 552 HOH A O   1 
HETATM 7310 O O   . HOH C 2 .   ? 69.733 21.578  14.355  1.00 19.00 ? 553 HOH A O   1 
HETATM 7311 O O   . HOH C 2 .   ? 41.924 17.388  6.288   1.00 21.20 ? 554 HOH A O   1 
HETATM 7312 O O   . HOH C 2 .   ? 40.274 29.458  17.237  1.00 20.76 ? 555 HOH A O   1 
HETATM 7313 O O   . HOH C 2 .   ? 77.667 16.928  14.280  1.00 19.21 ? 556 HOH A O   1 
HETATM 7314 O O   . HOH C 2 .   ? 32.147 9.892   32.037  1.00 20.25 ? 557 HOH A O   1 
HETATM 7315 O O   . HOH C 2 .   ? 65.404 19.943  18.255  1.00 14.94 ? 558 HOH A O   1 
HETATM 7316 O O   . HOH C 2 .   ? 63.788 6.246   5.013   1.00 17.26 ? 559 HOH A O   1 
HETATM 7317 O O   . HOH C 2 .   ? 42.698 30.107  6.964   1.00 14.42 ? 560 HOH A O   1 
HETATM 7318 O O   . HOH C 2 .   ? 41.811 37.535  7.945   1.00 24.80 ? 561 HOH A O   1 
HETATM 7319 O O   . HOH C 2 .   ? 57.083 18.346  29.358  1.00 20.10 ? 562 HOH A O   1 
HETATM 7320 O O   . HOH C 2 .   ? 55.292 2.121   8.718   1.00 22.14 ? 563 HOH A O   1 
HETATM 7321 O O   . HOH C 2 .   ? 53.148 31.600  17.216  1.00 22.96 ? 564 HOH A O   1 
HETATM 7322 O O   . HOH C 2 .   ? 50.616 16.634  21.243  1.00 16.81 ? 565 HOH A O   1 
HETATM 7323 O O   . HOH C 2 .   ? 56.750 5.261   0.588   1.00 23.10 ? 566 HOH A O   1 
HETATM 7324 O O   . HOH C 2 .   ? 61.000 14.672  16.227  1.00 16.21 ? 567 HOH A O   1 
HETATM 7325 O O   . HOH C 2 .   ? 56.346 9.959   31.421  1.00 19.17 ? 568 HOH A O   1 
HETATM 7326 O O   . HOH C 2 .   ? 53.357 10.568  24.568  1.00 21.48 ? 569 HOH A O   1 
HETATM 7327 O O   . HOH C 2 .   ? 54.471 0.589   27.050  1.00 19.11 ? 570 HOH A O   1 
HETATM 7328 O O   . HOH C 2 .   ? 53.056 36.798  20.270  1.00 17.31 ? 571 HOH A O   1 
HETATM 7329 O O   . HOH C 2 .   ? 53.035 -1.768  28.503  1.00 20.73 ? 572 HOH A O   1 
HETATM 7330 O O   . HOH C 2 .   ? 75.924 12.554  28.415  1.00 19.78 ? 573 HOH A O   1 
HETATM 7331 O O   . HOH C 2 .   ? 46.895 25.250  2.335   1.00 15.87 ? 574 HOH A O   1 
HETATM 7332 O O   . HOH C 2 .   ? 55.863 33.762  20.641  1.00 21.98 ? 575 HOH A O   1 
HETATM 7333 O O   . HOH C 2 .   ? 46.489 26.504  27.299  1.00 19.30 ? 576 HOH A O   1 
HETATM 7334 O O   . HOH C 2 .   ? 74.337 12.954  15.831  1.00 23.14 ? 577 HOH A O   1 
HETATM 7335 O O   . HOH C 2 .   ? 41.902 19.860  10.098  1.00 25.85 ? 578 HOH A O   1 
HETATM 7336 O O   . HOH C 2 .   ? 76.957 13.265  17.298  1.00 27.32 ? 579 HOH A O   1 
HETATM 7337 O O   . HOH C 2 .   ? 74.021 -1.637  19.533  1.00 32.80 ? 580 HOH A O   1 
HETATM 7338 O O   . HOH C 2 .   ? 50.016 24.104  -5.702  1.00 23.24 ? 581 HOH A O   1 
HETATM 7339 O O   . HOH C 2 .   ? 59.410 7.211   9.584   1.00 18.31 ? 582 HOH A O   1 
HETATM 7340 O O   . HOH C 2 .   ? 58.513 8.681   23.844  1.00 18.72 ? 583 HOH A O   1 
HETATM 7341 O O   . HOH C 2 .   ? 75.200 7.078   33.112  1.00 27.35 ? 584 HOH A O   1 
HETATM 7342 O O   . HOH C 2 .   ? 72.641 8.505   23.289  1.00 16.21 ? 585 HOH A O   1 
HETATM 7343 O O   . HOH C 2 .   ? 72.162 21.414  13.134  1.00 25.41 ? 586 HOH A O   1 
HETATM 7344 O O   . HOH C 2 .   ? 70.829 10.629  23.159  1.00 24.65 ? 587 HOH A O   1 
HETATM 7345 O O   . HOH C 2 .   ? 39.781 15.139  9.820   1.00 30.82 ? 588 HOH A O   1 
HETATM 7346 O O   . HOH C 2 .   ? 46.025 21.437  5.351   1.00 21.61 ? 589 HOH A O   1 
HETATM 7347 O O   . HOH C 2 .   ? 68.744 10.183  10.170  1.00 24.19 ? 590 HOH A O   1 
HETATM 7348 O O   . HOH C 2 .   ? 42.411 33.554  18.153  1.00 21.08 ? 591 HOH A O   1 
HETATM 7349 O O   . HOH C 2 .   ? 68.324 21.247  18.757  1.00 22.81 ? 592 HOH A O   1 
HETATM 7350 O O   . HOH C 2 .   ? 49.188 34.994  13.779  1.00 20.39 ? 593 HOH A O   1 
HETATM 7351 O O   . HOH C 2 .   ? 52.387 39.371  20.849  1.00 20.69 ? 594 HOH A O   1 
HETATM 7352 O O   . HOH C 2 .   ? 67.443 11.510  22.962  1.00 21.46 ? 595 HOH A O   1 
HETATM 7353 O O   . HOH C 2 .   ? 49.409 13.137  -1.510  1.00 24.88 ? 596 HOH A O   1 
HETATM 7354 O O   . HOH C 2 .   ? 56.267 8.391   25.195  1.00 20.96 ? 597 HOH A O   1 
HETATM 7355 O O   . HOH C 2 .   ? 63.871 18.465  26.530  1.00 20.24 ? 598 HOH A O   1 
HETATM 7356 O O   . HOH C 2 .   ? 31.557 16.736  31.220  1.00 20.62 ? 599 HOH A O   1 
HETATM 7357 O O   . HOH C 2 .   ? 57.487 0.654   28.204  1.00 31.57 ? 600 HOH A O   1 
HETATM 7358 O O   . HOH C 2 .   ? 41.489 -2.732  17.273  1.00 22.24 ? 601 HOH A O   1 
HETATM 7359 O O   . HOH C 2 .   ? 51.419 49.667  4.679   1.00 33.46 ? 602 HOH A O   1 
HETATM 7360 O O   . HOH C 2 .   ? 39.725 3.030   10.341  1.00 18.34 ? 603 HOH A O   1 
HETATM 7361 O O   . HOH C 2 .   ? 28.822 8.020   26.276  1.00 25.43 ? 604 HOH A O   1 
HETATM 7362 O O   . HOH C 2 .   ? 54.724 10.115  36.120  1.00 19.30 ? 605 HOH A O   1 
HETATM 7363 O O   . HOH C 2 .   ? 33.616 23.622  29.425  1.00 27.73 ? 606 HOH A O   1 
HETATM 7364 O O   . HOH C 2 .   ? 29.538 13.925  26.998  1.00 22.44 ? 607 HOH A O   1 
HETATM 7365 O O   . HOH C 2 .   ? 29.753 18.360  24.552  1.00 24.50 ? 608 HOH A O   1 
HETATM 7366 O O   . HOH C 2 .   ? 49.844 40.599  26.991  1.00 27.62 ? 609 HOH A O   1 
HETATM 7367 O O   . HOH C 2 .   ? 70.383 31.459  9.342   1.00 28.74 ? 610 HOH A O   1 
HETATM 7368 O O   . HOH C 2 .   ? 71.448 10.487  10.553  1.00 32.99 ? 611 HOH A O   1 
HETATM 7369 O O   . HOH C 2 .   ? 57.687 6.908   30.527  1.00 37.97 ? 612 HOH A O   1 
HETATM 7370 O O   . HOH C 2 .   ? 63.727 19.870  31.521  1.00 28.83 ? 613 HOH A O   1 
HETATM 7371 O O   . HOH C 2 .   ? 44.839 41.736  7.445   1.00 24.50 ? 614 HOH A O   1 
HETATM 7372 O O   . HOH C 2 .   ? 42.627 0.198   26.791  1.00 22.46 ? 615 HOH A O   1 
HETATM 7373 O O   . HOH C 2 .   ? 50.034 7.612   19.719  1.00 23.05 ? 616 HOH A O   1 
HETATM 7374 O O   . HOH C 2 .   ? 38.332 16.090  21.233  1.00 18.67 ? 617 HOH A O   1 
HETATM 7375 O O   . HOH C 2 .   ? 54.895 10.886  29.277  1.00 27.49 ? 618 HOH A O   1 
HETATM 7376 O O   . HOH C 2 .   ? 16.528 6.717   19.916  1.00 37.66 ? 619 HOH A O   1 
HETATM 7377 O O   . HOH C 2 .   ? 61.263 -0.113  25.774  1.00 21.73 ? 620 HOH A O   1 
HETATM 7378 O O   . HOH C 2 .   ? 54.478 1.911   15.773  1.00 21.93 ? 621 HOH A O   1 
HETATM 7379 O O   . HOH C 2 .   ? 48.971 39.640  21.897  1.00 31.02 ? 622 HOH A O   1 
HETATM 7380 O O   . HOH C 2 .   ? 33.674 11.336  15.999  1.00 33.41 ? 623 HOH A O   1 
HETATM 7381 O O   . HOH C 2 .   ? 70.037 -1.369  25.769  1.00 22.29 ? 624 HOH A O   1 
HETATM 7382 O O   . HOH C 2 .   ? 61.034 45.127  17.601  1.00 30.25 ? 625 HOH A O   1 
HETATM 7383 O O   . HOH C 2 .   ? 54.002 0.768   18.328  1.00 25.86 ? 626 HOH A O   1 
HETATM 7384 O O   . HOH C 2 .   ? 55.181 10.507  26.643  1.00 20.15 ? 627 HOH A O   1 
HETATM 7385 O O   . HOH C 2 .   ? 74.355 10.419  14.729  1.00 22.91 ? 628 HOH A O   1 
HETATM 7386 O O   . HOH C 2 .   ? 71.136 38.777  7.177   1.00 30.10 ? 629 HOH A O   1 
HETATM 7387 O O   . HOH C 2 .   ? 38.028 18.551  9.377   1.00 30.54 ? 630 HOH A O   1 
HETATM 7388 O O   . HOH C 2 .   ? 57.092 44.885  20.149  1.00 29.96 ? 631 HOH A O   1 
HETATM 7389 O O   . HOH C 2 .   ? 45.421 -3.802  26.361  1.00 25.03 ? 632 HOH A O   1 
HETATM 7390 O O   . HOH C 2 .   ? 56.698 -2.746  13.327  1.00 30.30 ? 633 HOH A O   1 
HETATM 7391 O O   . HOH C 2 .   ? 69.054 37.310  8.810   1.00 23.48 ? 634 HOH A O   1 
HETATM 7392 O O   . HOH C 2 .   ? 57.002 42.698  3.458   1.00 27.16 ? 635 HOH A O   1 
HETATM 7393 O O   . HOH C 2 .   ? 46.260 -0.108  8.155   1.00 24.11 ? 636 HOH A O   1 
HETATM 7394 O O   . HOH C 2 .   ? 69.288 25.897  23.211  1.00 32.57 ? 637 HOH A O   1 
HETATM 7395 O O   . HOH C 2 .   ? 68.185 25.283  12.689  1.00 27.45 ? 638 HOH A O   1 
HETATM 7396 O O   . HOH C 2 .   ? 56.780 11.853  37.172  1.00 22.79 ? 639 HOH A O   1 
HETATM 7397 O O   . HOH C 2 .   ? 58.648 12.947  0.956   1.00 25.37 ? 640 HOH A O   1 
HETATM 7398 O O   . HOH C 2 .   ? 45.707 48.062  13.553  1.00 27.24 ? 641 HOH A O   1 
HETATM 7399 O O   . HOH C 2 .   ? 32.187 3.448   16.556  1.00 29.81 ? 642 HOH A O   1 
HETATM 7400 O O   . HOH C 2 .   ? 30.985 11.765  15.533  1.00 25.22 ? 643 HOH A O   1 
HETATM 7401 O O   . HOH C 2 .   ? 54.802 45.220  24.709  1.00 32.99 ? 644 HOH A O   1 
HETATM 7402 O O   . HOH C 2 .   ? 73.360 14.341  31.519  1.00 23.55 ? 645 HOH A O   1 
HETATM 7403 O O   . HOH C 2 .   ? 41.548 16.027  2.577   1.00 30.84 ? 646 HOH A O   1 
HETATM 7404 O O   . HOH C 2 .   ? 58.532 -1.808  2.631   1.00 28.64 ? 647 HOH A O   1 
HETATM 7405 O O   . HOH C 2 .   ? 77.789 16.379  19.946  1.00 27.11 ? 648 HOH A O   1 
HETATM 7406 O O   . HOH C 2 .   ? 29.842 9.267   15.588  1.00 23.03 ? 649 HOH A O   1 
HETATM 7407 O O   . HOH C 2 .   ? 47.414 -1.185  32.866  1.00 35.15 ? 650 HOH A O   1 
HETATM 7408 O O   . HOH C 2 .   ? 31.224 22.027  29.803  1.00 30.29 ? 651 HOH A O   1 
HETATM 7409 O O   . HOH C 2 .   ? 46.119 39.006  18.553  1.00 29.94 ? 652 HOH A O   1 
HETATM 7410 O O   . HOH C 2 .   ? 58.945 35.832  22.934  1.00 26.61 ? 653 HOH A O   1 
HETATM 7411 O O   . HOH C 2 .   ? 56.713 -7.830  18.651  1.00 40.87 ? 654 HOH A O   1 
HETATM 7412 O O   . HOH C 2 .   ? 70.862 -6.622  21.515  1.00 31.67 ? 655 HOH A O   1 
HETATM 7413 O O   . HOH C 2 .   ? 44.003 39.685  1.172   1.00 29.25 ? 656 HOH A O   1 
HETATM 7414 O O   . HOH C 2 .   ? 63.049 35.738  23.996  1.00 20.31 ? 657 HOH A O   1 
HETATM 7415 O O   . HOH C 2 .   ? 44.104 31.976  -5.010  1.00 43.38 ? 658 HOH A O   1 
HETATM 7416 O O   . HOH C 2 .   ? 56.874 46.023  23.071  1.00 38.41 ? 659 HOH A O   1 
HETATM 7417 O O   . HOH C 2 .   ? 31.278 5.762   13.532  1.00 31.57 ? 660 HOH A O   1 
HETATM 7418 O O   . HOH C 2 .   ? 43.514 38.926  12.751  1.00 25.36 ? 661 HOH A O   1 
HETATM 7419 O O   . HOH C 2 .   ? 46.517 47.505  6.881   1.00 34.64 ? 662 HOH A O   1 
HETATM 7420 O O   . HOH C 2 .   ? 75.810 14.636  30.454  1.00 27.72 ? 663 HOH A O   1 
HETATM 7421 O O   . HOH C 2 .   ? 45.852 39.258  5.760   1.00 29.95 ? 664 HOH A O   1 
HETATM 7422 O O   . HOH C 2 .   ? 67.393 11.880  8.428   1.00 35.30 ? 665 HOH A O   1 
HETATM 7423 O O   . HOH C 2 .   ? 67.980 7.668   7.547   1.00 33.16 ? 666 HOH A O   1 
HETATM 7424 O O   . HOH C 2 .   ? 73.209 32.152  18.125  1.00 35.62 ? 667 HOH A O   1 
HETATM 7425 O O   . HOH C 2 .   ? 45.277 19.432  44.525  1.00 37.19 ? 668 HOH A O   1 
HETATM 7426 O O   . HOH C 2 .   ? 56.496 35.031  31.621  1.00 34.10 ? 669 HOH A O   1 
HETATM 7427 O O   . HOH C 2 .   ? 49.644 10.720  39.313  1.00 36.36 ? 670 HOH A O   1 
HETATM 7428 O O   . HOH C 2 .   ? 68.295 22.356  29.526  1.00 24.43 ? 671 HOH A O   1 
HETATM 7429 O O   . HOH C 2 .   ? 59.325 -1.565  24.528  1.00 25.86 ? 672 HOH A O   1 
HETATM 7430 O O   . HOH C 2 .   ? 47.346 29.947  -3.626  1.00 32.20 ? 673 HOH A O   1 
HETATM 7431 O O   . HOH C 2 .   ? 45.167 5.193   3.237   1.00 39.10 ? 674 HOH A O   1 
HETATM 7432 O O   . HOH C 2 .   ? 55.706 -13.117 26.634  1.00 31.43 ? 675 HOH A O   1 
HETATM 7433 O O   . HOH C 2 .   ? 54.744 3.011   0.414   1.00 33.93 ? 676 HOH A O   1 
HETATM 7434 O O   . HOH C 2 .   ? 72.572 38.159  15.126  1.00 29.03 ? 677 HOH A O   1 
HETATM 7435 O O   . HOH C 2 .   ? 35.977 11.874  39.560  1.00 27.00 ? 678 HOH A O   1 
HETATM 7436 O O   . HOH C 2 .   ? 46.625 18.707  5.918   1.00 31.17 ? 679 HOH A O   1 
HETATM 7437 O O   . HOH C 2 .   ? 46.626 10.865  43.504  1.00 42.23 ? 680 HOH A O   1 
HETATM 7438 O O   . HOH C 2 .   ? 57.323 -0.806  10.958  1.00 33.88 ? 681 HOH A O   1 
HETATM 7439 O O   . HOH C 2 .   ? 30.428 12.269  31.891  1.00 33.18 ? 682 HOH A O   1 
HETATM 7440 O O   . HOH C 2 .   ? 59.506 5.875   33.097  1.00 32.91 ? 683 HOH A O   1 
HETATM 7441 O O   . HOH C 2 .   ? 57.934 7.871   28.120  1.00 38.62 ? 684 HOH A O   1 
HETATM 7442 O O   . HOH C 2 .   ? 62.672 38.375  23.380  1.00 29.48 ? 685 HOH A O   1 
HETATM 7443 O O   . HOH C 2 .   ? 50.878 -0.719  5.678   1.00 29.86 ? 686 HOH A O   1 
HETATM 7444 O O   . HOH C 2 .   ? 79.078 11.913  18.410  1.00 33.87 ? 687 HOH A O   1 
HETATM 7445 O O   . HOH C 2 .   ? 38.478 -0.553  34.326  1.00 29.57 ? 688 HOH A O   1 
HETATM 7446 O O   . HOH C 2 .   ? 56.716 2.151   14.202  1.00 26.45 ? 689 HOH A O   1 
HETATM 7447 O O   . HOH C 2 .   ? 47.646 26.399  -2.319  1.00 48.61 ? 690 HOH A O   1 
HETATM 7448 O O   . HOH C 2 .   ? 34.685 -0.280  11.664  1.00 36.74 ? 691 HOH A O   1 
HETATM 7449 O O   . HOH C 2 .   ? 65.224 17.530  -0.734  1.00 49.00 ? 692 HOH A O   1 
HETATM 7450 O O   . HOH C 2 .   ? 40.615 9.631   3.766   1.00 27.78 ? 693 HOH A O   1 
HETATM 7451 O O   . HOH C 2 .   ? 59.548 36.862  -4.656  1.00 32.27 ? 694 HOH A O   1 
HETATM 7452 O O   . HOH C 2 .   ? 68.403 28.458  12.628  1.00 27.14 ? 695 HOH A O   1 
HETATM 7453 O O   . HOH C 2 .   ? 61.199 14.374  35.733  1.00 26.06 ? 696 HOH A O   1 
HETATM 7454 O O   . HOH C 2 .   ? 49.079 16.908  44.564  1.00 32.50 ? 697 HOH A O   1 
HETATM 7455 O O   . HOH C 2 .   ? 26.025 9.305   19.983  1.00 41.29 ? 698 HOH A O   1 
HETATM 7456 O O   . HOH C 2 .   ? 63.718 10.636  5.114   1.00 34.25 ? 699 HOH A O   1 
HETATM 7457 O O   . HOH C 2 .   ? 41.428 13.132  2.091   1.00 35.30 ? 700 HOH A O   1 
HETATM 7458 O O   . HOH C 2 .   ? 20.772 5.285   19.472  1.00 42.17 ? 701 HOH A O   1 
HETATM 7459 O O   . HOH C 2 .   ? 62.098 24.249  32.644  1.00 31.15 ? 702 HOH A O   1 
HETATM 7460 O O   . HOH C 2 .   ? 38.311 28.637  14.402  1.00 46.72 ? 703 HOH A O   1 
HETATM 7461 O O   . HOH C 2 .   ? 66.894 4.165   5.627   1.00 33.50 ? 704 HOH A O   1 
HETATM 7462 O O   . HOH C 2 .   ? 57.642 24.695  39.269  1.00 26.97 ? 705 HOH A O   1 
HETATM 7463 O O   . HOH C 2 .   ? 60.058 11.756  21.828  1.00 25.64 ? 706 HOH A O   1 
HETATM 7464 O O   . HOH C 2 .   ? 61.718 3.508   29.472  1.00 32.63 ? 707 HOH A O   1 
HETATM 7465 O O   . HOH C 2 .   ? 35.834 27.981  30.199  1.00 44.28 ? 708 HOH A O   1 
HETATM 7466 O O   . HOH C 2 .   ? 27.888 12.572  25.127  1.00 28.51 ? 709 HOH A O   1 
HETATM 7467 O O   . HOH C 2 .   ? 44.208 42.523  18.090  1.00 32.33 ? 710 HOH A O   1 
HETATM 7468 O O   . HOH C 2 .   ? 48.185 32.580  -3.650  1.00 28.53 ? 711 HOH A O   1 
HETATM 7469 O O   . HOH C 2 .   ? 72.891 12.547  22.983  1.00 22.83 ? 712 HOH A O   1 
HETATM 7470 O O   . HOH C 2 .   ? 56.210 43.108  -1.236  1.00 29.37 ? 713 HOH A O   1 
HETATM 7471 O O   . HOH C 2 .   ? 44.052 19.737  6.249   1.00 30.92 ? 714 HOH A O   1 
HETATM 7472 O O   . HOH C 2 .   ? 46.281 24.592  -0.264  1.00 31.26 ? 715 HOH A O   1 
HETATM 7473 O O   . HOH C 2 .   ? 30.982 18.160  33.835  1.00 41.54 ? 716 HOH A O   1 
HETATM 7474 O O   . HOH C 2 .   ? 46.415 13.179  44.672  1.00 34.25 ? 717 HOH A O   1 
HETATM 7475 O O   . HOH C 2 .   ? 67.929 -8.235  14.917  1.00 29.46 ? 718 HOH A O   1 
HETATM 7476 O O   . HOH C 2 .   ? 72.521 -5.505  17.045  1.00 38.64 ? 719 HOH A O   1 
HETATM 7477 O O   . HOH C 2 .   ? 48.949 26.220  46.517  1.00 44.25 ? 720 HOH A O   1 
HETATM 7478 O O   . HOH C 2 .   ? 59.947 38.238  22.328  1.00 35.31 ? 721 HOH A O   1 
HETATM 7479 O O   . HOH C 2 .   ? 73.691 -3.834  23.067  1.00 29.64 ? 722 HOH A O   1 
HETATM 7480 O O   . HOH C 2 .   ? 50.490 40.379  -4.880  1.00 32.26 ? 723 HOH A O   1 
HETATM 7481 O O   . HOH C 2 .   ? 78.698 0.805   21.046  1.00 27.22 ? 724 HOH A O   1 
HETATM 7482 O O   . HOH C 2 .   ? 71.705 10.142  13.856  1.00 27.26 ? 725 HOH A O   1 
HETATM 7483 O O   . HOH C 2 .   ? 54.763 7.547   -0.834  1.00 37.10 ? 726 HOH A O   1 
HETATM 7484 O O   . HOH C 2 .   ? 41.298 15.823  43.695  1.00 44.28 ? 727 HOH A O   1 
HETATM 7485 O O   . HOH C 2 .   ? 25.980 12.884  21.195  1.00 36.86 ? 728 HOH A O   1 
HETATM 7486 O O   . HOH C 2 .   ? 56.907 -6.647  30.417  1.00 45.63 ? 729 HOH A O   1 
HETATM 7487 O O   . HOH C 2 .   ? 69.591 -13.767 19.785  1.00 42.32 ? 730 HOH A O   1 
HETATM 7488 O O   . HOH C 2 .   ? 37.180 7.703   39.252  1.00 47.46 ? 731 HOH A O   1 
HETATM 7489 O O   . HOH C 2 .   ? 38.162 21.137  7.287   1.00 33.77 ? 732 HOH A O   1 
HETATM 7490 O O   . HOH C 2 .   ? 71.392 25.164  14.612  1.00 42.37 ? 733 HOH A O   1 
HETATM 7491 O O   . HOH C 2 .   ? 59.888 -16.420 21.694  1.00 42.68 ? 734 HOH A O   1 
HETATM 7492 O O   . HOH C 2 .   ? 60.401 1.732   27.580  1.00 29.09 ? 735 HOH A O   1 
HETATM 7493 O O   . HOH C 2 .   ? 42.455 32.479  24.179  1.00 35.18 ? 736 HOH A O   1 
HETATM 7494 O O   . HOH C 2 .   ? 58.906 16.031  35.567  1.00 32.66 ? 737 HOH A O   1 
HETATM 7495 O O   . HOH C 2 .   ? 28.840 19.343  22.193  1.00 26.31 ? 738 HOH A O   1 
HETATM 7496 O O   . HOH C 2 .   ? 45.652 -0.694  25.259  1.00 25.89 ? 739 HOH A O   1 
HETATM 7497 O O   . HOH C 2 .   ? 27.910 21.960  22.851  1.00 42.85 ? 740 HOH A O   1 
HETATM 7498 O O   . HOH C 2 .   ? 63.112 24.488  -1.578  1.00 33.29 ? 741 HOH A O   1 
HETATM 7499 O O   . HOH C 2 .   ? 72.223 -4.021  25.332  1.00 34.72 ? 742 HOH A O   1 
HETATM 7500 O O   . HOH C 2 .   ? 53.452 28.573  41.501  1.00 44.97 ? 743 HOH A O   1 
HETATM 7501 O O   . HOH C 2 .   ? 26.761 23.132  15.058  1.00 25.47 ? 744 HOH A O   1 
HETATM 7502 O O   . HOH C 2 .   ? 52.837 40.499  23.455  1.00 34.30 ? 745 HOH A O   1 
HETATM 7503 O O   . HOH C 2 .   ? 21.466 8.491   21.486  1.00 45.48 ? 746 HOH A O   1 
HETATM 7504 O O   . HOH C 2 .   ? 48.925 28.008  38.322  1.00 37.04 ? 747 HOH A O   1 
HETATM 7505 O O   . HOH C 2 .   ? 56.964 45.164  17.057  1.00 33.92 ? 748 HOH A O   1 
HETATM 7506 O O   . HOH C 2 .   ? 36.916 13.876  9.596   1.00 49.75 ? 749 HOH A O   1 
HETATM 7507 O O   . HOH C 2 .   ? 40.576 -2.789  28.642  1.00 37.17 ? 750 HOH A O   1 
HETATM 7508 O O   . HOH C 2 .   ? 72.611 3.798   11.793  1.00 30.10 ? 751 HOH A O   1 
HETATM 7509 O O   . HOH C 2 .   ? 40.360 23.501  43.075  1.00 32.76 ? 752 HOH A O   1 
HETATM 7510 O O   . HOH C 2 .   ? 68.373 29.282  9.877   1.00 33.56 ? 753 HOH A O   1 
HETATM 7511 O O   . HOH C 2 .   ? 42.586 39.109  15.255  1.00 40.32 ? 754 HOH A O   1 
HETATM 7512 O O   . HOH C 2 .   ? 79.187 12.097  21.797  1.00 40.05 ? 755 HOH A O   1 
HETATM 7513 O O   . HOH C 2 .   ? 67.226 -5.409  10.388  1.00 41.68 ? 756 HOH A O   1 
