data_1KEK
# 
_entry.id   1KEK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KEK         
RCSB  RCSB014871   
WWPDB D_1000014871 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1B0P '1B0P is the native structure.'    unspecified 
PDB 2PDA '2PDA is complexed with pyruvate.' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KEK 
_pdbx_database_status.recvd_initial_deposition_date   2001-11-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chabriere, E.'          1 
'Vernede, X.'            2 
'Guigliarelli, B.'       3 
'Charon, M.-H.'          4 
'Hatchikian, E.C.'       5 
'Fontecilla-Camps, J.C.' 6 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            294 
_citation.page_first                2559 
_citation.page_last                 2563 
_citation.year                      2001 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11752578 
_citation.pdbx_database_id_DOI      10.1126/science.1066198 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chabriere, E.'          1 
primary 'Vernede, X.'            2 
primary 'Guigliarelli, B.'       3 
primary 'Charon, M.H.'           4 
primary 'Hatchikian, E.C.'       5 
primary 'Fontecilla-Camps, J.C.' 6 
# 
_cell.entry_id           1KEK 
_cell.length_a           86.110 
_cell.length_b           145.760 
_cell.length_c           210.260 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KEK 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Pyruvate-Ferredoxin Oxidoreductase' 133703.906 2    1.2.7.1 ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'                      24.305     2    ?       ? ? ? 
3 non-polymer syn 'CALCIUM ION'                        40.078     2    ?       ? ? ? 
4 non-polymer syn 'IRON/SULFUR CLUSTER'                351.640    6    ?       ? ? ? 
5 non-polymer syn '2-ACETYL-THIAMINE DIPHOSPHATE'      467.351    2    ?       ? ? ? 
6 non-polymer syn 'CARBON DIOXIDE'                     44.010     2    ?       ? ? ? 
7 water       nat water                                18.015     1893 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GKKMMTTDGNTATAHVAYAMSEVAAIYPITPSSTMGEEADDWAAQGRKNIFGQTLTIREMQSEAGAAGAVHGALAAGALT
TTFTASQGLLLMIPNMYKISGELLPGVFHVTARAIAAHALSIFGDHQDIYAARQTGFAMLASSSVQEAHDMALVAHLAAI
ESNVPFMHFFDGFRTSHEIQKIEVLDYADMASLVNQKALAEFRAKSMNPEHPHVRGTAQNPDIYFQGREAANPYYLKVPG
IVAEYMQKVASLTGRSYKLFDYVGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASA
KVITVLDRTKEPGAPGDPLYLDVCSAFVERGEAMPKILAGRYGLGSKEFSPAMVKSVYDNMSGAKKNHFTVGIEDDVTGT
SLPVDNAFADTTPKGTIQCQFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKPIQSTYLV
NRADYVACHNPAYVGIYDILEGIKDGGTFVLNSPWSSLEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDVGLGGRINM
IMQTAFFKLAGVLPFEKAVDLLKKSIHKAYGKKGEKIVKMNTDAVDQAVTSLQEFKYPDSWKDAPAETKAEPMTNEFFKN
VVKPILTQQGDKLPVSAFEADGRFPLGTSQFEKRGVAINVPQWVPENCIQCNQCAFVCPHSAILPVLAKEEELVGAPANF
TALEAKGKELKGYKFRIQINTLDCMGCGNCADICPPKEKALVMQPLDTQRDAQVPNLEYAARIPVKSEVLPRDSLKGSQF
QEPLMEFSGACSGCGETPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTNRLGQGPAWGNSLFEDAAEYGFGMNM
SMFARRTHLADLAAKALESDASGDVKEALQGWLAGKNDPIKSKEYGDKLKKLLAGQKDGLLGQIAAMSDLYTKKSVWIFG
GDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAGKRTGKKDLARMVMTYGYVYVATVS
MGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGMGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAPD
GSVEEFLMAQNRFAVLDRSFPEDAKRLRAQVAHELDVRFKELEHMAATNIFESFAPAGGKADGSVDFGEGAEFCTRDDTP
MMARPDSGEACDQNRAGTSEQQGDLSKRTKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GKKMMTTDGNTATAHVAYAMSEVAAIYPITPSSTMGEEADDWAAQGRKNIFGQTLTIREMQSEAGAAGAVHGALAAGALT
TTFTASQGLLLMIPNMYKISGELLPGVFHVTARAIAAHALSIFGDHQDIYAARQTGFAMLASSSVQEAHDMALVAHLAAI
ESNVPFMHFFDGFRTSHEIQKIEVLDYADMASLVNQKALAEFRAKSMNPEHPHVRGTAQNPDIYFQGREAANPYYLKVPG
IVAEYMQKVASLTGRSYKLFDYVGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASA
KVITVLDRTKEPGAPGDPLYLDVCSAFVERGEAMPKILAGRYGLGSKEFSPAMVKSVYDNMSGAKKNHFTVGIEDDVTGT
SLPVDNAFADTTPKGTIQCQFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKPIQSTYLV
NRADYVACHNPAYVGIYDILEGIKDGGTFVLNSPWSSLEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDVGLGGRINM
IMQTAFFKLAGVLPFEKAVDLLKKSIHKAYGKKGEKIVKMNTDAVDQAVTSLQEFKYPDSWKDAPAETKAEPMTNEFFKN
VVKPILTQQGDKLPVSAFEADGRFPLGTSQFEKRGVAINVPQWVPENCIQCNQCAFVCPHSAILPVLAKEEELVGAPANF
TALEAKGKELKGYKFRIQINTLDCMGCGNCADICPPKEKALVMQPLDTQRDAQVPNLEYAARIPVKSEVLPRDSLKGSQF
QEPLMEFSGACSGCGETPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTNRLGQGPAWGNSLFEDAAEYGFGMNM
SMFARRTHLADLAAKALESDASGDVKEALQGWLAGKNDPIKSKEYGDKLKKLLAGQKDGLLGQIAAMSDLYTKKSVWIFG
GDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAGKRTGKKDLARMVMTYGYVYVATVS
MGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGMGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAPD
GSVEEFLMAQNRFAVLDRSFPEDAKRLRAQVAHELDVRFKELEHMAATNIFESFAPAGGKADGSVDFGEGAEFCTRDDTP
MMARPDSGEACDQNRAGTSEQQGDLSKRTKK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    GLY n 
1 2    LYS n 
1 3    LYS n 
1 4    MET n 
1 5    MET n 
1 6    THR n 
1 7    THR n 
1 8    ASP n 
1 9    GLY n 
1 10   ASN n 
1 11   THR n 
1 12   ALA n 
1 13   THR n 
1 14   ALA n 
1 15   HIS n 
1 16   VAL n 
1 17   ALA n 
1 18   TYR n 
1 19   ALA n 
1 20   MET n 
1 21   SER n 
1 22   GLU n 
1 23   VAL n 
1 24   ALA n 
1 25   ALA n 
1 26   ILE n 
1 27   TYR n 
1 28   PRO n 
1 29   ILE n 
1 30   THR n 
1 31   PRO n 
1 32   SER n 
1 33   SER n 
1 34   THR n 
1 35   MET n 
1 36   GLY n 
1 37   GLU n 
1 38   GLU n 
1 39   ALA n 
1 40   ASP n 
1 41   ASP n 
1 42   TRP n 
1 43   ALA n 
1 44   ALA n 
1 45   GLN n 
1 46   GLY n 
1 47   ARG n 
1 48   LYS n 
1 49   ASN n 
1 50   ILE n 
1 51   PHE n 
1 52   GLY n 
1 53   GLN n 
1 54   THR n 
1 55   LEU n 
1 56   THR n 
1 57   ILE n 
1 58   ARG n 
1 59   GLU n 
1 60   MET n 
1 61   GLN n 
1 62   SER n 
1 63   GLU n 
1 64   ALA n 
1 65   GLY n 
1 66   ALA n 
1 67   ALA n 
1 68   GLY n 
1 69   ALA n 
1 70   VAL n 
1 71   HIS n 
1 72   GLY n 
1 73   ALA n 
1 74   LEU n 
1 75   ALA n 
1 76   ALA n 
1 77   GLY n 
1 78   ALA n 
1 79   LEU n 
1 80   THR n 
1 81   THR n 
1 82   THR n 
1 83   PHE n 
1 84   THR n 
1 85   ALA n 
1 86   SER n 
1 87   GLN n 
1 88   GLY n 
1 89   LEU n 
1 90   LEU n 
1 91   LEU n 
1 92   MET n 
1 93   ILE n 
1 94   PRO n 
1 95   ASN n 
1 96   MET n 
1 97   TYR n 
1 98   LYS n 
1 99   ILE n 
1 100  SER n 
1 101  GLY n 
1 102  GLU n 
1 103  LEU n 
1 104  LEU n 
1 105  PRO n 
1 106  GLY n 
1 107  VAL n 
1 108  PHE n 
1 109  HIS n 
1 110  VAL n 
1 111  THR n 
1 112  ALA n 
1 113  ARG n 
1 114  ALA n 
1 115  ILE n 
1 116  ALA n 
1 117  ALA n 
1 118  HIS n 
1 119  ALA n 
1 120  LEU n 
1 121  SER n 
1 122  ILE n 
1 123  PHE n 
1 124  GLY n 
1 125  ASP n 
1 126  HIS n 
1 127  GLN n 
1 128  ASP n 
1 129  ILE n 
1 130  TYR n 
1 131  ALA n 
1 132  ALA n 
1 133  ARG n 
1 134  GLN n 
1 135  THR n 
1 136  GLY n 
1 137  PHE n 
1 138  ALA n 
1 139  MET n 
1 140  LEU n 
1 141  ALA n 
1 142  SER n 
1 143  SER n 
1 144  SER n 
1 145  VAL n 
1 146  GLN n 
1 147  GLU n 
1 148  ALA n 
1 149  HIS n 
1 150  ASP n 
1 151  MET n 
1 152  ALA n 
1 153  LEU n 
1 154  VAL n 
1 155  ALA n 
1 156  HIS n 
1 157  LEU n 
1 158  ALA n 
1 159  ALA n 
1 160  ILE n 
1 161  GLU n 
1 162  SER n 
1 163  ASN n 
1 164  VAL n 
1 165  PRO n 
1 166  PHE n 
1 167  MET n 
1 168  HIS n 
1 169  PHE n 
1 170  PHE n 
1 171  ASP n 
1 172  GLY n 
1 173  PHE n 
1 174  ARG n 
1 175  THR n 
1 176  SER n 
1 177  HIS n 
1 178  GLU n 
1 179  ILE n 
1 180  GLN n 
1 181  LYS n 
1 182  ILE n 
1 183  GLU n 
1 184  VAL n 
1 185  LEU n 
1 186  ASP n 
1 187  TYR n 
1 188  ALA n 
1 189  ASP n 
1 190  MET n 
1 191  ALA n 
1 192  SER n 
1 193  LEU n 
1 194  VAL n 
1 195  ASN n 
1 196  GLN n 
1 197  LYS n 
1 198  ALA n 
1 199  LEU n 
1 200  ALA n 
1 201  GLU n 
1 202  PHE n 
1 203  ARG n 
1 204  ALA n 
1 205  LYS n 
1 206  SER n 
1 207  MET n 
1 208  ASN n 
1 209  PRO n 
1 210  GLU n 
1 211  HIS n 
1 212  PRO n 
1 213  HIS n 
1 214  VAL n 
1 215  ARG n 
1 216  GLY n 
1 217  THR n 
1 218  ALA n 
1 219  GLN n 
1 220  ASN n 
1 221  PRO n 
1 222  ASP n 
1 223  ILE n 
1 224  TYR n 
1 225  PHE n 
1 226  GLN n 
1 227  GLY n 
1 228  ARG n 
1 229  GLU n 
1 230  ALA n 
1 231  ALA n 
1 232  ASN n 
1 233  PRO n 
1 234  TYR n 
1 235  TYR n 
1 236  LEU n 
1 237  LYS n 
1 238  VAL n 
1 239  PRO n 
1 240  GLY n 
1 241  ILE n 
1 242  VAL n 
1 243  ALA n 
1 244  GLU n 
1 245  TYR n 
1 246  MET n 
1 247  GLN n 
1 248  LYS n 
1 249  VAL n 
1 250  ALA n 
1 251  SER n 
1 252  LEU n 
1 253  THR n 
1 254  GLY n 
1 255  ARG n 
1 256  SER n 
1 257  TYR n 
1 258  LYS n 
1 259  LEU n 
1 260  PHE n 
1 261  ASP n 
1 262  TYR n 
1 263  VAL n 
1 264  GLY n 
1 265  ALA n 
1 266  PRO n 
1 267  ASP n 
1 268  ALA n 
1 269  GLU n 
1 270  ARG n 
1 271  VAL n 
1 272  ILE n 
1 273  VAL n 
1 274  SER n 
1 275  MET n 
1 276  GLY n 
1 277  SER n 
1 278  SER n 
1 279  CYS n 
1 280  GLU n 
1 281  THR n 
1 282  ILE n 
1 283  GLU n 
1 284  GLU n 
1 285  VAL n 
1 286  ILE n 
1 287  ASN n 
1 288  HIS n 
1 289  LEU n 
1 290  ALA n 
1 291  ALA n 
1 292  LYS n 
1 293  GLY n 
1 294  GLU n 
1 295  LYS n 
1 296  ILE n 
1 297  GLY n 
1 298  LEU n 
1 299  ILE n 
1 300  LYS n 
1 301  VAL n 
1 302  ARG n 
1 303  LEU n 
1 304  TYR n 
1 305  ARG n 
1 306  PRO n 
1 307  PHE n 
1 308  VAL n 
1 309  SER n 
1 310  GLU n 
1 311  ALA n 
1 312  PHE n 
1 313  PHE n 
1 314  ALA n 
1 315  ALA n 
1 316  LEU n 
1 317  PRO n 
1 318  ALA n 
1 319  SER n 
1 320  ALA n 
1 321  LYS n 
1 322  VAL n 
1 323  ILE n 
1 324  THR n 
1 325  VAL n 
1 326  LEU n 
1 327  ASP n 
1 328  ARG n 
1 329  THR n 
1 330  LYS n 
1 331  GLU n 
1 332  PRO n 
1 333  GLY n 
1 334  ALA n 
1 335  PRO n 
1 336  GLY n 
1 337  ASP n 
1 338  PRO n 
1 339  LEU n 
1 340  TYR n 
1 341  LEU n 
1 342  ASP n 
1 343  VAL n 
1 344  CYS n 
1 345  SER n 
1 346  ALA n 
1 347  PHE n 
1 348  VAL n 
1 349  GLU n 
1 350  ARG n 
1 351  GLY n 
1 352  GLU n 
1 353  ALA n 
1 354  MET n 
1 355  PRO n 
1 356  LYS n 
1 357  ILE n 
1 358  LEU n 
1 359  ALA n 
1 360  GLY n 
1 361  ARG n 
1 362  TYR n 
1 363  GLY n 
1 364  LEU n 
1 365  GLY n 
1 366  SER n 
1 367  LYS n 
1 368  GLU n 
1 369  PHE n 
1 370  SER n 
1 371  PRO n 
1 372  ALA n 
1 373  MET n 
1 374  VAL n 
1 375  LYS n 
1 376  SER n 
1 377  VAL n 
1 378  TYR n 
1 379  ASP n 
1 380  ASN n 
1 381  MET n 
1 382  SER n 
1 383  GLY n 
1 384  ALA n 
1 385  LYS n 
1 386  LYS n 
1 387  ASN n 
1 388  HIS n 
1 389  PHE n 
1 390  THR n 
1 391  VAL n 
1 392  GLY n 
1 393  ILE n 
1 394  GLU n 
1 395  ASP n 
1 396  ASP n 
1 397  VAL n 
1 398  THR n 
1 399  GLY n 
1 400  THR n 
1 401  SER n 
1 402  LEU n 
1 403  PRO n 
1 404  VAL n 
1 405  ASP n 
1 406  ASN n 
1 407  ALA n 
1 408  PHE n 
1 409  ALA n 
1 410  ASP n 
1 411  THR n 
1 412  THR n 
1 413  PRO n 
1 414  LYS n 
1 415  GLY n 
1 416  THR n 
1 417  ILE n 
1 418  GLN n 
1 419  CYS n 
1 420  GLN n 
1 421  PHE n 
1 422  TRP n 
1 423  GLY n 
1 424  LEU n 
1 425  GLY n 
1 426  ALA n 
1 427  ASP n 
1 428  GLY n 
1 429  THR n 
1 430  VAL n 
1 431  GLY n 
1 432  ALA n 
1 433  ASN n 
1 434  LYS n 
1 435  GLN n 
1 436  ALA n 
1 437  ILE n 
1 438  LYS n 
1 439  ILE n 
1 440  ILE n 
1 441  GLY n 
1 442  ASP n 
1 443  ASN n 
1 444  THR n 
1 445  ASP n 
1 446  LEU n 
1 447  PHE n 
1 448  ALA n 
1 449  GLN n 
1 450  GLY n 
1 451  TYR n 
1 452  PHE n 
1 453  SER n 
1 454  TYR n 
1 455  ASP n 
1 456  SER n 
1 457  LYS n 
1 458  LYS n 
1 459  SER n 
1 460  GLY n 
1 461  GLY n 
1 462  ILE n 
1 463  THR n 
1 464  ILE n 
1 465  SER n 
1 466  HIS n 
1 467  LEU n 
1 468  ARG n 
1 469  PHE n 
1 470  GLY n 
1 471  GLU n 
1 472  LYS n 
1 473  PRO n 
1 474  ILE n 
1 475  GLN n 
1 476  SER n 
1 477  THR n 
1 478  TYR n 
1 479  LEU n 
1 480  VAL n 
1 481  ASN n 
1 482  ARG n 
1 483  ALA n 
1 484  ASP n 
1 485  TYR n 
1 486  VAL n 
1 487  ALA n 
1 488  CYS n 
1 489  HIS n 
1 490  ASN n 
1 491  PRO n 
1 492  ALA n 
1 493  TYR n 
1 494  VAL n 
1 495  GLY n 
1 496  ILE n 
1 497  TYR n 
1 498  ASP n 
1 499  ILE n 
1 500  LEU n 
1 501  GLU n 
1 502  GLY n 
1 503  ILE n 
1 504  LYS n 
1 505  ASP n 
1 506  GLY n 
1 507  GLY n 
1 508  THR n 
1 509  PHE n 
1 510  VAL n 
1 511  LEU n 
1 512  ASN n 
1 513  SER n 
1 514  PRO n 
1 515  TRP n 
1 516  SER n 
1 517  SER n 
1 518  LEU n 
1 519  GLU n 
1 520  ASP n 
1 521  MET n 
1 522  ASP n 
1 523  LYS n 
1 524  HIS n 
1 525  LEU n 
1 526  PRO n 
1 527  SER n 
1 528  GLY n 
1 529  ILE n 
1 530  LYS n 
1 531  ARG n 
1 532  THR n 
1 533  ILE n 
1 534  ALA n 
1 535  ASN n 
1 536  LYS n 
1 537  LYS n 
1 538  LEU n 
1 539  LYS n 
1 540  PHE n 
1 541  TYR n 
1 542  ASN n 
1 543  ILE n 
1 544  ASP n 
1 545  ALA n 
1 546  VAL n 
1 547  LYS n 
1 548  ILE n 
1 549  ALA n 
1 550  THR n 
1 551  ASP n 
1 552  VAL n 
1 553  GLY n 
1 554  LEU n 
1 555  GLY n 
1 556  GLY n 
1 557  ARG n 
1 558  ILE n 
1 559  ASN n 
1 560  MET n 
1 561  ILE n 
1 562  MET n 
1 563  GLN n 
1 564  THR n 
1 565  ALA n 
1 566  PHE n 
1 567  PHE n 
1 568  LYS n 
1 569  LEU n 
1 570  ALA n 
1 571  GLY n 
1 572  VAL n 
1 573  LEU n 
1 574  PRO n 
1 575  PHE n 
1 576  GLU n 
1 577  LYS n 
1 578  ALA n 
1 579  VAL n 
1 580  ASP n 
1 581  LEU n 
1 582  LEU n 
1 583  LYS n 
1 584  LYS n 
1 585  SER n 
1 586  ILE n 
1 587  HIS n 
1 588  LYS n 
1 589  ALA n 
1 590  TYR n 
1 591  GLY n 
1 592  LYS n 
1 593  LYS n 
1 594  GLY n 
1 595  GLU n 
1 596  LYS n 
1 597  ILE n 
1 598  VAL n 
1 599  LYS n 
1 600  MET n 
1 601  ASN n 
1 602  THR n 
1 603  ASP n 
1 604  ALA n 
1 605  VAL n 
1 606  ASP n 
1 607  GLN n 
1 608  ALA n 
1 609  VAL n 
1 610  THR n 
1 611  SER n 
1 612  LEU n 
1 613  GLN n 
1 614  GLU n 
1 615  PHE n 
1 616  LYS n 
1 617  TYR n 
1 618  PRO n 
1 619  ASP n 
1 620  SER n 
1 621  TRP n 
1 622  LYS n 
1 623  ASP n 
1 624  ALA n 
1 625  PRO n 
1 626  ALA n 
1 627  GLU n 
1 628  THR n 
1 629  LYS n 
1 630  ALA n 
1 631  GLU n 
1 632  PRO n 
1 633  MET n 
1 634  THR n 
1 635  ASN n 
1 636  GLU n 
1 637  PHE n 
1 638  PHE n 
1 639  LYS n 
1 640  ASN n 
1 641  VAL n 
1 642  VAL n 
1 643  LYS n 
1 644  PRO n 
1 645  ILE n 
1 646  LEU n 
1 647  THR n 
1 648  GLN n 
1 649  GLN n 
1 650  GLY n 
1 651  ASP n 
1 652  LYS n 
1 653  LEU n 
1 654  PRO n 
1 655  VAL n 
1 656  SER n 
1 657  ALA n 
1 658  PHE n 
1 659  GLU n 
1 660  ALA n 
1 661  ASP n 
1 662  GLY n 
1 663  ARG n 
1 664  PHE n 
1 665  PRO n 
1 666  LEU n 
1 667  GLY n 
1 668  THR n 
1 669  SER n 
1 670  GLN n 
1 671  PHE n 
1 672  GLU n 
1 673  LYS n 
1 674  ARG n 
1 675  GLY n 
1 676  VAL n 
1 677  ALA n 
1 678  ILE n 
1 679  ASN n 
1 680  VAL n 
1 681  PRO n 
1 682  GLN n 
1 683  TRP n 
1 684  VAL n 
1 685  PRO n 
1 686  GLU n 
1 687  ASN n 
1 688  CYS n 
1 689  ILE n 
1 690  GLN n 
1 691  CYS n 
1 692  ASN n 
1 693  GLN n 
1 694  CYS n 
1 695  ALA n 
1 696  PHE n 
1 697  VAL n 
1 698  CYS n 
1 699  PRO n 
1 700  HIS n 
1 701  SER n 
1 702  ALA n 
1 703  ILE n 
1 704  LEU n 
1 705  PRO n 
1 706  VAL n 
1 707  LEU n 
1 708  ALA n 
1 709  LYS n 
1 710  GLU n 
1 711  GLU n 
1 712  GLU n 
1 713  LEU n 
1 714  VAL n 
1 715  GLY n 
1 716  ALA n 
1 717  PRO n 
1 718  ALA n 
1 719  ASN n 
1 720  PHE n 
1 721  THR n 
1 722  ALA n 
1 723  LEU n 
1 724  GLU n 
1 725  ALA n 
1 726  LYS n 
1 727  GLY n 
1 728  LYS n 
1 729  GLU n 
1 730  LEU n 
1 731  LYS n 
1 732  GLY n 
1 733  TYR n 
1 734  LYS n 
1 735  PHE n 
1 736  ARG n 
1 737  ILE n 
1 738  GLN n 
1 739  ILE n 
1 740  ASN n 
1 741  THR n 
1 742  LEU n 
1 743  ASP n 
1 744  CYS n 
1 745  MET n 
1 746  GLY n 
1 747  CYS n 
1 748  GLY n 
1 749  ASN n 
1 750  CYS n 
1 751  ALA n 
1 752  ASP n 
1 753  ILE n 
1 754  CYS n 
1 755  PRO n 
1 756  PRO n 
1 757  LYS n 
1 758  GLU n 
1 759  LYS n 
1 760  ALA n 
1 761  LEU n 
1 762  VAL n 
1 763  MET n 
1 764  GLN n 
1 765  PRO n 
1 766  LEU n 
1 767  ASP n 
1 768  THR n 
1 769  GLN n 
1 770  ARG n 
1 771  ASP n 
1 772  ALA n 
1 773  GLN n 
1 774  VAL n 
1 775  PRO n 
1 776  ASN n 
1 777  LEU n 
1 778  GLU n 
1 779  TYR n 
1 780  ALA n 
1 781  ALA n 
1 782  ARG n 
1 783  ILE n 
1 784  PRO n 
1 785  VAL n 
1 786  LYS n 
1 787  SER n 
1 788  GLU n 
1 789  VAL n 
1 790  LEU n 
1 791  PRO n 
1 792  ARG n 
1 793  ASP n 
1 794  SER n 
1 795  LEU n 
1 796  LYS n 
1 797  GLY n 
1 798  SER n 
1 799  GLN n 
1 800  PHE n 
1 801  GLN n 
1 802  GLU n 
1 803  PRO n 
1 804  LEU n 
1 805  MET n 
1 806  GLU n 
1 807  PHE n 
1 808  SER n 
1 809  GLY n 
1 810  ALA n 
1 811  CYS n 
1 812  SER n 
1 813  GLY n 
1 814  CYS n 
1 815  GLY n 
1 816  GLU n 
1 817  THR n 
1 818  PRO n 
1 819  TYR n 
1 820  VAL n 
1 821  ARG n 
1 822  VAL n 
1 823  ILE n 
1 824  THR n 
1 825  GLN n 
1 826  LEU n 
1 827  PHE n 
1 828  GLY n 
1 829  GLU n 
1 830  ARG n 
1 831  MET n 
1 832  PHE n 
1 833  ILE n 
1 834  ALA n 
1 835  ASN n 
1 836  ALA n 
1 837  THR n 
1 838  GLY n 
1 839  CYS n 
1 840  SER n 
1 841  SER n 
1 842  ILE n 
1 843  TRP n 
1 844  GLY n 
1 845  ALA n 
1 846  SER n 
1 847  ALA n 
1 848  PRO n 
1 849  SER n 
1 850  MET n 
1 851  PRO n 
1 852  TYR n 
1 853  LYS n 
1 854  THR n 
1 855  ASN n 
1 856  ARG n 
1 857  LEU n 
1 858  GLY n 
1 859  GLN n 
1 860  GLY n 
1 861  PRO n 
1 862  ALA n 
1 863  TRP n 
1 864  GLY n 
1 865  ASN n 
1 866  SER n 
1 867  LEU n 
1 868  PHE n 
1 869  GLU n 
1 870  ASP n 
1 871  ALA n 
1 872  ALA n 
1 873  GLU n 
1 874  TYR n 
1 875  GLY n 
1 876  PHE n 
1 877  GLY n 
1 878  MET n 
1 879  ASN n 
1 880  MET n 
1 881  SER n 
1 882  MET n 
1 883  PHE n 
1 884  ALA n 
1 885  ARG n 
1 886  ARG n 
1 887  THR n 
1 888  HIS n 
1 889  LEU n 
1 890  ALA n 
1 891  ASP n 
1 892  LEU n 
1 893  ALA n 
1 894  ALA n 
1 895  LYS n 
1 896  ALA n 
1 897  LEU n 
1 898  GLU n 
1 899  SER n 
1 900  ASP n 
1 901  ALA n 
1 902  SER n 
1 903  GLY n 
1 904  ASP n 
1 905  VAL n 
1 906  LYS n 
1 907  GLU n 
1 908  ALA n 
1 909  LEU n 
1 910  GLN n 
1 911  GLY n 
1 912  TRP n 
1 913  LEU n 
1 914  ALA n 
1 915  GLY n 
1 916  LYS n 
1 917  ASN n 
1 918  ASP n 
1 919  PRO n 
1 920  ILE n 
1 921  LYS n 
1 922  SER n 
1 923  LYS n 
1 924  GLU n 
1 925  TYR n 
1 926  GLY n 
1 927  ASP n 
1 928  LYS n 
1 929  LEU n 
1 930  LYS n 
1 931  LYS n 
1 932  LEU n 
1 933  LEU n 
1 934  ALA n 
1 935  GLY n 
1 936  GLN n 
1 937  LYS n 
1 938  ASP n 
1 939  GLY n 
1 940  LEU n 
1 941  LEU n 
1 942  GLY n 
1 943  GLN n 
1 944  ILE n 
1 945  ALA n 
1 946  ALA n 
1 947  MET n 
1 948  SER n 
1 949  ASP n 
1 950  LEU n 
1 951  TYR n 
1 952  THR n 
1 953  LYS n 
1 954  LYS n 
1 955  SER n 
1 956  VAL n 
1 957  TRP n 
1 958  ILE n 
1 959  PHE n 
1 960  GLY n 
1 961  GLY n 
1 962  ASP n 
1 963  GLY n 
1 964  TRP n 
1 965  ALA n 
1 966  TYR n 
1 967  ASP n 
1 968  ILE n 
1 969  GLY n 
1 970  TYR n 
1 971  GLY n 
1 972  GLY n 
1 973  LEU n 
1 974  ASP n 
1 975  HIS n 
1 976  VAL n 
1 977  LEU n 
1 978  ALA n 
1 979  SER n 
1 980  GLY n 
1 981  GLU n 
1 982  ASP n 
1 983  VAL n 
1 984  ASN n 
1 985  VAL n 
1 986  PHE n 
1 987  VAL n 
1 988  MET n 
1 989  ASP n 
1 990  THR n 
1 991  GLU n 
1 992  VAL n 
1 993  TYR n 
1 994  SER n 
1 995  ASN n 
1 996  THR n 
1 997  GLY n 
1 998  GLY n 
1 999  GLN n 
1 1000 SER n 
1 1001 SER n 
1 1002 LYS n 
1 1003 ALA n 
1 1004 THR n 
1 1005 PRO n 
1 1006 THR n 
1 1007 GLY n 
1 1008 ALA n 
1 1009 VAL n 
1 1010 ALA n 
1 1011 LYS n 
1 1012 PHE n 
1 1013 ALA n 
1 1014 ALA n 
1 1015 ALA n 
1 1016 GLY n 
1 1017 LYS n 
1 1018 ARG n 
1 1019 THR n 
1 1020 GLY n 
1 1021 LYS n 
1 1022 LYS n 
1 1023 ASP n 
1 1024 LEU n 
1 1025 ALA n 
1 1026 ARG n 
1 1027 MET n 
1 1028 VAL n 
1 1029 MET n 
1 1030 THR n 
1 1031 TYR n 
1 1032 GLY n 
1 1033 TYR n 
1 1034 VAL n 
1 1035 TYR n 
1 1036 VAL n 
1 1037 ALA n 
1 1038 THR n 
1 1039 VAL n 
1 1040 SER n 
1 1041 MET n 
1 1042 GLY n 
1 1043 TYR n 
1 1044 SER n 
1 1045 LYS n 
1 1046 GLN n 
1 1047 GLN n 
1 1048 PHE n 
1 1049 LEU n 
1 1050 LYS n 
1 1051 VAL n 
1 1052 LEU n 
1 1053 LYS n 
1 1054 GLU n 
1 1055 ALA n 
1 1056 GLU n 
1 1057 SER n 
1 1058 PHE n 
1 1059 PRO n 
1 1060 GLY n 
1 1061 PRO n 
1 1062 SER n 
1 1063 LEU n 
1 1064 VAL n 
1 1065 ILE n 
1 1066 ALA n 
1 1067 TYR n 
1 1068 ALA n 
1 1069 THR n 
1 1070 CYS n 
1 1071 ILE n 
1 1072 ASN n 
1 1073 GLN n 
1 1074 GLY n 
1 1075 LEU n 
1 1076 ARG n 
1 1077 LYS n 
1 1078 GLY n 
1 1079 MET n 
1 1080 GLY n 
1 1081 LYS n 
1 1082 SER n 
1 1083 GLN n 
1 1084 ASP n 
1 1085 VAL n 
1 1086 MET n 
1 1087 ASN n 
1 1088 THR n 
1 1089 ALA n 
1 1090 VAL n 
1 1091 LYS n 
1 1092 SER n 
1 1093 GLY n 
1 1094 TYR n 
1 1095 TRP n 
1 1096 PRO n 
1 1097 LEU n 
1 1098 PHE n 
1 1099 ARG n 
1 1100 TYR n 
1 1101 ASP n 
1 1102 PRO n 
1 1103 ARG n 
1 1104 LEU n 
1 1105 ALA n 
1 1106 ALA n 
1 1107 GLN n 
1 1108 GLY n 
1 1109 LYS n 
1 1110 ASN n 
1 1111 PRO n 
1 1112 PHE n 
1 1113 GLN n 
1 1114 LEU n 
1 1115 ASP n 
1 1116 SER n 
1 1117 LYS n 
1 1118 ALA n 
1 1119 PRO n 
1 1120 ASP n 
1 1121 GLY n 
1 1122 SER n 
1 1123 VAL n 
1 1124 GLU n 
1 1125 GLU n 
1 1126 PHE n 
1 1127 LEU n 
1 1128 MET n 
1 1129 ALA n 
1 1130 GLN n 
1 1131 ASN n 
1 1132 ARG n 
1 1133 PHE n 
1 1134 ALA n 
1 1135 VAL n 
1 1136 LEU n 
1 1137 ASP n 
1 1138 ARG n 
1 1139 SER n 
1 1140 PHE n 
1 1141 PRO n 
1 1142 GLU n 
1 1143 ASP n 
1 1144 ALA n 
1 1145 LYS n 
1 1146 ARG n 
1 1147 LEU n 
1 1148 ARG n 
1 1149 ALA n 
1 1150 GLN n 
1 1151 VAL n 
1 1152 ALA n 
1 1153 HIS n 
1 1154 GLU n 
1 1155 LEU n 
1 1156 ASP n 
1 1157 VAL n 
1 1158 ARG n 
1 1159 PHE n 
1 1160 LYS n 
1 1161 GLU n 
1 1162 LEU n 
1 1163 GLU n 
1 1164 HIS n 
1 1165 MET n 
1 1166 ALA n 
1 1167 ALA n 
1 1168 THR n 
1 1169 ASN n 
1 1170 ILE n 
1 1171 PHE n 
1 1172 GLU n 
1 1173 SER n 
1 1174 PHE n 
1 1175 ALA n 
1 1176 PRO n 
1 1177 ALA n 
1 1178 GLY n 
1 1179 GLY n 
1 1180 LYS n 
1 1181 ALA n 
1 1182 ASP n 
1 1183 GLY n 
1 1184 SER n 
1 1185 VAL n 
1 1186 ASP n 
1 1187 PHE n 
1 1188 GLY n 
1 1189 GLU n 
1 1190 GLY n 
1 1191 ALA n 
1 1192 GLU n 
1 1193 PHE n 
1 1194 CYS n 
1 1195 THR n 
1 1196 ARG n 
1 1197 ASP n 
1 1198 ASP n 
1 1199 THR n 
1 1200 PRO n 
1 1201 MET n 
1 1202 MET n 
1 1203 ALA n 
1 1204 ARG n 
1 1205 PRO n 
1 1206 ASP n 
1 1207 SER n 
1 1208 GLY n 
1 1209 GLU n 
1 1210 ALA n 
1 1211 CYS n 
1 1212 ASP n 
1 1213 GLN n 
1 1214 ASN n 
1 1215 ARG n 
1 1216 ALA n 
1 1217 GLY n 
1 1218 THR n 
1 1219 SER n 
1 1220 GLU n 
1 1221 GLN n 
1 1222 GLN n 
1 1223 GLY n 
1 1224 ASP n 
1 1225 LEU n 
1 1226 SER n 
1 1227 LYS n 
1 1228 ARG n 
1 1229 THR n 
1 1230 LYS n 
1 1231 LYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Desulfovibrio africanus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      873 
_entity_src_nat.genus                      Desulfovibrio 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    P94692_DESAF 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GKKMMTTDGNTATAHVAYAMSEVAAIYPITPSSTMGEEADDWAAQGRKNIFGQTLTIREMQSEAGAAGAVHGALAAGALT
TTFTASQGLLLMIPNMYKISGELLPGVFHVTARAIAAHALSIFGDHQDIYAARQTGFAMLASSSVQEAHDMALVAHLAAI
ESNVPFMHFFDGFRTSHEIQKIEVLDYADMASLVNQKALAEFRAKSMNPEHPHVRGTAQNPDIYFQGREAANPYYLKVPG
IVAEYMQKVASLTGRSYKLFDYVGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASA
KVITVLDRTKEPGAPGDPLYLDVCSAFVERGEAMPKILAGRYGLGSKEFSPAMVKSVYDNMSGAKKNHFTVGIEDDVTGT
SLPVDNAFADTTPKGTIQCQFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKPIQSTYLV
NRADYVACHNPAYVGIYDILEGIKDGGTFVLNSPWSSLEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDVGLGGRINM
IMQTAFFKLAGVLPFEKAVDLLKKSIHKAYGKKGEKIVKMNTDAVDQAVTSLQEFKYPDSWKDAPAETKAEPMTNEFFKN
VVKPILTQQGDKLPVSAFEADGRFPLGTSQFEKRGVAINVPQWVPENCIQCNQCAFVCPHSAILPVLAKEEELVGAPANF
TALEAKGKELKGYKFRIQINTLDCMGCGNCADICPPKEKALVMQPLDTQRDAQVPNLEYAARIPVKSEVLPRDSLKGSQF
QEPLMEFSGACSGCGETPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTNRLGQGPAWGNSLFEDAAEYGFGMNM
SMFARRTHLADLAAKALESDASGDVKEALQGWLAGKNDPIKSKEYGDKLKKLLAGQKDGLLGQIAAMSDLYTKKSVWIFG
GDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAGKRTGKKDLARMVMTYGYVYVATVS
MGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGMGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAPD
GSVEEFLMAQNRFAVLDRSFPEDAKRLRAQVAHELDVRFKELEHMAATNIFESFAPAGGKADGSVDFGEGAEFCTRDDTP
MMARPDSGEACDQNRAGTSEQQGDLSKRTKK
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_accession          P94692 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KEK A 1 ? 1231 ? P94692 2 ? 1232 ? 2 1232 
2 1 1KEK B 1 ? 1231 ? P94692 2 ? 1232 ? 2 1232 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                         ? 'C3 H7 N O2'           89.093  
ARG 'L-peptide linking' y ARGININE                        ? 'C6 H15 N4 O2 1'       175.209 
ASN 'L-peptide linking' y ASPARAGINE                      ? 'C4 H8 N2 O3'          132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                 ? 'C4 H7 N O4'           133.103 
CA  non-polymer         . 'CALCIUM ION'                   ? 'Ca 2'                 40.078  
CO2 non-polymer         . 'CARBON DIOXIDE'                ? 'C O2'                 44.010  
CYS 'L-peptide linking' y CYSTEINE                        ? 'C3 H7 N O2 S'         121.158 
GLN 'L-peptide linking' y GLUTAMINE                       ? 'C5 H10 N2 O3'         146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                 ? 'C5 H9 N O4'           147.129 
GLY 'peptide linking'   y GLYCINE                         ? 'C2 H5 N O2'           75.067  
HIS 'L-peptide linking' y HISTIDINE                       ? 'C6 H10 N3 O2 1'       156.162 
HOH non-polymer         . WATER                           ? 'H2 O'                 18.015  
HTL non-polymer         . '2-ACETYL-THIAMINE DIPHOSPHATE' 
;2-ACETYL-3-[(4-AMINO-2-METHYL-5-PYRIMIDINYL)METHYL]-4-METHYL-5-(4,6,6-TRIHYDROXY-3,5-DIOXA-4,6-DIPHOSPHAHEX-1-YL)THIAZOLIUM INNER SALT P,P'-DIOXIDE
;
'C14 H21 N4 O8 P2 S 1' 467.351 
ILE 'L-peptide linking' y ISOLEUCINE                      ? 'C6 H13 N O2'          131.173 
LEU 'L-peptide linking' y LEUCINE                         ? 'C6 H13 N O2'          131.173 
LYS 'L-peptide linking' y LYSINE                          ? 'C6 H15 N2 O2 1'       147.195 
MET 'L-peptide linking' y METHIONINE                      ? 'C5 H11 N O2 S'        149.211 
MG  non-polymer         . 'MAGNESIUM ION'                 ? 'Mg 2'                 24.305  
PHE 'L-peptide linking' y PHENYLALANINE                   ? 'C9 H11 N O2'          165.189 
PRO 'L-peptide linking' y PROLINE                         ? 'C5 H9 N O2'           115.130 
SER 'L-peptide linking' y SERINE                          ? 'C3 H7 N O3'           105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER'           ? 'Fe4 S4'               351.640 
THR 'L-peptide linking' y THREONINE                       ? 'C4 H9 N O3'           119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                      ? 'C11 H12 N2 O2'        204.225 
TYR 'L-peptide linking' y TYROSINE                        ? 'C9 H11 N O3'          181.189 
VAL 'L-peptide linking' y VALINE                          ? 'C5 H11 N O2'          117.146 
# 
_exptl.entry_id          1KEK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.47 
_exptl_crystal.density_percent_sol   50.12 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9 
_exptl_crystal_grow.pdbx_details    'PEG 6000 10-15%, pH 9, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1998-12-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    diamond 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.005 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-3' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-3 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.005 
# 
_reflns.entry_id                     1KEK 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   11.6 
_reflns.d_resolution_low             27.38 
_reflns.d_resolution_high            1.9 
_reflns.number_obs                   216598 
_reflns.number_all                   216598 
_reflns.percent_possible_obs         94.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.084 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        16.2 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.87 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   97.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.293 
_reflns_shell.meanI_over_sigI_obs    1.4 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1KEK 
_refine.ls_number_reflns_obs                     210949 
_refine.ls_number_reflns_all                     210949 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               3963562.61 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             27.38 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    97.5 
_refine.ls_R_factor_obs                          0.178 
_refine.ls_R_factor_all                          0.178 
_refine.ls_R_factor_R_work                       0.178 
_refine.ls_R_factor_R_free                       0.227 
_refine.ls_R_factor_R_free_error                 0.002 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  10008 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               28.4 
_refine.aniso_B[1][1]                            -4.53 
_refine.aniso_B[2][2]                            1.34 
_refine.aniso_B[3][3]                            3.18 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.38557 
_refine.solvent_model_param_bsol                 79.3491 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;THIS REFINED SET DIFFERS SLIGHTLY FROM THE ONE REPORTED IN REF. FOR EXAMPLE, THE C2ALPHA-C2 DISTANCES OF THE RADICAL SPECIES DO NOT MATCH EXACTLY THE PUBLISHED ONES.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'X-PLOR + Home dictionary' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1KEK 
_refine_analyze.Luzzati_coordinate_error_obs    0.18 
_refine_analyze.Luzzati_sigma_a_obs             0.22 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.25 
_refine_analyze.Luzzati_sigma_a_free            0.27 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        18766 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         116 
_refine_hist.number_atoms_solvent             1893 
_refine_hist.number_atoms_total               20775 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        27.38 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.022 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        2.9   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 25.7  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 2.87  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        2.02 
_refine_ls_shell.number_reflns_R_work             29881 
_refine_ls_shell.R_factor_R_work                  0.263 
_refine_ls_shell.percent_reflns_obs               91.5 
_refine_ls_shell.R_factor_R_free                  0.324 
_refine_ls_shell.R_factor_R_free_error            0.008 
_refine_ls_shell.percent_reflns_R_free            4.9 
_refine_ls_shell.number_reflns_R_free             1525 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 PARA.INP          TOPO.INP    'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1KEK 
_struct.title                     'Crystal Structure of the Free Radical Intermediate of Pyruvate:Ferredoxin Oxidoreductase' 
_struct.pdbx_descriptor           'Pyruvate-Ferredoxin Oxidoreductase (E.C.1.2.7.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KEK 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'homodimer, 7 domains, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 2 ? 
K N N 3 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 5 ? 
P N N 6 ? 
Q N N 7 ? 
R N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY A 9    ? SER A 21   ? GLY A 10   SER A 22   1 ? 13 
HELX_P HELX_P2   2   SER A 32   ? GLY A 46   ? SER A 33   GLY A 47   1 ? 15 
HELX_P HELX_P3   3   SER A 62   ? ALA A 76   ? SER A 63   ALA A 77   1 ? 15 
HELX_P HELX_P4   4   ALA A 85   ? GLU A 102  ? ALA A 86   GLU A 103  1 ? 18 
HELX_P HELX_P5   5   HIS A 126  ? ALA A 132  ? HIS A 127  ALA A 133  1 ? 7  
HELX_P HELX_P6   6   SER A 144  ? ASN A 163  ? SER A 145  ASN A 164  1 ? 20 
HELX_P HELX_P7   7   ASP A 186  ? VAL A 194  ? ASP A 187  VAL A 195  1 ? 9  
HELX_P HELX_P8   8   ASN A 195  ? SER A 206  ? ASN A 196  SER A 207  1 ? 12 
HELX_P HELX_P9   9   ILE A 223  ? ALA A 230  ? ILE A 224  ALA A 231  1 ? 8  
HELX_P HELX_P10  10  ALA A 231  ? GLY A 254  ? ALA A 232  GLY A 255  1 ? 24 
HELX_P HELX_P11  11  SER A 277  ? ALA A 291  ? SER A 278  ALA A 292  1 ? 15 
HELX_P HELX_P12  12  VAL A 308  ? LEU A 316  ? VAL A 309  LEU A 317  1 ? 9  
HELX_P HELX_P13  13  ASP A 337  ? GLY A 351  ? ASP A 338  GLY A 352  1 ? 15 
HELX_P HELX_P14  14  GLY A 363  ? LYS A 367  ? GLY A 364  LYS A 368  5 ? 5  
HELX_P HELX_P15  15  SER A 370  ? GLY A 383  ? SER A 371  GLY A 384  1 ? 14 
HELX_P HELX_P16  16  GLY A 428  ? THR A 444  ? GLY A 429  THR A 445  1 ? 17 
HELX_P HELX_P17  17  ASN A 490  ? ILE A 496  ? ASN A 491  ILE A 497  5 ? 7  
HELX_P HELX_P18  18  SER A 517  ? LEU A 525  ? SER A 518  LEU A 526  1 ? 9  
HELX_P HELX_P19  19  PRO A 526  ? LYS A 536  ? PRO A 527  LYS A 537  1 ? 11 
HELX_P HELX_P20  20  ASP A 544  ? VAL A 552  ? ASP A 545  VAL A 553  1 ? 9  
HELX_P HELX_P21  21  ILE A 558  ? ALA A 570  ? ILE A 559  ALA A 571  1 ? 13 
HELX_P HELX_P22  22  PRO A 574  ? ALA A 589  ? PRO A 575  ALA A 590  1 ? 16 
HELX_P HELX_P23  23  GLU A 595  ? LEU A 612  ? GLU A 596  LEU A 613  1 ? 18 
HELX_P HELX_P24  24  PRO A 618  ? ALA A 624  ? PRO A 619  ALA A 625  5 ? 7  
HELX_P HELX_P25  25  ASN A 635  ? VAL A 641  ? ASN A 636  VAL A 642  1 ? 7  
HELX_P HELX_P26  26  VAL A 641  ? THR A 647  ? VAL A 642  THR A 648  1 ? 7  
HELX_P HELX_P27  27  GLN A 649  ? LEU A 653  ? GLN A 650  LEU A 654  5 ? 5  
HELX_P HELX_P28  28  PRO A 654  ? PHE A 658  ? PRO A 655  PHE A 659  5 ? 5  
HELX_P HELX_P29  29  GLY A 667  ? GLU A 672  ? GLY A 668  GLU A 673  5 ? 6  
HELX_P HELX_P30  30  ASN A 692  ? CYS A 698  ? ASN A 693  CYS A 699  1 ? 7  
HELX_P HELX_P31  31  GLU A 711  ? VAL A 714  ? GLU A 712  VAL A 715  5 ? 4  
HELX_P HELX_P32  32  GLY A 748  ? CYS A 754  ? GLY A 749  CYS A 755  1 ? 7  
HELX_P HELX_P33  33  GLN A 769  ? ALA A 781  ? GLN A 770  ALA A 782  1 ? 13 
HELX_P HELX_P34  34  SER A 794  ? GLN A 799  ? SER A 795  GLN A 800  1 ? 6  
HELX_P HELX_P35  35  GLU A 816  ? GLY A 828  ? GLU A 817  GLY A 829  1 ? 13 
HELX_P HELX_P36  36  GLY A 838  ? SER A 846  ? GLY A 839  SER A 847  1 ? 9  
HELX_P HELX_P37  37  ASP A 870  ? GLU A 898  ? ASP A 871  GLU A 899  1 ? 29 
HELX_P HELX_P38  38  SER A 902  ? GLY A 915  ? SER A 903  GLY A 916  1 ? 14 
HELX_P HELX_P39  39  ASP A 918  ? LEU A 933  ? ASP A 919  LEU A 934  1 ? 16 
HELX_P HELX_P40  40  ASP A 938  ? MET A 947  ? ASP A 939  MET A 948  1 ? 10 
HELX_P HELX_P41  41  SER A 948  ? TYR A 951  ? SER A 949  TYR A 952  5 ? 4  
HELX_P HELX_P42  42  ASP A 962  ? ASP A 967  ? ASP A 963  ASP A 968  1 ? 6  
HELX_P HELX_P43  43  GLY A 969  ? SER A 979  ? GLY A 970  SER A 980  1 ? 11 
HELX_P HELX_P44  44  ASP A 1023 ? THR A 1030 ? ASP A 1024 THR A 1031 1 ? 8  
HELX_P HELX_P45  45  SER A 1044 ? PHE A 1058 ? SER A 1045 PHE A 1059 1 ? 15 
HELX_P HELX_P46  46  CYS A 1070 ? GLY A 1074 ? CYS A 1071 GLY A 1075 5 ? 5  
HELX_P HELX_P47  47  GLY A 1078 ? GLY A 1080 ? GLY A 1079 GLY A 1081 5 ? 3  
HELX_P HELX_P48  48  LYS A 1081 ? SER A 1092 ? LYS A 1082 SER A 1093 1 ? 12 
HELX_P HELX_P49  49  ASP A 1101 ? GLN A 1107 ? ASP A 1102 GLN A 1108 1 ? 7  
HELX_P HELX_P50  50  SER A 1122 ? ALA A 1129 ? SER A 1123 ALA A 1130 1 ? 8  
HELX_P HELX_P51  51  GLN A 1130 ? PHE A 1140 ? GLN A 1131 PHE A 1141 1 ? 11 
HELX_P HELX_P52  52  PHE A 1140 ? THR A 1168 ? PHE A 1141 THR A 1169 1 ? 29 
HELX_P HELX_P53  53  THR A 1218 ? LYS A 1230 ? THR A 1219 LYS A 1231 1 ? 13 
HELX_P HELX_P54  54  GLY B 9    ? SER B 21   ? GLY B 10   SER B 22   1 ? 13 
HELX_P HELX_P55  55  SER B 32   ? GLN B 45   ? SER B 33   GLN B 46   1 ? 14 
HELX_P HELX_P56  56  SER B 62   ? ALA B 76   ? SER B 63   ALA B 77   1 ? 15 
HELX_P HELX_P57  57  ALA B 85   ? GLU B 102  ? ALA B 86   GLU B 103  1 ? 18 
HELX_P HELX_P58  58  HIS B 126  ? ALA B 132  ? HIS B 127  ALA B 133  1 ? 7  
HELX_P HELX_P59  59  SER B 144  ? ASN B 163  ? SER B 145  ASN B 164  1 ? 20 
HELX_P HELX_P60  60  ASP B 186  ? LEU B 193  ? ASP B 187  LEU B 194  1 ? 8  
HELX_P HELX_P61  61  ASN B 195  ? SER B 206  ? ASN B 196  SER B 207  1 ? 12 
HELX_P HELX_P62  62  ILE B 223  ? ALA B 230  ? ILE B 224  ALA B 231  1 ? 8  
HELX_P HELX_P63  63  ALA B 231  ? GLY B 254  ? ALA B 232  GLY B 255  1 ? 24 
HELX_P HELX_P64  64  SER B 277  ? ALA B 291  ? SER B 278  ALA B 292  1 ? 15 
HELX_P HELX_P65  65  VAL B 308  ? ALA B 315  ? VAL B 309  ALA B 316  1 ? 8  
HELX_P HELX_P66  66  ASP B 337  ? GLY B 351  ? ASP B 338  GLY B 352  1 ? 15 
HELX_P HELX_P67  67  GLY B 363  ? LYS B 367  ? GLY B 364  LYS B 368  5 ? 5  
HELX_P HELX_P68  68  SER B 370  ? GLY B 383  ? SER B 371  GLY B 384  1 ? 14 
HELX_P HELX_P69  69  GLY B 428  ? THR B 444  ? GLY B 429  THR B 445  1 ? 17 
HELX_P HELX_P70  70  ASN B 490  ? ILE B 496  ? ASN B 491  ILE B 497  5 ? 7  
HELX_P HELX_P71  71  SER B 517  ? LEU B 525  ? SER B 518  LEU B 526  1 ? 9  
HELX_P HELX_P72  72  PRO B 526  ? LYS B 536  ? PRO B 527  LYS B 537  1 ? 11 
HELX_P HELX_P73  73  ASP B 544  ? VAL B 552  ? ASP B 545  VAL B 553  1 ? 9  
HELX_P HELX_P74  74  ILE B 558  ? ALA B 570  ? ILE B 559  ALA B 571  1 ? 13 
HELX_P HELX_P75  75  PRO B 574  ? ALA B 589  ? PRO B 575  ALA B 590  1 ? 16 
HELX_P HELX_P76  76  GLU B 595  ? LEU B 612  ? GLU B 596  LEU B 613  1 ? 18 
HELX_P HELX_P77  77  PRO B 618  ? ALA B 624  ? PRO B 619  ALA B 625  5 ? 7  
HELX_P HELX_P78  78  ASN B 635  ? VAL B 641  ? ASN B 636  VAL B 642  1 ? 7  
HELX_P HELX_P79  79  VAL B 641  ? THR B 647  ? VAL B 642  THR B 648  1 ? 7  
HELX_P HELX_P80  80  GLN B 649  ? LEU B 653  ? GLN B 650  LEU B 654  5 ? 5  
HELX_P HELX_P81  81  PRO B 654  ? PHE B 658  ? PRO B 655  PHE B 659  5 ? 5  
HELX_P HELX_P82  82  GLY B 667  ? GLU B 672  ? GLY B 668  GLU B 673  5 ? 6  
HELX_P HELX_P83  83  PRO B 685  ? CYS B 688  ? PRO B 686  CYS B 689  5 ? 4  
HELX_P HELX_P84  84  ASN B 692  ? CYS B 698  ? ASN B 693  CYS B 699  1 ? 7  
HELX_P HELX_P85  85  LYS B 709  ? VAL B 714  ? LYS B 710  VAL B 715  5 ? 6  
HELX_P HELX_P86  86  GLY B 727  ? LYS B 731  ? GLY B 728  LYS B 732  5 ? 5  
HELX_P HELX_P87  87  GLY B 748  ? CYS B 754  ? GLY B 749  CYS B 755  1 ? 7  
HELX_P HELX_P88  88  GLN B 769  ? ALA B 781  ? GLN B 770  ALA B 782  1 ? 13 
HELX_P HELX_P89  89  SER B 794  ? GLN B 799  ? SER B 795  GLN B 800  1 ? 6  
HELX_P HELX_P90  90  GLU B 816  ? GLY B 828  ? GLU B 817  GLY B 829  1 ? 13 
HELX_P HELX_P91  91  GLY B 838  ? SER B 846  ? GLY B 839  SER B 847  1 ? 9  
HELX_P HELX_P92  92  ASP B 870  ? LEU B 897  ? ASP B 871  LEU B 898  1 ? 28 
HELX_P HELX_P93  93  SER B 902  ? LYS B 916  ? SER B 903  LYS B 917  1 ? 15 
HELX_P HELX_P94  94  ASP B 918  ? LEU B 933  ? ASP B 919  LEU B 934  1 ? 16 
HELX_P HELX_P95  95  ASP B 938  ? MET B 947  ? ASP B 939  MET B 948  1 ? 10 
HELX_P HELX_P96  96  SER B 948  ? TYR B 951  ? SER B 949  TYR B 952  5 ? 4  
HELX_P HELX_P97  97  ASP B 962  ? ASP B 967  ? ASP B 963  ASP B 968  1 ? 6  
HELX_P HELX_P98  98  GLY B 969  ? SER B 979  ? GLY B 970  SER B 980  1 ? 11 
HELX_P HELX_P99  99  ASP B 1023 ? THR B 1030 ? ASP B 1024 THR B 1031 1 ? 8  
HELX_P HELX_P100 100 SER B 1044 ? PHE B 1058 ? SER B 1045 PHE B 1059 1 ? 15 
HELX_P HELX_P101 101 CYS B 1070 ? GLY B 1074 ? CYS B 1071 GLY B 1075 5 ? 5  
HELX_P HELX_P102 102 GLY B 1078 ? GLY B 1080 ? GLY B 1079 GLY B 1081 5 ? 3  
HELX_P HELX_P103 103 LYS B 1081 ? SER B 1092 ? LYS B 1082 SER B 1093 1 ? 12 
HELX_P HELX_P104 104 ASP B 1101 ? GLN B 1107 ? ASP B 1102 GLN B 1108 1 ? 7  
HELX_P HELX_P105 105 SER B 1122 ? ALA B 1129 ? SER B 1123 ALA B 1130 1 ? 8  
HELX_P HELX_P106 106 GLN B 1130 ? PHE B 1140 ? GLN B 1131 PHE B 1141 1 ? 11 
HELX_P HELX_P107 107 PHE B 1140 ? THR B 1168 ? PHE B 1141 THR B 1169 1 ? 29 
HELX_P HELX_P108 108 THR B 1218 ? LYS B 1230 ? THR B 1219 LYS B 1231 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 1194 SG  ? ? ? 1_555 A CYS 1211 SG  ? ? A CYS 1195 A CYS 1212 1_555 ? ? ? ? ? ? ? 2.008 ? 
metalc1  metalc ? ? A CYS 688  SG  ? ? ? 1_555 E SF4 .    FE1 ? ? A CYS 689  A SF4 2233 1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc2  metalc ? ? A CYS 691  SG  ? ? ? 1_555 E SF4 .    FE2 ? ? A CYS 692  A SF4 2233 1_555 ? ? ? ? ? ? ? 2.250 ? 
metalc3  metalc ? ? A CYS 694  SG  ? ? ? 1_555 E SF4 .    FE3 ? ? A CYS 695  A SF4 2233 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc4  metalc ? ? A CYS 698  SG  ? ? ? 1_555 F SF4 .    FE1 ? ? A CYS 699  A SF4 2234 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc5  metalc ? ? A CYS 744  SG  ? ? ? 1_555 F SF4 .    FE2 ? ? A CYS 745  A SF4 2234 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc6  metalc ? ? A CYS 747  SG  ? ? ? 1_555 F SF4 .    FE4 ? ? A CYS 748  A SF4 2234 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc7  metalc ? ? A CYS 750  SG  ? ? ? 1_555 F SF4 .    FE3 ? ? A CYS 751  A SF4 2234 1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc8  metalc ? ? A CYS 754  SG  ? ? ? 1_555 E SF4 .    FE4 ? ? A CYS 755  A SF4 2233 1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc9  metalc ? ? A CYS 811  SG  ? ? ? 1_555 G SF4 .    FE1 ? ? A CYS 812  A SF4 2235 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc10 metalc ? ? A CYS 814  SG  ? ? ? 1_555 G SF4 .    FE2 ? ? A CYS 815  A SF4 2235 1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc11 metalc ? ? A CYS 839  SG  ? ? ? 1_555 G SF4 .    FE3 ? ? A CYS 840  A SF4 2235 1_555 ? ? ? ? ? ? ? 2.286 ? 
metalc12 metalc ? ? A ASP 962  OD1 ? ? ? 1_555 C MG  .    MG  ? ? A ASP 963  A MG  2237 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc13 metalc ? ? A ASP 982  OD2 ? ? ? 1_555 D CA  .    CA  ? ? A ASP 983  A CA  2238 1_555 ? ? ? ? ? ? ? 2.791 ? 
metalc14 metalc ? ? A ASN 984  OD1 ? ? ? 1_555 D CA  .    CA  ? ? A ASN 985  A CA  2238 1_555 ? ? ? ? ? ? ? 2.717 ? 
metalc15 metalc ? ? A THR 990  OG1 ? ? ? 1_555 C MG  .    MG  ? ? A THR 991  A MG  2237 1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc16 metalc ? ? A VAL 992  O   ? ? ? 1_555 C MG  .    MG  ? ? A VAL 993  A MG  2237 1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc17 metalc ? ? A ALA 1055 O   ? ? ? 1_555 D CA  .    CA  ? ? A ALA 1056 A CA  2238 1_555 ? ? ? ? ? ? ? 2.884 ? 
metalc18 metalc ? ? A PHE 1058 O   ? ? ? 1_555 D CA  .    CA  ? ? A PHE 1059 A CA  2238 1_555 ? ? ? ? ? ? ? 2.644 ? 
metalc19 metalc ? ? A GLY 1060 O   ? ? ? 1_555 D CA  .    CA  ? ? A GLY 1061 A CA  2238 1_555 ? ? ? ? ? ? ? 3.043 ? 
metalc20 metalc ? ? A CYS 1070 SG  ? ? ? 1_555 G SF4 .    FE4 ? ? A CYS 1071 A SF4 2235 1_555 ? ? ? ? ? ? ? 2.280 ? 
metalc21 metalc ? ? B CYS 688  SG  ? ? ? 1_555 L SF4 .    FE1 ? ? B CYS 689  B SF4 3233 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc22 metalc ? ? B CYS 691  SG  ? ? ? 1_555 L SF4 .    FE2 ? ? B CYS 692  B SF4 3233 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc23 metalc ? ? B CYS 694  SG  ? ? ? 1_555 L SF4 .    FE3 ? ? B CYS 695  B SF4 3233 1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc24 metalc ? ? B CYS 698  SG  ? ? ? 1_555 M SF4 .    FE1 ? ? B CYS 699  B SF4 3234 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc25 metalc ? ? B CYS 744  SG  ? ? ? 1_555 M SF4 .    FE2 ? ? B CYS 745  B SF4 3234 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc26 metalc ? ? B CYS 747  SG  ? ? ? 1_555 M SF4 .    FE4 ? ? B CYS 748  B SF4 3234 1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc27 metalc ? ? B CYS 750  SG  ? ? ? 1_555 M SF4 .    FE3 ? ? B CYS 751  B SF4 3234 1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc28 metalc ? ? B CYS 754  SG  ? ? ? 1_555 L SF4 .    FE4 ? ? B CYS 755  B SF4 3233 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc29 metalc ? ? B CYS 811  SG  ? ? ? 1_555 N SF4 .    FE1 ? ? B CYS 812  B SF4 3235 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc30 metalc ? ? B CYS 814  SG  ? ? ? 1_555 N SF4 .    FE2 ? ? B CYS 815  B SF4 3235 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc31 metalc ? ? B CYS 839  SG  ? ? ? 1_555 N SF4 .    FE3 ? ? B CYS 840  B SF4 3235 1_555 ? ? ? ? ? ? ? 2.294 ? 
metalc32 metalc ? ? B ASP 962  OD1 ? ? ? 1_555 J MG  .    MG  ? ? B ASP 963  B MG  3237 1_555 ? ? ? ? ? ? ? 2.027 ? 
metalc33 metalc ? ? B ASP 982  OD2 ? ? ? 1_555 K CA  .    CA  ? ? B ASP 983  B CA  3238 1_555 ? ? ? ? ? ? ? 2.842 ? 
metalc34 metalc ? ? B ASN 984  OD1 ? ? ? 1_555 K CA  .    CA  ? ? B ASN 985  B CA  3238 1_555 ? ? ? ? ? ? ? 2.739 ? 
metalc35 metalc ? ? B THR 990  OG1 ? ? ? 1_555 J MG  .    MG  ? ? B THR 991  B MG  3237 1_555 ? ? ? ? ? ? ? 2.262 ? 
metalc36 metalc ? ? B VAL 992  O   ? ? ? 1_555 J MG  .    MG  ? ? B VAL 993  B MG  3237 1_555 ? ? ? ? ? ? ? 2.212 ? 
metalc37 metalc ? ? B ALA 1055 O   ? ? ? 1_555 K CA  .    CA  ? ? B ALA 1056 B CA  3238 1_555 ? ? ? ? ? ? ? 2.876 ? 
metalc38 metalc ? ? B PHE 1058 O   ? ? ? 1_555 K CA  .    CA  ? ? B PHE 1059 B CA  3238 1_555 ? ? ? ? ? ? ? 2.711 ? 
metalc39 metalc ? ? B GLY 1060 O   ? ? ? 1_555 K CA  .    CA  ? ? B GLY 1061 B CA  3238 1_555 ? ? ? ? ? ? ? 2.972 ? 
metalc40 metalc ? ? B CYS 1070 SG  ? ? ? 1_555 N SF4 .    FE4 ? ? B CYS 1071 B SF4 3235 1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc41 metalc ? ? C MG  .    MG  ? ? ? 1_555 H HTL .    O23 ? ? A MG  2237 A HTL 2236 1_555 ? ? ? ? ? ? ? 2.024 ? 
metalc42 metalc ? ? C MG  .    MG  ? ? ? 1_555 Q HOH .    O   ? ? A MG  2237 A HOH 2375 1_555 ? ? ? ? ? ? ? 2.201 ? 
metalc43 metalc ? ? C MG  .    MG  ? ? ? 1_555 H HTL .    O12 ? ? A MG  2237 A HTL 2236 1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc44 metalc ? ? J MG  .    MG  ? ? ? 1_555 O HTL .    O12 ? ? B MG  3237 B HTL 3236 1_555 ? ? ? ? ? ? ? 2.077 ? 
metalc45 metalc ? ? J MG  .    MG  ? ? ? 1_555 O HTL .    O23 ? ? B MG  3237 B HTL 3236 1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc46 metalc ? ? J MG  .    MG  ? ? ? 1_555 R HOH .    O   ? ? B MG  3237 B HOH 3382 1_555 ? ? ? ? ? ? ? 2.240 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 30  A . ? THR 31  A PRO 31  A ? PRO 32  A 1 7.53   
2 ARG 305 A . ? ARG 306 A PRO 306 A ? PRO 307 A 1 -7.60  
3 ALA 847 A . ? ALA 848 A PRO 848 A ? PRO 849 A 1 6.48   
4 THR 30  B . ? THR 31  B PRO 31  B ? PRO 32  B 1 4.66   
5 ARG 305 B . ? ARG 306 B PRO 306 B ? PRO 307 B 1 -18.40 
6 ALA 847 B . ? ALA 848 B PRO 848 B ? PRO 849 B 1 15.79  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 7 ? 
C ? 2 ? 
D ? 9 ? 
E ? 6 ? 
F ? 2 ? 
G ? 3 ? 
H ? 9 ? 
I ? 8 ? 
J ? 7 ? 
K ? 6 ? 
L ? 2 ? 
M ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
C 1 2 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? parallel      
D 7 8 ? anti-parallel 
D 8 9 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? parallel      
H 6 7 ? parallel      
H 7 8 ? parallel      
H 8 9 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
I 5 6 ? parallel      
I 6 7 ? parallel      
I 7 8 ? parallel      
J 1 2 ? parallel      
J 2 3 ? parallel      
J 3 4 ? parallel      
J 4 5 ? parallel      
J 5 6 ? parallel      
J 6 7 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? parallel      
K 3 4 ? parallel      
K 4 5 ? parallel      
K 5 6 ? parallel      
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 2    ? ASP A 8    ? LYS A 3    ASP A 9    
A 2 ILE A 179  ? LEU A 185  ? ILE A 180  LEU A 186  
A 3 PHE A 447  ? TYR A 454  ? PHE A 448  TYR A 455  
A 4 ILE A 462  ? GLY A 470  ? ILE A 463  GLY A 471  
A 5 ILE A 417  ? LEU A 424  ? ILE A 418  LEU A 425  
A 6 TYR A 485  ? CYS A 488  ? TYR A 486  CYS A 489  
A 7 THR A 508  ? ASN A 512  ? THR A 509  ASN A 513  
A 8 LYS A 539  ? ILE A 543  ? LYS A 540  ILE A 544  
B 1 THR A 56   ? GLU A 59   ? THR A 57   GLU A 60   
B 2 VAL A 23   ? ILE A 26   ? VAL A 24   ILE A 27   
B 3 THR A 80   ? THR A 84   ? THR A 81   THR A 85   
B 4 VAL A 107  ? ALA A 112  ? VAL A 108  ALA A 113  
B 5 PHE A 166  ? ASP A 171  ? PHE A 167  ASP A 172  
B 6 ALA A 138  ? ALA A 141  ? ALA A 139  ALA A 142  
B 7 LEU A 303  ? ARG A 305  ? LEU A 304  ARG A 306  
C 1 ALA A 119  ? LEU A 120  ? ALA A 120  LEU A 121  
C 2 THR B 217  ? ALA B 218  ? THR B 218  ALA B 219  
D 1 VAL A 214  ? ARG A 215  ? VAL A 215  ARG A 216  
D 2 ALA B 862  ? GLY B 864  ? ALA B 863  GLY B 865  
D 3 MET B 831  ? ASN B 835  ? MET B 832  ASN B 836  
D 4 SER B 955  ? GLY B 961  ? SER B 956  GLY B 962  
D 5 ASN B 984  ? ASP B 989  ? ASN B 985  ASP B 990  
D 6 SER B 1062 ? TYR B 1067 ? SER B 1063 TYR B 1068 
D 7 TYR B 1035 ? VAL B 1039 ? TYR B 1036 VAL B 1040 
D 8 PHE B 1098 ? TYR B 1100 ? PHE B 1099 TYR B 1101 
D 9 PHE B 1112 ? LEU B 1114 ? PHE B 1113 LEU B 1115 
E 1 PHE A 260  ? GLY A 264  ? PHE A 261  GLY A 265  
E 2 ILE A 296  ? VAL A 301  ? ILE A 297  VAL A 302  
E 3 ARG A 270  ? SER A 274  ? ARG A 271  SER A 275  
E 4 VAL A 322  ? ASP A 327  ? VAL A 323  ASP A 328  
E 5 ILE A 357  ? ARG A 361  ? ILE A 358  ARG A 362  
E 6 PHE A 389  ? THR A 390  ? PHE A 390  THR A 391  
F 1 ASN A 679  ? TRP A 683  ? ASN A 680  TRP A 684  
F 2 LEU A 761  ? PRO A 765  ? LEU A 762  PRO A 766  
G 1 ILE A 703  ? LYS A 709  ? ILE A 704  LYS A 710  
G 2 TYR A 733  ? ILE A 739  ? TYR A 734  ILE A 740  
G 3 LEU A 723  ? GLU A 724  ? LEU A 724  GLU A 725  
H 1 PHE A 1112 ? LEU A 1114 ? PHE A 1113 LEU A 1115 
H 2 PHE A 1098 ? TYR A 1100 ? PHE A 1099 TYR A 1101 
H 3 TYR A 1035 ? VAL A 1039 ? TYR A 1036 VAL A 1040 
H 4 SER A 1062 ? TYR A 1067 ? SER A 1063 TYR A 1068 
H 5 ASN A 984  ? ASP A 989  ? ASN A 985  ASP A 990  
H 6 SER A 955  ? GLY A 961  ? SER A 956  GLY A 962  
H 7 MET A 831  ? ASN A 835  ? MET A 832  ASN A 836  
H 8 ALA A 862  ? GLY A 864  ? ALA A 863  GLY A 865  
H 9 VAL B 214  ? ARG B 215  ? VAL B 215  ARG B 216  
I 1 LYS B 2    ? ASP B 8    ? LYS B 3    ASP B 9    
I 2 ILE B 179  ? LEU B 185  ? ILE B 180  LEU B 186  
I 3 PHE B 447  ? TYR B 454  ? PHE B 448  TYR B 455  
I 4 ILE B 462  ? GLY B 470  ? ILE B 463  GLY B 471  
I 5 ILE B 417  ? LEU B 424  ? ILE B 418  LEU B 425  
I 6 TYR B 485  ? CYS B 488  ? TYR B 486  CYS B 489  
I 7 THR B 508  ? ASN B 512  ? THR B 509  ASN B 513  
I 8 LYS B 539  ? ILE B 543  ? LYS B 540  ILE B 544  
J 1 THR B 56   ? GLU B 59   ? THR B 57   GLU B 60   
J 2 VAL B 23   ? ILE B 26   ? VAL B 24   ILE B 27   
J 3 THR B 80   ? THR B 84   ? THR B 81   THR B 85   
J 4 VAL B 107  ? ALA B 112  ? VAL B 108  ALA B 113  
J 5 PHE B 166  ? ASP B 171  ? PHE B 167  ASP B 172  
J 6 ALA B 138  ? ALA B 141  ? ALA B 139  ALA B 142  
J 7 LEU B 303  ? ARG B 305  ? LEU B 304  ARG B 306  
K 1 PHE B 260  ? GLY B 264  ? PHE B 261  GLY B 265  
K 2 ILE B 296  ? VAL B 301  ? ILE B 297  VAL B 302  
K 3 ARG B 270  ? SER B 274  ? ARG B 271  SER B 275  
K 4 VAL B 322  ? ASP B 327  ? VAL B 323  ASP B 328  
K 5 ILE B 357  ? ARG B 361  ? ILE B 358  ARG B 362  
K 6 PHE B 389  ? THR B 390  ? PHE B 390  THR B 391  
L 1 ASN B 679  ? TRP B 683  ? ASN B 680  TRP B 684  
L 2 LEU B 761  ? PRO B 765  ? LEU B 762  PRO B 766  
M 1 ILE B 703  ? ALA B 708  ? ILE B 704  ALA B 709  
M 2 LYS B 734  ? ILE B 739  ? LYS B 735  ILE B 740  
M 3 LEU B 723  ? GLU B 724  ? LEU B 724  GLU B 725  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N MET A 5    ? N MET A 6    O ILE A 182  ? O ILE A 183  
A 2 3 N ILE A 179  ? N ILE A 180  O GLY A 450  ? O GLY A 451  
A 3 4 N PHE A 447  ? N PHE A 448  O GLY A 470  ? O GLY A 471  
A 4 5 O THR A 463  ? O THR A 464  N GLY A 423  ? N GLY A 424  
A 5 6 N TRP A 422  ? N TRP A 423  O ALA A 487  ? O ALA A 488  
A 6 7 N CYS A 488  ? N CYS A 489  O VAL A 510  ? O VAL A 511  
A 7 8 N LEU A 511  ? N LEU A 512  O TYR A 541  ? O TYR A 542  
B 1 2 O THR A 56   ? O THR A 57   N ALA A 24   ? N ALA A 25   
B 2 3 N VAL A 23   ? N VAL A 24   O THR A 81   ? O THR A 82   
B 3 4 N THR A 82   ? N THR A 83   O HIS A 109  ? O HIS A 110  
B 4 5 N ALA A 112  ? N ALA A 113  O PHE A 170  ? O PHE A 171  
B 5 6 O MET A 167  ? O MET A 168  N LEU A 140  ? N LEU A 141  
B 6 7 N MET A 139  ? N MET A 140  O ARG A 305  ? O ARG A 306  
C 1 2 N LEU A 120  ? N LEU A 121  O THR B 217  ? O THR B 218  
D 1 2 N ARG A 215  ? N ARG A 216  O TRP B 863  ? O TRP B 864  
D 2 3 O ALA B 862  ? O ALA B 863  N ILE B 833  ? N ILE B 834  
D 3 4 N PHE B 832  ? N PHE B 833  O TRP B 957  ? O TRP B 958  
D 4 5 N ILE B 958  ? N ILE B 959  O PHE B 986  ? O PHE B 987  
D 5 6 N VAL B 985  ? N VAL B 986  O SER B 1062 ? O SER B 1063 
D 6 7 O LEU B 1063 ? O LEU B 1064 N TYR B 1035 ? N TYR B 1036 
D 7 8 N VAL B 1036 ? N VAL B 1037 O TYR B 1100 ? O TYR B 1101 
D 8 9 N ARG B 1099 ? N ARG B 1100 O GLN B 1113 ? O GLN B 1114 
E 1 2 N ASP A 261  ? N ASP A 262  O LYS A 300  ? O LYS A 301  
E 2 3 O ILE A 299  ? O ILE A 300  N ILE A 272  ? N ILE A 273  
E 3 4 N VAL A 273  ? N VAL A 274  O LEU A 326  ? O LEU A 327  
E 4 5 N VAL A 325  ? N VAL A 326  O LEU A 358  ? O LEU A 359  
E 5 6 N ARG A 361  ? N ARG A 362  O PHE A 389  ? O PHE A 390  
F 1 2 N VAL A 680  ? N VAL A 681  O GLN A 764  ? O GLN A 765  
G 1 2 N ALA A 708  ? N ALA A 709  O LYS A 734  ? O LYS A 735  
G 2 3 O PHE A 735  ? O PHE A 736  N LEU A 723  ? N LEU A 724  
H 1 2 O GLN A 1113 ? O GLN A 1114 N ARG A 1099 ? N ARG A 1100 
H 2 3 O TYR A 1100 ? O TYR A 1101 N VAL A 1036 ? N VAL A 1037 
H 3 4 N TYR A 1035 ? N TYR A 1036 O LEU A 1063 ? O LEU A 1064 
H 4 5 O SER A 1062 ? O SER A 1063 N VAL A 985  ? N VAL A 986  
H 5 6 O PHE A 986  ? O PHE A 987  N ILE A 958  ? N ILE A 959  
H 6 7 O TRP A 957  ? O TRP A 958  N PHE A 832  ? N PHE A 833  
H 7 8 N ILE A 833  ? N ILE A 834  O ALA A 862  ? O ALA A 863  
H 8 9 N TRP A 863  ? N TRP A 864  O ARG B 215  ? O ARG B 216  
I 1 2 N MET B 5    ? N MET B 6    O ILE B 182  ? O ILE B 183  
I 2 3 N ILE B 179  ? N ILE B 180  O GLY B 450  ? O GLY B 451  
I 3 4 N PHE B 447  ? N PHE B 448  O GLY B 470  ? O GLY B 471  
I 4 5 O LEU B 467  ? O LEU B 468  N CYS B 419  ? N CYS B 420  
I 5 6 N TRP B 422  ? N TRP B 423  O ALA B 487  ? O ALA B 488  
I 6 7 N VAL B 486  ? N VAL B 487  O THR B 508  ? O THR B 509  
I 7 8 N LEU B 511  ? N LEU B 512  O ILE B 543  ? O ILE B 544  
J 1 2 O THR B 56   ? O THR B 57   N ALA B 24   ? N ALA B 25   
J 2 3 N VAL B 23   ? N VAL B 24   O THR B 81   ? O THR B 82   
J 3 4 N THR B 82   ? N THR B 83   O HIS B 109  ? O HIS B 110  
J 4 5 N PHE B 108  ? N PHE B 109  O PHE B 166  ? O PHE B 167  
J 5 6 O MET B 167  ? O MET B 168  N LEU B 140  ? N LEU B 141  
J 6 7 N MET B 139  ? N MET B 140  O ARG B 305  ? O ARG B 306  
K 1 2 N ASP B 261  ? N ASP B 262  O LYS B 300  ? O LYS B 301  
K 2 3 O ILE B 299  ? O ILE B 300  N ILE B 272  ? N ILE B 273  
K 3 4 N VAL B 273  ? N VAL B 274  O THR B 324  ? O THR B 325  
K 4 5 N ILE B 323  ? N ILE B 324  O LEU B 358  ? O LEU B 359  
K 5 6 N ARG B 361  ? N ARG B 362  O PHE B 389  ? O PHE B 390  
L 1 2 N VAL B 680  ? N VAL B 681  O GLN B 764  ? O GLN B 765  
M 1 2 N VAL B 706  ? N VAL B 707  O ARG B 736  ? O ARG B 737  
M 2 3 O PHE B 735  ? O PHE B 736  N LEU B 723  ? N LEU B 724  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 2237'  
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 2238'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG B 3237'  
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA B 3238'  
AC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE SF4 A 2233' 
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SF4 A 2234' 
AC7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SF4 A 2235' 
AC8 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE HTL A 2236' 
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CO2 A 2240' 
BC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SF4 B 3233' 
BC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SF4 B 3234' 
BC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SF4 B 3235' 
BC4 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE HTL B 3236' 
BC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CO2 B 3240' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  ASP A 962  ? ASP A 963  . ? 1_555 ? 
2   AC1 5  THR A 990  ? THR A 991  . ? 1_555 ? 
3   AC1 5  VAL A 992  ? VAL A 993  . ? 1_555 ? 
4   AC1 5  HTL H .    ? HTL A 2236 . ? 1_555 ? 
5   AC1 5  HOH Q .    ? HOH A 2375 . ? 1_555 ? 
6   AC2 7  ASP A 982  ? ASP A 983  . ? 1_555 ? 
7   AC2 7  ASN A 984  ? ASN A 985  . ? 1_555 ? 
8   AC2 7  ALA A 1055 ? ALA A 1056 . ? 1_555 ? 
9   AC2 7  GLU A 1056 ? GLU A 1057 . ? 1_555 ? 
10  AC2 7  PHE A 1058 ? PHE A 1059 . ? 1_555 ? 
11  AC2 7  GLY A 1060 ? GLY A 1061 . ? 1_555 ? 
12  AC2 7  SER A 1062 ? SER A 1063 . ? 1_555 ? 
13  AC3 5  ASP B 962  ? ASP B 963  . ? 1_555 ? 
14  AC3 5  THR B 990  ? THR B 991  . ? 1_555 ? 
15  AC3 5  VAL B 992  ? VAL B 993  . ? 1_555 ? 
16  AC3 5  HTL O .    ? HTL B 3236 . ? 1_555 ? 
17  AC3 5  HOH R .    ? HOH B 3382 . ? 1_555 ? 
18  AC4 7  ASP B 982  ? ASP B 983  . ? 1_555 ? 
19  AC4 7  ASN B 984  ? ASN B 985  . ? 1_555 ? 
20  AC4 7  ALA B 1055 ? ALA B 1056 . ? 1_555 ? 
21  AC4 7  GLU B 1056 ? GLU B 1057 . ? 1_555 ? 
22  AC4 7  PHE B 1058 ? PHE B 1059 . ? 1_555 ? 
23  AC4 7  GLY B 1060 ? GLY B 1061 . ? 1_555 ? 
24  AC4 7  SER B 1062 ? SER B 1063 . ? 1_555 ? 
25  AC5 9  TRP A 683  ? TRP A 684  . ? 1_555 ? 
26  AC5 9  CYS A 688  ? CYS A 689  . ? 1_555 ? 
27  AC5 9  ILE A 689  ? ILE A 690  . ? 1_555 ? 
28  AC5 9  CYS A 691  ? CYS A 692  . ? 1_555 ? 
29  AC5 9  ASN A 692  ? ASN A 693  . ? 1_555 ? 
30  AC5 9  CYS A 694  ? CYS A 695  . ? 1_555 ? 
31  AC5 9  CYS A 754  ? CYS A 755  . ? 1_555 ? 
32  AC5 9  PRO A 755  ? PRO A 756  . ? 1_555 ? 
33  AC5 9  LEU A 761  ? LEU A 762  . ? 1_555 ? 
34  AC6 7  CYS A 698  ? CYS A 699  . ? 1_555 ? 
35  AC6 7  ILE A 703  ? ILE A 704  . ? 1_555 ? 
36  AC6 7  CYS A 744  ? CYS A 745  . ? 1_555 ? 
37  AC6 7  MET A 745  ? MET A 746  . ? 1_555 ? 
38  AC6 7  CYS A 747  ? CYS A 748  . ? 1_555 ? 
39  AC6 7  GLY A 748  ? GLY A 749  . ? 1_555 ? 
40  AC6 7  CYS A 750  ? CYS A 751  . ? 1_555 ? 
41  AC7 8  LYS A 458  ? LYS A 459  . ? 1_555 ? 
42  AC7 8  CYS A 811  ? CYS A 812  . ? 1_555 ? 
43  AC7 8  CYS A 814  ? CYS A 815  . ? 1_555 ? 
44  AC7 8  GLU A 816  ? GLU A 817  . ? 1_555 ? 
45  AC7 8  CYS A 839  ? CYS A 840  . ? 1_555 ? 
46  AC7 8  CYS A 1070 ? CYS A 1071 . ? 1_555 ? 
47  AC7 8  ILE A 1071 ? ILE A 1072 . ? 1_555 ? 
48  AC7 8  MET B 1202 ? MET B 1203 . ? 1_555 ? 
49  AC8 28 PRO A 28   ? PRO A 29   . ? 1_555 ? 
50  AC8 28 ILE A 29   ? ILE A 30   . ? 1_555 ? 
51  AC8 28 GLU A 63   ? GLU A 64   . ? 1_555 ? 
52  AC8 28 GLN A 87   ? GLN A 88   . ? 1_555 ? 
53  AC8 28 LEU A 91   ? LEU A 92   . ? 1_555 ? 
54  AC8 28 ARG A 113  ? ARG A 114  . ? 1_555 ? 
55  AC8 28 GLU A 816  ? GLU A 817  . ? 1_555 ? 
56  AC8 28 THR A 837  ? THR A 838  . ? 1_555 ? 
57  AC8 28 GLY A 838  ? GLY A 839  . ? 1_555 ? 
58  AC8 28 CYS A 839  ? CYS A 840  . ? 1_555 ? 
59  AC8 28 PHE A 868  ? PHE A 869  . ? 1_555 ? 
60  AC8 28 GLU A 869  ? GLU A 870  . ? 1_555 ? 
61  AC8 28 GLY A 961  ? GLY A 962  . ? 1_555 ? 
62  AC8 28 ASP A 962  ? ASP A 963  . ? 1_555 ? 
63  AC8 28 GLY A 963  ? GLY A 964  . ? 1_555 ? 
64  AC8 28 TRP A 964  ? TRP A 965  . ? 1_555 ? 
65  AC8 28 THR A 990  ? THR A 991  . ? 1_555 ? 
66  AC8 28 VAL A 992  ? VAL A 993  . ? 1_555 ? 
67  AC8 28 TYR A 993  ? TYR A 994  . ? 1_555 ? 
68  AC8 28 SER A 994  ? SER A 995  . ? 1_555 ? 
69  AC8 28 ASN A 995  ? ASN A 996  . ? 1_555 ? 
70  AC8 28 THR A 996  ? THR A 997  . ? 1_555 ? 
71  AC8 28 MG  C .    ? MG  A 2237 . ? 1_555 ? 
72  AC8 28 CO2 I .    ? CO2 A 2240 . ? 1_555 ? 
73  AC8 28 HOH Q .    ? HOH A 2248 . ? 1_555 ? 
74  AC8 28 HOH Q .    ? HOH A 2264 . ? 1_555 ? 
75  AC8 28 HOH Q .    ? HOH A 2265 . ? 1_555 ? 
76  AC8 28 HOH Q .    ? HOH A 2375 . ? 1_555 ? 
77  AC9 6  THR A 30   ? THR A 31   . ? 1_555 ? 
78  AC9 6  ARG A 113  ? ARG A 114  . ? 1_555 ? 
79  AC9 6  ASN A 995  ? ASN A 996  . ? 1_555 ? 
80  AC9 6  THR A 996  ? THR A 997  . ? 1_555 ? 
81  AC9 6  HTL H .    ? HTL A 2236 . ? 1_555 ? 
82  AC9 6  MET B 1201 ? MET B 1202 . ? 1_555 ? 
83  BC1 10 TRP B 683  ? TRP B 684  . ? 1_555 ? 
84  BC1 10 CYS B 688  ? CYS B 689  . ? 1_555 ? 
85  BC1 10 ILE B 689  ? ILE B 690  . ? 1_555 ? 
86  BC1 10 CYS B 691  ? CYS B 692  . ? 1_555 ? 
87  BC1 10 ASN B 692  ? ASN B 693  . ? 1_555 ? 
88  BC1 10 CYS B 694  ? CYS B 695  . ? 1_555 ? 
89  BC1 10 CYS B 754  ? CYS B 755  . ? 1_555 ? 
90  BC1 10 PRO B 755  ? PRO B 756  . ? 1_555 ? 
91  BC1 10 ALA B 760  ? ALA B 761  . ? 1_555 ? 
92  BC1 10 LEU B 761  ? LEU B 762  . ? 1_555 ? 
93  BC2 8  CYS B 698  ? CYS B 699  . ? 1_555 ? 
94  BC2 8  PRO B 699  ? PRO B 700  . ? 1_555 ? 
95  BC2 8  ILE B 703  ? ILE B 704  . ? 1_555 ? 
96  BC2 8  CYS B 744  ? CYS B 745  . ? 1_555 ? 
97  BC2 8  MET B 745  ? MET B 746  . ? 1_555 ? 
98  BC2 8  CYS B 747  ? CYS B 748  . ? 1_555 ? 
99  BC2 8  GLY B 748  ? GLY B 749  . ? 1_555 ? 
100 BC2 8  CYS B 750  ? CYS B 751  . ? 1_555 ? 
101 BC3 8  MET A 1202 ? MET A 1203 . ? 1_555 ? 
102 BC3 8  LYS B 458  ? LYS B 459  . ? 1_555 ? 
103 BC3 8  CYS B 811  ? CYS B 812  . ? 1_555 ? 
104 BC3 8  CYS B 814  ? CYS B 815  . ? 1_555 ? 
105 BC3 8  GLU B 816  ? GLU B 817  . ? 1_555 ? 
106 BC3 8  CYS B 839  ? CYS B 840  . ? 1_555 ? 
107 BC3 8  CYS B 1070 ? CYS B 1071 . ? 1_555 ? 
108 BC3 8  ILE B 1071 ? ILE B 1072 . ? 1_555 ? 
109 BC4 27 PRO B 28   ? PRO B 29   . ? 1_555 ? 
110 BC4 27 GLU B 63   ? GLU B 64   . ? 1_555 ? 
111 BC4 27 GLN B 87   ? GLN B 88   . ? 1_555 ? 
112 BC4 27 LEU B 91   ? LEU B 92   . ? 1_555 ? 
113 BC4 27 ARG B 113  ? ARG B 114  . ? 1_555 ? 
114 BC4 27 GLU B 816  ? GLU B 817  . ? 1_555 ? 
115 BC4 27 THR B 837  ? THR B 838  . ? 1_555 ? 
116 BC4 27 GLY B 838  ? GLY B 839  . ? 1_555 ? 
117 BC4 27 CYS B 839  ? CYS B 840  . ? 1_555 ? 
118 BC4 27 PHE B 868  ? PHE B 869  . ? 1_555 ? 
119 BC4 27 GLU B 869  ? GLU B 870  . ? 1_555 ? 
120 BC4 27 GLY B 961  ? GLY B 962  . ? 1_555 ? 
121 BC4 27 ASP B 962  ? ASP B 963  . ? 1_555 ? 
122 BC4 27 GLY B 963  ? GLY B 964  . ? 1_555 ? 
123 BC4 27 TRP B 964  ? TRP B 965  . ? 1_555 ? 
124 BC4 27 THR B 990  ? THR B 991  . ? 1_555 ? 
125 BC4 27 VAL B 992  ? VAL B 993  . ? 1_555 ? 
126 BC4 27 TYR B 993  ? TYR B 994  . ? 1_555 ? 
127 BC4 27 SER B 994  ? SER B 995  . ? 1_555 ? 
128 BC4 27 ASN B 995  ? ASN B 996  . ? 1_555 ? 
129 BC4 27 THR B 996  ? THR B 997  . ? 1_555 ? 
130 BC4 27 MG  J .    ? MG  B 3237 . ? 1_555 ? 
131 BC4 27 CO2 P .    ? CO2 B 3240 . ? 1_555 ? 
132 BC4 27 HOH R .    ? HOH B 3273 . ? 1_555 ? 
133 BC4 27 HOH R .    ? HOH B 3308 . ? 1_555 ? 
134 BC4 27 HOH R .    ? HOH B 3340 . ? 1_555 ? 
135 BC4 27 HOH R .    ? HOH B 3382 . ? 1_555 ? 
136 BC5 7  MET A 1201 ? MET A 1202 . ? 1_555 ? 
137 BC5 7  ILE B 29   ? ILE B 30   . ? 1_555 ? 
138 BC5 7  THR B 30   ? THR B 31   . ? 1_555 ? 
139 BC5 7  ARG B 113  ? ARG B 114  . ? 1_555 ? 
140 BC5 7  ASN B 995  ? ASN B 996  . ? 1_555 ? 
141 BC5 7  THR B 996  ? THR B 997  . ? 1_555 ? 
142 BC5 7  HTL O .    ? HTL B 3236 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1KEK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KEK 
_atom_sites.fract_transf_matrix[1][1]   0.011613 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006861 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004756 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
FE 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLY A 1 1    ? -62.391 -67.687  35.562  1.00 49.20  ? 2    GLY A N     1 
ATOM   2     C  CA    . GLY A 1 1    ? -62.387 -69.103  36.006  1.00 52.73  ? 2    GLY A CA    1 
ATOM   3     C  C     . GLY A 1 1    ? -61.013 -69.762  35.896  1.00 53.70  ? 2    GLY A C     1 
ATOM   4     O  O     . GLY A 1 1    ? -60.001 -69.116  35.636  1.00 52.91  ? 2    GLY A O     1 
ATOM   5     N  N     . LYS A 1 2    ? -61.016 -71.066  36.132  1.00 54.72  ? 3    LYS A N     1 
ATOM   6     C  CA    . LYS A 1 2    ? -59.883 -71.959  36.031  1.00 54.66  ? 3    LYS A CA    1 
ATOM   7     C  C     . LYS A 1 2    ? -60.058 -72.825  34.773  1.00 53.83  ? 3    LYS A C     1 
ATOM   8     O  O     . LYS A 1 2    ? -61.149 -73.222  34.350  1.00 53.64  ? 3    LYS A O     1 
ATOM   9     C  CB    . LYS A 1 2    ? -59.735 -72.860  37.250  1.00 56.39  ? 3    LYS A CB    1 
ATOM   10    C  CG    . LYS A 1 2    ? -60.430 -72.434  38.531  1.00 58.01  ? 3    LYS A CG    1 
ATOM   11    C  CD    . LYS A 1 2    ? -60.761 -73.632  39.415  1.00 59.11  ? 3    LYS A CD    1 
ATOM   12    C  CE    . LYS A 1 2    ? -60.199 -73.493  40.821  1.00 59.85  ? 3    LYS A CE    1 
ATOM   13    N  NZ    . LYS A 1 2    ? -59.188 -74.534  41.162  1.00 60.20  ? 3    LYS A NZ    1 
ATOM   14    N  N     . LYS A 1 3    ? -58.955 -73.111  34.100  1.00 50.68  ? 4    LYS A N     1 
ATOM   15    C  CA    . LYS A 1 3    ? -58.962 -73.896  32.870  1.00 48.34  ? 4    LYS A CA    1 
ATOM   16    C  C     . LYS A 1 3    ? -57.881 -74.967  32.964  1.00 45.88  ? 4    LYS A C     1 
ATOM   17    O  O     . LYS A 1 3    ? -56.850 -74.676  33.580  1.00 41.37  ? 4    LYS A O     1 
ATOM   18    C  CB    . LYS A 1 3    ? -58.704 -72.894  31.747  1.00 51.19  ? 4    LYS A CB    1 
ATOM   19    C  CG    . LYS A 1 3    ? -58.677 -73.444  30.337  1.00 53.44  ? 4    LYS A CG    1 
ATOM   20    C  CD    . LYS A 1 3    ? -58.224 -72.371  29.352  1.00 56.35  ? 4    LYS A CD    1 
ATOM   21    C  CE    . LYS A 1 3    ? -58.339 -72.856  27.913  1.00 57.56  ? 4    LYS A CE    1 
ATOM   22    N  NZ    . LYS A 1 3    ? -59.726 -73.300  27.585  1.00 58.78  ? 4    LYS A NZ    1 
ATOM   23    N  N     . MET A 1 4    ? -58.131 -76.181  32.493  1.00 42.55  ? 5    MET A N     1 
ATOM   24    C  CA    . MET A 1 4    ? -57.097 -77.214  32.516  1.00 42.46  ? 5    MET A CA    1 
ATOM   25    C  C     . MET A 1 4    ? -56.266 -77.030  31.236  1.00 41.00  ? 5    MET A C     1 
ATOM   26    O  O     . MET A 1 4    ? -56.815 -76.482  30.273  1.00 40.72  ? 5    MET A O     1 
ATOM   27    C  CB    . MET A 1 4    ? -57.598 -78.644  32.566  1.00 44.64  ? 5    MET A CB    1 
ATOM   28    C  CG    . MET A 1 4    ? -58.328 -79.055  33.822  1.00 46.43  ? 5    MET A CG    1 
ATOM   29    S  SD    . MET A 1 4    ? -57.322 -78.711  35.281  1.00 50.04  ? 5    MET A SD    1 
ATOM   30    C  CE    . MET A 1 4    ? -58.249 -77.343  35.984  1.00 51.44  ? 5    MET A CE    1 
ATOM   31    N  N     . MET A 1 5    ? -55.001 -77.452  31.248  1.00 37.26  ? 6    MET A N     1 
ATOM   32    C  CA    . MET A 1 5    ? -54.163 -77.254  30.054  1.00 35.56  ? 6    MET A CA    1 
ATOM   33    C  C     . MET A 1 5    ? -52.934 -78.152  30.168  1.00 33.27  ? 6    MET A C     1 
ATOM   34    O  O     . MET A 1 5    ? -52.400 -78.170  31.279  1.00 29.16  ? 6    MET A O     1 
ATOM   35    C  CB    . MET A 1 5    ? -53.647 -75.816  30.161  1.00 37.76  ? 6    MET A CB    1 
ATOM   36    C  CG    . MET A 1 5    ? -53.083 -75.113  28.965  1.00 42.07  ? 6    MET A CG    1 
ATOM   37    S  SD    . MET A 1 5    ? -52.694 -73.377  29.258  1.00 44.17  ? 6    MET A SD    1 
ATOM   38    C  CE    . MET A 1 5    ? -51.108 -73.203  28.456  1.00 43.96  ? 6    MET A CE    1 
ATOM   39    N  N     . THR A 1 6    ? -52.532 -78.868  29.125  1.00 30.58  ? 7    THR A N     1 
ATOM   40    C  CA    . THR A 1 6    ? -51.241 -79.578  29.224  1.00 28.30  ? 7    THR A CA    1 
ATOM   41    C  C     . THR A 1 6    ? -50.245 -78.670  28.507  1.00 26.69  ? 7    THR A C     1 
ATOM   42    O  O     . THR A 1 6    ? -50.409 -78.251  27.357  1.00 27.25  ? 7    THR A O     1 
ATOM   43    C  CB    . THR A 1 6    ? -51.273 -81.020  28.760  1.00 29.81  ? 7    THR A CB    1 
ATOM   44    O  OG1   . THR A 1 6    ? -51.378 -81.120  27.340  1.00 30.89  ? 7    THR A OG1   1 
ATOM   45    C  CG2   . THR A 1 6    ? -52.519 -81.703  29.337  1.00 29.41  ? 7    THR A CG2   1 
ATOM   46    N  N     . THR A 1 7    ? -49.283 -78.122  29.280  1.00 26.25  ? 8    THR A N     1 
ATOM   47    C  CA    . THR A 1 7    ? -48.304 -77.225  28.711  1.00 24.58  ? 8    THR A CA    1 
ATOM   48    C  C     . THR A 1 7    ? -46.965 -77.404  29.477  1.00 21.03  ? 8    THR A C     1 
ATOM   49    O  O     . THR A 1 7    ? -46.972 -78.038  30.504  1.00 18.56  ? 8    THR A O     1 
ATOM   50    C  CB    . THR A 1 7    ? -48.384 -75.690  28.774  1.00 26.67  ? 8    THR A CB    1 
ATOM   51    O  OG1   . THR A 1 7    ? -49.126 -75.271  29.889  1.00 30.44  ? 8    THR A OG1   1 
ATOM   52    C  CG2   . THR A 1 7    ? -48.659 -75.034  27.471  1.00 29.13  ? 8    THR A CG2   1 
ATOM   53    N  N     . ASP A 1 8    ? -45.979 -76.641  29.006  1.00 19.33  ? 9    ASP A N     1 
ATOM   54    C  CA    . ASP A 1 8    ? -44.659 -76.731  29.696  1.00 19.38  ? 9    ASP A CA    1 
ATOM   55    C  C     . ASP A 1 8    ? -44.542 -75.499  30.584  1.00 18.67  ? 9    ASP A C     1 
ATOM   56    O  O     . ASP A 1 8    ? -45.374 -74.583  30.559  1.00 17.60  ? 9    ASP A O     1 
ATOM   57    C  CB    . ASP A 1 8    ? -43.525 -76.891  28.706  1.00 18.45  ? 9    ASP A CB    1 
ATOM   58    C  CG    . ASP A 1 8    ? -43.301 -75.739  27.751  1.00 22.20  ? 9    ASP A CG    1 
ATOM   59    O  OD1   . ASP A 1 8    ? -42.585 -75.932  26.749  1.00 22.98  ? 9    ASP A OD1   1 
ATOM   60    O  OD2   . ASP A 1 8    ? -43.808 -74.603  27.944  1.00 18.24  ? 9    ASP A OD2   1 
ATOM   61    N  N     . GLY A 1 9    ? -43.442 -75.414  31.333  1.00 18.63  ? 10   GLY A N     1 
ATOM   62    C  CA    . GLY A 1 9    ? -43.275 -74.327  32.307  1.00 17.96  ? 10   GLY A CA    1 
ATOM   63    C  C     . GLY A 1 9    ? -43.068 -72.988  31.662  1.00 15.20  ? 10   GLY A C     1 
ATOM   64    O  O     . GLY A 1 9    ? -43.543 -71.949  32.139  1.00 14.78  ? 10   GLY A O     1 
ATOM   65    N  N     . ASN A 1 10   ? -42.401 -72.973  30.503  1.00 15.51  ? 11   ASN A N     1 
ATOM   66    C  CA    . ASN A 1 10   ? -42.275 -71.761  29.727  1.00 16.13  ? 11   ASN A CA    1 
ATOM   67    C  C     . ASN A 1 10   ? -43.680 -71.249  29.366  1.00 16.59  ? 11   ASN A C     1 
ATOM   68    O  O     . ASN A 1 10   ? -43.952 -70.072  29.573  1.00 14.97  ? 11   ASN A O     1 
ATOM   69    C  CB    . ASN A 1 10   ? -41.531 -72.066  28.405  1.00 13.85  ? 11   ASN A CB    1 
ATOM   70    C  CG    . ASN A 1 10   ? -40.014 -71.974  28.576  1.00 16.13  ? 11   ASN A CG    1 
ATOM   71    O  OD1   . ASN A 1 10   ? -39.216 -72.641  27.832  1.00 17.22  ? 11   ASN A OD1   1 
ATOM   72    N  ND2   . ASN A 1 10   ? -39.598 -71.133  29.475  1.00 11.32  ? 11   ASN A ND2   1 
ATOM   73    N  N     . THR A 1 11   ? -44.501 -72.155  28.844  1.00 16.17  ? 12   THR A N     1 
ATOM   74    C  CA    . THR A 1 11   ? -45.809 -71.607  28.435  1.00 19.33  ? 12   THR A CA    1 
ATOM   75    C  C     . THR A 1 11   ? -46.783 -71.297  29.555  1.00 18.63  ? 12   THR A C     1 
ATOM   76    O  O     . THR A 1 11   ? -47.469 -70.247  29.385  1.00 18.88  ? 12   THR A O     1 
ATOM   77    C  CB    . THR A 1 11   ? -46.397 -72.082  27.129  1.00 22.18  ? 12   THR A CB    1 
ATOM   78    O  OG1   . THR A 1 11   ? -47.822 -72.197  27.037  1.00 26.14  ? 12   THR A OG1   1 
ATOM   79    C  CG2   . THR A 1 11   ? -45.582 -73.058  26.379  1.00 14.68  ? 12   THR A CG2   1 
ATOM   80    N  N     . ALA A 1 12   ? -46.712 -71.956  30.694  1.00 16.11  ? 13   ALA A N     1 
ATOM   81    C  CA    . ALA A 1 12   ? -47.481 -71.611  31.867  1.00 17.28  ? 13   ALA A CA    1 
ATOM   82    C  C     . ALA A 1 12   ? -47.124 -70.219  32.413  1.00 19.88  ? 13   ALA A C     1 
ATOM   83    O  O     . ALA A 1 12   ? -48.008 -69.457  32.842  1.00 18.61  ? 13   ALA A O     1 
ATOM   84    C  CB    . ALA A 1 12   ? -47.141 -72.625  32.980  1.00 18.02  ? 13   ALA A CB    1 
ATOM   85    N  N     . THR A 1 13   ? -45.816 -69.883  32.324  1.00 15.78  ? 14   THR A N     1 
ATOM   86    C  CA    . THR A 1 13   ? -45.430 -68.557  32.815  1.00 16.46  ? 14   THR A CA    1 
ATOM   87    C  C     . THR A 1 13   ? -45.651 -67.496  31.741  1.00 13.36  ? 14   THR A C     1 
ATOM   88    O  O     . THR A 1 13   ? -46.178 -66.472  32.131  1.00 16.38  ? 14   THR A O     1 
ATOM   89    C  CB    . THR A 1 13   ? -44.085 -68.393  33.568  1.00 19.04  ? 14   THR A CB    1 
ATOM   90    O  OG1   . THR A 1 13   ? -43.237 -67.296  33.228  1.00 22.39  ? 14   THR A OG1   1 
ATOM   91    C  CG2   . THR A 1 13   ? -43.387 -69.659  33.827  1.00 7.90   ? 14   THR A CG2   1 
ATOM   92    N  N     . ALA A 1 14   ? -45.511 -67.781  30.462  1.00 13.25  ? 15   ALA A N     1 
ATOM   93    C  CA    . ALA A 1 14   ? -45.811 -66.725  29.478  1.00 14.77  ? 15   ALA A CA    1 
ATOM   94    C  C     . ALA A 1 14   ? -47.305 -66.396  29.542  1.00 15.00  ? 15   ALA A C     1 
ATOM   95    O  O     . ALA A 1 14   ? -47.716 -65.268  29.356  1.00 13.83  ? 15   ALA A O     1 
ATOM   96    C  CB    . ALA A 1 14   ? -45.436 -67.233  28.096  1.00 14.23  ? 15   ALA A CB    1 
ATOM   97    N  N     . HIS A 1 15   ? -48.134 -67.380  29.846  1.00 14.83  ? 16   HIS A N     1 
ATOM   98    C  CA    . HIS A 1 15   ? -49.602 -67.180  29.961  1.00 14.71  ? 16   HIS A CA    1 
ATOM   99    C  C     . HIS A 1 15   ? -49.887 -66.012  30.881  1.00 13.67  ? 16   HIS A C     1 
ATOM   100   O  O     . HIS A 1 15   ? -50.604 -65.087  30.582  1.00 13.39  ? 16   HIS A O     1 
ATOM   101   C  CB    . HIS A 1 15   ? -50.246 -68.455  30.518  1.00 16.32  ? 16   HIS A CB    1 
ATOM   102   C  CG    . HIS A 1 15   ? -51.720 -68.442  30.705  1.00 18.52  ? 16   HIS A CG    1 
ATOM   103   N  ND1   . HIS A 1 15   ? -52.275 -68.199  31.956  1.00 20.55  ? 16   HIS A ND1   1 
ATOM   104   C  CD2   . HIS A 1 15   ? -52.718 -68.579  29.838  1.00 16.87  ? 16   HIS A CD2   1 
ATOM   105   C  CE1   . HIS A 1 15   ? -53.595 -68.248  31.876  1.00 18.85  ? 16   HIS A CE1   1 
ATOM   106   N  NE2   . HIS A 1 15   ? -53.866 -68.446  30.572  1.00 23.00  ? 16   HIS A NE2   1 
ATOM   107   N  N     . VAL A 1 16   ? -49.194 -66.031  32.028  1.00 13.74  ? 17   VAL A N     1 
ATOM   108   C  CA    . VAL A 1 16   ? -49.391 -64.988  33.010  1.00 12.35  ? 17   VAL A CA    1 
ATOM   109   C  C     . VAL A 1 16   ? -48.680 -63.695  32.619  1.00 13.83  ? 17   VAL A C     1 
ATOM   110   O  O     . VAL A 1 16   ? -49.237 -62.637  32.797  1.00 14.77  ? 17   VAL A O     1 
ATOM   111   C  CB    . VAL A 1 16   ? -48.880 -65.436  34.413  1.00 13.36  ? 17   VAL A CB    1 
ATOM   112   C  CG1   . VAL A 1 16   ? -48.962 -64.301  35.402  1.00 13.35  ? 17   VAL A CG1   1 
ATOM   113   C  CG2   . VAL A 1 16   ? -49.733 -66.646  34.830  1.00 13.77  ? 17   VAL A CG2   1 
ATOM   114   N  N     . ALA A 1 17   ? -47.439 -63.798  32.159  1.00 16.10  ? 18   ALA A N     1 
ATOM   115   C  CA    . ALA A 1 17   ? -46.665 -62.615  31.833  1.00 13.85  ? 18   ALA A CA    1 
ATOM   116   C  C     . ALA A 1 17   ? -47.302 -61.755  30.726  1.00 15.17  ? 18   ALA A C     1 
ATOM   117   O  O     . ALA A 1 17   ? -47.304 -60.507  30.826  1.00 13.05  ? 18   ALA A O     1 
ATOM   118   C  CB    . ALA A 1 17   ? -45.249 -63.050  31.441  1.00 14.84  ? 18   ALA A CB    1 
ATOM   119   N  N     . TYR A 1 18   ? -47.886 -62.390  29.746  1.00 15.00  ? 19   TYR A N     1 
ATOM   120   C  CA    . TYR A 1 18   ? -48.594 -61.659  28.670  1.00 17.87  ? 19   TYR A CA    1 
ATOM   121   C  C     . TYR A 1 18   ? -49.756 -60.876  29.266  1.00 16.92  ? 19   TYR A C     1 
ATOM   122   O  O     . TYR A 1 18   ? -49.999 -59.691  28.970  1.00 18.97  ? 19   TYR A O     1 
ATOM   123   C  CB    . TYR A 1 18   ? -49.090 -62.670  27.583  1.00 15.52  ? 19   TYR A CB    1 
ATOM   124   C  CG    . TYR A 1 18   ? -49.652 -61.952  26.374  1.00 18.60  ? 19   TYR A CG    1 
ATOM   125   C  CD1   . TYR A 1 18   ? -48.868 -61.748  25.236  1.00 17.66  ? 19   TYR A CD1   1 
ATOM   126   C  CD2   . TYR A 1 18   ? -50.950 -61.382  26.367  1.00 19.62  ? 19   TYR A CD2   1 
ATOM   127   C  CE1   . TYR A 1 18   ? -49.355 -61.059  24.145  1.00 17.55  ? 19   TYR A CE1   1 
ATOM   128   C  CE2   . TYR A 1 18   ? -51.445 -60.686  25.271  1.00 17.62  ? 19   TYR A CE2   1 
ATOM   129   C  CZ    . TYR A 1 18   ? -50.618 -60.503  24.171  1.00 17.13  ? 19   TYR A CZ    1 
ATOM   130   O  OH    . TYR A 1 18   ? -51.006 -59.815  23.058  1.00 20.33  ? 19   TYR A OH    1 
ATOM   131   N  N     . ALA A 1 19   ? -50.528 -61.514  30.138  1.00 16.75  ? 20   ALA A N     1 
ATOM   132   C  CA    . ALA A 1 19   ? -51.715 -60.907  30.730  1.00 16.35  ? 20   ALA A CA    1 
ATOM   133   C  C     . ALA A 1 19   ? -51.365 -59.635  31.505  1.00 15.97  ? 20   ALA A C     1 
ATOM   134   O  O     . ALA A 1 19   ? -51.984 -58.584  31.450  1.00 17.06  ? 20   ALA A O     1 
ATOM   135   C  CB    . ALA A 1 19   ? -52.417 -61.826  31.737  1.00 15.43  ? 20   ALA A CB    1 
ATOM   136   N  N     . MET A 1 20   ? -50.280 -59.796  32.284  1.00 15.68  ? 21   MET A N     1 
ATOM   137   C  CA    . MET A 1 20   ? -49.909 -58.767  33.241  1.00 15.87  ? 21   MET A CA    1 
ATOM   138   C  C     . MET A 1 20   ? -48.975 -57.673  32.760  1.00 15.29  ? 21   MET A C     1 
ATOM   139   O  O     . MET A 1 20   ? -48.646 -56.837  33.600  1.00 14.86  ? 21   MET A O     1 
ATOM   140   C  CB    . MET A 1 20   ? -49.253 -59.517  34.438  1.00 14.96  ? 21   MET A CB    1 
ATOM   141   C  CG    . MET A 1 20   ? -50.172 -60.564  35.066  1.00 17.72  ? 21   MET A CG    1 
ATOM   142   S  SD    . MET A 1 20   ? -51.754 -59.922  35.697  1.00 18.53  ? 21   MET A SD    1 
ATOM   143   C  CE    . MET A 1 20   ? -51.351 -58.831  36.997  1.00 16.73  ? 21   MET A CE    1 
ATOM   144   N  N     . SER A 1 21   ? -48.558 -57.642  31.519  1.00 15.63  ? 22   SER A N     1 
ATOM   145   C  CA    . SER A 1 21   ? -47.602 -56.643  31.088  1.00 16.31  ? 22   SER A CA    1 
ATOM   146   C  C     . SER A 1 21   ? -48.150 -55.842  29.898  1.00 16.56  ? 22   SER A C     1 
ATOM   147   O  O     . SER A 1 21   ? -48.928 -56.370  29.108  1.00 18.68  ? 22   SER A O     1 
ATOM   148   C  CB    . SER A 1 21   ? -46.297 -57.341  30.641  1.00 16.47  ? 22   SER A CB    1 
ATOM   149   O  OG    . SER A 1 21   ? -45.859 -58.252  31.648  1.00 18.34  ? 22   SER A OG    1 
ATOM   150   N  N     . GLU A 1 22   ? -47.601 -54.628  29.749  1.00 16.67  ? 23   GLU A N     1 
ATOM   151   C  CA    . GLU A 1 22   ? -47.971 -53.833  28.568  1.00 16.57  ? 23   GLU A CA    1 
ATOM   152   C  C     . GLU A 1 22   ? -46.854 -53.861  27.531  1.00 15.78  ? 23   GLU A C     1 
ATOM   153   O  O     . GLU A 1 22   ? -47.078 -53.790  26.335  1.00 14.09  ? 23   GLU A O     1 
ATOM   154   C  CB    . GLU A 1 22   ? -48.233 -52.381  29.001  1.00 17.48  ? 23   GLU A CB    1 
ATOM   155   C  CG    . GLU A 1 22   ? -49.399 -52.345  30.007  1.00 17.52  ? 23   GLU A CG    1 
ATOM   156   C  CD    . GLU A 1 22   ? -49.540 -50.962  30.618  1.00 19.14  ? 23   GLU A CD    1 
ATOM   157   O  OE1   . GLU A 1 22   ? -50.619 -50.329  30.441  1.00 17.85  ? 23   GLU A OE1   1 
ATOM   158   O  OE2   . GLU A 1 22   ? -48.640 -50.445  31.350  1.00 19.53  ? 23   GLU A OE2   1 
ATOM   159   N  N     . VAL A 1 23   ? -45.631 -54.007  28.041  1.00 15.56  ? 24   VAL A N     1 
ATOM   160   C  CA    . VAL A 1 23   ? -44.445 -53.999  27.168  1.00 17.50  ? 24   VAL A CA    1 
ATOM   161   C  C     . VAL A 1 23   ? -43.529 -55.164  27.490  1.00 16.84  ? 24   VAL A C     1 
ATOM   162   O  O     . VAL A 1 23   ? -43.446 -55.528  28.655  1.00 17.05  ? 24   VAL A O     1 
ATOM   163   C  CB    . VAL A 1 23   ? -43.641 -52.690  27.386  1.00 17.94  ? 24   VAL A CB    1 
ATOM   164   C  CG1   . VAL A 1 23   ? -42.323 -52.658  26.588  1.00 16.31  ? 24   VAL A CG1   1 
ATOM   165   C  CG2   . VAL A 1 23   ? -44.465 -51.467  26.962  1.00 17.31  ? 24   VAL A CG2   1 
ATOM   166   N  N     . ALA A 1 24   ? -42.838 -55.689  26.476  1.00 16.34  ? 25   ALA A N     1 
ATOM   167   C  CA    . ALA A 1 24   ? -41.833 -56.684  26.743  1.00 17.66  ? 25   ALA A CA    1 
ATOM   168   C  C     . ALA A 1 24   ? -40.622 -56.429  25.811  1.00 17.64  ? 25   ALA A C     1 
ATOM   169   O  O     . ALA A 1 24   ? -40.890 -56.241  24.638  1.00 15.82  ? 25   ALA A O     1 
ATOM   170   C  CB    . ALA A 1 24   ? -42.277 -58.085  26.498  1.00 16.66  ? 25   ALA A CB    1 
ATOM   171   N  N     . ALA A 1 25   ? -39.434 -56.257  26.377  1.00 16.34  ? 26   ALA A N     1 
ATOM   172   C  CA    . ALA A 1 25   ? -38.203 -56.172  25.557  1.00 16.22  ? 26   ALA A CA    1 
ATOM   173   C  C     . ALA A 1 25   ? -37.507 -57.524  25.631  1.00 19.53  ? 26   ALA A C     1 
ATOM   174   O  O     . ALA A 1 25   ? -37.224 -58.032  26.751  1.00 20.55  ? 26   ALA A O     1 
ATOM   175   C  CB    . ALA A 1 25   ? -37.328 -55.055  26.068  1.00 18.93  ? 26   ALA A CB    1 
ATOM   176   N  N     . ILE A 1 26   ? -37.230 -58.185  24.548  1.00 17.40  ? 27   ILE A N     1 
ATOM   177   C  CA    . ILE A 1 26   ? -36.861 -59.583  24.389  1.00 19.45  ? 27   ILE A CA    1 
ATOM   178   C  C     . ILE A 1 26   ? -35.536 -59.840  23.697  1.00 18.60  ? 27   ILE A C     1 
ATOM   179   O  O     . ILE A 1 26   ? -35.109 -58.970  22.883  1.00 16.57  ? 27   ILE A O     1 
ATOM   180   C  CB    . ILE A 1 26   ? -38.094 -60.039  23.571  1.00 24.03  ? 27   ILE A CB    1 
ATOM   181   C  CG1   . ILE A 1 26   ? -38.934 -60.940  24.518  1.00 27.24  ? 27   ILE A CG1   1 
ATOM   182   C  CG2   . ILE A 1 26   ? -38.137 -60.603  22.201  1.00 24.33  ? 27   ILE A CG2   1 
ATOM   183   C  CD1   . ILE A 1 26   ? -39.796 -59.971  25.285  1.00 29.40  ? 27   ILE A CD1   1 
ATOM   184   N  N     . TYR A 1 27   ? -34.939 -60.998  23.964  1.00 15.90  ? 28   TYR A N     1 
ATOM   185   C  CA    . TYR A 1 27   ? -33.692 -61.436  23.278  1.00 15.91  ? 28   TYR A CA    1 
ATOM   186   C  C     . TYR A 1 27   ? -33.646 -62.970  23.462  1.00 16.75  ? 28   TYR A C     1 
ATOM   187   O  O     . TYR A 1 27   ? -33.917 -63.462  24.579  1.00 17.71  ? 28   TYR A O     1 
ATOM   188   C  CB    . TYR A 1 27   ? -32.444 -60.798  23.883  1.00 15.05  ? 28   TYR A CB    1 
ATOM   189   C  CG    . TYR A 1 27   ? -31.275 -60.978  22.886  1.00 13.29  ? 28   TYR A CG    1 
ATOM   190   C  CD1   . TYR A 1 27   ? -31.235 -60.209  21.710  1.00 12.68  ? 28   TYR A CD1   1 
ATOM   191   C  CD2   . TYR A 1 27   ? -30.339 -61.984  23.061  1.00 15.20  ? 28   TYR A CD2   1 
ATOM   192   C  CE1   . TYR A 1 27   ? -30.254 -60.385  20.762  1.00 13.51  ? 28   TYR A CE1   1 
ATOM   193   C  CE2   . TYR A 1 27   ? -29.318 -62.133  22.124  1.00 13.84  ? 28   TYR A CE2   1 
ATOM   194   C  CZ    . TYR A 1 27   ? -29.269 -61.354  20.998  1.00 16.32  ? 28   TYR A CZ    1 
ATOM   195   O  OH    . TYR A 1 27   ? -28.243 -61.503  20.058  1.00 14.50  ? 28   TYR A OH    1 
ATOM   196   N  N     . PRO A 1 28   ? -33.347 -63.738  22.451  1.00 18.92  ? 29   PRO A N     1 
ATOM   197   C  CA    . PRO A 1 28   ? -33.407 -65.183  22.472  1.00 19.28  ? 29   PRO A CA    1 
ATOM   198   C  C     . PRO A 1 28   ? -32.246 -65.824  23.191  1.00 18.85  ? 29   PRO A C     1 
ATOM   199   O  O     . PRO A 1 28   ? -31.096 -65.447  22.928  1.00 15.74  ? 29   PRO A O     1 
ATOM   200   C  CB    . PRO A 1 28   ? -33.249 -65.633  20.980  1.00 20.06  ? 29   PRO A CB    1 
ATOM   201   C  CG    . PRO A 1 28   ? -32.440 -64.503  20.420  1.00 21.41  ? 29   PRO A CG    1 
ATOM   202   C  CD    . PRO A 1 28   ? -33.049 -63.273  21.055  1.00 18.38  ? 29   PRO A CD    1 
ATOM   203   N  N     . ILE A 1 29   ? -32.563 -66.688  24.142  1.00 18.12  ? 30   ILE A N     1 
ATOM   204   C  CA    . ILE A 1 29   ? -31.515 -67.479  24.766  1.00 16.20  ? 30   ILE A CA    1 
ATOM   205   C  C     . ILE A 1 29   ? -32.185 -68.761  25.279  1.00 18.17  ? 30   ILE A C     1 
ATOM   206   O  O     . ILE A 1 29   ? -33.221 -68.702  25.960  1.00 18.00  ? 30   ILE A O     1 
ATOM   207   C  CB    . ILE A 1 29   ? -30.712 -66.753  25.871  1.00 16.11  ? 30   ILE A CB    1 
ATOM   208   C  CG1   . ILE A 1 29   ? -29.614 -67.762  26.370  1.00 15.19  ? 30   ILE A CG1   1 
ATOM   209   C  CG2   . ILE A 1 29   ? -31.490 -66.294  27.081  1.00 16.42  ? 30   ILE A CG2   1 
ATOM   210   C  CD1   . ILE A 1 29   ? -28.551 -66.995  27.175  1.00 17.41  ? 30   ILE A CD1   1 
ATOM   211   N  N     . THR A 1 30   ? -31.586 -69.901  24.940  1.00 17.01  ? 31   THR A N     1 
ATOM   212   C  CA    . THR A 1 30   ? -32.103 -71.188  25.457  1.00 17.05  ? 31   THR A CA    1 
ATOM   213   C  C     . THR A 1 30   ? -31.881 -71.371  26.943  1.00 18.01  ? 31   THR A C     1 
ATOM   214   O  O     . THR A 1 30   ? -30.801 -70.911  27.226  1.00 19.20  ? 31   THR A O     1 
ATOM   215   C  CB    . THR A 1 30   ? -31.387 -72.338  24.725  1.00 17.01  ? 31   THR A CB    1 
ATOM   216   O  OG1   . THR A 1 30   ? -31.552 -72.189  23.294  1.00 17.13  ? 31   THR A OG1   1 
ATOM   217   C  CG2   . THR A 1 30   ? -31.947 -73.719  25.149  1.00 18.44  ? 31   THR A CG2   1 
ATOM   218   N  N     . PRO A 1 31   ? -32.786 -71.821  27.766  1.00 16.22  ? 32   PRO A N     1 
ATOM   219   C  CA    . PRO A 1 31   ? -34.077 -72.360  27.414  1.00 15.13  ? 32   PRO A CA    1 
ATOM   220   C  C     . PRO A 1 31   ? -35.272 -71.428  27.573  1.00 15.35  ? 32   PRO A C     1 
ATOM   221   O  O     . PRO A 1 31   ? -36.408 -71.867  27.630  1.00 17.67  ? 32   PRO A O     1 
ATOM   222   C  CB    . PRO A 1 31   ? -34.169 -73.651  28.250  1.00 14.78  ? 32   PRO A CB    1 
ATOM   223   C  CG    . PRO A 1 31   ? -33.578 -73.219  29.556  1.00 12.71  ? 32   PRO A CG    1 
ATOM   224   C  CD    . PRO A 1 31   ? -32.577 -72.119  29.166  1.00 13.13  ? 32   PRO A CD    1 
ATOM   225   N  N     . SER A 1 32   ? -35.064 -70.106  27.536  1.00 12.88  ? 33   SER A N     1 
ATOM   226   C  CA    . SER A 1 32   ? -36.166 -69.179  27.769  1.00 14.44  ? 33   SER A CA    1 
ATOM   227   C  C     . SER A 1 32   ? -36.855 -68.713  26.507  1.00 17.23  ? 33   SER A C     1 
ATOM   228   O  O     . SER A 1 32   ? -37.922 -68.112  26.577  1.00 17.29  ? 33   SER A O     1 
ATOM   229   C  CB    . SER A 1 32   ? -35.513 -68.050  28.601  1.00 17.01  ? 33   SER A CB    1 
ATOM   230   O  OG    . SER A 1 32   ? -34.770 -67.149  27.763  1.00 17.90  ? 33   SER A OG    1 
ATOM   231   N  N     . SER A 1 33   ? -36.255 -68.928  25.336  1.00 15.29  ? 34   SER A N     1 
ATOM   232   C  CA    . SER A 1 33   ? -36.777 -68.416  24.049  1.00 16.84  ? 34   SER A CA    1 
ATOM   233   C  C     . SER A 1 33   ? -38.260 -68.614  23.797  1.00 17.17  ? 34   SER A C     1 
ATOM   234   O  O     . SER A 1 33   ? -38.983 -67.740  23.284  1.00 16.04  ? 34   SER A O     1 
ATOM   235   C  CB    . SER A 1 33   ? -35.950 -69.055  22.946  1.00 15.67  ? 34   SER A CB    1 
ATOM   236   O  OG    . SER A 1 33   ? -34.617 -68.732  23.091  1.00 19.66  ? 34   SER A OG    1 
ATOM   237   N  N     . THR A 1 34   ? -38.749 -69.755  24.260  1.00 17.64  ? 35   THR A N     1 
ATOM   238   C  CA    . THR A 1 34   ? -40.149 -70.161  24.069  1.00 17.89  ? 35   THR A CA    1 
ATOM   239   C  C     . THR A 1 34   ? -41.053 -69.066  24.599  1.00 17.41  ? 35   THR A C     1 
ATOM   240   O  O     . THR A 1 34   ? -42.130 -68.820  23.988  1.00 18.50  ? 35   THR A O     1 
ATOM   241   C  CB    . THR A 1 34   ? -40.474 -71.545  24.698  1.00 18.34  ? 35   THR A CB    1 
ATOM   242   O  OG1   . THR A 1 34   ? -39.774 -72.662  24.114  1.00 18.93  ? 35   THR A OG1   1 
ATOM   243   C  CG2   . THR A 1 34   ? -41.960 -71.861  24.692  1.00 19.61  ? 35   THR A CG2   1 
ATOM   244   N  N     . MET A 1 35   ? -40.757 -68.457  25.755  1.00 16.49  ? 36   MET A N     1 
ATOM   245   C  CA    . MET A 1 35   ? -41.664 -67.464  26.327  1.00 16.79  ? 36   MET A CA    1 
ATOM   246   C  C     . MET A 1 35   ? -41.843 -66.237  25.449  1.00 16.81  ? 36   MET A C     1 
ATOM   247   O  O     . MET A 1 35   ? -42.979 -65.847  25.134  1.00 17.24  ? 36   MET A O     1 
ATOM   248   C  CB    . MET A 1 35   ? -41.322 -67.018  27.757  1.00 16.14  ? 36   MET A CB    1 
ATOM   249   C  CG    . MET A 1 35   ? -41.288 -68.211  28.750  1.00 16.50  ? 36   MET A CG    1 
ATOM   250   S  SD    . MET A 1 35   ? -40.935 -67.612  30.447  1.00 17.84  ? 36   MET A SD    1 
ATOM   251   C  CE    . MET A 1 35   ? -39.128 -67.751  30.443  1.00 18.99  ? 36   MET A CE    1 
ATOM   252   N  N     . GLY A 1 36   ? -40.736 -65.698  24.926  1.00 16.76  ? 37   GLY A N     1 
ATOM   253   C  CA    . GLY A 1 36   ? -40.805 -64.567  24.007  1.00 16.66  ? 37   GLY A CA    1 
ATOM   254   C  C     . GLY A 1 36   ? -41.513 -64.984  22.715  1.00 18.53  ? 37   GLY A C     1 
ATOM   255   O  O     . GLY A 1 36   ? -42.300 -64.194  22.216  1.00 19.20  ? 37   GLY A O     1 
ATOM   256   N  N     . GLU A 1 37   ? -41.253 -66.173  22.182  1.00 16.59  ? 38   GLU A N     1 
ATOM   257   C  CA    . GLU A 1 37   ? -41.897 -66.588  20.943  1.00 17.00  ? 38   GLU A CA    1 
ATOM   258   C  C     . GLU A 1 37   ? -43.398 -66.765  21.066  1.00 20.04  ? 38   GLU A C     1 
ATOM   259   O  O     . GLU A 1 37   ? -44.187 -66.271  20.254  1.00 17.83  ? 38   GLU A O     1 
ATOM   260   C  CB    . GLU A 1 37   ? -41.220 -67.909  20.498  1.00 20.36  ? 38   GLU A CB    1 
ATOM   261   C  CG    . GLU A 1 37   ? -39.892 -67.469  19.815  1.00 18.60  ? 38   GLU A CG    1 
ATOM   262   C  CD    . GLU A 1 37   ? -39.081 -68.732  19.475  1.00 19.54  ? 38   GLU A CD    1 
ATOM   263   O  OE1   . GLU A 1 37   ? -37.827 -68.587  19.563  1.00 19.78  ? 38   GLU A OE1   1 
ATOM   264   O  OE2   . GLU A 1 37   ? -39.570 -69.805  19.126  1.00 19.85  ? 38   GLU A OE2   1 
ATOM   265   N  N     . GLU A 1 38   ? -43.835 -67.348  22.187  1.00 18.27  ? 39   GLU A N     1 
ATOM   266   C  CA    . GLU A 1 38   ? -45.296 -67.414  22.425  1.00 19.13  ? 39   GLU A CA    1 
ATOM   267   C  C     . GLU A 1 38   ? -45.932 -66.054  22.596  1.00 18.87  ? 39   GLU A C     1 
ATOM   268   O  O     . GLU A 1 38   ? -47.029 -65.848  22.087  1.00 17.14  ? 39   GLU A O     1 
ATOM   269   C  CB    . GLU A 1 38   ? -45.482 -68.205  23.735  1.00 22.42  ? 39   GLU A CB    1 
ATOM   270   C  CG    . GLU A 1 38   ? -44.885 -69.555  23.281  1.00 28.37  ? 39   GLU A CG    1 
ATOM   271   C  CD    . GLU A 1 38   ? -45.990 -70.568  23.459  1.00 33.46  ? 39   GLU A CD    1 
ATOM   272   O  OE1   . GLU A 1 38   ? -46.950 -70.633  22.682  1.00 33.44  ? 39   GLU A OE1   1 
ATOM   273   O  OE2   . GLU A 1 38   ? -45.716 -71.143  24.513  1.00 37.87  ? 39   GLU A OE2   1 
ATOM   274   N  N     . ALA A 1 39   ? -45.274 -65.164  23.336  1.00 18.53  ? 40   ALA A N     1 
ATOM   275   C  CA    . ALA A 1 39   ? -45.847 -63.803  23.495  1.00 19.00  ? 40   ALA A CA    1 
ATOM   276   C  C     . ALA A 1 39   ? -46.032 -63.148  22.128  1.00 20.07  ? 40   ALA A C     1 
ATOM   277   O  O     . ALA A 1 39   ? -47.054 -62.527  21.851  1.00 20.13  ? 40   ALA A O     1 
ATOM   278   C  CB    . ALA A 1 39   ? -45.011 -62.939  24.382  1.00 16.84  ? 40   ALA A CB    1 
ATOM   279   N  N     . ASP A 1 40   ? -45.025 -63.311  21.264  1.00 20.48  ? 41   ASP A N     1 
ATOM   280   C  CA    . ASP A 1 40   ? -45.185 -62.735  19.908  1.00 22.75  ? 41   ASP A CA    1 
ATOM   281   C  C     . ASP A 1 40   ? -46.295 -63.413  19.114  1.00 23.67  ? 41   ASP A C     1 
ATOM   282   O  O     . ASP A 1 40   ? -47.075 -62.686  18.467  1.00 23.93  ? 41   ASP A O     1 
ATOM   283   C  CB    . ASP A 1 40   ? -43.872 -62.925  19.138  1.00 25.31  ? 41   ASP A CB    1 
ATOM   284   C  CG    . ASP A 1 40   ? -43.801 -61.948  17.949  1.00 28.83  ? 41   ASP A CG    1 
ATOM   285   O  OD1   . ASP A 1 40   ? -43.970 -62.430  16.822  1.00 28.55  ? 41   ASP A OD1   1 