HETATM 7514 O O   . HOH C 2 .   ? 51.388 9.969   37.345  1.00 36.33 ? 757 HOH A O   1 
HETATM 7515 O O   . HOH C 2 .   ? 56.495 -0.787  0.686   1.00 29.87 ? 758 HOH A O   1 
HETATM 7516 O O   . HOH C 2 .   ? 67.943 44.221  12.233  1.00 37.12 ? 759 HOH A O   1 
HETATM 7517 O O   . HOH C 2 .   ? 77.265 31.828  16.398  1.00 37.93 ? 760 HOH A O   1 
HETATM 7518 O O   . HOH C 2 .   ? 36.300 28.217  17.987  1.00 26.69 ? 761 HOH A O   1 
HETATM 7519 O O   . HOH C 2 .   ? 46.764 -8.233  33.471  1.00 40.98 ? 762 HOH A O   1 
HETATM 7520 O O   . HOH C 2 .   ? 58.155 7.709   34.338  1.00 39.31 ? 763 HOH A O   1 
HETATM 7521 O O   . HOH C 2 .   ? 67.809 39.455  6.931   1.00 41.79 ? 764 HOH A O   1 
HETATM 7522 O O   . HOH C 2 .   ? 63.472 43.717  17.554  1.00 32.10 ? 765 HOH A O   1 
HETATM 7523 O O   . HOH C 2 .   ? 78.441 22.272  11.808  1.00 36.36 ? 766 HOH A O   1 
HETATM 7524 O O   . HOH C 2 .   ? 45.889 5.072   34.790  1.00 44.64 ? 767 HOH A O   1 
HETATM 7525 O O   . HOH C 2 .   ? 26.792 17.858  21.631  1.00 30.87 ? 768 HOH A O   1 
HETATM 7526 O O   . HOH C 2 .   ? 67.167 15.944  1.849   1.00 44.24 ? 769 HOH A O   1 
HETATM 7527 O O   . HOH C 2 .   ? 77.289 14.957  9.862   1.00 35.50 ? 770 HOH A O   1 
HETATM 7528 O O   . HOH C 2 .   ? 31.134 19.759  39.940  1.00 40.45 ? 771 HOH A O   1 
HETATM 7529 O O   . HOH C 2 .   ? 15.035 9.461   18.620  1.00 43.97 ? 772 HOH A O   1 
HETATM 7530 O O   . HOH C 2 .   ? 68.494 18.704  17.943  1.00 32.38 ? 773 HOH A O   1 
HETATM 7531 O O   . HOH C 2 .   ? 69.316 12.170  6.566   1.00 46.45 ? 774 HOH A O   1 
HETATM 7532 O O   . HOH C 2 .   ? 67.099 22.939  11.917  1.00 40.15 ? 775 HOH A O   1 
HETATM 7533 O O   . HOH C 2 .   ? 66.110 19.572  32.774  1.00 38.60 ? 776 HOH A O   1 
HETATM 7534 O O   . HOH C 2 .   ? 45.965 45.779  15.557  1.00 43.27 ? 777 HOH A O   1 
HETATM 7535 O O   . HOH C 2 .   ? 48.021 -0.451  6.100   1.00 31.39 ? 778 HOH A O   1 
HETATM 7536 O O   . HOH C 2 .   ? 43.617 0.195   7.210   1.00 30.34 ? 779 HOH A O   1 
HETATM 7537 O O   . HOH C 2 .   ? 65.228 11.511  1.108   1.00 40.51 ? 780 HOH A O   1 
HETATM 7538 O O   . HOH C 2 .   ? 40.996 5.070   3.383   1.00 29.53 ? 781 HOH A O   1 
HETATM 7539 O O   . HOH C 2 .   ? 69.886 32.208  -0.203  1.00 36.36 ? 782 HOH A O   1 
HETATM 7540 O O   . HOH C 2 .   ? 46.505 33.722  -5.503  1.00 43.11 ? 783 HOH A O   1 
HETATM 7541 O O   . HOH C 2 .   ? 46.210 36.562  26.937  1.00 46.76 ? 784 HOH A O   1 
HETATM 7542 O O   . HOH C 2 .   ? 56.585 14.495  36.511  1.00 26.13 ? 785 HOH A O   1 
HETATM 7543 O O   . HOH C 2 .   ? 61.047 -3.373  7.868   1.00 41.61 ? 786 HOH A O   1 
HETATM 7544 O O   . HOH C 2 .   ? 45.430 18.550  0.245   1.00 33.58 ? 787 HOH A O   1 
HETATM 7545 O O   . HOH C 2 .   ? 70.167 34.846  23.349  1.00 37.04 ? 788 HOH A O   1 
HETATM 7546 O O   . HOH C 2 .   ? 76.411 -2.606  23.630  1.00 34.51 ? 789 HOH A O   1 
HETATM 7547 O O   . HOH C 2 .   ? 28.299 16.451  25.589  1.00 28.30 ? 790 HOH A O   1 
HETATM 7548 O O   . HOH C 2 .   ? 51.754 6.943   37.886  1.00 46.39 ? 791 HOH A O   1 
HETATM 7549 O O   . HOH C 2 .   ? 72.560 1.334   10.951  1.00 37.84 ? 792 HOH A O   1 
HETATM 7550 O O   . HOH C 2 .   ? 45.224 23.474  3.587   1.00 42.30 ? 793 HOH A O   1 
HETATM 7551 O O   . HOH C 2 .   ? 31.908 26.873  20.367  1.00 45.96 ? 794 HOH A O   1 
HETATM 7552 O O   . HOH C 2 .   ? 64.820 -2.028  2.821   1.00 39.59 ? 795 HOH A O   1 
HETATM 7553 O O   . HOH C 2 .   ? 67.100 46.605  9.952   1.00 39.41 ? 796 HOH A O   1 
HETATM 7554 O O   . HOH C 2 .   ? 69.103 13.785  20.334  1.00 40.06 ? 797 HOH A O   1 
HETATM 7555 O O   . HOH C 2 .   ? 42.267 30.036  39.360  1.00 45.46 ? 798 HOH A O   1 
HETATM 7556 O O   . HOH C 2 .   ? 44.650 30.094  -3.139  1.00 39.07 ? 799 HOH A O   1 
HETATM 7557 O O   . HOH C 2 .   ? 62.522 2.984   0.951   1.00 47.31 ? 800 HOH A O   1 
HETATM 7558 O O   . HOH C 2 .   ? 78.190 16.013  26.750  1.00 34.64 ? 801 HOH A O   1 
HETATM 7559 O O   . HOH C 2 .   ? 79.651 9.641   17.262  1.00 37.45 ? 802 HOH A O   1 
HETATM 7560 O O   . HOH C 2 .   ? 32.234 26.148  29.212  1.00 35.83 ? 803 HOH A O   1 
HETATM 7561 O O   . HOH C 2 .   ? 64.475 -2.341  7.991   1.00 35.91 ? 804 HOH A O   1 
HETATM 7562 O O   . HOH C 2 .   ? 52.603 3.404   -1.300  1.00 46.71 ? 805 HOH A O   1 
HETATM 7563 O O   . HOH C 2 .   ? 45.225 27.855  42.037  1.00 49.62 ? 806 HOH A O   1 
HETATM 7564 O O   . HOH C 2 .   ? 67.947 1.311   35.932  1.00 42.72 ? 807 HOH A O   1 
HETATM 7565 O O   . HOH C 2 .   ? 70.278 34.542  26.288  1.00 38.77 ? 808 HOH A O   1 
HETATM 7566 O O   . HOH C 2 .   ? 49.563 21.719  45.323  1.00 45.48 ? 809 HOH A O   1 
HETATM 7567 O O   . HOH C 2 .   ? 76.296 9.721   12.898  1.00 41.60 ? 810 HOH A O   1 
HETATM 7568 O O   . HOH C 2 .   ? 60.337 33.989  -1.685  1.00 40.11 ? 811 HOH A O   1 
HETATM 7569 O O   . HOH C 2 .   ? 36.153 30.176  16.148  1.00 31.54 ? 812 HOH A O   1 
HETATM 7570 O O   . HOH C 2 .   ? 33.424 22.902  33.648  1.00 40.50 ? 813 HOH A O   1 
HETATM 7571 O O   . HOH C 2 .   ? 71.168 -9.525  17.890  1.00 41.15 ? 814 HOH A O   1 
HETATM 7572 O O   . HOH C 2 .   ? 55.670 -1.324  6.808   1.00 38.67 ? 815 HOH A O   1 
HETATM 7573 O O   . HOH C 2 .   ? 42.558 35.268  27.550  1.00 47.22 ? 816 HOH A O   1 
HETATM 7574 O O   . HOH C 2 .   ? 53.073 -0.928  7.121   1.00 35.00 ? 817 HOH A O   1 
HETATM 7575 O O   . HOH C 2 .   ? 78.622 15.151  16.043  1.00 42.09 ? 818 HOH A O   1 
HETATM 7576 O O   . HOH C 2 .   ? 52.565 44.151  -5.374  1.00 47.27 ? 819 HOH A O   1 
HETATM 7577 O O   . HOH C 2 .   ? 42.766 4.047   38.222  1.00 49.60 ? 820 HOH A O   1 
HETATM 7578 O O   . HOH C 2 .   ? 38.166 3.763   37.078  1.00 37.57 ? 821 HOH A O   1 
HETATM 7579 O O   . HOH C 2 .   ? 70.453 -3.022  33.691  1.00 45.18 ? 822 HOH A O   1 
HETATM 7580 O O   . HOH C 2 .   ? 68.388 44.127  15.444  1.00 46.36 ? 823 HOH A O   1 
HETATM 7581 O O   . HOH C 2 .   ? 50.926 -6.940  9.049   1.00 37.55 ? 824 HOH A O   1 
HETATM 7582 O O   . HOH C 2 .   ? 74.000 20.593  0.988   1.00 37.09 ? 825 HOH A O   1 
HETATM 7583 O O   . HOH C 2 .   ? 54.822 -1.766  4.035   1.00 40.80 ? 826 HOH A O   1 
HETATM 7584 O O   . HOH C 2 .   ? 57.136 6.194   38.127  1.00 47.58 ? 827 HOH A O   1 
HETATM 7585 O O   . HOH C 2 .   ? 61.501 45.905  20.977  1.00 44.69 ? 828 HOH A O   1 
HETATM 7586 O O   . HOH C 2 .   ? 57.598 17.995  41.559  1.00 33.08 ? 829 HOH A O   1 
HETATM 7587 O O   . HOH C 2 .   ? 44.032 25.520  4.652   1.00 40.49 ? 830 HOH A O   1 
HETATM 7588 O O   . HOH C 2 .   ? 60.866 53.580  16.385  1.00 39.35 ? 831 HOH A O   1 
HETATM 7589 O O   . HOH C 2 .   ? 66.569 10.358  6.048   1.00 43.09 ? 832 HOH A O   1 
HETATM 7590 O O   . HOH C 2 .   ? 39.860 31.671  18.716  1.00 42.30 ? 833 HOH A O   1 
HETATM 7591 O O   . HOH C 2 .   ? 76.742 -3.556  20.174  1.00 35.50 ? 834 HOH A O   1 
HETATM 7592 O O   . HOH C 2 .   ? 54.589 -4.696  32.363  1.00 38.29 ? 835 HOH A O   1 
HETATM 7593 O O   . HOH C 2 .   ? 48.105 49.553  1.066   1.00 46.09 ? 836 HOH A O   1 
HETATM 7594 O O   . HOH C 2 .   ? 70.332 14.726  3.130   1.00 30.15 ? 837 HOH A O   1 
HETATM 7595 O O   . HOH C 2 .   ? 73.201 8.240   9.981   1.00 44.99 ? 838 HOH A O   1 
HETATM 7596 O O   . HOH C 2 .   ? 47.690 2.117   34.913  1.00 35.95 ? 839 HOH A O   1 
HETATM 7597 O O   . HOH C 2 .   ? 63.871 -17.795 24.566  1.00 42.00 ? 840 HOH A O   1 
HETATM 7598 O O   . HOH C 2 .   ? 46.564 24.663  39.599  1.00 39.60 ? 841 HOH A O   1 
HETATM 7599 O O   . HOH C 2 .   ? 59.237 61.415  9.142   1.00 47.72 ? 842 HOH A O   1 
HETATM 7600 O O   . HOH C 2 .   ? 74.688 24.247  6.916   1.00 45.32 ? 843 HOH A O   1 
HETATM 7601 O O   . HOH C 2 .   ? 45.758 48.502  9.245   1.00 33.49 ? 844 HOH A O   1 
HETATM 7602 O O   . HOH C 2 .   ? 50.786 33.328  33.298  1.00 38.23 ? 845 HOH A O   1 
HETATM 7603 O O   . HOH C 2 .   ? 46.343 43.951  2.056   1.00 46.91 ? 846 HOH A O   1 
HETATM 7604 O O   . HOH C 2 .   ? 43.015 3.860   4.517   1.00 29.51 ? 847 HOH A O   1 
HETATM 7605 O O   . HOH C 2 .   ? 57.599 27.646  -4.319  1.00 48.76 ? 848 HOH A O   1 
HETATM 7606 O O   . HOH C 2 .   ? 52.664 34.305  31.279  1.00 28.81 ? 849 HOH A O   1 
HETATM 7607 O O   . HOH C 2 .   ? 52.899 11.435  -3.211  1.00 41.56 ? 850 HOH A O   1 
HETATM 7608 O O   . HOH C 2 .   ? 57.097 12.995  -4.405  1.00 49.60 ? 851 HOH A O   1 
HETATM 7609 O O   . HOH C 2 .   ? 38.833 33.691  17.320  1.00 43.14 ? 852 HOH A O   1 
HETATM 7610 O O   . HOH C 2 .   ? 56.270 50.986  21.267  1.00 36.05 ? 853 HOH A O   1 
HETATM 7611 O O   . HOH C 2 .   ? 74.139 23.313  10.545  1.00 47.46 ? 854 HOH A O   1 
HETATM 7612 O O   . HOH C 2 .   ? 59.100 -2.372  14.816  1.00 36.26 ? 855 HOH A O   1 
HETATM 7613 O O   . HOH C 2 .   ? 29.576 14.973  31.911  1.00 41.22 ? 856 HOH A O   1 
HETATM 7614 O O   . HOH C 2 .   ? 60.735 0.291   33.931  1.00 35.35 ? 857 HOH A O   1 
HETATM 7615 O O   . HOH C 2 .   ? 62.508 34.643  34.648  1.00 33.56 ? 858 HOH A O   1 
HETATM 7616 O O   . HOH C 2 .   ? 37.566 -1.969  30.780  1.00 35.43 ? 859 HOH A O   1 
HETATM 7617 O O   . HOH C 2 .   ? 36.866 -0.731  9.723   1.00 33.68 ? 860 HOH A O   1 
HETATM 7618 O O   . HOH C 2 .   ? 56.130 31.608  38.001  1.00 36.86 ? 861 HOH A O   1 
HETATM 7619 O O   . HOH C 2 .   ? 79.897 -1.736  18.618  1.00 40.35 ? 862 HOH A O   1 
HETATM 7620 O O   . HOH C 2 .   ? 71.170 -7.617  30.749  1.00 39.69 ? 863 HOH A O   1 
HETATM 7621 O O   . HOH C 2 .   ? 32.722 32.132  26.186  1.00 40.39 ? 864 HOH A O   1 
HETATM 7622 O O   . HOH C 2 .   ? 68.027 -4.963  34.024  1.00 38.35 ? 865 HOH A O   1 
HETATM 7623 O O   . HOH C 2 .   ? 54.787 -0.017  32.181  1.00 43.09 ? 866 HOH A O   1 
HETATM 7624 O O   . HOH C 2 .   ? 45.502 27.943  -1.909  1.00 43.93 ? 867 HOH A O   1 
HETATM 7625 O O   . HOH C 2 .   ? 40.545 17.674  8.938   1.00 37.20 ? 868 HOH A O   1 
HETATM 7626 O O   . HOH C 2 .   ? 61.858 1.770   36.248  1.00 45.32 ? 869 HOH A O   1 
HETATM 7627 O O   . HOH C 2 .   ? 45.037 39.053  -3.257  1.00 45.19 ? 870 HOH A O   1 
HETATM 7628 O O   . HOH C 2 .   ? 46.786 30.733  36.938  1.00 45.70 ? 871 HOH A O   1 
HETATM 7629 O O   . HOH C 2 .   ? 44.796 45.681  5.397   1.00 40.61 ? 872 HOH A O   1 
HETATM 7630 O O   . HOH C 2 .   ? 47.886 9.809   41.442  1.00 40.64 ? 873 HOH A O   1 
HETATM 7631 O O   . HOH C 2 .   ? 71.434 16.248  30.553  1.00 49.40 ? 874 HOH A O   1 
HETATM 7632 O O   . HOH C 2 .   ? 28.217 10.771  31.161  1.00 44.03 ? 875 HOH A O   1 
HETATM 7633 O O   . HOH C 2 .   ? 73.948 -3.750  12.229  1.00 41.19 ? 876 HOH A O   1 
HETATM 7634 O O   . HOH C 2 .   ? 79.979 5.870   21.345  1.00 41.26 ? 877 HOH A O   1 
HETATM 7635 O O   . HOH C 2 .   ? 62.055 0.944   -1.014  1.00 34.09 ? 878 HOH A O   1 
HETATM 7636 O O   . HOH C 2 .   ? 31.485 16.890  37.964  1.00 46.86 ? 879 HOH A O   1 
HETATM 7637 O O   . HOH C 2 .   ? 36.500 3.698   10.669  1.00 42.75 ? 880 HOH A O   1 
HETATM 7638 O O   . HOH C 2 .   ? 27.322 7.126   28.925  1.00 41.68 ? 881 HOH A O   1 
HETATM 7639 O O   . HOH C 2 .   ? 30.603 21.481  32.399  1.00 41.33 ? 882 HOH A O   1 
HETATM 7640 O O   . HOH C 2 .   ? 68.049 35.404  28.977  1.00 44.17 ? 883 HOH A O   1 
HETATM 7641 O O   . HOH C 2 .   ? 59.395 52.042  18.063  1.00 47.39 ? 884 HOH A O   1 
HETATM 7642 O O   . HOH C 2 .   ? 46.328 1.226   2.363   1.00 44.46 ? 885 HOH A O   1 
HETATM 7643 O O   . HOH C 2 .   ? 66.687 5.255   36.649  1.00 42.87 ? 886 HOH A O   1 
HETATM 7644 O O   . HOH C 2 .   ? 42.711 44.618  14.740  1.00 42.70 ? 887 HOH A O   1 
HETATM 7645 O O   . HOH C 2 .   ? 43.530 37.801  17.375  1.00 37.16 ? 888 HOH A O   1 
HETATM 7646 O O   . HOH C 2 .   ? 58.470 32.873  -3.317  1.00 35.92 ? 889 HOH A O   1 
HETATM 7647 O O   . HOH C 2 .   ? 59.160 15.470  38.792  1.00 41.46 ? 890 HOH A O   1 
HETATM 7648 O O   . HOH C 2 .   ? 53.392 57.097  4.739   1.00 45.14 ? 891 HOH A O   1 
HETATM 7649 O O   . HOH C 2 .   ? 42.943 0.187   34.457  1.00 44.59 ? 892 HOH A O   1 
HETATM 7650 O O   . HOH C 2 .   ? 35.132 28.776  20.936  1.00 40.56 ? 893 HOH A O   1 
HETATM 7651 O O   . HOH C 2 .   ? 42.591 43.915  7.450   1.00 47.65 ? 894 HOH A O   1 
HETATM 7652 O O   . HOH C 2 .   ? 78.301 25.870  14.850  1.00 40.62 ? 895 HOH A O   1 
HETATM 7653 O O   . HOH C 2 .   ? 60.580 5.422   -0.098  1.00 47.46 ? 896 HOH A O   1 
HETATM 7654 O O   . HOH C 2 .   ? 68.219 21.287  32.124  1.00 34.49 ? 897 HOH A O   1 
HETATM 7655 O O   . HOH C 2 .   ? 70.779 28.089  14.012  1.00 34.57 ? 898 HOH A O   1 
HETATM 7656 O O   . HOH C 2 .   ? 64.185 59.461  10.608  1.00 44.35 ? 899 HOH A O   1 
HETATM 7657 O O   . HOH C 2 .   ? 50.321 38.629  29.434  1.00 42.30 ? 900 HOH A O   1 
HETATM 7658 O O   . HOH C 2 .   ? 57.195 -0.472  15.049  1.00 33.52 ? 901 HOH A O   1 
HETATM 7659 O O   . HOH C 2 .   ? 55.308 -2.687  29.746  1.00 41.82 ? 902 HOH A O   1 
HETATM 7660 O O   . HOH C 2 .   ? 59.319 7.821   37.782  1.00 39.59 ? 903 HOH A O   1 
HETATM 7661 O O   . HOH C 2 .   ? 69.910 3.456   7.329   1.00 42.20 ? 904 HOH A O   1 
HETATM 7662 O O   . HOH C 2 .   ? 71.378 32.230  25.930  1.00 36.63 ? 905 HOH A O   1 
HETATM 7663 O O   . HOH C 2 .   ? 62.331 17.809  37.587  1.00 45.66 ? 906 HOH A O   1 
HETATM 7664 O O   . HOH C 2 .   ? 27.790 20.846  25.754  1.00 48.67 ? 907 HOH A O   1 
HETATM 7665 O O   . HOH C 2 .   ? 54.777 7.546   36.791  1.00 37.66 ? 908 HOH A O   1 
HETATM 7666 O O   . HOH C 2 .   ? 43.207 32.846  20.722  1.00 41.70 ? 909 HOH A O   1 
HETATM 7667 O O   . HOH C 2 .   ? 66.342 -1.581  5.099   1.00 36.43 ? 910 HOH A O   1 
HETATM 7668 O O   . HOH C 2 .   ? 43.919 17.369  45.394  1.00 44.57 ? 911 HOH A O   1 
HETATM 7669 O O   . HOH C 2 .   ? 33.891 28.059  24.402  1.00 36.92 ? 912 HOH A O   1 
HETATM 7670 O O   . HOH C 2 .   ? 17.602 10.476  21.926  1.00 46.93 ? 913 HOH A O   1 
HETATM 7671 O O   . HOH C 2 .   ? 73.201 37.110  18.839  1.00 38.58 ? 914 HOH A O   1 
HETATM 7672 O O   . HOH C 2 .   ? 51.610 34.433  35.479  1.00 45.49 ? 915 HOH A O   1 
HETATM 7673 O O   . HOH C 2 .   ? 74.954 27.134  15.765  1.00 37.05 ? 916 HOH A O   1 
HETATM 7674 O O   . HOH C 2 .   ? 40.318 31.136  28.791  1.00 49.73 ? 917 HOH A O   1 
HETATM 7675 O O   . HOH C 2 .   ? 69.412 40.305  16.953  1.00 40.70 ? 918 HOH A O   1 
HETATM 7676 O O   . HOH C 2 .   ? 47.479 50.299  5.801   1.00 43.95 ? 919 HOH A O   1 
HETATM 7677 O O   . HOH C 2 .   ? 65.115 22.252  34.698  1.00 41.09 ? 920 HOH A O   1 
HETATM 7678 O O   . HOH C 2 .   ? 62.058 47.217  15.912  1.00 45.22 ? 921 HOH A O   1 
HETATM 7679 O O   . HOH C 2 .   ? 72.036 32.546  1.829   1.00 42.49 ? 922 HOH A O   1 
HETATM 7680 O O   . HOH C 2 .   ? 30.007 15.259  36.593  1.00 46.53 ? 923 HOH A O   1 
HETATM 7681 O O   . HOH C 2 .   ? 55.097 42.930  23.117  1.00 39.20 ? 924 HOH A O   1 
HETATM 7682 O O   . HOH C 2 .   ? 62.525 8.952   2.472   1.00 41.89 ? 925 HOH A O   1 
HETATM 7683 O O   . HOH C 2 .   ? 44.074 -2.461  31.011  1.00 46.85 ? 926 HOH A O   1 
HETATM 7684 O O   . HOH C 2 .   ? 53.260 -7.339  32.936  1.00 48.76 ? 927 HOH A O   1 
HETATM 7685 O O   . HOH C 2 .   ? 53.898 35.951  33.708  1.00 45.47 ? 928 HOH A O   1 
HETATM 7686 O O   . HOH C 2 .   ? 74.750 -7.505  31.829  1.00 43.34 ? 929 HOH A O   1 
HETATM 7687 O O   . HOH C 2 .   ? 69.639 37.546  16.969  1.00 43.21 ? 930 HOH A O   1 
HETATM 7688 O O   . HOH C 2 .   ? 58.670 58.571  14.176  1.00 44.19 ? 931 HOH A O   1 
HETATM 7689 O O   . HOH C 2 .   ? 61.848 27.341  35.684  1.00 44.92 ? 932 HOH A O   1 
HETATM 7690 O O   . HOH C 2 .   ? 67.190 12.083  20.155  1.00 40.66 ? 933 HOH A O   1 
HETATM 7691 O O   . HOH C 2 .   ? 59.144 49.008  23.122  1.00 41.69 ? 934 HOH A O   1 
HETATM 7692 O O   . HOH C 2 .   ? 37.816 32.319  34.850  1.00 42.84 ? 935 HOH A O   1 
HETATM 7693 O O   . HOH C 2 .   ? 21.357 7.052   15.173  1.00 46.48 ? 936 HOH A O   1 
HETATM 7694 O O   . HOH C 2 .   ? 61.437 56.981  7.091   1.00 41.41 ? 937 HOH A O   1 
HETATM 7695 O O   . HOH C 2 .   ? 44.003 38.199  4.108   1.00 39.80 ? 938 HOH A O   1 
HETATM 7696 O O   . HOH C 2 .   ? 68.433 28.319  -6.859  1.00 45.12 ? 939 HOH A O   1 
HETATM 7697 O O   . HOH C 2 .   ? 35.788 27.252  12.948  1.00 37.14 ? 940 HOH A O   1 
HETATM 7698 O O   . HOH C 2 .   ? 17.251 10.605  15.592  1.00 49.77 ? 941 HOH A O   1 
HETATM 7699 O O   . HOH C 2 .   ? 76.110 18.650  3.767   1.00 46.22 ? 942 HOH A O   1 
HETATM 7700 O O   . HOH C 2 .   ? 53.883 59.842  12.060  1.00 48.46 ? 943 HOH A O   1 
HETATM 7701 O O   . HOH C 2 .   ? 73.110 29.643  22.351  1.00 45.56 ? 944 HOH A O   1 
HETATM 7702 O O   . HOH C 2 .   ? 33.666 28.316  27.447  1.00 42.39 ? 945 HOH A O   1 
HETATM 7703 O O   . HOH C 2 .   ? 69.619 33.926  30.872  1.00 35.43 ? 946 HOH A O   1 
HETATM 7704 O O   . HOH D 2 .   ? 31.227 25.416  -5.928  1.00 12.51 ? 526 HOH B O   1 
HETATM 7705 O O   . HOH D 2 .   ? 10.143 4.070   -19.232 1.00 30.75 ? 527 HOH B O   1 
HETATM 7706 O O   . HOH D 2 .   ? 32.305 22.388  -15.100 1.00 14.64 ? 528 HOH B O   1 
HETATM 7707 O O   . HOH D 2 .   ? 23.979 26.762  -8.473  1.00 12.47 ? 529 HOH B O   1 
HETATM 7708 O O   . HOH D 2 .   ? 40.135 30.730  2.791   1.00 17.13 ? 530 HOH B O   1 
HETATM 7709 O O   . HOH D 2 .   ? 33.015 21.093  13.050  1.00 17.19 ? 531 HOH B O   1 
HETATM 7710 O O   . HOH D 2 .   ? 26.147 26.797  -22.357 1.00 20.65 ? 532 HOH B O   1 
HETATM 7711 O O   . HOH D 2 .   ? 41.212 37.984  4.451   1.00 20.55 ? 533 HOH B O   1 
HETATM 7712 O O   . HOH D 2 .   ? 29.855 41.281  -7.607  1.00 13.59 ? 534 HOH B O   1 
HETATM 7713 O O   . HOH D 2 .   ? 28.550 6.753   -14.397 1.00 19.07 ? 535 HOH B O   1 
HETATM 7714 O O   . HOH D 2 .   ? 31.034 18.869  -17.873 1.00 16.70 ? 536 HOH B O   1 
HETATM 7715 O O   . HOH D 2 .   ? 23.618 9.999   -6.897  1.00 19.85 ? 537 HOH B O   1 
HETATM 7716 O O   . HOH D 2 .   ? 31.026 34.594  -3.886  1.00 17.63 ? 538 HOH B O   1 
HETATM 7717 O O   . HOH D 2 .   ? 10.557 15.349  -19.502 1.00 19.56 ? 539 HOH B O   1 
HETATM 7718 O O   . HOH D 2 .   ? 43.112 17.342  -4.894  1.00 22.20 ? 540 HOH B O   1 
HETATM 7719 O O   . HOH D 2 .   ? 19.709 26.590  -3.419  1.00 14.65 ? 541 HOH B O   1 
HETATM 7720 O O   . HOH D 2 .   ? 18.479 22.646  3.287   1.00 16.60 ? 542 HOH B O   1 
HETATM 7721 O O   . HOH D 2 .   ? 33.542 25.730  -4.006  1.00 18.29 ? 543 HOH B O   1 
HETATM 7722 O O   . HOH D 2 .   ? 26.186 19.047  -20.232 1.00 20.06 ? 544 HOH B O   1 
HETATM 7723 O O   . HOH D 2 .   ? 8.648  17.126  -11.256 1.00 23.56 ? 545 HOH B O   1 
HETATM 7724 O O   . HOH D 2 .   ? 29.820 35.379  -6.357  1.00 19.22 ? 546 HOH B O   1 
HETATM 7725 O O   . HOH D 2 .   ? 27.760 4.824   -7.729  1.00 22.82 ? 547 HOH B O   1 
HETATM 7726 O O   . HOH D 2 .   ? 44.740 29.942  -6.845  1.00 18.43 ? 548 HOH B O   1 
HETATM 7727 O O   . HOH D 2 .   ? 31.198 36.799  -2.196  1.00 17.33 ? 549 HOH B O   1 
HETATM 7728 O O   . HOH D 2 .   ? 19.131 25.812  -19.615 1.00 17.96 ? 550 HOH B O   1 
HETATM 7729 O O   . HOH D 2 .   ? 25.817 14.251  -15.251 1.00 15.07 ? 551 HOH B O   1 
HETATM 7730 O O   . HOH D 2 .   ? 46.856 23.769  -33.879 1.00 23.56 ? 552 HOH B O   1 
HETATM 7731 O O   . HOH D 2 .   ? 29.486 30.099  -0.237  1.00 15.64 ? 553 HOH B O   1 
HETATM 7732 O O   . HOH D 2 .   ? 11.502 -3.079  -19.915 1.00 27.97 ? 554 HOH B O   1 
HETATM 7733 O O   . HOH D 2 .   ? 30.133 7.454   -27.544 1.00 19.19 ? 555 HOH B O   1 
HETATM 7734 O O   . HOH D 2 .   ? 31.873 19.488  -33.485 1.00 34.16 ? 556 HOH B O   1 
HETATM 7735 O O   . HOH D 2 .   ? 37.146 35.047  7.982   1.00 21.16 ? 557 HOH B O   1 
HETATM 7736 O O   . HOH D 2 .   ? 35.950 24.779  5.761   1.00 16.73 ? 558 HOH B O   1 
HETATM 7737 O O   . HOH D 2 .   ? 14.375 12.765  -6.673  1.00 19.92 ? 559 HOH B O   1 
HETATM 7738 O O   . HOH D 2 .   ? 27.984 18.307  -22.058 1.00 21.25 ? 560 HOH B O   1 
HETATM 7739 O O   . HOH D 2 .   ? 36.903 16.800  -26.937 1.00 24.08 ? 561 HOH B O   1 
HETATM 7740 O O   . HOH D 2 .   ? 17.342 24.504  -11.224 1.00 15.40 ? 562 HOH B O   1 
HETATM 7741 O O   . HOH D 2 .   ? 28.916 8.932   -25.527 1.00 22.86 ? 563 HOH B O   1 
HETATM 7742 O O   . HOH D 2 .   ? 22.067 19.136  -10.843 1.00 16.15 ? 564 HOH B O   1 
HETATM 7743 O O   . HOH D 2 .   ? 24.397 9.598   -9.594  1.00 20.81 ? 565 HOH B O   1 
HETATM 7744 O O   . HOH D 2 .   ? 44.928 20.836  -2.844  1.00 26.36 ? 566 HOH B O   1 
HETATM 7745 O O   . HOH D 2 .   ? 7.588  17.748  -30.334 1.00 35.27 ? 567 HOH B O   1 
HETATM 7746 O O   . HOH D 2 .   ? 38.722 27.145  0.418   1.00 22.88 ? 568 HOH B O   1 
HETATM 7747 O O   . HOH D 2 .   ? 44.739 21.892  -15.094 1.00 17.85 ? 569 HOH B O   1 
HETATM 7748 O O   . HOH D 2 .   ? 28.943 6.460   -17.146 1.00 20.36 ? 570 HOH B O   1 
HETATM 7749 O O   . HOH D 2 .   ? 9.337  40.632  -7.302  1.00 31.24 ? 571 HOH B O   1 
HETATM 7750 O O   . HOH D 2 .   ? 35.028 29.716  13.734  1.00 22.62 ? 572 HOH B O   1 
HETATM 7751 O O   . HOH D 2 .   ? 51.704 16.078  -11.063 1.00 24.22 ? 573 HOH B O   1 
HETATM 7752 O O   . HOH D 2 .   ? 10.864 24.537  -5.814  1.00 26.40 ? 574 HOH B O   1 
HETATM 7753 O O   . HOH D 2 .   ? 36.958 42.756  -5.247  1.00 18.38 ? 575 HOH B O   1 
HETATM 7754 O O   . HOH D 2 .   ? 22.611 7.483   -0.349  1.00 24.38 ? 576 HOH B O   1 
HETATM 7755 O O   . HOH D 2 .   ? 40.966 22.274  -3.445  1.00 25.90 ? 577 HOH B O   1 
HETATM 7756 O O   . HOH D 2 .   ? 28.164 19.622  -24.400 1.00 20.30 ? 578 HOH B O   1 
HETATM 7757 O O   . HOH D 2 .   ? 38.950 45.938  -3.778  1.00 27.78 ? 579 HOH B O   1 
HETATM 7758 O O   . HOH D 2 .   ? 40.893 18.553  -0.660  1.00 19.63 ? 580 HOH B O   1 
HETATM 7759 O O   . HOH D 2 .   ? 51.228 25.937  -24.419 1.00 25.81 ? 581 HOH B O   1 
HETATM 7760 O O   . HOH D 2 .   ? 37.070 21.898  1.612   1.00 23.49 ? 582 HOH B O   1 
HETATM 7761 O O   . HOH D 2 .   ? 25.056 16.836  -26.846 1.00 32.66 ? 583 HOH B O   1 
HETATM 7762 O O   . HOH D 2 .   ? 19.295 7.563   -2.844  1.00 21.26 ? 584 HOH B O   1 
HETATM 7763 O O   . HOH D 2 .   ? 43.420 5.933   -8.939  1.00 25.31 ? 585 HOH B O   1 
HETATM 7764 O O   . HOH D 2 .   ? 13.426 24.746  -6.735  1.00 21.26 ? 586 HOH B O   1 
HETATM 7765 O O   . HOH D 2 .   ? 40.452 8.457   -25.330 1.00 29.36 ? 587 HOH B O   1 
HETATM 7766 O O   . HOH D 2 .   ? 27.068 38.731  -8.866  1.00 21.63 ? 588 HOH B O   1 
HETATM 7767 O O   . HOH D 2 .   ? 26.562 19.477  -26.676 1.00 18.88 ? 589 HOH B O   1 
HETATM 7768 O O   . HOH D 2 .   ? 11.431 21.281  -30.303 1.00 36.70 ? 590 HOH B O   1 
HETATM 7769 O O   . HOH D 2 .   ? 33.785 37.644  -1.948  1.00 24.32 ? 591 HOH B O   1 
HETATM 7770 O O   . HOH D 2 .   ? 33.545 12.018  5.572   1.00 28.08 ? 592 HOH B O   1 
HETATM 7771 O O   . HOH D 2 .   ? 46.768 6.999   -9.472  1.00 35.06 ? 593 HOH B O   1 
HETATM 7772 O O   . HOH D 2 .   ? 21.969 27.569  -5.850  1.00 21.87 ? 594 HOH B O   1 
HETATM 7773 O O   . HOH D 2 .   ? 36.527 32.595  2.549   1.00 16.46 ? 595 HOH B O   1 
HETATM 7774 O O   . HOH D 2 .   ? 10.315 18.911  -18.050 1.00 20.44 ? 596 HOH B O   1 
HETATM 7775 O O   . HOH D 2 .   ? 26.295 5.466   0.991   1.00 26.48 ? 597 HOH B O   1 
HETATM 7776 O O   . HOH D 2 .   ? 39.396 41.216  0.181   1.00 23.76 ? 598 HOH B O   1 
HETATM 7777 O O   . HOH D 2 .   ? 42.453 35.959  -11.863 1.00 19.83 ? 599 HOH B O   1 
HETATM 7778 O O   . HOH D 2 .   ? 53.251 25.320  -17.643 1.00 21.74 ? 600 HOH B O   1 
HETATM 7779 O O   . HOH D 2 .   ? 33.715 16.892  7.405   1.00 24.98 ? 601 HOH B O   1 
HETATM 7780 O O   . HOH D 2 .   ? 13.119 35.740  1.626   1.00 32.26 ? 602 HOH B O   1 
HETATM 7781 O O   . HOH D 2 .   ? 20.652 43.705  -9.915  1.00 29.80 ? 603 HOH B O   1 
HETATM 7782 O O   . HOH D 2 .   ? 36.092 19.416  0.500   1.00 30.25 ? 604 HOH B O   1 
HETATM 7783 O O   . HOH D 2 .   ? 36.374 33.779  -17.425 1.00 30.94 ? 605 HOH B O   1 
HETATM 7784 O O   . HOH D 2 .   ? 13.499 6.974   -24.979 1.00 25.67 ? 606 HOH B O   1 
HETATM 7785 O O   . HOH D 2 .   ? 12.513 17.316  -18.924 1.00 24.76 ? 607 HOH B O   1 
HETATM 7786 O O   . HOH D 2 .   ? 8.752  14.299  -10.844 1.00 24.56 ? 608 HOH B O   1 
HETATM 7787 O O   . HOH D 2 .   ? 26.399 51.301  -7.174  1.00 39.41 ? 609 HOH B O   1 
HETATM 7788 O O   . HOH D 2 .   ? 14.866 25.704  -10.965 1.00 32.11 ? 610 HOH B O   1 
HETATM 7789 O O   . HOH D 2 .   ? 6.258  17.812  -12.790 1.00 28.13 ? 611 HOH B O   1 
HETATM 7790 O O   . HOH D 2 .   ? 30.543 43.945  -7.540  1.00 25.75 ? 612 HOH B O   1 
HETATM 7791 O O   . HOH D 2 .   ? 32.877 11.933  -14.187 1.00 25.74 ? 613 HOH B O   1 
HETATM 7792 O O   . HOH D 2 .   ? 36.955 39.077  7.154   1.00 27.01 ? 614 HOH B O   1 
HETATM 7793 O O   . HOH D 2 .   ? 45.976 2.633   -9.427  1.00 26.36 ? 615 HOH B O   1 
HETATM 7794 O O   . HOH D 2 .   ? 28.152 2.961   0.519   1.00 36.88 ? 616 HOH B O   1 
HETATM 7795 O O   . HOH D 2 .   ? 56.241 24.055  -14.673 1.00 31.39 ? 617 HOH B O   1 
HETATM 7796 O O   . HOH D 2 .   ? 29.815 45.953  -9.701  1.00 32.70 ? 618 HOH B O   1 
HETATM 7797 O O   . HOH D 2 .   ? 39.047 37.994  12.122  1.00 42.86 ? 619 HOH B O   1 
HETATM 7798 O O   . HOH D 2 .   ? 9.946  0.137   -18.083 1.00 40.10 ? 620 HOH B O   1 
HETATM 7799 O O   . HOH D 2 .   ? 54.650 23.430  -19.534 1.00 29.78 ? 621 HOH B O   1 
HETATM 7800 O O   . HOH D 2 .   ? 24.067 41.376  -10.486 1.00 32.59 ? 622 HOH B O   1 
HETATM 7801 O O   . HOH D 2 .   ? 37.374 5.228   -26.058 1.00 31.43 ? 623 HOH B O   1 
HETATM 7802 O O   . HOH D 2 .   ? 5.492  20.065  -8.090  1.00 47.38 ? 624 HOH B O   1 
HETATM 7803 O O   . HOH D 2 .   ? 14.935 30.586  -20.917 1.00 23.02 ? 625 HOH B O   1 
HETATM 7804 O O   . HOH D 2 .   ? 27.978 6.700   -29.299 1.00 36.69 ? 626 HOH B O   1 
HETATM 7805 O O   . HOH D 2 .   ? 23.078 17.953  -16.956 1.00 28.10 ? 627 HOH B O   1 
HETATM 7806 O O   . HOH D 2 .   ? 51.039 8.581   -14.300 1.00 41.64 ? 628 HOH B O   1 
HETATM 7807 O O   . HOH D 2 .   ? 40.711 37.584  -6.546  1.00 29.18 ? 629 HOH B O   1 
HETATM 7808 O O   . HOH D 2 .   ? 14.366 30.506  0.146   1.00 24.71 ? 630 HOH B O   1 
HETATM 7809 O O   . HOH D 2 .   ? 10.382 7.253   -10.221 1.00 32.32 ? 631 HOH B O   1 
HETATM 7810 O O   . HOH D 2 .   ? 24.147 6.317   -23.855 1.00 30.17 ? 632 HOH B O   1 
HETATM 7811 O O   . HOH D 2 .   ? 35.630 23.388  9.622   1.00 47.08 ? 633 HOH B O   1 
HETATM 7812 O O   . HOH D 2 .   ? 22.895 10.496  -25.677 1.00 22.67 ? 634 HOH B O   1 
HETATM 7813 O O   . HOH D 2 .   ? 14.311 19.201  -14.933 1.00 30.44 ? 635 HOH B O   1 
HETATM 7814 O O   . HOH D 2 .   ? 35.388 43.493  -13.590 1.00 33.11 ? 636 HOH B O   1 
HETATM 7815 O O   . HOH D 2 .   ? 49.009 15.625  -11.642 1.00 26.16 ? 637 HOH B O   1 
HETATM 7816 O O   . HOH D 2 .   ? 37.331 7.415   -24.342 1.00 27.33 ? 638 HOH B O   1 
HETATM 7817 O O   . HOH D 2 .   ? 29.955 6.976   3.620   1.00 37.33 ? 639 HOH B O   1 
HETATM 7818 O O   . HOH D 2 .   ? 26.422 43.397  -18.757 1.00 30.20 ? 640 HOH B O   1 
HETATM 7819 O O   . HOH D 2 .   ? 39.761 5.041   -3.120  1.00 25.29 ? 641 HOH B O   1 
HETATM 7820 O O   . HOH D 2 .   ? 33.019 13.630  -16.425 1.00 28.07 ? 642 HOH B O   1 
HETATM 7821 O O   . HOH D 2 .   ? 15.448 5.347   -33.911 1.00 29.49 ? 643 HOH B O   1 
HETATM 7822 O O   . HOH D 2 .   ? 28.098 20.561  -31.282 1.00 29.87 ? 644 HOH B O   1 
HETATM 7823 O O   . HOH D 2 .   ? 42.368 10.417  -0.670  1.00 31.54 ? 645 HOH B O   1 
HETATM 7824 O O   . HOH D 2 .   ? 39.705 8.116   1.310   1.00 48.06 ? 646 HOH B O   1 
HETATM 7825 O O   . HOH D 2 .   ? 41.282 29.180  4.753   1.00 29.09 ? 647 HOH B O   1 
HETATM 7826 O O   . HOH D 2 .   ? 15.759 24.340  -29.207 1.00 27.00 ? 648 HOH B O   1 
HETATM 7827 O O   . HOH D 2 .   ? 25.729 49.045  -5.331  1.00 35.14 ? 649 HOH B O   1 
HETATM 7828 O O   . HOH D 2 .   ? 35.132 1.726   -5.853  1.00 28.96 ? 650 HOH B O   1 
HETATM 7829 O O   . HOH D 2 .   ? 36.714 2.584   -7.868  1.00 25.47 ? 651 HOH B O   1 
HETATM 7830 O O   . HOH D 2 .   ? 21.871 8.121   -24.707 1.00 34.47 ? 652 HOH B O   1 
HETATM 7831 O O   . HOH D 2 .   ? 24.978 36.128  -28.878 1.00 29.93 ? 653 HOH B O   1 
HETATM 7832 O O   . HOH D 2 .   ? 15.307 17.897  -18.106 1.00 26.12 ? 654 HOH B O   1 
HETATM 7833 O O   . HOH D 2 .   ? 53.041 23.802  -25.485 1.00 30.78 ? 655 HOH B O   1 
HETATM 7834 O O   . HOH D 2 .   ? 15.676 27.156  -25.451 1.00 31.13 ? 656 HOH B O   1 
HETATM 7835 O O   . HOH D 2 .   ? 19.073 33.573  15.202  1.00 35.70 ? 657 HOH B O   1 
HETATM 7836 O O   . HOH D 2 .   ? 37.222 49.863  2.352   1.00 27.56 ? 658 HOH B O   1 
HETATM 7837 O O   . HOH D 2 .   ? 22.217 48.636  -2.718  1.00 30.51 ? 659 HOH B O   1 
HETATM 7838 O O   . HOH D 2 .   ? 26.336 6.740   -12.756 1.00 30.25 ? 660 HOH B O   1 
HETATM 7839 O O   . HOH D 2 .   ? 32.699 1.890   -30.754 1.00 26.83 ? 661 HOH B O   1 
HETATM 7840 O O   . HOH D 2 .   ? 25.531 16.298  -24.167 1.00 32.46 ? 662 HOH B O   1 
HETATM 7841 O O   . HOH D 2 .   ? 9.560  3.538   -23.257 1.00 27.88 ? 663 HOH B O   1 
HETATM 7842 O O   . HOH D 2 .   ? 46.651 32.751  -8.197  1.00 26.44 ? 664 HOH B O   1 
HETATM 7843 O O   . HOH D 2 .   ? 41.329 40.025  -5.735  1.00 38.87 ? 665 HOH B O   1 
HETATM 7844 O O   . HOH D 2 .   ? 19.894 18.849  11.484  1.00 29.64 ? 666 HOH B O   1 
HETATM 7845 O O   . HOH D 2 .   ? 67.070 12.554  -16.335 1.00 38.77 ? 667 HOH B O   1 
HETATM 7846 O O   . HOH D 2 .   ? 53.538 21.815  -21.415 1.00 28.20 ? 668 HOH B O   1 
HETATM 7847 O O   . HOH D 2 .   ? 19.936 22.815  9.423   1.00 33.20 ? 669 HOH B O   1 
HETATM 7848 O O   . HOH D 2 .   ? 47.547 33.727  -10.788 1.00 30.35 ? 670 HOH B O   1 
HETATM 7849 O O   . HOH D 2 .   ? 32.351 36.959  17.171  1.00 28.68 ? 671 HOH B O   1 
HETATM 7850 O O   . HOH D 2 .   ? 32.670 2.196   -3.170  1.00 37.76 ? 672 HOH B O   1 
HETATM 7851 O O   . HOH D 2 .   ? 56.223 26.947  -7.071  1.00 28.86 ? 673 HOH B O   1 
HETATM 7852 O O   . HOH D 2 .   ? 41.213 4.171   -25.244 1.00 35.35 ? 674 HOH B O   1 
HETATM 7853 O O   . HOH D 2 .   ? 34.495 44.337  -8.572  1.00 40.86 ? 675 HOH B O   1 
HETATM 7854 O O   . HOH D 2 .   ? 27.237 12.403  9.947   1.00 29.19 ? 676 HOH B O   1 
HETATM 7855 O O   . HOH D 2 .   ? 15.038 2.684   -4.446  1.00 45.55 ? 677 HOH B O   1 
HETATM 7856 O O   . HOH D 2 .   ? 43.277 3.258   -9.535  1.00 35.44 ? 678 HOH B O   1 
HETATM 7857 O O   . HOH D 2 .   ? 26.056 2.992   -11.137 1.00 37.47 ? 679 HOH B O   1 
HETATM 7858 O O   . HOH D 2 .   ? 10.104 32.951  -13.668 1.00 36.95 ? 680 HOH B O   1 
HETATM 7859 O O   . HOH D 2 .   ? 53.368 14.021  -11.873 1.00 36.69 ? 681 HOH B O   1 
HETATM 7860 O O   . HOH D 2 .   ? 41.565 1.669   -8.010  1.00 34.75 ? 682 HOH B O   1 
HETATM 7861 O O   . HOH D 2 .   ? 49.586 31.698  -20.388 1.00 27.26 ? 683 HOH B O   1 
HETATM 7862 O O   . HOH D 2 .   ? 38.490 25.599  8.359   1.00 33.99 ? 684 HOH B O   1 
HETATM 7863 O O   . HOH D 2 .   ? 23.079 43.335  -8.968  1.00 36.12 ? 685 HOH B O   1 
HETATM 7864 O O   . HOH D 2 .   ? 30.890 42.468  -18.954 1.00 34.95 ? 686 HOH B O   1 
HETATM 7865 O O   . HOH D 2 .   ? 8.194  26.095  -14.959 1.00 32.03 ? 687 HOH B O   1 
HETATM 7866 O O   . HOH D 2 .   ? 29.297 1.443   -7.075  1.00 41.90 ? 688 HOH B O   1 
HETATM 7867 O O   . HOH D 2 .   ? 10.125 26.938  7.256   1.00 47.65 ? 689 HOH B O   1 
HETATM 7868 O O   . HOH D 2 .   ? 20.148 42.131  13.922  1.00 34.95 ? 690 HOH B O   1 
HETATM 7869 O O   . HOH D 2 .   ? 25.781 41.383  10.075  1.00 28.24 ? 691 HOH B O   1 
HETATM 7870 O O   . HOH D 2 .   ? 13.840 38.040  3.419   1.00 28.28 ? 692 HOH B O   1 
HETATM 7871 O O   . HOH D 2 .   ? 11.707 12.966  -7.014  1.00 31.02 ? 693 HOH B O   1 
HETATM 7872 O O   . HOH D 2 .   ? 43.428 33.165  -18.823 1.00 31.29 ? 694 HOH B O   1 
HETATM 7873 O O   . HOH D 2 .   ? 31.064 48.456  10.999  1.00 41.26 ? 695 HOH B O   1 
HETATM 7874 O O   . HOH D 2 .   ? 23.722 2.831   -14.981 1.00 32.51 ? 696 HOH B O   1 
HETATM 7875 O O   . HOH D 2 .   ? 20.068 41.413  -11.264 1.00 25.04 ? 697 HOH B O   1 
HETATM 7876 O O   . HOH D 2 .   ? 38.155 41.931  6.238   1.00 28.44 ? 698 HOH B O   1 
HETATM 7877 O O   . HOH D 2 .   ? 41.088 19.937  -38.462 1.00 34.43 ? 699 HOH B O   1 
HETATM 7878 O O   . HOH D 2 .   ? 19.551 14.847  9.034   1.00 37.27 ? 700 HOH B O   1 
HETATM 7879 O O   . HOH D 2 .   ? 22.185 31.155  12.353  1.00 43.37 ? 701 HOH B O   1 
HETATM 7880 O O   . HOH D 2 .   ? 6.777  23.870  -17.425 1.00 36.46 ? 702 HOH B O   1 
HETATM 7881 O O   . HOH D 2 .   ? 26.250 3.233   -31.307 1.00 28.01 ? 703 HOH B O   1 
HETATM 7882 O O   . HOH D 2 .   ? 10.810 25.078  -21.336 1.00 34.62 ? 704 HOH B O   1 
HETATM 7883 O O   . HOH D 2 .   ? 22.484 -0.529  -7.993  1.00 30.94 ? 705 HOH B O   1 
HETATM 7884 O O   . HOH D 2 .   ? 7.717  -3.031  -17.003 1.00 33.35 ? 706 HOH B O   1 
HETATM 7885 O O   . HOH D 2 .   ? 24.406 15.735  -20.047 1.00 28.33 ? 707 HOH B O   1 
HETATM 7886 O O   . HOH D 2 .   ? 18.995 15.063  4.997   1.00 37.05 ? 708 HOH B O   1 
HETATM 7887 O O   . HOH D 2 .   ? 26.652 40.584  14.675  1.00 37.29 ? 709 HOH B O   1 
HETATM 7888 O O   . HOH D 2 .   ? 5.423  14.572  -24.981 1.00 39.59 ? 710 HOH B O   1 
HETATM 7889 O O   . HOH D 2 .   ? 36.960 15.823  -31.407 1.00 33.74 ? 711 HOH B O   1 
HETATM 7890 O O   . HOH D 2 .   ? 28.586 37.741  -31.941 1.00 42.37 ? 712 HOH B O   1 
HETATM 7891 O O   . HOH D 2 .   ? 15.575 9.469   -4.937  1.00 41.31 ? 713 HOH B O   1 
HETATM 7892 O O   . HOH D 2 .   ? 52.682 16.872  -26.835 1.00 36.92 ? 714 HOH B O   1 
HETATM 7893 O O   . HOH D 2 .   ? 12.128 14.682  1.725   1.00 38.18 ? 715 HOH B O   1 
HETATM 7894 O O   . HOH D 2 .   ? 10.898 4.343   -25.325 1.00 36.42 ? 716 HOH B O   1 
HETATM 7895 O O   . HOH D 2 .   ? 52.233 12.538  -10.032 1.00 41.51 ? 717 HOH B O   1 
HETATM 7896 O O   . HOH D 2 .   ? 52.700 35.232  -5.458  1.00 44.64 ? 718 HOH B O   1 
HETATM 7897 O O   . HOH D 2 .   ? 4.801  21.726  -1.827  1.00 40.89 ? 719 HOH B O   1 
HETATM 7898 O O   . HOH D 2 .   ? 48.568 33.973  -21.688 1.00 45.35 ? 720 HOH B O   1 
HETATM 7899 O O   . HOH D 2 .   ? 39.217 2.749   -6.984  1.00 34.57 ? 721 HOH B O   1 
HETATM 7900 O O   . HOH D 2 .   ? 55.286 28.041  -18.527 1.00 42.35 ? 722 HOH B O   1 
HETATM 7901 O O   . HOH D 2 .   ? 16.623 11.125  -2.956  1.00 44.05 ? 723 HOH B O   1 
HETATM 7902 O O   . HOH D 2 .   ? 22.269 -0.777  -2.823  1.00 35.26 ? 724 HOH B O   1 
HETATM 7903 O O   . HOH D 2 .   ? 27.223 39.071  19.324  1.00 45.65 ? 725 HOH B O   1 
HETATM 7904 O O   . HOH D 2 .   ? 31.842 39.469  -28.404 1.00 35.16 ? 726 HOH B O   1 
HETATM 7905 O O   . HOH D 2 .   ? 9.505  21.072  3.971   1.00 47.58 ? 727 HOH B O   1 
HETATM 7906 O O   . HOH D 2 .   ? 43.228 3.941   -23.682 1.00 46.94 ? 728 HOH B O   1 
HETATM 7907 O O   . HOH D 2 .   ? 37.513 6.181   -32.110 1.00 41.82 ? 729 HOH B O   1 
HETATM 7908 O O   . HOH D 2 .   ? 26.502 -0.739  -1.444  1.00 39.76 ? 730 HOH B O   1 
HETATM 7909 O O   . HOH D 2 .   ? 14.537 28.133  -4.145  1.00 35.77 ? 731 HOH B O   1 
HETATM 7910 O O   . HOH D 2 .   ? 28.989 -0.697  -9.614  1.00 42.55 ? 732 HOH B O   1 
HETATM 7911 O O   . HOH D 2 .   ? 20.947 3.604   0.546   1.00 40.29 ? 733 HOH B O   1 
HETATM 7912 O O   . HOH D 2 .   ? 35.412 12.503  -32.315 1.00 40.13 ? 734 HOH B O   1 
HETATM 7913 O O   . HOH D 2 .   ? 26.905 15.952  -21.426 1.00 35.68 ? 735 HOH B O   1 
HETATM 7914 O O   . HOH D 2 .   ? 32.645 15.900  -35.130 1.00 35.90 ? 736 HOH B O   1 
HETATM 7915 O O   . HOH D 2 .   ? 51.088 27.620  -30.695 1.00 43.61 ? 737 HOH B O   1 
HETATM 7916 O O   . HOH D 2 .   ? 37.852 5.654   -1.230  1.00 32.27 ? 738 HOH B O   1 
HETATM 7917 O O   . HOH D 2 .   ? 48.632 8.809   -12.232 1.00 43.49 ? 739 HOH B O   1 
HETATM 7918 O O   . HOH D 2 .   ? 34.940 33.557  16.530  1.00 40.95 ? 740 HOH B O   1 
HETATM 7919 O O   . HOH D 2 .   ? 16.834 39.222  7.570   1.00 42.08 ? 741 HOH B O   1 
HETATM 7920 O O   . HOH D 2 .   ? 55.195 19.651  -19.725 1.00 29.09 ? 742 HOH B O   1 
HETATM 7921 O O   . HOH D 2 .   ? 9.010  36.226  3.038   1.00 40.29 ? 743 HOH B O   1 
HETATM 7922 O O   . HOH D 2 .   ? 27.215 25.823  -31.042 1.00 46.94 ? 744 HOH B O   1 