ATOM   286   O  OD2   . ASP A 1 40   ? -43.602 -60.742  18.240  1.00 32.45  ? 41   ASP A OD2   1 
ATOM   287   N  N     . ASP A 1 41   ? -46.426 -64.744  19.177  1.00 22.46  ? 42   ASP A N     1 
ATOM   288   C  CA    . ASP A 1 41   ? -47.484 -65.419  18.450  1.00 22.89  ? 42   ASP A CA    1 
ATOM   289   C  C     . ASP A 1 41   ? -48.858 -64.886  18.954  1.00 24.72  ? 42   ASP A C     1 
ATOM   290   O  O     . ASP A 1 41   ? -49.717 -64.565  18.149  1.00 24.29  ? 42   ASP A O     1 
ATOM   291   C  CB    . ASP A 1 41   ? -47.594 -66.926  18.570  1.00 24.28  ? 42   ASP A CB    1 
ATOM   292   C  CG    . ASP A 1 41   ? -46.464 -67.682  17.882  1.00 26.42  ? 42   ASP A CG    1 
ATOM   293   O  OD1   . ASP A 1 41   ? -45.779 -67.100  17.009  1.00 27.06  ? 42   ASP A OD1   1 
ATOM   294   O  OD2   . ASP A 1 41   ? -46.213 -68.819  18.289  1.00 25.66  ? 42   ASP A OD2   1 
ATOM   295   N  N     . TRP A 1 42   ? -48.963 -64.856  20.286  1.00 20.29  ? 43   TRP A N     1 
ATOM   296   C  CA    . TRP A 1 42   ? -50.238 -64.399  20.883  1.00 21.16  ? 43   TRP A CA    1 
ATOM   297   C  C     . TRP A 1 42   ? -50.580 -62.944  20.552  1.00 21.64  ? 43   TRP A C     1 
ATOM   298   O  O     . TRP A 1 42   ? -51.766 -62.690  20.238  1.00 23.41  ? 43   TRP A O     1 
ATOM   299   C  CB    . TRP A 1 42   ? -50.193 -64.612  22.390  1.00 20.44  ? 43   TRP A CB    1 
ATOM   300   C  CG    . TRP A 1 42   ? -50.021 -66.039  22.809  1.00 19.53  ? 43   TRP A CG    1 
ATOM   301   C  CD1   . TRP A 1 42   ? -50.207 -67.179  22.089  1.00 19.07  ? 43   TRP A CD1   1 
ATOM   302   C  CD2   . TRP A 1 42   ? -49.579 -66.481  24.118  1.00 20.67  ? 43   TRP A CD2   1 
ATOM   303   N  NE1   . TRP A 1 42   ? -49.960 -68.275  22.873  1.00 19.96  ? 43   TRP A NE1   1 
ATOM   304   C  CE2   . TRP A 1 42   ? -49.548 -67.869  24.109  1.00 18.93  ? 43   TRP A CE2   1 
ATOM   305   C  CE3   . TRP A 1 42   ? -49.179 -65.759  25.266  1.00 19.91  ? 43   TRP A CE3   1 
ATOM   306   C  CZ2   . TRP A 1 42   ? -49.146 -68.629  25.205  1.00 22.59  ? 43   TRP A CZ2   1 
ATOM   307   C  CZ3   . TRP A 1 42   ? -48.801 -66.525  26.348  1.00 20.90  ? 43   TRP A CZ3   1 
ATOM   308   C  CH2   . TRP A 1 42   ? -48.766 -67.923  26.313  1.00 22.29  ? 43   TRP A CH2   1 
ATOM   309   N  N     . ALA A 1 43   ? -49.614 -62.046  20.559  1.00 20.81  ? 44   ALA A N     1 
ATOM   310   C  CA    . ALA A 1 43   ? -49.830 -60.660  20.171  1.00 20.85  ? 44   ALA A CA    1 
ATOM   311   C  C     . ALA A 1 43   ? -50.274 -60.537  18.707  1.00 23.53  ? 44   ALA A C     1 
ATOM   312   O  O     . ALA A 1 43   ? -51.257 -59.849  18.447  1.00 20.64  ? 44   ALA A O     1 
ATOM   313   C  CB    . ALA A 1 43   ? -48.620 -59.811  20.428  1.00 22.10  ? 44   ALA A CB    1 
ATOM   314   N  N     . ALA A 1 44   ? -49.766 -61.367  17.809  1.00 23.87  ? 45   ALA A N     1 
ATOM   315   C  CA    . ALA A 1 44   ? -50.180 -61.378  16.401  1.00 26.18  ? 45   ALA A CA    1 
ATOM   316   C  C     . ALA A 1 44   ? -51.514 -62.049  16.192  1.00 26.24  ? 45   ALA A C     1 
ATOM   317   O  O     . ALA A 1 44   ? -52.322 -61.718  15.305  1.00 24.70  ? 45   ALA A O     1 
ATOM   318   C  CB    . ALA A 1 44   ? -49.012 -62.025  15.616  1.00 26.44  ? 45   ALA A CB    1 
ATOM   319   N  N     . GLN A 1 45   ? -51.877 -63.032  17.009  1.00 27.14  ? 46   GLN A N     1 
ATOM   320   C  CA    . GLN A 1 45   ? -53.147 -63.743  16.973  1.00 27.39  ? 46   GLN A CA    1 
ATOM   321   C  C     . GLN A 1 45   ? -54.295 -62.857  17.437  1.00 28.38  ? 46   GLN A C     1 
ATOM   322   O  O     . GLN A 1 45   ? -55.474 -63.062  17.069  1.00 30.23  ? 46   GLN A O     1 
ATOM   323   C  CB    . GLN A 1 45   ? -53.047 -65.002  17.854  1.00 29.79  ? 46   GLN A CB    1 
ATOM   324   C  CG    . GLN A 1 45   ? -52.228 -66.133  17.208  1.00 31.23  ? 46   GLN A CG    1 
ATOM   325   C  CD    . GLN A 1 45   ? -51.948 -67.316  18.111  1.00 33.55  ? 46   GLN A CD    1 
ATOM   326   O  OE1   . GLN A 1 45   ? -51.208 -68.276  17.803  1.00 34.90  ? 46   GLN A OE1   1 
ATOM   327   N  NE2   . GLN A 1 45   ? -52.506 -67.347  19.311  1.00 31.84  ? 46   GLN A NE2   1 
ATOM   328   N  N     . GLY A 1 46   ? -54.022 -61.800  18.192  1.00 26.32  ? 47   GLY A N     1 
ATOM   329   C  CA    . GLY A 1 46   ? -55.063 -60.901  18.674  1.00 24.57  ? 47   GLY A CA    1 
ATOM   330   C  C     . GLY A 1 46   ? -55.338 -61.046  20.167  1.00 23.81  ? 47   GLY A C     1 
ATOM   331   O  O     . GLY A 1 46   ? -56.285 -60.489  20.732  1.00 22.59  ? 47   GLY A O     1 
ATOM   332   N  N     . ARG A 1 47   ? -54.480 -61.793  20.910  1.00 19.64  ? 48   ARG A N     1 
ATOM   333   C  CA    . ARG A 1 47   ? -54.665 -61.912  22.333  1.00 20.74  ? 48   ARG A CA    1 
ATOM   334   C  C     . ARG A 1 47   ? -54.564 -60.557  23.044  1.00 17.90  ? 48   ARG A C     1 
ATOM   335   O  O     . ARG A 1 47   ? -53.604 -59.852  22.794  1.00 18.91  ? 48   ARG A O     1 
ATOM   336   C  CB    . ARG A 1 47   ? -53.565 -62.809  22.895  1.00 19.58  ? 48   ARG A CB    1 
ATOM   337   C  CG    . ARG A 1 47   ? -53.820 -63.399  24.273  1.00 25.38  ? 48   ARG A CG    1 
ATOM   338   C  CD    . ARG A 1 47   ? -53.648 -64.908  23.870  1.00 28.36  ? 48   ARG A CD    1 
ATOM   339   N  NE    . ARG A 1 47   ? -53.105 -65.657  24.892  1.00 28.00  ? 48   ARG A NE    1 
ATOM   340   C  CZ    . ARG A 1 47   ? -52.764 -66.860  25.248  1.00 25.56  ? 48   ARG A CZ    1 
ATOM   341   N  NH1   . ARG A 1 47   ? -52.827 -67.855  24.408  1.00 25.36  ? 48   ARG A NH1   1 
ATOM   342   N  NH2   . ARG A 1 47   ? -52.341 -66.849  26.505  1.00 24.06  ? 48   ARG A NH2   1 
ATOM   343   N  N     . LYS A 1 48   ? -55.417 -60.254  24.005  1.00 17.63  ? 49   LYS A N     1 
ATOM   344   C  CA    . LYS A 1 48   ? -55.380 -59.070  24.809  1.00 15.81  ? 49   LYS A CA    1 
ATOM   345   C  C     . LYS A 1 48   ? -54.850 -59.320  26.228  1.00 17.49  ? 49   LYS A C     1 
ATOM   346   O  O     . LYS A 1 48   ? -55.164 -60.337  26.842  1.00 15.89  ? 49   LYS A O     1 
ATOM   347   C  CB    . LYS A 1 48   ? -56.749 -58.360  24.888  1.00 19.14  ? 49   LYS A CB    1 
ATOM   348   C  CG    . LYS A 1 48   ? -57.360 -58.023  23.512  1.00 24.07  ? 49   LYS A CG    1 
ATOM   349   C  CD    . LYS A 1 48   ? -56.348 -57.529  22.493  1.00 26.50  ? 49   LYS A CD    1 
ATOM   350   C  CE    . LYS A 1 48   ? -56.985 -57.111  21.157  1.00 30.93  ? 49   LYS A CE    1 
ATOM   351   N  NZ    . LYS A 1 48   ? -58.216 -56.330  21.526  1.00 34.79  ? 49   LYS A NZ    1 
ATOM   352   N  N     . ASN A 1 49   ? -54.123 -58.349  26.802  1.00 18.03  ? 50   ASN A N     1 
ATOM   353   C  CA    . ASN A 1 49   ? -53.680 -58.436  28.189  1.00 16.94  ? 50   ASN A CA    1 
ATOM   354   C  C     . ASN A 1 49   ? -54.833 -57.989  29.085  1.00 18.91  ? 50   ASN A C     1 
ATOM   355   O  O     . ASN A 1 49   ? -55.963 -57.746  28.566  1.00 17.76  ? 50   ASN A O     1 
ATOM   356   C  CB    . ASN A 1 49   ? -52.435 -57.569  28.429  1.00 17.53  ? 50   ASN A CB    1 
ATOM   357   C  CG    . ASN A 1 49   ? -52.635 -56.082  28.091  1.00 18.28  ? 50   ASN A CG    1 
ATOM   358   O  OD1   . ASN A 1 49   ? -53.768 -55.588  27.912  1.00 16.97  ? 50   ASN A OD1   1 
ATOM   359   N  ND2   . ASN A 1 49   ? -51.514 -55.358  28.012  1.00 16.64  ? 50   ASN A ND2   1 
ATOM   360   N  N     . ILE A 1 50   ? -54.595 -57.749  30.366  1.00 16.04  ? 51   ILE A N     1 
ATOM   361   C  CA    . ILE A 1 50   ? -55.694 -57.298  31.240  1.00 17.17  ? 51   ILE A CA    1 
ATOM   362   C  C     . ILE A 1 50   ? -56.186 -55.903  30.951  1.00 18.99  ? 51   ILE A C     1 
ATOM   363   O  O     . ILE A 1 50   ? -57.225 -55.495  31.511  1.00 17.86  ? 51   ILE A O     1 
ATOM   364   C  CB    . ILE A 1 50   ? -55.297 -57.368  32.729  1.00 15.66  ? 51   ILE A CB    1 
ATOM   365   C  CG1   . ILE A 1 50   ? -54.102 -56.397  33.027  1.00 15.00  ? 51   ILE A CG1   1 
ATOM   366   C  CG2   . ILE A 1 50   ? -54.975 -58.826  33.059  1.00 16.33  ? 51   ILE A CG2   1 
ATOM   367   C  CD1   . ILE A 1 50   ? -53.730 -56.372  34.489  1.00 16.06  ? 51   ILE A CD1   1 
ATOM   368   N  N     . PHE A 1 51   ? -55.478 -55.137  30.141  1.00 17.28  ? 52   PHE A N     1 
ATOM   369   C  CA    . PHE A 1 51   ? -55.978 -53.788  29.830  1.00 19.40  ? 52   PHE A CA    1 
ATOM   370   C  C     . PHE A 1 51   ? -56.732 -53.834  28.515  1.00 18.49  ? 52   PHE A C     1 
ATOM   371   O  O     . PHE A 1 51   ? -57.083 -52.761  28.010  1.00 20.48  ? 52   PHE A O     1 
ATOM   372   C  CB    . PHE A 1 51   ? -54.708 -52.881  29.675  1.00 18.50  ? 52   PHE A CB    1 
ATOM   373   C  CG    . PHE A 1 51   ? -53.946 -52.835  30.988  1.00 19.77  ? 52   PHE A CG    1 
ATOM   374   C  CD1   . PHE A 1 51   ? -52.749 -53.543  31.093  1.00 20.72  ? 52   PHE A CD1   1 
ATOM   375   C  CD2   . PHE A 1 51   ? -54.406 -52.173  32.098  1.00 20.82  ? 52   PHE A CD2   1 
ATOM   376   C  CE1   . PHE A 1 51   ? -52.035 -53.556  32.268  1.00 19.95  ? 52   PHE A CE1   1 
ATOM   377   C  CE2   . PHE A 1 51   ? -53.667 -52.161  33.283  1.00 21.67  ? 52   PHE A CE2   1 
ATOM   378   C  CZ    . PHE A 1 51   ? -52.489 -52.871  33.388  1.00 20.45  ? 52   PHE A CZ    1 
ATOM   379   N  N     . GLY A 1 52   ? -56.939 -55.018  27.955  1.00 17.86  ? 53   GLY A N     1 
ATOM   380   C  CA    . GLY A 1 52   ? -57.609 -55.164  26.653  1.00 18.17  ? 53   GLY A CA    1 
ATOM   381   C  C     . GLY A 1 52   ? -56.773 -54.757  25.452  1.00 19.03  ? 53   GLY A C     1 
ATOM   382   O  O     . GLY A 1 52   ? -57.234 -54.485  24.323  1.00 14.33  ? 53   GLY A O     1 
ATOM   383   N  N     . GLN A 1 53   ? -55.449 -54.750  25.665  1.00 17.26  ? 54   GLN A N     1 
ATOM   384   C  CA    . GLN A 1 53   ? -54.517 -54.332  24.601  1.00 18.01  ? 54   GLN A CA    1 
ATOM   385   C  C     . GLN A 1 53   ? -53.618 -55.449  24.123  1.00 17.45  ? 54   GLN A C     1 
ATOM   386   O  O     . GLN A 1 53   ? -53.359 -56.413  24.876  1.00 18.42  ? 54   GLN A O     1 
ATOM   387   C  CB    . GLN A 1 53   ? -53.542 -53.282  25.191  1.00 19.81  ? 54   GLN A CB    1 
ATOM   388   C  CG    . GLN A 1 53   ? -54.149 -51.998  25.709  1.00 21.92  ? 54   GLN A CG    1 
ATOM   389   C  CD    . GLN A 1 53   ? -54.858 -51.275  24.562  1.00 25.47  ? 54   GLN A CD    1 
ATOM   390   O  OE1   . GLN A 1 53   ? -54.242 -50.765  23.633  1.00 27.32  ? 54   GLN A OE1   1 
ATOM   391   N  NE2   . GLN A 1 53   ? -56.168 -51.318  24.568  1.00 25.56  ? 54   GLN A NE2   1 
ATOM   392   N  N     . THR A 1 54   ? -53.054 -55.350  22.925  1.00 17.83  ? 55   THR A N     1 
ATOM   393   C  CA    . THR A 1 54   ? -52.060 -56.368  22.510  1.00 18.55  ? 55   THR A CA    1 
ATOM   394   C  C     . THR A 1 54   ? -50.706 -56.009  23.123  1.00 18.60  ? 55   THR A C     1 
ATOM   395   O  O     . THR A 1 54   ? -50.414 -54.825  23.226  1.00 17.03  ? 55   THR A O     1 
ATOM   396   C  CB    . THR A 1 54   ? -51.897 -56.394  20.984  1.00 22.03  ? 55   THR A CB    1 
ATOM   397   O  OG1   . THR A 1 54   ? -51.642 -55.066  20.587  1.00 27.58  ? 55   THR A OG1   1 
ATOM   398   C  CG2   . THR A 1 54   ? -53.219 -56.537  20.234  1.00 22.73  ? 55   THR A CG2   1 
ATOM   399   N  N     . LEU A 1 55   ? -49.912 -56.975  23.569  1.00 15.35  ? 56   LEU A N     1 
ATOM   400   C  CA    . LEU A 1 55   ? -48.618 -56.657  24.190  1.00 16.66  ? 56   LEU A CA    1 
ATOM   401   C  C     . LEU A 1 55   ? -47.715 -55.939  23.158  1.00 15.59  ? 56   LEU A C     1 
ATOM   402   O  O     . LEU A 1 55   ? -47.693 -56.305  21.960  1.00 16.66  ? 56   LEU A O     1 
ATOM   403   C  CB    . LEU A 1 55   ? -47.940 -58.000  24.523  1.00 17.69  ? 56   LEU A CB    1 
ATOM   404   C  CG    . LEU A 1 55   ? -46.581 -57.975  25.252  1.00 16.71  ? 56   LEU A CG    1 
ATOM   405   C  CD1   . LEU A 1 55   ? -46.887 -57.364  26.636  1.00 17.72  ? 56   LEU A CD1   1 
ATOM   406   C  CD2   . LEU A 1 55   ? -46.056 -59.403  25.369  1.00 19.60  ? 56   LEU A CD2   1 
ATOM   407   N  N     . THR A 1 56   ? -47.003 -54.943  23.624  1.00 16.44  ? 57   THR A N     1 
ATOM   408   C  CA    . THR A 1 56   ? -46.043 -54.212  22.744  1.00 18.42  ? 57   THR A CA    1 
ATOM   409   C  C     . THR A 1 56   ? -44.698 -54.929  22.939  1.00 18.56  ? 57   THR A C     1 
ATOM   410   O  O     . THR A 1 56   ? -44.179 -54.923  24.069  1.00 15.10  ? 57   THR A O     1 
ATOM   411   C  CB    . THR A 1 56   ? -45.991 -52.762  23.179  1.00 19.65  ? 57   THR A CB    1 
ATOM   412   O  OG1   . THR A 1 56   ? -47.219 -52.038  22.916  1.00 18.29  ? 57   THR A OG1   1 
ATOM   413   C  CG2   . THR A 1 56   ? -44.895 -51.950  22.454  1.00 21.15  ? 57   THR A CG2   1 
ATOM   414   N  N     . ILE A 1 57   ? -44.216 -55.635  21.932  1.00 17.37  ? 58   ILE A N     1 
ATOM   415   C  CA    . ILE A 1 57   ? -42.977 -56.406  22.120  1.00 19.76  ? 58   ILE A CA    1 
ATOM   416   C  C     . ILE A 1 57   ? -41.918 -55.930  21.123  1.00 19.60  ? 58   ILE A C     1 
ATOM   417   O  O     . ILE A 1 57   ? -42.290 -55.822  19.960  1.00 19.94  ? 58   ILE A O     1 
ATOM   418   C  CB    . ILE A 1 57   ? -43.223 -57.885  21.811  1.00 22.41  ? 58   ILE A CB    1 
ATOM   419   C  CG1   . ILE A 1 57   ? -44.491 -58.426  22.480  1.00 23.88  ? 58   ILE A CG1   1 
ATOM   420   C  CG2   . ILE A 1 57   ? -42.026 -58.793  22.079  1.00 22.91  ? 58   ILE A CG2   1 
ATOM   421   C  CD1   . ILE A 1 57   ? -44.948 -59.743  21.886  1.00 26.30  ? 58   ILE A CD1   1 
ATOM   422   N  N     . ARG A 1 58   ? -40.663 -55.827  21.495  1.00 17.33  ? 59   ARG A N     1 
ATOM   423   C  CA    . ARG A 1 58   ? -39.555 -55.486  20.566  1.00 17.17  ? 59   ARG A CA    1 
ATOM   424   C  C     . ARG A 1 58   ? -38.352 -56.362  20.941  1.00 17.82  ? 59   ARG A C     1 
ATOM   425   O  O     . ARG A 1 58   ? -38.093 -56.597  22.120  1.00 16.05  ? 59   ARG A O     1 
ATOM   426   C  CB    . ARG A 1 58   ? -39.124 -54.037  20.696  1.00 20.27  ? 59   ARG A CB    1 
ATOM   427   C  CG    . ARG A 1 58   ? -40.188 -52.980  20.427  1.00 25.00  ? 59   ARG A CG    1 
ATOM   428   C  CD    . ARG A 1 58   ? -40.581 -53.052  18.955  1.00 27.88  ? 59   ARG A CD    1 
ATOM   429   N  NE    . ARG A 1 58   ? -41.604 -52.025  18.674  1.00 34.62  ? 59   ARG A NE    1 
ATOM   430   C  CZ    . ARG A 1 58   ? -42.918 -52.187  18.757  1.00 34.66  ? 59   ARG A CZ    1 
ATOM   431   N  NH1   . ARG A 1 58   ? -43.451 -53.346  19.107  1.00 34.15  ? 59   ARG A NH1   1 
ATOM   432   N  NH2   . ARG A 1 58   ? -43.673 -51.139  18.431  1.00 36.25  ? 59   ARG A NH2   1 
ATOM   433   N  N     . GLU A 1 59   ? -37.640 -56.819  19.938  1.00 15.60  ? 60   GLU A N     1 
ATOM   434   C  CA    . GLU A 1 59   ? -36.447 -57.644  20.084  1.00 15.86  ? 60   GLU A CA    1 
ATOM   435   C  C     . GLU A 1 59   ? -35.259 -56.665  20.127  1.00 15.73  ? 60   GLU A C     1 
ATOM   436   O  O     . GLU A 1 59   ? -35.253 -55.763  19.273  1.00 15.90  ? 60   GLU A O     1 
ATOM   437   C  CB    . GLU A 1 59   ? -36.303 -58.579  18.867  1.00 18.03  ? 60   GLU A CB    1 
ATOM   438   C  CG    . GLU A 1 59   ? -35.075 -59.513  18.914  1.00 22.84  ? 60   GLU A CG    1 
ATOM   439   C  CD    . GLU A 1 59   ? -34.868 -60.386  17.664  1.00 27.78  ? 60   GLU A CD    1 
ATOM   440   O  OE1   . GLU A 1 59   ? -35.367 -60.163  16.543  1.00 29.03  ? 60   GLU A OE1   1 
ATOM   441   O  OE2   . GLU A 1 59   ? -34.190 -61.439  17.817  1.00 30.12  ? 60   GLU A OE2   1 
ATOM   442   N  N     . MET A 1 60   ? -34.321 -56.779  21.072  1.00 12.80  ? 61   MET A N     1 
ATOM   443   C  CA    . MET A 1 60   ? -33.213 -55.822  21.095  1.00 13.92  ? 61   MET A CA    1 
ATOM   444   C  C     . MET A 1 60   ? -31.968 -56.475  20.481  1.00 14.38  ? 61   MET A C     1 
ATOM   445   O  O     . MET A 1 60   ? -32.052 -57.576  19.948  1.00 12.89  ? 61   MET A O     1 
ATOM   446   C  CB    . MET A 1 60   ? -32.924 -55.365  22.530  1.00 15.19  ? 61   MET A CB    1 
ATOM   447   C  CG    . MET A 1 60   ? -34.090 -54.632  23.199  1.00 15.42  ? 61   MET A CG    1 
ATOM   448   S  SD    . MET A 1 60   ? -34.598 -53.213  22.170  1.00 17.48  ? 61   MET A SD    1 
ATOM   449   C  CE    . MET A 1 60   ? -33.276 -52.057  22.498  1.00 15.54  ? 61   MET A CE    1 
ATOM   450   N  N     . GLN A 1 61   ? -30.816 -55.828  20.562  1.00 12.26  ? 62   GLN A N     1 
ATOM   451   C  CA    . GLN A 1 61   ? -29.565 -56.397  20.008  1.00 14.88  ? 62   GLN A CA    1 
ATOM   452   C  C     . GLN A 1 61   ? -28.852 -57.333  20.967  1.00 12.80  ? 62   GLN A C     1 
ATOM   453   O  O     . GLN A 1 61   ? -27.907 -58.065  20.560  1.00 13.25  ? 62   GLN A O     1 
ATOM   454   C  CB    . GLN A 1 61   ? -28.635 -55.217  19.628  1.00 14.08  ? 62   GLN A CB    1 
ATOM   455   C  CG    . GLN A 1 61   ? -27.786 -54.575  20.684  1.00 16.50  ? 62   GLN A CG    1 
ATOM   456   C  CD    . GLN A 1 61   ? -28.481 -53.759  21.752  1.00 18.70  ? 62   GLN A CD    1 
ATOM   457   O  OE1   . GLN A 1 61   ? -29.709 -53.642  21.851  1.00 17.30  ? 62   GLN A OE1   1 
ATOM   458   N  NE2   . GLN A 1 61   ? -27.688 -53.184  22.674  1.00 19.55  ? 62   GLN A NE2   1 
ATOM   459   N  N     . SER A 1 62   ? -29.214 -57.266  22.265  1.00 13.47  ? 63   SER A N     1 
ATOM   460   C  CA    . SER A 1 62   ? -28.627 -58.162  23.280  1.00 14.50  ? 63   SER A CA    1 
ATOM   461   C  C     . SER A 1 62   ? -29.524 -58.100  24.523  1.00 15.94  ? 63   SER A C     1 
ATOM   462   O  O     . SER A 1 62   ? -30.457 -57.295  24.506  1.00 11.74  ? 63   SER A O     1 
ATOM   463   C  CB    . SER A 1 62   ? -27.236 -57.740  23.804  1.00 15.59  ? 63   SER A CB    1 
ATOM   464   O  OG    . SER A 1 62   ? -27.398 -56.442  24.403  1.00 15.56  ? 63   SER A OG    1 
ATOM   465   N  N     . GLU A 1 63   ? -29.140 -58.836  25.582  1.00 14.23  ? 64   GLU A N     1 
ATOM   466   C  CA    . GLU A 1 63   ? -29.951 -58.780  26.808  1.00 15.14  ? 64   GLU A CA    1 
ATOM   467   C  C     . GLU A 1 63   ? -29.657 -57.498  27.550  1.00 12.14  ? 64   GLU A C     1 
ATOM   468   O  O     . GLU A 1 63   ? -30.496 -56.979  28.290  1.00 14.41  ? 64   GLU A O     1 
ATOM   469   C  CB    . GLU A 1 63   ? -29.645 -60.002  27.682  1.00 10.98  ? 64   GLU A CB    1 
ATOM   470   C  CG    . GLU A 1 63   ? -30.224 -61.324  27.210  1.00 13.42  ? 64   GLU A CG    1 
ATOM   471   C  CD    . GLU A 1 63   ? -29.290 -62.092  26.306  1.00 15.42  ? 64   GLU A CD    1 
ATOM   472   O  OE1   . GLU A 1 63   ? -29.605 -63.289  26.027  1.00 19.50  ? 64   GLU A OE1   1 
ATOM   473   O  OE2   . GLU A 1 63   ? -28.266 -61.595  25.793  1.00 14.49  ? 64   GLU A OE2   1 
ATOM   474   N  N     . ALA A 1 64   ? -28.495 -56.914  27.273  1.00 11.18  ? 65   ALA A N     1 
ATOM   475   C  CA    . ALA A 1 64   ? -28.161 -55.597  27.887  1.00 13.38  ? 65   ALA A CA    1 
ATOM   476   C  C     . ALA A 1 64   ? -29.064 -54.494  27.323  1.00 13.64  ? 65   ALA A C     1 
ATOM   477   O  O     . ALA A 1 64   ? -29.564 -53.677  28.091  1.00 13.77  ? 65   ALA A O     1 
ATOM   478   C  CB    . ALA A 1 64   ? -26.686 -55.223  27.789  1.00 13.51  ? 65   ALA A CB    1 
ATOM   479   N  N     . GLY A 1 65   ? -29.305 -54.527  26.019  1.00 13.79  ? 66   GLY A N     1 
ATOM   480   C  CA    . GLY A 1 65   ? -30.219 -53.600  25.330  1.00 12.96  ? 66   GLY A CA    1 
ATOM   481   C  C     . GLY A 1 65   ? -31.659 -53.923  25.771  1.00 11.68  ? 66   GLY A C     1 
ATOM   482   O  O     . GLY A 1 65   ? -32.442 -52.990  26.087  1.00 12.89  ? 66   GLY A O     1 
ATOM   483   N  N     . ALA A 1 66   ? -32.002 -55.191  25.963  1.00 12.17  ? 67   ALA A N     1 
ATOM   484   C  CA    . ALA A 1 66   ? -33.332 -55.556  26.486  1.00 14.65  ? 67   ALA A CA    1 
ATOM   485   C  C     . ALA A 1 66   ? -33.531 -54.962  27.889  1.00 13.84  ? 67   ALA A C     1 
ATOM   486   O  O     . ALA A 1 66   ? -34.586 -54.401  28.203  1.00 12.93  ? 67   ALA A O     1 
ATOM   487   C  CB    . ALA A 1 66   ? -33.502 -57.067  26.547  1.00 11.18  ? 67   ALA A CB    1 
ATOM   488   N  N     . ALA A 1 67   ? -32.532 -55.147  28.761  1.00 12.81  ? 68   ALA A N     1 
ATOM   489   C  CA    . ALA A 1 67   ? -32.703 -54.610  30.145  1.00 12.76  ? 68   ALA A CA    1 
ATOM   490   C  C     . ALA A 1 67   ? -32.763 -53.078  30.174  1.00 14.83  ? 68   ALA A C     1 
ATOM   491   O  O     . ALA A 1 67   ? -33.521 -52.514  30.950  1.00 12.27  ? 68   ALA A O     1 
ATOM   492   C  CB    . ALA A 1 67   ? -31.546 -55.098  31.027  1.00 14.24  ? 68   ALA A CB    1 
ATOM   493   N  N     . GLY A 1 68   ? -32.008 -52.441  29.298  1.00 11.72  ? 69   GLY A N     1 
ATOM   494   C  CA    . GLY A 1 68   ? -32.048 -50.943  29.214  1.00 11.37  ? 69   GLY A CA    1 
ATOM   495   C  C     . GLY A 1 68   ? -33.434 -50.502  28.719  1.00 11.55  ? 69   GLY A C     1 
ATOM   496   O  O     . GLY A 1 68   ? -34.067 -49.635  29.333  1.00 12.77  ? 69   GLY A O     1 
ATOM   497   N  N     . ALA A 1 69   ? -34.029 -51.180  27.757  1.00 12.30  ? 70   ALA A N     1 
ATOM   498   C  CA    . ALA A 1 69   ? -35.372 -50.853  27.258  1.00 11.75  ? 70   ALA A CA    1 
ATOM   499   C  C     . ALA A 1 69   ? -36.441 -51.075  28.343  1.00 12.03  ? 70   ALA A C     1 
ATOM   500   O  O     . ALA A 1 69   ? -37.354 -50.271  28.554  1.00 12.09  ? 70   ALA A O     1 
ATOM   501   C  CB    . ALA A 1 69   ? -35.654 -51.727  26.037  1.00 11.83  ? 70   ALA A CB    1 
ATOM   502   N  N     . VAL A 1 70   ? -36.318 -52.199  29.055  1.00 11.84  ? 71   VAL A N     1 
ATOM   503   C  CA    . VAL A 1 70   ? -37.242 -52.543  30.167  1.00 12.18  ? 71   VAL A CA    1 
ATOM   504   C  C     . VAL A 1 70   ? -37.145 -51.426  31.203  1.00 13.60  ? 71   VAL A C     1 
ATOM   505   O  O     . VAL A 1 70   ? -38.169 -50.981  31.727  1.00 14.26  ? 71   VAL A O     1 
ATOM   506   C  CB    . VAL A 1 70   ? -36.886 -53.885  30.814  1.00 12.40  ? 71   VAL A CB    1 
ATOM   507   C  CG1   . VAL A 1 70   ? -37.539 -54.120  32.201  1.00 10.93  ? 71   VAL A CG1   1 
ATOM   508   C  CG2   . VAL A 1 70   ? -37.244 -55.106  29.920  1.00 13.18  ? 71   VAL A CG2   1 
ATOM   509   N  N     . HIS A 1 71   ? -35.896 -51.045  31.528  1.00 12.20  ? 72   HIS A N     1 
ATOM   510   C  CA    . HIS A 1 71   ? -35.769 -49.945  32.450  1.00 12.03  ? 72   HIS A CA    1 
ATOM   511   C  C     . HIS A 1 71   ? -36.489 -48.670  31.977  1.00 10.72  ? 72   HIS A C     1 
ATOM   512   O  O     . HIS A 1 71   ? -37.190 -47.960  32.761  1.00 14.04  ? 72   HIS A O     1 
ATOM   513   C  CB    . HIS A 1 71   ? -34.246 -49.672  32.705  1.00 9.33   ? 72   HIS A CB    1 
ATOM   514   C  CG    . HIS A 1 71   ? -33.988 -48.565  33.688  1.00 11.27  ? 72   HIS A CG    1 
ATOM   515   N  ND1   . HIS A 1 71   ? -32.725 -47.977  33.814  1.00 14.08  ? 72   HIS A ND1   1 
ATOM   516   C  CD2   . HIS A 1 71   ? -34.762 -47.913  34.592  1.00 14.34  ? 72   HIS A CD2   1 
ATOM   517   C  CE1   . HIS A 1 71   ? -32.777 -46.986  34.726  1.00 13.03  ? 72   HIS A CE1   1 
ATOM   518   N  NE2   . HIS A 1 71   ? -34.023 -46.944  35.232  1.00 14.57  ? 72   HIS A NE2   1 
ATOM   519   N  N     . GLY A 1 72   ? -36.297 -48.339  30.701  1.00 9.25   ? 73   GLY A N     1 
ATOM   520   C  CA    . GLY A 1 72   ? -36.911 -47.061  30.254  1.00 10.59  ? 73   GLY A CA    1 
ATOM   521   C  C     . GLY A 1 72   ? -38.436 -47.142  30.178  1.00 11.50  ? 73   GLY A C     1 
ATOM   522   O  O     . GLY A 1 72   ? -39.113 -46.161  30.516  1.00 10.81  ? 73   GLY A O     1 
ATOM   523   N  N     . ALA A 1 73   ? -38.990 -48.251  29.757  1.00 12.03  ? 74   ALA A N     1 
ATOM   524   C  CA    . ALA A 1 73   ? -40.457 -48.428  29.714  1.00 12.53  ? 74   ALA A CA    1 
ATOM   525   C  C     . ALA A 1 73   ? -41.065 -48.357  31.127  1.00 11.89  ? 74   ALA A C     1 
ATOM   526   O  O     . ALA A 1 73   ? -42.089 -47.725  31.347  1.00 12.06  ? 74   ALA A O     1 
ATOM   527   C  CB    . ALA A 1 73   ? -40.818 -49.732  29.017  1.00 12.41  ? 74   ALA A CB    1 
ATOM   528   N  N     . LEU A 1 74   ? -40.388 -48.932  32.116  1.00 11.71  ? 75   LEU A N     1 
ATOM   529   C  CA    . LEU A 1 74   ? -40.837 -48.874  33.499  1.00 12.21  ? 75   LEU A CA    1 
ATOM   530   C  C     . LEU A 1 74   ? -40.765 -47.456  34.041  1.00 14.82  ? 75   LEU A C     1 
ATOM   531   O  O     . LEU A 1 74   ? -41.705 -46.904  34.671  1.00 14.40  ? 75   LEU A O     1 
ATOM   532   C  CB    . LEU A 1 74   ? -40.013 -49.798  34.440  1.00 12.14  ? 75   LEU A CB    1 
ATOM   533   C  CG    . LEU A 1 74   ? -40.321 -51.299  34.222  1.00 12.77  ? 75   LEU A CG    1 
ATOM   534   C  CD1   . LEU A 1 74   ? -39.180 -52.157  34.762  1.00 13.76  ? 75   LEU A CD1   1 
ATOM   535   C  CD2   . LEU A 1 74   ? -41.669 -51.633  34.871  1.00 11.84  ? 75   LEU A CD2   1 
ATOM   536   N  N     . ALA A 1 75   ? -39.648 -46.778  33.739  1.00 12.50  ? 76   ALA A N     1 
ATOM   537   C  CA    . ALA A 1 75   ? -39.467 -45.413  34.182  1.00 10.92  ? 76   ALA A CA    1 
ATOM   538   C  C     . ALA A 1 75   ? -40.525 -44.470  33.570  1.00 12.00  ? 76   ALA A C     1 
ATOM   539   O  O     . ALA A 1 75   ? -40.910 -43.510  34.262  1.00 13.80  ? 76   ALA A O     1 
ATOM   540   C  CB    . ALA A 1 75   ? -38.096 -44.827  33.765  1.00 12.26  ? 76   ALA A CB    1 
ATOM   541   N  N     . ALA A 1 76   ? -40.987 -44.851  32.406  1.00 11.36  ? 77   ALA A N     1 
ATOM   542   C  CA    . ALA A 1 76   ? -42.002 -44.098  31.676  1.00 13.85  ? 77   ALA A CA    1 
ATOM   543   C  C     . ALA A 1 76   ? -43.421 -44.615  31.876  1.00 13.51  ? 77   ALA A C     1 
ATOM   544   O  O     . ALA A 1 76   ? -44.327 -44.276  31.110  1.00 14.20  ? 77   ALA A O     1 
ATOM   545   C  CB    . ALA A 1 76   ? -41.607 -44.040  30.198  1.00 12.75  ? 77   ALA A CB    1 
ATOM   546   N  N     . GLY A 1 77   ? -43.596 -45.435  32.922  1.00 15.80  ? 78   GLY A N     1 
ATOM   547   C  CA    . GLY A 1 77   ? -44.924 -45.790  33.380  1.00 15.17  ? 78   GLY A CA    1 
ATOM   548   C  C     . GLY A 1 77   ? -45.676 -46.906  32.758  1.00 15.90  ? 78   GLY A C     1 
ATOM   549   O  O     . GLY A 1 77   ? -46.902 -46.918  32.853  1.00 16.38  ? 78   GLY A O     1 
ATOM   550   N  N     . ALA A 1 78   ? -44.935 -47.832  32.090  1.00 15.89  ? 79   ALA A N     1 
ATOM   551   C  CA    . ALA A 1 78   ? -45.615 -48.978  31.551  1.00 15.25  ? 79   ALA A CA    1 
ATOM   552   C  C     . ALA A 1 78   ? -45.204 -50.247  32.335  1.00 14.56  ? 79   ALA A C     1 
ATOM   553   O  O     . ALA A 1 78   ? -43.996 -50.454  32.601  1.00 13.29  ? 79   ALA A O     1 
ATOM   554   C  CB    . ALA A 1 78   ? -45.268 -49.224  30.090  1.00 13.06  ? 79   ALA A CB    1 
ATOM   555   N  N     . LEU A 1 79   ? -46.154 -51.165  32.553  1.00 14.11  ? 80   LEU A N     1 
ATOM   556   C  CA    . LEU A 1 79   ? -45.806 -52.441  33.152  1.00 13.88  ? 80   LEU A CA    1 
ATOM   557   C  C     . LEU A 1 79   ? -45.008 -53.233  32.090  1.00 15.94  ? 80   LEU A C     1 
ATOM   558   O  O     . LEU A 1 79   ? -45.461 -53.460  30.983  1.00 12.41  ? 80   LEU A O     1 
ATOM   559   C  CB    . LEU A 1 79   ? -47.016 -53.293  33.575  1.00 13.74  ? 80   LEU A CB    1 
ATOM   560   C  CG    . LEU A 1 79   ? -47.919 -52.609  34.645  1.00 15.19  ? 80   LEU A CG    1 
ATOM   561   C  CD1   . LEU A 1 79   ? -49.202 -53.393  34.944  1.00 11.74  ? 80   LEU A CD1   1 
ATOM   562   C  CD2   . LEU A 1 79   ? -47.114 -52.418  35.923  1.00 16.84  ? 80   LEU A CD2   1 
ATOM   563   N  N     . THR A 1 80   ? -43.786 -53.618  32.451  1.00 17.36  ? 81   THR A N     1 
ATOM   564   C  CA    . THR A 1 80   ? -42.899 -54.284  31.506  1.00 16.22  ? 81   THR A CA    1 
ATOM   565   C  C     . THR A 1 80   ? -42.363 -55.607  32.023  1.00 15.18  ? 81   THR A C     1 
ATOM   566   O  O     . THR A 1 80   ? -42.181 -55.774  33.241  1.00 15.69  ? 81   THR A O     1 
ATOM   567   C  CB    . THR A 1 80   ? -41.698 -53.305  31.269  1.00 14.02  ? 81   THR A CB    1 
ATOM   568   O  OG1   . THR A 1 80   ? -42.245 -51.997  31.049  1.00 15.19  ? 81   THR A OG1   1 
ATOM   569   C  CG2   . THR A 1 80   ? -40.872 -53.732  30.061  1.00 11.78  ? 81   THR A CG2   1 
ATOM   570   N  N     . THR A 1 81   ? -42.005 -56.532  31.110  1.00 15.84  ? 82   THR A N     1 
ATOM   571   C  CA    . THR A 1 81   ? -41.472 -57.813  31.540  1.00 15.51  ? 82   THR A CA    1 
ATOM   572   C  C     . THR A 1 81   ? -40.328 -58.180  30.555  1.00 15.13  ? 82   THR A C     1 
ATOM   573   O  O     . THR A 1 81   ? -40.308 -57.587  29.498  1.00 14.17  ? 82   THR A O     1 
ATOM   574   C  CB    . THR A 1 81   ? -42.229 -59.117  31.267  1.00 18.74  ? 82   THR A CB    1 
ATOM   575   O  OG1   . THR A 1 81   ? -43.293 -59.111  30.344  1.00 22.14  ? 82   THR A OG1   1 
ATOM   576   C  CG2   . THR A 1 81   ? -42.231 -60.115  32.384  1.00 13.95  ? 82   THR A CG2   1 
ATOM   577   N  N     . THR A 1 82   ? -39.603 -59.248  30.923  1.00 12.99  ? 83   THR A N     1 
ATOM   578   C  CA    . THR A 1 82   ? -38.614 -59.801  30.010  1.00 13.85  ? 83   THR A CA    1 
ATOM   579   C  C     . THR A 1 82   ? -38.402 -61.282  30.391  1.00 13.76  ? 83   THR A C     1 
ATOM   580   O  O     . THR A 1 82   ? -38.813 -61.684  31.510  1.00 13.95  ? 83   THR A O     1 
ATOM   581   C  CB    . THR A 1 82   ? -37.306 -59.025  29.899  1.00 14.96  ? 83   THR A CB    1 
ATOM   582   O  OG1   . THR A 1 82   ? -36.586 -59.529  28.739  1.00 15.57  ? 83   THR A OG1   1 
ATOM   583   C  CG2   . THR A 1 82   ? -36.409 -59.150  31.133  1.00 16.48  ? 83   THR A CG2   1 
ATOM   584   N  N     . PHE A 1 83   ? -37.831 -62.058  29.500  1.00 12.67  ? 84   PHE A N     1 
ATOM   585   C  CA    . PHE A 1 83   ? -37.598 -63.470  29.726  1.00 16.35  ? 84   PHE A CA    1 
ATOM   586   C  C     . PHE A 1 83   ? -36.123 -63.769  29.455  1.00 15.75  ? 84   PHE A C     1 
ATOM   587   O  O     . PHE A 1 83   ? -35.641 -63.376  28.380  1.00 19.01  ? 84   PHE A O     1 
ATOM   588   C  CB    . PHE A 1 83   ? -38.415 -64.309  28.731  1.00 15.28  ? 84   PHE A CB    1 
ATOM   589   C  CG    . PHE A 1 83   ? -39.821 -63.785  28.615  1.00 17.67  ? 84   PHE A CG    1 
ATOM   590   C  CD1   . PHE A 1 83   ? -40.211 -62.967  27.572  1.00 17.43  ? 84   PHE A CD1   1 
ATOM   591   C  CD2   . PHE A 1 83   ? -40.741 -64.137  29.587  1.00 17.21  ? 84   PHE A CD2   1 
ATOM   592   C  CE1   . PHE A 1 83   ? -41.532 -62.533  27.487  1.00 18.50  ? 84   PHE A CE1   1 
ATOM   593   C  CE2   . PHE A 1 83   ? -42.045 -63.661  29.525  1.00 18.24  ? 84   PHE A CE2   1 
ATOM   594   C  CZ    . PHE A 1 83   ? -42.440 -62.874  28.474  1.00 17.32  ? 84   PHE A CZ    1 
ATOM   595   N  N     . THR A 1 84   ? -35.412 -64.440  30.334  1.00 16.26  ? 85   THR A N     1 
ATOM   596   C  CA    . THR A 1 84   ? -33.978 -64.621  29.983  1.00 17.35  ? 85   THR A CA    1 
ATOM   597   C  C     . THR A 1 84   ? -33.406 -65.774  30.780  1.00 15.36  ? 85   THR A C     1 
ATOM   598   O  O     . THR A 1 84   ? -34.105 -66.516  31.465  1.00 15.10  ? 85   THR A O     1 
ATOM   599   C  CB    . THR A 1 84   ? -33.116 -63.363  30.156  1.00 17.54  ? 85   THR A CB    1 
ATOM   600   O  OG1   . THR A 1 84   ? -31.796 -63.475  29.530  1.00 15.84  ? 85   THR A OG1   1 
ATOM   601   C  CG2   . THR A 1 84   ? -32.886 -62.959  31.622  1.00 20.29  ? 85   THR A CG2   1 
ATOM   602   N  N     . ALA A 1 85   ? -32.070 -65.890  30.684  1.00 14.25  ? 86   ALA A N     1 
ATOM   603   C  CA    . ALA A 1 85   ? -31.368 -66.951  31.393  1.00 16.74  ? 86   ALA A CA    1 
ATOM   604   C  C     . ALA A 1 85   ? -29.851 -66.746  31.310  1.00 16.84  ? 86   ALA A C     1 
ATOM   605   O  O     . ALA A 1 85   ? -29.417 -66.018  30.454  1.00 12.90  ? 86   ALA A O     1 
ATOM   606   C  CB    . ALA A 1 85   ? -31.570 -68.294  30.693  1.00 17.01  ? 86   ALA A CB    1 
ATOM   607   N  N     . SER A 1 86   ? -29.116 -67.416  32.193  1.00 13.25  ? 87   SER A N     1 
ATOM   608   C  CA    . SER A 1 86   ? -27.666 -67.613  32.048  1.00 17.35  ? 87   SER A CA    1 
ATOM   609   C  C     . SER A 1 86   ? -26.867 -66.407  31.604  1.00 17.65  ? 87   SER A C     1 
ATOM   610   O  O     . SER A 1 86   ? -27.025 -65.367  32.280  1.00 15.81  ? 87   SER A O     1 
ATOM   611   C  CB    . SER A 1 86   ? -27.511 -68.794  31.072  1.00 19.97  ? 87   SER A CB    1 
ATOM   612   O  OG    . SER A 1 86   ? -26.164 -69.115  30.815  1.00 18.33  ? 87   SER A OG    1 
ATOM   613   N  N     . GLN A 1 87   ? -26.104 -66.500  30.537  1.00 15.49  ? 88   GLN A N     1 
ATOM   614   C  CA    . GLN A 1 87   ? -25.308 -65.383  30.052  1.00 19.64  ? 88   GLN A CA    1 
ATOM   615   C  C     . GLN A 1 87   ? -26.113 -64.101  29.829  1.00 15.36  ? 88   GLN A C     1 
ATOM   616   O  O     . GLN A 1 87   ? -25.598 -62.982  29.952  1.00 17.21  ? 88   GLN A O     1 
ATOM   617   C  CB    . GLN A 1 87   ? -24.722 -65.723  28.652  1.00 16.85  ? 88   GLN A CB    1 
ATOM   618   C  CG    . GLN A 1 87   ? -24.038 -67.077  28.602  1.00 18.90  ? 88   GLN A CG    1 
ATOM   619   C  CD    . GLN A 1 87   ? -22.950 -67.263  29.665  1.00 19.73  ? 88   GLN A CD    1 
ATOM   620   O  OE1   . GLN A 1 87   ? -22.824 -68.417  30.112  1.00 16.37  ? 88   GLN A OE1   1 
ATOM   621   N  NE2   . GLN A 1 87   ? -22.200 -66.188  29.961  1.00 18.54  ? 88   GLN A NE2   1 
ATOM   622   N  N     . GLY A 1 88   ? -27.385 -64.344  29.495  1.00 13.23  ? 89   GLY A N     1 
ATOM   623   C  CA    . GLY A 1 88   ? -28.275 -63.179  29.203  1.00 13.86  ? 89   GLY A CA    1 
ATOM   624   C  C     . GLY A 1 88   ? -28.618 -62.451  30.493  1.00 15.88  ? 89   GLY A C     1 
ATOM   625   O  O     . GLY A 1 88   ? -28.605 -61.215  30.572  1.00 15.02  ? 89   GLY A O     1 
ATOM   626   N  N     . LEU A 1 89   ? -28.906 -63.220  31.558  1.00 14.55  ? 90   LEU A N     1 
ATOM   627   C  CA    . LEU A 1 89   ? -29.200 -62.556  32.823  1.00 12.71  ? 90   LEU A CA    1 
ATOM   628   C  C     . LEU A 1 89   ? -28.002 -61.727  33.326  1.00 12.43  ? 90   LEU A C     1 
ATOM   629   O  O     . LEU A 1 89   ? -28.154 -60.644  33.886  1.00 9.56   ? 90   LEU A O     1 
ATOM   630   C  CB    . LEU A 1 89   ? -29.705 -63.555  33.850  1.00 12.25  ? 90   LEU A CB    1 
ATOM   631   C  CG    . LEU A 1 89   ? -30.017 -63.090  35.238  1.00 13.60  ? 90   LEU A CG    1 
ATOM   632   C  CD1   . LEU A 1 89   ? -31.168 -62.030  35.216  1.00 13.08  ? 90   LEU A CD1   1 
ATOM   633   C  CD2   . LEU A 1 89   ? -30.386 -64.174  36.244  1.00 16.12  ? 90   LEU A CD2   1 
ATOM   634   N  N     . LEU A 1 90   ? -26.787 -62.227  33.142  1.00 13.02  ? 91   LEU A N     1 
ATOM   635   C  CA    . LEU A 1 90   ? -25.573 -61.530  33.543  1.00 12.68  ? 91   LEU A CA    1 
ATOM   636   C  C     . LEU A 1 90   ? -25.462 -60.192  32.839  1.00 12.39  ? 91   LEU A C     1 
ATOM   637   O  O     . LEU A 1 90   ? -25.088 -59.254  33.528  1.00 11.55  ? 91   LEU A O     1 
ATOM   638   C  CB    . LEU A 1 90   ? -24.292 -62.330  33.157  1.00 11.67  ? 91   LEU A CB    1 
ATOM   639   C  CG    . LEU A 1 90   ? -24.132 -63.715  33.824  1.00 15.12  ? 91   LEU A CG    1 
ATOM   640   C  CD1   . LEU A 1 90   ? -22.701 -64.254  33.587  1.00 13.07  ? 91   LEU A CD1   1 
ATOM   641   C  CD2   . LEU A 1 90   ? -24.370 -63.635  35.302  1.00 14.93  ? 91   LEU A CD2   1 
ATOM   642   N  N     . LEU A 1 91   ? -25.918 -60.112  31.580  1.00 10.82  ? 92   LEU A N     1 
ATOM   643   C  CA    . LEU A 1 91   ? -25.859 -58.826  30.863  1.00 12.84  ? 92   LEU A CA    1 
ATOM   644   C  C     . LEU A 1 91   ? -26.926 -57.845  31.386  1.00 12.24  ? 92   LEU A C     1 
ATOM   645   O  O     . LEU A 1 91   ? -26.822 -56.654  31.088  1.00 12.63  ? 92   LEU A O     1 
ATOM   646   C  CB    . LEU A 1 91   ? -26.079 -59.083  29.352  1.00 12.26  ? 92   LEU A CB    1 
ATOM   647   C  CG    . LEU A 1 91   ? -25.014 -59.903  28.627  1.00 16.87  ? 92   LEU A CG    1 
ATOM   648   C  CD1   . LEU A 1 91   ? -25.118 -59.703  27.113  1.00 18.65  ? 92   LEU A CD1   1 
ATOM   649   C  CD2   . LEU A 1 91   ? -23.594 -59.548  29.032  1.00 17.03  ? 92   LEU A CD2   1 
ATOM   650   N  N     . MET A 1 92   ? -27.934 -58.369  32.074  1.00 12.86  ? 93   MET A N     1 
ATOM   651   C  CA    . MET A 1 92   ? -28.951 -57.471  32.631  1.00 11.91  ? 93   MET A CA    1 
ATOM   652   C  C     . MET A 1 92   ? -28.566 -56.960  33.999  1.00 11.39  ? 93   MET A C     1 
ATOM   653   O  O     . MET A 1 92   ? -29.228 -56.039  34.491  1.00 11.72  ? 93   MET A O     1 
ATOM   654   C  CB    . MET A 1 92   ? -30.303 -58.242  32.854  1.00 11.08  ? 93   MET A CB    1 
ATOM   655   C  CG    . MET A 1 92   ? -30.761 -58.777  31.480  1.00 12.69  ? 93   MET A CG    1 
ATOM   656   S  SD    . MET A 1 92   ? -32.572 -59.037  31.410  1.00 14.40  ? 93   MET A SD    1 
ATOM   657   C  CE    . MET A 1 92   ? -32.802 -59.691  29.757  1.00 13.18  ? 93   MET A CE    1 
ATOM   658   N  N     . ILE A 1 93   ? -27.564 -57.552  34.654  1.00 11.85  ? 94   ILE A N     1 
ATOM   659   C  CA    . ILE A 1 93   ? -27.256 -57.133  36.029  1.00 10.91  ? 94   ILE A CA    1 
ATOM   660   C  C     . ILE A 1 93   ? -27.129 -55.641  36.270  1.00 12.34  ? 94   ILE A C     1 
ATOM   661   O  O     . ILE A 1 93   ? -27.658 -55.104  37.250  1.00 11.70  ? 94   ILE A O     1 
ATOM   662   C  CB    . ILE A 1 93   ? -26.059 -57.996  36.522  1.00 9.94   ? 94   ILE A CB    1 
ATOM   663   C  CG1   . ILE A 1 93   ? -26.559 -59.427  36.914  1.00 9.83   ? 94   ILE A CG1   1 
ATOM   664   C  CG2   . ILE A 1 93   ? -25.370 -57.366  37.740  1.00 11.21  ? 94   ILE A CG2   1 
ATOM   665   C  CD1   . ILE A 1 93   ? -25.392 -60.399  37.109  1.00 13.71  ? 94   ILE A CD1   1 
ATOM   666   N  N     . PRO A 1 94   ? -26.397 -54.861  35.484  1.00 12.06  ? 95   PRO A N     1 
ATOM   667   C  CA    . PRO A 1 94   ? -26.224 -53.443  35.714  1.00 12.79  ? 95   PRO A CA    1 
ATOM   668   C  C     . PRO A 1 94   ? -27.549 -52.689  35.786  1.00 11.79  ? 95   PRO A C     1 
ATOM   669   O  O     . PRO A 1 94   ? -27.805 -51.976  36.742  1.00 13.74  ? 95   PRO A O     1 
ATOM   670   C  CB    . PRO A 1 94   ? -25.326 -52.990  34.556  1.00 12.54  ? 95   PRO A CB    1 
ATOM   671   C  CG    . PRO A 1 94   ? -24.632 -54.266  34.124  1.00 12.60  ? 95   PRO A CG    1 
ATOM   672   C  CD    . PRO A 1 94   ? -25.640 -55.374  34.308  1.00 13.05  ? 95   PRO A CD    1 
ATOM   673   N  N     . ASN A 1 95   ? -28.468 -52.982  34.820  1.00 8.72   ? 96   ASN A N     1 
ATOM   674   C  CA    . ASN A 1 95   ? -29.772 -52.374  34.842  1.00 12.20  ? 96   ASN A CA    1 
ATOM   675   C  C     . ASN A 1 95   ? -30.660 -52.947  35.951  1.00 11.44  ? 96   ASN A C     1 
ATOM   676   O  O     . ASN A 1 95   ? -31.490 -52.219  36.493  1.00 10.68  ? 96   ASN A O     1 
ATOM   677   C  CB    . ASN A 1 95   ? -30.459 -52.634  33.481  1.00 12.26  ? 96   ASN A CB    1 
ATOM   678   C  CG    . ASN A 1 95   ? -30.392 -51.358  32.645  1.00 13.51  ? 96   ASN A CG    1 
ATOM   679   O  OD1   . ASN A 1 95   ? -31.034 -50.399  33.063  1.00 14.53  ? 96   ASN A OD1   1 
ATOM   680   N  ND2   . ASN A 1 95   ? -29.627 -51.347  31.579  1.00 11.96  ? 96   ASN A ND2   1 
ATOM   681   N  N     . MET A 1 96   ? -30.403 -54.148  36.456  1.00 11.06  ? 97   MET A N     1 
ATOM   682   C  CA    . MET A 1 96   ? -31.196 -54.681  37.578  1.00 11.89  ? 97   MET A CA    1 
ATOM   683   C  C     . MET A 1 96   ? -30.967 -53.818  38.797  1.00 11.61  ? 97   MET A C     1 
ATOM   684   O  O     . MET A 1 96   ? -31.857 -53.475  39.586  1.00 12.46  ? 97   MET A O     1 
ATOM   685   C  CB    . MET A 1 96   ? -30.836 -56.153  37.899  1.00 11.47  ? 97   MET A CB    1 
ATOM   686   C  CG    . MET A 1 96   ? -31.369 -57.095  36.830  1.00 10.45  ? 97   MET A CG    1 
ATOM   687   S  SD    . MET A 1 96   ? -30.871 -58.826  36.910  1.00 15.02  ? 97   MET A SD    1 
ATOM   688   C  CE    . MET A 1 96   ? -31.963 -59.261  38.321  1.00 13.75  ? 97   MET A CE    1 
ATOM   689   N  N     . TYR A 1 97   ? -29.712 -53.406  39.046  1.00 13.01  ? 98   TYR A N     1 
ATOM   690   C  CA    . TYR A 1 97   ? -29.411 -52.478  40.129  1.00 13.45  ? 98   TYR A CA    1 
ATOM   691   C  C     . TYR A 1 97   ? -30.133 -51.143  39.978  1.00 13.81  ? 98   TYR A C     1 
ATOM   692   O  O     . TYR A 1 97   ? -30.669 -50.588  40.941  1.00 11.90  ? 98   TYR A O     1 
ATOM   693   C  CB    . TYR A 1 97   ? -27.908 -52.170  40.223  1.00 12.75  ? 98   TYR A CB    1 
ATOM   694   C  CG    . TYR A 1 97   ? -27.037 -53.204  40.920  1.00 12.75  ? 98   TYR A CG    1 
ATOM   695   C  CD1   . TYR A 1 97   ? -26.317 -54.078  40.112  1.00 12.91  ? 98   TYR A CD1   1 
ATOM   696   C  CD2   . TYR A 1 97   ? -26.861 -53.256  42.302  1.00 13.62  ? 98   TYR A CD2   1 
ATOM   697   C  CE1   . TYR A 1 97   ? -25.403 -54.990  40.629  1.00 13.79  ? 98   TYR A CE1   1 
ATOM   698   C  CE2   . TYR A 1 97   ? -25.975 -54.198  42.826  1.00 14.79  ? 98   TYR A CE2   1 
ATOM   699   C  CZ    . TYR A 1 97   ? -25.273 -55.041  42.016  1.00 14.19  ? 98   TYR A CZ    1 
ATOM   700   O  OH    . TYR A 1 97   ? -24.379 -55.980  42.498  1.00 15.38  ? 98   TYR A OH    1 
ATOM   701   N  N     . LYS A 1 98   ? -30.271 -50.655  38.759  1.00 12.67  ? 99   LYS A N     1 
ATOM   702   C  CA    . LYS A 1 98   ? -31.043 -49.428  38.542  1.00 15.00  ? 99   LYS A CA    1 
ATOM   703   C  C     . LYS A 1 98   ? -32.565 -49.663  38.723  1.00 14.68  ? 99   LYS A C     1 
ATOM   704   O  O     . LYS A 1 98   ? -33.214 -48.771  39.304  1.00 12.98  ? 99   LYS A O     1 
ATOM   705   C  CB    . LYS A 1 98   ? -30.798 -48.907  37.131  1.00 12.82  ? 99   LYS A CB    1 
ATOM   706   C  CG    . LYS A 1 98   ? -29.393 -48.212  37.062  1.00 14.07  ? 99   LYS A CG    1 
ATOM   707   C  CD    . LYS A 1 98   ? -29.733 -46.676  37.161  1.00 14.30  ? 99   LYS A CD    1 
ATOM   708   C  CE    . LYS A 1 98   ? -28.476 -45.962  37.630  1.00 15.88  ? 99   LYS A CE    1 
ATOM   709   N  NZ    . LYS A 1 98   ? -28.628 -44.474  37.363  1.00 14.88  ? 99   LYS A NZ    1 
ATOM   710   N  N     . ILE A 1 99   ? -33.094 -50.725  38.161  1.00 13.48  ? 100  ILE A N     1 
ATOM   711   C  CA    . ILE A 1 99   ? -34.546 -51.010  38.220  1.00 12.61  ? 100  ILE A CA    1 
ATOM   712   C  C     . ILE A 1 99   ? -34.983 -51.145  39.690  1.00 13.47  ? 100  ILE A C     1 
ATOM   713   O  O     . ILE A 1 99   ? -36.021 -50.586  40.117  1.00 14.61  ? 100  ILE A O     1 
ATOM   714   C  CB    . ILE A 1 99   ? -34.921 -52.226  37.346  1.00 15.50  ? 100  ILE A CB    1 
ATOM   715   C  CG1   . ILE A 1 99   ? -34.648 -51.932  35.834  1.00 11.81  ? 100  ILE A CG1   1 
ATOM   716   C  CG2   . ILE A 1 99   ? -36.300 -52.794  37.556  1.00 13.09  ? 100  ILE A CG2   1 
ATOM   717   C  CD1   . ILE A 1 99   ? -34.599 -53.173  34.978  1.00 16.21  ? 100  ILE A CD1   1 
ATOM   718   N  N     . SER A 1 100  ? -34.207 -51.826  40.476  1.00 14.62  ? 101  SER A N     1 
ATOM   719   C  CA    . SER A 1 100  ? -34.542 -51.988  41.916  1.00 14.60  ? 101  SER A CA    1 
ATOM   720   C  C     . SER A 1 100  ? -34.195 -50.702  42.636  1.00 13.85  ? 101  SER A C     1 
ATOM   721   O  O     . SER A 1 100  ? -34.955 -50.252  43.526  1.00 13.18  ? 101  SER A O     1 
ATOM   722   C  CB    . SER A 1 100  ? -33.810 -53.208  42.491  1.00 14.76  ? 101  SER A CB    1 
ATOM   723   O  OG    . SER A 1 100  ? -32.378 -52.949  42.547  1.00 14.73  ? 101  SER A OG    1 
ATOM   724   N  N     . GLY A 1 101  ? -33.107 -50.025  42.283  1.00 15.10  ? 102  GLY A N     1 
ATOM   725   C  CA    . GLY A 1 101  ? -32.724 -48.775  42.905  1.00 13.52  ? 102  GLY A CA    1 
ATOM   726   C  C     . GLY A 1 101  ? -33.788 -47.693  42.774  1.00 15.49  ? 102  GLY A C     1 
ATOM   727   O  O     . GLY A 1 101  ? -33.980 -46.875  43.697  1.00 18.38  ? 102  GLY A O     1 
ATOM   728   N  N     . GLU A 1 102  ? -34.471 -47.678  41.633  1.00 10.38  ? 103  GLU A N     1 
ATOM   729   C  CA    . GLU A 1 102  ? -35.514 -46.718  41.360  1.00 12.79  ? 103  GLU A CA    1 
ATOM   730   C  C     . GLU A 1 102  ? -36.903 -47.253  41.721  1.00 11.79  ? 103  GLU A C     1 
ATOM   731   O  O     . GLU A 1 102  ? -37.896 -46.653  41.353  1.00 12.81  ? 103  GLU A O     1 
ATOM   732   C  CB    . GLU A 1 102  ? -35.424 -46.320  39.871  1.00 12.66  ? 103  GLU A CB    1 
ATOM   733   C  CG    . GLU A 1 102  ? -34.199 -45.438  39.640  1.00 14.97  ? 103  GLU A CG    1 
ATOM   734   C  CD    . GLU A 1 102  ? -34.002 -45.120  38.172  1.00 18.89  ? 103  GLU A CD    1 
ATOM   735   O  OE1   . GLU A 1 102  ? -34.913 -45.439  37.359  1.00 18.78  ? 103  GLU A OE1   1 
ATOM   736   O  OE2   . GLU A 1 102  ? -32.912 -44.553  37.840  1.00 20.15  ? 103  GLU A OE2   1 
ATOM   737   N  N     . LEU A 1 103  ? -36.958 -48.388  42.396  1.00 14.56  ? 104  LEU A N     1 
ATOM   738   C  CA    . LEU A 1 103  ? -38.208 -49.015  42.842  1.00 13.87  ? 104  LEU A CA    1 
ATOM   739   C  C     . LEU A 1 103  ? -39.289 -49.055  41.761  1.00 13.07  ? 104  LEU A C     1 
ATOM   740   O  O     . LEU A 1 103  ? -40.400 -48.522  41.870  1.00 12.49  ? 104  LEU A O     1 
ATOM   741   C  CB    . LEU A 1 103  ? -38.715 -48.262  44.063  1.00 12.74  ? 104  LEU A CB    1 
ATOM   742   C  CG    . LEU A 1 103  ? -37.837 -48.390  45.337  1.00 13.74  ? 104  LEU A CG    1 
ATOM   743   C  CD1   . LEU A 1 103  ? -38.290 -47.278  46.301  1.00 14.57  ? 104  LEU A CD1   1 
ATOM   744   C  CD2   . LEU A 1 103  ? -37.943 -49.761  45.947  1.00 14.87  ? 104  LEU A CD2   1 
ATOM   745   N  N     . LEU A 1 104  ? -38.941 -49.823  40.726  1.00 14.28  ? 105  LEU A N     1 
ATOM   746   C  CA    . LEU A 1 104  ? -39.864 -49.949  39.600  1.00 15.04  ? 105  LEU A CA    1 
ATOM   747   C  C     . LEU A 1 104  ? -40.447 -51.347  39.561  1.00 14.33  ? 105  LEU A C     1 
ATOM   748   O  O     . LEU A 1 104  ? -39.770 -52.353  39.832  1.00 16.82  ? 105  LEU A O     1 
ATOM   749   C  CB    . LEU A 1 104  ? -39.081 -49.619  38.338  1.00 13.74  ? 105  LEU A CB    1 
ATOM   750   C  CG    . LEU A 1 104  ? -38.574 -48.214  38.099  1.00 12.82  ? 105  LEU A CG    1 
ATOM   751   C  CD1   . LEU A 1 104  ? -37.615 -48.133  36.913  1.00 15.64  ? 105  LEU A CD1   1 
ATOM   752   C  CD2   . LEU A 1 104  ? -39.833 -47.333  37.865  1.00 14.82  ? 105  LEU A CD2   1 
ATOM   753   N  N     . PRO A 1 105  ? -41.733 -51.477  39.285  1.00 15.98  ? 106  PRO A N     1 
ATOM   754   C  CA    . PRO A 1 105  ? -42.422 -52.768  39.291  1.00 15.45  ? 106  PRO A CA    1 
ATOM   755   C  C     . PRO A 1 105  ? -42.103 -53.722  38.175  1.00 16.43  ? 106  PRO A C     1 
ATOM   756   O  O     . PRO A 1 105  ? -43.032 -54.311  37.568  1.00 17.19  ? 106  PRO A O     1 
ATOM   757   C  CB    . PRO A 1 105  ? -43.884 -52.314  39.340  1.00 15.33  ? 106  PRO A CB    1 
ATOM   758   C  CG    . PRO A 1 105  ? -43.924 -51.042  38.527  1.00 16.71  ? 106  PRO A CG    1 
ATOM   759   C  CD    . PRO A 1 105  ? -42.667 -50.337  39.046  1.00 15.09  ? 106  PRO A CD    1 
ATOM   760   N  N     . GLY A 1 106  ? -40.820 -53.904  37.815  1.00 14.34  ? 107  GLY A N     1 
ATOM   761   C  CA    . GLY A 1 106  ? -40.529 -54.854  36.732  1.00 14.92  ? 107  GLY A CA    1 
ATOM   762   C  C     . GLY A 1 106  ? -40.618 -56.330  37.132  1.00 14.57  ? 107  GLY A C     1 
ATOM   763   O  O     . GLY A 1 106  ? -40.460 -56.661  38.343  1.00 13.42  ? 107  GLY A O     1 
ATOM   764   N  N     . VAL A 1 107  ? -40.879 -57.196  36.155  1.00 14.05  ? 108  VAL A N     1 
ATOM   765   C  CA    . VAL A 1 107  ? -40.835 -58.643  36.470  1.00 13.84  ? 108  VAL A CA    1 
ATOM   766   C  C     . VAL A 1 107  ? -40.004 -59.372  35.411  1.00 13.92  ? 108  VAL A C     1 
ATOM   767   O  O     . VAL A 1 107  ? -40.275 -59.293  34.179  1.00 14.35  ? 108  VAL A O     1 
ATOM   768   C  CB    . VAL A 1 107  ? -42.238 -59.249  36.562  1.00 13.82  ? 108  VAL A CB    1 
ATOM   769   C  CG1   . VAL A 1 107  ? -42.157 -60.753  36.831  1.00 14.26  ? 108  VAL A CG1   1 
ATOM   770   C  CG2   . VAL A 1 107  ? -43.052 -58.546  37.637  1.00 16.05  ? 108  VAL A CG2   1 
ATOM   771   N  N     . PHE A 1 108  ? -38.926 -60.022  35.790  1.00 11.40  ? 109  PHE A N     1 
ATOM   772   C  CA    . PHE A 1 108  ? -38.125 -60.847  34.899  1.00 11.95  ? 109  PHE A CA    1 
ATOM   773   C  C     . PHE A 1 108  ? -38.515 -62.308  35.085  1.00 14.01  ? 109  PHE A C     1 
ATOM   774   O  O     . PHE A 1 108  ? -38.553 -62.774  36.249  1.00 17.78  ? 109  PHE A O     1 
ATOM   775   C  CB    . PHE A 1 108  ? -36.613 -60.758  35.200  1.00 13.82  ? 109  PHE A CB    1 
ATOM   776   C  CG    . PHE A 1 108  ? -35.931 -59.432  34.903  1.00 15.20  ? 109  PHE A CG    1 
ATOM   777   C  CD1   . PHE A 1 108  ? -34.510 -59.390  34.918  1.00 15.76  ? 109  PHE A CD1   1 
ATOM   778   C  CD2   . PHE A 1 108  ? -36.636 -58.272  34.610  1.00 17.45  ? 109  PHE A CD2   1 
ATOM   779   C  CE1   . PHE A 1 108  ? -33.890 -58.197  34.583  1.00 15.42  ? 109  PHE A CE1   1 
ATOM   780   C  CE2   . PHE A 1 108  ? -35.979 -57.080  34.332  1.00 16.28  ? 109  PHE A CE2   1 
ATOM   781   C  CZ    . PHE A 1 108  ? -34.596 -57.040  34.326  1.00 16.77  ? 109  PHE A CZ    1 
ATOM   782   N  N     . HIS A 1 109  ? -38.737 -63.074  34.043  1.00 12.90  ? 110  HIS A N     1 
ATOM   783   C  CA    . HIS A 1 109  ? -39.023 -64.512  34.186  1.00 13.54  ? 110  HIS A CA    1 
ATOM   784   C  C     . HIS A 1 109  ? -37.785 -65.272  33.682  1.00 13.16  ? 110  HIS A C     1 
ATOM   785   O  O     . HIS A 1 109  ? -37.384 -65.004  32.519  1.00 15.68  ? 110  HIS A O     1 
ATOM   786   C  CB    . HIS A 1 109  ? -40.228 -64.866  33.303  1.00 13.31  ? 110  HIS A CB    1 
ATOM   787   C  CG    . HIS A 1 109  ? -41.430 -64.256  33.954  1.00 13.56  ? 110  HIS A CG    1 
ATOM   788   N  ND1   . HIS A 1 109  ? -42.113 -63.146  33.473  1.00 14.83  ? 110  HIS A ND1   1 
ATOM   789   C  CD2   . HIS A 1 109  ? -42.079 -64.622  35.084  1.00 11.22  ? 110  HIS A CD2   1 
ATOM   790   C  CE1   . HIS A 1 109  ? -43.124 -62.819  34.275  1.00 9.10   ? 110  HIS A CE1   1 
ATOM   791   N  NE2   . HIS A 1 109  ? -43.111 -63.731  35.247  1.00 11.77  ? 110  HIS A NE2   1 
ATOM   792   N  N     . VAL A 1 110  ? -37.093 -65.943  34.572  1.00 13.13  ? 111  VAL A N     1 
ATOM   793   C  CA    . VAL A 1 110  ? -35.831 -66.552  34.066  1.00 14.36  ? 111  VAL A CA    1 
ATOM   794   C  C     . VAL A 1 110  ? -35.877 -68.059  34.166  1.00 13.94  ? 111  VAL A C     1 
ATOM   795   O  O     . VAL A 1 110  ? -36.308 -68.624  35.169  1.00 13.87  ? 111  VAL A O     1 
ATOM   796   C  CB    . VAL A 1 110  ? -34.568 -65.915  34.632  1.00 19.00  ? 111  VAL A CB    1 
ATOM   797   C  CG1   . VAL A 1 110  ? -34.719 -64.646  35.404  1.00 18.99  ? 111  VAL A CG1   1 
ATOM   798   C  CG2   . VAL A 1 110  ? -33.472 -66.876  35.041  1.00 14.04  ? 111  VAL A CG2   1 
ATOM   799   N  N     . THR A 1 111  ? -35.407 -68.734  33.118  1.00 13.79  ? 112  THR A N     1 
ATOM   800   C  CA    . THR A 1 111  ? -35.264 -70.195  33.161  1.00 13.24  ? 112  THR A CA    1 
ATOM   801   C  C     . THR A 1 111  ? -33.836 -70.394  33.648  1.00 16.83  ? 112  THR A C     1 
ATOM   802   O  O     . THR A 1 111  ? -32.878 -69.981  32.958  1.00 18.27  ? 112  THR A O     1 
ATOM   803   C  CB    . THR A 1 111  ? -35.449 -70.785  31.755  1.00 15.21  ? 112  THR A CB    1 
ATOM   804   O  OG1   . THR A 1 111  ? -34.436 -70.151  30.908  1.00 13.25  ? 112  THR A OG1   1 
ATOM   805   C  CG2   . THR A 1 111  ? -36.870 -70.511  31.289  1.00 13.79  ? 112  THR A CG2   1 
ATOM   806   N  N     . ALA A 1 112  ? -33.604 -70.796  34.865  1.00 15.58  ? 113  ALA A N     1 
ATOM   807   C  CA    . ALA A 1 112  ? -32.277 -70.859  35.469  1.00 16.60  ? 113  ALA A CA    1 
ATOM   808   C  C     . ALA A 1 112  ? -31.391 -71.860  34.772  1.00 15.59  ? 113  ALA A C     1 
ATOM   809   O  O     . ALA A 1 112  ? -31.759 -73.046  34.624  1.00 18.87  ? 113  ALA A O     1 
ATOM   810   C  CB    . ALA A 1 112  ? -32.422 -71.029  36.956  1.00 16.38  ? 113  ALA A CB    1 
ATOM   811   N  N     . ARG A 1 113  ? -30.250 -71.375  34.266  1.00 14.11  ? 114  ARG A N     1 
ATOM   812   C  CA    . ARG A 1 113  ? -29.374 -72.147  33.430  1.00 15.76  ? 114  ARG A CA    1 
ATOM   813   C  C     . ARG A 1 113  ? -27.935 -71.834  33.843  1.00 17.49  ? 114  ARG A C     1 
ATOM   814   O  O     . ARG A 1 113  ? -27.624 -70.734  34.251  1.00 12.52  ? 114  ARG A O     1 
ATOM   815   C  CB    . ARG A 1 113  ? -29.634 -71.796  31.950  1.00 15.39  ? 114  ARG A CB    1 
ATOM   816   C  CG    . ARG A 1 113  ? -28.483 -72.118  31.009  1.00 16.76  ? 114  ARG A CG    1 
ATOM   817   C  CD    . ARG A 1 113  ? -28.688 -71.544  29.602  1.00 16.05  ? 114  ARG A CD    1 
ATOM   818   N  NE    . ARG A 1 113  ? -27.381 -71.455  28.943  1.00 18.27  ? 114  ARG A NE    1 
ATOM   819   C  CZ    . ARG A 1 113  ? -27.104 -71.041  27.721  1.00 19.97  ? 114  ARG A CZ    1 
ATOM   820   N  NH1   . ARG A 1 113  ? -28.061 -70.686  26.849  1.00 19.58  ? 114  ARG A NH1   1 
ATOM   821   N  NH2   . ARG A 1 113  ? -25.835 -71.035  27.273  1.00 18.41  ? 114  ARG A NH2   1 
ATOM   822   N  N     . ALA A 1 114  ? -27.093 -72.845  33.675  1.00 14.57  ? 115  ALA A N     1 
ATOM   823   C  CA    . ALA A 1 114  ? -25.698 -72.776  33.979  1.00 15.20  ? 115  ALA A CA    1 
ATOM   824   C  C     . ALA A 1 114  ? -24.979 -71.612  33.250  1.00 16.66  ? 115  ALA A C     1 
ATOM   825   O  O     . ALA A 1 114  ? -25.221 -71.380  32.059  1.00 13.79  ? 115  ALA A O     1 
ATOM   826   C  CB    . ALA A 1 114  ? -24.986 -74.043  33.519  1.00 15.98  ? 115  ALA A CB    1 
ATOM   827   N  N     . ILE A 1 115  ? -23.939 -71.162  33.956  1.00 16.56  ? 116  ILE A N     1 
ATOM   828   C  CA    . ILE A 1 115  ? -23.048 -70.137  33.385  1.00 16.30  ? 116  ILE A CA    1 
ATOM   829   C  C     . ILE A 1 115  ? -21.837 -70.831  32.770  1.00 15.62  ? 116  ILE A C     1 
ATOM   830   O  O     . ILE A 1 115  ? -21.434 -71.866  33.289  1.00 17.45  ? 116  ILE A O     1 
ATOM   831   C  CB    . ILE A 1 115  ? -22.641 -69.142  34.462  1.00 14.17  ? 116  ILE A CB    1 
ATOM   832   C  CG1   . ILE A 1 115  ? -23.844 -68.410  35.012  1.00 16.26  ? 116  ILE A CG1   1 
ATOM   833   C  CG2   . ILE A 1 115  ? -21.532 -68.146  34.013  1.00 11.72  ? 116  ILE A CG2   1 
ATOM   834   C  CD1   . ILE A 1 115  ? -24.583 -67.482  34.084  1.00 16.28  ? 116  ILE A CD1   1 
ATOM   835   N  N     . ALA A 1 116  ? -21.348 -70.328  31.652  1.00 15.30  ? 117  ALA A N     1 
ATOM   836   C  CA    . ALA A 1 116  ? -20.205 -70.922  30.939  1.00 15.79  ? 117  ALA A CA    1 
ATOM   837   C  C     . ALA A 1 116  ? -18.879 -70.606  31.641  1.00 17.89  ? 117  ALA A C     1 
ATOM   838   O  O     . ALA A 1 116  ? -18.666 -69.441  32.013  1.00 15.41  ? 117  ALA A O     1 
ATOM   839   C  CB    . ALA A 1 116  ? -20.188 -70.349  29.532  1.00 15.50  ? 117  ALA A CB    1 
ATOM   840   N  N     . ALA A 1 117  ? -18.140 -71.620  32.027  1.00 13.95  ? 118  ALA A N     1 
ATOM   841   C  CA    . ALA A 1 117  ? -16.908 -71.441  32.782  1.00 14.70  ? 118  ALA A CA    1 
ATOM   842   C  C     . ALA A 1 117  ? -15.855 -72.346  32.169  1.00 14.81  ? 118  ALA A C     1 
ATOM   843   O  O     . ALA A 1 117  ? -15.351 -71.920  31.124  1.00 15.60  ? 118  ALA A O     1 
ATOM   844   C  CB    . ALA A 1 117  ? -17.226 -71.694  34.260  1.00 15.30  ? 118  ALA A CB    1 
ATOM   845   N  N     . HIS A 1 118  ? -15.755 -73.631  32.565  1.00 16.06  ? 119  HIS A N     1 
ATOM   846   C  CA    . HIS A 1 118  ? -14.810 -74.506  31.851  1.00 15.76  ? 119  HIS A CA    1 
ATOM   847   C  C     . HIS A 1 118  ? -15.393 -74.942  30.502  1.00 15.09  ? 119  HIS A C     1 
ATOM   848   O  O     . HIS A 1 118  ? -14.744 -75.447  29.621  1.00 16.34  ? 119  HIS A O     1 
ATOM   849   C  CB    . HIS A 1 118  ? -14.573 -75.789  32.681  1.00 15.22  ? 119  HIS A CB    1 
ATOM   850   C  CG    . HIS A 1 118  ? -15.839 -76.617  32.861  1.00 14.47  ? 119  HIS A CG    1 
ATOM   851   N  ND1   . HIS A 1 118  ? -16.866 -76.302  33.713  1.00 16.79  ? 119  HIS A ND1   1 
ATOM   852   C  CD2   . HIS A 1 118  ? -16.152 -77.789  32.218  1.00 16.84  ? 119  HIS A CD2   1 
ATOM   853   C  CE1   . HIS A 1 118  ? -17.809 -77.250  33.576  1.00 16.95  ? 119  HIS A CE1   1 
ATOM   854   N  NE2   . HIS A 1 118  ? -17.390 -78.162  32.708  1.00 19.24  ? 119  HIS A NE2   1 
ATOM   855   N  N     . ALA A 1 119  ? -16.712 -74.854  30.411  1.00 15.59  ? 120  ALA A N     1 
ATOM   856   C  CA    . ALA A 1 119  ? -17.559 -75.193  29.305  1.00 15.18  ? 120  ALA A CA    1 
ATOM   857   C  C     . ALA A 1 119  ? -18.897 -74.441  29.352  1.00 15.10  ? 120  ALA A C     1 
ATOM   858   O  O     . ALA A 1 119  ? -19.349 -74.006  30.420  1.00 14.42  ? 120  ALA A O     1 
ATOM   859   C  CB    . ALA A 1 119  ? -17.941 -76.707  29.326  1.00 14.61  ? 120  ALA A CB    1 
ATOM   860   N  N     . LEU A 1 120  ? -19.528 -74.338  28.177  1.00 15.40  ? 121  LEU A N     1 
ATOM   861   C  CA    . LEU A 1 120  ? -20.882 -73.778  28.115  1.00 16.55  ? 121  LEU A CA    1 
ATOM   862   C  C     . LEU A 1 120  ? -21.867 -74.924  28.358  1.00 15.78  ? 121  LEU A C     1 
ATOM   863   O  O     . LEU A 1 120  ? -21.630 -76.067  27.949  1.00 15.84  ? 121  LEU A O     1 
ATOM   864   C  CB    . LEU A 1 120  ? -21.160 -73.168  26.718  1.00 16.22  ? 121  LEU A CB    1 
ATOM   865   C  CG    . LEU A 1 120  ? -22.599 -72.659  26.432  1.00 16.56  ? 121  LEU A CG    1 
ATOM   866   C  CD1   . LEU A 1 120  ? -22.505 -71.457  25.506  1.00 16.18  ? 121  LEU A CD1   1 
ATOM   867   C  CD2   . LEU A 1 120  ? -23.440 -73.777  25.776  1.00 14.92  ? 121  LEU A CD2   1 
ATOM   868   N  N     . SER A 1 121  ? -23.008 -74.611  28.987  1.00 14.32  ? 122  SER A N     1 
ATOM   869   C  CA    . SER A 1 121  ? -24.074 -75.602  29.124  1.00 15.43  ? 122  SER A CA    1 
ATOM   870   C  C     . SER A 1 121  ? -25.377 -74.788  28.956  1.00 16.54  ? 122  SER A C     1 
ATOM   871   O  O     . SER A 1 121  ? -25.456 -73.688  29.498  1.00 15.40  ? 122  SER A O     1 
ATOM   872   C  CB    . SER A 1 121  ? -24.126 -76.291  30.494  1.00 17.13  ? 122  SER A CB    1 
ATOM   873   O  OG    . SER A 1 121  ? -25.388 -76.917  30.660  1.00 17.67  ? 122  SER A OG    1 
ATOM   874   N  N     . ILE A 1 122  ? -26.343 -75.291  28.197  1.00 16.83  ? 123  ILE A N     1 
ATOM   875   C  CA    . ILE A 1 122  ? -27.647 -74.651  28.085  1.00 17.22  ? 123  ILE A CA    1 
ATOM   876   C  C     . ILE A 1 122  ? -28.611 -75.207  29.135  1.00 17.03  ? 123  ILE A C     1 
ATOM   877   O  O     . ILE A 1 122  ? -29.806 -74.871  29.175  1.00 16.33  ? 123  ILE A O     1 
ATOM   878   C  CB    . ILE A 1 122  ? -28.260 -74.985  26.686  1.00 17.97  ? 123  ILE A CB    1 
ATOM   879   C  CG1   . ILE A 1 122  ? -28.421 -76.491  26.475  1.00 18.03  ? 123  ILE A CG1   1 
ATOM   880   C  CG2   . ILE A 1 122  ? -27.368 -74.362  25.627  1.00 19.26  ? 123  ILE A CG2   1 
ATOM   881   C  CD1   . ILE A 1 122  ? -29.232 -76.839  25.205  1.00 19.32  ? 123  ILE A CD1   1 
ATOM   882   N  N     . PHE A 1 123  ? -28.078 -76.004  30.066  1.00 18.11  ? 124  PHE A N     1 
ATOM   883   C  CA    . PHE A 1 123  ? -28.918 -76.774  30.965  1.00 18.96  ? 124  PHE A CA    1 
ATOM   884   C  C     . PHE A 1 123  ? -29.142 -76.099  32.290  1.00 18.55  ? 124  PHE A C     1 
ATOM   885   O  O     . PHE A 1 123  ? -28.531 -75.111  32.680  1.00 17.97  ? 124  PHE A O     1 
ATOM   886   C  CB    . PHE A 1 123  ? -28.426 -78.250  30.989  1.00 15.90  ? 124  PHE A CB    1 
ATOM   887   C  CG    . PHE A 1 123  ? -28.728 -78.955  29.669  1.00 20.84  ? 124  PHE A CG    1 
ATOM   888   C  CD1   . PHE A 1 123  ? -29.977 -79.454  29.352  1.00 19.14  ? 124  PHE A CD1   1 
ATOM   889   C  CD2   . PHE A 1 123  ? -27.712 -79.126  28.747  1.00 18.45  ? 124  PHE A CD2   1 
ATOM   890   C  CE1   . PHE A 1 123  ? -30.210 -80.044  28.098  1.00 22.55  ? 124  PHE A CE1   1 
ATOM   891   C  CE2   . PHE A 1 123  ? -27.908 -79.726  27.532  1.00 20.83  ? 124  PHE A CE2   1 
ATOM   892   C  CZ    . PHE A 1 123  ? -29.163 -80.205  27.207  1.00 19.50  ? 124  PHE A CZ    1 
ATOM   893   N  N     . GLY A 1 124  ? -30.079 -76.633  33.100  1.00 18.08  ? 125  GLY A N     1 
ATOM   894   C  CA    . GLY A 1 124  ? -30.557 -75.981  34.275  1.00 15.41  ? 125  GLY A CA    1 
ATOM   895   C  C     . GLY A 1 124  ? -29.792 -76.109  35.572  1.00 15.87  ? 125  GLY A C     1 
ATOM   896   O  O     . GLY A 1 124  ? -29.444 -77.206  36.023  1.00 16.37  ? 125  GLY A O     1 
ATOM   897   N  N     . ASP A 1 125  ? -29.515 -74.993  36.204  1.00 15.70  ? 126  ASP A N     1 
ATOM   898   C  CA    . ASP A 1 125  ? -29.028 -74.843  37.557  1.00 15.72  ? 126  ASP A CA    1 
ATOM   899   C  C     . ASP A 1 125  ? -29.210 -73.391  38.009  1.00 17.62  ? 126  ASP A C     1 
ATOM   900   O  O     . ASP A 1 125  ? -29.635 -72.538  37.213  1.00 17.62  ? 126  ASP A O     1 
ATOM   901   C  CB    . ASP A 1 125  ? -27.634 -75.394  37.834  1.00 16.71  ? 126  ASP A CB    1 
ATOM   902   C  CG    . ASP A 1 125  ? -26.520 -74.692  37.062  1.00 21.25  ? 126  ASP A CG    1 
ATOM   903   O  OD1   . ASP A 1 125  ? -25.629 -75.370  36.503  1.00 19.15  ? 126  ASP A OD1   1 
ATOM   904   O  OD2   . ASP A 1 125  ? -26.533 -73.430  37.019  1.00 20.63  ? 126  ASP A OD2   1 
ATOM   905   N  N     . HIS A 1 126  ? -28.826 -73.070  39.258  1.00 13.43  ? 127  HIS A N     1 
ATOM   906   C  CA    . HIS A 1 126  ? -29.086 -71.737  39.790  1.00 12.41  ? 127  HIS A CA    1 
ATOM   907   C  C     . HIS A 1 126  ? -27.892 -70.814  39.793  1.00 12.49  ? 127  HIS A C     1 
ATOM   908   O  O     . HIS A 1 126  ? -27.858 -69.736  40.366  1.00 11.45  ? 127  HIS A O     1 
ATOM   909   C  CB    . HIS A 1 126  ? -29.655 -71.854  41.222  1.00 13.60  ? 127  HIS A CB    1 
ATOM   910   C  CG    . HIS A 1 126  ? -30.952 -72.628  41.223  1.00 13.86  ? 127  HIS A CG    1 
ATOM   911   N  ND1   . HIS A 1 126  ? -31.470 -73.106  42.404  1.00 13.92  ? 127  HIS A ND1   1 
ATOM   912   C  CD2   . HIS A 1 126  ? -31.750 -73.038  40.215  1.00 13.03  ? 127  HIS A CD2   1 
ATOM   913   C  CE1   . HIS A 1 126  ? -32.584 -73.772  42.101  1.00 14.52  ? 127  HIS A CE1   1 
ATOM   914   N  NE2   . HIS A 1 126  ? -32.804 -73.701  40.780  1.00 12.80  ? 127  HIS A NE2   1 
ATOM   915   N  N     . GLN A 1 127  ? -26.860 -71.194  39.034  1.00 15.08  ? 128  GLN A N     1 
ATOM   916   C  CA    . GLN A 1 127  ? -25.671 -70.362  38.887  1.00 15.28  ? 128  GLN A CA    1 
ATOM   917   C  C     . GLN A 1 127  ? -26.023 -68.943  38.383  1.00 17.87  ? 128  GLN A C     1 
ATOM   918   O  O     . GLN A 1 127  ? -25.476 -67.997  38.944  1.00 16.75  ? 128  GLN A O     1 
ATOM   919   C  CB    . GLN A 1 127  ? -24.708 -71.021  37.917  1.00 17.75  ? 128  GLN A CB    1 
ATOM   920   C  CG    . GLN A 1 127  ? -24.082 -72.332  38.364  1.00 23.82  ? 128  GLN A CG    1 
ATOM   921   C  CD    . GLN A 1 127  ? -23.071 -72.920  37.387  1.00 26.16  ? 128  GLN A CD    1 
ATOM   922   O  OE1   . GLN A 1 127  ? -23.243 -73.820  36.538  1.00 25.78  ? 128  GLN A OE1   1 
ATOM   923   N  NE2   . GLN A 1 127  ? -21.881 -72.354  37.549  1.00 28.26  ? 128  GLN A NE2   1 
ATOM   924   N  N     . ASP A 1 128  ? -27.010 -68.841  37.510  1.00 13.97  ? 129  ASP A N     1 
ATOM   925   C  CA    . ASP A 1 128  ? -27.345 -67.523  36.968  1.00 16.02  ? 129  ASP A CA    1 
ATOM   926   C  C     . ASP A 1 128  ? -28.114 -66.684  37.966  1.00 15.68  ? 129  ASP A C     1 
ATOM   927   O  O     . ASP A 1 128  ? -27.761 -65.536  38.320  1.00 14.48  ? 129  ASP A O     1 
ATOM   928   C  CB    . ASP A 1 128  ? -28.043 -67.638  35.608  1.00 12.88  ? 129  ASP A CB    1 
ATOM   929   C  CG    . ASP A 1 128  ? -29.264 -68.538  35.549  1.00 15.94  ? 129  ASP A CG    1 
ATOM   930   O  OD1   . ASP A 1 128  ? -29.917 -68.620  34.482  1.00 14.76  ? 129  ASP A OD1   1 
ATOM   931   O  OD2   . ASP A 1 128  ? -29.644 -69.189  36.521  1.00 15.70  ? 129  ASP A OD2   1 
ATOM   932   N  N     . ILE A 1 129  ? -29.199 -67.257  38.513  1.00 14.85  ? 130  ILE A N     1 
ATOM   933   C  CA    . ILE A 1 129  ? -30.004 -66.483  39.465  1.00 13.71  ? 130  ILE A CA    1 
ATOM   934   C  C     . ILE A 1 129  ? -29.210 -66.031  40.689  1.00 14.96  ? 130  ILE A C     1 
ATOM   935   O  O     . ILE A 1 129  ? -29.387 -64.906  41.192  1.00 11.88  ? 130  ILE A O     1 
ATOM   936   C  CB    . ILE A 1 129  ? -31.311 -67.190  39.792  1.00 17.51  ? 130  ILE A CB    1 
ATOM   937   C  CG1   . ILE A 1 129  ? -31.206 -68.505  40.571  1.00 19.33  ? 130  ILE A CG1   1 
ATOM   938   C  CG2   . ILE A 1 129  ? -32.077 -67.539  38.477  1.00 17.59  ? 130  ILE A CG2   1 
ATOM   939   C  CD1   . ILE A 1 129  ? -31.351 -68.182  42.082  1.00 17.42  ? 130  ILE A CD1   1 
ATOM   940   N  N     . TYR A 1 130  ? -28.302 -66.900  41.175  1.00 12.54  ? 131  TYR A N     1 
ATOM   941   C  CA    . TYR A 1 130  ? -27.535 -66.500  42.365  1.00 15.08  ? 131  TYR A CA    1 
ATOM   942   C  C     . TYR A 1 130  ? -26.518 -65.392  42.010  1.00 15.18  ? 131  TYR A C     1 
ATOM   943   O  O     . TYR A 1 130  ? -26.206 -64.618  42.922  1.00 14.06  ? 131  TYR A O     1 
ATOM   944   C  CB    . TYR A 1 130  ? -26.830 -67.640  43.055  1.00 11.55  ? 131  TYR A CB    1 
ATOM   945   C  CG    . TYR A 1 130  ? -27.586 -68.673  43.864  1.00 12.30  ? 131  TYR A CG    1 
ATOM   946   C  CD1   . TYR A 1 130  ? -27.375 -70.020  43.588  1.00 13.02  ? 131  TYR A CD1   1 
ATOM   947   C  CD2   . TYR A 1 130  ? -28.434 -68.302  44.906  1.00 14.82  ? 131  TYR A CD2   1 
ATOM   948   C  CE1   . TYR A 1 130  ? -28.023 -71.004  44.358  1.00 11.34  ? 131  TYR A CE1   1 
ATOM   949   C  CE2   . TYR A 1 130  ? -29.107 -69.246  45.656  1.00 12.83  ? 131  TYR A CE2   1 
ATOM   950   C  CZ    . TYR A 1 130  ? -28.848 -70.592  45.381  1.00 15.21  ? 131  TYR A CZ    1 
ATOM   951   O  OH    . TYR A 1 130  ? -29.513 -71.525  46.165  1.00 16.56  ? 131  TYR A OH    1 
ATOM   952   N  N     . ALA A 1 131  ? -26.092 -65.272  40.775  1.00 14.63  ? 132  ALA A N     1 
ATOM   953   C  CA    . ALA A 1 131  ? -25.175 -64.199  40.404  1.00 18.36  ? 132  ALA A CA    1 
ATOM   954   C  C     . ALA A 1 131  ? -25.836 -62.826  40.489  1.00 18.51  ? 132  ALA A C     1 
ATOM   955   O  O     . ALA A 1 131  ? -25.173 -61.805  40.460  1.00 18.63  ? 132  ALA A O     1 
ATOM   956   C  CB    . ALA A 1 131  ? -24.719 -64.414  38.946  1.00 15.69  ? 132  ALA A CB    1 
ATOM   957   N  N     . ALA A 1 132  ? -27.180 -62.813  40.472  1.00 16.64  ? 133  ALA A N     1 
ATOM   958   C  CA    . ALA A 1 132  ? -27.949 -61.594  40.536  1.00 17.08  ? 133  ALA A CA    1 
ATOM   959   C  C     . ALA A 1 132  ? -28.617 -61.402  41.879  1.00 15.81  ? 133  ALA A C     1 
ATOM   960   O  O     . ALA A 1 132  ? -29.441 -60.476  42.013  1.00 17.87  ? 133  ALA A O     1 
ATOM   961   C  CB    . ALA A 1 132  ? -29.053 -61.512  39.453  1.00 17.90  ? 133  ALA A CB    1 
ATOM   962   N  N     . ARG A 1 133  ? -28.267 -62.142  42.924  1.00 16.62  ? 134  ARG A N     1 
ATOM   963   C  CA    . ARG A 1 133  ? -28.928 -62.013  44.200  1.00 16.98  ? 134  ARG A CA    1 
ATOM   964   C  C     . ARG A 1 133  ? -28.639 -60.672  44.884  1.00 17.37  ? 134  ARG A C     1 
ATOM   965   O  O     . ARG A 1 133  ? -29.386 -60.401  45.813  1.00 16.54  ? 134  ARG A O     1 
ATOM   966   C  CB    . ARG A 1 133  ? -28.604 -63.105  45.240  1.00 19.08  ? 134  ARG A CB    1 
ATOM   967   C  CG    . ARG A 1 133  ? -27.133 -63.128  45.736  1.00 17.59  ? 134  ARG A CG    1 
ATOM   968   C  CD    . ARG A 1 133  ? -26.927 -64.405  46.508  1.00 18.61  ? 134  ARG A CD    1 
ATOM   969   N  NE    . ARG A 1 133  ? -25.634 -64.694  47.111  1.00 18.10  ? 134  ARG A NE    1 
ATOM   970   C  CZ    . ARG A 1 133  ? -24.566 -65.212  46.560  1.00 17.06  ? 134  ARG A CZ    1 
ATOM   971   N  NH1   . ARG A 1 133  ? -23.477 -65.428  47.331  1.00 15.74  ? 134  ARG A NH1   1 
ATOM   972   N  NH2   . ARG A 1 133  ? -24.525 -65.476  45.265  1.00 16.46  ? 134  ARG A NH2   1 
ATOM   973   N  N     . GLN A 1 134  ? -27.607 -59.938  44.527  1.00 16.84  ? 135  GLN A N     1 
ATOM   974   C  CA    . GLN A 1 134  ? -27.356 -58.707  45.255  1.00 17.36  ? 135  GLN A CA    1 
ATOM   975   C  C     . GLN A 1 134  ? -27.893 -57.487  44.494  1.00 15.66  ? 135  GLN A C     1 
ATOM   976   O  O     . GLN A 1 134  ? -27.636 -56.403  44.982  1.00 14.00  ? 135  GLN A O     1 
ATOM   977   C  CB    . GLN A 1 134  ? -25.862 -58.399  45.489  1.00 21.61  ? 135  GLN A CB    1 
ATOM   978   C  CG    . GLN A 1 134  ? -24.995 -58.643  44.301  1.00 23.22  ? 135  GLN A CG    1 
ATOM   979   C  CD    . GLN A 1 134  ? -24.711 -60.121  44.072  1.00 27.22  ? 135  GLN A CD    1 
ATOM   980   O  OE1   . GLN A 1 134  ? -23.958 -60.768  44.822  1.00 33.33  ? 135  GLN A OE1   1 
ATOM   981   N  NE2   . GLN A 1 134  ? -25.268 -60.707  43.042  1.00 21.12  ? 135  GLN A NE2   1 
ATOM   982   N  N     . THR A 1 135  ? -28.585 -57.681  43.393  1.00 15.79  ? 136  THR A N     1 
ATOM   983   C  CA    . THR A 1 135  ? -29.082 -56.562  42.626  1.00 14.66  ? 136  THR A CA    1 
ATOM   984   C  C     . THR A 1 135  ? -30.222 -55.845  43.315  1.00 15.55  ? 136  THR A C     1 
ATOM   985   O  O     . THR A 1 135  ? -30.595 -54.782  42.823  1.00 19.74  ? 136  THR A O     1 
ATOM   986   C  CB    . THR A 1 135  ? -29.547 -57.013  41.213  1.00 14.07  ? 136  THR A CB    1 
ATOM   987   O  OG1   . THR A 1 135  ? -30.607 -57.952  41.376  1.00 13.75  ? 136  THR A OG1   1 
ATOM   988   C  CG2   . THR A 1 135  ? -28.368 -57.581  40.474  1.00 16.74  ? 136  THR A CG2   1 
ATOM   989   N  N     . GLY A 1 136  ? -30.878 -56.427  44.288  1.00 15.40  ? 137  GLY A N     1 
ATOM   990   C  CA    . GLY A 1 136  ? -32.011 -55.850  44.994  1.00 15.46  ? 137  GLY A CA    1 
ATOM   991   C  C     . GLY A 1 136  ? -33.355 -56.307  44.385  1.00 15.39  ? 137  GLY A C     1 
ATOM   992   O  O     . GLY A 1 136  ? -34.422 -55.820  44.783  1.00 16.40  ? 137  GLY A O     1 
ATOM   993   N  N     . PHE A 1 137  ? -33.389 -57.259  43.451  1.00 14.41  ? 138  PHE A N     1 
ATOM   994   C  CA    . PHE A 1 137  ? -34.650 -57.820  42.978  1.00 15.79  ? 138  PHE A CA    1 
ATOM   995   C  C     . PHE A 1 137  ? -35.166 -58.767  44.078  1.00 15.67  ? 138  PHE A C     1 
ATOM   996   O  O     . PHE A 1 137  ? -34.389 -59.527  44.707  1.00 17.65  ? 138  PHE A O     1 
ATOM   997   C  CB    . PHE A 1 137  ? -34.500 -58.578  41.670  1.00 14.96  ? 138  PHE A CB    1 
ATOM   998   C  CG    . PHE A 1 137  ? -34.740 -57.828  40.375  1.00 12.52  ? 138  PHE A CG    1 
ATOM   999   C  CD1   . PHE A 1 137  ? -34.050 -56.660  40.126  1.00 15.68  ? 138  PHE A CD1   1 
ATOM   1000  C  CD2   . PHE A 1 137  ? -35.596 -58.332  39.410  1.00 13.44  ? 138  PHE A CD2   1 
ATOM   1001  C  CE1   . PHE A 1 137  ? -34.272 -55.942  38.942  1.00 13.95  ? 138  PHE A CE1   1 
ATOM   1002  C  CE2   . PHE A 1 137  ? -35.756 -57.652  38.192  1.00 12.04  ? 138  PHE A CE2   1 
ATOM   1003  C  CZ    . PHE A 1 137  ? -35.113 -56.445  37.970  1.00 15.30  ? 138  PHE A CZ    1 
ATOM   1004  N  N     . ALA A 1 138  ? -36.473 -58.875  44.254  1.00 14.49  ? 139  ALA A N     1 
ATOM   1005  C  CA    . ALA A 1 138  ? -37.107 -59.967  44.990  1.00 14.58  ? 139  ALA A CA    1 
ATOM   1006  C  C     . ALA A 1 138  ? -36.917 -61.215  44.087  1.00 14.31  ? 139  ALA A C     1 
ATOM   1007  O  O     . ALA A 1 138  ? -36.865 -61.102  42.843  1.00 16.14  ? 139  ALA A O     1 
ATOM   1008  C  CB    . ALA A 1 138  ? -38.572 -59.722  45.364  1.00 9.60   ? 139  ALA A CB    1 
ATOM   1009  N  N     . MET A 1 139  ? -36.787 -62.395  44.679  1.00 11.80  ? 140  MET A N     1 
ATOM   1010  C  CA    . MET A 1 139  ? -36.513 -63.610  43.956  1.00 12.94  ? 140  MET A CA    1 
ATOM   1011  C  C     . MET A 1 139  ? -37.477 -64.716  44.361  1.00 14.11  ? 140  MET A C     1 
ATOM   1012  O  O     . MET A 1 139  ? -37.440 -65.070  45.563  1.00 15.44  ? 140  MET A O     1 
ATOM   1013  C  CB    . MET A 1 139  ? -35.055 -64.039  44.200  1.00 12.98  ? 140  MET A CB    1 
ATOM   1014  C  CG    . MET A 1 139  ? -34.096 -62.962  43.633  1.00 17.27  ? 140  MET A CG    1 
ATOM   1015  S  SD    . MET A 1 139  ? -32.347 -63.369  43.956  1.00 17.08  ? 140  MET A SD    1 
ATOM   1016  C  CE    . MET A 1 139  ? -32.128 -64.878  43.015  1.00 18.63  ? 140  MET A CE    1 
ATOM   1017  N  N     . LEU A 1 140  ? -38.321 -65.116  43.428  1.00 12.03  ? 141  LEU A N     1 
ATOM   1018  C  CA    . LEU A 1 140  ? -39.378 -66.083  43.819  1.00 12.32  ? 141  LEU A CA    1 
ATOM   1019  C  C     . LEU A 1 140  ? -39.242 -67.305  42.943  1.00 15.27  ? 141  LEU A C     1 
ATOM   1020  O  O     . LEU A 1 140  ? -39.178 -67.166  41.715  1.00 17.99  ? 141  LEU A O     1 
ATOM   1021  C  CB    . LEU A 1 140  ? -40.745 -65.505  43.466  1.00 16.69  ? 141  LEU A CB    1 
ATOM   1022  C  CG    . LEU A 1 140  ? -41.994 -65.446  44.295  1.00 19.29  ? 141  LEU A CG    1 
ATOM   1023  C  CD1   . LEU A 1 140  ? -43.238 -65.265  43.416  1.00 13.76  ? 141  LEU A CD1   1 
ATOM   1024  C  CD2   . LEU A 1 140  ? -42.120 -66.399  45.465  1.00 20.86  ? 141  LEU A CD2   1 
ATOM   1025  N  N     . ALA A 1 141  ? -39.066 -68.454  43.579  1.00 14.99  ? 142  ALA A N     1 
ATOM   1026  C  CA    . ALA A 1 141  ? -38.815 -69.674  42.833  1.00 15.05  ? 142  ALA A CA    1 
ATOM   1027  C  C     . ALA A 1 141  ? -40.077 -70.534  42.675  1.00 17.75  ? 142  ALA A C     1 
ATOM   1028  O  O     . ALA A 1 141  ? -40.878 -70.509  43.619  1.00 17.52  ? 142  ALA A O     1 
ATOM   1029  C  CB    . ALA A 1 141  ? -37.803 -70.537  43.594  1.00 17.06  ? 142  ALA A CB    1 
ATOM   1030  N  N     . SER A 1 142  ? -40.216 -71.068  41.470  1.00 18.67  ? 143  SER A N     1 
ATOM   1031  C  CA    . SER A 1 142  ? -41.275 -72.067  41.265  1.00 17.58  ? 143  SER A CA    1 
ATOM   1032  C  C     . SER A 1 142  ? -40.585 -73.414  41.122  1.00 18.33  ? 143  SER A C     1 
ATOM   1033  O  O     . SER A 1 142  ? -39.519 -73.476  40.489  1.00 19.43  ? 143  SER A O     1 
ATOM   1034  C  CB    . SER A 1 142  ? -42.206 -71.765  40.102  1.00 17.72  ? 143  SER A CB    1 
ATOM   1035  O  OG    . SER A 1 142  ? -41.521 -71.465  38.913  1.00 19.25  ? 143  SER A OG    1 
ATOM   1036  N  N     . SER A 1 143  ? -41.210 -74.476  41.659  1.00 17.40  ? 144  SER A N     1 
ATOM   1037  C  CA    . SER A 1 143  ? -40.669 -75.821  41.590  1.00 18.88  ? 144  SER A CA    1 
ATOM   1038  C  C     . SER A 1 143  ? -41.366 -76.836  40.717  1.00 21.71  ? 144  SER A C     1 
ATOM   1039  O  O     . SER A 1 143  ? -40.904 -77.997  40.632  1.00 19.25  ? 144  SER A O     1 
ATOM   1040  C  CB    . SER A 1 143  ? -40.531 -76.294  43.047  1.00 21.57  ? 144  SER A CB    1 
ATOM   1041  O  OG    . SER A 1 143  ? -41.805 -76.533  43.604  1.00 25.44  ? 144  SER A OG    1 
ATOM   1042  N  N     . SER A 1 144  ? -42.385 -76.459  39.946  1.00 18.20  ? 145  SER A N     1 
ATOM   1043  C  CA    . SER A 1 144  ? -43.080 -77.384  39.088  1.00 17.75  ? 145  SER A CA    1 
ATOM   1044  C  C     . SER A 1 144  ? -43.749 -76.570  37.992  1.00 18.15  ? 145  SER A C     1 
ATOM   1045  O  O     . SER A 1 144  ? -43.794 -75.321  38.098  1.00 14.05  ? 145  SER A O     1 
ATOM   1046  C  CB    . SER A 1 144  ? -44.179 -78.163  39.885  1.00 18.08  ? 145  SER A CB    1 
ATOM   1047  O  OG    . SER A 1 144  ? -45.268 -77.221  40.161  1.00 16.19  ? 145  SER A OG    1 
ATOM   1048  N  N     . VAL A 1 145  ? -44.284 -77.231  36.970  1.00 17.28  ? 146  VAL A N     1 
ATOM   1049  C  CA    . VAL A 1 145  ? -44.984 -76.454  35.918  1.00 17.31  ? 146  VAL A CA    1 
ATOM   1050  C  C     . VAL A 1 145  ? -46.148 -75.696  36.523  1.00 18.17  ? 146  VAL A C     1 
ATOM   1051  O  O     . VAL A 1 145  ? -46.433 -74.556  36.127  1.00 18.78  ? 146  VAL A O     1 
ATOM   1052  C  CB    . VAL A 1 145  ? -45.478 -77.385  34.801  1.00 18.39  ? 146  VAL A CB    1 
ATOM   1053  C  CG1   . VAL A 1 145  ? -46.302 -76.758  33.688  1.00 19.76  ? 146  VAL A CG1   1 
ATOM   1054  C  CG2   . VAL A 1 145  ? -44.258 -78.073  34.178  1.00 21.32  ? 146  VAL A CG2   1 
ATOM   1055  N  N     . GLN A 1 146  ? -46.932 -76.324  37.428  1.00 18.53  ? 147  GLN A N     1 
ATOM   1056  C  CA    . GLN A 1 146  ? -48.107 -75.615  37.964  1.00 17.12  ? 147  GLN A CA    1 
ATOM   1057  C  C     . GLN A 1 146  ? -47.687 -74.367  38.729  1.00 16.70  ? 147  GLN A C     1 
ATOM   1058  O  O     . GLN A 1 146  ? -48.339 -73.359  38.756  1.00 15.43  ? 147  GLN A O     1 
ATOM   1059  C  CB    . GLN A 1 146  ? -48.768 -76.526  39.032  1.00 18.77  ? 147  GLN A CB    1 
ATOM   1060  C  CG    . GLN A 1 146  ? -50.019 -75.980  39.692  1.00 16.26  ? 147  GLN A CG    1 
ATOM   1061  C  CD    . GLN A 1 146  ? -51.051 -75.552  38.643  1.00 19.13  ? 147  GLN A CD    1 
ATOM   1062  O  OE1   . GLN A 1 146  ? -51.123 -74.404  38.172  1.00 18.41  ? 147  GLN A OE1   1 
ATOM   1063  N  NE2   . GLN A 1 146  ? -51.923 -76.480  38.277  1.00 14.88  ? 147  GLN A NE2   1 
ATOM   1064  N  N     . GLU A 1 147  ? -46.661 -74.574  39.588  1.00 16.48  ? 148  GLU A N     1 
ATOM   1065  C  CA    . GLU A 1 147  ? -46.152 -73.454  40.369  1.00 17.12  ? 148  GLU A CA    1 
ATOM   1066  C  C     . GLU A 1 147  ? -45.599 -72.301  39.522  1.00 16.42  ? 148  GLU A C     1 
ATOM   1067  O  O     . GLU A 1 147  ? -45.585 -71.173  40.007  1.00 15.64  ? 148  GLU A O     1 
ATOM   1068  C  CB    . GLU A 1 147  ? -44.986 -73.882  41.295  1.00 18.77  ? 148  GLU A CB    1 
ATOM   1069  C  CG    . GLU A 1 147  ? -45.469 -74.486  42.588  1.00 20.76  ? 148  GLU A CG    1 
ATOM   1070  C  CD    . GLU A 1 147  ? -44.381 -74.903  43.571  1.00 22.87  ? 148  GLU A CD    1 
ATOM   1071  O  OE1   . GLU A 1 147  ? -43.238 -74.448  43.502  1.00 20.26  ? 148  GLU A OE1   1 
ATOM   1072  O  OE2   . GLU A 1 147  ? -44.725 -75.670  44.499  1.00 22.21  ? 148  GLU A OE2   1 
ATOM   1073  N  N     . ALA A 1 148  ? -45.074 -72.607  38.336  1.00 13.60  ? 149  ALA A N     1 
ATOM   1074  C  CA    . ALA A 1 148  ? -44.555 -71.586  37.424  1.00 16.30  ? 149  ALA A CA    1 
ATOM   1075  C  C     . ALA A 1 148  ? -45.700 -70.619  37.071  1.00 17.37  ? 149  ALA A C     1 
ATOM   1076  O  O     . ALA A 1 148  ? -45.584 -69.395  37.203  1.00 15.54  ? 149  ALA A O     1 
ATOM   1077  C  CB    . ALA A 1 148  ? -43.936 -72.225  36.197  1.00 15.03  ? 149  ALA A CB    1 
ATOM   1078  N  N     . HIS A 1 149  ? -46.884 -71.194  36.753  1.00 16.98  ? 150  HIS A N     1 
ATOM   1079  C  CA    . HIS A 1 149  ? -48.050 -70.313  36.549  1.00 17.40  ? 150  HIS A CA    1 
ATOM   1080  C  C     . HIS A 1 149  ? -48.352 -69.471  37.780  1.00 19.33  ? 150  HIS A C     1 
ATOM   1081  O  O     . HIS A 1 149  ? -48.497 -68.234  37.736  1.00 18.12  ? 150  HIS A O     1 
ATOM   1082  C  CB    . HIS A 1 149  ? -49.275 -71.200  36.177  1.00 16.93  ? 150  HIS A CB    1 
ATOM   1083  C  CG    . HIS A 1 149  ? -50.593 -70.485  36.226  1.00 16.50  ? 150  HIS A CG    1 
ATOM   1084  N  ND1   . HIS A 1 149  ? -51.283 -70.342  37.395  1.00 18.57  ? 150  HIS A ND1   1 
ATOM   1085  C  CD2   . HIS A 1 149  ? -51.342 -69.908  35.275  1.00 18.41  ? 150  HIS A CD2   1 
ATOM   1086  C  CE1   . HIS A 1 149  ? -52.424 -69.664  37.196  1.00 19.65  ? 150  HIS A CE1   1 
ATOM   1087  N  NE2   . HIS A 1 149  ? -52.463 -69.375  35.899  1.00 19.89  ? 150  HIS A NE2   1 
ATOM   1088  N  N     . ASP A 1 150  ? -48.544 -70.172  38.917  1.00 18.25  ? 151  ASP A N     1 
ATOM   1089  C  CA    . ASP A 1 150  ? -48.967 -69.485  40.151  1.00 18.63  ? 151  ASP A CA    1 
ATOM   1090  C  C     . ASP A 1 150  ? -47.933 -68.458  40.615  1.00 19.29  ? 151  ASP A C     1 
ATOM   1091  O  O     . ASP A 1 150  ? -48.305 -67.372  40.995  1.00 17.54  ? 151  ASP A O     1 
ATOM   1092  C  CB    . ASP A 1 150  ? -49.219 -70.497  41.283  1.00 20.33  ? 151  ASP A CB    1 
ATOM   1093  C  CG    . ASP A 1 150  ? -50.329 -71.500  40.964  1.00 20.50  ? 151  ASP A CG    1 
ATOM   1094  O  OD1   . ASP A 1 150  ? -51.083 -71.372  39.971  1.00 20.80  ? 151  ASP A OD1   1 
ATOM   1095  O  OD2   . ASP A 1 150  ? -50.450 -72.493  41.704  1.00 19.36  ? 151  ASP A OD2   1 
ATOM   1096  N  N     . MET A 1 151  ? -46.643 -68.827  40.682  1.00 15.82  ? 152  MET A N     1 
ATOM   1097  C  CA    . MET A 1 151  ? -45.657 -67.844  41.166  1.00 15.81  ? 152  MET A CA    1 
ATOM   1098  C  C     . MET A 1 151  ? -45.443 -66.666  40.203  1.00 16.27  ? 152  MET A C     1 
ATOM   1099  O  O     . MET A 1 151  ? -45.027 -65.581  40.620  1.00 14.63  ? 152  MET A O     1 
ATOM   1100  C  CB    . MET A 1 151  ? -44.324 -68.555  41.438  1.00 15.18  ? 152  MET A CB    1 
ATOM   1101  C  CG    . MET A 1 151  ? -44.408 -69.543  42.580  1.00 17.95  ? 152  MET A CG    1 
ATOM   1102  S  SD    . MET A 1 151  ? -44.909 -68.883  44.181  1.00 22.37  ? 152  MET A SD    1 
ATOM   1103  C  CE    . MET A 1 151  ? -44.830 -70.348  45.181  1.00 26.70  ? 152  MET A CE    1 
ATOM   1104  N  N     . ALA A 1 152  ? -45.579 -66.914  38.883  1.00 15.60  ? 153  ALA A N     1 
ATOM   1105  C  CA    . ALA A 1 152  ? -45.471 -65.854  37.922  1.00 16.36  ? 153  ALA A CA    1 
ATOM   1106  C  C     . ALA A 1 152  ? -46.538 -64.777  38.227  1.00 15.69  ? 153  ALA A C     1 
ATOM   1107  O  O     . ALA A 1 152  ? -46.312 -63.590  38.288  1.00 13.87  ? 153  ALA A O     1 
ATOM   1108  C  CB    . ALA A 1 152  ? -45.742 -66.438  36.503  1.00 13.55  ? 153  ALA A CB    1 
ATOM   1109  N  N     . LEU A 1 153  ? -47.737 -65.238  38.646  1.00 14.85  ? 154  LEU A N     1 
ATOM   1110  C  CA    . LEU A 1 153  ? -48.826 -64.334  38.958  1.00 14.45  ? 154  LEU A CA    1 
ATOM   1111  C  C     . LEU A 1 153  ? -48.573 -63.613  40.256  1.00 13.35  ? 154  LEU A C     1 
ATOM   1112  O  O     . LEU A 1 153  ? -48.756 -62.388  40.357  1.00 15.46  ? 154  LEU A O     1 
ATOM   1113  C  CB    . LEU A 1 153  ? -50.173 -65.082  39.040  1.00 16.94  ? 154  LEU A CB    1 
ATOM   1114  C  CG    . LEU A 1 153  ? -51.487 -64.360  38.735  1.00 22.65  ? 154  LEU A CG    1 
ATOM   1115  C  CD1   . LEU A 1 153  ? -52.648 -65.087  39.465  1.00 22.43  ? 154  LEU A CD1   1 
ATOM   1116  C  CD2   . LEU A 1 153  ? -51.568 -62.885  38.792  1.00 21.51  ? 154  LEU A CD2   1 
ATOM   1117  N  N     . VAL A 1 154  ? -48.102 -64.334  41.300  1.00 11.40  ? 155  VAL A N     1 
ATOM   1118  C  CA    . VAL A 1 154  ? -47.819 -63.602  42.543  1.00 10.64  ? 155  VAL A CA    1 
ATOM   1119  C  C     . VAL A 1 154  ? -46.734 -62.531  42.293  1.00 11.23  ? 155  VAL A C     1 
ATOM   1120  O  O     . VAL A 1 154  ? -46.740 -61.445  42.851  1.00 12.05  ? 155  VAL A O     1 
ATOM   1121  C  CB    . VAL A 1 154  ? -47.322 -64.599  43.595  1.00 11.74  ? 155  VAL A CB    1 
ATOM   1122  C  CG1   . VAL A 1 154  ? -46.740 -64.004  44.880  1.00 12.38  ? 155  VAL A CG1   1 
ATOM   1123  C  CG2   . VAL A 1 154  ? -48.507 -65.522  43.984  1.00 10.22  ? 155  VAL A CG2   1 
ATOM   1124  N  N     . ALA A 1 155  ? -45.729 -62.938  41.485  1.00 13.45  ? 156  ALA A N     1 
ATOM   1125  C  CA    . ALA A 1 155  ? -44.607 -62.013  41.237  1.00 14.74  ? 156  ALA A CA    1 
ATOM   1126  C  C     . ALA A 1 155  ? -45.068 -60.692  40.608  1.00 15.15  ? 156  ALA A C     1 
ATOM   1127  O  O     . ALA A 1 155  ? -44.688 -59.582  41.036  1.00 16.01  ? 156  ALA A O     1 
ATOM   1128  C  CB    . ALA A 1 155  ? -43.574 -62.670  40.312  1.00 12.69  ? 156  ALA A CB    1 
ATOM   1129  N  N     . HIS A 1 156  ? -45.928 -60.800  39.576  1.00 15.06  ? 157  HIS A N     1 
ATOM   1130  C  CA    . HIS A 1 156  ? -46.414 -59.550  38.967  1.00 14.96  ? 157  HIS A CA    1 
ATOM   1131  C  C     . HIS A 1 156  ? -47.266 -58.719  39.932  1.00 16.54  ? 157  HIS A C     1 
ATOM   1132  O  O     . HIS A 1 156  ? -47.171 -57.508  40.019  1.00 13.51  ? 157  HIS A O     1 
ATOM   1133  C  CB    . HIS A 1 156  ? -47.275 -59.847  37.734  1.00 14.70  ? 157  HIS A CB    1 
ATOM   1134  C  CG    . HIS A 1 156  ? -46.477 -60.164  36.500  1.00 13.57  ? 157  HIS A CG    1 
ATOM   1135  N  ND1   . HIS A 1 156  ? -46.097 -59.171  35.623  1.00 13.60  ? 157  HIS A ND1   1 
ATOM   1136  C  CD2   . HIS A 1 156  ? -45.991 -61.334  36.043  1.00 13.77  ? 157  HIS A CD2   1 
ATOM   1137  C  CE1   . HIS A 1 156  ? -45.400 -59.745  34.642  1.00 12.24  ? 157  HIS A CE1   1 
ATOM   1138  N  NE2   . HIS A 1 156  ? -45.325 -61.022  34.875  1.00 14.00  ? 157  HIS A NE2   1 
ATOM   1139  N  N     . LEU A 1 157  ? -48.176 -59.387  40.646  1.00 14.90  ? 158  LEU A N     1 
ATOM   1140  C  CA    . LEU A 1 157  ? -49.031 -58.655  41.582  1.00 16.70  ? 158  LEU A CA    1 
ATOM   1141  C  C     . LEU A 1 157  ? -48.199 -58.013  42.690  1.00 16.85  ? 158  LEU A C     1 
ATOM   1142  O  O     . LEU A 1 157  ? -48.376 -56.853  43.044  1.00 15.05  ? 158  LEU A O     1 
ATOM   1143  C  CB    . LEU A 1 157  ? -50.093 -59.587  42.163  1.00 16.95  ? 158  LEU A CB    1 
ATOM   1144  C  CG    . LEU A 1 157  ? -51.122 -60.132  41.151  1.00 17.13  ? 158  LEU A CG    1 
ATOM   1145  C  CD1   . LEU A 1 157  ? -51.829 -61.307  41.843  1.00 20.74  ? 158  LEU A CD1   1 
ATOM   1146  C  CD2   . LEU A 1 157  ? -52.111 -59.049  40.747  1.00 19.39  ? 158  LEU A CD2   1 
ATOM   1147  N  N     . ALA A 1 158  ? -47.275 -58.803  43.254  1.00 14.58  ? 159  ALA A N     1 
ATOM   1148  C  CA    . ALA A 1 158  ? -46.454 -58.271  44.333  1.00 16.86  ? 159  ALA A CA    1 
ATOM   1149  C  C     . ALA A 1 158  ? -45.542 -57.110  43.862  1.00 15.23  ? 159  ALA A C     1 
ATOM   1150  O  O     . ALA A 1 158  ? -45.360 -56.134  44.606  1.00 14.71  ? 159  ALA A O     1 
ATOM   1151  C  CB    . ALA A 1 158  ? -45.608 -59.330  44.978  1.00 15.10  ? 159  ALA A CB    1 
ATOM   1152  N  N     . ALA A 1 159  ? -44.992 -57.225  42.668  1.00 15.32  ? 160  ALA A N     1 
ATOM   1153  C  CA    . ALA A 1 159  ? -44.189 -56.187  42.033  1.00 15.82  ? 160  ALA A CA    1 
ATOM   1154  C  C     . ALA A 1 159  ? -44.954 -54.859  41.913  1.00 18.92  ? 160  ALA A C     1 
ATOM   1155  O  O     . ALA A 1 159  ? -44.526 -53.837  42.433  1.00 15.76  ? 160  ALA A O     1 
ATOM   1156  C  CB    . ALA A 1 159  ? -43.669 -56.644  40.666  1.00 16.23  ? 160  ALA A CB    1 
ATOM   1157  N  N     . ILE A 1 160  ? -46.209 -54.932  41.407  1.00 17.64  ? 161  ILE A N     1 
ATOM   1158  C  CA    . ILE A 1 160  ? -47.027 -53.718  41.319  1.00 15.92  ? 161  ILE A CA    1 
ATOM   1159  C  C     . ILE A 1 160  ? -47.323 -53.079  42.661  1.00 15.50  ? 161  ILE A C     1 
ATOM   1160  O  O     . ILE A 1 160  ? -47.214 -51.847  42.855  1.00 14.79  ? 161  ILE A O     1 
ATOM   1161  C  CB    . ILE A 1 160  ? -48.405 -54.053  40.631  1.00 14.02  ? 161  ILE A CB    1 
ATOM   1162  C  CG1   . ILE A 1 160  ? -48.129 -54.487  39.187  1.00 14.88  ? 161  ILE A CG1   1 
ATOM   1163  C  CG2   . ILE A 1 160  ? -49.363 -52.882  40.668  1.00 15.81  ? 161  ILE A CG2   1 
ATOM   1164  C  CD1   . ILE A 1 160  ? -49.190 -55.477  38.668  1.00 17.52  ? 161  ILE A CD1   1 
ATOM   1165  N  N     . GLU A 1 161  ? -47.695 -53.876  43.661  1.00 15.90  ? 162  GLU A N     1 
ATOM   1166  C  CA    . GLU A 1 161  ? -48.033 -53.281  44.966  1.00 17.27  ? 162  GLU A CA    1 
ATOM   1167  C  C     . GLU A 1 161  ? -46.798 -52.833  45.744  1.00 18.03  ? 162  GLU A C     1 
ATOM   1168  O  O     . GLU A 1 161  ? -46.846 -51.804  46.405  1.00 15.65  ? 162  GLU A O     1 
ATOM   1169  C  CB    . GLU A 1 161  ? -48.845 -54.282  45.830  1.00 17.88  ? 162  GLU A CB    1 
ATOM   1170  C  CG    . GLU A 1 161  ? -49.216 -53.693  47.218  1.00 18.22  ? 162  GLU A CG    1 
ATOM   1171  C  CD    . GLU A 1 161  ? -50.318 -54.494  47.888  1.00 20.24  ? 162  GLU A CD    1 
ATOM   1172  O  OE1   . GLU A 1 161  ? -51.299 -54.897  47.246  1.00 20.88  ? 162  GLU A OE1   1 
ATOM   1173  O  OE2   . GLU A 1 161  ? -50.178 -54.787  49.093  1.00 23.13  ? 162  GLU A OE2   1 
ATOM   1174  N  N     . SER A 1 162  ? -45.725 -53.633  45.725  1.00 17.56  ? 163  SER A N     1 
ATOM   1175  C  CA    . SER A 1 162  ? -44.563 -53.279  46.552  1.00 16.41  ? 163  SER A CA    1 
ATOM   1176  C  C     . SER A 1 162  ? -43.549 -52.322  45.921  1.00 16.72  ? 163  SER A C     1 
ATOM   1177  O  O     . SER A 1 162  ? -42.749 -51.799  46.713  1.00 15.62  ? 163  SER A O     1 
ATOM   1178  C  CB    . SER A 1 162  ? -43.777 -54.548  46.867  1.00 16.83  ? 163  SER A CB    1 
ATOM   1179  O  OG    . SER A 1 162  ? -43.115 -54.993  45.649  1.00 16.19  ? 163  SER A OG    1 
ATOM   1180  N  N     . ASN A 1 163  ? -43.567 -52.089  44.628  1.00 16.07  ? 164  ASN A N     1 
ATOM   1181  C  CA    . ASN A 1 163  ? -42.605 -51.247  43.938  1.00 17.36  ? 164  ASN A CA    1 
ATOM   1182  C  C     . ASN A 1 163  ? -41.206 -51.862  43.961  1.00 17.28  ? 164  ASN A C     1 
ATOM   1183  O  O     . ASN A 1 163  ? -40.262 -51.154  43.592  1.00 17.05  ? 164  ASN A O     1 
ATOM   1184  C  CB    . ASN A 1 163  ? -42.562 -49.781  44.407  1.00 17.88  ? 164  ASN A CB    1 
ATOM   1185  C  CG    . ASN A 1 163  ? -43.743 -49.032  43.817  1.00 24.94  ? 164  ASN A CG    1 
ATOM   1186  O  OD1   . ASN A 1 163  ? -44.604 -48.639  44.635  1.00 28.62  ? 164  ASN A OD1   1 
ATOM   1187  N  ND2   . ASN A 1 163  ? -43.839 -48.891  42.509  1.00 25.32  ? 164  ASN A ND2   1 
ATOM   1188  N  N     . VAL A 1 164  ? -41.120 -53.133  44.362  1.00 15.13  ? 165  VAL A N     1 
ATOM   1189  C  CA    . VAL A 1 164  ? -39.786 -53.812  44.242  1.00 15.40  ? 165  VAL A CA    1 
ATOM   1190  C  C     . VAL A 1 164  ? -39.914 -54.722  43.039  1.00 14.81  ? 165  VAL A C     1 
ATOM   1191  O  O     . VAL A 1 164  ? -40.854 -55.571  43.027  1.00 14.48  ? 165  VAL A O     1 
ATOM   1192  C  CB    . VAL A 1 164  ? -39.540 -54.554  45.560  1.00 15.98  ? 165  VAL A CB    1 
ATOM   1193  C  CG1   . VAL A 1 164  ? -38.251 -55.380  45.497  1.00 15.85  ? 165  VAL A CG1   1 
ATOM   1194  C  CG2   . VAL A 1 164  ? -39.459 -53.607  46.766  1.00 17.02  ? 165  VAL A CG2   1 
ATOM   1195  N  N     . PRO A 1 165  ? -38.929 -54.740  42.115  1.00 13.06  ? 166  PRO A N     1 
ATOM   1196  C  CA    . PRO A 1 165  ? -38.968 -55.626  40.988  1.00 12.59  ? 166  PRO A CA    1 
ATOM   1197  C  C     . PRO A 1 165  ? -38.739 -57.077  41.400  1.00 14.17  ? 166  PRO A C     1 
ATOM   1198  O  O     . PRO A 1 165  ? -38.097 -57.346  42.445  1.00 13.36  ? 166  PRO A O     1 
ATOM   1199  C  CB    . PRO A 1 165  ? -37.891 -55.134  40.035  1.00 11.46  ? 166  PRO A CB    1 
ATOM   1200  C  CG    . PRO A 1 165  ? -36.868 -54.526  41.005  1.00 12.39  ? 166  PRO A CG    1 
ATOM   1201  C  CD    . PRO A 1 165  ? -37.762 -53.860  42.071  1.00 13.45  ? 166  PRO A CD    1 
ATOM   1202  N  N     . PHE A 1 166  ? -39.363 -57.924  40.649  1.00 12.62  ? 167  PHE A N     1 
ATOM   1203  C  CA    . PHE A 1 166  ? -39.288 -59.339  40.913  1.00 15.33  ? 167  PHE A CA    1 
ATOM   1204  C  C     . PHE A 1 166  ? -38.598 -60.104  39.812  1.00 12.85  ? 167  PHE A C     1 
ATOM   1205  O  O     . PHE A 1 166  ? -38.771 -59.868  38.637  1.00 15.46  ? 167  PHE A O     1 
ATOM   1206  C  CB    . PHE A 1 166  ? -40.653 -60.061  41.116  1.00 13.72  ? 167  PHE A CB    1 
ATOM   1207  C  CG    . PHE A 1 166  ? -41.151 -59.915  42.512  1.00 13.56  ? 167  PHE A CG    1 
ATOM   1208  C  CD1   . PHE A 1 166  ? -41.418 -58.685  43.051  1.00 13.59  ? 167  PHE A CD1   1 
ATOM   1209  C  CD2   . PHE A 1 166  ? -41.376 -61.062  43.285  1.00 14.00  ? 167  PHE A CD2   1 
ATOM   1210  C  CE1   . PHE A 1 166  ? -41.895 -58.524  44.353  1.00 14.01  ? 167  PHE A CE1   1 
ATOM   1211  C  CE2   . PHE A 1 166  ? -41.801 -60.940  44.616  1.00 15.00  ? 167  PHE A CE2   1 
ATOM   1212  C  CZ    . PHE A 1 166  ? -42.078 -59.685  45.146  1.00 12.94  ? 167  PHE A CZ    1 
ATOM   1213  N  N     . MET A 1 167  ? -37.820 -61.096  40.274  1.00 14.98  ? 168  MET A N     1 
ATOM   1214  C  CA    . MET A 1 167  ? -37.308 -62.142  39.422  1.00 16.27  ? 168  MET A CA    1 
ATOM   1215  C  C     . MET A 1 167  ? -38.012 -63.472  39.798  1.00 16.55  ? 168  MET A C     1 
ATOM   1216  O  O     . MET A 1 167  ? -37.846 -64.048  40.900  1.00 15.97  ? 168  MET A O     1 
ATOM   1217  C  CB    . MET A 1 167  ? -35.770 -62.326  39.549  1.00 19.49  ? 168  MET A CB    1 
ATOM   1218  C  CG    . MET A 1 167  ? -35.241 -63.484  38.732  1.00 22.01  ? 168  MET A CG    1 
ATOM   1219  S  SD    . MET A 1 167  ? -33.430 -63.785  38.958  1.00 29.69  ? 168  MET A SD    1 
ATOM   1220  C  CE    . MET A 1 167  ? -32.885 -62.538  37.871  1.00 28.07  ? 168  MET A CE    1 
ATOM   1221  N  N     . HIS A 1 168  ? -38.864 -63.954  38.921  1.00 14.07  ? 169  HIS A N     1 
ATOM   1222  C  CA    . HIS A 1 168  ? -39.518 -65.264  39.044  1.00 13.52  ? 169  HIS A CA    1 
ATOM   1223  C  C     . HIS A 1 168  ? -38.626 -66.248  38.275  1.00 15.25  ? 169  HIS A C     1 
ATOM   1224  O  O     . HIS A 1 168  ? -38.376 -65.998  37.081  1.00 15.36  ? 169  HIS A O     1 
ATOM   1225  C  CB    . HIS A 1 168  ? -40.953 -65.214  38.491  1.00 14.03  ? 169  HIS A CB    1 
ATOM   1226  C  CG    . HIS A 1 168  ? -41.544 -66.534  38.103  1.00 15.04  ? 169  HIS A CG    1 
ATOM   1227  N  ND1   . HIS A 1 168  ? -41.560 -67.574  39.001  1.00 17.21  ? 169  HIS A ND1   1 
ATOM   1228  C  CD2   . HIS A 1 168  ? -42.069 -67.049  36.963  1.00 12.84  ? 169  HIS A CD2   1 
ATOM   1229  C  CE1   . HIS A 1 168  ? -42.072 -68.675  38.474  1.00 14.46  ? 169  HIS A CE1   1 
ATOM   1230  N  NE2   . HIS A 1 168  ? -42.432 -68.322  37.249  1.00 18.33  ? 169  HIS A NE2   1 
ATOM   1231  N  N     . PHE A 1 169  ? -38.200 -67.335  38.933  1.00 14.99  ? 170  PHE A N     1 
ATOM   1232  C  CA    . PHE A 1 169  ? -37.374 -68.306  38.224  1.00 15.34  ? 170  PHE A CA    1 
ATOM   1233  C  C     . PHE A 1 169  ? -37.777 -69.752  38.438  1.00 16.95  ? 170  PHE A C     1 
ATOM   1234  O  O     . PHE A 1 169  ? -38.265 -70.148  39.515  1.00 16.92  ? 170  PHE A O     1 
ATOM   1235  C  CB    . PHE A 1 169  ? -35.880 -68.045  38.569  1.00 15.56  ? 170  PHE A CB    1 
ATOM   1236  C  CG    . PHE A 1 169  ? -35.497 -68.354  39.991  1.00 16.39  ? 170  PHE A CG    1 
ATOM   1237  C  CD1   . PHE A 1 169  ? -34.938 -69.607  40.288  1.00 16.53  ? 170  PHE A CD1   1 
ATOM   1238  C  CD2   . PHE A 1 169  ? -35.683 -67.436  40.994  1.00 15.67  ? 170  PHE A CD2   1 
ATOM   1239  C  CE1   . PHE A 1 169  ? -34.622 -69.883  41.633  1.00 16.70  ? 170  PHE A CE1   1 
ATOM   1240  C  CE2   . PHE A 1 169  ? -35.372 -67.723  42.326  1.00 16.03  ? 170  PHE A CE2   1 
ATOM   1241  C  CZ    . PHE A 1 169  ? -34.811 -68.933  42.627  1.00 13.77  ? 170  PHE A CZ    1 
ATOM   1242  N  N     . PHE A 1 170  ? -37.435 -70.595  37.459  1.00 13.42  ? 171  PHE A N     1 
ATOM   1243  C  CA    . PHE A 1 170  ? -37.737 -72.018  37.497  1.00 15.54  ? 171  PHE A CA    1 
ATOM   1244  C  C     . PHE A 1 170  ? -36.615 -72.708  36.739  1.00 17.31  ? 171  PHE A C     1 
ATOM   1245  O  O     . PHE A 1 170  ? -35.882 -72.084  35.911  1.00 17.22  ? 171  PHE A O     1 
ATOM   1246  C  CB    . PHE A 1 170  ? -39.128 -72.369  36.937  1.00 17.22  ? 171  PHE A CB    1 
ATOM   1247  C  CG    . PHE A 1 170  ? -39.484 -71.721  35.614  1.00 18.19  ? 171  PHE A CG    1 
ATOM   1248  C  CD1   . PHE A 1 170  ? -39.400 -72.441  34.425  1.00 18.28  ? 171  PHE A CD1   1 
ATOM   1249  C  CD2   . PHE A 1 170  ? -39.913 -70.419  35.563  1.00 18.71  ? 171  PHE A CD2   1 
ATOM   1250  C  CE1   . PHE A 1 170  ? -39.670 -71.829  33.201  1.00 17.97  ? 171  PHE A CE1   1 
ATOM   1251  C  CE2   . PHE A 1 170  ? -40.238 -69.827  34.351  1.00 16.53  ? 171  PHE A CE2   1 
ATOM   1252  C  CZ    . PHE A 1 170  ? -40.128 -70.530  33.144  1.00 18.59  ? 171  PHE A CZ    1 
ATOM   1253  N  N     . ASP A 1 171  ? -36.419 -73.982  37.022  1.00 17.18  ? 172  ASP A N     1 
ATOM   1254  C  CA    . ASP A 1 171  ? -35.288 -74.686  36.434  1.00 15.88  ? 172  ASP A CA    1 
ATOM   1255  C  C     . ASP A 1 171  ? -35.268 -74.812  34.924  1.00 16.88  ? 172  ASP A C     1 
ATOM   1256  O  O     . ASP A 1 171  ? -36.170 -75.369  34.318  1.00 16.78  ? 172  ASP A O     1 
ATOM   1257  C  CB    . ASP A 1 171  ? -35.263 -76.086  37.103  1.00 19.34  ? 172  ASP A CB    1 
ATOM   1258  C  CG    . ASP A 1 171  ? -34.856 -75.946  38.561  1.00 18.49  ? 172  ASP A CG    1 
ATOM   1259  O  OD1   . ASP A 1 171  ? -34.882 -76.943  39.315  1.00 19.13  ? 172  ASP A OD1   1 
ATOM   1260  O  OD2   . ASP A 1 171  ? -34.503 -74.848  39.020  1.00 16.73  ? 172  ASP A OD2   1 
ATOM   1261  N  N     . GLY A 1 172  ? -34.136 -74.411  34.314  1.00 14.15  ? 173  GLY A N     1 
ATOM   1262  C  CA    . GLY A 1 172  ? -33.983 -74.612  32.882  1.00 18.36  ? 173  GLY A CA    1 
ATOM   1263  C  C     . GLY A 1 172  ? -34.084 -76.079  32.476  1.00 18.89  ? 173  GLY A C     1 
ATOM   1264  O  O     . GLY A 1 172  ? -33.474 -77.021  33.033  1.00 17.03  ? 173  GLY A O     1 
ATOM   1265  N  N     . PHE A 1 173  ? -34.940 -76.309  31.486  1.00 18.08  ? 174  PHE A N     1 
ATOM   1266  C  CA    . PHE A 1 173  ? -35.339 -77.598  30.969  1.00 17.24  ? 174  PHE A CA    1 
ATOM   1267  C  C     . PHE A 1 173  ? -36.163 -78.456  31.935  1.00 18.63  ? 174  PHE A C     1 
ATOM   1268  O  O     . PHE A 1 173  ? -37.315 -78.750  31.636  1.00 16.41  ? 174  PHE A O     1 
ATOM   1269  C  CB    . PHE A 1 173  ? -34.211 -78.462  30.394  1.00 17.20  ? 174  PHE A CB    1 
ATOM   1270  C  CG    . PHE A 1 173  ? -33.759 -77.934  29.053  1.00 14.38  ? 174  PHE A CG    1 
ATOM   1271  C  CD1   . PHE A 1 173  ? -34.379 -78.296  27.863  1.00 19.16  ? 174  PHE A CD1   1 
ATOM   1272  C  CD2   . PHE A 1 173  ? -32.670 -77.086  29.023  1.00 15.66  ? 174  PHE A CD2   1 
ATOM   1273  C  CE1   . PHE A 1 173  ? -33.956 -77.758  26.665  1.00 20.35  ? 174  PHE A CE1   1 
ATOM   1274  C  CE2   . PHE A 1 173  ? -32.229 -76.563  27.810  1.00 17.90  ? 174  PHE A CE2   1 
ATOM   1275  C  CZ    . PHE A 1 173  ? -32.869 -76.920  26.646  1.00 19.14  ? 174  PHE A CZ    1 
ATOM   1276  N  N     . ARG A 1 174  ? -35.672 -78.749  33.126  1.00 16.74  ? 175  ARG A N     1 
ATOM   1277  C  CA    . ARG A 1 174  ? -36.367 -79.640  34.048  1.00 18.72  ? 175  ARG A CA    1 
ATOM   1278  C  C     . ARG A 1 174  ? -37.740 -79.153  34.460  1.00 17.39  ? 175  ARG A C     1 
ATOM   1279  O  O     . ARG A 1 174  ? -38.661 -79.986  34.704  1.00 17.41  ? 175  ARG A O     1 
ATOM   1280  C  CB    . ARG A 1 174  ? -35.423 -79.950  35.228  1.00 17.98  ? 175  ARG A CB    1 
ATOM   1281  C  CG    . ARG A 1 174  ? -35.950 -81.063  36.162  1.00 18.52  ? 175  ARG A CG    1 
ATOM   1282  C  CD    . ARG A 1 174  ? -36.011 -82.415  35.442  1.00 16.21  ? 175  ARG A CD    1 
ATOM   1283  N  NE    . ARG A 1 174  ? -37.435 -82.625  35.014  1.00 16.47  ? 175  ARG A NE    1 
ATOM   1284  C  CZ    . ARG A 1 174  ? -37.767 -83.795  34.439  1.00 18.82  ? 175  ARG A CZ    1 
ATOM   1285  N  NH1   . ARG A 1 174  ? -39.035 -83.967  34.082  1.00 19.16  ? 175  ARG A NH1   1 
ATOM   1286  N  NH2   . ARG A 1 174  ? -36.844 -84.721  34.259  1.00 16.80  ? 175  ARG A NH2   1 
ATOM   1287  N  N     . THR A 1 175  ? -37.929 -77.837  34.471  1.00 16.00  ? 176  THR A N     1 
ATOM   1288  C  CA    . THR A 1 175  ? -39.291 -77.287  34.639  1.00 15.54  ? 176  THR A CA    1 
ATOM   1289  C  C     . THR A 1 175  ? -39.712 -76.566  33.352  1.00 16.20  ? 176  THR A C     1 
ATOM   1290  O  O     . THR A 1 175  ? -40.850 -76.680  32.845  1.00 17.38  ? 176  THR A O     1 
ATOM   1291  C  CB    . THR A 1 175  ? -39.427 -76.287  35.811  1.00 15.45  ? 176  THR A CB    1 
ATOM   1292  O  OG1   . THR A 1 175  ? -39.145 -77.002  37.050  1.00 17.48  ? 176  THR A OG1   1 
ATOM   1293  C  CG2   . THR A 1 175  ? -40.803 -75.604  35.874  1.00 14.17  ? 176  THR A CG2   1 
ATOM   1294  N  N     . SER A 1 176  ? -38.848 -75.732  32.739  1.00 14.47  ? 177  SER A N     1 
ATOM   1295  C  CA    . SER A 1 176  ? -39.239 -74.966  31.542  1.00 16.63  ? 177  SER A CA    1 
ATOM   1296  C  C     . SER A 1 176  ? -39.708 -75.832  30.372  1.00 14.90  ? 177  SER A C     1 
ATOM   1297  O  O     . SER A 1 176  ? -40.559 -75.355  29.610  1.00 15.90  ? 177  SER A O     1 
ATOM   1298  C  CB    . SER A 1 176  ? -38.067 -74.068  31.039  1.00 15.49  ? 177  SER A CB    1 
ATOM   1299  O  OG    . SER A 1 176  ? -37.043 -74.801  30.358  1.00 17.79  ? 177  SER A OG    1 
ATOM   1300  N  N     . HIS A 1 177  ? -39.153 -77.006  30.208  1.00 16.52  ? 178  HIS A N     1 
ATOM   1301  C  CA    . HIS A 1 177  ? -39.528 -77.848  29.053  1.00 16.84  ? 178  HIS A CA    1 
ATOM   1302  C  C     . HIS A 1 177  ? -40.275 -79.102  29.442  1.00 19.15  ? 178  HIS A C     1 
ATOM   1303  O  O     . HIS A 1 177  ? -40.532 -79.963  28.596  1.00 21.60  ? 178  HIS A O     1 
ATOM   1304  C  CB    . HIS A 1 177  ? -38.247 -78.268  28.310  1.00 18.93  ? 178  HIS A CB    1 
ATOM   1305  C  CG    . HIS A 1 177  ? -37.691 -77.145  27.487  1.00 19.20  ? 178  HIS A CG    1 
ATOM   1306  N  ND1   . HIS A 1 177  ? -37.525 -75.873  28.022  1.00 20.17  ? 178  HIS A ND1   1 
ATOM   1307  C  CD2   . HIS A 1 177  ? -37.359 -77.092  26.162  1.00 22.06  ? 178  HIS A CD2   1 
ATOM   1308  C  CE1   . HIS A 1 177  ? -37.046 -75.082  27.078  1.00 19.20  ? 178  HIS A CE1   1 
ATOM   1309  N  NE2   . HIS A 1 177  ? -36.947 -75.776  25.955  1.00 20.54  ? 178  HIS A NE2   1 
ATOM   1310  N  N     . GLU A 1 178  ? -40.569 -79.291  30.715  1.00 19.90  ? 179  GLU A N     1 
ATOM   1311  C  CA    . GLU A 1 178  ? -41.371 -80.453  31.115  1.00 17.27  ? 179  GLU A CA    1 
ATOM   1312  C  C     . GLU A 1 178  ? -42.826 -80.146  30.754  1.00 18.38  ? 179  GLU A C     1 
ATOM   1313  O  O     . GLU A 1 178  ? -43.240 -79.002  31.010  1.00 19.15  ? 179  GLU A O     1 
ATOM   1314  C  CB    . GLU A 1 178  ? -41.243 -80.655  32.634  1.00 18.50  ? 179  GLU A CB    1 
ATOM   1315  C  CG    . GLU A 1 178  ? -41.930 -81.900  33.202  1.00 21.38  ? 179  GLU A CG    1 
ATOM   1316  C  CD    . GLU A 1 178  ? -41.755 -82.070  34.703  1.00 25.60  ? 179  GLU A CD    1 
ATOM   1317  O  OE1   . GLU A 1 178  ? -42.794 -82.118  35.402  1.00 26.43  ? 179  GLU A OE1   1 
ATOM   1318  O  OE2   . GLU A 1 178  ? -40.631 -82.202  35.254  1.00 24.93  ? 179  GLU A OE2   1 
ATOM   1319  N  N     . ILE A 1 179  ? -43.547 -81.083  30.167  1.00 18.57  ? 180  ILE A N     1 
ATOM   1320  C  CA    . ILE A 1 179  ? -44.952 -80.775  29.933  1.00 19.28  ? 180  ILE A CA    1 
ATOM   1321  C  C     . ILE A 1 179  ? -45.751 -81.513  31.003  1.00 17.51  ? 180  ILE A C     1 
ATOM   1322  O  O     . ILE A 1 179  ? -45.357 -82.576  31.523  1.00 18.35  ? 180  ILE A O     1 
ATOM   1323  C  CB    . ILE A 1 179  ? -45.387 -80.815  28.468  1.00 22.28  ? 180  ILE A CB    1 
ATOM   1324  C  CG1   . ILE A 1 179  ? -46.660 -81.689  28.301  1.00 22.65  ? 180  ILE A CG1   1 
ATOM   1325  C  CG2   . ILE A 1 179  ? -44.467 -81.026  27.296  1.00 21.81  ? 180  ILE A CG2   1 
ATOM   1326  C  CD1   . ILE A 1 179  ? -47.813 -80.759  28.578  1.00 23.96  ? 180  ILE A CD1   1 
ATOM   1327  N  N     . GLN A 1 180  ? -46.765 -80.872  31.555  1.00 20.11  ? 181  GLN A N     1 
ATOM   1328  C  CA    . GLN A 1 180  ? -47.642 -81.337  32.590  1.00 20.84  ? 181  GLN A CA    1 
ATOM   1329  C  C     . GLN A 1 180  ? -49.079 -80.871  32.332  1.00 19.76  ? 181  GLN A C     1 
ATOM   1330  O  O     . GLN A 1 180  ? -49.335 -79.797  31.797  1.00 20.63  ? 181  GLN A O     1 
ATOM   1331  C  CB    . GLN A 1 180  ? -47.405 -80.777  34.027  1.00 20.76  ? 181  GLN A CB    1 
ATOM   1332  C  CG    . GLN A 1 180  ? -46.176 -81.458  34.669  1.00 24.81  ? 181  GLN A CG    1 
ATOM   1333  C  CD    . GLN A 1 180  ? -46.473 -82.654  35.540  1.00 24.81  ? 181  GLN A CD    1 
ATOM   1334  O  OE1   . GLN A 1 180  ? -45.545 -83.311  36.058  1.00 27.41  ? 181  GLN A OE1   1 
ATOM   1335  N  NE2   . GLN A 1 180  ? -47.729 -82.967  35.837  1.00 24.41  ? 181  GLN A NE2   1 
ATOM   1336  N  N     . LYS A 1 181  ? -50.012 -81.694  32.839  1.00 21.33  ? 182  LYS A N     1 
ATOM   1337  C  CA    . LYS A 1 181  ? -51.417 -81.248  32.807  1.00 20.48  ? 182  LYS A CA    1 
ATOM   1338  C  C     . LYS A 1 181  ? -51.614 -80.375  34.021  1.00 19.83  ? 182  LYS A C     1 
ATOM   1339  O  O     . LYS A 1 181  ? -51.456 -80.820  35.180  1.00 20.82  ? 182  LYS A O     1 
ATOM   1340  C  CB    . LYS A 1 181  ? -52.377 -82.450  32.774  1.00 23.33  ? 182  LYS A CB    1 
ATOM   1341  C  CG    . LYS A 1 181  ? -53.838 -81.964  32.858  1.00 27.02  ? 182  LYS A CG    1 
ATOM   1342  C  CD    . LYS A 1 181  ? -54.727 -83.034  33.488  1.00 32.78  ? 182  LYS A CD    1 
ATOM   1343  C  CE    . LYS A 1 181  ? -55.529 -83.759  32.426  1.00 32.24  ? 182  LYS A CE    1 
ATOM   1344  N  NZ    . LYS A 1 181  ? -56.539 -84.655  33.096  1.00 32.46  ? 182  LYS A NZ    1 
ATOM   1345  N  N     . ILE A 1 182  ? -51.940 -79.074  33.849  1.00 19.91  ? 183  ILE A N     1 
ATOM   1346  C  CA    . ILE A 1 182  ? -52.073 -78.178  34.980  1.00 19.74  ? 183  ILE A CA    1 
ATOM   1347  C  C     . ILE A 1 182  ? -53.347 -77.329  34.871  1.00 22.07  ? 183  ILE A C     1 
ATOM   1348  O  O     . ILE A 1 182  ? -53.979 -77.366  33.796  1.00 22.11  ? 183  ILE A O     1 
ATOM   1349  C  CB    . ILE A 1 182  ? -50.903 -77.134  35.026  1.00 22.59  ? 183  ILE A CB    1 
ATOM   1350  C  CG1   . ILE A 1 182  ? -50.890 -76.186  33.804  1.00 22.13  ? 183  ILE A CG1   1 
ATOM   1351  C  CG2   . ILE A 1 182  ? -49.579 -77.893  35.067  1.00 21.25  ? 183  ILE A CG2   1 
ATOM   1352  C  CD1   . ILE A 1 182  ? -50.092 -74.887  33.979  1.00 20.16  ? 183  ILE A CD1   1 
ATOM   1353  N  N     . GLU A 1 183  ? -53.575 -76.494  35.888  1.00 19.50  ? 184  GLU A N     1 
ATOM   1354  C  CA    . GLU A 1 183  ? -54.698 -75.537  35.741  1.00 21.83  ? 184  GLU A CA    1 
ATOM   1355  C  C     . GLU A 1 183  ? -54.194 -74.120  35.642  1.00 24.36  ? 184  GLU A C     1 
ATOM   1356  O  O     . GLU A 1 183  ? -53.323 -73.751  36.447  1.00 23.30  ? 184  GLU A O     1 
ATOM   1357  C  CB    . GLU A 1 183  ? -55.610 -75.649  36.982  1.00 21.04  ? 184  GLU A CB    1 
ATOM   1358  C  CG    . GLU A 1 183  ? -56.762 -74.802  37.289  0.00 12.80  ? 184  GLU A CG    1 
ATOM   1359  C  CD    . GLU A 1 183  ? -56.612 -73.816  38.436  0.00 12.63  ? 184  GLU A CD    1 
ATOM   1360  O  OE1   . GLU A 1 183  ? -57.083 -74.116  39.556  0.00 12.54  ? 184  GLU A OE1   1 
ATOM   1361  O  OE2   . GLU A 1 183  ? -56.018 -72.740  38.217  0.00 12.69  ? 184  GLU A OE2   1 
ATOM   1362  N  N     . VAL A 1 184  ? -54.798 -73.271  34.806  1.00 23.58  ? 185  VAL A N     1 
ATOM   1363  C  CA    . VAL A 1 184  ? -54.415 -71.882  34.626  1.00 24.07  ? 185  VAL A CA    1 
ATOM   1364  C  C     . VAL A 1 184  ? -55.622 -70.983  34.887  1.00 25.83  ? 185  VAL A C     1 
ATOM   1365  O  O     . VAL A 1 184  ? -56.753 -71.473  34.785  1.00 26.61  ? 185  VAL A O     1 
ATOM   1366  C  CB    . VAL A 1 184  ? -53.848 -71.592  33.222  1.00 22.75  ? 185  VAL A CB    1 
ATOM   1367  C  CG1   . VAL A 1 184  ? -52.634 -72.486  32.995  1.00 19.92  ? 185  VAL A CG1   1 
ATOM   1368  C  CG2   . VAL A 1 184  ? -54.846 -71.824  32.073  1.00 22.11  ? 185  VAL A CG2   1 
ATOM   1369  N  N     . LEU A 1 185  ? -55.425 -69.756  35.310  1.00 22.61  ? 186  LEU A N     1 
ATOM   1370  C  CA    . LEU A 1 185  ? -56.528 -68.839  35.501  1.00 22.62  ? 186  LEU A CA    1 
ATOM   1371  C  C     . LEU A 1 185  ? -56.814 -68.019  34.254  1.00 23.68  ? 186  LEU A C     1 
ATOM   1372  O  O     . LEU A 1 185  ? -55.922 -67.774  33.427  1.00 21.21  ? 186  LEU A O     1 
ATOM   1373  C  CB    . LEU A 1 185  ? -56.123 -67.824  36.598  1.00 21.44  ? 186  LEU A CB    1 
ATOM   1374  C  CG    . LEU A 1 185  ? -56.183 -68.463  37.987  1.00 22.40  ? 186  LEU A CG    1 
ATOM   1375  C  CD1   . LEU A 1 185  ? -55.441 -67.542  38.959  1.00 22.66  ? 186  LEU A CD1   1 
ATOM   1376  C  CD2   . LEU A 1 185  ? -57.635 -68.633  38.466  1.00 24.17  ? 186  LEU A CD2   1 
ATOM   1377  N  N     . ASP A 1 186  ? -58.059 -67.562  34.097  1.00 21.69  ? 187  ASP A N     1 
ATOM   1378  C  CA    . ASP A 1 186  ? -58.435 -66.642  33.046  1.00 23.17  ? 187  ASP A CA    1 
ATOM   1379  C  C     . ASP A 1 186  ? -57.763 -65.287  33.340  1.00 21.22  ? 187  ASP A C     1 
ATOM   1380  O  O     . ASP A 1 186  ? -57.562 -64.977  34.518  1.00 17.99  ? 187  ASP A O     1 
ATOM   1381  C  CB    . ASP A 1 186  ? -59.913 -66.243  33.077  1.00 30.39  ? 187  ASP A CB    1 
ATOM   1382  C  CG    . ASP A 1 186  ? -60.856 -67.337  32.668  1.00 35.72  ? 187  ASP A CG    1 
ATOM   1383  O  OD1   . ASP A 1 186  ? -60.468 -68.306  31.967  1.00 39.01  ? 187  ASP A OD1   1 
ATOM   1384  O  OD2   . ASP A 1 186  ? -62.011 -67.153  33.120  1.00 37.60  ? 187  ASP A OD2   1 
ATOM   1385  N  N     . TYR A 1 187  ? -57.639 -64.477  32.318  1.00 18.72  ? 188  TYR A N     1 
ATOM   1386  C  CA    . TYR A 1 187  ? -57.070 -63.133  32.500  1.00 20.10  ? 188  TYR A CA    1 
ATOM   1387  C  C     . TYR A 1 187  ? -57.936 -62.213  33.357  1.00 19.08  ? 188  TYR A C     1 
ATOM   1388  O  O     . TYR A 1 187  ? -57.446 -61.333  34.041  1.00 19.10  ? 188  TYR A O     1 
ATOM   1389  C  CB    . TYR A 1 187  ? -56.778 -62.480  31.139  1.00 16.62  ? 188  TYR A CB    1 
ATOM   1390  C  CG    . TYR A 1 187  ? -55.545 -63.021  30.446  1.00 17.05  ? 188  TYR A CG    1 
ATOM   1391  C  CD1   . TYR A 1 187  ? -54.907 -64.182  30.885  1.00 16.37  ? 188  TYR A CD1   1 
ATOM   1392  C  CD2   . TYR A 1 187  ? -55.086 -62.409  29.272  1.00 15.66  ? 188  TYR A CD2   1 
ATOM   1393  C  CE1   . TYR A 1 187  ? -53.798 -64.704  30.246  1.00 16.92  ? 188  TYR A CE1   1 
ATOM   1394  C  CE2   . TYR A 1 187  ? -53.970 -62.939  28.637  1.00 15.00  ? 188  TYR A CE2   1 
ATOM   1395  C  CZ    . TYR A 1 187  ? -53.336 -64.048  29.116  1.00 16.64  ? 188  TYR A CZ    1 
ATOM   1396  O  OH    . TYR A 1 187  ? -52.222 -64.579  28.498  1.00 15.91  ? 188  TYR A OH    1 
ATOM   1397  N  N     . ALA A 1 188  ? -59.256 -62.381  33.293  1.00 17.89  ? 189  ALA A N     1 
ATOM   1398  C  CA    . ALA A 1 188  ? -60.158 -61.572  34.116  1.00 19.43  ? 189  ALA A CA    1 
ATOM   1399  C  C     . ALA A 1 188  ? -59.951 -61.755  35.621  1.00 19.05  ? 189  ALA A C     1 
ATOM   1400  O  O     . ALA A 1 188  ? -59.899 -60.788  36.404  1.00 19.14  ? 189  ALA A O     1 
ATOM   1401  C  CB    . ALA A 1 188  ? -61.624 -61.918  33.741  1.00 20.15  ? 189  ALA A CB    1 
ATOM   1402  N  N     . ASP A 1 189  ? -59.635 -62.999  36.009  1.00 19.12  ? 190  ASP A N     1 
ATOM   1403  C  CA    . ASP A 1 189  ? -59.342 -63.390  37.387  1.00 20.14  ? 190  ASP A CA    1 
ATOM   1404  C  C     . ASP A 1 189  ? -58.049 -62.748  37.882  1.00 21.54  ? 190  ASP A C     1 
ATOM   1405  O  O     . ASP A 1 189  ? -57.873 -62.160  38.971  1.00 22.16  ? 190  ASP A O     1 
ATOM   1406  C  CB    . ASP A 1 189  ? -59.213 -64.923  37.388  1.00 25.19  ? 190  ASP A CB    1 
ATOM   1407  C  CG    . ASP A 1 189  ? -60.568 -65.586  37.619  1.00 31.51  ? 190  ASP A CG    1 
ATOM   1408  O  OD1   . ASP A 1 189  ? -61.614 -65.074  37.179  1.00 34.10  ? 190  ASP A OD1   1 
ATOM   1409  O  OD2   . ASP A 1 189  ? -60.585 -66.617  38.294  1.00 34.73  ? 190  ASP A OD2   1 
ATOM   1410  N  N     . MET A 1 190  ? -57.058 -62.786  36.987  1.00 19.41  ? 191  MET A N     1 
ATOM   1411  C  CA    . MET A 1 190  ? -55.775 -62.135  37.291  1.00 19.56  ? 191  MET A CA    1 
ATOM   1412  C  C     . MET A 1 190  ? -55.961 -60.644  37.456  1.00 17.01  ? 191  MET A C     1 
ATOM   1413  O  O     . MET A 1 190  ? -55.524 -60.073  38.446  1.00 19.75  ? 191  MET A O     1 
ATOM   1414  C  CB    . MET A 1 190  ? -54.808 -62.379  36.119  1.00 20.56  ? 191  MET A CB    1 
ATOM   1415  C  CG    . MET A 1 190  ? -54.383 -63.844  36.047  1.00 18.36  ? 191  MET A CG    1 
ATOM   1416  S  SD    . MET A 1 190  ? -53.215 -63.906  34.645  1.00 19.45  ? 191  MET A SD    1 
ATOM   1417  C  CE    . MET A 1 190  ? -53.349 -65.599  34.093  1.00 20.64  ? 191  MET A CE    1 
ATOM   1418  N  N     . ALA A 1 191  ? -56.755 -60.050  36.565  1.00 18.48  ? 192  ALA A N     1 
ATOM   1419  C  CA    . ALA A 1 191  ? -56.991 -58.596  36.627  1.00 16.69  ? 192  ALA A CA    1 
ATOM   1420  C  C     . ALA A 1 191  ? -57.606 -58.207  37.956  1.00 17.91  ? 192  ALA A C     1 
ATOM   1421  O  O     . ALA A 1 191  ? -57.413 -57.088  38.475  1.00 18.62  ? 192  ALA A O     1 
ATOM   1422  C  CB    . ALA A 1 191  ? -57.939 -58.250  35.494  1.00 15.43  ? 192  ALA A CB    1 
ATOM   1423  N  N     . SER A 1 192  ? -58.557 -59.012  38.445  1.00 19.31  ? 193  SER A N     1 
ATOM   1424  C  CA    . SER A 1 192  ? -59.315 -58.699  39.648  1.00 20.26  ? 193  SER A CA    1 
ATOM   1425  C  C     . SER A 1 192  ? -58.447 -58.584  40.895  1.00 21.55  ? 193  SER A C     1 
ATOM   1426  O  O     . SER A 1 192  ? -58.888 -57.930  41.833  1.00 20.44  ? 193  SER A O     1 
ATOM   1427  C  CB    . SER A 1 192  ? -60.446 -59.706  39.945  1.00 20.71  ? 193  SER A CB    1 
ATOM   1428  O  OG    . SER A 1 192  ? -59.867 -60.905  40.512  1.00 20.27  ? 193  SER A OG    1 
ATOM   1429  N  N     . LEU A 1 193  ? -57.275 -59.197  40.925  1.00 20.16  ? 194  LEU A N     1 
ATOM   1430  C  CA    . LEU A 1 193  ? -56.366 -59.138  42.088  1.00 21.05  ? 194  LEU A CA    1 
ATOM   1431  C  C     . LEU A 1 193  ? -55.425 -57.942  42.086  1.00 20.01  ? 194  LEU A C     1 
ATOM   1432  O  O     . LEU A 1 193  ? -54.751 -57.632  43.093  1.00 15.88  ? 194  LEU A O     1 
ATOM   1433  C  CB    . LEU A 1 193  ? -55.505 -60.416  42.057  1.00 22.34  ? 194  LEU A CB    1 
ATOM   1434  C  CG    . LEU A 1 193  ? -55.908 -61.709  42.753  1.00 25.82  ? 194  LEU A CG    1 
ATOM   1435  C  CD1   . LEU A 1 193  ? -57.305 -61.709  43.307  1.00 23.96  ? 194  LEU A CD1   1 
ATOM   1436  C  CD2   . LEU A 1 193  ? -55.612 -62.947  41.907  1.00 26.02  ? 194  LEU A CD2   1 
ATOM   1437  N  N     . VAL A 1 194  ? -55.290 -57.237  40.971  1.00 18.73  ? 195  VAL A N     1 
ATOM   1438  C  CA    . VAL A 1 194  ? -54.390 -56.072  40.853  1.00 19.26  ? 195  VAL A CA    1 
ATOM   1439  C  C     . VAL A 1 194  ? -54.816 -54.954  41.803  1.00 19.87  ? 195  VAL A C     1 
ATOM   1440  O  O     . VAL A 1 194  ? -55.999 -54.662  41.956  1.00 18.52  ? 195  VAL A O     1 
ATOM   1441  C  CB    . VAL A 1 194  ? -54.386 -55.555  39.390  1.00 20.00  ? 195  VAL A CB    1 
ATOM   1442  C  CG1   . VAL A 1 194  ? -53.804 -54.148  39.269  1.00 17.44  ? 195  VAL A CG1   1 
ATOM   1443  C  CG2   . VAL A 1 194  ? -53.613 -56.527  38.498  1.00 19.06  ? 195  VAL A CG2   1 
ATOM   1444  N  N     . ASN A 1 195  ? -53.848 -54.327  42.489  1.00 18.42  ? 196  ASN A N     1 
ATOM   1445  C  CA    . ASN A 1 195  ? -54.090 -53.262  43.436  1.00 19.88  ? 196  ASN A CA    1 
ATOM   1446  C  C     . ASN A 1 195  ? -54.204 -52.019  42.577  1.00 21.39  ? 196  ASN A C     1 
ATOM   1447  O  O     . ASN A 1 195  ? -53.178 -51.483  42.162  1.00 19.99  ? 196  ASN A O     1 
ATOM   1448  C  CB    . ASN A 1 195  ? -52.979 -53.175  44.469  1.00 17.30  ? 196  ASN A CB    1 
ATOM   1449  C  CG    . ASN A 1 195  ? -53.109 -52.083  45.514  1.00 20.34  ? 196  ASN A CG    1 
ATOM   1450  O  OD1   . ASN A 1 195  ? -53.543 -50.978  45.183  1.00 22.05  ? 196  ASN A OD1   1 
ATOM   1451  N  ND2   . ASN A 1 195  ? -52.665 -52.433  46.716  1.00 19.50  ? 196  ASN A ND2   1 
ATOM   1452  N  N     . GLN A 1 196  ? -55.445 -51.601  42.304  1.00 21.37  ? 197  GLN A N     1 
ATOM   1453  C  CA    . GLN A 1 196  ? -55.637 -50.444  41.437  1.00 20.65  ? 197  GLN A CA    1 
ATOM   1454  C  C     . GLN A 1 196  ? -55.047 -49.156  41.970  1.00 20.72  ? 197  GLN A C     1 
ATOM   1455  O  O     . GLN A 1 196  ? -54.522 -48.291  41.233  1.00 17.47  ? 197  GLN A O     1 
ATOM   1456  C  CB    . GLN A 1 196  ? -57.137 -50.330  41.048  1.00 22.13  ? 197  GLN A CB    1 
ATOM   1457  C  CG    . GLN A 1 196  ? -57.556 -51.612  40.325  1.00 24.20  ? 197  GLN A CG    1 
ATOM   1458  C  CD    . GLN A 1 196  ? -57.137 -51.621  38.870  1.00 27.92  ? 197  GLN A CD    1 
ATOM   1459  O  OE1   . GLN A 1 196  ? -56.820 -50.582  38.241  1.00 29.99  ? 197  GLN A OE1   1 
ATOM   1460  N  NE2   . GLN A 1 196  ? -57.148 -52.827  38.261  1.00 25.95  ? 197  GLN A NE2   1 
ATOM   1461  N  N     . LYS A 1 197  ? -55.027 -48.957  43.268  1.00 21.20  ? 198  LYS A N     1 
ATOM   1462  C  CA    . LYS A 1 197  ? -54.403 -47.720  43.805  1.00 23.04  ? 198  LYS A CA    1 
ATOM   1463  C  C     . LYS A 1 197  ? -52.892 -47.722  43.531  1.00 20.10  ? 198  LYS A C     1 
ATOM   1464  O  O     . LYS A 1 197  ? -52.347 -46.681  43.095  1.00 17.93  ? 198  LYS A O     1 
ATOM   1465  C  CB    . LYS A 1 197  ? -54.589 -47.592  45.317  1.00 26.52  ? 198  LYS A CB    1 
ATOM   1466  C  CG    . LYS A 1 197  ? -55.831 -48.319  45.774  1.00 33.64  ? 198  LYS A CG    1 
ATOM   1467  C  CD    . LYS A 1 197  ? -55.665 -49.571  46.637  1.00 35.66  ? 198  LYS A CD    1 
ATOM   1468  C  CE    . LYS A 1 197  ? -56.522 -50.712  46.043  1.00 34.86  ? 198  LYS A CE    1 
ATOM   1469  N  NZ    . LYS A 1 197  ? -57.123 -50.316  44.747  1.00 30.06  ? 198  LYS A NZ    1 
ATOM   1470  N  N     . ALA A 1 198  ? -52.263 -48.864  43.781  1.00 16.85  ? 199  ALA A N     1 
ATOM   1471  C  CA    . ALA A 1 198  ? -50.799 -48.935  43.534  1.00 19.07  ? 199  ALA A CA    1 
ATOM   1472  C  C     . ALA A 1 198  ? -50.491 -48.763  42.044  1.00 18.24  ? 199  ALA A C     1 
ATOM   1473  O  O     . ALA A 1 198  ? -49.600 -47.956  41.679  1.00 18.92  ? 199  ALA A O     1 
ATOM   1474  C  CB    . ALA A 1 198  ? -50.249 -50.237  44.101  1.00 19.24  ? 199  ALA A CB    1 
ATOM   1475  N  N     . LEU A 1 199  ? -51.339 -49.255  41.152  1.00 15.00  ? 200  LEU A N     1 
ATOM   1476  C  CA    . LEU A 1 199  ? -51.083 -49.072  39.719  1.00 18.44  ? 200  LEU A CA    1 
ATOM   1477  C  C     . LEU A 1 199  ? -51.191 -47.610  39.331  1.00 16.75  ? 200  LEU A C     1 
ATOM   1478  O  O     . LEU A 1 199  ? -50.370 -47.070  38.631  1.00 15.00  ? 200  LEU A O     1 
ATOM   1479  C  CB    . LEU A 1 199  ? -52.074 -49.917  38.931  1.00 19.76  ? 200  LEU A CB    1 
ATOM   1480  C  CG    . LEU A 1 199  ? -51.952 -49.962  37.418  1.00 21.32  ? 200  LEU A CG    1 
ATOM   1481  C  CD1   . LEU A 1 199  ? -50.541 -50.339  36.984  1.00 18.60  ? 200  LEU A CD1   1 
ATOM   1482  C  CD2   . LEU A 1 199  ? -53.001 -50.932  36.857  1.00 22.06  ? 200  LEU A CD2   1 
ATOM   1483  N  N     . ALA A 1 200  ? -52.238 -46.919  39.834  1.00 19.72  ? 201  ALA A N     1 
ATOM   1484  C  CA    . ALA A 1 200  ? -52.407 -45.497  39.607  1.00 19.42  ? 201  ALA A CA    1 
ATOM   1485  C  C     . ALA A 1 200  ? -51.222 -44.694  40.125  1.00 18.94  ? 201  ALA A C     1 
ATOM   1486  O  O     . ALA A 1 200  ? -50.798 -43.714  39.498  1.00 15.86  ? 201  ALA A O     1 
ATOM   1487  C  CB    . ALA A 1 200  ? -53.697 -44.979  40.268  1.00 20.58  ? 201  ALA A CB    1 
ATOM   1488  N  N     . GLU A 1 201  ? -50.734 -45.031  41.319  1.00 17.19  ? 202  GLU A N     1 
ATOM   1489  C  CA    . GLU A 1 201  ? -49.572 -44.321  41.859  1.00 17.41  ? 202  GLU A CA    1 
ATOM   1490  C  C     . GLU A 1 201  ? -48.311 -44.634  41.033  1.00 14.99  ? 202  GLU A C     1 
ATOM   1491  O  O     . GLU A 1 201  ? -47.481 -43.729  40.833  1.00 16.00  ? 202  GLU A O     1 
ATOM   1492  C  CB    . GLU A 1 201  ? -49.264 -44.612  43.336  1.00 23.11  ? 202  GLU A CB    1 
ATOM   1493  C  CG    . GLU A 1 201  ? -50.382 -44.062  44.231  1.00 25.64  ? 202  GLU A CG    1 
ATOM   1494  C  CD    . GLU A 1 201  ? -50.408 -44.630  45.618  1.00 29.92  ? 202  GLU A CD    1 
ATOM   1495  O  OE1   . GLU A 1 201  ? -51.254 -44.200  46.451  1.00 30.06  ? 202  GLU A OE1   1 
ATOM   1496  O  OE2   . GLU A 1 201  ? -49.621 -45.552  45.945  1.00 32.91  ? 202  GLU A OE2   1 
ATOM   1497  N  N     . PHE A 1 202  ? -48.236 -45.824  40.470  1.00 15.93  ? 203  PHE A N     1 
ATOM   1498  C  CA    . PHE A 1 202  ? -47.118 -46.129  39.572  1.00 16.71  ? 203  PHE A CA    1 
ATOM   1499  C  C     . PHE A 1 202  ? -47.166 -45.199  38.364  1.00 16.92  ? 203  PHE A C     1 
ATOM   1500  O  O     . PHE A 1 202  ? -46.116 -44.662  37.993  1.00 17.34  ? 203  PHE A O     1 
ATOM   1501  C  CB    . PHE A 1 202  ? -47.131 -47.588  39.142  1.00 18.10  ? 203  PHE A CB    1 
ATOM   1502  C  CG    . PHE A 1 202  ? -46.259 -47.896  37.945  1.00 18.12  ? 203  PHE A CG    1 
ATOM   1503  C  CD1   . PHE A 1 202  ? -44.884 -47.748  38.047  1.00 17.78  ? 203  PHE A CD1   1 
ATOM   1504  C  CD2   . PHE A 1 202  ? -46.817 -48.403  36.782  1.00 18.29  ? 203  PHE A CD2   1 
ATOM   1505  C  CE1   . PHE A 1 202  ? -44.063 -48.038  36.966  1.00 16.95  ? 203  PHE A CE1   1 
ATOM   1506  C  CE2   . PHE A 1 202  ? -46.008 -48.727  35.724  1.00 18.75  ? 203  PHE A CE2   1 
ATOM   1507  C  CZ    . PHE A 1 202  ? -44.645 -48.538  35.788  1.00 19.15  ? 203  PHE A CZ    1 
ATOM   1508  N  N     . ARG A 1 203  ? -48.333 -45.044  37.728  1.00 16.83  ? 204  ARG A N     1 
ATOM   1509  C  CA    . ARG A 1 203  ? -48.421 -44.147  36.588  1.00 18.82  ? 204  ARG A CA    1 
ATOM   1510  C  C     . ARG A 1 203  ? -48.094 -42.707  36.961  1.00 16.17  ? 204  ARG A C     1 
ATOM   1511  O  O     . ARG A 1 203  ? -47.452 -41.942  36.230  1.00 14.25  ? 204  ARG A O     1 
ATOM   1512  C  CB    . ARG A 1 203  ? -49.856 -44.222  35.958  1.00 20.59  ? 204  ARG A CB    1 
ATOM   1513  C  CG    . ARG A 1 203  ? -49.804 -45.426  34.976  1.00 21.67  ? 204  ARG A CG    1 
ATOM   1514  C  CD    . ARG A 1 203  ? -50.974 -46.321  35.076  1.00 23.86  ? 204  ARG A CD    1 
ATOM   1515  N  NE    . ARG A 1 203  ? -50.885 -47.466  34.285  1.00 19.92  ? 204  ARG A NE    1 
ATOM   1516  C  CZ    . ARG A 1 203  ? -50.536 -48.377  33.446  1.00 19.98  ? 204  ARG A CZ    1 
ATOM   1517  N  NH1   . ARG A 1 203  ? -51.436 -49.393  33.374  1.00 15.87  ? 204  ARG A NH1   1 
ATOM   1518  N  NH2   . ARG A 1 203  ? -49.368 -48.315  32.782  1.00 15.13  ? 204  ARG A NH2   1 
ATOM   1519  N  N     . ALA A 1 204  ? -48.639 -42.252  38.084  1.00 13.81  ? 205  ALA A N     1 
ATOM   1520  C  CA    . ALA A 1 204  ? -48.419 -40.855  38.473  1.00 16.18  ? 205  ALA A CA    1 
ATOM   1521  C  C     . ALA A 1 204  ? -47.002 -40.488  38.860  1.00 15.46  ? 205  ALA A C     1 
ATOM   1522  O  O     . ALA A 1 204  ? -46.630 -39.282  38.726  1.00 17.39  ? 205  ALA A O     1 
ATOM   1523  C  CB    . ALA A 1 204  ? -49.506 -40.537  39.499  1.00 17.24  ? 205  ALA A CB    1 
ATOM   1524  N  N     . LYS A 1 205  ? -46.221 -41.467  39.334  1.00 15.51  ? 206  LYS A N     1 
ATOM   1525  C  CA    . LYS A 1 205  ? -44.813 -41.131  39.660  1.00 15.26  ? 206  LYS A CA    1 
ATOM   1526  C  C     . LYS A 1 205  ? -43.903 -41.254  38.428  1.00 13.78  ? 206  LYS A C     1 
ATOM   1527  O  O     . LYS A 1 205  ? -42.725 -40.869  38.522  1.00 16.68  ? 206  LYS A O     1 
ATOM   1528  C  CB    . LYS A 1 205  ? -44.237 -42.055  40.742  1.00 16.02  ? 206  LYS A CB    1 
ATOM   1529  C  CG    . LYS A 1 205  ? -44.007 -43.502  40.334  1.00 16.35  ? 206  LYS A CG    1 
ATOM   1530  C  CD    . LYS A 1 205  ? -43.441 -44.316  41.490  1.00 19.16  ? 206  LYS A CD    1 
ATOM   1531  C  CE    . LYS A 1 205  ? -43.100 -45.738  41.088  1.00 17.56  ? 206  LYS A CE    1 
ATOM   1532  N  NZ    . LYS A 1 205  ? -42.176 -46.258  42.176  1.00 20.73  ? 206  LYS A NZ    1 
ATOM   1533  N  N     . SER A 1 206  ? -44.417 -41.732  37.311  1.00 14.77  ? 207  SER A N     1 
ATOM   1534  C  CA    . SER A 1 206  ? -43.512 -41.958  36.161  1.00 13.62  ? 207  SER A CA    1 
ATOM   1535  C  C     . SER A 1 206  ? -43.039 -40.704  35.492  1.00 14.67  ? 207  SER A C     1 
ATOM   1536  O  O     . SER A 1 206  ? -43.628 -39.631  35.635  1.00 14.01  ? 207  SER A O     1 
ATOM   1537  C  CB    . SER A 1 206  ? -44.263 -42.860  35.148  1.00 13.76  ? 207  SER A CB    1 
ATOM   1538  O  OG    . SER A 1 206  ? -44.349 -44.070  35.933  1.00 17.24  ? 207  SER A OG    1 
ATOM   1539  N  N     . MET A 1 207  ? -41.990 -40.875  34.693  1.00 14.52  ? 208  MET A N     1 
ATOM   1540  C  CA    . MET A 1 207  ? -41.438 -39.808  33.895  1.00 13.05  ? 208  MET A CA    1 
ATOM   1541  C  C     . MET A 1 207  ? -42.550 -39.223  32.996  1.00 13.05  ? 208  MET A C     1 
ATOM   1542  O  O     . MET A 1 207  ? -43.220 -39.975  32.261  1.00 13.16  ? 208  MET A O     1 
ATOM   1543  C  CB    . MET A 1 207  ? -40.336 -40.346  32.935  1.00 13.76  ? 208  MET A CB    1 
ATOM   1544  C  CG    . MET A 1 207  ? -39.041 -40.712  33.725  1.00 14.65  ? 208  MET A CG    1 
ATOM   1545  S  SD    . MET A 1 207  ? -37.777 -41.301  32.529  1.00 16.41  ? 208  MET A SD    1 
ATOM   1546  C  CE    . MET A 1 207  ? -37.129 -39.646  32.163  1.00 15.56  ? 208  MET A CE    1 
ATOM   1547  N  N     . ASN A 1 208  ? -42.607 -37.915  32.964  1.00 13.52  ? 209  ASN A N     1 
ATOM   1548  C  CA    . ASN A 1 208  ? -43.564 -37.213  32.044  1.00 16.55  ? 209  ASN A CA    1 
ATOM   1549  C  C     . ASN A 1 208  ? -43.246 -35.719  32.090  1.00 14.95  ? 209  ASN A C     1 
ATOM   1550  O  O     . ASN A 1 208  ? -43.113 -35.117  33.187  1.00 15.33  ? 209  ASN A O     1 
ATOM   1551  C  CB    . ASN A 1 208  ? -45.029 -37.404  32.523  1.00 17.15  ? 209  ASN A CB    1 
ATOM   1552  C  CG    . ASN A 1 208  ? -46.013 -37.005  31.425  1.00 16.73  ? 209  ASN A CG    1 
ATOM   1553  O  OD1   . ASN A 1 208  ? -46.149 -35.823  31.082  1.00 16.19  ? 209  ASN A OD1   1 
ATOM   1554  N  ND2   . ASN A 1 208  ? -46.674 -37.978  30.845  1.00 15.14  ? 209  ASN A ND2   1 
ATOM   1555  N  N     . PRO A 1 209  ? -43.123 -35.062  30.935  1.00 14.84  ? 210  PRO A N     1 
ATOM   1556  C  CA    . PRO A 1 209  ? -42.740 -33.665  30.868  1.00 14.07  ? 210  PRO A CA    1 
ATOM   1557  C  C     . PRO A 1 209  ? -43.824 -32.750  31.408  1.00 15.83  ? 210  PRO A C     1 
ATOM   1558  O  O     . PRO A 1 209  ? -43.525 -31.616  31.775  1.00 15.79  ? 210  PRO A O     1 
ATOM   1559  C  CB    . PRO A 1 209  ? -42.384 -33.430  29.386  1.00 16.27  ? 210  PRO A CB    1 
ATOM   1560  C  CG    . PRO A 1 209  ? -43.188 -34.436  28.649  1.00 16.79  ? 210  PRO A CG    1 
ATOM   1561  C  CD    . PRO A 1 209  ? -43.220 -35.671  29.580  1.00 15.61  ? 210  PRO A CD    1 
ATOM   1562  N  N     . GLU A 1 210  ? -45.051 -33.289  31.604  1.00 16.14  ? 211  GLU A N     1 
ATOM   1563  C  CA    . GLU A 1 210  ? -46.048 -32.352  32.171  1.00 17.18  ? 211  GLU A CA    1 
ATOM   1564  C  C     . GLU A 1 210  ? -45.885 -32.312  33.681  1.00 21.03  ? 211  GLU A C     1 
ATOM   1565  O  O     . GLU A 1 210  ? -46.452 -31.427  34.319  1.00 20.74  ? 211  GLU A O     1 
ATOM   1566  C  CB    . GLU A 1 210  ? -47.459 -32.730  31.691  1.00 18.95  ? 211  GLU A CB    1 
ATOM   1567  C  CG    . GLU A 1 210  ? -47.641 -32.146  30.291  1.00 23.36  ? 211  GLU A CG    1 
ATOM   1568  C  CD    . GLU A 1 210  ? -48.940 -32.334  29.600  1.00 26.08  ? 211  GLU A CD    1 
ATOM   1569  O  OE1   . GLU A 1 210  ? -49.939 -32.704  30.327  1.00 29.59  ? 211  GLU A OE1   1 
ATOM   1570  O  OE2   . GLU A 1 210  ? -48.943 -32.149  28.364  1.00 25.61  ? 211  GLU A OE2   1 
ATOM   1571  N  N     . HIS A 1 211  ? -45.133 -33.234  34.315  1.00 18.22  ? 212  HIS A N     1 
ATOM   1572  C  CA    . HIS A 1 211  ? -44.912 -33.139  35.775  1.00 17.68  ? 212  HIS A CA    1 
ATOM   1573  C  C     . HIS A 1 211  ? -43.570 -33.845  36.038  1.00 16.46  ? 212  HIS A C     1 
ATOM   1574  O  O     . HIS A 1 211  ? -43.465 -34.936  36.620  1.00 15.17  ? 212  HIS A O     1 
ATOM   1575  C  CB    . HIS A 1 211  ? -46.045 -33.852  36.541  1.00 15.64  ? 212  HIS A CB    1 
ATOM   1576  C  CG    . HIS A 1 211  ? -46.452 -35.219  36.045  1.00 17.73  ? 212  HIS A CG    1 
ATOM   1577  N  ND1   . HIS A 1 211  ? -47.431 -35.469  35.113  1.00 19.80  ? 212  HIS A ND1   1 
ATOM   1578  C  CD2   . HIS A 1 211  ? -45.980 -36.432  36.401  1.00 16.23  ? 212  HIS A CD2   1 
ATOM   1579  C  CE1   . HIS A 1 211  ? -47.563 -36.784  34.917  1.00 17.65  ? 212  HIS A CE1   1 
ATOM   1580  N  NE2   . HIS A 1 211  ? -46.675 -37.419  35.691  1.00 21.64  ? 212  HIS A NE2   1 
ATOM   1581  N  N     . PRO A 1 212  ? -42.486 -33.238  35.576  1.00 16.34  ? 213  PRO A N     1 
ATOM   1582  C  CA    . PRO A 1 212  ? -41.196 -33.897  35.572  1.00 15.54  ? 213  PRO A CA    1 
ATOM   1583  C  C     . PRO A 1 212  ? -40.450 -33.969  36.881  1.00 17.29  ? 213  PRO A C     1 
ATOM   1584  O  O     . PRO A 1 212  ? -40.724 -33.112  37.750  1.00 16.81  ? 213  PRO A O     1 
ATOM   1585  C  CB    . PRO A 1 212  ? -40.391 -33.080  34.529  1.00 15.52  ? 213  PRO A CB    1 
ATOM   1586  C  CG    . PRO A 1 212  ? -40.909 -31.690  34.807  1.00 14.45  ? 213  PRO A CG    1 
ATOM   1587  C  CD    . PRO A 1 212  ? -42.413 -31.911  34.929  1.00 15.89  ? 213  PRO A CD    1 
ATOM   1588  N  N     . HIS A 1 213  ? -39.464 -34.889  36.868  1.00 13.75  ? 214  HIS A N     1 
ATOM   1589  C  CA    . HIS A 1 213  ? -38.521 -34.944  37.995  1.00 15.53  ? 214  HIS A CA    1 
ATOM   1590  C  C     . HIS A 1 213  ? -37.175 -35.353  37.350  1.00 15.37  ? 214  HIS A C     1 
ATOM   1591  O  O     . HIS A 1 213  ? -37.140 -35.621  36.142  1.00 16.99  ? 214  HIS A O     1 
ATOM   1592  C  CB    . HIS A 1 213  ? -38.960 -36.040  38.999  1.00 11.86  ? 214  HIS A CB    1 
ATOM   1593  C  CG    . HIS A 1 213  ? -39.096 -37.409  38.403  1.00 14.36  ? 214  HIS A CG    1 
ATOM   1594  N  ND1   . HIS A 1 213  ? -40.178 -37.884  37.663  1.00 14.93  ? 214  HIS A ND1   1 
ATOM   1595  C  CD2   . HIS A 1 213  ? -38.249 -38.473  38.448  1.00 14.34  ? 214  HIS A CD2   1 
ATOM   1596  C  CE1   . HIS A 1 213  ? -39.985 -39.106  37.330  1.00 17.92  ? 214  HIS A CE1   1 
ATOM   1597  N  NE2   . HIS A 1 213  ? -38.805 -39.525  37.767  1.00 18.26  ? 214  HIS A NE2   1 
ATOM   1598  N  N     . VAL A 1 214  ? -36.121 -35.388  38.141  1.00 14.66  ? 215  VAL A N     1 
ATOM   1599  C  CA    . VAL A 1 214  ? -34.841 -35.916  37.582  1.00 16.43  ? 215  VAL A CA    1 
ATOM   1600  C  C     . VAL A 1 214  ? -34.549 -37.215  38.333  1.00 14.93  ? 215  VAL A C     1 
ATOM   1601  O  O     . VAL A 1 214  ? -34.747 -37.268  39.550  1.00 14.08  ? 215  VAL A O     1 
ATOM   1602  C  CB    . VAL A 1 214  ? -33.676 -34.959  37.447  1.00 20.25  ? 215  VAL A CB    1 
ATOM   1603  C  CG1   . VAL A 1 214  ? -33.870 -33.558  37.949  1.00 18.81  ? 215  VAL A CG1   1 
ATOM   1604  C  CG2   . VAL A 1 214  ? -32.256 -35.535  37.579  1.00 14.95  ? 215  VAL A CG2   1 
ATOM   1605  N  N     . ARG A 1 215  ? -34.141 -38.238  37.615  1.00 11.14  ? 216  ARG A N     1 
ATOM   1606  C  CA    . ARG A 1 215  ? -33.826 -39.547  38.100  1.00 13.18  ? 216  ARG A CA    1 
ATOM   1607  C  C     . ARG A 1 215  ? -32.408 -39.890  37.586  1.00 12.39  ? 216  ARG A C     1 
ATOM   1608  O  O     . ARG A 1 215  ? -31.909 -39.330  36.593  1.00 12.64  ? 216  ARG A O     1 
ATOM   1609  C  CB    . ARG A 1 215  ? -34.827 -40.615  37.688  1.00 12.63  ? 216  ARG A CB    1 
ATOM   1610  C  CG    . ARG A 1 215  ? -34.889 -40.923  36.182  1.00 15.08  ? 216  ARG A CG    1 
ATOM   1611  C  CD    . ARG A 1 215  ? -36.173 -41.657  35.891  1.00 18.70  ? 216  ARG A CD    1 
ATOM   1612  N  NE    . ARG A 1 215  ? -36.533 -42.829  36.586  1.00 19.32  ? 216  ARG A NE    1 
ATOM   1613  C  CZ    . ARG A 1 215  ? -37.537 -43.286  37.310  1.00 17.16  ? 216  ARG A CZ    1 
ATOM   1614  N  NH1   . ARG A 1 215  ? -38.549 -42.479  37.567  1.00 18.04  ? 216  ARG A NH1   1 
ATOM   1615  N  NH2   . ARG A 1 215  ? -37.562 -44.557  37.738  1.00 17.24  ? 216  ARG A NH2   1 
ATOM   1616  N  N     . GLY A 1 216  ? -31.720 -40.669  38.381  1.00 11.85  ? 217  GLY A N     1 
ATOM   1617  C  CA    . GLY A 1 216  ? -30.328 -41.049  38.005  1.00 14.07  ? 217  GLY A CA    1 
ATOM   1618  C  C     . GLY A 1 216  ? -29.338 -39.891  38.203  1.00 15.34  ? 217  GLY A C     1 
ATOM   1619  O  O     . GLY A 1 216  ? -28.486 -39.540  37.382  1.00 14.51  ? 217  GLY A O     1 
ATOM   1620  N  N     . THR A 1 217  ? -29.418 -39.248  39.380  1.00 14.38  ? 218  THR A N     1 
ATOM   1621  C  CA    . THR A 1 217  ? -28.454 -38.198  39.725  1.00 13.09  ? 218  THR A CA    1 
ATOM   1622  C  C     . THR A 1 217  ? -27.098 -38.852  40.063  1.00 13.55  ? 218  THR A C     1 
ATOM   1623  O  O     . THR A 1 217  ? -27.005 -40.066  40.203  1.00 13.07  ? 218  THR A O     1 
ATOM   1624  C  CB    . THR A 1 217  ? -28.850 -37.337  40.939  1.00 14.09  ? 218  THR A CB    1 
ATOM   1625  O  OG1   . THR A 1 217  ? -28.835 -38.148  42.126  1.00 14.50  ? 218  THR A OG1   1 
ATOM   1626  C  CG2   . THR A 1 217  ? -30.256 -36.729  40.760  1.00 12.10  ? 218  THR A CG2   1 
ATOM   1627  N  N     . ALA A 1 218  ? -26.035 -38.065  40.162  1.00 14.31  ? 219  ALA A N     1 
ATOM   1628  C  CA    . ALA A 1 218  ? -24.712 -38.512  40.646  1.00 15.23  ? 219  ALA A CA    1 
ATOM   1629  C  C     . ALA A 1 218  ? -24.523 -37.814  42.018  1.00 16.72  ? 219  ALA A C     1 
ATOM   1630  O  O     . ALA A 1 218  ? -24.752 -36.601  42.206  1.00 14.54  ? 219  ALA A O     1 
ATOM   1631  C  CB    . ALA A 1 218  ? -23.664 -38.076  39.628  1.00 14.99  ? 219  ALA A CB    1 
ATOM   1632  N  N     . GLN A 1 219  ? -24.140 -38.589  43.000  1.00 14.01  ? 220  GLN A N     1 
ATOM   1633  C  CA    . GLN A 1 219  ? -24.092 -38.207  44.418  1.00 15.55  ? 220  GLN A CA    1 
ATOM   1634  C  C     . GLN A 1 219  ? -22.730 -38.333  45.038  1.00 16.22  ? 220  GLN A C     1 
ATOM   1635  O  O     . GLN A 1 219  ? -22.110 -39.389  44.870  1.00 18.73  ? 220  GLN A O     1 
ATOM   1636  C  CB    . GLN A 1 219  ? -25.151 -39.042  45.154  1.00 13.75  ? 220  GLN A CB    1 
ATOM   1637  C  CG    . GLN A 1 219  ? -26.580 -38.663  44.700  1.00 13.51  ? 220  GLN A CG    1 
ATOM   1638  C  CD    . GLN A 1 219  ? -27.710 -39.308  45.531  1.00 14.68  ? 220  GLN A CD    1 
ATOM   1639  O  OE1   . GLN A 1 219  ? -28.938 -39.077  45.294  1.00 16.55  ? 220  GLN A OE1   1 
ATOM   1640  N  NE2   . GLN A 1 219  ? -27.444 -40.156  46.504  1.00 12.27  ? 220  GLN A NE2   1 
ATOM   1641  N  N     . ASN A 1 220  ? -22.335 -37.363  45.839  1.00 14.59  ? 221  ASN A N     1 
ATOM   1642  C  CA    . ASN A 1 220  ? -21.087 -37.410  46.600  1.00 15.54  ? 221  ASN A CA    1 
ATOM   1643  C  C     . ASN A 1 220  ? -21.230 -38.224  47.875  1.00 15.07  ? 221  ASN A C     1 
ATOM   1644  O  O     . ASN A 1 220  ? -22.344 -38.605  48.288  1.00 14.57  ? 221  ASN A O     1 
ATOM   1645  C  CB    . ASN A 1 220  ? -20.710 -35.929  46.960  1.00 17.12  ? 221  ASN A CB    1 
ATOM   1646  C  CG    . ASN A 1 220  ? -20.284 -35.204  45.673  1.00 21.04  ? 221  ASN A CG    1 
ATOM   1647  O  OD1   . ASN A 1 220  ? -20.653 -34.023  45.508  1.00 22.15  ? 221  ASN A OD1   1 
ATOM   1648  N  ND2   . ASN A 1 220  ? -19.571 -35.827  44.755  1.00 19.79  ? 221  ASN A ND2   1 
ATOM   1649  N  N     . PRO A 1 221  ? -20.153 -38.334  48.658  1.00 14.67  ? 222  PRO A N     1 
ATOM   1650  C  CA    . PRO A 1 221  ? -20.137 -39.033  49.922  1.00 15.21  ? 222  PRO A CA    1 
ATOM   1651  C  C     . PRO A 1 221  ? -21.067 -38.446  50.988  1.00 15.00  ? 222  PRO A C     1 
ATOM   1652  O  O     . PRO A 1 221  ? -21.525 -39.204  51.893  1.00 14.35  ? 222  PRO A O     1 
ATOM   1653  C  CB    . PRO A 1 221  ? -18.663 -38.913  50.405  1.00 14.38  ? 222  PRO A CB    1 
ATOM   1654  C  CG    . PRO A 1 221  ? -17.913 -38.970  49.072  1.00 14.98  ? 222  PRO A CG    1 
ATOM   1655  C  CD    . PRO A 1 221  ? -18.784 -37.914  48.265  1.00 15.02  ? 222  PRO A CD    1 
ATOM   1656  N  N     . ASP A 1 222  ? -21.402 -37.172  50.846  1.00 13.54  ? 223  ASP A N     1 
ATOM   1657  C  CA    . ASP A 1 222  ? -22.300 -36.526  51.822  1.00 16.44  ? 223  ASP A CA    1 
ATOM   1658  C  C     . ASP A 1 222  ? -23.674 -37.168  51.928  1.00 17.49  ? 223  ASP A C     1 
ATOM   1659  O  O     . ASP A 1 222  ? -24.234 -37.225  53.040  1.00 14.99  ? 223  ASP A O     1 
ATOM   1660  C  CB    . ASP A 1 222  ? -22.385 -35.017  51.574  1.00 18.67  ? 223  ASP A CB    1 
ATOM   1661  C  CG    . ASP A 1 222  ? -22.652 -34.618  50.125  1.00 21.13  ? 223  ASP A CG    1 
ATOM   1662  O  OD1   . ASP A 1 222  ? -22.961 -35.494  49.290  1.00 19.79  ? 223  ASP A OD1   1 
ATOM   1663  O  OD2   . ASP A 1 222  ? -22.597 -33.375  49.864  1.00 21.70  ? 223  ASP A OD2   1 
ATOM   1664  N  N     . ILE A 1 223  ? -24.222 -37.611  50.797  1.00 15.24  ? 224  ILE A N     1 
ATOM   1665  C  CA    . ILE A 1 223  ? -25.591 -38.118  50.762  1.00 15.71  ? 224  ILE A CA    1 
ATOM   1666  C  C     . ILE A 1 223  ? -25.767 -39.494  50.138  1.00 17.14  ? 224  ILE A C     1 
ATOM   1667  O  O     . ILE A 1 223  ? -26.889 -40.002  50.298  1.00 16.89  ? 224  ILE A O     1 
ATOM   1668  C  CB    . ILE A 1 223  ? -26.527 -37.103  50.068  1.00 16.06  ? 224  ILE A CB    1 
ATOM   1669  C  CG1   . ILE A 1 223  ? -26.318 -37.072  48.512  1.00 12.62  ? 224  ILE A CG1   1 
ATOM   1670  C  CG2   . ILE A 1 223  ? -26.361 -35.691  50.655  1.00 16.16  ? 224  ILE A CG2   1 
ATOM   1671  C  CD1   . ILE A 1 223  ? -27.453 -36.235  47.887  1.00 14.63  ? 224  ILE A CD1   1 
ATOM   1672  N  N     . TYR A 1 224  ? -24.809 -40.139  49.475  1.00 12.32  ? 225  TYR A N     1 
ATOM   1673  C  CA    . TYR A 1 224  ? -25.094 -41.402  48.797  1.00 14.59  ? 225  TYR A CA    1 
ATOM   1674  C  C     . TYR A 1 224  ? -25.610 -42.480  49.784  1.00 13.04  ? 225  TYR A C     1 
ATOM   1675  O  O     . TYR A 1 224  ? -26.601 -43.084  49.478  1.00 14.15  ? 225  TYR A O     1 
ATOM   1676  C  CB    . TYR A 1 224  ? -23.891 -41.894  47.934  1.00 10.95  ? 225  TYR A CB    1 
ATOM   1677  C  CG    . TYR A 1 224  ? -24.043 -43.272  47.283  1.00 14.75  ? 225  TYR A CG    1 
ATOM   1678  C  CD1   . TYR A 1 224  ? -24.665 -43.407  46.027  1.00 13.63  ? 225  TYR A CD1   1 
ATOM   1679  C  CD2   . TYR A 1 224  ? -23.642 -44.422  47.941  1.00 13.03  ? 225  TYR A CD2   1 
ATOM   1680  C  CE1   . TYR A 1 224  ? -24.788 -44.675  45.442  1.00 15.86  ? 225  TYR A CE1   1 
ATOM   1681  C  CE2   . TYR A 1 224  ? -23.751 -45.691  47.384  1.00 15.20  ? 225  TYR A CE2   1 
ATOM   1682  C  CZ    . TYR A 1 224  ? -24.368 -45.802  46.116  1.00 16.47  ? 225  TYR A CZ    1 
ATOM   1683  O  OH    . TYR A 1 224  ? -24.506 -47.103  45.624  1.00 17.67  ? 225  TYR A OH    1 
ATOM   1684  N  N     . PHE A 1 225  ? -24.940 -42.774  50.912  1.00 14.61  ? 226  PHE A N     1 
ATOM   1685  C  CA    . PHE A 1 225  ? -25.347 -43.844  51.810  1.00 12.21  ? 226  PHE A CA    1 
ATOM   1686  C  C     . PHE A 1 225  ? -26.768 -43.584  52.313  1.00 13.25  ? 226  PHE A C     1 
ATOM   1687  O  O     . PHE A 1 225  ? -27.583 -44.518  52.191  1.00 13.83  ? 226  PHE A O     1 
ATOM   1688  C  CB    . PHE A 1 225  ? -24.283 -43.861  52.926  1.00 12.71  ? 226  PHE A CB    1 
ATOM   1689  C  CG    . PHE A 1 225  ? -24.279 -44.979  53.913  1.00 16.60  ? 226  PHE A CG    1 
ATOM   1690  C  CD1   . PHE A 1 225  ? -23.193 -45.018  54.814  1.00 15.01  ? 226  PHE A CD1   1 
ATOM   1691  C  CD2   . PHE A 1 225  ? -25.240 -45.976  53.957  1.00 13.71  ? 226  PHE A CD2   1 
ATOM   1692  C  CE1   . PHE A 1 225  ? -23.134 -46.034  55.749  1.00 14.17  ? 226  PHE A CE1   1 
ATOM   1693  C  CE2   . PHE A 1 225  ? -25.156 -46.967  54.912  1.00 18.17  ? 226  PHE A CE2   1 
ATOM   1694  C  CZ    . PHE A 1 225  ? -24.112 -46.997  55.820  1.00 14.24  ? 226  PHE A CZ    1 
ATOM   1695  N  N     . GLN A 1 226  ? -27.156 -42.380  52.718  1.00 12.36  ? 227  GLN A N     1 
ATOM   1696  C  CA    . GLN A 1 226  ? -28.538 -42.111  53.165  1.00 12.87  ? 227  GLN A CA    1 
ATOM   1697  C  C     . GLN A 1 226  ? -29.542 -42.469  52.053  1.00 14.37  ? 227  GLN A C     1 
ATOM   1698  O  O     . GLN A 1 226  ? -30.563 -43.095  52.233  1.00 13.59  ? 227  GLN A O     1 
ATOM   1699  C  CB    . GLN A 1 226  ? -28.711 -40.600  53.458  1.00 12.28  ? 227  GLN A CB    1 
ATOM   1700  C  CG    . GLN A 1 226  ? -27.890 -40.114  54.671  1.00 13.20  ? 227  GLN A CG    1 
ATOM   1701  C  CD    . GLN A 1 226  ? -26.663 -39.354  54.214  1.00 15.93  ? 227  GLN A CD    1 
ATOM   1702  O  OE1   . GLN A 1 226  ? -26.506 -38.102  54.374  1.00 16.40  ? 227  GLN A OE1   1 
ATOM   1703  N  NE2   . GLN A 1 226  ? -25.778 -40.108  53.601  1.00 11.67  ? 227  GLN A NE2   1 
ATOM   1704  N  N     . GLY A 1 227  ? -29.087 -42.144  50.814  1.00 12.36  ? 228  GLY A N     1 
ATOM   1705  C  CA    . GLY A 1 227  ? -29.942 -42.322  49.618  1.00 12.83  ? 228  GLY A CA    1 
ATOM   1706  C  C     . GLY A 1 227  ? -30.137 -43.798  49.366  1.00 15.85  ? 228  GLY A C     1 
ATOM   1707  O  O     . GLY A 1 227  ? -31.207 -44.226  49.000  1.00 17.20  ? 228  GLY A O     1 
ATOM   1708  N  N     . ARG A 1 228  ? -29.104 -44.604  49.589  1.00 13.41  ? 229  ARG A N     1 
ATOM   1709  C  CA    . ARG A 1 228  ? -29.179 -46.048  49.416  1.00 15.78  ? 229  ARG A CA    1 
ATOM   1710  C  C     . ARG A 1 228  ? -30.086 -46.685  50.455  1.00 17.77  ? 229  ARG A C     1 
ATOM   1711  O  O     . ARG A 1 228  ? -30.735 -47.704  50.236  1.00 16.31  ? 229  ARG A O     1 
ATOM   1712  C  CB    . ARG A 1 228  ? -27.730 -46.576  49.494  1.00 18.05  ? 229  ARG A CB    1 
ATOM   1713  C  CG    . ARG A 1 228  ? -27.547 -47.984  48.928  1.00 19.04  ? 229  ARG A CG    1 
ATOM   1714  C  CD    . ARG A 1 228  ? -27.483 -48.021  47.393  1.00 19.50  ? 229  ARG A CD    1 
ATOM   1715  N  NE    . ARG A 1 228  ? -27.074 -49.430  47.138  1.00 20.04  ? 229  ARG A NE    1 
ATOM   1716  C  CZ    . ARG A 1 228  ? -27.842 -50.378  46.645  1.00 20.31  ? 229  ARG A CZ    1 
ATOM   1717  N  NH1   . ARG A 1 228  ? -29.075 -50.150  46.202  1.00 17.23  ? 229  ARG A NH1   1 
ATOM   1718  N  NH2   . ARG A 1 228  ? -27.342 -51.627  46.546  1.00 18.77  ? 229  ARG A NH2   1 
ATOM   1719  N  N     . GLU A 1 229  ? -30.163 -46.096  51.679  1.00 17.45  ? 230  GLU A N     1 
ATOM   1720  C  CA    . GLU A 1 229  ? -30.970 -46.778  52.707  1.00 16.23  ? 230  GLU A CA    1 
ATOM   1721  C  C     . GLU A 1 229  ? -32.402 -46.238  52.743  1.00 17.50  ? 230  GLU A C     1 
ATOM   1722  O  O     . GLU A 1 229  ? -33.196 -46.876  53.438  1.00 17.23  ? 230  GLU A O     1 
ATOM   1723  C  CB    . GLU A 1 229  ? -30.341 -46.539  54.094  1.00 14.88  ? 230  GLU A CB    1 
ATOM   1724  C  CG    . GLU A 1 229  ? -28.917 -47.030  54.287  1.00 14.94  ? 230  GLU A CG    1 
ATOM   1725  C  CD    . GLU A 1 229  ? -28.921 -48.515  54.642  1.00 17.76  ? 230  GLU A CD    1 
ATOM   1726  O  OE1   . GLU A 1 229  ? -29.904 -48.944  55.317  1.00 20.01  ? 230  GLU A OE1   1 
ATOM   1727  O  OE2   . GLU A 1 229  ? -27.987 -49.222  54.277  1.00 17.25  ? 230  GLU A OE2   1 
ATOM   1728  N  N     . ALA A 1 230  ? -32.764 -45.252  51.922  1.00 17.68  ? 231  ALA A N     1 
ATOM   1729  C  CA    . ALA A 1 230  ? -34.129 -44.727  51.905  1.00 18.33  ? 231  ALA A CA    1 
ATOM   1730  C  C     . ALA A 1 230  ? -35.176 -45.731  51.385  1.00 19.84  ? 231  ALA A C     1 
ATOM   1731  O  O     . ALA A 1 230  ? -36.362 -45.628  51.745  1.00 20.81  ? 231  ALA A O     1 
ATOM   1732  C  CB    . ALA A 1 230  ? -34.233 -43.463  51.094  1.00 17.79  ? 231  ALA A CB    1 
ATOM   1733  N  N     . ALA A 1 231  ? -34.760 -46.722  50.620  1.00 17.89  ? 232  ALA A N     1 
ATOM   1734  C  CA    . ALA A 1 231  ? -35.780 -47.727  50.222  1.00 18.65  ? 232  ALA A CA    1 
ATOM   1735  C  C     . ALA A 1 231  ? -36.032 -48.772  51.295  1.00 16.51  ? 232  ALA A C     1 
ATOM   1736  O  O     . ALA A 1 231  ? -36.840 -49.669  50.999  1.00 14.89  ? 232  ALA A O     1 
ATOM   1737  C  CB    . ALA A 1 231  ? -35.385 -48.405  48.904  1.00 18.22  ? 232  ALA A CB    1 
ATOM   1738  N  N     . ASN A 1 232  ? -35.359 -48.844  52.438  1.00 16.22  ? 233  ASN A N     1 
ATOM   1739  C  CA    . ASN A 1 232  ? -35.593 -49.980  53.371  1.00 16.15  ? 233  ASN A CA    1 
ATOM   1740  C  C     . ASN A 1 232  ? -37.046 -50.334  53.676  1.00 15.32  ? 233  ASN A C     1 
ATOM   1741  O  O     . ASN A 1 232  ? -37.412 -51.518  53.681  1.00 18.43  ? 233  ASN A O     1 
ATOM   1742  C  CB    . ASN A 1 232  ? -34.861 -49.688  54.689  1.00 17.61  ? 233  ASN A CB    1 
ATOM   1743  C  CG    . ASN A 1 232  ? -33.347 -49.640  54.691  1.00 17.86  ? 233  ASN A CG    1 
ATOM   1744  O  OD1   . ASN A 1 232  ? -32.768 -49.178  55.713  1.00 19.96  ? 233  ASN A OD1   1 
ATOM   1745  N  ND2   . ASN A 1 232  ? -32.768 -50.061  53.595  1.00 12.57  ? 233  ASN A ND2   1 
ATOM   1746  N  N     . PRO A 1 233  ? -37.914 -49.387  53.919  1.00 17.59  ? 234  PRO A N     1 
ATOM   1747  C  CA    . PRO A 1 233  ? -39.320 -49.647  54.231  1.00 19.65  ? 234  PRO A CA    1 
ATOM   1748  C  C     . PRO A 1 233  ? -40.021 -50.407  53.103  1.00 19.45  ? 234  PRO A C     1 
ATOM   1749  O  O     . PRO A 1 233  ? -40.858 -51.250  53.412  1.00 20.37  ? 234  PRO A O     1 
ATOM   1750  C  CB    . PRO A 1 233  ? -39.987 -48.281  54.303  1.00 17.87  ? 234  PRO A CB    1 
ATOM   1751  C  CG    . PRO A 1 233  ? -38.892 -47.302  54.418  1.00 19.56  ? 234  PRO A CG    1 
ATOM   1752  C  CD    . PRO A 1 233  ? -37.650 -47.941  53.930  1.00 16.53  ? 234  PRO A CD    1 
ATOM   1753  N  N     . TYR A 1 234  ? -39.630 -50.195  51.858  1.00 18.15  ? 235  TYR A N     1 
ATOM   1754  C  CA    . TYR A 1 234  ? -40.276 -50.990  50.773  1.00 17.79  ? 235  TYR A CA    1 
ATOM   1755  C  C     . TYR A 1 234  ? -39.886 -52.453  50.854  1.00 15.12  ? 235  TYR A C     1 
ATOM   1756  O  O     . TYR A 1 234  ? -40.644 -53.386  50.645  1.00 19.74  ? 235  TYR A O     1 
ATOM   1757  C  CB    . TYR A 1 234  ? -39.840 -50.403  49.421  1.00 16.97  ? 235  TYR A CB    1 
ATOM   1758  C  CG    . TYR A 1 234  ? -40.413 -49.009  49.271  1.00 18.19  ? 235  TYR A CG    1 
ATOM   1759  C  CD1   . TYR A 1 234  ? -41.652 -48.888  48.641  1.00 22.38  ? 235  TYR A CD1   1 
ATOM   1760  C  CD2   . TYR A 1 234  ? -39.823 -47.890  49.811  1.00 21.41  ? 235  TYR A CD2   1 
ATOM   1761  C  CE1   . TYR A 1 234  ? -42.263 -47.658  48.510  1.00 24.72  ? 235  TYR A CE1   1 
ATOM   1762  C  CE2   . TYR A 1 234  ? -40.430 -46.657  49.671  1.00 22.70  ? 235  TYR A CE2   1 
ATOM   1763  C  CZ    . TYR A 1 234  ? -41.649 -46.554  49.048  1.00 24.75  ? 235  TYR A CZ    1 
ATOM   1764  O  OH    . TYR A 1 234  ? -42.273 -45.340  48.914  1.00 27.44  ? 235  TYR A OH    1 
ATOM   1765  N  N     . TYR A 1 235  ? -38.617 -52.714  51.159  1.00 16.69  ? 236  TYR A N     1 
ATOM   1766  C  CA    . TYR A 1 235  ? -38.046 -54.040  51.292  1.00 14.48  ? 236  TYR A CA    1 
ATOM   1767  C  C     . TYR A 1 235  ? -38.587 -54.740  52.544  1.00 18.55  ? 236  TYR A C     1 
ATOM   1768  O  O     . TYR A 1 235  ? -38.836 -55.964  52.492  1.00 18.69  ? 236  TYR A O     1 
ATOM   1769  C  CB    . TYR A 1 235  ? -36.530 -54.032  51.349  1.00 15.32  ? 236  TYR A CB    1 
ATOM   1770  C  CG    . TYR A 1 235  ? -35.981 -53.885  49.907  1.00 17.62  ? 236  TYR A CG    1 
ATOM   1771  C  CD1   . TYR A 1 235  ? -35.728 -52.620  49.436  1.00 17.61  ? 236  TYR A CD1   1 
ATOM   1772  C  CD2   . TYR A 1 235  ? -35.786 -55.035  49.161  1.00 18.34  ? 236  TYR A CD2   1 
ATOM   1773  C  CE1   . TYR A 1 235  ? -35.238 -52.508  48.117  1.00 19.74  ? 236  TYR A CE1   1 
ATOM   1774  C  CE2   . TYR A 1 235  ? -35.294 -54.903  47.843  1.00 20.10  ? 236  TYR A CE2   1 
ATOM   1775  C  CZ    . TYR A 1 235  ? -35.044 -53.634  47.369  1.00 20.22  ? 236  TYR A CZ    1 
ATOM   1776  O  OH    . TYR A 1 235  ? -34.532 -53.500  46.095  1.00 20.66  ? 236  TYR A OH    1 
ATOM   1777  N  N     . LEU A 1 236  ? -38.872 -53.923  53.569  1.00 17.67  ? 237  LEU A N     1 
ATOM   1778  C  CA    . LEU A 1 236  ? -39.475 -54.514  54.771  1.00 19.61  ? 237  LEU A CA    1 
ATOM   1779  C  C     . LEU A 1 236  ? -40.911 -55.008  54.518  1.00 18.81  ? 237  LEU A C     1 
ATOM   1780  O  O     . LEU A 1 236  ? -41.359 -55.954  55.146  1.00 18.58  ? 237  LEU A O     1 
ATOM   1781  C  CB    . LEU A 1 236  ? -39.451 -53.478  55.911  1.00 22.09  ? 237  LEU A CB    1 
ATOM   1782  C  CG    . LEU A 1 236  ? -38.091 -53.168  56.524  1.00 24.91  ? 237  LEU A CG    1 
ATOM   1783  C  CD1   . LEU A 1 236  ? -38.114 -52.025  57.533  1.00 27.06  ? 237  LEU A CD1   1 
ATOM   1784  C  CD2   . LEU A 1 236  ? -37.483 -54.416  57.202  1.00 25.87  ? 237  LEU A CD2   1 
ATOM   1785  N  N     . LYS A 1 237  ? -41.672 -54.416  53.626  1.00 18.33  ? 238  LYS A N     1 
ATOM   1786  C  CA    . LYS A 1 237  ? -43.056 -54.819  53.338  1.00 18.49  ? 238  LYS A CA    1 
ATOM   1787  C  C     . LYS A 1 237  ? -43.206 -55.895  52.298  1.00 19.02  ? 238  LYS A C     1 
ATOM   1788  O  O     . LYS A 1 237  ? -44.281 -56.533  52.208  1.00 15.15  ? 238  LYS A O     1 
ATOM   1789  C  CB    . LYS A 1 237  ? -43.789 -53.538  52.851  1.00 20.97  ? 238  LYS A CB    1 
ATOM   1790  C  CG    . LYS A 1 237  ? -43.928 -52.586  54.019  1.00 26.74  ? 238  LYS A CG    1 
ATOM   1791  C  CD    . LYS A 1 237  ? -44.453 -51.206  53.616  1.00 32.40  ? 238  LYS A CD    1 
ATOM   1792  C  CE    . LYS A 1 237  ? -45.091 -50.528  54.811  1.00 36.82  ? 238  LYS A CE    1 
ATOM   1793  N  NZ    . LYS A 1 237  ? -45.424 -49.091  54.551  1.00 39.75  ? 238  LYS A NZ    1 
ATOM   1794  N  N     . VAL A 1 238  ? -42.155 -56.161  51.472  1.00 16.63  ? 239  VAL A N     1 
ATOM   1795  C  CA    . VAL A 1 238  ? -42.418 -57.155  50.424  1.00 19.28  ? 239  VAL A CA    1 
ATOM   1796  C  C     . VAL A 1 238  ? -42.764 -58.542  50.878  1.00 19.09  ? 239  VAL A C     1 
ATOM   1797  O  O     . VAL A 1 238  ? -43.620 -59.145  50.227  1.00 18.25  ? 239  VAL A O     1 
ATOM   1798  C  CB    . VAL A 1 238  ? -41.481 -57.245  49.192  1.00 24.31  ? 239  VAL A CB    1 
ATOM   1799  C  CG1   . VAL A 1 238  ? -40.643 -56.018  48.971  1.00 24.40  ? 239  VAL A CG1   1 
ATOM   1800  C  CG2   . VAL A 1 238  ? -40.708 -58.568  49.053  1.00 25.85  ? 239  VAL A CG2   1 
ATOM   1801  N  N     . PRO A 1 239  ? -42.141 -59.128  51.887  1.00 19.58  ? 240  PRO A N     1 
ATOM   1802  C  CA    . PRO A 1 239  ? -42.491 -60.482  52.299  1.00 19.10  ? 240  PRO A CA    1 
ATOM   1803  C  C     . PRO A 1 239  ? -43.978 -60.619  52.630  1.00 19.15  ? 240  PRO A C     1 
ATOM   1804  O  O     . PRO A 1 239  ? -44.660 -61.538  52.162  1.00 18.31  ? 240  PRO A O     1 
ATOM   1805  C  CB    . PRO A 1 239  ? -41.571 -60.727  53.504  1.00 20.68  ? 240  PRO A CB    1 
ATOM   1806  C  CG    . PRO A 1 239  ? -40.614 -59.574  53.596  1.00 21.81  ? 240  PRO A CG    1 
ATOM   1807  C  CD    . PRO A 1 239  ? -41.059 -58.492  52.677  1.00 17.81  ? 240  PRO A CD    1 
ATOM   1808  N  N     . GLY A 1 240  ? -44.525 -59.616  53.325  1.00 17.27  ? 241  GLY A N     1 
ATOM   1809  C  CA    . GLY A 1 240  ? -45.946 -59.622  53.679  1.00 18.97  ? 241  GLY A CA    1 
ATOM   1810  C  C     . GLY A 1 240  ? -46.887 -59.454  52.479  1.00 18.40  ? 241  GLY A C     1 
ATOM   1811  O  O     . GLY A 1 240  ? -47.926 -60.132  52.460  1.00 16.95  ? 241  GLY A O     1 
ATOM   1812  N  N     . ILE A 1 241  ? -46.484 -58.708  51.462  1.00 16.11  ? 242  ILE A N     1 
ATOM   1813  C  CA    . ILE A 1 241  ? -47.175 -58.489  50.218  1.00 15.73  ? 242  ILE A CA    1 
ATOM   1814  C  C     . ILE A 1 241  ? -47.182 -59.790  49.421  1.00 17.36  ? 242  ILE A C     1 
ATOM   1815  O  O     . ILE A 1 241  ? -48.271 -60.253  49.016  1.00 15.99  ? 242  ILE A O     1 
ATOM   1816  C  CB    . ILE A 1 241  ? -46.566 -57.301  49.434  1.00 18.30  ? 242  ILE A CB    1 
ATOM   1817  C  CG1   . ILE A 1 241  ? -46.905 -55.967  50.097  1.00 15.68  ? 242  ILE A CG1   1 
ATOM   1818  C  CG2   . ILE A 1 241  ? -47.085 -57.339  47.986  1.00 16.58  ? 242  ILE A CG2   1 
ATOM   1819  C  CD1   . ILE A 1 241  ? -46.146 -54.723  49.657  1.00 16.11  ? 242  ILE A CD1   1 
ATOM   1820  N  N     . VAL A 1 242  ? -46.007 -60.403  49.322  1.00 17.05  ? 243  VAL A N     1 
ATOM   1821  C  CA    . VAL A 1 242  ? -45.953 -61.737  48.683  1.00 16.67  ? 243  VAL A CA    1 
ATOM   1822  C  C     . VAL A 1 242  ? -46.896 -62.702  49.389  1.00 15.30  ? 243  VAL A C     1 
ATOM   1823  O  O     . VAL A 1 242  ? -47.672 -63.421  48.760  1.00 16.02  ? 243  VAL A O     1 
ATOM   1824  C  CB    . VAL A 1 242  ? -44.522 -62.274  48.669  1.00 15.13  ? 243  VAL A CB    1 
ATOM   1825  C  CG1   . VAL A 1 242  ? -44.442 -63.751  48.226  1.00 16.33  ? 243  VAL A CG1   1 
ATOM   1826  C  CG2   . VAL A 1 242  ? -43.659 -61.429  47.718  1.00 16.67  ? 243  VAL A CG2   1 
ATOM   1827  N  N     . ALA A 1 243  ? -46.773 -62.812  50.702  1.00 16.42  ? 244  ALA A N     1 
ATOM   1828  C  CA    . ALA A 1 243  ? -47.593 -63.747  51.490  1.00 16.31  ? 244  ALA A CA    1 
ATOM   1829  C  C     . ALA A 1 243  ? -49.084 -63.560  51.289  1.00 17.31  ? 244  ALA A C     1 
ATOM   1830  O  O     . ALA A 1 243  ? -49.898 -64.521  51.190  1.00 16.18  ? 244  ALA A O     1 
ATOM   1831  C  CB    . ALA A 1 243  ? -47.281 -63.554  52.985  1.00 14.95  ? 244  ALA A CB    1 
ATOM   1832  N  N     . GLU A 1 244  ? -49.474 -62.294  51.266  1.00 18.64  ? 245  GLU A N     1 
ATOM   1833  C  CA    . GLU A 1 244  ? -50.880 -61.910  51.015  1.00 21.48  ? 245  GLU A CA    1 
ATOM   1834  C  C     . GLU A 1 244  ? -51.329 -62.306  49.632  1.00 19.37  ? 245  GLU A C     1 
ATOM   1835  O  O     . GLU A 1 244  ? -52.413 -62.855  49.457  1.00 15.09  ? 245  GLU A O     1 
ATOM   1836  C  CB    . GLU A 1 244  ? -51.026 -60.426  51.353  1.00 25.41  ? 245  GLU A CB    1 
ATOM   1837  C  CG    . GLU A 1 244  ? -52.070 -59.512  50.778  1.00 34.04  ? 245  GLU A CG    1 
ATOM   1838  C  CD    . GLU A 1 244  ? -51.694 -58.335  49.856  1.00 35.93  ? 245  GLU A CD    1 
ATOM   1839  O  OE1   . GLU A 1 244  ? -52.179 -58.318  48.682  1.00 32.89  ? 245  GLU A OE1   1 
ATOM   1840  O  OE2   . GLU A 1 244  ? -50.947 -57.371  50.220  1.00 35.83  ? 245  GLU A OE2   1 
ATOM   1841  N  N     . TYR A 1 245  ? -50.523 -62.087  48.572  1.00 17.06  ? 246  TYR A N     1 
ATOM   1842  C  CA    . TYR A 1 245  ? -50.879 -62.459  47.211  1.00 16.52  ? 246  TYR A CA    1 
ATOM   1843  C  C     . TYR A 1 245  ? -50.882 -63.965  47.082  1.00 18.33  ? 246  TYR A C     1 
ATOM   1844  O  O     . TYR A 1 245  ? -51.742 -64.562  46.415  1.00 19.62  ? 246  TYR A O     1 
ATOM   1845  C  CB    . TYR A 1 245  ? -50.004 -61.779  46.128  1.00 15.93  ? 246  TYR A CB    1 
ATOM   1846  C  CG    . TYR A 1 245  ? -50.517 -60.366  45.920  1.00 16.85  ? 246  TYR A CG    1 
ATOM   1847  C  CD1   . TYR A 1 245  ? -49.794 -59.236  46.281  1.00 17.24  ? 246  TYR A CD1   1 
ATOM   1848  C  CD2   . TYR A 1 245  ? -51.770 -60.169  45.339  1.00 17.54  ? 246  TYR A CD2   1 
ATOM   1849  C  CE1   . TYR A 1 245  ? -50.327 -57.969  46.069  1.00 19.16  ? 246  TYR A CE1   1 
ATOM   1850  C  CE2   . TYR A 1 245  ? -52.283 -58.905  45.118  1.00 18.42  ? 246  TYR A CE2   1 
ATOM   1851  C  CZ    . TYR A 1 245  ? -51.568 -57.801  45.499  1.00 19.92  ? 246  TYR A CZ    1 
ATOM   1852  O  OH    . TYR A 1 245  ? -52.049 -56.499  45.287  1.00 19.34  ? 246  TYR A OH    1 
ATOM   1853  N  N     . MET A 1 246  ? -50.025 -64.660  47.835  1.00 16.27  ? 247  MET A N     1 
ATOM   1854  C  CA    . MET A 1 246  ? -50.128 -66.144  47.829  1.00 16.12  ? 247  MET A CA    1 
ATOM   1855  C  C     . MET A 1 246  ? -51.508 -66.564  48.371  1.00 18.18  ? 247  MET A C     1 
ATOM   1856  O  O     . MET A 1 246  ? -52.193 -67.369  47.752  1.00 18.56  ? 247  MET A O     1 
ATOM   1857  C  CB    . MET A 1 246  ? -49.078 -66.795  48.732  1.00 16.26  ? 247  MET A CB    1 
ATOM   1858  C  CG    . MET A 1 246  ? -47.702 -66.791  47.949  1.00 16.73  ? 247  MET A CG    1 
ATOM   1859  S  SD    . MET A 1 246  ? -46.394 -67.291  49.079  1.00 17.92  ? 247  MET A SD    1 
ATOM   1860  C  CE    . MET A 1 246  ? -45.012 -67.574  47.932  1.00 15.89  ? 247  MET A CE    1 
ATOM   1861  N  N     . GLN A 1 247  ? -51.994 -65.884  49.394  1.00 21.86  ? 248  GLN A N     1 
ATOM   1862  C  CA    . GLN A 1 247  ? -53.332 -66.258  49.901  1.00 24.03  ? 248  GLN A CA    1 
ATOM   1863  C  C     . GLN A 1 247  ? -54.472 -65.894  48.961  1.00 24.57  ? 248  GLN A C     1 
ATOM   1864  O  O     . GLN A 1 247  ? -55.436 -66.631  48.804  1.00 21.49  ? 248  GLN A O     1 
ATOM   1865  C  CB    . GLN A 1 247  ? -53.525 -65.638  51.277  1.00 27.14  ? 248  GLN A CB    1 
ATOM   1866  C  CG    . GLN A 1 247  ? -52.604 -66.325  52.283  1.00 32.54  ? 248  GLN A CG    1 
ATOM   1867  C  CD    . GLN A 1 247  ? -52.284 -65.385  53.424  1.00 38.20  ? 248  GLN A CD    1 
ATOM   1868  O  OE1   . GLN A 1 247  ? -53.061 -64.488  53.776  1.00 38.24  ? 248  GLN A OE1   1 
ATOM   1869  N  NE2   . GLN A 1 247  ? -51.100 -65.521  54.040  1.00 41.67  ? 248  GLN A NE2   1 
ATOM   1870  N  N     . LYS A 1 248  ? -54.346 -64.774  48.268  1.00 23.28  ? 249  LYS A N     1 
ATOM   1871  C  CA    . LYS A 1 248  ? -55.408 -64.343  47.353  1.00 23.37  ? 249  LYS A CA    1 
ATOM   1872  C  C     . LYS A 1 248  ? -55.493 -65.222  46.128  1.00 23.93  ? 249  LYS A C     1 
ATOM   1873  O  O     . LYS A 1 248  ? -56.569 -65.658  45.691  1.00 21.84  ? 249  LYS A O     1 
ATOM   1874  C  CB    . LYS A 1 248  ? -55.151 -62.908  46.939  1.00 23.65  ? 249  LYS A CB    1 
ATOM   1875  C  CG    . LYS A 1 248  ? -55.361 -61.865  48.016  1.00 24.79  ? 249  LYS A CG    1 
ATOM   1876  C  CD    . LYS A 1 248  ? -54.926 -60.516  47.472  1.00 26.67  ? 249  LYS A CD    1 
ATOM   1877  C  CE    . LYS A 1 248  ? -55.328 -59.415  48.453  1.00 28.62  ? 249  LYS A CE    1 
ATOM   1878  N  NZ    . LYS A 1 248  ? -54.788 -58.109  47.964  1.00 31.10  ? 249  LYS A NZ    1 
ATOM   1879  N  N     . VAL A 1 249  ? -54.290 -65.632  45.634  1.00 22.88  ? 250  VAL A N     1 
ATOM   1880  C  CA    . VAL A 1 249  ? -54.286 -66.493  44.459  1.00 24.10  ? 250  VAL A CA    1 
ATOM   1881  C  C     . VAL A 1 249  ? -54.897 -67.837  44.843  1.00 25.67  ? 250  VAL A C     1 
ATOM   1882  O  O     . VAL A 1 249  ? -55.687 -68.414  44.071  1.00 25.95  ? 250  VAL A O     1 
ATOM   1883  C  CB    . VAL A 1 249  ? -52.837 -66.672  43.927  1.00 23.00  ? 250  VAL A CB    1 
ATOM   1884  C  CG1   . VAL A 1 249  ? -52.746 -67.782  42.879  1.00 25.20  ? 250  VAL A CG1   1 
ATOM   1885  C  CG2   . VAL A 1 249  ? -52.471 -65.319  43.330  1.00 21.42  ? 250  VAL A CG2   1 
ATOM   1886  N  N     . ALA A 1 250  ? -54.547 -68.264  46.034  1.00 25.87  ? 251  ALA A N     1 
ATOM   1887  C  CA    . ALA A 1 250  ? -55.022 -69.525  46.579  1.00 27.51  ? 251  ALA A CA    1 
ATOM   1888  C  C     . ALA A 1 250  ? -56.556 -69.547  46.786  1.00 29.98  ? 251  ALA A C     1 
ATOM   1889  O  O     . ALA A 1 250  ? -57.149 -70.634  46.690  1.00 27.20  ? 251  ALA A O     1 
ATOM   1890  C  CB    . ALA A 1 250  ? -54.350 -69.845  47.889  1.00 27.70  ? 251  ALA A CB    1 
ATOM   1891  N  N     . SER A 1 251  ? -57.107 -68.375  47.034  1.00 30.04  ? 252  SER A N     1 
ATOM   1892  C  CA    . SER A 1 251  ? -58.570 -68.299  47.213  1.00 31.92  ? 252  SER A CA    1 
ATOM   1893  C  C     . SER A 1 251  ? -59.249 -68.511  45.866  1.00 32.44  ? 252  SER A C     1 
ATOM   1894  O  O     . SER A 1 251  ? -60.404 -68.975  45.884  1.00 32.83  ? 252  SER A O     1 
ATOM   1895  C  CB    . SER A 1 251  ? -58.990 -67.000  47.900  1.00 32.80  ? 252  SER A CB    1 
ATOM   1896  O  OG    . SER A 1 251  ? -58.833 -65.935  46.944  1.00 37.88  ? 252  SER A OG    1 
ATOM   1897  N  N     . LEU A 1 252  ? -58.508 -68.342  44.771  1.00 27.71  ? 253  LEU A N     1 
ATOM   1898  C  CA    . LEU A 1 252  ? -59.051 -68.627  43.463  1.00 29.26  ? 253  LEU A CA    1 
ATOM   1899  C  C     . LEU A 1 252  ? -58.639 -69.996  42.930  1.00 29.75  ? 253  LEU A C     1 
ATOM   1900  O  O     . LEU A 1 252  ? -59.293 -70.548  42.020  1.00 30.18  ? 253  LEU A O     1 
ATOM   1901  C  CB    . LEU A 1 252  ? -58.536 -67.567  42.456  1.00 27.52  ? 253  LEU A CB    1 
ATOM   1902  C  CG    . LEU A 1 252  ? -58.960 -66.112  42.712  1.00 26.83  ? 253  LEU A CG    1 
ATOM   1903  C  CD1   . LEU A 1 252  ? -58.497 -65.198  41.602  1.00 27.68  ? 253  LEU A CD1   1 
ATOM   1904  C  CD2   . LEU A 1 252  ? -60.485 -65.980  42.801  1.00 27.69  ? 253  LEU A CD2   1 
ATOM   1905  N  N     . THR A 1 253  ? -57.529 -70.573  43.410  1.00 25.94  ? 254  THR A N     1 
ATOM   1906  C  CA    . THR A 1 253  ? -57.100 -71.831  42.779  1.00 26.54  ? 254  THR A CA    1 
ATOM   1907  C  C     . THR A 1 253  ? -57.206 -72.995  43.733  1.00 25.32  ? 254  THR A C     1 
ATOM   1908  O  O     . THR A 1 253  ? -57.149 -74.152  43.324  1.00 26.00  ? 254  THR A O     1 
ATOM   1909  C  CB    . THR A 1 253  ? -55.622 -71.720  42.346  1.00 25.01  ? 254  THR A CB    1 
ATOM   1910  O  OG1   . THR A 1 253  ? -54.867 -71.480  43.549  1.00 20.67  ? 254  THR A OG1   1 
ATOM   1911  C  CG2   . THR A 1 253  ? -55.385 -70.599  41.359  1.00 26.65  ? 254  THR A CG2   1 
ATOM   1912  N  N     . GLY A 1 254  ? -57.218 -72.707  45.025  1.00 27.03  ? 255  GLY A N     1 
ATOM   1913  C  CA    . GLY A 1 254  ? -57.130 -73.790  46.034  1.00 25.77  ? 255  GLY A CA    1 
ATOM   1914  C  C     . GLY A 1 254  ? -55.671 -74.302  46.140  1.00 26.47  ? 255  GLY A C     1 
ATOM   1915  O  O     . GLY A 1 254  ? -55.424 -75.346  46.781  1.00 24.49  ? 255  GLY A O     1 
ATOM   1916  N  N     . ARG A 1 255  ? -54.702 -73.543  45.572  1.00 22.13  ? 256  ARG A N     1 
ATOM   1917  C  CA    . ARG A 1 255  ? -53.304 -73.996  45.740  1.00 23.16  ? 256  ARG A CA    1 
ATOM   1918  C  C     . ARG A 1 255  ? -52.575 -73.027  46.659  1.00 23.85  ? 256  ARG A C     1 
ATOM   1919  O  O     . ARG A 1 255  ? -52.414 -71.836  46.351  1.00 23.24  ? 256  ARG A O     1 
ATOM   1920  C  CB    . ARG A 1 255  ? -52.615 -74.160  44.400  1.00 21.08  ? 256  ARG A CB    1 
ATOM   1921  C  CG    . ARG A 1 255  ? -53.217 -75.297  43.576  1.00 23.64  ? 256  ARG A CG    1 
ATOM   1922  C  CD    . ARG A 1 255  ? -52.395 -75.454  42.294  1.00 20.50  ? 256  ARG A CD    1 
ATOM   1923  N  NE    . ARG A 1 255  ? -52.469 -74.242  41.494  1.00 20.58  ? 256  ARG A NE    1 
ATOM   1924  C  CZ    . ARG A 1 255  ? -53.468 -74.021  40.647  1.00 21.44  ? 256  ARG A CZ    1 
ATOM   1925  N  NH1   . ARG A 1 255  ? -54.484 -74.904  40.567  1.00 21.79  ? 256  ARG A NH1   1 
ATOM   1926  N  NH2   . ARG A 1 255  ? -53.419 -72.892  39.960  1.00 21.82  ? 256  ARG A NH2   1 
ATOM   1927  N  N     . SER A 1 256  ? -52.286 -73.463  47.886  1.00 22.99  ? 257  SER A N     1 
ATOM   1928  C  CA    . SER A 1 256  ? -51.742 -72.612  48.921  1.00 22.44  ? 257  SER A CA    1 
ATOM   1929  C  C     . SER A 1 256  ? -50.206 -72.620  48.969  1.00 21.33  ? 257  SER A C     1 
ATOM   1930  O  O     . SER A 1 256  ? -49.599 -73.641  48.755  1.00 25.19  ? 257  SER A O     1 
ATOM   1931  C  CB    . SER A 1 256  ? -52.270 -73.023  50.316  1.00 23.55  ? 257  SER A CB    1 
ATOM   1932  O  OG    . SER A 1 256  ? -53.677 -72.757  50.287  1.00 27.40  ? 257  SER A OG    1 
ATOM   1933  N  N     . TYR A 1 257  ? -49.610 -71.504  49.271  1.00 18.74  ? 258  TYR A N     1 
ATOM   1934  C  CA    . TYR A 1 257  ? -48.158 -71.400  49.320  1.00 20.59  ? 258  TYR A CA    1 
ATOM   1935  C  C     . TYR A 1 257  ? -47.816 -70.521  50.513  1.00 18.18  ? 258  TYR A C     1 
ATOM   1936  O  O     . TYR A 1 257  ? -48.586 -69.648  50.861  1.00 20.14  ? 258  TYR A O     1 
ATOM   1937  C  CB    . TYR A 1 257  ? -47.635 -70.675  48.046  1.00 20.96  ? 258  TYR A CB    1 
ATOM   1938  C  CG    . TYR A 1 257  ? -47.911 -71.435  46.766  1.00 20.54  ? 258  TYR A CG    1 
ATOM   1939  C  CD1   . TYR A 1 257  ? -48.845 -71.022  45.849  1.00 20.34  ? 258  TYR A CD1   1 
ATOM   1940  C  CD2   . TYR A 1 257  ? -47.264 -72.649  46.498  1.00 22.56  ? 258  TYR A CD2   1 
ATOM   1941  C  CE1   . TYR A 1 257  ? -49.096 -71.742  44.718  1.00 20.43  ? 258  TYR A CE1   1 
ATOM   1942  C  CE2   . TYR A 1 257  ? -47.500 -73.380  45.355  1.00 22.96  ? 258  TYR A CE2   1 
ATOM   1943  C  CZ    . TYR A 1 257  ? -48.433 -72.907  44.448  1.00 21.03  ? 258  TYR A CZ    1 
ATOM   1944  O  OH    . TYR A 1 257  ? -48.692 -73.593  43.278  1.00 22.80  ? 258  TYR A OH    1 
ATOM   1945  N  N     . LYS A 1 258  ? -46.579 -70.663  50.988  1.00 17.93  ? 259  LYS A N     1 
ATOM   1946  C  CA    . LYS A 1 258  ? -46.001 -69.801  52.005  1.00 19.98  ? 259  LYS A CA    1 
ATOM   1947  C  C     . LYS A 1 258  ? -44.618 -69.388  51.504  1.00 18.49  ? 259  LYS A C     1 
ATOM   1948  O  O     . LYS A 1 258  ? -44.166 -69.988  50.533  1.00 17.25  ? 259  LYS A O     1 
ATOM   1949  C  CB    . LYS A 1 258  ? -45.843 -70.540  53.360  1.00 20.80  ? 259  LYS A CB    1 
ATOM   1950  C  CG    . LYS A 1 258  ? -47.195 -70.597  54.095  1.00 25.53  ? 259  LYS A CG    1 
ATOM   1951  C  CD    . LYS A 1 258  ? -46.981 -71.247  55.469  1.00 30.96  ? 259  LYS A CD    1 
ATOM   1952  C  CE    . LYS A 1 258  ? -48.212 -70.998  56.333  1.00 34.12  ? 259  LYS A CE    1 
ATOM   1953  N  NZ    . LYS A 1 258  ? -48.906 -72.292  56.629  1.00 37.42  ? 259  LYS A NZ    1 
ATOM   1954  N  N     . LEU A 1 259  ? -43.962 -68.451  52.130  1.00 16.17  ? 260  LEU A N     1 
ATOM   1955  C  CA    . LEU A 1 259  ? -42.596 -68.012  51.822  1.00 18.47  ? 260  LEU A CA    1 
ATOM   1956  C  C     . LEU A 1 259  ? -41.659 -69.203  51.861  1.00 18.13  ? 260  LEU A C     1 
ATOM   1957  O  O     . LEU A 1 259  ? -40.797 -69.408  51.013  1.00 16.83  ? 260  LEU A O     1 
ATOM   1958  C  CB    . LEU A 1 259  ? -42.215 -66.963  52.877  1.00 18.34  ? 260  LEU A CB    1 
ATOM   1959  C  CG    . LEU A 1 259  ? -42.520 -65.491  52.524  1.00 21.06  ? 260  LEU A CG    1 
ATOM   1960  C  CD1   . LEU A 1 259  ? -43.713 -65.267  51.623  1.00 20.85  ? 260  LEU A CD1   1 
ATOM   1961  C  CD2   . LEU A 1 259  ? -42.478 -64.542  53.689  1.00 18.84  ? 260  LEU A CD2   1 
ATOM   1962  N  N     . PHE A 1 260  ? -41.854 -70.056  52.874  1.00 18.58  ? 261  PHE A N     1 
ATOM   1963  C  CA    . PHE A 1 260  ? -41.159 -71.319  53.004  1.00 18.18  ? 261  PHE A CA    1 
ATOM   1964  C  C     . PHE A 1 260  ? -42.276 -72.335  53.347  1.00 19.24  ? 261  PHE A C     1 
ATOM   1965  O  O     . PHE A 1 260  ? -43.048 -72.030  54.253  1.00 19.92  ? 261  PHE A O     1 
ATOM   1966  C  CB    . PHE A 1 260  ? -40.146 -71.391  54.160  1.00 17.57  ? 261  PHE A CB    1 
ATOM   1967  C  CG    . PHE A 1 260  ? -39.002 -70.398  53.964  1.00 18.72  ? 261  PHE A CG    1 
ATOM   1968  C  CD1   . PHE A 1 260  ? -37.805 -70.804  53.412  1.00 16.42  ? 261  PHE A CD1   1 
ATOM   1969  C  CD2   . PHE A 1 260  ? -39.168 -69.077  54.333  1.00 17.43  ? 261  PHE A CD2   1 
ATOM   1970  C  CE1   . PHE A 1 260  ? -36.767 -69.870  53.227  1.00 16.66  ? 261  PHE A CE1   1 
ATOM   1971  C  CE2   . PHE A 1 260  ? -38.170 -68.143  54.143  1.00 18.12  ? 261  PHE A CE2   1 
ATOM   1972  C  CZ    . PHE A 1 260  ? -36.957 -68.545  53.581  1.00 17.78  ? 261  PHE A CZ    1 
ATOM   1973  N  N     . ASP A 1 261  ? -42.332 -73.461  52.682  1.00 19.39  ? 262  ASP A N     1 
ATOM   1974  C  CA    . ASP A 1 261  ? -43.403 -74.429  53.047  1.00 20.32  ? 262  ASP A CA    1 
ATOM   1975  C  C     . ASP A 1 261  ? -42.704 -75.679  53.545  1.00 20.71  ? 262  ASP A C     1 
ATOM   1976  O  O     . ASP A 1 261  ? -41.568 -75.890  53.110  1.00 20.66  ? 262  ASP A O     1 
ATOM   1977  C  CB    . ASP A 1 261  ? -44.229 -74.767  51.810  1.00 21.96  ? 262  ASP A CB    1 
ATOM   1978  C  CG    . ASP A 1 261  ? -45.351 -73.758  51.623  1.00 22.83  ? 262  ASP A CG    1 
ATOM   1979  O  OD1   . ASP A 1 261  ? -45.417 -73.206  50.506  1.00 23.47  ? 262  ASP A OD1   1 
ATOM   1980  O  OD2   . ASP A 1 261  ? -46.166 -73.570  52.572  1.00 19.96  ? 262  ASP A OD2   1 
ATOM   1981  N  N     . TYR A 1 262  ? -43.286 -76.418  54.479  1.00 20.27  ? 263  TYR A N     1 
ATOM   1982  C  CA    . TYR A 1 262  ? -42.705 -77.657  54.980  1.00 19.60  ? 263  TYR A CA    1 
ATOM   1983  C  C     . TYR A 1 262  ? -43.569 -78.842  54.541  1.00 20.53  ? 263  TYR A C     1 
ATOM   1984  O  O     . TYR A 1 262  ? -44.808 -78.740  54.595  1.00 19.86  ? 263  TYR A O     1 
ATOM   1985  C  CB    . TYR A 1 262  ? -42.587 -77.631  56.512  1.00 19.41  ? 263  TYR A CB    1 
ATOM   1986  C  CG    . TYR A 1 262  ? -42.093 -78.951  57.077  1.00 22.03  ? 263  TYR A CG    1 
ATOM   1987  C  CD1   . TYR A 1 262  ? -42.993 -79.906  57.581  1.00 19.70  ? 263  TYR A CD1   1 
ATOM   1988  C  CD2   . TYR A 1 262  ? -40.734 -79.256  57.047  1.00 19.86  ? 263  TYR A CD2   1 
ATOM   1989  C  CE1   . TYR A 1 262  ? -42.479 -81.118  58.029  1.00 21.31  ? 263  TYR A CE1   1 
ATOM   1990  C  CE2   . TYR A 1 262  ? -40.236 -80.445  57.512  1.00 20.52  ? 263  TYR A CE2   1 
ATOM   1991  C  CZ    . TYR A 1 262  ? -41.132 -81.376  58.049  1.00 21.44  ? 263  TYR A CZ    1 
ATOM   1992  O  OH    . TYR A 1 262  ? -40.635 -82.579  58.482  1.00 18.81  ? 263  TYR A OH    1 
ATOM   1993  N  N     . VAL A 1 263  ? -42.939 -79.951  54.280  1.00 20.07  ? 264  VAL A N     1 
ATOM   1994  C  CA    . VAL A 1 263  ? -43.579 -81.219  53.899  1.00 21.32  ? 264  VAL A CA    1 
ATOM   1995  C  C     . VAL A 1 263  ? -42.852 -82.373  54.594  1.00 23.89  ? 264  VAL A C     1 
ATOM   1996  O  O     . VAL A 1 263  ? -41.627 -82.358  54.789  1.00 20.42  ? 264  VAL A O     1 
ATOM   1997  C  CB    . VAL A 1 263  ? -43.403 -81.147  52.376  1.00 23.42  ? 264  VAL A CB    1 
ATOM   1998  C  CG1   . VAL A 1 263  ? -42.458 -82.055  51.667  1.00 21.66  ? 264  VAL A CG1   1 
ATOM   1999  C  CG2   . VAL A 1 263  ? -44.736 -80.875  51.730  1.00 22.26  ? 264  VAL A CG2   1 
ATOM   2000  N  N     . GLY A 1 264  ? -43.592 -83.416  54.983  1.00 20.48  ? 265  GLY A N     1 
ATOM   2001  C  CA    . GLY A 1 264  ? -42.916 -84.534  55.661  1.00 22.51  ? 265  GLY A CA    1 
ATOM   2002  C  C     . GLY A 1 264  ? -43.396 -84.727  57.094  1.00 23.04  ? 265  GLY A C     1 
ATOM   2003  O  O     . GLY A 1 264  ? -44.324 -84.085  57.624  1.00 22.28  ? 265  GLY A O     1 
ATOM   2004  N  N     . ALA A 1 265  ? -42.768 -85.667  57.778  1.00 23.57  ? 266  ALA A N     1 
ATOM   2005  C  CA    . ALA A 1 265  ? -43.103 -85.937  59.188  1.00 26.17  ? 266  ALA A CA    1 
ATOM   2006  C  C     . ALA A 1 265  ? -43.002 -84.745  60.113  1.00 25.29  ? 266  ALA A C     1 
ATOM   2007  O  O     . ALA A 1 265  ? -42.006 -84.022  60.213  1.00 24.27  ? 266  ALA A O     1 
ATOM   2008  C  CB    . ALA A 1 265  ? -42.162 -87.059  59.668  1.00 25.81  ? 266  ALA A CB    1 
ATOM   2009  N  N     . PRO A 1 266  ? -44.078 -84.453  60.857  1.00 27.52  ? 267  PRO A N     1 
ATOM   2010  C  CA    . PRO A 1 266  ? -44.151 -83.339  61.778  1.00 26.22  ? 267  PRO A CA    1 
ATOM   2011  C  C     . PRO A 1 266  ? -43.105 -83.384  62.873  1.00 27.72  ? 267  PRO A C     1 
ATOM   2012  O  O     . PRO A 1 266  ? -42.711 -82.376  63.478  1.00 29.30  ? 267  PRO A O     1 
ATOM   2013  C  CB    . PRO A 1 266  ? -45.543 -83.521  62.426  1.00 28.09  ? 267  PRO A CB    1 
ATOM   2014  C  CG    . PRO A 1 266  ? -46.301 -84.195  61.357  1.00 27.50  ? 267  PRO A CG    1 
ATOM   2015  C  CD    . PRO A 1 266  ? -45.361 -85.220  60.779  1.00 26.84  ? 267  PRO A CD    1 
ATOM   2016  N  N     . ASP A 1 267  ? -42.626 -84.605  63.156  1.00 26.18  ? 268  ASP A N     1 
ATOM   2017  C  CA    . ASP A 1 267  ? -41.603 -84.799  64.179  1.00 27.16  ? 268  ASP A CA    1 
ATOM   2018  C  C     . ASP A 1 267  ? -40.269 -85.160  63.512  1.00 26.85  ? 268  ASP A C     1 
ATOM   2019  O  O     . ASP A 1 267  ? -39.434 -85.881  64.068  1.00 25.04  ? 268  ASP A O     1 
ATOM   2020  C  CB    . ASP A 1 267  ? -42.068 -85.892  65.171  1.00 28.88  ? 268  ASP A CB    1 
ATOM   2021  C  CG    . ASP A 1 267  ? -42.296 -87.258  64.539  1.00 29.54  ? 268  ASP A CG    1 
ATOM   2022  O  OD1   . ASP A 1 267  ? -42.455 -87.371  63.300  1.00 28.55  ? 268  ASP A OD1   1 
ATOM   2023  O  OD2   . ASP A 1 267  ? -42.346 -88.288  65.264  1.00 29.38  ? 268  ASP A OD2   1 
ATOM   2024  N  N     . ALA A 1 268  ? -40.015 -84.652  62.282  1.00 24.09  ? 269  ALA A N     1 
ATOM   2025  C  CA    . ALA A 1 268  ? -38.844 -85.041  61.539  1.00 23.90  ? 269  ALA A CA    1 
ATOM   2026  C  C     . ALA A 1 268  ? -37.551 -84.706  62.299  1.00 21.79  ? 269  ALA A C     1 
ATOM   2027  O  O     . ALA A 1 268  ? -37.541 -83.616  62.855  1.00 17.83  ? 269  ALA A O     1 
ATOM   2028  C  CB    . ALA A 1 268  ? -38.691 -84.332  60.184  1.00 21.39  ? 269  ALA A CB    1 
ATOM   2029  N  N     . GLU A 1 269  ? -36.619 -85.629  62.248  1.00 21.56  ? 270  GLU A N     1 
ATOM   2030  C  CA    . GLU A 1 269  ? -35.298 -85.373  62.812  1.00 25.61  ? 270  GLU A CA    1 
ATOM   2031  C  C     . GLU A 1 269  ? -34.228 -84.938  61.777  1.00 25.30  ? 270  GLU A C     1 
ATOM   2032  O  O     . GLU A 1 269  ? -33.207 -84.317  62.116  1.00 24.56  ? 270  GLU A O     1 
ATOM   2033  C  CB    . GLU A 1 269  ? -34.767 -86.624  63.517  1.00 28.58  ? 270  GLU A CB    1 
ATOM   2034  C  CG    . GLU A 1 269  ? -35.675 -86.984  64.684  1.00 34.71  ? 270  GLU A CG    1 
ATOM   2035  C  CD    . GLU A 1 269  ? -35.282 -88.322  65.291  1.00 38.97  ? 270  GLU A CD    1 
ATOM   2036  O  OE1   . GLU A 1 269  ? -35.171 -88.391  66.529  1.00 42.29  ? 270  GLU A OE1   1 
ATOM   2037  O  OE2   . GLU A 1 269  ? -35.092 -89.283  64.520  1.00 40.99  ? 270  GLU A OE2   1 
ATOM   2038  N  N     . ARG A 1 270  ? -34.459 -85.319  60.543  1.00 22.49  ? 271  ARG A N     1 
ATOM   2039  C  CA    . ARG A 1 270  ? -33.547 -84.959  59.426  1.00 21.96  ? 271  ARG A CA    1 
ATOM   2040  C  C     . ARG A 1 270  ? -34.328 -84.197  58.351  1.00 22.72  ? 271  ARG A C     1 
ATOM   2041  O  O     . ARG A 1 270  ? -35.257 -84.776  57.768  1.00 20.93  ? 271  ARG A O     1 
ATOM   2042  C  CB    . ARG A 1 270  ? -33.050 -86.279  58.874  1.00 19.68  ? 271  ARG A CB    1 
ATOM   2043  C  CG    . ARG A 1 270  ? -32.126 -86.997  59.886  1.00 20.39  ? 271  ARG A CG    1 
ATOM   2044  C  CD    . ARG A 1 270  ? -31.759 -88.357  59.326  1.00 23.14  ? 271  ARG A CD    1 
ATOM   2045  N  NE    . ARG A 1 270  ? -32.893 -89.296  59.452  1.00 24.09  ? 271  ARG A NE    1 
ATOM   2046  C  CZ    . ARG A 1 270  ? -33.166 -90.211  58.519  1.00 25.18  ? 271  ARG A CZ    1 
ATOM   2047  N  NH1   . ARG A 1 270  ? -32.433 -90.293  57.420  1.00 22.66  ? 271  ARG A NH1   1 
ATOM   2048  N  NH2   . ARG A 1 270  ? -34.197 -91.076  58.678  1.00 24.55  ? 271  ARG A NH2   1 
ATOM   2049  N  N     . VAL A 1 271  ? -33.962 -82.976  58.035  1.00 19.10  ? 272  VAL A N     1 
ATOM   2050  C  CA    . VAL A 1 271  ? -34.685 -82.113  57.117  1.00 18.19  ? 272  VAL A CA    1 
ATOM   2051  C  C     . VAL A 1 271  ? -33.757 -81.566  55.999  1.00 19.04  ? 272  VAL A C     1 
ATOM   2052  O  O     . VAL A 1 271  ? -32.645 -81.136  56.278  1.00 18.43  ? 272  VAL A O     1 
ATOM   2053  C  CB    . VAL A 1 271  ? -35.212 -80.880  57.853  1.00 20.10  ? 272  VAL A CB    1 
ATOM   2054  C  CG1   . VAL A 1 271  ? -35.957 -79.897  56.945  1.00 18.74  ? 272  VAL A CG1   1 
ATOM   2055  C  CG2   . VAL A 1 271  ? -36.224 -81.323  58.945  1.00 21.27  ? 272  VAL A CG2   1 
ATOM   2056  N  N     . ILE A 1 272  ? -34.244 -81.556  54.791  1.00 18.47  ? 273  ILE A N     1 
ATOM   2057  C  CA    . ILE A 1 272  ? -33.528 -80.955  53.642  1.00 16.97  ? 273  ILE A CA    1 
ATOM   2058  C  C     . ILE A 1 272  ? -34.129 -79.562  53.465  1.00 17.36  ? 273  ILE A C     1 
ATOM   2059  O  O     . ILE A 1 272  ? -35.316 -79.363  53.697  1.00 18.23  ? 273  ILE A O     1 
ATOM   2060  C  CB    . ILE A 1 272  ? -33.711 -81.781  52.353  1.00 18.42  ? 273  ILE A CB    1 
ATOM   2061  C  CG1   . ILE A 1 272  ? -32.965 -83.104  52.533  1.00 17.49  ? 273  ILE A CG1   1 
ATOM   2062  C  CG2   . ILE A 1 272  ? -33.273 -81.071  51.082  1.00 18.31  ? 273  ILE A CG2   1 
ATOM   2063  C  CD1   . ILE A 1 272  ? -33.086 -84.100  51.395  1.00 20.55  ? 273  ILE A CD1   1 
ATOM   2064  N  N     . VAL A 1 273  ? -33.326 -78.584  53.066  1.00 17.02  ? 274  VAL A N     1 
ATOM   2065  C  CA    . VAL A 1 273  ? -33.816 -77.273  52.588  1.00 18.11  ? 274  VAL A CA    1 
ATOM   2066  C  C     . VAL A 1 273  ? -33.429 -77.200  51.099  1.00 17.90  ? 274  VAL A C     1 
ATOM   2067  O  O     . VAL A 1 273  ? -32.272 -77.507  50.802  1.00 16.20  ? 274  VAL A O     1 
ATOM   2068  C  CB    . VAL A 1 273  ? -33.190 -76.091  53.342  1.00 17.07  ? 274  VAL A CB    1 
ATOM   2069  C  CG1   . VAL A 1 273  ? -33.786 -74.751  52.895  1.00 17.02  ? 274  VAL A CG1   1 
ATOM   2070  C  CG2   . VAL A 1 273  ? -33.451 -76.289  54.826  1.00 14.71  ? 274  VAL A CG2   1 
ATOM   2071  N  N     . SER A 1 274  ? -34.390 -76.905  50.212  1.00 16.49  ? 275  SER A N     1 
ATOM   2072  C  CA    . SER A 1 274  ? -34.058 -76.970  48.767  1.00 16.08  ? 275  SER A CA    1 
ATOM   2073  C  C     . SER A 1 274  ? -34.952 -76.028  47.999  1.00 14.18  ? 275  SER A C     1 
ATOM   2074  O  O     . SER A 1 274  ? -35.934 -75.474  48.559  1.00 14.89  ? 275  SER A O     1 
ATOM   2075  C  CB    . SER A 1 274  ? -34.024 -78.389  48.242  1.00 18.45  ? 275  SER A CB    1 
ATOM   2076  O  OG    . SER A 1 274  ? -33.462 -78.388  46.920  1.00 18.91  ? 275  SER A OG    1 
ATOM   2077  N  N     . MET A 1 275  ? -34.621 -75.753  46.722  1.00 13.83  ? 276  MET A N     1 
ATOM   2078  C  CA    . MET A 1 275  ? -35.367 -74.784  45.959  1.00 13.35  ? 276  MET A CA    1 
ATOM   2079  C  C     . MET A 1 275  ? -35.454 -75.231  44.500  1.00 12.79  ? 276  MET A C     1 
ATOM   2080  O  O     . MET A 1 275  ? -34.478 -75.726  43.936  1.00 14.23  ? 276  MET A O     1 
ATOM   2081  C  CB    . MET A 1 275  ? -34.560 -73.453  46.129  1.00 17.10  ? 276  MET A CB    1 
ATOM   2082  C  CG    . MET A 1 275  ? -35.168 -72.257  45.386  1.00 18.14  ? 276  MET A CG    1 
ATOM   2083  S  SD    . MET A 1 275  ? -34.446 -70.717  46.048  1.00 15.74  ? 276  MET A SD    1 
ATOM   2084  C  CE    . MET A 1 275  ? -32.794 -70.901  45.384  1.00 16.73  ? 276  MET A CE    1 
ATOM   2085  N  N     . GLY A 1 276  ? -36.564 -75.033  43.838  1.00 13.43  ? 277  GLY A N     1 
ATOM   2086  C  CA    . GLY A 1 276  ? -36.729 -75.385  42.442  1.00 14.31  ? 277  GLY A CA    1 
ATOM   2087  C  C     . GLY A 1 276  ? -37.198 -76.834  42.303  1.00 17.02  ? 277  GLY A C     1 
ATOM   2088  O  O     . GLY A 1 276  ? -37.643 -77.492  43.280  1.00 16.00  ? 277  GLY A O     1 
ATOM   2089  N  N     . SER A 1 277  ? -37.092 -77.383  41.090  1.00 17.52  ? 278  SER A N     1 
ATOM   2090  C  CA    . SER A 1 277  ? -37.664 -78.688  40.773  1.00 18.38  ? 278  SER A CA    1 
ATOM   2091  C  C     . SER A 1 277  ? -37.253 -79.862  41.649  1.00 20.31  ? 278  SER A C     1 
ATOM   2092  O  O     . SER A 1 277  ? -37.995 -80.844  41.820  1.00 19.13  ? 278  SER A O     1 
ATOM   2093  C  CB    . SER A 1 277  ? -37.451 -79.005  39.270  1.00 17.19  ? 278  SER A CB    1 
ATOM   2094  O  OG    . SER A 1 277  ? -36.066 -79.350  39.089  1.00 16.56  ? 278  SER A OG    1 
ATOM   2095  N  N     . SER A 1 278  ? -36.075 -79.786  42.282  1.00 19.69  ? 279  SER A N     1 
ATOM   2096  C  CA    . SER A 1 278  ? -35.581 -80.795  43.201  1.00 16.15  ? 279  SER A CA    1 
ATOM   2097  C  C     . SER A 1 278  ? -36.597 -81.022  44.319  1.00 18.29  ? 279  SER A C     1 
ATOM   2098  O  O     . SER A 1 278  ? -36.829 -82.103  44.788  1.00 16.13  ? 279  SER A O     1 
ATOM   2099  C  CB    . SER A 1 278  ? -34.252 -80.262  43.752  1.00 16.02  ? 279  SER A CB    1 
ATOM   2100  O  OG    . SER A 1 278  ? -34.401 -79.122  44.631  1.00 15.59  ? 279  SER A OG    1 
ATOM   2101  N  N     . CYS A 1 279  ? -37.350 -79.974  44.722  1.00 14.00  ? 280  CYS A N     1 
ATOM   2102  C  CA    . CYS A 1 279  ? -38.343 -80.101  45.778  1.00 18.70  ? 280  CYS A CA    1 
ATOM   2103  C  C     . CYS A 1 279  ? -39.442 -81.135  45.445  1.00 18.24  ? 280  CYS A C     1 
ATOM   2104  O  O     . CYS A 1 279  ? -40.001 -81.720  46.376  1.00 18.92  ? 280  CYS A O     1 
ATOM   2105  C  CB    . CYS A 1 279  ? -39.037 -78.746  46.065  1.00 15.98  ? 280  CYS A CB    1 
ATOM   2106  S  SG    . CYS A 1 279  ? -37.912 -77.560  46.938  1.00 17.65  ? 280  CYS A SG    1 
ATOM   2107  N  N     . GLU A 1 280  ? -39.833 -81.279  44.187  1.00 17.36  ? 281  GLU A N     1 
ATOM   2108  C  CA    . GLU A 1 280  ? -40.888 -82.213  43.842  1.00 19.98  ? 281  GLU A CA    1 
ATOM   2109  C  C     . GLU A 1 280  ? -40.404 -83.636  44.147  1.00 19.49  ? 281  GLU A C     1 
ATOM   2110  O  O     . GLU A 1 280  ? -41.119 -84.486  44.686  1.00 17.64  ? 281  GLU A O     1 
ATOM   2111  C  CB    . GLU A 1 280  ? -41.287 -82.067  42.354  1.00 19.22  ? 281  GLU A CB    1 
ATOM   2112  C  CG    . GLU A 1 280  ? -42.102 -80.770  42.107  1.00 20.00  ? 281  GLU A CG    1 
ATOM   2113  C  CD    . GLU A 1 280  ? -43.541 -80.930  42.615  1.00 23.51  ? 281  GLU A CD    1 
ATOM   2114  O  OE1   . GLU A 1 280  ? -43.845 -80.560  43.771  1.00 22.38  ? 281  GLU A OE1   1 
ATOM   2115  O  OE2   . GLU A 1 280  ? -44.368 -81.440  41.839  1.00 21.29  ? 281  GLU A OE2   1 
ATOM   2116  N  N     . THR A 1 281  ? -39.190 -83.929  43.681  1.00 17.99  ? 282  THR A N     1 
ATOM   2117  C  CA    . THR A 1 281  ? -38.602 -85.278  43.767  1.00 18.02  ? 282  THR A CA    1 
ATOM   2118  C  C     . THR A 1 281  ? -38.349 -85.563  45.224  1.00 18.07  ? 282  THR A C     1 
ATOM   2119  O  O     . THR A 1 281  ? -38.634 -86.678  45.675  1.00 17.63  ? 282  THR A O     1 
ATOM   2120  C  CB    . THR A 1 281  ? -37.334 -85.470  42.905  1.00 17.19  ? 282  THR A CB    1 
ATOM   2121  O  OG1   . THR A 1 281  ? -37.663 -85.444  41.504  1.00 17.83  ? 282  THR A OG1   1 
ATOM   2122  C  CG2   . THR A 1 281  ? -36.631 -86.819  43.158  1.00 18.29  ? 282  THR A CG2   1 
ATOM   2123  N  N     . ILE A 1 282  ? -37.966 -84.526  45.991  1.00 18.24  ? 283  ILE A N     1 
ATOM   2124  C  CA    . ILE A 1 282  ? -37.694 -84.777  47.417  1.00 17.04  ? 283  ILE A CA    1 
ATOM   2125  C  C     . ILE A 1 282  ? -39.001 -85.138  48.126  1.00 18.65  ? 283  ILE A C     1 
ATOM   2126  O  O     . ILE A 1 282  ? -39.095 -86.136  48.848  1.00 16.73  ? 283  ILE A O     1 
ATOM   2127  C  CB    . ILE A 1 282  ? -36.999 -83.554  48.087  1.00 15.78  ? 283  ILE A CB    1 
ATOM   2128  C  CG1   . ILE A 1 282  ? -35.548 -83.401  47.550  1.00 15.41  ? 283  ILE A CG1   1 