HETATM 7923 O O   . HOH D 2 .   ? 54.049 16.131  -22.425 1.00 31.00 ? 745 HOH B O   1 
HETATM 7924 O O   . HOH D 2 .   ? 6.975  27.191  -11.327 1.00 37.34 ? 746 HOH B O   1 
HETATM 7925 O O   . HOH D 2 .   ? 19.672 47.323  -3.487  1.00 32.02 ? 747 HOH B O   1 
HETATM 7926 O O   . HOH D 2 .   ? 39.050 37.333  7.712   1.00 34.90 ? 748 HOH B O   1 
HETATM 7927 O O   . HOH D 2 .   ? 35.544 41.960  13.431  1.00 41.39 ? 749 HOH B O   1 
HETATM 7928 O O   . HOH D 2 .   ? 40.190 39.876  -10.790 1.00 39.52 ? 750 HOH B O   1 
HETATM 7929 O O   . HOH D 2 .   ? 45.473 7.574   -29.961 1.00 28.72 ? 751 HOH B O   1 
HETATM 7930 O O   . HOH D 2 .   ? 26.565 45.732  -15.705 1.00 43.58 ? 752 HOH B O   1 
HETATM 7931 O O   . HOH D 2 .   ? 14.745 40.573  4.961   1.00 33.87 ? 753 HOH B O   1 
HETATM 7932 O O   . HOH D 2 .   ? 37.671 42.208  -13.523 1.00 39.50 ? 754 HOH B O   1 
HETATM 7933 O O   . HOH D 2 .   ? 56.042 14.717  -11.515 1.00 38.07 ? 755 HOH B O   1 
HETATM 7934 O O   . HOH D 2 .   ? 37.824 17.746  5.522   1.00 38.74 ? 756 HOH B O   1 
HETATM 7935 O O   . HOH D 2 .   ? 12.983 5.241   -6.375  1.00 41.21 ? 757 HOH B O   1 
HETATM 7936 O O   . HOH D 2 .   ? 4.340  22.583  -20.838 1.00 42.70 ? 758 HOH B O   1 
HETATM 7937 O O   . HOH D 2 .   ? 46.472 34.334  -32.950 1.00 43.59 ? 759 HOH B O   1 
HETATM 7938 O O   . HOH D 2 .   ? 38.106 31.934  15.087  1.00 31.45 ? 760 HOH B O   1 
HETATM 7939 O O   . HOH D 2 .   ? 39.000 25.605  3.736   1.00 36.70 ? 761 HOH B O   1 
HETATM 7940 O O   . HOH D 2 .   ? 28.381 -6.678  -24.038 1.00 24.96 ? 762 HOH B O   1 
HETATM 7941 O O   . HOH D 2 .   ? 33.659 53.871  -4.586  1.00 44.96 ? 763 HOH B O   1 
HETATM 7942 O O   . HOH D 2 .   ? 54.367 27.907  -14.611 1.00 39.47 ? 764 HOH B O   1 
HETATM 7943 O O   . HOH D 2 .   ? 4.480  7.101   -20.279 1.00 29.64 ? 765 HOH B O   1 
HETATM 7944 O O   . HOH D 2 .   ? 43.679 27.188  0.600   1.00 34.74 ? 766 HOH B O   1 
HETATM 7945 O O   . HOH D 2 .   ? 15.763 44.143  7.829   1.00 31.62 ? 767 HOH B O   1 
HETATM 7946 O O   . HOH D 2 .   ? 36.451 20.175  4.332   1.00 41.64 ? 768 HOH B O   1 
HETATM 7947 O O   . HOH D 2 .   ? 50.968 19.694  -27.101 1.00 33.51 ? 769 HOH B O   1 
HETATM 7948 O O   . HOH D 2 .   ? 36.604 47.708  8.336   1.00 29.11 ? 770 HOH B O   1 
HETATM 7949 O O   . HOH D 2 .   ? 2.670  6.718   -14.833 1.00 43.04 ? 771 HOH B O   1 
HETATM 7950 O O   . HOH D 2 .   ? 37.461 23.491  3.948   1.00 43.23 ? 772 HOH B O   1 
HETATM 7951 O O   . HOH D 2 .   ? 24.387 55.777  -1.520  1.00 45.95 ? 773 HOH B O   1 
HETATM 7952 O O   . HOH D 2 .   ? 12.233 27.858  -22.834 1.00 37.24 ? 774 HOH B O   1 
HETATM 7953 O O   . HOH D 2 .   ? 6.998  6.720   -11.218 1.00 35.35 ? 775 HOH B O   1 
HETATM 7954 O O   . HOH D 2 .   ? 53.875 25.306  -15.005 1.00 33.25 ? 776 HOH B O   1 
HETATM 7955 O O   . HOH D 2 .   ? 27.851 -0.869  -4.037  1.00 41.91 ? 777 HOH B O   1 
HETATM 7956 O O   . HOH D 2 .   ? 13.459 13.452  -2.699  1.00 36.82 ? 778 HOH B O   1 
HETATM 7957 O O   . HOH D 2 .   ? 43.493 36.422  -7.710  1.00 34.90 ? 779 HOH B O   1 
HETATM 7958 O O   . HOH D 2 .   ? 24.346 12.646  3.110   1.00 29.64 ? 780 HOH B O   1 
HETATM 7959 O O   . HOH D 2 .   ? 62.049 10.942  -17.527 1.00 43.21 ? 781 HOH B O   1 
HETATM 7960 O O   . HOH D 2 .   ? 23.334 39.397  16.610  1.00 43.24 ? 782 HOH B O   1 
HETATM 7961 O O   . HOH D 2 .   ? 3.246  4.153   -18.826 1.00 42.31 ? 783 HOH B O   1 
HETATM 7962 O O   . HOH D 2 .   ? 25.885 48.096  -1.993  1.00 40.52 ? 784 HOH B O   1 
HETATM 7963 O O   . HOH D 2 .   ? 13.918 46.145  1.964   1.00 45.31 ? 785 HOH B O   1 
HETATM 7964 O O   . HOH D 2 .   ? 7.759  12.641  -6.459  1.00 41.76 ? 786 HOH B O   1 
HETATM 7965 O O   . HOH D 2 .   ? 35.953 2.284   -34.631 1.00 40.34 ? 787 HOH B O   1 
HETATM 7966 O O   . HOH D 2 .   ? 13.243 34.513  -21.072 1.00 44.74 ? 788 HOH B O   1 
HETATM 7967 O O   . HOH D 2 .   ? 9.730  23.253  -25.900 1.00 33.08 ? 789 HOH B O   1 
HETATM 7968 O O   . HOH D 2 .   ? 7.368  6.120   -26.177 1.00 48.08 ? 790 HOH B O   1 
HETATM 7969 O O   . HOH D 2 .   ? 14.896 -0.806  -30.919 1.00 37.02 ? 791 HOH B O   1 
HETATM 7970 O O   . HOH D 2 .   ? 15.393 -3.237  -17.291 1.00 45.03 ? 792 HOH B O   1 
HETATM 7971 O O   . HOH D 2 .   ? 24.722 24.442  11.923  1.00 41.73 ? 793 HOH B O   1 
HETATM 7972 O O   . HOH D 2 .   ? 4.682  10.701  -12.148 1.00 38.18 ? 794 HOH B O   1 
HETATM 7973 O O   . HOH D 2 .   ? 44.622 36.889  -10.132 1.00 43.91 ? 795 HOH B O   1 
HETATM 7974 O O   . HOH D 2 .   ? 3.521  3.986   -11.668 1.00 43.61 ? 796 HOH B O   1 
HETATM 7975 O O   . HOH D 2 .   ? 11.479 13.696  -9.971  1.00 31.11 ? 797 HOH B O   1 
HETATM 7976 O O   . HOH D 2 .   ? 51.102 7.400   -1.280  1.00 43.25 ? 798 HOH B O   1 
HETATM 7977 O O   . HOH D 2 .   ? 19.180 28.613  -23.546 1.00 36.62 ? 799 HOH B O   1 
HETATM 7978 O O   . HOH D 2 .   ? 37.208 22.659  -30.697 1.00 36.28 ? 800 HOH B O   1 
HETATM 7979 O O   . HOH D 2 .   ? 17.156 29.521  -25.374 1.00 43.79 ? 801 HOH B O   1 
HETATM 7980 O O   . HOH D 2 .   ? 31.420 13.156  7.288   1.00 41.20 ? 802 HOH B O   1 
HETATM 7981 O O   . HOH D 2 .   ? 23.838 16.241  -29.643 1.00 35.19 ? 803 HOH B O   1 
HETATM 7982 O O   . HOH D 2 .   ? 30.732 31.546  15.922  1.00 48.65 ? 804 HOH B O   1 
HETATM 7983 O O   . HOH D 2 .   ? 28.525 6.218   -32.054 1.00 47.73 ? 805 HOH B O   1 
HETATM 7984 O O   . HOH D 2 .   ? 33.868 31.942  -37.502 1.00 41.99 ? 806 HOH B O   1 
HETATM 7985 O O   . HOH D 2 .   ? 12.415 35.770  8.655   1.00 44.06 ? 807 HOH B O   1 
HETATM 7986 O O   . HOH D 2 .   ? 20.275 44.145  -22.105 1.00 38.02 ? 808 HOH B O   1 
HETATM 7987 O O   . HOH D 2 .   ? 4.827  10.715  -20.185 1.00 38.20 ? 809 HOH B O   1 
HETATM 7988 O O   . HOH D 2 .   ? 44.509 10.621  -33.133 1.00 37.12 ? 810 HOH B O   1 
HETATM 7989 O O   . HOH D 2 .   ? 20.240 8.805   0.755   1.00 47.19 ? 811 HOH B O   1 
HETATM 7990 O O   . HOH D 2 .   ? 16.514 25.687  15.949  1.00 42.91 ? 812 HOH B O   1 
HETATM 7991 O O   . HOH D 2 .   ? 29.132 42.217  -25.523 1.00 45.62 ? 813 HOH B O   1 
HETATM 7992 O O   . HOH D 2 .   ? 19.812 30.434  -25.543 1.00 44.05 ? 814 HOH B O   1 
HETATM 7993 O O   . HOH D 2 .   ? 21.487 -7.077  -28.603 1.00 34.78 ? 815 HOH B O   1 
HETATM 7994 O O   . HOH D 2 .   ? 23.197 19.758  -31.403 1.00 36.66 ? 816 HOH B O   1 
HETATM 7995 O O   . HOH D 2 .   ? 18.122 44.758  -7.349  1.00 47.58 ? 817 HOH B O   1 
HETATM 7996 O O   . HOH D 2 .   ? 6.688  4.166   -11.883 1.00 37.63 ? 818 HOH B O   1 
HETATM 7997 O O   . HOH D 2 .   ? 33.934 29.184  -37.290 1.00 39.88 ? 819 HOH B O   1 
HETATM 7998 O O   . HOH D 2 .   ? 13.467 7.325   -33.164 1.00 41.95 ? 820 HOH B O   1 
HETATM 7999 O O   . HOH D 2 .   ? 40.469 40.960  5.122   1.00 37.35 ? 821 HOH B O   1 
HETATM 8000 O O   . HOH D 2 .   ? 11.561 29.157  -6.651  1.00 36.55 ? 822 HOH B O   1 
HETATM 8001 O O   . HOH D 2 .   ? 38.021 26.811  11.562  1.00 40.07 ? 823 HOH B O   1 
HETATM 8002 O O   . HOH D 2 .   ? 5.215  21.740  -14.210 1.00 38.71 ? 824 HOH B O   1 
HETATM 8003 O O   . HOH D 2 .   ? 42.701 33.406  -7.064  1.00 28.46 ? 825 HOH B O   1 
HETATM 8004 O O   . HOH D 2 .   ? 38.591 45.674  8.922   1.00 48.66 ? 826 HOH B O   1 
HETATM 8005 O O   . HOH D 2 .   ? 37.889 35.698  15.492  1.00 39.85 ? 827 HOH B O   1 
HETATM 8006 O O   . HOH D 2 .   ? 7.230  5.141   -23.760 1.00 33.42 ? 828 HOH B O   1 
HETATM 8007 O O   . HOH D 2 .   ? 32.249 28.613  -33.700 1.00 35.98 ? 829 HOH B O   1 
HETATM 8008 O O   . HOH D 2 .   ? 8.761  30.414  -16.499 1.00 47.05 ? 830 HOH B O   1 
HETATM 8009 O O   . HOH D 2 .   ? 51.753 28.148  -26.019 1.00 47.33 ? 831 HOH B O   1 
HETATM 8010 O O   . HOH D 2 .   ? 12.192 0.347   -23.256 1.00 33.43 ? 832 HOH B O   1 
HETATM 8011 O O   . HOH D 2 .   ? 38.578 9.278   -30.832 1.00 45.69 ? 833 HOH B O   1 
HETATM 8012 O O   . HOH D 2 .   ? 42.547 19.430  -3.038  1.00 36.85 ? 834 HOH B O   1 
HETATM 8013 O O   . HOH D 2 .   ? 42.538 18.256  1.502   1.00 44.51 ? 835 HOH B O   1 
HETATM 8014 O O   . HOH D 2 .   ? 34.826 14.455  7.219   1.00 41.61 ? 836 HOH B O   1 
HETATM 8015 O O   . HOH D 2 .   ? 4.223  14.751  -18.435 1.00 39.55 ? 837 HOH B O   1 
HETATM 8016 O O   . HOH D 2 .   ? 18.444 -1.397  -33.256 1.00 37.33 ? 838 HOH B O   1 
HETATM 8017 O O   . HOH D 2 .   ? 18.787 -4.043  -15.137 1.00 43.40 ? 839 HOH B O   1 
HETATM 8018 O O   . HOH D 2 .   ? 48.129 15.781  -2.352  1.00 34.45 ? 840 HOH B O   1 
HETATM 8019 O O   . HOH D 2 .   ? 13.270 41.956  -4.012  1.00 34.25 ? 841 HOH B O   1 
HETATM 8020 O O   . HOH D 2 .   ? 40.479 15.857  -34.855 1.00 42.80 ? 842 HOH B O   1 
HETATM 8021 O O   . HOH D 2 .   ? 20.765 61.093  9.136   1.00 47.75 ? 843 HOH B O   1 
HETATM 8022 O O   . HOH D 2 .   ? 54.350 30.583  -15.174 1.00 40.76 ? 844 HOH B O   1 
HETATM 8023 O O   . HOH D 2 .   ? 42.633 6.316   -28.042 1.00 36.46 ? 845 HOH B O   1 
HETATM 8024 O O   . HOH D 2 .   ? 13.078 11.743  -33.494 1.00 38.31 ? 846 HOH B O   1 
HETATM 8025 O O   . HOH D 2 .   ? 21.493 13.054  -26.737 1.00 36.94 ? 847 HOH B O   1 
HETATM 8026 O O   . HOH D 2 .   ? 22.656 37.830  -27.822 1.00 40.77 ? 848 HOH B O   1 
HETATM 8027 O O   . HOH D 2 .   ? 18.292 0.498   -8.070  1.00 44.55 ? 849 HOH B O   1 
HETATM 8028 O O   . HOH D 2 .   ? 38.301 27.388  -37.349 1.00 45.29 ? 850 HOH B O   1 
HETATM 8029 O O   . HOH D 2 .   ? 41.055 38.586  1.852   1.00 43.16 ? 851 HOH B O   1 
HETATM 8030 O O   . HOH D 2 .   ? 22.810 5.288   -32.376 1.00 43.96 ? 852 HOH B O   1 
HETATM 8031 O O   . HOH D 2 .   ? 23.065 -9.055  -26.117 1.00 41.77 ? 853 HOH B O   1 
HETATM 8032 O O   . HOH D 2 .   ? 31.604 33.471  17.561  1.00 44.74 ? 854 HOH B O   1 
HETATM 8033 O O   . HOH D 2 .   ? 19.502 11.835  -1.599  1.00 47.37 ? 855 HOH B O   1 
HETATM 8034 O O   . HOH D 2 .   ? 64.451 11.847  -16.795 1.00 43.15 ? 856 HOH B O   1 
HETATM 8035 O O   . HOH D 2 .   ? 40.816 37.984  -12.727 1.00 40.20 ? 857 HOH B O   1 
HETATM 8036 O O   . HOH D 2 .   ? 15.678 15.503  3.153   1.00 45.86 ? 858 HOH B O   1 
HETATM 8037 O O   . HOH D 2 .   ? 47.227 14.911  -4.660  1.00 33.15 ? 859 HOH B O   1 
HETATM 8038 O O   . HOH D 2 .   ? 23.093 45.121  -20.820 1.00 43.10 ? 860 HOH B O   1 
HETATM 8039 O O   . HOH D 2 .   ? 12.576 -0.823  -11.160 1.00 43.24 ? 861 HOH B O   1 
HETATM 8040 O O   . HOH D 2 .   ? 19.524 -8.854  -29.269 1.00 42.89 ? 862 HOH B O   1 
HETATM 8041 O O   . HOH D 2 .   ? 35.590 -0.207  -14.250 1.00 38.33 ? 863 HOH B O   1 
HETATM 8042 O O   . HOH D 2 .   ? 22.352 1.338   -33.320 1.00 45.61 ? 864 HOH B O   1 
HETATM 8043 O O   . HOH D 2 .   ? 48.703 34.776  -14.282 1.00 36.57 ? 865 HOH B O   1 
HETATM 8044 O O   . HOH D 2 .   ? 27.700 61.097  3.615   1.00 35.61 ? 866 HOH B O   1 
HETATM 8045 O O   . HOH D 2 .   ? 53.497 13.308  -7.599  1.00 41.33 ? 867 HOH B O   1 
HETATM 8046 O O   . HOH D 2 .   ? 40.669 41.288  -26.645 1.00 48.70 ? 868 HOH B O   1 
HETATM 8047 O O   . HOH D 2 .   ? 8.985  29.366  -13.987 1.00 33.79 ? 869 HOH B O   1 
HETATM 8048 O O   . HOH D 2 .   ? 24.973 46.028  15.283  1.00 48.67 ? 870 HOH B O   1 
HETATM 8049 O O   . HOH D 2 .   ? 15.139 33.368  12.943  1.00 43.24 ? 871 HOH B O   1 
HETATM 8050 O O   . HOH D 2 .   ? 37.016 19.151  -36.610 1.00 37.35 ? 872 HOH B O   1 
HETATM 8051 O O   . HOH D 2 .   ? 34.324 42.621  -17.871 1.00 41.38 ? 873 HOH B O   1 
HETATM 8052 O O   . HOH D 2 .   ? 38.395 40.704  -21.898 1.00 47.24 ? 874 HOH B O   1 
HETATM 8053 O O   . HOH D 2 .   ? 42.821 29.359  -36.279 1.00 44.89 ? 875 HOH B O   1 
HETATM 8054 O O   . HOH D 2 .   ? 48.263 3.416   -10.871 1.00 36.27 ? 876 HOH B O   1 
HETATM 8055 O O   . HOH D 2 .   ? 47.811 35.625  -28.394 1.00 45.20 ? 877 HOH B O   1 
HETATM 8056 O O   . HOH D 2 .   ? 31.009 2.006   -0.912  1.00 36.75 ? 878 HOH B O   1 
HETATM 8057 O O   . HOH D 2 .   ? 41.312 42.952  3.189   1.00 38.66 ? 879 HOH B O   1 
HETATM 8058 O O   . HOH D 2 .   ? 64.094 12.064  -11.200 1.00 47.59 ? 880 HOH B O   1 
HETATM 8059 O O   . HOH D 2 .   ? 38.211 22.811  -38.716 1.00 38.53 ? 881 HOH B O   1 
HETATM 8060 O O   . HOH D 2 .   ? 32.949 42.026  -21.230 1.00 43.88 ? 882 HOH B O   1 
HETATM 8061 O O   . HOH D 2 .   ? 16.140 48.187  9.296   1.00 46.49 ? 883 HOH B O   1 
HETATM 8062 O O   . HOH D 2 .   ? 10.998 35.661  -19.265 1.00 48.83 ? 884 HOH B O   1 
HETATM 8063 O O   . HOH D 2 .   ? 47.616 20.757  -33.475 1.00 45.91 ? 885 HOH B O   1 
HETATM 8064 O O   . HOH D 2 .   ? 26.142 23.586  -32.334 1.00 47.94 ? 886 HOH B O   1 
HETATM 8065 O O   . HOH D 2 .   ? 50.429 34.081  -19.402 1.00 38.04 ? 887 HOH B O   1 
HETATM 8066 O O   . HOH D 2 .   ? 42.625 36.911  -33.011 1.00 39.29 ? 888 HOH B O   1 
HETATM 8067 O O   . HOH D 2 .   ? 56.758 6.704   -13.059 1.00 49.35 ? 889 HOH B O   1 
HETATM 8068 O O   . HOH D 2 .   ? 24.095 29.384  13.594  1.00 46.30 ? 890 HOH B O   1 
HETATM 8069 O O   . HOH D 2 .   ? 20.181 12.580  3.270   1.00 46.07 ? 891 HOH B O   1 
HETATM 8070 O O   . HOH D 2 .   ? 35.613 23.394  -32.712 1.00 39.86 ? 892 HOH B O   1 
HETATM 8071 O O   . HOH D 2 .   ? 60.071 18.134  -15.535 1.00 49.72 ? 893 HOH B O   1 
HETATM 8072 O O   . HOH D 2 .   ? 26.247 10.790  8.019   1.00 41.36 ? 894 HOH B O   1 
HETATM 8073 O O   . HOH D 2 .   ? 27.319 -0.962  -12.503 1.00 46.11 ? 895 HOH B O   1 
HETATM 8074 O O   . HOH D 2 .   ? 40.728 23.467  -39.415 1.00 41.06 ? 896 HOH B O   1 
HETATM 8075 O O   . HOH D 2 .   ? 39.404 6.988   -29.960 1.00 39.43 ? 897 HOH B O   1 
HETATM 8076 O O   . HOH D 2 .   ? 15.814 46.260  -14.671 1.00 39.62 ? 898 HOH B O   1 
HETATM 8077 O O   . HOH D 2 .   ? 39.894 49.583  3.343   1.00 41.61 ? 899 HOH B O   1 
HETATM 8078 O O   . HOH D 2 .   ? 25.599 4.798   -14.546 1.00 46.49 ? 900 HOH B O   1 
HETATM 8079 O O   . HOH D 2 .   ? 4.095  26.132  -4.505  1.00 37.29 ? 901 HOH B O   1 
HETATM 8080 O O   . HOH D 2 .   ? 24.665 26.757  13.265  1.00 40.09 ? 902 HOH B O   1 
HETATM 8081 O O   . HOH D 2 .   ? 37.027 1.208   -2.062  1.00 47.88 ? 903 HOH B O   1 
HETATM 8082 O O   . HOH D 2 .   ? 9.715  0.792   -22.466 1.00 47.79 ? 904 HOH B O   1 
HETATM 8083 O O   . HOH D 2 .   ? 17.116 51.340  6.505   1.00 38.82 ? 905 HOH B O   1 
HETATM 8084 O O   . HOH D 2 .   ? 7.899  24.832  0.991   1.00 47.27 ? 906 HOH B O   1 
HETATM 8085 O O   . HOH D 2 .   ? 21.618 12.706  -33.871 1.00 46.25 ? 907 HOH B O   1 
HETATM 8086 O O   . HOH D 2 .   ? 16.085 5.597   -4.095  1.00 34.13 ? 908 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   8   ?   ?   ?   A . n 
A 1 2   ILE 2   9   ?   ?   ?   A . n 
A 1 3   PRO 3   10  ?   ?   ?   A . n 
A 1 4   HIS 4   11  ?   ?   ?   A . n 
A 1 5   ILE 5   12  ?   ?   ?   A . n 
A 1 6   THR 6   13  ?   ?   ?   A . n 
A 1 7   SER 7   14  ?   ?   ?   A . n 
A 1 8   ASP 8   15  15  ASP ASP A . n 
A 1 9   ARG 9   16  16  ARG ARG A . n 
A 1 10  LEU 10  17  17  LEU LEU A . n 
A 1 11  LEU 11  18  18  LEU LEU A . n 
A 1 12  ILE 12  19  19  ILE ILE A . n 
A 1 13  ARG 13  20  20  ARG ARG A . n 
A 1 14  GLY 14  21  21  GLY GLY A . n 
A 1 15  GLY 15  22  22  GLY GLY A . n 
A 1 16  ARG 16  23  23  ARG ARG A . n 
A 1 17  ILE 17  24  24  ILE ILE A . n 
A 1 18  ILE 18  25  25  ILE ILE A . n 
A 1 19  ASN 19  26  26  ASN ASN A . n 
A 1 20  ASP 20  27  27  ASP ASP A . n 
A 1 21  ASP 21  28  28  ASP ASP A . n 
A 1 22  GLN 22  29  29  GLN GLN A . n 
A 1 23  SER 23  30  30  SER SER A . n 
A 1 24  PHE 24  31  31  PHE PHE A . n 
A 1 25  TYR 25  32  32  TYR TYR A . n 
A 1 26  ALA 26  33  33  ALA ALA A . n 
A 1 27  ASP 27  34  34  ASP ASP A . n 
A 1 28  VAL 28  35  35  VAL VAL A . n 
A 1 29  TYR 29  36  36  TYR TYR A . n 
A 1 30  LEU 30  37  37  LEU LEU A . n 
A 1 31  GLU 31  38  38  GLU GLU A . n 
A 1 32  ASP 32  39  39  ASP ASP A . n 
A 1 33  GLY 33  40  40  GLY GLY A . n 
A 1 34  LEU 34  41  41  LEU LEU A . n 
A 1 35  ILE 35  42  42  ILE ILE A . n 
A 1 36  LYS 36  43  43  LYS LYS A . n 
A 1 37  GLN 37  44  44  GLN GLN A . n 
A 1 38  ILE 38  45  45  ILE ILE A . n 
A 1 39  GLY 39  46  46  GLY GLY A . n 
A 1 40  GLU 40  47  47  GLU ALA A . n 
A 1 41  ASN 41  48  48  ASN ALA A . n 
A 1 42  LEU 42  49  49  LEU ALA A . n 
A 1 43  ILE 43  50  50  ILE ILE A . n 
A 1 44  VAL 44  51  51  VAL ALA A . n 
A 1 45  PRO 45  52  52  PRO PRO A . n 
A 1 46  GLY 46  53  53  GLY GLY A . n 
A 1 47  GLY 47  54  54  GLY GLY A . n 
A 1 48  VAL 48  55  55  VAL VAL A . n 
A 1 49  LYS 49  56  56  LYS LYS A . n 
A 1 50  THR 50  57  57  THR THR A . n 
A 1 51  ILE 51  58  58  ILE ILE A . n 
A 1 52  GLU 52  59  59  GLU GLU A . n 
A 1 53  ALA 53  60  60  ALA ALA A . n 
A 1 54  ASN 54  61  61  ASN ASN A . n 
A 1 55  GLY 55  62  62  GLY GLY A . n 
A 1 56  ARG 56  63  63  ARG ARG A . n 
A 1 57  MET 57  64  64  MET MET A . n 
A 1 58  VAL 58  65  65  VAL VAL A . n 
A 1 59  ILE 59  66  66  ILE ILE A . n 
A 1 60  PRO 60  67  67  PRO PRO A . n 
A 1 61  GLY 61  68  68  GLY GLY A . n 
A 1 62  GLY 62  69  69  GLY GLY A . n 
A 1 63  ILE 63  70  70  ILE ILE A . n 
A 1 64  ASP 64  71  71  ASP ASP A . n 
A 1 65  VAL 65  72  72  VAL VAL A . n 
A 1 66  ASN 66  73  73  ASN ASN A . n 
A 1 67  THR 67  74  74  THR THR A . n 
A 1 68  TYR 68  75  75  TYR TYR A . n 
A 1 69  LEU 69  76  76  LEU LEU A . n 
A 1 70  GLN 70  77  77  GLN GLN A . n 
A 1 71  LYS 71  78  78  LYS LYS A . n 
A 1 72  PRO 72  79  79  PRO PRO A . n 
A 1 73  SER 73  80  80  SER SER A . n 
A 1 74  GLN 74  81  81  GLN GLN A . n 
A 1 75  GLY 75  82  82  GLY GLY A . n 
A 1 76  MET 76  83  83  MET MET A . n 
A 1 77  THR 77  84  84  THR THR A . n 
A 1 78  SER 78  85  85  SER SER A . n 
A 1 79  ALA 79  86  86  ALA ALA A . n 
A 1 80  ASP 80  87  87  ASP ASP A . n 
A 1 81  ASP 81  88  88  ASP ASP A . n 
A 1 82  PHE 82  89  89  PHE PHE A . n 
A 1 83  PHE 83  90  90  PHE PHE A . n 
A 1 84  GLN 84  91  91  GLN GLN A . n 
A 1 85  GLY 85  92  92  GLY GLY A . n 
A 1 86  THR 86  93  93  THR THR A . n 
A 1 87  LYS 87  94  94  LYS LYS A . n 
A 1 88  ALA 88  95  95  ALA ALA A . n 
A 1 89  ALA 89  96  96  ALA ALA A . n 
A 1 90  LEU 90  97  97  LEU LEU A . n 
A 1 91  ALA 91  98  98  ALA ALA A . n 