ATOM   2129  C  CG2   . ILE A 1 282  ? -36.898 -83.698  49.631  1.00 17.32  ? 283  ILE A CG2   1 
ATOM   2130  C  CD1   . ILE A 1 282  ? -35.018 -81.919  47.795  1.00 12.77  ? 283  ILE A CD1   1 
ATOM   2131  N  N     . GLU A 1 283  ? -40.064 -84.419  47.823  1.00 17.47  ? 284  GLU A N     1 
ATOM   2132  C  CA    . GLU A 1 283  ? -41.405 -84.666  48.361  1.00 17.73  ? 284  GLU A CA    1 
ATOM   2133  C  C     . GLU A 1 283  ? -41.842 -86.107  48.015  1.00 19.77  ? 284  GLU A C     1 
ATOM   2134  O  O     . GLU A 1 283  ? -42.302 -86.772  48.946  1.00 20.32  ? 284  GLU A O     1 
ATOM   2135  C  CB    . GLU A 1 283  ? -42.467 -83.694  47.869  1.00 18.15  ? 284  GLU A CB    1 
ATOM   2136  C  CG    . GLU A 1 283  ? -43.775 -83.934  48.657  1.00 22.31  ? 284  GLU A CG    1 
ATOM   2137  C  CD    . GLU A 1 283  ? -44.806 -82.837  48.608  1.00 24.26  ? 284  GLU A CD    1 
ATOM   2138  O  OE1   . GLU A 1 283  ? -45.823 -82.995  49.358  1.00 25.67  ? 284  GLU A OE1   1 
ATOM   2139  O  OE2   . GLU A 1 283  ? -44.724 -81.826  47.854  1.00 23.60  ? 284  GLU A OE2   1 
ATOM   2140  N  N     . GLU A 1 284  ? -41.711 -86.517  46.752  1.00 18.75  ? 285  GLU A N     1 
ATOM   2141  C  CA    . GLU A 1 284  ? -42.047 -87.879  46.347  1.00 20.65  ? 285  GLU A CA    1 
ATOM   2142  C  C     . GLU A 1 284  ? -41.342 -88.887  47.263  1.00 22.26  ? 285  GLU A C     1 
ATOM   2143  O  O     . GLU A 1 284  ? -41.995 -89.749  47.849  1.00 20.17  ? 285  GLU A O     1 
ATOM   2144  C  CB    . GLU A 1 284  ? -41.642 -88.162  44.919  1.00 20.86  ? 285  GLU A CB    1 
ATOM   2145  C  CG    . GLU A 1 284  ? -41.972 -89.501  44.307  1.00 21.11  ? 285  GLU A CG    1 
ATOM   2146  C  CD    . GLU A 1 284  ? -41.558 -89.670  42.866  1.00 23.14  ? 285  GLU A CD    1 
ATOM   2147  O  OE1   . GLU A 1 284  ? -40.574 -90.430  42.669  1.00 22.03  ? 285  GLU A OE1   1 
ATOM   2148  O  OE2   . GLU A 1 284  ? -42.224 -89.059  42.000  1.00 23.76  ? 285  GLU A OE2   1 
ATOM   2149  N  N     . VAL A 1 285  ? -40.009 -88.732  47.406  1.00 19.94  ? 286  VAL A N     1 
ATOM   2150  C  CA    . VAL A 1 285  ? -39.248 -89.672  48.239  1.00 20.78  ? 286  VAL A CA    1 
ATOM   2151  C  C     . VAL A 1 285  ? -39.691 -89.585  49.700  1.00 21.08  ? 286  VAL A C     1 
ATOM   2152  O  O     . VAL A 1 285  ? -39.832 -90.632  50.379  1.00 19.94  ? 286  VAL A O     1 
ATOM   2153  C  CB    . VAL A 1 285  ? -37.742 -89.435  48.074  1.00 20.41  ? 286  VAL A CB    1 
ATOM   2154  C  CG1   . VAL A 1 285  ? -36.909 -90.269  49.050  1.00 19.16  ? 286  VAL A CG1   1 
ATOM   2155  C  CG2   . VAL A 1 285  ? -37.317 -89.776  46.636  1.00 18.11  ? 286  VAL A CG2   1 
ATOM   2156  N  N     . ILE A 1 286  ? -39.957 -88.397  50.207  1.00 17.99  ? 287  ILE A N     1 
ATOM   2157  C  CA    . ILE A 1 286  ? -40.461 -88.307  51.593  1.00 20.04  ? 287  ILE A CA    1 
ATOM   2158  C  C     . ILE A 1 286  ? -41.747 -89.126  51.776  1.00 21.96  ? 287  ILE A C     1 
ATOM   2159  O  O     . ILE A 1 286  ? -41.935 -89.787  52.816  1.00 21.59  ? 287  ILE A O     1 
ATOM   2160  C  CB    . ILE A 1 286  ? -40.688 -86.841  51.980  1.00 19.19  ? 287  ILE A CB    1 
ATOM   2161  C  CG1   . ILE A 1 286  ? -39.327 -86.147  52.184  1.00 17.83  ? 287  ILE A CG1   1 
ATOM   2162  C  CG2   . ILE A 1 286  ? -41.500 -86.692  53.289  1.00 20.66  ? 287  ILE A CG2   1 
ATOM   2163  C  CD1   . ILE A 1 286  ? -39.470 -84.591  52.304  1.00 14.79  ? 287  ILE A CD1   1 
ATOM   2164  N  N     . ASN A 1 287  ? -42.664 -89.089  50.816  1.00 19.85  ? 288  ASN A N     1 
ATOM   2165  C  CA    . ASN A 1 287  ? -43.953 -89.752  50.948  1.00 21.27  ? 288  ASN A CA    1 
ATOM   2166  C  C     . ASN A 1 287  ? -43.721 -91.269  51.081  1.00 21.97  ? 288  ASN A C     1 
ATOM   2167  O  O     . ASN A 1 287  ? -44.346 -91.925  51.935  1.00 20.83  ? 288  ASN A O     1 
ATOM   2168  C  CB    . ASN A 1 287  ? -44.827 -89.475  49.727  1.00 20.70  ? 288  ASN A CB    1 
ATOM   2169  C  CG    . ASN A 1 287  ? -45.410 -88.069  49.684  1.00 18.24  ? 288  ASN A CG    1 
ATOM   2170  O  OD1   . ASN A 1 287  ? -45.961 -87.653  48.658  1.00 22.06  ? 288  ASN A OD1   1 
ATOM   2171  N  ND2   . ASN A 1 287  ? -45.389 -87.349  50.768  1.00 18.61  ? 288  ASN A ND2   1 
ATOM   2172  N  N     . HIS A 1 288  ? -42.807 -91.748  50.293  1.00 18.73  ? 289  HIS A N     1 
ATOM   2173  C  CA    . HIS A 1 288  ? -42.397 -93.141  50.307  1.00 21.73  ? 289  HIS A CA    1 
ATOM   2174  C  C     . HIS A 1 288  ? -41.763 -93.563  51.644  1.00 23.81  ? 289  HIS A C     1 
ATOM   2175  O  O     . HIS A 1 288  ? -42.208 -94.450  52.362  1.00 21.74  ? 289  HIS A O     1 
ATOM   2176  C  CB    . HIS A 1 288  ? -41.330 -93.335  49.236  1.00 22.22  ? 289  HIS A CB    1 
ATOM   2177  C  CG    . HIS A 1 288  ? -40.960 -94.777  49.081  1.00 24.52  ? 289  HIS A CG    1 
ATOM   2178  N  ND1   . HIS A 1 288  ? -39.835 -95.309  49.706  1.00 27.54  ? 289  HIS A ND1   1 
ATOM   2179  C  CD2   . HIS A 1 288  ? -41.554 -95.763  48.406  1.00 25.18  ? 289  HIS A CD2   1 
ATOM   2180  C  CE1   . HIS A 1 288  ? -39.766 -96.605  49.370  1.00 27.57  ? 289  HIS A CE1   1 
ATOM   2181  N  NE2   . HIS A 1 288  ? -40.802 -96.896  48.598  1.00 27.79  ? 289  HIS A NE2   1 
ATOM   2182  N  N     . LEU A 1 289  ? -40.652 -92.923  51.980  1.00 21.46  ? 290  LEU A N     1 
ATOM   2183  C  CA    . LEU A 1 289  ? -39.923 -93.195  53.215  1.00 21.22  ? 290  LEU A CA    1 
ATOM   2184  C  C     . LEU A 1 289  ? -40.623 -92.871  54.525  1.00 20.37  ? 290  LEU A C     1 
ATOM   2185  O  O     . LEU A 1 289  ? -40.580 -93.666  55.505  1.00 19.62  ? 290  LEU A O     1 
ATOM   2186  C  CB    . LEU A 1 289  ? -38.642 -92.333  53.119  1.00 21.84  ? 290  LEU A CB    1 
ATOM   2187  C  CG    . LEU A 1 289  ? -37.334 -93.033  52.828  1.00 26.67  ? 290  LEU A CG    1 
ATOM   2188  C  CD1   . LEU A 1 289  ? -37.409 -94.358  52.114  1.00 25.85  ? 290  LEU A CD1   1 
ATOM   2189  C  CD2   . LEU A 1 289  ? -36.314 -92.075  52.198  1.00 20.80  ? 290  LEU A CD2   1 
ATOM   2190  N  N     . ALA A 1 290  ? -41.359 -91.740  54.607  1.00 18.20  ? 291  ALA A N     1 
ATOM   2191  C  CA    . ALA A 1 290  ? -42.022 -91.370  55.840  1.00 20.07  ? 291  ALA A CA    1 
ATOM   2192  C  C     . ALA A 1 290  ? -43.144 -92.417  56.153  1.00 21.16  ? 291  ALA A C     1 
ATOM   2193  O  O     . ALA A 1 290  ? -43.347 -92.645  57.342  1.00 20.36  ? 291  ALA A O     1 
ATOM   2194  C  CB    . ALA A 1 290  ? -42.660 -90.003  55.886  1.00 19.31  ? 291  ALA A CB    1 
ATOM   2195  N  N     . ALA A 1 291  ? -43.740 -92.961  55.102  1.00 19.38  ? 292  ALA A N     1 
ATOM   2196  C  CA    . ALA A 1 291  ? -44.784 -93.983  55.383  1.00 24.16  ? 292  ALA A CA    1 
ATOM   2197  C  C     . ALA A 1 291  ? -44.220 -95.264  55.993  1.00 25.82  ? 292  ALA A C     1 
ATOM   2198  O  O     . ALA A 1 291  ? -44.938 -96.130  56.524  1.00 24.84  ? 292  ALA A O     1 
ATOM   2199  C  CB    . ALA A 1 291  ? -45.469 -94.327  54.044  1.00 22.06  ? 292  ALA A CB    1 
ATOM   2200  N  N     . LYS A 1 292  ? -42.903 -95.432  55.849  1.00 27.17  ? 293  LYS A N     1 
ATOM   2201  C  CA    . LYS A 1 292  ? -42.138 -96.531  56.366  1.00 29.34  ? 293  LYS A CA    1 
ATOM   2202  C  C     . LYS A 1 292  ? -41.592 -96.172  57.755  1.00 29.33  ? 293  LYS A C     1 
ATOM   2203  O  O     . LYS A 1 292  ? -40.917 -96.990  58.373  1.00 32.49  ? 293  LYS A O     1 
ATOM   2204  C  CB    . LYS A 1 292  ? -40.963 -96.966  55.478  1.00 31.54  ? 293  LYS A CB    1 
ATOM   2205  C  CG    . LYS A 1 292  ? -41.424 -97.538  54.149  1.00 32.91  ? 293  LYS A CG    1 
ATOM   2206  C  CD    . LYS A 1 292  ? -40.228 -97.911  53.288  1.00 35.74  ? 293  LYS A CD    1 
ATOM   2207  C  CE    . LYS A 1 292  ? -40.535 -99.210  52.565  1.00 37.57  ? 293  LYS A CE    1 
ATOM   2208  N  NZ    . LYS A 1 292  ? -41.016 -98.923  51.200  1.00 39.26  ? 293  LYS A NZ    1 
ATOM   2209  N  N     . GLY A 1 293  ? -41.916 -95.002  58.277  1.00 26.78  ? 294  GLY A N     1 
ATOM   2210  C  CA    . GLY A 1 293  ? -41.478 -94.655  59.620  1.00 26.08  ? 294  GLY A CA    1 
ATOM   2211  C  C     . GLY A 1 293  ? -40.314 -93.677  59.623  1.00 25.11  ? 294  GLY A C     1 
ATOM   2212  O  O     . GLY A 1 293  ? -40.049 -93.124  60.694  1.00 24.60  ? 294  GLY A O     1 
ATOM   2213  N  N     . GLU A 1 294  ? -39.757 -93.326  58.463  1.00 23.79  ? 295  GLU A N     1 
ATOM   2214  C  CA    . GLU A 1 294  ? -38.615 -92.371  58.526  1.00 25.30  ? 295  GLU A CA    1 
ATOM   2215  C  C     . GLU A 1 294  ? -39.017 -90.971  58.967  1.00 23.37  ? 295  GLU A C     1 
ATOM   2216  O  O     . GLU A 1 294  ? -39.960 -90.351  58.489  1.00 22.60  ? 295  GLU A O     1 
ATOM   2217  C  CB    . GLU A 1 294  ? -37.855 -92.361  57.203  1.00 24.46  ? 295  GLU A CB    1 
ATOM   2218  C  CG    . GLU A 1 294  ? -37.240 -93.729  56.922  1.00 27.21  ? 295  GLU A CG    1 
ATOM   2219  C  CD    . GLU A 1 294  ? -35.909 -93.609  56.171  1.00 29.37  ? 295  GLU A CD    1 
ATOM   2220  O  OE1   . GLU A 1 294  ? -35.168 -92.597  56.347  1.00 30.87  ? 295  GLU A OE1   1 
ATOM   2221  O  OE2   . GLU A 1 294  ? -35.649 -94.521  55.376  1.00 28.94  ? 295  GLU A OE2   1 
ATOM   2222  N  N     . LYS A 1 295  ? -38.304 -90.455  59.955  1.00 23.00  ? 296  LYS A N     1 
ATOM   2223  C  CA    . LYS A 1 295  ? -38.558 -89.128  60.494  1.00 24.11  ? 296  LYS A CA    1 
ATOM   2224  C  C     . LYS A 1 295  ? -37.824 -88.055  59.666  1.00 24.06  ? 296  LYS A C     1 
ATOM   2225  O  O     . LYS A 1 295  ? -36.898 -87.442  60.159  1.00 24.57  ? 296  LYS A O     1 
ATOM   2226  C  CB    . LYS A 1 295  ? -38.196 -89.052  61.959  1.00 25.07  ? 296  LYS A CB    1 
ATOM   2227  C  CG    . LYS A 1 295  ? -38.745 -90.279  62.743  1.00 28.86  ? 296  LYS A CG    1 
ATOM   2228  C  CD    . LYS A 1 295  ? -40.193 -90.011  63.111  1.00 31.88  ? 296  LYS A CD    1 
ATOM   2229  C  CE    . LYS A 1 295  ? -40.502 -90.686  64.462  1.00 34.73  ? 296  LYS A CE    1 
ATOM   2230  N  NZ    . LYS A 1 295  ? -41.971 -90.583  64.740  1.00 35.42  ? 296  LYS A NZ    1 
ATOM   2231  N  N     . ILE A 1 296  ? -38.366 -87.813  58.479  1.00 22.02  ? 297  ILE A N     1 
ATOM   2232  C  CA    . ILE A 1 296  ? -37.750 -86.875  57.538  1.00 22.93  ? 297  ILE A CA    1 
ATOM   2233  C  C     . ILE A 1 296  ? -38.728 -85.824  57.018  1.00 22.31  ? 297  ILE A C     1 
ATOM   2234  O  O     . ILE A 1 296  ? -39.950 -86.054  56.877  1.00 20.14  ? 297  ILE A O     1 
ATOM   2235  C  CB    . ILE A 1 296  ? -37.161 -87.709  56.389  1.00 21.80  ? 297  ILE A CB    1 
ATOM   2236  C  CG1   . ILE A 1 296  ? -38.281 -88.493  55.662  1.00 21.60  ? 297  ILE A CG1   1 
ATOM   2237  C  CG2   . ILE A 1 296  ? -36.081 -88.680  56.902  1.00 22.75  ? 297  ILE A CG2   1 
ATOM   2238  C  CD1   . ILE A 1 296  ? -37.676 -89.227  54.449  1.00 19.39  ? 297  ILE A CD1   1 
ATOM   2239  N  N     . GLY A 1 297  ? -38.137 -84.709  56.566  1.00 20.13  ? 298  GLY A N     1 
ATOM   2240  C  CA    . GLY A 1 297  ? -38.927 -83.588  56.049  1.00 19.80  ? 298  GLY A CA    1 
ATOM   2241  C  C     . GLY A 1 297  ? -38.134 -82.720  55.057  1.00 21.15  ? 298  GLY A C     1 
ATOM   2242  O  O     . GLY A 1 297  ? -36.977 -83.045  54.723  1.00 18.27  ? 298  GLY A O     1 
ATOM   2243  N  N     . LEU A 1 298  ? -38.827 -81.715  54.549  1.00 19.55  ? 299  LEU A N     1 
ATOM   2244  C  CA    . LEU A 1 298  ? -38.245 -80.832  53.535  1.00 18.54  ? 299  LEU A CA    1 
ATOM   2245  C  C     . LEU A 1 298  ? -38.844 -79.450  53.753  1.00 17.90  ? 299  LEU A C     1 
ATOM   2246  O  O     . LEU A 1 298  ? -40.069 -79.271  53.924  1.00 17.57  ? 299  LEU A O     1 
ATOM   2247  C  CB    . LEU A 1 298  ? -38.583 -81.304  52.108  1.00 18.74  ? 299  LEU A CB    1 
ATOM   2248  C  CG    . LEU A 1 298  ? -38.456 -80.236  50.956  1.00 20.17  ? 299  LEU A CG    1 
ATOM   2249  C  CD1   . LEU A 1 298  ? -36.985 -80.054  50.569  1.00 18.13  ? 299  LEU A CD1   1 
ATOM   2250  C  CD2   . LEU A 1 298  ? -39.294 -80.706  49.754  1.00 18.04  ? 299  LEU A CD2   1 
ATOM   2251  N  N     . ILE A 1 299  ? -37.979 -78.435  53.667  1.00 14.96  ? 300  ILE A N     1 
ATOM   2252  C  CA    . ILE A 1 299  ? -38.434 -77.033  53.658  1.00 14.65  ? 300  ILE A CA    1 
ATOM   2253  C  C     . ILE A 1 299  ? -38.208 -76.599  52.200  1.00 15.80  ? 300  ILE A C     1 
ATOM   2254  O  O     . ILE A 1 299  ? -37.060 -76.540  51.672  1.00 16.46  ? 300  ILE A O     1 
ATOM   2255  C  CB    . ILE A 1 299  ? -37.672 -76.119  54.599  1.00 15.97  ? 300  ILE A CB    1 
ATOM   2256  C  CG1   . ILE A 1 299  ? -38.043 -76.522  56.055  1.00 17.63  ? 300  ILE A CG1   1 
ATOM   2257  C  CG2   . ILE A 1 299  ? -37.993 -74.633  54.439  1.00 15.65  ? 300  ILE A CG2   1 
ATOM   2258  C  CD1   . ILE A 1 299  ? -37.206 -75.867  57.151  1.00 18.45  ? 300  ILE A CD1   1 
ATOM   2259  N  N     . LYS A 1 300  ? -39.277 -76.230  51.537  1.00 16.15  ? 301  LYS A N     1 
ATOM   2260  C  CA    . LYS A 1 300  ? -39.248 -75.715  50.175  1.00 17.09  ? 301  LYS A CA    1 
ATOM   2261  C  C     . LYS A 1 300  ? -39.034 -74.195  50.221  1.00 16.20  ? 301  LYS A C     1 
ATOM   2262  O  O     . LYS A 1 300  ? -39.839 -73.513  50.841  1.00 15.94  ? 301  LYS A O     1 
ATOM   2263  C  CB    . LYS A 1 300  ? -40.568 -76.018  49.472  1.00 16.07  ? 301  LYS A CB    1 
ATOM   2264  C  CG    . LYS A 1 300  ? -40.826 -77.553  49.422  1.00 17.57  ? 301  LYS A CG    1 
ATOM   2265  C  CD    . LYS A 1 300  ? -42.073 -77.772  48.544  1.00 17.63  ? 301  LYS A CD    1 
ATOM   2266  C  CE    . LYS A 1 300  ? -42.620 -79.171  48.542  1.00 18.34  ? 301  LYS A CE    1 
ATOM   2267  N  NZ    . LYS A 1 300  ? -43.887 -79.249  47.721  1.00 18.62  ? 301  LYS A NZ    1 
ATOM   2268  N  N     . VAL A 1 301  ? -38.058 -73.637  49.540  1.00 16.80  ? 302  VAL A N     1 
ATOM   2269  C  CA    . VAL A 1 301  ? -38.002 -72.136  49.566  1.00 15.58  ? 302  VAL A CA    1 
ATOM   2270  C  C     . VAL A 1 301  ? -38.705 -71.573  48.354  1.00 12.82  ? 302  VAL A C     1 
ATOM   2271  O  O     . VAL A 1 301  ? -38.380 -71.948  47.224  1.00 17.03  ? 302  VAL A O     1 
ATOM   2272  C  CB    . VAL A 1 301  ? -36.658 -71.519  49.923  1.00 19.34  ? 302  VAL A CB    1 
ATOM   2273  C  CG1   . VAL A 1 301  ? -35.555 -72.452  50.292  1.00 16.09  ? 302  VAL A CG1   1 
ATOM   2274  C  CG2   . VAL A 1 301  ? -36.172 -70.253  49.220  1.00 16.95  ? 302  VAL A CG2   1 
ATOM   2275  N  N     . ARG A 1 302  ? -39.684 -70.715  48.578  1.00 13.87  ? 303  ARG A N     1 
ATOM   2276  C  CA    . ARG A 1 302  ? -40.417 -70.024  47.529  1.00 14.14  ? 303  ARG A CA    1 
ATOM   2277  C  C     . ARG A 1 302  ? -39.796 -68.606  47.433  1.00 16.07  ? 303  ARG A C     1 
ATOM   2278  O  O     . ARG A 1 302  ? -39.188 -68.270  46.393  1.00 15.92  ? 303  ARG A O     1 
ATOM   2279  C  CB    . ARG A 1 302  ? -41.888 -69.803  47.931  1.00 16.70  ? 303  ARG A CB    1 
ATOM   2280  C  CG    . ARG A 1 302  ? -42.785 -71.023  47.777  1.00 17.76  ? 303  ARG A CG    1 
ATOM   2281  C  CD    . ARG A 1 302  ? -42.275 -72.292  48.480  1.00 19.18  ? 303  ARG A CD    1 
ATOM   2282  N  NE    . ARG A 1 302  ? -43.459 -73.219  48.586  1.00 19.60  ? 303  ARG A NE    1 
ATOM   2283  C  CZ    . ARG A 1 302  ? -43.711 -74.136  47.653  1.00 21.94  ? 303  ARG A CZ    1 
ATOM   2284  N  NH1   . ARG A 1 302  ? -44.792 -74.923  47.805  1.00 21.93  ? 303  ARG A NH1   1 
ATOM   2285  N  NH2   . ARG A 1 302  ? -42.964 -74.290  46.562  1.00 22.06  ? 303  ARG A NH2   1 
ATOM   2286  N  N     . LEU A 1 303  ? -39.866 -67.825  48.504  1.00 15.13  ? 304  LEU A N     1 
ATOM   2287  C  CA    . LEU A 1 303  ? -39.247 -66.477  48.400  1.00 14.96  ? 304  LEU A CA    1 
ATOM   2288  C  C     . LEU A 1 303  ? -37.801 -66.560  48.924  1.00 17.09  ? 304  LEU A C     1 
ATOM   2289  O  O     . LEU A 1 303  ? -37.544 -66.748  50.125  1.00 17.62  ? 304  LEU A O     1 
ATOM   2290  C  CB    . LEU A 1 303  ? -40.026 -65.491  49.265  1.00 14.08  ? 304  LEU A CB    1 
ATOM   2291  C  CG    . LEU A 1 303  ? -39.665 -63.983  49.058  1.00 13.65  ? 304  LEU A CG    1 
ATOM   2292  C  CD1   . LEU A 1 303  ? -40.131 -63.568  47.637  1.00 14.45  ? 304  LEU A CD1   1 
ATOM   2293  C  CD2   . LEU A 1 303  ? -40.352 -63.102  50.070  1.00 12.69  ? 304  LEU A CD2   1 
ATOM   2294  N  N     . TYR A 1 304  ? -36.819 -66.477  48.031  1.00 14.53  ? 305  TYR A N     1 
ATOM   2295  C  CA    . TYR A 1 304  ? -35.402 -66.492  48.369  1.00 12.56  ? 305  TYR A CA    1 
ATOM   2296  C  C     . TYR A 1 304  ? -34.927 -65.087  48.708  1.00 14.23  ? 305  TYR A C     1 
ATOM   2297  O  O     . TYR A 1 304  ? -34.047 -64.981  49.619  1.00 15.43  ? 305  TYR A O     1 
ATOM   2298  C  CB    . TYR A 1 304  ? -34.615 -67.154  47.189  1.00 12.38  ? 305  TYR A CB    1 
ATOM   2299  C  CG    . TYR A 1 304  ? -33.118 -67.133  47.426  1.00 13.99  ? 305  TYR A CG    1 
ATOM   2300  C  CD1   . TYR A 1 304  ? -32.586 -67.919  48.438  1.00 17.98  ? 305  TYR A CD1   1 
ATOM   2301  C  CD2   . TYR A 1 304  ? -32.302 -66.236  46.740  1.00 16.89  ? 305  TYR A CD2   1 
ATOM   2302  C  CE1   . TYR A 1 304  ? -31.230 -67.845  48.752  1.00 16.58  ? 305  TYR A CE1   1 
ATOM   2303  C  CE2   . TYR A 1 304  ? -30.951 -66.149  47.070  1.00 18.31  ? 305  TYR A CE2   1 
ATOM   2304  C  CZ    . TYR A 1 304  ? -30.431 -66.987  48.046  1.00 15.59  ? 305  TYR A CZ    1 
ATOM   2305  O  OH    . TYR A 1 304  ? -29.070 -66.923  48.341  1.00 13.35  ? 305  TYR A OH    1 
ATOM   2306  N  N     . ARG A 1 305  ? -35.450 -63.999  48.122  1.00 14.34  ? 306  ARG A N     1 
ATOM   2307  C  CA    . ARG A 1 305  ? -35.096 -62.644  48.432  1.00 13.55  ? 306  ARG A CA    1 
ATOM   2308  C  C     . ARG A 1 305  ? -36.303 -61.725  48.471  1.00 15.95  ? 306  ARG A C     1 
ATOM   2309  O  O     . ARG A 1 305  ? -36.942 -61.921  47.464  1.00 15.80  ? 306  ARG A O     1 
ATOM   2310  C  CB    . ARG A 1 305  ? -34.094 -62.020  47.469  1.00 15.02  ? 306  ARG A CB    1 
ATOM   2311  C  CG    . ARG A 1 305  ? -32.669 -62.613  47.676  1.00 13.68  ? 306  ARG A CG    1 
ATOM   2312  C  CD    . ARG A 1 305  ? -31.984 -61.944  48.833  1.00 17.42  ? 306  ARG A CD    1 
ATOM   2313  N  NE    . ARG A 1 305  ? -30.623 -62.454  49.110  1.00 18.03  ? 306  ARG A NE    1 
ATOM   2314  C  CZ    . ARG A 1 305  ? -30.308 -63.595  49.699  1.00 19.31  ? 306  ARG A CZ    1 
ATOM   2315  N  NH1   . ARG A 1 305  ? -31.207 -64.505  50.138  1.00 15.89  ? 306  ARG A NH1   1 
ATOM   2316  N  NH2   . ARG A 1 305  ? -29.017 -63.848  49.867  1.00 15.91  ? 306  ARG A NH2   1 
ATOM   2317  N  N     . PRO A 1 306  ? -36.506 -60.988  49.496  1.00 17.16  ? 307  PRO A N     1 
ATOM   2318  C  CA    . PRO A 1 306  ? -35.892 -60.898  50.778  1.00 16.15  ? 307  PRO A CA    1 
ATOM   2319  C  C     . PRO A 1 306  ? -35.950 -62.268  51.483  1.00 18.49  ? 307  PRO A C     1 
ATOM   2320  O  O     . PRO A 1 306  ? -36.926 -63.022  51.260  1.00 16.80  ? 307  PRO A O     1 
ATOM   2321  C  CB    . PRO A 1 306  ? -36.676 -59.897  51.613  1.00 16.13  ? 307  PRO A CB    1 
ATOM   2322  C  CG    . PRO A 1 306  ? -37.119 -58.957  50.481  1.00 17.50  ? 307  PRO A CG    1 
ATOM   2323  C  CD    . PRO A 1 306  ? -37.613 -60.000  49.521  1.00 14.02  ? 307  PRO A CD    1 
ATOM   2324  N  N     . PHE A 1 307  ? -34.913 -62.551  52.256  1.00 17.15  ? 308  PHE A N     1 
ATOM   2325  C  CA    . PHE A 1 307  ? -34.821 -63.815  52.975  1.00 18.35  ? 308  PHE A CA    1 
ATOM   2326  C  C     . PHE A 1 307  ? -35.343 -63.604  54.405  1.00 19.49  ? 308  PHE A C     1 
ATOM   2327  O  O     . PHE A 1 307  ? -34.734 -62.879  55.186  1.00 20.29  ? 308  PHE A O     1 
ATOM   2328  C  CB    . PHE A 1 307  ? -33.393 -64.358  53.038  1.00 17.66  ? 308  PHE A CB    1 
ATOM   2329  C  CG    . PHE A 1 307  ? -33.316 -65.801  53.458  1.00 17.39  ? 308  PHE A CG    1 
ATOM   2330  C  CD1   . PHE A 1 307  ? -33.315 -66.800  52.527  1.00 18.31  ? 308  PHE A CD1   1 
ATOM   2331  C  CD2   . PHE A 1 307  ? -33.229 -66.147  54.805  1.00 17.81  ? 308  PHE A CD2   1 
ATOM   2332  C  CE1   . PHE A 1 307  ? -33.287 -68.147  52.910  1.00 20.06  ? 308  PHE A CE1   1 
ATOM   2333  C  CE2   . PHE A 1 307  ? -33.175 -67.463  55.192  1.00 17.53  ? 308  PHE A CE2   1 
ATOM   2334  C  CZ    . PHE A 1 307  ? -33.194 -68.479  54.248  1.00 17.21  ? 308  PHE A CZ    1 
ATOM   2335  N  N     . VAL A 1 308  ? -36.520 -64.141  54.697  1.00 19.94  ? 309  VAL A N     1 
ATOM   2336  C  CA    . VAL A 1 308  ? -37.148 -63.870  55.988  1.00 19.99  ? 309  VAL A CA    1 
ATOM   2337  C  C     . VAL A 1 308  ? -36.921 -64.987  56.998  1.00 20.05  ? 309  VAL A C     1 
ATOM   2338  O  O     . VAL A 1 308  ? -37.635 -66.006  56.908  1.00 18.62  ? 309  VAL A O     1 
ATOM   2339  C  CB    . VAL A 1 308  ? -38.662 -63.627  55.778  1.00 20.92  ? 309  VAL A CB    1 
ATOM   2340  C  CG1   . VAL A 1 308  ? -39.324 -63.373  57.135  1.00 21.86  ? 309  VAL A CG1   1 
ATOM   2341  C  CG2   . VAL A 1 308  ? -38.861 -62.437  54.847  1.00 21.65  ? 309  VAL A CG2   1 
ATOM   2342  N  N     . SER A 1 309  ? -35.991 -64.833  57.947  1.00 17.12  ? 310  SER A N     1 
ATOM   2343  C  CA    . SER A 1 309  ? -35.730 -65.944  58.870  1.00 21.55  ? 310  SER A CA    1 
ATOM   2344  C  C     . SER A 1 309  ? -36.909 -66.440  59.694  1.00 21.26  ? 310  SER A C     1 
ATOM   2345  O  O     . SER A 1 309  ? -37.043 -67.647  59.940  1.00 22.13  ? 310  SER A O     1 
ATOM   2346  C  CB    . SER A 1 309  ? -34.632 -65.573  59.907  1.00 21.63  ? 310  SER A CB    1 
ATOM   2347  O  OG    . SER A 1 309  ? -33.487 -65.476  59.026  1.00 27.99  ? 310  SER A OG    1 
ATOM   2348  N  N     . GLU A 1 310  ? -37.762 -65.510  60.084  1.00 21.96  ? 311  GLU A N     1 
ATOM   2349  C  CA    . GLU A 1 310  ? -38.983 -65.888  60.846  1.00 26.04  ? 311  GLU A CA    1 
ATOM   2350  C  C     . GLU A 1 310  ? -39.891 -66.797  60.054  1.00 25.26  ? 311  GLU A C     1 
ATOM   2351  O  O     . GLU A 1 310  ? -40.289 -67.807  60.645  1.00 23.19  ? 311  GLU A O     1 
ATOM   2352  C  CB    . GLU A 1 310  ? -39.551 -64.612  61.394  1.00 30.74  ? 311  GLU A CB    1 
ATOM   2353  C  CG    . GLU A 1 310  ? -40.935 -64.506  61.960  1.00 39.00  ? 311  GLU A CG    1 
ATOM   2354  C  CD    . GLU A 1 310  ? -41.151 -63.005  62.233  1.00 43.08  ? 311  GLU A CD    1 
ATOM   2355  O  OE1   . GLU A 1 310  ? -40.973 -62.593  63.400  1.00 45.14  ? 311  GLU A OE1   1 
ATOM   2356  O  OE2   . GLU A 1 310  ? -41.456 -62.309  61.237  1.00 45.18  ? 311  GLU A OE2   1 
ATOM   2357  N  N     . ALA A 1 311  ? -40.059 -66.643  58.736  1.00 21.01  ? 312  ALA A N     1 
ATOM   2358  C  CA    . ALA A 1 311  ? -40.807 -67.588  57.898  1.00 19.28  ? 312  ALA A CA    1 
ATOM   2359  C  C     . ALA A 1 311  ? -40.094 -68.898  57.676  1.00 19.61  ? 312  ALA A C     1 
ATOM   2360  O  O     . ALA A 1 311  ? -40.713 -69.984  57.607  1.00 19.08  ? 312  ALA A O     1 
ATOM   2361  C  CB    . ALA A 1 311  ? -41.136 -66.898  56.558  1.00 19.86  ? 312  ALA A CB    1 
ATOM   2362  N  N     . PHE A 1 312  ? -38.747 -68.885  57.616  1.00 16.47  ? 313  PHE A N     1 
ATOM   2363  C  CA    . PHE A 1 312  ? -37.975 -70.123  57.575  1.00 18.02  ? 313  PHE A CA    1 
ATOM   2364  C  C     . PHE A 1 312  ? -38.223 -70.923  58.867  1.00 19.31  ? 313  PHE A C     1 
ATOM   2365  O  O     . PHE A 1 312  ? -38.486 -72.145  58.844  1.00 19.56  ? 313  PHE A O     1 
ATOM   2366  C  CB    . PHE A 1 312  ? -36.475 -69.799  57.392  1.00 17.19  ? 313  PHE A CB    1 
ATOM   2367  C  CG    . PHE A 1 312  ? -35.575 -71.027  57.512  1.00 16.55  ? 313  PHE A CG    1 
ATOM   2368  C  CD1   . PHE A 1 312  ? -35.445 -71.914  56.467  1.00 17.45  ? 313  PHE A CD1   1 
ATOM   2369  C  CD2   . PHE A 1 312  ? -34.885 -71.262  58.675  1.00 18.79  ? 313  PHE A CD2   1 
ATOM   2370  C  CE1   . PHE A 1 312  ? -34.648 -73.047  56.548  1.00 19.15  ? 313  PHE A CE1   1 
ATOM   2371  C  CE2   . PHE A 1 312  ? -34.086 -72.386  58.799  1.00 17.72  ? 313  PHE A CE2   1 
ATOM   2372  C  CZ    . PHE A 1 312  ? -33.945 -73.270  57.741  1.00 17.58  ? 313  PHE A CZ    1 
ATOM   2373  N  N     . PHE A 1 313  ? -38.060 -70.254  60.007  1.00 20.35  ? 314  PHE A N     1 
ATOM   2374  C  CA    . PHE A 1 313  ? -38.314 -70.952  61.283  1.00 22.03  ? 314  PHE A CA    1 
ATOM   2375  C  C     . PHE A 1 313  ? -39.748 -71.402  61.488  1.00 24.18  ? 314  PHE A C     1 
ATOM   2376  O  O     . PHE A 1 313  ? -39.919 -72.500  62.025  1.00 24.42  ? 314  PHE A O     1 
ATOM   2377  C  CB    . PHE A 1 313  ? -37.851 -70.125  62.503  1.00 21.08  ? 314  PHE A CB    1 
ATOM   2378  C  CG    . PHE A 1 313  ? -36.332 -70.156  62.572  1.00 22.06  ? 314  PHE A CG    1 
ATOM   2379  C  CD1   . PHE A 1 313  ? -35.615 -68.955  62.504  1.00 21.27  ? 314  PHE A CD1   1 
ATOM   2380  C  CD2   . PHE A 1 313  ? -35.642 -71.332  62.657  1.00 21.02  ? 314  PHE A CD2   1 
ATOM   2381  C  CE1   . PHE A 1 313  ? -34.241 -68.980  62.547  1.00 19.26  ? 314  PHE A CE1   1 
ATOM   2382  C  CE2   . PHE A 1 313  ? -34.260 -71.358  62.709  1.00 21.26  ? 314  PHE A CE2   1 
ATOM   2383  C  CZ    . PHE A 1 313  ? -33.569 -70.168  62.646  1.00 20.10  ? 314  PHE A CZ    1 
ATOM   2384  N  N     . ALA A 1 314  ? -40.753 -70.674  60.965  1.00 24.76  ? 315  ALA A N     1 
ATOM   2385  C  CA    . ALA A 1 314  ? -42.133 -71.172  60.981  1.00 25.14  ? 315  ALA A CA    1 
ATOM   2386  C  C     . ALA A 1 314  ? -42.281 -72.508  60.283  1.00 24.75  ? 315  ALA A C     1 
ATOM   2387  O  O     . ALA A 1 314  ? -43.180 -73.267  60.627  1.00 24.44  ? 315  ALA A O     1 
ATOM   2388  C  CB    . ALA A 1 314  ? -43.102 -70.215  60.264  1.00 23.65  ? 315  ALA A CB    1 
ATOM   2389  N  N     . ALA A 1 315  ? -41.361 -72.839  59.335  1.00 23.54  ? 316  ALA A N     1 
ATOM   2390  C  CA    . ALA A 1 315  ? -41.463 -74.063  58.588  1.00 21.48  ? 316  ALA A CA    1 
ATOM   2391  C  C     . ALA A 1 315  ? -40.629 -75.209  59.145  1.00 22.65  ? 316  ALA A C     1 
ATOM   2392  O  O     . ALA A 1 315  ? -40.639 -76.371  58.693  1.00 25.15  ? 316  ALA A O     1 
ATOM   2393  C  CB    . ALA A 1 315  ? -41.051 -73.777  57.118  1.00 22.29  ? 316  ALA A CB    1 
ATOM   2394  N  N     . LEU A 1 316  ? -39.786 -74.946  60.131  1.00 23.24  ? 317  LEU A N     1 
ATOM   2395  C  CA    . LEU A 1 316  ? -38.843 -75.884  60.688  1.00 23.81  ? 317  LEU A CA    1 
ATOM   2396  C  C     . LEU A 1 316  ? -39.416 -76.605  61.910  1.00 24.76  ? 317  LEU A C     1 
ATOM   2397  O  O     . LEU A 1 316  ? -39.645 -75.985  62.962  1.00 23.05  ? 317  LEU A O     1 
ATOM   2398  C  CB    . LEU A 1 316  ? -37.611 -75.103  61.161  1.00 25.65  ? 317  LEU A CB    1 
ATOM   2399  C  CG    . LEU A 1 316  ? -36.192 -75.611  61.159  1.00 27.70  ? 317  LEU A CG    1 
ATOM   2400  C  CD1   . LEU A 1 316  ? -35.463 -75.209  62.451  1.00 28.62  ? 317  LEU A CD1   1 
ATOM   2401  C  CD2   . LEU A 1 316  ? -35.966 -77.061  60.845  1.00 27.42  ? 317  LEU A CD2   1 
ATOM   2402  N  N     . PRO A 1 317  ? -39.540 -77.929  61.843  1.00 25.40  ? 318  PRO A N     1 
ATOM   2403  C  CA    . PRO A 1 317  ? -39.926 -78.696  63.007  1.00 26.17  ? 318  PRO A CA    1 
ATOM   2404  C  C     . PRO A 1 317  ? -38.894 -78.531  64.134  1.00 28.00  ? 318  PRO A C     1 
ATOM   2405  O  O     . PRO A 1 317  ? -37.659 -78.549  63.970  1.00 25.45  ? 318  PRO A O     1 
ATOM   2406  C  CB    . PRO A 1 317  ? -39.901 -80.145  62.521  1.00 27.58  ? 318  PRO A CB    1 
ATOM   2407  C  CG    . PRO A 1 317  ? -39.886 -80.080  61.034  1.00 28.20  ? 318  PRO A CG    1 
ATOM   2408  C  CD    . PRO A 1 317  ? -39.304 -78.752  60.658  1.00 26.10  ? 318  PRO A CD    1 
ATOM   2409  N  N     . ALA A 1 318  ? -39.340 -78.414  65.372  1.00 27.52  ? 319  ALA A N     1 
ATOM   2410  C  CA    . ALA A 1 318  ? -38.463 -78.290  66.557  1.00 25.89  ? 319  ALA A CA    1 
ATOM   2411  C  C     . ALA A 1 318  ? -37.669 -79.557  66.819  1.00 26.42  ? 319  ALA A C     1 
ATOM   2412  O  O     . ALA A 1 318  ? -36.596 -79.548  67.440  1.00 29.91  ? 319  ALA A O     1 
ATOM   2413  C  CB    . ALA A 1 318  ? -39.437 -78.015  67.715  1.00 25.40  ? 319  ALA A CB    1 
ATOM   2414  N  N     . SER A 1 319  ? -38.162 -80.701  66.355  1.00 23.00  ? 320  SER A N     1 
ATOM   2415  C  CA    . SER A 1 319  ? -37.451 -81.960  66.502  1.00 25.19  ? 320  SER A CA    1 
ATOM   2416  C  C     . SER A 1 319  ? -36.275 -82.098  65.540  1.00 25.15  ? 320  SER A C     1 
ATOM   2417  O  O     . SER A 1 319  ? -35.532 -83.089  65.627  1.00 23.78  ? 320  SER A O     1 
ATOM   2418  C  CB    . SER A 1 319  ? -38.474 -83.077  66.265  1.00 24.14  ? 320  SER A CB    1 
ATOM   2419  O  OG    . SER A 1 319  ? -39.169 -82.814  65.037  1.00 25.92  ? 320  SER A OG    1 
ATOM   2420  N  N     . ALA A 1 320  ? -36.084 -81.170  64.600  1.00 24.50  ? 321  ALA A N     1 
ATOM   2421  C  CA    . ALA A 1 320  ? -34.972 -81.321  63.628  1.00 23.28  ? 321  ALA A CA    1 
ATOM   2422  C  C     . ALA A 1 320  ? -33.616 -81.373  64.305  1.00 23.33  ? 321  ALA A C     1 
ATOM   2423  O  O     . ALA A 1 320  ? -33.342 -80.520  65.159  1.00 24.86  ? 321  ALA A O     1 
ATOM   2424  C  CB    . ALA A 1 320  ? -35.045 -80.167  62.625  1.00 24.89  ? 321  ALA A CB    1 
ATOM   2425  N  N     . LYS A 1 321  ? -32.819 -82.372  64.073  1.00 22.53  ? 322  LYS A N     1 
ATOM   2426  C  CA    . LYS A 1 321  ? -31.510 -82.483  64.723  1.00 25.97  ? 322  LYS A CA    1 
ATOM   2427  C  C     . LYS A 1 321  ? -30.369 -82.208  63.736  1.00 24.16  ? 322  LYS A C     1 
ATOM   2428  O  O     . LYS A 1 321  ? -29.289 -81.767  64.125  1.00 22.67  ? 322  LYS A O     1 
ATOM   2429  C  CB    . LYS A 1 321  ? -31.347 -83.902  65.276  1.00 27.41  ? 322  LYS A CB    1 
ATOM   2430  C  CG    . LYS A 1 321  ? -32.325 -84.114  66.452  1.00 33.21  ? 322  LYS A CG    1 
ATOM   2431  C  CD    . LYS A 1 321  ? -32.023 -85.450  67.146  1.00 37.71  ? 322  LYS A CD    1 
ATOM   2432  C  CE    . LYS A 1 321  ? -32.583 -85.394  68.581  1.00 40.99  ? 322  LYS A CE    1 
ATOM   2433  N  NZ    . LYS A 1 321  ? -31.817 -84.356  69.362  1.00 44.11  ? 322  LYS A NZ    1 
ATOM   2434  N  N     . VAL A 1 322  ? -30.681 -82.525  62.488  1.00 23.27  ? 323  VAL A N     1 
ATOM   2435  C  CA    . VAL A 1 322  ? -29.708 -82.337  61.405  1.00 23.09  ? 323  VAL A CA    1 
ATOM   2436  C  C     . VAL A 1 322  ? -30.499 -81.701  60.240  1.00 23.20  ? 323  VAL A C     1 
ATOM   2437  O  O     . VAL A 1 322  ? -31.603 -82.124  59.904  1.00 22.24  ? 323  VAL A O     1 
ATOM   2438  C  CB    . VAL A 1 322  ? -29.099 -83.657  60.927  1.00 23.27  ? 323  VAL A CB    1 
ATOM   2439  C  CG1   . VAL A 1 322  ? -27.897 -83.406  59.993  1.00 21.43  ? 323  VAL A CG1   1 
ATOM   2440  C  CG2   . VAL A 1 322  ? -28.617 -84.522  62.093  1.00 21.01  ? 323  VAL A CG2   1 
ATOM   2441  N  N     . ILE A 1 323  ? -29.832 -80.816  59.518  1.00 22.56  ? 324  ILE A N     1 
ATOM   2442  C  CA    . ILE A 1 323  ? -30.468 -80.181  58.364  1.00 23.50  ? 324  ILE A CA    1 
ATOM   2443  C  C     . ILE A 1 323  ? -29.450 -80.103  57.229  1.00 20.60  ? 324  ILE A C     1 
ATOM   2444  O  O     . ILE A 1 323  ? -28.353 -79.693  57.541  1.00 21.06  ? 324  ILE A O     1 
ATOM   2445  C  CB    . ILE A 1 323  ? -31.078 -78.824  58.738  1.00 28.25  ? 324  ILE A CB    1 
ATOM   2446  C  CG1   . ILE A 1 323  ? -31.280 -77.887  57.551  1.00 28.00  ? 324  ILE A CG1   1 
ATOM   2447  C  CG2   . ILE A 1 323  ? -30.358 -78.136  59.879  1.00 29.66  ? 324  ILE A CG2   1 
ATOM   2448  C  CD1   . ILE A 1 323  ? -30.699 -76.508  57.681  1.00 32.91  ? 324  ILE A CD1   1 
ATOM   2449  N  N     . THR A 1 324  ? -29.825 -80.511  56.049  1.00 19.04  ? 325  THR A N     1 
ATOM   2450  C  CA    . THR A 1 324  ? -28.908 -80.305  54.913  1.00 20.34  ? 325  THR A CA    1 
ATOM   2451  C  C     . THR A 1 324  ? -29.591 -79.340  53.937  1.00 18.86  ? 325  THR A C     1 
ATOM   2452  O  O     . THR A 1 324  ? -30.787 -79.360  53.692  1.00 16.20  ? 325  THR A O     1 
ATOM   2453  C  CB    . THR A 1 324  ? -28.192 -81.490  54.313  1.00 23.66  ? 325  THR A CB    1 
ATOM   2454  O  OG1   . THR A 1 324  ? -28.223 -81.636  52.881  1.00 27.83  ? 325  THR A OG1   1 
ATOM   2455  C  CG2   . THR A 1 324  ? -28.386 -82.767  55.046  1.00 15.23  ? 325  THR A CG2   1 
ATOM   2456  N  N     . VAL A 1 325  ? -28.787 -78.305  53.620  1.00 17.63  ? 326  VAL A N     1 
ATOM   2457  C  CA    . VAL A 1 325  ? -29.220 -77.290  52.692  1.00 16.02  ? 326  VAL A CA    1 
ATOM   2458  C  C     . VAL A 1 325  ? -28.583 -77.623  51.339  1.00 16.16  ? 326  VAL A C     1 
ATOM   2459  O  O     . VAL A 1 325  ? -27.366 -77.731  51.306  1.00 17.17  ? 326  VAL A O     1 
ATOM   2460  C  CB    . VAL A 1 325  ? -28.726 -75.870  53.070  1.00 15.44  ? 326  VAL A CB    1 
ATOM   2461  C  CG1   . VAL A 1 325  ? -29.375 -74.811  52.161  1.00 12.90  ? 326  VAL A CG1   1 
ATOM   2462  C  CG2   . VAL A 1 325  ? -29.064 -75.667  54.546  1.00 13.80  ? 326  VAL A CG2   1 
ATOM   2463  N  N     . LEU A 1 326  ? -29.430 -77.773  50.343  1.00 15.00  ? 327  LEU A N     1 
ATOM   2464  C  CA    . LEU A 1 326  ? -28.933 -78.090  49.012  1.00 16.48  ? 327  LEU A CA    1 
ATOM   2465  C  C     . LEU A 1 326  ? -28.908 -76.817  48.157  1.00 16.36  ? 327  LEU A C     1 
ATOM   2466  O  O     . LEU A 1 326  ? -29.955 -76.166  48.054  1.00 14.99  ? 327  LEU A O     1 
ATOM   2467  C  CB    . LEU A 1 326  ? -29.915 -79.104  48.425  1.00 16.13  ? 327  LEU A CB    1 
ATOM   2468  C  CG    . LEU A 1 326  ? -29.681 -80.615  48.497  1.00 20.42  ? 327  LEU A CG    1 
ATOM   2469  C  CD1   . LEU A 1 326  ? -28.478 -81.102  49.282  1.00 16.84  ? 327  LEU A CD1   1 
ATOM   2470  C  CD2   . LEU A 1 326  ? -30.951 -81.372  48.738  1.00 18.35  ? 327  LEU A CD2   1 
ATOM   2471  N  N     . ASP A 1 327  ? -27.766 -76.595  47.507  1.00 15.79  ? 328  ASP A N     1 
ATOM   2472  C  CA    . ASP A 1 327  ? -27.612 -75.495  46.578  1.00 15.65  ? 328  ASP A CA    1 
ATOM   2473  C  C     . ASP A 1 327  ? -27.319 -76.077  45.189  1.00 13.90  ? 328  ASP A C     1 
ATOM   2474  O  O     . ASP A 1 327  ? -26.464 -76.966  45.012  1.00 15.33  ? 328  ASP A O     1 
ATOM   2475  C  CB    . ASP A 1 327  ? -26.388 -74.608  46.890  1.00 15.16  ? 328  ASP A CB    1 
ATOM   2476  C  CG    . ASP A 1 327  ? -26.744 -73.511  47.870  1.00 13.76  ? 328  ASP A CG    1 
ATOM   2477  O  OD1   . ASP A 1 327  ? -27.258 -72.443  47.507  1.00 16.13  ? 328  ASP A OD1   1 
ATOM   2478  O  OD2   . ASP A 1 327  ? -26.500 -73.655  49.103  1.00 15.19  ? 328  ASP A OD2   1 
ATOM   2479  N  N     . ARG A 1 328  ? -27.998 -75.537  44.214  1.00 14.61  ? 329  ARG A N     1 
ATOM   2480  C  CA    . ARG A 1 328  ? -27.871 -75.915  42.826  1.00 15.48  ? 329  ARG A CA    1 
ATOM   2481  C  C     . ARG A 1 328  ? -26.867 -75.006  42.108  1.00 15.77  ? 329  ARG A C     1 
ATOM   2482  O  O     . ARG A 1 328  ? -27.143 -74.497  41.028  1.00 13.72  ? 329  ARG A O     1 
ATOM   2483  C  CB    . ARG A 1 328  ? -29.196 -75.856  42.049  1.00 12.45  ? 329  ARG A CB    1 
ATOM   2484  C  CG    . ARG A 1 328  ? -29.412 -76.948  41.010  1.00 15.94  ? 329  ARG A CG    1 
ATOM   2485  C  CD    . ARG A 1 328  ? -30.707 -76.841  40.192  1.00 15.12  ? 329  ARG A CD    1 
ATOM   2486  N  NE    . ARG A 1 328  ? -30.558 -77.865  39.147  1.00 18.64  ? 329  ARG A NE    1 
ATOM   2487  C  CZ    . ARG A 1 328  ? -31.215 -78.991  38.933  1.00 19.26  ? 329  ARG A CZ    1 
ATOM   2488  N  NH1   . ARG A 1 328  ? -32.293 -79.273  39.663  1.00 17.91  ? 329  ARG A NH1   1 
ATOM   2489  N  NH2   . ARG A 1 328  ? -30.864 -79.830  37.945  1.00 18.71  ? 329  ARG A NH2   1 
ATOM   2490  N  N     . THR A 1 329  ? -25.699 -74.856  42.673  1.00 14.48  ? 330  THR A N     1 
ATOM   2491  C  CA    . THR A 1 329  ? -24.668 -73.982  42.097  1.00 14.63  ? 330  THR A CA    1 
ATOM   2492  C  C     . THR A 1 329  ? -23.288 -74.338  42.631  1.00 16.57  ? 330  THR A C     1 
ATOM   2493  O  O     . THR A 1 329  ? -23.210 -75.040  43.634  1.00 15.41  ? 330  THR A O     1 
ATOM   2494  C  CB    . THR A 1 329  ? -25.022 -72.523  42.454  1.00 15.83  ? 330  THR A CB    1 
ATOM   2495  O  OG1   . THR A 1 329  ? -24.189 -71.641  41.640  1.00 13.51  ? 330  THR A OG1   1 
ATOM   2496  C  CG2   . THR A 1 329  ? -24.846 -72.111  43.915  1.00 14.14  ? 330  THR A CG2   1 
ATOM   2497  N  N     . LYS A 1 330  ? -22.234 -73.671  42.141  1.00 17.60  ? 331  LYS A N     1 
ATOM   2498  C  CA    . LYS A 1 330  ? -20.895 -73.827  42.779  1.00 16.92  ? 331  LYS A CA    1 
ATOM   2499  C  C     . LYS A 1 330  ? -20.279 -72.431  42.820  1.00 14.63  ? 331  LYS A C     1 
ATOM   2500  O  O     . LYS A 1 330  ? -20.208 -71.796  41.740  1.00 14.28  ? 331  LYS A O     1 
ATOM   2501  C  CB    . LYS A 1 330  ? -20.094 -74.785  41.922  1.00 17.22  ? 331  LYS A CB    1 
ATOM   2502  C  CG    . LYS A 1 330  ? -18.599 -75.024  41.910  1.00 21.58  ? 331  LYS A CG    1 
ATOM   2503  C  CD    . LYS A 1 330  ? -18.162 -75.692  43.165  1.00 28.35  ? 331  LYS A CD    1 
ATOM   2504  C  CE    . LYS A 1 330  ? -16.878 -76.599  43.113  1.00 26.83  ? 331  LYS A CE    1 
ATOM   2505  N  NZ    . LYS A 1 330  ? -16.133 -76.098  41.924  1.00 28.35  ? 331  LYS A NZ    1 
ATOM   2506  N  N     . GLU A 1 331  ? -19.877 -71.869  43.925  1.00 15.78  ? 332  GLU A N     1 
ATOM   2507  C  CA    . GLU A 1 331  ? -19.140 -70.609  44.006  1.00 16.36  ? 332  GLU A CA    1 
ATOM   2508  C  C     . GLU A 1 331  ? -17.740 -71.036  44.504  1.00 15.15  ? 332  GLU A C     1 
ATOM   2509  O  O     . GLU A 1 331  ? -17.523 -71.209  45.713  1.00 16.77  ? 332  GLU A O     1 
ATOM   2510  C  CB    . GLU A 1 331  ? -19.747 -69.557  44.964  1.00 18.03  ? 332  GLU A CB    1 
ATOM   2511  C  CG    . GLU A 1 331  ? -21.160 -69.238  44.430  1.00 19.84  ? 332  GLU A CG    1 
ATOM   2512  C  CD    . GLU A 1 331  ? -21.850 -68.023  45.023  1.00 18.03  ? 332  GLU A CD    1 
ATOM   2513  O  OE1   . GLU A 1 331  ? -21.389 -67.416  45.995  1.00 16.59  ? 332  GLU A OE1   1 
ATOM   2514  O  OE2   . GLU A 1 331  ? -22.946 -67.687  44.470  1.00 17.48  ? 332  GLU A OE2   1 
ATOM   2515  N  N     . PRO A 1 332  ? -16.777 -71.113  43.604  1.00 15.95  ? 333  PRO A N     1 
ATOM   2516  C  CA    . PRO A 1 332  ? -15.458 -71.655  43.925  1.00 15.48  ? 333  PRO A CA    1 
ATOM   2517  C  C     . PRO A 1 332  ? -14.782 -70.763  44.955  1.00 17.57  ? 333  PRO A C     1 
ATOM   2518  O  O     . PRO A 1 332  ? -14.786 -69.510  44.837  1.00 18.20  ? 333  PRO A O     1 
ATOM   2519  C  CB    . PRO A 1 332  ? -14.729 -71.758  42.600  1.00 18.35  ? 333  PRO A CB    1 
ATOM   2520  C  CG    . PRO A 1 332  ? -15.817 -71.742  41.549  1.00 14.36  ? 333  PRO A CG    1 
ATOM   2521  C  CD    . PRO A 1 332  ? -16.890 -70.888  42.158  1.00 14.69  ? 333  PRO A CD    1 
ATOM   2522  N  N     . GLY A 1 333  ? -14.209 -71.448  45.960  1.00 16.11  ? 334  GLY A N     1 
ATOM   2523  C  CA    . GLY A 1 333  ? -13.528 -70.666  47.010  1.00 13.37  ? 334  GLY A CA    1 
ATOM   2524  C  C     . GLY A 1 333  ? -14.444 -70.100  48.046  1.00 16.53  ? 334  GLY A C     1 
ATOM   2525  O  O     . GLY A 1 333  ? -13.964 -69.647  49.111  1.00 16.39  ? 334  GLY A O     1 
ATOM   2526  N  N     . ALA A 1 334  ? -15.764 -69.998  47.873  1.00 16.76  ? 335  ALA A N     1 
ATOM   2527  C  CA    . ALA A 1 334  ? -16.632 -69.462  48.957  1.00 17.79  ? 335  ALA A CA    1 
ATOM   2528  C  C     . ALA A 1 334  ? -16.661 -70.493  50.095  1.00 17.14  ? 335  ALA A C     1 
ATOM   2529  O  O     . ALA A 1 334  ? -16.376 -71.677  49.893  1.00 19.05  ? 335  ALA A O     1 
ATOM   2530  C  CB    . ALA A 1 334  ? -18.069 -69.297  48.406  1.00 17.14  ? 335  ALA A CB    1 
ATOM   2531  N  N     . PRO A 1 335  ? -16.930 -70.077  51.330  1.00 18.23  ? 336  PRO A N     1 
ATOM   2532  C  CA    . PRO A 1 335  ? -17.063 -70.987  52.464  1.00 19.78  ? 336  PRO A CA    1 
ATOM   2533  C  C     . PRO A 1 335  ? -18.336 -71.826  52.459  1.00 20.55  ? 336  PRO A C     1 
ATOM   2534  O  O     . PRO A 1 335  ? -18.485 -72.807  53.191  1.00 17.97  ? 336  PRO A O     1 
ATOM   2535  C  CB    . PRO A 1 335  ? -16.928 -70.055  53.646  1.00 20.00  ? 336  PRO A CB    1 
ATOM   2536  C  CG    . PRO A 1 335  ? -17.699 -68.859  53.204  1.00 20.37  ? 336  PRO A CG    1 
ATOM   2537  C  CD    . PRO A 1 335  ? -17.291 -68.696  51.719  1.00 18.07  ? 336  PRO A CD    1 
ATOM   2538  N  N     . GLY A 1 336  ? -19.251 -71.491  51.549  1.00 17.92  ? 337  GLY A N     1 
ATOM   2539  C  CA    . GLY A 1 336  ? -20.465 -72.308  51.385  1.00 18.53  ? 337  GLY A CA    1 
ATOM   2540  C  C     . GLY A 1 336  ? -21.250 -71.675  50.234  1.00 16.70  ? 337  GLY A C     1 
ATOM   2541  O  O     . GLY A 1 336  ? -20.940 -70.514  49.974  1.00 17.65  ? 337  GLY A O     1 
ATOM   2542  N  N     . ASP A 1 337  ? -22.241 -72.366  49.691  1.00 15.48  ? 338  ASP A N     1 
ATOM   2543  C  CA    . ASP A 1 337  ? -23.059 -71.873  48.602  1.00 16.52  ? 338  ASP A CA    1 
ATOM   2544  C  C     . ASP A 1 337  ? -24.188 -71.034  49.191  1.00 16.59  ? 338  ASP A C     1 
ATOM   2545  O  O     . ASP A 1 337  ? -24.276 -70.928  50.432  1.00 15.64  ? 338  ASP A O     1 
ATOM   2546  C  CB    . ASP A 1 337  ? -23.479 -73.091  47.752  1.00 17.10  ? 338  ASP A CB    1 
ATOM   2547  C  CG    . ASP A 1 337  ? -22.330 -73.543  46.877  1.00 20.05  ? 338  ASP A CG    1 
ATOM   2548  O  OD1   . ASP A 1 337  ? -21.490 -72.726  46.389  1.00 19.18  ? 338  ASP A OD1   1 
ATOM   2549  O  OD2   . ASP A 1 337  ? -22.316 -74.769  46.587  1.00 19.53  ? 338  ASP A OD2   1 
ATOM   2550  N  N     . PRO A 1 338  ? -24.848 -70.164  48.419  1.00 16.09  ? 339  PRO A N     1 
ATOM   2551  C  CA    . PRO A 1 338  ? -25.649 -69.076  48.965  1.00 13.90  ? 339  PRO A CA    1 
ATOM   2552  C  C     . PRO A 1 338  ? -26.783 -69.468  49.888  1.00 13.90  ? 339  PRO A C     1 
ATOM   2553  O  O     . PRO A 1 338  ? -26.946 -68.797  50.918  1.00 14.07  ? 339  PRO A O     1 
ATOM   2554  C  CB    . PRO A 1 338  ? -26.189 -68.373  47.702  1.00 15.84  ? 339  PRO A CB    1 
ATOM   2555  C  CG    . PRO A 1 338  ? -25.106 -68.626  46.688  1.00 14.98  ? 339  PRO A CG    1 
ATOM   2556  C  CD    . PRO A 1 338  ? -24.675 -70.066  46.932  1.00 14.19  ? 339  PRO A CD    1 
ATOM   2557  N  N     . LEU A 1 339  ? -27.538 -70.520  49.511  1.00 11.58  ? 340  LEU A N     1 
ATOM   2558  C  CA    . LEU A 1 339  ? -28.705 -70.852  50.382  1.00 11.55  ? 340  LEU A CA    1 
ATOM   2559  C  C     . LEU A 1 339  ? -28.208 -71.309  51.740  1.00 13.17  ? 340  LEU A C     1 
ATOM   2560  O  O     . LEU A 1 339  ? -28.716 -70.970  52.836  1.00 12.90  ? 340  LEU A O     1 
ATOM   2561  C  CB    . LEU A 1 339  ? -29.596 -71.843  49.647  1.00 12.50  ? 340  LEU A CB    1 
ATOM   2562  C  CG    . LEU A 1 339  ? -30.917 -72.224  50.344  1.00 15.51  ? 340  LEU A CG    1 
ATOM   2563  C  CD1   . LEU A 1 339  ? -31.809 -71.030  50.708  1.00 13.50  ? 340  LEU A CD1   1 
ATOM   2564  C  CD2   . LEU A 1 339  ? -31.644 -73.248  49.493  1.00 13.22  ? 340  LEU A CD2   1 
ATOM   2565  N  N     . TYR A 1 340  ? -27.138 -72.109  51.683  1.00 11.26  ? 341  TYR A N     1 
ATOM   2566  C  CA    . TYR A 1 340  ? -26.525 -72.646  52.930  1.00 13.27  ? 341  TYR A CA    1 
ATOM   2567  C  C     . TYR A 1 340  ? -26.090 -71.496  53.811  1.00 13.99  ? 341  TYR A C     1 
ATOM   2568  O  O     . TYR A 1 340  ? -26.372 -71.451  55.000  1.00 12.70  ? 341  TYR A O     1 
ATOM   2569  C  CB    . TYR A 1 340  ? -25.328 -73.506  52.570  1.00 14.60  ? 341  TYR A CB    1 
ATOM   2570  C  CG    . TYR A 1 340  ? -24.375 -73.816  53.698  1.00 17.19  ? 341  TYR A CG    1 
ATOM   2571  C  CD1   . TYR A 1 340  ? -24.760 -74.702  54.705  1.00 18.06  ? 341  TYR A CD1   1 
ATOM   2572  C  CD2   . TYR A 1 340  ? -23.129 -73.228  53.776  1.00 16.98  ? 341  TYR A CD2   1 
ATOM   2573  C  CE1   . TYR A 1 340  ? -23.900 -75.024  55.755  1.00 18.83  ? 341  TYR A CE1   1 
ATOM   2574  C  CE2   . TYR A 1 340  ? -22.264 -73.506  54.828  1.00 18.65  ? 341  TYR A CE2   1 
ATOM   2575  C  CZ    . TYR A 1 340  ? -22.660 -74.394  55.791  1.00 20.33  ? 341  TYR A CZ    1 
ATOM   2576  O  OH    . TYR A 1 340  ? -21.769 -74.685  56.795  1.00 24.35  ? 341  TYR A OH    1 
ATOM   2577  N  N     . LEU A 1 341  ? -25.373 -70.535  53.187  1.00 14.09  ? 342  LEU A N     1 
ATOM   2578  C  CA    . LEU A 1 341  ? -24.967 -69.350  53.992  1.00 15.36  ? 342  LEU A CA    1 
ATOM   2579  C  C     . LEU A 1 341  ? -26.171 -68.599  54.526  1.00 15.41  ? 342  LEU A C     1 
ATOM   2580  O  O     . LEU A 1 341  ? -26.149 -68.155  55.694  1.00 16.35  ? 342  LEU A O     1 
ATOM   2581  C  CB    . LEU A 1 341  ? -24.164 -68.381  53.136  1.00 16.88  ? 342  LEU A CB    1 
ATOM   2582  C  CG    . LEU A 1 341  ? -22.658 -68.439  53.092  1.00 20.83  ? 342  LEU A CG    1 
ATOM   2583  C  CD1   . LEU A 1 341  ? -21.934 -69.594  53.698  1.00 17.10  ? 342  LEU A CD1   1 
ATOM   2584  C  CD2   . LEU A 1 341  ? -22.084 -68.120  51.718  1.00 18.84  ? 342  LEU A CD2   1 
ATOM   2585  N  N     . ASP A 1 342  ? -27.281 -68.462  53.746  1.00 14.63  ? 343  ASP A N     1 
ATOM   2586  C  CA    . ASP A 1 342  ? -28.415 -67.723  54.316  1.00 18.82  ? 343  ASP A CA    1 
ATOM   2587  C  C     . ASP A 1 342  ? -28.993 -68.466  55.532  1.00 18.37  ? 343  ASP A C     1 
ATOM   2588  O  O     . ASP A 1 342  ? -29.311 -67.866  56.590  1.00 18.34  ? 343  ASP A O     1 
ATOM   2589  C  CB    . ASP A 1 342  ? -29.535 -67.538  53.275  1.00 19.73  ? 343  ASP A CB    1 
ATOM   2590  C  CG    . ASP A 1 342  ? -29.137 -66.652  52.095  1.00 20.46  ? 343  ASP A CG    1 
ATOM   2591  O  OD1   . ASP A 1 342  ? -28.222 -65.820  52.311  1.00 21.35  ? 343  ASP A OD1   1 
ATOM   2592  O  OD2   . ASP A 1 342  ? -29.792 -66.819  51.039  1.00 21.22  ? 343  ASP A OD2   1 
ATOM   2593  N  N     . VAL A 1 343  ? -29.121 -69.785  55.369  1.00 16.58  ? 344  VAL A N     1 
ATOM   2594  C  CA    . VAL A 1 343  ? -29.624 -70.620  56.481  1.00 17.52  ? 344  VAL A CA    1 
ATOM   2595  C  C     . VAL A 1 343  ? -28.703 -70.550  57.702  1.00 19.22  ? 344  VAL A C     1 
ATOM   2596  O  O     . VAL A 1 343  ? -29.207 -70.379  58.806  1.00 19.27  ? 344  VAL A O     1 
ATOM   2597  C  CB    . VAL A 1 343  ? -29.856 -72.068  56.053  1.00 19.47  ? 344  VAL A CB    1 
ATOM   2598  C  CG1   . VAL A 1 343  ? -30.129 -73.024  57.237  1.00 18.66  ? 344  VAL A CG1   1 
ATOM   2599  C  CG2   . VAL A 1 343  ? -31.116 -72.086  55.160  1.00 17.69  ? 344  VAL A CG2   1 
ATOM   2600  N  N     . CYS A 1 344  ? -27.374 -70.642  57.582  1.00 18.01  ? 345  CYS A N     1 
ATOM   2601  C  CA    . CYS A 1 344  ? -26.477 -70.510  58.731  1.00 20.08  ? 345  CYS A CA    1 
ATOM   2602  C  C     . CYS A 1 344  ? -26.684 -69.198  59.483  1.00 19.13  ? 345  CYS A C     1 
ATOM   2603  O  O     . CYS A 1 344  ? -26.761 -69.081  60.709  1.00 19.20  ? 345  CYS A O     1 
ATOM   2604  C  CB    . CYS A 1 344  ? -24.974 -70.587  58.359  1.00 19.41  ? 345  CYS A CB    1 
ATOM   2605  S  SG    . CYS A 1 344  ? -24.472 -72.200  57.763  1.00 20.81  ? 345  CYS A SG    1 
ATOM   2606  N  N     . SER A 1 345  ? -26.922 -68.133  58.741  1.00 19.13  ? 346  SER A N     1 
ATOM   2607  C  CA    . SER A 1 345  ? -27.096 -66.803  59.330  1.00 19.01  ? 346  SER A CA    1 
ATOM   2608  C  C     . SER A 1 345  ? -28.404 -66.739  60.116  1.00 17.49  ? 346  SER A C     1 
ATOM   2609  O  O     . SER A 1 345  ? -28.490 -66.008  61.123  1.00 18.57  ? 346  SER A O     1 
ATOM   2610  C  CB    . SER A 1 345  ? -27.092 -65.718  58.245  1.00 15.41  ? 346  SER A CB    1 
ATOM   2611  O  OG    . SER A 1 345  ? -28.403 -65.648  57.658  1.00 19.78  ? 346  SER A OG    1 
ATOM   2612  N  N     . ALA A 1 346  ? -29.423 -67.484  59.661  1.00 17.00  ? 347  ALA A N     1 
ATOM   2613  C  CA    . ALA A 1 346  ? -30.695 -67.503  60.398  1.00 17.76  ? 347  ALA A CA    1 
ATOM   2614  C  C     . ALA A 1 346  ? -30.461 -68.165  61.775  1.00 20.18  ? 347  ALA A C     1 
ATOM   2615  O  O     . ALA A 1 346  ? -30.932 -67.660  62.806  1.00 19.90  ? 347  ALA A O     1 
ATOM   2616  C  CB    . ALA A 1 346  ? -31.767 -68.284  59.633  1.00 16.99  ? 347  ALA A CB    1 
ATOM   2617  N  N     . PHE A 1 347  ? -29.710 -69.291  61.788  1.00 20.38  ? 348  PHE A N     1 
ATOM   2618  C  CA    . PHE A 1 347  ? -29.485 -69.993  63.042  1.00 22.34  ? 348  PHE A CA    1 
ATOM   2619  C  C     . PHE A 1 347  ? -28.540 -69.165  63.921  1.00 24.06  ? 348  PHE A C     1 
ATOM   2620  O  O     . PHE A 1 347  ? -28.860 -69.004  65.140  1.00 23.17  ? 348  PHE A O     1 
ATOM   2621  C  CB    . PHE A 1 347  ? -28.939 -71.428  62.879  1.00 22.65  ? 348  PHE A CB    1 
ATOM   2622  C  CG    . PHE A 1 347  ? -29.959 -72.440  62.431  1.00 22.41  ? 348  PHE A CG    1 
ATOM   2623  C  CD1   . PHE A 1 347  ? -30.089 -72.780  61.102  1.00 21.67  ? 348  PHE A CD1   1 
ATOM   2624  C  CD2   . PHE A 1 347  ? -30.834 -73.022  63.357  1.00 23.38  ? 348  PHE A CD2   1 
ATOM   2625  C  CE1   . PHE A 1 347  ? -31.070 -73.678  60.705  1.00 24.13  ? 348  PHE A CE1   1 
ATOM   2626  C  CE2   . PHE A 1 347  ? -31.817 -73.918  62.971  1.00 24.35  ? 348  PHE A CE2   1 
ATOM   2627  C  CZ    . PHE A 1 347  ? -31.939 -74.248  61.633  1.00 23.31  ? 348  PHE A CZ    1 
ATOM   2628  N  N     . VAL A 1 348  ? -27.522 -68.498  63.342  1.00 20.59  ? 349  VAL A N     1 
ATOM   2629  C  CA    . VAL A 1 348  ? -26.681 -67.716  64.260  1.00 26.74  ? 349  VAL A CA    1 
ATOM   2630  C  C     . VAL A 1 348  ? -27.432 -66.528  64.861  1.00 29.09  ? 349  VAL A C     1 
ATOM   2631  O  O     . VAL A 1 348  ? -27.335 -66.259  66.082  1.00 28.56  ? 349  VAL A O     1 
ATOM   2632  C  CB    . VAL A 1 348  ? -25.241 -67.350  63.906  1.00 28.74  ? 349  VAL A CB    1 
ATOM   2633  C  CG1   . VAL A 1 348  ? -24.625 -68.264  62.869  1.00 27.72  ? 349  VAL A CG1   1 
ATOM   2634  C  CG2   . VAL A 1 348  ? -24.914 -65.870  63.744  1.00 28.39  ? 349  VAL A CG2   1 
ATOM   2635  N  N     . GLU A 1 349  ? -28.208 -65.869  64.030  1.00 27.77  ? 350  GLU A N     1 
ATOM   2636  C  CA    . GLU A 1 349  ? -28.994 -64.750  64.508  1.00 32.77  ? 350  GLU A CA    1 
ATOM   2637  C  C     . GLU A 1 349  ? -29.957 -65.172  65.628  1.00 31.55  ? 350  GLU A C     1 
ATOM   2638  O  O     . GLU A 1 349  ? -30.118 -64.458  66.615  1.00 32.24  ? 350  GLU A O     1 
ATOM   2639  C  CB    . GLU A 1 349  ? -29.891 -64.215  63.390  1.00 35.79  ? 350  GLU A CB    1 
ATOM   2640  C  CG    . GLU A 1 349  ? -30.288 -62.763  63.658  1.00 41.52  ? 350  GLU A CG    1 
ATOM   2641  C  CD    . GLU A 1 349  ? -30.100 -62.055  62.326  1.00 45.09  ? 350  GLU A CD    1 
ATOM   2642  O  OE1   . GLU A 1 349  ? -29.076 -62.375  61.644  1.00 47.73  ? 350  GLU A OE1   1 
ATOM   2643  O  OE2   . GLU A 1 349  ? -31.033 -61.270  62.068  1.00 45.54  ? 350  GLU A OE2   1 
ATOM   2644  N  N     . ARG A 1 350  ? -30.627 -66.279  65.419  1.00 28.57  ? 351  ARG A N     1 
ATOM   2645  C  CA    . ARG A 1 350  ? -31.591 -66.803  66.398  1.00 30.89  ? 351  ARG A CA    1 
ATOM   2646  C  C     . ARG A 1 350  ? -30.956 -66.965  67.783  1.00 32.06  ? 351  ARG A C     1 
ATOM   2647  O  O     . ARG A 1 350  ? -31.548 -66.691  68.828  1.00 31.85  ? 351  ARG A O     1 
ATOM   2648  C  CB    . ARG A 1 350  ? -32.162 -68.122  65.890  1.00 27.65  ? 351  ARG A CB    1 
ATOM   2649  C  CG    . ARG A 1 350  ? -33.402 -68.591  66.662  1.00 29.35  ? 351  ARG A CG    1 
ATOM   2650  C  CD    . ARG A 1 350  ? -33.117 -70.020  67.004  1.00 31.05  ? 351  ARG A CD    1 
ATOM   2651  N  NE    . ARG A 1 350  ? -33.808 -71.090  66.451  1.00 30.38  ? 351  ARG A NE    1 
ATOM   2652  C  CZ    . ARG A 1 350  ? -33.627 -72.362  66.264  1.00 31.03  ? 351  ARG A CZ    1 
ATOM   2653  N  NH1   . ARG A 1 350  ? -32.577 -73.114  66.462  1.00 29.70  ? 351  ARG A NH1   1 
ATOM   2654  N  NH2   . ARG A 1 350  ? -34.736 -72.955  65.809  1.00 33.26  ? 351  ARG A NH2   1 
ATOM   2655  N  N     . GLY A 1 351  ? -29.718 -67.405  67.786  1.00 32.12  ? 352  GLY A N     1 
ATOM   2656  C  CA    . GLY A 1 351  ? -28.919 -67.592  68.963  1.00 36.15  ? 352  GLY A CA    1 
ATOM   2657  C  C     . GLY A 1 351  ? -29.409 -68.598  69.985  1.00 36.98  ? 352  GLY A C     1 
ATOM   2658  O  O     . GLY A 1 351  ? -29.214 -68.389  71.181  1.00 37.94  ? 352  GLY A O     1 
ATOM   2659  N  N     . GLU A 1 352  ? -30.059 -69.659  69.565  1.00 36.91  ? 353  GLU A N     1 
ATOM   2660  C  CA    . GLU A 1 352  ? -30.577 -70.647  70.501  1.00 40.04  ? 353  GLU A CA    1 
ATOM   2661  C  C     . GLU A 1 352  ? -30.069 -72.012  70.073  1.00 39.88  ? 353  GLU A C     1 
ATOM   2662  O  O     . GLU A 1 352  ? -28.896 -72.198  69.809  1.00 39.31  ? 353  GLU A O     1 
ATOM   2663  C  CB    . GLU A 1 352  ? -32.100 -70.656  70.580  1.00 41.10  ? 353  GLU A CB    1 
ATOM   2664  C  CG    . GLU A 1 352  ? -32.786 -69.348  70.834  1.00 44.87  ? 353  GLU A CG    1 
ATOM   2665  C  CD    . GLU A 1 352  ? -34.240 -69.323  70.412  1.00 48.05  ? 353  GLU A CD    1 
ATOM   2666  O  OE1   . GLU A 1 352  ? -34.877 -68.237  70.514  1.00 50.73  ? 353  GLU A OE1   1 
ATOM   2667  O  OE2   . GLU A 1 352  ? -34.778 -70.365  69.978  1.00 48.00  ? 353  GLU A OE2   1 
ATOM   2668  N  N     . ALA A 1 353  ? -31.010 -72.920  69.812  1.00 41.85  ? 354  ALA A N     1 
ATOM   2669  C  CA    . ALA A 1 353  ? -30.709 -74.272  69.389  1.00 40.85  ? 354  ALA A CA    1 
ATOM   2670  C  C     . ALA A 1 353  ? -29.930 -74.282  68.072  1.00 41.36  ? 354  ALA A C     1 
ATOM   2671  O  O     . ALA A 1 353  ? -30.246 -73.464  67.186  1.00 42.26  ? 354  ALA A O     1 
ATOM   2672  C  CB    . ALA A 1 353  ? -31.992 -75.088  69.296  1.00 40.67  ? 354  ALA A CB    1 
ATOM   2673  N  N     . MET A 1 354  ? -28.927 -75.145  68.038  1.00 38.73  ? 355  MET A N     1 
ATOM   2674  C  CA    . MET A 1 354  ? -28.145 -75.295  66.826  1.00 39.35  ? 355  MET A CA    1 
ATOM   2675  C  C     . MET A 1 354  ? -28.120 -76.760  66.429  1.00 38.66  ? 355  MET A C     1 
ATOM   2676  O  O     . MET A 1 354  ? -27.343 -77.520  66.980  1.00 37.34  ? 355  MET A O     1 
ATOM   2677  C  CB    . MET A 1 354  ? -26.765 -74.678  67.037  1.00 41.89  ? 355  MET A CB    1 
ATOM   2678  C  CG    . MET A 1 354  ? -26.895 -73.145  66.876  1.00 44.88  ? 355  MET A CG    1 
ATOM   2679  S  SD    . MET A 1 354  ? -26.344 -72.649  65.225  1.00 47.03  ? 355  MET A SD    1 
ATOM   2680  C  CE    . MET A 1 354  ? -25.699 -71.033  65.679  1.00 46.68  ? 355  MET A CE    1 
ATOM   2681  N  N     . PRO A 1 355  ? -28.994 -77.129  65.501  1.00 37.63  ? 356  PRO A N     1 
ATOM   2682  C  CA    . PRO A 1 355  ? -29.164 -78.460  64.985  1.00 37.25  ? 356  PRO A CA    1 
ATOM   2683  C  C     . PRO A 1 355  ? -28.304 -79.055  63.906  1.00 38.42  ? 356  PRO A C     1 
ATOM   2684  O  O     . PRO A 1 355  ? -28.962 -79.560  62.932  1.00 44.69  ? 356  PRO A O     1 
ATOM   2685  C  CB    . PRO A 1 355  ? -30.552 -78.340  64.284  1.00 36.67  ? 356  PRO A CB    1 
ATOM   2686  C  CG    . PRO A 1 355  ? -30.527 -76.968  63.736  1.00 37.52  ? 356  PRO A CG    1 
ATOM   2687  C  CD    . PRO A 1 355  ? -29.960 -76.157  64.891  1.00 37.17  ? 356  PRO A CD    1 
ATOM   2688  N  N     . LYS A 1 356  ? -27.033 -79.107  63.832  1.00 31.10  ? 357  LYS A N     1 
ATOM   2689  C  CA    . LYS A 1 356  ? -26.215 -79.683  62.798  1.00 28.43  ? 357  LYS A CA    1 
ATOM   2690  C  C     . LYS A 1 356  ? -26.684 -79.350  61.356  1.00 25.90  ? 357  LYS A C     1 
ATOM   2691  O  O     . LYS A 1 356  ? -27.685 -79.882  60.858  1.00 22.67  ? 357  LYS A O     1 
ATOM   2692  C  CB    . LYS A 1 356  ? -25.842 -81.150  62.913  1.00 29.84  ? 357  LYS A CB    1 
ATOM   2693  C  CG    . LYS A 1 356  ? -24.689 -81.493  61.958  1.00 32.89  ? 357  LYS A CG    1 
ATOM   2694  C  CD    . LYS A 1 356  ? -23.405 -80.759  62.313  1.00 39.17  ? 357  LYS A CD    1 
ATOM   2695  C  CE    . LYS A 1 356  ? -22.331 -80.719  61.237  1.00 42.47  ? 357  LYS A CE    1 
ATOM   2696  N  NZ    . LYS A 1 356  ? -21.825 -79.324  60.992  1.00 44.63  ? 357  LYS A NZ    1 
ATOM   2697  N  N     . ILE A 1 357  ? -25.804 -78.530  60.756  1.00 21.36  ? 358  ILE A N     1 
ATOM   2698  C  CA    . ILE A 1 357  ? -26.169 -78.058  59.407  1.00 23.23  ? 358  ILE A CA    1 
ATOM   2699  C  C     . ILE A 1 357  ? -25.141 -78.502  58.397  1.00 23.53  ? 358  ILE A C     1 
ATOM   2700  O  O     . ILE A 1 357  ? -23.956 -78.152  58.522  1.00 24.73  ? 358  ILE A O     1 
ATOM   2701  C  CB    . ILE A 1 357  ? -26.298 -76.521  59.422  1.00 23.75  ? 358  ILE A CB    1 
ATOM   2702  C  CG1   . ILE A 1 357  ? -27.223 -76.054  60.546  1.00 25.09  ? 358  ILE A CG1   1 
ATOM   2703  C  CG2   . ILE A 1 357  ? -26.835 -76.010  58.065  1.00 22.72  ? 358  ILE A CG2   1 
ATOM   2704  C  CD1   . ILE A 1 357  ? -27.056 -74.639  61.071  1.00 25.73  ? 358  ILE A CD1   1 
ATOM   2705  N  N     . LEU A 1 358  ? -25.565 -79.188  57.367  1.00 19.26  ? 359  LEU A N     1 
ATOM   2706  C  CA    . LEU A 1 358  ? -24.681 -79.639  56.301  1.00 18.98  ? 359  LEU A CA    1 
ATOM   2707  C  C     . LEU A 1 358  ? -24.994 -78.944  54.985  1.00 16.80  ? 359  LEU A C     1 
ATOM   2708  O  O     . LEU A 1 358  ? -26.172 -78.677  54.688  1.00 17.11  ? 359  LEU A O     1 
ATOM   2709  C  CB    . LEU A 1 358  ? -24.957 -81.141  56.174  1.00 18.42  ? 359  LEU A CB    1 
ATOM   2710  C  CG    . LEU A 1 358  ? -24.184 -82.190  56.972  1.00 22.66  ? 359  LEU A CG    1 
ATOM   2711  C  CD1   . LEU A 1 358  ? -23.196 -81.698  58.023  1.00 18.75  ? 359  LEU A CD1   1 
ATOM   2712  C  CD2   . LEU A 1 358  ? -25.082 -83.339  57.359  1.00 18.82  ? 359  LEU A CD2   1 
ATOM   2713  N  N     . ALA A 1 359  ? -23.994 -78.811  54.107  1.00 16.26  ? 360  ALA A N     1 
ATOM   2714  C  CA    . ALA A 1 359  ? -24.210 -78.187  52.798  1.00 16.61  ? 360  ALA A CA    1 
ATOM   2715  C  C     . ALA A 1 359  ? -23.985 -79.267  51.754  1.00 16.54  ? 360  ALA A C     1 
ATOM   2716  O  O     . ALA A 1 359  ? -23.054 -80.106  51.823  1.00 16.37  ? 360  ALA A O     1 
ATOM   2717  C  CB    . ALA A 1 359  ? -23.217 -77.023  52.565  1.00 18.96  ? 360  ALA A CB    1 
ATOM   2718  N  N     . GLY A 1 360  ? -24.869 -79.254  50.745  1.00 14.87  ? 361  GLY A N     1 
ATOM   2719  C  CA    . GLY A 1 360  ? -24.725 -80.241  49.669  1.00 14.21  ? 361  GLY A CA    1 
ATOM   2720  C  C     . GLY A 1 360  ? -24.980 -79.499  48.335  1.00 14.88  ? 361  GLY A C     1 
ATOM   2721  O  O     . GLY A 1 360  ? -25.758 -78.573  48.357  1.00 16.82  ? 361  GLY A O     1 
ATOM   2722  N  N     . ARG A 1 361  ? -24.350 -80.006  47.299  1.00 15.49  ? 362  ARG A N     1 
ATOM   2723  C  CA    . ARG A 1 361  ? -24.468 -79.451  45.948  1.00 15.41  ? 362  ARG A CA    1 
ATOM   2724  C  C     . ARG A 1 361  ? -25.000 -80.528  45.031  1.00 16.73  ? 362  ARG A C     1 
ATOM   2725  O  O     . ARG A 1 361  ? -24.533 -81.673  45.104  1.00 16.47  ? 362  ARG A O     1 
ATOM   2726  C  CB    . ARG A 1 361  ? -23.036 -79.059  45.445  1.00 16.15  ? 362  ARG A CB    1 
ATOM   2727  C  CG    . ARG A 1 361  ? -23.038 -78.313  44.111  1.00 14.77  ? 362  ARG A CG    1 
ATOM   2728  C  CD    . ARG A 1 361  ? -21.638 -77.886  43.619  1.00 16.06  ? 362  ARG A CD    1 
ATOM   2729  N  NE    . ARG A 1 361  ? -21.176 -76.905  44.609  1.00 16.06  ? 362  ARG A NE    1 
ATOM   2730  C  CZ    . ARG A 1 361  ? -20.135 -77.092  45.415  1.00 19.96  ? 362  ARG A CZ    1 
ATOM   2731  N  NH1   . ARG A 1 361  ? -19.861 -76.160  46.318  1.00 19.20  ? 362  ARG A NH1   1 
ATOM   2732  N  NH2   . ARG A 1 361  ? -19.338 -78.134  45.259  1.00 18.06  ? 362  ARG A NH2   1 
ATOM   2733  N  N     . TYR A 1 362  ? -25.850 -80.136  44.083  1.00 15.91  ? 363  TYR A N     1 
ATOM   2734  C  CA    . TYR A 1 362  ? -26.453 -81.139  43.205  1.00 16.71  ? 363  TYR A CA    1 
ATOM   2735  C  C     . TYR A 1 362  ? -26.867 -80.464  41.907  1.00 17.54  ? 363  TYR A C     1 
ATOM   2736  O  O     . TYR A 1 362  ? -26.920 -79.222  41.907  1.00 14.89  ? 363  TYR A O     1 
ATOM   2737  C  CB    . TYR A 1 362  ? -27.710 -81.634  43.988  1.00 16.41  ? 363  TYR A CB    1 
ATOM   2738  C  CG    . TYR A 1 362  ? -28.864 -80.599  43.971  1.00 15.93  ? 363  TYR A CG    1 
ATOM   2739  C  CD1   . TYR A 1 362  ? -28.869 -79.566  44.902  1.00 15.97  ? 363  TYR A CD1   1 
ATOM   2740  C  CD2   . TYR A 1 362  ? -29.869 -80.645  43.039  1.00 15.96  ? 363  TYR A CD2   1 
ATOM   2741  C  CE1   . TYR A 1 362  ? -29.902 -78.612  44.890  1.00 17.24  ? 363  TYR A CE1   1 
ATOM   2742  C  CE2   . TYR A 1 362  ? -30.910 -79.700  43.027  1.00 17.96  ? 363  TYR A CE2   1 
ATOM   2743  C  CZ    . TYR A 1 362  ? -30.890 -78.676  43.915  1.00 16.64  ? 363  TYR A CZ    1 
ATOM   2744  O  OH    . TYR A 1 362  ? -31.885 -77.702  43.951  1.00 14.31  ? 363  TYR A OH    1 
ATOM   2745  N  N     . GLY A 1 363  ? -27.255 -81.260  40.920  1.00 17.65  ? 364  GLY A N     1 
ATOM   2746  C  CA    . GLY A 1 363  ? -27.952 -80.824  39.730  1.00 17.68  ? 364  GLY A CA    1 
ATOM   2747  C  C     . GLY A 1 363  ? -27.340 -79.811  38.776  1.00 17.50  ? 364  GLY A C     1 
ATOM   2748  O  O     . GLY A 1 363  ? -28.053 -79.244  37.954  1.00 14.31  ? 364  GLY A O     1 
ATOM   2749  N  N     . LEU A 1 364  ? -26.008 -79.572  38.824  1.00 17.86  ? 365  LEU A N     1 
ATOM   2750  C  CA    . LEU A 1 364  ? -25.403 -78.621  37.886  1.00 17.94  ? 365  LEU A CA    1 
ATOM   2751  C  C     . LEU A 1 364  ? -25.626 -78.998  36.433  1.00 18.14  ? 365  LEU A C     1 
ATOM   2752  O  O     . LEU A 1 364  ? -25.448 -80.188  36.057  1.00 17.20  ? 365  LEU A O     1 
ATOM   2753  C  CB    . LEU A 1 364  ? -23.879 -78.550  38.144  1.00 18.12  ? 365  LEU A CB    1 
ATOM   2754  C  CG    . LEU A 1 364  ? -23.438 -77.572  39.216  1.00 20.80  ? 365  LEU A CG    1 
ATOM   2755  C  CD1   . LEU A 1 364  ? -24.349 -77.401  40.420  1.00 18.75  ? 365  LEU A CD1   1 
ATOM   2756  C  CD2   . LEU A 1 364  ? -21.986 -77.662  39.644  1.00 20.24  ? 365  LEU A CD2   1 
ATOM   2757  N  N     . GLY A 1 365  ? -25.973 -78.023  35.588  1.00 16.19  ? 366  GLY A N     1 
ATOM   2758  C  CA    . GLY A 1 365  ? -26.190 -78.359  34.180  1.00 16.21  ? 366  GLY A CA    1 
ATOM   2759  C  C     . GLY A 1 365  ? -27.153 -79.513  33.902  1.00 13.99  ? 366  GLY A C     1 
ATOM   2760  O  O     . GLY A 1 365  ? -26.909 -80.347  33.037  1.00 16.09  ? 366  GLY A O     1 
ATOM   2761  N  N     . SER A 1 366  ? -28.255 -79.503  34.612  1.00 16.05  ? 367  SER A N     1 
ATOM   2762  C  CA    . SER A 1 366  ? -29.373 -80.427  34.589  1.00 16.78  ? 367  SER A CA    1 
ATOM   2763  C  C     . SER A 1 366  ? -28.924 -81.834  34.973  1.00 16.79  ? 367  SER A C     1 
ATOM   2764  O  O     . SER A 1 366  ? -29.575 -82.832  34.596  1.00 17.52  ? 367  SER A O     1 
ATOM   2765  C  CB    . SER A 1 366  ? -30.062 -80.449  33.199  1.00 14.22  ? 367  SER A CB    1 
ATOM   2766  O  OG    . SER A 1 366  ? -30.995 -79.399  33.043  1.00 16.45  ? 367  SER A OG    1 
ATOM   2767  N  N     . LYS A 1 367  ? -27.823 -82.018  35.747  1.00 16.26  ? 368  LYS A N     1 
ATOM   2768  C  CA    . LYS A 1 367  ? -27.488 -83.409  36.152  1.00 15.69  ? 368  LYS A CA    1 
ATOM   2769  C  C     . LYS A 1 367  ? -28.717 -84.004  36.878  1.00 15.05  ? 368  LYS A C     1 
ATOM   2770  O  O     . LYS A 1 367  ? -29.378 -83.297  37.674  1.00 15.47  ? 368  LYS A O     1 
ATOM   2771  C  CB    . LYS A 1 367  ? -26.333 -83.360  37.164  1.00 14.81  ? 368  LYS A CB    1 
ATOM   2772  C  CG    . LYS A 1 367  ? -25.916 -84.700  37.777  1.00 14.23  ? 368  LYS A CG    1 
ATOM   2773  C  CD    . LYS A 1 367  ? -25.281 -85.691  36.819  1.00 14.66  ? 368  LYS A CD    1 
ATOM   2774  C  CE    . LYS A 1 367  ? -23.908 -85.105  36.444  1.00 16.72  ? 368  LYS A CE    1 
ATOM   2775  N  NZ    . LYS A 1 367  ? -23.249 -85.906  35.367  1.00 16.10  ? 368  LYS A NZ    1 
ATOM   2776  N  N     . GLU A 1 368  ? -28.989 -85.298  36.640  1.00 18.00  ? 369  GLU A N     1 
ATOM   2777  C  CA    . GLU A 1 368  ? -30.150 -85.890  37.301  1.00 18.22  ? 369  GLU A CA    1 
ATOM   2778  C  C     . GLU A 1 368  ? -30.112 -85.676  38.812  1.00 19.37  ? 369  GLU A C     1 
ATOM   2779  O  O     . GLU A 1 368  ? -29.033 -85.743  39.413  1.00 16.37  ? 369  GLU A O     1 
ATOM   2780  C  CB    . GLU A 1 368  ? -30.204 -87.442  37.130  1.00 19.50  ? 369  GLU A CB    1 
ATOM   2781  C  CG    . GLU A 1 368  ? -30.598 -87.894  35.745  1.00 24.42  ? 369  GLU A CG    1 
ATOM   2782  C  CD    . GLU A 1 368  ? -32.075 -87.496  35.483  1.00 26.65  ? 369  GLU A CD    1 
ATOM   2783  O  OE1   . GLU A 1 368  ? -32.157 -86.526  34.703  1.00 28.60  ? 369  GLU A OE1   1 
ATOM   2784  O  OE2   . GLU A 1 368  ? -33.026 -88.112  35.980  1.00 26.80  ? 369  GLU A OE2   1 
ATOM   2785  N  N     . PHE A 1 369  ? -31.292 -85.460  39.364  1.00 17.88  ? 370  PHE A N     1 
ATOM   2786  C  CA    . PHE A 1 369  ? -31.392 -85.406  40.832  1.00 19.56  ? 370  PHE A CA    1 
ATOM   2787  C  C     . PHE A 1 369  ? -32.523 -86.441  41.120  1.00 20.28  ? 370  PHE A C     1 
ATOM   2788  O  O     . PHE A 1 369  ? -33.687 -86.065  41.034  1.00 20.90  ? 370  PHE A O     1 
ATOM   2789  C  CB    . PHE A 1 369  ? -31.628 -84.048  41.394  1.00 17.24  ? 370  PHE A CB    1 
ATOM   2790  C  CG    . PHE A 1 369  ? -31.620 -84.005  42.902  1.00 17.70  ? 370  PHE A CG    1 
ATOM   2791  C  CD1   . PHE A 1 369  ? -32.789 -83.756  43.592  1.00 16.72  ? 370  PHE A CD1   1 
ATOM   2792  C  CD2   . PHE A 1 369  ? -30.479 -84.327  43.621  1.00 19.18  ? 370  PHE A CD2   1 
ATOM   2793  C  CE1   . PHE A 1 369  ? -32.806 -83.785  44.987  1.00 14.57  ? 370  PHE A CE1   1 
ATOM   2794  C  CE2   . PHE A 1 369  ? -30.477 -84.304  44.996  1.00 17.24  ? 370  PHE A CE2   1 
ATOM   2795  C  CZ    . PHE A 1 369  ? -31.653 -84.036  45.690  1.00 17.70  ? 370  PHE A CZ    1 
ATOM   2796  N  N     . SER A 1 370  ? -32.132 -87.681  41.292  1.00 18.22  ? 371  SER A N     1 
ATOM   2797  C  CA    . SER A 1 370  ? -33.108 -88.788  41.337  1.00 20.03  ? 371  SER A CA    1 
ATOM   2798  C  C     . SER A 1 370  ? -33.469 -89.243  42.714  1.00 17.61  ? 371  SER A C     1 
ATOM   2799  O  O     . SER A 1 370  ? -32.778 -88.923  43.671  1.00 18.69  ? 371  SER A O     1 
ATOM   2800  C  CB    . SER A 1 370  ? -32.416 -90.012  40.647  1.00 19.23  ? 371  SER A CB    1 
ATOM   2801  O  OG    . SER A 1 370  ? -31.331 -90.271  41.529  1.00 21.54  ? 371  SER A OG    1 
ATOM   2802  N  N     . PRO A 1 371  ? -34.523 -90.029  42.927  1.00 17.52  ? 372  PRO A N     1 
ATOM   2803  C  CA    . PRO A 1 371  ? -34.851 -90.516  44.259  1.00 18.00  ? 372  PRO A CA    1 
ATOM   2804  C  C     . PRO A 1 371  ? -33.676 -91.199  44.962  1.00 17.35  ? 372  PRO A C     1 
ATOM   2805  O  O     . PRO A 1 371  ? -33.589 -91.041  46.183  1.00 18.55  ? 372  PRO A O     1 
ATOM   2806  C  CB    . PRO A 1 371  ? -35.995 -91.548  44.004  1.00 19.00  ? 372  PRO A CB    1 
ATOM   2807  C  CG    . PRO A 1 371  ? -36.673 -90.885  42.829  1.00 19.55  ? 372  PRO A CG    1 
ATOM   2808  C  CD    . PRO A 1 371  ? -35.509 -90.432  41.904  1.00 18.48  ? 372  PRO A CD    1 
ATOM   2809  N  N     . ALA A 1 372  ? -32.813 -91.918  44.255  1.00 18.72  ? 373  ALA A N     1 
ATOM   2810  C  CA    . ALA A 1 372  ? -31.705 -92.631  44.896  1.00 20.22  ? 373  ALA A CA    1 
ATOM   2811  C  C     . ALA A 1 372  ? -30.722 -91.605  45.491  1.00 20.49  ? 373  ALA A C     1 
ATOM   2812  O  O     . ALA A 1 372  ? -30.141 -91.820  46.568  1.00 19.17  ? 373  ALA A O     1 
ATOM   2813  C  CB    . ALA A 1 372  ? -31.058 -93.628  43.955  1.00 18.14  ? 373  ALA A CB    1 
ATOM   2814  N  N     . MET A 1 373  ? -30.648 -90.457  44.818  1.00 17.98  ? 374  MET A N     1 
ATOM   2815  C  CA    . MET A 1 373  ? -29.791 -89.372  45.282  1.00 19.84  ? 374  MET A CA    1 
ATOM   2816  C  C     . MET A 1 373  ? -30.383 -88.728  46.510  1.00 17.85  ? 374  MET A C     1 
ATOM   2817  O  O     . MET A 1 373  ? -29.682 -88.422  47.489  1.00 19.45  ? 374  MET A O     1 
ATOM   2818  C  CB    . MET A 1 373  ? -29.490 -88.295  44.213  1.00 16.83  ? 374  MET A CB    1 
ATOM   2819  C  CG    . MET A 1 373  ? -28.628 -88.824  43.094  1.00 17.46  ? 374  MET A CG    1 
ATOM   2820  S  SD    . MET A 1 373  ? -28.556 -87.690  41.710  1.00 18.24  ? 374  MET A SD    1 
ATOM   2821  C  CE    . MET A 1 373  ? -28.154 -88.708  40.335  1.00 16.35  ? 374  MET A CE    1 
ATOM   2822  N  N     . VAL A 1 374  ? -31.717 -88.551  46.478  1.00 17.18  ? 375  VAL A N     1 
ATOM   2823  C  CA    . VAL A 1 374  ? -32.371 -87.995  47.682  1.00 18.81  ? 375  VAL A CA    1 
ATOM   2824  C  C     . VAL A 1 374  ? -32.158 -88.983  48.850  1.00 16.42  ? 375  VAL A C     1 
ATOM   2825  O  O     . VAL A 1 374  ? -31.917 -88.571  49.967  1.00 17.54  ? 375  VAL A O     1 
ATOM   2826  C  CB    . VAL A 1 374  ? -33.877 -87.783  47.444  1.00 19.01  ? 375  VAL A CB    1 
ATOM   2827  C  CG1   . VAL A 1 374  ? -34.579 -87.295  48.725  1.00 20.82  ? 375  VAL A CG1   1 
ATOM   2828  C  CG2   . VAL A 1 374  ? -34.162 -86.705  46.370  1.00 19.81  ? 375  VAL A CG2   1 
ATOM   2829  N  N     . LYS A 1 375  ? -32.321 -90.299  48.626  1.00 18.52  ? 376  LYS A N     1 
ATOM   2830  C  CA    . LYS A 1 375  ? -32.111 -91.311  49.677  1.00 18.29  ? 376  LYS A CA    1 
ATOM   2831  C  C     . LYS A 1 375  ? -30.727 -91.186  50.294  1.00 18.29  ? 376  LYS A C     1 
ATOM   2832  O  O     . LYS A 1 375  ? -30.509 -91.157  51.522  1.00 19.21  ? 376  LYS A O     1 
ATOM   2833  C  CB    . LYS A 1 375  ? -32.297 -92.735  49.103  1.00 21.41  ? 376  LYS A CB    1 
ATOM   2834  C  CG    . LYS A 1 375  ? -32.010 -93.845  50.139  1.00 21.93  ? 376  LYS A CG    1 
ATOM   2835  C  CD    . LYS A 1 375  ? -32.879 -93.705  51.375  1.00 22.77  ? 376  LYS A CD    1 
ATOM   2836  C  CE    . LYS A 1 375  ? -33.171 -95.125  51.961  1.00 27.07  ? 376  LYS A CE    1 
ATOM   2837  N  NZ    . LYS A 1 375  ? -31.962 -96.006  51.824  1.00 26.40  ? 376  LYS A NZ    1 
ATOM   2838  N  N     . SER A 1 376  ? -29.732 -91.016  49.411  1.00 19.79  ? 377  SER A N     1 
ATOM   2839  C  CA    . SER A 1 376  ? -28.347 -90.793  49.840  1.00 20.06  ? 377  SER A CA    1 
ATOM   2840  C  C     . SER A 1 376  ? -28.192 -89.605  50.767  1.00 18.81  ? 377  SER A C     1 
ATOM   2841  O  O     . SER A 1 376  ? -27.473 -89.612  51.805  1.00 17.20  ? 377  SER A O     1 
ATOM   2842  C  CB    . SER A 1 376  ? -27.535 -90.481  48.556  1.00 23.15  ? 377  SER A CB    1 
ATOM   2843  O  OG    . SER A 1 376  ? -26.245 -90.968  48.701  1.00 31.15  ? 377  SER A OG    1 
ATOM   2844  N  N     . VAL A 1 377  ? -28.874 -88.495  50.425  1.00 16.26  ? 378  VAL A N     1 
ATOM   2845  C  CA    . VAL A 1 377  ? -28.805 -87.285  51.218  1.00 16.20  ? 378  VAL A CA    1 
ATOM   2846  C  C     . VAL A 1 377  ? -29.415 -87.573  52.588  1.00 19.18  ? 378  VAL A C     1 
ATOM   2847  O  O     . VAL A 1 377  ? -28.935 -87.015  53.566  1.00 19.58  ? 378  VAL A O     1 
ATOM   2848  C  CB    . VAL A 1 377  ? -29.540 -86.078  50.587  1.00 16.12  ? 378  VAL A CB    1 
ATOM   2849  C  CG1   . VAL A 1 377  ? -29.650 -84.837  51.492  1.00 15.64  ? 378  VAL A CG1   1 
ATOM   2850  C  CG2   . VAL A 1 377  ? -28.809 -85.648  49.318  1.00 13.57  ? 378  VAL A CG2   1 
ATOM   2851  N  N     . TYR A 1 378  ? -30.541 -88.302  52.615  1.00 17.95  ? 379  TYR A N     1 
ATOM   2852  C  CA    . TYR A 1 378  ? -31.137 -88.540  53.929  1.00 19.90  ? 379  TYR A CA    1 
ATOM   2853  C  C     . TYR A 1 378  ? -30.279 -89.526  54.716  1.00 17.72  ? 379  TYR A C     1 
ATOM   2854  O  O     . TYR A 1 378  ? -30.172 -89.303  55.918  1.00 19.62  ? 379  TYR A O     1 
ATOM   2855  C  CB    . TYR A 1 378  ? -32.584 -89.086  53.899  1.00 16.91  ? 379  TYR A CB    1 
ATOM   2856  C  CG    . TYR A 1 378  ? -33.553 -87.950  53.690  1.00 17.93  ? 379  TYR A CG    1 
ATOM   2857  C  CD1   . TYR A 1 378  ? -34.275 -87.893  52.489  1.00 18.98  ? 379  TYR A CD1   1 
ATOM   2858  C  CD2   . TYR A 1 378  ? -33.758 -86.955  54.652  1.00 17.18  ? 379  TYR A CD2   1 
ATOM   2859  C  CE1   . TYR A 1 378  ? -35.159 -86.862  52.265  1.00 17.87  ? 379  TYR A CE1   1 
ATOM   2860  C  CE2   . TYR A 1 378  ? -34.631 -85.904  54.399  1.00 17.30  ? 379  TYR A CE2   1 
ATOM   2861  C  CZ    . TYR A 1 378  ? -35.333 -85.890  53.196  1.00 17.68  ? 379  TYR A CZ    1 
ATOM   2862  O  OH    . TYR A 1 378  ? -36.203 -84.866  52.953  1.00 20.44  ? 379  TYR A OH    1 
ATOM   2863  N  N     . ASP A 1 379  ? -29.720 -90.542  54.103  1.00 19.44  ? 380  ASP A N     1 
ATOM   2864  C  CA    . ASP A 1 379  ? -28.861 -91.544  54.710  1.00 20.17  ? 380  ASP A CA    1 
ATOM   2865  C  C     . ASP A 1 379  ? -27.591 -90.931  55.293  1.00 21.01  ? 380  ASP A C     1 
ATOM   2866  O  O     . ASP A 1 379  ? -27.164 -91.191  56.424  1.00 18.15  ? 380  ASP A O     1 
ATOM   2867  C  CB    . ASP A 1 379  ? -28.420 -92.649  53.726  1.00 22.47  ? 380  ASP A CB    1 
ATOM   2868  C  CG    . ASP A 1 379  ? -29.564 -93.622  53.398  1.00 23.71  ? 380  ASP A CG    1 
ATOM   2869  O  OD1   . ASP A 1 379  ? -30.586 -93.635  54.106  1.00 25.01  ? 380  ASP A OD1   1 
ATOM   2870  O  OD2   . ASP A 1 379  ? -29.390 -94.362  52.400  1.00 27.23  ? 380  ASP A OD2   1 
ATOM   2871  N  N     . ASN A 1 380  ? -27.053 -89.941  54.565  1.00 21.10  ? 381  ASN A N     1 
ATOM   2872  C  CA    . ASN A 1 380  ? -25.901 -89.150  55.066  1.00 20.69  ? 381  ASN A CA    1 
ATOM   2873  C  C     . ASN A 1 380  ? -26.190 -88.488  56.412  1.00 19.47  ? 381  ASN A C     1 
ATOM   2874  O  O     . ASN A 1 380  ? -25.287 -88.419  57.258  1.00 18.96  ? 381  ASN A O     1 
ATOM   2875  C  CB    . ASN A 1 380  ? -25.484 -88.082  54.072  1.00 18.95  ? 381  ASN A CB    1 
ATOM   2876  C  CG    . ASN A 1 380  ? -24.229 -87.303  54.411  1.00 20.52  ? 381  ASN A CG    1 
ATOM   2877  O  OD1   . ASN A 1 380  ? -23.206 -87.943  54.689  1.00 20.92  ? 381  ASN A OD1   1 
ATOM   2878  N  ND2   . ASN A 1 380  ? -24.338 -85.972  54.386  1.00 19.14  ? 381  ASN A ND2   1 
ATOM   2879  N  N     . MET A 1 381  ? -27.363 -87.975  56.661  1.00 19.46  ? 382  MET A N     1 
ATOM   2880  C  CA    . MET A 1 381  ? -27.701 -87.292  57.892  1.00 20.97  ? 382  MET A CA    1 
ATOM   2881  C  C     . MET A 1 381  ? -27.868 -88.285  59.058  1.00 24.29  ? 382  MET A C     1 
ATOM   2882  O  O     . MET A 1 381  ? -27.718 -87.884  60.210  1.00 23.16  ? 382  MET A O     1 
ATOM   2883  C  CB    . MET A 1 381  ? -29.001 -86.485  57.807  1.00 19.98  ? 382  MET A CB    1 
ATOM   2884  C  CG    . MET A 1 381  ? -28.830 -85.249  56.887  1.00 20.45  ? 382  MET A CG    1 
ATOM   2885  S  SD    . MET A 1 381  ? -30.256 -84.118  57.031  1.00 20.60  ? 382  MET A SD    1 
ATOM   2886  C  CE    . MET A 1 381  ? -31.247 -84.611  55.667  1.00 19.17  ? 382  MET A CE    1 
ATOM   2887  N  N     . SER A 1 382  ? -28.152 -89.540  58.733  1.00 24.85  ? 383  SER A N     1 
ATOM   2888  C  CA    . SER A 1 382  ? -28.162 -90.492  59.862  1.00 29.25  ? 383  SER A CA    1 
ATOM   2889  C  C     . SER A 1 382  ? -26.801 -91.184  59.963  1.00 30.02  ? 383  SER A C     1 
ATOM   2890  O  O     . SER A 1 382  ? -26.465 -91.702  61.023  1.00 33.65  ? 383  SER A O     1 
ATOM   2891  C  CB    . SER A 1 382  ? -29.333 -91.448  59.788  1.00 29.02  ? 383  SER A CB    1 
ATOM   2892  O  OG    . SER A 1 382  ? -29.387 -92.082  58.534  1.00 34.00  ? 383  SER A OG    1 
ATOM   2893  N  N     . GLY A 1 383  ? -25.949 -91.210  58.956  1.00 28.47  ? 384  GLY A N     1 
ATOM   2894  C  CA    . GLY A 1 383  ? -24.671 -91.877  59.010  1.00 28.76  ? 384  GLY A CA    1 
ATOM   2895  C  C     . GLY A 1 383  ? -23.456 -90.983  59.159  1.00 27.50  ? 384  GLY A C     1 
ATOM   2896  O  O     . GLY A 1 383  ? -23.239 -90.330  60.174  1.00 29.61  ? 384  GLY A O     1 
ATOM   2897  N  N     . ALA A 1 384  ? -22.666 -90.890  58.112  1.00 26.49  ? 385  ALA A N     1 
ATOM   2898  C  CA    . ALA A 1 384  ? -21.417 -90.120  58.091  1.00 25.64  ? 385  ALA A CA    1 
ATOM   2899  C  C     . ALA A 1 384  ? -21.548 -88.647  58.334  1.00 25.16  ? 385  ALA A C     1 
ATOM   2900  O  O     . ALA A 1 384  ? -20.653 -88.006  58.894  1.00 25.26  ? 385  ALA A O     1 
ATOM   2901  C  CB    . ALA A 1 384  ? -20.729 -90.443  56.786  1.00 26.43  ? 385  ALA A CB    1 
ATOM   2902  N  N     . LYS A 1 385  ? -22.656 -87.980  58.018  1.00 23.92  ? 386  LYS A N     1 
ATOM   2903  C  CA    . LYS A 1 385  ? -22.803 -86.556  58.197  1.00 23.75  ? 386  LYS A CA    1 
ATOM   2904  C  C     . LYS A 1 385  ? -21.705 -85.756  57.463  1.00 23.98  ? 386  LYS A C     1 
ATOM   2905  O  O     . LYS A 1 385  ? -21.195 -84.784  57.950  1.00 25.27  ? 386  LYS A O     1 
ATOM   2906  C  CB    . LYS A 1 385  ? -22.859 -86.180  59.667  1.00 25.92  ? 386  LYS A CB    1 
ATOM   2907  C  CG    . LYS A 1 385  ? -24.177 -86.706  60.305  1.00 27.47  ? 386  LYS A CG    1 
ATOM   2908  C  CD    . LYS A 1 385  ? -24.024 -86.544  61.814  1.00 31.37  ? 386  LYS A CD    1 
ATOM   2909  C  CE    . LYS A 1 385  ? -25.322 -86.764  62.566  1.00 35.29  ? 386  LYS A CE    1 
ATOM   2910  N  NZ    . LYS A 1 385  ? -25.792 -88.187  62.503  1.00 36.09  ? 386  LYS A NZ    1 
ATOM   2911  N  N     . LYS A 1 386  ? -21.322 -86.228  56.277  1.00 21.12  ? 387  LYS A N     1 
ATOM   2912  C  CA    . LYS A 1 386  ? -20.378 -85.552  55.417  1.00 22.01  ? 387  LYS A CA    1 
ATOM   2913  C  C     . LYS A 1 386  ? -20.924 -84.156  55.040  1.00 22.30  ? 387  LYS A C     1 
ATOM   2914  O  O     . LYS A 1 386  ? -22.110 -84.061  54.677  1.00 18.96  ? 387  LYS A O     1 
ATOM   2915  C  CB    . LYS A 1 386  ? -20.239 -86.317  54.101  1.00 23.61  ? 387  LYS A CB    1 
ATOM   2916  C  CG    . LYS A 1 386  ? -18.999 -85.955  53.340  1.00 24.08  ? 387  LYS A CG    1 
ATOM   2917  C  CD    . LYS A 1 386  ? -19.131 -86.440  51.915  1.00 26.47  ? 387  LYS A CD    1 
ATOM   2918  C  CE    . LYS A 1 386  ? -17.972 -87.267  51.458  1.00 29.14  ? 387  LYS A CE    1 
ATOM   2919  N  NZ    . LYS A 1 386  ? -16.647 -86.664  51.851  1.00 28.43  ? 387  LYS A NZ    1 
ATOM   2920  N  N     . ASN A 1 387  ? -20.055 -83.185  55.203  1.00 17.45  ? 388  ASN A N     1 
ATOM   2921  C  CA    . ASN A 1 387  ? -20.362 -81.802  54.935  1.00 19.10  ? 388  ASN A CA    1 
ATOM   2922  C  C     . ASN A 1 387  ? -19.764 -81.349  53.606  1.00 19.32  ? 388  ASN A C     1 
ATOM   2923  O  O     . ASN A 1 387  ? -18.862 -81.967  53.084  1.00 20.26  ? 388  ASN A O     1 
ATOM   2924  C  CB    . ASN A 1 387  ? -19.845 -80.882  56.044  1.00 18.57  ? 388  ASN A CB    1 
ATOM   2925  C  CG    . ASN A 1 387  ? -20.689 -79.622  56.115  1.00 21.05  ? 388  ASN A CG    1 
ATOM   2926  O  OD1   . ASN A 1 387  ? -21.589 -79.441  55.287  1.00 23.37  ? 388  ASN A OD1   1 
ATOM   2927  N  ND2   . ASN A 1 387  ? -20.420 -78.788  57.103  1.00 22.57  ? 388  ASN A ND2   1 
ATOM   2928  N  N     . HIS A 1 388  ? -20.298 -80.255  53.046  1.00 19.21  ? 389  HIS A N     1 
ATOM   2929  C  CA    . HIS A 1 388  ? -19.863 -79.784  51.730  1.00 20.62  ? 389  HIS A CA    1 
ATOM   2930  C  C     . HIS A 1 388  ? -19.735 -80.865  50.687  1.00 19.85  ? 389  HIS A C     1 
ATOM   2931  O  O     . HIS A 1 388  ? -18.702 -80.931  50.001  1.00 18.03  ? 389  HIS A O     1 
ATOM   2932  C  CB    . HIS A 1 388  ? -18.478 -79.084  51.960  1.00 19.61  ? 389  HIS A CB    1 
ATOM   2933  C  CG    . HIS A 1 388  ? -18.770 -77.846  52.777  1.00 21.15  ? 389  HIS A CG    1 
ATOM   2934  N  ND1   . HIS A 1 388  ? -18.440 -77.640  54.092  1.00 24.09  ? 389  HIS A ND1   1 
ATOM   2935  C  CD2   . HIS A 1 388  ? -19.482 -76.783  52.381  1.00 21.60  ? 389  HIS A CD2   1 
ATOM   2936  C  CE1   . HIS A 1 388  ? -18.914 -76.429  54.411  1.00 24.08  ? 389  HIS A CE1   1 
ATOM   2937  N  NE2   . HIS A 1 388  ? -19.541 -75.879  53.406  1.00 24.06  ? 389  HIS A NE2   1 
ATOM   2938  N  N     . PHE A 1 389  ? -20.794 -81.699  50.511  1.00 15.73  ? 390  PHE A N     1 
ATOM   2939  C  CA    . PHE A 1 389  ? -20.656 -82.793  49.588  1.00 16.56  ? 390  PHE A CA    1 
ATOM   2940  C  C     . PHE A 1 389  ? -21.165 -82.463  48.195  1.00 16.94  ? 390  PHE A C     1 
ATOM   2941  O  O     . PHE A 1 389  ? -21.819 -81.415  48.038  1.00 13.41  ? 390  PHE A O     1 
ATOM   2942  C  CB    . PHE A 1 389  ? -21.438 -83.987  50.176  1.00 17.04  ? 390  PHE A CB    1 
ATOM   2943  C  CG    . PHE A 1 389  ? -22.918 -83.786  50.335  1.00 17.47  ? 390  PHE A CG    1 
ATOM   2944  C  CD1   . PHE A 1 389  ? -23.758 -83.973  49.249  1.00 16.85  ? 390  PHE A CD1   1 
ATOM   2945  C  CD2   . PHE A 1 389  ? -23.449 -83.417  51.568  1.00 17.78  ? 390  PHE A CD2   1 
ATOM   2946  C  CE1   . PHE A 1 389  ? -25.114 -83.808  49.386  1.00 18.85  ? 390  PHE A CE1   1 
ATOM   2947  C  CE2   . PHE A 1 389  ? -24.821 -83.207  51.693  1.00 20.85  ? 390  PHE A CE2   1 
ATOM   2948  C  CZ    . PHE A 1 389  ? -25.659 -83.417  50.601  1.00 17.87  ? 390  PHE A CZ    1 
ATOM   2949  N  N     . THR A 1 390  ? -21.052 -83.418  47.289  1.00 16.15  ? 391  THR A N     1 
ATOM   2950  C  CA    . THR A 1 390  ? -21.738 -83.286  45.997  1.00 16.79  ? 391  THR A CA    1 
ATOM   2951  C  C     . THR A 1 390  ? -22.574 -84.564  45.850  1.00 17.29  ? 391  THR A C     1 
ATOM   2952  O  O     . THR A 1 390  ? -22.298 -85.540  46.565  1.00 16.83  ? 391  THR A O     1 
ATOM   2953  C  CB    . THR A 1 390  ? -20.719 -83.200  44.847  1.00 17.16  ? 391  THR A CB    1 
ATOM   2954  O  OG1   . THR A 1 390  ? -19.699 -84.195  45.072  1.00 18.28  ? 391  THR A OG1   1 
ATOM   2955  C  CG2   . THR A 1 390  ? -20.078 -81.794  44.880  1.00 16.26  ? 391  THR A CG2   1 
ATOM   2956  N  N     . VAL A 1 391  ? -23.624 -84.551  45.021  1.00 17.03  ? 392  VAL A N     1 
ATOM   2957  C  CA    . VAL A 1 391  ? -24.449 -85.721  44.825  1.00 15.91  ? 392  VAL A CA    1 
ATOM   2958  C  C     . VAL A 1 391  ? -24.802 -85.804  43.342  1.00 15.73  ? 392  VAL A C     1 
ATOM   2959  O  O     . VAL A 1 391  ? -25.225 -84.755  42.858  1.00 16.11  ? 392  VAL A O     1 
ATOM   2960  C  CB    . VAL A 1 391  ? -25.905 -85.732  45.370  1.00 20.65  ? 392  VAL A CB    1 
ATOM   2961  C  CG1   . VAL A 1 391  ? -26.182 -87.036  46.082  1.00 22.93  ? 392  VAL A CG1   1 
ATOM   2962  C  CG2   . VAL A 1 391  ? -26.466 -84.456  45.978  1.00 15.22  ? 392  VAL A CG2   1 
ATOM   2963  N  N     . GLY A 1 392  ? -24.632 -86.987  42.745  1.00 15.72  ? 393  GLY A N     1 
ATOM   2964  C  CA    . GLY A 1 392  ? -24.990 -87.151  41.342  1.00 16.83  ? 393  GLY A CA    1 
ATOM   2965  C  C     . GLY A 1 392  ? -23.747 -87.338  40.488  1.00 16.97  ? 393  GLY A C     1 
ATOM   2966  O  O     . GLY A 1 392  ? -23.857 -87.632  39.298  1.00 17.33  ? 393  GLY A O     1 
ATOM   2967  N  N     . ILE A 1 393  ? -22.569 -87.201  41.144  1.00 16.45  ? 394  ILE A N     1 
ATOM   2968  C  CA    . ILE A 1 393  ? -21.304 -87.462  40.485  1.00 17.92  ? 394  ILE A CA    1 
ATOM   2969  C  C     . ILE A 1 393  ? -20.408 -88.388  41.349  1.00 17.01  ? 394  ILE A C     1 
ATOM   2970  O  O     . ILE A 1 393  ? -20.627 -88.456  42.547  1.00 17.74  ? 394  ILE A O     1 
ATOM   2971  C  CB    . ILE A 1 393  ? -20.488 -86.170  40.183  1.00 19.02  ? 394  ILE A CB    1 
ATOM   2972  C  CG1   . ILE A 1 393  ? -20.210 -85.358  41.460  1.00 18.93  ? 394  ILE A CG1   1 
ATOM   2973  C  CG2   . ILE A 1 393  ? -21.272 -85.253  39.228  1.00 17.15  ? 394  ILE A CG2   1 
ATOM   2974  C  CD1   . ILE A 1 393  ? -19.162 -84.294  41.281  1.00 15.08  ? 394  ILE A CD1   1 
ATOM   2975  N  N     . GLU A 1 394  ? -19.384 -88.934  40.724  1.00 17.80  ? 395  GLU A N     1 
ATOM   2976  C  CA    . GLU A 1 394  ? -18.343 -89.615  41.486  1.00 19.87  ? 395  GLU A CA    1 
ATOM   2977  C  C     . GLU A 1 394  ? -17.082 -88.721  41.501  1.00 17.47  ? 395  GLU A C     1 
ATOM   2978  O  O     . GLU A 1 394  ? -16.395 -88.586  40.469  1.00 17.23  ? 395  GLU A O     1 
ATOM   2979  C  CB    . GLU A 1 394  ? -18.008 -91.008  40.919  1.00 18.84  ? 395  GLU A CB    1 
ATOM   2980  C  CG    . GLU A 1 394  ? -16.883 -91.654  41.792  1.00 21.39  ? 395  GLU A CG    1 
ATOM   2981  C  CD    . GLU A 1 394  ? -16.353 -92.929  41.137  1.00 25.33  ? 395  GLU A CD    1 
ATOM   2982  O  OE1   . GLU A 1 394  ? -16.912 -93.487  40.173  1.00 26.60  ? 395  GLU A OE1   1 
ATOM   2983  O  OE2   . GLU A 1 394  ? -15.287 -93.419  41.621  1.00 25.08  ? 395  GLU A OE2   1 
ATOM   2984  N  N     . ASP A 1 395  ? -16.822 -88.153  42.675  1.00 18.16  ? 396  ASP A N     1 
ATOM   2985  C  CA    . ASP A 1 395  ? -15.670 -87.255  42.813  1.00 18.49  ? 396  ASP A CA    1 
ATOM   2986  C  C     . ASP A 1 395  ? -14.511 -88.044  43.477  1.00 19.05  ? 396  ASP A C     1 
ATOM   2987  O  O     . ASP A 1 395  ? -14.345 -88.029  44.692  1.00 19.51  ? 396  ASP A O     1 
ATOM   2988  C  CB    . ASP A 1 395  ? -15.961 -85.974  43.554  1.00 17.32  ? 396  ASP A CB    1 
ATOM   2989  C  CG    . ASP A 1 395  ? -14.677 -85.148  43.810  1.00 15.19  ? 396  ASP A CG    1 
ATOM   2990  O  OD1   . ASP A 1 395  ? -14.705 -84.429  44.816  1.00 14.78  ? 396  ASP A OD1   1 
ATOM   2991  O  OD2   . ASP A 1 395  ? -13.684 -85.235  43.065  1.00 15.98  ? 396  ASP A OD2   1 
ATOM   2992  N  N     . ASP A 1 396  ? -13.766 -88.686  42.582  1.00 18.73  ? 397  ASP A N     1 
ATOM   2993  C  CA    . ASP A 1 396  ? -12.631 -89.504  42.989  1.00 21.36  ? 397  ASP A CA    1 
ATOM   2994  C  C     . ASP A 1 396  ? -11.394 -88.629  43.153  1.00 21.75  ? 397  ASP A C     1 
ATOM   2995  O  O     . ASP A 1 396  ? -10.300 -89.104  43.508  1.00 21.32  ? 397  ASP A O     1 
ATOM   2996  C  CB    . ASP A 1 396  ? -12.460 -90.610  41.944  1.00 22.54  ? 397  ASP A CB    1 
ATOM   2997  C  CG    . ASP A 1 396  ? -12.234 -90.167  40.524  1.00 22.09  ? 397  ASP A CG    1 
ATOM   2998  O  OD1   . ASP A 1 396  ? -12.522 -88.983  40.123  1.00 21.35  ? 397  ASP A OD1   1 
ATOM   2999  O  OD2   . ASP A 1 396  ? -11.727 -91.016  39.760  1.00 19.04  ? 397  ASP A OD2   1 
ATOM   3000  N  N     . VAL A 1 397  ? -11.516 -87.321  42.834  1.00 21.20  ? 398  VAL A N     1 
ATOM   3001  C  CA    . VAL A 1 397  ? -10.303 -86.488  43.000  1.00 19.44  ? 398  VAL A CA    1 
ATOM   3002  C  C     . VAL A 1 397  ? -10.347 -85.781  44.329  1.00 18.89  ? 398  VAL A C     1 
ATOM   3003  O  O     . VAL A 1 397  ? -9.312  -85.849  45.017  1.00 20.63  ? 398  VAL A O     1 
ATOM   3004  C  CB    . VAL A 1 397  ? -9.867  -85.729  41.755  1.00 22.50  ? 398  VAL A CB    1 
ATOM   3005  C  CG1   . VAL A 1 397  ? -10.738 -85.889  40.567  1.00 22.25  ? 398  VAL A CG1   1 
ATOM   3006  C  CG2   . VAL A 1 397  ? -9.345  -84.292  41.946  1.00 19.60  ? 398  VAL A CG2   1 
ATOM   3007  N  N     . THR A 1 398  ? -11.464 -85.191  44.776  1.00 17.53  ? 399  THR A N     1 
ATOM   3008  C  CA    . THR A 1 398  ? -11.421 -84.483  46.064  1.00 16.46  ? 399  THR A CA    1 
ATOM   3009  C  C     . THR A 1 398  ? -12.298 -85.188  47.081  1.00 14.54  ? 399  THR A C     1 
ATOM   3010  O  O     . THR A 1 398  ? -12.341 -84.790  48.231  1.00 15.81  ? 399  THR A O     1 
ATOM   3011  C  CB    . THR A 1 398  ? -11.716 -82.980  46.024  1.00 18.09  ? 399  THR A CB    1 
ATOM   3012  O  OG1   . THR A 1 398  ? -12.723 -82.790  45.035  1.00 17.26  ? 399  THR A OG1   1 
ATOM   3013  C  CG2   . THR A 1 398  ? -10.433 -82.330  45.460  1.00 17.20  ? 399  THR A CG2   1 
ATOM   3014  N  N     . GLY A 1 399  ? -13.015 -86.204  46.674  1.00 16.13  ? 400  GLY A N     1 
ATOM   3015  C  CA    . GLY A 1 399  ? -13.700 -87.067  47.676  1.00 17.74  ? 400  GLY A CA    1 
ATOM   3016  C  C     . GLY A 1 399  ? -14.905 -86.409  48.286  1.00 20.48  ? 400  GLY A C     1 
ATOM   3017  O  O     . GLY A 1 399  ? -15.304 -86.718  49.436  1.00 20.25  ? 400  GLY A O     1 
ATOM   3018  N  N     . THR A 1 400  ? -15.511 -85.459  47.550  1.00 19.71  ? 401  THR A N     1 
ATOM   3019  C  CA    . THR A 1 400  ? -16.659 -84.780  48.126  1.00 19.54  ? 401  THR A CA    1 
ATOM   3020  C  C     . THR A 1 400  ? -18.029 -85.454  47.863  1.00 21.33  ? 401  THR A C     1 
ATOM   3021  O  O     . THR A 1 400  ? -19.007 -84.942  48.426  1.00 17.86  ? 401  THR A O     1 
ATOM   3022  C  CB    . THR A 1 400  ? -16.819 -83.337  47.595  1.00 20.59  ? 401  THR A CB    1 
ATOM   3023  O  OG1   . THR A 1 400  ? -17.088 -83.384  46.193  1.00 16.58  ? 401  THR A OG1   1 
ATOM   3024  C  CG2   . THR A 1 400  ? -15.520 -82.573  47.910  1.00 20.13  ? 401  THR A CG2   1 
ATOM   3025  N  N     . SER A 1 401  ? -18.046 -86.440  47.003  1.00 20.33  ? 402  SER A N     1 
ATOM   3026  C  CA    . SER A 1 401  ? -19.329 -87.040  46.652  1.00 20.20  ? 402  SER A CA    1 
ATOM   3027  C  C     . SER A 1 401  ? -19.854 -88.096  47.619  1.00 21.49  ? 402  SER A C     1 
ATOM   3028  O  O     . SER A 1 401  ? -19.196 -88.858  48.352  1.00 18.93  ? 402  SER A O     1 
ATOM   3029  C  CB    . SER A 1 401  ? -19.264 -87.607  45.235  1.00 19.82  ? 402  SER A CB    1 
ATOM   3030  O  OG    . SER A 1 401  ? -18.251 -88.593  45.134  1.00 18.15  ? 402  SER A OG    1 
ATOM   3031  N  N     . LEU A 1 402  ? -21.205 -88.155  47.609  1.00 19.35  ? 403  LEU A N     1 
ATOM   3032  C  CA    . LEU A 1 402  ? -21.947 -89.163  48.367  1.00 20.95  ? 403  LEU A CA    1 
ATOM   3033  C  C     . LEU A 1 402  ? -22.187 -90.401  47.526  1.00 20.74  ? 403  LEU A C     1 
ATOM   3034  O  O     . LEU A 1 402  ? -22.453 -90.351  46.335  1.00 19.61  ? 403  LEU A O     1 
ATOM   3035  C  CB    . LEU A 1 402  ? -23.268 -88.433  48.676  1.00 21.96  ? 403  LEU A CB    1 
ATOM   3036  C  CG    . LEU A 1 402  ? -23.606 -87.962  50.065  1.00 23.12  ? 403  LEU A CG    1 
ATOM   3037  C  CD1   . LEU A 1 402  ? -22.459 -87.360  50.823  1.00 23.24  ? 403  LEU A CD1   1 
ATOM   3038  C  CD2   . LEU A 1 402  ? -24.837 -87.054  50.087  1.00 23.87  ? 403  LEU A CD2   1 
ATOM   3039  N  N     . PRO A 1 403  ? -22.010 -91.615  48.046  1.00 22.96  ? 404  PRO A N     1 
ATOM   3040  C  CA    . PRO A 1 403  ? -22.266 -92.844  47.280  1.00 24.39  ? 404  PRO A CA    1 
ATOM   3041  C  C     . PRO A 1 403  ? -23.749 -92.952  46.965  1.00 22.47  ? 404  PRO A C     1 
ATOM   3042  O  O     . PRO A 1 403  ? -24.521 -92.534  47.834  1.00 21.81  ? 404  PRO A O     1 
ATOM   3043  C  CB    . PRO A 1 403  ? -21.702 -93.946  48.164  1.00 25.13  ? 404  PRO A CB    1 
ATOM   3044  C  CG    . PRO A 1 403  ? -21.746 -93.374  49.543  1.00 27.17  ? 404  PRO A CG    1 
ATOM   3045  C  CD    . PRO A 1 403  ? -21.650 -91.879  49.459  1.00 23.50  ? 404  PRO A CD    1 
ATOM   3046  N  N     . VAL A 1 404  ? -24.120 -93.302  45.756  1.00 22.58  ? 405  VAL A N     1 
ATOM   3047  C  CA    . VAL A 1 404  ? -25.567 -93.413  45.441  1.00 24.51  ? 405  VAL A CA    1 
ATOM   3048  C  C     . VAL A 1 404  ? -25.839 -94.888  45.136  1.00 26.90  ? 405  VAL A C     1 
ATOM   3049  O  O     . VAL A 1 404  ? -25.206 -95.471  44.250  1.00 28.19  ? 405  VAL A O     1 