A 1 92  GLY 92  99  99  GLY GLY A . n 
A 1 93  GLY 93  100 100 GLY GLY A . n 
A 1 94  THR 94  101 101 THR THR A . n 
A 1 95  THR 95  102 102 THR THR A . n 
A 1 96  MET 96  103 103 MET MET A . n 
A 1 97  ILE 97  104 104 ILE ILE A . n 
A 1 98  ILE 98  105 105 ILE ILE A . n 
A 1 99  ASP 99  106 106 ASP ASP A . n 
A 1 100 HIS 100 107 107 HIS HIS A . n 
A 1 101 VAL 101 108 108 VAL VAL A . n 
A 1 102 VAL 102 109 109 VAL VAL A . n 
A 1 103 PRO 103 110 110 PRO PRO A . n 
A 1 104 GLU 104 111 111 GLU GLU A . n 
A 1 105 PRO 105 112 112 PRO PRO A . n 
A 1 106 GLY 106 113 113 GLY GLY A . n 
A 1 107 SER 107 114 114 SER SER A . n 
A 1 108 SER 108 115 115 SER SER A . n 
A 1 109 LEU 109 116 116 LEU LEU A . n 
A 1 110 LEU 110 117 117 LEU LEU A . n 
A 1 111 THR 111 118 118 THR THR A . n 
A 1 112 SER 112 119 119 SER SER A . n 
A 1 113 PHE 113 120 120 PHE PHE A . n 
A 1 114 GLU 114 121 121 GLU GLU A . n 
A 1 115 LYS 115 122 122 LYS LYS A . n 
A 1 116 TRP 116 123 123 TRP TRP A . n 
A 1 117 HIS 117 124 124 HIS HIS A . n 
A 1 118 GLU 118 125 125 GLU GLU A . n 
A 1 119 ALA 119 126 126 ALA ALA A . n 
A 1 120 ALA 120 127 127 ALA ALA A . n 
A 1 121 ASP 121 128 128 ASP ASP A . n 
A 1 122 THR 122 129 129 THR THR A . n 
A 1 123 LYS 123 130 130 LYS LYS A . n 
A 1 124 SER 124 131 131 SER SER A . n 
A 1 125 CYS 125 132 132 CYS CYS A . n 
A 1 126 CYS 126 133 133 CYS CYS A . n 
A 1 127 ASP 127 134 134 ASP ASP A . n 
A 1 128 TYR 128 135 135 TYR TYR A . n 
A 1 129 SER 129 136 136 SER SER A . n 
A 1 130 LEU 130 137 137 LEU LEU A . n 
A 1 131 HIS 131 138 138 HIS HIS A . n 
A 1 132 VAL 132 139 139 VAL VAL A . n 
A 1 133 ASP 133 140 140 ASP ASP A . n 
A 1 134 ILE 134 141 141 ILE ILE A . n 
A 1 135 THR 135 142 142 THR THR A . n 
A 1 136 SER 136 143 143 SER SER A . n 
A 1 137 TRP 137 144 144 TRP TRP A . n 
A 1 138 TYR 138 145 145 TYR TYR A . n 
A 1 139 ASP 139 146 146 ASP ASP A . n 
A 1 140 GLY 140 147 147 GLY GLY A . n 
A 1 141 VAL 141 148 148 VAL VAL A . n 
A 1 142 ARG 142 149 149 ARG ARG A . n 
A 1 143 GLU 143 150 150 GLU GLU A . n 
A 1 144 GLU 144 151 151 GLU GLU A . n 
A 1 145 LEU 145 152 152 LEU LEU A . n 
A 1 146 GLU 146 153 153 GLU GLU A . n 
A 1 147 VAL 147 154 154 VAL VAL A . n 
A 1 148 LEU 148 155 155 LEU LEU A . n 
A 1 149 VAL 149 156 156 VAL VAL A . n 
A 1 150 GLN 150 157 157 GLN GLN A . n 
A 1 151 ASP 151 158 158 ASP ASP A . n 
A 1 152 LYS 152 159 159 LYS LYS A . n 
A 1 153 GLY 153 160 160 GLY GLY A . n 
A 1 154 VAL 154 161 161 VAL VAL A . n 
A 1 155 ASN 155 162 162 ASN ASN A . n 
A 1 156 SER 156 163 163 SER SER A . n 
A 1 157 PHE 157 164 164 PHE PHE A . n 
A 1 158 GLN 158 165 165 GLN GLN A . n 
A 1 159 VAL 159 166 166 VAL VAL A . n 
A 1 160 TYR 160 167 167 TYR TYR A . n 
A 1 161 MET 161 168 168 MET MET A . n 
A 1 162 ALA 162 169 169 ALA ALA A . n 
A 1 163 TYR 163 170 170 TYR TYR A . n 
A 1 164 LYS 164 171 171 LYS LYS A . n 
A 1 165 ASP 165 172 172 ASP ASP A . n 
A 1 166 LEU 166 173 173 LEU LEU A . n 
A 1 167 TYR 167 174 174 TYR TYR A . n 
A 1 168 GLN 168 175 175 GLN GLN A . n 
A 1 169 MET 169 176 176 MET MET A . n 
A 1 170 SER 170 177 177 SER SER A . n 
A 1 171 ASP 171 178 178 ASP ASP A . n 
A 1 172 SER 172 179 179 SER SER A . n 
A 1 173 GLN 173 180 180 GLN GLN A . n 
A 1 174 LEU 174 181 181 LEU LEU A . n 
A 1 175 TYR 175 182 182 TYR TYR A . n 
A 1 176 GLU 176 183 183 GLU GLU A . n 
A 1 177 ALA 177 184 184 ALA ALA A . n 
A 1 178 PHE 178 185 185 PHE PHE A . n 
A 1 179 THR 179 186 186 THR THR A . n 
A 1 180 PHE 180 187 187 PHE PHE A . n 
A 1 181 LEU 181 188 188 LEU LEU A . n 
A 1 182 LYS 182 189 189 LYS LYS A . n 
A 1 183 GLY 183 190 190 GLY GLY A . n 
A 1 184 LEU 184 191 191 LEU LEU A . n 
A 1 185 GLY 185 192 192 GLY GLY A . n 
A 1 186 ALA 186 193 193 ALA ALA A . n 
A 1 187 VAL 187 194 194 VAL VAL A . n 
A 1 188 ILE 188 195 195 ILE ILE A . n 
A 1 189 LEU 189 196 196 LEU LEU A . n 
A 1 190 VAL 190 197 197 VAL VAL A . n 
A 1 191 HIS 191 198 198 HIS HIS A . n 
A 1 192 ALA 192 199 199 ALA ALA A . n 
A 1 193 GLU 193 200 200 GLU GLU A . n 
A 1 194 ASN 194 201 201 ASN ASN A . n 
A 1 195 GLY 195 202 202 GLY GLY A . n 
A 1 196 ASP 196 203 203 ASP ASP A . n 
A 1 197 LEU 197 204 204 LEU LEU A . n 
A 1 198 ILE 198 205 205 ILE ILE A . n 
A 1 199 ALA 199 206 206 ALA ALA A . n 
A 1 200 GLN 200 207 207 GLN GLN A . n 
A 1 201 GLU 201 208 208 GLU GLU A . n 
A 1 202 GLN 202 209 209 GLN GLN A . n 
A 1 203 LYS 203 210 210 LYS LYS A . n 
A 1 204 ARG 204 211 211 ARG ARG A . n 
A 1 205 ILE 205 212 212 ILE ILE A . n 
A 1 206 LEU 206 213 213 LEU LEU A . n 
A 1 207 GLU 207 214 214 GLU GLU A . n 
A 1 208 MET 208 215 215 MET MET A . n 
A 1 209 GLY 209 216 216 GLY GLY A . n 
A 1 210 ILE 210 217 217 ILE ILE A . n 
A 1 211 THR 211 218 218 THR THR A . n 
A 1 212 GLY 212 219 219 GLY GLY A . n 
A 1 213 PRO 213 220 220 PRO PRO A . n 
A 1 214 GLU 214 221 221 GLU GLU A . n 
A 1 215 GLY 215 222 222 GLY GLY A . n 
A 1 216 HIS 216 223 223 HIS HIS A . n 
A 1 217 ALA 217 224 224 ALA ALA A . n 
A 1 218 LEU 218 225 225 LEU LEU A . n 
A 1 219 SER 219 226 226 SER SER A . n 
A 1 220 ARG 220 227 227 ARG ARG A . n 
A 1 221 PRO 221 228 228 PRO PRO A . n 
A 1 222 GLU 222 229 229 GLU GLU A . n 
A 1 223 GLU 223 230 230 GLU GLU A . n 
A 1 224 LEU 224 231 231 LEU LEU A . n 
A 1 225 GLU 225 232 232 GLU GLU A . n 
A 1 226 ALA 226 233 233 ALA ALA A . n 
A 1 227 GLU 227 234 234 GLU GLU A . n 
A 1 228 ALA 228 235 235 ALA ALA A . n 
A 1 229 VAL 229 236 236 VAL VAL A . n 
A 1 230 PHE 230 237 237 PHE PHE A . n 
A 1 231 ARG 231 238 238 ARG ARG A . n 
A 1 232 ALA 232 239 239 ALA ALA A . n 
A 1 233 ILE 233 240 240 ILE ILE A . n 
A 1 234 ALA 234 241 241 ALA ALA A . n 
A 1 235 ILE 235 242 242 ILE ILE A . n 
A 1 236 ALA 236 243 243 ALA ALA A . n 
A 1 237 GLY 237 244 244 GLY GLY A . n 
A 1 238 ARG 238 245 245 ARG ARG A . n 
A 1 239 ILE 239 246 246 ILE ILE A . n 
A 1 240 ASN 240 247 247 ASN ASN A . n 
A 1 241 CYS 241 248 248 CYS CYS A . n 
A 1 242 PRO 242 249 249 PRO PRO A . n 
A 1 243 VAL 243 250 250 VAL VAL A . n 
A 1 244 TYR 244 251 251 TYR TYR A . n 
A 1 245 ILE 245 252 252 ILE ILE A . n 
A 1 246 THR 246 253 253 THR THR A . n 
A 1 247 LYS 247 254 254 LYS LYS A . n 
A 1 248 VAL 248 255 255 VAL VAL A . n 
A 1 249 MET 249 256 256 MET MET A . n 
A 1 250 SER 250 257 257 SER SER A . n 
A 1 251 LYS 251 258 258 LYS LYS A . n 
A 1 252 SER 252 259 259 SER SER A . n 
A 1 253 ALA 253 260 260 ALA ALA A . n 
A 1 254 ALA 254 261 261 ALA ALA A . n 
A 1 255 ASP 255 262 262 ASP ASP A . n 
A 1 256 ILE 256 263 263 ILE ILE A . n 
A 1 257 ILE 257 264 264 ILE ILE A . n 
A 1 258 ALA 258 265 265 ALA ALA A . n 
A 1 259 LEU 259 266 266 LEU LEU A . n 
A 1 260 ALA 260 267 267 ALA ALA A . n 
A 1 261 ARG 261 268 268 ARG ARG A . n 
A 1 262 LYS 262 269 269 LYS LYS A . n 
A 1 263 LYS 263 270 270 LYS LYS A . n 
A 1 264 GLY 264 271 271 GLY GLY A . n 
A 1 265 PRO 265 272 272 PRO PRO A . n 
A 1 266 LEU 266 273 273 LEU LEU A . n 
A 1 267 VAL 267 274 274 VAL VAL A . n 
A 1 268 PHE 268 275 275 PHE PHE A . n 
A 1 269 GLY 269 276 276 GLY GLY A . n 
A 1 270 GLU 270 277 277 GLU GLU A . n 
A 1 271 PRO 271 278 278 PRO PRO A . n 
A 1 272 ILE 272 279 279 ILE ILE A . n 
A 1 273 ALA 273 280 280 ALA ALA A . n 
A 1 274 ALA 274 281 281 ALA ALA A . n 
A 1 275 SER 275 282 282 SER SER A . n 
A 1 276 LEU 276 283 283 LEU LEU A . n 
A 1 277 GLY 277 284 284 GLY GLY A . n 
A 1 278 THR 278 285 285 THR THR A . n 
A 1 279 ASP 279 286 286 ASP ASP A . n 
A 1 280 GLY 280 287 287 GLY GLY A . n 
A 1 281 THR 281 288 288 THR THR A . n 
A 1 282 HIS 282 289 289 HIS HIS A . n 
A 1 283 TYR 283 290 290 TYR TYR A . n 
A 1 284 TRP 284 291 291 TRP TRP A . n 
A 1 285 SER 285 292 292 SER SER A . n 
A 1 286 LYS 286 293 293 LYS LYS A . n 
A 1 287 ASN 287 294 294 ASN ASN A . n 
A 1 288 TRP 288 295 295 TRP TRP A . n 
A 1 289 ALA 289 296 296 ALA ALA A . n 
A 1 290 LYS 290 297 297 LYS LYS A . n 
A 1 291 ALA 291 298 298 ALA ALA A . n 
A 1 292 ALA 292 299 299 ALA ALA A . n 
A 1 293 ALA 293 300 300 ALA ALA A . n 
A 1 294 PHE 294 301 301 PHE PHE A . n 
A 1 295 VAL 295 302 302 VAL VAL A . n 
A 1 296 THR 296 303 303 THR THR A . n 
A 1 297 SER 297 304 304 SER SER A . n 
A 1 298 PRO 298 305 305 PRO PRO A . n 
A 1 299 PRO 299 306 306 PRO PRO A . n 
A 1 300 LEU 300 307 307 LEU LEU A . n 
A 1 301 SER 301 308 308 SER SER A . n 
A 1 302 PRO 302 309 309 PRO PRO A . n 
A 1 303 ASP 303 310 310 ASP ASP A . n 
A 1 304 PRO 304 311 311 PRO PRO A . n 
A 1 305 THR 305 312 312 THR THR A . n 
A 1 306 THR 306 313 313 THR THR A . n 
A 1 307 PRO 307 314 314 PRO PRO A . n 
A 1 308 ASP 308 315 315 ASP ASP A . n 
A 1 309 TYR 309 316 316 TYR TYR A . n 
A 1 310 LEU 310 317 317 LEU LEU A . n 
A 1 311 THR 311 318 318 THR THR A . n 
A 1 312 SER 312 319 319 SER SER A . n 
A 1 313 LEU 313 320 320 LEU LEU A . n 
A 1 314 LEU 314 321 321 LEU LEU A . n 
A 1 315 ALA 315 322 322 ALA ALA A . n 
A 1 316 CYS 316 323 323 CYS CYS A . n 
A 1 317 GLY 317 324 324 GLY GLY A . n 
A 1 318 ASP 318 325 325 ASP ASP A . n 
A 1 319 LEU 319 326 326 LEU LEU A . n 
A 1 320 GLN 320 327 327 GLN GLN A . n 
A 1 321 VAL 321 328 328 VAL VAL A . n 
A 1 322 THR 322 329 329 THR THR A . n 
A 1 323 GLY 323 330 330 GLY GLY A . n 
A 1 324 SER 324 331 331 SER SER A . n 
A 1 325 GLY 325 332 332 GLY GLY A . n 
A 1 326 HIS 326 333 333 HIS HIS A . n 
A 1 327 CYS 327 334 334 CYS CYS A . n 
A 1 328 PRO 328 335 335 PRO PRO A . n 
A 1 329 TYR 329 336 336 TYR TYR A . n 
A 1 330 SER 330 337 337 SER SER A . n 
A 1 331 THR 331 338 338 THR THR A . n 
A 1 332 ALA 332 339 339 ALA ALA A . n 
A 1 333 GLN 333 340 340 GLN GLN A . n 
A 1 334 LYS 334 341 341 LYS LYS A . n 
A 1 335 ALA 335 342 342 ALA ALA A . n 
A 1 336 VAL 336 343 343 VAL ALA A . n 
A 1 337 GLY 337 344 344 GLY ALA A . n 
A 1 338 LYS 338 345 345 LYS LYS A . n 
A 1 339 ASP 339 346 346 ASP ASP A . n 
A 1 340 ASN 340 347 347 ASN ASN A . n 
A 1 341 PHE 341 348 348 PHE PHE A . n 
A 1 342 THR 342 349 349 THR THR A . n 
A 1 343 LEU 343 350 350 LEU LEU A . n 
A 1 344 ILE 344 351 351 ILE ILE A . n 
A 1 345 PRO 345 352 352 PRO PRO A . n 
A 1 346 GLU 346 353 353 GLU GLU A . n 
A 1 347 GLY 347 354 354 GLY GLY A . n 
A 1 348 VAL 348 355 355 VAL VAL A . n 
A 1 349 ASN 349 356 356 ASN ASN A . n 
A 1 350 GLY 350 357 357 GLY GLY A . n 
A 1 351 ILE 351 358 358 ILE ILE A . n 
A 1 352 GLU 352 359 359 GLU GLU A . n 
A 1 353 GLU 353 360 360 GLU GLU A . n 
A 1 354 ARG 354 361 361 ARG ARG A . n 
A 1 355 MET 355 362 362 MET MET A . n 
A 1 356 THR 356 363 363 THR THR A . n 
A 1 357 VAL 357 364 364 VAL VAL A . n 
A 1 358 VAL 358 365 365 VAL VAL A . n 
A 1 359 TRP 359 366 366 TRP TRP A . n 
A 1 360 ASP 360 367 367 ASP ASP A . n 
A 1 361 LYS 361 368 368 LYS LYS A . n 
A 1 362 ALA 362 369 369 ALA ALA A . n 
A 1 363 VAL 363 370 370 VAL VAL A . n 
A 1 364 ALA 364 371 371 ALA ALA A . n 
A 1 365 THR 365 372 372 THR THR A . n 
A 1 366 GLY 366 373 373 GLY GLY A . n 
A 1 367 LYS 367 374 374 LYS LYS A . n 
A 1 368 MET 368 375 375 MET MET A . n 
A 1 369 ASP 369 376 376 ASP ASP A . n 
A 1 370 GLU 370 377 377 GLU GLU A . n 
A 1 371 ASN 371 378 378 ASN ASN A . n 
A 1 372 GLN 372 379 379 GLN GLN A . n 
A 1 373 PHE 373 380 380 PHE PHE A . n 
A 1 374 VAL 374 381 381 VAL VAL A . n 
A 1 375 ALA 375 382 382 ALA ALA A . n 
A 1 376 VAL 376 383 383 VAL VAL A . n 
A 1 377 THR 377 384 384 THR THR A . n 
A 1 378 SER 378 385 385 SER SER A . n 
A 1 379 THR 379 386 386 THR THR A . n 
A 1 380 ASN 380 387 387 ASN ASN A . n 
A 1 381 ALA 381 388 388 ALA ALA A . n 
A 1 382 ALA 382 389 389 ALA ALA A . n 
A 1 383 LYS 383 390 390 LYS LYS A . n 
A 1 384 ILE 384 391 391 ILE ILE A . n 
A 1 385 PHE 385 392 392 PHE PHE A . n 
A 1 386 ASN 386 393 393 ASN ASN A . n 
A 1 387 LEU 387 394 394 LEU LEU A . n 
A 1 388 TYR 388 395 395 TYR TYR A . n 
A 1 389 PRO 389 396 396 PRO PRO A . n 
A 1 390 ARG 390 397 397 ARG ARG A . n 
A 1 391 LYS 391 398 398 LYS LYS A . n 
A 1 392 GLY 392 399 399 GLY GLY A . n 
A 1 393 ARG 393 400 400 ARG ARG A . n 
A 1 394 ILE 394 401 401 ILE ILE A . n 
A 1 395 ALA 395 402 402 ALA ALA A . n 
A 1 396 VAL 396 403 403 VAL VAL A . n 
A 1 397 GLY 397 404 404 GLY GLY A . n 
A 1 398 SER 398 405 405 SER SER A . n 
A 1 399 ASP 399 406 406 ASP ASP A . n 
A 1 400 ALA 400 407 407 ALA ALA A . n 
A 1 401 ASP 401 408 408 ASP ASP A . n 
A 1 402 VAL 402 409 409 VAL VAL A . n 
A 1 403 VAL 403 410 410 VAL VAL A . n 
A 1 404 ILE 404 411 411 ILE ILE A . n 
A 1 405 TRP 405 412 412 TRP TRP A . n 
A 1 406 ASP 406 413 413 ASP ASP A . n 
A 1 407 PRO 407 414 414 PRO PRO A . n 
A 1 408 ASP 408 415 415 ASP ASP A . n 
A 1 409 LYS 409 416 416 LYS LYS A . n 
A 1 410 MET 410 417 417 MET MET A . n 
A 1 411 LYS 411 418 418 LYS LYS A . n 
A 1 412 THR 412 419 419 THR THR A . n 
A 1 413 ILE 413 420 420 ILE ILE A . n 
A 1 414 THR 414 421 421 THR THR A . n 
A 1 415 ALA 415 422 422 ALA ALA A . n 
A 1 416 LYS 416 423 423 LYS LYS A . n 
A 1 417 SER 417 424 424 SER SER A . n 
A 1 418 HIS 418 425 425 HIS HIS A . n 
A 1 419 LYS 419 426 426 LYS LYS A . n 
A 1 420 SER 420 427 427 SER SER A . n 
A 1 421 THR 421 428 428 THR THR A . n 
A 1 422 VAL 422 429 429 VAL VAL A . n 
A 1 423 GLU 423 430 430 GLU GLU A . n 
A 1 424 TYR 424 431 431 TYR TYR A . n 
A 1 425 ASN 425 432 432 ASN ASN A . n 
A 1 426 ILE 426 433 433 ILE ILE A . n 
A 1 427 PHE 427 434 434 PHE PHE A . n 
A 1 428 GLU 428 435 435 GLU GLU A . n 
A 1 429 GLY 429 436 436 GLY GLY A . n 
A 1 430 MET 430 437 437 MET MET A . n 
A 1 431 GLU 431 438 438 GLU GLU A . n 
A 1 432 CYS 432 439 439 CYS CYS A . n 
A 1 433 HIS 433 440 440 HIS HIS A . n 
A 1 434 GLY 434 441 441 GLY GLY A . n 
A 1 435 SER 435 442 442 SER SER A . n 
A 1 436 PRO 436 443 443 PRO PRO A . n 
A 1 437 LEU 437 444 444 LEU LEU A . n 
A 1 438 VAL 438 445 445 VAL VAL A . n 
A 1 439 VAL 439 446 446 VAL VAL A . n 
A 1 440 ILE 440 447 447 ILE ILE A . n 
A 1 441 SER 441 448 448 SER SER A . n 
A 1 442 GLN 442 449 449 GLN GLN A . n 
A 1 443 GLY 443 450 450 GLY GLY A . n 
A 1 444 LYS 444 451 451 LYS LYS A . n 
A 1 445 ILE 445 452 452 ILE ILE A . n 
A 1 446 VAL 446 453 453 VAL VAL A . n 
A 1 447 PHE 447 454 454 PHE PHE A . n 
A 1 448 GLU 448 455 455 GLU GLU A . n 
A 1 449 ASP 449 456 456 ASP ASP A . n 
A 1 450 GLY 450 457 457 GLY GLY A . n 
A 1 451 ASN 451 458 458 ASN ASN A . n 
A 1 452 ILE 452 459 459 ILE ILE A . n 
A 1 453 SER 453 460 460 SER SER A . n 
A 1 454 VAL 454 461 461 VAL VAL A . n 
A 1 455 SER 455 462 462 SER SER A . n 
A 1 456 LYS 456 463 463 LYS LYS A . n 
A 1 457 GLY 457 464 464 GLY GLY A . n 
A 1 458 MET 458 465 465 MET MET A . n 
A 1 459 GLY 459 466 466 GLY GLY A . n 
A 1 460 ARG 460 467 467 ARG ARG A . n 
A 1 461 PHE 461 468 468 PHE PHE A . n 
A 1 462 ILE 462 469 469 ILE ILE A . n 
A 1 463 PRO 463 470 470 PRO PRO A . n 
A 1 464 ARG 464 471 471 ARG ARG A . n 
A 1 465 LYS 465 472 472 LYS LYS A . n 
A 1 466 PRO 466 473 473 PRO PRO A . n 
A 1 467 PHE 467 474 474 PHE PHE A . n 
A 1 468 PRO 468 475 475 PRO PRO A . n 
A 1 469 GLU 469 476 476 GLU GLU A . n 
A 1 470 HIS 470 477 477 HIS HIS A . n 
A 1 471 LEU 471 478 478 LEU LEU A . n 
A 1 472 TYR 472 479 479 TYR TYR A . n 
A 1 473 GLN 473 480 480 GLN GLN A . n 
A 1 474 ARG 474 481 481 ARG ARG A . n 
A 1 475 VAL 475 482 482 VAL VAL A . n 
A 1 476 ARG 476 483 483 ARG ARG A . n 
A 1 477 ILE 477 484 484 ILE ILE A . n 
A 1 478 ARG 478 485 485 ARG ARG A . n 
A 1 479 SER 479 486 486 SER SER A . n 
A 1 480 LYS 480 487 487 LYS LYS A . n 
A 1 481 VAL 481 488 488 VAL VAL A . n 
A 1 482 PHE 482 489 489 PHE PHE A . n 
A 1 483 GLY 483 490 490 GLY GLY A . n 
A 1 484 LEU 484 491 ?   ?   ?   A . n 
A 1 485 HIS 485 492 ?   ?   ?   A . n 
A 1 486 SER 486 493 ?   ?   ?   A . n 
A 1 487 VAL 487 494 ?   ?   ?   A . n 
A 1 488 SER 488 495 ?   ?   ?   A . n 
A 1 489 ARG 489 496 ?   ?   ?   A . n 
A 1 490 GLY 490 497 ?   ?   ?   A . n 
A 1 491 MET 491 498 ?   ?   ?   A . n 
A 1 492 TYR 492 499 ?   ?   ?   A . n 
A 1 493 ASP 493 500 ?   ?   ?   A . n 
A 1 494 GLY 494 501 ?   ?   ?   A . n 
A 1 495 PRO 495 502 ?   ?   ?   A . n 
A 1 496 VAL 496 503 ?   ?   ?   A . n 
A 1 497 TYR 497 504 ?   ?   ?   A . n 
A 1 498 GLU 498 505 ?   ?   ?   A . n 
A 1 499 VAL 499 506 ?   ?   ?   A . n 
A 1 500 PRO 500 507 ?   ?   ?   A . n 
A 1 501 ALA 501 508 ?   ?   ?   A . n 
A 1 502 THR 502 509 ?   ?   ?   A . n 
A 1 503 PRO 503 510 ?   ?   ?   A . n 
A 1 504 LYS 504 511 ?   ?   ?   A . n 
A 1 505 HIS 505 512 ?   ?   ?   A . n 
A 1 506 ALA 506 513 ?   ?   ?   A . n 
A 1 507 ALA 507 514 ?   ?   ?   A . n 
A 1 508 PRO 508 515 ?   ?   ?   A . n 
A 1 509 ALA 509 516 ?   ?   ?   A . n 
A 1 510 PRO 510 517 ?   ?   ?   A . n 
A 1 511 SER 511 518 ?   ?   ?   A . n 
A 1 512 ALA 512 519 ?   ?   ?   A . n 
A 1 513 LYS 513 520 ?   ?   ?   A . n 
A 1 514 SER 514 521 ?   ?   ?   A . n 
A 1 515 SER 515 522 ?   ?   ?   A . n 
A 1 516 PRO 516 523 ?   ?   ?   A . n 
A 1 517 SER 517 524 ?   ?   ?   A . n 
A 1 518 LYS 518 525 ?   ?   ?   A . n 
B 1 1   SER 1   8   ?   ?   ?   B . n 
B 1 2   ILE 2   9   ?   ?   ?   B . n 
B 1 3   PRO 3   10  ?   ?   ?   B . n 
B 1 4   HIS 4   11  ?   ?   ?   B . n 
B 1 5   ILE 5   12  ?   ?   ?   B . n 
B 1 6   THR 6   13  ?   ?   ?   B . n 
B 1 7   SER 7   14  ?   ?   ?   B . n 
B 1 8   ASP 8   15  15  ASP ASP B . n 
B 1 9   ARG 9   16  16  ARG ARG B . n 
B 1 10  LEU 10  17  17  LEU LEU B . n 
B 1 11  LEU 11  18  18  LEU LEU B . n 
B 1 12  ILE 12  19  19  ILE ILE B . n 
B 1 13  ARG 13  20  20  ARG ARG B . n 
B 1 14  GLY 14  21  21  GLY GLY B . n 
B 1 15  GLY 15  22  22  GLY GLY B . n 
B 1 16  ARG 16  23  23  ARG ARG B . n 
B 1 17  ILE 17  24  24  ILE ILE B . n 
B 1 18  ILE 18  25  25  ILE ILE B . n 
B 1 19  ASN 19  26  26  ASN ASN B . n 
B 1 20  ASP 20  27  27  ASP ASP B . n 
B 1 21  ASP 21  28  28  ASP ASP B . n 
B 1 22  GLN 22  29  29  GLN GLN B . n 
B 1 23  SER 23  30  30  SER SER B . n 
B 1 24  PHE 24  31  31  PHE PHE B . n 
B 1 25  TYR 25  32  32  TYR TYR B . n 
B 1 26  ALA 26  33  33  ALA ALA B . n 
B 1 27  ASP 27  34  34  ASP ASP B . n 
B 1 28  VAL 28  35  35  VAL VAL B . n 
B 1 29  TYR 29  36  36  TYR TYR B . n 