ATOM   3050  C  CB    . VAL A 1 404  ? -26.001 -92.485  44.305  1.00 23.14  ? 405  VAL A CB    1 
ATOM   3051  C  CG1   . VAL A 1 404  ? -27.497 -92.655  43.948  1.00 19.20  ? 405  VAL A CG1   1 
ATOM   3052  C  CG2   . VAL A 1 404  ? -25.768 -91.016  44.743  1.00 22.32  ? 405  VAL A CG2   1 
ATOM   3053  N  N     . ASP A 1 405  ? -26.859 -95.436  45.749  1.00 28.86  ? 406  ASP A N     1 
ATOM   3054  C  CA    . ASP A 1 405  ? -27.286 -96.808  45.501  1.00 33.20  ? 406  ASP A CA    1 
ATOM   3055  C  C     . ASP A 1 405  ? -28.465 -96.788  44.529  1.00 33.26  ? 406  ASP A C     1 
ATOM   3056  O  O     . ASP A 1 405  ? -29.569 -96.494  45.004  1.00 31.82  ? 406  ASP A O     1 
ATOM   3057  C  CB    . ASP A 1 405  ? -27.775 -97.416  46.822  1.00 36.07  ? 406  ASP A CB    1 
ATOM   3058  C  CG    . ASP A 1 405  ? -28.014 -98.918  46.711  1.00 37.93  ? 406  ASP A CG    1 
ATOM   3059  O  OD1   . ASP A 1 405  ? -28.095 -99.489  47.821  1.00 39.81  ? 406  ASP A OD1   1 
ATOM   3060  O  OD2   . ASP A 1 405  ? -28.090 -99.507  45.618  1.00 37.89  ? 406  ASP A OD2   1 
ATOM   3061  N  N     . ASN A 1 406  ? -28.230 -97.159  43.292  1.00 35.24  ? 407  ASN A N     1 
ATOM   3062  C  CA    . ASN A 1 406  ? -29.333 -97.115  42.326  1.00 39.17  ? 407  ASN A CA    1 
ATOM   3063  C  C     . ASN A 1 406  ? -30.299 -98.279  42.434  1.00 39.88  ? 407  ASN A C     1 
ATOM   3064  O  O     . ASN A 1 406  ? -31.298 -98.302  41.713  1.00 41.39  ? 407  ASN A O     1 
ATOM   3065  C  CB    . ASN A 1 406  ? -28.758 -96.992  40.901  1.00 41.79  ? 407  ASN A CB    1 
ATOM   3066  C  CG    . ASN A 1 406  ? -28.307 -95.535  40.753  1.00 43.76  ? 407  ASN A CG    1 
ATOM   3067  O  OD1   . ASN A 1 406  ? -29.131 -94.626  40.873  1.00 42.63  ? 407  ASN A OD1   1 
ATOM   3068  N  ND2   . ASN A 1 406  ? -27.012 -95.324  40.565  1.00 44.37  ? 407  ASN A ND2   1 
ATOM   3069  N  N     . ALA A 1 407  ? -30.076 -99.211  43.357  1.00 38.05  ? 408  ALA A N     1 
ATOM   3070  C  CA    . ALA A 1 407  ? -31.040 -100.287 43.565  1.00 38.24  ? 408  ALA A CA    1 
ATOM   3071  C  C     . ALA A 1 407  ? -32.261 -99.728  44.311  1.00 36.27  ? 408  ALA A C     1 
ATOM   3072  O  O     . ALA A 1 407  ? -33.188 -100.498 44.563  1.00 35.60  ? 408  ALA A O     1 
ATOM   3073  C  CB    . ALA A 1 407  ? -30.511 -101.417 44.438  1.00 37.99  ? 408  ALA A CB    1 
ATOM   3074  N  N     . PHE A 1 408  ? -32.238 -98.458  44.685  1.00 32.42  ? 409  PHE A N     1 
ATOM   3075  C  CA    . PHE A 1 408  ? -33.332 -97.875  45.452  1.00 32.14  ? 409  PHE A CA    1 
ATOM   3076  C  C     . PHE A 1 408  ? -34.693 -98.136  44.814  1.00 31.72  ? 409  PHE A C     1 
ATOM   3077  O  O     . PHE A 1 408  ? -34.788 -98.082  43.597  1.00 31.29  ? 409  PHE A O     1 
ATOM   3078  C  CB    . PHE A 1 408  ? -33.124 -96.366  45.659  1.00 30.65  ? 409  PHE A CB    1 
ATOM   3079  C  CG    . PHE A 1 408  ? -34.098 -95.686  46.576  1.00 29.82  ? 409  PHE A CG    1 
ATOM   3080  C  CD1   . PHE A 1 408  ? -34.768 -94.546  46.146  1.00 29.01  ? 409  PHE A CD1   1 
ATOM   3081  C  CD2   . PHE A 1 408  ? -34.340 -96.154  47.858  1.00 28.10  ? 409  PHE A CD2   1 
ATOM   3082  C  CE1   . PHE A 1 408  ? -35.658 -93.890  46.976  1.00 28.77  ? 409  PHE A CE1   1 
ATOM   3083  C  CE2   . PHE A 1 408  ? -35.254 -95.528  48.673  1.00 28.01  ? 409  PHE A CE2   1 
ATOM   3084  C  CZ    . PHE A 1 408  ? -35.914 -94.383  48.246  1.00 28.64  ? 409  PHE A CZ    1 
ATOM   3085  N  N     . ALA A 1 409  ? -35.727 -98.373  45.622  1.00 31.59  ? 410  ALA A N     1 
ATOM   3086  C  CA    . ALA A 1 409  ? -37.056 -98.622  45.061  1.00 31.71  ? 410  ALA A CA    1 
ATOM   3087  C  C     . ALA A 1 409  ? -37.637 -97.484  44.228  1.00 32.39  ? 410  ALA A C     1 
ATOM   3088  O  O     . ALA A 1 409  ? -37.355 -96.293  44.461  1.00 31.20  ? 410  ALA A O     1 
ATOM   3089  C  CB    . ALA A 1 409  ? -37.992 -98.818  46.257  1.00 32.92  ? 410  ALA A CB    1 
ATOM   3090  N  N     . ASP A 1 410  ? -38.527 -97.817  43.304  1.00 31.05  ? 411  ASP A N     1 
ATOM   3091  C  CA    . ASP A 1 410  ? -39.267 -96.819  42.527  1.00 31.75  ? 411  ASP A CA    1 
ATOM   3092  C  C     . ASP A 1 410  ? -40.187 -96.099  43.531  1.00 30.69  ? 411  ASP A C     1 
ATOM   3093  O  O     . ASP A 1 410  ? -40.835 -96.744  44.361  1.00 27.63  ? 411  ASP A O     1 
ATOM   3094  C  CB    . ASP A 1 410  ? -40.075 -97.506  41.415  1.00 33.58  ? 411  ASP A CB    1 
ATOM   3095  C  CG    . ASP A 1 410  ? -40.689 -96.477  40.485  1.00 36.35  ? 411  ASP A CG    1 
ATOM   3096  O  OD1   . ASP A 1 410  ? -41.836 -96.113  40.741  1.00 38.32  ? 411  ASP A OD1   1 
ATOM   3097  O  OD2   . ASP A 1 410  ? -40.049 -95.988  39.539  1.00 37.92  ? 411  ASP A OD2   1 
ATOM   3098  N  N     . THR A 1 411  ? -40.189 -94.775  43.537  1.00 26.96  ? 412  THR A N     1 
ATOM   3099  C  CA    . THR A 1 411  ? -40.997 -94.007  44.469  1.00 27.42  ? 412  THR A CA    1 
ATOM   3100  C  C     . THR A 1 411  ? -42.187 -93.328  43.794  1.00 25.49  ? 412  THR A C     1 
ATOM   3101  O  O     . THR A 1 411  ? -42.900 -92.593  44.495  1.00 24.98  ? 412  THR A O     1 
ATOM   3102  C  CB    . THR A 1 411  ? -40.126 -92.942  45.187  1.00 27.65  ? 412  THR A CB    1 
ATOM   3103  O  OG1   . THR A 1 411  ? -39.448 -92.136  44.200  1.00 27.71  ? 412  THR A OG1   1 
ATOM   3104  C  CG2   . THR A 1 411  ? -39.057 -93.648  46.010  1.00 29.73  ? 412  THR A CG2   1 
ATOM   3105  N  N     . THR A 1 412  ? -42.511 -93.644  42.530  1.00 25.51  ? 413  THR A N     1 
ATOM   3106  C  CA    . THR A 1 412  ? -43.685 -92.982  41.941  1.00 24.51  ? 413  THR A CA    1 
ATOM   3107  C  C     . THR A 1 412  ? -44.969 -93.457  42.598  1.00 26.26  ? 413  THR A C     1 
ATOM   3108  O  O     . THR A 1 412  ? -45.011 -94.585  43.082  1.00 24.68  ? 413  THR A O     1 
ATOM   3109  C  CB    . THR A 1 412  ? -43.800 -93.303  40.439  1.00 26.87  ? 413  THR A CB    1 
ATOM   3110  O  OG1   . THR A 1 412  ? -43.743 -94.721  40.290  1.00 27.51  ? 413  THR A OG1   1 
ATOM   3111  C  CG2   . THR A 1 412  ? -42.700 -92.601  39.663  1.00 26.29  ? 413  THR A CG2   1 
ATOM   3112  N  N     . PRO A 1 413  ? -45.996 -92.639  42.680  1.00 27.31  ? 414  PRO A N     1 
ATOM   3113  C  CA    . PRO A 1 413  ? -47.243 -93.033  43.317  1.00 28.24  ? 414  PRO A CA    1 
ATOM   3114  C  C     . PRO A 1 413  ? -47.812 -94.291  42.717  1.00 26.48  ? 414  PRO A C     1 
ATOM   3115  O  O     . PRO A 1 413  ? -47.635 -94.672  41.546  1.00 26.44  ? 414  PRO A O     1 
ATOM   3116  C  CB    . PRO A 1 413  ? -48.146 -91.814  43.126  1.00 27.83  ? 414  PRO A CB    1 
ATOM   3117  C  CG    . PRO A 1 413  ? -47.181 -90.670  42.982  1.00 29.54  ? 414  PRO A CG    1 
ATOM   3118  C  CD    . PRO A 1 413  ? -46.048 -91.248  42.149  1.00 27.49  ? 414  PRO A CD    1 
ATOM   3119  N  N     . LYS A 1 414  ? -48.580 -94.984  43.546  1.00 30.89  ? 415  LYS A N     1 
ATOM   3120  C  CA    . LYS A 1 414  ? -49.274 -96.200  43.127  1.00 33.39  ? 415  LYS A CA    1 
ATOM   3121  C  C     . LYS A 1 414  ? -50.128 -95.894  41.903  1.00 31.90  ? 415  LYS A C     1 
ATOM   3122  O  O     . LYS A 1 414  ? -50.778 -94.855  41.968  1.00 31.34  ? 415  LYS A O     1 
ATOM   3123  C  CB    . LYS A 1 414  ? -50.142 -96.650  44.317  1.00 37.57  ? 415  LYS A CB    1 
ATOM   3124  C  CG    . LYS A 1 414  ? -49.905 -98.134  44.545  1.00 42.01  ? 415  LYS A CG    1 
ATOM   3125  C  CD    . LYS A 1 414  ? -51.031 -98.817  45.304  1.00 44.89  ? 415  LYS A CD    1 
ATOM   3126  C  CE    . LYS A 1 414  ? -50.394 -99.721  46.376  1.00 46.94  ? 415  LYS A CE    1 
ATOM   3127  N  NZ    . LYS A 1 414  ? -51.240 -99.733  47.625  1.00 47.75  ? 415  LYS A NZ    1 
ATOM   3128  N  N     . GLY A 1 415  ? -49.985 -96.680  40.829  1.00 30.52  ? 416  GLY A N     1 
ATOM   3129  C  CA    . GLY A 1 415  ? -50.827 -96.377  39.690  1.00 29.98  ? 416  GLY A CA    1 
ATOM   3130  C  C     . GLY A 1 415  ? -50.109 -95.765  38.503  1.00 29.93  ? 416  GLY A C     1 
ATOM   3131  O  O     . GLY A 1 415  ? -50.491 -96.017  37.356  1.00 31.90  ? 416  GLY A O     1 
ATOM   3132  N  N     . THR A 1 416  ? -49.000 -95.062  38.735  1.00 26.49  ? 417  THR A N     1 
ATOM   3133  C  CA    . THR A 1 416  ? -48.301 -94.404  37.660  1.00 24.35  ? 417  THR A CA    1 
ATOM   3134  C  C     . THR A 1 416  ? -47.741 -95.291  36.576  1.00 24.63  ? 417  THR A C     1 
ATOM   3135  O  O     . THR A 1 416  ? -47.023 -96.228  36.894  1.00 25.86  ? 417  THR A O     1 
ATOM   3136  C  CB    . THR A 1 416  ? -47.147 -93.569  38.286  1.00 23.74  ? 417  THR A CB    1 
ATOM   3137  O  OG1   . THR A 1 416  ? -47.593 -92.813  39.416  1.00 24.12  ? 417  THR A OG1   1 
ATOM   3138  C  CG2   . THR A 1 416  ? -46.623 -92.617  37.208  1.00 24.95  ? 417  THR A CG2   1 
ATOM   3139  N  N     . ILE A 1 417  ? -47.997 -95.007  35.311  1.00 23.75  ? 418  ILE A N     1 
ATOM   3140  C  CA    . ILE A 1 417  ? -47.417 -95.731  34.184  1.00 25.60  ? 418  ILE A CA    1 
ATOM   3141  C  C     . ILE A 1 417  ? -46.259 -94.893  33.618  1.00 24.74  ? 418  ILE A C     1 
ATOM   3142  O  O     . ILE A 1 417  ? -46.530 -93.760  33.272  1.00 26.75  ? 418  ILE A O     1 
ATOM   3143  C  CB    . ILE A 1 417  ? -48.401 -96.025  33.038  1.00 26.03  ? 418  ILE A CB    1 
ATOM   3144  C  CG1   . ILE A 1 417  ? -49.384 -97.075  33.616  1.00 28.05  ? 418  ILE A CG1   1 
ATOM   3145  C  CG2   . ILE A 1 417  ? -47.809 -96.616  31.780  1.00 27.07  ? 418  ILE A CG2   1 
ATOM   3146  C  CD1   . ILE A 1 417  ? -50.448 -96.374  34.421  1.00 31.89  ? 418  ILE A CD1   1 
ATOM   3147  N  N     . GLN A 1 418  ? -45.099 -95.466  33.484  1.00 25.64  ? 419  GLN A N     1 
ATOM   3148  C  CA    . GLN A 1 418  ? -43.892 -94.783  33.002  1.00 24.43  ? 419  GLN A CA    1 
ATOM   3149  C  C     . GLN A 1 418  ? -43.421 -95.408  31.716  1.00 26.41  ? 419  GLN A C     1 
ATOM   3150  O  O     . GLN A 1 418  ? -43.260 -96.652  31.626  1.00 25.91  ? 419  GLN A O     1 
ATOM   3151  C  CB    . GLN A 1 418  ? -42.796 -94.941  34.068  1.00 27.35  ? 419  GLN A CB    1 
ATOM   3152  C  CG    . GLN A 1 418  ? -43.343 -94.604  35.462  1.00 28.99  ? 419  GLN A CG    1 
ATOM   3153  C  CD    . GLN A 1 418  ? -42.230 -94.506  36.487  1.00 29.59  ? 419  GLN A CD    1 
ATOM   3154  O  OE1   . GLN A 1 418  ? -41.430 -93.559  36.435  1.00 29.42  ? 419  GLN A OE1   1 
ATOM   3155  N  NE2   . GLN A 1 418  ? -42.179 -95.425  37.432  1.00 29.92  ? 419  GLN A NE2   1 
ATOM   3156  N  N     . CYS A 1 419  ? -43.171 -94.562  30.711  1.00 25.48  ? 420  CYS A N     1 
ATOM   3157  C  CA    . CYS A 1 419  ? -42.832 -95.042  29.377  1.00 24.85  ? 420  CYS A CA    1 
ATOM   3158  C  C     . CYS A 1 419  ? -41.572 -94.395  28.810  1.00 26.15  ? 420  CYS A C     1 
ATOM   3159  O  O     . CYS A 1 419  ? -41.358 -93.212  29.126  1.00 23.37  ? 420  CYS A O     1 
ATOM   3160  C  CB    . CYS A 1 419  ? -43.991 -94.613  28.468  1.00 25.67  ? 420  CYS A CB    1 
ATOM   3161  S  SG    . CYS A 1 419  ? -45.655 -95.070  29.006  1.00 27.39  ? 420  CYS A SG    1 
ATOM   3162  N  N     . GLN A 1 420  ? -40.809 -95.147  28.006  1.00 23.90  ? 421  GLN A N     1 
ATOM   3163  C  CA    . GLN A 1 420  ? -39.676 -94.459  27.368  1.00 24.61  ? 421  GLN A CA    1 
ATOM   3164  C  C     . GLN A 1 420  ? -39.773 -94.768  25.885  1.00 25.41  ? 421  GLN A C     1 
ATOM   3165  O  O     . GLN A 1 420  ? -40.190 -95.868  25.556  1.00 24.50  ? 421  GLN A O     1 
ATOM   3166  C  CB    . GLN A 1 420  ? -38.336 -94.897  27.919  1.00 25.50  ? 421  GLN A CB    1 
ATOM   3167  C  CG    . GLN A 1 420  ? -38.121 -94.690  29.417  1.00 28.38  ? 421  GLN A CG    1 
ATOM   3168  C  CD    . GLN A 1 420  ? -36.875 -95.458  29.865  1.00 30.12  ? 421  GLN A CD    1 
ATOM   3169  O  OE1   . GLN A 1 420  ? -36.031 -94.969  30.616  1.00 30.03  ? 421  GLN A OE1   1 
ATOM   3170  N  NE2   . GLN A 1 420  ? -36.798 -96.704  29.414  1.00 31.51  ? 421  GLN A NE2   1 
ATOM   3171  N  N     . PHE A 1 421  ? -39.448 -93.854  25.001  1.00 24.51  ? 422  PHE A N     1 
ATOM   3172  C  CA    . PHE A 1 421  ? -39.488 -94.054  23.575  1.00 24.02  ? 422  PHE A CA    1 
ATOM   3173  C  C     . PHE A 1 421  ? -38.160 -93.589  22.981  1.00 24.82  ? 422  PHE A C     1 
ATOM   3174  O  O     . PHE A 1 421  ? -37.767 -92.430  23.185  1.00 21.60  ? 422  PHE A O     1 
ATOM   3175  C  CB    . PHE A 1 421  ? -40.604 -93.249  22.915  1.00 25.77  ? 422  PHE A CB    1 
ATOM   3176  C  CG    . PHE A 1 421  ? -41.971 -93.403  23.501  1.00 26.13  ? 422  PHE A CG    1 
ATOM   3177  C  CD1   . PHE A 1 421  ? -42.337 -92.834  24.700  1.00 26.14  ? 422  PHE A CD1   1 
ATOM   3178  C  CD2   . PHE A 1 421  ? -42.920 -94.140  22.787  1.00 28.03  ? 422  PHE A CD2   1 
ATOM   3179  C  CE1   . PHE A 1 421  ? -43.631 -92.994  25.173  1.00 27.12  ? 422  PHE A CE1   1 
ATOM   3180  C  CE2   . PHE A 1 421  ? -44.207 -94.302  23.257  1.00 27.61  ? 422  PHE A CE2   1 
ATOM   3181  C  CZ    . PHE A 1 421  ? -44.565 -93.725  24.463  1.00 27.21  ? 422  PHE A CZ    1 
ATOM   3182  N  N     . TRP A 1 422  ? -37.529 -94.480  22.232  1.00 24.18  ? 423  TRP A N     1 
ATOM   3183  C  CA    . TRP A 1 422  ? -36.261 -94.215  21.578  1.00 24.49  ? 423  TRP A CA    1 
ATOM   3184  C  C     . TRP A 1 422  ? -36.539 -93.877  20.110  1.00 26.55  ? 423  TRP A C     1 
ATOM   3185  O  O     . TRP A 1 422  ? -37.079 -94.676  19.331  1.00 25.95  ? 423  TRP A O     1 
ATOM   3186  C  CB    . TRP A 1 422  ? -35.356 -95.447  21.639  1.00 26.25  ? 423  TRP A CB    1 
ATOM   3187  C  CG    . TRP A 1 422  ? -34.855 -95.714  23.031  1.00 27.29  ? 423  TRP A CG    1 
ATOM   3188  C  CD1   . TRP A 1 422  ? -35.616 -96.051  24.116  1.00 27.67  ? 423  TRP A CD1   1 
ATOM   3189  C  CD2   . TRP A 1 422  ? -33.517 -95.597  23.505  1.00 29.15  ? 423  TRP A CD2   1 
ATOM   3190  N  NE1   . TRP A 1 422  ? -34.813 -96.208  25.225  1.00 28.57  ? 423  TRP A NE1   1 
ATOM   3191  C  CE2   . TRP A 1 422  ? -33.520 -95.929  24.868  1.00 27.69  ? 423  TRP A CE2   1 
ATOM   3192  C  CE3   . TRP A 1 422  ? -32.301 -95.264  22.877  1.00 29.93  ? 423  TRP A CE3   1 
ATOM   3193  C  CZ2   . TRP A 1 422  ? -32.361 -95.942  25.618  1.00 29.80  ? 423  TRP A CZ2   1 
ATOM   3194  C  CZ3   . TRP A 1 422  ? -31.147 -95.280  23.661  1.00 31.83  ? 423  TRP A CZ3   1 
ATOM   3195  C  CH2   . TRP A 1 422  ? -31.180 -95.634  25.011  1.00 29.80  ? 423  TRP A CH2   1 
ATOM   3196  N  N     . GLY A 1 423  ? -36.218 -92.658  19.725  1.00 26.27  ? 424  GLY A N     1 
ATOM   3197  C  CA    . GLY A 1 423  ? -36.532 -92.206  18.376  1.00 26.50  ? 424  GLY A CA    1 
ATOM   3198  C  C     . GLY A 1 423  ? -35.277 -91.754  17.655  1.00 29.53  ? 424  GLY A C     1 
ATOM   3199  O  O     . GLY A 1 423  ? -34.229 -91.659  18.280  1.00 27.52  ? 424  GLY A O     1 
ATOM   3200  N  N     . LEU A 1 424  ? -35.444 -91.602  16.347  1.00 31.74  ? 425  LEU A N     1 
ATOM   3201  C  CA    . LEU A 1 424  ? -34.361 -91.137  15.484  1.00 34.40  ? 425  LEU A CA    1 
ATOM   3202  C  C     . LEU A 1 424  ? -34.893 -89.811  14.952  1.00 35.58  ? 425  LEU A C     1 
ATOM   3203  O  O     . LEU A 1 424  ? -36.031 -89.825  14.489  1.00 36.69  ? 425  LEU A O     1 
ATOM   3204  C  CB    . LEU A 1 424  ? -34.106 -92.085  14.329  1.00 36.06  ? 425  LEU A CB    1 
ATOM   3205  C  CG    . LEU A 1 424  ? -33.222 -91.575  13.174  1.00 37.06  ? 425  LEU A CG    1 
ATOM   3206  C  CD1   . LEU A 1 424  ? -31.869 -91.155  13.720  1.00 36.77  ? 425  LEU A CD1   1 
ATOM   3207  C  CD2   . LEU A 1 424  ? -33.157 -92.648  12.098  1.00 37.05  ? 425  LEU A CD2   1 
ATOM   3208  N  N     . GLY A 1 425  ? -34.161 -88.710  15.039  1.00 36.59  ? 426  GLY A N     1 
ATOM   3209  C  CA    . GLY A 1 425  ? -34.728 -87.428  14.683  1.00 37.51  ? 426  GLY A CA    1 
ATOM   3210  C  C     . GLY A 1 425  ? -35.533 -87.330  13.409  1.00 35.97  ? 426  GLY A C     1 
ATOM   3211  O  O     . GLY A 1 425  ? -35.114 -87.838  12.388  1.00 37.81  ? 426  GLY A O     1 
ATOM   3212  N  N     . ALA A 1 426  ? -36.608 -86.577  13.403  1.00 35.75  ? 427  ALA A N     1 
ATOM   3213  C  CA    . ALA A 1 426  ? -37.453 -86.297  12.266  1.00 32.26  ? 427  ALA A CA    1 
ATOM   3214  C  C     . ALA A 1 426  ? -38.343 -87.503  11.947  1.00 31.44  ? 427  ALA A C     1 
ATOM   3215  O  O     . ALA A 1 426  ? -39.029 -87.410  10.935  1.00 30.43  ? 427  ALA A O     1 
ATOM   3216  C  CB    . ALA A 1 426  ? -36.713 -85.805  11.031  1.00 32.08  ? 427  ALA A CB    1 
ATOM   3217  N  N     . ASP A 1 427  ? -38.343 -88.514  12.819  1.00 30.24  ? 428  ASP A N     1 
ATOM   3218  C  CA    . ASP A 1 427  ? -39.203 -89.684  12.581  1.00 29.36  ? 428  ASP A CA    1 
ATOM   3219  C  C     . ASP A 1 427  ? -40.600 -89.454  13.150  1.00 29.62  ? 428  ASP A C     1 
ATOM   3220  O  O     . ASP A 1 427  ? -41.451 -90.353  13.068  1.00 31.60  ? 428  ASP A O     1 
ATOM   3221  C  CB    . ASP A 1 427  ? -38.572 -90.973  13.079  1.00 28.29  ? 428  ASP A CB    1 
ATOM   3222  C  CG    . ASP A 1 427  ? -38.525 -91.282  14.564  1.00 28.42  ? 428  ASP A CG    1 
ATOM   3223  O  OD1   . ASP A 1 427  ? -38.972 -90.452  15.379  1.00 24.74  ? 428  ASP A OD1   1 
ATOM   3224  O  OD2   . ASP A 1 427  ? -38.001 -92.374  14.962  1.00 27.30  ? 428  ASP A OD2   1 
ATOM   3225  N  N     . GLY A 1 428  ? -40.824 -88.297  13.756  1.00 27.18  ? 429  GLY A N     1 
ATOM   3226  C  CA    . GLY A 1 428  ? -42.153 -87.998  14.287  1.00 26.14  ? 429  GLY A CA    1 
ATOM   3227  C  C     . GLY A 1 428  ? -42.518 -88.558  15.646  1.00 25.50  ? 429  GLY A C     1 
ATOM   3228  O  O     . GLY A 1 428  ? -43.633 -88.357  16.171  1.00 24.91  ? 429  GLY A O     1 
ATOM   3229  N  N     . THR A 1 429  ? -41.572 -89.238  16.262  1.00 25.92  ? 430  THR A N     1 
ATOM   3230  C  CA    . THR A 1 429  ? -41.793 -89.800  17.589  1.00 25.79  ? 430  THR A CA    1 
ATOM   3231  C  C     . THR A 1 429  ? -42.175 -88.754  18.641  1.00 26.14  ? 430  THR A C     1 
ATOM   3232  O  O     . THR A 1 429  ? -43.096 -89.003  19.432  1.00 25.66  ? 430  THR A O     1 
ATOM   3233  C  CB    . THR A 1 429  ? -40.575 -90.585  18.082  1.00 27.12  ? 430  THR A CB    1 
ATOM   3234  O  OG1   . THR A 1 429  ? -40.249 -91.641  17.152  1.00 27.79  ? 430  THR A OG1   1 
ATOM   3235  C  CG2   . THR A 1 429  ? -40.831 -91.221  19.444  1.00 26.75  ? 430  THR A CG2   1 
ATOM   3236  N  N     . VAL A 1 430  ? -41.413 -87.692  18.742  1.00 25.26  ? 431  VAL A N     1 
ATOM   3237  C  CA    . VAL A 1 430  ? -41.703 -86.636  19.731  1.00 26.64  ? 431  VAL A CA    1 
ATOM   3238  C  C     . VAL A 1 430  ? -43.081 -86.047  19.502  1.00 25.44  ? 431  VAL A C     1 
ATOM   3239  O  O     . VAL A 1 430  ? -43.841 -85.785  20.450  1.00 23.57  ? 431  VAL A O     1 
ATOM   3240  C  CB    . VAL A 1 430  ? -40.609 -85.552  19.697  1.00 25.87  ? 431  VAL A CB    1 
ATOM   3241  C  CG1   . VAL A 1 430  ? -40.901 -84.318  20.554  1.00 26.89  ? 431  VAL A CG1   1 
ATOM   3242  C  CG2   . VAL A 1 430  ? -39.261 -86.152  20.109  1.00 24.96  ? 431  VAL A CG2   1 
ATOM   3243  N  N     . GLY A 1 431  ? -43.429 -85.873  18.230  1.00 26.04  ? 432  GLY A N     1 
ATOM   3244  C  CA    . GLY A 1 431  ? -44.729 -85.276  17.875  1.00 26.08  ? 432  GLY A CA    1 
ATOM   3245  C  C     . GLY A 1 431  ? -45.894 -86.128  18.344  1.00 27.25  ? 432  GLY A C     1 
ATOM   3246  O  O     . GLY A 1 431  ? -46.897 -85.673  18.910  1.00 27.59  ? 432  GLY A O     1 
ATOM   3247  N  N     . ALA A 1 432  ? -45.729 -87.447  18.173  1.00 27.01  ? 433  ALA A N     1 
ATOM   3248  C  CA    . ALA A 1 432  ? -46.775 -88.406  18.544  1.00 24.49  ? 433  ALA A CA    1 
ATOM   3249  C  C     . ALA A 1 432  ? -46.890 -88.441  20.055  1.00 25.48  ? 433  ALA A C     1 
ATOM   3250  O  O     . ALA A 1 432  ? -47.986 -88.454  20.613  1.00 24.52  ? 433  ALA A O     1 
ATOM   3251  C  CB    . ALA A 1 432  ? -46.404 -89.789  17.975  1.00 24.69  ? 433  ALA A CB    1 
ATOM   3252  N  N     . ASN A 1 433  ? -45.735 -88.403  20.745  1.00 26.84  ? 434  ASN A N     1 
ATOM   3253  C  CA    . ASN A 1 433  ? -45.826 -88.429  22.230  1.00 26.84  ? 434  ASN A CA    1 
ATOM   3254  C  C     . ASN A 1 433  ? -46.565 -87.217  22.767  1.00 27.40  ? 434  ASN A C     1 
ATOM   3255  O  O     . ASN A 1 433  ? -47.423 -87.298  23.651  1.00 27.30  ? 434  ASN A O     1 
ATOM   3256  C  CB    . ASN A 1 433  ? -44.445 -88.457  22.849  1.00 26.38  ? 434  ASN A CB    1 
ATOM   3257  C  CG    . ASN A 1 433  ? -43.677 -89.687  22.428  1.00 28.35  ? 434  ASN A CG    1 
ATOM   3258  O  OD1   . ASN A 1 433  ? -44.218 -90.794  22.310  1.00 29.74  ? 434  ASN A OD1   1 
ATOM   3259  N  ND2   . ASN A 1 433  ? -42.399 -89.422  22.243  1.00 27.17  ? 434  ASN A ND2   1 
ATOM   3260  N  N     . LYS A 1 434  ? -46.240 -86.037  22.209  1.00 27.13  ? 435  LYS A N     1 
ATOM   3261  C  CA    . LYS A 1 434  ? -46.939 -84.825  22.625  1.00 28.08  ? 435  LYS A CA    1 
ATOM   3262  C  C     . LYS A 1 434  ? -48.433 -84.901  22.340  1.00 30.26  ? 435  LYS A C     1 
ATOM   3263  O  O     . LYS A 1 434  ? -49.266 -84.581  23.191  1.00 30.81  ? 435  LYS A O     1 
ATOM   3264  C  CB    . LYS A 1 434  ? -46.341 -83.599  21.919  1.00 28.31  ? 435  LYS A CB    1 
ATOM   3265  C  CG    . LYS A 1 434  ? -45.162 -82.952  22.661  1.00 26.93  ? 435  LYS A CG    1 
ATOM   3266  C  CD    . LYS A 1 434  ? -44.375 -82.142  21.630  1.00 26.15  ? 435  LYS A CD    1 
ATOM   3267  C  CE    . LYS A 1 434  ? -43.018 -81.712  22.154  1.00 25.19  ? 435  LYS A CE    1 
ATOM   3268  N  NZ    . LYS A 1 434  ? -42.406 -80.765  21.140  1.00 26.04  ? 435  LYS A NZ    1 
ATOM   3269  N  N     . GLN A 1 435  ? -48.802 -85.425  21.160  1.00 31.23  ? 436  GLN A N     1 
ATOM   3270  C  CA    . GLN A 1 435  ? -50.218 -85.572  20.834  1.00 33.25  ? 436  GLN A CA    1 
ATOM   3271  C  C     . GLN A 1 435  ? -50.895 -86.563  21.771  1.00 32.42  ? 436  GLN A C     1 
ATOM   3272  O  O     . GLN A 1 435  ? -51.995 -86.344  22.255  1.00 32.40  ? 436  GLN A O     1 
ATOM   3273  C  CB    . GLN A 1 435  ? -50.360 -86.108  19.393  1.00 37.39  ? 436  GLN A CB    1 
ATOM   3274  C  CG    . GLN A 1 435  ? -50.410 -84.990  18.354  1.00 40.93  ? 436  GLN A CG    1 
ATOM   3275  C  CD    . GLN A 1 435  ? -51.604 -84.087  18.665  1.00 44.07  ? 436  GLN A CD    1 
ATOM   3276  O  OE1   . GLN A 1 435  ? -52.701 -84.600  18.956  1.00 45.83  ? 436  GLN A OE1   1 
ATOM   3277  N  NE2   . GLN A 1 435  ? -51.308 -82.788  18.606  1.00 45.12  ? 436  GLN A NE2   1 
ATOM   3278  N  N     . ALA A 1 436  ? -50.142 -87.615  22.110  1.00 30.42  ? 437  ALA A N     1 
ATOM   3279  C  CA    . ALA A 1 436  ? -50.661 -88.639  23.030  1.00 29.67  ? 437  ALA A CA    1 
ATOM   3280  C  C     . ALA A 1 436  ? -50.887 -88.073  24.429  1.00 29.80  ? 437  ALA A C     1 
ATOM   3281  O  O     . ALA A 1 436  ? -51.852 -88.480  25.075  1.00 29.52  ? 437  ALA A O     1 
ATOM   3282  C  CB    . ALA A 1 436  ? -49.720 -89.809  23.117  1.00 29.40  ? 437  ALA A CB    1 
ATOM   3283  N  N     . ILE A 1 437  ? -50.021 -87.149  24.862  1.00 29.64  ? 438  ILE A N     1 
ATOM   3284  C  CA    . ILE A 1 437  ? -50.216 -86.498  26.163  1.00 28.47  ? 438  ILE A CA    1 
ATOM   3285  C  C     . ILE A 1 437  ? -51.445 -85.601  26.088  1.00 29.92  ? 438  ILE A C     1 
ATOM   3286  O  O     . ILE A 1 437  ? -52.212 -85.497  27.049  1.00 31.37  ? 438  ILE A O     1 
ATOM   3287  C  CB    . ILE A 1 437  ? -48.995 -85.650  26.564  1.00 28.03  ? 438  ILE A CB    1 
ATOM   3288  C  CG1   . ILE A 1 437  ? -47.800 -86.567  26.961  1.00 25.03  ? 438  ILE A CG1   1 
ATOM   3289  C  CG2   . ILE A 1 437  ? -49.234 -84.658  27.696  1.00 25.40  ? 438  ILE A CG2   1 
ATOM   3290  C  CD1   . ILE A 1 437  ? -46.538 -85.690  27.024  1.00 25.19  ? 438  ILE A CD1   1 
ATOM   3291  N  N     . LYS A 1 438  ? -51.647 -84.927  24.971  1.00 31.66  ? 439  LYS A N     1 
ATOM   3292  C  CA    . LYS A 1 438  ? -52.831 -84.088  24.777  1.00 33.05  ? 439  LYS A CA    1 
ATOM   3293  C  C     . LYS A 1 438  ? -54.129 -84.893  24.794  1.00 32.03  ? 439  LYS A C     1 
ATOM   3294  O  O     . LYS A 1 438  ? -55.059 -84.601  25.539  1.00 29.86  ? 439  LYS A O     1 
ATOM   3295  C  CB    . LYS A 1 438  ? -52.737 -83.331  23.445  1.00 36.88  ? 439  LYS A CB    1 
ATOM   3296  C  CG    . LYS A 1 438  ? -52.367 -81.867  23.646  1.00 41.40  ? 439  LYS A CG    1 
ATOM   3297  C  CD    . LYS A 1 438  ? -50.884 -81.632  23.430  1.00 44.49  ? 439  LYS A CD    1 
ATOM   3298  C  CE    . LYS A 1 438  ? -50.160 -81.151  24.689  1.00 45.36  ? 439  LYS A CE    1 
ATOM   3299  N  NZ    . LYS A 1 438  ? -48.687 -81.429  24.588  1.00 46.33  ? 439  LYS A NZ    1 
ATOM   3300  N  N     . ILE A 1 439  ? -54.199 -85.943  23.978  1.00 31.35  ? 440  ILE A N     1 
ATOM   3301  C  CA    . ILE A 1 439  ? -55.380 -86.796  23.876  1.00 32.64  ? 440  ILE A CA    1 
ATOM   3302  C  C     . ILE A 1 439  ? -55.779 -87.416  25.202  1.00 32.60  ? 440  ILE A C     1 
ATOM   3303  O  O     . ILE A 1 439  ? -56.956 -87.505  25.587  1.00 33.31  ? 440  ILE A O     1 
ATOM   3304  C  CB    . ILE A 1 439  ? -55.071 -87.925  22.855  1.00 34.35  ? 440  ILE A CB    1 
ATOM   3305  C  CG1   . ILE A 1 439  ? -54.988 -87.296  21.453  1.00 34.23  ? 440  ILE A CG1   1 
ATOM   3306  C  CG2   . ILE A 1 439  ? -56.083 -89.065  22.899  1.00 33.13  ? 440  ILE A CG2   1 
ATOM   3307  C  CD1   . ILE A 1 439  ? -54.346 -88.166  20.401  1.00 35.89  ? 440  ILE A CD1   1 
ATOM   3308  N  N     . ILE A 1 440  ? -54.790 -87.988  25.899  1.00 31.36  ? 441  ILE A N     1 
ATOM   3309  C  CA    . ILE A 1 440  ? -55.055 -88.676  27.153  1.00 30.27  ? 441  ILE A CA    1 
ATOM   3310  C  C     . ILE A 1 440  ? -55.419 -87.669  28.232  1.00 30.12  ? 441  ILE A C     1 
ATOM   3311  O  O     . ILE A 1 440  ? -56.343 -87.904  29.030  1.00 30.47  ? 441  ILE A O     1 
ATOM   3312  C  CB    . ILE A 1 440  ? -53.846 -89.520  27.574  1.00 32.04  ? 441  ILE A CB    1 
ATOM   3313  C  CG1   . ILE A 1 440  ? -53.613 -90.603  26.497  1.00 34.02  ? 441  ILE A CG1   1 
ATOM   3314  C  CG2   . ILE A 1 440  ? -53.951 -90.102  28.973  1.00 31.65  ? 441  ILE A CG2   1 
ATOM   3315  C  CD1   . ILE A 1 440  ? -52.456 -91.519  26.843  1.00 35.53  ? 441  ILE A CD1   1 
ATOM   3316  N  N     . GLY A 1 441  ? -54.706 -86.555  28.260  1.00 28.23  ? 442  GLY A N     1 
ATOM   3317  C  CA    . GLY A 1 441  ? -54.928 -85.549  29.298  1.00 30.66  ? 442  GLY A CA    1 
ATOM   3318  C  C     . GLY A 1 441  ? -56.335 -84.948  29.143  1.00 32.47  ? 442  GLY A C     1 
ATOM   3319  O  O     . GLY A 1 441  ? -57.005 -84.683  30.139  1.00 31.99  ? 442  GLY A O     1 
ATOM   3320  N  N     . ASP A 1 442  ? -56.691 -84.682  27.887  1.00 32.48  ? 443  ASP A N     1 
ATOM   3321  C  CA    . ASP A 1 442  ? -57.984 -84.109  27.586  1.00 35.03  ? 443  ASP A CA    1 
ATOM   3322  C  C     . ASP A 1 442  ? -59.172 -85.054  27.662  1.00 35.14  ? 443  ASP A C     1 
ATOM   3323  O  O     . ASP A 1 442  ? -60.277 -84.493  27.691  1.00 35.64  ? 443  ASP A O     1 
ATOM   3324  C  CB    . ASP A 1 442  ? -57.983 -83.555  26.159  1.00 38.33  ? 443  ASP A CB    1 
ATOM   3325  C  CG    . ASP A 1 442  ? -57.155 -82.293  26.080  1.00 40.34  ? 443  ASP A CG    1 
ATOM   3326  O  OD1   . ASP A 1 442  ? -56.996 -81.827  24.928  1.00 42.97  ? 443  ASP A OD1   1 
ATOM   3327  O  OD2   . ASP A 1 442  ? -56.685 -81.799  27.125  1.00 42.57  ? 443  ASP A OD2   1 
ATOM   3328  N  N     . ASN A 1 443  ? -58.979 -86.366  27.709  1.00 33.95  ? 444  ASN A N     1 
ATOM   3329  C  CA    . ASN A 1 443  ? -60.128 -87.272  27.739  1.00 33.72  ? 444  ASN A CA    1 
ATOM   3330  C  C     . ASN A 1 443  ? -60.176 -88.182  28.944  1.00 34.12  ? 444  ASN A C     1 
ATOM   3331  O  O     . ASN A 1 443  ? -61.016 -89.097  29.037  1.00 33.19  ? 444  ASN A O     1 
ATOM   3332  C  CB    . ASN A 1 443  ? -60.106 -88.068  26.414  1.00 36.00  ? 444  ASN A CB    1 
ATOM   3333  C  CG    . ASN A 1 443  ? -60.330 -87.061  25.280  1.00 38.33  ? 444  ASN A CG    1 
ATOM   3334  O  OD1   . ASN A 1 443  ? -61.459 -86.591  25.109  1.00 39.13  ? 444  ASN A OD1   1 
ATOM   3335  N  ND2   . ASN A 1 443  ? -59.290 -86.700  24.542  1.00 36.52  ? 444  ASN A ND2   1 
ATOM   3336  N  N     . THR A 1 444  ? -59.290 -87.912  29.928  1.00 30.37  ? 445  THR A N     1 
ATOM   3337  C  CA    . THR A 1 444  ? -59.262 -88.732  31.126  1.00 29.56  ? 445  THR A CA    1 
ATOM   3338  C  C     . THR A 1 444  ? -59.009 -87.863  32.348  1.00 28.97  ? 445  THR A C     1 
ATOM   3339  O  O     . THR A 1 444  ? -58.728 -86.654  32.240  1.00 31.33  ? 445  THR A O     1 
ATOM   3340  C  CB    . THR A 1 444  ? -58.156 -89.817  31.065  1.00 30.62  ? 445  THR A CB    1 
ATOM   3341  O  OG1   . THR A 1 444  ? -56.887 -89.184  31.279  1.00 29.36  ? 445  THR A OG1   1 
ATOM   3342  C  CG2   . THR A 1 444  ? -58.168 -90.492  29.702  1.00 31.37  ? 445  THR A CG2   1 
ATOM   3343  N  N     . ASP A 1 445  ? -59.019 -88.473  33.533  1.00 26.79  ? 446  ASP A N     1 
ATOM   3344  C  CA    . ASP A 1 445  ? -58.730 -87.679  34.722  1.00 27.71  ? 446  ASP A CA    1 
ATOM   3345  C  C     . ASP A 1 445  ? -57.262 -87.871  35.119  1.00 26.14  ? 446  ASP A C     1 
ATOM   3346  O  O     . ASP A 1 445  ? -56.936 -87.566  36.271  1.00 26.41  ? 446  ASP A O     1 
ATOM   3347  C  CB    . ASP A 1 445  ? -59.645 -88.054  35.881  1.00 30.09  ? 446  ASP A CB    1 
ATOM   3348  C  CG    . ASP A 1 445  ? -61.116 -87.887  35.537  1.00 33.62  ? 446  ASP A CG    1 
ATOM   3349  O  OD1   . ASP A 1 445  ? -61.905 -88.791  35.887  1.00 35.78  ? 446  ASP A OD1   1 
ATOM   3350  O  OD2   . ASP A 1 445  ? -61.503 -86.875  34.934  1.00 35.01  ? 446  ASP A OD2   1 
ATOM   3351  N  N     . LEU A 1 446  ? -56.487 -88.545  34.294  1.00 25.84  ? 447  LEU A N     1 
ATOM   3352  C  CA    . LEU A 1 446  ? -55.090 -88.834  34.616  1.00 24.60  ? 447  LEU A CA    1 
ATOM   3353  C  C     . LEU A 1 446  ? -54.217 -87.578  34.548  1.00 25.09  ? 447  LEU A C     1 
ATOM   3354  O  O     . LEU A 1 446  ? -54.476 -86.652  33.769  1.00 23.78  ? 447  LEU A O     1 
ATOM   3355  C  CB    . LEU A 1 446  ? -54.487 -89.841  33.609  1.00 24.63  ? 447  LEU A CB    1 
ATOM   3356  C  CG    . LEU A 1 446  ? -55.122 -91.235  33.589  1.00 25.74  ? 447  LEU A CG    1 
ATOM   3357  C  CD1   . LEU A 1 446  ? -54.471 -92.174  32.577  1.00 24.45  ? 447  LEU A CD1   1 
ATOM   3358  C  CD2   . LEU A 1 446  ? -55.036 -91.868  34.986  1.00 27.47  ? 447  LEU A CD2   1 
ATOM   3359  N  N     . PHE A 1 447  ? -53.193 -87.537  35.403  1.00 23.39  ? 448  PHE A N     1 
ATOM   3360  C  CA    . PHE A 1 447  ? -52.159 -86.515  35.331  1.00 22.36  ? 448  PHE A CA    1 
ATOM   3361  C  C     . PHE A 1 447  ? -51.184 -86.996  34.254  1.00 21.62  ? 448  PHE A C     1 
ATOM   3362  O  O     . PHE A 1 447  ? -51.066 -88.225  34.036  1.00 21.40  ? 448  PHE A O     1 
ATOM   3363  C  CB    . PHE A 1 447  ? -51.401 -86.360  36.650  1.00 22.57  ? 448  PHE A CB    1 
ATOM   3364  C  CG    . PHE A 1 447  ? -52.301 -85.813  37.729  1.00 25.37  ? 448  PHE A CG    1 
ATOM   3365  C  CD1   . PHE A 1 447  ? -53.076 -86.666  38.495  1.00 22.34  ? 448  PHE A CD1   1 
ATOM   3366  C  CD2   . PHE A 1 447  ? -52.382 -84.439  37.923  1.00 26.80  ? 448  PHE A CD2   1 
ATOM   3367  C  CE1   . PHE A 1 447  ? -53.916 -86.129  39.463  1.00 26.95  ? 448  PHE A CE1   1 
ATOM   3368  C  CE2   . PHE A 1 447  ? -53.230 -83.917  38.893  1.00 27.12  ? 448  PHE A CE2   1 
ATOM   3369  C  CZ    . PHE A 1 447  ? -54.005 -84.771  39.677  1.00 26.68  ? 448  PHE A CZ    1 
ATOM   3370  N  N     . ALA A 1 448  ? -50.531 -86.108  33.529  1.00 20.35  ? 449  ALA A N     1 
ATOM   3371  C  CA    . ALA A 1 448  ? -49.664 -86.562  32.440  1.00 20.85  ? 449  ALA A CA    1 
ATOM   3372  C  C     . ALA A 1 448  ? -48.352 -85.788  32.458  1.00 22.56  ? 449  ALA A C     1 
ATOM   3373  O  O     . ALA A 1 448  ? -48.438 -84.589  32.724  1.00 19.76  ? 449  ALA A O     1 
ATOM   3374  C  CB    . ALA A 1 448  ? -50.443 -86.330  31.140  1.00 22.84  ? 449  ALA A CB    1 
ATOM   3375  N  N     . GLN A 1 449  ? -47.241 -86.463  32.245  1.00 21.02  ? 450  GLN A N     1 
ATOM   3376  C  CA    . GLN A 1 449  ? -45.971 -85.673  32.158  1.00 20.70  ? 450  GLN A CA    1 
ATOM   3377  C  C     . GLN A 1 449  ? -45.185 -86.174  30.968  1.00 19.29  ? 450  GLN A C     1 
ATOM   3378  O  O     . GLN A 1 449  ? -45.051 -87.395  30.768  1.00 22.50  ? 450  GLN A O     1 
ATOM   3379  C  CB    . GLN A 1 449  ? -45.228 -85.871  33.475  1.00 20.66  ? 450  GLN A CB    1 
ATOM   3380  C  CG    . GLN A 1 449  ? -43.811 -85.284  33.537  1.00 20.44  ? 450  GLN A CG    1 
ATOM   3381  C  CD    . GLN A 1 449  ? -42.973 -86.026  34.532  1.00 19.19  ? 450  GLN A CD    1 
ATOM   3382  O  OE1   . GLN A 1 449  ? -42.768 -87.270  34.441  1.00 21.17  ? 450  GLN A OE1   1 
ATOM   3383  N  NE2   . GLN A 1 449  ? -42.417 -85.330  35.511  1.00 17.92  ? 450  GLN A NE2   1 
ATOM   3384  N  N     . GLY A 1 450  ? -44.500 -85.267  30.259  1.00 20.03  ? 451  GLY A N     1 
ATOM   3385  C  CA    . GLY A 1 450  ? -43.565 -85.623  29.221  1.00 19.36  ? 451  GLY A CA    1 
ATOM   3386  C  C     . GLY A 1 450  ? -42.274 -84.815  29.346  1.00 20.19  ? 451  GLY A C     1 
ATOM   3387  O  O     . GLY A 1 450  ? -42.289 -83.634  29.723  1.00 23.10  ? 451  GLY A O     1 
ATOM   3388  N  N     . TYR A 1 451  ? -41.156 -85.425  29.057  1.00 20.16  ? 452  TYR A N     1 
ATOM   3389  C  CA    . TYR A 1 451  ? -39.860 -84.714  29.076  1.00 19.84  ? 452  TYR A CA    1 
ATOM   3390  C  C     . TYR A 1 451  ? -39.055 -85.351  27.947  1.00 22.03  ? 452  TYR A C     1 
ATOM   3391  O  O     . TYR A 1 451  ? -39.162 -86.569  27.746  1.00 19.42  ? 452  TYR A O     1 
ATOM   3392  C  CB    . TYR A 1 451  ? -39.181 -84.872  30.431  1.00 22.35  ? 452  TYR A CB    1 
ATOM   3393  C  CG    . TYR A 1 451  ? -37.826 -84.186  30.496  1.00 23.82  ? 452  TYR A CG    1 
ATOM   3394  C  CD1   . TYR A 1 451  ? -37.745 -82.846  30.900  1.00 24.32  ? 452  TYR A CD1   1 
ATOM   3395  C  CD2   . TYR A 1 451  ? -36.667 -84.851  30.131  1.00 23.32  ? 452  TYR A CD2   1 
ATOM   3396  C  CE1   . TYR A 1 451  ? -36.526 -82.201  30.972  1.00 23.87  ? 452  TYR A CE1   1 
ATOM   3397  C  CE2   . TYR A 1 451  ? -35.426 -84.210  30.165  1.00 25.18  ? 452  TYR A CE2   1 
ATOM   3398  C  CZ    . TYR A 1 451  ? -35.376 -82.901  30.628  1.00 25.53  ? 452  TYR A CZ    1 
ATOM   3399  O  OH    . TYR A 1 451  ? -34.146 -82.259  30.631  1.00 24.68  ? 452  TYR A OH    1 
ATOM   3400  N  N     . PHE A 1 452  ? -38.412 -84.533  27.136  1.00 21.14  ? 453  PHE A N     1 
ATOM   3401  C  CA    . PHE A 1 452  ? -37.697 -85.119  25.998  1.00 22.98  ? 453  PHE A CA    1 
ATOM   3402  C  C     . PHE A 1 452  ? -36.194 -84.881  26.076  1.00 27.27  ? 453  PHE A C     1 
ATOM   3403  O  O     . PHE A 1 452  ? -35.754 -83.735  26.297  1.00 26.99  ? 453  PHE A O     1 
ATOM   3404  C  CB    . PHE A 1 452  ? -38.297 -84.590  24.699  1.00 23.93  ? 453  PHE A CB    1 
ATOM   3405  C  CG    . PHE A 1 452  ? -39.782 -84.811  24.637  1.00 25.66  ? 453  PHE A CG    1 
ATOM   3406  C  CD1   . PHE A 1 452  ? -40.671 -83.871  25.093  1.00 26.84  ? 453  PHE A CD1   1 
ATOM   3407  C  CD2   . PHE A 1 452  ? -40.285 -86.006  24.092  1.00 26.46  ? 453  PHE A CD2   1 
ATOM   3408  C  CE1   . PHE A 1 452  ? -42.044 -84.109  25.019  1.00 27.51  ? 453  PHE A CE1   1 
ATOM   3409  C  CE2   . PHE A 1 452  ? -41.619 -86.266  24.002  1.00 26.10  ? 453  PHE A CE2   1 
ATOM   3410  C  CZ    . PHE A 1 452  ? -42.499 -85.299  24.475  1.00 30.73  ? 453  PHE A CZ    1 
ATOM   3411  N  N     . SER A 1 453  ? -35.429 -85.946  25.900  1.00 29.25  ? 454  SER A N     1 
ATOM   3412  C  CA    . SER A 1 453  ? -33.972 -85.849  25.858  1.00 31.65  ? 454  SER A CA    1 
ATOM   3413  C  C     . SER A 1 453  ? -33.511 -85.856  24.398  1.00 32.85  ? 454  SER A C     1 
ATOM   3414  O  O     . SER A 1 453  ? -33.823 -86.783  23.674  1.00 31.45  ? 454  SER A O     1 
ATOM   3415  C  CB    . SER A 1 453  ? -33.228 -87.031  26.465  1.00 33.72  ? 454  SER A CB    1 
ATOM   3416  O  OG    . SER A 1 453  ? -33.466 -87.087  27.845  1.00 37.68  ? 454  SER A OG    1 
ATOM   3417  N  N     . TYR A 1 454  ? -32.758 -84.814  24.028  1.00 34.16  ? 455  TYR A N     1 
ATOM   3418  C  CA    . TYR A 1 454  ? -32.236 -84.663  22.692  1.00 33.29  ? 455  TYR A CA    1 
ATOM   3419  C  C     . TYR A 1 454  ? -30.720 -84.793  22.648  1.00 33.45  ? 455  TYR A C     1 
ATOM   3420  O  O     . TYR A 1 454  ? -30.031 -84.367  23.559  1.00 34.39  ? 455  TYR A O     1 
ATOM   3421  C  CB    . TYR A 1 454  ? -32.559 -83.241  22.182  1.00 33.35  ? 455  TYR A CB    1 
ATOM   3422  C  CG    . TYR A 1 454  ? -34.035 -83.004  21.968  1.00 32.84  ? 455  TYR A CG    1 
ATOM   3423  C  CD1   . TYR A 1 454  ? -34.905 -82.524  22.909  1.00 32.54  ? 455  TYR A CD1   1 
ATOM   3424  C  CD2   . TYR A 1 454  ? -34.522 -83.287  20.696  1.00 33.59  ? 455  TYR A CD2   1 
ATOM   3425  C  CE1   . TYR A 1 454  ? -36.238 -82.316  22.620  1.00 33.49  ? 455  TYR A CE1   1 
ATOM   3426  C  CE2   . TYR A 1 454  ? -35.850 -83.101  20.377  1.00 34.74  ? 455  TYR A CE2   1 
ATOM   3427  C  CZ    . TYR A 1 454  ? -36.696 -82.614  21.350  1.00 35.45  ? 455  TYR A CZ    1 
ATOM   3428  O  OH    . TYR A 1 454  ? -38.027 -82.431  21.008  1.00 37.38  ? 455  TYR A OH    1 
ATOM   3429  N  N     . ASP A 1 455  ? -30.178 -85.239  21.537  1.00 33.70  ? 456  ASP A N     1 
ATOM   3430  C  CA    . ASP A 1 455  ? -28.807 -85.303  21.169  1.00 34.38  ? 456  ASP A CA    1 
ATOM   3431  C  C     . ASP A 1 455  ? -28.177 -83.936  20.914  1.00 31.97  ? 456  ASP A C     1 
ATOM   3432  O  O     . ASP A 1 455  ? -28.964 -83.087  20.505  1.00 33.53  ? 456  ASP A O     1 
ATOM   3433  C  CB    . ASP A 1 455  ? -28.739 -85.875  19.676  1.00 34.89  ? 456  ASP A CB    1 
ATOM   3434  C  CG    . ASP A 1 455  ? -27.881 -87.106  19.743  1.00 36.87  ? 456  ASP A CG    1 
ATOM   3435  O  OD1   . ASP A 1 455  ? -27.831 -87.924  18.852  1.00 35.71  ? 456  ASP A OD1   1 
ATOM   3436  O  OD2   . ASP A 1 455  ? -27.265 -87.224  20.853  1.00 41.93  ? 456  ASP A OD2   1 
ATOM   3437  N  N     . SER A 1 456  ? -26.870 -83.804  20.927  1.00 31.17  ? 457  SER A N     1 
ATOM   3438  C  CA    . SER A 1 456  ? -26.269 -82.554  20.428  1.00 30.89  ? 457  SER A CA    1 
ATOM   3439  C  C     . SER A 1 456  ? -26.121 -82.628  18.902  1.00 30.31  ? 457  SER A C     1 
ATOM   3440  O  O     . SER A 1 456  ? -25.780 -81.628  18.258  1.00 31.06  ? 457  SER A O     1 
ATOM   3441  C  CB    . SER A 1 456  ? -24.865 -82.378  21.007  1.00 31.35  ? 457  SER A CB    1 
ATOM   3442  O  OG    . SER A 1 456  ? -24.947 -82.445  22.417  1.00 29.78  ? 457  SER A OG    1 
ATOM   3443  N  N     . LYS A 1 457  ? -26.328 -83.829  18.336  1.00 26.99  ? 458  LYS A N     1 
ATOM   3444  C  CA    . LYS A 1 457  ? -26.239 -84.055  16.902  1.00 26.60  ? 458  LYS A CA    1 
ATOM   3445  C  C     . LYS A 1 457  ? -27.413 -83.354  16.236  1.00 24.17  ? 458  LYS A C     1 
ATOM   3446  O  O     . LYS A 1 457  ? -28.489 -83.473  16.814  1.00 23.55  ? 458  LYS A O     1 
ATOM   3447  C  CB    . LYS A 1 457  ? -26.261 -85.550  16.549  1.00 28.18  ? 458  LYS A CB    1 
ATOM   3448  C  CG    . LYS A 1 457  ? -25.034 -86.321  16.989  1.00 29.40  ? 458  LYS A CG    1 
ATOM   3449  C  CD    . LYS A 1 457  ? -23.728 -85.628  16.562  1.00 30.12  ? 458  LYS A CD    1 
ATOM   3450  C  CE    . LYS A 1 457  ? -22.576 -86.574  16.858  1.00 29.55  ? 458  LYS A CE    1 
ATOM   3451  N  NZ    . LYS A 1 457  ? -21.234 -85.960  16.703  1.00 29.77  ? 458  LYS A NZ    1 
ATOM   3452  N  N     . LYS A 1 458  ? -27.228 -82.534  15.227  1.00 22.20  ? 459  LYS A N     1 
ATOM   3453  C  CA    . LYS A 1 458  ? -28.347 -81.799  14.656  1.00 23.41  ? 459  LYS A CA    1 
ATOM   3454  C  C     . LYS A 1 458  ? -29.168 -82.617  13.666  1.00 24.15  ? 459  LYS A C     1 
ATOM   3455  O  O     . LYS A 1 458  ? -30.337 -82.340  13.429  1.00 24.43  ? 459  LYS A O     1 
ATOM   3456  C  CB    . LYS A 1 458  ? -27.790 -80.540  13.933  1.00 24.06  ? 459  LYS A CB    1 
ATOM   3457  C  CG    . LYS A 1 458  ? -27.445 -79.482  14.972  1.00 23.30  ? 459  LYS A CG    1 
ATOM   3458  C  CD    . LYS A 1 458  ? -26.452 -78.469  14.370  1.00 24.25  ? 459  LYS A CD    1 
ATOM   3459  C  CE    . LYS A 1 458  ? -26.522 -77.241  15.266  1.00 24.86  ? 459  LYS A CE    1 
ATOM   3460  N  NZ    . LYS A 1 458  ? -27.673 -76.348  15.038  1.00 23.99  ? 459  LYS A NZ    1 
ATOM   3461  N  N     . SER A 1 459  ? -28.541 -83.649  13.105  1.00 24.87  ? 460  SER A N     1 
ATOM   3462  C  CA    . SER A 1 459  ? -29.236 -84.444  12.075  1.00 27.95  ? 460  SER A CA    1 
ATOM   3463  C  C     . SER A 1 459  ? -29.057 -85.917  12.398  1.00 26.25  ? 460  SER A C     1 
ATOM   3464  O  O     . SER A 1 459  ? -28.003 -86.327  12.884  1.00 24.26  ? 460  SER A O     1 
ATOM   3465  C  CB    . SER A 1 459  ? -28.639 -84.174  10.682  1.00 29.50  ? 460  SER A CB    1 
ATOM   3466  O  OG    . SER A 1 459  ? -29.216 -85.109  9.744   1.00 31.68  ? 460  SER A OG    1 
ATOM   3467  N  N     . GLY A 1 460  ? -30.118 -86.691  12.206  1.00 27.89  ? 461  GLY A N     1 
ATOM   3468  C  CA    . GLY A 1 460  ? -30.079 -88.123  12.493  1.00 26.50  ? 461  GLY A CA    1 
ATOM   3469  C  C     . GLY A 1 460  ? -29.772 -88.363  13.967  1.00 28.04  ? 461  GLY A C     1 
ATOM   3470  O  O     . GLY A 1 460  ? -29.082 -89.306  14.325  1.00 26.21  ? 461  GLY A O     1 
ATOM   3471  N  N     . GLY A 1 461  ? -30.240 -87.444  14.807  1.00 27.03  ? 462  GLY A N     1 
ATOM   3472  C  CA    . GLY A 1 461  ? -29.971 -87.560  16.236  1.00 26.60  ? 462  GLY A CA    1 
ATOM   3473  C  C     . GLY A 1 461  ? -30.859 -88.551  16.954  1.00 26.75  ? 462  GLY A C     1 
ATOM   3474  O  O     . GLY A 1 461  ? -31.963 -88.863  16.506  1.00 27.40  ? 462  GLY A O     1 
ATOM   3475  N  N     . ILE A 1 462  ? -30.447 -88.975  18.158  1.00 27.14  ? 463  ILE A N     1 
ATOM   3476  C  CA    . ILE A 1 462  ? -31.348 -89.848  18.901  1.00 28.28  ? 463  ILE A CA    1 
ATOM   3477  C  C     . ILE A 1 462  ? -32.165 -88.997  19.873  1.00 28.75  ? 463  ILE A C     1 
ATOM   3478  O  O     . ILE A 1 462  ? -31.676 -88.073  20.549  1.00 27.98  ? 463  ILE A O     1 
ATOM   3479  C  CB    . ILE A 1 462  ? -30.711 -91.101  19.467  1.00 32.43  ? 463  ILE A CB    1 
ATOM   3480  C  CG1   . ILE A 1 462  ? -30.638 -91.099  21.011  1.00 34.13  ? 463  ILE A CG1   1 
ATOM   3481  C  CG2   . ILE A 1 462  ? -29.316 -91.456  18.986  1.00 32.67  ? 463  ILE A CG2   1 
ATOM   3482  C  CD1   . ILE A 1 462  ? -31.698 -92.063  21.507  1.00 36.35  ? 463  ILE A CD1   1 
ATOM   3483  N  N     . THR A 1 463  ? -33.443 -89.348  19.974  1.00 26.28  ? 464  THR A N     1 
ATOM   3484  C  CA    . THR A 1 463  ? -34.352 -88.742  20.910  1.00 28.93  ? 464  THR A CA    1 
ATOM   3485  C  C     . THR A 1 463  ? -34.871 -89.855  21.829  1.00 28.58  ? 464  THR A C     1 
ATOM   3486  O  O     . THR A 1 463  ? -35.166 -90.988  21.422  1.00 28.33  ? 464  THR A O     1 
ATOM   3487  C  CB    . THR A 1 463  ? -35.600 -88.034  20.328  1.00 30.17  ? 464  THR A CB    1 
ATOM   3488  O  OG1   . THR A 1 463  ? -35.208 -87.009  19.414  1.00 32.78  ? 464  THR A OG1   1 
ATOM   3489  C  CG2   . THR A 1 463  ? -36.307 -87.248  21.445  1.00 32.48  ? 464  THR A CG2   1 
ATOM   3490  N  N     . ILE A 1 464  ? -34.919 -89.449  23.098  1.00 28.03  ? 465  ILE A N     1 
ATOM   3491  C  CA    . ILE A 1 464  ? -35.568 -90.377  24.016  1.00 28.82  ? 465  ILE A CA    1 
ATOM   3492  C  C     . ILE A 1 464  ? -36.633 -89.591  24.768  1.00 27.00  ? 465  ILE A C     1 
ATOM   3493  O  O     . ILE A 1 464  ? -36.358 -88.571  25.384  1.00 25.23  ? 465  ILE A O     1 
ATOM   3494  C  CB    . ILE A 1 464  ? -34.661 -91.361  24.720  1.00 30.14  ? 465  ILE A CB    1 
ATOM   3495  C  CG1   . ILE A 1 464  ? -34.809 -91.344  26.228  1.00 31.52  ? 465  ILE A CG1   1 
ATOM   3496  C  CG2   . ILE A 1 464  ? -33.188 -91.421  24.411  1.00 29.16  ? 465  ILE A CG2   1 
ATOM   3497  C  CD1   . ILE A 1 464  ? -35.633 -92.531  26.664  1.00 31.87  ? 465  ILE A CD1   1 
ATOM   3498  N  N     . SER A 1 465  ? -37.882 -90.048  24.652  1.00 24.27  ? 466  SER A N     1 
ATOM   3499  C  CA    . SER A 1 465  ? -39.006 -89.465  25.347  1.00 21.40  ? 466  SER A CA    1 
ATOM   3500  C  C     . SER A 1 465  ? -39.323 -90.185  26.646  1.00 22.33  ? 466  SER A C     1 
ATOM   3501  O  O     . SER A 1 465  ? -39.295 -91.418  26.721  1.00 23.20  ? 466  SER A O     1 
ATOM   3502  C  CB    . SER A 1 465  ? -40.243 -89.479  24.432  1.00 19.84  ? 466  SER A CB    1 
ATOM   3503  O  OG    . SER A 1 465  ? -39.906 -88.925  23.174  1.00 22.08  ? 466  SER A OG    1 
ATOM   3504  N  N     . HIS A 1 466  ? -39.668 -89.395  27.670  1.00 20.26  ? 467  HIS A N     1 
ATOM   3505  C  CA    . HIS A 1 466  ? -39.969 -89.915  28.986  1.00 21.69  ? 467  HIS A CA    1 
ATOM   3506  C  C     . HIS A 1 466  ? -41.368 -89.415  29.328  1.00 23.95  ? 467  HIS A C     1 
ATOM   3507  O  O     . HIS A 1 466  ? -41.560 -88.201  29.498  1.00 19.89  ? 467  HIS A O     1 
ATOM   3508  C  CB    . HIS A 1 466  ? -38.992 -89.453  30.071  1.00 20.89  ? 467  HIS A CB    1 
ATOM   3509  C  CG    . HIS A 1 466  ? -37.596 -89.923  29.864  1.00 20.68  ? 467  HIS A CG    1 
ATOM   3510  N  ND1   . HIS A 1 466  ? -36.779 -89.362  28.888  1.00 22.33  ? 467  HIS A ND1   1 
ATOM   3511  C  CD2   . HIS A 1 466  ? -36.905 -90.893  30.471  1.00 19.60  ? 467  HIS A CD2   1 
ATOM   3512  C  CE1   . HIS A 1 466  ? -35.614 -89.992  28.937  1.00 22.19  ? 467  HIS A CE1   1 
ATOM   3513  N  NE2   . HIS A 1 466  ? -35.670 -90.943  29.854  1.00 22.03  ? 467  HIS A NE2   1 
ATOM   3514  N  N     . LEU A 1 467  ? -42.293 -90.400  29.347  1.00 22.29  ? 468  LEU A N     1 
ATOM   3515  C  CA    . LEU A 1 467  ? -43.659 -90.037  29.664  1.00 21.67  ? 468  LEU A CA    1 
ATOM   3516  C  C     . LEU A 1 467  ? -44.189 -90.742  30.925  1.00 23.38  ? 468  LEU A C     1 
ATOM   3517  O  O     . LEU A 1 467  ? -43.861 -91.906  31.217  1.00 21.96  ? 468  LEU A O     1 
ATOM   3518  C  CB    . LEU A 1 467  ? -44.687 -90.380  28.577  1.00 24.42  ? 468  LEU A CB    1 
ATOM   3519  C  CG    . LEU A 1 467  ? -44.481 -89.990  27.125  1.00 26.55  ? 468  LEU A CG    1 
ATOM   3520  C  CD1   . LEU A 1 467  ? -45.831 -89.929  26.411  1.00 25.82  ? 468  LEU A CD1   1 
ATOM   3521  C  CD2   . LEU A 1 467  ? -43.672 -88.752  26.877  1.00 24.08  ? 468  LEU A CD2   1 
ATOM   3522  N  N     . ARG A 1 468  ? -44.986 -89.981  31.679  1.00 20.93  ? 469  ARG A N     1 
ATOM   3523  C  CA    . ARG A 1 468  ? -45.643 -90.584  32.835  1.00 23.65  ? 469  ARG A CA    1 
ATOM   3524  C  C     . ARG A 1 468  ? -47.132 -90.206  32.820  1.00 23.05  ? 469  ARG A C     1 
ATOM   3525  O  O     . ARG A 1 468  ? -47.541 -89.106  32.484  1.00 20.56  ? 469  ARG A O     1 
ATOM   3526  C  CB    . ARG A 1 468  ? -45.050 -90.233  34.196  1.00 18.03  ? 469  ARG A CB    1 
ATOM   3527  C  CG    . ARG A 1 468  ? -43.639 -90.763  34.415  1.00 19.83  ? 469  ARG A CG    1 
ATOM   3528  C  CD    . ARG A 1 468  ? -43.114 -90.382  35.786  1.00 18.58  ? 469  ARG A CD    1 
ATOM   3529  N  NE    . ARG A 1 468  ? -41.783 -90.871  36.114  1.00 21.45  ? 469  ARG A NE    1 
ATOM   3530  C  CZ    . ARG A 1 468  ? -40.678 -90.125  35.983  1.00 22.19  ? 469  ARG A CZ    1 
ATOM   3531  N  NH1   . ARG A 1 468  ? -39.495 -90.575  36.378  1.00 21.52  ? 469  ARG A NH1   1 
ATOM   3532  N  NH2   . ARG A 1 468  ? -40.781 -88.900  35.492  1.00 18.60  ? 469  ARG A NH2   1 
ATOM   3533  N  N     . PHE A 1 469  ? -47.926 -91.210  33.256  1.00 22.82  ? 470  PHE A N     1 
ATOM   3534  C  CA    . PHE A 1 469  ? -49.363 -91.029  33.365  1.00 24.02  ? 470  PHE A CA    1 
ATOM   3535  C  C     . PHE A 1 469  ? -49.812 -91.585  34.712  1.00 22.95  ? 470  PHE A C     1 
ATOM   3536  O  O     . PHE A 1 469  ? -49.331 -92.670  35.053  1.00 24.67  ? 470  PHE A O     1 
ATOM   3537  C  CB    . PHE A 1 469  ? -50.203 -91.689  32.265  1.00 25.73  ? 470  PHE A CB    1 
ATOM   3538  C  CG    . PHE A 1 469  ? -49.901 -91.084  30.915  1.00 25.48  ? 470  PHE A CG    1 
ATOM   3539  C  CD1   . PHE A 1 469  ? -48.979 -91.696  30.087  1.00 24.98  ? 470  PHE A CD1   1 
ATOM   3540  C  CD2   . PHE A 1 469  ? -50.540 -89.922  30.527  1.00 25.33  ? 470  PHE A CD2   1 
ATOM   3541  C  CE1   . PHE A 1 469  ? -48.672 -91.132  28.848  1.00 25.35  ? 470  PHE A CE1   1 
ATOM   3542  C  CE2   . PHE A 1 469  ? -50.246 -89.384  29.283  1.00 26.60  ? 470  PHE A CE2   1 
ATOM   3543  C  CZ    . PHE A 1 469  ? -49.324 -89.986  28.440  1.00 25.32  ? 470  PHE A CZ    1 
ATOM   3544  N  N     . GLY A 1 470  ? -50.593 -90.811  35.437  1.00 23.05  ? 471  GLY A N     1 
ATOM   3545  C  CA    . GLY A 1 470  ? -51.008 -91.289  36.739  1.00 26.32  ? 471  GLY A CA    1 
ATOM   3546  C  C     . GLY A 1 470  ? -52.343 -90.784  37.235  1.00 28.71  ? 471  GLY A C     1 
ATOM   3547  O  O     . GLY A 1 470  ? -52.826 -89.694  36.867  1.00 28.28  ? 471  GLY A O     1 
ATOM   3548  N  N     . GLU A 1 471  ? -52.872 -91.525  38.227  1.00 28.49  ? 472  GLU A N     1 
ATOM   3549  C  CA    . GLU A 1 471  ? -54.087 -91.034  38.887  1.00 32.07  ? 472  GLU A CA    1 
ATOM   3550  C  C     . GLU A 1 471  ? -53.736 -89.993  39.946  1.00 29.32  ? 472  GLU A C     1 
ATOM   3551  O  O     . GLU A 1 471  ? -54.653 -89.311  40.337  1.00 27.83  ? 472  GLU A O     1 
ATOM   3552  C  CB    . GLU A 1 471  ? -54.818 -92.130  39.656  1.00 35.34  ? 472  GLU A CB    1 
ATOM   3553  C  CG    . GLU A 1 471  ? -54.822 -93.494  39.002  1.00 40.57  ? 472  GLU A CG    1 
ATOM   3554  C  CD    . GLU A 1 471  ? -55.488 -94.534  39.898  1.00 45.09  ? 472  GLU A CD    1 
ATOM   3555  O  OE1   . GLU A 1 471  ? -55.789 -94.304  41.101  1.00 47.34  ? 472  GLU A OE1   1 
ATOM   3556  O  OE2   . GLU A 1 471  ? -55.705 -95.641  39.340  1.00 48.11  ? 472  GLU A OE2   1 
ATOM   3557  N  N     . LYS A 1 472  ? -52.491 -89.989  40.442  1.00 26.17  ? 473  LYS A N     1 
ATOM   3558  C  CA    . LYS A 1 472  ? -52.072 -89.013  41.432  1.00 26.15  ? 473  LYS A CA    1 
ATOM   3559  C  C     . LYS A 1 472  ? -51.128 -88.021  40.717  1.00 26.47  ? 473  LYS A C     1 
ATOM   3560  O  O     . LYS A 1 472  ? -50.523 -88.354  39.688  1.00 24.56  ? 473  LYS A O     1 
ATOM   3561  C  CB    . LYS A 1 472  ? -51.306 -89.553  42.626  1.00 29.12  ? 473  LYS A CB    1 
ATOM   3562  C  CG    . LYS A 1 472  ? -51.956 -90.487  43.652  1.00 31.23  ? 473  LYS A CG    1 
ATOM   3563  C  CD    . LYS A 1 472  ? -53.472 -90.428  43.606  1.00 34.58  ? 473  LYS A CD    1 
ATOM   3564  C  CE    . LYS A 1 472  ? -54.079 -91.176  44.797  1.00 37.13  ? 473  LYS A CE    1 
ATOM   3565  N  NZ    . LYS A 1 472  ? -55.536 -91.408  44.535  1.00 39.99  ? 473  LYS A NZ    1 
ATOM   3566  N  N     . PRO A 1 473  ? -50.994 -86.843  41.274  1.00 25.28  ? 474  PRO A N     1 
ATOM   3567  C  CA    . PRO A 1 473  ? -50.103 -85.804  40.733  1.00 23.38  ? 474  PRO A CA    1 
ATOM   3568  C  C     . PRO A 1 473  ? -48.676 -86.328  40.523  1.00 23.00  ? 474  PRO A C     1 
ATOM   3569  O  O     . PRO A 1 473  ? -48.219 -87.098  41.344  1.00 20.32  ? 474  PRO A O     1 
ATOM   3570  C  CB    . PRO A 1 473  ? -50.118 -84.758  41.833  1.00 23.72  ? 474  PRO A CB    1 
ATOM   3571  C  CG    . PRO A 1 473  ? -51.418 -84.934  42.553  1.00 24.91  ? 474  PRO A CG    1 
ATOM   3572  C  CD    . PRO A 1 473  ? -51.684 -86.420  42.524  1.00 25.58  ? 474  PRO A CD    1 
ATOM   3573  N  N     . ILE A 1 474  ? -47.993 -85.984  39.454  1.00 22.34  ? 475  ILE A N     1 
ATOM   3574  C  CA    . ILE A 1 474  ? -46.671 -86.457  39.091  1.00 21.30  ? 475  ILE A CA    1 
ATOM   3575  C  C     . ILE A 1 474  ? -45.596 -85.435  39.523  1.00 20.80  ? 475  ILE A C     1 
ATOM   3576  O  O     . ILE A 1 474  ? -45.451 -84.378  38.906  1.00 19.98  ? 475  ILE A O     1 
ATOM   3577  C  CB    . ILE A 1 474  ? -46.577 -86.717  37.588  1.00 21.42  ? 475  ILE A CB    1 
ATOM   3578  C  CG1   . ILE A 1 474  ? -47.543 -87.862  37.182  1.00 21.77  ? 475  ILE A CG1   1 
ATOM   3579  C  CG2   . ILE A 1 474  ? -45.196 -87.108  37.120  1.00 20.89  ? 475  ILE A CG2   1 
ATOM   3580  C  CD1   . ILE A 1 474  ? -47.901 -87.877  35.723  1.00 24.89  ? 475  ILE A CD1   1 
ATOM   3581  N  N     . GLN A 1 475  ? -44.911 -85.766  40.590  1.00 18.35  ? 476  GLN A N     1 
ATOM   3582  C  CA    . GLN A 1 475  ? -43.853 -84.931  41.148  1.00 20.19  ? 476  GLN A CA    1 
ATOM   3583  C  C     . GLN A 1 475  ? -42.460 -85.425  40.714  1.00 19.19  ? 476  GLN A C     1 
ATOM   3584  O  O     . GLN A 1 475  ? -41.446 -85.098  41.314  1.00 19.98  ? 476  GLN A O     1 
ATOM   3585  C  CB    . GLN A 1 475  ? -43.887 -84.935  42.689  1.00 17.06  ? 476  GLN A CB    1 
ATOM   3586  C  CG    . GLN A 1 475  ? -45.192 -84.364  43.237  1.00 17.63  ? 476  GLN A CG    1 
ATOM   3587  C  CD    . GLN A 1 475  ? -45.184 -83.996  44.700  1.00 20.48  ? 476  GLN A CD    1 
ATOM   3588  O  OE1   . GLN A 1 475  ? -45.376 -84.897  45.542  1.00 20.14  ? 476  GLN A OE1   1 
ATOM   3589  N  NE2   . GLN A 1 475  ? -45.024 -82.735  45.086  1.00 20.03  ? 476  GLN A NE2   1 
ATOM   3590  N  N     . SER A 1 476  ? -42.420 -86.302  39.740  1.00 19.09  ? 477  SER A N     1 
ATOM   3591  C  CA    . SER A 1 476  ? -41.242 -87.053  39.358  1.00 20.23  ? 477  SER A CA    1 
ATOM   3592  C  C     . SER A 1 476  ? -40.330 -86.225  38.434  1.00 20.47  ? 477  SER A C     1 
ATOM   3593  O  O     . SER A 1 476  ? -40.325 -86.450  37.238  1.00 19.65  ? 477  SER A O     1 
ATOM   3594  C  CB    . SER A 1 476  ? -41.666 -88.341  38.624  1.00 21.82  ? 477  SER A CB    1 
ATOM   3595  O  OG    . SER A 1 476  ? -42.498 -89.061  39.523  1.00 23.43  ? 477  SER A OG    1 
ATOM   3596  N  N     . THR A 1 477  ? -39.649 -85.256  39.050  1.00 17.69  ? 478  THR A N     1 
ATOM   3597  C  CA    . THR A 1 477  ? -38.786 -84.373  38.237  1.00 16.80  ? 478  THR A CA    1 
ATOM   3598  C  C     . THR A 1 477  ? -37.434 -84.995  37.948  1.00 17.71  ? 478  THR A C     1 
ATOM   3599  O  O     . THR A 1 477  ? -36.358 -84.476  38.300  1.00 16.53  ? 478  THR A O     1 
ATOM   3600  C  CB    . THR A 1 477  ? -38.713 -82.965  38.867  1.00 16.59  ? 478  THR A CB    1 
ATOM   3601  O  OG1   . THR A 1 477  ? -38.388 -82.991  40.280  1.00 16.78  ? 478  THR A OG1   1 
ATOM   3602  C  CG2   . THR A 1 477  ? -40.104 -82.325  38.760  1.00 16.08  ? 478  THR A CG2   1 
ATOM   3603  N  N     . TYR A 1 478  ? -37.437 -86.130  37.276  1.00 17.36  ? 479  TYR A N     1 
ATOM   3604  C  CA    . TYR A 1 478  ? -36.260 -86.898  36.884  1.00 17.70  ? 479  TYR A CA    1 
ATOM   3605  C  C     . TYR A 1 478  ? -36.653 -87.817  35.753  1.00 18.74  ? 479  TYR A C     1 
ATOM   3606  O  O     . TYR A 1 478  ? -37.848 -88.073  35.497  1.00 18.07  ? 479  TYR A O     1 
ATOM   3607  C  CB    . TYR A 1 478  ? -35.663 -87.635  38.112  1.00 18.72  ? 479  TYR A CB    1 
ATOM   3608  C  CG    . TYR A 1 478  ? -36.682 -88.514  38.821  1.00 20.68  ? 479  TYR A CG    1 
ATOM   3609  C  CD1   . TYR A 1 478  ? -36.754 -89.851  38.411  1.00 20.55  ? 479  TYR A CD1   1 
ATOM   3610  C  CD2   . TYR A 1 478  ? -37.555 -88.060  39.803  1.00 20.72  ? 479  TYR A CD2   1 
ATOM   3611  C  CE1   . TYR A 1 478  ? -37.711 -90.691  39.010  1.00 21.81  ? 479  TYR A CE1   1 
ATOM   3612  C  CE2   . TYR A 1 478  ? -38.482 -88.908  40.421  1.00 20.74  ? 479  TYR A CE2   1 
ATOM   3613  C  CZ    . TYR A 1 478  ? -38.544 -90.221  40.002  1.00 21.43  ? 479  TYR A CZ    1 
ATOM   3614  O  OH    . TYR A 1 478  ? -39.452 -91.128  40.539  1.00 21.84  ? 479  TYR A OH    1 
ATOM   3615  N  N     . LEU A 1 479  ? -35.662 -88.359  35.031  1.00 17.62  ? 480  LEU A N     1 
ATOM   3616  C  CA    . LEU A 1 479  ? -35.971 -89.156  33.865  1.00 20.68  ? 480  LEU A CA    1 
ATOM   3617  C  C     . LEU A 1 479  ? -36.602 -90.475  34.335  1.00 19.67  ? 480  LEU A C     1 
ATOM   3618  O  O     . LEU A 1 479  ? -36.515 -90.831  35.502  1.00 22.28  ? 480  LEU A O     1 
ATOM   3619  C  CB    . LEU A 1 479  ? -34.692 -89.490  33.050  1.00 20.46  ? 480  LEU A CB    1 
ATOM   3620  C  CG    . LEU A 1 479  ? -34.004 -88.189  32.548  1.00 19.94  ? 480  LEU A CG    1 
ATOM   3621  C  CD1   . LEU A 1 479  ? -32.709 -88.618  31.871  1.00 21.60  ? 480  LEU A CD1   1 
ATOM   3622  C  CD2   . LEU A 1 479  ? -34.904 -87.546  31.487  1.00 19.83  ? 480  LEU A CD2   1 
ATOM   3623  N  N     . VAL A 1 480  ? -37.273 -91.161  33.473  1.00 21.53  ? 481  VAL A N     1 
ATOM   3624  C  CA    . VAL A 1 480  ? -37.842 -92.460  33.843  1.00 21.88  ? 481  VAL A CA    1 
ATOM   3625  C  C     . VAL A 1 480  ? -36.660 -93.423  33.971  1.00 23.46  ? 481  VAL A C     1 
ATOM   3626  O  O     . VAL A 1 480  ? -35.924 -93.569  32.990  1.00 24.66  ? 481  VAL A O     1 
ATOM   3627  C  CB    . VAL A 1 480  ? -38.853 -92.892  32.767  1.00 23.35  ? 481  VAL A CB    1 
ATOM   3628  C  CG1   . VAL A 1 480  ? -39.248 -94.362  32.925  1.00 20.49  ? 481  VAL A CG1   1 
ATOM   3629  C  CG2   . VAL A 1 480  ? -40.082 -91.974  32.820  1.00 19.82  ? 481  VAL A CG2   1 
ATOM   3630  N  N     . ASN A 1 481  ? -36.556 -94.089  35.104  1.00 27.98  ? 482  ASN A N     1 
ATOM   3631  C  CA    . ASN A 1 481  ? -35.495 -95.091  35.219  1.00 31.03  ? 482  ASN A CA    1 
ATOM   3632  C  C     . ASN A 1 481  ? -36.062 -96.497  35.391  1.00 33.40  ? 482  ASN A C     1 
ATOM   3633  O  O     . ASN A 1 481  ? -35.317 -97.464  35.332  1.00 32.63  ? 482  ASN A O     1 
ATOM   3634  C  CB    . ASN A 1 481  ? -34.471 -94.727  36.264  1.00 34.00  ? 482  ASN A CB    1 
ATOM   3635  C  CG    . ASN A 1 481  ? -35.008 -94.206  37.566  1.00 36.46  ? 482  ASN A CG    1 
ATOM   3636  O  OD1   . ASN A 1 481  ? -35.832 -94.856  38.206  1.00 39.36  ? 482  ASN A OD1   1 
ATOM   3637  N  ND2   . ASN A 1 481  ? -34.538 -93.030  37.964  1.00 37.75  ? 482  ASN A ND2   1 
ATOM   3638  N  N     . ARG A 1 482  ? -37.345 -96.640  35.582  1.00 33.98  ? 483  ARG A N     1 
ATOM   3639  C  CA    . ARG A 1 482  ? -37.998 -97.948  35.714  1.00 37.16  ? 483  ARG A CA    1 
ATOM   3640  C  C     . ARG A 1 482  ? -39.307 -97.859  34.943  1.00 34.08  ? 483  ARG A C     1 
ATOM   3641  O  O     . ARG A 1 482  ? -40.285 -97.283  35.410  1.00 35.83  ? 483  ARG A O     1 
ATOM   3642  C  CB    . ARG A 1 482  ? -38.243 -98.238  37.192  1.00 40.02  ? 483  ARG A CB    1 
ATOM   3643  C  CG    . ARG A 1 482  ? -37.021 -98.741  37.962  1.00 43.70  ? 483  ARG A CG    1 
ATOM   3644  C  CD    . ARG A 1 482  ? -37.522 -99.164  39.334  1.00 47.42  ? 483  ARG A CD    1 
ATOM   3645  N  NE    . ARG A 1 482  ? -36.585 -99.043  40.439  1.00 50.47  ? 483  ARG A NE    1 
ATOM   3646  C  CZ    . ARG A 1 482  ? -35.454 -99.730  40.495  1.00 52.93  ? 483  ARG A CZ    1 
ATOM   3647  N  NH1   . ARG A 1 482  ? -35.117 -100.554 39.503  1.00 53.45  ? 483  ARG A NH1   1 
ATOM   3648  N  NH2   . ARG A 1 482  ? -34.635 -99.601  41.528  1.00 54.71  ? 483  ARG A NH2   1 
ATOM   3649  N  N     . ALA A 1 483  ? -39.253 -98.280  33.700  1.00 32.20  ? 484  ALA A N     1 
ATOM   3650  C  CA    . ALA A 1 483  ? -40.343 -98.176  32.769  1.00 32.23  ? 484  ALA A CA    1 
ATOM   3651  C  C     . ALA A 1 483  ? -41.240 -99.414  32.750  1.00 32.09  ? 484  ALA A C     1 
ATOM   3652  O  O     . ALA A 1 483  ? -40.759 -100.546 32.877  1.00 31.06  ? 484  ALA A O     1 
ATOM   3653  C  CB    . ALA A 1 483  ? -39.797 -97.951  31.350  1.00 31.43  ? 484  ALA A CB    1 
ATOM   3654  N  N     . ASP A 1 484  ? -42.488 -99.121  32.456  1.00 30.79  ? 485  ASP A N     1 
ATOM   3655  C  CA    . ASP A 1 484  ? -43.523 -100.146 32.280  1.00 31.12  ? 485  ASP A CA    1 
ATOM   3656  C  C     . ASP A 1 484  ? -43.559 -100.532 30.815  1.00 30.47  ? 485  ASP A C     1 
ATOM   3657  O  O     . ASP A 1 484  ? -43.815 -101.643 30.355  1.00 28.95  ? 485  ASP A O     1 
ATOM   3658  C  CB    . ASP A 1 484  ? -44.869 -99.465  32.623  1.00 32.92  ? 485  ASP A CB    1 
ATOM   3659  C  CG    . ASP A 1 484  ? -44.979 -99.180  34.107  1.00 34.54  ? 485  ASP A CG    1 
ATOM   3660  O  OD1   . ASP A 1 484  ? -44.913 -98.028  34.568  1.00 32.01  ? 485  ASP A OD1   1 
ATOM   3661  O  OD2   . ASP A 1 484  ? -45.130 -100.198 34.821  1.00 35.43  ? 485  ASP A OD2   1 
ATOM   3662  N  N     . TYR A 1 485  ? -43.306 -99.492  29.992  1.00 28.83  ? 486  TYR A N     1 
ATOM   3663  C  CA    . TYR A 1 485  ? -43.329 -99.611  28.556  1.00 26.68  ? 486  TYR A CA    1 
ATOM   3664  C  C     . TYR A 1 485  ? -42.063 -98.968  27.960  1.00 28.13  ? 486  TYR A C     1 
ATOM   3665  O  O     . TYR A 1 485  ? -41.856 -97.781  28.250  1.00 25.64  ? 486  TYR A O     1 
ATOM   3666  C  CB    . TYR A 1 485  ? -44.563 -98.846  28.042  1.00 25.71  ? 486  TYR A CB    1 
ATOM   3667  C  CG    . TYR A 1 485  ? -44.804 -98.812  26.559  1.00 25.60  ? 486  TYR A CG    1 
ATOM   3668  C  CD1   . TYR A 1 485  ? -45.593 -99.764  25.924  1.00 27.67  ? 486  TYR A CD1   1 
ATOM   3669  C  CD2   . TYR A 1 485  ? -44.255 -97.819  25.760  1.00 25.91  ? 486  TYR A CD2   1 
ATOM   3670  C  CE1   . TYR A 1 485  ? -45.826 -99.741  24.551  1.00 26.87  ? 486  TYR A CE1   1 
ATOM   3671  C  CE2   . TYR A 1 485  ? -44.453 -97.766  24.394  1.00 26.47  ? 486  TYR A CE2   1 
ATOM   3672  C  CZ    . TYR A 1 485  ? -45.245 -98.745  23.800  1.00 26.67  ? 486  TYR A CZ    1 
ATOM   3673  O  OH    . TYR A 1 485  ? -45.438 -98.684  22.447  1.00 27.88  ? 486  TYR A OH    1 
ATOM   3674  N  N     . VAL A 1 486  ? -41.400 -99.684  27.076  1.00 26.57  ? 487  VAL A N     1 
ATOM   3675  C  CA    . VAL A 1 486  ? -40.237 -99.188  26.361  1.00 25.88  ? 487  VAL A CA    1 
ATOM   3676  C  C     . VAL A 1 486  ? -40.460 -99.502  24.877  1.00 28.46  ? 487  VAL A C     1 
ATOM   3677  O  O     . VAL A 1 486  ? -40.711 -100.653 24.497  1.00 27.10  ? 487  VAL A O     1 
ATOM   3678  C  CB    . VAL A 1 486  ? -38.864 -99.750  26.756  1.00 24.74  ? 487  VAL A CB    1 
ATOM   3679  C  CG1   . VAL A 1 486  ? -37.720 -99.091  25.953  1.00 22.87  ? 487  VAL A CG1   1 
ATOM   3680  C  CG2   . VAL A 1 486  ? -38.567 -99.514  28.232  1.00 21.60  ? 487  VAL A CG2   1 
ATOM   3681  N  N     . ALA A 1 487  ? -40.316 -98.460  24.056  1.00 26.24  ? 488  ALA A N     1 
ATOM   3682  C  CA    . ALA A 1 487  ? -40.417 -98.636  22.626  1.00 26.54  ? 488  ALA A CA    1 
ATOM   3683  C  C     . ALA A 1 487  ? -39.139 -98.171  21.921  1.00 27.32  ? 488  ALA A C     1 
ATOM   3684  O  O     . ALA A 1 487  ? -38.536 -97.155  22.285  1.00 26.81  ? 488  ALA A O     1 
ATOM   3685  C  CB    . ALA A 1 487  ? -41.634 -97.935  22.033  1.00 25.40  ? 488  ALA A CB    1 
ATOM   3686  N  N     . CYS A 1 488  ? -38.656 -99.036  21.008  1.00 26.48  ? 489  CYS A N     1 
ATOM   3687  C  CA    . CYS A 1 488  ? -37.520 -98.706  20.158  1.00 27.16  ? 489  CYS A CA    1 
ATOM   3688  C  C     . CYS A 1 488  ? -38.022 -98.518  18.737  1.00 27.82  ? 489  CYS A C     1 
ATOM   3689  O  O     . CYS A 1 488  ? -38.459 -99.476  18.070  1.00 28.61  ? 489  CYS A O     1 
ATOM   3690  C  CB    . CYS A 1 488  ? -36.399 -99.746  20.215  1.00 27.70  ? 489  CYS A CB    1 
ATOM   3691  S  SG    . CYS A 1 488  ? -34.920 -99.308  19.274  1.00 29.81  ? 489  CYS A SG    1 
ATOM   3692  N  N     . HIS A 1 489  ? -38.017 -97.260  18.289  1.00 25.62  ? 490  HIS A N     1 
ATOM   3693  C  CA    . HIS A 1 489  ? -38.586 -96.896  17.006  1.00 27.88  ? 490  HIS A CA    1 
ATOM   3694  C  C     . HIS A 1 489  ? -37.563 -96.965  15.881  1.00 27.28  ? 490  HIS A C     1 
ATOM   3695  O  O     . HIS A 1 489  ? -37.937 -96.795  14.738  1.00 29.22  ? 490  HIS A O     1 
ATOM   3696  C  CB    . HIS A 1 489  ? -39.192 -95.468  17.049  1.00 27.58  ? 490  HIS A CB    1 
ATOM   3697  C  CG    . HIS A 1 489  ? -40.424 -95.390  17.920  1.00 27.11  ? 490  HIS A CG    1 
ATOM   3698  N  ND1   . HIS A 1 489  ? -41.146 -94.222  18.040  1.00 25.09  ? 490  HIS A ND1   1 
ATOM   3699  C  CD2   . HIS A 1 489  ? -41.040 -96.298  18.705  1.00 26.05  ? 490  HIS A CD2   1 
ATOM   3700  C  CE1   . HIS A 1 489  ? -42.175 -94.430  18.847  1.00 25.41  ? 490  HIS A CE1   1 
ATOM   3701  N  NE2   . HIS A 1 489  ? -42.149 -95.666  19.261  1.00 25.61  ? 490  HIS A NE2   1 
ATOM   3702  N  N     . ASN A 1 490  ? -36.322 -97.223  16.225  1.00 30.10  ? 491  ASN A N     1 
ATOM   3703  C  CA    . ASN A 1 490  ? -35.233 -97.311  15.248  1.00 32.01  ? 491  ASN A CA    1 
ATOM   3704  C  C     . ASN A 1 490  ? -34.441 -98.583  15.534  1.00 31.58  ? 491  ASN A C     1 
ATOM   3705  O  O     . ASN A 1 490  ? -33.692 -98.683  16.511  1.00 30.31  ? 491  ASN A O     1 
ATOM   3706  C  CB    . ASN A 1 490  ? -34.337 -96.074  15.287  1.00 33.39  ? 491  ASN A CB    1 
ATOM   3707  C  CG    . ASN A 1 490  ? -33.157 -96.115  14.341  1.00 37.03  ? 491  ASN A CG    1 
ATOM   3708  O  OD1   . ASN A 1 490  ? -32.259 -95.271  14.451  1.00 41.27  ? 491  ASN A OD1   1 
ATOM   3709  N  ND2   . ASN A 1 490  ? -33.004 -97.042  13.392  1.00 35.35  ? 491  ASN A ND2   1 
ATOM   3710  N  N     . PRO A 1 491  ? -34.567 -99.546  14.631  1.00 31.49  ? 492  PRO A N     1 
ATOM   3711  C  CA    . PRO A 1 491  ? -33.965 -100.857 14.779  1.00 32.26  ? 492  PRO A CA    1 
ATOM   3712  C  C     . PRO A 1 491  ? -32.460 -100.844 14.921  1.00 32.02  ? 492  PRO A C     1 
ATOM   3713  O  O     . PRO A 1 491  ? -31.837 -101.607 15.673  1.00 34.65  ? 492  PRO A O     1 
ATOM   3714  C  CB    . PRO A 1 491  ? -34.397 -101.603 13.519  1.00 32.71  ? 492  PRO A CB    1 
ATOM   3715  C  CG    . PRO A 1 491  ? -34.957 -100.580 12.583  1.00 34.35  ? 492  PRO A CG    1 
ATOM   3716  C  CD    . PRO A 1 491  ? -35.497 -99.494  13.478  1.00 32.72  ? 492  PRO A CD    1 
ATOM   3717  N  N     . ALA A 1 492  ? -31.832 -99.879  14.244  1.00 32.39  ? 493  ALA A N     1 
ATOM   3718  C  CA    . ALA A 1 492  ? -30.382 -99.763  14.303  1.00 34.77  ? 493  ALA A CA    1 
ATOM   3719  C  C     . ALA A 1 492  ? -29.876 -99.536  15.720  1.00 35.32  ? 493  ALA A C     1 
ATOM   3720  O  O     . ALA A 1 492  ? -28.762 -99.974  16.031  1.00 36.93  ? 493  ALA A O     1 
ATOM   3721  C  CB    . ALA A 1 492  ? -29.957 -98.677  13.320  1.00 34.85  ? 493  ALA A CB    1 
ATOM   3722  N  N     . TYR A 1 493  ? -30.711 -99.072  16.652  1.00 33.60  ? 494  TYR A N     1 
ATOM   3723  C  CA    . TYR A 1 493  ? -30.241 -98.839  18.015  1.00 33.90  ? 494  TYR A CA    1 
ATOM   3724  C  C     . TYR A 1 493  ? -30.040 -100.084 18.857  1.00 35.58  ? 494  TYR A C     1 
ATOM   3725  O  O     . TYR A 1 493  ? -29.440 -100.069 19.935  1.00 34.07  ? 494  TYR A O     1 
ATOM   3726  C  CB    . TYR A 1 493  ? -31.241 -97.953  18.775  1.00 31.00  ? 494  TYR A CB    1 
ATOM   3727  C  CG    . TYR A 1 493  ? -31.414 -96.533  18.299  1.00 30.69  ? 494  TYR A CG    1 
ATOM   3728  C  CD1   . TYR A 1 493  ? -32.603 -95.856  18.586  1.00 29.65  ? 494  TYR A CD1   1 
ATOM   3729  C  CD2   . TYR A 1 493  ? -30.439 -95.829  17.594  1.00 29.08  ? 494  TYR A CD2   1 
ATOM   3730  C  CE1   . TYR A 1 493  ? -32.841 -94.559  18.193  1.00 28.30  ? 494  TYR A CE1   1 
ATOM   3731  C  CE2   . TYR A 1 493  ? -30.671 -94.518  17.198  1.00 30.01  ? 494  TYR A CE2   1 
ATOM   3732  C  CZ    . TYR A 1 493  ? -31.863 -93.892  17.496  1.00 29.59  ? 494  TYR A CZ    1 
ATOM   3733  O  OH    . TYR A 1 493  ? -32.077 -92.592  17.097  1.00 29.63  ? 494  TYR A OH    1 
ATOM   3734  N  N     . VAL A 1 494  ? -30.661 -101.170 18.415  1.00 38.64  ? 495  VAL A N     1 
ATOM   3735  C  CA    . VAL A 1 494  ? -30.677 -102.435 19.129  1.00 42.49  ? 495  VAL A CA    1 
ATOM   3736  C  C     . VAL A 1 494  ? -29.285 -102.915 19.501  1.00 45.11  ? 495  VAL A C     1 
ATOM   3737  O  O     . VAL A 1 494  ? -29.031 -103.275 20.649  1.00 46.91  ? 495  VAL A O     1 
ATOM   3738  C  CB    . VAL A 1 494  ? -31.513 -103.417 18.289  1.00 43.11  ? 495  VAL A CB    1 
ATOM   3739  C  CG1   . VAL A 1 494  ? -30.804 -104.654 17.796  1.00 44.07  ? 495  VAL A CG1   1 
ATOM   3740  C  CG2   . VAL A 1 494  ? -32.790 -103.725 19.076  1.00 43.17  ? 495  VAL A CG2   1 
ATOM   3741  N  N     . GLY A 1 495  ? -28.353 -102.852 18.560  1.00 46.43  ? 496  GLY A N     1 
ATOM   3742  C  CA    . GLY A 1 495  ? -26.997 -103.287 18.859  1.00 48.78  ? 496  GLY A CA    1 
ATOM   3743  C  C     . GLY A 1 495  ? -26.059 -102.160 19.252  1.00 49.06  ? 496  GLY A C     1 
ATOM   3744  O  O     . GLY A 1 495  ? -24.851 -102.365 19.143  1.00 50.80  ? 496  GLY A O     1 
ATOM   3745  N  N     . ILE A 1 496  ? -26.553 -101.006 19.694  1.00 49.09  ? 497  ILE A N     1 
ATOM   3746  C  CA    . ILE A 1 496  ? -25.635 -99.925  20.072  1.00 47.97  ? 497  ILE A CA    1 
ATOM   3747  C  C     . ILE A 1 496  ? -25.975 -99.303  21.406  1.00 46.35  ? 497  ILE A C     1 
ATOM   3748  O  O     . ILE A 1 496  ? -25.038 -99.009  22.160  1.00 45.82  ? 497  ILE A O     1 
ATOM   3749  C  CB    . ILE A 1 496  ? -25.454 -98.922  18.935  1.00 50.17  ? 497  ILE A CB    1 
ATOM   3750  C  CG1   . ILE A 1 496  ? -26.732 -98.278  18.414  1.00 51.16  ? 497  ILE A CG1   1 
ATOM   3751  C  CG2   . ILE A 1 496  ? -24.785 -99.649  17.749  1.00 51.61  ? 497  ILE A CG2   1 
ATOM   3752  C  CD1   . ILE A 1 496  ? -26.474 -97.264  17.297  1.00 51.46  ? 497  ILE A CD1   1 
ATOM   3753  N  N     . TYR A 1 497  ? -27.238 -99.212  21.811  1.00 43.86  ? 498  TYR A N     1 
ATOM   3754  C  CA    . TYR A 1 497  ? -27.571 -98.656  23.110  1.00 42.31  ? 498  TYR A CA    1 
ATOM   3755  C  C     . TYR A 1 497  ? -28.258 -99.626  24.060  1.00 41.04  ? 498  TYR A C     1 
ATOM   3756  O  O     . TYR A 1 497  ? -28.976 -100.533 23.644  1.00 39.54  ? 498  TYR A O     1 
ATOM   3757  C  CB    . TYR A 1 497  ? -28.501 -97.441  22.951  1.00 41.99  ? 498  TYR A CB    1 
ATOM   3758  C  CG    . TYR A 1 497  ? -27.910 -96.394  22.035  1.00 43.92  ? 498  TYR A CG    1 
ATOM   3759  C  CD1   . TYR A 1 497  ? -28.376 -96.270  20.732  1.00 43.90  ? 498  TYR A CD1   1 
ATOM   3760  C  CD2   . TYR A 1 497  ? -26.898 -95.542  22.452  1.00 44.39  ? 498  TYR A CD2   1 
ATOM   3761  C  CE1   . TYR A 1 497  ? -27.857 -95.322  19.878  1.00 45.58  ? 498  TYR A CE1   1 
ATOM   3762  C  CE2   . TYR A 1 497  ? -26.371 -94.580  21.602  1.00 45.83  ? 498  TYR A CE2   1 
ATOM   3763  C  CZ    . TYR A 1 497  ? -26.854 -94.478  20.316  1.00 46.66  ? 498  TYR A CZ    1 
ATOM   3764  O  OH    . TYR A 1 497  ? -26.341 -93.541  19.446  1.00 47.90  ? 498  TYR A OH    1 
ATOM   3765  N  N     . ASP A 1 498  ? -28.152 -99.350  25.348  1.00 39.73  ? 499  ASP A N     1 
ATOM   3766  C  CA    . ASP A 1 498  ? -28.821 -100.115 26.390  1.00 41.46  ? 499  ASP A CA    1 
ATOM   3767  C  C     . ASP A 1 498  ? -30.304 -99.741  26.502  1.00 38.85  ? 499  ASP A C     1 
ATOM   3768  O  O     . ASP A 1 498  ? -30.783 -99.278  27.524  1.00 36.78  ? 499  ASP A O     1 
ATOM   3769  C  CB    . ASP A 1 498  ? -28.082 -99.869  27.695  1.00 44.37  ? 499  ASP A CB    1 
ATOM   3770  C  CG    . ASP A 1 498  ? -28.442 -100.696 28.900  1.00 46.68  ? 499  ASP A CG    1 
ATOM   3771  O  OD1   . ASP A 1 498  ? -29.309 -101.583 28.770  1.00 47.85  ? 499  ASP A OD1   1 
ATOM   3772  O  OD2   . ASP A 1 498  ? -27.885 -100.463 30.007  1.00 48.18  ? 499  ASP A OD2   1 
ATOM   3773  N  N     . ILE A 1 499  ? -31.073 -100.021 25.453  1.00 39.72  ? 500  ILE A N     1 
ATOM   3774  C  CA    . ILE A 1 499  ? -32.491 -99.714  25.375  1.00 40.87  ? 500  ILE A CA    1 
ATOM   3775  C  C     . ILE A 1 499  ? -33.355 -100.200 26.540  1.00 39.57  ? 500  ILE A C     1 
ATOM   3776  O  O     . ILE A 1 499  ? -34.366 -99.578  26.848  1.00 37.74  ? 500  ILE A O     1 
ATOM   3777  C  CB    . ILE A 1 499  ? -33.095 -100.323 24.091  1.00 42.51  ? 500  ILE A CB    1 
ATOM   3778  C  CG1   . ILE A 1 499  ? -32.158 -100.151 22.909  1.00 43.96  ? 500  ILE A CG1   1 
ATOM   3779  C  CG2   . ILE A 1 499  ? -34.460 -99.722  23.770  1.00 44.54  ? 500  ILE A CG2   1 
ATOM   3780  C  CD1   . ILE A 1 499  ? -32.120 -98.777  22.293  1.00 43.63  ? 500  ILE A CD1   1 
ATOM   3781  N  N     . LEU A 1 500  ? -33.023 -101.346 27.123  1.00 37.71  ? 501  LEU A N     1 
ATOM   3782  C  CA    . LEU A 1 500  ? -33.883 -101.986 28.120  1.00 38.14  ? 501  LEU A CA    1 
ATOM   3783  C  C     . LEU A 1 500  ? -33.414 -101.753 29.540  1.00 38.54  ? 501  LEU A C     1 
ATOM   3784  O  O     . LEU A 1 500  ? -33.915 -102.311 30.520  1.00 36.23  ? 501  LEU A O     1 
ATOM   3785  C  CB    . LEU A 1 500  ? -33.968 -103.488 27.807  1.00 38.74  ? 501  LEU A CB    1 
ATOM   3786  C  CG    . LEU A 1 500  ? -35.091 -104.143 27.027  1.00 39.46  ? 501  LEU A CG    1 
ATOM   3787  C  CD1   . LEU A 1 500  ? -36.067 -103.218 26.325  1.00 38.47  ? 501  LEU A CD1   1 
ATOM   3788  C  CD2   . LEU A 1 500  ? -34.554 -105.133 25.989  1.00 40.41  ? 501  LEU A CD2   1 
ATOM   3789  N  N     . GLU A 1 501  ? -32.440 -100.872 29.728  1.00 39.66  ? 502  GLU A N     1 
ATOM   3790  C  CA    . GLU A 1 501  ? -31.949 -100.515 31.056  1.00 42.41  ? 502  GLU A CA    1 
ATOM   3791  C  C     . GLU A 1 501  ? -33.094 -100.068 31.964  1.00 42.90  ? 502  GLU A C     1 
ATOM   3792  O  O     . GLU A 1 501  ? -33.938 -99.263  31.574  1.00 41.20  ? 502  GLU A O     1 
ATOM   3793  C  CB    . GLU A 1 501  ? -30.858 -99.455  30.923  1.00 43.47  ? 502  GLU A CB    1 
ATOM   3794  C  CG    . GLU A 1 501  ? -29.881 -99.388  32.091  1.00 46.72  ? 502  GLU A CG    1 
ATOM   3795  C  CD    . GLU A 1 501  ? -29.317 -97.994  32.306  1.00 49.20  ? 502  GLU A CD    1 
ATOM   3796  O  OE1   . GLU A 1 501  ? -29.236 -97.218  31.327  1.00 49.44  ? 502  GLU A OE1   1 
ATOM   3797  O  OE2   . GLU A 1 501  ? -28.966 -97.638  33.454  1.00 50.93  ? 502  GLU A OE2   1 
ATOM   3798  N  N     . GLY A 1 502  ? -33.217 -100.722 33.115  1.00 43.78  ? 503  GLY A N     1 
ATOM   3799  C  CA    . GLY A 1 502  ? -34.255 -100.412 34.084  1.00 44.76  ? 503  GLY A CA    1 
ATOM   3800  C  C     . GLY A 1 502  ? -35.646 -100.961 33.827  1.00 44.57  ? 503  GLY A C     1 
ATOM   3801  O  O     . GLY A 1 502  ? -36.501 -100.948 34.739  1.00 44.63  ? 503  GLY A O     1 
ATOM   3802  N  N     . ILE A 1 503  ? -35.976 -101.448 32.633  1.00 44.10  ? 504  ILE A N     1 
ATOM   3803  C  CA    . ILE A 1 503  ? -37.327 -101.948 32.351  1.00 44.56  ? 504  ILE A CA    1 
ATOM   3804  C  C     . ILE A 1 503  ? -37.834 -102.873 33.464  1.00 45.75  ? 504  ILE A C     1 
ATOM   3805  O  O     . ILE A 1 503  ? -37.091 -103.741 33.960  1.00 44.84  ? 504  ILE A O     1 
ATOM   3806  C  CB    . ILE A 1 503  ? -37.452 -102.634 30.987  1.00 43.61  ? 504  ILE A CB    1 
ATOM   3807  C  CG1   . ILE A 1 503  ? -38.934 -102.861 30.642  1.00 43.46  ? 504  ILE A CG1   1 
ATOM   3808  C  CG2   . ILE A 1 503  ? -36.724 -103.978 30.945  1.00 42.95  ? 504  ILE A CG2   1 
ATOM   3809  C  CD1   . ILE A 1 503  ? -39.212 -103.241 29.211  1.00 42.74  ? 504  ILE A CD1   1 
ATOM   3810  N  N     . LYS A 1 504  ? -39.074 -102.664 33.888  1.00 45.64  ? 505  LYS A N     1 
ATOM   3811  C  CA    . LYS A 1 504  ? -39.611 -103.464 34.975  1.00 47.71  ? 505  LYS A CA    1 
ATOM   3812  C  C     . LYS A 1 504  ? -39.748 -104.927 34.570  1.00 47.92  ? 505  LYS A C     1 
ATOM   3813  O  O     . LYS A 1 504  ? -39.892 -105.263 33.390  1.00 47.20  ? 505  LYS A O     1 
ATOM   3814  C  CB    . LYS A 1 504  ? -40.933 -102.855 35.440  1.00 48.95  ? 505  LYS A CB    1 
ATOM   3815  C  CG    . LYS A 1 504  ? -40.755 -101.427 35.961  1.00 51.44  ? 505  LYS A CG    1 
ATOM   3816  C  CD    . LYS A 1 504  ? -42.079 -100.831 36.417  1.00 52.87  ? 505  LYS A CD    1 
ATOM   3817  C  CE    . LYS A 1 504  ? -41.907 -99.505  37.144  1.00 54.40  ? 505  LYS A CE    1 
ATOM   3818  N  NZ    . LYS A 1 504  ? -42.807 -99.462  38.348  1.00 56.49  ? 505  LYS A NZ    1 
ATOM   3819  N  N     . ASP A 1 505  ? -39.720 -105.832 35.545  1.00 48.41  ? 506  ASP A N     1 
ATOM   3820  C  CA    . ASP A 1 505  ? -39.929 -107.253 35.286  1.00 48.68  ? 506  ASP A CA    1 
ATOM   3821  C  C     . ASP A 1 505  ? -41.298 -107.446 34.654  1.00 46.73  ? 506  ASP A C     1 
ATOM   3822  O  O     . ASP A 1 505  ? -42.258 -106.871 35.174  1.00 47.36  ? 506  ASP A O     1 
ATOM   3823  C  CB    . ASP A 1 505  ? -39.839 -108.063 36.587  1.00 51.34  ? 506  ASP A CB    1 
ATOM   3824  C  CG    . ASP A 1 505  ? -38.391 -108.353 36.936  1.00 53.58  ? 506  ASP A CG    1 
ATOM   3825  O  OD1   . ASP A 1 505  ? -38.107 -108.955 37.996  1.00 55.87  ? 506  ASP A OD1   1 
ATOM   3826  O  OD2   . ASP A 1 505  ? -37.523 -107.964 36.120  1.00 54.57  ? 506  ASP A OD2   1 
ATOM   3827  N  N     . GLY A 1 506  ? -41.354 -108.103 33.508  1.00 44.98  ? 507  GLY A N     1 
ATOM   3828  C  CA    . GLY A 1 506  ? -42.616 -108.295 32.814  1.00 42.69  ? 507  GLY A CA    1 
ATOM   3829  C  C     . GLY A 1 506  ? -43.194 -107.029 32.225  1.00 42.02  ? 507  GLY A C     1 
ATOM   3830  O  O     . GLY A 1 506  ? -44.407 -106.932 31.981  1.00 43.40  ? 507  GLY A O     1 
ATOM   3831  N  N     . GLY A 1 507  ? -42.362 -106.030 31.914  1.00 40.19  ? 508  GLY A N     1 
ATOM   3832  C  CA    . GLY A 1 507  ? -42.838 -104.777 31.311  1.00 36.84  ? 508  GLY A CA    1 
ATOM   3833  C  C     . GLY A 1 507  ? -42.982 -105.040 29.816  1.00 36.55  ? 508  GLY A C     1 
ATOM   3834  O  O     . GLY A 1 507  ? -42.596 -106.156 29.432  1.00 39.04  ? 508  GLY A O     1 
ATOM   3835  N  N     . THR A 1 508  ? -43.453 -104.085 29.031  1.00 34.42  ? 509  THR A N     1 
ATOM   3836  C  CA    . THR A 1 508  ? -43.563 -104.358 27.601  1.00 34.10  ? 509  THR A CA    1 
ATOM   3837  C  C     . THR A 1 508  ? -42.584 -103.552 26.771  1.00 35.31  ? 509  THR A C     1 
ATOM   3838  O  O     . THR A 1 508  ? -42.229 -102.389 27.022  1.00 35.42  ? 509  THR A O     1 
ATOM   3839  C  CB    . THR A 1 508  ? -44.986 -104.421 27.053  1.00 35.21  ? 509  THR A CB    1 
ATOM   3840  O  OG1   . THR A 1 508  ? -45.290 -103.456 26.042  1.00 34.49  ? 509  THR A OG1   1 
ATOM   3841  C  CG2   . THR A 1 508  ? -46.057 -104.372 28.130  1.00 30.95  ? 509  THR A CG2   1 
ATOM   3842  N  N     . PHE A 1 509  ? -42.050 -104.248 25.758  1.00 35.44  ? 510  PHE A N     1 
ATOM   3843  C  CA    . PHE A 1 509  ? -41.046 -103.719 24.845  1.00 34.52  ? 510  PHE A CA    1 
ATOM   3844  C  C     . PHE A 1 509  ? -41.526 -103.915 23.420  1.00 34.29  ? 510  PHE A C     1 
ATOM   3845  O  O     . PHE A 1 509  ? -41.815 -105.041 23.000  1.00 33.25  ? 510  PHE A O     1 
ATOM   3846  C  CB    . PHE A 1 509  ? -39.694 -104.400 25.087  1.00 35.49  ? 510  PHE A CB    1 
ATOM   3847  C  CG    . PHE A 1 509  ? -38.583 -104.169 24.093  1.00 36.15  ? 510  PHE A CG    1 
ATOM   3848  C  CD1   . PHE A 1 509  ? -38.259 -102.887 23.654  1.00 34.88  ? 510  PHE A CD1   1 
ATOM   3849  C  CD2   . PHE A 1 509  ? -37.834 -105.233 23.615  1.00 35.48  ? 510  PHE A CD2   1 
ATOM   3850  C  CE1   . PHE A 1 509  ? -37.244 -102.675 22.755  1.00 35.99  ? 510  PHE A CE1   1 
ATOM   3851  C  CE2   . PHE A 1 509  ? -36.808 -105.026 22.702  1.00 36.74  ? 510  PHE A CE2   1 
ATOM   3852  C  CZ    . PHE A 1 509  ? -36.501 -103.746 22.262  1.00 36.28  ? 510  PHE A CZ    1 
ATOM   3853  N  N     . VAL A 1 510  ? -41.658 -102.782 22.709  1.00 33.51  ? 511  VAL A N     1 
ATOM   3854  C  CA    . VAL A 1 510  ? -42.065 -102.847 21.322  1.00 32.93  ? 511  VAL A CA    1 
ATOM   3855  C  C     . VAL A 1 510  ? -40.881 -102.357 20.482  1.00 35.23  ? 511  VAL A C     1 
ATOM   3856  O  O     . VAL A 1 510  ? -40.308 -101.291 20.708  1.00 33.36  ? 511  VAL A O     1 
ATOM   3857  C  CB    . VAL A 1 510  ? -43.410 -102.265 20.926  1.00 33.78  ? 511  VAL A CB    1 
ATOM   3858  C  CG1   . VAL A 1 510  ? -44.129 -101.639 22.110  1.00 33.03  ? 511  VAL A CG1   1 
ATOM   3859  C  CG2   . VAL A 1 510  ? -43.424 -101.360 19.706  1.00 32.08  ? 511  VAL A CG2   1 
ATOM   3860  N  N     . LEU A 1 511  ? -40.600 -103.184 19.475  1.00 34.65  ? 512  LEU A N     1 
ATOM   3861  C  CA    . LEU A 1 511  ? -39.521 -102.883 18.549  1.00 34.08  ? 512  LEU A CA    1 
ATOM   3862  C  C     . LEU A 1 511  ? -40.098 -102.671 17.162  1.00 34.86  ? 512  LEU A C     1 
ATOM   3863  O  O     . LEU A 1 511  ? -40.953 -103.437 16.738  1.00 35.70  ? 512  LEU A O     1 
ATOM   3864  C  CB    . LEU A 1 511  ? -38.516 -104.054 18.573  1.00 32.87  ? 512  LEU A CB    1 
ATOM   3865  C  CG    . LEU A 1 511  ? -37.422 -104.070 17.495  1.00 33.10  ? 512  LEU A CG    1 
ATOM   3866  C  CD1   . LEU A 1 511  ? -36.608 -102.767 17.589  1.00 33.80  ? 512  LEU A CD1   1 
ATOM   3867  C  CD2   . LEU A 1 511  ? -36.511 -105.279 17.646  1.00 31.65  ? 512  LEU A CD2   1 
ATOM   3868  N  N     . ASN A 1 512  ? -39.567 -101.705 16.448  1.00 35.59  ? 513  ASN A N     1 
ATOM   3869  C  CA    . ASN A 1 512  ? -39.865 -101.416 15.061  1.00 37.17  ? 513  ASN A CA    1 
ATOM   3870  C  C     . ASN A 1 512  ? -38.689 -102.052 14.286  1.00 39.19  ? 513  ASN A C     1 
ATOM   3871  O  O     . ASN A 1 512  ? -37.562 -101.578 14.414  1.00 40.03  ? 513  ASN A O     1 
ATOM   3872  C  CB    . ASN A 1 512  ? -39.952 -99.937  14.710  1.00 35.36  ? 513  ASN A CB    1 
ATOM   3873  C  CG    . ASN A 1 512  ? -39.767 -99.569  13.256  1.00 35.10  ? 513  ASN A CG    1 
ATOM   3874  O  OD1   . ASN A 1 512  ? -39.100 -98.598  12.859  1.00 33.92  ? 513  ASN A OD1   1 
ATOM   3875  N  ND2   . ASN A 1 512  ? -40.370 -100.375 12.367  1.00 32.82  ? 513  ASN A ND2   1 
ATOM   3876  N  N     . SER A 1 513  ? -38.983 -103.081 13.511  1.00 40.79  ? 514  SER A N     1 
ATOM   3877  C  CA    . SER A 1 513  ? -37.990 -103.762 12.693  1.00 42.89  ? 514  SER A CA    1 
ATOM   3878  C  C     . SER A 1 513  ? -38.658 -104.809 11.790  1.00 44.08  ? 514  SER A C     1 
ATOM   3879  O  O     . SER A 1 513  ? -39.762 -105.276 12.068  1.00 44.37  ? 514  SER A O     1 
ATOM   3880  C  CB    . SER A 1 513  ? -36.912 -104.455 13.522  1.00 42.64  ? 514  SER A CB    1 
ATOM   3881  O  OG    . SER A 1 513  ? -37.302 -105.742 13.917  1.00 43.60  ? 514  SER A OG    1 
ATOM   3882  N  N     . PRO A 1 514  ? -37.986 -105.137 10.701  1.00 45.48  ? 515  PRO A N     1 
ATOM   3883  C  CA    . PRO A 1 514  ? -38.470 -106.105 9.739   1.00 46.47  ? 515  PRO A CA    1 
ATOM   3884  C  C     . PRO A 1 514  ? -38.077 -107.538 10.056  1.00 48.09  ? 515  PRO A C     1 
ATOM   3885  O  O     . PRO A 1 514  ? -38.268 -108.411 9.208   1.00 49.22  ? 515  PRO A O     1 
ATOM   3886  C  CB    . PRO A 1 514  ? -37.785 -105.629 8.457   1.00 45.69  ? 515  PRO A CB    1 
ATOM   3887  C  CG    . PRO A 1 514  ? -36.477 -105.088 8.902   1.00 44.82  ? 515  PRO A CG    1 
ATOM   3888  C  CD    . PRO A 1 514  ? -36.684 -104.546 10.289  1.00 45.34  ? 515  PRO A CD    1 
ATOM   3889  N  N     . TRP A 1 515  ? -37.513 -107.776 11.236  1.00 50.05  ? 516  TRP A N     1 
ATOM   3890  C  CA    . TRP A 1 515  ? -37.041 -109.100 11.623  1.00 51.99  ? 516  TRP A CA    1 
ATOM   3891  C  C     . TRP A 1 515  ? -38.165 -109.974 12.168  1.00 53.98  ? 516  TRP A C     1 
ATOM   3892  O  O     . TRP A 1 515  ? -38.094 -110.564 13.250  1.00 54.29  ? 516  TRP A O     1 
ATOM   3893  C  CB    . TRP A 1 515  ? -35.889 -108.996 12.627  1.00 51.71  ? 516  TRP A CB    1 
ATOM   3894  C  CG    . TRP A 1 515  ? -34.880 -107.926 12.307  1.00 51.65  ? 516  TRP A CG    1 
ATOM   3895  C  CD1   . TRP A 1 515  ? -34.428 -107.547 11.081  1.00 51.97  ? 516  TRP A CD1   1 
ATOM   3896  C  CD2   . TRP A 1 515  ? -34.204 -107.089 13.252  1.00 51.52  ? 516  TRP A CD2   1 
ATOM   3897  N  NE1   . TRP A 1 515  ? -33.524 -106.526 11.201  1.00 52.35  ? 516  TRP A NE1   1 
ATOM   3898  C  CE2   . TRP A 1 515  ? -33.368 -106.224 12.526  1.00 52.04  ? 516  TRP A CE2   1 
ATOM   3899  C  CE3   . TRP A 1 515  ? -34.245 -106.980 14.648  1.00 51.48  ? 516  TRP A CE3   1 
ATOM   3900  C  CZ2   . TRP A 1 515  ? -32.561 -105.262 13.135  1.00 51.41  ? 516  TRP A CZ2   1 
ATOM   3901  C  CZ3   . TRP A 1 515  ? -33.447 -106.034 15.257  1.00 51.28  ? 516  TRP A CZ3   1 
ATOM   3902  C  CH2   . TRP A 1 515  ? -32.616 -105.196 14.499  1.00 51.54  ? 516  TRP A CH2   1 
ATOM   3903  N  N     . SER A 1 516  ? -39.240 -110.089 11.393  1.00 56.00  ? 517  SER A N     1 
ATOM   3904  C  CA    . SER A 1 516  ? -40.447 -110.805 11.763  1.00 58.91  ? 517  SER A CA    1 
ATOM   3905  C  C     . SER A 1 516  ? -40.292 -112.267 12.155  1.00 60.23  ? 517  SER A C     1 
ATOM   3906  O  O     . SER A 1 516  ? -41.020 -112.733 13.042  1.00 61.11  ? 517  SER A O     1 
ATOM   3907  C  CB    . SER A 1 516  ? -41.467 -110.705 10.624  1.00 59.25  ? 517  SER A CB    1 
ATOM   3908  O  OG    . SER A 1 516  ? -42.334 -109.604 10.810  1.00 60.46  ? 517  SER A OG    1 
ATOM   3909  N  N     . SER A 1 517  ? -39.374 -113.007 11.540  1.00 61.69  ? 518  SER A N     1 
ATOM   3910  C  CA    . SER A 1 517  ? -39.159 -114.411 11.843  1.00 63.17  ? 518  SER A CA    1 
ATOM   3911  C  C     . SER A 1 517  ? -38.303 -114.642 13.078  1.00 63.61  ? 518  SER A C     1 
ATOM   3912  O  O     . SER A 1 517  ? -37.545 -113.748 13.458  1.00 63.61  ? 518  SER A O     1 
ATOM   3913  C  CB    . SER A 1 517  ? -38.402 -115.131 10.714  1.00 63.28  ? 518  SER A CB    1 
ATOM   3914  O  OG    . SER A 1 517  ? -38.439 -114.392 9.508   1.00 64.45  ? 518  SER A OG    1 
ATOM   3915  N  N     . LEU A 1 518  ? -38.332 -115.870 13.600  1.00 64.50  ? 519  LEU A N     1 
ATOM   3916  C  CA    . LEU A 1 518  ? -37.470 -116.182 14.741  1.00 65.18  ? 519  LEU A CA    1 
ATOM   3917  C  C     . LEU A 1 518  ? -36.041 -116.316 14.218  1.00 65.94  ? 519  LEU A C     1 
ATOM   3918  O  O     . LEU A 1 518  ? -35.104 -116.065 14.971  1.00 66.23  ? 519  LEU A O     1 
ATOM   3919  C  CB    . LEU A 1 518  ? -37.923 -117.394 15.537  1.00 65.47  ? 519  LEU A CB    1 
ATOM   3920  C  CG    . LEU A 1 518  ? -37.290 -117.637 16.914  1.00 65.74  ? 519  LEU A CG    1 
ATOM   3921  C  CD1   . LEU A 1 518  ? -37.604 -116.531 17.909  1.00 66.07  ? 519  LEU A CD1   1 
ATOM   3922  C  CD2   . LEU A 1 518  ? -37.712 -118.994 17.458  1.00 65.38  ? 519  LEU A CD2   1 
ATOM   3923  N  N     . GLU A 1 519  ? -35.891 -116.597 12.921  1.00 66.92  ? 520  GLU A N     1 
ATOM   3924  C  CA    . GLU A 1 519  ? -34.540 -116.704 12.355  1.00 68.07  ? 520  GLU A CA    1 
ATOM   3925  C  C     . GLU A 1 519  ? -33.974 -115.312 12.075  1.00 67.70  ? 520  GLU A C     1 
ATOM   3926  O  O     . GLU A 1 519  ? -32.773 -115.080 12.176  1.00 67.71  ? 520  GLU A O     1 
ATOM   3927  C  CB    . GLU A 1 519  ? -34.459 -117.591 11.125  1.00 68.96  ? 520  GLU A CB    1 
ATOM   3928  C  CG    . GLU A 1 519  ? -35.204 -117.151 9.882   1.00 70.51  ? 520  GLU A CG    1 
ATOM   3929  C  CD    . GLU A 1 519  ? -34.501 -117.535 8.594   1.00 71.78  ? 520  GLU A CD    1 
ATOM   3930  O  OE1   . GLU A 1 519  ? -34.822 -116.945 7.537   1.00 72.50  ? 520  GLU A OE1   1 
ATOM   3931  O  OE2   . GLU A 1 519  ? -33.624 -118.425 8.609   1.00 71.85  ? 520  GLU A OE2   1 
ATOM   3932  N  N     . ASP A 1 520  ? -34.851 -114.364 11.759  1.00 67.31  ? 521  ASP A N     1 
ATOM   3933  C  CA    . ASP A 1 520  ? -34.427 -112.984 11.518  1.00 67.03  ? 521  ASP A CA    1 
ATOM   3934  C  C     . ASP A 1 520  ? -34.033 -112.332 12.843  1.00 65.96  ? 521  ASP A C     1 
ATOM   3935  O  O     . ASP A 1 520  ? -32.942 -111.809 13.057  1.00 65.58  ? 521  ASP A O     1 
ATOM   3936  C  CB    . ASP A 1 520  ? -35.550 -112.214 10.851  1.00 67.99  ? 521  ASP A CB    1 
ATOM   3937  C  CG    . ASP A 1 520  ? -35.474 -112.081 9.348   1.00 69.12  ? 521  ASP A CG    1 
ATOM   3938  O  OD1   . ASP A 1 520  ? -34.770 -112.812 8.621   1.00 69.48  ? 521  ASP A OD1   1 
ATOM   3939  O  OD2   . ASP A 1 520  ? -36.184 -111.178 8.835   1.00 69.94  ? 521  ASP A OD2   1 
ATOM   3940  N  N     . MET A 1 521  ? -34.919 -112.471 13.818  1.00 64.49  ? 522  MET A N     1 
ATOM   3941  C  CA    . MET A 1 521  ? -34.737 -111.963 15.165  1.00 63.46  ? 522  MET A CA    1 
ATOM   3942  C  C     . MET A 1 521  ? -33.534 -112.579 15.859  1.00 63.75  ? 522  MET A C     1 
ATOM   3943  O  O     . MET A 1 521  ? -32.903 -111.983 16.733  1.00 64.29  ? 522  MET A O     1 
ATOM   3944  C  CB    . MET A 1 521  ? -36.004 -112.259 15.987  1.00 61.68  ? 522  MET A CB    1 
ATOM   3945  C  CG    . MET A 1 521  ? -36.071 -111.466 17.289  1.00 60.57  ? 522  MET A CG    1 
ATOM   3946  S  SD    . MET A 1 521  ? -36.335 -109.711 16.971  1.00 59.34  ? 522  MET A SD    1 
ATOM   3947  C  CE    . MET A 1 521  ? -38.060 -109.648 16.555  1.00 58.41  ? 522  MET A CE    1 
ATOM   3948  N  N     . ASP A 1 522  ? -33.211 -113.815 15.483  1.00 64.23  ? 523  ASP A N     1 
ATOM   3949  C  CA    . ASP A 1 522  ? -32.090 -114.521 16.100  1.00 65.16  ? 523  ASP A CA    1 
ATOM   3950  C  C     . ASP A 1 522  ? -30.746 -114.044 15.570  1.00 64.99  ? 523  ASP A C     1 
ATOM   3951  O  O     . ASP A 1 522  ? -29.718 -114.096 16.238  1.00 64.35  ? 523  ASP A O     1 
ATOM   3952  C  CB    . ASP A 1 522  ? -32.257 -116.027 15.899  1.00 65.79  ? 523  ASP A CB    1 
ATOM   3953  C  CG    . ASP A 1 522  ? -33.057 -116.636 17.041  1.00 66.04  ? 523  ASP A CG    1 
ATOM   3954  O  OD1   . ASP A 1 522  ? -33.790 -117.614 16.792  1.00 66.09  ? 523  ASP A OD1   1 
ATOM   3955  O  OD2   . ASP A 1 522  ? -32.951 -116.124 18.178  1.00 66.80  ? 523  ASP A OD2   1 
ATOM   3956  N  N     . LYS A 1 523  ? -30.801 -113.506 14.364  1.00 65.92  ? 524  LYS A N     1 
ATOM   3957  C  CA    . LYS A 1 523  ? -29.677 -112.940 13.646  1.00 66.80  ? 524  LYS A CA    1 
ATOM   3958  C  C     . LYS A 1 523  ? -29.351 -111.505 14.041  1.00 66.04  ? 524  LYS A C     1 
ATOM   3959  O  O     . LYS A 1 523  ? -28.176 -111.133 14.038  1.00 66.17  ? 524  LYS A O     1 
ATOM   3960  C  CB    . LYS A 1 523  ? -30.032 -112.977 12.152  1.00 68.10  ? 524  LYS A CB    1 
ATOM   3961  C  CG    . LYS A 1 523  ? -28.949 -112.555 11.177  1.00 70.11  ? 524  LYS A CG    1 
ATOM   3962  C  CD    . LYS A 1 523  ? -29.434 -112.678 9.738   1.00 71.53  ? 524  LYS A CD    1 
ATOM   3963  C  CE    . LYS A 1 523  ? -29.362 -114.120 9.252   1.00 72.84  ? 524  LYS A CE    1 
ATOM   3964  N  NZ    . LYS A 1 523  ? -30.691 -114.663 8.860   1.00 72.82  ? 524  LYS A NZ    1 
ATOM   3965  N  N     . HIS A 1 524  ? -30.352 -110.683 14.345  1.00 65.27  ? 525  HIS A N     1 
ATOM   3966  C  CA    . HIS A 1 524  ? -30.084 -109.276 14.637  1.00 64.46  ? 525  HIS A CA    1 
ATOM   3967  C  C     . HIS A 1 524  ? -30.175 -108.833 16.081  1.00 63.47  ? 525  HIS A C     1 
ATOM   3968  O  O     . HIS A 1 524  ? -29.608 -107.784 16.392  1.00 63.20  ? 525  HIS A O     1 
ATOM   3969  C  CB    . HIS A 1 524  ? -31.023 -108.401 13.791  1.00 64.43  ? 525  HIS A CB    1 
ATOM   3970  C  CG    . HIS A 1 524  ? -30.908 -108.704 12.332  1.00 64.73  ? 525  HIS A CG    1 
ATOM   3971  N  ND1   . HIS A 1 524  ? -31.609 -109.703 11.704  1.00 64.98  ? 525  HIS A ND1   1 
ATOM   3972  C  CD2   . HIS A 1 524  ? -30.152 -108.124 11.369  1.00 65.13  ? 525  HIS A CD2   1 
ATOM   3973  C  CE1   . HIS A 1 524  ? -31.293 -109.726 10.422  1.00 64.81  ? 525  HIS A CE1   1 
ATOM   3974  N  NE2   . HIS A 1 524  ? -30.414 -108.775 10.189  1.00 64.69  ? 525  HIS A NE2   1 
ATOM   3975  N  N     . LEU A 1 525  ? -30.847 -109.568 16.953  1.00 62.92  ? 526  LEU A N     1 
ATOM   3976  C  CA    . LEU A 1 525  ? -30.963 -109.129 18.340  1.00 63.14  ? 526  LEU A CA    1 
ATOM   3977  C  C     . LEU A 1 525  ? -29.785 -109.578 19.176  1.00 63.61  ? 526  LEU A C     1 
ATOM   3978  O  O     . LEU A 1 525  ? -29.556 -110.778 19.347  1.00 64.83  ? 526  LEU A O     1 
ATOM   3979  C  CB    . LEU A 1 525  ? -32.281 -109.674 18.910  1.00 62.53  ? 526  LEU A CB    1 
ATOM   3980  C  CG    . LEU A 1 525  ? -33.094 -108.746 19.814  1.00 62.47  ? 526  LEU A CG    1 
ATOM   3981  C  CD1   . LEU A 1 525  ? -33.619 -107.536 19.059  1.00 61.36  ? 526  LEU A CD1   1 
ATOM   3982  C  CD2   . LEU A 1 525  ? -34.237 -109.508 20.474  1.00 62.07  ? 526  LEU A CD2   1 
ATOM   3983  N  N     . PRO A 1 526  ? -29.015 -108.657 19.740  1.00 63.56  ? 527  PRO A N     1 
ATOM   3984  C  CA    . PRO A 1 526  ? -27.882 -108.953 20.596  1.00 63.65  ? 527  PRO A CA    1 
ATOM   3985  C  C     . PRO A 1 526  ? -28.216 -109.960 21.682  1.00 63.49  ? 527  PRO A C     1 
ATOM   3986  O  O     . PRO A 1 526  ? -29.346 -109.978 22.195  1.00 63.49  ? 527  PRO A O     1 
ATOM   3987  C  CB    . PRO A 1 526  ? -27.545 -107.594 21.213  1.00 63.37  ? 527  PRO A CB    1 
ATOM   3988  C  CG    . PRO A 1 526  ? -27.942 -106.639 20.141  1.00 63.78  ? 527  PRO A CG    1 
ATOM   3989  C  CD    . PRO A 1 526  ? -29.219 -107.197 19.576  1.00 63.52  ? 527  PRO A CD    1 
ATOM   3990  N  N     . SER A 1 527  ? -27.266 -110.812 22.043  1.00 62.92  ? 528  SER A N     1 
ATOM   3991  C  CA    . SER A 1 527  ? -27.518 -111.841 23.052  1.00 61.83  ? 528  SER A CA    1 
ATOM   3992  C  C     . SER A 1 527  ? -27.917 -111.242 24.395  1.00 60.23  ? 528  SER A C     1 
ATOM   3993  O  O     . SER A 1 527  ? -28.571 -111.879 25.213  1.00 59.59  ? 528  SER A O     1 
ATOM   3994  C  CB    . SER A 1 527  ? -26.283 -112.735 23.169  1.00 62.36  ? 528  SER A CB    1 
ATOM   3995  O  OG    . SER A 1 527  ? -25.332 -112.172 24.060  1.00 62.59  ? 528  SER A OG    1 
ATOM   3996  N  N     . GLY A 1 528  ? -27.548 -109.975 24.597  1.00 59.51  ? 529  GLY A N     1 
ATOM   3997  C  CA    . GLY A 1 528  ? -27.885 -109.262 25.824  1.00 58.03  ? 529  GLY A CA    1 
ATOM   3998  C  C     . GLY A 1 528  ? -29.373 -108.921 25.907  1.00 57.22  ? 529  GLY A C     1 
ATOM   3999  O  O     . GLY A 1 528  ? -29.957 -108.990 26.987  1.00 57.52  ? 529  GLY A O     1 
ATOM   4000  N  N     . ILE A 1 529  ? -29.986 -108.598 24.771  1.00 56.00  ? 530  ILE A N     1 
ATOM   4001  C  CA    . ILE A 1 529  ? -31.404 -108.232 24.724  1.00 55.00  ? 530  ILE A CA    1 
ATOM   4002  C  C     . ILE A 1 529  ? -32.269 -109.473 24.819  1.00 54.80  ? 530  ILE A C     1 
ATOM   4003  O  O     . ILE A 1 529  ? -33.343 -109.511 25.429  1.00 54.40  ? 530  ILE A O     1 
ATOM   4004  C  CB    . ILE A 1 529  ? -31.669 -107.331 23.513  1.00 55.15  ? 530  ILE A CB    1 
ATOM   4005  C  CG1   . ILE A 1 529  ? -31.305 -105.873 23.907  1.00 55.07  ? 530  ILE A CG1   1 
ATOM   4006  C  CG2   . ILE A 1 529  ? -33.082 -107.342 22.951  1.00 54.12  ? 530  ILE A CG2   1 
ATOM   4007  C  CD1   . ILE A 1 529  ? -30.998 -104.978 22.736  1.00 54.72  ? 530  ILE A CD1   1 
ATOM   4008  N  N     . LYS A 1 530  ? -31.801 -110.576 24.241  1.00 54.58  ? 531  LYS A N     1 
ATOM   4009  C  CA    . LYS A 1 530  ? -32.514 -111.855 24.363  1.00 53.87  ? 531  LYS A CA    1 
ATOM   4010  C  C     . LYS A 1 530  ? -32.480 -112.308 25.825  1.00 52.57  ? 531  LYS A C     1 
ATOM   4011  O  O     . LYS A 1 530  ? -33.468 -112.750 26.411  1.00 51.79  ? 531  LYS A O     1 
ATOM   4012  C  CB    . LYS A 1 530  ? -31.872 -112.865 23.423  1.00 55.21  ? 531  LYS A CB    1 
ATOM   4013  C  CG    . LYS A 1 530  ? -32.247 -112.697 21.959  1.00 56.15  ? 531  LYS A CG    1 
ATOM   4014  C  CD    . LYS A 1 530  ? -31.757 -113.851 21.107  1.00 57.68  ? 531  LYS A CD    1 
ATOM   4015  C  CE    . LYS A 1 530  ? -31.785 -113.554 19.620  1.00 58.30  ? 531  LYS A CE    1 
ATOM   4016  N  NZ    . LYS A 1 530  ? -30.538 -113.998 18.921  1.00 59.70  ? 531  LYS A NZ    1 
ATOM   4017  N  N     . ARG A 1 531  ? -31.325 -112.094 26.443  1.00 52.17  ? 532  ARG A N     1 
ATOM   4018  C  CA    . ARG A 1 531  ? -31.088 -112.448 27.842  1.00 52.21  ? 532  ARG A CA    1 
ATOM   4019  C  C     . ARG A 1 531  ? -32.366 -111.556 28.806  0.00 27.83  ? 532  ARG A C     1 
ATOM   4020  O  O     . ARG A 1 531  ? -33.171 -112.398 29.028  1.00 49.61  ? 532  ARG A O     1 
ATOM   4021  C  CB    . ARG A 1 531  ? -29.956 -112.081 28.510  0.00 27.38  ? 532  ARG A CB    1 
ATOM   4022  C  CG    . ARG A 1 531  ? -29.279 -113.251 29.221  0.00 26.97  ? 532  ARG A CG    1 
ATOM   4023  C  CD    . ARG A 1 531  ? -28.157 -113.841 28.371  0.00 26.62  ? 532  ARG A CD    1 
ATOM   4024  N  NE    . ARG A 1 531  ? -27.193 -112.832 27.925  0.00 26.30  ? 532  ARG A NE    1 
ATOM   4025  C  CZ    . ARG A 1 531  ? -25.892 -113.056 27.745  0.00 26.15  ? 532  ARG A CZ    1 
ATOM   4026  N  NH1   . ARG A 1 531  ? -25.374 -114.258 27.973  0.00 25.87  ? 532  ARG A NH1   1 
ATOM   4027  N  NH2   . ARG A 1 531  ? -25.103 -112.068 27.343  0.00 26.20  ? 532  ARG A NH2   1 
ATOM   4028  N  N     . THR A 1 532  ? -32.287 -110.409 28.435  1.00 49.51  ? 533  THR A N     1 
ATOM   4029  C  CA    . THR A 1 532  ? -33.162 -109.628 29.315  1.00 49.51  ? 533  THR A CA    1 
ATOM   4030  C  C     . THR A 1 532  ? -34.621 -109.931 29.032  1.00 48.19  ? 533  THR A C     1 
ATOM   4031  O  O     . THR A 1 532  ? -35.386 -110.131 29.982  1.00 48.12  ? 533  THR A O     1 
ATOM   4032  C  CB    . THR A 1 532  ? -32.860 -108.119 29.186  1.00 50.18  ? 533  THR A CB    1 
ATOM   4033  O  OG1   . THR A 1 532  ? -31.577 -107.902 29.796  1.00 50.39  ? 533  THR A OG1   1 
ATOM   4034  C  CG2   . THR A 1 532  ? -33.853 -107.219 29.896  1.00 49.09  ? 533  THR A CG2   1 
ATOM   4035  N  N     . ILE A 1 533  ? -34.989 -109.995 27.759  1.00 47.78  ? 534  ILE A N     1 
ATOM   4036  C  CA    . ILE A 1 533  ? -36.381 -110.238 27.383  1.00 50.34  ? 534  ILE A CA    1 
ATOM   4037  C  C     . ILE A 1 533  ? -36.869 -111.557 27.990  1.00 52.34  ? 534  ILE A C     1 
ATOM   4038  O  O     . ILE A 1 533  ? -38.035 -111.695 28.352  1.00 53.23  ? 534  ILE A O     1 
ATOM   4039  C  CB    . ILE A 1 533  ? -36.565 -110.229 25.852  1.00 49.92  ? 534  ILE A CB    1 
ATOM   4040  C  CG1   . ILE A 1 533  ? -36.340 -108.834 25.266  1.00 49.81  ? 534  ILE A CG1   1 
ATOM   4041  C  CG2   . ILE A 1 533  ? -37.931 -110.736 25.397  1.00 50.17  ? 534  ILE A CG2   1 
ATOM   4042  C  CD1   . ILE A 1 533  ? -36.177 -108.773 23.764  1.00 47.73  ? 534  ILE A CD1   1 
ATOM   4043  N  N     . ALA A 1 534  ? -35.950 -112.517 28.096  1.00 53.01  ? 535  ALA A N     1 
ATOM   4044  C  CA    . ALA A 1 534  ? -36.323 -113.830 28.612  1.00 54.39  ? 535  ALA A CA    1 
ATOM   4045  C  C     . ALA A 1 534  ? -36.281 -113.866 30.131  1.00 54.15  ? 535  ALA A C     1 
ATOM   4046  O  O     . ALA A 1 534  ? -37.223 -114.367 30.754  1.00 54.13  ? 535  ALA A O     1 
ATOM   4047  C  CB    . ALA A 1 534  ? -35.403 -114.890 28.003  1.00 54.58  ? 535  ALA A CB    1 
ATOM   4048  N  N     . ASN A 1 535  ? -35.226 -113.332 30.736  1.00 54.96  ? 536  ASN A N     1 
ATOM   4049  C  CA    . ASN A 1 535  ? -35.117 -113.378 32.192  1.00 55.99  ? 536  ASN A CA    1 
ATOM   4050  C  C     . ASN A 1 535  ? -36.045 -112.428 32.925  1.00 55.89  ? 536  ASN A C     1 
ATOM   4051  O  O     . ASN A 1 535  ? -36.291 -112.622 34.125  1.00 55.76  ? 536  ASN A O     1 
ATOM   4052  C  CB    . ASN A 1 535  ? -33.655 -113.148 32.592  1.00 56.87  ? 536  ASN A CB    1 
ATOM   4053  C  CG    . ASN A 1 535  ? -32.831 -114.399 32.319  1.00 57.86  ? 536  ASN A CG    1 
ATOM   4054  O  OD1   . ASN A 1 535  ? -32.038 -114.415 31.375  1.00 58.55  ? 536  ASN A OD1   1 
ATOM   4055  N  ND2   . ASN A 1 535  ? -33.010 -115.438 33.126  1.00 57.76  ? 536  ASN A ND2   1 
ATOM   4056  N  N     . LYS A 1 536  ? -36.593 -111.426 32.239  1.00 56.18  ? 537  LYS A N     1 
ATOM   4057  C  CA    . LYS A 1 536  ? -37.481 -110.464 32.908  1.00 55.40  ? 537  LYS A CA    1 
ATOM   4058  C  C     . LYS A 1 536  ? -38.930 -110.709 32.546  1.00 55.04  ? 537  LYS A C     1 
ATOM   4059  O  O     . LYS A 1 536  ? -39.880 -110.073 33.001  1.00 54.42  ? 537  LYS A O     1 
ATOM   4060  C  CB    . LYS A 1 536  ? -37.041 -109.038 32.588  1.00 56.12  ? 537  LYS A CB    1 
ATOM   4061  C  CG    . LYS A 1 536  ? -35.814 -108.581 33.374  1.00 56.16  ? 537  LYS A CG    1 
ATOM   4062  C  CD    . LYS A 1 536  ? -35.658 -107.072 33.256  1.00 56.99  ? 537  LYS A CD    1 
ATOM   4063  C  CE    . LYS A 1 536  ? -35.333 -106.430 34.595  1.00 57.17  ? 537  LYS A CE    1 
ATOM   4064  N  NZ    . LYS A 1 536  ? -34.846 -105.034 34.425  1.00 56.33  ? 537  LYS A NZ    1 
ATOM   4065  N  N     . LYS A 1 537  ? -39.182 -111.715 31.712  1.00 55.52  ? 538  LYS A N     1 
ATOM   4066  C  CA    . LYS A 1 537  ? -40.528 -112.097 31.305  1.00 55.29  ? 538  LYS A CA    1 
ATOM   4067  C  C     . LYS A 1 537  ? -41.294 -110.952 30.651  1.00 54.69  ? 538  LYS A C     1 
ATOM   4068  O  O     . LYS A 1 537  ? -42.475 -110.743 30.931  1.00 54.21  ? 538  LYS A O     1 
ATOM   4069  C  CB    . LYS A 1 537  ? -41.315 -112.595 32.523  1.00 56.97  ? 538  LYS A CB    1 
ATOM   4070  C  CG    . LYS A 1 537  ? -41.027 -114.024 32.922  1.00 58.32  ? 538  LYS A CG    1 
ATOM   4071  C  CD    . LYS A 1 537  ? -39.873 -114.086 33.920  1.00 59.60  ? 538  LYS A CD    1 
ATOM   4072  C  CE    . LYS A 1 537  ? -39.637 -115.523 34.378  1.00 60.32  ? 538  LYS A CE    1 
ATOM   4073  N  NZ    . LYS A 1 537  ? -39.793 -116.488 33.251  1.00 60.26  ? 538  LYS A NZ    1 
ATOM   4074  N  N     . LEU A 1 538  ? -40.604 -110.200 29.787  1.00 53.28  ? 539  LEU A N     1 
ATOM   4075  C  CA    . LEU A 1 538  ? -41.200 -109.067 29.111  1.00 51.20  ? 539  LEU A CA    1 
ATOM   4076  C  C     . LEU A 1 538  ? -42.146 -109.482 27.992  1.00 51.33  ? 539  LEU A C     1 
ATOM   4077  O  O     . LEU A 1 538  ? -41.949 -110.479 27.302  1.00 51.93  ? 539  LEU A O     1 
ATOM   4078  C  CB    . LEU A 1 538  ? -40.163 -108.135 28.466  1.00 49.32  ? 539  LEU A CB    1 
ATOM   4079  C  CG    . LEU A 1 538  ? -38.874 -107.882 29.253  1.00 48.46  ? 539  LEU A CG    1 
ATOM   4080  C  CD1   . LEU A 1 538  ? -37.898 -107.134 28.365  1.00 47.86  ? 539  LEU A CD1   1 
ATOM   4081  C  CD2   . LEU A 1 538  ? -39.201 -107.151 30.543  1.00 47.52  ? 539  LEU A CD2   1 
ATOM   4082  N  N     . LYS A 1 539  ? -43.145 -108.623 27.791  1.00 50.22  ? 540  LYS A N     1 
ATOM   4083  C  CA    . LYS A 1 539  ? -44.080 -108.827 26.687  1.00 49.14  ? 540  LYS A CA    1 
ATOM   4084  C  C     . LYS A 1 539  ? -43.426 -108.126 25.487  1.00 48.44  ? 540  LYS A C     1 
ATOM   4085  O  O     . LYS A 1 539  ? -43.415 -106.906 25.396  1.00 45.40  ? 540  LYS A O     1 
ATOM   4086  C  CB    . LYS A 1 539  ? -45.447 -108.270 27.039  1.00 49.60  ? 540  LYS A CB    1 
ATOM   4087  C  CG    . LYS A 1 539  ? -46.024 -108.817 28.336  1.00 49.70  ? 540  LYS A CG    1 
ATOM   4088  C  CD    . LYS A 1 539  ? -47.299 -108.068 28.714  1.00 49.44  ? 540  LYS A CD    1 
ATOM   4089  C  CE    . LYS A 1 539  ? -48.207 -108.587 29.604  0.00 23.43  ? 540  LYS A CE    1 
ATOM   4090  N  NZ    . LYS A 1 539  ? -49.563 -108.020 29.387  0.00 23.44  ? 540  LYS A NZ    1 
ATOM   4091  N  N     . PHE A 1 540  ? -42.774 -108.942 24.669  1.00 47.76  ? 541  PHE A N     1 
ATOM   4092  C  CA    . PHE A 1 540  ? -42.023 -108.454 23.513  1.00 46.30  ? 541  PHE A CA    1 
ATOM   4093  C  C     . PHE A 1 540  ? -42.923 -108.356 22.302  1.00 46.37  ? 541  PHE A C     1 
ATOM   4094  O  O     . PHE A 1 540  ? -43.732 -109.252 22.020  1.00 47.36  ? 541  PHE A O     1 
ATOM   4095  C  CB    . PHE A 1 540  ? -40.781 -109.326 23.308  1.00 46.10  ? 541  PHE A CB    1 
ATOM   4096  C  CG    . PHE A 1 540  ? -39.936 -108.960 22.125  1.00 47.44  ? 541  PHE A CG    1 
ATOM   4097  C  CD1   . PHE A 1 540  ? -39.432 -107.680 21.969  1.00 46.63  ? 541  PHE A CD1   1 
ATOM   4098  C  CD2   . PHE A 1 540  ? -39.649 -109.900 21.141  1.00 47.93  ? 541  PHE A CD2   1 
ATOM   4099  C  CE1   . PHE A 1 540  ? -38.667 -107.360 20.871  1.00 47.52  ? 541  PHE A CE1   1 
ATOM   4100  C  CE2   . PHE A 1 540  ? -38.889 -109.575 20.035  1.00 48.08  ? 541  PHE A CE2   1 
ATOM   4101  C  CZ    . PHE A 1 540  ? -38.390 -108.293 19.895  1.00 47.65  ? 541  PHE A CZ    1 
ATOM   4102  N  N     . TYR A 1 541  ? -42.810 -107.256 21.570  1.00 45.55  ? 542  TYR A N     1 
ATOM   4103  C  CA    . TYR A 1 541  ? -43.636 -106.995 20.407  1.00 45.25  ? 542  TYR A CA    1 
ATOM   4104  C  C     . TYR A 1 541  ? -42.767 -106.462 19.274  1.00 45.32  ? 542  TYR A C     1 
ATOM   4105  O  O     . TYR A 1 541  ? -42.005 -105.515 19.506  1.00 46.34  ? 542  TYR A O     1 
ATOM   4106  C  CB    . TYR A 1 541  ? -44.736 -105.965 20.686  1.00 44.18  ? 542  TYR A CB    1 
ATOM   4107  C  CG    . TYR A 1 541  ? -45.877 -106.443 21.544  1.00 45.28  ? 542  TYR A CG    1 
ATOM   4108  C  CD1   . TYR A 1 541  ? -45.818 -106.333 22.929  1.00 45.41  ? 542  TYR A CD1   1 
ATOM   4109  C  CD2   . TYR A 1 541  ? -47.020 -107.011 20.987  1.00 45.32  ? 542  TYR A CD2   1 
ATOM   4110  C  CE1   . TYR A 1 541  ? -46.846 -106.774 23.730  1.00 45.28  ? 542  TYR A CE1   1 
ATOM   4111  C  CE2   . TYR A 1 541  ? -48.051 -107.459 21.783  1.00 45.96  ? 542  TYR A CE2   1 
ATOM   4112  C  CZ    . TYR A 1 541  ? -47.961 -107.337 23.147  1.00 45.54  ? 542  TYR A CZ    1 
ATOM   4113  O  OH    . TYR A 1 541  ? -48.990 -107.760 23.948  1.00 46.77  ? 542  TYR A OH    1 
ATOM   4114  N  N     . ASN A 1 542  ? -42.886 -107.052 18.101  1.00 44.82  ? 543  ASN A N     1 
ATOM   4115  C  CA    . ASN A 1 542  ? -42.139 -106.603 16.948  1.00 45.15  ? 543  ASN A CA    1 
ATOM   4116  C  C     . ASN A 1 542  ? -43.152 -106.178 15.891  1.00 46.31  ? 543  ASN A C     1 
ATOM   4117  O  O     . ASN A 1 542  ? -44.119 -106.912 15.693  1.00 47.90  ? 543  ASN A O     1 
ATOM   4118  C  CB    . ASN A 1 542  ? -41.171 -107.647 16.396  1.00 43.37  ? 543  ASN A CB    1 
ATOM   4119  C  CG    . ASN A 1 542  ? -40.247 -106.986 15.387  1.00 43.34  ? 543  ASN A CG    1 
ATOM   4120  O  OD1   . ASN A 1 542  ? -39.208 -106.439 15.774  1.00 42.46  ? 543  ASN A OD1   1 
ATOM   4121  N  ND2   . ASN A 1 542  ? -40.612 -107.013 14.107  1.00 42.17  ? 543  ASN A ND2   1 
ATOM   4122  N  N     . ILE A 1 543  ? -42.932 -105.034 15.271  1.00 45.93  ? 544  ILE A N     1 
ATOM   4123  C  CA    . ILE A 1 543  ? -43.816 -104.544 14.221  1.00 45.79  ? 544  ILE A CA    1 
ATOM   4124  C  C     . ILE A 1 543  ? -42.964 -103.951 13.102  1.00 46.79  ? 544  ILE A C     1 
ATOM   4125  O  O     . ILE A 1 543  ? -42.045 -103.160 13.338  1.00 45.53  ? 544  ILE A O     1 
ATOM   4126  C  CB    . ILE A 1 543  ? -44.867 -103.555 14.740  1.00 46.54  ? 544  ILE A CB    1 
ATOM   4127  C  CG1   . ILE A 1 543  ? -45.782 -103.055 13.609  1.00 46.06  ? 544  ILE A CG1   1 
ATOM   4128  C  CG2   . ILE A 1 543  ? -44.271 -102.340 15.446  1.00 45.73  ? 544  ILE A CG2   1 
ATOM   4129  C  CD1   . ILE A 1 543  ? -47.222 -102.944 14.059  1.00 47.91  ? 544  ILE A CD1   1 
ATOM   4130  N  N     . ASP A 1 544  ? -43.235 -104.372 11.870  1.00 46.92  ? 545  ASP A N     1 
ATOM   4131  C  CA    . ASP A 1 544  ? -42.483 -103.870 10.720  1.00 47.40  ? 545  ASP A CA    1 
ATOM   4132  C  C     . ASP A 1 544  ? -43.230 -102.642 10.201  1.00 47.27  ? 545  ASP A C     1 
ATOM   4133  O  O     . ASP A 1 544  ? -43.849 -102.659 9.143   1.00 46.02  ? 545  ASP A O     1 
ATOM   4134  C  CB    . ASP A 1 544  ? -42.287 -104.929 9.659   1.00 48.16  ? 545  ASP A CB    1 
ATOM   4135  C  CG    . ASP A 1 544  ? -41.333 -104.601 8.538   1.00 50.50  ? 545  ASP A CG    1 
ATOM   4136  O  OD1   . ASP A 1 544  ? -40.966 -103.429 8.288   1.00 50.04  ? 545  ASP A OD1   1 
ATOM   4137  O  OD2   . ASP A 1 544  ? -40.913 -105.569 7.845   1.00 51.75  ? 545  ASP A OD2   1 
ATOM   4138  N  N     . ALA A 1 545  ? -43.152 -101.577 11.000  1.00 47.47  ? 546  ALA A N     1 
ATOM   4139  C  CA    . ALA A 1 545  ? -43.822 -100.319 10.774  1.00 47.64  ? 546  ALA A CA    1 
ATOM   4140  C  C     . ALA A 1 545  ? -43.569 -99.710  9.402   1.00 47.97  ? 546  ALA A C     1 
ATOM   4141  O  O     . ALA A 1 545  ? -44.371 -98.966  8.852   1.00 48.04  ? 546  ALA A O     1 
ATOM   4142  C  CB    . ALA A 1 545  ? -43.322 -99.274  11.801  1.00 46.82  ? 546  ALA A CB    1 
ATOM   4143  N  N     . VAL A 1 546  ? -42.376 -99.966  8.876   1.00 49.21  ? 547  VAL A N     1 
ATOM   4144  C  CA    . VAL A 1 546  ? -42.029 -99.378  7.569   1.00 51.09  ? 547  VAL A CA    1 
ATOM   4145  C  C     . VAL A 1 546  ? -42.789 -100.109 6.462   1.00 52.18  ? 547  VAL A C     1 
ATOM   4146  O  O     . VAL A 1 546  ? -43.138 -99.531  5.440   1.00 51.41  ? 547  VAL A O     1 
ATOM   4147  C  CB    . VAL A 1 546  ? -40.518 -99.418  7.326   1.00 50.64  ? 547  VAL A CB    1 
ATOM   4148  C  CG1   . VAL A 1 546  ? -40.132 -98.805  5.989   1.00 49.10  ? 547  VAL A CG1   1 
ATOM   4149  C  CG2   . VAL A 1 546  ? -39.808 -98.710  8.477   1.00 50.63  ? 547  VAL A CG2   1 
ATOM   4150  N  N     . LYS A 1 547  ? -43.071 -101.379 6.731   1.00 53.65  ? 548  LYS A N     1 
ATOM   4151  C  CA    . LYS A 1 547  ? -43.816 -102.208 5.790   1.00 55.79  ? 548  LYS A CA    1 
ATOM   4152  C  C     . LYS A 1 547  ? -45.296 -101.845 5.792   1.00 56.25  ? 548  LYS A C     1 
ATOM   4153  O  O     . LYS A 1 547  ? -45.925 -101.699 4.738   1.00 56.65  ? 548  LYS A O     1 
ATOM   4154  C  CB    . LYS A 1 547  ? -43.620 -103.675 6.174   1.00 57.52  ? 548  LYS A CB    1 
ATOM   4155  C  CG    . LYS A 1 547  ? -43.887 -104.657 5.046   1.00 58.84  ? 548  LYS A CG    1 
ATOM   4156  C  CD    . LYS A 1 547  ? -45.281 -105.256 5.189   1.00 60.23  ? 548  LYS A CD    1 
ATOM   4157  C  CE    . LYS A 1 547  ? -45.697 -106.020 3.942   1.00 61.30  ? 548  LYS A CE    1 
ATOM   4158  N  NZ    . LYS A 1 547  ? -45.175 -105.417 2.677   1.00 61.76  ? 548  LYS A NZ    1 
ATOM   4159  N  N     . ILE A 1 548  ? -45.844 -101.633 6.989   1.00 55.92  ? 549  ILE A N     1 
ATOM   4160  C  CA    . ILE A 1 548  ? -47.245 -101.245 7.135   1.00 56.36  ? 549  ILE A CA    1 
ATOM   4161  C  C     . ILE A 1 548  ? -47.500 -99.872  6.536   1.00 56.86  ? 549  ILE A C     1 
ATOM   4162  O  O     . ILE A 1 548  ? -48.448 -99.730  5.758   1.00 56.13  ? 549  ILE A O     1 
ATOM   4163  C  CB    . ILE A 1 548  ? -47.703 -101.346 8.602   1.00 56.34  ? 549  ILE A CB    1 
ATOM   4164  C  CG1   . ILE A 1 548  ? -47.381 -102.754 9.138   1.00 56.54  ? 549  ILE A CG1   1 
ATOM   4165  C  CG2   . ILE A 1 548  ? -49.183 -101.070 8.782   1.00 54.90  ? 549  ILE A CG2   1 
ATOM   4166  C  CD1   . ILE A 1 548  ? -47.760 -103.001 10.588  1.00 56.83  ? 549  ILE A CD1   1 
ATOM   4167  N  N     . ALA A 1 549  ? -46.648 -98.888  6.800   1.00 57.48  ? 550  ALA A N     1 
ATOM   4168  C  CA    . ALA A 1 549  ? -46.809 -97.540  6.261   1.00 57.99  ? 550  ALA A CA    1 
ATOM   4169  C  C     . ALA A 1 549  ? -46.682 -97.504  4.740   1.00 58.83  ? 550  ALA A C     1 
ATOM   4170  O  O     . ALA A 1 549  ? -47.396 -96.766  4.053   1.00 58.38  ? 550  ALA A O     1 
ATOM   4171  C  CB    . ALA A 1 549  ? -45.786 -96.595  6.886   1.00 57.01  ? 550  ALA A CB    1 
ATOM   4172  N  N     . THR A 1 550  ? -45.784 -98.319  4.190   1.00 59.56  ? 551  THR A N     1 
ATOM   4173  C  CA    . THR A 1 550  ? -45.606 -98.417  2.736   1.00 61.55  ? 551  THR A CA    1 
ATOM   4174  C  C     . THR A 1 550  ? -46.862 -99.050  2.119   1.00 62.37  ? 551  THR A C     1 
ATOM   4175  O  O     . THR A 1 550  ? -47.368 -98.599  1.097   1.00 62.67  ? 551  THR A O     1 
ATOM   4176  C  CB    . THR A 1 550  ? -44.366 -99.245  2.364   1.00 61.35  ? 551  THR A CB    1 
ATOM   4177  O  OG1   . THR A 1 550  ? -43.174 -98.560  2.771   1.00 61.27  ? 551  THR A OG1   1 
ATOM   4178  C  CG2   . THR A 1 550  ? -44.244 -99.543  0.873   1.00 61.55  ? 551  THR A CG2   1 
ATOM   4179  N  N     . ASP A 1 551  ? -47.401 -100.057 2.800   1.00 63.40  ? 552  ASP A N     1 
ATOM   4180  C  CA    . ASP A 1 551  ? -48.596 -100.744 2.328   1.00 64.69  ? 552  ASP A CA    1 
ATOM   4181  C  C     . ASP A 1 551  ? -49.856 -99.886  2.337   1.00 65.25  ? 552  ASP A C     1 
ATOM   4182  O  O     . ASP A 1 551  ? -50.648 -99.979  1.391   1.00 65.53  ? 552  ASP A O     1 
ATOM   4183  C  CB    . ASP A 1 551  ? -48.827 -102.005 3.163   1.00 64.49  ? 552  ASP A CB    1 
ATOM   4184  C  CG    . ASP A 1 551  ? -47.898 -103.142 2.770   1.00 64.92  ? 552  ASP A CG    1 
ATOM   4185  O  OD1   . ASP A 1 551  ? -47.182 -103.011 1.755   1.00 65.05  ? 552  ASP A OD1   1 
ATOM   4186  O  OD2   . ASP A 1 551  ? -47.899 -104.167 3.488   1.00 64.98  ? 552  ASP A OD2   1 
ATOM   4187  N  N     . VAL A 1 552  ? -50.045 -99.061  3.362   1.00 64.89  ? 553  VAL A N     1 
ATOM   4188  C  CA    . VAL A 1 552  ? -51.247 -98.236  3.426   1.00 64.80  ? 553  VAL A CA    1 
ATOM   4189  C  C     . VAL A 1 552  ? -51.055 -96.889  2.751   1.00 65.10  ? 553  VAL A C     1 
ATOM   4190  O  O     . VAL A 1 552  ? -51.948 -96.052  2.825   1.00 65.11  ? 553  VAL A O     1 
ATOM   4191  C  CB    . VAL A 1 552  ? -51.721 -98.056  4.878   1.00 64.61  ? 553  VAL A CB    1 
ATOM   4192  C  CG1   . VAL A 1 552  ? -52.024 -99.415  5.499   1.00 63.93  ? 553  VAL A CG1   1 
ATOM   4193  C  CG2   . VAL A 1 552  ? -50.695 -97.306  5.713   1.00 63.88  ? 553  VAL A CG2   1 
ATOM   4194  N  N     . GLY A 1 553  ? -49.890 -96.660  2.155   1.00 65.75  ? 554  GLY A N     1 
ATOM   4195  C  CA    . GLY A 1 553  ? -49.591 -95.400  1.508   1.00 66.14  ? 554  GLY A CA    1 
ATOM   4196  C  C     . GLY A 1 553  ? -48.957 -94.319  2.353   1.00 66.54  ? 554  GLY A C     1 
ATOM   4197  O  O     . GLY A 1 553  ? -48.699 -93.239  1.791   1.00 68.18  ? 554  GLY A O     1 
ATOM   4198  N  N     . LEU A 1 554  ? -48.673 -94.508  3.639   1.00 66.40  ? 555  LEU A N     1 
ATOM   4199  C  CA    . LEU A 1 554  ? -48.081 -93.428  4.440   1.00 65.67  ? 555  LEU A CA    1 
ATOM   4200  C  C     . LEU A 1 554  ? -46.581 -93.324  4.201   1.00 65.49  ? 555  LEU A C     1 
ATOM   4201  O  O     . LEU A 1 554  ? -45.772 -92.904  5.023   1.00 65.11  ? 555  LEU A O     1 
ATOM   4202  C  CB    . LEU A 1 554  ? -48.426 -93.557  5.919   1.00 65.68  ? 555  LEU A CB    1 
ATOM   4203  C  CG    . LEU A 1 554  ? -49.850 -93.156  6.330   1.00 65.62  ? 555  LEU A CG    1 
ATOM   4204  C  CD1   . LEU A 1 554  ? -50.063 -93.527  7.794   1.00 65.80  ? 555  LEU A CD1   1 
ATOM   4205  C  CD2   . LEU A 1 554  ? -50.164 -91.706  6.008   1.00 65.26  ? 555  LEU A CD2   1 
ATOM   4206  N  N     . GLY A 1 555  ? -46.160 -93.737  3.008   1.00 64.85  ? 556  GLY A N     1 
ATOM   4207  C  CA    . GLY A 1 555  ? -44.832 -93.732  2.488   1.00 63.89  ? 556  GLY A CA    1 
ATOM   4208  C  C     . GLY A 1 555  ? -43.660 -94.274  3.263   1.00 63.97  ? 556  GLY A C     1 
ATOM   4209  O  O     . GLY A 1 555  ? -42.510 -94.011  2.879   1.00 64.26  ? 556  GLY A O     1 
ATOM   4210  N  N     . GLY A 1 556  ? -43.866 -95.062  4.313   1.00 62.76  ? 557  GLY A N     1 
ATOM   4211  C  CA    . GLY A 1 556  ? -42.762 -95.577  5.110   1.00 60.49  ? 557  GLY A CA    1 
ATOM   4212  C  C     . GLY A 1 556  ? -42.668 -94.815  6.435   1.00 58.72  ? 557  GLY A C     1 
ATOM   4213  O  O     . GLY A 1 556  ? -41.852 -95.158  7.288   1.00 59.40  ? 557  GLY A O     1 
ATOM   4214  N  N     . ARG A 1 557  ? -43.522 -93.809  6.607   1.00 57.22  ? 558  ARG A N     1 
ATOM   4215  C  CA    . ARG A 1 557  ? -43.539 -93.016  7.835   1.00 54.81  ? 558  ARG A CA    1 
ATOM   4216  C  C     . ARG A 1 557  ? -44.171 -93.836  8.953   1.00 52.35  ? 558  ARG A C     1 
ATOM   4217  O  O     . ARG A 1 557  ? -45.324 -94.238  8.853   1.00 52.02  ? 558  ARG A O     1 
ATOM   4218  C  CB    . ARG A 1 557  ? -44.251 -91.678  7.635   1.00 55.58  ? 558  ARG A CB    1 
ATOM   4219  C  CG    . ARG A 1 557  ? -43.305 -90.519  7.965   1.00 57.24  ? 558  ARG A CG    1 
ATOM   4220  C  CD    . ARG A 1 557  ? -43.818 -89.204  7.436   1.00 58.52  ? 558  ARG A CD    1 
ATOM   4221  N  NE    . ARG A 1 557  ? -42.778 -88.339  6.868   1.00 58.19  ? 558  ARG A NE    1 
ATOM   4222  C  CZ    . ARG A 1 557  ? -43.007 -87.041  6.685   1.00 58.18  ? 558  ARG A CZ    1 
ATOM   4223  N  NH1   . ARG A 1 557  ? -44.197 -86.572  7.065   1.00 57.87  ? 558  ARG A NH1   1 
ATOM   4224  N  NH2   . ARG A 1 557  ? -42.072 -86.269  6.157   1.00 57.88  ? 558  ARG A NH2   1 
ATOM   4225  N  N     . ILE A 1 558  ? -43.388 -94.128  9.982   1.00 49.05  ? 559  ILE A N     1 
ATOM   4226  C  CA    . ILE A 1 558  ? -43.821 -95.009  11.051  1.00 47.07  ? 559  ILE A CA    1 
ATOM   4227  C  C     . ILE A 1 558  ? -44.530 -94.415  12.243  1.00 45.41  ? 559  ILE A C     1 
ATOM   4228  O  O     . ILE A 1 558  ? -44.943 -95.171  13.126  1.00 46.63  ? 559  ILE A O     1 
ATOM   4229  C  CB    . ILE A 1 558  ? -42.541 -95.753  11.535  1.00 45.95  ? 559  ILE A CB    1 
ATOM   4230  C  CG1   . ILE A 1 558  ? -41.565 -94.797  12.216  1.00 45.66  ? 559  ILE A CG1   1 
ATOM   4231  C  CG2   . ILE A 1 558  ? -41.878 -96.393  10.319  1.00 45.90  ? 559  ILE A CG2   1 
ATOM   4232  C  CD1   . ILE A 1 558  ? -40.913 -95.319  13.474  1.00 45.98  ? 559  ILE A CD1   1 
ATOM   4233  N  N     . ASN A 1 559  ? -44.664 -93.109  12.359  1.00 44.58  ? 560  ASN A N     1 
ATOM   4234  C  CA    . ASN A 1 559  ? -45.185 -92.479  13.567  1.00 43.29  ? 560  ASN A CA    1 
ATOM   4235  C  C     . ASN A 1 559  ? -46.575 -92.938  13.967  1.00 42.13  ? 560  ASN A C     1 
ATOM   4236  O  O     . ASN A 1 559  ? -46.799 -93.282  15.133  1.00 42.66  ? 560  ASN A O     1 
ATOM   4237  C  CB    . ASN A 1 559  ? -45.073 -90.967  13.434  1.00 43.79  ? 560  ASN A CB    1 
ATOM   4238  C  CG    . ASN A 1 559  ? -45.820 -90.387  12.269  1.00 44.95  ? 560  ASN A CG    1 
ATOM   4239  O  OD1   . ASN A 1 559  ? -46.755 -89.627  12.541  1.00 48.49  ? 560  ASN A OD1   1 
ATOM   4240  N  ND2   . ASN A 1 559  ? -45.510 -90.684  11.016  1.00 44.00  ? 560  ASN A ND2   1 
ATOM   4241  N  N     . MET A 1 560  ? -47.494 -93.009  13.020  1.00 41.09  ? 561  MET A N     1 
ATOM   4242  C  CA    . MET A 1 560  ? -48.855 -93.463  13.332  1.00 41.87  ? 561  MET A CA    1 
ATOM   4243  C  C     . MET A 1 560  ? -48.930 -94.914  13.783  1.00 39.98  ? 561  MET A C     1 
ATOM   4244  O  O     . MET A 1 560  ? -49.706 -95.213  14.702  1.00 40.53  ? 561  MET A O     1 
ATOM   4245  C  CB    . MET A 1 560  ? -49.752 -93.180  12.119  1.00 44.37  ? 561  MET A CB    1 
ATOM   4246  C  CG    . MET A 1 560  ? -51.238 -93.241  12.464  1.00 47.01  ? 561  MET A CG    1 
ATOM   4247  S  SD    . MET A 1 560  ? -51.634 -92.036  13.759  1.00 50.70  ? 561  MET A SD    1 
ATOM   4248  C  CE    . MET A 1 560  ? -52.722 -92.988  14.790  1.00 48.71  ? 561  MET A CE    1 
ATOM   4249  N  N     . ILE A 1 561  ? -48.072 -95.803  13.302  1.00 38.52  ? 562  ILE A N     1 
ATOM   4250  C  CA    . ILE A 1 561  ? -48.029 -97.198  13.692  1.00 37.29  ? 562  ILE A CA    1 
ATOM   4251  C  C     . ILE A 1 561  ? -47.518 -97.321  15.122  1.00 37.02  ? 562  ILE A C     1 
ATOM   4252  O  O     . ILE A 1 561  ? -48.071 -97.993  15.980  1.00 36.65  ? 562  ILE A O     1 
ATOM   4253  C  CB    . ILE A 1 561  ? -47.184 -98.063  12.733  1.00 37.49  ? 562  ILE A CB    1 
ATOM   4254  C  CG1   . ILE A 1 561  ? -47.901 -98.209  11.379  1.00 37.67  ? 562  ILE A CG1   1 
ATOM   4255  C  CG2   . ILE A 1 561  ? -46.883 -99.475  13.260  1.00 37.70  ? 562  ILE A CG2   1 
ATOM   4256  C  CD1   . ILE A 1 561  ? -47.795 -96.954  10.523  1.00 36.58  ? 562  ILE A CD1   1 
ATOM   4257  N  N     . MET A 1 562  ? -46.403 -96.661  15.406  1.00 36.90  ? 563  MET A N     1 
ATOM   4258  C  CA    . MET A 1 562  ? -45.824 -96.696  16.765  1.00 34.99  ? 563  MET A CA    1 
ATOM   4259  C  C     . MET A 1 562  ? -46.763 -96.041  17.765  1.00 34.04  ? 563  MET A C     1 
ATOM   4260  O  O     . MET A 1 562  ? -46.850 -96.489  18.912  1.00 34.42  ? 563  MET A O     1 
ATOM   4261  C  CB    . MET A 1 562  ? -44.456 -96.020  16.718  1.00 33.87  ? 563  MET A CB    1 
ATOM   4262  C  CG    . MET A 1 562  ? -43.498 -96.658  15.723  1.00 34.53  ? 563  MET A CG    1 
ATOM   4263  S  SD    . MET A 1 562  ? -43.557 -98.466  15.666  1.00 35.32  ? 563  MET A SD    1 
ATOM   4264  C  CE    . MET A 1 562  ? -43.095 -98.874  17.344  1.00 35.40  ? 563  MET A CE    1 
ATOM   4265  N  N     . GLN A 1 563  ? -47.475 -95.005  17.333  1.00 34.77  ? 564  GLN A N     1 
ATOM   4266  C  CA    . GLN A 1 563  ? -48.487 -94.346  18.190  1.00 32.15  ? 564  GLN A CA    1 
ATOM   4267  C  C     . GLN A 1 563  ? -49.596 -95.320  18.557  1.00 30.63  ? 564  GLN A C     1 
ATOM   4268  O  O     . GLN A 1 563  ? -49.994 -95.539  19.683  1.00 26.76  ? 564  GLN A O     1 
ATOM   4269  C  CB    . GLN A 1 563  ? -49.058 -93.183  17.386  1.00 32.62  ? 564  GLN A CB    1 
ATOM   4270  C  CG    . GLN A 1 563  ? -50.203 -92.384  17.995  1.00 33.45  ? 564  GLN A CG    1 
ATOM   4271  C  CD    . GLN A 1 563  ? -49.687 -91.554  19.173  1.00 33.55  ? 564  GLN A CD    1 
ATOM   4272  O  OE1   . GLN A 1 563  ? -49.333 -92.113  20.214  1.00 34.88  ? 564  GLN A OE1   1 
ATOM   4273  N  NE2   . GLN A 1 563  ? -49.698 -90.248  18.999  1.00 32.20  ? 564  GLN A NE2   1 
ATOM   4274  N  N     . THR A 1 564  ? -50.009 -96.115  17.546  1.00 33.38  ? 565  THR A N     1 
ATOM   4275  C  CA    . THR A 1 564  ? -51.028 -97.162  17.756  1.00 32.39  ? 565  THR A CA    1 
ATOM   4276  C  C     . THR A 1 564  ? -50.493 -98.192  18.728  1.00 30.98  ? 565  THR A C     1 
ATOM   4277  O  O     . THR A 1 564  ? -51.164 -98.664  19.655  1.00 33.20  ? 565  THR A O     1 
ATOM   4278  C  CB    . THR A 1 564  ? -51.424 -97.793  16.405  1.00 34.06  ? 565  THR A CB    1 
ATOM   4279  O  OG1   . THR A 1 564  ? -51.864 -96.766  15.494  1.00 35.60  ? 565  THR A OG1   1 
ATOM   4280  C  CG2   . THR A 1 564  ? -52.535 -98.821  16.557  1.00 32.81  ? 565  THR A CG2   1 
ATOM   4281  N  N     . ALA A 1 565  ? -49.190 -98.476  18.628  1.00 30.55  ? 566  ALA A N     1 
ATOM   4282  C  CA    . ALA A 1 565  ? -48.620 -99.480  19.560  1.00 29.67  ? 566  ALA A CA    1 
ATOM   4283  C  C     . ALA A 1 565  ? -48.698 -99.006  21.002  1.00 30.71  ? 566  ALA A C     1 
ATOM   4284  O  O     . ALA A 1 565  ? -48.939 -99.815  21.903  1.00 32.41  ? 566  ALA A O     1 
ATOM   4285  C  CB    . ALA A 1 565  ? -47.198 -99.872  19.216  1.00 27.30  ? 566  ALA A CB    1 
ATOM   4286  N  N     . PHE A 1 566  ? -48.448 -97.703  21.231  1.00 29.96  ? 567  PHE A N     1 
ATOM   4287  C  CA    . PHE A 1 566  ? -48.504 -97.171  22.599  1.00 30.29  ? 567  PHE A CA    1 
ATOM   4288  C  C     . PHE A 1 566  ? -49.924 -97.262  23.154  1.00 28.70  ? 567  PHE A C     1 
ATOM   4289  O  O     . PHE A 1 566  ? -50.148 -97.751  24.261  1.00 27.45  ? 567  PHE A O     1 
ATOM   4290  C  CB    . PHE A 1 566  ? -48.019 -95.705  22.595  1.00 29.29  ? 567  PHE A CB    1 
ATOM   4291  C  CG    . PHE A 1 566  ? -48.426 -94.862  23.774  1.00 27.50  ? 567  PHE A CG    1 
ATOM   4292  C  CD1   . PHE A 1 566  ? -47.871 -95.067  25.020  1.00 27.75  ? 567  PHE A CD1   1 
ATOM   4293  C  CD2   . PHE A 1 566  ? -49.421 -93.902  23.621  1.00 27.19  ? 567  PHE A CD2   1 
ATOM   4294  C  CE1   . PHE A 1 566  ? -48.277 -94.297  26.109  1.00 26.78  ? 567  PHE A CE1   1 
ATOM   4295  C  CE2   . PHE A 1 566  ? -49.855 -93.161  24.689  1.00 26.45  ? 567  PHE A CE2   1 
ATOM   4296  C  CZ    . PHE A 1 566  ? -49.273 -93.366  25.927  1.00 27.01  ? 567  PHE A CZ    1 
ATOM   4297  N  N     . PHE A 1 567  ? -50.858 -96.719  22.378  1.00 30.89  ? 568  PHE A N     1 
ATOM   4298  C  CA    . PHE A 1 567  ? -52.267 -96.688  22.820  1.00 33.54  ? 568  PHE A CA    1 
ATOM   4299  C  C     . PHE A 1 567  ? -52.769 -98.105  23.053  1.00 35.33  ? 568  PHE A C     1 
ATOM   4300  O  O     . PHE A 1 567  ? -53.433 -98.390  24.047  1.00 38.04  ? 568  PHE A O     1 
ATOM   4301  C  CB    . PHE A 1 567  ? -53.162 -95.932  21.838  1.00 33.37  ? 568  PHE A CB    1 
ATOM   4302  C  CG    . PHE A 1 567  ? -53.141 -94.433  22.010  1.00 35.33  ? 568  PHE A CG    1 
ATOM   4303  C  CD1   . PHE A 1 567  ? -54.009 -93.813  22.888  1.00 35.17  ? 568  PHE A CD1   1 
ATOM   4304  C  CD2   . PHE A 1 567  ? -52.259 -93.636  21.305  1.00 34.65  ? 568  PHE A CD2   1 
ATOM   4305  C  CE1   . PHE A 1 567  ? -53.993 -92.441  23.069  1.00 35.87  ? 568  PHE A CE1   1 
ATOM   4306  C  CE2   . PHE A 1 567  ? -52.258 -92.256  21.457  1.00 34.64  ? 568  PHE A CE2   1 
ATOM   4307  C  CZ    . PHE A 1 567  ? -53.116 -91.664  22.354  1.00 34.61  ? 568  PHE A CZ    1 
ATOM   4308  N  N     . LYS A 1 568  ? -52.349 -99.047  22.195  1.00 35.92  ? 569  LYS A N     1 
ATOM   4309  C  CA    . LYS A 1 568  ? -52.866 -100.407 22.389  1.00 36.56  ? 569  LYS A CA    1 
ATOM   4310  C  C     . LYS A 1 568  ? -52.189 -101.127 23.538  1.00 37.39  ? 569  LYS A C     1 
ATOM   4311  O  O     . LYS A 1 568  ? -52.869 -101.832 24.308  1.00 36.80  ? 569  LYS A O     1 
ATOM   4312  C  CB    . LYS A 1 568  ? -52.781 -101.201 21.084  1.00 37.84  ? 569  LYS A CB    1 
ATOM   4313  C  CG    . LYS A 1 568  ? -53.290 -102.628 21.208  1.00 38.52  ? 569  LYS A CG    1 
ATOM   4314  C  CD    . LYS A 1 568  ? -52.636 -103.549 20.182  1.00 38.83  ? 569  LYS A CD    1 
ATOM   4315  C  CE    . LYS A 1 568  ? -53.415 -104.872 20.227  1.00 40.49  ? 569  LYS A CE    1 
ATOM   4316  N  NZ    . LYS A 1 568  ? -53.277 -105.640 18.956  1.00 41.26  ? 569  LYS A NZ    1 
ATOM   4317  N  N     . LEU A 1 569  ? -50.867 -100.958 23.652  1.00 35.76  ? 570  LEU A N     1 
ATOM   4318  C  CA    . LEU A 1 569  ? -50.118 -101.742 24.624  1.00 35.19  ? 570  LEU A CA    1 
ATOM   4319  C  C     . LEU A 1 569  ? -49.621 -101.062 25.873  1.00 35.44  ? 570  LEU A C     1 
ATOM   4320  O  O     . LEU A 1 569  ? -49.086 -101.812 26.716  1.00 36.55  ? 570  LEU A O     1 
ATOM   4321  C  CB    . LEU A 1 569  ? -48.900 -102.281 23.855  1.00 35.49  ? 570  LEU A CB    1 
ATOM   4322  C  CG    . LEU A 1 569  ? -48.764 -103.747 23.478  1.00 36.03  ? 570  LEU A CG    1 
ATOM   4323  C  CD1   . LEU A 1 569  ? -50.123 -104.423 23.318  1.00 35.01  ? 570  LEU A CD1   1 
ATOM   4324  C  CD2   . LEU A 1 569  ? -47.962 -103.845 22.178  1.00 34.99  ? 570  LEU A CD2   1 
ATOM   4325  N  N     . ALA A 1 570  ? -49.731 -99.754  26.074  1.00 35.69  ? 571  ALA A N     1 
ATOM   4326  C  CA    . ALA A 1 570  ? -49.078 -99.160  27.240  1.00 37.58  ? 571  ALA A CA    1 
ATOM   4327  C  C     . ALA A 1 570  ? -49.924 -99.232  28.485  1.00 38.54  ? 571  ALA A C     1 
ATOM   4328  O  O     . ALA A 1 570  ? -49.419 -98.916  29.551  1.00 37.87  ? 571  ALA A O     1 
ATOM   4329  C  CB    . ALA A 1 570  ? -48.643 -97.714  26.995  1.00 37.00  ? 571  ALA A CB    1 
ATOM   4330  N  N     . GLY A 1 571  ? -51.195 -99.612  28.377  1.00 40.53  ? 572  GLY A N     1 
ATOM   4331  C  CA    . GLY A 1 571  ? -52.018 -99.764  29.561  1.00 42.40  ? 572  GLY A CA    1 
ATOM   4332  C  C     . GLY A 1 571  ? -52.495 -98.502  30.240  1.00 44.55  ? 572  GLY A C     1 
ATOM   4333  O  O     . GLY A 1 571  ? -52.915 -98.559  31.411  1.00 44.29  ? 572  GLY A O     1 
ATOM   4334  N  N     . VAL A 1 572  ? -52.444 -97.343  29.583  1.00 46.22  ? 573  VAL A N     1 
ATOM   4335  C  CA    . VAL A 1 572  ? -52.928 -96.138  30.291  1.00 47.58  ? 573  VAL A CA    1 
ATOM   4336  C  C     . VAL A 1 572  ? -54.431 -96.052  30.047  1.00 49.06  ? 573  VAL A C     1 
ATOM   4337  O  O     . VAL A 1 572  ? -55.167 -95.498  30.854  1.00 50.77  ? 573  VAL A O     1 
ATOM   4338  C  CB    . VAL A 1 572  ? -52.091 -94.888  30.014  1.00 46.58  ? 573  VAL A CB    1 
ATOM   4339  C  CG1   . VAL A 1 572  ? -51.032 -95.126  28.939  1.00 46.67  ? 573  VAL A CG1   1 
ATOM   4340  C  CG2   . VAL A 1 572  ? -52.863 -93.621  29.716  1.00 46.55  ? 573  VAL A CG2   1 
ATOM   4341  N  N     . LEU A 1 573  ? -54.895 -96.627  28.956  1.00 51.36  ? 574  LEU A N     1 
ATOM   4342  C  CA    . LEU A 1 573  ? -56.306 -96.641  28.614  1.00 54.31  ? 574  LEU A CA    1 
ATOM   4343  C  C     . LEU A 1 573  ? -56.690 -98.021  28.089  1.00 57.31  ? 574  LEU A C     1 
ATOM   4344  O  O     . LEU A 1 573  ? -55.972 -98.650  27.310  1.00 55.39  ? 574  LEU A O     1 
ATOM   4345  C  CB    . LEU A 1 573  ? -56.661 -95.676  27.491  1.00 54.98  ? 574  LEU A CB    1 
ATOM   4346  C  CG    . LEU A 1 573  ? -56.647 -94.177  27.749  1.00 55.46  ? 574  LEU A CG    1 
ATOM   4347  C  CD1   . LEU A 1 573  ? -57.387 -93.490  26.618  1.00 56.04  ? 574  LEU A CD1   1 
ATOM   4348  C  CD2   . LEU A 1 573  ? -57.276 -93.833  29.092  1.00 56.34  ? 574  LEU A CD2   1 
ATOM   4349  N  N     . PRO A 1 574  ? -57.910 -98.428  28.424  1.00 60.05  ? 575  PRO A N     1 
ATOM   4350  C  CA    . PRO A 1 574  ? -58.453 -99.696  27.943  1.00 61.95  ? 575  PRO A CA    1 
ATOM   4351  C  C     . PRO A 1 574  ? -58.595 -99.656  26.427  1.00 62.92  ? 575  PRO A C     1 
ATOM   4352  O  O     . PRO A 1 574  ? -58.773 -98.592  25.824  1.00 61.92  ? 575  PRO A O     1 
ATOM   4353  C  CB    . PRO A 1 574  ? -59.755 -99.849  28.711  1.00 61.93  ? 575  PRO A CB    1 
ATOM   4354  C  CG    . PRO A 1 574  ? -60.154 -98.448  29.048  1.00 61.95  ? 575  PRO A CG    1 
ATOM   4355  C  CD    . PRO A 1 574  ? -58.865 -97.705  29.294  1.00 60.92  ? 575  PRO A CD    1 
ATOM   4356  N  N     . PHE A 1 575  ? -58.461 -100.801 25.776  1.00 65.09  ? 576  PHE A N     1 
ATOM   4357  C  CA    . PHE A 1 575  ? -58.517 -100.952 24.337  1.00 67.19  ? 576  PHE A CA    1 
ATOM   4358  C  C     . PHE A 1 575  ? -59.482 -100.055 23.576  1.00 67.96  ? 576  PHE A C     1 
ATOM   4359  O  O     . PHE A 1 575  ? -59.074 -99.222  22.768  1.00 68.32  ? 576  PHE A O     1 
ATOM   4360  C  CB    . PHE A 1 575  ? -58.845 -102.419 23.983  1.00 67.98  ? 576  PHE A CB    1 
ATOM   4361  C  CG    . PHE A 1 575  ? -58.829 -102.675 22.495  1.00 68.97  ? 576  PHE A CG    1 
ATOM   4362  C  CD1   . PHE A 1 575  ? -60.030 -102.817 21.812  1.00 69.10  ? 576  PHE A CD1   1 
ATOM   4363  C  CD2   . PHE A 1 575  ? -57.638 -102.732 21.790  1.00 69.19  ? 576  PHE A CD2   1 
ATOM   4364  C  CE1   . PHE A 1 575  ? -60.044 -103.036 20.448  1.00 69.26  ? 576  PHE A CE1   1 
ATOM   4365  C  CE2   . PHE A 1 575  ? -57.650 -102.959 20.426  1.00 69.52  ? 576  PHE A CE2   1 
ATOM   4366  C  CZ    . PHE A 1 575  ? -58.852 -103.112 19.755  1.00 69.36  ? 576  PHE A CZ    1 
ATOM   4367  N  N     . GLU A 1 576  ? -60.776 -100.295 23.745  1.00 68.90  ? 577  GLU A N     1 
ATOM   4368  C  CA    . GLU A 1 576  ? -61.801 -99.570  23.007  1.00 70.02  ? 577  GLU A CA    1 
ATOM   4369  C  C     . GLU A 1 576  ? -61.672 -98.057  23.148  1.00 70.45  ? 577  GLU A C     1 
ATOM   4370  O  O     . GLU A 1 576  ? -61.633 -97.357  22.127  1.00 69.88  ? 577  GLU A O     1 
ATOM   4371  C  CB    . GLU A 1 576  ? -63.194 -100.073 23.393  1.00 71.30  ? 577  GLU A CB    1 
ATOM   4372  C  CG    . GLU A 1 576  ? -63.310 -101.578 23.589  1.00 72.83  ? 577  GLU A CG    1 
ATOM   4373  C  CD    . GLU A 1 576  ? -64.062 -102.294 22.481  1.00 73.89  ? 577  GLU A CD    1 
ATOM   4374  O  OE1   . GLU A 1 576  ? -63.488 -102.428 21.370  1.00 74.51  ? 577  GLU A OE1   1 
ATOM   4375  O  OE2   . GLU A 1 576  ? -65.219 -102.737 22.682  1.00 74.14  ? 577  GLU A OE2   1 
ATOM   4376  N  N     . LYS A 1 577  ? -61.506 -97.553  24.371  1.00 70.25  ? 578  LYS A N     1 
ATOM   4377  C  CA    . LYS A 1 577  ? -61.361 -96.113  24.581  1.00 71.24  ? 578  LYS A CA    1 
ATOM   4378  C  C     . LYS A 1 577  ? -60.145 -95.544  23.842  1.00 70.54  ? 578  LYS A C     1 
ATOM   4379  O  O     . LYS A 1 577  ? -60.263 -94.592  23.065  1.00 69.95  ? 578  LYS A O     1 
ATOM   4380  C  CB    . LYS A 1 577  ? -61.334 -95.799  26.081  1.00 71.67  ? 578  LYS A CB    1 
ATOM   4381  C  CG    . LYS A 1 577  ? -61.094 -94.346  26.431  1.00 72.27  ? 578  LYS A CG    1 
ATOM   4382  C  CD    . LYS A 1 577  ? -62.150 -93.719  27.310  1.00 72.77  ? 578  LYS A CD    1 
ATOM   4383  C  CE    . LYS A 1 577  ? -61.886 -92.238  27.536  1.00 72.97  ? 578  LYS A CE    1 
ATOM   4384  N  NZ    . LYS A 1 577  ? -62.759 -91.374  26.689  1.00 73.84  ? 578  LYS A NZ    1 
ATOM   4385  N  N     . ALA A 1 578  ? -58.992 -96.174  24.015  1.00 69.87  ? 579  ALA A N     1 
ATOM   4386  C  CA    . ALA A 1 578  ? -57.751 -95.758  23.390  1.00 69.78  ? 579  ALA A CA    1 
ATOM   4387  C  C     . ALA A 1 578  ? -57.806 -95.733  21.870  1.00 70.02  ? 579  ALA A C     1 
ATOM   4388  O  O     . ALA A 1 578  ? -57.442 -94.738  21.242  1.00 69.27  ? 579  ALA A O     1 
ATOM   4389  C  CB    . ALA A 1 578  ? -56.622 -96.681  23.835  1.00 69.83  ? 579  ALA A CB    1 
ATOM   4390  N  N     . VAL A 1 579  ? -58.300 -96.820  21.280  1.00 70.87  ? 580  VAL A N     1 
ATOM   4391  C  CA    . VAL A 1 579  ? -58.391 -96.921  19.827  1.00 71.59  ? 580  VAL A CA    1 
ATOM   4392  C  C     . VAL A 1 579  ? -59.459 -95.983  19.285  1.00 72.36  ? 580  VAL A C     1 
ATOM   4393  O  O     . VAL A 1 579  ? -59.379 -95.531  18.145  1.00 72.46  ? 580  VAL A O     1 
ATOM   4394  C  CB    . VAL A 1 579  ? -58.624 -98.367  19.365  1.00 71.84  ? 580  VAL A CB    1 
ATOM   4395  C  CG1   . VAL A 1 579  ? -58.451 -98.481  17.855  1.00 72.35  ? 580  VAL A CG1   1 
ATOM   4396  C  CG2   . VAL A 1 579  ? -57.661 -99.330  20.044  1.00 71.70  ? 580  VAL A CG2   1 
ATOM   4397  N  N     . ASP A 1 580  ? -60.432 -95.639  20.121  1.00 73.54  ? 581  ASP A N     1 
ATOM   4398  C  CA    . ASP A 1 580  ? -61.506 -94.726  19.732  1.00 74.55  ? 581  ASP A CA    1 
ATOM   4399  C  C     . ASP A 1 580  ? -60.964 -93.299  19.688  1.00 74.67  ? 581  ASP A C     1 
ATOM   4400  O  O     . ASP A 1 580  ? -61.074 -92.585  18.691  1.00 73.88  ? 581  ASP A O     1 
ATOM   4401  C  CB    . ASP A 1 580  ? -62.685 -94.878  20.691  1.00 75.34  ? 581  ASP A CB    1 
ATOM   4402  C  CG    . ASP A 1 580  ? -63.726 -93.779  20.659  1.00 76.44  ? 581  ASP A CG    1 
ATOM   4403  O  OD1   . ASP A 1 580  ? -63.981 -93.207  21.745  1.00 76.78  ? 581  ASP A OD1   1 
ATOM   4404  O  OD2   . ASP A 1 580  ? -64.256 -93.483  19.565  1.00 76.79  ? 581  ASP A OD2   1 
ATOM   4405  N  N     . LEU A 1 581  ? -60.338 -92.913  20.800  1.00 74.92  ? 582  LEU A N     1 
ATOM   4406  C  CA    . LEU A 1 581  ? -59.741 -91.590  20.944  1.00 75.42  ? 582  LEU A CA    1 
ATOM   4407  C  C     . LEU A 1 581  ? -58.709 -91.326  19.856  1.00 76.11  ? 582  LEU A C     1 
ATOM   4408  O  O     . LEU A 1 581  ? -58.688 -90.275  19.210  1.00 75.87  ? 582  LEU A O     1 
ATOM   4409  C  CB    . LEU A 1 581  ? -59.126 -91.487  22.329  1.00 75.49  ? 582  LEU A CB    1 
ATOM   4410  C  CG    . LEU A 1 581  ? -59.471 -90.330  23.258  1.00 75.58  ? 582  LEU A CG    1 
ATOM   4411  C  CD1   . LEU A 1 581  ? -60.924 -89.906  23.204  1.00 75.36  ? 582  LEU A CD1   1 
ATOM   4412  C  CD2   . LEU A 1 581  ? -59.102 -90.744  24.684  1.00 75.95  ? 582  LEU A CD2   1 
ATOM   4413  N  N     . LEU A 1 582  ? -57.896 -92.347  19.571  1.00 76.87  ? 583  LEU A N     1 
ATOM   4414  C  CA    . LEU A 1 582  ? -56.886 -92.248  18.524  1.00 78.22  ? 583  LEU A CA    1 
ATOM   4415  C  C     . LEU A 1 582  ? -57.509 -91.882  17.176  1.00 79.14  ? 583  LEU A C     1 
ATOM   4416  O  O     . LEU A 1 582  ? -57.144 -90.892  16.550  1.00 78.28  ? 583  LEU A O     1 
ATOM   4417  C  CB    . LEU A 1 582  ? -56.097 -93.544  18.384  1.00 77.98  ? 583  LEU A CB    1 
ATOM   4418  C  CG    . LEU A 1 582  ? -54.577 -93.534  18.265  1.00 77.90  ? 583  LEU A CG    1 
ATOM   4419  C  CD1   . LEU A 1 582  ? -54.104 -94.694  17.400  1.00 77.51  ? 583  LEU A CD1   1 
ATOM   4420  C  CD2   . LEU A 1 582  ? -54.025 -92.220  17.734  1.00 77.54  ? 583  LEU A CD2   1 
ATOM   4421  N  N     . LYS A 1 583  ? -58.516 -92.643  16.760  1.00 80.76  ? 584  LYS A N     1 
ATOM   4422  C  CA    . LYS A 1 583  ? -59.193 -92.385  15.492  1.00 82.93  ? 584  LYS A CA    1 
ATOM   4423  C  C     . LYS A 1 583  ? -59.901 -91.038  15.485  1.00 84.48  ? 584  LYS A C     1 
ATOM   4424  O  O     . LYS A 1 583  ? -59.890 -90.326  14.480  1.00 84.01  ? 584  LYS A O     1 
ATOM   4425  C  CB    . LYS A 1 583  ? -60.147 -93.535  15.164  1.00 82.93  ? 584  LYS A CB    1 
ATOM   4426  C  CG    . LYS A 1 583  ? -59.430 -94.881  15.130  1.00 82.80  ? 584  LYS A CG    1 
ATOM   4427  C  CD    . LYS A 1 583  ? -59.718 -95.653  13.857  1.00 82.79  ? 584  LYS A CD    1 
ATOM   4428  C  CE    . LYS A 1 583  ? -60.435 -96.957  14.175  1.00 82.85  ? 584  LYS A CE    1 
ATOM   4429  N  NZ    . LYS A 1 583  ? -60.304 -97.947  13.070  1.00 83.02  ? 584  LYS A NZ    1 
ATOM   4430  N  N     . LYS A 1 584  ? -60.417 -90.639  16.645  1.00 86.66  ? 585  LYS A N     1 
ATOM   4431  C  CA    . LYS A 1 584  ? -61.072 -89.352  16.818  1.00 88.89  ? 585  LYS A CA    1 
ATOM   4432  C  C     . LYS A 1 584  ? -60.128 -88.179  16.548  1.00 90.08  ? 585  LYS A C     1 
ATOM   4433  O  O     . LYS A 1 584  ? -60.530 -87.155  15.996  1.00 90.30  ? 585  LYS A O     1 
ATOM   4434  C  CB    . LYS A 1 584  ? -61.609 -89.217  18.243  1.00 89.39  ? 585  LYS A CB    1 
ATOM   4435  C  CG    . LYS A 1 584  ? -62.896 -89.956  18.551  1.00 90.07  ? 585  LYS A CG    1 
ATOM   4436  C  CD    . LYS A 1 584  ? -63.681 -89.243  19.644  1.00 90.75  ? 585  LYS A CD    1 
ATOM   4437  C  CE    . LYS A 1 584  ? -64.472 -90.211  20.508  1.00 91.00  ? 585  LYS A CE    1 
ATOM   4438  N  NZ    . LYS A 1 584  ? -64.832 -89.635  21.836  1.00 91.13  ? 585  LYS A NZ    1 
ATOM   4439  N  N     . SER A 1 585  ? -58.862 -88.356  16.913  1.00 91.10  ? 586  SER A N     1 
ATOM   4440  C  CA    . SER A 1 585  ? -57.851 -87.318  16.751  1.00 92.33  ? 586  SER A CA    1 
ATOM   4441  C  C     . SER A 1 585  ? -57.326 -87.215  15.326  1.00 93.16  ? 586  SER A C     1 
ATOM   4442  O  O     . SER A 1 585  ? -56.904 -86.142  14.880  1.00 92.98  ? 586  SER A O     1 
ATOM   4443  C  CB    . SER A 1 585  ? -56.723 -87.535  17.759  1.00 92.20  ? 586  SER A CB    1 
ATOM   4444  O  OG    . SER A 1 585  ? -55.483 -87.884  17.177  1.00 92.08  ? 586  SER A OG    1 
ATOM   4445  N  N     . ILE A 1 586  ? -57.356 -88.326  14.598  1.00 94.20  ? 587  ILE A N     1 
ATOM   4446  C  CA    . ILE A 1 586  ? -56.887 -88.350  13.212  1.00 95.48  ? 587  ILE A CA    1 
ATOM   4447  C  C     . ILE A 1 586  ? -57.875 -87.582  12.333  1.00 96.60  ? 587  ILE A C     1 
ATOM   4448  O  O     . ILE A 1 586  ? -57.684 -87.332  11.146  1.00 96.71  ? 587  ILE A O     1 
ATOM   4449  C  CB    . ILE A 1 586  ? -56.627 -89.775  12.714  1.00 95.24  ? 587  ILE A CB    1 
ATOM   4450  C  CG1   . ILE A 1 586  ? -55.804 -90.555  13.744  1.00 95.14  ? 587  ILE A CG1   1 
ATOM   4451  C  CG2   . ILE A 1 586  ? -55.891 -89.773  11.381  1.00 94.97  ? 587  ILE A CG2   1 
ATOM   4452  C  CD1   . ILE A 1 586  ? -55.877 -92.060  13.627  1.00 95.29  ? 587  ILE A CD1   1 
ATOM   4453  N  N     . HIS A 1 587  ? -58.942 -87.128  12.990  1.00 97.83  ? 588  HIS A N     1 
ATOM   4454  C  CA    . HIS A 1 587  ? -59.944 -86.277  12.356  1.00 98.96  ? 588  HIS A CA    1 
ATOM   4455  C  C     . HIS A 1 587  ? -59.700 -84.848  12.819  1.00 99.56  ? 588  HIS A C     1 
ATOM   4456  O  O     . HIS A 1 587  ? -59.465 -83.938  12.028  1.00 99.58  ? 588  HIS A O     1 
ATOM   4457  C  CB    . HIS A 1 587  ? -61.357 -86.750  12.686  1.00 99.31  ? 588  HIS A CB    1 
ATOM   4458  C  CG    . HIS A 1 587  ? -61.788 -87.861  11.774  1.00 99.73  ? 588  HIS A CG    1 
ATOM   4459  N  ND1   . HIS A 1 587  ? -62.217 -89.080  12.252  1.00 100.04 ? 588  HIS A ND1   1 
ATOM   4460  C  CD2   . HIS A 1 587  ? -61.850 -87.937  10.423  1.00 99.85  ? 588  HIS A CD2   1 
ATOM   4461  C  CE1   . HIS A 1 587  ? -62.525 -89.866  11.235  1.00 100.14 ? 588  HIS A CE1   1 
ATOM   4462  N  NE2   . HIS A 1 587  ? -62.307 -89.198  10.114  1.00 100.13 ? 588  HIS A NE2   1 
ATOM   4463  N  N     . LYS A 1 588  ? -59.648 -84.672  14.135  1.00 100.37 ? 589  LYS A N     1 
ATOM   4464  C  CA    . LYS A 1 588  ? -59.373 -83.400  14.807  1.00 101.15 ? 589  LYS A CA    1 
ATOM   4465  C  C     . LYS A 1 588  ? -58.199 -82.683  14.143  1.00 101.44 ? 589  LYS A C     1 
ATOM   4466  O  O     . LYS A 1 588  ? -58.370 -81.677  13.453  1.00 101.42 ? 589  LYS A O     1 
ATOM   4467  C  CB    . LYS A 1 588  ? -59.107 -83.707  16.276  1.00 101.49 ? 589  LYS A CB    1 
ATOM   4468  C  CG    . LYS A 1 588  ? -58.940 -82.566  17.250  1.00 101.59 ? 589  LYS A CG    1 
ATOM   4469  C  CD    . LYS A 1 588  ? -58.591 -83.064  18.647  1.00 101.51 ? 589  LYS A CD    1 
ATOM   4470  C  CE    . LYS A 1 588  ? -57.213 -83.692  18.711  1.00 101.68 ? 589  LYS A CE    1 
ATOM   4471  N  NZ    . LYS A 1 588  ? -56.311 -83.036  19.698  1.00 101.67 ? 589  LYS A NZ    1 
ATOM   4472  N  N     . ALA A 1 589  ? -57.026 -83.305  14.241  1.00 101.60 ? 590  ALA A N     1 
ATOM   4473  C  CA    . ALA A 1 589  ? -55.864 -82.818  13.484  1.00 101.83 ? 590  ALA A CA    1 
ATOM   4474  C  C     . ALA A 1 589  ? -55.995 -83.576  12.162  1.00 102.15 ? 590  ALA A C     1 
ATOM   4475  O  O     . ALA A 1 589  ? -56.742 -84.569  12.141  1.00 102.40 ? 590  ALA A O     1 
ATOM   4476  C  CB    . ALA A 1 589  ? -54.547 -83.050  14.174  1.00 101.86 ? 590  ALA A CB    1 
ATOM   4477  N  N     . TYR A 1 590  ? -55.405 -83.129  11.069  1.00 102.12 ? 591  TYR A N     1 
ATOM   4478  C  CA    . TYR A 1 590  ? -55.584 -83.760  9.765   1.00 102.00 ? 591  TYR A CA    1 
ATOM   4479  C  C     . TYR A 1 590  ? -56.937 -83.325  9.185   1.00 102.27 ? 591  TYR A C     1 
ATOM   4480  O  O     . TYR A 1 590  ? -57.673 -82.566  9.821   1.00 102.61 ? 591  TYR A O     1 
ATOM   4481  C  CB    . TYR A 1 590  ? -55.466 -85.277  9.749   1.00 101.63 ? 591  TYR A CB    1 
ATOM   4482  C  CG    . TYR A 1 590  ? -54.126 -85.840  10.155  1.00 101.27 ? 591  TYR A CG    1 
ATOM   4483  C  CD1   . TYR A 1 590  ? -52.957 -85.448  9.522   1.00 101.06 ? 591  TYR A CD1   1 
ATOM   4484  C  CD2   . TYR A 1 590  ? -54.037 -86.779  11.177  1.00 101.31 ? 591  TYR A CD2   1 
ATOM   4485  C  CE1   . TYR A 1 590  ? -51.736 -85.970  9.904   1.00 101.27 ? 591  TYR A CE1   1 
ATOM   4486  C  CE2   . TYR A 1 590  ? -52.820 -87.308  11.568  1.00 101.29 ? 591  TYR A CE2   1 
ATOM   4487  C  CZ    . TYR A 1 590  ? -51.671 -86.898  10.925  1.00 101.39 ? 591  TYR A CZ    1 
ATOM   4488  O  OH    . TYR A 1 590  ? -50.449 -87.413  11.298  1.00 101.11 ? 591  TYR A OH    1 
ATOM   4489  N  N     . GLY A 1 591  ? -57.267 -83.793  7.985   1.00 102.24 ? 592  GLY A N     1 
ATOM   4490  C  CA    . GLY A 1 591  ? -58.501 -83.353  7.319   1.00 102.26 ? 592  GLY A CA    1 
ATOM   4491  C  C     . GLY A 1 591  ? -58.119 -82.109  6.500   1.00 102.64 ? 592  GLY A C     1 
ATOM   4492  O  O     . GLY A 1 591  ? -58.893 -81.362  5.924   1.00 102.63 ? 592  GLY A O     1 
ATOM   4493  N  N     . LYS A 1 592  ? -56.811 -81.888  6.475   1.00 102.89 ? 593  LYS A N     1 
ATOM   4494  C  CA    . LYS A 1 592  ? -56.112 -80.816  5.810   1.00 102.72 ? 593  LYS A CA    1 
ATOM   4495  C  C     . LYS A 1 592  ? -56.241 -80.904  4.291   1.00 102.64 ? 593  LYS A C     1 
ATOM   4496  O  O     . LYS A 1 592  ? -56.886 -80.048  3.681   1.00 102.94 ? 593  LYS A O     1 
ATOM   4497  C  CB    . LYS A 1 592  ? -54.616 -80.855  6.170   1.00 102.94 ? 593  LYS A CB    1 
ATOM   4498  C  CG    . LYS A 1 592  ? -54.085 -82.240  6.523   1.00 102.77 ? 593  LYS A CG    1 
ATOM   4499  C  CD    . LYS A 1 592  ? -52.796 -82.574  5.790   1.00 102.52 ? 593  LYS A CD    1 
ATOM   4500  C  CE    . LYS A 1 592  ? -51.824 -83.329  6.681   1.00 102.39 ? 593  LYS A CE    1 
ATOM   4501  N  NZ    . LYS A 1 592  ? -51.586 -82.616  7.966   1.00 102.52 ? 593  LYS A NZ    1 
ATOM   4502  N  N     . LYS A 1 593  ? -55.628 -81.942  3.718   1.00 102.26 ? 594  LYS A N     1 
ATOM   4503  C  CA    . LYS A 1 593  ? -55.708 -82.091  2.266   1.00 102.26 ? 594  LYS A CA    1 
ATOM   4504  C  C     . LYS A 1 593  ? -56.527 -83.322  1.894   1.00 102.13 ? 594  LYS A C     1 
ATOM   4505  O  O     . LYS A 1 593  ? -56.017 -84.291  1.334   1.00 102.37 ? 594  LYS A O     1 
ATOM   4506  C  CB    . LYS A 1 593  ? -54.333 -82.103  1.604   1.00 102.40 ? 594  LYS A CB    1 
ATOM   4507  C  CG    . LYS A 1 593  ? -54.220 -81.208  0.375   1.00 102.55 ? 594  LYS A CG    1 
ATOM   4508  C  CD    . LYS A 1 593  ? -53.008 -81.540  -0.479  1.00 102.41 ? 594  LYS A CD    1 
ATOM   4509  C  CE    . LYS A 1 593  ? -53.376 -82.085  -1.853  1.00 102.42 ? 594  LYS A CE    1 
ATOM   4510  N  NZ    . LYS A 1 593  ? -52.295 -82.952  -2.411  1.00 101.95 ? 594  LYS A NZ    1 
ATOM   4511  N  N     . GLY A 1 594  ? -57.819 -83.278  2.212   1.00 101.70 ? 595  GLY A N     1 
ATOM   4512  C  CA    . GLY A 1 594  ? -58.750 -84.327  1.876   1.00 100.84 ? 595  GLY A CA    1 
ATOM   4513  C  C     . GLY A 1 594  ? -58.927 -85.455  2.870   1.00 100.35 ? 595  GLY A C     1 
ATOM   4514  O  O     . GLY A 1 594  ? -58.293 -85.544  3.921   1.00 100.28 ? 595  GLY A O     1 
ATOM   4515  N  N     . GLU A 1 595  ? -59.841 -86.358  2.511   1.00 99.68  ? 596  GLU A N     1 
ATOM   4516  C  CA    . GLU A 1 595  ? -60.188 -87.533  3.292   1.00 98.73  ? 596  GLU A CA    1 
ATOM   4517  C  C     . GLU A 1 595  ? -59.290 -88.714  2.929   1.00 97.51  ? 596  GLU A C     1 
ATOM   4518  O  O     . GLU A 1 595  ? -59.410 -89.801  3.489   1.00 97.62  ? 596  GLU A O     1 
ATOM   4519  C  CB    . GLU A 1 595  ? -61.642 -87.944  3.041   1.00 99.46  ? 596  GLU A CB    1 
ATOM   4520  C  CG    . GLU A 1 595  ? -62.639 -87.605  4.129   1.00 100.08 ? 596  GLU A CG    1 
ATOM   4521  C  CD    . GLU A 1 595  ? -62.587 -88.537  5.323   1.00 100.57 ? 596  GLU A CD    1 
ATOM   4522  O  OE1   . GLU A 1 595  ? -62.196 -89.717  5.180   1.00 100.91 ? 596  GLU A OE1   1 
ATOM   4523  O  OE2   . GLU A 1 595  ? -62.951 -88.073  6.427   1.00 100.60 ? 596  GLU A OE2   1 
ATOM   4524  N  N     . LYS A 1 596  ? -58.387 -88.506  1.975   1.00 95.95  ? 597  LYS A N     1 
ATOM   4525  C  CA    . LYS A 1 596  ? -57.472 -89.567  1.553   1.00 94.46  ? 597  LYS A CA    1 
ATOM   4526  C  C     . LYS A 1 596  ? -56.367 -89.722  2.593   1.00 93.04  ? 597  LYS A C     1 
ATOM   4527  O  O     . LYS A 1 596  ? -55.973 -90.830  2.940   1.00 92.90  ? 597  LYS A O     1 
ATOM   4528  C  CB    . LYS A 1 596  ? -56.902 -89.272  0.169   1.00 94.70  ? 597  LYS A CB    1 
ATOM   4529  C  CG    . LYS A 1 596  ? -56.046 -90.371  -0.450  1.00 94.88  ? 597  LYS A CG    1 
ATOM   4530  C  CD    . LYS A 1 596  ? -54.843 -89.781  -1.169  1.00 95.10  ? 597  LYS A CD    1 
ATOM   4531  C  CE    . LYS A 1 596  ? -53.895 -90.822  -1.731  1.00 95.14  ? 597  LYS A CE    1 
ATOM   4532  N  NZ    . LYS A 1 596  ? -52.496 -90.318  -1.856  1.00 95.28  ? 597  LYS A NZ    1 
ATOM   4533  N  N     . ILE A 1 597  ? -55.914 -88.587  3.115   1.00 91.45  ? 598  ILE A N     1 
ATOM   4534  C  CA    . ILE A 1 597  ? -54.869 -88.543  4.133   1.00 89.64  ? 598  ILE A CA    1 
ATOM   4535  C  C     . ILE A 1 597  ? -55.416 -88.985  5.483   1.00 88.25  ? 598  ILE A C     1 
ATOM   4536  O  O     . ILE A 1 597  ? -54.678 -89.497  6.324   1.00 88.52  ? 598  ILE A O     1 
ATOM   4537  C  CB    . ILE A 1 597  ? -54.249 -87.135  4.210   1.00 89.72  ? 598  ILE A CB    1 
ATOM   4538  C  CG1   . ILE A 1 597  ? -53.863 -86.641  2.811   1.00 89.63  ? 598  ILE A CG1   1 
ATOM   4539  C  CG2   . ILE A 1 597  ? -53.050 -87.077  5.145   1.00 89.90  ? 598  ILE A CG2   1 
ATOM   4540  C  CD1   . ILE A 1 597  ? -52.880 -87.487  2.041   1.00 89.35  ? 598  ILE A CD1   1 
ATOM   4541  N  N     . VAL A 1 598  ? -56.722 -88.831  5.680   1.00 86.45  ? 599  VAL A N     1 
ATOM   4542  C  CA    . VAL A 1 598  ? -57.358 -89.246  6.928   1.00 84.98  ? 599  VAL A CA    1 
ATOM   4543  C  C     . VAL A 1 598  ? -57.588 -90.755  6.902   1.00 83.70  ? 599  VAL A C     1 
ATOM   4544  O  O     . VAL A 1 598  ? -57.548 -91.459  7.905   1.00 83.24  ? 599  VAL A O     1 
ATOM   4545  C  CB    . VAL A 1 598  ? -58.698 -88.539  7.184   1.00 85.20  ? 599  VAL A CB    1 
ATOM   4546  C  CG1   . VAL A 1 598  ? -59.139 -88.737  8.627   1.00 85.11  ? 599  VAL A CG1   1 
ATOM   4547  C  CG2   . VAL A 1 598  ? -58.615 -87.055  6.854   1.00 85.35  ? 599  VAL A CG2   1 
ATOM   4548  N  N     . LYS A 1 599  ? -57.808 -91.261  5.693   1.00 82.70  ? 600  LYS A N     1 
ATOM   4549  C  CA    . LYS A 1 599  ? -58.019 -92.697  5.482   1.00 81.46  ? 600  LYS A CA    1 
ATOM   4550  C  C     . LYS A 1 599  ? -56.672 -93.416  5.472   1.00 79.76  ? 600  LYS A C     1 
ATOM   4551  O  O     . LYS A 1 599  ? -56.524 -94.511  6.009   1.00 79.19  ? 600  LYS A O     1 
ATOM   4552  C  CB    . LYS A 1 599  ? -58.803 -92.904  4.199   1.00 82.12  ? 600  LYS A CB    1 
ATOM   4553  C  CG    . LYS A 1 599  ? -59.088 -94.290  3.699   1.00 83.13  ? 600  LYS A CG    1 
ATOM   4554  C  CD    . LYS A 1 599  ? -59.563 -95.295  4.721   1.00 83.98  ? 600  LYS A CD    1 
ATOM   4555  C  CE    . LYS A 1 599  ? -60.899 -94.976  5.363   1.00 84.57  ? 600  LYS A CE    1 
ATOM   4556  N  NZ    . LYS A 1 599  ? -61.206 -95.879  6.513   1.00 85.14  ? 600  LYS A NZ    1 
ATOM   4557  N  N     . MET A 1 600  ? -55.680 -92.765  4.873   1.00 78.60  ? 601  MET A N     1 
ATOM   4558  C  CA    . MET A 1 600  ? -54.333 -93.325  4.812   1.00 76.23  ? 601  MET A CA    1 
ATOM   4559  C  C     . MET A 1 600  ? -53.891 -93.910  6.555   0.00 36.29  ? 601  MET A C     1 
ATOM   4560  O  O     . MET A 1 600  ? -53.418 -94.718  6.520   1.00 72.12  ? 601  MET A O     1 
ATOM   4561  C  CB    . MET A 1 600  ? -53.259 -92.949  4.361   0.00 36.03  ? 601  MET A CB    1 
ATOM   4562  C  CG    . MET A 1 600  ? -53.501 -92.719  2.883   0.00 35.28  ? 601  MET A CG    1 
ATOM   4563  S  SD    . MET A 1 600  ? -52.229 -91.626  2.197   0.00 34.30  ? 601  MET A SD    1 
ATOM   4564  C  CE    . MET A 1 600  ? -51.825 -92.441  0.630   0.00 34.28  ? 601  MET A CE    1 
ATOM   4565  N  N     . ASN A 1 601  ? -54.362 -92.800  7.199   1.00 71.36  ? 602  ASN A N     1 
ATOM   4566  C  CA    . ASN A 1 601  ? -53.858 -92.879  8.564   1.00 70.47  ? 602  ASN A CA    1 
ATOM   4567  C  C     . ASN A 1 601  ? -54.679 -93.846  9.404   1.00 70.35  ? 602  ASN A C     1 
ATOM   4568  O  O     . ASN A 1 601  ? -54.143 -94.635  10.180  1.00 69.86  ? 602  ASN A O     1 
ATOM   4569  C  CB    . ASN A 1 601  ? -53.847 -91.489  9.201   1.00 70.32  ? 602  ASN A CB    1 
ATOM   4570  C  CG    . ASN A 1 601  ? -52.546 -90.745  8.974   1.00 70.11  ? 602  ASN A CG    1 
ATOM   4571  O  OD1   . ASN A 1 601  ? -52.543 -89.790  8.194   1.00 70.04  ? 602  ASN A OD1   1 
ATOM   4572  N  ND2   . ASN A 1 601  ? -51.470 -91.169  9.626   1.00 69.58  ? 602  ASN A ND2   1 
ATOM   4573  N  N     . THR A 1 602  ? -55.997 -93.814  9.235   1.00 70.42  ? 603  THR A N     1 
ATOM   4574  C  CA    . THR A 1 602  ? -56.922 -94.677  9.970   1.00 70.51  ? 603  THR A CA    1 
ATOM   4575  C  C     . THR A 1 602  ? -56.700 -96.145  9.637   1.00 70.03  ? 603  THR A C     1 
ATOM   4576  O  O     . THR A 1 602  ? -56.820 -97.021  10.496  1.00 69.95  ? 603  THR A O     1 
ATOM   4577  C  CB    . THR A 1 602  ? -58.383 -94.263  9.724   1.00 70.94  ? 603  THR A CB    1 
ATOM   4578  O  OG1   . THR A 1 602  ? -58.558 -92.944  10.272  1.00 71.06  ? 603  THR A OG1   1 
ATOM   4579  C  CG2   . THR A 1 602  ? -59.407 -95.163  10.393  1.00 70.99  ? 603  THR A CG2   1 
ATOM   4580  N  N     . ASP A 1 603  ? -56.312 -96.415  8.394   1.00 69.08  ? 604  ASP A N     1 
ATOM   4581  C  CA    . ASP A 1 603  ? -56.005 -97.785  7.988   1.00 68.33  ? 604  ASP A CA    1 
ATOM   4582  C  C     . ASP A 1 603  ? -54.726 -98.281  8.649   1.00 66.09  ? 604  ASP A C     1 
ATOM   4583  O  O     . ASP A 1 603  ? -54.595 -99.439  9.047   1.00 66.23  ? 604  ASP A O     1 
ATOM   4584  C  CB    . ASP A 1 603  ? -55.885 -97.856  6.465   1.00 69.74  ? 604  ASP A CB    1 
ATOM   4585  C  CG    . ASP A 1 603  ? -57.226 -97.832  5.752   1.00 70.99  ? 604  ASP A CG    1 
ATOM   4586  O  OD1   . ASP A 1 603  ? -57.199 -98.070  4.518   1.00 71.91  ? 604  ASP A OD1   1 
ATOM   4587  O  OD2   . ASP A 1 603  ? -58.279 -97.580  6.379   1.00 71.14  ? 604  ASP A OD2   1 
ATOM   4588  N  N     . ALA A 1 604  ? -53.771 -97.371  8.823   1.00 63.39  ? 605  ALA A N     1 
ATOM   4589  C  CA    . ALA A 1 604  ? -52.489 -97.705  9.448   1.00 61.28  ? 605  ALA A CA    1 
ATOM   4590  C  C     . ALA A 1 604  ? -52.727 -98.217  10.864  1.00 59.73  ? 605  ALA A C     1 
ATOM   4591  O  O     . ALA A 1 604  ? -52.216 -99.257  11.267  1.00 59.14  ? 605  ALA A O     1 
ATOM   4592  C  CB    . ALA A 1 604  ? -51.568 -96.493  9.437   1.00 61.87  ? 605  ALA A CB    1 
ATOM   4593  N  N     . VAL A 1 605  ? -53.633 -97.542  11.560  1.00 58.13  ? 606  VAL A N     1 
ATOM   4594  C  CA    . VAL A 1 605  ? -54.032 -97.897  12.916  1.00 57.87  ? 606  VAL A CA    1 
ATOM   4595  C  C     . VAL A 1 605  ? -54.639 -99.292  12.939  1.00 58.00  ? 606  VAL A C     1 
ATOM   4596  O  O     . VAL A 1 605  ? -54.262 -100.173 13.702  1.00 57.78  ? 606  VAL A O     1 
ATOM   4597  C  CB    . VAL A 1 605  ? -55.032 -96.859  13.456  1.00 57.46  ? 606  VAL A CB    1 
ATOM   4598  C  CG1   . VAL A 1 605  ? -55.417 -97.056  14.910  1.00 56.79  ? 606  VAL A CG1   1 
ATOM   4599  C  CG2   . VAL A 1 605  ? -54.434 -95.463  13.258  1.00 58.16  ? 606  VAL A CG2   1 
ATOM   4600  N  N     . ASP A 1 606  ? -55.556 -99.510  11.998  1.00 59.25  ? 607  ASP A N     1 
ATOM   4601  C  CA    . ASP A 1 606  ? -56.269 -100.770 11.842  1.00 59.35  ? 607  ASP A CA    1 
ATOM   4602  C  C     . ASP A 1 606  ? -55.335 -101.942 11.578  1.00 58.88  ? 607  ASP A C     1 
ATOM   4603  O  O     . ASP A 1 606  ? -55.357 -102.930 12.315  1.00 58.51  ? 607  ASP A O     1 
ATOM   4604  C  CB    . ASP A 1 606  ? -57.305 -100.625 10.722  1.00 59.66  ? 607  ASP A CB    1 
ATOM   4605  C  CG    . ASP A 1 606  ? -58.518 -99.849  11.216  1.00 60.41  ? 607  ASP A CG    1 
ATOM   4606  O  OD1   . ASP A 1 606  ? -59.022 -98.991  10.451  1.00 61.58  ? 607  ASP A OD1   1 
ATOM   4607  O  OD2   . ASP A 1 606  ? -58.973 -100.097 12.355  1.00 59.18  ? 607  ASP A OD2   1 
ATOM   4608  N  N     . GLN A 1 607  ? -54.430 -101.783 10.609  1.00 58.92  ? 608  GLN A N     1 
ATOM   4609  C  CA    . GLN A 1 607  ? -53.452 -102.835 10.340  1.00 59.54  ? 608  GLN A CA    1 
ATOM   4610  C  C     . GLN A 1 607  ? -52.502 -103.020 11.516  1.00 58.73  ? 608  GLN A C     1 
ATOM   4611  O  O     . GLN A 1 607  ? -52.205 -104.136 11.941  1.00 57.74  ? 608  GLN A O     1 
ATOM   4612  C  CB    . GLN A 1 607  ? -52.664 -102.559 9.059   1.00 61.71  ? 608  GLN A CB    1 
ATOM   4613  C  CG    . GLN A 1 607  ? -52.214 -103.854 8.387   1.00 64.20  ? 608  GLN A CG    1 
ATOM   4614  C  CD    . GLN A 1 607  ? -51.752 -103.644 6.964   1.00 65.58  ? 608  GLN A CD    1 
ATOM   4615  O  OE1   . GLN A 1 607  ? -52.516 -103.177 6.111   1.00 67.11  ? 608  GLN A OE1   1 
ATOM   4616  N  NE2   . GLN A 1 607  ? -50.488 -103.986 6.717   1.00 66.05  ? 608  GLN A NE2   1 
ATOM   4617  N  N     . ALA A 1 608  ? -52.101 -101.902 12.130  1.00 58.06  ? 609  ALA A N     1 
ATOM   4618  C  CA    . ALA A 1 608  ? -51.200 -101.970 13.285  1.00 57.22  ? 609  ALA A CA    1 
ATOM   4619  C  C     . ALA A 1 608  ? -51.824 -102.728 14.445  1.00 55.83  ? 609  ALA A C     1 
ATOM   4620  O  O     . ALA A 1 608  ? -51.184 -103.644 14.958  1.00 55.36  ? 609  ALA A O     1 
ATOM   4621  C  CB    . ALA A 1 608  ? -50.731 -100.569 13.655  1.00 56.59  ? 609  ALA A CB    1 
ATOM   4622  N  N     . VAL A 1 609  ? -53.067 -102.442 14.818  1.00 56.64  ? 610  VAL A N     1 
ATOM   4623  C  CA    . VAL A 1 609  ? -53.734 -103.153 15.909  1.00 58.19  ? 610  VAL A CA    1 
ATOM   4624  C  C     . VAL A 1 609  ? -53.776 -104.666 15.640  1.00 59.00  ? 610  VAL A C     1 
ATOM   4625  O  O     . VAL A 1 609  ? -53.616 -105.519 16.514  1.00 58.38  ? 610  VAL A O     1 
ATOM   4626  C  CB    . VAL A 1 609  ? -55.164 -102.636 16.151  1.00 58.73  ? 610  VAL A CB    1 
ATOM   4627  C  CG1   . VAL A 1 609  ? -55.790 -103.244 17.405  1.00 58.76  ? 610  VAL A CG1   1 
ATOM   4628  C  CG2   . VAL A 1 609  ? -55.228 -101.122 16.300  1.00 58.75  ? 610  VAL A CG2   1 
ATOM   4629  N  N     . THR A 1 610  ? -53.939 -105.004 14.357  1.00 59.54  ? 611  THR A N     1 
ATOM   4630  C  CA    . THR A 1 610  ? -53.998 -106.402 13.925  1.00 61.29  ? 611  THR A CA    1 
ATOM   4631  C  C     . THR A 1 610  ? -52.616 -107.043 14.066  1.00 60.71  ? 611  THR A C     1 
ATOM   4632  O  O     . THR A 1 610  ? -52.471 -108.150 14.592  1.00 60.15  ? 611  THR A O     1 
ATOM   4633  C  CB    . THR A 1 610  ? -54.537 -106.513 12.488  1.00 62.05  ? 611  THR A CB    1 
ATOM   4634  O  OG1   . THR A 1 610  ? -55.951 -106.218 12.482  1.00 63.25  ? 611  THR A OG1   1 
ATOM   4635  C  CG2   . THR A 1 610  ? -54.383 -107.877 11.843  1.00 62.74  ? 611  THR A CG2   1 
ATOM   4636  N  N     . SER A 1 611  ? -51.608 -106.306 13.612  1.00 60.37  ? 612  SER A N     1 
ATOM   4637  C  CA    . SER A 1 611  ? -50.245 -106.808 13.625  1.00 61.12  ? 612  SER A CA    1 
ATOM   4638  C  C     . SER A 1 611  ? -49.593 -106.795 14.996  1.00 61.30  ? 612  SER A C     1 
ATOM   4639  O  O     . SER A 1 611  ? -48.617 -107.527 15.210  1.00 61.37  ? 612  SER A O     1 
ATOM   4640  C  CB    . SER A 1 611  ? -49.392 -105.989 12.648  1.00 61.76  ? 612  SER A CB    1 
ATOM   4641  O  OG    . SER A 1 611  ? -50.178 -105.535 11.558  1.00 61.66  ? 612  SER A OG    1 
ATOM   4642  N  N     . LEU A 1 612  ? -50.112 -105.988 15.916  1.00 61.33  ? 613  LEU A N     1 
ATOM   4643  C  CA    . LEU A 1 612  ? -49.510 -105.897 17.240  1.00 61.37  ? 613  LEU A CA    1 
ATOM   4644  C  C     . LEU A 1 612  ? -49.790 -107.127 18.095  1.00 62.04  ? 613  LEU A C     1 
ATOM   4645  O  O     . LEU A 1 612  ? -50.561 -107.078 19.060  1.00 63.05  ? 613  LEU A O     1 
ATOM   4646  C  CB    . LEU A 1 612  ? -49.935 -104.628 17.956  1.00 61.25  ? 613  LEU A CB    1 
ATOM   4647  C  CG    . LEU A 1 612  ? -48.994 -103.446 18.145  1.00 61.74  ? 613  LEU A CG    1 
ATOM   4648  C  CD1   . LEU A 1 612  ? -47.612 -103.615 17.524  1.00 61.32  ? 613  LEU A CD1   1 
ATOM   4649  C  CD2   . LEU A 1 612  ? -49.663 -102.171 17.630  1.00 61.16  ? 613  LEU A CD2   1 
ATOM   4650  N  N     . GLN A 1 613  ? -49.147 -108.243 17.754  1.00 61.03  ? 614  GLN A N     1 
ATOM   4651  C  CA    . GLN A 1 613  ? -49.292 -109.456 18.547  1.00 60.75  ? 614  GLN A CA    1 
ATOM   4652  C  C     . GLN A 1 613  ? -47.955 -109.786 19.216  1.00 60.61  ? 614  GLN A C     1 
ATOM   4653  O  O     . GLN A 1 613  ? -46.891 -109.575 18.633  1.00 59.76  ? 614  GLN A O     1 
ATOM   4654  C  CB    . GLN A 1 613  ? -49.758 -110.666 17.748  1.00 60.54  ? 614  GLN A CB    1 
ATOM   4655  C  CG    . GLN A 1 613  ? -51.040 -110.617 16.962  1.00 60.58  ? 614  GLN A CG    1 
ATOM   4656  C  CD    . GLN A 1 613  ? -52.232 -110.041 17.688  1.00 60.59  ? 614  GLN A CD    1 
ATOM   4657  O  OE1   . GLN A 1 613  ? -52.441 -110.388 18.852  1.00 60.43  ? 614  GLN A OE1   1 
ATOM   4658  N  NE2   . GLN A 1 613  ? -53.011 -109.177 17.042  1.00 60.38  ? 614  GLN A NE2   1 
ATOM   4659  N  N     . GLU A 1 614  ? -47.998 -110.371 20.408  1.00 60.96  ? 615  GLU A N     1 
ATOM   4660  C  CA    . GLU A 1 614  ? -46.802 -110.772 21.132  1.00 63.03  ? 615  GLU A CA    1 
ATOM   4661  C  C     . GLU A 1 614  ? -45.839 -111.637 20.328  1.00 64.22  ? 615  GLU A C     1 
ATOM   4662  O  O     . GLU A 1 614  ? -46.284 -112.558 19.637  1.00 64.38  ? 615  GLU A O     1 
ATOM   4663  C  CB    . GLU A 1 614  ? -47.226 -111.563 22.374  1.00 63.29  ? 615  GLU A CB    1 
ATOM   4664  C  CG    . GLU A 1 614  ? -46.146 -111.762 23.412  1.00 64.28  ? 615  GLU A CG    1 
ATOM   4665  C  CD    . GLU A 1 614  ? -46.640 -111.793 24.841  1.00 64.91  ? 615  GLU A CD    1 
ATOM   4666  O  OE1   . GLU A 1 614  ? -45.822 -112.121 25.734  1.00 65.38  ? 615  GLU A OE1   1 
ATOM   4667  O  OE2   . GLU A 1 614  ? -47.828 -111.500 25.095  1.00 65.05  ? 615  GLU A OE2   1 
ATOM   4668  N  N     . PHE A 1 615  ? -44.544 -111.356 20.385  1.00 65.26  ? 616  PHE A N     1 
ATOM   4669  C  CA    . PHE A 1 615  ? -43.542 -112.161 19.681  1.00 66.67  ? 616  PHE A CA    1 
ATOM   4670  C  C     . PHE A 1 615  ? -43.243 -113.359 20.589  1.00 68.17  ? 616  PHE A C     1 
ATOM   4671  O  O     . PHE A 1 615  ? -43.006 -113.137 21.780  1.00 68.63  ? 616  PHE A O     1 
ATOM   4672  C  CB    . PHE A 1 615  ? -42.276 -111.386 19.362  1.00 65.43  ? 616  PHE A CB    1 
ATOM   4673  C  CG    . PHE A 1 615  ? -41.235 -112.043 18.506  1.00 64.92  ? 616  PHE A CG    1 
ATOM   4674  C  CD1   . PHE A 1 615  ? -41.167 -111.772 17.146  1.00 65.08  ? 616  PHE A CD1   1 
ATOM   4675  C  CD2   . PHE A 1 615  ? -40.306 -112.924 19.038  1.00 64.15  ? 616  PHE A CD2   1 
ATOM   4676  C  CE1   . PHE A 1 615  ? -40.213 -112.366 16.340  1.00 64.45  ? 616  PHE A CE1   1 
ATOM   4677  C  CE2   . PHE A 1 615  ? -39.351 -113.523 18.239  1.00 63.69  ? 616  PHE A CE2   1 
ATOM   4678  C  CZ    . PHE A 1 615  ? -39.305 -113.246 16.891  1.00 63.82  ? 616  PHE A CZ    1 
ATOM   4679  N  N     . LYS A 1 616  ? -43.300 -114.571 20.040  1.00 70.04  ? 617  LYS A N     1 
ATOM   4680  C  CA    . LYS A 1 616  ? -43.063 -115.727 20.912  1.00 71.37  ? 617  LYS A CA    1 
ATOM   4681  C  C     . LYS A 1 616  ? -41.634 -116.233 20.802  1.00 71.80  ? 617  LYS A C     1 
ATOM   4682  O  O     . LYS A 1 616  ? -41.206 -116.871 19.845  1.00 72.24  ? 617  LYS A O     1 
ATOM   4683  C  CB    . LYS A 1 616  ? -44.106 -116.815 20.684  1.00 72.33  ? 617  LYS A CB    1 
ATOM   4684  C  CG    . LYS A 1 616  ? -45.297 -116.682 21.638  1.00 73.78  ? 617  LYS A CG    1 
ATOM   4685  C  CD    . LYS A 1 616  ? -44.859 -116.656 23.093  1.00 74.49  ? 617  LYS A CD    1 
ATOM   4686  C  CE    . LYS A 1 616  ? -45.989 -116.450 24.074  1.00 74.96  ? 617  LYS A CE    1 
ATOM   4687  N  NZ    . LYS A 1 616  ? -46.855 -115.287 23.743  1.00 75.04  ? 617  LYS A NZ    1 
ATOM   4688  N  N     . TYR A 1 617  ? -40.865 -115.906 21.837  1.00 71.63  ? 618  TYR A N     1 
ATOM   4689  C  CA    . TYR A 1 617  ? -39.461 -116.274 21.889  1.00 71.94  ? 618  TYR A CA    1 
ATOM   4690  C  C     . TYR A 1 617  ? -39.244 -117.556 22.682  1.00 72.67  ? 618  TYR A C     1 
ATOM   4691  O  O     . TYR A 1 617  ? -39.839 -117.765 23.742  1.00 71.73  ? 618  TYR A O     1 
ATOM   4692  C  CB    . TYR A 1 617  ? -38.652 -115.120 22.485  1.00 70.91  ? 618  TYR A CB    1 
ATOM   4693  C  CG    . TYR A 1 617  ? -39.140 -114.607 23.818  1.00 71.18  ? 618  TYR A CG    1 
ATOM   4694  C  CD1   . TYR A 1 617  ? -38.674 -115.138 25.013  1.00 71.02  ? 618  TYR A CD1   1 
ATOM   4695  C  CD2   . TYR A 1 617  ? -40.075 -113.579 23.881  1.00 70.96  ? 618  TYR A CD2   1 
ATOM   4696  C  CE1   . TYR A 1 617  ? -39.129 -114.663 26.230  1.00 71.32  ? 618  TYR A CE1   1 
ATOM   4697  C  CE2   . TYR A 1 617  ? -40.530 -113.094 25.090  1.00 70.67  ? 618  TYR A CE2   1 
ATOM   4698  C  CZ    . TYR A 1 617  ? -40.051 -113.638 26.258  1.00 71.10  ? 618  TYR A CZ    1 
ATOM   4699  O  OH    . TYR A 1 617  ? -40.500 -113.166 27.469  1.00 71.26  ? 618  TYR A OH    1 
ATOM   4700  N  N     . PRO A 1 618  ? -38.318 -118.386 22.211  1.00 73.47  ? 619  PRO A N     1 
ATOM   4701  C  CA    . PRO A 1 618  ? -37.931 -119.609 22.886  1.00 74.11  ? 619  PRO A CA    1 
ATOM   4702  C  C     . PRO A 1 618  ? -37.252 -119.353 24.225  1.00 74.98  ? 619  PRO A C     1 
ATOM   4703  O  O     . PRO A 1 618  ? -36.728 -118.262 24.458  1.00 75.12  ? 619  PRO A O     1 
ATOM   4704  C  CB    . PRO A 1 618  ? -36.958 -120.264 21.909  1.00 74.08  ? 619  PRO A CB    1 
ATOM   4705  C  CG    . PRO A 1 618  ? -36.395 -119.134 21.113  1.00 73.68  ? 619  PRO A CG    1 
ATOM   4706  C  CD    . PRO A 1 618  ? -37.537 -118.164 20.962  1.00 73.52  ? 619  PRO A CD    1 
ATOM   4707  N  N     . ASP A 1 619  ? -37.210 -120.357 25.090  1.00 76.08  ? 620  ASP A N     1 
ATOM   4708  C  CA    . ASP A 1 619  ? -36.607 -120.255 26.405  1.00 76.91  ? 620  ASP A CA    1 
ATOM   4709  C  C     . ASP A 1 619  ? -35.099 -120.074 26.391  1.00 76.25  ? 620  ASP A C     1 
ATOM   4710  O  O     . ASP A 1 619  ? -34.473 -119.543 27.304  1.00 75.87  ? 620  ASP A O     1 
ATOM   4711  C  CB    . ASP A 1 619  ? -36.933 -121.533 27.210  1.00 78.72  ? 620  ASP A CB    1 
ATOM   4712  C  CG    . ASP A 1 619  ? -37.110 -121.172 28.681  1.00 79.80  ? 620  ASP A CG    1 
ATOM   4713  O  OD1   . ASP A 1 619  ? -37.921 -120.251 28.926  1.00 80.26  ? 620  ASP A OD1   1 
ATOM   4714  O  OD2   . ASP A 1 619  ? -36.448 -121.787 29.538  1.00 80.56  ? 620  ASP A OD2   1 
ATOM   4715  N  N     . SER A 1 620  ? -34.482 -120.549 25.322  1.00 76.03  ? 621  SER A N     1 
ATOM   4716  C  CA    . SER A 1 620  ? -33.052 -120.505 25.093  1.00 75.43  ? 621  SER A CA    1 
ATOM   4717  C  C     . SER A 1 620  ? -32.460 -119.112 25.254  1.00 75.30  ? 621  SER A C     1 
ATOM   4718  O  O     . SER A 1 620  ? -31.308 -118.933 25.654  1.00 75.33  ? 621  SER A O     1 
ATOM   4719  C  CB    . SER A 1 620  ? -32.756 -121.021 23.681  1.00 75.53  ? 621  SER A CB    1 
ATOM   4720  O  OG    . SER A 1 620  ? -33.909 -121.410 22.963  1.00 74.85  ? 621  SER A OG    1 
ATOM   4721  N  N     . TRP A 1 621  ? -33.279 -118.100 24.987  1.00 74.50  ? 622  TRP A N     1 
ATOM   4722  C  CA    . TRP A 1 621  ? -32.871 -116.705 25.101  1.00 74.03  ? 622  TRP A CA    1 
ATOM   4723  C  C     . TRP A 1 621  ? -32.343 -116.412 26.498  1.00 75.24  ? 622  TRP A C     1 
ATOM   4724  O  O     . TRP A 1 621  ? -31.454 -115.593 26.711  1.00 76.18  ? 622  TRP A O     1 
ATOM   4725  C  CB    . TRP A 1 621  ? -34.052 -115.804 24.744  1.00 72.23  ? 622  TRP A CB    1 
ATOM   4726  C  CG    . TRP A 1 621  ? -34.320 -115.618 23.283  1.00 70.67  ? 622  TRP A CG    1 
ATOM   4727  C  CD1   . TRP A 1 621  ? -33.969 -116.454 22.267  1.00 70.33  ? 622  TRP A CD1   1 
ATOM   4728  C  CD2   . TRP A 1 621  ? -35.005 -114.514 22.670  1.00 70.34  ? 622  TRP A CD2   1 
ATOM   4729  N  NE1   . TRP A 1 621  ? -34.386 -115.947 21.061  1.00 70.19  ? 622  TRP A NE1   1 
ATOM   4730  C  CE2   . TRP A 1 621  ? -35.031 -114.756 21.282  1.00 70.28  ? 622  TRP A CE2   1 
ATOM   4731  C  CE3   . TRP A 1 621  ? -35.600 -113.343 23.158  1.00 69.88  ? 622  TRP A CE3   1 
ATOM   4732  C  CZ2   . TRP A 1 621  ? -35.621 -113.873 20.376  1.00 69.97  ? 622  TRP A CZ2   1 
ATOM   4733  C  CZ3   . TRP A 1 621  ? -36.186 -112.478 22.254  1.00 69.55  ? 622  TRP A CZ3   1 
ATOM   4734  C  CH2   . TRP A 1 621  ? -36.193 -112.740 20.878  1.00 68.98  ? 622  TRP A CH2   1 
ATOM   4735  N  N     . LYS A 1 622  ? -32.843 -117.167 27.471  1.00 76.78  ? 623  LYS A N     1 
ATOM   4736  C  CA    . LYS A 1 622  ? -32.456 -116.989 28.867  1.00 78.76  ? 623  LYS A CA    1 
ATOM   4737  C  C     . LYS A 1 622  ? -30.965 -117.231 29.066  1.00 79.89  ? 623  LYS A C     1 
ATOM   4738  O  O     . LYS A 1 622  ? -30.389 -116.964 30.121  1.00 80.56  ? 623  LYS A O     1 
ATOM   4739  C  CB    . LYS A 1 622  ? -33.278 -117.910 29.768  1.00 79.58  ? 623  LYS A CB    1 
ATOM   4740  C  CG    . LYS A 1 622  ? -34.628 -117.346 30.197  1.00 80.46  ? 623  LYS A CG    1 
ATOM   4741  C  CD    . LYS A 1 622  ? -35.548 -118.424 30.753  1.00 80.83  ? 623  LYS A CD    1 
ATOM   4742  C  CE    . LYS A 1 622  ? -36.222 -117.999 32.047  1.00 80.94  ? 623  LYS A CE    1 
ATOM   4743  N  NZ    . LYS A 1 622  ? -35.929 -118.937 33.169  1.00 80.39  ? 623  LYS A NZ    1 
ATOM   4744  N  N     . ASP A 1 623  ? -30.342 -117.735 28.002  1.00 81.01  ? 624  ASP A N     1 
ATOM   4745  C  CA    . ASP A 1 623  ? -28.914 -118.029 28.035  1.00 82.03  ? 624  ASP A CA    1 
ATOM   4746  C  C     . ASP A 1 623  ? -28.330 -118.013 26.628  1.00 82.41  ? 624  ASP A C     1 
ATOM   4747  O  O     . ASP A 1 623  ? -27.656 -118.928 26.161  1.00 81.91  ? 624  ASP A O     1 
ATOM   4748  C  CB    . ASP A 1 623  ? -28.606 -119.333 28.768  1.00 82.84  ? 624  ASP A CB    1 
ATOM   4749  C  CG    . ASP A 1 623  ? -29.464 -120.508 28.335  1.00 83.41  ? 624  ASP A CG    1 
ATOM   4750  O  OD1   . ASP A 1 623  ? -29.201 -121.082 27.252  1.00 83.23  ? 624  ASP A OD1   1 
ATOM   4751  O  OD2   . ASP A 1 623  ? -30.403 -120.853 29.089  1.00 83.69  ? 624  ASP A OD2   1 
ATOM   4752  N  N     . ALA A 1 624  ? -28.584 -116.897 25.940  1.00 83.28  ? 625  ALA A N     1 
ATOM   4753  C  CA    . ALA A 1 624  ? -28.024 -116.660 24.613  1.00 83.92  ? 625  ALA A CA    1 
ATOM   4754  C  C     . ALA A 1 624  ? -26.552 -116.293 24.820  1.00 84.56  ? 625  ALA A C     1 
ATOM   4755  O  O     . ALA A 1 624  ? -26.255 -115.480 25.693  1.00 84.92  ? 625  ALA A O     1 
ATOM   4756  C  CB    . ALA A 1 624  ? -28.735 -115.538 23.884  1.00 83.79  ? 625  ALA A CB    1 
ATOM   4757  N  N     . PRO A 1 625  ? -25.665 -116.922 24.076  1.00 85.53  ? 626  PRO A N     1 
ATOM   4758  C  CA    . PRO A 1 625  ? -24.238 -116.702 24.200  1.00 86.56  ? 626  PRO A CA    1 
ATOM   4759  C  C     . PRO A 1 625  ? -23.730 -115.346 23.751  1.00 87.73  ? 626  PRO A C     1 
ATOM   4760  O  O     . PRO A 1 625  ? -24.117 -114.812 22.711  1.00 87.33  ? 626  PRO A O     1 
ATOM   4761  C  CB    . PRO A 1 625  ? -23.640 -117.812 23.332  1.00 86.32  ? 626  PRO A CB    1 
ATOM   4762  C  CG    . PRO A 1 625  ? -24.696 -118.113 22.324  1.00 85.84  ? 626  PRO A CG    1 
ATOM   4763  C  CD    . PRO A 1 625  ? -26.004 -117.943 23.048  1.00 85.67  ? 626  PRO A CD    1 
ATOM   4764  N  N     . ALA A 1 626  ? -22.782 -114.786 24.503  1.00 89.46  ? 627  ALA A N     1 
ATOM   4765  C  CA    . ALA A 1 626  ? -22.171 -113.499 24.201  1.00 91.40  ? 627  ALA A CA    1 
ATOM   4766  C  C     . ALA A 1 626  ? -21.467 -113.490 22.847  1.00 93.09  ? 627  ALA A C     1 
ATOM   4767  O  O     . ALA A 1 626  ? -21.157 -114.556 22.306  1.00 93.55  ? 627  ALA A O     1 
ATOM   4768  C  CB    . ALA A 1 626  ? -21.181 -113.129 25.300  1.00 91.17  ? 627  ALA A CB    1 
ATOM   4769  N  N     . GLU A 1 627  ? -21.216 -112.304 22.301  1.00 94.85  ? 628  GLU A N     1 
ATOM   4770  C  CA    . GLU A 1 627  ? -20.582 -112.170 20.996  1.00 96.19  ? 628  GLU A CA    1 
ATOM   4771  C  C     . GLU A 1 627  ? -19.152 -111.646 21.069  1.00 96.92  ? 628  GLU A C     1 
ATOM   4772  O  O     . GLU A 1 627  ? -18.555 -111.536 22.137  1.00 96.79  ? 628  GLU A O     1 
ATOM   4773  C  CB    . GLU A 1 627  ? -21.430 -111.257 20.102  1.00 96.73  ? 628  GLU A CB    1 
ATOM   4774  C  CG    . GLU A 1 627  ? -21.707 -109.871 20.660  1.00 97.42  ? 628  GLU A CG    1 
ATOM   4775  C  CD    . GLU A 1 627  ? -21.895 -108.808 19.594  1.00 97.75  ? 628  GLU A CD    1 
ATOM   4776  O  OE1   . GLU A 1 627  ? -21.923 -109.132 18.386  1.00 97.74  ? 628  GLU A OE1   1 
ATOM   4777  O  OE2   . GLU A 1 627  ? -22.013 -107.622 19.980  1.00 97.99  ? 628  GLU A OE2   1 
ATOM   4778  N  N     . THR A 1 628  ? -18.617 -111.307 19.900  1.00 98.05  ? 629  THR A N     1 
ATOM   4779  C  CA    . THR A 1 628  ? -17.262 -110.783 19.765  1.00 98.94  ? 629  THR A CA    1 
ATOM   4780  C  C     . THR A 1 628  ? -17.246 -109.261 19.793  1.00 99.35  ? 629  THR A C     1 
ATOM   4781  O  O     . THR A 1 628  ? -18.231 -108.631 20.196  1.00 99.31  ? 629  THR A O     1 
ATOM   4782  C  CB    . THR A 1 628  ? -16.633 -111.327 18.465  1.00 98.99  ? 629  THR A CB    1 
ATOM   4783  O  OG1   . THR A 1 628  ? -17.504 -111.056 17.360  1.00 98.88  ? 629  THR A OG1   1 
ATOM   4784  C  CG2   . THR A 1 628  ? -16.437 -112.834 18.586  1.00 99.09  ? 629  THR A CG2   1 
ATOM   4785  N  N     . LYS A 1 629  ? -16.140 -108.649 19.381  1.00 99.90  ? 630  LYS A N     1 
ATOM   4786  C  CA    . LYS A 1 629  ? -16.011 -107.198 19.348  1.00 100.16 ? 630  LYS A CA    1 
ATOM   4787  C  C     . LYS A 1 629  ? -15.162 -106.748 18.164  1.00 100.20 ? 630  LYS A C     1 
ATOM   4788  O  O     . LYS A 1 629  ? -13.975 -106.440 18.298  1.00 100.11 ? 630  LYS A O     1 
ATOM   4789  C  CB    . LYS A 1 629  ? -15.445 -106.652 20.657  1.00 100.47 ? 630  LYS A CB    1 
ATOM   4790  C  CG    . LYS A 1 629  ? -14.268 -107.412 21.237  1.00 101.14 ? 630  LYS A CG    1 
ATOM   4791  C  CD    . LYS A 1 629  ? -13.033 -106.527 21.347  1.00 101.59 ? 630  LYS A CD    1 
ATOM   4792  C  CE    . LYS A 1 629  ? -11.859 -107.114 20.576  1.00 101.76 ? 630  LYS A CE    1 
ATOM   4793  N  NZ    . LYS A 1 629  ? -11.677 -108.565 20.884  1.00 101.75 ? 630  LYS A NZ    1 
ATOM   4794  N  N     . ALA A 1 630  ? -15.781 -106.708 16.985  1.00 100.13 ? 631  ALA A N     1 
ATOM   4795  C  CA    . ALA A 1 630  ? -15.088 -106.296 15.765  1.00 100.03 ? 631  ALA A CA    1 
ATOM   4796  C  C     . ALA A 1 630  ? -14.788 -104.800 15.769  1.00 99.51  ? 631  ALA A C     1 
ATOM   4797  O  O     . ALA A 1 630  ? -14.714 -104.115 14.748  1.00 99.73  ? 631  ALA A O     1 
ATOM   4798  C  CB    . ALA A 1 630  ? -15.882 -106.704 14.533  1.00 100.20 ? 631  ALA A CB    1 
ATOM   4799  N  N     . GLU A 1 631  ? -14.554 -104.277 16.974  1.00 98.61  ? 632  GLU A N     1 
ATOM   4800  C  CA    . GLU A 1 631  ? -14.246 -102.871 17.194  1.00 97.23  ? 632  GLU A CA    1 
ATOM   4801  C  C     . GLU A 1 631  ? -13.007 -102.438 16.426  1.00 95.43  ? 632  GLU A C     1 
ATOM   4802  O  O     . GLU A 1 631  ? -12.007 -103.157 16.401  1.00 96.07  ? 632  GLU A O     1 
ATOM   4803  C  CB    . GLU A 1 631  ? -14.039 -102.595 18.684  1.00 98.16  ? 632  GLU A CB    1 
ATOM   4804  C  CG    . GLU A 1 631  ? -13.102 -103.548 19.404  1.00 99.20  ? 632  GLU A CG    1 
ATOM   4805  C  CD    . GLU A 1 631  ? -11.663 -103.070 19.428  1.00 99.82  ? 632  GLU A CD    1 
ATOM   4806  O  OE1   . GLU A 1 631  ? -11.398 -102.012 20.037  1.00 100.46 ? 632  GLU A OE1   1 
ATOM   4807  O  OE2   . GLU A 1 631  ? -10.806 -103.747 18.819  1.00 99.96  ? 632  GLU A OE2   1 
ATOM   4808  N  N     . PRO A 1 632  ? -13.055 -101.266 15.820  1.00 93.28  ? 633  PRO A N     1 
ATOM   4809  C  CA    . PRO A 1 632  ? -11.933 -100.743 15.058  1.00 90.97  ? 633  PRO A CA    1 
ATOM   4810  C  C     . PRO A 1 632  ? -10.838 -100.231 15.979  1.00 88.28  ? 633  PRO A C     1 
ATOM   4811  O  O     . PRO A 1 632  ? -11.087 -100.090 17.183  1.00 87.89  ? 633  PRO A O     1 
ATOM   4812  C  CB    . PRO A 1 632  ? -12.551 -99.627  14.233  1.00 91.73  ? 633  PRO A CB    1 
ATOM   4813  C  CG    . PRO A 1 632  ? -13.994 -99.555  14.560  1.00 92.42  ? 633  PRO A CG    1 
ATOM   4814  C  CD    . PRO A 1 632  ? -14.221 -100.349 15.813  1.00 92.92  ? 633  PRO A CD    1 
ATOM   4815  N  N     . MET A 1 633  ? -9.652  -99.923  15.443  1.00 85.03  ? 634  MET A N     1 
ATOM   4816  C  CA    . MET A 1 633  ? -8.618  -99.331  16.302  1.00 81.46  ? 634  MET A CA    1 
ATOM   4817  C  C     . MET A 1 633  ? -9.060  -97.869  16.495  1.00 77.03  ? 634  MET A C     1 
ATOM   4818  O  O     . MET A 1 633  ? -9.567  -97.266  15.553  1.00 76.02  ? 634  MET A O     1 
ATOM   4819  C  CB    . MET A 1 633  ? -7.208  -99.442  15.778  1.00 83.41  ? 634  MET A CB    1 
ATOM   4820  C  CG    . MET A 1 633  ? -6.098  -98.773  16.557  1.00 85.38  ? 634  MET A CG    1 
ATOM   4821  S  SD    . MET A 1 633  ? -6.154  -98.938  18.349  1.00 87.85  ? 634  MET A SD    1 
ATOM   4822  C  CE    . MET A 1 633  ? -4.412  -98.908  18.786  1.00 87.23  ? 634  MET A CE    1 
ATOM   4823  N  N     . THR A 1 634  ? -8.993  -97.427  17.736  1.00 71.35  ? 635  THR A N     1 
ATOM   4824  C  CA    . THR A 1 634  ? -9.439  -96.055  18.047  1.00 66.26  ? 635  THR A CA    1 
ATOM   4825  C  C     . THR A 1 634  ? -8.337  -95.412  18.860  1.00 62.54  ? 635  THR A C     1 
ATOM   4826  O  O     . THR A 1 634  ? -7.168  -95.784  18.681  1.00 63.27  ? 635  THR A O     1 
ATOM   4827  C  CB    . THR A 1 634  ? -10.855 -96.182  18.613  1.00 65.82  ? 635  THR A CB    1 
ATOM   4828  O  OG1   . THR A 1 634  ? -11.700 -95.252  17.922  1.00 66.40  ? 635  THR A OG1   1 
ATOM   4829  C  CG2   . THR A 1 634  ? -11.044 -96.025  20.097  1.00 65.12  ? 635  THR A CG2   1 
ATOM   4830  N  N     . ASN A 1 635  ? -8.605  -94.476  19.725  1.00 56.46  ? 636  ASN A N     1 
ATOM   4831  C  CA    . ASN A 1 635  ? -7.688  -93.799  20.597  1.00 51.62  ? 636  ASN A CA    1 
ATOM   4832  C  C     . ASN A 1 635  ? -7.825  -94.375  22.005  1.00 46.36  ? 636  ASN A C     1 
ATOM   4833  O  O     . ASN A 1 635  ? -8.819  -95.042  22.247  1.00 45.16  ? 636  ASN A O     1 
ATOM   4834  C  CB    . ASN A 1 635  ? -8.129  -92.304  20.701  1.00 51.44  ? 636  ASN A CB    1 
ATOM   4835  C  CG    . ASN A 1 635  ? -7.220  -91.481  19.825  1.00 52.55  ? 636  ASN A CG    1 
ATOM   4836  O  OD1   . ASN A 1 635  ? -6.598  -92.068  18.946  1.00 53.45  ? 636  ASN A OD1   1 
ATOM   4837  N  ND2   . ASN A 1 635  ? -7.148  -90.180  20.067  1.00 53.94  ? 636  ASN A ND2   1 
ATOM   4838  N  N     . GLU A 1 636  ? -6.937  -93.977  22.885  1.00 42.46  ? 637  GLU A N     1 
ATOM   4839  C  CA    . GLU A 1 636  ? -6.990  -94.290  24.294  1.00 36.45  ? 637  GLU A CA    1 
ATOM   4840  C  C     . GLU A 1 636  ? -8.081  -93.146  24.764  0.00 26.50  ? 637  GLU A C     1 
ATOM   4841  O  O     . GLU A 1 636  ? -9.113  -93.723  25.214  1.00 32.39  ? 637  GLU A O     1 
ATOM   4842  C  CB    . GLU A 1 636  ? -5.584  -93.589  24.827  0.00 27.03  ? 637  GLU A CB    1 
ATOM   4843  C  CG    . GLU A 1 636  ? -5.233  -92.090  24.883  0.00 26.38  ? 637  GLU A CG    1 
ATOM   4844  C  CD    . GLU A 1 636  ? -4.912  -91.467  23.526  0.00 26.02  ? 637  GLU A CD    1 
ATOM   4845  O  OE1   . GLU A 1 636  ? -5.772  -90.739  22.987  0.00 25.83  ? 637  GLU A OE1   1 
ATOM   4846  O  OE2   . GLU A 1 636  ? -3.794  -91.679  23.011  0.00 25.73  ? 637  GLU A OE2   1 
ATOM   4847  N  N     . PHE A 1 637  ? -8.194  -92.132  24.079  1.00 28.71  ? 638  PHE A N     1 
ATOM   4848  C  CA    . PHE A 1 637  ? -9.136  -91.103  24.535  1.00 27.88  ? 638  PHE A CA    1 
ATOM   4849  C  C     . PHE A 1 637  ? -10.545 -91.446  24.045  1.00 28.41  ? 638  PHE A C     1 
ATOM   4850  O  O     . PHE A 1 637  ? -11.553 -91.238  24.719  1.00 25.53  ? 638  PHE A O     1 
ATOM   4851  C  CB    . PHE A 1 637  ? -8.785  -89.702  24.070  1.00 27.73  ? 638  PHE A CB    1 
ATOM   4852  C  CG    . PHE A 1 637  ? -9.655  -88.624  24.666  1.00 27.64  ? 638  PHE A CG    1 
ATOM   4853  C  CD1   . PHE A 1 637  ? -9.555  -88.263  25.999  1.00 27.47  ? 638  PHE A CD1   1 
ATOM   4854  C  CD2   . PHE A 1 637  ? -10.563 -87.942  23.871  1.00 27.42  ? 638  PHE A CD2   1 
ATOM   4855  C  CE1   . PHE A 1 637  ? -10.357 -87.259  26.549  1.00 26.78  ? 638  PHE A CE1   1 
ATOM   4856  C  CE2   . PHE A 1 637  ? -11.367 -86.948  24.424  1.00 26.49  ? 638  PHE A CE2   1 
ATOM   4857  C  CZ    . PHE A 1 637  ? -11.278 -86.598  25.749  1.00 25.72  ? 638  PHE A CZ    1 
ATOM   4858  N  N     . PHE A 1 638  ? -10.617 -91.931  22.795  1.00 28.80  ? 639  PHE A N     1 
ATOM   4859  C  CA    . PHE A 1 638  ? -11.919 -92.278  22.233  1.00 31.31  ? 639  PHE A CA    1 
ATOM   4860  C  C     . PHE A 1 638  ? -12.496 -93.462  23.011  1.00 31.90  ? 639  PHE A C     1 
ATOM   4861  O  O     . PHE A 1 638  ? -13.677 -93.528  23.321  1.00 32.49  ? 639  PHE A O     1 
ATOM   4862  C  CB    . PHE A 1 638  ? -11.833 -92.604  20.735  1.00 31.52  ? 639  PHE A CB    1 
ATOM   4863  C  CG    . PHE A 1 638  ? -13.207 -92.734  20.106  1.00 32.43  ? 639  PHE A CG    1 
ATOM   4864  C  CD1   . PHE A 1 638  ? -13.826 -91.614  19.591  1.00 32.17  ? 639  PHE A CD1   1 
ATOM   4865  C  CD2   . PHE A 1 638  ? -13.853 -93.955  20.047  1.00 34.07  ? 639  PHE A CD2   1 
ATOM   4866  C  CE1   . PHE A 1 638  ? -15.088 -91.719  19.023  1.00 33.05  ? 639  PHE A CE1   1 
ATOM   4867  C  CE2   . PHE A 1 638  ? -15.116 -94.059  19.475  1.00 33.91  ? 639  PHE A CE2   1 
ATOM   4868  C  CZ    . PHE A 1 638  ? -15.733 -92.938  18.962  1.00 32.95  ? 639  PHE A CZ    1 
ATOM   4869  N  N     . LYS A 1 639  ? -11.626 -94.425  23.323  1.00 34.17  ? 640  LYS A N     1 
ATOM   4870  C  CA    . LYS A 1 639  ? -12.070 -95.595  24.070  1.00 35.72  ? 640  LYS A CA    1 
ATOM   4871  C  C     . LYS A 1 639  ? -12.481 -95.261  25.499  1.00 35.41  ? 640  LYS A C     1 
ATOM   4872  O  O     . LYS A 1 639  ? -13.538 -95.729  25.917  1.00 35.62  ? 640  LYS A O     1 
ATOM   4873  C  CB    . LYS A 1 639  ? -10.959 -96.657  24.146  1.00 39.65  ? 640  LYS A CB    1 
ATOM   4874  C  CG    . LYS A 1 639  ? -11.253 -97.887  23.303  1.00 42.92  ? 640  LYS A CG    1 
ATOM   4875  C  CD    . LYS A 1 639  ? -10.018 -98.710  22.969  1.00 44.71  ? 640  LYS A CD    1 
ATOM   4876  C  CE    . LYS A 1 639  ? -9.214  -98.106  21.839  1.00 46.15  ? 640  LYS A CE    1 
ATOM   4877  N  NZ    . LYS A 1 639  ? -8.475  -99.034  20.928  1.00 46.49  ? 640  LYS A NZ    1 
ATOM   4878  N  N     . ASN A 1 640  ? -11.671 -94.492  26.228  1.00 33.06  ? 641  ASN A N     1 
ATOM   4879  C  CA    . ASN A 1 640  ? -11.970 -94.293  27.643  1.00 32.85  ? 641  ASN A CA    1 
ATOM   4880  C  C     . ASN A 1 640  ? -12.925 -93.143  27.976  1.00 31.00  ? 641  ASN A C     1 
ATOM   4881  O  O     . ASN A 1 640  ? -13.484 -93.149  29.079  1.00 29.72  ? 641  ASN A O     1 
ATOM   4882  C  CB    . ASN A 1 640  ? -10.685 -94.074  28.430  1.00 35.26  ? 641  ASN A CB    1 
ATOM   4883  C  CG    . ASN A 1 640  ? -9.655  -95.191  28.305  1.00 38.89  ? 641  ASN A CG    1 
ATOM   4884  O  OD1   . ASN A 1 640  ? -10.039 -96.336  28.142  1.00 38.69  ? 641  ASN A OD1   1 
ATOM   4885  N  ND2   . ASN A 1 640  ? -8.350  -94.828  28.353  1.00 38.69  ? 641  ASN A ND2   1 
ATOM   4886  N  N     . VAL A 1 641  ? -13.084 -92.202  27.063  1.00 29.45  ? 642  VAL A N     1 
ATOM   4887  C  CA    . VAL A 1 641  ? -13.974 -91.059  27.341  1.00 26.38  ? 642  VAL A CA    1 
ATOM   4888  C  C     . VAL A 1 641  ? -15.036 -90.863  26.274  1.00 24.36  ? 642  VAL A C     1 
ATOM   4889  O  O     . VAL A 1 641  ? -16.203 -90.678  26.625  1.00 24.23  ? 642  VAL A O     1 
ATOM   4890  C  CB    . VAL A 1 641  ? -13.118 -89.772  27.449  1.00 25.64  ? 642  VAL A CB    1 
ATOM   4891  C  CG1   . VAL A 1 641  ? -13.887 -88.502  27.762  1.00 24.94  ? 642  VAL A CG1   1 
ATOM   4892  C  CG2   . VAL A 1 641  ? -12.031 -89.969  28.509  1.00 24.60  ? 642  VAL A CG2   1 
ATOM   4893  N  N     . VAL A 1 642  ? -14.671 -90.725  24.990  1.00 24.13  ? 643  VAL A N     1 