B 1 30  LEU 30  37  37  LEU LEU B . n 
B 1 31  GLU 31  38  38  GLU GLU B . n 
B 1 32  ASP 32  39  39  ASP ASP B . n 
B 1 33  GLY 33  40  40  GLY GLY B . n 
B 1 34  LEU 34  41  41  LEU LEU B . n 
B 1 35  ILE 35  42  42  ILE ILE B . n 
B 1 36  LYS 36  43  43  LYS LYS B . n 
B 1 37  GLN 37  44  44  GLN GLN B . n 
B 1 38  ILE 38  45  45  ILE ILE B . n 
B 1 39  GLY 39  46  46  GLY GLY B . n 
B 1 40  GLU 40  47  47  GLU ALA B . n 
B 1 41  ASN 41  48  48  ASN ALA B . n 
B 1 42  LEU 42  49  49  LEU ALA B . n 
B 1 43  ILE 43  50  50  ILE ILE B . n 
B 1 44  VAL 44  51  51  VAL ALA B . n 
B 1 45  PRO 45  52  52  PRO PRO B . n 
B 1 46  GLY 46  53  53  GLY GLY B . n 
B 1 47  GLY 47  54  54  GLY GLY B . n 
B 1 48  VAL 48  55  55  VAL VAL B . n 
B 1 49  LYS 49  56  56  LYS LYS B . n 
B 1 50  THR 50  57  57  THR THR B . n 
B 1 51  ILE 51  58  58  ILE ILE B . n 
B 1 52  GLU 52  59  59  GLU GLU B . n 
B 1 53  ALA 53  60  60  ALA ALA B . n 
B 1 54  ASN 54  61  61  ASN ASN B . n 
B 1 55  GLY 55  62  62  GLY GLY B . n 
B 1 56  ARG 56  63  63  ARG ARG B . n 
B 1 57  MET 57  64  64  MET MET B . n 
B 1 58  VAL 58  65  65  VAL VAL B . n 
B 1 59  ILE 59  66  66  ILE ILE B . n 
B 1 60  PRO 60  67  67  PRO PRO B . n 
B 1 61  GLY 61  68  68  GLY GLY B . n 
B 1 62  GLY 62  69  69  GLY GLY B . n 
B 1 63  ILE 63  70  70  ILE ILE B . n 
B 1 64  ASP 64  71  71  ASP ASP B . n 
B 1 65  VAL 65  72  72  VAL VAL B . n 
B 1 66  ASN 66  73  73  ASN ASN B . n 
B 1 67  THR 67  74  74  THR THR B . n 
B 1 68  TYR 68  75  75  TYR TYR B . n 
B 1 69  LEU 69  76  76  LEU LEU B . n 
B 1 70  GLN 70  77  77  GLN GLN B . n 
B 1 71  LYS 71  78  78  LYS LYS B . n 
B 1 72  PRO 72  79  79  PRO PRO B . n 
B 1 73  SER 73  80  80  SER SER B . n 
B 1 74  GLN 74  81  81  GLN GLN B . n 
B 1 75  GLY 75  82  82  GLY GLY B . n 
B 1 76  MET 76  83  83  MET MET B . n 
B 1 77  THR 77  84  84  THR THR B . n 
B 1 78  SER 78  85  85  SER SER B . n 
B 1 79  ALA 79  86  86  ALA ALA B . n 
B 1 80  ASP 80  87  87  ASP ASP B . n 
B 1 81  ASP 81  88  88  ASP ASP B . n 
B 1 82  PHE 82  89  89  PHE PHE B . n 
B 1 83  PHE 83  90  90  PHE PHE B . n 
B 1 84  GLN 84  91  91  GLN GLN B . n 
B 1 85  GLY 85  92  92  GLY GLY B . n 
B 1 86  THR 86  93  93  THR THR B . n 
B 1 87  LYS 87  94  94  LYS LYS B . n 
B 1 88  ALA 88  95  95  ALA ALA B . n 
B 1 89  ALA 89  96  96  ALA ALA B . n 
B 1 90  LEU 90  97  97  LEU LEU B . n 
B 1 91  ALA 91  98  98  ALA ALA B . n 
B 1 92  GLY 92  99  99  GLY GLY B . n 
B 1 93  GLY 93  100 100 GLY GLY B . n 
B 1 94  THR 94  101 101 THR THR B . n 
B 1 95  THR 95  102 102 THR THR B . n 
B 1 96  MET 96  103 103 MET MET B . n 
B 1 97  ILE 97  104 104 ILE ILE B . n 
B 1 98  ILE 98  105 105 ILE ILE B . n 
B 1 99  ASP 99  106 106 ASP ASP B . n 
B 1 100 HIS 100 107 107 HIS HIS B . n 
B 1 101 VAL 101 108 108 VAL VAL B . n 
B 1 102 VAL 102 109 109 VAL VAL B . n 
B 1 103 PRO 103 110 110 PRO PRO B . n 
B 1 104 GLU 104 111 111 GLU GLU B . n 
B 1 105 PRO 105 112 112 PRO PRO B . n 
B 1 106 GLY 106 113 113 GLY GLY B . n 
B 1 107 SER 107 114 114 SER SER B . n 
B 1 108 SER 108 115 115 SER SER B . n 
B 1 109 LEU 109 116 116 LEU LEU B . n 
B 1 110 LEU 110 117 117 LEU LEU B . n 
B 1 111 THR 111 118 118 THR THR B . n 
B 1 112 SER 112 119 119 SER SER B . n 
B 1 113 PHE 113 120 120 PHE PHE B . n 
B 1 114 GLU 114 121 121 GLU GLU B . n 
B 1 115 LYS 115 122 122 LYS LYS B . n 
B 1 116 TRP 116 123 123 TRP TRP B . n 
B 1 117 HIS 117 124 124 HIS HIS B . n 
B 1 118 GLU 118 125 125 GLU GLU B . n 
B 1 119 ALA 119 126 126 ALA ALA B . n 
B 1 120 ALA 120 127 127 ALA ALA B . n 
B 1 121 ASP 121 128 128 ASP ASP B . n 
B 1 122 THR 122 129 129 THR THR B . n 
B 1 123 LYS 123 130 130 LYS LYS B . n 
B 1 124 SER 124 131 131 SER SER B . n 
B 1 125 CYS 125 132 132 CYS CYS B . n 
B 1 126 CYS 126 133 133 CYS CYS B . n 
B 1 127 ASP 127 134 134 ASP ASP B . n 
B 1 128 TYR 128 135 135 TYR TYR B . n 
B 1 129 SER 129 136 136 SER SER B . n 
B 1 130 LEU 130 137 137 LEU LEU B . n 
B 1 131 HIS 131 138 138 HIS HIS B . n 
B 1 132 VAL 132 139 139 VAL VAL B . n 
B 1 133 ASP 133 140 140 ASP ASP B . n 
B 1 134 ILE 134 141 141 ILE ILE B . n 
B 1 135 THR 135 142 142 THR THR B . n 
B 1 136 SER 136 143 143 SER SER B . n 
B 1 137 TRP 137 144 144 TRP TRP B . n 
B 1 138 TYR 138 145 145 TYR TYR B . n 
B 1 139 ASP 139 146 146 ASP ASP B . n 
B 1 140 GLY 140 147 147 GLY GLY B . n 
B 1 141 VAL 141 148 148 VAL VAL B . n 
B 1 142 ARG 142 149 149 ARG ARG B . n 
B 1 143 GLU 143 150 150 GLU GLU B . n 
B 1 144 GLU 144 151 151 GLU GLU B . n 
B 1 145 LEU 145 152 152 LEU LEU B . n 
B 1 146 GLU 146 153 153 GLU GLU B . n 
B 1 147 VAL 147 154 154 VAL VAL B . n 
B 1 148 LEU 148 155 155 LEU LEU B . n 
B 1 149 VAL 149 156 156 VAL VAL B . n 
B 1 150 GLN 150 157 157 GLN GLN B . n 
B 1 151 ASP 151 158 158 ASP ASP B . n 
B 1 152 LYS 152 159 159 LYS LYS B . n 
B 1 153 GLY 153 160 160 GLY GLY B . n 
B 1 154 VAL 154 161 161 VAL VAL B . n 
B 1 155 ASN 155 162 162 ASN ASN B . n 
B 1 156 SER 156 163 163 SER SER B . n 
B 1 157 PHE 157 164 164 PHE PHE B . n 
B 1 158 GLN 158 165 165 GLN GLN B . n 
B 1 159 VAL 159 166 166 VAL VAL B . n 
B 1 160 TYR 160 167 167 TYR TYR B . n 
B 1 161 MET 161 168 168 MET MET B . n 
B 1 162 ALA 162 169 169 ALA ALA B . n 
B 1 163 TYR 163 170 170 TYR TYR B . n 
B 1 164 LYS 164 171 171 LYS LYS B . n 
B 1 165 ASP 165 172 172 ASP ASP B . n 
B 1 166 LEU 166 173 173 LEU LEU B . n 
B 1 167 TYR 167 174 174 TYR TYR B . n 
B 1 168 GLN 168 175 175 GLN GLN B . n 
B 1 169 MET 169 176 176 MET MET B . n 
B 1 170 SER 170 177 177 SER SER B . n 
B 1 171 ASP 171 178 178 ASP ASP B . n 
B 1 172 SER 172 179 179 SER SER B . n 
B 1 173 GLN 173 180 180 GLN GLN B . n 
B 1 174 LEU 174 181 181 LEU LEU B . n 
B 1 175 TYR 175 182 182 TYR TYR B . n 
B 1 176 GLU 176 183 183 GLU GLU B . n 
B 1 177 ALA 177 184 184 ALA ALA B . n 
B 1 178 PHE 178 185 185 PHE PHE B . n 
B 1 179 THR 179 186 186 THR THR B . n 
B 1 180 PHE 180 187 187 PHE PHE B . n 
B 1 181 LEU 181 188 188 LEU LEU B . n 
B 1 182 LYS 182 189 189 LYS LYS B . n 
B 1 183 GLY 183 190 190 GLY GLY B . n 
B 1 184 LEU 184 191 191 LEU LEU B . n 
B 1 185 GLY 185 192 192 GLY GLY B . n 
B 1 186 ALA 186 193 193 ALA ALA B . n 
B 1 187 VAL 187 194 194 VAL VAL B . n 
B 1 188 ILE 188 195 195 ILE ILE B . n 
B 1 189 LEU 189 196 196 LEU LEU B . n 
B 1 190 VAL 190 197 197 VAL VAL B . n 
B 1 191 HIS 191 198 198 HIS HIS B . n 
B 1 192 ALA 192 199 199 ALA ALA B . n 
B 1 193 GLU 193 200 200 GLU GLU B . n 
B 1 194 ASN 194 201 201 ASN ASN B . n 
B 1 195 GLY 195 202 202 GLY GLY B . n 
B 1 196 ASP 196 203 203 ASP ASP B . n 
B 1 197 LEU 197 204 204 LEU LEU B . n 
B 1 198 ILE 198 205 205 ILE ILE B . n 
B 1 199 ALA 199 206 206 ALA ALA B . n 
B 1 200 GLN 200 207 207 GLN GLN B . n 
B 1 201 GLU 201 208 208 GLU GLU B . n 
B 1 202 GLN 202 209 209 GLN GLN B . n 
B 1 203 LYS 203 210 210 LYS LYS B . n 
B 1 204 ARG 204 211 211 ARG ARG B . n 
B 1 205 ILE 205 212 212 ILE ILE B . n 
B 1 206 LEU 206 213 213 LEU LEU B . n 
B 1 207 GLU 207 214 214 GLU GLU B . n 
B 1 208 MET 208 215 215 MET MET B . n 
B 1 209 GLY 209 216 216 GLY GLY B . n 
B 1 210 ILE 210 217 217 ILE ILE B . n 
B 1 211 THR 211 218 218 THR THR B . n 
B 1 212 GLY 212 219 219 GLY GLY B . n 
B 1 213 PRO 213 220 220 PRO PRO B . n 
B 1 214 GLU 214 221 221 GLU GLU B . n 
B 1 215 GLY 215 222 222 GLY GLY B . n 
B 1 216 HIS 216 223 223 HIS HIS B . n 
B 1 217 ALA 217 224 224 ALA ALA B . n 
B 1 218 LEU 218 225 225 LEU LEU B . n 
B 1 219 SER 219 226 226 SER SER B . n 
B 1 220 ARG 220 227 227 ARG ARG B . n 
B 1 221 PRO 221 228 228 PRO PRO B . n 
B 1 222 GLU 222 229 229 GLU GLU B . n 
B 1 223 GLU 223 230 230 GLU GLU B . n 
B 1 224 LEU 224 231 231 LEU LEU B . n 
B 1 225 GLU 225 232 232 GLU GLU B . n 
B 1 226 ALA 226 233 233 ALA ALA B . n 
B 1 227 GLU 227 234 234 GLU GLU B . n 
B 1 228 ALA 228 235 235 ALA ALA B . n 
B 1 229 VAL 229 236 236 VAL VAL B . n 
B 1 230 PHE 230 237 237 PHE PHE B . n 
B 1 231 ARG 231 238 238 ARG ARG B . n 
B 1 232 ALA 232 239 239 ALA ALA B . n 
B 1 233 ILE 233 240 240 ILE ILE B . n 
B 1 234 ALA 234 241 241 ALA ALA B . n 
B 1 235 ILE 235 242 242 ILE ILE B . n 
B 1 236 ALA 236 243 243 ALA ALA B . n 
B 1 237 GLY 237 244 244 GLY GLY B . n 
B 1 238 ARG 238 245 245 ARG ARG B . n 
B 1 239 ILE 239 246 246 ILE ILE B . n 
B 1 240 ASN 240 247 247 ASN ASN B . n 
B 1 241 CYS 241 248 248 CYS CYS B . n 
B 1 242 PRO 242 249 249 PRO PRO B . n 
B 1 243 VAL 243 250 250 VAL VAL B . n 
B 1 244 TYR 244 251 251 TYR TYR B . n 
B 1 245 ILE 245 252 252 ILE ILE B . n 
B 1 246 THR 246 253 253 THR THR B . n 
B 1 247 LYS 247 254 254 LYS LYS B . n 
B 1 248 VAL 248 255 255 VAL VAL B . n 
B 1 249 MET 249 256 256 MET MET B . n 
B 1 250 SER 250 257 257 SER SER B . n 
B 1 251 LYS 251 258 258 LYS LYS B . n 
B 1 252 SER 252 259 259 SER SER B . n 
B 1 253 ALA 253 260 260 ALA ALA B . n 
B 1 254 ALA 254 261 261 ALA ALA B . n 
B 1 255 ASP 255 262 262 ASP ASP B . n 
B 1 256 ILE 256 263 263 ILE ILE B . n 
B 1 257 ILE 257 264 264 ILE ILE B . n 
B 1 258 ALA 258 265 265 ALA ALA B . n 
B 1 259 LEU 259 266 266 LEU LEU B . n 
B 1 260 ALA 260 267 267 ALA ALA B . n 
B 1 261 ARG 261 268 268 ARG ARG B . n 
B 1 262 LYS 262 269 269 LYS LYS B . n 
B 1 263 LYS 263 270 270 LYS LYS B . n 
B 1 264 GLY 264 271 271 GLY GLY B . n 
B 1 265 PRO 265 272 272 PRO PRO B . n 
B 1 266 LEU 266 273 273 LEU LEU B . n 
B 1 267 VAL 267 274 274 VAL VAL B . n 
B 1 268 PHE 268 275 275 PHE PHE B . n 
B 1 269 GLY 269 276 276 GLY GLY B . n 
B 1 270 GLU 270 277 277 GLU GLU B . n 
B 1 271 PRO 271 278 278 PRO PRO B . n 
B 1 272 ILE 272 279 279 ILE ILE B . n 
B 1 273 ALA 273 280 280 ALA ALA B . n 
B 1 274 ALA 274 281 281 ALA ALA B . n 
B 1 275 SER 275 282 282 SER SER B . n 
B 1 276 LEU 276 283 283 LEU LEU B . n 
B 1 277 GLY 277 284 284 GLY GLY B . n 
B 1 278 THR 278 285 285 THR THR B . n 
B 1 279 ASP 279 286 286 ASP ASP B . n 
B 1 280 GLY 280 287 287 GLY GLY B . n 
B 1 281 THR 281 288 288 THR THR B . n 
B 1 282 HIS 282 289 289 HIS HIS B . n 
B 1 283 TYR 283 290 290 TYR TYR B . n 
B 1 284 TRP 284 291 291 TRP TRP B . n 
B 1 285 SER 285 292 292 SER SER B . n 
B 1 286 LYS 286 293 293 LYS LYS B . n 
B 1 287 ASN 287 294 294 ASN ASN B . n 
B 1 288 TRP 288 295 295 TRP TRP B . n 
B 1 289 ALA 289 296 296 ALA ALA B . n 
B 1 290 LYS 290 297 297 LYS LYS B . n 
B 1 291 ALA 291 298 298 ALA ALA B . n 
B 1 292 ALA 292 299 299 ALA ALA B . n 
B 1 293 ALA 293 300 300 ALA ALA B . n 
B 1 294 PHE 294 301 301 PHE PHE B . n 
B 1 295 VAL 295 302 302 VAL VAL B . n 
B 1 296 THR 296 303 303 THR THR B . n 
B 1 297 SER 297 304 304 SER SER B . n 
B 1 298 PRO 298 305 305 PRO PRO B . n 
B 1 299 PRO 299 306 306 PRO PRO B . n 
B 1 300 LEU 300 307 307 LEU LEU B . n 
B 1 301 SER 301 308 308 SER SER B . n 
B 1 302 PRO 302 309 309 PRO PRO B . n 
B 1 303 ASP 303 310 310 ASP ASP B . n 
B 1 304 PRO 304 311 311 PRO PRO B . n 
B 1 305 THR 305 312 312 THR THR B . n 
B 1 306 THR 306 313 313 THR THR B . n 
B 1 307 PRO 307 314 314 PRO PRO B . n 
B 1 308 ASP 308 315 315 ASP ASP B . n 
B 1 309 TYR 309 316 316 TYR TYR B . n 
B 1 310 LEU 310 317 317 LEU LEU B . n 
B 1 311 THR 311 318 318 THR THR B . n 
B 1 312 SER 312 319 319 SER SER B . n 
B 1 313 LEU 313 320 320 LEU LEU B . n 
B 1 314 LEU 314 321 321 LEU LEU B . n 
B 1 315 ALA 315 322 322 ALA ALA B . n 
B 1 316 CYS 316 323 323 CYS CYS B . n 
B 1 317 GLY 317 324 324 GLY GLY B . n 
B 1 318 ASP 318 325 325 ASP ASP B . n 
B 1 319 LEU 319 326 326 LEU LEU B . n 
B 1 320 GLN 320 327 327 GLN GLN B . n 
B 1 321 VAL 321 328 328 VAL VAL B . n 
B 1 322 THR 322 329 329 THR THR B . n 
B 1 323 GLY 323 330 330 GLY GLY B . n 
B 1 324 SER 324 331 331 SER SER B . n 
B 1 325 GLY 325 332 332 GLY GLY B . n 
B 1 326 HIS 326 333 333 HIS HIS B . n 
B 1 327 CYS 327 334 334 CYS CYS B . n 
B 1 328 PRO 328 335 335 PRO PRO B . n 
B 1 329 TYR 329 336 336 TYR TYR B . n 
B 1 330 SER 330 337 337 SER SER B . n 
B 1 331 THR 331 338 338 THR THR B . n 
B 1 332 ALA 332 339 339 ALA ALA B . n 
B 1 333 GLN 333 340 340 GLN GLN B . n 
B 1 334 LYS 334 341 341 LYS LYS B . n 
B 1 335 ALA 335 342 342 ALA ALA B . n 
B 1 336 VAL 336 343 343 VAL ALA B . n 
B 1 337 GLY 337 344 344 GLY ALA B . n 
B 1 338 LYS 338 345 345 LYS LYS B . n 
B 1 339 ASP 339 346 346 ASP ASP B . n 
B 1 340 ASN 340 347 347 ASN ASN B . n 
B 1 341 PHE 341 348 348 PHE PHE B . n 
B 1 342 THR 342 349 349 THR THR B . n 
B 1 343 LEU 343 350 350 LEU LEU B . n 
B 1 344 ILE 344 351 351 ILE ILE B . n 
B 1 345 PRO 345 352 352 PRO PRO B . n 
B 1 346 GLU 346 353 353 GLU GLU B . n 
B 1 347 GLY 347 354 354 GLY GLY B . n 
B 1 348 VAL 348 355 355 VAL VAL B . n 
B 1 349 ASN 349 356 356 ASN ASN B . n 
B 1 350 GLY 350 357 357 GLY GLY B . n 
B 1 351 ILE 351 358 358 ILE ILE B . n 
B 1 352 GLU 352 359 359 GLU GLU B . n 
B 1 353 GLU 353 360 360 GLU GLU B . n 
B 1 354 ARG 354 361 361 ARG ARG B . n 
B 1 355 MET 355 362 362 MET MET B . n 
B 1 356 THR 356 363 363 THR THR B . n 
B 1 357 VAL 357 364 364 VAL VAL B . n 
B 1 358 VAL 358 365 365 VAL VAL B . n 
B 1 359 TRP 359 366 366 TRP TRP B . n 
B 1 360 ASP 360 367 367 ASP ASP B . n 
B 1 361 LYS 361 368 368 LYS LYS B . n 
B 1 362 ALA 362 369 369 ALA ALA B . n 
B 1 363 VAL 363 370 370 VAL VAL B . n 
B 1 364 ALA 364 371 371 ALA ALA B . n 
B 1 365 THR 365 372 372 THR THR B . n 
B 1 366 GLY 366 373 373 GLY GLY B . n 
B 1 367 LYS 367 374 374 LYS LYS B . n 
B 1 368 MET 368 375 375 MET MET B . n 
B 1 369 ASP 369 376 376 ASP ASP B . n 
B 1 370 GLU 370 377 377 GLU GLU B . n 
B 1 371 ASN 371 378 378 ASN ASN B . n 
B 1 372 GLN 372 379 379 GLN GLN B . n 
B 1 373 PHE 373 380 380 PHE PHE B . n 
B 1 374 VAL 374 381 381 VAL VAL B . n 
B 1 375 ALA 375 382 382 ALA ALA B . n 
B 1 376 VAL 376 383 383 VAL VAL B . n 
B 1 377 THR 377 384 384 THR THR B . n 
B 1 378 SER 378 385 385 SER SER B . n 
B 1 379 THR 379 386 386 THR THR B . n 
B 1 380 ASN 380 387 387 ASN ASN B . n 
B 1 381 ALA 381 388 388 ALA ALA B . n 
B 1 382 ALA 382 389 389 ALA ALA B . n 
B 1 383 LYS 383 390 390 LYS LYS B . n 
B 1 384 ILE 384 391 391 ILE ILE B . n 
B 1 385 PHE 385 392 392 PHE PHE B . n 
B 1 386 ASN 386 393 393 ASN ASN B . n 
B 1 387 LEU 387 394 394 LEU LEU B . n 
B 1 388 TYR 388 395 395 TYR TYR B . n 
B 1 389 PRO 389 396 396 PRO PRO B . n 
B 1 390 ARG 390 397 397 ARG ARG B . n 
B 1 391 LYS 391 398 398 LYS LYS B . n 
B 1 392 GLY 392 399 399 GLY GLY B . n 
B 1 393 ARG 393 400 400 ARG ARG B . n 
B 1 394 ILE 394 401 401 ILE ILE B . n 
B 1 395 ALA 395 402 402 ALA ALA B . n 
B 1 396 VAL 396 403 403 VAL VAL B . n 
B 1 397 GLY 397 404 404 GLY GLY B . n 
B 1 398 SER 398 405 405 SER SER B . n 
B 1 399 ASP 399 406 406 ASP ASP B . n 
B 1 400 ALA 400 407 407 ALA ALA B . n 
B 1 401 ASP 401 408 408 ASP ASP B . n 
B 1 402 VAL 402 409 409 VAL VAL B . n 
B 1 403 VAL 403 410 410 VAL VAL B . n 
B 1 404 ILE 404 411 411 ILE ILE B . n 
B 1 405 TRP 405 412 412 TRP TRP B . n 
B 1 406 ASP 406 413 413 ASP ASP B . n 
B 1 407 PRO 407 414 414 PRO PRO B . n 
B 1 408 ASP 408 415 415 ASP ASP B . n 
B 1 409 LYS 409 416 416 LYS LYS B . n 
B 1 410 MET 410 417 417 MET MET B . n 
B 1 411 LYS 411 418 418 LYS LYS B . n 
B 1 412 THR 412 419 419 THR THR B . n 
B 1 413 ILE 413 420 420 ILE ILE B . n 
B 1 414 THR 414 421 421 THR THR B . n 
B 1 415 ALA 415 422 422 ALA ALA B . n 
B 1 416 LYS 416 423 423 LYS LYS B . n 
B 1 417 SER 417 424 424 SER SER B . n 
B 1 418 HIS 418 425 425 HIS HIS B . n 
B 1 419 LYS 419 426 426 LYS LYS B . n 
B 1 420 SER 420 427 427 SER SER B . n 
B 1 421 THR 421 428 428 THR THR B . n 
B 1 422 VAL 422 429 429 VAL VAL B . n 
B 1 423 GLU 423 430 430 GLU GLU B . n 
B 1 424 TYR 424 431 431 TYR TYR B . n 
B 1 425 ASN 425 432 432 ASN ASN B . n 
B 1 426 ILE 426 433 433 ILE ILE B . n 
B 1 427 PHE 427 434 434 PHE PHE B . n 
B 1 428 GLU 428 435 435 GLU GLU B . n 
B 1 429 GLY 429 436 436 GLY GLY B . n 
B 1 430 MET 430 437 437 MET MET B . n 
B 1 431 GLU 431 438 438 GLU GLU B . n 
B 1 432 CYS 432 439 439 CYS CYS B . n 
B 1 433 HIS 433 440 440 HIS HIS B . n 
B 1 434 GLY 434 441 441 GLY GLY B . n 
B 1 435 SER 435 442 442 SER SER B . n 
B 1 436 PRO 436 443 443 PRO PRO B . n 
B 1 437 LEU 437 444 444 LEU LEU B . n 
B 1 438 VAL 438 445 445 VAL VAL B . n 
B 1 439 VAL 439 446 446 VAL VAL B . n 
B 1 440 ILE 440 447 447 ILE ILE B . n 
B 1 441 SER 441 448 448 SER SER B . n 
B 1 442 GLN 442 449 449 GLN GLN B . n 
B 1 443 GLY 443 450 450 GLY GLY B . n 
B 1 444 LYS 444 451 451 LYS LYS B . n 
B 1 445 ILE 445 452 452 ILE ILE B . n 
B 1 446 VAL 446 453 453 VAL VAL B . n 
B 1 447 PHE 447 454 454 PHE PHE B . n 
B 1 448 GLU 448 455 455 GLU GLU B . n 
B 1 449 ASP 449 456 456 ASP ASP B . n 
B 1 450 GLY 450 457 457 GLY GLY B . n 
B 1 451 ASN 451 458 458 ASN ASN B . n 
B 1 452 ILE 452 459 459 ILE ILE B . n 
B 1 453 SER 453 460 460 SER SER B . n 
B 1 454 VAL 454 461 461 VAL VAL B . n 
B 1 455 SER 455 462 462 SER SER B . n 
B 1 456 LYS 456 463 463 LYS LYS B . n 
B 1 457 GLY 457 464 464 GLY GLY B . n 
B 1 458 MET 458 465 465 MET MET B . n 
B 1 459 GLY 459 466 466 GLY GLY B . n 
B 1 460 ARG 460 467 467 ARG ARG B . n 
B 1 461 PHE 461 468 468 PHE PHE B . n 
B 1 462 ILE 462 469 469 ILE ILE B . n 
B 1 463 PRO 463 470 470 PRO PRO B . n 
B 1 464 ARG 464 471 471 ARG ARG B . n 
B 1 465 LYS 465 472 472 LYS LYS B . n 
B 1 466 PRO 466 473 473 PRO PRO B . n 
B 1 467 PHE 467 474 474 PHE PHE B . n 
B 1 468 PRO 468 475 475 PRO PRO B . n 
B 1 469 GLU 469 476 476 GLU GLU B . n 
B 1 470 HIS 470 477 477 HIS HIS B . n 
B 1 471 LEU 471 478 478 LEU LEU B . n 
B 1 472 TYR 472 479 479 TYR TYR B . n 
B 1 473 GLN 473 480 480 GLN GLN B . n 
B 1 474 ARG 474 481 481 ARG ARG B . n 
B 1 475 VAL 475 482 482 VAL VAL B . n 
B 1 476 ARG 476 483 483 ARG ARG B . n 
B 1 477 ILE 477 484 484 ILE ILE B . n 
B 1 478 ARG 478 485 485 ARG ARG B . n 
B 1 479 SER 479 486 486 SER SER B . n 
B 1 480 LYS 480 487 487 LYS LYS B . n 
B 1 481 VAL 481 488 488 VAL VAL B . n 
B 1 482 PHE 482 489 489 PHE PHE B . n 
B 1 483 GLY 483 490 490 GLY GLY B . n 
B 1 484 LEU 484 491 ?   ?   ?   B . n 
B 1 485 HIS 485 492 ?   ?   ?   B . n 