ATOM   4894  C  CA    . VAL A 1 642  ? -15.707 -90.309  24.051  1.00 24.91  ? 643  VAL A CA    1 
ATOM   4895  C  C     . VAL A 1 642  ? -16.728 -91.418  23.769  1.00 25.78  ? 643  VAL A C     1 
ATOM   4896  O  O     . VAL A 1 642  ? -17.917 -91.085  23.813  1.00 25.34  ? 643  VAL A O     1 
ATOM   4897  C  CB    . VAL A 1 642  ? -15.255 -89.449  22.873  1.00 26.25  ? 643  VAL A CB    1 
ATOM   4898  C  CG1   . VAL A 1 642  ? -13.782 -89.071  22.779  1.00 23.81  ? 643  VAL A CG1   1 
ATOM   4899  C  CG2   . VAL A 1 642  ? -15.850 -89.752  21.510  1.00 25.34  ? 643  VAL A CG2   1 
ATOM   4900  N  N     . LYS A 1 643  ? -16.289 -92.685  23.581  1.00 27.32  ? 644  LYS A N     1 
ATOM   4901  C  CA    . LYS A 1 643  ? -17.264 -93.730  23.275  1.00 26.21  ? 644  LYS A CA    1 
ATOM   4902  C  C     . LYS A 1 643  ? -18.293 -93.880  24.389  1.00 25.62  ? 644  LYS A C     1 
ATOM   4903  O  O     . LYS A 1 643  ? -19.496 -93.993  24.139  1.00 24.85  ? 644  LYS A O     1 
ATOM   4904  C  CB    . LYS A 1 643  ? -16.602 -95.074  22.933  1.00 30.11  ? 644  LYS A CB    1 
ATOM   4905  C  CG    . LYS A 1 643  ? -17.608 -96.042  22.317  1.00 31.80  ? 644  LYS A CG    1 
ATOM   4906  C  CD    . LYS A 1 643  ? -17.006 -97.213  21.544  1.00 37.76  ? 644  LYS A CD    1 
ATOM   4907  C  CE    . LYS A 1 643  ? -18.159 -98.031  20.933  1.00 38.51  ? 644  LYS A CE    1 
ATOM   4908  N  NZ    . LYS A 1 643  ? -17.659 -99.226  20.178  1.00 41.65  ? 644  LYS A NZ    1 
ATOM   4909  N  N     . PRO A 1 644  ? -17.848 -93.875  25.630  1.00 25.85  ? 645  PRO A N     1 
ATOM   4910  C  CA    . PRO A 1 644  ? -18.727 -93.954  26.779  1.00 25.03  ? 645  PRO A CA    1 
ATOM   4911  C  C     . PRO A 1 644  ? -19.753 -92.833  26.782  1.00 25.33  ? 645  PRO A C     1 
ATOM   4912  O  O     . PRO A 1 644  ? -20.935 -93.026  27.060  1.00 24.39  ? 645  PRO A O     1 
ATOM   4913  C  CB    . PRO A 1 644  ? -17.798 -93.878  27.977  1.00 25.81  ? 645  PRO A CB    1 
ATOM   4914  C  CG    . PRO A 1 644  ? -16.475 -94.327  27.443  1.00 28.27  ? 645  PRO A CG    1 
ATOM   4915  C  CD    . PRO A 1 644  ? -16.415 -93.748  26.037  1.00 26.70  ? 645  PRO A CD    1 
ATOM   4916  N  N     . ILE A 1 645  ? -19.315 -91.613  26.419  1.00 24.14  ? 646  ILE A N     1 
ATOM   4917  C  CA    . ILE A 1 645  ? -20.274 -90.500  26.368  1.00 22.61  ? 646  ILE A CA    1 
ATOM   4918  C  C     . ILE A 1 645  ? -21.240 -90.701  25.212  1.00 23.87  ? 646  ILE A C     1 
ATOM   4919  O  O     . ILE A 1 645  ? -22.467 -90.484  25.354  1.00 25.03  ? 646  ILE A O     1 
ATOM   4920  C  CB    . ILE A 1 645  ? -19.555 -89.141  26.294  1.00 23.22  ? 646  ILE A CB    1 
ATOM   4921  C  CG1   . ILE A 1 645  ? -18.731 -88.874  27.567  1.00 22.36  ? 646  ILE A CG1   1 
ATOM   4922  C  CG2   . ILE A 1 645  ? -20.511 -87.976  26.073  1.00 23.31  ? 646  ILE A CG2   1 
ATOM   4923  C  CD1   . ILE A 1 645  ? -17.639 -87.807  27.426  1.00 25.63  ? 646  ILE A CD1   1 
ATOM   4924  N  N     . LEU A 1 646  ? -20.769 -91.107  24.041  1.00 24.15  ? 647  LEU A N     1 
ATOM   4925  C  CA    . LEU A 1 646  ? -21.642 -91.318  22.900  1.00 23.69  ? 647  LEU A CA    1 
ATOM   4926  C  C     . LEU A 1 646  ? -22.655 -92.449  23.146  1.00 25.94  ? 647  LEU A C     1 
ATOM   4927  O  O     . LEU A 1 646  ? -23.742 -92.423  22.544  1.00 26.21  ? 647  LEU A O     1 
ATOM   4928  C  CB    . LEU A 1 646  ? -20.804 -91.620  21.641  1.00 25.94  ? 647  LEU A CB    1 
ATOM   4929  C  CG    . LEU A 1 646  ? -19.872 -90.493  21.161  1.00 25.97  ? 647  LEU A CG    1 
ATOM   4930  C  CD1   . LEU A 1 646  ? -19.133 -90.913  19.902  1.00 27.16  ? 647  LEU A CD1   1 
ATOM   4931  C  CD2   . LEU A 1 646  ? -20.683 -89.222  20.939  1.00 23.91  ? 647  LEU A CD2   1 
ATOM   4932  N  N     . THR A 1 647  ? -22.295 -93.395  24.000  1.00 26.62  ? 648  THR A N     1 
ATOM   4933  C  CA    . THR A 1 647  ? -23.234 -94.496  24.250  1.00 30.75  ? 648  THR A CA    1 
ATOM   4934  C  C     . THR A 1 647  ? -24.081 -94.296  25.500  1.00 32.31  ? 648  THR A C     1 
ATOM   4935  O  O     . THR A 1 647  ? -24.535 -95.217  26.153  1.00 29.49  ? 648  THR A O     1 
ATOM   4936  C  CB    . THR A 1 647  ? -22.468 -95.824  24.203  1.00 31.12  ? 648  THR A CB    1 
ATOM   4937  O  OG1   . THR A 1 647  ? -21.425 -95.859  25.187  1.00 33.59  ? 648  THR A OG1   1 
ATOM   4938  C  CG2   . THR A 1 647  ? -21.820 -95.992  22.827  1.00 29.64  ? 648  THR A CG2   1 
ATOM   4939  N  N     . GLN A 1 648  ? -24.362 -93.038  25.852  1.00 32.40  ? 649  GLN A N     1 
ATOM   4940  C  CA    . GLN A 1 648  ? -25.196 -92.580  26.936  1.00 32.66  ? 649  GLN A CA    1 
ATOM   4941  C  C     . GLN A 1 648  ? -24.692 -92.961  28.304  1.00 31.73  ? 649  GLN A C     1 
ATOM   4942  O  O     . GLN A 1 648  ? -25.428 -93.069  29.290  1.00 31.48  ? 649  GLN A O     1 
ATOM   4943  C  CB    . GLN A 1 648  ? -26.669 -93.004  26.741  1.00 38.45  ? 649  GLN A CB    1 
ATOM   4944  C  CG    . GLN A 1 648  ? -27.280 -92.655  25.388  1.00 43.74  ? 649  GLN A CG    1 
ATOM   4945  C  CD    . GLN A 1 648  ? -27.526 -91.180  25.138  1.00 48.70  ? 649  GLN A CD    1 
ATOM   4946  O  OE1   . GLN A 1 648  ? -28.471 -90.542  25.644  1.00 51.49  ? 649  GLN A OE1   1 
ATOM   4947  N  NE2   . GLN A 1 648  ? -26.689 -90.501  24.332  1.00 49.80  ? 649  GLN A NE2   1 
ATOM   4948  N  N     . GLN A 1 649  ? -23.389 -93.187  28.445  1.00 29.47  ? 650  GLN A N     1 
ATOM   4949  C  CA    . GLN A 1 649  ? -22.804 -93.534  29.737  1.00 27.07  ? 650  GLN A CA    1 
ATOM   4950  C  C     . GLN A 1 649  ? -21.987 -92.425  30.365  1.00 26.04  ? 650  GLN A C     1 
ATOM   4951  O  O     . GLN A 1 649  ? -21.210 -92.719  31.298  1.00 23.54  ? 650  GLN A O     1 
ATOM   4952  C  CB    . GLN A 1 649  ? -21.801 -94.669  29.468  1.00 31.43  ? 650  GLN A CB    1 
ATOM   4953  C  CG    . GLN A 1 649  ? -22.470 -95.760  28.617  1.00 36.86  ? 650  GLN A CG    1 
ATOM   4954  C  CD    . GLN A 1 649  ? -22.742 -96.914  29.564  1.00 40.16  ? 650  GLN A CD    1 
ATOM   4955  O  OE1   . GLN A 1 649  ? -23.811 -96.894  30.172  1.00 43.29  ? 650  GLN A OE1   1 
ATOM   4956  N  NE2   . GLN A 1 649  ? -21.732 -97.771  29.654  1.00 42.47  ? 650  GLN A NE2   1 
ATOM   4957  N  N     . GLY A 1 650  ? -22.006 -91.206  29.831  1.00 21.62  ? 651  GLY A N     1 
ATOM   4958  C  CA    . GLY A 1 650  ? -21.129 -90.152  30.354  1.00 21.76  ? 651  GLY A CA    1 
ATOM   4959  C  C     . GLY A 1 650  ? -21.306 -89.913  31.837  1.00 20.63  ? 651  GLY A C     1 
ATOM   4960  O  O     . GLY A 1 650  ? -20.399 -89.483  32.553  1.00 17.61  ? 651  GLY A O     1 
ATOM   4961  N  N     . ASP A 1 651  ? -22.532 -90.191  32.339  1.00 19.84  ? 652  ASP A N     1 
ATOM   4962  C  CA    . ASP A 1 651  ? -22.788 -89.926  33.741  1.00 20.29  ? 652  ASP A CA    1 
ATOM   4963  C  C     . ASP A 1 651  ? -21.921 -90.766  34.662  1.00 20.34  ? 652  ASP A C     1 
ATOM   4964  O  O     . ASP A 1 651  ? -21.795 -90.441  35.851  1.00 20.09  ? 652  ASP A O     1 
ATOM   4965  C  CB    . ASP A 1 651  ? -24.244 -90.208  34.104  1.00 24.43  ? 652  ASP A CB    1 
ATOM   4966  C  CG    . ASP A 1 651  ? -25.138 -89.029  33.733  1.00 26.81  ? 652  ASP A CG    1 
ATOM   4967  O  OD1   . ASP A 1 651  ? -25.085 -88.029  34.476  1.00 27.05  ? 652  ASP A OD1   1 
ATOM   4968  O  OD2   . ASP A 1 651  ? -25.855 -89.129  32.705  1.00 28.60  ? 652  ASP A OD2   1 
ATOM   4969  N  N     . LYS A 1 652  ? -21.415 -91.870  34.085  1.00 20.46  ? 653  LYS A N     1 
ATOM   4970  C  CA    . LYS A 1 652  ? -20.582 -92.757  34.888  1.00 21.26  ? 653  LYS A CA    1 
ATOM   4971  C  C     . LYS A 1 652  ? -19.133 -92.371  34.979  1.00 22.13  ? 653  LYS A C     1 
ATOM   4972  O  O     . LYS A 1 652  ? -18.422 -92.973  35.786  1.00 21.38  ? 653  LYS A O     1 
ATOM   4973  C  CB    . LYS A 1 652  ? -20.658 -94.162  34.235  1.00 24.35  ? 653  LYS A CB    1 
ATOM   4974  C  CG    . LYS A 1 652  ? -22.040 -94.745  34.617  1.00 26.87  ? 653  LYS A CG    1 
ATOM   4975  C  CD    . LYS A 1 652  ? -22.248 -96.071  33.862  1.00 34.01  ? 653  LYS A CD    1 
ATOM   4976  C  CE    . LYS A 1 652  ? -22.962 -95.709  32.565  1.00 38.40  ? 653  LYS A CE    1 
ATOM   4977  N  NZ    . LYS A 1 652  ? -24.444 -95.872  32.503  1.00 40.50  ? 653  LYS A NZ    1 
ATOM   4978  N  N     . LEU A 1 653  ? -18.746 -91.383  34.174  1.00 20.89  ? 654  LEU A N     1 
ATOM   4979  C  CA    . LEU A 1 653  ? -17.347 -90.896  34.197  1.00 22.02  ? 654  LEU A CA    1 
ATOM   4980  C  C     . LEU A 1 653  ? -17.133 -90.067  35.449  1.00 21.16  ? 654  LEU A C     1 
ATOM   4981  O  O     . LEU A 1 653  ? -17.941 -89.187  35.790  1.00 20.09  ? 654  LEU A O     1 
ATOM   4982  C  CB    . LEU A 1 653  ? -17.180 -90.009  32.962  1.00 24.94  ? 654  LEU A CB    1 
ATOM   4983  C  CG    . LEU A 1 653  ? -16.460 -90.482  31.714  1.00 28.56  ? 654  LEU A CG    1 
ATOM   4984  C  CD1   . LEU A 1 653  ? -16.401 -91.971  31.531  1.00 29.88  ? 654  LEU A CD1   1 
ATOM   4985  C  CD2   . LEU A 1 653  ? -16.930 -89.788  30.439  1.00 25.86  ? 654  LEU A CD2   1 
ATOM   4986  N  N     . PRO A 1 654  ? -16.063 -90.379  36.204  1.00 20.42  ? 655  PRO A N     1 
ATOM   4987  C  CA    . PRO A 1 654  ? -15.754 -89.732  37.443  1.00 18.57  ? 655  PRO A CA    1 
ATOM   4988  C  C     . PRO A 1 654  ? -15.056 -88.402  37.185  1.00 18.37  ? 655  PRO A C     1 
ATOM   4989  O  O     . PRO A 1 654  ? -14.615 -88.187  36.044  1.00 18.54  ? 655  PRO A O     1 
ATOM   4990  C  CB    . PRO A 1 654  ? -14.796 -90.712  38.150  1.00 17.97  ? 655  PRO A CB    1 
ATOM   4991  C  CG    . PRO A 1 654  ? -14.103 -91.370  37.018  1.00 18.83  ? 655  PRO A CG    1 
ATOM   4992  C  CD    . PRO A 1 654  ? -15.110 -91.490  35.896  1.00 18.15  ? 655  PRO A CD    1 
ATOM   4993  N  N     . VAL A 1 655  ? -14.938 -87.573  38.206  1.00 18.01  ? 656  VAL A N     1 
ATOM   4994  C  CA    . VAL A 1 655  ? -14.308 -86.274  37.920  1.00 20.73  ? 656  VAL A CA    1 
ATOM   4995  C  C     . VAL A 1 655  ? -12.879 -86.426  37.410  1.00 22.25  ? 656  VAL A C     1 
ATOM   4996  O  O     . VAL A 1 655  ? -12.459 -85.597  36.602  1.00 19.88  ? 656  VAL A O     1 
ATOM   4997  C  CB    . VAL A 1 655  ? -14.533 -85.148  38.890  1.00 21.67  ? 656  VAL A CB    1 
ATOM   4998  C  CG1   . VAL A 1 655  ? -15.608 -85.334  39.962  1.00 19.69  ? 656  VAL A CG1   1 
ATOM   4999  C  CG2   . VAL A 1 655  ? -13.361 -84.381  39.456  1.00 19.57  ? 656  VAL A CG2   1 
ATOM   5000  N  N     . SER A 1 656  ? -12.198 -87.511  37.793  1.00 19.49  ? 657  SER A N     1 
ATOM   5001  C  CA    . SER A 1 656  ? -10.833 -87.676  37.311  1.00 20.37  ? 657  SER A CA    1 
ATOM   5002  C  C     . SER A 1 656  ? -10.754 -87.906  35.812  1.00 21.22  ? 657  SER A C     1 
ATOM   5003  O  O     . SER A 1 656  ? -9.615  -87.822  35.325  1.00 19.21  ? 657  SER A O     1 
ATOM   5004  C  CB    . SER A 1 656  ? -10.125 -88.908  37.945  1.00 21.90  ? 657  SER A CB    1 
ATOM   5005  O  OG    . SER A 1 656  ? -10.932 -90.041  37.614  1.00 21.05  ? 657  SER A OG    1 
ATOM   5006  N  N     . ALA A 1 657  ? -11.820 -88.148  35.074  1.00 17.57  ? 658  ALA A N     1 
ATOM   5007  C  CA    . ALA A 1 657  ? -11.623 -88.244  33.627  1.00 20.15  ? 658  ALA A CA    1 
ATOM   5008  C  C     . ALA A 1 657  ? -11.428 -86.951  32.865  1.00 18.59  ? 658  ALA A C     1 
ATOM   5009  O  O     . ALA A 1 657  ? -11.209 -86.945  31.649  1.00 20.08  ? 658  ALA A O     1 
ATOM   5010  C  CB    . ALA A 1 657  ? -12.903 -88.895  33.041  1.00 18.65  ? 658  ALA A CB    1 
ATOM   5011  N  N     . PHE A 1 658  ? -11.694 -85.799  33.446  1.00 20.93  ? 659  PHE A N     1 
ATOM   5012  C  CA    . PHE A 1 658  ? -11.713 -84.523  32.733  1.00 18.52  ? 659  PHE A CA    1 
ATOM   5013  C  C     . PHE A 1 658  ? -10.545 -83.607  33.012  1.00 18.95  ? 659  PHE A C     1 
ATOM   5014  O  O     . PHE A 1 658  ? -9.993  -83.605  34.123  1.00 19.56  ? 659  PHE A O     1 
ATOM   5015  C  CB    . PHE A 1 658  ? -13.061 -83.805  33.150  1.00 18.62  ? 659  PHE A CB    1 
ATOM   5016  C  CG    . PHE A 1 658  ? -14.242 -84.688  32.787  1.00 19.12  ? 659  PHE A CG    1 
ATOM   5017  C  CD1   . PHE A 1 658  ? -14.927 -85.407  33.760  1.00 19.27  ? 659  PHE A CD1   1 
ATOM   5018  C  CD2   . PHE A 1 658  ? -14.598 -84.891  31.461  1.00 19.79  ? 659  PHE A CD2   1 
ATOM   5019  C  CE1   . PHE A 1 658  ? -15.966 -86.237  33.430  1.00 18.74  ? 659  PHE A CE1   1 
ATOM   5020  C  CE2   . PHE A 1 658  ? -15.672 -85.688  31.132  1.00 20.89  ? 659  PHE A CE2   1 
ATOM   5021  C  CZ    . PHE A 1 658  ? -16.341 -86.395  32.107  1.00 20.23  ? 659  PHE A CZ    1 
ATOM   5022  N  N     . GLU A 1 659  ? -10.132 -82.767  32.062  1.00 16.66  ? 660  GLU A N     1 
ATOM   5023  C  CA    . GLU A 1 659  ? -9.105  -81.762  32.400  1.00 19.91  ? 660  GLU A CA    1 
ATOM   5024  C  C     . GLU A 1 659  ? -9.685  -80.688  33.295  1.00 18.34  ? 660  GLU A C     1 
ATOM   5025  O  O     . GLU A 1 659  ? -10.840 -80.298  33.077  1.00 17.06  ? 660  GLU A O     1 
ATOM   5026  C  CB    . GLU A 1 659  ? -8.639  -81.063  31.133  1.00 24.52  ? 660  GLU A CB    1 
ATOM   5027  C  CG    . GLU A 1 659  ? -7.790  -81.987  30.240  1.00 28.60  ? 660  GLU A CG    1 
ATOM   5028  C  CD    . GLU A 1 659  ? -6.444  -82.105  30.939  1.00 34.75  ? 660  GLU A CD    1 
ATOM   5029  O  OE1   . GLU A 1 659  ? -6.017  -83.239  31.206  1.00 38.52  ? 660  GLU A OE1   1 
ATOM   5030  O  OE2   . GLU A 1 659  ? -5.829  -81.072  31.281  1.00 37.23  ? 660  GLU A OE2   1 
ATOM   5031  N  N     . ALA A 1 660  ? -8.965  -80.175  34.280  1.00 16.33  ? 661  ALA A N     1 
ATOM   5032  C  CA    . ALA A 1 660  ? -9.468  -79.113  35.137  1.00 16.15  ? 661  ALA A CA    1 
ATOM   5033  C  C     . ALA A 1 660  ? -9.941  -77.875  34.378  1.00 18.79  ? 661  ALA A C     1 
ATOM   5034  O  O     . ALA A 1 660  ? -10.877 -77.241  34.868  1.00 18.27  ? 661  ALA A O     1 
ATOM   5035  C  CB    . ALA A 1 660  ? -8.404  -78.728  36.178  1.00 16.85  ? 661  ALA A CB    1 
ATOM   5036  N  N     . ASP A 1 661  ? -9.305  -77.507  33.274  1.00 15.98  ? 662  ASP A N     1 
ATOM   5037  C  CA    . ASP A 1 661  ? -9.672  -76.257  32.585  1.00 17.49  ? 662  ASP A CA    1 
ATOM   5038  C  C     . ASP A 1 661  ? -10.705 -76.494  31.524  1.00 15.83  ? 662  ASP A C     1 
ATOM   5039  O  O     . ASP A 1 661  ? -11.003 -75.619  30.729  1.00 17.49  ? 662  ASP A O     1 
ATOM   5040  C  CB    . ASP A 1 661  ? -8.411  -75.581  32.031  1.00 19.68  ? 662  ASP A CB    1 
ATOM   5041  C  CG    . ASP A 1 661  ? -7.669  -76.411  31.001  1.00 21.32  ? 662  ASP A CG    1 
ATOM   5042  O  OD1   . ASP A 1 661  ? -6.520  -76.068  30.648  1.00 22.39  ? 662  ASP A OD1   1 
ATOM   5043  O  OD2   . ASP A 1 661  ? -8.195  -77.404  30.462  1.00 23.35  ? 662  ASP A OD2   1 
ATOM   5044  N  N     . GLY A 1 662  ? -11.215 -77.750  31.398  1.00 17.82  ? 663  GLY A N     1 
ATOM   5045  C  CA    . GLY A 1 662  ? -12.187 -78.038  30.364  1.00 16.92  ? 663  GLY A CA    1 
ATOM   5046  C  C     . GLY A 1 662  ? -11.703 -78.324  28.979  1.00 15.01  ? 663  GLY A C     1 
ATOM   5047  O  O     . GLY A 1 662  ? -12.577 -78.569  28.103  1.00 15.60  ? 663  GLY A O     1 
ATOM   5048  N  N     . ARG A 1 663  ? -10.406 -78.400  28.690  1.00 13.58  ? 664  ARG A N     1 
ATOM   5049  C  CA    . ARG A 1 663  ? -9.996  -78.620  27.305  1.00 16.57  ? 664  ARG A CA    1 
ATOM   5050  C  C     . ARG A 1 663  ? -10.279 -80.060  26.804  1.00 16.07  ? 664  ARG A C     1 
ATOM   5051  O  O     . ARG A 1 663  ? -10.398 -80.955  27.618  1.00 18.08  ? 664  ARG A O     1 
ATOM   5052  C  CB    . ARG A 1 663  ? -8.497  -78.274  27.117  1.00 15.02  ? 664  ARG A CB    1 
ATOM   5053  C  CG    . ARG A 1 663  ? -7.559  -79.183  27.863  1.00 18.35  ? 664  ARG A CG    1 
ATOM   5054  C  CD    . ARG A 1 663  ? -6.095  -78.776  27.698  1.00 19.33  ? 664  ARG A CD    1 
ATOM   5055  N  NE    . ARG A 1 663  ? -5.886  -77.439  28.244  1.00 20.94  ? 664  ARG A NE    1 
ATOM   5056  C  CZ    . ARG A 1 663  ? -4.877  -76.656  27.828  1.00 19.57  ? 664  ARG A CZ    1 
ATOM   5057  N  NH1   . ARG A 1 663  ? -4.009  -77.102  26.911  1.00 19.43  ? 664  ARG A NH1   1 
ATOM   5058  N  NH2   . ARG A 1 663  ? -4.856  -75.475  28.399  1.00 18.73  ? 664  ARG A NH2   1 
ATOM   5059  N  N     . PHE A 1 664  ? -10.375 -80.222  25.507  1.00 17.77  ? 665  PHE A N     1 
ATOM   5060  C  CA    . PHE A 1 664  ? -10.537 -81.518  24.832  1.00 20.87  ? 665  PHE A CA    1 
ATOM   5061  C  C     . PHE A 1 664  ? -9.468  -81.572  23.748  1.00 22.22  ? 665  PHE A C     1 
ATOM   5062  O  O     . PHE A 1 664  ? -9.038  -80.522  23.234  1.00 20.67  ? 665  PHE A O     1 
ATOM   5063  C  CB    . PHE A 1 664  ? -11.922 -81.562  24.172  1.00 20.29  ? 665  PHE A CB    1 
ATOM   5064  C  CG    . PHE A 1 664  ? -12.936 -82.278  25.038  1.00 21.06  ? 665  PHE A CG    1 
ATOM   5065  C  CD1   . PHE A 1 664  ? -13.297 -81.802  26.267  1.00 19.94  ? 665  PHE A CD1   1 
ATOM   5066  C  CD2   . PHE A 1 664  ? -13.485 -83.471  24.597  1.00 22.06  ? 665  PHE A CD2   1 
ATOM   5067  C  CE1   . PHE A 1 664  ? -14.207 -82.447  27.086  1.00 21.75  ? 665  PHE A CE1   1 
ATOM   5068  C  CE2   . PHE A 1 664  ? -14.424 -84.140  25.401  1.00 23.56  ? 665  PHE A CE2   1 
ATOM   5069  C  CZ    . PHE A 1 664  ? -14.761 -83.631  26.651  1.00 22.38  ? 665  PHE A CZ    1 
ATOM   5070  N  N     . PRO A 1 665  ? -9.046  -82.771  23.350  1.00 22.55  ? 666  PRO A N     1 
ATOM   5071  C  CA    . PRO A 1 665  ? -8.095  -82.905  22.241  1.00 21.65  ? 666  PRO A CA    1 
ATOM   5072  C  C     . PRO A 1 665  ? -8.835  -82.664  20.920  1.00 21.85  ? 666  PRO A C     1 
ATOM   5073  O  O     . PRO A 1 665  ? -10.051 -82.850  20.878  1.00 22.62  ? 666  PRO A O     1 
ATOM   5074  C  CB    . PRO A 1 665  ? -7.620  -84.337  22.314  1.00 24.08  ? 666  PRO A CB    1 
ATOM   5075  C  CG    . PRO A 1 665  ? -8.726  -85.060  23.012  1.00 22.66  ? 666  PRO A CG    1 
ATOM   5076  C  CD    . PRO A 1 665  ? -9.477  -84.075  23.898  1.00 22.64  ? 666  PRO A CD    1 
ATOM   5077  N  N     . LEU A 1 666  ? -8.114  -82.430  19.845  1.00 20.44  ? 667  LEU A N     1 
ATOM   5078  C  CA    . LEU A 1 666  ? -8.711  -82.308  18.538  1.00 19.34  ? 667  LEU A CA    1 
ATOM   5079  C  C     . LEU A 1 666  ? -8.999  -83.701  17.962  1.00 22.40  ? 667  LEU A C     1 
ATOM   5080  O  O     . LEU A 1 666  ? -8.392  -84.674  18.422  1.00 20.77  ? 667  LEU A O     1 
ATOM   5081  C  CB    . LEU A 1 666  ? -7.667  -81.607  17.617  1.00 21.54  ? 667  LEU A CB    1 
ATOM   5082  C  CG    . LEU A 1 666  ? -7.848  -80.081  17.522  1.00 22.75  ? 667  LEU A CG    1 
ATOM   5083  C  CD1   . LEU A 1 666  ? -7.496  -79.458  18.857  1.00 25.02  ? 667  LEU A CD1   1 
ATOM   5084  C  CD2   . LEU A 1 666  ? -7.037  -79.392  16.433  1.00 24.19  ? 667  LEU A CD2   1 
ATOM   5085  N  N     . GLY A 1 667  ? -9.794  -83.740  16.887  1.00 22.00  ? 668  GLY A N     1 
ATOM   5086  C  CA    . GLY A 1 667  ? -9.908  -84.973  16.144  1.00 22.23  ? 668  GLY A CA    1 
ATOM   5087  C  C     . GLY A 1 667  ? -10.712 -86.114  16.677  1.00 22.88  ? 668  GLY A C     1 
ATOM   5088  O  O     . GLY A 1 667  ? -10.609 -87.204  16.059  1.00 26.17  ? 668  GLY A O     1 
ATOM   5089  N  N     . THR A 1 668  ? -11.483 -85.981  17.758  1.00 21.14  ? 669  THR A N     1 
ATOM   5090  C  CA    . THR A 1 668  ? -12.299 -87.092  18.230  1.00 19.98  ? 669  THR A CA    1 
ATOM   5091  C  C     . THR A 1 668  ? -13.378 -87.501  17.230  1.00 22.55  ? 669  THR A C     1 
ATOM   5092  O  O     . THR A 1 668  ? -13.937 -88.587  17.395  1.00 21.18  ? 669  THR A O     1 
ATOM   5093  C  CB    . THR A 1 668  ? -12.948 -86.901  19.586  1.00 20.94  ? 669  THR A CB    1 
ATOM   5094  O  OG1   . THR A 1 668  ? -13.999 -85.931  19.532  1.00 21.24  ? 669  THR A OG1   1 
ATOM   5095  C  CG2   . THR A 1 668  ? -11.893 -86.405  20.614  1.00 20.08  ? 669  THR A CG2   1 
ATOM   5096  N  N     . SER A 1 669  ? -13.752 -86.639  16.278  1.00 22.90  ? 670  SER A N     1 
ATOM   5097  C  CA    . SER A 1 669  ? -14.841 -87.037  15.395  1.00 22.53  ? 670  SER A CA    1 
ATOM   5098  C  C     . SER A 1 669  ? -14.416 -88.110  14.386  1.00 24.12  ? 670  SER A C     1 
ATOM   5099  O  O     . SER A 1 669  ? -15.284 -88.704  13.738  1.00 22.72  ? 670  SER A O     1 
ATOM   5100  C  CB    . SER A 1 669  ? -15.374 -85.841  14.665  1.00 24.28  ? 670  SER A CB    1 
ATOM   5101  O  OG    . SER A 1 669  ? -14.557 -85.444  13.587  1.00 23.63  ? 670  SER A OG    1 
ATOM   5102  N  N     . GLN A 1 670  ? -13.120 -88.276  14.181  1.00 23.12  ? 671  GLN A N     1 
ATOM   5103  C  CA    . GLN A 1 670  ? -12.576 -89.191  13.202  1.00 26.84  ? 671  GLN A CA    1 
ATOM   5104  C  C     . GLN A 1 670  ? -13.069 -90.630  13.391  1.00 28.02  ? 671  GLN A C     1 
ATOM   5105  O  O     . GLN A 1 670  ? -13.051 -91.430  12.464  1.00 28.64  ? 671  GLN A O     1 
ATOM   5106  C  CB    . GLN A 1 670  ? -11.026 -89.245  13.319  1.00 25.33  ? 671  GLN A CB    1 
ATOM   5107  C  CG    . GLN A 1 670  ? -10.370 -87.901  12.945  1.00 27.28  ? 671  GLN A CG    1 
ATOM   5108  C  CD    . GLN A 1 670  ? -10.459 -87.658  11.446  1.00 28.04  ? 671  GLN A CD    1 
ATOM   5109  O  OE1   . GLN A 1 670  ? -10.019 -88.511  10.645  1.00 28.62  ? 671  GLN A OE1   1 
ATOM   5110  N  NE2   . GLN A 1 670  ? -11.008 -86.517  11.080  1.00 25.00  ? 671  GLN A NE2   1 
ATOM   5111  N  N     . PHE A 1 671  ? -13.532 -90.902  14.619  1.00 26.79  ? 672  PHE A N     1 
ATOM   5112  C  CA    . PHE A 1 671  ? -13.868 -92.259  14.991  1.00 26.60  ? 672  PHE A CA    1 
ATOM   5113  C  C     . PHE A 1 671  ? -15.372 -92.454  15.130  1.00 27.96  ? 672  PHE A C     1 
ATOM   5114  O  O     . PHE A 1 671  ? -15.787 -93.598  15.261  1.00 28.32  ? 672  PHE A O     1 
ATOM   5115  C  CB    . PHE A 1 671  ? -13.195 -92.610  16.315  1.00 27.83  ? 672  PHE A CB    1 
ATOM   5116  C  CG    . PHE A 1 671  ? -11.713 -92.347  16.338  1.00 30.80  ? 672  PHE A CG    1 
ATOM   5117  C  CD1   . PHE A 1 671  ? -11.217 -91.270  17.083  1.00 30.88  ? 672  PHE A CD1   1 
ATOM   5118  C  CD2   . PHE A 1 671  ? -10.829 -93.138  15.624  1.00 31.74  ? 672  PHE A CD2   1 
ATOM   5119  C  CE1   . PHE A 1 671  ? -9.866  -91.001  17.131  1.00 32.34  ? 672  PHE A CE1   1 
ATOM   5120  C  CE2   . PHE A 1 671  ? -9.472  -92.877  15.673  1.00 31.89  ? 672  PHE A CE2   1 
ATOM   5121  C  CZ    . PHE A 1 671  ? -8.993  -91.815  16.422  1.00 32.51  ? 672  PHE A CZ    1 
ATOM   5122  N  N     . GLU A 1 672  ? -16.164 -91.398  15.044  1.00 26.57  ? 673  GLU A N     1 
ATOM   5123  C  CA    . GLU A 1 672  ? -17.609 -91.564  15.187  1.00 27.47  ? 673  GLU A CA    1 
ATOM   5124  C  C     . GLU A 1 672  ? -18.275 -92.423  14.118  1.00 27.02  ? 673  GLU A C     1 
ATOM   5125  O  O     . GLU A 1 672  ? -19.193 -93.179  14.450  1.00 24.31  ? 673  GLU A O     1 
ATOM   5126  C  CB    . GLU A 1 672  ? -18.207 -90.133  15.263  1.00 27.14  ? 673  GLU A CB    1 
ATOM   5127  C  CG    . GLU A 1 672  ? -18.089 -89.609  16.702  1.00 28.38  ? 673  GLU A CG    1 
ATOM   5128  C  CD    . GLU A 1 672  ? -18.732 -88.230  16.793  1.00 29.13  ? 673  GLU A CD    1 
ATOM   5129  O  OE1   . GLU A 1 672  ? -18.073 -87.296  16.284  1.00 30.38  ? 673  GLU A OE1   1 
ATOM   5130  O  OE2   . GLU A 1 672  ? -19.852 -88.079  17.284  1.00 28.10  ? 673  GLU A OE2   1 
ATOM   5131  N  N     . LYS A 1 673  ? -17.972 -92.243  12.835  1.00 27.16  ? 674  LYS A N     1 
ATOM   5132  C  CA    . LYS A 1 673  ? -18.550 -93.017  11.718  1.00 27.82  ? 674  LYS A CA    1 
ATOM   5133  C  C     . LYS A 1 673  ? -20.002 -93.467  11.902  1.00 28.49  ? 674  LYS A C     1 
ATOM   5134  O  O     . LYS A 1 673  ? -20.405 -94.646  11.917  1.00 27.62  ? 674  LYS A O     1 
ATOM   5135  C  CB    . LYS A 1 673  ? -17.593 -94.200  11.462  1.00 27.32  ? 674  LYS A CB    1 
ATOM   5136  C  CG    . LYS A 1 673  ? -16.141 -93.661  11.250  1.00 27.05  ? 674  LYS A CG    1 
ATOM   5137  C  CD    . LYS A 1 673  ? -15.885 -93.473  9.753   1.00 27.31  ? 674  LYS A CD    1 
ATOM   5138  C  CE    . LYS A 1 673  ? -14.502 -92.884  9.432   1.00 28.88  ? 674  LYS A CE    1 
ATOM   5139  N  NZ    . LYS A 1 673  ? -14.386 -91.475  9.908   1.00 27.89  ? 674  LYS A NZ    1 
ATOM   5140  N  N     . ARG A 1 674  ? -20.882 -92.482  12.144  1.00 28.21  ? 675  ARG A N     1 
ATOM   5141  C  CA    . ARG A 1 674  ? -22.271 -92.744  12.489  1.00 29.26  ? 675  ARG A CA    1 
ATOM   5142  C  C     . ARG A 1 674  ? -23.112 -93.467  11.435  1.00 29.77  ? 675  ARG A C     1 
ATOM   5143  O  O     . ARG A 1 674  ? -24.060 -94.181  11.774  1.00 30.56  ? 675  ARG A O     1 
ATOM   5144  C  CB    . ARG A 1 674  ? -23.003 -91.422  12.806  1.00 27.40  ? 675  ARG A CB    1 
ATOM   5145  C  CG    . ARG A 1 674  ? -22.477 -90.723  14.065  1.00 27.78  ? 675  ARG A CG    1 
ATOM   5146  C  CD    . ARG A 1 674  ? -22.833 -89.243  13.962  1.00 31.19  ? 675  ARG A CD    1 
ATOM   5147  N  NE    . ARG A 1 674  ? -24.234 -89.060  14.224  1.00 29.34  ? 675  ARG A NE    1 
ATOM   5148  C  CZ    . ARG A 1 674  ? -25.165 -88.222  13.824  1.00 30.31  ? 675  ARG A CZ    1 
ATOM   5149  N  NH1   . ARG A 1 674  ? -24.974 -87.226  12.990  1.00 29.49  ? 675  ARG A NH1   1 
ATOM   5150  N  NH2   . ARG A 1 674  ? -26.387 -88.426  14.332  1.00 29.11  ? 675  ARG A NH2   1 
ATOM   5151  N  N     . GLY A 1 675  ? -22.816 -93.186  10.161  1.00 29.35  ? 676  GLY A N     1 
ATOM   5152  C  CA    . GLY A 1 675  ? -23.568 -93.758  9.065   1.00 30.04  ? 676  GLY A CA    1 
ATOM   5153  C  C     . GLY A 1 675  ? -25.069 -93.489  9.141   1.00 30.67  ? 676  GLY A C     1 
ATOM   5154  O  O     . GLY A 1 675  ? -25.844 -94.466  9.091   1.00 31.64  ? 676  GLY A O     1 
ATOM   5155  N  N     . VAL A 1 676  ? -25.460 -92.222  9.231   1.00 30.05  ? 677  VAL A N     1 
ATOM   5156  C  CA    . VAL A 1 676  ? -26.900 -91.948  9.299   1.00 30.45  ? 677  VAL A CA    1 
ATOM   5157  C  C     . VAL A 1 676  ? -27.490 -91.494  7.980   1.00 30.67  ? 677  VAL A C     1 
ATOM   5158  O  O     . VAL A 1 676  ? -28.691 -91.199  7.870   1.00 30.21  ? 677  VAL A O     1 
ATOM   5159  C  CB    . VAL A 1 676  ? -27.244 -90.975  10.448  1.00 31.76  ? 677  VAL A CB    1 
ATOM   5160  C  CG1   . VAL A 1 676  ? -26.866 -91.630  11.773  1.00 31.30  ? 677  VAL A CG1   1 
ATOM   5161  C  CG2   . VAL A 1 676  ? -26.560 -89.628  10.281  1.00 30.85  ? 677  VAL A CG2   1 
ATOM   5162  N  N     . ALA A 1 677  ? -26.710 -91.508  6.895   1.00 29.36  ? 678  ALA A N     1 
ATOM   5163  C  CA    . ALA A 1 677  ? -27.280 -91.109  5.600   1.00 29.87  ? 678  ALA A CA    1 
ATOM   5164  C  C     . ALA A 1 677  ? -28.257 -92.196  5.095   1.00 30.64  ? 678  ALA A C     1 
ATOM   5165  O  O     . ALA A 1 677  ? -28.154 -93.356  5.477   1.00 30.16  ? 678  ALA A O     1 
ATOM   5166  C  CB    . ALA A 1 677  ? -26.215 -90.814  4.563   1.00 28.27  ? 678  ALA A CB    1 
ATOM   5167  N  N     . ILE A 1 678  ? -29.260 -91.747  4.342   1.00 30.54  ? 679  ILE A N     1 
ATOM   5168  C  CA    . ILE A 1 678  ? -30.250 -92.658  3.748   1.00 32.27  ? 679  ILE A CA    1 
ATOM   5169  C  C     . ILE A 1 678  ? -29.649 -93.032  2.374   1.00 31.48  ? 679  ILE A C     1 
ATOM   5170  O  O     . ILE A 1 678  ? -29.470 -94.194  2.031   1.00 33.12  ? 679  ILE A O     1 
ATOM   5171  C  CB    . ILE A 1 678  ? -31.610 -92.013  3.517   1.00 32.71  ? 679  ILE A CB    1 
ATOM   5172  C  CG1   . ILE A 1 678  ? -32.204 -91.344  4.764   1.00 34.49  ? 679  ILE A CG1   1 
ATOM   5173  C  CG2   . ILE A 1 678  ? -32.635 -92.992  2.961   1.00 32.51  ? 679  ILE A CG2   1 
ATOM   5174  C  CD1   . ILE A 1 678  ? -32.250 -92.267  5.952   1.00 35.36  ? 679  ILE A CD1   1 
ATOM   5175  N  N     . ASN A 1 679  ? -29.273 -91.988  1.632   1.00 30.24  ? 680  ASN A N     1 
ATOM   5176  C  CA    . ASN A 1 679  ? -28.577 -92.211  0.366   1.00 29.04  ? 680  ASN A CA    1 
ATOM   5177  C  C     . ASN A 1 679  ? -27.213 -91.523  0.389   1.00 28.87  ? 680  ASN A C     1 
ATOM   5178  O  O     . ASN A 1 679  ? -27.104 -90.494  1.083   1.00 27.75  ? 680  ASN A O     1 
ATOM   5179  C  CB    . ASN A 1 679  ? -29.369 -91.657  -0.820  1.00 30.69  ? 680  ASN A CB    1 
ATOM   5180  C  CG    . ASN A 1 679  ? -30.736 -92.337  -0.857  1.00 29.91  ? 680  ASN A CG    1 
ATOM   5181  O  OD1   . ASN A 1 679  ? -30.730 -93.571  -0.797  1.00 31.38  ? 680  ASN A OD1   1 
ATOM   5182  N  ND2   . ASN A 1 679  ? -31.775 -91.543  -0.940  1.00 30.74  ? 680  ASN A ND2   1 
ATOM   5183  N  N     . VAL A 1 680  ? -26.259 -92.067  -0.348  1.00 27.66  ? 681  VAL A N     1 
ATOM   5184  C  CA    . VAL A 1 680  ? -24.932 -91.418  -0.423  1.00 28.52  ? 681  VAL A CA    1 
ATOM   5185  C  C     . VAL A 1 680  ? -24.536 -91.421  -1.883  1.00 29.25  ? 681  VAL A C     1 
ATOM   5186  O  O     . VAL A 1 680  ? -25.084 -92.231  -2.653  1.00 29.35  ? 681  VAL A O     1 
ATOM   5187  C  CB    . VAL A 1 680  ? -23.919 -92.099  0.494   1.00 27.67  ? 681  VAL A CB    1 
ATOM   5188  C  CG1   . VAL A 1 680  ? -24.512 -92.380  1.876   1.00 28.72  ? 681  VAL A CG1   1 
ATOM   5189  C  CG2   . VAL A 1 680  ? -23.431 -93.444  -0.063  1.00 29.45  ? 681  VAL A CG2   1 
ATOM   5190  N  N     . PRO A 1 681  ? -23.601 -90.595  -2.302  1.00 29.30  ? 682  PRO A N     1 
ATOM   5191  C  CA    . PRO A 1 681  ? -23.149 -90.586  -3.684  1.00 29.94  ? 682  PRO A CA    1 
ATOM   5192  C  C     . PRO A 1 681  ? -22.306 -91.830  -4.013  1.00 30.44  ? 682  PRO A C     1 
ATOM   5193  O  O     . PRO A 1 681  ? -21.623 -92.351  -3.141  1.00 27.46  ? 682  PRO A O     1 
ATOM   5194  C  CB    . PRO A 1 681  ? -22.173 -89.399  -3.736  1.00 29.85  ? 682  PRO A CB    1 
ATOM   5195  C  CG    . PRO A 1 681  ? -21.688 -89.297  -2.325  1.00 29.25  ? 682  PRO A CG    1 
ATOM   5196  C  CD    . PRO A 1 681  ? -22.918 -89.578  -1.476  1.00 29.91  ? 682  PRO A CD    1 
ATOM   5197  N  N     . GLN A 1 682  ? -22.457 -92.311  -5.234  1.00 32.49  ? 683  GLN A N     1 
ATOM   5198  C  CA    . GLN A 1 682  ? -21.651 -93.374  -5.797  1.00 34.39  ? 683  GLN A CA    1 
ATOM   5199  C  C     . GLN A 1 682  ? -20.819 -92.756  -6.931  1.00 32.04  ? 683  GLN A C     1 
ATOM   5200  O  O     . GLN A 1 682  ? -21.382 -92.147  -7.844  1.00 31.71  ? 683  GLN A O     1 
ATOM   5201  C  CB    . GLN A 1 682  ? -22.552 -94.475  -6.383  1.00 36.67  ? 683  GLN A CB    1 
ATOM   5202  C  CG    . GLN A 1 682  ? -21.787 -95.594  -7.102  1.00 41.07  ? 683  GLN A CG    1 
ATOM   5203  C  CD    . GLN A 1 682  ? -22.737 -96.626  -7.697  1.00 44.58  ? 683  GLN A CD    1 
ATOM   5204  O  OE1   . GLN A 1 682  ? -23.345 -97.448  -7.003  1.00 47.19  ? 683  GLN A OE1   1 
ATOM   5205  N  NE2   . GLN A 1 682  ? -22.918 -96.613  -9.001  1.00 46.42  ? 683  GLN A NE2   1 
ATOM   5206  N  N     . TRP A 1 683  ? -19.514 -92.962  -6.944  1.00 30.80  ? 684  TRP A N     1 
ATOM   5207  C  CA    . TRP A 1 683  ? -18.664 -92.435  -8.008  1.00 31.61  ? 684  TRP A CA    1 
ATOM   5208  C  C     . TRP A 1 683  ? -18.780 -93.248  -9.301  1.00 32.86  ? 684  TRP A C     1 
ATOM   5209  O  O     . TRP A 1 683  ? -18.963 -94.467  -9.264  1.00 33.60  ? 684  TRP A O     1 
ATOM   5210  C  CB    . TRP A 1 683  ? -17.220 -92.342  -7.525  1.00 29.73  ? 684  TRP A CB    1 
ATOM   5211  C  CG    . TRP A 1 683  ? -16.327 -91.494  -8.368  1.00 30.03  ? 684  TRP A CG    1 
ATOM   5212  C  CD1   . TRP A 1 683  ? -16.553 -90.233  -8.864  1.00 30.66  ? 684  TRP A CD1   1 
ATOM   5213  C  CD2   . TRP A 1 683  ? -15.018 -91.870  -8.836  1.00 30.51  ? 684  TRP A CD2   1 
ATOM   5214  N  NE1   . TRP A 1 683  ? -15.469 -89.809  -9.607  1.00 29.77  ? 684  TRP A NE1   1 
ATOM   5215  C  CE2   . TRP A 1 683  ? -14.511 -90.798  -9.594  1.00 30.04  ? 684  TRP A CE2   1 
ATOM   5216  C  CE3   . TRP A 1 683  ? -14.234 -93.012  -8.683  1.00 28.69  ? 684  TRP A CE3   1 
ATOM   5217  C  CZ2   . TRP A 1 683  ? -13.249 -90.849  -10.186 1.00 30.15  ? 684  TRP A CZ2   1 
ATOM   5218  C  CZ3   . TRP A 1 683  ? -12.992 -93.073  -9.274  1.00 29.00  ? 684  TRP A CZ3   1 
ATOM   5219  C  CH2   . TRP A 1 683  ? -12.506 -91.999  -10.018 1.00 28.85  ? 684  TRP A CH2   1 
ATOM   5220  N  N     . VAL A 1 684  ? -18.727 -92.549  -10.423 1.00 33.42  ? 685  VAL A N     1 
ATOM   5221  C  CA    . VAL A 1 684  ? -18.802 -93.126  -11.772 1.00 34.48  ? 685  VAL A CA    1 
ATOM   5222  C  C     . VAL A 1 684  ? -17.628 -92.571  -12.582 1.00 33.65  ? 685  VAL A C     1 
ATOM   5223  O  O     . VAL A 1 684  ? -17.688 -91.595  -13.344 1.00 34.52  ? 685  VAL A O     1 
ATOM   5224  C  CB    . VAL A 1 684  ? -20.173 -92.876  -12.405 1.00 34.26  ? 685  VAL A CB    1 
ATOM   5225  C  CG1   . VAL A 1 684  ? -20.321 -93.619  -13.726 1.00 33.47  ? 685  VAL A CG1   1 
ATOM   5226  C  CG2   . VAL A 1 684  ? -21.297 -93.282  -11.458 1.00 33.96  ? 685  VAL A CG2   1 
ATOM   5227  N  N     . PRO A 1 685  ? -16.467 -93.196  -12.370 1.00 33.94  ? 686  PRO A N     1 
ATOM   5228  C  CA    . PRO A 1 685  ? -15.191 -92.818  -12.933 1.00 34.71  ? 686  PRO A CA    1 
ATOM   5229  C  C     . PRO A 1 685  ? -15.154 -92.549  -14.421 1.00 36.01  ? 686  PRO A C     1 
ATOM   5230  O  O     . PRO A 1 685  ? -14.371 -91.694  -14.849 1.00 35.88  ? 686  PRO A O     1 
ATOM   5231  C  CB    . PRO A 1 685  ? -14.246 -93.962  -12.555 1.00 35.41  ? 686  PRO A CB    1 
ATOM   5232  C  CG    . PRO A 1 685  ? -15.130 -95.089  -12.135 1.00 34.09  ? 686  PRO A CG    1 
ATOM   5233  C  CD    . PRO A 1 685  ? -16.329 -94.414  -11.512 1.00 33.91  ? 686  PRO A CD    1 
ATOM   5234  N  N     . GLU A 1 686  ? -16.012 -93.188  -15.203 1.00 36.89  ? 687  GLU A N     1 
ATOM   5235  C  CA    . GLU A 1 686  ? -16.104 -92.996  -16.632 1.00 38.75  ? 687  GLU A CA    1 
ATOM   5236  C  C     . GLU A 1 686  ? -16.638 -91.625  -17.006 1.00 40.57  ? 687  GLU A C     1 
ATOM   5237  O  O     . GLU A 1 686  ? -16.395 -91.139  -18.112 1.00 41.11  ? 687  GLU A O     1 
ATOM   5238  C  CB    . GLU A 1 686  ? -17.047 -94.028  -17.269 1.00 42.08  ? 687  GLU A CB    1 
ATOM   5239  C  CG    . GLU A 1 686  ? -16.882 -95.424  -16.661 1.00 43.54  ? 687  GLU A CG    1 
ATOM   5240  C  CD    . GLU A 1 686  ? -17.939 -95.561  -15.561 1.00 45.07  ? 687  GLU A CD    1 
ATOM   5241  O  OE1   . GLU A 1 686  ? -19.124 -95.587  -15.967 1.00 47.64  ? 687  GLU A OE1   1 
ATOM   5242  O  OE2   . GLU A 1 686  ? -17.560 -95.608  -14.381 1.00 44.33  ? 687  GLU A OE2   1 
ATOM   5243  N  N     . ASN A 1 687  ? -17.348 -90.995  -16.075 1.00 39.03  ? 688  ASN A N     1 
ATOM   5244  C  CA    . ASN A 1 687  ? -17.910 -89.676  -16.295 1.00 38.13  ? 688  ASN A CA    1 
ATOM   5245  C  C     . ASN A 1 687  ? -17.059 -88.627  -15.578 1.00 37.83  ? 688  ASN A C     1 
ATOM   5246  O  O     . ASN A 1 687  ? -17.161 -87.447  -15.944 1.00 37.33  ? 688  ASN A O     1 
ATOM   5247  C  CB    . ASN A 1 687  ? -19.360 -89.604  -15.791 1.00 37.24  ? 688  ASN A CB    1 
ATOM   5248  C  CG    . ASN A 1 687  ? -20.280 -90.620  -16.433 1.00 40.21  ? 688  ASN A CG    1 
ATOM   5249  O  OD1   . ASN A 1 687  ? -21.189 -91.206  -15.819 1.00 40.27  ? 688  ASN A OD1   1 
ATOM   5250  N  ND2   . ASN A 1 687  ? -20.076 -90.893  -17.722 1.00 39.61  ? 688  ASN A ND2   1 
ATOM   5251  N  N     . CYS A 1 688  ? -16.213 -89.046  -14.629 1.00 37.76  ? 689  CYS A N     1 
ATOM   5252  C  CA    . CYS A 1 688  ? -15.428 -88.078  -13.851 1.00 37.38  ? 689  CYS A CA    1 
ATOM   5253  C  C     . CYS A 1 688  ? -14.439 -87.277  -14.672 1.00 37.15  ? 689  CYS A C     1 
ATOM   5254  O  O     . CYS A 1 688  ? -13.611 -87.826  -15.405 1.00 37.66  ? 689  CYS A O     1 
ATOM   5255  C  CB    . CYS A 1 688  ? -14.708 -88.749  -12.675 1.00 36.94  ? 689  CYS A CB    1 
ATOM   5256  S  SG    . CYS A 1 688  ? -13.927 -87.569  -11.521 1.00 32.91  ? 689  CYS A SG    1 
ATOM   5257  N  N     . ILE A 1 689  ? -14.509 -85.952  -14.544 1.00 35.64  ? 690  ILE A N     1 
ATOM   5258  C  CA    . ILE A 1 689  ? -13.618 -85.020  -15.215 1.00 35.49  ? 690  ILE A CA    1 
ATOM   5259  C  C     . ILE A 1 689  ? -12.488 -84.573  -14.296 1.00 34.77  ? 690  ILE A C     1 
ATOM   5260  O  O     . ILE A 1 689  ? -11.559 -83.842  -14.643 1.00 34.61  ? 690  ILE A O     1 
ATOM   5261  C  CB    . ILE A 1 689  ? -14.359 -83.823  -15.811 1.00 36.32  ? 690  ILE A CB    1 
ATOM   5262  C  CG1   . ILE A 1 689  ? -14.775 -82.792  -14.756 1.00 35.80  ? 690  ILE A CG1   1 
ATOM   5263  C  CG2   . ILE A 1 689  ? -15.625 -84.314  -16.546 1.00 37.18  ? 690  ILE A CG2   1 
ATOM   5264  C  CD1   . ILE A 1 689  ? -15.257 -81.479  -15.329 1.00 35.55  ? 690  ILE A CD1   1 
ATOM   5265  N  N     . GLN A 1 690  ? -12.482 -85.047  -13.068 1.00 33.10  ? 691  GLN A N     1 
ATOM   5266  C  CA    . GLN A 1 690  ? -11.399 -84.790  -12.109 1.00 33.64  ? 691  GLN A CA    1 
ATOM   5267  C  C     . GLN A 1 690  ? -11.263 -83.324  -11.742 1.00 32.88  ? 691  GLN A C     1 
ATOM   5268  O  O     . GLN A 1 690  ? -10.163 -82.767  -11.715 1.00 33.83  ? 691  GLN A O     1 
ATOM   5269  C  CB    . GLN A 1 690  ? -10.075 -85.390  -12.645 1.00 34.97  ? 691  GLN A CB    1 
ATOM   5270  C  CG    . GLN A 1 690  ? -10.185 -86.812  -13.169 1.00 34.95  ? 691  GLN A CG    1 
ATOM   5271  C  CD    . GLN A 1 690  ? -8.899  -87.412  -13.695 1.00 37.56  ? 691  GLN A CD    1 
ATOM   5272  O  OE1   . GLN A 1 690  ? -8.933  -88.455  -14.400 1.00 39.97  ? 691  GLN A OE1   1 
ATOM   5273  N  NE2   . GLN A 1 690  ? -7.705  -86.881  -13.447 1.00 37.02  ? 691  GLN A NE2   1 
ATOM   5274  N  N     . CYS A 1 691  ? -12.367 -82.652  -11.405 1.00 31.48  ? 692  CYS A N     1 
ATOM   5275  C  CA    . CYS A 1 691  ? -12.285 -81.218  -11.082 1.00 31.77  ? 692  CYS A CA    1 
ATOM   5276  C  C     . CYS A 1 691  ? -12.135 -80.965  -9.579  1.00 30.09  ? 692  CYS A C     1 
ATOM   5277  O  O     . CYS A 1 691  ? -11.765 -79.855  -9.215  1.00 30.25  ? 692  CYS A O     1 
ATOM   5278  C  CB    . CYS A 1 691  ? -13.543 -80.476  -11.553 1.00 28.24  ? 692  CYS A CB    1 
ATOM   5279  S  SG    . CYS A 1 691  ? -15.070 -81.128  -10.840 1.00 29.39  ? 692  CYS A SG    1 
ATOM   5280  N  N     . ASN A 1 692  ? -12.469 -81.960  -8.768  1.00 29.05  ? 693  ASN A N     1 
ATOM   5281  C  CA    . ASN A 1 692  ? -12.417 -81.876  -7.323  1.00 28.67  ? 693  ASN A CA    1 
ATOM   5282  C  C     . ASN A 1 692  ? -13.505 -80.937  -6.749  1.00 28.95  ? 693  ASN A C     1 
ATOM   5283  O  O     . ASN A 1 692  ? -13.423 -80.586  -5.563  1.00 25.93  ? 693  ASN A O     1 
ATOM   5284  C  CB    . ASN A 1 692  ? -11.022 -81.408  -6.866  1.00 28.74  ? 693  ASN A CB    1 
ATOM   5285  C  CG    . ASN A 1 692  ? -10.052 -82.554  -6.629  1.00 28.44  ? 693  ASN A CG    1 
ATOM   5286  O  OD1   . ASN A 1 692  ? -8.856  -82.306  -6.354  1.00 30.76  ? 693  ASN A OD1   1 
ATOM   5287  N  ND2   . ASN A 1 692  ? -10.519 -83.783  -6.729  1.00 25.73  ? 693  ASN A ND2   1 
ATOM   5288  N  N     . GLN A 1 693  ? -14.502 -80.563  -7.544  1.00 26.19  ? 694  GLN A N     1 
ATOM   5289  C  CA    . GLN A 1 693  ? -15.547 -79.658  -7.084  1.00 27.59  ? 694  GLN A CA    1 
ATOM   5290  C  C     . GLN A 1 693  ? -16.437 -80.284  -6.031  1.00 28.12  ? 694  GLN A C     1 
ATOM   5291  O  O     . GLN A 1 693  ? -16.871 -79.619  -5.099  1.00 23.93  ? 694  GLN A O     1 
ATOM   5292  C  CB    . GLN A 1 693  ? -16.451 -79.146  -8.224  1.00 27.65  ? 694  GLN A CB    1 
ATOM   5293  C  CG    . GLN A 1 693  ? -15.807 -77.976  -8.949  1.00 28.20  ? 694  GLN A CG    1 
ATOM   5294  C  CD    . GLN A 1 693  ? -16.787 -77.255  -9.873  1.00 28.95  ? 694  GLN A CD    1 
ATOM   5295  O  OE1   . GLN A 1 693  ? -17.889 -76.876  -9.487  1.00 28.84  ? 694  GLN A OE1   1 
ATOM   5296  N  NE2   . GLN A 1 693  ? -16.361 -77.057  -11.113 1.00 30.67  ? 694  GLN A NE2   1 
ATOM   5297  N  N     . CYS A 1 694  ? -16.659 -81.609  -6.159  1.00 28.02  ? 695  CYS A N     1 
ATOM   5298  C  CA    . CYS A 1 694  ? -17.497 -82.334  -5.207  1.00 28.43  ? 695  CYS A CA    1 
ATOM   5299  C  C     . CYS A 1 694  ? -16.890 -82.330  -3.810  1.00 28.88  ? 695  CYS A C     1 
ATOM   5300  O  O     . CYS A 1 694  ? -17.639 -82.233  -2.823  1.00 28.30  ? 695  CYS A O     1 
ATOM   5301  C  CB    . CYS A 1 694  ? -17.663 -83.786  -5.672  1.00 27.53  ? 695  CYS A CB    1 
ATOM   5302  S  SG    . CYS A 1 694  ? -16.103 -84.656  -6.026  1.00 29.24  ? 695  CYS A SG    1 
ATOM   5303  N  N     . ALA A 1 695  ? -15.551 -82.493  -3.712  1.00 26.96  ? 696  ALA A N     1 
ATOM   5304  C  CA    . ALA A 1 695  ? -14.929 -82.485  -2.377  1.00 25.18  ? 696  ALA A CA    1 
ATOM   5305  C  C     . ALA A 1 695  ? -14.908 -81.084  -1.738  1.00 24.80  ? 696  ALA A C     1 
ATOM   5306  O  O     . ALA A 1 695  ? -15.109 -80.909  -0.523  1.00 21.36  ? 696  ALA A O     1 
ATOM   5307  C  CB    . ALA A 1 695  ? -13.539 -83.105  -2.410  1.00 22.04  ? 696  ALA A CB    1 
ATOM   5308  N  N     . PHE A 1 696  ? -14.759 -80.072  -2.588  1.00 25.17  ? 697  PHE A N     1 
ATOM   5309  C  CA    . PHE A 1 696  ? -14.779 -78.677  -2.156  1.00 23.71  ? 697  PHE A CA    1 
ATOM   5310  C  C     . PHE A 1 696  ? -16.113 -78.300  -1.510  1.00 23.94  ? 697  PHE A C     1 
ATOM   5311  O  O     . PHE A 1 696  ? -16.171 -77.521  -0.564  1.00 20.26  ? 697  PHE A O     1 
ATOM   5312  C  CB    . PHE A 1 696  ? -14.520 -77.777  -3.372  1.00 23.87  ? 697  PHE A CB    1 
ATOM   5313  C  CG    . PHE A 1 696  ? -14.030 -76.384  -3.125  1.00 23.85  ? 697  PHE A CG    1 
ATOM   5314  C  CD1   . PHE A 1 696  ? -12.705 -76.024  -3.237  1.00 21.81  ? 697  PHE A CD1   1 
ATOM   5315  C  CD2   . PHE A 1 696  ? -14.965 -75.386  -2.807  1.00 24.06  ? 697  PHE A CD2   1 
ATOM   5316  C  CE1   . PHE A 1 696  ? -12.304 -74.716  -3.007  1.00 23.18  ? 697  PHE A CE1   1 
ATOM   5317  C  CE2   . PHE A 1 696  ? -14.593 -74.086  -2.593  1.00 22.15  ? 697  PHE A CE2   1 
ATOM   5318  C  CZ    . PHE A 1 696  ? -13.252 -73.733  -2.707  1.00 22.63  ? 697  PHE A CZ    1 
ATOM   5319  N  N     . VAL A 1 697  ? -17.201 -78.818  -2.055  1.00 23.04  ? 698  VAL A N     1 
ATOM   5320  C  CA    . VAL A 1 697  ? -18.533 -78.451  -1.540  1.00 25.43  ? 698  VAL A CA    1 
ATOM   5321  C  C     . VAL A 1 697  ? -19.049 -79.179  -0.333  1.00 23.73  ? 698  VAL A C     1 
ATOM   5322  O  O     . VAL A 1 697  ? -20.111 -78.796  0.223   1.00 22.22  ? 698  VAL A O     1 
ATOM   5323  C  CB    . VAL A 1 697  ? -19.376 -78.616  -2.844  1.00 26.98  ? 698  VAL A CB    1 
ATOM   5324  C  CG1   . VAL A 1 697  ? -20.818 -78.895  -2.643  1.00 31.49  ? 698  VAL A CG1   1 
ATOM   5325  C  CG2   . VAL A 1 697  ? -19.080 -77.368  -3.682  1.00 27.44  ? 698  VAL A CG2   1 
ATOM   5326  N  N     . CYS A 1 698  ? -18.505 -80.318  0.063   1.00 22.14  ? 699  CYS A N     1 
ATOM   5327  C  CA    . CYS A 1 698  ? -19.138 -81.179  1.059   1.00 23.17  ? 699  CYS A CA    1 
ATOM   5328  C  C     . CYS A 1 698  ? -19.147 -80.568  2.448   1.00 21.12  ? 699  CYS A C     1 
ATOM   5329  O  O     . CYS A 1 698  ? -18.063 -80.175  2.880   1.00 21.69  ? 699  CYS A O     1 
ATOM   5330  C  CB    . CYS A 1 698  ? -18.385 -82.538  1.131   1.00 20.41  ? 699  CYS A CB    1 
ATOM   5331  S  SG    . CYS A 1 698  ? -19.060 -83.716  2.313   1.00 23.05  ? 699  CYS A SG    1 
ATOM   5332  N  N     . PRO A 1 699  ? -20.302 -80.490  3.077   1.00 22.79  ? 700  PRO A N     1 
ATOM   5333  C  CA    . PRO A 1 699  ? -20.432 -79.892  4.404   1.00 22.76  ? 700  PRO A CA    1 
ATOM   5334  C  C     . PRO A 1 699  ? -19.895 -80.805  5.492   1.00 23.16  ? 700  PRO A C     1 
ATOM   5335  O  O     . PRO A 1 699  ? -19.954 -80.401  6.648   1.00 22.72  ? 700  PRO A O     1 
ATOM   5336  C  CB    . PRO A 1 699  ? -21.929 -79.582  4.552   1.00 24.34  ? 700  PRO A CB    1 
ATOM   5337  C  CG    . PRO A 1 699  ? -22.509 -79.771  3.166   1.00 22.02  ? 700  PRO A CG    1 
ATOM   5338  C  CD    . PRO A 1 699  ? -21.633 -80.835  2.523   1.00 24.14  ? 700  PRO A CD    1 
ATOM   5339  N  N     . HIS A 1 700  ? -19.417 -82.006  5.161   1.00 21.96  ? 701  HIS A N     1 
ATOM   5340  C  CA    . HIS A 1 700  ? -18.900 -82.896  6.201   1.00 21.83  ? 701  HIS A CA    1 
ATOM   5341  C  C     . HIS A 1 700  ? -17.556 -83.522  5.903   1.00 22.57  ? 701  HIS A C     1 
ATOM   5342  O  O     . HIS A 1 700  ? -17.018 -84.321  6.687   1.00 22.44  ? 701  HIS A O     1 
ATOM   5343  C  CB    . HIS A 1 700  ? -19.956 -84.025  6.470   1.00 22.94  ? 701  HIS A CB    1 
ATOM   5344  C  CG    . HIS A 1 700  ? -21.067 -83.432  7.316   1.00 22.72  ? 701  HIS A CG    1 
ATOM   5345  N  ND1   . HIS A 1 700  ? -22.130 -82.796  6.725   1.00 21.66  ? 701  HIS A ND1   1 
ATOM   5346  C  CD2   . HIS A 1 700  ? -21.260 -83.378  8.675   1.00 22.39  ? 701  HIS A CD2   1 
ATOM   5347  C  CE1   . HIS A 1 700  ? -22.953 -82.344  7.676   1.00 21.72  ? 701  HIS A CE1   1 
ATOM   5348  N  NE2   . HIS A 1 700  ? -22.442 -82.688  8.849   1.00 22.31  ? 701  HIS A NE2   1 
ATOM   5349  N  N     . SER A 1 701  ? -16.890 -83.170  4.801   1.00 25.33  ? 702  SER A N     1 
ATOM   5350  C  CA    . SER A 1 701  ? -15.579 -83.720  4.468   1.00 23.71  ? 702  SER A CA    1 
ATOM   5351  C  C     . SER A 1 701  ? -15.675 -85.196  4.095   1.00 25.78  ? 702  SER A C     1 
ATOM   5352  O  O     . SER A 1 701  ? -14.675 -85.929  4.256   1.00 24.67  ? 702  SER A O     1 
ATOM   5353  C  CB    . SER A 1 701  ? -14.550 -83.568  5.612   1.00 22.33  ? 702  SER A CB    1 
ATOM   5354  O  OG    . SER A 1 701  ? -13.239 -83.508  5.026   1.00 21.87  ? 702  SER A OG    1 
ATOM   5355  N  N     . ALA A 1 702  ? -16.868 -85.597  3.617   1.00 25.77  ? 703  ALA A N     1 
ATOM   5356  C  CA    . ALA A 1 702  ? -17.092 -86.990  3.299   1.00 27.55  ? 703  ALA A CA    1 
ATOM   5357  C  C     . ALA A 1 702  ? -16.594 -87.374  1.903   1.00 26.25  ? 703  ALA A C     1 
ATOM   5358  O  O     . ALA A 1 702  ? -16.888 -88.513  1.522   1.00 28.30  ? 703  ALA A O     1 
ATOM   5359  C  CB    . ALA A 1 702  ? -18.561 -87.392  3.447   1.00 25.08  ? 703  ALA A CB    1 
ATOM   5360  N  N     . ILE A 1 703  ? -15.928 -86.505  1.190   1.00 26.89  ? 704  ILE A N     1 
ATOM   5361  C  CA    . ILE A 1 703  ? -15.368 -86.875  -0.113  1.00 26.58  ? 704  ILE A CA    1 
ATOM   5362  C  C     . ILE A 1 703  ? -13.857 -86.699  0.015   1.00 27.29  ? 704  ILE A C     1 
ATOM   5363  O  O     . ILE A 1 703  ? -13.396 -85.591  0.291   1.00 26.72  ? 704  ILE A O     1 
ATOM   5364  C  CB    . ILE A 1 703  ? -15.961 -86.117  -1.284  1.00 26.88  ? 704  ILE A CB    1 
ATOM   5365  C  CG1   . ILE A 1 703  ? -17.441 -86.520  -1.522  1.00 23.32  ? 704  ILE A CG1   1 
ATOM   5366  C  CG2   . ILE A 1 703  ? -15.198 -86.359  -2.604  1.00 27.00  ? 704  ILE A CG2   1 
ATOM   5367  C  CD1   . ILE A 1 703  ? -18.066 -85.652  -2.626  1.00 24.64  ? 704  ILE A CD1   1 
ATOM   5368  N  N     . LEU A 1 704  ? -13.121 -87.767  -0.263  1.00 27.09  ? 705  LEU A N     1 
ATOM   5369  C  CA    . LEU A 1 704  ? -11.659 -87.719  -0.252  1.00 28.79  ? 705  LEU A CA    1 
ATOM   5370  C  C     . LEU A 1 704  ? -11.061 -87.948  -1.641  1.00 28.04  ? 705  LEU A C     1 
ATOM   5371  O  O     . LEU A 1 704  ? -11.009 -89.075  -2.108  1.00 27.73  ? 705  LEU A O     1 
ATOM   5372  C  CB    . LEU A 1 704  ? -11.114 -88.769  0.726   1.00 27.89  ? 705  LEU A CB    1 
ATOM   5373  C  CG    . LEU A 1 704  ? -9.604  -89.005  0.797   1.00 30.53  ? 705  LEU A CG    1 
ATOM   5374  C  CD1   . LEU A 1 704  ? -8.814  -87.723  1.049   1.00 29.65  ? 705  LEU A CD1   1 
ATOM   5375  C  CD2   . LEU A 1 704  ? -9.284  -90.075  1.843   1.00 30.43  ? 705  LEU A CD2   1 
ATOM   5376  N  N     . PRO A 1 705  ? -10.552 -86.910  -2.280  1.00 29.03  ? 706  PRO A N     1 
ATOM   5377  C  CA    . PRO A 1 705  ? -9.841  -87.002  -3.553  1.00 29.94  ? 706  PRO A CA    1 
ATOM   5378  C  C     . PRO A 1 705  ? -8.485  -87.670  -3.337  1.00 32.36  ? 706  PRO A C     1 
ATOM   5379  O  O     . PRO A 1 705  ? -7.736  -87.350  -2.389  1.00 31.65  ? 706  PRO A O     1 
ATOM   5380  C  CB    . PRO A 1 705  ? -9.716  -85.557  -4.002  1.00 30.60  ? 706  PRO A CB    1 
ATOM   5381  C  CG    . PRO A 1 705  ? -10.591 -84.770  -3.082  1.00 31.37  ? 706  PRO A CG    1 
ATOM   5382  C  CD    . PRO A 1 705  ? -10.531 -85.514  -1.761  1.00 29.42  ? 706  PRO A CD    1 
ATOM   5383  N  N     . VAL A 1 706  ? -8.247  -88.791  -4.014  1.00 33.00  ? 707  VAL A N     1 
ATOM   5384  C  CA    . VAL A 1 706  ? -7.018  -89.562  -3.837  1.00 33.05  ? 707  VAL A CA    1 
ATOM   5385  C  C     . VAL A 1 706  ? -6.089  -89.328  -5.023  1.00 34.17  ? 707  VAL A C     1 
ATOM   5386  O  O     . VAL A 1 706  ? -6.536  -89.422  -6.158  1.00 33.25  ? 707  VAL A O     1 
ATOM   5387  C  CB    . VAL A 1 706  ? -7.321  -91.078  -3.760  1.00 34.10  ? 707  VAL A CB    1 
ATOM   5388  C  CG1   . VAL A 1 706  ? -6.068  -91.922  -3.562  1.00 34.01  ? 707  VAL A CG1   1 
ATOM   5389  C  CG2   . VAL A 1 706  ? -8.294  -91.417  -2.645  1.00 32.67  ? 707  VAL A CG2   1 
ATOM   5390  N  N     . LEU A 1 707  ? -4.836  -88.984  -4.739  1.00 34.73  ? 708  LEU A N     1 
ATOM   5391  C  CA    . LEU A 1 707  ? -3.874  -88.839  -5.824  1.00 37.04  ? 708  LEU A CA    1 
ATOM   5392  C  C     . LEU A 1 707  ? -2.707  -89.746  -5.430  1.00 38.26  ? 708  LEU A C     1 
ATOM   5393  O  O     . LEU A 1 707  ? -1.982  -89.513  -4.468  1.00 36.07  ? 708  LEU A O     1 
ATOM   5394  C  CB    . LEU A 1 707  ? -3.513  -87.391  -6.061  1.00 37.92  ? 708  LEU A CB    1 
ATOM   5395  C  CG    . LEU A 1 707  ? -2.729  -87.107  -7.349  1.00 39.79  ? 708  LEU A CG    1 
ATOM   5396  C  CD1   . LEU A 1 707  ? -3.668  -87.219  -8.545  1.00 38.17  ? 708  LEU A CD1   1 
ATOM   5397  C  CD2   . LEU A 1 707  ? -2.044  -85.750  -7.278  1.00 38.86  ? 708  LEU A CD2   1 
ATOM   5398  N  N     . ALA A 1 708  ? -2.565  -90.841  -6.176  1.00 41.39  ? 709  ALA A N     1 
ATOM   5399  C  CA    . ALA A 1 708  ? -1.568  -91.854  -5.876  1.00 43.92  ? 709  ALA A CA    1 
ATOM   5400  C  C     . ALA A 1 708  ? -0.631  -92.193  -7.024  1.00 47.51  ? 709  ALA A C     1 
ATOM   5401  O  O     . ALA A 1 708  ? -1.039  -92.164  -8.186  1.00 48.06  ? 709  ALA A O     1 
ATOM   5402  C  CB    . ALA A 1 708  ? -2.325  -93.145  -5.549  1.00 43.13  ? 709  ALA A CB    1 
ATOM   5403  N  N     . LYS A 1 709  ? 0.580   -92.599  -6.674  1.00 50.86  ? 710  LYS A N     1 
ATOM   5404  C  CA    . LYS A 1 709  ? 1.508   -93.134  -7.684  1.00 55.07  ? 710  LYS A CA    1 
ATOM   5405  C  C     . LYS A 1 709  ? 1.255   -94.641  -7.651  1.00 57.08  ? 710  LYS A C     1 
ATOM   5406  O  O     . LYS A 1 709  ? 0.803   -95.158  -6.622  1.00 56.45  ? 710  LYS A O     1 
ATOM   5407  C  CB    . LYS A 1 709  ? 2.943   -92.726  -7.429  1.00 55.85  ? 710  LYS A CB    1 
ATOM   5408  C  CG    . LYS A 1 709  ? 3.245   -92.447  -5.966  1.00 57.92  ? 710  LYS A CG    1 
ATOM   5409  C  CD    . LYS A 1 709  ? 3.337   -90.959  -5.669  1.00 58.78  ? 710  LYS A CD    1 
ATOM   5410  C  CE    . LYS A 1 709  ? 4.788   -90.572  -5.435  1.00 59.64  ? 710  LYS A CE    1 
ATOM   5411  N  NZ    . LYS A 1 709  ? 5.173   -89.384  -6.259  1.00 60.82  ? 710  LYS A NZ    1 
ATOM   5412  N  N     . GLU A 1 710  ? 1.413   -95.350  -8.753  1.00 61.09  ? 711  GLU A N     1 
ATOM   5413  C  CA    . GLU A 1 710  ? 1.061   -96.751  -8.877  1.00 64.81  ? 711  GLU A CA    1 
ATOM   5414  C  C     . GLU A 1 710  ? 1.549   -97.689  -7.785  1.00 65.01  ? 711  GLU A C     1 
ATOM   5415  O  O     . GLU A 1 710  ? 0.877   -98.676  -7.464  1.00 64.40  ? 711  GLU A O     1 
ATOM   5416  C  CB    . GLU A 1 710  ? 1.419   -97.274  -10.269 1.00 68.30  ? 711  GLU A CB    1 
ATOM   5417  C  CG    . GLU A 1 710  ? 2.875   -97.456  -10.620 1.00 71.72  ? 711  GLU A CG    1 
ATOM   5418  C  CD    . GLU A 1 710  ? 3.056   -98.396  -11.804 1.00 74.13  ? 711  GLU A CD    1 
ATOM   5419  O  OE1   . GLU A 1 710  ? 3.613   -97.947  -12.831 1.00 75.00  ? 711  GLU A OE1   1 
ATOM   5420  O  OE2   . GLU A 1 710  ? 2.661   -99.588  -11.738 1.00 74.99  ? 711  GLU A OE2   1 
ATOM   5421  N  N     . GLU A 1 711  ? 2.652   -97.381  -7.116  1.00 65.42  ? 712  GLU A N     1 
ATOM   5422  C  CA    . GLU A 1 711  ? 3.145   -98.270  -6.066  1.00 66.37  ? 712  GLU A CA    1 
ATOM   5423  C  C     . GLU A 1 711  ? 2.336   -98.160  -4.784  1.00 65.47  ? 712  GLU A C     1 
ATOM   5424  O  O     . GLU A 1 711  ? 2.220   -99.111  -4.000  1.00 63.91  ? 712  GLU A O     1 
ATOM   5425  C  CB    . GLU A 1 711  ? 4.645   -98.064  -5.891  1.00 68.99  ? 712  GLU A CB    1 
ATOM   5426  C  CG    . GLU A 1 711  ? 5.461   -98.417  -7.124  1.00 72.86  ? 712  GLU A CG    1 
ATOM   5427  C  CD    . GLU A 1 711  ? 5.254   -99.772  -7.773  1.00 75.00  ? 712  GLU A CD    1 
ATOM   5428  O  OE1   . GLU A 1 711  ? 4.895   -99.834  -8.983  1.00 75.54  ? 712  GLU A OE1   1 
ATOM   5429  O  OE2   . GLU A 1 711  ? 5.456   -100.811 -7.097  1.00 75.44  ? 712  GLU A OE2   1 
ATOM   5430  N  N     . GLU A 1 712  ? 1.692   -97.012  -4.576  1.00 63.78  ? 713  GLU A N     1 
ATOM   5431  C  CA    . GLU A 1 712  ? 0.853   -96.788  -3.409  1.00 62.89  ? 713  GLU A CA    1 
ATOM   5432  C  C     . GLU A 1 712  ? -0.493  -97.502  -3.551  1.00 62.53  ? 713  GLU A C     1 
ATOM   5433  O  O     . GLU A 1 712  ? -1.253  -97.635  -2.607  1.00 61.38  ? 713  GLU A O     1 
ATOM   5434  C  CB    . GLU A 1 712  ? 0.548   -95.300  -3.217  1.00 61.59  ? 713  GLU A CB    1 
ATOM   5435  C  CG    . GLU A 1 712  ? 1.753   -94.385  -3.350  1.00 60.63  ? 713  GLU A CG    1 
ATOM   5436  C  CD    . GLU A 1 712  ? 1.346   -92.943  -3.090  1.00 59.60  ? 713  GLU A CD    1 
ATOM   5437  O  OE1   . GLU A 1 712  ? 1.585   -92.463  -1.974  1.00 58.74  ? 713  GLU A OE1   1 
ATOM   5438  O  OE2   . GLU A 1 712  ? 0.795   -92.325  -4.014  1.00 59.42  ? 713  GLU A OE2   1 
ATOM   5439  N  N     . LEU A 1 713  ? -0.781  -97.906  -4.780  1.00 63.62  ? 714  LEU A N     1 
ATOM   5440  C  CA    . LEU A 1 713  ? -2.064  -98.537  -5.081  1.00 65.30  ? 714  LEU A CA    1 
ATOM   5441  C  C     . LEU A 1 713  ? -1.945  -100.048 -5.137  1.00 66.28  ? 714  LEU A C     1 
ATOM   5442  O  O     . LEU A 1 713  ? -2.918  -100.777 -5.356  1.00 66.11  ? 714  LEU A O     1 
ATOM   5443  C  CB    . LEU A 1 713  ? -2.601  -97.904  -6.365  1.00 65.16  ? 714  LEU A CB    1 
ATOM   5444  C  CG    . LEU A 1 713  ? -3.789  -96.943  -6.301  1.00 65.40  ? 714  LEU A CG    1 
ATOM   5445  C  CD1   . LEU A 1 713  ? -3.900  -96.207  -4.977  1.00 64.92  ? 714  LEU A CD1   1 
ATOM   5446  C  CD2   . LEU A 1 713  ? -3.732  -95.930  -7.441  1.00 65.06  ? 714  LEU A CD2   1 
ATOM   5447  N  N     . VAL A 1 714  ? -0.756  -100.554 -4.834  1.00 67.43  ? 715  VAL A N     1 
ATOM   5448  C  CA    . VAL A 1 714  ? -0.445  -101.982 -4.852  1.00 68.61  ? 715  VAL A CA    1 
ATOM   5449  C  C     . VAL A 1 714  ? -1.172  -102.811 -3.808  1.00 68.75  ? 715  VAL A C     1 
ATOM   5450  O  O     . VAL A 1 714  ? -1.494  -103.981 -4.096  1.00 69.76  ? 715  VAL A O     1 
ATOM   5451  C  CB    . VAL A 1 714  ? 1.087   -102.168 -4.781  1.00 68.97  ? 715  VAL A CB    1 
ATOM   5452  C  CG1   . VAL A 1 714  ? 1.567   -103.586 -4.524  1.00 68.63  ? 715  VAL A CG1   1 
ATOM   5453  C  CG2   . VAL A 1 714  ? 1.708   -101.675 -6.094  1.00 69.09  ? 715  VAL A CG2   1 
ATOM   5454  N  N     . GLY A 1 715  ? -1.456  -102.280 -2.626  1.00 68.08  ? 716  GLY A N     1 
ATOM   5455  C  CA    . GLY A 1 715  ? -2.149  -103.085 -1.623  1.00 67.66  ? 716  GLY A CA    1 
ATOM   5456  C  C     . GLY A 1 715  ? -3.635  -102.812 -1.523  1.00 66.95  ? 716  GLY A C     1 
ATOM   5457  O  O     . GLY A 1 715  ? -4.278  -103.147 -0.520  1.00 67.77  ? 716  GLY A O     1 
ATOM   5458  N  N     . ALA A 1 716  ? -4.219  -102.218 -2.555  1.00 66.40  ? 717  ALA A N     1 
ATOM   5459  C  CA    . ALA A 1 716  ? -5.624  -101.835 -2.557  1.00 64.57  ? 717  ALA A CA    1 
ATOM   5460  C  C     . ALA A 1 716  ? -6.575  -102.927 -3.007  1.00 64.11  ? 717  ALA A C     1 
ATOM   5461  O  O     . ALA A 1 716  ? -6.242  -103.776 -3.831  1.00 63.63  ? 717  ALA A O     1 
ATOM   5462  C  CB    . ALA A 1 716  ? -5.777  -100.631 -3.485  1.00 63.81  ? 717  ALA A CB    1 
ATOM   5463  N  N     . PRO A 1 717  ? -7.827  -102.851 -2.561  1.00 63.62  ? 718  PRO A N     1 
ATOM   5464  C  CA    . PRO A 1 717  ? -8.890  -103.758 -2.954  1.00 62.72  ? 718  PRO A CA    1 
ATOM   5465  C  C     . PRO A 1 717  ? -9.199  -103.655 -4.439  1.00 61.76  ? 718  PRO A C     1 
ATOM   5466  O  O     . PRO A 1 717  ? -8.907  -102.638 -5.071  1.00 60.52  ? 718  PRO A O     1 
ATOM   5467  C  CB    . PRO A 1 717  ? -10.072 -103.337 -2.089  1.00 63.39  ? 718  PRO A CB    1 
ATOM   5468  C  CG    . PRO A 1 717  ? -9.496  -102.531 -0.977  1.00 62.70  ? 718  PRO A CG    1 
ATOM   5469  C  CD    . PRO A 1 717  ? -8.319  -101.824 -1.597  1.00 63.42  ? 718  PRO A CD    1 
ATOM   5470  N  N     . ALA A 1 718  ? -9.730  -104.713 -5.048  1.00 61.07  ? 719  ALA A N     1 
ATOM   5471  C  CA    . ALA A 1 718  ? -9.976  -104.768 -6.480  1.00 60.29  ? 719  ALA A CA    1 
ATOM   5472  C  C     . ALA A 1 718  ? -10.895 -103.668 -7.006  1.00 59.79  ? 719  ALA A C     1 
ATOM   5473  O  O     . ALA A 1 718  ? -10.681 -103.186 -8.124  1.00 58.95  ? 719  ALA A O     1 
ATOM   5474  C  CB    . ALA A 1 718  ? -10.562 -106.125 -6.877  1.00 61.33  ? 719  ALA A CB    1 
ATOM   5475  N  N     . ASN A 1 719  ? -11.893 -103.272 -6.216  1.00 57.90  ? 720  ASN A N     1 
ATOM   5476  C  CA    . ASN A 1 719  ? -12.823 -102.254 -6.712  1.00 57.47  ? 720  ASN A CA    1 
ATOM   5477  C  C     . ASN A 1 719  ? -12.324 -100.838 -6.436  1.00 55.35  ? 720  ASN A C     1 
ATOM   5478  O  O     . ASN A 1 719  ? -13.041 -99.861  -6.635  1.00 55.69  ? 720  ASN A O     1 
ATOM   5479  C  CB    . ASN A 1 719  ? -14.223 -102.515 -6.157  1.00 57.65  ? 720  ASN A CB    1 
ATOM   5480  C  CG    . ASN A 1 719  ? -14.235 -102.697 -4.654  1.00 57.77  ? 720  ASN A CG    1 
ATOM   5481  O  OD1   . ASN A 1 719  ? -14.750 -103.701 -4.171  1.00 57.43  ? 720  ASN A OD1   1 
ATOM   5482  N  ND2   . ASN A 1 719  ? -13.670 -101.741 -3.924  1.00 58.04  ? 720  ASN A ND2   1 
ATOM   5483  N  N     . PHE A 1 720  ? -11.062 -100.738 -6.006  1.00 52.61  ? 721  PHE A N     1 
ATOM   5484  C  CA    . PHE A 1 720  ? -10.460 -99.428  -5.778  1.00 49.86  ? 721  PHE A CA    1 
ATOM   5485  C  C     . PHE A 1 720  ? -10.094 -98.804  -7.119  1.00 47.99  ? 721  PHE A C     1 
ATOM   5486  O  O     . PHE A 1 720  ? -8.946  -98.465  -7.389  1.00 46.91  ? 721  PHE A O     1 
ATOM   5487  C  CB    . PHE A 1 720  ? -9.236  -99.508  -4.865  1.00 49.15  ? 721  PHE A CB    1 
ATOM   5488  C  CG    . PHE A 1 720  ? -8.907  -98.210  -4.182  1.00 48.10  ? 721  PHE A CG    1 
ATOM   5489  C  CD1   . PHE A 1 720  ? -9.655  -97.775  -3.098  1.00 46.78  ? 721  PHE A CD1   1 
ATOM   5490  C  CD2   . PHE A 1 720  ? -7.857  -97.418  -4.635  1.00 47.62  ? 721  PHE A CD2   1 
ATOM   5491  C  CE1   . PHE A 1 720  ? -9.359  -96.588  -2.466  1.00 47.15  ? 721  PHE A CE1   1 
ATOM   5492  C  CE2   . PHE A 1 720  ? -7.560  -96.221  -4.019  1.00 47.66  ? 721  PHE A CE2   1 
ATOM   5493  C  CZ    . PHE A 1 720  ? -8.322  -95.809  -2.931  1.00 47.24  ? 721  PHE A CZ    1 
ATOM   5494  N  N     . THR A 1 721  ? -11.098 -98.625  -7.976  1.00 47.28  ? 722  THR A N     1 
ATOM   5495  C  CA    . THR A 1 721  ? -10.880 -98.024  -9.282  1.00 48.28  ? 722  THR A CA    1 
ATOM   5496  C  C     . THR A 1 721  ? -10.287 -96.617  -9.238  1.00 49.73  ? 722  THR A C     1 
ATOM   5497  O  O     . THR A 1 721  ? -10.819 -95.708  -8.604  1.00 49.49  ? 722  THR A O     1 
ATOM   5498  C  CB    . THR A 1 721  ? -12.185 -97.925  -10.099 1.00 47.82  ? 722  THR A CB    1 
ATOM   5499  O  OG1   . THR A 1 721  ? -12.956 -99.113  -9.914  1.00 48.15  ? 722  THR A OG1   1 
ATOM   5500  C  CG2   . THR A 1 721  ? -11.841 -97.739  -11.569 1.00 47.78  ? 722  THR A CG2   1 
ATOM   5501  N  N     . ALA A 1 722  ? -9.195  -96.455  -9.979  1.00 50.66  ? 723  ALA A N     1 
ATOM   5502  C  CA    . ALA A 1 722  ? -8.523  -95.172  -10.111 1.00 50.56  ? 723  ALA A CA    1 
ATOM   5503  C  C     . ALA A 1 722  ? -8.406  -94.821  -11.591 1.00 51.60  ? 723  ALA A C     1 
ATOM   5504  O  O     . ALA A 1 722  ? -8.351  -95.730  -12.429 1.00 51.87  ? 723  ALA A O     1 
ATOM   5505  C  CB    . ALA A 1 722  ? -7.147  -95.163  -9.473  1.00 50.31  ? 723  ALA A CB    1 
ATOM   5506  N  N     . LEU A 1 723  ? -8.383  -93.531  -11.896 1.00 50.63  ? 724  LEU A N     1 
ATOM   5507  C  CA    . LEU A 1 723  ? -8.231  -93.090  -13.276 1.00 51.04  ? 724  LEU A CA    1 
ATOM   5508  C  C     . LEU A 1 723  ? -6.811  -92.594  -13.490 1.00 52.00  ? 724  LEU A C     1 
ATOM   5509  O  O     . LEU A 1 723  ? -6.123  -92.379  -12.485 1.00 50.05  ? 724  LEU A O     1 
ATOM   5510  C  CB    . LEU A 1 723  ? -9.195  -91.931  -13.538 1.00 50.92  ? 724  LEU A CB    1 
ATOM   5511  C  CG    . LEU A 1 723  ? -10.667 -92.211  -13.236 1.00 50.52  ? 724  LEU A CG    1 
ATOM   5512  C  CD1   . LEU A 1 723  ? -11.438 -90.908  -13.357 1.00 50.17  ? 724  LEU A CD1   1 
ATOM   5513  C  CD2   . LEU A 1 723  ? -11.192 -93.274  -14.193 1.00 51.23  ? 724  LEU A CD2   1 
ATOM   5514  N  N     . GLU A 1 724  ? -6.366  -92.381  -14.737 1.00 53.03  ? 725  GLU A N     1 
ATOM   5515  C  CA    . GLU A 1 724  ? -5.027  -91.770  -14.835 1.00 55.58  ? 725  GLU A CA    1 
ATOM   5516  C  C     . GLU A 1 724  ? -5.271  -90.259  -14.726 1.00 55.37  ? 725  GLU A C     1 
ATOM   5517  O  O     . GLU A 1 724  ? -6.161  -89.714  -15.383 1.00 53.99  ? 725  GLU A O     1 
ATOM   5518  C  CB    . GLU A 1 724  ? -4.219  -92.169  -16.033 1.00 57.40  ? 725  GLU A CB    1 
ATOM   5519  C  CG    . GLU A 1 724  ? -4.941  -92.315  -17.349 1.00 60.91  ? 725  GLU A CG    1 
ATOM   5520  C  CD    . GLU A 1 724  ? -4.136  -93.179  -18.314 1.00 63.10  ? 725  GLU A CD    1 
ATOM   5521  O  OE1   . GLU A 1 724  ? -4.158  -92.872  -19.527 1.00 63.52  ? 725  GLU A OE1   1 
ATOM   5522  O  OE2   . GLU A 1 724  ? -3.510  -94.149  -17.822 1.00 64.21  ? 725  GLU A OE2   1 
ATOM   5523  N  N     . ALA A 1 725  ? -4.543  -89.598  -13.835 1.00 55.89  ? 726  ALA A N     1 
ATOM   5524  C  CA    . ALA A 1 725  ? -4.720  -88.178  -13.600 1.00 57.25  ? 726  ALA A CA    1 
ATOM   5525  C  C     . ALA A 1 725  ? -4.519  -87.334  -14.855 1.00 58.60  ? 726  ALA A C     1 
ATOM   5526  O  O     . ALA A 1 725  ? -3.543  -87.540  -15.567 1.00 58.02  ? 726  ALA A O     1 
ATOM   5527  C  CB    . ALA A 1 725  ? -3.757  -87.684  -12.529 1.00 56.97  ? 726  ALA A CB    1 
ATOM   5528  N  N     . LYS A 1 726  ? -5.441  -86.418  -15.090 1.00 61.03  ? 727  LYS A N     1 
ATOM   5529  C  CA    . LYS A 1 726  ? -5.350  -85.461  -16.178 1.00 64.70  ? 727  LYS A CA    1 
ATOM   5530  C  C     . LYS A 1 726  ? -4.510  -84.287  -15.650 1.00 66.53  ? 727  LYS A C     1 
ATOM   5531  O  O     . LYS A 1 726  ? -4.393  -84.182  -14.425 1.00 66.31  ? 727  LYS A O     1 
ATOM   5532  C  CB    . LYS A 1 726  ? -6.710  -84.962  -16.646 1.00 65.86  ? 727  LYS A CB    1 
ATOM   5533  C  CG    . LYS A 1 726  ? -7.815  -85.988  -16.799 1.00 66.70  ? 727  LYS A CG    1 
ATOM   5534  C  CD    . LYS A 1 726  ? -9.193  -85.377  -16.605 1.00 67.73  ? 727  LYS A CD    1 
ATOM   5535  C  CE    . LYS A 1 726  ? -9.729  -84.720  -17.861 1.00 68.27  ? 727  LYS A CE    1 
ATOM   5536  N  NZ    . LYS A 1 726  ? -10.080 -83.283  -17.683 1.00 68.52  ? 727  LYS A NZ    1 
ATOM   5537  N  N     . GLY A 1 727  ? -3.933  -83.473  -16.517 1.00 68.15  ? 728  GLY A N     1 
ATOM   5538  C  CA    . GLY A 1 727  ? -3.083  -82.379  -16.042 1.00 71.15  ? 728  GLY A CA    1 
ATOM   5539  C  C     . GLY A 1 727  ? -1.610  -82.632  -16.379 1.00 72.52  ? 728  GLY A C     1 
ATOM   5540  O  O     . GLY A 1 727  ? -1.212  -83.772  -16.625 1.00 72.63  ? 728  GLY A O     1 
ATOM   5541  N  N     . LYS A 1 728  ? -0.822  -81.568  -16.428 1.00 73.74  ? 729  LYS A N     1 
ATOM   5542  C  CA    . LYS A 1 728  ? 0.601   -81.641  -16.761 1.00 75.00  ? 729  LYS A CA    1 
ATOM   5543  C  C     . LYS A 1 728  ? 1.376   -82.036  -15.508 1.00 74.40  ? 729  LYS A C     1 
ATOM   5544  O  O     . LYS A 1 728  ? 2.135   -82.997  -15.470 1.00 74.12  ? 729  LYS A O     1 
ATOM   5545  C  CB    . LYS A 1 728  ? 1.058   -80.300  -17.328 1.00 76.68  ? 729  LYS A CB    1 
ATOM   5546  C  CG    . LYS A 1 728  ? 2.504   -79.882  -17.234 1.00 78.55  ? 729  LYS A CG    1 
ATOM   5547  C  CD    . LYS A 1 728  ? 2.807   -78.978  -16.045 1.00 79.92  ? 729  LYS A CD    1 
ATOM   5548  C  CE    . LYS A 1 728  ? 4.047   -78.132  -16.302 1.00 80.79  ? 729  LYS A CE    1 
ATOM   5549  N  NZ    . LYS A 1 728  ? 3.683   -76.782  -16.845 1.00 81.42  ? 729  LYS A NZ    1 
ATOM   5550  N  N     . GLU A 1 729  ? 1.113   -81.274  -14.459 1.00 73.18  ? 730  GLU A N     1 
ATOM   5551  C  CA    . GLU A 1 729  ? 1.703   -81.413  -13.142 1.00 72.38  ? 730  GLU A CA    1 
ATOM   5552  C  C     . GLU A 1 729  ? 1.468   -82.799  -12.554 1.00 70.36  ? 730  GLU A C     1 
ATOM   5553  O  O     . GLU A 1 729  ? 2.206   -83.299  -11.717 1.00 69.24  ? 730  GLU A O     1 
ATOM   5554  C  CB    . GLU A 1 729  ? 1.116   -80.342  -12.214 1.00 73.83  ? 730  GLU A CB    1 
ATOM   5555  C  CG    . GLU A 1 729  ? 1.000   -78.955  -12.799 1.00 75.62  ? 730  GLU A CG    1 
ATOM   5556  C  CD    . GLU A 1 729  ? -0.202  -78.682  -13.672 1.00 76.75  ? 730  GLU A CD    1 
ATOM   5557  O  OE1   . GLU A 1 729  ? -1.157  -79.482  -13.787 1.00 77.48  ? 730  GLU A OE1   1 
ATOM   5558  O  OE2   . GLU A 1 729  ? -0.231  -77.605  -14.315 1.00 77.53  ? 730  GLU A OE2   1 
ATOM   5559  N  N     . LEU A 1 730  ? 0.399   -83.423  -13.027 1.00 68.60  ? 731  LEU A N     1 
ATOM   5560  C  CA    . LEU A 1 730  ? 0.035   -84.777  -12.588 1.00 67.93  ? 731  LEU A CA    1 
ATOM   5561  C  C     . LEU A 1 730  ? 0.222   -85.652  -13.808 1.00 68.01  ? 731  LEU A C     1 
ATOM   5562  O  O     . LEU A 1 730  ? 0.148   -85.074  -14.905 1.00 69.25  ? 731  LEU A O     1 
ATOM   5563  C  CB    . LEU A 1 730  ? -1.375  -84.767  -12.010 1.00 66.87  ? 731  LEU A CB    1 
ATOM   5564  C  CG    . LEU A 1 730  ? -1.806  -83.479  -11.298 1.00 66.17  ? 731  LEU A CG    1 
ATOM   5565  C  CD1   . LEU A 1 730  ? -3.252  -83.528  -10.845 1.00 65.93  ? 731  LEU A CD1   1 
ATOM   5566  C  CD2   . LEU A 1 730  ? -0.902  -83.191  -10.109 1.00 66.14  ? 731  LEU A CD2   1 
ATOM   5567  N  N     . LYS A 1 731  ? 0.569   -86.925  -13.730 1.00 67.73  ? 732  LYS A N     1 
ATOM   5568  C  CA    . LYS A 1 731  ? 0.821   -87.642  -14.994 1.00 67.36  ? 732  LYS A CA    1 
ATOM   5569  C  C     . LYS A 1 731  ? 0.961   -89.141  -14.782 1.00 64.57  ? 732  LYS A C     1 
ATOM   5570  O  O     . LYS A 1 731  ? 0.176   -89.923  -15.314 1.00 64.69  ? 732  LYS A O     1 
ATOM   5571  C  CB    . LYS A 1 731  ? 2.058   -87.085  -15.702 1.00 69.62  ? 732  LYS A CB    1 
ATOM   5572  C  CG    . LYS A 1 731  ? 1.739   -86.526  -17.080 1.00 71.97  ? 732  LYS A CG    1 
ATOM   5573  C  CD    . LYS A 1 731  ? 3.014   -86.188  -17.838 1.00 74.21  ? 732  LYS A CD    1 
ATOM   5574  C  CE    . LYS A 1 731  ? 3.304   -84.696  -17.802 1.00 75.32  ? 732  LYS A CE    1 
ATOM   5575  N  NZ    . LYS A 1 731  ? 2.875   -84.006  -19.053 1.00 75.80  ? 732  LYS A NZ    1 
ATOM   5576  N  N     . GLY A 1 732  ? 1.938   -89.527  -13.983 1.00 61.84  ? 733  GLY A N     1 
ATOM   5577  C  CA    . GLY A 1 732  ? 2.112   -90.942  -13.640 1.00 58.14  ? 733  GLY A CA    1 
ATOM   5578  C  C     . GLY A 1 732  ? 1.214   -91.235  -12.434 1.00 55.15  ? 733  GLY A C     1 
ATOM   5579  O  O     . GLY A 1 732  ? 1.263   -92.328  -11.885 1.00 55.11  ? 733  GLY A O     1 
ATOM   5580  N  N     . TYR A 1 733  ? 0.425   -90.213  -12.078 1.00 51.96  ? 734  TYR A N     1 
ATOM   5581  C  CA    . TYR A 1 733  ? -0.481  -90.300  -10.946 1.00 48.83  ? 734  TYR A CA    1 
ATOM   5582  C  C     . TYR A 1 733  ? -1.852  -90.856  -11.343 1.00 46.27  ? 734  TYR A C     1 
ATOM   5583  O  O     . TYR A 1 733  ? -2.346  -90.623  -12.433 1.00 45.17  ? 734  TYR A O     1 
ATOM   5584  C  CB    . TYR A 1 733  ? -0.749  -88.931  -10.312 1.00 48.91  ? 734  TYR A CB    1 
ATOM   5585  C  CG    . TYR A 1 733  ? 0.369   -88.347  -9.487  1.00 49.43  ? 734  TYR A CG    1 
ATOM   5586  C  CD1   . TYR A 1 733  ? 1.049   -87.220  -9.936  1.00 48.85  ? 734  TYR A CD1   1 
ATOM   5587  C  CD2   . TYR A 1 733  ? 0.734   -88.907  -8.264  1.00 48.93  ? 734  TYR A CD2   1 
ATOM   5588  C  CE1   . TYR A 1 733  ? 2.082   -86.661  -9.202  1.00 49.26  ? 734  TYR A CE1   1 
ATOM   5589  C  CE2   . TYR A 1 733  ? 1.761   -88.346  -7.520  1.00 49.67  ? 734  TYR A CE2   1 
ATOM   5590  C  CZ    . TYR A 1 733  ? 2.424   -87.234  -7.998  1.00 49.77  ? 734  TYR A CZ    1 
ATOM   5591  O  OH    . TYR A 1 733  ? 3.443   -86.677  -7.256  1.00 51.84  ? 734  TYR A OH    1 
ATOM   5592  N  N     . LYS A 1 734  ? -2.448  -91.570  -10.413 1.00 44.89  ? 735  LYS A N     1 
ATOM   5593  C  CA    . LYS A 1 734  ? -3.761  -92.158  -10.500 1.00 44.11  ? 735  LYS A CA    1 
ATOM   5594  C  C     . LYS A 1 734  ? -4.708  -91.325  -9.625  1.00 42.74  ? 735  LYS A C     1 
ATOM   5595  O  O     . LYS A 1 734  ? -4.328  -90.997  -8.505  1.00 42.33  ? 735  LYS A O     1 
ATOM   5596  C  CB    . LYS A 1 734  ? -3.744  -93.596  -9.985  1.00 46.15  ? 735  LYS A CB    1 
ATOM   5597  C  CG    . LYS A 1 734  ? -2.789  -94.517  -10.729 1.00 49.01  ? 735  LYS A CG    1 
ATOM   5598  C  CD    . LYS A 1 734  ? -3.125  -94.641  -12.203 1.00 50.22  ? 735  LYS A CD    1 
ATOM   5599  C  CE    . LYS A 1 734  ? -3.499  -96.076  -12.563 1.00 53.19  ? 735  LYS A CE    1 
ATOM   5600  N  NZ    . LYS A 1 734  ? -2.971  -96.389  -13.933 1.00 53.85  ? 735  LYS A NZ    1 
ATOM   5601  N  N     . PHE A 1 735  ? -5.871  -91.001  -10.140 1.00 40.30  ? 736  PHE A N     1 
ATOM   5602  C  CA    . PHE A 1 735  ? -6.838  -90.171  -9.420  1.00 39.18  ? 736  PHE A CA    1 
ATOM   5603  C  C     . PHE A 1 735  ? -8.051  -91.001  -9.026  1.00 38.07  ? 736  PHE A C     1 
ATOM   5604  O  O     . PHE A 1 735  ? -8.499  -91.801  -9.853  1.00 39.65  ? 736  PHE A O     1 
ATOM   5605  C  CB    . PHE A 1 735  ? -7.256  -89.021  -10.343 1.00 37.43  ? 736  PHE A CB    1 
ATOM   5606  C  CG    . PHE A 1 735  ? -8.309  -88.115  -9.754  1.00 36.77  ? 736  PHE A CG    1 
ATOM   5607  C  CD1   . PHE A 1 735  ? -7.958  -87.180  -8.796  1.00 35.98  ? 736  PHE A CD1   1 
ATOM   5608  C  CD2   . PHE A 1 735  ? -9.637  -88.238  -10.121 1.00 36.34  ? 736  PHE A CD2   1 
ATOM   5609  C  CE1   . PHE A 1 735  ? -8.945  -86.385  -8.241  1.00 36.66  ? 736  PHE A CE1   1 
ATOM   5610  C  CE2   . PHE A 1 735  ? -10.619 -87.433  -9.567  1.00 35.91  ? 736  PHE A CE2   1 
ATOM   5611  C  CZ    . PHE A 1 735  ? -10.257 -86.493  -8.631  1.00 35.40  ? 736  PHE A CZ    1 
ATOM   5612  N  N     . ARG A 1 736  ? -8.586  -90.796  -7.833  1.00 35.77  ? 737  ARG A N     1 
ATOM   5613  C  CA    . ARG A 1 736  ? -9.789  -91.492  -7.409  1.00 33.59  ? 737  ARG A CA    1 
ATOM   5614  C  C     . ARG A 1 736  ? -10.629 -90.568  -6.494  1.00 31.98  ? 737  ARG A C     1 
ATOM   5615  O  O     . ARG A 1 736  ? -10.063 -90.028  -5.559  1.00 32.13  ? 737  ARG A O     1 
ATOM   5616  C  CB    . ARG A 1 736  ? -9.556  -92.798  -6.643  1.00 32.80  ? 737  ARG A CB    1 
ATOM   5617  C  CG    . ARG A 1 736  ? -10.831 -93.464  -6.099  1.00 32.65  ? 737  ARG A CG    1 
ATOM   5618  C  CD    . ARG A 1 736  ? -10.536 -94.800  -5.428  1.00 33.19  ? 737  ARG A CD    1 
ATOM   5619  N  NE    . ARG A 1 736  ? -11.715 -95.423  -4.832  1.00 32.30  ? 737  ARG A NE    1 
ATOM   5620  C  CZ    . ARG A 1 736  ? -12.731 -95.978  -5.463  1.00 32.11  ? 737  ARG A CZ    1 
ATOM   5621  N  NH1   . ARG A 1 736  ? -13.744 -96.467  -4.759  1.00 31.37  ? 737  ARG A NH1   1 
ATOM   5622  N  NH2   . ARG A 1 736  ? -12.725 -96.034  -6.796  1.00 32.15  ? 737  ARG A NH2   1 
ATOM   5623  N  N     . ILE A 1 737  ? -11.913 -90.523  -6.745  1.00 30.26  ? 738  ILE A N     1 
ATOM   5624  C  CA    . ILE A 1 737  ? -12.842 -89.806  -5.860  1.00 30.36  ? 738  ILE A CA    1 
ATOM   5625  C  C     . ILE A 1 737  ? -13.346 -90.860  -4.874  1.00 30.16  ? 738  ILE A C     1 
ATOM   5626  O  O     . ILE A 1 737  ? -14.077 -91.795  -5.272  1.00 29.26  ? 738  ILE A O     1 
ATOM   5627  C  CB    . ILE A 1 737  ? -13.982 -89.089  -6.598  1.00 30.52  ? 738  ILE A CB    1 
ATOM   5628  C  CG1   . ILE A 1 737  ? -13.497 -87.845  -7.356  1.00 29.80  ? 738  ILE A CG1   1 
ATOM   5629  C  CG2   . ILE A 1 737  ? -15.112 -88.634  -5.652  1.00 31.34  ? 738  ILE A CG2   1 
ATOM   5630  C  CD1   . ILE A 1 737  ? -12.752 -86.871  -6.444  1.00 30.92  ? 738  ILE A CD1   1 
ATOM   5631  N  N     . GLN A 1 738  ? -12.894 -90.790  -3.614  1.00 28.84  ? 739  GLN A N     1 
ATOM   5632  C  CA    . GLN A 1 738  ? -13.348 -91.789  -2.659  1.00 29.34  ? 739  GLN A CA    1 
ATOM   5633  C  C     . GLN A 1 738  ? -14.478 -91.263  -1.774  1.00 30.59  ? 739  GLN A C     1 
ATOM   5634  O  O     . GLN A 1 738  ? -14.194 -90.408  -0.910  1.00 28.24  ? 739  GLN A O     1 
ATOM   5635  C  CB    . GLN A 1 738  ? -12.208 -92.236  -1.731  1.00 28.37  ? 739  GLN A CB    1 
ATOM   5636  C  CG    . GLN A 1 738  ? -12.562 -93.284  -0.704  1.00 29.34  ? 739  GLN A CG    1 
ATOM   5637  C  CD    . GLN A 1 738  ? -13.256 -94.528  -1.222  1.00 30.33  ? 739  GLN A CD    1 
ATOM   5638  O  OE1   . GLN A 1 738  ? -14.399 -94.816  -0.815  1.00 31.28  ? 739  GLN A OE1   1 
ATOM   5639  N  NE2   . GLN A 1 738  ? -12.576 -95.250  -2.092  1.00 28.24  ? 739  GLN A NE2   1 
ATOM   5640  N  N     . ILE A 1 739  ? -15.648 -91.924  -1.840  1.00 30.25  ? 740  ILE A N     1 
ATOM   5641  C  CA    . ILE A 1 739  ? -16.718 -91.533  -0.930  1.00 29.30  ? 740  ILE A CA    1 
ATOM   5642  C  C     . ILE A 1 739  ? -16.523 -92.164  0.447   1.00 30.74  ? 740  ILE A C     1 
ATOM   5643  O  O     . ILE A 1 739  ? -16.350 -93.377  0.625   1.00 29.63  ? 740  ILE A O     1 
ATOM   5644  C  CB    . ILE A 1 739  ? -18.108 -91.942  -1.472  1.00 29.32  ? 740  ILE A CB    1 
ATOM   5645  C  CG1   . ILE A 1 739  ? -18.340 -91.384  -2.878  1.00 28.78  ? 740  ILE A CG1   1 
ATOM   5646  C  CG2   . ILE A 1 739  ? -19.228 -91.505  -0.540  1.00 30.35  ? 740  ILE A CG2   1 
ATOM   5647  C  CD1   . ILE A 1 739  ? -17.904 -89.962  -3.126  1.00 28.27  ? 740  ILE A CD1   1 
ATOM   5648  N  N     . ASN A 1 740  ? -16.764 -91.306  1.448   1.00 29.25  ? 741  ASN A N     1 
ATOM   5649  C  CA    . ASN A 1 740  ? -16.767 -91.722  2.856   1.00 28.08  ? 741  ASN A CA    1 
ATOM   5650  C  C     . ASN A 1 740  ? -18.228 -91.962  3.196   1.00 28.23  ? 741  ASN A C     1 
ATOM   5651  O  O     . ASN A 1 740  ? -18.938 -91.009  3.555   1.00 25.50  ? 741  ASN A O     1 
ATOM   5652  C  CB    . ASN A 1 740  ? -16.126 -90.616  3.707   1.00 25.44  ? 741  ASN A CB    1 
ATOM   5653  C  CG    . ASN A 1 740  ? -15.960 -90.999  5.162   1.00 27.36  ? 741  ASN A CG    1 
ATOM   5654  O  OD1   . ASN A 1 740  ? -15.165 -90.366  5.907   1.00 29.28  ? 741  ASN A OD1   1 
ATOM   5655  N  ND2   . ASN A 1 740  ? -16.672 -91.967  5.713   1.00 24.57  ? 741  ASN A ND2   1 
ATOM   5656  N  N     . THR A 1 741  ? -18.707 -93.215  3.025   1.00 27.68  ? 742  THR A N     1 
ATOM   5657  C  CA    . THR A 1 741  ? -20.116 -93.494  3.191   1.00 26.26  ? 742  THR A CA    1 
ATOM   5658  C  C     . THR A 1 741  ? -20.644 -93.473  4.614   1.00 28.35  ? 742  THR A C     1 
ATOM   5659  O  O     . THR A 1 741  ? -21.859 -93.263  4.758   1.00 26.10  ? 742  THR A O     1 
ATOM   5660  C  CB    . THR A 1 741  ? -20.546 -94.847  2.564   1.00 27.83  ? 742  THR A CB    1 
ATOM   5661  O  OG1   . THR A 1 741  ? -19.783 -95.852  3.220   1.00 28.78  ? 742  THR A OG1   1 
ATOM   5662  C  CG2   . THR A 1 741  ? -20.260 -94.811  1.067   1.00 27.39  ? 742  THR A CG2   1 
ATOM   5663  N  N     . LEU A 1 742  ? -19.796 -93.607  5.635   1.00 28.37  ? 743  LEU A N     1 
ATOM   5664  C  CA    . LEU A 1 742  ? -20.300 -93.556  7.002   1.00 26.97  ? 743  LEU A CA    1 
ATOM   5665  C  C     . LEU A 1 742  ? -20.319 -92.124  7.557   1.00 25.75  ? 743  LEU A C     1 
ATOM   5666  O  O     . LEU A 1 742  ? -21.138 -91.846  8.458   1.00 24.66  ? 743  LEU A O     1 
ATOM   5667  C  CB    . LEU A 1 742  ? -19.501 -94.468  7.945   1.00 29.63  ? 743  LEU A CB    1 
ATOM   5668  C  CG    . LEU A 1 742  ? -19.655 -95.981  7.682   1.00 31.37  ? 743  LEU A CG    1 
ATOM   5669  C  CD1   . LEU A 1 742  ? -18.836 -96.811  8.657   1.00 29.57  ? 743  LEU A CD1   1 
ATOM   5670  C  CD2   . LEU A 1 742  ? -21.118 -96.411  7.688   1.00 32.25  ? 743  LEU A CD2   1 
ATOM   5671  N  N     . ASP A 1 743  ? -19.536 -91.229  7.004   1.00 23.69  ? 744  ASP A N     1 
ATOM   5672  C  CA    . ASP A 1 743  ? -19.510 -89.827  7.457   1.00 24.80  ? 744  ASP A CA    1 
ATOM   5673  C  C     . ASP A 1 743  ? -20.381 -88.957  6.563   1.00 24.72  ? 744  ASP A C     1 
ATOM   5674  O  O     . ASP A 1 743  ? -20.829 -87.877  6.961   1.00 24.91  ? 744  ASP A O     1 
ATOM   5675  C  CB    . ASP A 1 743  ? -18.074 -89.364  7.554   1.00 24.01  ? 744  ASP A CB    1 
ATOM   5676  C  CG    . ASP A 1 743  ? -17.390 -89.896  8.810   1.00 26.06  ? 744  ASP A CG    1 
ATOM   5677  O  OD1   . ASP A 1 743  ? -18.003 -89.935  9.904   1.00 26.57  ? 744  ASP A OD1   1 
ATOM   5678  O  OD2   . ASP A 1 743  ? -16.204 -90.273  8.753   1.00 26.47  ? 744  ASP A OD2   1 
ATOM   5679  N  N     . CYS A 1 744  ? -20.805 -89.460  5.393   1.00 23.60  ? 745  CYS A N     1 
ATOM   5680  C  CA    . CYS A 1 744  ? -21.715 -88.727  4.504   1.00 23.71  ? 745  CYS A CA    1 
ATOM   5681  C  C     . CYS A 1 744  ? -23.044 -88.489  5.229   1.00 23.91  ? 745  CYS A C     1 
ATOM   5682  O  O     . CYS A 1 744  ? -23.420 -89.381  6.015   1.00 25.36  ? 745  CYS A O     1 
ATOM   5683  C  CB    . CYS A 1 744  ? -22.000 -89.542  3.224   1.00 23.26  ? 745  CYS A CB    1 
ATOM   5684  S  SG    . CYS A 1 744  ? -23.254 -88.833  2.131   1.00 24.23  ? 745  CYS A SG    1 
ATOM   5685  N  N     . MET A 1 745  ? -23.657 -87.332  4.978   1.00 23.62  ? 746  MET A N     1 
ATOM   5686  C  CA    . MET A 1 745  ? -24.912 -87.034  5.662   1.00 24.16  ? 746  MET A CA    1 
ATOM   5687  C  C     . MET A 1 745  ? -26.066 -87.115  4.664   1.00 24.14  ? 746  MET A C     1 
ATOM   5688  O  O     . MET A 1 745  ? -27.209 -86.988  5.101   1.00 25.20  ? 746  MET A O     1 
ATOM   5689  C  CB    . MET A 1 745  ? -24.897 -85.698  6.391   1.00 25.05  ? 746  MET A CB    1 
ATOM   5690  C  CG    . MET A 1 745  ? -23.900 -85.672  7.559   1.00 26.64  ? 746  MET A CG    1 
ATOM   5691  S  SD    . MET A 1 745  ? -24.364 -86.736  8.911   1.00 26.94  ? 746  MET A SD    1 
ATOM   5692  C  CE    . MET A 1 745  ? -25.980 -86.100  9.349   1.00 27.26  ? 746  MET A CE    1 
ATOM   5693  N  N     . GLY A 1 746  ? -25.796 -87.406  3.401   1.00 27.29  ? 747  GLY A N     1 
ATOM   5694  C  CA    . GLY A 1 746  ? -26.824 -87.652  2.401   1.00 23.51  ? 747  GLY A CA    1 
ATOM   5695  C  C     . GLY A 1 746  ? -27.512 -86.431  1.848   1.00 26.41  ? 747  GLY A C     1 
ATOM   5696  O  O     . GLY A 1 746  ? -28.545 -86.548  1.164   1.00 24.45  ? 747  GLY A O     1 
ATOM   5697  N  N     . CYS A 1 747  ? -26.865 -85.252  1.975   1.00 24.37  ? 748  CYS A N     1 
ATOM   5698  C  CA    . CYS A 1 747  ? -27.494 -84.018  1.494   1.00 26.31  ? 748  CYS A CA    1 
ATOM   5699  C  C     . CYS A 1 747  ? -27.682 -83.947  -0.012  1.00 27.18  ? 748  CYS A C     1 
ATOM   5700  O  O     . CYS A 1 747  ? -28.672 -83.377  -0.488  1.00 26.99  ? 748  CYS A O     1 
ATOM   5701  C  CB    . CYS A 1 747  ? -26.684 -82.788  1.957   1.00 23.84  ? 748  CYS A CB    1 
ATOM   5702  S  SG    . CYS A 1 747  ? -25.047 -82.498  1.197   1.00 27.32  ? 748  CYS A SG    1 
ATOM   5703  N  N     . GLY A 1 748  ? -26.707 -84.473  -0.760  1.00 28.19  ? 749  GLY A N     1 
ATOM   5704  C  CA    . GLY A 1 748  ? -26.750 -84.427  -2.198  1.00 27.53  ? 749  GLY A CA    1 
ATOM   5705  C  C     . GLY A 1 748  ? -26.116 -83.227  -2.879  1.00 27.84  ? 749  GLY A C     1 
ATOM   5706  O  O     . GLY A 1 748  ? -26.208 -83.208  -4.126  1.00 26.61  ? 749  GLY A O     1 
ATOM   5707  N  N     . ASN A 1 749  ? -25.403 -82.305  -2.222  1.00 25.75  ? 750  ASN A N     1 
ATOM   5708  C  CA    . ASN A 1 749  ? -24.811 -81.154  -2.919  1.00 25.72  ? 750  ASN A CA    1 
ATOM   5709  C  C     . ASN A 1 749  ? -23.765 -81.494  -3.977  1.00 27.06  ? 750  ASN A C     1 
ATOM   5710  O  O     . ASN A 1 749  ? -23.636 -80.896  -5.063  1.00 29.59  ? 750  ASN A O     1 
ATOM   5711  C  CB    . ASN A 1 749  ? -24.126 -80.224  -1.893  1.00 24.98  ? 750  ASN A CB    1 
ATOM   5712  C  CG    . ASN A 1 749  ? -25.116 -79.264  -1.253  1.00 24.26  ? 750  ASN A CG    1 
ATOM   5713  O  OD1   . ASN A 1 749  ? -25.492 -79.419  -0.077  1.00 24.27  ? 750  ASN A OD1   1 
ATOM   5714  N  ND2   . ASN A 1 749  ? -25.536 -78.297  -2.030  1.00 22.65  ? 750  ASN A ND2   1 
ATOM   5715  N  N     . CYS A 1 750  ? -22.956 -82.494  -3.643  1.00 26.75  ? 751  CYS A N     1 
ATOM   5716  C  CA    . CYS A 1 750  ? -21.884 -82.961  -4.501  1.00 28.10  ? 751  CYS A CA    1 
ATOM   5717  C  C     . CYS A 1 750  ? -22.420 -83.488  -5.837  1.00 26.63  ? 751  CYS A C     1 
ATOM   5718  O  O     . CYS A 1 750  ? -21.926 -83.022  -6.862  1.00 28.77  ? 751  CYS A O     1 
ATOM   5719  C  CB    . CYS A 1 750  ? -21.051 -84.030  -3.804  1.00 26.82  ? 751  CYS A CB    1 
ATOM   5720  S  SG    . CYS A 1 750  ? -21.929 -85.521  -3.288  1.00 30.38  ? 751  CYS A SG    1 
ATOM   5721  N  N     . ALA A 1 751  ? -23.406 -84.352  -5.810  1.00 27.90  ? 752  ALA A N     1 
ATOM   5722  C  CA    . ALA A 1 751  ? -23.940 -84.887  -7.074  1.00 29.51  ? 752  ALA A CA    1 
ATOM   5723  C  C     . ALA A 1 751  ? -24.806 -83.845  -7.761  1.00 30.45  ? 752  ALA A C     1 
ATOM   5724  O  O     . ALA A 1 751  ? -24.968 -83.839  -8.990  1.00 31.98  ? 752  ALA A O     1 
ATOM   5725  C  CB    . ALA A 1 751  ? -24.685 -86.177  -6.771  1.00 30.28  ? 752  ALA A CB    1 
ATOM   5726  N  N     . ASP A 1 752  ? -25.341 -82.892  -6.991  1.00 26.57  ? 753  ASP A N     1 
ATOM   5727  C  CA    . ASP A 1 752  ? -26.097 -81.814  -7.588  1.00 29.32  ? 753  ASP A CA    1 
ATOM   5728  C  C     . ASP A 1 752  ? -25.162 -80.937  -8.429  1.00 27.92  ? 753  ASP A C     1 
ATOM   5729  O  O     . ASP A 1 752  ? -25.511 -80.475  -9.499  1.00 26.34  ? 753  ASP A O     1 
ATOM   5730  C  CB    . ASP A 1 752  ? -26.804 -80.934  -6.540  1.00 31.10  ? 753  ASP A CB    1 
ATOM   5731  C  CG    . ASP A 1 752  ? -27.724 -79.931  -7.229  1.00 31.82  ? 753  ASP A CG    1 
ATOM   5732  O  OD1   . ASP A 1 752  ? -28.690 -80.457  -7.829  1.00 33.26  ? 753  ASP A OD1   1 
ATOM   5733  O  OD2   . ASP A 1 752  ? -27.476 -78.709  -7.240  1.00 30.00  ? 753  ASP A OD2   1 
ATOM   5734  N  N     . ILE A 1 753  ? -23.923 -80.827  -7.961  1.00 27.23  ? 754  ILE A N     1 
ATOM   5735  C  CA    . ILE A 1 753  ? -22.943 -79.953  -8.577  1.00 28.31  ? 754  ILE A CA    1 
ATOM   5736  C  C     . ILE A 1 753  ? -22.047 -80.600  -9.586  1.00 26.79  ? 754  ILE A C     1 
ATOM   5737  O  O     . ILE A 1 753  ? -21.404 -79.904  -10.383 1.00 27.37  ? 754  ILE A O     1 
ATOM   5738  C  CB    . ILE A 1 753  ? -22.212 -79.193  -7.431  1.00 29.15  ? 754  ILE A CB    1 
ATOM   5739  C  CG1   . ILE A 1 753  ? -22.642 -77.732  -7.659  1.00 31.05  ? 754  ILE A CG1   1 
ATOM   5740  C  CG2   . ILE A 1 753  ? -20.734 -79.321  -7.193  1.00 29.21  ? 754  ILE A CG2   1 
ATOM   5741  C  CD1   . ILE A 1 753  ? -24.085 -77.553  -7.214  1.00 32.17  ? 754  ILE A CD1   1 
ATOM   5742  N  N     . CYS A 1 754  ? -21.803 -81.880  -9.535  1.00 29.47  ? 755  CYS A N     1 
ATOM   5743  C  CA    . CYS A 1 754  ? -20.946 -82.621  -10.449 1.00 31.28  ? 755  CYS A CA    1 
ATOM   5744  C  C     . CYS A 1 754  ? -21.144 -82.159  -11.904 1.00 32.45  ? 755  CYS A C     1 
ATOM   5745  O  O     . CYS A 1 754  ? -22.249 -82.273  -12.440 1.00 33.26  ? 755  CYS A O     1 
ATOM   5746  C  CB    . CYS A 1 754  ? -21.333 -84.093  -10.337 1.00 32.87  ? 755  CYS A CB    1 
ATOM   5747  S  SG    . CYS A 1 754  ? -20.036 -85.075  -11.153 1.00 33.48  ? 755  CYS A SG    1 
ATOM   5748  N  N     . PRO A 1 755  ? -20.172 -81.490  -12.482 1.00 32.25  ? 756  PRO A N     1 
ATOM   5749  C  CA    . PRO A 1 755  ? -20.285 -80.836  -13.762 1.00 34.12  ? 756  PRO A CA    1 
ATOM   5750  C  C     . PRO A 1 755  ? -20.843 -81.572  -14.960 1.00 36.84  ? 756  PRO A C     1 
ATOM   5751  O  O     . PRO A 1 755  ? -21.725 -81.024  -15.644 1.00 36.78  ? 756  PRO A O     1 
ATOM   5752  C  CB    . PRO A 1 755  ? -18.880 -80.298  -14.032 1.00 34.01  ? 756  PRO A CB    1 
ATOM   5753  C  CG    . PRO A 1 755  ? -18.388 -80.018  -12.635 1.00 34.43  ? 756  PRO A CG    1 
ATOM   5754  C  CD    . PRO A 1 755  ? -18.840 -81.222  -11.849 1.00 33.28  ? 756  PRO A CD    1 
ATOM   5755  N  N     . PRO A 1 756  ? -20.388 -82.780  -15.254 1.00 39.92  ? 757  PRO A N     1 
ATOM   5756  C  CA    . PRO A 1 756  ? -20.882 -83.532  -16.413 1.00 41.72  ? 757  PRO A CA    1 
ATOM   5757  C  C     . PRO A 1 756  ? -22.378 -83.757  -16.398 1.00 44.65  ? 757  PRO A C     1 
ATOM   5758  O  O     . PRO A 1 756  ? -22.900 -84.205  -15.371 1.00 45.11  ? 757  PRO A O     1 
ATOM   5759  C  CB    . PRO A 1 756  ? -20.074 -84.817  -16.335 1.00 40.50  ? 757  PRO A CB    1 
ATOM   5760  C  CG    . PRO A 1 756  ? -19.701 -84.932  -14.893 1.00 41.45  ? 757  PRO A CG    1 
ATOM   5761  C  CD    . PRO A 1 756  ? -19.372 -83.519  -14.470 1.00 38.66  ? 757  PRO A CD    1 
ATOM   5762  N  N     . LYS A 1 757  ? -23.115 -83.482  -17.481 1.00 48.78  ? 758  LYS A N     1 
ATOM   5763  C  CA    . LYS A 1 757  ? -24.557 -83.726  -17.514 1.00 50.64  ? 758  LYS A CA    1 
ATOM   5764  C  C     . LYS A 1 757  ? -24.804 -85.229  -17.277 1.00 49.48  ? 758  LYS A C     1 
ATOM   5765  O  O     . LYS A 1 757  ? -25.763 -85.660  -16.658 1.00 49.04  ? 758  LYS A O     1 
ATOM   5766  C  CB    . LYS A 1 757  ? -25.262 -83.313  -18.792 1.00 53.53  ? 758  LYS A CB    1 
ATOM   5767  C  CG    . LYS A 1 757  ? -24.528 -82.407  -19.767 1.00 56.63  ? 758  LYS A CG    1 
ATOM   5768  C  CD    . LYS A 1 757  ? -25.464 -82.033  -20.924 1.00 58.17  ? 758  LYS A CD    1 
ATOM   5769  C  CE    . LYS A 1 757  ? -24.796 -82.144  -22.284 1.00 58.50  ? 758  LYS A CE    1 
ATOM   5770  N  NZ    . LYS A 1 757  ? -24.805 -83.530  -22.832 1.00 59.82  ? 758  LYS A NZ    1 
ATOM   5771  N  N     . GLU A 1 758  ? -23.823 -85.996  -17.742 1.00 48.76  ? 759  GLU A N     1 
ATOM   5772  C  CA    . GLU A 1 758  ? -23.784 -87.441  -17.504 1.00 48.24  ? 759  GLU A CA    1 
ATOM   5773  C  C     . GLU A 1 758  ? -22.960 -87.544  -16.210 1.00 44.89  ? 759  GLU A C     1 
ATOM   5774  O  O     . GLU A 1 758  ? -21.728 -87.525  -16.226 1.00 45.01  ? 759  GLU A O     1 
ATOM   5775  C  CB    . GLU A 1 758  ? -23.149 -88.165  -18.686 1.00 51.02  ? 759  GLU A CB    1 
ATOM   5776  C  CG    . GLU A 1 758  ? -21.952 -87.436  -19.291 1.00 54.60  ? 759  GLU A CG    1 
ATOM   5777  C  CD    . GLU A 1 758  ? -22.374 -86.422  -20.340 1.00 56.99  ? 759  GLU A CD    1 
ATOM   5778  O  OE1   . GLU A 1 758  ? -22.625 -86.866  -21.489 1.00 59.27  ? 759  GLU A OE1   1 
ATOM   5779  O  OE2   . GLU A 1 758  ? -22.478 -85.213  -20.028 1.00 57.10  ? 759  GLU A OE2   1 
ATOM   5780  N  N     . LYS A 1 759  ? -23.665 -87.460  -15.089 1.00 40.89  ? 760  LYS A N     1 
ATOM   5781  C  CA    . LYS A 1 759  ? -23.089 -87.337  -13.761 1.00 37.98  ? 760  LYS A CA    1 
ATOM   5782  C  C     . LYS A 1 759  ? -22.040 -88.334  -13.321 1.00 36.15  ? 760  LYS A C     1 
ATOM   5783  O  O     . LYS A 1 759  ? -22.172 -89.546  -13.484 1.00 35.26  ? 760  LYS A O     1 
ATOM   5784  C  CB    . LYS A 1 759  ? -24.267 -87.284  -12.759 1.00 37.79  ? 760  LYS A CB    1 
ATOM   5785  C  CG    . LYS A 1 759  ? -25.171 -86.046  -12.977 1.00 37.67  ? 760  LYS A CG    1 
ATOM   5786  C  CD    . LYS A 1 759  ? -24.523 -84.825  -12.331 1.00 38.56  ? 760  LYS A CD    1 
ATOM   5787  C  CE    . LYS A 1 759  ? -25.475 -83.645  -12.160 1.00 39.75  ? 760  LYS A CE    1 
ATOM   5788  N  NZ    . LYS A 1 759  ? -24.800 -82.522  -11.429 1.00 38.07  ? 760  LYS A NZ    1 
ATOM   5789  N  N     . ALA A 1 760  ? -21.005 -87.866  -12.609 1.00 33.64  ? 761  ALA A N     1 
ATOM   5790  C  CA    . ALA A 1 760  ? -19.993 -88.823  -12.118 1.00 33.13  ? 761  ALA A CA    1 
ATOM   5791  C  C     . ALA A 1 760  ? -20.300 -89.213  -10.675 1.00 33.16  ? 761  ALA A C     1 
ATOM   5792  O  O     . ALA A 1 760  ? -19.672 -90.080  -10.067 1.00 31.62  ? 761  ALA A O     1 
ATOM   5793  C  CB    . ALA A 1 760  ? -18.589 -88.322  -12.356 1.00 32.98  ? 761  ALA A CB    1 
ATOM   5794  N  N     . LEU A 1 761  ? -21.364 -88.585  -10.124 1.00 31.95  ? 762  LEU A N     1 
ATOM   5795  C  CA    . LEU A 1 761  ? -21.816 -88.980  -8.793  1.00 30.23  ? 762  LEU A CA    1 
ATOM   5796  C  C     . LEU A 1 761  ? -23.311 -89.276  -8.867  1.00 28.44  ? 762  LEU A C     1 
ATOM   5797  O  O     . LEU A 1 761  ? -23.990 -88.402  -9.351  1.00 27.33  ? 762  LEU A O     1 
ATOM   5798  C  CB    . LEU A 1 761  ? -21.575 -87.858  -7.762  1.00 27.80  ? 762  LEU A CB    1 
ATOM   5799  C  CG    . LEU A 1 761  ? -20.093 -87.619  -7.457  1.00 29.14  ? 762  LEU A CG    1 
ATOM   5800  C  CD1   . LEU A 1 761  ? -19.893 -86.270  -6.756  1.00 27.90  ? 762  LEU A CD1   1 
ATOM   5801  C  CD2   . LEU A 1 761  ? -19.463 -88.772  -6.667  1.00 27.14  ? 762  LEU A CD2   1 
ATOM   5802  N  N     . VAL A 1 762  ? -23.779 -90.381  -8.339  1.00 29.76  ? 763  VAL A N     1 
ATOM   5803  C  CA    . VAL A 1 762  ? -25.201 -90.698  -8.320  1.00 29.43  ? 763  VAL A CA    1 
ATOM   5804  C  C     . VAL A 1 762  ? -25.603 -91.141  -6.929  1.00 28.68  ? 763  VAL A C     1 
ATOM   5805  O  O     . VAL A 1 762  ? -25.017 -92.057  -6.388  1.00 28.49  ? 763  VAL A O     1 
ATOM   5806  C  CB    . VAL A 1 762  ? -25.493 -91.853  -9.317  1.00 31.07  ? 763  VAL A CB    1 
ATOM   5807  C  CG1   . VAL A 1 762  ? -26.937 -92.355  -9.301  1.00 32.85  ? 763  VAL A CG1   1 
ATOM   5808  C  CG2   . VAL A 1 762  ? -25.097 -91.337  -10.692 1.00 31.34  ? 763  VAL A CG2   1 
ATOM   5809  N  N     . MET A 1 763  ? -26.653 -90.564  -6.352  1.00 29.11  ? 764  MET A N     1 
ATOM   5810  C  CA    . MET A 1 763  ? -27.125 -90.909  -5.027  1.00 29.02  ? 764  MET A CA    1 
ATOM   5811  C  C     . MET A 1 763  ? -27.714 -92.328  -5.081  1.00 32.08  ? 764  MET A C     1 
ATOM   5812  O  O     . MET A 1 763  ? -28.521 -92.622  -5.987  1.00 31.87  ? 764  MET A O     1 
ATOM   5813  C  CB    . MET A 1 763  ? -28.176 -89.923  -4.522  1.00 27.12  ? 764  MET A CB    1 
ATOM   5814  C  CG    . MET A 1 763  ? -27.734 -88.477  -4.366  1.00 28.33  ? 764  MET A CG    1 