B 1 486 SER 486 493 ?   ?   ?   B . n 
B 1 487 VAL 487 494 ?   ?   ?   B . n 
B 1 488 SER 488 495 ?   ?   ?   B . n 
B 1 489 ARG 489 496 ?   ?   ?   B . n 
B 1 490 GLY 490 497 ?   ?   ?   B . n 
B 1 491 MET 491 498 ?   ?   ?   B . n 
B 1 492 TYR 492 499 ?   ?   ?   B . n 
B 1 493 ASP 493 500 ?   ?   ?   B . n 
B 1 494 GLY 494 501 ?   ?   ?   B . n 
B 1 495 PRO 495 502 ?   ?   ?   B . n 
B 1 496 VAL 496 503 ?   ?   ?   B . n 
B 1 497 TYR 497 504 ?   ?   ?   B . n 
B 1 498 GLU 498 505 ?   ?   ?   B . n 
B 1 499 VAL 499 506 ?   ?   ?   B . n 
B 1 500 PRO 500 507 ?   ?   ?   B . n 
B 1 501 ALA 501 508 ?   ?   ?   B . n 
B 1 502 THR 502 509 ?   ?   ?   B . n 
B 1 503 PRO 503 510 ?   ?   ?   B . n 
B 1 504 LYS 504 511 ?   ?   ?   B . n 
B 1 505 HIS 505 512 ?   ?   ?   B . n 
B 1 506 ALA 506 513 ?   ?   ?   B . n 
B 1 507 ALA 507 514 ?   ?   ?   B . n 
B 1 508 PRO 508 515 ?   ?   ?   B . n 
B 1 509 ALA 509 516 ?   ?   ?   B . n 
B 1 510 PRO 510 517 ?   ?   ?   B . n 
B 1 511 SER 511 518 ?   ?   ?   B . n 
B 1 512 ALA 512 519 ?   ?   ?   B . n 
B 1 513 LYS 513 520 ?   ?   ?   B . n 
B 1 514 SER 514 521 ?   ?   ?   B . n 
B 1 515 SER 515 522 ?   ?   ?   B . n 
B 1 516 PRO 516 523 ?   ?   ?   B . n 
B 1 517 SER 517 524 ?   ?   ?   B . n 
B 1 518 LYS 518 525 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
_pdbx_SG_project.full_name_of_center   'New York SGX Research Center for Structural Genomics' 
_pdbx_SG_project.initial_of_center     NYSGXRC 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-08-05 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
MLPHARE   phasing          . ? 3 
CNS       refinement       . ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 SD A MET 417 ? ? OG A SER 442 ? ? 2.11 
2 1 O  A TYR 395 ? ? O  A LYS 398 ? ? 2.15 
3 1 O  B TYR 395 ? ? O  B LYS 398 ? ? 2.17 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     758 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     758 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_555 
_pdbx_validate_symm_contact.dist              2.09 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A LYS 416 ? ? CG A LYS 416 ? ? 1.772 1.521 0.251 0.027 N 
2 1 CG A LYS 416 ? ? CD A LYS 416 ? ? 1.858 1.520 0.338 0.034 N 
3 1 CD A LYS 416 ? ? CE A LYS 416 ? ? 1.701 1.508 0.193 0.025 N 
4 1 CG A MET 417 ? ? SD A MET 417 ? ? 2.166 1.807 0.359 0.026 N 
5 1 SD A MET 417 ? ? CE A MET 417 ? ? 2.257 1.774 0.483 0.056 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 415 ? ? CG A ASP 415 ? ? OD1 A ASP 415 ? ? 112.10 118.30 -6.20  0.90 N 
2 1 N  A ASP 415 ? ? CA A ASP 415 ? ? C   A ASP 415 ? ? 127.92 111.00 16.92  2.70 N 
3 1 CD A LYS 416 ? ? CE A LYS 416 ? ? NZ  A LYS 416 ? ? 129.30 111.70 17.60  2.30 N 
4 1 CG A MET 417 ? ? SD A MET 417 ? ? CE  A MET 417 ? ? 114.93 100.20 14.73  1.60 N 
5 1 N  A MET 417 ? ? CA A MET 417 ? ? C   A MET 417 ? ? 141.26 111.00 30.26  2.70 N 
6 1 C  A MET 417 ? ? N  A LYS 418 ? ? CA  A LYS 418 ? ? 97.97  121.70 -23.73 2.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 48  ? ? -172.91 141.28  
2  1 LEU A 49  ? ? 52.24   -160.62 
3  1 ILE A 50  ? ? 106.93  9.15    
4  1 TYR A 170 ? ? 68.19   63.80   
5  1 LEU A 173 ? ? -124.00 -66.67  
6  1 CYS A 334 ? ? -173.88 60.87   
7  1 SER A 385 ? ? -153.78 -61.20  
8  1 TYR A 395 ? ? -37.38  -93.68  
9  1 ASP A 415 ? ? -90.14  35.55   
10 1 LYS A 416 ? ? 176.43  -168.86 
11 1 MET A 417 ? ? 35.26   29.77   
12 1 ASN B 48  ? ? 166.97  179.30  
13 1 LEU B 49  ? ? 66.92   170.02  
14 1 ILE B 50  ? ? 81.29   50.93   
15 1 GLU B 111 ? ? -58.94  -163.40 
16 1 PRO B 112 ? ? -67.06  92.04   
17 1 SER B 143 ? ? -173.64 145.57  
18 1 TYR B 170 ? ? 71.04   57.29   
19 1 LEU B 173 ? ? -117.55 -70.89  
20 1 ASN B 247 ? ? 68.75   66.88   
21 1 CYS B 334 ? ? -179.11 55.70   
22 1 ALA B 342 ? ? -52.35  -7.83   
23 1 VAL B 343 ? ? -63.18  1.22    
24 1 ASN B 347 ? ? -168.32 99.31   
25 1 SER B 385 ? ? -152.69 -60.26  
26 1 TYR B 395 ? ? -36.65  -88.68  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 47  ? CG  ? A GLU 40  CG  
2  1 Y 1 A GLU 47  ? CD  ? A GLU 40  CD  
3  1 Y 1 A GLU 47  ? OE1 ? A GLU 40  OE1 
4  1 Y 1 A GLU 47  ? OE2 ? A GLU 40  OE2 
5  1 Y 1 A ASN 48  ? CG  ? A ASN 41  CG  
6  1 Y 1 A ASN 48  ? OD1 ? A ASN 41  OD1 
7  1 Y 1 A ASN 48  ? ND2 ? A ASN 41  ND2 
8  1 Y 1 A LEU 49  ? CG  ? A LEU 42  CG  
9  1 Y 1 A LEU 49  ? CD1 ? A LEU 42  CD1 
10 1 Y 1 A LEU 49  ? CD2 ? A LEU 42  CD2 
11 1 Y 1 A VAL 51  ? CG1 ? A VAL 44  CG1 
12 1 Y 1 A VAL 51  ? CG2 ? A VAL 44  CG2 
13 1 Y 1 A VAL 343 ? CG1 ? A VAL 336 CG1 
14 1 Y 1 A VAL 343 ? CG2 ? A VAL 336 CG2 
15 1 Y 1 B GLU 47  ? CG  ? B GLU 40  CG  
16 1 Y 1 B GLU 47  ? CD  ? B GLU 40  CD  
17 1 Y 1 B GLU 47  ? OE1 ? B GLU 40  OE1 
18 1 Y 1 B GLU 47  ? OE2 ? B GLU 40  OE2 
19 1 Y 1 B ASN 48  ? CG  ? B ASN 41  CG  
20 1 Y 1 B ASN 48  ? OD1 ? B ASN 41  OD1 
21 1 Y 1 B ASN 48  ? ND2 ? B ASN 41  ND2 
22 1 Y 1 B LEU 49  ? CG  ? B LEU 42  CG  
23 1 Y 1 B LEU 49  ? CD1 ? B LEU 42  CD1 
24 1 Y 1 B LEU 49  ? CD2 ? B LEU 42  CD2 
25 1 Y 1 B VAL 51  ? CG1 ? B VAL 44  CG1 
26 1 Y 1 B VAL 51  ? CG2 ? B VAL 44  CG2 
27 1 Y 1 B VAL 343 ? CG1 ? B VAL 336 CG1 
28 1 Y 1 B VAL 343 ? CG2 ? B VAL 336 CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 8   ? A SER 1   
2  1 Y 1 A ILE 9   ? A ILE 2   
3  1 Y 1 A PRO 10  ? A PRO 3   
4  1 Y 1 A HIS 11  ? A HIS 4   
5  1 Y 1 A ILE 12  ? A ILE 5   
6  1 Y 1 A THR 13  ? A THR 6   
7  1 Y 1 A SER 14  ? A SER 7   
8  1 Y 1 A LEU 491 ? A LEU 484 
9  1 Y 1 A HIS 492 ? A HIS 485 
10 1 Y 1 A SER 493 ? A SER 486 
11 1 Y 1 A VAL 494 ? A VAL 487 
12 1 Y 1 A SER 495 ? A SER 488 
13 1 Y 1 A ARG 496 ? A ARG 489 
14 1 Y 1 A GLY 497 ? A GLY 490 
15 1 Y 1 A MET 498 ? A MET 491 
16 1 Y 1 A TYR 499 ? A TYR 492 
17 1 Y 1 A ASP 500 ? A ASP 493 
18 1 Y 1 A GLY 501 ? A GLY 494 
19 1 Y 1 A PRO 502 ? A PRO 495 
20 1 Y 1 A VAL 503 ? A VAL 496 
21 1 Y 1 A TYR 504 ? A TYR 497 
22 1 Y 1 A GLU 505 ? A GLU 498 
23 1 Y 1 A VAL 506 ? A VAL 499 
24 1 Y 1 A PRO 507 ? A PRO 500 
25 1 Y 1 A ALA 508 ? A ALA 501 
26 1 Y 1 A THR 509 ? A THR 502 
27 1 Y 1 A PRO 510 ? A PRO 503 
28 1 Y 1 A LYS 511 ? A LYS 504 
29 1 Y 1 A HIS 512 ? A HIS 505 
30 1 Y 1 A ALA 513 ? A ALA 506 
31 1 Y 1 A ALA 514 ? A ALA 507 
32 1 Y 1 A PRO 515 ? A PRO 508 
33 1 Y 1 A ALA 516 ? A ALA 509 
34 1 Y 1 A PRO 517 ? A PRO 510 
35 1 Y 1 A SER 518 ? A SER 511 
36 1 Y 1 A ALA 519 ? A ALA 512 
37 1 Y 1 A LYS 520 ? A LYS 513 
38 1 Y 1 A SER 521 ? A SER 514 
39 1 Y 1 A SER 522 ? A SER 515 
40 1 Y 1 A PRO 523 ? A PRO 516 
41 1 Y 1 A SER 524 ? A SER 517 
42 1 Y 1 A LYS 525 ? A LYS 518 
43 1 Y 1 B SER 8   ? B SER 1   
44 1 Y 1 B ILE 9   ? B ILE 2   
45 1 Y 1 B PRO 10  ? B PRO 3   
46 1 Y 1 B HIS 11  ? B HIS 4   
47 1 Y 1 B ILE 12  ? B ILE 5   
48 1 Y 1 B THR 13  ? B THR 6   
49 1 Y 1 B SER 14  ? B SER 7   
50 1 Y 1 B LEU 491 ? B LEU 484 
51 1 Y 1 B HIS 492 ? B HIS 485 
52 1 Y 1 B SER 493 ? B SER 486 
53 1 Y 1 B VAL 494 ? B VAL 487 
54 1 Y 1 B SER 495 ? B SER 488 
55 1 Y 1 B ARG 496 ? B ARG 489 
56 1 Y 1 B GLY 497 ? B GLY 490 
57 1 Y 1 B MET 498 ? B MET 491 
58 1 Y 1 B TYR 499 ? B TYR 492 
59 1 Y 1 B ASP 500 ? B ASP 493 
60 1 Y 1 B GLY 501 ? B GLY 494 
61 1 Y 1 B PRO 502 ? B PRO 495 
62 1 Y 1 B VAL 503 ? B VAL 496 
63 1 Y 1 B TYR 504 ? B TYR 497 
64 1 Y 1 B GLU 505 ? B GLU 498 
65 1 Y 1 B VAL 506 ? B VAL 499 
66 1 Y 1 B PRO 507 ? B PRO 500 
67 1 Y 1 B ALA 508 ? B ALA 501 
68 1 Y 1 B THR 509 ? B THR 502 
69 1 Y 1 B PRO 510 ? B PRO 503 
70 1 Y 1 B LYS 511 ? B LYS 504 
71 1 Y 1 B HIS 512 ? B HIS 505 
72 1 Y 1 B ALA 513 ? B ALA 506 
73 1 Y 1 B ALA 514 ? B ALA 507 
74 1 Y 1 B PRO 515 ? B PRO 508 
75 1 Y 1 B ALA 516 ? B ALA 509 
76 1 Y 1 B PRO 517 ? B PRO 510 
77 1 Y 1 B SER 518 ? B SER 511 
78 1 Y 1 B ALA 519 ? B ALA 512 
79 1 Y 1 B LYS 520 ? B LYS 513 
80 1 Y 1 B SER 521 ? B SER 514 
81 1 Y 1 B SER 522 ? B SER 515 
82 1 Y 1 B PRO 523 ? B PRO 516 
83 1 Y 1 B SER 524 ? B SER 517 
84 1 Y 1 B LYS 525 ? B LYS 518 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1   526 100 HOH TIP A . 
C 2 HOH 2   527 101 HOH TIP A . 
C 2 HOH 3   528 103 HOH TIP A . 
C 2 HOH 4   529 106 HOH TIP A . 
C 2 HOH 5   530 108 HOH TIP A . 
C 2 HOH 6   531 109 HOH TIP A . 
C 2 HOH 7   532 110 HOH TIP A . 
C 2 HOH 8   533 111 HOH TIP A . 
C 2 HOH 9   534 112 HOH TIP A . 
C 2 HOH 10  535 116 HOH TIP A . 
C 2 HOH 11  536 118 HOH TIP A . 
C 2 HOH 12  537 121 HOH TIP A . 
C 2 HOH 13  538 123 HOH TIP A . 
C 2 HOH 14  539 125 HOH TIP A . 
C 2 HOH 15  540 126 HOH TIP A . 
C 2 HOH 16  541 127 HOH TIP A . 
C 2 HOH 17  542 128 HOH TIP A . 
C 2 HOH 18  543 130 HOH TIP A . 
C 2 HOH 19  544 133 HOH TIP A . 
C 2 HOH 20  545 134 HOH TIP A . 
C 2 HOH 21  546 135 HOH TIP A . 
C 2 HOH 22  547 136 HOH TIP A . 
C 2 HOH 23  548 140 HOH TIP A . 
C 2 HOH 24  549 141 HOH TIP A . 
C 2 HOH 25  550 142 HOH TIP A . 
C 2 HOH 26  551 145 HOH TIP A . 
C 2 HOH 27  552 146 HOH TIP A . 
C 2 HOH 28  553 147 HOH TIP A . 
C 2 HOH 29  554 151 HOH TIP A . 
C 2 HOH 30  555 152 HOH TIP A . 
C 2 HOH 31  556 153 HOH TIP A . 
C 2 HOH 32  557 154 HOH TIP A . 
C 2 HOH 33  558 159 HOH TIP A . 
C 2 HOH 34  559 160 HOH TIP A . 
C 2 HOH 35  560 161 HOH TIP A . 
C 2 HOH 36  561 164 HOH TIP A . 
C 2 HOH 37  562 165 HOH TIP A . 
C 2 HOH 38  563 166 HOH TIP A . 
C 2 HOH 39  564 167 HOH TIP A . 
C 2 HOH 40  565 168 HOH TIP A . 
C 2 HOH 41  566 170 HOH TIP A . 
C 2 HOH 42  567 171 HOH TIP A . 
C 2 HOH 43  568 172 HOH TIP A . 
C 2 HOH 44  569 176 HOH TIP A . 
C 2 HOH 45  570 180 HOH TIP A . 
C 2 HOH 46  571 183 HOH TIP A . 
C 2 HOH 47  572 184 HOH TIP A . 
C 2 HOH 48  573 185 HOH TIP A . 
C 2 HOH 49  574 186 HOH TIP A . 
C 2 HOH 50  575 188 HOH TIP A . 
C 2 HOH 51  576 189 HOH TIP A . 
C 2 HOH 52  577 190 HOH TIP A . 
C 2 HOH 53  578 191 HOH TIP A . 
C 2 HOH 54  579 192 HOH TIP A . 
C 2 HOH 55  580 193 HOH TIP A . 
C 2 HOH 56  581 194 HOH TIP A . 
C 2 HOH 57  582 195 HOH TIP A . 
C 2 HOH 58  583 196 HOH TIP A . 
C 2 HOH 59  584 202 HOH TIP A . 
C 2 HOH 60  585 203 HOH TIP A . 
C 2 HOH 61  586 205 HOH TIP A . 
C 2 HOH 62  587 207 HOH TIP A . 
C 2 HOH 63  588 210 HOH TIP A . 
C 2 HOH 64  589 212 HOH TIP A . 
C 2 HOH 65  590 213 HOH TIP A . 
C 2 HOH 66  591 215 HOH TIP A . 
C 2 HOH 67  592 216 HOH TIP A . 
C 2 HOH 68  593 218 HOH TIP A . 
C 2 HOH 69  594 219 HOH TIP A . 
C 2 HOH 70  595 220 HOH TIP A . 
C 2 HOH 71  596 221 HOH TIP A . 
C 2 HOH 72  597 222 HOH TIP A . 
C 2 HOH 73  598 223 HOH TIP A . 
C 2 HOH 74  599 224 HOH TIP A . 
C 2 HOH 75  600 228 HOH TIP A . 
C 2 HOH 76  601 230 HOH TIP A . 
C 2 HOH 77  602 232 HOH TIP A . 
C 2 HOH 78  603 233 HOH TIP A . 
C 2 HOH 79  604 234 HOH TIP A . 
C 2 HOH 80  605 237 HOH TIP A . 
C 2 HOH 81  606 243 HOH TIP A . 
C 2 HOH 82  607 246 HOH TIP A . 
C 2 HOH 83  608 247 HOH TIP A . 
C 2 HOH 84  609 248 HOH TIP A . 
C 2 HOH 85  610 249 HOH TIP A . 
C 2 HOH 86  611 251 HOH TIP A . 
C 2 HOH 87  612 252 HOH TIP A . 
C 2 HOH 88  613 253 HOH TIP A . 
C 2 HOH 89  614 255 HOH TIP A . 
C 2 HOH 90  615 256 HOH TIP A . 
C 2 HOH 91  616 258 HOH TIP A . 
C 2 HOH 92  617 259 HOH TIP A . 
C 2 HOH 93  618 260 HOH TIP A . 
C 2 HOH 94  619 261 HOH TIP A . 
C 2 HOH 95  620 263 HOH TIP A . 
C 2 HOH 96  621 264 HOH TIP A . 
C 2 HOH 97  622 266 HOH TIP A . 
C 2 HOH 98  623 269 HOH TIP A . 
C 2 HOH 99  624 271 HOH TIP A . 
C 2 HOH 100 625 273 HOH TIP A . 
C 2 HOH 101 626 274 HOH TIP A . 
C 2 HOH 102 627 276 HOH TIP A . 
C 2 HOH 103 628 280 HOH TIP A . 
C 2 HOH 104 629 282 HOH TIP A . 
C 2 HOH 105 630 283 HOH TIP A . 
C 2 HOH 106 631 286 HOH TIP A . 
C 2 HOH 107 632 288 HOH TIP A . 
C 2 HOH 108 633 289 HOH TIP A . 
C 2 HOH 109 634 290 HOH TIP A . 
C 2 HOH 110 635 291 HOH TIP A . 
C 2 HOH 111 636 294 HOH TIP A . 
C 2 HOH 112 637 295 HOH TIP A . 
C 2 HOH 113 638 296 HOH TIP A . 
C 2 HOH 114 639 297 HOH TIP A . 
C 2 HOH 115 640 298 HOH TIP A . 
C 2 HOH 116 641 299 HOH TIP A . 
C 2 HOH 117 642 301 HOH TIP A . 
C 2 HOH 118 643 302 HOH TIP A . 
C 2 HOH 119 644 307 HOH TIP A . 
C 2 HOH 120 645 308 HOH TIP A . 
C 2 HOH 121 646 309 HOH TIP A . 
C 2 HOH 122 647 310 HOH TIP A . 
C 2 HOH 123 648 315 HOH TIP A . 
C 2 HOH 124 649 316 HOH TIP A . 
C 2 HOH 125 650 318 HOH TIP A . 
C 2 HOH 126 651 321 HOH TIP A . 
C 2 HOH 127 652 322 HOH TIP A . 
C 2 HOH 128 653 324 HOH TIP A . 
C 2 HOH 129 654 325 HOH TIP A . 
C 2 HOH 130 655 327 HOH TIP A . 
C 2 HOH 131 656 328 HOH TIP A . 
C 2 HOH 132 657 329 HOH TIP A . 
C 2 HOH 133 658 333 HOH TIP A . 
C 2 HOH 134 659 334 HOH TIP A . 
C 2 HOH 135 660 335 HOH TIP A . 
C 2 HOH 136 661 337 HOH TIP A . 
C 2 HOH 137 662 338 HOH TIP A . 
C 2 HOH 138 663 339 HOH TIP A . 
C 2 HOH 139 664 340 HOH TIP A . 
C 2 HOH 140 665 341 HOH TIP A . 
C 2 HOH 141 666 342 HOH TIP A . 
C 2 HOH 142 667 343 HOH TIP A . 
C 2 HOH 143 668 345 HOH TIP A . 
C 2 HOH 144 669 346 HOH TIP A . 
C 2 HOH 145 670 347 HOH TIP A . 
C 2 HOH 146 671 348 HOH TIP A . 
C 2 HOH 147 672 349 HOH TIP A . 
C 2 HOH 148 673 350 HOH TIP A . 
C 2 HOH 149 674 354 HOH TIP A . 
C 2 HOH 150 675 357 HOH TIP A . 
C 2 HOH 151 676 358 HOH TIP A . 
C 2 HOH 152 677 360 HOH TIP A . 
C 2 HOH 153 678 362 HOH TIP A . 
C 2 HOH 154 679 363 HOH TIP A . 
C 2 HOH 155 680 364 HOH TIP A . 
C 2 HOH 156 681 365 HOH TIP A . 
C 2 HOH 157 682 368 HOH TIP A . 
C 2 HOH 158 683 373 HOH TIP A . 
C 2 HOH 159 684 376 HOH TIP A . 
C 2 HOH 160 685 379 HOH TIP A . 
C 2 HOH 161 686 380 HOH TIP A . 
C 2 HOH 162 687 386 HOH TIP A . 
C 2 HOH 163 688 387 HOH TIP A . 
C 2 HOH 164 689 389 HOH TIP A . 
C 2 HOH 165 690 390 HOH TIP A . 
C 2 HOH 166 691 391 HOH TIP A . 
C 2 HOH 167 692 392 HOH TIP A . 
C 2 HOH 168 693 393 HOH TIP A . 
C 2 HOH 169 694 395 HOH TIP A . 
C 2 HOH 170 695 396 HOH TIP A . 
C 2 HOH 171 696 397 HOH TIP A . 
C 2 HOH 172 697 398 HOH TIP A . 
C 2 HOH 173 698 402 HOH TIP A . 
C 2 HOH 174 699 407 HOH TIP A . 
C 2 HOH 175 700 409 HOH TIP A . 
C 2 HOH 176 701 410 HOH TIP A . 
C 2 HOH 177 702 411 HOH TIP A . 
C 2 HOH 178 703 412 HOH TIP A . 
C 2 HOH 179 704 417 HOH TIP A . 
C 2 HOH 180 705 418 HOH TIP A . 
C 2 HOH 181 706 422 HOH TIP A . 
C 2 HOH 182 707 427 HOH TIP A . 
C 2 HOH 183 708 429 HOH TIP A . 
C 2 HOH 184 709 430 HOH TIP A . 
C 2 HOH 185 710 431 HOH TIP A . 
C 2 HOH 186 711 432 HOH TIP A . 
C 2 HOH 187 712 433 HOH TIP A . 
C 2 HOH 188 713 435 HOH TIP A . 
C 2 HOH 189 714 437 HOH TIP A . 
C 2 HOH 190 715 441 HOH TIP A . 
C 2 HOH 191 716 443 HOH TIP A . 
C 2 HOH 192 717 450 HOH TIP A . 
C 2 HOH 193 718 451 HOH TIP A . 
C 2 HOH 194 719 454 HOH TIP A . 
C 2 HOH 195 720 456 HOH TIP A . 
C 2 HOH 196 721 461 HOH TIP A . 
C 2 HOH 197 722 462 HOH TIP A . 
C 2 HOH 198 723 463 HOH TIP A . 
C 2 HOH 199 724 465 HOH TIP A . 
C 2 HOH 200 725 471 HOH TIP A . 
C 2 HOH 201 726 473 HOH TIP A . 
C 2 HOH 202 727 474 HOH TIP A . 
C 2 HOH 203 728 476 HOH TIP A . 
C 2 HOH 204 729 478 HOH TIP A . 
C 2 HOH 205 730 479 HOH TIP A . 
C 2 HOH 206 731 480 HOH TIP A . 
C 2 HOH 207 732 482 HOH TIP A . 
C 2 HOH 208 733 483 HOH TIP A . 
C 2 HOH 209 734 484 HOH TIP A . 
C 2 HOH 210 735 485 HOH TIP A . 
C 2 HOH 211 736 486 HOH TIP A . 
C 2 HOH 212 737 487 HOH TIP A . 
C 2 HOH 213 738 488 HOH TIP A . 
C 2 HOH 214 739 490 HOH TIP A . 
C 2 HOH 215 740 495 HOH TIP A . 
C 2 HOH 216 741 496 HOH TIP A . 
C 2 HOH 217 742 501 HOH TIP A . 
C 2 HOH 218 743 503 HOH TIP A . 
C 2 HOH 219 744 506 HOH TIP A . 
C 2 HOH 220 745 509 HOH TIP A . 
C 2 HOH 221 746 511 HOH TIP A . 
C 2 HOH 222 747 512 HOH TIP A . 
C 2 HOH 223 748 514 HOH TIP A . 
C 2 HOH 224 749 515 HOH TIP A . 
C 2 HOH 225 750 516 HOH TIP A . 
C 2 HOH 226 751 518 HOH TIP A . 
C 2 HOH 227 752 519 HOH TIP A . 
C 2 HOH 228 753 520 HOH TIP A . 
C 2 HOH 229 754 521 HOH TIP A . 
C 2 HOH 230 755 524 HOH TIP A . 
C 2 HOH 231 756 525 HOH TIP A . 
C 2 HOH 232 757 526 HOH TIP A . 
C 2 HOH 233 758 529 HOH TIP A . 
C 2 HOH 234 759 531 HOH TIP A . 
C 2 HOH 235 760 533 HOH TIP A . 
C 2 HOH 236 761 535 HOH TIP A . 
C 2 HOH 237 762 539 HOH TIP A . 
C 2 HOH 238 763 540 HOH TIP A . 
C 2 HOH 239 764 541 HOH TIP A . 
C 2 HOH 240 765 542 HOH TIP A . 
C 2 HOH 241 766 543 HOH TIP A . 
C 2 HOH 242 767 544 HOH TIP A . 
C 2 HOH 243 768 546 HOH TIP A . 
C 2 HOH 244 769 550 HOH TIP A . 
C 2 HOH 245 770 553 HOH TIP A . 
C 2 HOH 246 771 555 HOH TIP A . 
C 2 HOH 247 772 557 HOH TIP A . 
C 2 HOH 248 773 558 HOH TIP A . 
C 2 HOH 249 774 560 HOH TIP A . 
C 2 HOH 250 775 561 HOH TIP A . 
C 2 HOH 251 776 562 HOH TIP A . 
C 2 HOH 252 777 563 HOH TIP A . 
C 2 HOH 253 778 564 HOH TIP A . 
C 2 HOH 254 779 567 HOH TIP A . 
C 2 HOH 255 780 568 HOH TIP A . 
C 2 HOH 256 781 569 HOH TIP A . 
C 2 HOH 257 782 570 HOH TIP A . 
C 2 HOH 258 783 571 HOH TIP A . 
C 2 HOH 259 784 574 HOH TIP A . 
C 2 HOH 260 785 579 HOH TIP A . 
C 2 HOH 261 786 585 HOH TIP A . 
C 2 HOH 262 787 590 HOH TIP A . 
C 2 HOH 263 788 592 HOH TIP A . 
C 2 HOH 264 789 594 HOH TIP A . 
C 2 HOH 265 790 596 HOH TIP A . 
C 2 HOH 266 791 597 HOH TIP A . 
C 2 HOH 267 792 598 HOH TIP A . 
C 2 HOH 268 793 600 HOH TIP A . 
C 2 HOH 269 794 601 HOH TIP A . 
C 2 HOH 270 795 604 HOH TIP A . 
C 2 HOH 271 796 608 HOH TIP A . 
C 2 HOH 272 797 609 HOH TIP A . 
C 2 HOH 273 798 610 HOH TIP A . 
C 2 HOH 274 799 612 HOH TIP A . 
C 2 HOH 275 800 618 HOH TIP A . 
C 2 HOH 276 801 621 HOH TIP A . 
C 2 HOH 277 802 622 HOH TIP A . 
C 2 HOH 278 803 624 HOH TIP A . 
C 2 HOH 279 804 626 HOH TIP A . 
C 2 HOH 280 805 628 HOH TIP A . 
C 2 HOH 281 806 629 HOH TIP A . 
C 2 HOH 282 807 630 HOH TIP A . 
C 2 HOH 283 808 631 HOH TIP A . 
C 2 HOH 284 809 634 HOH TIP A . 
C 2 HOH 285 810 638 HOH TIP A . 
C 2 HOH 286 811 642 HOH TIP A . 
C 2 HOH 287 812 644 HOH TIP A . 
C 2 HOH 288 813 645 HOH TIP A . 
C 2 HOH 289 814 646 HOH TIP A . 
C 2 HOH 290 815 652 HOH TIP A . 
C 2 HOH 291 816 658 HOH TIP A . 
C 2 HOH 292 817 659 HOH TIP A . 
C 2 HOH 293 818 665 HOH TIP A . 
C 2 HOH 294 819 667 HOH TIP A . 
C 2 HOH 295 820 669 HOH TIP A . 
C 2 HOH 296 821 670 HOH TIP A . 
C 2 HOH 297 822 672 HOH TIP A . 
C 2 HOH 298 823 674 HOH TIP A . 
C 2 HOH 299 824 675 HOH TIP A . 
C 2 HOH 300 825 677 HOH TIP A . 
C 2 HOH 301 826 678 HOH TIP A . 
C 2 HOH 302 827 679 HOH TIP A . 
C 2 HOH 303 828 680 HOH TIP A . 
C 2 HOH 304 829 681 HOH TIP A . 
C 2 HOH 305 830 683 HOH TIP A . 
C 2 HOH 306 831 685 HOH TIP A . 
C 2 HOH 307 832 687 HOH TIP A . 
C 2 HOH 308 833 690 HOH TIP A . 
C 2 HOH 309 834 693 HOH TIP A . 
C 2 HOH 310 835 694 HOH TIP A . 
C 2 HOH 311 836 695 HOH TIP A . 
C 2 HOH 312 837 697 HOH TIP A . 
C 2 HOH 313 838 698 HOH TIP A . 
C 2 HOH 314 839 702 HOH TIP A . 
C 2 HOH 315 840 703 HOH TIP A . 
C 2 HOH 316 841 704 HOH TIP A . 
C 2 HOH 317 842 705 HOH TIP A . 
C 2 HOH 318 843 712 HOH TIP A . 
C 2 HOH 319 844 713 HOH TIP A . 
C 2 HOH 320 845 715 HOH TIP A . 
C 2 HOH 321 846 718 HOH TIP A . 
C 2 HOH 322 847 721 HOH TIP A . 
C 2 HOH 323 848 722 HOH TIP A . 
C 2 HOH 324 849 725 HOH TIP A . 
C 2 HOH 325 850 730 HOH TIP A . 
C 2 HOH 326 851 733 HOH TIP A . 
C 2 HOH 327 852 734 HOH TIP A . 
C 2 HOH 328 853 735 HOH TIP A . 
C 2 HOH 329 854 737 HOH TIP A . 
C 2 HOH 330 855 739 HOH TIP A . 
C 2 HOH 331 856 740 HOH TIP A . 
C 2 HOH 332 857 742 HOH TIP A . 
C 2 HOH 333 858 744 HOH TIP A . 
C 2 HOH 334 859 745 HOH TIP A . 
C 2 HOH 335 860 747 HOH TIP A . 
C 2 HOH 336 861 749 HOH TIP A . 
C 2 HOH 337 862 750 HOH TIP A . 
C 2 HOH 338 863 751 HOH TIP A . 
C 2 HOH 339 864 753 HOH TIP A . 
C 2 HOH 340 865 754 HOH TIP A . 
C 2 HOH 341 866 755 HOH TIP A . 
C 2 HOH 342 867 758 HOH TIP A . 
C 2 HOH 343 868 759 HOH TIP A . 
C 2 HOH 344 869 761 HOH TIP A . 
C 2 HOH 345 870 762 HOH TIP A . 
C 2 HOH 346 871 764 HOH TIP A . 
C 2 HOH 347 872 765 HOH TIP A . 
C 2 HOH 348 873 766 HOH TIP A . 
C 2 HOH 349 874 767 HOH TIP A . 
C 2 HOH 350 875 772 HOH TIP A . 
C 2 HOH 351 876 773 HOH TIP A . 
C 2 HOH 352 877 774 HOH TIP A . 
C 2 HOH 353 878 776 HOH TIP A . 
C 2 HOH 354 879 778 HOH TIP A . 
C 2 HOH 355 880 779 HOH TIP A . 
C 2 HOH 356 881 780 HOH TIP A . 
C 2 HOH 357 882 781 HOH TIP A . 
C 2 HOH 358 883 782 HOH TIP A . 
C 2 HOH 359 884 783 HOH TIP A . 
C 2 HOH 360 885 784 HOH TIP A . 
C 2 HOH 361 886 787 HOH TIP A . 
C 2 HOH 362 887 788 HOH TIP A . 
C 2 HOH 363 888 789 HOH TIP A . 
C 2 HOH 364 889 790 HOH TIP A . 
C 2 HOH 365 890 794 HOH TIP A . 
C 2 HOH 366 891 797 HOH TIP A . 
C 2 HOH 367 892 798 HOH TIP A . 
C 2 HOH 368 893 799 HOH TIP A . 
C 2 HOH 369 894 800 HOH TIP A . 
C 2 HOH 370 895 802 HOH TIP A . 
C 2 HOH 371 896 806 HOH TIP A . 
C 2 HOH 372 897 807 HOH TIP A . 
C 2 HOH 373 898 808 HOH TIP A . 
C 2 HOH 374 899 809 HOH TIP A . 
C 2 HOH 375 900 810 HOH TIP A . 
C 2 HOH 376 901 812 HOH TIP A . 
C 2 HOH 377 902 813 HOH TIP A . 
C 2 HOH 378 903 816 HOH TIP A . 
C 2 HOH 379 904 817 HOH TIP A . 
C 2 HOH 380 905 821 HOH TIP A . 
C 2 HOH 381 906 822 HOH TIP A . 
C 2 HOH 382 907 823 HOH TIP A . 
C 2 HOH 383 908 829 HOH TIP A . 
C 2 HOH 384 909 831 HOH TIP A . 
C 2 HOH 385 910 832 HOH TIP A . 
C 2 HOH 386 911 835 HOH TIP A . 
C 2 HOH 387 912 836 HOH TIP A . 
C 2 HOH 388 913 839 HOH TIP A . 
C 2 HOH 389 914 840 HOH TIP A . 
C 2 HOH 390 915 844 HOH TIP A . 
C 2 HOH 391 916 848 HOH TIP A . 
C 2 HOH 392 917 851 HOH TIP A . 
C 2 HOH 393 918 852 HOH TIP A . 
C 2 HOH 394 919 853 HOH TIP A . 
C 2 HOH 395 920 855 HOH TIP A . 
C 2 HOH 396 921 857 HOH TIP A . 
C 2 HOH 397 922 860 HOH TIP A . 
C 2 HOH 398 923 865 HOH TIP A . 
C 2 HOH 399 924 868 HOH TIP A . 
C 2 HOH 400 925 870 HOH TIP A . 
C 2 HOH 401 926 872 HOH TIP A . 
C 2 HOH 402 927 873 HOH TIP A . 
C 2 HOH 403 928 874 HOH TIP A . 
C 2 HOH 404 929 875 HOH TIP A . 
C 2 HOH 405 930 876 HOH TIP A . 
C 2 HOH 406 931 877 HOH TIP A . 
C 2 HOH 407 932 878 HOH TIP A . 
C 2 HOH 408 933 879 HOH TIP A . 
C 2 HOH 409 934 880 HOH TIP A . 
C 2 HOH 410 935 882 HOH TIP A . 
C 2 HOH 411 936 883 HOH TIP A . 
C 2 HOH 412 937 885 HOH TIP A . 
C 2 HOH 413 938 886 HOH TIP A . 
C 2 HOH 414 939 888 HOH TIP A . 
C 2 HOH 415 940 891 HOH TIP A . 
C 2 HOH 416 941 892 HOH TIP A . 
C 2 HOH 417 942 895 HOH TIP A . 
C 2 HOH 418 943 897 HOH TIP A . 
C 2 HOH 419 944 899 HOH TIP A . 
C 2 HOH 420 945 900 HOH TIP A . 
C 2 HOH 421 946 901 HOH TIP A . 
D 2 HOH 1   526 102 HOH TIP B . 
D 2 HOH 2   527 104 HOH TIP B . 
D 2 HOH 3   528 105 HOH TIP B . 
D 2 HOH 4   529 107 HOH TIP B . 
D 2 HOH 5   530 113 HOH TIP B . 
D 2 HOH 6   531 114 HOH TIP B . 
D 2 HOH 7   532 115 HOH TIP B . 
D 2 HOH 8   533 117 HOH TIP B . 
D 2 HOH 9   534 119 HOH TIP B . 
D 2 HOH 10  535 120 HOH TIP B . 
D 2 HOH 11  536 122 HOH TIP B . 
D 2 HOH 12  537 124 HOH TIP B . 
D 2 HOH 13  538 129 HOH TIP B . 
D 2 HOH 14  539 131 HOH TIP B . 
D 2 HOH 15  540 132 HOH TIP B . 
D 2 HOH 16  541 137 HOH TIP B . 
D 2 HOH 17  542 138 HOH TIP B . 
D 2 HOH 18  543 139 HOH TIP B . 
D 2 HOH 19  544 143 HOH TIP B . 
D 2 HOH 20  545 144 HOH TIP B . 
D 2 HOH 21  546 148 HOH TIP B . 
D 2 HOH 22  547 149 HOH TIP B . 
D 2 HOH 23  548 150 HOH TIP B . 
D 2 HOH 24  549 155 HOH TIP B . 
D 2 HOH 25  550 156 HOH TIP B . 
D 2 HOH 26  551 157 HOH TIP B . 
D 2 HOH 27  552 158 HOH TIP B . 
D 2 HOH 28  553 162 HOH TIP B . 
D 2 HOH 29  554 163 HOH TIP B . 
D 2 HOH 30  555 169 HOH TIP B . 
D 2 HOH 31  556 173 HOH TIP B . 
D 2 HOH 32  557 174 HOH TIP B . 
D 2 HOH 33  558 175 HOH TIP B . 
D 2 HOH 34  559 177 HOH TIP B . 
D 2 HOH 35  560 178 HOH TIP B . 
D 2 HOH 36  561 179 HOH TIP B . 
D 2 HOH 37  562 181 HOH TIP B . 
D 2 HOH 38  563 182 HOH TIP B . 
D 2 HOH 39  564 187 HOH TIP B . 
D 2 HOH 40  565 197 HOH TIP B . 
D 2 HOH 41  566 198 HOH TIP B . 
D 2 HOH 42  567 199 HOH TIP B . 
D 2 HOH 43  568 200 HOH TIP B . 
D 2 HOH 44  569 201 HOH TIP B . 
D 2 HOH 45  570 204 HOH TIP B . 
D 2 HOH 46  571 206 HOH TIP B . 
D 2 HOH 47  572 208 HOH TIP B . 
D 2 HOH 48  573 209 HOH TIP B . 
D 2 HOH 49  574 211 HOH TIP B . 
D 2 HOH 50  575 214 HOH TIP B . 
D 2 HOH 51  576 217 HOH TIP B . 
D 2 HOH 52  577 225 HOH TIP B . 
D 2 HOH 53  578 226 HOH TIP B . 
D 2 HOH 54  579 227 HOH TIP B . 
D 2 HOH 55  580 229 HOH TIP B . 
D 2 HOH 56  581 231 HOH TIP B . 
D 2 HOH 57  582 235 HOH TIP B . 
D 2 HOH 58  583 236 HOH TIP B . 
D 2 HOH 59  584 238 HOH TIP B . 
D 2 HOH 60  585 239 HOH TIP B . 
D 2 HOH 61  586 240 HOH TIP B . 
D 2 HOH 62  587 241 HOH TIP B . 
D 2 HOH 63  588 242 HOH TIP B . 
D 2 HOH 64  589 244 HOH TIP B . 
D 2 HOH 65  590 245 HOH TIP B . 
D 2 HOH 66  591 250 HOH TIP B . 
D 2 HOH 67  592 254 HOH TIP B . 
D 2 HOH 68  593 257 HOH TIP B . 
D 2 HOH 69  594 262 HOH TIP B . 
D 2 HOH 70  595 265 HOH TIP B . 
D 2 HOH 71  596 267 HOH TIP B . 
D 2 HOH 72  597 268 HOH TIP B . 
D 2 HOH 73  598 270 HOH TIP B . 
D 2 HOH 74  599 272 HOH TIP B . 
D 2 HOH 75  600 275 HOH TIP B . 
D 2 HOH 76  601 277 HOH TIP B . 
D 2 HOH 77  602 278 HOH TIP B . 
D 2 HOH 78  603 279 HOH TIP B . 
D 2 HOH 79  604 281 HOH TIP B . 
D 2 HOH 80  605 284 HOH TIP B . 
D 2 HOH 81  606 285 HOH TIP B . 
D 2 HOH 82  607 287 HOH TIP B . 
D 2 HOH 83  608 292 HOH TIP B . 
D 2 HOH 84  609 293 HOH TIP B . 
D 2 HOH 85  610 300 HOH TIP B . 
D 2 HOH 86  611 303 HOH TIP B . 
D 2 HOH 87  612 304 HOH TIP B . 
D 2 HOH 88  613 305 HOH TIP B . 
D 2 HOH 89  614 306 HOH TIP B . 
D 2 HOH 90  615 311 HOH TIP B . 
D 2 HOH 91  616 312 HOH TIP B . 
D 2 HOH 92  617 313 HOH TIP B . 
D 2 HOH 93  618 314 HOH TIP B . 
D 2 HOH 94  619 317 HOH TIP B . 
D 2 HOH 95  620 319 HOH TIP B . 
D 2 HOH 96  621 320 HOH TIP B . 
D 2 HOH 97  622 323 HOH TIP B . 
D 2 HOH 98  623 326 HOH TIP B . 
D 2 HOH 99  624 330 HOH TIP B . 
D 2 HOH 100 625 331 HOH TIP B . 
D 2 HOH 101 626 332 HOH TIP B . 
D 2 HOH 102 627 336 HOH TIP B . 
D 2 HOH 103 628 344 HOH TIP B . 
D 2 HOH 104 629 351 HOH TIP B . 
D 2 HOH 105 630 352 HOH TIP B . 
D 2 HOH 106 631 353 HOH TIP B . 
D 2 HOH 107 632 355 HOH TIP B . 
D 2 HOH 108 633 356 HOH TIP B . 
D 2 HOH 109 634 359 HOH TIP B . 
D 2 HOH 110 635 361 HOH TIP B . 
D 2 HOH 111 636 366 HOH TIP B . 
D 2 HOH 112 637 367 HOH TIP B . 
D 2 HOH 113 638 369 HOH TIP B . 
D 2 HOH 114 639 370 HOH TIP B . 
D 2 HOH 115 640 371 HOH TIP B . 
D 2 HOH 116 641 372 HOH TIP B . 
D 2 HOH 117 642 374 HOH TIP B . 
D 2 HOH 118 643 375 HOH TIP B . 
D 2 HOH 119 644 377 HOH TIP B . 
D 2 HOH 120 645 378 HOH TIP B . 
D 2 HOH 121 646 381 HOH TIP B . 
D 2 HOH 122 647 382 HOH TIP B . 
D 2 HOH 123 648 383 HOH TIP B . 
D 2 HOH 124 649 384 HOH TIP B . 
D 2 HOH 125 650 385 HOH TIP B . 
D 2 HOH 126 651 388 HOH TIP B . 
D 2 HOH 127 652 394 HOH TIP B . 
D 2 HOH 128 653 399 HOH TIP B . 
D 2 HOH 129 654 400 HOH TIP B . 
D 2 HOH 130 655 401 HOH TIP B . 
D 2 HOH 131 656 403 HOH TIP B . 
D 2 HOH 132 657 404 HOH TIP B . 
D 2 HOH 133 658 405 HOH TIP B . 
D 2 HOH 134 659 406 HOH TIP B . 
D 2 HOH 135 660 408 HOH TIP B . 
D 2 HOH 136 661 413 HOH TIP B . 
D 2 HOH 137 662 414 HOH TIP B . 
D 2 HOH 138 663 415 HOH TIP B . 
D 2 HOH 139 664 416 HOH TIP B . 
D 2 HOH 140 665 419 HOH TIP B . 
D 2 HOH 141 666 420 HOH TIP B . 
D 2 HOH 142 667 421 HOH TIP B . 
D 2 HOH 143 668 423 HOH TIP B . 
D 2 HOH 144 669 424 HOH TIP B . 
D 2 HOH 145 670 425 HOH TIP B . 
D 2 HOH 146 671 426 HOH TIP B . 
D 2 HOH 147 672 428 HOH TIP B . 
D 2 HOH 148 673 434 HOH TIP B . 
D 2 HOH 149 674 436 HOH TIP B . 
D 2 HOH 150 675 438 HOH TIP B . 
D 2 HOH 151 676 439 HOH TIP B . 
D 2 HOH 152 677 440 HOH TIP B . 
D 2 HOH 153 678 442 HOH TIP B . 
D 2 HOH 154 679 444 HOH TIP B . 
D 2 HOH 155 680 445 HOH TIP B . 
D 2 HOH 156 681 446 HOH TIP B . 
D 2 HOH 157 682 447 HOH TIP B . 
D 2 HOH 158 683 448 HOH TIP B . 
D 2 HOH 159 684 449 HOH TIP B . 
D 2 HOH 160 685 452 HOH TIP B . 
D 2 HOH 161 686 453 HOH TIP B . 
D 2 HOH 162 687 455 HOH TIP B . 
D 2 HOH 163 688 457 HOH TIP B . 
D 2 HOH 164 689 458 HOH TIP B . 
D 2 HOH 165 690 459 HOH TIP B . 
D 2 HOH 166 691 460 HOH TIP B . 
D 2 HOH 167 692 464 HOH TIP B . 
D 2 HOH 168 693 466 HOH TIP B . 
D 2 HOH 169 694 467 HOH TIP B . 
D 2 HOH 170 695 468 HOH TIP B . 
D 2 HOH 171 696 469 HOH TIP B . 
D 2 HOH 172 697 470 HOH TIP B . 
D 2 HOH 173 698 472 HOH TIP B . 
D 2 HOH 174 699 475 HOH TIP B . 
D 2 HOH 175 700 477 HOH TIP B . 
D 2 HOH 176 701 481 HOH TIP B . 
D 2 HOH 177 702 489 HOH TIP B . 
D 2 HOH 178 703 491 HOH TIP B . 
D 2 HOH 179 704 492 HOH TIP B . 
D 2 HOH 180 705 493 HOH TIP B . 
D 2 HOH 181 706 494 HOH TIP B . 
D 2 HOH 182 707 497 HOH TIP B . 
D 2 HOH 183 708 498 HOH TIP B . 
D 2 HOH 184 709 499 HOH TIP B . 
D 2 HOH 185 710 500 HOH TIP B . 
D 2 HOH 186 711 502 HOH TIP B . 
D 2 HOH 187 712 504 HOH TIP B . 
D 2 HOH 188 713 505 HOH TIP B . 
D 2 HOH 189 714 507 HOH TIP B . 
D 2 HOH 190 715 508 HOH TIP B . 
D 2 HOH 191 716 510 HOH TIP B . 
D 2 HOH 192 717 513 HOH TIP B . 
D 2 HOH 193 718 517 HOH TIP B . 
D 2 HOH 194 719 522 HOH TIP B . 
D 2 HOH 195 720 523 HOH TIP B . 
D 2 HOH 196 721 527 HOH TIP B . 
D 2 HOH 197 722 528 HOH TIP B . 
D 2 HOH 198 723 530 HOH TIP B . 
D 2 HOH 199 724 532 HOH TIP B . 
D 2 HOH 200 725 534 HOH TIP B . 
D 2 HOH 201 726 536 HOH TIP B . 
D 2 HOH 202 727 537 HOH TIP B . 
D 2 HOH 203 728 538 HOH TIP B . 
D 2 HOH 204 729 545 HOH TIP B . 
D 2 HOH 205 730 547 HOH TIP B . 
D 2 HOH 206 731 548 HOH TIP B . 
D 2 HOH 207 732 549 HOH TIP B . 
D 2 HOH 208 733 551 HOH TIP B . 
D 2 HOH 209 734 552 HOH TIP B . 
D 2 HOH 210 735 554 HOH TIP B . 
D 2 HOH 211 736 556 HOH TIP B . 
D 2 HOH 212 737 559 HOH TIP B . 
D 2 HOH 213 738 565 HOH TIP B . 
D 2 HOH 214 739 566 HOH TIP B . 
D 2 HOH 215 740 572 HOH TIP B . 
D 2 HOH 216 741 573 HOH TIP B . 
D 2 HOH 217 742 575 HOH TIP B . 
D 2 HOH 218 743 576 HOH TIP B . 
D 2 HOH 219 744 577 HOH TIP B . 
D 2 HOH 220 745 578 HOH TIP B . 
D 2 HOH 221 746 580 HOH TIP B . 
D 2 HOH 222 747 581 HOH TIP B . 
D 2 HOH 223 748 582 HOH TIP B . 
D 2 HOH 224 749 583 HOH TIP B . 
D 2 HOH 225 750 584 HOH TIP B . 
D 2 HOH 226 751 586 HOH TIP B . 
D 2 HOH 227 752 587 HOH TIP B . 
D 2 HOH 228 753 588 HOH TIP B . 
D 2 HOH 229 754 589 HOH TIP B . 
D 2 HOH 230 755 591 HOH TIP B . 
D 2 HOH 231 756 593 HOH TIP B . 
D 2 HOH 232 757 595 HOH TIP B . 
D 2 HOH 233 758 599 HOH TIP B . 
D 2 HOH 234 759 602 HOH TIP B . 
D 2 HOH 235 760 603 HOH TIP B . 
D 2 HOH 236 761 605 HOH TIP B . 
D 2 HOH 237 762 606 HOH TIP B . 
D 2 HOH 238 763 607 HOH TIP B . 
D 2 HOH 239 764 611 HOH TIP B . 
D 2 HOH 240 765 613 HOH TIP B . 
D 2 HOH 241 766 614 HOH TIP B . 
D 2 HOH 242 767 615 HOH TIP B . 
D 2 HOH 243 768 616 HOH TIP B . 
D 2 HOH 244 769 617 HOH TIP B . 
D 2 HOH 245 770 619 HOH TIP B . 
D 2 HOH 246 771 620 HOH TIP B . 
D 2 HOH 247 772 623 HOH TIP B . 
D 2 HOH 248 773 625 HOH TIP B . 
D 2 HOH 249 774 627 HOH TIP B . 
D 2 HOH 250 775 632 HOH TIP B . 
D 2 HOH 251 776 633 HOH TIP B . 
D 2 HOH 252 777 635 HOH TIP B . 
D 2 HOH 253 778 636 HOH TIP B . 
D 2 HOH 254 779 637 HOH TIP B . 
D 2 HOH 255 780 639 HOH TIP B . 
D 2 HOH 256 781 640 HOH TIP B . 
D 2 HOH 257 782 641 HOH TIP B . 
D 2 HOH 258 783 643 HOH TIP B . 
D 2 HOH 259 784 647 HOH TIP B . 
D 2 HOH 260 785 648 HOH TIP B . 
D 2 HOH 261 786 649 HOH TIP B . 
D 2 HOH 262 787 650 HOH TIP B . 
D 2 HOH 263 788 651 HOH TIP B . 
D 2 HOH 264 789 653 HOH TIP B . 
D 2 HOH 265 790 654 HOH TIP B . 
D 2 HOH 266 791 655 HOH TIP B . 
D 2 HOH 267 792 656 HOH TIP B . 
D 2 HOH 268 793 657 HOH TIP B . 
D 2 HOH 269 794 660 HOH TIP B . 
D 2 HOH 270 795 661 HOH TIP B . 
D 2 HOH 271 796 662 HOH TIP B . 
D 2 HOH 272 797 663 HOH TIP B . 
D 2 HOH 273 798 664 HOH TIP B . 
D 2 HOH 274 799 666 HOH TIP B . 
D 2 HOH 275 800 668 HOH TIP B . 
D 2 HOH 276 801 671 HOH TIP B . 
D 2 HOH 277 802 673 HOH TIP B . 
D 2 HOH 278 803 676 HOH TIP B . 
D 2 HOH 279 804 682 HOH TIP B . 
D 2 HOH 280 805 684 HOH TIP B . 
D 2 HOH 281 806 686 HOH TIP B . 
D 2 HOH 282 807 688 HOH TIP B . 
D 2 HOH 283 808 689 HOH TIP B . 
D 2 HOH 284 809 691 HOH TIP B . 
D 2 HOH 285 810 692 HOH TIP B . 
D 2 HOH 286 811 696 HOH TIP B . 
D 2 HOH 287 812 699 HOH TIP B . 
D 2 HOH 288 813 700 HOH TIP B . 
D 2 HOH 289 814 701 HOH TIP B . 
D 2 HOH 290 815 706 HOH TIP B . 
D 2 HOH 291 816 707 HOH TIP B . 
D 2 HOH 292 817 708 HOH TIP B . 
D 2 HOH 293 818 709 HOH TIP B . 
D 2 HOH 294 819 710 HOH TIP B . 
D 2 HOH 295 820 711 HOH TIP B . 
D 2 HOH 296 821 714 HOH TIP B . 
D 2 HOH 297 822 716 HOH TIP B . 
D 2 HOH 298 823 717 HOH TIP B . 
D 2 HOH 299 824 719 HOH TIP B . 
D 2 HOH 300 825 720 HOH TIP B . 
D 2 HOH 301 826 723 HOH TIP B . 
D 2 HOH 302 827 724 HOH TIP B . 
D 2 HOH 303 828 726 HOH TIP B . 
D 2 HOH 304 829 727 HOH TIP B . 
D 2 HOH 305 830 728 HOH TIP B . 
D 2 HOH 306 831 729 HOH TIP B . 
D 2 HOH 307 832 731 HOH TIP B . 
D 2 HOH 308 833 732 HOH TIP B . 
D 2 HOH 309 834 736 HOH TIP B . 
D 2 HOH 310 835 738 HOH TIP B . 
D 2 HOH 311 836 741 HOH TIP B . 
D 2 HOH 312 837 743 HOH TIP B . 
D 2 HOH 313 838 746 HOH TIP B . 
D 2 HOH 314 839 748 HOH TIP B . 
D 2 HOH 315 840 752 HOH TIP B . 
D 2 HOH 316 841 756 HOH TIP B . 
D 2 HOH 317 842 757 HOH TIP B . 
D 2 HOH 318 843 760 HOH TIP B . 
D 2 HOH 319 844 763 HOH TIP B . 
D 2 HOH 320 845 768 HOH TIP B . 
D 2 HOH 321 846 769 HOH TIP B . 
D 2 HOH 322 847 770 HOH TIP B . 
D 2 HOH 323 848 771 HOH TIP B . 
D 2 HOH 324 849 775 HOH TIP B . 
D 2 HOH 325 850 777 HOH TIP B . 
D 2 HOH 326 851 785 HOH TIP B . 
D 2 HOH 327 852 786 HOH TIP B . 
D 2 HOH 328 853 791 HOH TIP B . 
D 2 HOH 329 854 792 HOH TIP B . 
D 2 HOH 330 855 793 HOH TIP B . 
D 2 HOH 331 856 795 HOH TIP B . 
D 2 HOH 332 857 796 HOH TIP B . 
D 2 HOH 333 858 801 HOH TIP B . 
D 2 HOH 334 859 803 HOH TIP B . 
D 2 HOH 335 860 804 HOH TIP B . 
D 2 HOH 336 861 805 HOH TIP B . 
D 2 HOH 337 862 811 HOH TIP B . 
D 2 HOH 338 863 814 HOH TIP B . 
D 2 HOH 339 864 815 HOH TIP B . 
D 2 HOH 340 865 818 HOH TIP B . 
D 2 HOH 341 866 819 HOH TIP B . 
D 2 HOH 342 867 820 HOH TIP B . 
D 2 HOH 343 868 824 HOH TIP B . 
D 2 HOH 344 869 825 HOH TIP B . 
D 2 HOH 345 870 826 HOH TIP B . 
D 2 HOH 346 871 827 HOH TIP B . 
D 2 HOH 347 872 828 HOH TIP B . 
D 2 HOH 348 873 830 HOH TIP B . 
D 2 HOH 349 874 833 HOH TIP B . 
D 2 HOH 350 875 834 HOH TIP B . 
D 2 HOH 351 876 837 HOH TIP B . 
D 2 HOH 352 877 838 HOH TIP B . 
D 2 HOH 353 878 841 HOH TIP B . 
D 2 HOH 354 879 842 HOH TIP B . 
D 2 HOH 355 880 843 HOH TIP B . 
D 2 HOH 356 881 845 HOH TIP B . 
D 2 HOH 357 882 846 HOH TIP B . 
D 2 HOH 358 883 847 HOH TIP B . 
D 2 HOH 359 884 849 HOH TIP B . 
D 2 HOH 360 885 850 HOH TIP B . 
D 2 HOH 361 886 854 HOH TIP B . 
D 2 HOH 362 887 856 HOH TIP B . 
D 2 HOH 363 888 858 HOH TIP B . 
D 2 HOH 364 889 859 HOH TIP B . 
D 2 HOH 365 890 861 HOH TIP B . 
D 2 HOH 366 891 862 HOH TIP B . 
D 2 HOH 367 892 863 HOH TIP B . 
D 2 HOH 368 893 864 HOH TIP B . 
D 2 HOH 369 894 866 HOH TIP B . 
D 2 HOH 370 895 867 HOH TIP B . 
D 2 HOH 371 896 869 HOH TIP B . 
D 2 HOH 372 897 871 HOH TIP B . 
D 2 HOH 373 898 881 HOH TIP B . 
D 2 HOH 374 899 884 HOH TIP B . 
D 2 HOH 375 900 887 HOH TIP B . 
D 2 HOH 376 901 889 HOH TIP B . 
D 2 HOH 377 902 890 HOH TIP B . 
D 2 HOH 378 903 893 HOH TIP B . 
D 2 HOH 379 904 894 HOH TIP B . 
D 2 HOH 380 905 896 HOH TIP B . 
D 2 HOH 381 906 898 HOH TIP B . 
D 2 HOH 382 907 902 HOH TIP B . 
D 2 HOH 383 908 903 HOH TIP B . 
#