ATOM   5815  S  SD    . MET A 1 763  ? -26.212 -88.207  -3.432  1.00 27.56  ? 764  MET A SD    1 
ATOM   5816  C  CE    . MET A 1 763  ? -26.713 -88.568  -1.762  1.00 26.50  ? 764  MET A CE    1 
ATOM   5817  N  N     . GLN A 1 764  ? -27.283 -93.140  -4.129  1.00 31.50  ? 765  GLN A N     1 
ATOM   5818  C  CA    . GLN A 1 764  ? -27.765 -94.507  -3.999  1.00 34.14  ? 765  GLN A CA    1 
ATOM   5819  C  C     . GLN A 1 764  ? -27.999 -94.791  -2.535  1.00 34.60  ? 765  GLN A C     1 
ATOM   5820  O  O     . GLN A 1 764  ? -27.386 -94.129  -1.690  1.00 35.83  ? 765  GLN A O     1 
ATOM   5821  C  CB    . GLN A 1 764  ? -26.700 -95.449  -4.577  1.00 33.63  ? 765  GLN A CB    1 
ATOM   5822  C  CG    . GLN A 1 764  ? -26.187 -94.974  -5.936  1.00 35.73  ? 765  GLN A CG    1 
ATOM   5823  C  CD    . GLN A 1 764  ? -26.993 -95.554  -7.094  1.00 37.34  ? 765  GLN A CD    1 
ATOM   5824  O  OE1   . GLN A 1 764  ? -26.452 -95.826  -8.177  1.00 39.46  ? 765  GLN A OE1   1 
ATOM   5825  N  NE2   . GLN A 1 764  ? -28.288 -95.752  -6.913  1.00 35.74  ? 765  GLN A NE2   1 
ATOM   5826  N  N     . PRO A 1 765  ? -28.763 -95.810  -2.187  1.00 35.50  ? 766  PRO A N     1 
ATOM   5827  C  CA    . PRO A 1 765  ? -28.994 -96.177  -0.792  1.00 35.29  ? 766  PRO A CA    1 
ATOM   5828  C  C     . PRO A 1 765  ? -27.698 -96.542  -0.092  1.00 34.92  ? 766  PRO A C     1 
ATOM   5829  O  O     . PRO A 1 765  ? -26.880 -97.181  -0.750  1.00 33.24  ? 766  PRO A O     1 
ATOM   5830  C  CB    . PRO A 1 765  ? -29.913 -97.405  -0.845  1.00 34.18  ? 766  PRO A CB    1 
ATOM   5831  C  CG    . PRO A 1 765  ? -30.501 -97.351  -2.203  1.00 34.81  ? 766  PRO A CG    1 
ATOM   5832  C  CD    . PRO A 1 765  ? -29.491 -96.712  -3.114  1.00 34.58  ? 766  PRO A CD    1 
ATOM   5833  N  N     . LEU A 1 766  ? -27.492 -96.126  1.150   1.00 34.62  ? 767  LEU A N     1 
ATOM   5834  C  CA    . LEU A 1 766  ? -26.278 -96.395  1.897   1.00 34.71  ? 767  LEU A CA    1 
ATOM   5835  C  C     . LEU A 1 766  ? -25.841 -97.859  1.839   1.00 35.67  ? 767  LEU A C     1 
ATOM   5836  O  O     . LEU A 1 766  ? -24.693 -98.234  1.622   1.00 35.10  ? 767  LEU A O     1 
ATOM   5837  C  CB    . LEU A 1 766  ? -26.465 -96.041  3.391   1.00 30.93  ? 767  LEU A CB    1 
ATOM   5838  C  CG    . LEU A 1 766  ? -25.303 -96.345  4.347   1.00 31.51  ? 767  LEU A CG    1 
ATOM   5839  C  CD1   . LEU A 1 766  ? -23.971 -95.813  3.798   1.00 30.90  ? 767  LEU A CD1   1 
ATOM   5840  C  CD2   . LEU A 1 766  ? -25.527 -95.771  5.737   1.00 31.27  ? 767  LEU A CD2   1 
ATOM   5841  N  N     . ASP A 1 767  ? -26.823 -98.701  2.114   1.00 38.24  ? 768  ASP A N     1 
ATOM   5842  C  CA    . ASP A 1 767  ? -26.667 -100.145 2.223   1.00 41.28  ? 768  ASP A CA    1 
ATOM   5843  C  C     . ASP A 1 767  ? -26.135 -100.770 0.941   1.00 40.81  ? 768  ASP A C     1 
ATOM   5844  O  O     . ASP A 1 767  ? -25.425 -101.787 0.988   1.00 39.82  ? 768  ASP A O     1 
ATOM   5845  C  CB    . ASP A 1 767  ? -28.011 -100.710 2.721   1.00 44.16  ? 768  ASP A CB    1 
ATOM   5846  C  CG    . ASP A 1 767  ? -29.175 -99.909  2.130   1.00 48.56  ? 768  ASP A CG    1 
ATOM   5847  O  OD1   . ASP A 1 767  ? -29.516 -100.240 0.957   1.00 48.59  ? 768  ASP A OD1   1 
ATOM   5848  O  OD2   . ASP A 1 767  ? -29.687 -98.946  2.797   1.00 49.29  ? 768  ASP A OD2   1 
ATOM   5849  N  N     . THR A 1 768  ? -26.368 -100.111 -0.205  1.00 39.94  ? 769  THR A N     1 
ATOM   5850  C  CA    . THR A 1 768  ? -25.804 -100.675 -1.445  1.00 39.20  ? 769  THR A CA    1 
ATOM   5851  C  C     . THR A 1 768  ? -24.349 -100.273 -1.637  1.00 39.67  ? 769  THR A C     1 
ATOM   5852  O  O     . THR A 1 768  ? -23.701 -100.698 -2.609  1.00 40.29  ? 769  THR A O     1 
ATOM   5853  C  CB    . THR A 1 768  ? -26.592 -100.233 -2.693  1.00 39.39  ? 769  THR A CB    1 
ATOM   5854  O  OG1   . THR A 1 768  ? -26.422 -98.844  -2.984  1.00 38.22  ? 769  THR A OG1   1 
ATOM   5855  C  CG2   . THR A 1 768  ? -28.088 -100.530 -2.501  1.00 39.89  ? 769  THR A CG2   1 
ATOM   5856  N  N     . GLN A 1 769  ? -23.837 -99.399  -0.774  1.00 37.55  ? 770  GLN A N     1 
ATOM   5857  C  CA    . GLN A 1 769  ? -22.486 -98.885  -0.942  1.00 38.70  ? 770  GLN A CA    1 
ATOM   5858  C  C     . GLN A 1 769  ? -21.508 -99.197  0.178   1.00 37.97  ? 770  GLN A C     1 
ATOM   5859  O  O     . GLN A 1 769  ? -20.297 -99.156  -0.055  1.00 37.71  ? 770  GLN A O     1 
ATOM   5860  C  CB    . GLN A 1 769  ? -22.532 -97.328  -1.058  1.00 37.39  ? 770  GLN A CB    1 
ATOM   5861  C  CG    . GLN A 1 769  ? -23.553 -96.815  -2.062  1.00 37.02  ? 770  GLN A CG    1 
ATOM   5862  C  CD    . GLN A 1 769  ? -23.132 -97.185  -3.474  1.00 37.82  ? 770  GLN A CD    1 
ATOM   5863  O  OE1   . GLN A 1 769  ? -22.003 -96.878  -3.868  1.00 35.94  ? 770  GLN A OE1   1 
ATOM   5864  N  NE2   . GLN A 1 769  ? -24.062 -97.857  -4.164  1.00 37.61  ? 770  GLN A NE2   1 
ATOM   5865  N  N     . ARG A 1 770  ? -22.004 -99.409  1.396   1.00 38.76  ? 771  ARG A N     1 
ATOM   5866  C  CA    . ARG A 1 770  ? -21.091 -99.533  2.528   1.00 41.62  ? 771  ARG A CA    1 
ATOM   5867  C  C     . ARG A 1 770  ? -20.089 -100.668 2.472   1.00 41.59  ? 771  ARG A C     1 
ATOM   5868  O  O     . ARG A 1 770  ? -18.916 -100.445 2.773   1.00 41.09  ? 771  ARG A O     1 
ATOM   5869  C  CB    . ARG A 1 770  ? -21.854 -99.581  3.843   1.00 42.23  ? 771  ARG A CB    1 
ATOM   5870  C  CG    . ARG A 1 770  ? -22.932 -100.644 3.930   1.00 45.20  ? 771  ARG A CG    1 
ATOM   5871  C  CD    . ARG A 1 770  ? -23.697 -100.451 5.241   1.00 46.98  ? 771  ARG A CD    1 
ATOM   5872  N  NE    . ARG A 1 770  ? -22.794 -100.413 6.391   1.00 48.23  ? 771  ARG A NE    1 
ATOM   5873  C  CZ    . ARG A 1 770  ? -23.077 -99.786  7.535   1.00 48.82  ? 771  ARG A CZ    1 
ATOM   5874  N  NH1   . ARG A 1 770  ? -24.240 -99.162  7.696   1.00 49.37  ? 771  ARG A NH1   1 
ATOM   5875  N  NH2   . ARG A 1 770  ? -22.201 -99.802  8.536   1.00 48.95  ? 771  ARG A NH2   1 
ATOM   5876  N  N     . ASP A 1 771  ? -20.533 -101.865 2.114   1.00 42.76  ? 772  ASP A N     1 
ATOM   5877  C  CA    . ASP A 1 771  ? -19.622 -103.019 2.071   1.00 44.11  ? 772  ASP A CA    1 
ATOM   5878  C  C     . ASP A 1 771  ? -18.448 -102.814 1.125   1.00 42.02  ? 772  ASP A C     1 
ATOM   5879  O  O     . ASP A 1 771  ? -17.318 -103.172 1.470   1.00 42.22  ? 772  ASP A O     1 
ATOM   5880  C  CB    . ASP A 1 771  ? -20.363 -104.318 1.752   1.00 46.91  ? 772  ASP A CB    1 
ATOM   5881  C  CG    . ASP A 1 771  ? -21.366 -104.676 2.817   1.00 49.65  ? 772  ASP A CG    1 
ATOM   5882  O  OD1   . ASP A 1 771  ? -21.173 -104.276 3.992   1.00 52.57  ? 772  ASP A OD1   1 
ATOM   5883  O  OD2   . ASP A 1 771  ? -22.363 -105.345 2.467   1.00 51.73  ? 772  ASP A OD2   1 
ATOM   5884  N  N     . ALA A 1 772  ? -18.632 -102.088 0.019   1.00 40.92  ? 773  ALA A N     1 
ATOM   5885  C  CA    . ALA A 1 772  ? -17.459 -101.821 -0.822  1.00 39.93  ? 773  ALA A CA    1 
ATOM   5886  C  C     . ALA A 1 772  ? -16.687 -100.607 -0.312  1.00 38.79  ? 773  ALA A C     1 
ATOM   5887  O  O     . ALA A 1 772  ? -15.471 -100.623 -0.084  1.00 38.18  ? 773  ALA A O     1 
ATOM   5888  C  CB    . ALA A 1 772  ? -17.851 -101.587 -2.270  1.00 40.17  ? 773  ALA A CB    1 
ATOM   5889  N  N     . GLN A 1 773  ? -17.414 -99.511  -0.086  1.00 37.31  ? 774  GLN A N     1 
ATOM   5890  C  CA    . GLN A 1 773  ? -16.721 -98.251  0.252   1.00 35.99  ? 774  GLN A CA    1 
ATOM   5891  C  C     . GLN A 1 773  ? -16.098 -98.135  1.606   1.00 34.52  ? 774  GLN A C     1 
ATOM   5892  O  O     . GLN A 1 773  ? -15.150 -97.361  1.772   1.00 33.72  ? 774  GLN A O     1 
ATOM   5893  C  CB    . GLN A 1 773  ? -17.658 -97.071  -0.059  1.00 36.14  ? 774  GLN A CB    1 
ATOM   5894  C  CG    . GLN A 1 773  ? -18.070 -97.008  -1.520  1.00 35.63  ? 774  GLN A CG    1 
ATOM   5895  C  CD    . GLN A 1 773  ? -16.987 -97.347  -2.519  1.00 36.65  ? 774  GLN A CD    1 
ATOM   5896  O  OE1   . GLN A 1 773  ? -17.260 -98.033  -3.513  1.00 37.20  ? 774  GLN A OE1   1 
ATOM   5897  N  NE2   . GLN A 1 773  ? -15.744 -96.931  -2.316  1.00 34.84  ? 774  GLN A NE2   1 
ATOM   5898  N  N     . VAL A 1 774  ? -16.524 -98.904  2.606   1.00 36.30  ? 775  VAL A N     1 
ATOM   5899  C  CA    . VAL A 1 774  ? -15.889 -98.751  3.930   1.00 35.15  ? 775  VAL A CA    1 
ATOM   5900  C  C     . VAL A 1 774  ? -14.427 -99.137  3.958   1.00 37.22  ? 775  VAL A C     1 
ATOM   5901  O  O     . VAL A 1 774  ? -13.594 -98.395  4.491   1.00 36.37  ? 775  VAL A O     1 
ATOM   5902  C  CB    . VAL A 1 774  ? -16.742 -99.448  4.996   1.00 35.31  ? 775  VAL A CB    1 
ATOM   5903  C  CG1   . VAL A 1 774  ? -16.069 -99.610  6.356   1.00 34.34  ? 775  VAL A CG1   1 
ATOM   5904  C  CG2   . VAL A 1 774  ? -17.995 -98.586  5.168   1.00 32.96  ? 775  VAL A CG2   1 
ATOM   5905  N  N     . PRO A 1 775  ? -14.076 -100.310 3.435   1.00 36.58  ? 776  PRO A N     1 
ATOM   5906  C  CA    . PRO A 1 775  ? -12.693 -100.756 3.364   1.00 36.44  ? 776  PRO A CA    1 
ATOM   5907  C  C     . PRO A 1 775  ? -11.891 -99.905  2.396   1.00 35.39  ? 776  PRO A C     1 
ATOM   5908  O  O     . PRO A 1 775  ? -10.727 -99.611  2.667   1.00 37.41  ? 776  PRO A O     1 
ATOM   5909  C  CB    . PRO A 1 775  ? -12.789 -102.207 2.913   1.00 36.53  ? 776  PRO A CB    1 
ATOM   5910  C  CG    . PRO A 1 775  ? -14.091 -102.314 2.217   1.00 37.75  ? 776  PRO A CG    1 
ATOM   5911  C  CD    . PRO A 1 775  ? -15.001 -101.238 2.754   1.00 38.16  ? 776  PRO A CD    1 
ATOM   5912  N  N     . ASN A 1 776  ? -12.520 -99.411  1.329   1.00 34.50  ? 777  ASN A N     1 
ATOM   5913  C  CA    . ASN A 1 776  ? -11.866 -98.522  0.376   1.00 35.49  ? 777  ASN A CA    1 
ATOM   5914  C  C     . ASN A 1 776  ? -11.474 -97.205  1.043   1.00 35.10  ? 777  ASN A C     1 
ATOM   5915  O  O     . ASN A 1 776  ? -10.379 -96.676  0.883   1.00 34.72  ? 777  ASN A O     1 
ATOM   5916  C  CB    . ASN A 1 776  ? -12.733 -98.216  -0.852  1.00 36.58  ? 777  ASN A CB    1 
ATOM   5917  C  CG    . ASN A 1 776  ? -12.734 -99.351  -1.870  1.00 38.58  ? 777  ASN A CG    1 
ATOM   5918  O  OD1   . ASN A 1 776  ? -13.362 -99.251  -2.927  1.00 39.71  ? 777  ASN A OD1   1 
ATOM   5919  N  ND2   . ASN A 1 776  ? -11.999 -100.402 -1.532  1.00 37.99  ? 777  ASN A ND2   1 
ATOM   5920  N  N     . LEU A 1 777  ? -12.402 -96.690  1.840   1.00 35.50  ? 778  LEU A N     1 
ATOM   5921  C  CA    . LEU A 1 777  ? -12.141 -95.467  2.610   1.00 33.79  ? 778  LEU A CA    1 
ATOM   5922  C  C     . LEU A 1 777  ? -10.992 -95.702  3.577   1.00 35.04  ? 778  LEU A C     1 
ATOM   5923  O  O     . LEU A 1 777  ? -10.053 -94.919  3.696   1.00 32.51  ? 778  LEU A O     1 
ATOM   5924  C  CB    . LEU A 1 777  ? -13.408 -95.052  3.354   1.00 32.80  ? 778  LEU A CB    1 
ATOM   5925  C  CG    . LEU A 1 777  ? -13.487 -93.594  3.843   1.00 33.57  ? 778  LEU A CG    1 
ATOM   5926  C  CD1   . LEU A 1 777  ? -12.953 -93.490  5.268   1.00 31.57  ? 778  LEU A CD1   1 
ATOM   5927  C  CD2   . LEU A 1 777  ? -12.741 -92.597  2.963   1.00 30.77  ? 778  LEU A CD2   1 
ATOM   5928  N  N     . GLU A 1 778  ? -11.020 -96.860  4.243   1.00 38.70  ? 779  GLU A N     1 
ATOM   5929  C  CA    . GLU A 1 778  ? -9.935  -97.190  5.180   1.00 42.85  ? 779  GLU A CA    1 
ATOM   5930  C  C     . GLU A 1 778  ? -8.587  -97.317  4.496   1.00 42.73  ? 779  GLU A C     1 
ATOM   5931  O  O     . GLU A 1 778  ? -7.582  -96.856  5.041   1.00 43.57  ? 779  GLU A O     1 
ATOM   5932  C  CB    . GLU A 1 778  ? -10.280 -98.416  6.012   1.00 44.83  ? 779  GLU A CB    1 
ATOM   5933  C  CG    . GLU A 1 778  ? -11.562 -98.150  6.803   1.00 49.29  ? 779  GLU A CG    1 
ATOM   5934  C  CD    . GLU A 1 778  ? -11.459 -96.920  7.698   1.00 51.33  ? 779  GLU A CD    1 
ATOM   5935  O  OE1   . GLU A 1 778  ? -12.121 -95.896  7.401   1.00 52.45  ? 779  GLU A OE1   1 
ATOM   5936  O  OE2   . GLU A 1 778  ? -10.712 -96.941  8.705   1.00 50.80  ? 779  GLU A OE2   1 
ATOM   5937  N  N     . TYR A 1 779  ? -8.564  -97.792  3.251   1.00 42.17  ? 780  TYR A N     1 
ATOM   5938  C  CA    . TYR A 1 779  ? -7.319  -97.878  2.507   1.00 39.68  ? 780  TYR A CA    1 
ATOM   5939  C  C     . TYR A 1 779  ? -6.923  -96.486  2.017   1.00 39.05  ? 780  TYR A C     1 
ATOM   5940  O  O     . TYR A 1 779  ? -5.752  -96.100  2.119   1.00 40.07  ? 780  TYR A O     1 
ATOM   5941  C  CB    . TYR A 1 779  ? -7.430  -98.804  1.302   1.00 41.84  ? 780  TYR A CB    1 
ATOM   5942  C  CG    . TYR A 1 779  ? -6.104  -99.007  0.582   1.00 43.52  ? 780  TYR A CG    1 
ATOM   5943  C  CD1   . TYR A 1 779  ? -5.215  -99.997  0.995   1.00 44.20  ? 780  TYR A CD1   1 
ATOM   5944  C  CD2   . TYR A 1 779  ? -5.770  -98.217  -0.502  1.00 42.99  ? 780  TYR A CD2   1 
ATOM   5945  C  CE1   . TYR A 1 779  ? -4.016  -100.181 0.323   1.00 44.99  ? 780  TYR A CE1   1 
ATOM   5946  C  CE2   . TYR A 1 779  ? -4.579  -98.386  -1.172  1.00 44.74  ? 780  TYR A CE2   1 
ATOM   5947  C  CZ    . TYR A 1 779  ? -3.713  -99.378  -0.758  1.00 45.25  ? 780  TYR A CZ    1 
ATOM   5948  O  OH    . TYR A 1 779  ? -2.521  -99.538  -1.425  1.00 47.11  ? 780  TYR A OH    1 
ATOM   5949  N  N     . ALA A 1 780  ? -7.890  -95.792  1.424   1.00 36.65  ? 781  ALA A N     1 
ATOM   5950  C  CA    . ALA A 1 780  ? -7.658  -94.448  0.911   1.00 36.09  ? 781  ALA A CA    1 
ATOM   5951  C  C     . ALA A 1 780  ? -7.107  -93.508  1.989   1.00 35.49  ? 781  ALA A C     1 
ATOM   5952  O  O     . ALA A 1 780  ? -6.247  -92.702  1.682   1.00 34.03  ? 781  ALA A O     1 
ATOM   5953  C  CB    . ALA A 1 780  ? -8.908  -93.764  0.389   1.00 35.18  ? 781  ALA A CB    1 
ATOM   5954  N  N     . ALA A 1 781  ? -7.546  -93.714  3.223   1.00 36.23  ? 782  ALA A N     1 
ATOM   5955  C  CA    . ALA A 1 781  ? -7.070  -92.874  4.324   1.00 38.91  ? 782  ALA A CA    1 
ATOM   5956  C  C     . ALA A 1 781  ? -5.578  -93.058  4.605   1.00 41.37  ? 782  ALA A C     1 
ATOM   5957  O  O     . ALA A 1 781  ? -4.951  -92.196  5.212   1.00 41.21  ? 782  ALA A O     1 
ATOM   5958  C  CB    . ALA A 1 781  ? -7.883  -93.133  5.586   1.00 37.72  ? 782  ALA A CB    1 
ATOM   5959  N  N     . ARG A 1 782  ? -4.987  -94.167  4.157   1.00 44.05  ? 783  ARG A N     1 
ATOM   5960  C  CA    . ARG A 1 782  ? -3.569  -94.394  4.431   1.00 45.81  ? 783  ARG A CA    1 
ATOM   5961  C  C     . ARG A 1 782  ? -2.735  -93.890  3.251   1.00 44.22  ? 783  ARG A C     1 
ATOM   5962  O  O     . ARG A 1 782  ? -1.516  -94.007  3.328   1.00 43.04  ? 783  ARG A O     1 
ATOM   5963  C  CB    . ARG A 1 782  ? -3.162  -95.817  4.746   1.00 49.79  ? 783  ARG A CB    1 
ATOM   5964  C  CG    . ARG A 1 782  ? -4.007  -96.738  5.592   1.00 53.70  ? 783  ARG A CG    1 
ATOM   5965  C  CD    . ARG A 1 782  ? -4.424  -97.937  4.739   1.00 58.73  ? 783  ARG A CD    1 
ATOM   5966  N  NE    . ARG A 1 782  ? -4.211  -99.236  5.344   1.00 61.83  ? 783  ARG A NE    1 
ATOM   5967  C  CZ    . ARG A 1 782  ? -5.102  -100.216 5.461   1.00 64.32  ? 783  ARG A CZ    1 
ATOM   5968  N  NH1   . ARG A 1 782  ? -6.360  -100.176 5.032   1.00 64.52  ? 783  ARG A NH1   1 
ATOM   5969  N  NH2   . ARG A 1 782  ? -4.683  -101.336 6.063   1.00 65.44  ? 783  ARG A NH2   1 
ATOM   5970  N  N     . ILE A 1 783  ? -3.371  -93.374  2.205   1.00 41.76  ? 784  ILE A N     1 
ATOM   5971  C  CA    . ILE A 1 783  ? -2.607  -92.832  1.079   1.00 40.43  ? 784  ILE A CA    1 
ATOM   5972  C  C     . ILE A 1 783  ? -2.204  -91.388  1.401   1.00 39.76  ? 784  ILE A C     1 
ATOM   5973  O  O     . ILE A 1 783  ? -3.026  -90.543  1.720   1.00 39.41  ? 784  ILE A O     1 
ATOM   5974  C  CB    . ILE A 1 783  ? -3.395  -92.899  -0.232  1.00 40.67  ? 784  ILE A CB    1 
ATOM   5975  C  CG1   . ILE A 1 783  ? -3.695  -94.381  -0.546  1.00 40.27  ? 784  ILE A CG1   1 
ATOM   5976  C  CG2   . ILE A 1 783  ? -2.676  -92.222  -1.391  1.00 39.26  ? 784  ILE A CG2   1 
ATOM   5977  C  CD1   . ILE A 1 783  ? -4.580  -94.595  -1.746  1.00 41.48  ? 784  ILE A CD1   1 
ATOM   5978  N  N     . PRO A 1 784  ? -0.934  -91.074  1.246   1.00 39.62  ? 785  PRO A N     1 
ATOM   5979  C  CA    . PRO A 1 784  ? -0.396  -89.750  1.529   1.00 38.87  ? 785  PRO A CA    1 
ATOM   5980  C  C     . PRO A 1 784  ? -1.046  -88.691  0.665   1.00 38.98  ? 785  PRO A C     1 
ATOM   5981  O  O     . PRO A 1 784  ? -1.213  -88.895  -0.534  1.00 38.31  ? 785  PRO A O     1 
ATOM   5982  C  CB    . PRO A 1 784  ? 1.109   -89.874  1.265   1.00 38.91  ? 785  PRO A CB    1 
ATOM   5983  C  CG    . PRO A 1 784  ? 1.362   -91.345  1.413   1.00 39.55  ? 785  PRO A CG    1 
ATOM   5984  C  CD    . PRO A 1 784  ? 0.144   -92.037  0.851   1.00 39.54  ? 785  PRO A CD    1 
ATOM   5985  N  N     . VAL A 1 785  ? -1.461  -87.594  1.305   1.00 39.09  ? 786  VAL A N     1 
ATOM   5986  C  CA    . VAL A 1 785  ? -2.104  -86.480  0.602   1.00 37.10  ? 786  VAL A CA    1 
ATOM   5987  C  C     . VAL A 1 785  ? -1.035  -85.670  -0.125  1.00 36.80  ? 786  VAL A C     1 
ATOM   5988  O  O     . VAL A 1 785  ? -0.031  -85.305  0.474   1.00 35.84  ? 786  VAL A O     1 
ATOM   5989  C  CB    . VAL A 1 785  ? -2.914  -85.660  1.615   1.00 37.85  ? 786  VAL A CB    1 
ATOM   5990  C  CG1   . VAL A 1 785  ? -3.400  -84.317  1.098   1.00 36.87  ? 786  VAL A CG1   1 
ATOM   5991  C  CG2   . VAL A 1 785  ? -4.115  -86.519  2.062   1.00 36.82  ? 786  VAL A CG2   1 
ATOM   5992  N  N     . LYS A 1 786  ? -1.303  -85.380  -1.388  1.00 35.22  ? 787  LYS A N     1 
ATOM   5993  C  CA    . LYS A 1 786  ? -0.292  -84.731  -2.220  1.00 34.66  ? 787  LYS A CA    1 
ATOM   5994  C  C     . LYS A 1 786  ? -0.476  -83.221  -2.269  1.00 35.23  ? 787  LYS A C     1 
ATOM   5995  O  O     . LYS A 1 786  ? -0.789  -82.557  -3.248  1.00 32.30  ? 787  LYS A O     1 
ATOM   5996  C  CB    . LYS A 1 786  ? -0.319  -85.387  -3.592  1.00 35.02  ? 787  LYS A CB    1 
ATOM   5997  C  CG    . LYS A 1 786  ? -0.332  -86.909  -3.638  1.00 33.06  ? 787  LYS A CG    1 
ATOM   5998  C  CD    . LYS A 1 786  ? 0.954   -87.524  -3.141  1.00 34.16  ? 787  LYS A CD    1 
ATOM   5999  C  CE    . LYS A 1 786  ? 1.026   -89.018  -3.424  1.00 34.25  ? 787  LYS A CE    1 
ATOM   6000  N  NZ    . LYS A 1 786  ? 0.110   -89.859  -2.617  1.00 31.40  ? 787  LYS A NZ    1 
ATOM   6001  N  N     . SER A 1 787  ? -0.146  -82.632  -1.118  1.00 35.80  ? 788  SER A N     1 
ATOM   6002  C  CA    . SER A 1 787  ? -0.278  -81.214  -0.887  1.00 39.75  ? 788  SER A CA    1 
ATOM   6003  C  C     . SER A 1 787  ? 0.762   -80.364  -1.598  1.00 41.58  ? 788  SER A C     1 
ATOM   6004  O  O     . SER A 1 787  ? 0.601   -79.158  -1.641  1.00 41.42  ? 788  SER A O     1 
ATOM   6005  C  CB    . SER A 1 787  ? -0.164  -80.953  0.626   1.00 39.76  ? 788  SER A CB    1 
ATOM   6006  O  OG    . SER A 1 787  ? 1.023   -81.617  1.067   1.00 41.95  ? 788  SER A OG    1 
ATOM   6007  N  N     . GLU A 1 788  ? 1.786   -81.003  -2.162  1.00 44.52  ? 789  GLU A N     1 
ATOM   6008  C  CA    . GLU A 1 788  ? 2.884   -80.276  -2.788  1.00 47.08  ? 789  GLU A CA    1 
ATOM   6009  C  C     . GLU A 1 788  ? 2.794   -80.203  -4.302  1.00 47.23  ? 789  GLU A C     1 
ATOM   6010  O  O     . GLU A 1 788  ? 3.730   -79.666  -4.891  1.00 48.90  ? 789  GLU A O     1 
ATOM   6011  C  CB    . GLU A 1 788  ? 4.191   -81.033  -2.497  1.00 49.47  ? 789  GLU A CB    1 
ATOM   6012  C  CG    . GLU A 1 788  ? 5.231   -80.272  -1.721  1.00 52.97  ? 789  GLU A CG    1 
ATOM   6013  C  CD    . GLU A 1 788  ? 4.967   -80.127  -0.244  1.00 54.88  ? 789  GLU A CD    1 
ATOM   6014  O  OE1   . GLU A 1 788  ? 4.747   -78.965  0.172   1.00 55.67  ? 789  GLU A OE1   1 
ATOM   6015  O  OE2   . GLU A 1 788  ? 4.998   -81.147  0.485   1.00 56.22  ? 789  GLU A OE2   1 
ATOM   6016  N  N     . VAL A 1 789  ? 1.810   -80.860  -4.882  1.00 44.63  ? 790  VAL A N     1 
ATOM   6017  C  CA    . VAL A 1 789  ? 1.765   -81.015  -6.321  1.00 42.97  ? 790  VAL A CA    1 
ATOM   6018  C  C     . VAL A 1 789  ? 1.079   -79.865  -7.018  1.00 40.30  ? 790  VAL A C     1 
ATOM   6019  O  O     . VAL A 1 789  ? 1.532   -79.498  -8.114  1.00 39.93  ? 790  VAL A O     1 
ATOM   6020  C  CB    . VAL A 1 789  ? 1.209   -82.428  -6.639  1.00 43.88  ? 790  VAL A CB    1 
ATOM   6021  C  CG1   . VAL A 1 789  ? -0.316  -82.446  -6.685  1.00 44.63  ? 790  VAL A CG1   1 
ATOM   6022  C  CG2   . VAL A 1 789  ? 1.788   -82.932  -7.945  1.00 45.23  ? 790  VAL A CG2   1 
ATOM   6023  N  N     . LEU A 1 790  ? -0.005  -79.329  -6.470  1.00 35.79  ? 791  LEU A N     1 
ATOM   6024  C  CA    . LEU A 1 790  ? -0.715  -78.217  -7.101  1.00 35.80  ? 791  LEU A CA    1 
ATOM   6025  C  C     . LEU A 1 790  ? -0.741  -77.068  -6.094  1.00 35.43  ? 791  LEU A C     1 
ATOM   6026  O  O     . LEU A 1 790  ? -0.523  -77.275  -4.910  1.00 35.54  ? 791  LEU A O     1 
ATOM   6027  C  CB    . LEU A 1 790  ? -2.145  -78.581  -7.511  1.00 34.44  ? 791  LEU A CB    1 
ATOM   6028  C  CG    . LEU A 1 790  ? -2.324  -79.381  -8.803  1.00 35.73  ? 791  LEU A CG    1 
ATOM   6029  C  CD1   . LEU A 1 790  ? -3.775  -79.798  -9.022  1.00 34.58  ? 791  LEU A CD1   1 
ATOM   6030  C  CD2   . LEU A 1 790  ? -1.843  -78.625  -10.041 1.00 36.10  ? 791  LEU A CD2   1 
ATOM   6031  N  N     . PRO A 1 791  ? -0.939  -75.844  -6.540  1.00 36.61  ? 792  PRO A N     1 
ATOM   6032  C  CA    . PRO A 1 791  ? -0.981  -74.675  -5.667  1.00 35.61  ? 792  PRO A CA    1 
ATOM   6033  C  C     . PRO A 1 791  ? -2.138  -74.852  -4.689  1.00 32.70  ? 792  PRO A C     1 
ATOM   6034  O  O     . PRO A 1 791  ? -3.232  -75.313  -5.004  1.00 33.54  ? 792  PRO A O     1 
ATOM   6035  C  CB    . PRO A 1 791  ? -1.170  -73.490  -6.595  1.00 36.25  ? 792  PRO A CB    1 
ATOM   6036  C  CG    . PRO A 1 791  ? -0.867  -74.006  -7.966  1.00 37.82  ? 792  PRO A CG    1 
ATOM   6037  C  CD    . PRO A 1 791  ? -1.240  -75.468  -7.958  1.00 37.07  ? 792  PRO A CD    1 
ATOM   6038  N  N     . ARG A 1 792  ? -1.857  -74.654  -3.429  1.00 30.75  ? 793  ARG A N     1 
ATOM   6039  C  CA    . ARG A 1 792  ? -2.804  -74.792  -2.348  1.00 30.90  ? 793  ARG A CA    1 
ATOM   6040  C  C     . ARG A 1 792  ? -4.030  -73.913  -2.457  1.00 30.49  ? 793  ARG A C     1 
ATOM   6041  O  O     . ARG A 1 792  ? -5.083  -74.277  -1.935  1.00 31.11  ? 793  ARG A O     1 
ATOM   6042  C  CB    . ARG A 1 792  ? -1.955  -74.409  -1.136  1.00 31.82  ? 793  ARG A CB    1 
ATOM   6043  C  CG    . ARG A 1 792  ? -2.578  -74.653  0.196   1.00 27.70  ? 793  ARG A CG    1 
ATOM   6044  C  CD    . ARG A 1 792  ? -1.519  -74.395  1.300   1.00 24.07  ? 793  ARG A CD    1 
ATOM   6045  N  NE    . ARG A 1 792  ? -2.231  -74.956  2.468   1.00 22.60  ? 793  ARG A NE    1 
ATOM   6046  C  CZ    . ARG A 1 792  ? -1.775  -74.907  3.719   1.00 22.43  ? 793  ARG A CZ    1 
ATOM   6047  N  NH1   . ARG A 1 792  ? -0.599  -74.364  4.008   1.00 19.60  ? 793  ARG A NH1   1 
ATOM   6048  N  NH2   . ARG A 1 792  ? -2.547  -75.424  4.665   1.00 22.29  ? 793  ARG A NH2   1 
ATOM   6049  N  N     . ASP A 1 793  ? -3.915  -72.748  -3.088  1.00 31.63  ? 794  ASP A N     1 
ATOM   6050  C  CA    . ASP A 1 793  ? -5.066  -71.840  -3.182  1.00 31.69  ? 794  ASP A CA    1 
ATOM   6051  C  C     . ASP A 1 793  ? -5.744  -71.937  -4.543  1.00 30.96  ? 794  ASP A C     1 
ATOM   6052  O  O     . ASP A 1 793  ? -6.450  -71.017  -4.997  1.00 30.56  ? 794  ASP A O     1 
ATOM   6053  C  CB    . ASP A 1 793  ? -4.631  -70.400  -2.883  1.00 34.47  ? 794  ASP A CB    1 
ATOM   6054  C  CG    . ASP A 1 793  ? -3.541  -69.877  -3.808  1.00 37.17  ? 794  ASP A CG    1 
ATOM   6055  O  OD1   . ASP A 1 793  ? -3.365  -68.642  -3.947  1.00 38.30  ? 794  ASP A OD1   1 
ATOM   6056  O  OD2   . ASP A 1 793  ? -2.819  -70.680  -4.453  1.00 36.42  ? 794  ASP A OD2   1 
ATOM   6057  N  N     . SER A 1 794  ? -5.487  -73.043  -5.242  1.00 28.82  ? 795  SER A N     1 
ATOM   6058  C  CA    . SER A 1 794  ? -6.172  -73.264  -6.527  1.00 28.81  ? 795  SER A CA    1 
ATOM   6059  C  C     . SER A 1 794  ? -7.393  -74.120  -6.185  1.00 28.63  ? 795  SER A C     1 
ATOM   6060  O  O     . SER A 1 794  ? -7.346  -74.753  -5.134  1.00 28.60  ? 795  SER A O     1 
ATOM   6061  C  CB    . SER A 1 794  ? -5.241  -73.948  -7.543  1.00 28.93  ? 795  SER A CB    1 
ATOM   6062  O  OG    . SER A 1 794  ? -5.111  -75.330  -7.191  1.00 29.50  ? 795  SER A OG    1 
ATOM   6063  N  N     . LEU A 1 795  ? -8.475  -74.110  -6.946  1.00 28.54  ? 796  LEU A N     1 
ATOM   6064  C  CA    . LEU A 1 795  ? -9.644  -74.962  -6.685  1.00 30.52  ? 796  LEU A CA    1 
ATOM   6065  C  C     . LEU A 1 795  ? -9.264  -76.426  -6.494  1.00 30.83  ? 796  LEU A C     1 
ATOM   6066  O  O     . LEU A 1 795  ? -9.471  -77.026  -5.435  1.00 30.44  ? 796  LEU A O     1 
ATOM   6067  C  CB    . LEU A 1 795  ? -10.643 -74.849  -7.832  1.00 29.83  ? 796  LEU A CB    1 
ATOM   6068  C  CG    . LEU A 1 795  ? -12.120 -75.150  -7.605  1.00 32.21  ? 796  LEU A CG    1 
ATOM   6069  C  CD1   . LEU A 1 795  ? -12.952 -74.702  -8.819  1.00 31.33  ? 796  LEU A CD1   1 
ATOM   6070  C  CD2   . LEU A 1 795  ? -12.398 -76.631  -7.326  1.00 32.70  ? 796  LEU A CD2   1 
ATOM   6071  N  N     . LYS A 1 796  ? -8.661  -77.026  -7.525  1.00 30.53  ? 797  LYS A N     1 
ATOM   6072  C  CA    . LYS A 1 796  ? -8.297  -78.422  -7.474  1.00 30.56  ? 797  LYS A CA    1 
ATOM   6073  C  C     . LYS A 1 796  ? -7.227  -78.705  -6.438  1.00 29.59  ? 797  LYS A C     1 
ATOM   6074  O  O     . LYS A 1 796  ? -7.307  -79.734  -5.763  1.00 31.34  ? 797  LYS A O     1 
ATOM   6075  C  CB    . LYS A 1 796  ? -7.810  -78.897  -8.865  1.00 33.36  ? 797  LYS A CB    1 
ATOM   6076  C  CG    . LYS A 1 796  ? -7.584  -80.393  -8.945  1.00 32.14  ? 797  LYS A CG    1 
ATOM   6077  C  CD    . LYS A 1 796  ? -7.011  -80.775  -10.301 1.00 37.23  ? 797  LYS A CD    1 
ATOM   6078  C  CE    . LYS A 1 796  ? -7.116  -82.286  -10.559 1.00 38.55  ? 797  LYS A CE    1 
ATOM   6079  N  NZ    . LYS A 1 796  ? -6.839  -82.553  -12.017 1.00 41.33  ? 797  LYS A NZ    1 
ATOM   6080  N  N     . GLY A 1 797  ? -6.237  -77.828  -6.315  1.00 28.99  ? 798  GLY A N     1 
ATOM   6081  C  CA    . GLY A 1 797  ? -5.126  -78.069  -5.396  1.00 26.38  ? 798  GLY A CA    1 
ATOM   6082  C  C     . GLY A 1 797  ? -5.580  -77.933  -3.943  1.00 26.85  ? 798  GLY A C     1 
ATOM   6083  O  O     . GLY A 1 797  ? -4.994  -78.617  -3.082  1.00 25.96  ? 798  GLY A O     1 
ATOM   6084  N  N     . SER A 1 798  ? -6.644  -77.131  -3.739  1.00 24.87  ? 799  SER A N     1 
ATOM   6085  C  CA    . SER A 1 798  ? -7.128  -76.970  -2.363  1.00 26.39  ? 799  SER A CA    1 
ATOM   6086  C  C     . SER A 1 798  ? -7.648  -78.306  -1.823  1.00 26.37  ? 799  SER A C     1 
ATOM   6087  O  O     . SER A 1 798  ? -7.544  -78.587  -0.637  1.00 26.59  ? 799  SER A O     1 
ATOM   6088  C  CB    . SER A 1 798  ? -8.257  -75.932  -2.193  1.00 25.09  ? 799  SER A CB    1 
ATOM   6089  O  OG    . SER A 1 798  ? -9.413  -76.260  -2.962  1.00 23.26  ? 799  SER A OG    1 
ATOM   6090  N  N     . GLN A 1 799  ? -8.124  -79.135  -2.758  1.00 26.46  ? 800  GLN A N     1 
ATOM   6091  C  CA    . GLN A 1 799  ? -8.678  -80.414  -2.335  1.00 26.40  ? 800  GLN A CA    1 
ATOM   6092  C  C     . GLN A 1 799  ? -7.643  -81.525  -2.270  1.00 26.45  ? 800  GLN A C     1 
ATOM   6093  O  O     . GLN A 1 799  ? -7.993  -82.659  -1.909  1.00 27.46  ? 800  GLN A O     1 
ATOM   6094  C  CB    . GLN A 1 799  ? -9.919  -80.743  -3.157  1.00 24.90  ? 800  GLN A CB    1 
ATOM   6095  C  CG    . GLN A 1 799  ? -11.078 -79.734  -3.007  1.00 24.54  ? 800  GLN A CG    1 
ATOM   6096  C  CD    . GLN A 1 799  ? -11.300 -79.432  -1.519  1.00 23.26  ? 800  GLN A CD    1 
ATOM   6097  O  OE1   . GLN A 1 799  ? -11.615 -80.321  -0.733  1.00 24.67  ? 800  GLN A OE1   1 
ATOM   6098  N  NE2   . GLN A 1 799  ? -11.055 -78.167  -1.122  1.00 24.11  ? 800  GLN A NE2   1 
ATOM   6099  N  N     . PHE A 1 800  ? -6.376  -81.202  -2.497  1.00 28.24  ? 801  PHE A N     1 
ATOM   6100  C  CA    . PHE A 1 800  ? -5.267  -82.122  -2.272  1.00 26.02  ? 801  PHE A CA    1 
ATOM   6101  C  C     . PHE A 1 800  ? -4.533  -81.698  -1.001  1.00 28.51  ? 801  PHE A C     1 
ATOM   6102  O  O     . PHE A 1 800  ? -3.375  -82.034  -0.787  1.00 31.47  ? 801  PHE A O     1 
ATOM   6103  C  CB    . PHE A 1 800  ? -4.287  -82.190  -3.446  1.00 27.25  ? 801  PHE A CB    1 
ATOM   6104  C  CG    . PHE A 1 800  ? -4.878  -82.893  -4.651  1.00 28.24  ? 801  PHE A CG    1 
ATOM   6105  C  CD1   . PHE A 1 800  ? -4.621  -82.427  -5.930  1.00 29.69  ? 801  PHE A CD1   1 
ATOM   6106  C  CD2   . PHE A 1 800  ? -5.647  -84.031  -4.502  1.00 28.83  ? 801  PHE A CD2   1 
ATOM   6107  C  CE1   . PHE A 1 800  ? -5.172  -83.070  -7.033  1.00 29.66  ? 801  PHE A CE1   1 
ATOM   6108  C  CE2   . PHE A 1 800  ? -6.179  -84.706  -5.586  1.00 27.81  ? 801  PHE A CE2   1 
ATOM   6109  C  CZ    . PHE A 1 800  ? -5.943  -84.207  -6.837  1.00 28.63  ? 801  PHE A CZ    1 
ATOM   6110  N  N     . GLN A 1 801  ? -5.203  -80.876  -0.190  1.00 26.71  ? 802  GLN A N     1 
ATOM   6111  C  CA    . GLN A 1 801  ? -4.637  -80.497  1.108   1.00 26.35  ? 802  GLN A CA    1 
ATOM   6112  C  C     . GLN A 1 801  ? -5.479  -81.195  2.166   1.00 25.52  ? 802  GLN A C     1 
ATOM   6113  O  O     . GLN A 1 801  ? -6.619  -81.589  1.919   1.00 21.86  ? 802  GLN A O     1 
ATOM   6114  C  CB    . GLN A 1 801  ? -4.662  -78.998  1.359   1.00 27.76  ? 802  GLN A CB    1 
ATOM   6115  C  CG    . GLN A 1 801  ? -4.236  -78.165  0.160   1.00 30.17  ? 802  GLN A CG    1 
ATOM   6116  C  CD    . GLN A 1 801  ? -2.725  -78.235  -0.017  1.00 31.54  ? 802  GLN A CD    1 
ATOM   6117  O  OE1   . GLN A 1 801  ? -2.021  -78.093  0.970   1.00 31.86  ? 802  GLN A OE1   1 
ATOM   6118  N  NE2   . GLN A 1 801  ? -2.293  -78.405  -1.260  1.00 33.97  ? 802  GLN A NE2   1 
ATOM   6119  N  N     . GLU A 1 802  ? -4.956  -81.381  3.359   1.00 25.13  ? 803  GLU A N     1 
ATOM   6120  C  CA    . GLU A 1 802  ? -5.661  -82.015  4.447   1.00 25.23  ? 803  GLU A CA    1 
ATOM   6121  C  C     . GLU A 1 802  ? -6.746  -81.072  4.988   1.00 25.50  ? 803  GLU A C     1 
ATOM   6122  O  O     . GLU A 1 802  ? -6.451  -79.939  5.370   1.00 22.98  ? 803  GLU A O     1 
ATOM   6123  C  CB    . GLU A 1 802  ? -4.649  -82.291  5.572   1.00 26.64  ? 803  GLU A CB    1 
ATOM   6124  C  CG    . GLU A 1 802  ? -3.748  -83.489  5.251   1.00 27.57  ? 803  GLU A CG    1 
ATOM   6125  C  CD    . GLU A 1 802  ? -3.066  -84.012  6.500   1.00 27.33  ? 803  GLU A CD    1 
ATOM   6126  O  OE1   . GLU A 1 802  ? -1.887  -83.725  6.780   1.00 27.47  ? 803  GLU A OE1   1 
ATOM   6127  O  OE2   . GLU A 1 802  ? -3.698  -84.758  7.282   1.00 30.66  ? 803  GLU A OE2   1 
ATOM   6128  N  N     . PRO A 1 803  ? -7.996  -81.520  4.971   1.00 23.04  ? 804  PRO A N     1 
ATOM   6129  C  CA    . PRO A 1 803  ? -9.078  -80.725  5.575   1.00 21.20  ? 804  PRO A CA    1 
ATOM   6130  C  C     . PRO A 1 803  ? -8.964  -80.812  7.083   1.00 20.83  ? 804  PRO A C     1 
ATOM   6131  O  O     . PRO A 1 803  ? -8.811  -81.931  7.574   1.00 22.21  ? 804  PRO A O     1 
ATOM   6132  C  CB    . PRO A 1 803  ? -10.337 -81.396  5.044   1.00 21.22  ? 804  PRO A CB    1 
ATOM   6133  C  CG    . PRO A 1 803  ? -9.933  -82.824  4.699   1.00 22.36  ? 804  PRO A CG    1 
ATOM   6134  C  CD    . PRO A 1 803  ? -8.445  -82.843  4.470   1.00 22.80  ? 804  PRO A CD    1 
ATOM   6135  N  N     . LEU A 1 804  ? -8.961  -79.743  7.874   1.00 19.88  ? 805  LEU A N     1 
ATOM   6136  C  CA    . LEU A 1 804  ? -8.728  -79.857  9.313   1.00 19.11  ? 805  LEU A CA    1 
ATOM   6137  C  C     . LEU A 1 804  ? -9.980  -79.622  10.150  1.00 20.58  ? 805  LEU A C     1 
ATOM   6138  O  O     . LEU A 1 804  ? -9.927  -79.344  11.370  1.00 18.92  ? 805  LEU A O     1 
ATOM   6139  C  CB    . LEU A 1 804  ? -7.573  -78.886  9.648   1.00 20.43  ? 805  LEU A CB    1 
ATOM   6140  C  CG    . LEU A 1 804  ? -6.146  -79.402  9.646   1.00 24.43  ? 805  LEU A CG    1 
ATOM   6141  C  CD1   . LEU A 1 804  ? -5.912  -80.592  8.744   1.00 20.15  ? 805  LEU A CD1   1 
ATOM   6142  C  CD2   . LEU A 1 804  ? -5.073  -78.321  9.565   1.00 23.43  ? 805  LEU A CD2   1 
ATOM   6143  N  N     . MET A 1 805  ? -11.151 -79.759  9.534   1.00 18.48  ? 806  MET A N     1 
ATOM   6144  C  CA    . MET A 1 805  ? -12.455 -79.720  10.225  1.00 19.97  ? 806  MET A CA    1 
ATOM   6145  C  C     . MET A 1 805  ? -13.347 -80.721  9.468   1.00 18.84  ? 806  MET A C     1 
ATOM   6146  O  O     . MET A 1 805  ? -13.604 -80.489  8.289   1.00 18.14  ? 806  MET A O     1 
ATOM   6147  C  CB    . MET A 1 805  ? -13.037 -78.317  10.303  1.00 18.88  ? 806  MET A CB    1 
ATOM   6148  C  CG    . MET A 1 805  ? -14.213 -78.196  11.315  1.00 20.82  ? 806  MET A CG    1 
ATOM   6149  S  SD    . MET A 1 805  ? -15.740 -78.944  10.740  1.00 20.42  ? 806  MET A SD    1 
ATOM   6150  C  CE    . MET A 1 805  ? -16.225 -77.992  9.317   1.00 22.29  ? 806  MET A CE    1 
ATOM   6151  N  N     . GLU A 1 806  ? -13.625 -81.903  10.002  1.00 21.59  ? 807  GLU A N     1 
ATOM   6152  C  CA    . GLU A 1 806  ? -14.323 -82.974  9.330   1.00 21.16  ? 807  GLU A CA    1 
ATOM   6153  C  C     . GLU A 1 806  ? -15.383 -83.598  10.234  1.00 21.44  ? 807  GLU A C     1 
ATOM   6154  O  O     . GLU A 1 806  ? -15.167 -83.673  11.439  1.00 21.12  ? 807  GLU A O     1 
ATOM   6155  C  CB    . GLU A 1 806  ? -13.320 -84.155  9.076   1.00 23.09  ? 807  GLU A CB    1 
ATOM   6156  C  CG    . GLU A 1 806  ? -12.095 -83.760  8.231   1.00 24.91  ? 807  GLU A CG    1 
ATOM   6157  C  CD    . GLU A 1 806  ? -11.489 -85.019  7.566   1.00 26.27  ? 807  GLU A CD    1 
ATOM   6158  O  OE1   . GLU A 1 806  ? -10.890 -85.863  8.268   1.00 23.38  ? 807  GLU A OE1   1 
ATOM   6159  O  OE2   . GLU A 1 806  ? -11.702 -85.124  6.343   1.00 24.54  ? 807  GLU A OE2   1 
ATOM   6160  N  N     . PHE A 1 807  ? -16.449 -84.139  9.670   1.00 20.34  ? 808  PHE A N     1 
ATOM   6161  C  CA    . PHE A 1 807  ? -17.443 -84.960  10.301  1.00 22.19  ? 808  PHE A CA    1 
ATOM   6162  C  C     . PHE A 1 807  ? -18.113 -84.330  11.523  1.00 22.42  ? 808  PHE A C     1 
ATOM   6163  O  O     . PHE A 1 807  ? -18.250 -84.953  12.590  1.00 21.52  ? 808  PHE A O     1 
ATOM   6164  C  CB    . PHE A 1 807  ? -16.840 -86.351  10.690  1.00 23.10  ? 808  PHE A CB    1 
ATOM   6165  C  CG    . PHE A 1 807  ? -15.791 -86.878  9.731   1.00 25.42  ? 808  PHE A CG    1 
ATOM   6166  C  CD1   . PHE A 1 807  ? -14.641 -87.495  10.232  1.00 24.47  ? 808  PHE A CD1   1 
ATOM   6167  C  CD2   . PHE A 1 807  ? -15.914 -86.771  8.351   1.00 24.34  ? 808  PHE A CD2   1 
ATOM   6168  C  CE1   . PHE A 1 807  ? -13.668 -87.976  9.377   1.00 26.26  ? 808  PHE A CE1   1 
ATOM   6169  C  CE2   . PHE A 1 807  ? -14.949 -87.255  7.505   1.00 24.12  ? 808  PHE A CE2   1 
ATOM   6170  C  CZ    . PHE A 1 807  ? -13.810 -87.839  8.012   1.00 25.46  ? 808  PHE A CZ    1 
ATOM   6171  N  N     . SER A 1 808  ? -18.481 -83.041  11.389  1.00 21.70  ? 809  SER A N     1 
ATOM   6172  C  CA    . SER A 1 808  ? -19.086 -82.330  12.514  1.00 22.42  ? 809  SER A CA    1 
ATOM   6173  C  C     . SER A 1 808  ? -20.547 -82.714  12.714  1.00 24.06  ? 809  SER A C     1 
ATOM   6174  O  O     . SER A 1 808  ? -21.165 -83.244  11.776  1.00 24.98  ? 809  SER A O     1 
ATOM   6175  C  CB    . SER A 1 808  ? -18.970 -80.792  12.307  1.00 22.16  ? 809  SER A CB    1 
ATOM   6176  O  OG    . SER A 1 808  ? -19.961 -80.309  11.367  1.00 20.30  ? 809  SER A OG    1 
ATOM   6177  N  N     . GLY A 1 809  ? -21.153 -82.296  13.816  1.00 22.35  ? 810  GLY A N     1 
ATOM   6178  C  CA    . GLY A 1 809  ? -22.573 -82.487  14.043  1.00 22.71  ? 810  GLY A CA    1 
ATOM   6179  C  C     . GLY A 1 809  ? -23.405 -81.411  13.359  1.00 21.35  ? 810  GLY A C     1 
ATOM   6180  O  O     . GLY A 1 809  ? -24.590 -81.250  13.700  1.00 22.48  ? 810  GLY A O     1 
ATOM   6181  N  N     . ALA A 1 810  ? -22.928 -80.733  12.299  1.00 20.70  ? 811  ALA A N     1 
ATOM   6182  C  CA    . ALA A 1 810  ? -23.822 -79.778  11.606  1.00 18.01  ? 811  ALA A CA    1 
ATOM   6183  C  C     . ALA A 1 810  ? -24.924 -80.508  10.833  1.00 21.45  ? 811  ALA A C     1 
ATOM   6184  O  O     . ALA A 1 810  ? -24.767 -81.715  10.557  1.00 19.52  ? 811  ALA A O     1 
ATOM   6185  C  CB    . ALA A 1 810  ? -23.023 -78.950  10.588  1.00 19.72  ? 811  ALA A CB    1 
ATOM   6186  N  N     . CYS A 1 811  ? -26.045 -79.833  10.553  1.00 18.46  ? 812  CYS A N     1 
ATOM   6187  C  CA    . CYS A 1 811  ? -27.097 -80.513  9.736   1.00 22.40  ? 812  CYS A CA    1 
ATOM   6188  C  C     . CYS A 1 811  ? -26.652 -81.050  8.376   1.00 21.45  ? 812  CYS A C     1 
ATOM   6189  O  O     . CYS A 1 811  ? -25.698 -80.498  7.800   1.00 18.78  ? 812  CYS A O     1 
ATOM   6190  C  CB    . CYS A 1 811  ? -28.086 -79.379  9.363   1.00 20.44  ? 812  CYS A CB    1 
ATOM   6191  S  SG    . CYS A 1 811  ? -28.927 -78.666  10.804  1.00 20.14  ? 812  CYS A SG    1 
ATOM   6192  N  N     . SER A 1 812  ? -27.284 -82.080  7.777   1.00 20.70  ? 813  SER A N     1 
ATOM   6193  C  CA    . SER A 1 812  ? -26.957 -82.423  6.404   1.00 20.81  ? 813  SER A CA    1 
ATOM   6194  C  C     . SER A 1 812  ? -27.183 -81.211  5.500   1.00 21.42  ? 813  SER A C     1 
ATOM   6195  O  O     . SER A 1 812  ? -28.255 -80.633  5.566   1.00 22.45  ? 813  SER A O     1 
ATOM   6196  C  CB    . SER A 1 812  ? -27.815 -83.585  5.785   1.00 21.16  ? 813  SER A CB    1 
ATOM   6197  O  OG    . SER A 1 812  ? -28.307 -84.274  6.947   1.00 26.63  ? 813  SER A OG    1 
ATOM   6198  N  N     . GLY A 1 813  ? -26.176 -80.856  4.714   1.00 21.82  ? 814  GLY A N     1 
ATOM   6199  C  CA    . GLY A 1 813  ? -26.291 -79.828  3.720   1.00 21.95  ? 814  GLY A CA    1 
ATOM   6200  C  C     . GLY A 1 813  ? -25.989 -78.418  4.235   1.00 21.52  ? 814  GLY A C     1 
ATOM   6201  O  O     . GLY A 1 813  ? -26.113 -77.484  3.454   1.00 21.24  ? 814  GLY A O     1 
ATOM   6202  N  N     . CYS A 1 814  ? -25.590 -78.301  5.507   1.00 21.43  ? 815  CYS A N     1 
ATOM   6203  C  CA    . CYS A 1 814  ? -25.346 -77.004  6.147   1.00 20.68  ? 815  CYS A CA    1 
ATOM   6204  C  C     . CYS A 1 814  ? -24.499 -76.075  5.319   1.00 20.41  ? 815  CYS A C     1 
ATOM   6205  O  O     . CYS A 1 814  ? -23.485 -76.509  4.784   1.00 22.04  ? 815  CYS A O     1 
ATOM   6206  C  CB    . CYS A 1 814  ? -24.683 -77.347  7.511   1.00 19.85  ? 815  CYS A CB    1 
ATOM   6207  S  SG    . CYS A 1 814  ? -24.067 -75.874  8.340   1.00 19.86  ? 815  CYS A SG    1 
ATOM   6208  N  N     . GLY A 1 815  ? -24.830 -74.790  5.205   1.00 22.74  ? 816  GLY A N     1 
ATOM   6209  C  CA    . GLY A 1 815  ? -24.101 -73.863  4.357   1.00 22.12  ? 816  GLY A CA    1 
ATOM   6210  C  C     . GLY A 1 815  ? -22.938 -73.150  5.046   1.00 21.07  ? 816  GLY A C     1 
ATOM   6211  O  O     . GLY A 1 815  ? -22.189 -72.435  4.405   1.00 17.68  ? 816  GLY A O     1 
ATOM   6212  N  N     . GLU A 1 816  ? -22.683 -73.428  6.321   1.00 21.03  ? 817  GLU A N     1 
ATOM   6213  C  CA    . GLU A 1 816  ? -21.517 -72.912  6.997   1.00 21.24  ? 817  GLU A CA    1 
ATOM   6214  C  C     . GLU A 1 816  ? -20.268 -73.755  6.792   1.00 21.23  ? 817  GLU A C     1 
ATOM   6215  O  O     . GLU A 1 816  ? -19.181 -73.242  6.553   1.00 20.07  ? 817  GLU A O     1 
ATOM   6216  C  CB    . GLU A 1 816  ? -21.768 -72.901  8.535   1.00 20.53  ? 817  GLU A CB    1 
ATOM   6217  C  CG    . GLU A 1 816  ? -22.951 -71.963  8.846   1.00 19.91  ? 817  GLU A CG    1 
ATOM   6218  C  CD    . GLU A 1 816  ? -23.145 -71.658  10.314  1.00 20.68  ? 817  GLU A CD    1 
ATOM   6219  O  OE1   . GLU A 1 816  ? -22.689 -72.417  11.182  1.00 17.50  ? 817  GLU A OE1   1 
ATOM   6220  O  OE2   . GLU A 1 816  ? -23.798 -70.586  10.594  1.00 20.23  ? 817  GLU A OE2   1 
ATOM   6221  N  N     . THR A 1 817  ? -20.341 -75.070  7.097   1.00 19.81  ? 818  THR A N     1 
ATOM   6222  C  CA    . THR A 1 817  ? -19.215 -75.958  7.094   1.00 20.68  ? 818  THR A CA    1 
ATOM   6223  C  C     . THR A 1 817  ? -18.386 -76.098  5.837   1.00 19.52  ? 818  THR A C     1 
ATOM   6224  O  O     . THR A 1 817  ? -17.171 -76.141  6.005   1.00 20.82  ? 818  THR A O     1 
ATOM   6225  C  CB    . THR A 1 817  ? -19.625 -77.374  7.562   1.00 20.47  ? 818  THR A CB    1 
ATOM   6226  O  OG1   . THR A 1 817  ? -20.751 -77.711  6.755   1.00 19.08  ? 818  THR A OG1   1 
ATOM   6227  C  CG2   . THR A 1 817  ? -19.959 -77.363  9.046   1.00 17.99  ? 818  THR A CG2   1 
ATOM   6228  N  N     . PRO A 1 818  ? -18.892 -76.127  4.634   1.00 20.02  ? 819  PRO A N     1 
ATOM   6229  C  CA    . PRO A 1 818  ? -18.042 -76.135  3.431   1.00 18.56  ? 819  PRO A CA    1 
ATOM   6230  C  C     . PRO A 1 818  ? -17.007 -75.023  3.463   1.00 20.83  ? 819  PRO A C     1 
ATOM   6231  O  O     . PRO A 1 818  ? -15.801 -75.223  3.211   1.00 18.90  ? 819  PRO A O     1 
ATOM   6232  C  CB    . PRO A 1 818  ? -19.010 -75.974  2.260   1.00 21.08  ? 819  PRO A CB    1 
ATOM   6233  C  CG    . PRO A 1 818  ? -20.298 -76.555  2.795   1.00 21.31  ? 819  PRO A CG    1 
ATOM   6234  C  CD    . PRO A 1 818  ? -20.318 -76.116  4.270   1.00 22.43  ? 819  PRO A CD    1 
ATOM   6235  N  N     . TYR A 1 819  ? -17.454 -73.809  3.856   1.00 21.23  ? 820  TYR A N     1 
ATOM   6236  C  CA    . TYR A 1 819  ? -16.547 -72.672  3.936   1.00 19.56  ? 820  TYR A CA    1 
ATOM   6237  C  C     . TYR A 1 819  ? -15.417 -72.861  4.931   1.00 20.00  ? 820  TYR A C     1 
ATOM   6238  O  O     . TYR A 1 819  ? -14.245 -72.654  4.633   1.00 18.83  ? 820  TYR A O     1 
ATOM   6239  C  CB    . TYR A 1 819  ? -17.310 -71.405  4.362   1.00 18.78  ? 820  TYR A CB    1 
ATOM   6240  C  CG    . TYR A 1 819  ? -18.288 -70.840  3.353   1.00 17.75  ? 820  TYR A CG    1 
ATOM   6241  C  CD1   . TYR A 1 819  ? -19.653 -70.999  3.567   1.00 18.96  ? 820  TYR A CD1   1 
ATOM   6242  C  CD2   . TYR A 1 819  ? -17.851 -70.187  2.209   1.00 18.15  ? 820  TYR A CD2   1 
ATOM   6243  C  CE1   . TYR A 1 819  ? -20.592 -70.497  2.667   1.00 20.15  ? 820  TYR A CE1   1 
ATOM   6244  C  CE2   . TYR A 1 819  ? -18.757 -69.659  1.313   1.00 19.52  ? 820  TYR A CE2   1 
ATOM   6245  C  CZ    . TYR A 1 819  ? -20.118 -69.840  1.533   1.00 20.68  ? 820  TYR A CZ    1 
ATOM   6246  O  OH    . TYR A 1 819  ? -21.022 -69.329  0.647   1.00 20.31  ? 820  TYR A OH    1 
ATOM   6247  N  N     . VAL A 1 820  ? -15.737 -73.245  6.177   1.00 18.68  ? 821  VAL A N     1 
ATOM   6248  C  CA    . VAL A 1 820  ? -14.698 -73.380  7.189   1.00 19.73  ? 821  VAL A CA    1 
ATOM   6249  C  C     . VAL A 1 820  ? -13.720 -74.501  6.852   1.00 19.64  ? 821  VAL A C     1 
ATOM   6250  O  O     . VAL A 1 820  ? -12.512 -74.326  7.076   1.00 19.00  ? 821  VAL A O     1 
ATOM   6251  C  CB    . VAL A 1 820  ? -15.268 -73.548  8.606   1.00 21.12  ? 821  VAL A CB    1 
ATOM   6252  C  CG1   . VAL A 1 820  ? -16.137 -72.324  8.964   1.00 22.37  ? 821  VAL A CG1   1 
ATOM   6253  C  CG2   . VAL A 1 820  ? -16.170 -74.755  8.688   1.00 26.34  ? 821  VAL A CG2   1 
ATOM   6254  N  N     . ARG A 1 821  ? -14.198 -75.616  6.310   1.00 18.99  ? 822  ARG A N     1 
ATOM   6255  C  CA    . ARG A 1 821  ? -13.312 -76.674  5.844   1.00 19.55  ? 822  ARG A CA    1 
ATOM   6256  C  C     . ARG A 1 821  ? -12.310 -76.165  4.834   1.00 19.69  ? 822  ARG A C     1 
ATOM   6257  O  O     . ARG A 1 821  ? -11.099 -76.415  5.059   1.00 20.69  ? 822  ARG A O     1 
ATOM   6258  C  CB    . ARG A 1 821  ? -14.201 -77.847  5.317   1.00 19.81  ? 822  ARG A CB    1 
ATOM   6259  C  CG    . ARG A 1 821  ? -13.321 -78.904  4.653   1.00 21.62  ? 822  ARG A CG    1 
ATOM   6260  C  CD    . ARG A 1 821  ? -14.180 -80.045  4.112   1.00 23.35  ? 822  ARG A CD    1 
ATOM   6261  N  NE    . ARG A 1 821  ? -13.304 -81.045  3.443   1.00 24.41  ? 822  ARG A NE    1 
ATOM   6262  C  CZ    . ARG A 1 821  ? -13.010 -80.887  2.145   1.00 21.77  ? 822  ARG A CZ    1 
ATOM   6263  N  NH1   . ARG A 1 821  ? -12.258 -81.808  1.583   1.00 19.96  ? 822  ARG A NH1   1 
ATOM   6264  N  NH2   . ARG A 1 821  ? -13.481 -79.867  1.451   1.00 22.77  ? 822  ARG A NH2   1 
ATOM   6265  N  N     . VAL A 1 822  ? -12.656 -75.345  3.829   1.00 21.23  ? 823  VAL A N     1 
ATOM   6266  C  CA    . VAL A 1 822  ? -11.634 -74.876  2.906   1.00 22.17  ? 823  VAL A CA    1 
ATOM   6267  C  C     . VAL A 1 822  ? -10.722 -73.808  3.487   1.00 22.11  ? 823  VAL A C     1 
ATOM   6268  O  O     . VAL A 1 822  ? -9.485  -73.868  3.271   1.00 17.94  ? 823  VAL A O     1 
ATOM   6269  C  CB    . VAL A 1 822  ? -12.050 -74.569  1.466   1.00 23.99  ? 823  VAL A CB    1 
ATOM   6270  C  CG1   . VAL A 1 822  ? -13.481 -74.892  1.153   1.00 22.84  ? 823  VAL A CG1   1 
ATOM   6271  C  CG2   . VAL A 1 822  ? -11.590 -73.292  0.800   1.00 25.67  ? 823  VAL A CG2   1 
ATOM   6272  N  N     . ILE A 1 823  ? -11.271 -73.064  4.443   1.00 20.29  ? 824  ILE A N     1 
ATOM   6273  C  CA    . ILE A 1 823  ? -10.370 -72.121  5.141   1.00 19.59  ? 824  ILE A CA    1 
ATOM   6274  C  C     . ILE A 1 823  ? -9.271  -72.941  5.835   1.00 19.52  ? 824  ILE A C     1 
ATOM   6275  O  O     . ILE A 1 823  ? -8.070  -72.589  5.772   1.00 23.51  ? 824  ILE A O     1 
ATOM   6276  C  CB    . ILE A 1 823  ? -11.109 -71.207  6.142   1.00 18.42  ? 824  ILE A CB    1 
ATOM   6277  C  CG1   . ILE A 1 823  ? -11.987 -70.169  5.460   1.00 17.47  ? 824  ILE A CG1   1 
ATOM   6278  C  CG2   . ILE A 1 823  ? -10.098 -70.441  7.017   1.00 19.07  ? 824  ILE A CG2   1 
ATOM   6279  C  CD1   . ILE A 1 823  ? -13.020 -69.546  6.401   1.00 18.49  ? 824  ILE A CD1   1 
ATOM   6280  N  N     . THR A 1 824  ? -9.602  -74.059  6.437   1.00 19.46  ? 825  THR A N     1 
ATOM   6281  C  CA    . THR A 1 824  ? -8.549  -74.887  7.071   1.00 19.51  ? 825  THR A CA    1 
ATOM   6282  C  C     . THR A 1 824  ? -7.550  -75.479  6.059   1.00 20.06  ? 825  THR A C     1 
ATOM   6283  O  O     . THR A 1 824  ? -6.385  -75.631  6.465   1.00 19.15  ? 825  THR A O     1 
ATOM   6284  C  CB    . THR A 1 824  ? -9.046  -76.003  7.993   1.00 20.13  ? 825  THR A CB    1 
ATOM   6285  O  OG1   . THR A 1 824  ? -9.730  -77.013  7.238   1.00 19.25  ? 825  THR A OG1   1 
ATOM   6286  C  CG2   . THR A 1 824  ? -10.028 -75.413  9.052   1.00 19.04  ? 825  THR A CG2   1 
ATOM   6287  N  N     . GLN A 1 825  ? -7.939  -75.780  4.843   1.00 19.49  ? 826  GLN A N     1 
ATOM   6288  C  CA    . GLN A 1 825  ? -7.044  -76.331  3.833   1.00 22.78  ? 826  GLN A CA    1 
ATOM   6289  C  C     . GLN A 1 825  ? -6.068  -75.269  3.357   1.00 23.57  ? 826  GLN A C     1 
ATOM   6290  O  O     . GLN A 1 825  ? -5.031  -75.592  2.746   1.00 26.73  ? 826  GLN A O     1 
ATOM   6291  C  CB    . GLN A 1 825  ? -7.810  -76.906  2.615   1.00 22.50  ? 826  GLN A CB    1 
ATOM   6292  C  CG    . GLN A 1 825  ? -8.605  -78.141  2.951   1.00 24.58  ? 826  GLN A CG    1 
ATOM   6293  C  CD    . GLN A 1 825  ? -9.648  -78.631  1.960   1.00 26.22  ? 826  GLN A CD    1 
ATOM   6294  O  OE1   . GLN A 1 825  ? -10.491 -77.876  1.501   1.00 27.70  ? 826  GLN A OE1   1 
ATOM   6295  N  NE2   . GLN A 1 825  ? -9.588  -79.929  1.652   1.00 26.63  ? 826  GLN A NE2   1 
ATOM   6296  N  N     . LEU A 1 826  ? -6.347  -74.007  3.682   1.00 21.00  ? 827  LEU A N     1 
ATOM   6297  C  CA    . LEU A 1 826  ? -5.449  -72.947  3.240   1.00 20.23  ? 827  LEU A CA    1 
ATOM   6298  C  C     . LEU A 1 826  ? -4.564  -72.461  4.398   1.00 21.78  ? 827  LEU A C     1 
ATOM   6299  O  O     . LEU A 1 826  ? -3.400  -72.116  4.155   1.00 22.73  ? 827  LEU A O     1 
ATOM   6300  C  CB    . LEU A 1 826  ? -6.255  -71.777  2.690   1.00 19.52  ? 827  LEU A CB    1 
ATOM   6301  C  CG    . LEU A 1 826  ? -6.435  -71.691  1.175   1.00 22.40  ? 827  LEU A CG    1 
ATOM   6302  C  CD1   . LEU A 1 826  ? -7.286  -72.820  0.614   1.00 23.88  ? 827  LEU A CD1   1 
ATOM   6303  C  CD2   . LEU A 1 826  ? -7.047  -70.332  0.798   1.00 22.29  ? 827  LEU A CD2   1 
ATOM   6304  N  N     . PHE A 1 827  ? -5.120  -72.421  5.612   1.00 18.93  ? 828  PHE A N     1 
ATOM   6305  C  CA    . PHE A 1 827  ? -4.341  -71.853  6.711   1.00 18.40  ? 828  PHE A CA    1 
ATOM   6306  C  C     . PHE A 1 827  ? -4.370  -72.686  7.977   1.00 19.45  ? 828  PHE A C     1 
ATOM   6307  O  O     . PHE A 1 827  ? -3.840  -72.215  9.002   1.00 19.56  ? 828  PHE A O     1 
ATOM   6308  C  CB    . PHE A 1 827  ? -4.915  -70.456  7.080   1.00 18.64  ? 828  PHE A CB    1 
ATOM   6309  C  CG    . PHE A 1 827  ? -5.237  -69.568  5.907   1.00 19.07  ? 828  PHE A CG    1 
ATOM   6310  C  CD1   . PHE A 1 827  ? -6.558  -69.319  5.605   1.00 18.65  ? 828  PHE A CD1   1 
ATOM   6311  C  CD2   . PHE A 1 827  ? -4.251  -68.961  5.155   1.00 18.37  ? 828  PHE A CD2   1 
ATOM   6312  C  CE1   . PHE A 1 827  ? -6.910  -68.501  4.548   1.00 20.60  ? 828  PHE A CE1   1 
ATOM   6313  C  CE2   . PHE A 1 827  ? -4.605  -68.134  4.079   1.00 21.28  ? 828  PHE A CE2   1 
ATOM   6314  C  CZ    . PHE A 1 827  ? -5.919  -67.888  3.801   1.00 19.19  ? 828  PHE A CZ    1 
ATOM   6315  N  N     . GLY A 1 828  ? -5.026  -73.821  8.039   1.00 20.39  ? 829  GLY A N     1 
ATOM   6316  C  CA    . GLY A 1 828  ? -5.269  -74.584  9.263   1.00 18.62  ? 829  GLY A CA    1 
ATOM   6317  C  C     . GLY A 1 828  ? -4.085  -74.792  10.165  1.00 21.51  ? 829  GLY A C     1 
ATOM   6318  O  O     . GLY A 1 828  ? -4.240  -74.647  11.394  1.00 17.80  ? 829  GLY A O     1 
ATOM   6319  N  N     . GLU A 1 829  ? -2.891  -75.074  9.615   1.00 21.75  ? 830  GLU A N     1 
ATOM   6320  C  CA    . GLU A 1 829  ? -1.735  -75.358  10.457  1.00 21.89  ? 830  GLU A CA    1 
ATOM   6321  C  C     . GLU A 1 829  ? -1.220  -74.183  11.266  1.00 21.99  ? 830  GLU A C     1 
ATOM   6322  O  O     . GLU A 1 829  ? -0.304  -74.338  12.078  1.00 22.73  ? 830  GLU A O     1 
ATOM   6323  C  CB    . GLU A 1 829  ? -0.622  -75.918  9.543   1.00 22.71  ? 830  GLU A CB    1 
ATOM   6324  C  CG    . GLU A 1 829  ? 0.188   -74.910  8.748   1.00 21.76  ? 830  GLU A CG    1 
ATOM   6325  C  CD    . GLU A 1 829  ? -0.530  -74.455  7.478   1.00 25.15  ? 830  GLU A CD    1 
ATOM   6326  O  OE1   . GLU A 1 829  ? -1.710  -74.811  7.194   1.00 23.81  ? 830  GLU A OE1   1 
ATOM   6327  O  OE2   . GLU A 1 829  ? 0.118   -73.668  6.749   1.00 26.29  ? 830  GLU A OE2   1 
ATOM   6328  N  N     . ARG A 1 830  ? -1.590  -72.951  10.902  1.00 21.56  ? 831  ARG A N     1 
ATOM   6329  C  CA    . ARG A 1 830  ? -1.102  -71.783  11.621  1.00 19.91  ? 831  ARG A CA    1 
ATOM   6330  C  C     . ARG A 1 830  ? -2.240  -70.934  12.223  1.00 17.94  ? 831  ARG A C     1 
ATOM   6331  O  O     . ARG A 1 830  ? -2.050  -69.774  12.524  1.00 19.38  ? 831  ARG A O     1 
ATOM   6332  C  CB    . ARG A 1 830  ? -0.302  -70.857  10.733  1.00 21.45  ? 831  ARG A CB    1 
ATOM   6333  C  CG    . ARG A 1 830  ? -0.144  -71.141  9.287   1.00 23.10  ? 831  ARG A CG    1 
ATOM   6334  C  CD    . ARG A 1 830  ? 0.758   -70.162  8.554   1.00 20.31  ? 831  ARG A CD    1 
ATOM   6335  N  NE    . ARG A 1 830  ? 0.001   -69.425  7.522   1.00 18.94  ? 831  ARG A NE    1 
ATOM   6336  C  CZ    . ARG A 1 830  ? -0.289  -68.128  7.634   1.00 17.05  ? 831  ARG A CZ    1 
ATOM   6337  N  NH1   . ARG A 1 830  ? 0.123   -67.500  8.727   1.00 16.62  ? 831  ARG A NH1   1 
ATOM   6338  N  NH2   . ARG A 1 830  ? -0.959  -67.548  6.650   1.00 17.89  ? 831  ARG A NH2   1 
ATOM   6339  N  N     . MET A 1 831  ? -3.444  -71.507  12.257  1.00 16.81  ? 832  MET A N     1 
ATOM   6340  C  CA    . MET A 1 831  ? -4.541  -70.663  12.723  1.00 16.51  ? 832  MET A CA    1 
ATOM   6341  C  C     . MET A 1 831  ? -4.882  -70.720  14.177  1.00 15.37  ? 832  MET A C     1 
ATOM   6342  O  O     . MET A 1 831  ? -4.785  -71.700  14.886  1.00 14.52  ? 832  MET A O     1 
ATOM   6343  C  CB    . MET A 1 831  ? -5.695  -70.846  11.769  1.00 18.80  ? 832  MET A CB    1 
ATOM   6344  C  CG    . MET A 1 831  ? -6.720  -71.906  11.685  1.00 23.34  ? 832  MET A CG    1 
ATOM   6345  S  SD    . MET A 1 831  ? -7.557  -71.794  10.030  1.00 21.28  ? 832  MET A SD    1 
ATOM   6346  C  CE    . MET A 1 831  ? -8.823  -70.578  10.441  1.00 19.74  ? 832  MET A CE    1 
ATOM   6347  N  N     . PHE A 1 832  ? -5.325  -69.532  14.678  1.00 15.89  ? 833  PHE A N     1 
ATOM   6348  C  CA    . PHE A 1 832  ? -6.021  -69.395  15.933  1.00 15.86  ? 833  PHE A CA    1 
ATOM   6349  C  C     . PHE A 1 832  ? -7.495  -69.093  15.552  1.00 15.67  ? 833  PHE A C     1 
ATOM   6350  O  O     . PHE A 1 832  ? -7.724  -68.462  14.525  1.00 14.90  ? 833  PHE A O     1 
ATOM   6351  C  CB    . PHE A 1 832  ? -5.581  -68.206  16.790  1.00 15.49  ? 833  PHE A CB    1 
ATOM   6352  C  CG    . PHE A 1 832  ? -4.272  -68.347  17.510  1.00 16.09  ? 833  PHE A CG    1 
ATOM   6353  C  CD1   . PHE A 1 832  ? -3.076  -68.148  16.782  1.00 16.67  ? 833  PHE A CD1   1 
ATOM   6354  C  CD2   . PHE A 1 832  ? -4.181  -68.689  18.839  1.00 15.31  ? 833  PHE A CD2   1 
ATOM   6355  C  CE1   . PHE A 1 832  ? -1.859  -68.230  17.441  1.00 16.54  ? 833  PHE A CE1   1 
ATOM   6356  C  CE2   . PHE A 1 832  ? -2.948  -68.796  19.483  1.00 13.21  ? 833  PHE A CE2   1 
ATOM   6357  C  CZ    . PHE A 1 832  ? -1.771  -68.574  18.787  1.00 14.50  ? 833  PHE A CZ    1 
ATOM   6358  N  N     . ILE A 1 833  ? -8.505  -69.610  16.237  1.00 15.83  ? 834  ILE A N     1 
ATOM   6359  C  CA    . ILE A 1 833  ? -9.901  -69.312  15.897  1.00 15.91  ? 834  ILE A CA    1 
ATOM   6360  C  C     . ILE A 1 833  ? -10.623 -68.908  17.199  1.00 13.35  ? 834  ILE A C     1 
ATOM   6361  O  O     . ILE A 1 833  ? -10.604 -69.641  18.153  1.00 18.24  ? 834  ILE A O     1 
ATOM   6362  C  CB    . ILE A 1 833  ? -10.677 -70.534  15.326  1.00 15.71  ? 834  ILE A CB    1 
ATOM   6363  C  CG1   . ILE A 1 833  ? -10.044 -71.032  14.029  1.00 17.61  ? 834  ILE A CG1   1 
ATOM   6364  C  CG2   . ILE A 1 833  ? -12.159 -70.149  15.102  1.00 17.32  ? 834  ILE A CG2   1 
ATOM   6365  C  CD1   . ILE A 1 833  ? -10.589 -72.353  13.507  1.00 16.37  ? 834  ILE A CD1   1 
ATOM   6366  N  N     . ALA A 1 834  ? -11.180 -67.736  17.271  1.00 14.08  ? 835  ALA A N     1 
ATOM   6367  C  CA    . ALA A 1 834  ? -12.011 -67.180  18.340  1.00 14.23  ? 835  ALA A CA    1 
ATOM   6368  C  C     . ALA A 1 834  ? -13.435 -67.382  17.780  1.00 14.49  ? 835  ALA A C     1 
ATOM   6369  O  O     . ALA A 1 834  ? -13.646 -66.819  16.718  1.00 15.82  ? 835  ALA A O     1 
ATOM   6370  C  CB    . ALA A 1 834  ? -11.711 -65.689  18.539  1.00 14.50  ? 835  ALA A CB    1 
ATOM   6371  N  N     . ASN A 1 835  ? -14.200 -68.355  18.260  1.00 14.72  ? 836  ASN A N     1 
ATOM   6372  C  CA    . ASN A 1 835  ? -15.469 -68.648  17.624  1.00 17.23  ? 836  ASN A CA    1 
ATOM   6373  C  C     . ASN A 1 835  ? -16.636 -68.022  18.402  1.00 15.71  ? 836  ASN A C     1 
ATOM   6374  O  O     . ASN A 1 835  ? -16.777 -68.460  19.557  1.00 15.11  ? 836  ASN A O     1 
ATOM   6375  C  CB    . ASN A 1 835  ? -15.729 -70.170  17.572  1.00 16.89  ? 836  ASN A CB    1 
ATOM   6376  C  CG    . ASN A 1 835  ? -16.652 -70.492  16.406  1.00 18.53  ? 836  ASN A CG    1 
ATOM   6377  O  OD1   . ASN A 1 835  ? -17.894 -70.197  16.265  1.00 20.99  ? 836  ASN A OD1   1 
ATOM   6378  N  ND2   . ASN A 1 835  ? -16.000 -71.100  15.459  1.00 15.10  ? 836  ASN A ND2   1 
ATOM   6379  N  N     . ALA A 1 836  ? -17.523 -67.251  17.795  1.00 13.67  ? 837  ALA A N     1 
ATOM   6380  C  CA    . ALA A 1 836  ? -18.679 -66.806  18.622  1.00 14.60  ? 837  ALA A CA    1 
ATOM   6381  C  C     . ALA A 1 836  ? -19.585 -67.984  18.991  1.00 14.48  ? 837  ALA A C     1 
ATOM   6382  O  O     . ALA A 1 836  ? -19.683 -68.911  18.156  1.00 16.36  ? 837  ALA A O     1 
ATOM   6383  C  CB    . ALA A 1 836  ? -19.464 -65.813  17.795  1.00 12.97  ? 837  ALA A CB    1 
ATOM   6384  N  N     . THR A 1 837  ? -20.371 -67.917  20.064  1.00 13.39  ? 838  THR A N     1 
ATOM   6385  C  CA    . THR A 1 837  ? -21.387 -68.982  20.270  1.00 14.38  ? 838  THR A CA    1 
ATOM   6386  C  C     . THR A 1 837  ? -22.365 -68.867  19.084  1.00 16.17  ? 838  THR A C     1 
ATOM   6387  O  O     . THR A 1 837  ? -22.669 -67.769  18.577  1.00 15.68  ? 838  THR A O     1 
ATOM   6388  C  CB    . THR A 1 837  ? -22.064 -68.765  21.612  1.00 14.65  ? 838  THR A CB    1 
ATOM   6389  O  OG1   . THR A 1 837  ? -21.057 -68.448  22.608  1.00 12.22  ? 838  THR A OG1   1 
ATOM   6390  C  CG2   . THR A 1 837  ? -22.890 -69.960  22.018  1.00 14.11  ? 838  THR A CG2   1 
ATOM   6391  N  N     . GLY A 1 838  ? -22.852 -70.002  18.599  1.00 16.39  ? 839  GLY A N     1 
ATOM   6392  C  CA    . GLY A 1 838  ? -23.823 -70.031  17.496  1.00 17.27  ? 839  GLY A CA    1 
ATOM   6393  C  C     . GLY A 1 838  ? -23.757 -71.472  16.916  1.00 17.79  ? 839  GLY A C     1 
ATOM   6394  O  O     . GLY A 1 838  ? -23.060 -72.314  17.501  1.00 16.92  ? 839  GLY A O     1 
ATOM   6395  N  N     . CYS A 1 839  ? -24.393 -71.713  15.784  1.00 18.39  ? 840  CYS A N     1 
ATOM   6396  C  CA    . CYS A 1 839  ? -24.263 -73.029  15.189  1.00 19.80  ? 840  CYS A CA    1 
ATOM   6397  C  C     . CYS A 1 839  ? -22.791 -73.471  15.100  1.00 18.38  ? 840  CYS A C     1 
ATOM   6398  O  O     . CYS A 1 839  ? -22.469 -74.623  15.398  1.00 18.19  ? 840  CYS A O     1 
ATOM   6399  C  CB    . CYS A 1 839  ? -24.916 -73.086  13.787  1.00 17.42  ? 840  CYS A CB    1 
ATOM   6400  S  SG    . CYS A 1 839  ? -26.678 -73.448  14.009  1.00 17.56  ? 840  CYS A SG    1 
ATOM   6401  N  N     . SER A 1 840  ? -21.966 -72.477  14.782  1.00 17.83  ? 841  SER A N     1 
ATOM   6402  C  CA    . SER A 1 840  ? -20.547 -72.824  14.511  1.00 20.70  ? 841  SER A CA    1 
ATOM   6403  C  C     . SER A 1 840  ? -19.789 -73.305  15.736  1.00 21.26  ? 841  SER A C     1 
ATOM   6404  O  O     . SER A 1 840  ? -18.905 -74.178  15.650  1.00 20.34  ? 841  SER A O     1 
ATOM   6405  C  CB    . SER A 1 840  ? -19.867 -71.690  13.783  1.00 19.81  ? 841  SER A CB    1 
ATOM   6406  O  OG    . SER A 1 840  ? -19.747 -70.453  14.414  1.00 21.74  ? 841  SER A OG    1 
ATOM   6407  N  N     . SER A 1 841  ? -20.229 -72.854  16.925  1.00 18.36  ? 842  SER A N     1 
ATOM   6408  C  CA    . SER A 1 841  ? -19.607 -73.357  18.134  1.00 16.55  ? 842  SER A CA    1 
ATOM   6409  C  C     . SER A 1 841  ? -20.209 -74.718  18.508  1.00 19.39  ? 842  SER A C     1 
ATOM   6410  O  O     . SER A 1 841  ? -19.573 -75.439  19.258  1.00 17.84  ? 842  SER A O     1 
ATOM   6411  C  CB    . SER A 1 841  ? -19.669 -72.412  19.311  1.00 16.57  ? 842  SER A CB    1 
ATOM   6412  O  OG    . SER A 1 841  ? -20.952 -72.188  19.884  1.00 15.30  ? 842  SER A OG    1 
ATOM   6413  N  N     . ILE A 1 842  ? -21.486 -74.902  18.207  1.00 18.43  ? 843  ILE A N     1 
ATOM   6414  C  CA    . ILE A 1 842  ? -22.194 -76.142  18.545  1.00 21.09  ? 843  ILE A CA    1 
ATOM   6415  C  C     . ILE A 1 842  ? -21.771 -77.292  17.621  1.00 19.79  ? 843  ILE A C     1 
ATOM   6416  O  O     . ILE A 1 842  ? -21.451 -78.345  18.145  1.00 21.38  ? 843  ILE A O     1 
ATOM   6417  C  CB    . ILE A 1 842  ? -23.711 -75.853  18.485  1.00 21.89  ? 843  ILE A CB    1 
ATOM   6418  C  CG1   . ILE A 1 842  ? -24.096 -74.774  19.500  1.00 22.78  ? 843  ILE A CG1   1 
ATOM   6419  C  CG2   . ILE A 1 842  ? -24.577 -77.097  18.657  1.00 22.41  ? 843  ILE A CG2   1 
ATOM   6420  C  CD1   . ILE A 1 842  ? -23.577 -74.925  20.921  1.00 24.68  ? 843  ILE A CD1   1 
ATOM   6421  N  N     . TRP A 1 843  ? -21.687 -77.087  16.294  1.00 19.47  ? 844  TRP A N     1 
ATOM   6422  C  CA    . TRP A 1 843  ? -21.172 -78.184  15.464  1.00 21.29  ? 844  TRP A CA    1 
ATOM   6423  C  C     . TRP A 1 843  ? -19.629 -78.253  15.651  1.00 21.65  ? 844  TRP A C     1 
ATOM   6424  O  O     . TRP A 1 843  ? -19.020 -79.312  15.511  1.00 23.70  ? 844  TRP A O     1 
ATOM   6425  C  CB    . TRP A 1 843  ? -21.541 -78.083  14.000  1.00 20.82  ? 844  TRP A CB    1 
ATOM   6426  C  CG    . TRP A 1 843  ? -21.243 -76.858  13.219  1.00 19.61  ? 844  TRP A CG    1 
ATOM   6427  C  CD1   . TRP A 1 843  ? -22.220 -76.005  12.727  1.00 19.34  ? 844  TRP A CD1   1 
ATOM   6428  C  CD2   . TRP A 1 843  ? -20.002 -76.349  12.759  1.00 18.43  ? 844  TRP A CD2   1 
ATOM   6429  N  NE1   . TRP A 1 843  ? -21.624 -74.990  11.991  1.00 16.88  ? 844  TRP A NE1   1 
ATOM   6430  C  CE2   . TRP A 1 843  ? -20.264 -75.196  12.007  1.00 19.89  ? 844  TRP A CE2   1 
ATOM   6431  C  CE3   . TRP A 1 843  ? -18.674 -76.783  12.854  1.00 20.69  ? 844  TRP A CE3   1 
ATOM   6432  C  CZ2   . TRP A 1 843  ? -19.258 -74.436  11.399  1.00 21.14  ? 844  TRP A CZ2   1 
ATOM   6433  C  CZ3   . TRP A 1 843  ? -17.656 -76.023  12.272  1.00 19.89  ? 844  TRP A CZ3   1 
ATOM   6434  C  CH2   . TRP A 1 843  ? -17.963 -74.865  11.542  1.00 21.30  ? 844  TRP A CH2   1 
ATOM   6435  N  N     . GLY A 1 844  ? -19.049 -77.079  15.977  1.00 19.46  ? 845  GLY A N     1 
ATOM   6436  C  CA    . GLY A 1 844  ? -17.600 -76.987  16.178  1.00 19.05  ? 845  GLY A CA    1 
ATOM   6437  C  C     . GLY A 1 844  ? -17.078 -77.650  17.434  1.00 18.14  ? 845  GLY A C     1 
ATOM   6438  O  O     . GLY A 1 844  ? -15.977 -78.232  17.427  1.00 20.91  ? 845  GLY A O     1 
ATOM   6439  N  N     . ALA A 1 845  ? -17.786 -77.588  18.554  1.00 17.44  ? 846  ALA A N     1 
ATOM   6440  C  CA    . ALA A 1 845  ? -17.245 -78.222  19.768  1.00 17.59  ? 846  ALA A CA    1 
ATOM   6441  C  C     . ALA A 1 845  ? -18.242 -78.674  20.805  1.00 19.29  ? 846  ALA A C     1 
ATOM   6442  O  O     . ALA A 1 845  ? -18.100 -78.422  22.018  1.00 19.20  ? 846  ALA A O     1 
ATOM   6443  C  CB    . ALA A 1 845  ? -16.224 -77.250  20.352  1.00 15.49  ? 846  ALA A CB    1 
ATOM   6444  N  N     . SER A 1 846  ? -19.250 -79.475  20.377  1.00 19.21  ? 847  SER A N     1 
ATOM   6445  C  CA    . SER A 1 846  ? -20.151 -80.039  21.387  1.00 19.48  ? 847  SER A CA    1 
ATOM   6446  C  C     . SER A 1 846  ? -19.489 -81.316  21.930  1.00 20.50  ? 847  SER A C     1 
ATOM   6447  O  O     . SER A 1 846  ? -19.222 -82.240  21.161  1.00 21.96  ? 847  SER A O     1 
ATOM   6448  C  CB    . SER A 1 846  ? -21.512 -80.451  20.832  1.00 20.08  ? 847  SER A CB    1 
ATOM   6449  O  OG    . SER A 1 846  ? -22.260 -79.308  20.448  1.00 18.52  ? 847  SER A OG    1 
ATOM   6450  N  N     . ALA A 1 847  ? -19.119 -81.361  23.238  1.00 19.18  ? 848  ALA A N     1 
ATOM   6451  C  CA    . ALA A 1 847  ? -18.462 -82.568  23.717  1.00 19.85  ? 848  ALA A CA    1 
ATOM   6452  C  C     . ALA A 1 847  ? -19.240 -83.833  23.509  1.00 21.88  ? 848  ALA A C     1 
ATOM   6453  O  O     . ALA A 1 847  ? -20.421 -83.549  23.596  1.00 21.24  ? 848  ALA A O     1 
ATOM   6454  C  CB    . ALA A 1 847  ? -18.050 -82.481  25.182  1.00 20.52  ? 848  ALA A CB    1 
ATOM   6455  N  N     . PRO A 1 848  ? -18.693 -84.966  23.212  1.00 20.42  ? 849  PRO A N     1 
ATOM   6456  C  CA    . PRO A 1 848  ? -17.288 -85.273  23.152  1.00 22.60  ? 849  PRO A CA    1 
ATOM   6457  C  C     . PRO A 1 848  ? -16.711 -85.171  21.738  1.00 23.37  ? 849  PRO A C     1 
ATOM   6458  O  O     . PRO A 1 848  ? -15.556 -85.515  21.510  1.00 23.42  ? 849  PRO A O     1 
ATOM   6459  C  CB    . PRO A 1 848  ? -17.231 -86.672  23.780  1.00 21.42  ? 849  PRO A CB    1 
ATOM   6460  C  CG    . PRO A 1 848  ? -18.429 -87.305  23.104  1.00 22.00  ? 849  PRO A CG    1 
ATOM   6461  C  CD    . PRO A 1 848  ? -19.434 -86.198  22.989  1.00 19.79  ? 849  PRO A CD    1 
ATOM   6462  N  N     . SER A 1 849  ? -17.535 -84.677  20.826  1.00 22.06  ? 850  SER A N     1 
ATOM   6463  C  CA    . SER A 1 849  ? -17.227 -84.663  19.397  1.00 24.22  ? 850  SER A CA    1 
ATOM   6464  C  C     . SER A 1 849  ? -16.434 -83.445  18.917  1.00 24.57  ? 850  SER A C     1 
ATOM   6465  O  O     . SER A 1 849  ? -17.008 -82.374  18.739  1.00 24.25  ? 850  SER A O     1 
ATOM   6466  C  CB    . SER A 1 849  ? -18.583 -84.707  18.634  1.00 24.42  ? 850  SER A CB    1 
ATOM   6467  O  OG    . SER A 1 849  ? -18.310 -84.930  17.251  1.00 28.40  ? 850  SER A OG    1 
ATOM   6468  N  N     . MET A 1 850  ? -15.145 -83.640  18.636  1.00 22.09  ? 851  MET A N     1 
ATOM   6469  C  CA    . MET A 1 850  ? -14.317 -82.546  18.121  1.00 20.74  ? 851  MET A CA    1 
ATOM   6470  C  C     . MET A 1 850  ? -13.937 -82.752  16.653  1.00 20.96  ? 851  MET A C     1 
ATOM   6471  O  O     . MET A 1 850  ? -13.074 -83.590  16.356  1.00 23.39  ? 851  MET A O     1 
ATOM   6472  C  CB    . MET A 1 850  ? -13.061 -82.423  18.993  1.00 18.15  ? 851  MET A CB    1 
ATOM   6473  C  CG    . MET A 1 850  ? -13.333 -82.334  20.519  1.00 20.00  ? 851  MET A CG    1 
ATOM   6474  S  SD    . MET A 1 850  ? -14.106 -80.746  20.968  1.00 21.92  ? 851  MET A SD    1 
ATOM   6475  C  CE    . MET A 1 850  ? -15.665 -81.141  21.751  1.00 19.44  ? 851  MET A CE    1 
ATOM   6476  N  N     . PRO A 1 851  ? -14.555 -82.044  15.733  1.00 21.23  ? 852  PRO A N     1 
ATOM   6477  C  CA    . PRO A 1 851  ? -14.344 -82.099  14.313  1.00 19.67  ? 852  PRO A CA    1 
ATOM   6478  C  C     . PRO A 1 851  ? -13.073 -81.411  13.828  1.00 20.84  ? 852  PRO A C     1 
ATOM   6479  O  O     . PRO A 1 851  ? -12.428 -81.896  12.882  1.00 18.65  ? 852  PRO A O     1 
ATOM   6480  C  CB    . PRO A 1 851  ? -15.576 -81.393  13.728  1.00 22.02  ? 852  PRO A CB    1 
ATOM   6481  C  CG    . PRO A 1 851  ? -15.976 -80.407  14.785  1.00 18.18  ? 852  PRO A CG    1 
ATOM   6482  C  CD    . PRO A 1 851  ? -15.686 -81.105  16.102  1.00 21.01  ? 852  PRO A CD    1 
ATOM   6483  N  N     . TYR A 1 852  ? -12.604 -80.337  14.539  1.00 17.67  ? 853  TYR A N     1 
ATOM   6484  C  CA    . TYR A 1 852  ? -11.268 -79.846  14.123  1.00 19.31  ? 853  TYR A CA    1 
ATOM   6485  C  C     . TYR A 1 852  ? -10.215 -80.887  14.486  1.00 19.51  ? 853  TYR A C     1 
ATOM   6486  O  O     . TYR A 1 852  ? -10.393 -81.588  15.486  1.00 20.96  ? 853  TYR A O     1 
ATOM   6487  C  CB    . TYR A 1 852  ? -10.926 -78.512  14.771  1.00 21.19  ? 853  TYR A CB    1 
ATOM   6488  C  CG    . TYR A 1 852  ? -11.847 -77.396  14.304  1.00 18.56  ? 853  TYR A CG    1 
ATOM   6489  C  CD1   . TYR A 1 852  ? -13.058 -77.119  14.946  1.00 19.95  ? 853  TYR A CD1   1 
ATOM   6490  C  CD2   . TYR A 1 852  ? -11.480 -76.620  13.219  1.00 20.49  ? 853  TYR A CD2   1 
ATOM   6491  C  CE1   . TYR A 1 852  ? -13.871 -76.068  14.476  1.00 20.53  ? 853  TYR A CE1   1 
ATOM   6492  C  CE2   . TYR A 1 852  ? -12.248 -75.564  12.775  1.00 18.02  ? 853  TYR A CE2   1 
ATOM   6493  C  CZ    . TYR A 1 852  ? -13.437 -75.291  13.409  1.00 20.50  ? 853  TYR A CZ    1 
ATOM   6494  O  OH    . TYR A 1 852  ? -14.204 -74.245  12.920  1.00 19.76  ? 853  TYR A OH    1 
ATOM   6495  N  N     . LYS A 1 853  ? -9.185  -81.021  13.654  1.00 19.67  ? 854  LYS A N     1 
ATOM   6496  C  CA    . LYS A 1 853  ? -8.164  -82.035  13.825  1.00 21.28  ? 854  LYS A CA    1 
ATOM   6497  C  C     . LYS A 1 853  ? -6.775  -81.518  13.398  1.00 18.28  ? 854  LYS A C     1 
ATOM   6498  O  O     . LYS A 1 853  ? -6.653  -80.448  12.813  1.00 18.22  ? 854  LYS A O     1 
ATOM   6499  C  CB    . LYS A 1 853  ? -8.519  -83.268  12.947  1.00 21.75  ? 854  LYS A CB    1 
ATOM   6500  C  CG    . LYS A 1 853  ? -8.479  -82.887  11.461  1.00 23.50  ? 854  LYS A CG    1 
ATOM   6501  C  CD    . LYS A 1 853  ? -8.997  -84.103  10.673  1.00 27.85  ? 854  LYS A CD    1 
ATOM   6502  C  CE    . LYS A 1 853  ? -7.754  -84.870  10.222  1.00 28.22  ? 854  LYS A CE    1 
ATOM   6503  N  NZ    . LYS A 1 853  ? -7.916  -85.386  8.821   1.00 31.74  ? 854  LYS A NZ    1 
ATOM   6504  N  N     . THR A 1 854  ? -5.756  -82.333  13.679  1.00 19.84  ? 855  THR A N     1 
ATOM   6505  C  CA    . THR A 1 854  ? -4.411  -81.946  13.288  1.00 22.19  ? 855  THR A CA    1 
ATOM   6506  C  C     . THR A 1 854  ? -4.062  -82.616  11.963  1.00 23.35  ? 855  THR A C     1 
ATOM   6507  O  O     . THR A 1 854  ? -4.682  -83.621  11.582  1.00 23.07  ? 855  THR A O     1 
ATOM   6508  C  CB    . THR A 1 854  ? -3.402  -82.432  14.358  1.00 25.64  ? 855  THR A CB    1 
ATOM   6509  O  OG1   . THR A 1 854  ? -3.592  -83.819  14.628  1.00 26.29  ? 855  THR A OG1   1 
ATOM   6510  C  CG2   . THR A 1 854  ? -3.692  -81.663  15.658  1.00 24.28  ? 855  THR A CG2   1 
ATOM   6511  N  N     . ASN A 1 855  ? -3.090  -82.015  11.293  1.00 23.05  ? 856  ASN A N     1 
ATOM   6512  C  CA    . ASN A 1 855  ? -2.512  -82.564  10.078  1.00 24.07  ? 856  ASN A CA    1 
ATOM   6513  C  C     . ASN A 1 855  ? -1.572  -83.712  10.462  1.00 23.24  ? 856  ASN A C     1 
ATOM   6514  O  O     . ASN A 1 855  ? -1.490  -84.126  11.619  1.00 20.72  ? 856  ASN A O     1 
ATOM   6515  C  CB    . ASN A 1 855  ? -1.854  -81.501  9.200   1.00 22.09  ? 856  ASN A CB    1 
ATOM   6516  C  CG    . ASN A 1 855  ? -0.669  -80.790  9.821   1.00 21.34  ? 856  ASN A CG    1 
ATOM   6517  O  OD1   . ASN A 1 855  ? -0.040  -81.225  10.787  1.00 20.24  ? 856  ASN A OD1   1 
ATOM   6518  N  ND2   . ASN A 1 855  ? -0.266  -79.681  9.226   1.00 20.41  ? 856  ASN A ND2   1 
ATOM   6519  N  N     . ARG A 1 856  ? -0.800  -84.196  9.486   1.00 25.61  ? 857  ARG A N     1 
ATOM   6520  C  CA    . ARG A 1 856  ? 0.105   -85.314  9.741   1.00 29.19  ? 857  ARG A CA    1 
ATOM   6521  C  C     . ARG A 1 856  ? 1.266   -84.883  10.621  1.00 28.75  ? 857  ARG A C     1 
ATOM   6522  O  O     . ARG A 1 856  ? 1.971   -85.674  11.241  1.00 30.12  ? 857  ARG A O     1 
ATOM   6523  C  CB    . ARG A 1 856  ? 0.616   -85.866  8.401   1.00 34.64  ? 857  ARG A CB    1 
ATOM   6524  C  CG    . ARG A 1 856  ? 1.355   -84.852  7.548   1.00 39.00  ? 857  ARG A CG    1 
ATOM   6525  C  CD    . ARG A 1 856  ? 1.555   -85.348  6.120   1.00 45.95  ? 857  ARG A CD    1 
ATOM   6526  N  NE    . ARG A 1 856  ? 1.678   -84.205  5.207   1.00 50.66  ? 857  ARG A NE    1 
ATOM   6527  C  CZ    . ARG A 1 856  ? 1.146   -84.086  3.999   1.00 52.57  ? 857  ARG A CZ    1 
ATOM   6528  N  NH1   . ARG A 1 856  ? 0.427   -85.033  3.408   1.00 53.87  ? 857  ARG A NH1   1 
ATOM   6529  N  NH2   . ARG A 1 856  ? 1.383   -82.945  3.351   1.00 54.47  ? 857  ARG A NH2   1 
ATOM   6530  N  N     . LEU A 1 857  ? 1.498   -83.578  10.680  1.00 28.28  ? 858  LEU A N     1 
ATOM   6531  C  CA    . LEU A 1 857  ? 2.593   -83.035  11.481  1.00 26.68  ? 858  LEU A CA    1 
ATOM   6532  C  C     . LEU A 1 857  ? 2.120   -82.657  12.872  1.00 24.52  ? 858  LEU A C     1 
ATOM   6533  O  O     . LEU A 1 857  ? 2.923   -82.177  13.672  1.00 23.70  ? 858  LEU A O     1 
ATOM   6534  C  CB    . LEU A 1 857  ? 3.199   -81.874  10.745  1.00 28.83  ? 858  LEU A CB    1 
ATOM   6535  C  CG    . LEU A 1 857  ? 4.505   -82.004  9.982   1.00 33.49  ? 858  LEU A CG    1 
ATOM   6536  C  CD1   . LEU A 1 857  ? 4.781   -83.416  9.479   1.00 34.16  ? 858  LEU A CD1   1 
ATOM   6537  C  CD2   . LEU A 1 857  ? 4.514   -80.974  8.851   1.00 35.20  ? 858  LEU A CD2   1 
ATOM   6538  N  N     . GLY A 1 858  ? 0.842   -82.830  13.152  1.00 23.54  ? 859  GLY A N     1 
ATOM   6539  C  CA    . GLY A 1 858  ? 0.329   -82.593  14.507  1.00 23.21  ? 859  GLY A CA    1 
ATOM   6540  C  C     . GLY A 1 858  ? -0.015  -81.089  14.677  1.00 22.17  ? 859  GLY A C     1 
ATOM   6541  O  O     . GLY A 1 858  ? -0.261  -80.666  15.816  1.00 22.53  ? 859  GLY A O     1 
ATOM   6542  N  N     . GLN A 1 859  ? -0.159  -80.411  13.555  1.00 20.45  ? 860  GLN A N     1 
ATOM   6543  C  CA    . GLN A 1 859  ? -0.501  -79.004  13.541  1.00 20.07  ? 860  GLN A CA    1 
ATOM   6544  C  C     . GLN A 1 859  ? -1.973  -78.834  13.159  1.00 18.71  ? 860  GLN A C     1 
ATOM   6545  O  O     . GLN A 1 859  ? -2.476  -79.683  12.404  1.00 18.00  ? 860  GLN A O     1 
ATOM   6546  C  CB    . GLN A 1 859  ? 0.358   -78.333  12.447  1.00 21.88  ? 860  GLN A CB    1 
ATOM   6547  C  CG    . GLN A 1 859  ? 1.830   -78.603  12.721  1.00 22.51  ? 860  GLN A CG    1 
ATOM   6548  C  CD    . GLN A 1 859  ? 2.664   -78.065  11.579  1.00 25.35  ? 860  GLN A CD    1 
ATOM   6549  O  OE1   . GLN A 1 859  ? 3.759   -77.507  11.746  1.00 27.30  ? 860  GLN A OE1   1 
ATOM   6550  N  NE2   . GLN A 1 859  ? 2.142   -78.227  10.386  1.00 22.18  ? 860  GLN A NE2   1 
ATOM   6551  N  N     . GLY A 1 860  ? -2.623  -77.794  13.671  1.00 18.08  ? 861  GLY A N     1 
ATOM   6552  C  CA    . GLY A 1 860  ? -4.067  -77.615  13.278  1.00 17.42  ? 861  GLY A CA    1 
ATOM   6553  C  C     . GLY A 1 860  ? -4.655  -76.484  14.111  1.00 18.50  ? 861  GLY A C     1 
ATOM   6554  O  O     . GLY A 1 860  ? -3.978  -75.822  14.903  1.00 20.90  ? 861  GLY A O     1 
ATOM   6555  N  N     . PRO A 1 861  ? -5.884  -76.046  13.797  1.00 18.81  ? 862  PRO A N     1 
ATOM   6556  C  CA    . PRO A 1 861  ? -6.448  -74.855  14.396  1.00 18.45  ? 862  PRO A CA    1 
ATOM   6557  C  C     . PRO A 1 861  ? -6.525  -74.890  15.925  1.00 16.17  ? 862  PRO A C     1 
ATOM   6558  O  O     . PRO A 1 861  ? -7.046  -75.860  16.469  1.00 15.98  ? 862  PRO A O     1 
ATOM   6559  C  CB    . PRO A 1 861  ? -7.792  -74.663  13.709  1.00 18.61  ? 862  PRO A CB    1 
ATOM   6560  C  CG    . PRO A 1 861  ? -7.804  -75.546  12.481  1.00 19.07  ? 862  PRO A CG    1 
ATOM   6561  C  CD    . PRO A 1 861  ? -6.735  -76.586  12.722  1.00 19.34  ? 862  PRO A CD    1 
ATOM   6562  N  N     . ALA A 1 862  ? -5.974  -73.858  16.569  1.00 16.51  ? 863  ALA A N     1 
ATOM   6563  C  CA    . ALA A 1 862  ? -6.202  -73.758  18.049  1.00 16.11  ? 863  ALA A CA    1 
ATOM   6564  C  C     . ALA A 1 862  ? -7.539  -73.020  18.149  1.00 16.04  ? 863  ALA A C     1 
ATOM   6565  O  O     . ALA A 1 862  ? -7.600  -71.831  17.819  1.00 14.98  ? 863  ALA A O     1 
ATOM   6566  C  CB    . ALA A 1 862  ? -5.041  -73.048  18.714  1.00 16.64  ? 863  ALA A CB    1 
ATOM   6567  N  N     . TRP A 1 863  ? -8.534  -73.663  18.732  1.00 17.36  ? 864  TRP A N     1 
ATOM   6568  C  CA    . TRP A 1 863  ? -9.893  -73.166  18.679  1.00 17.18  ? 864  TRP A CA    1 
ATOM   6569  C  C     . TRP A 1 863  ? -10.451 -72.908  20.080  1.00 14.70  ? 864  TRP A C     1 
ATOM   6570  O  O     . TRP A 1 863  ? -10.317 -73.752  20.942  1.00 16.25  ? 864  TRP A O     1 
ATOM   6571  C  CB    . TRP A 1 863  ? -10.751 -74.241  18.000  1.00 17.06  ? 864  TRP A CB    1 
ATOM   6572  C  CG    . TRP A 1 863  ? -12.175 -73.951  17.701  1.00 17.54  ? 864  TRP A CG    1 
ATOM   6573  C  CD1   . TRP A 1 863  ? -12.650 -73.628  16.457  1.00 17.73  ? 864  TRP A CD1   1 
ATOM   6574  C  CD2   . TRP A 1 863  ? -13.317 -73.934  18.574  1.00 18.22  ? 864  TRP A CD2   1 
ATOM   6575  N  NE1   . TRP A 1 863  ? -14.022 -73.444  16.508  1.00 16.94  ? 864  TRP A NE1   1 
ATOM   6576  C  CE2   . TRP A 1 863  ? -14.449 -73.618  17.803  1.00 17.56  ? 864  TRP A CE2   1 
ATOM   6577  C  CE3   . TRP A 1 863  ? -13.476 -74.134  19.940  1.00 17.61  ? 864  TRP A CE3   1 
ATOM   6578  C  CZ2   . TRP A 1 863  ? -15.736 -73.532  18.323  1.00 15.28  ? 864  TRP A CZ2   1 
ATOM   6579  C  CZ3   . TRP A 1 863  ? -14.762 -74.045  20.455  1.00 18.05  ? 864  TRP A CZ3   1 
ATOM   6580  C  CH2   . TRP A 1 863  ? -15.876 -73.753  19.684  1.00 16.15  ? 864  TRP A CH2   1 
ATOM   6581  N  N     . GLY A 1 864  ? -11.130 -71.788  20.187  1.00 14.58  ? 865  GLY A N     1 
ATOM   6582  C  CA    . GLY A 1 864  ? -11.780 -71.476  21.480  1.00 14.39  ? 865  GLY A CA    1 
ATOM   6583  C  C     . GLY A 1 864  ? -13.110 -70.794  21.274  1.00 15.40  ? 865  GLY A C     1 
ATOM   6584  O  O     . GLY A 1 864  ? -13.305 -69.979  20.394  1.00 16.29  ? 865  GLY A O     1 
ATOM   6585  N  N     . ASN A 1 865  ? -14.044 -71.024  22.205  1.00 14.43  ? 866  ASN A N     1 
ATOM   6586  C  CA    . ASN A 1 865  ? -15.327 -70.286  22.269  1.00 15.46  ? 866  ASN A CA    1 
ATOM   6587  C  C     . ASN A 1 865  ? -15.290 -69.534  23.608  1.00 16.60  ? 866  ASN A C     1 
ATOM   6588  O  O     . ASN A 1 865  ? -15.049 -70.218  24.633  1.00 15.81  ? 866  ASN A O     1 
ATOM   6589  C  CB    . ASN A 1 865  ? -16.522 -71.264  22.240  1.00 15.77  ? 866  ASN A CB    1 
ATOM   6590  C  CG    . ASN A 1 865  ? -17.829 -70.558  22.554  1.00 18.69  ? 866  ASN A CG    1 
ATOM   6591  O  OD1   . ASN A 1 865  ? -18.213 -69.531  21.970  1.00 17.82  ? 866  ASN A OD1   1 
ATOM   6592  N  ND2   . ASN A 1 865  ? -18.497 -71.056  23.599  1.00 14.13  ? 866  ASN A ND2   1 
ATOM   6593  N  N     . SER A 1 866  ? -15.295 -68.197  23.578  1.00 16.39  ? 867  SER A N     1 
ATOM   6594  C  CA    . SER A 1 866  ? -15.322 -67.469  24.843  1.00 18.56  ? 867  SER A CA    1 
ATOM   6595  C  C     . SER A 1 866  ? -16.808 -67.312  25.167  1.00 17.90  ? 867  SER A C     1 
ATOM   6596  O  O     . SER A 1 866  ? -17.466 -68.172  25.813  1.00 20.51  ? 867  SER A O     1 
ATOM   6597  C  CB    . SER A 1 866  ? -14.600 -66.114  24.716  1.00 18.30  ? 867  SER A CB    1 
ATOM   6598  O  OG    . SER A 1 866  ? -14.650 -65.396  25.977  1.00 16.81  ? 867  SER A OG    1 
ATOM   6599  N  N     . LEU A 1 867  ? -17.395 -66.280  24.604  1.00 12.74  ? 868  LEU A N     1 
ATOM   6600  C  CA    . LEU A 1 867  ? -18.839 -66.050  24.813  1.00 16.81  ? 868  LEU A CA    1 
ATOM   6601  C  C     . LEU A 1 867  ? -19.495 -65.770  23.472  1.00 16.41  ? 868  LEU A C     1 
ATOM   6602  O  O     . LEU A 1 867  ? -18.825 -65.884  22.458  1.00 17.50  ? 868  LEU A O     1 
ATOM   6603  C  CB    . LEU A 1 867  ? -19.037 -64.891  25.775  1.00 18.45  ? 868  LEU A CB    1 
ATOM   6604  C  CG    . LEU A 1 867  ? -18.419 -64.992  27.191  1.00 19.17  ? 868  LEU A CG    1 
ATOM   6605  C  CD1   . LEU A 1 867  ? -18.402 -63.640  27.868  1.00 17.24  ? 868  LEU A CD1   1 
ATOM   6606  C  CD2   . LEU A 1 867  ? -19.250 -66.004  27.997  1.00 17.84  ? 868  LEU A CD2   1 
ATOM   6607  N  N     . PHE A 1 868  ? -20.786 -65.382  23.508  1.00 17.22  ? 869  PHE A N     1 
ATOM   6608  C  CA    . PHE A 1 868  ? -21.471 -65.036  22.262  1.00 16.61  ? 869  PHE A CA    1 
ATOM   6609  C  C     . PHE A 1 868  ? -21.102 -63.581  21.898  1.00 17.83  ? 869  PHE A C     1 
ATOM   6610  O  O     . PHE A 1 868  ? -20.829 -63.265  20.730  1.00 20.22  ? 869  PHE A O     1 
ATOM   6611  C  CB    . PHE A 1 868  ? -23.010 -65.155  22.503  1.00 14.73  ? 869  PHE A CB    1 
ATOM   6612  C  CG    . PHE A 1 868  ? -23.903 -64.843  21.334  1.00 17.93  ? 869  PHE A CG    1 
ATOM   6613  C  CD1   . PHE A 1 868  ? -23.546 -65.217  20.033  1.00 16.25  ? 869  PHE A CD1   1 
ATOM   6614  C  CD2   . PHE A 1 868  ? -25.121 -64.203  21.541  1.00 20.66  ? 869  PHE A CD2   1 
ATOM   6615  C  CE1   . PHE A 1 868  ? -24.397 -64.933  18.964  1.00 18.34  ? 869  PHE A CE1   1 
ATOM   6616  C  CE2   . PHE A 1 868  ? -25.978 -63.923  20.463  1.00 21.93  ? 869  PHE A CE2   1 
ATOM   6617  C  CZ    . PHE A 1 868  ? -25.596 -64.280  19.186  1.00 19.66  ? 869  PHE A CZ    1 
ATOM   6618  N  N     . GLU A 1 869  ? -21.086 -62.680  22.831  1.00 15.75  ? 870  GLU A N     1 
ATOM   6619  C  CA    . GLU A 1 869  ? -20.846 -61.267  22.600  1.00 17.28  ? 870  GLU A CA    1 
ATOM   6620  C  C     . GLU A 1 869  ? -19.415 -60.856  22.305  1.00 18.79  ? 870  GLU A C     1 
ATOM   6621  O  O     . GLU A 1 869  ? -19.245 -59.774  21.705  1.00 22.46  ? 870  GLU A O     1 
ATOM   6622  C  CB    . GLU A 1 869  ? -21.359 -60.439  23.786  1.00 17.18  ? 870  GLU A CB    1 
ATOM   6623  C  CG    . GLU A 1 869  ? -20.728 -60.745  25.173  1.00 15.44  ? 870  GLU A CG    1 
ATOM   6624  C  CD    . GLU A 1 869  ? -21.401 -61.838  26.001  1.00 20.10  ? 870  GLU A CD    1 
ATOM   6625  O  OE1   . GLU A 1 869  ? -21.263 -61.817  27.266  1.00 14.61  ? 870  GLU A OE1   1 
ATOM   6626  O  OE2   . GLU A 1 869  ? -22.101 -62.759  25.468  1.00 16.54  ? 870  GLU A OE2   1 
ATOM   6627  N  N     . ASP A 1 870  ? -18.391 -61.580  22.747  1.00 19.28  ? 871  ASP A N     1 
ATOM   6628  C  CA    . ASP A 1 870  ? -17.019 -61.067  22.684  1.00 17.23  ? 871  ASP A CA    1 
ATOM   6629  C  C     . ASP A 1 870  ? -16.072 -61.685  21.703  1.00 16.75  ? 871  ASP A C     1 
ATOM   6630  O  O     . ASP A 1 870  ? -14.850 -61.550  21.906  1.00 15.14  ? 871  ASP A O     1 
ATOM   6631  C  CB    . ASP A 1 870  ? -16.483 -61.390  24.101  1.00 17.18  ? 871  ASP A CB    1 
ATOM   6632  C  CG    . ASP A 1 870  ? -16.234 -62.824  24.422  1.00 15.52  ? 871  ASP A CG    1 
ATOM   6633  O  OD1   . ASP A 1 870  ? -15.421 -63.074  25.333  1.00 17.84  ? 871  ASP A OD1   1 
ATOM   6634  O  OD2   . ASP A 1 870  ? -16.684 -63.784  23.751  1.00 15.60  ? 871  ASP A OD2   1 
ATOM   6635  N  N     . ALA A 1 871  ? -16.554 -62.357  20.655  1.00 14.67  ? 872  ALA A N     1 
ATOM   6636  C  CA    . ALA A 1 871  ? -15.648 -63.156  19.837  1.00 14.41  ? 872  ALA A CA    1 
ATOM   6637  C  C     . ALA A 1 871  ? -14.558 -62.337  19.178  1.00 14.04  ? 872  ALA A C     1 
ATOM   6638  O  O     . ALA A 1 871  ? -13.369 -62.760  19.066  1.00 12.82  ? 872  ALA A O     1 
ATOM   6639  C  CB    . ALA A 1 871  ? -16.391 -63.978  18.747  1.00 14.04  ? 872  ALA A CB    1 
ATOM   6640  N  N     . ALA A 1 872  ? -14.917 -61.113  18.757  1.00 11.66  ? 873  ALA A N     1 
ATOM   6641  C  CA    . ALA A 1 872  ? -13.916 -60.309  18.068  1.00 12.42  ? 873  ALA A CA    1 
ATOM   6642  C  C     . ALA A 1 872  ? -12.868 -59.873  19.065  1.00 12.59  ? 873  ALA A C     1 
ATOM   6643  O  O     . ALA A 1 872  ? -11.673 -59.892  18.807  1.00 11.71  ? 873  ALA A O     1 
ATOM   6644  C  CB    . ALA A 1 872  ? -14.519 -59.096  17.349  1.00 12.51  ? 873  ALA A CB    1 
ATOM   6645  N  N     . GLU A 1 873  ? -13.320 -59.556  20.274  1.00 13.07  ? 874  GLU A N     1 
ATOM   6646  C  CA    . GLU A 1 873  ? -12.391 -59.089  21.317  1.00 13.37  ? 874  GLU A CA    1 
ATOM   6647  C  C     . GLU A 1 873  ? -11.497 -60.223  21.818  1.00 13.30  ? 874  GLU A C     1 
ATOM   6648  O  O     . GLU A 1 873  ? -10.294 -59.992  22.024  1.00 12.37  ? 874  GLU A O     1 
ATOM   6649  C  CB    . GLU A 1 873  ? -13.109 -58.431  22.514  1.00 14.66  ? 874  GLU A CB    1 
ATOM   6650  C  CG    . GLU A 1 873  ? -13.970 -57.235  22.004  1.00 15.93  ? 874  GLU A CG    1 
ATOM   6651  C  CD    . GLU A 1 873  ? -15.448 -57.636  21.883  1.00 20.50  ? 874  GLU A CD    1 
ATOM   6652  O  OE1   . GLU A 1 873  ? -16.242 -56.958  22.589  1.00 19.98  ? 874  GLU A OE1   1 
ATOM   6653  O  OE2   . GLU A 1 873  ? -15.829 -58.531  21.101  1.00 16.70  ? 874  GLU A OE2   1 
ATOM   6654  N  N     . TYR A 1 874  ? -12.037 -61.449  21.875  1.00 11.07  ? 875  TYR A N     1 
ATOM   6655  C  CA    . TYR A 1 874  ? -11.266 -62.628  22.291  1.00 12.15  ? 875  TYR A CA    1 
ATOM   6656  C  C     . TYR A 1 874  ? -10.183 -62.869  21.237  1.00 11.15  ? 875  TYR A C     1 
ATOM   6657  O  O     . TYR A 1 874  ? -9.002  -62.987  21.593  1.00 12.39  ? 875  TYR A O     1 
ATOM   6658  C  CB    . TYR A 1 874  ? -12.275 -63.796  22.375  1.00 11.36  ? 875  TYR A CB    1 
ATOM   6659  C  CG    . TYR A 1 874  ? -11.805 -65.151  22.859  1.00 14.17  ? 875  TYR A CG    1 
ATOM   6660  C  CD1   . TYR A 1 874  ? -11.029 -65.282  23.992  1.00 14.62  ? 875  TYR A CD1   1 
ATOM   6661  C  CD2   . TYR A 1 874  ? -12.249 -66.314  22.226  1.00 15.63  ? 875  TYR A CD2   1 
ATOM   6662  C  CE1   . TYR A 1 874  ? -10.604 -66.529  24.458  1.00 16.12  ? 875  TYR A CE1   1 
ATOM   6663  C  CE2   . TYR A 1 874  ? -11.807 -67.545  22.650  1.00 15.68  ? 875  TYR A CE2   1 
ATOM   6664  C  CZ    . TYR A 1 874  ? -11.014 -67.642  23.768  1.00 15.19  ? 875  TYR A CZ    1 
ATOM   6665  O  OH    . TYR A 1 874  ? -10.593 -68.881  24.178  1.00 16.67  ? 875  TYR A OH    1 
ATOM   6666  N  N     . GLY A 1 875  ? -10.589 -62.791  19.996  1.00 11.29  ? 876  GLY A N     1 
ATOM   6667  C  CA    . GLY A 1 875  ? -9.618  -62.916  18.862  1.00 12.44  ? 876  GLY A CA    1 
ATOM   6668  C  C     . GLY A 1 875  ? -8.561  -61.828  18.873  1.00 12.20  ? 876  GLY A C     1 
ATOM   6669  O  O     . GLY A 1 875  ? -7.330  -62.043  18.745  1.00 14.18  ? 876  GLY A O     1 
ATOM   6670  N  N     . PHE A 1 876  ? -8.944  -60.591  19.127  1.00 13.74  ? 877  PHE A N     1 
ATOM   6671  C  CA    . PHE A 1 876  ? -8.061  -59.446  19.219  1.00 14.57  ? 877  PHE A CA    1 
ATOM   6672  C  C     . PHE A 1 876  ? -6.993  -59.683  20.296  1.00 14.30  ? 877  PHE A C     1 
ATOM   6673  O  O     . PHE A 1 876  ? -5.788  -59.388  20.249  1.00 12.13  ? 877  PHE A O     1 
ATOM   6674  C  CB    . PHE A 1 876  ? -8.876  -58.182  19.515  1.00 14.50  ? 877  PHE A CB    1 
ATOM   6675  C  CG    . PHE A 1 876  ? -8.042  -56.918  19.422  1.00 15.88  ? 877  PHE A CG    1 
ATOM   6676  C  CD1   . PHE A 1 876  ? -7.614  -56.467  18.184  1.00 15.98  ? 877  PHE A CD1   1 
ATOM   6677  C  CD2   . PHE A 1 876  ? -7.721  -56.197  20.539  1.00 15.75  ? 877  PHE A CD2   1 
ATOM   6678  C  CE1   . PHE A 1 876  ? -6.862  -55.323  18.087  1.00 16.23  ? 877  PHE A CE1   1 
ATOM   6679  C  CE2   . PHE A 1 876  ? -6.936  -55.067  20.451  1.00 18.02  ? 877  PHE A CE2   1 
ATOM   6680  C  CZ    . PHE A 1 876  ? -6.500  -54.618  19.221  1.00 15.65  ? 877  PHE A CZ    1 
ATOM   6681  N  N     . GLY A 1 877  ? -7.465  -60.316  21.378  1.00 14.59  ? 878  GLY A N     1 
ATOM   6682  C  CA    . GLY A 1 877  ? -6.649  -60.607  22.520  1.00 12.57  ? 878  GLY A CA    1 
ATOM   6683  C  C     . GLY A 1 877  ? -5.559  -61.629  22.175  1.00 10.59  ? 878  GLY A C     1 
ATOM   6684  O  O     . GLY A 1 877  ? -4.400  -61.593  22.622  1.00 11.79  ? 878  GLY A O     1 
ATOM   6685  N  N     . MET A 1 878  ? -5.944  -62.655  21.406  1.00 13.79  ? 879  MET A N     1 
ATOM   6686  C  CA    . MET A 1 878  ? -4.985  -63.641  20.915  1.00 13.83  ? 879  MET A CA    1 
ATOM   6687  C  C     . MET A 1 878  ? -3.927  -62.955  20.037  1.00 16.37  ? 879  MET A C     1 
ATOM   6688  O  O     . MET A 1 878  ? -2.749  -63.296  20.213  1.00 14.50  ? 879  MET A O     1 
ATOM   6689  C  CB    . MET A 1 878  ? -5.732  -64.714  20.125  1.00 13.22  ? 879  MET A CB    1 
ATOM   6690  C  CG    . MET A 1 878  ? -6.742  -65.557  20.913  1.00 12.97  ? 879  MET A CG    1 
ATOM   6691  S  SD    . MET A 1 878  ? -7.628  -66.681  19.821  1.00 17.36  ? 879  MET A SD    1 
ATOM   6692  C  CE    . MET A 1 878  ? -8.991  -67.092  20.898  1.00 15.25  ? 879  MET A CE    1 
ATOM   6693  N  N     . ASN A 1 879  ? -4.378  -61.974  19.256  1.00 15.99  ? 880  ASN A N     1 
ATOM   6694  C  CA    . ASN A 1 879  ? -3.477  -61.174  18.425  1.00 18.91  ? 880  ASN A CA    1 
ATOM   6695  C  C     . ASN A 1 879  ? -2.512  -60.347  19.271  1.00 16.11  ? 880  ASN A C     1 
ATOM   6696  O  O     . ASN A 1 879  ? -1.307  -60.233  18.966  1.00 15.35  ? 880  ASN A O     1 
ATOM   6697  C  CB    . ASN A 1 879  ? -4.257  -60.238  17.524  1.00 20.34  ? 880  ASN A CB    1 
ATOM   6698  C  CG    . ASN A 1 879  ? -3.728  -58.852  17.187  1.00 25.89  ? 880  ASN A CG    1 
ATOM   6699  O  OD1   . ASN A 1 879  ? -4.096  -57.842  17.862  1.00 30.48  ? 880  ASN A OD1   1 
ATOM   6700  N  ND2   . ASN A 1 879  ? -2.899  -58.794  16.187  1.00 19.26  ? 880  ASN A ND2   1 
ATOM   6701  N  N     . MET A 1 880  ? -3.055  -59.722  20.325  1.00 16.09  ? 881  MET A N     1 
ATOM   6702  C  CA    . MET A 1 880  ? -2.222  -58.934  21.249  1.00 15.99  ? 881  MET A CA    1 
ATOM   6703  C  C     . MET A 1 880  ? -1.150  -59.818  21.894  1.00 15.48  ? 881  MET A C     1 
ATOM   6704  O  O     . MET A 1 880  ? 0.041   -59.411  21.948  1.00 14.79  ? 881  MET A O     1 
ATOM   6705  C  CB    . MET A 1 880  ? -2.996  -58.228  22.388  1.00 16.20  ? 881  MET A CB    1 
ATOM   6706  C  CG    . MET A 1 880  ? -3.889  -57.079  21.943  1.00 22.46  ? 881  MET A CG    1 
ATOM   6707  S  SD    . MET A 1 880  ? -5.080  -56.580  23.278  1.00 28.02  ? 881  MET A SD    1 
ATOM   6708  C  CE    . MET A 1 880  ? -3.882  -55.661  24.248  1.00 27.23  ? 881  MET A CE    1 
ATOM   6709  N  N     . SER A 1 881  ? -1.480  -61.046  22.325  1.00 14.75  ? 882  SER A N     1 
ATOM   6710  C  CA    . SER A 1 881  ? -0.453  -61.958  22.858  1.00 15.63  ? 882  SER A CA    1 
ATOM   6711  C  C     . SER A 1 881  ? 0.617   -62.239  21.803  1.00 15.86  ? 882  SER A C     1 
ATOM   6712  O  O     . SER A 1 881  ? 1.826   -62.159  22.039  1.00 14.62  ? 882  SER A O     1 
ATOM   6713  C  CB    . SER A 1 881  ? -1.029  -63.325  23.254  1.00 15.59  ? 882  SER A CB    1 
ATOM   6714  O  OG    . SER A 1 881  ? -0.019  -64.275  23.598  1.00 14.54  ? 882  SER A OG    1 
ATOM   6715  N  N     . MET A 1 882  ? 0.183   -62.619  20.610  1.00 15.48  ? 883  MET A N     1 
ATOM   6716  C  CA    . MET A 1 882  ? 1.136   -62.885  19.520  1.00 17.43  ? 883  MET A CA    1 
ATOM   6717  C  C     . MET A 1 882  ? 1.967   -61.627  19.261  1.00 16.92  ? 883  MET A C     1 
ATOM   6718  O  O     . MET A 1 882  ? 3.197   -61.676  19.095  1.00 17.86  ? 883  MET A O     1 
ATOM   6719  C  CB    . MET A 1 882  ? 0.420   -63.297  18.210  1.00 17.93  ? 883  MET A CB    1 
ATOM   6720  C  CG    . MET A 1 882  ? -0.144  -64.712  18.300  1.00 21.44  ? 883  MET A CG    1 
ATOM   6721  S  SD    . MET A 1 882  ? 1.071   -66.017  18.731  1.00 20.95  ? 883  MET A SD    1 
ATOM   6722  C  CE    . MET A 1 882  ? 2.114   -65.817  17.300  1.00 30.12  ? 883  MET A CE    1 
ATOM   6723  N  N     . PHE A 1 883  ? 1.395   -60.445  19.349  1.00 16.80  ? 884  PHE A N     1 
ATOM   6724  C  CA    . PHE A 1 883  ? 2.180   -59.232  19.146  1.00 16.88  ? 884  PHE A CA    1 
ATOM   6725  C  C     . PHE A 1 883  ? 3.271   -59.154  20.218  1.00 18.52  ? 884  PHE A C     1 
ATOM   6726  O  O     . PHE A 1 883  ? 4.468   -58.933  19.952  1.00 16.43  ? 884  PHE A O     1 
ATOM   6727  C  CB    . PHE A 1 883  ? 1.367   -57.926  19.049  1.00 18.88  ? 884  PHE A CB    1 
ATOM   6728  C  CG    . PHE A 1 883  ? 2.244   -56.719  18.769  1.00 20.47  ? 884  PHE A CG    1 
ATOM   6729  C  CD1   . PHE A 1 883  ? 2.560   -56.385  17.462  1.00 22.72  ? 884  PHE A CD1   1 
ATOM   6730  C  CD2   . PHE A 1 883  ? 2.754   -55.933  19.785  1.00 21.90  ? 884  PHE A CD2   1 
ATOM   6731  C  CE1   . PHE A 1 883  ? 3.392   -55.314  17.179  1.00 25.12  ? 884  PHE A CE1   1 
ATOM   6732  C  CE2   . PHE A 1 883  ? 3.565   -54.844  19.522  1.00 25.34  ? 884  PHE A CE2   1 
ATOM   6733  C  CZ    . PHE A 1 883  ? 3.900   -54.531  18.211  1.00 24.00  ? 884  PHE A CZ    1 
ATOM   6734  N  N     . ALA A 1 884  ? 2.859   -59.288  21.476  1.00 15.42  ? 885  ALA A N     1 
ATOM   6735  C  CA    . ALA A 1 884  ? 3.836   -59.101  22.553  1.00 16.20  ? 885  ALA A CA    1 
ATOM   6736  C  C     . ALA A 1 884  ? 4.901   -60.197  22.560  1.00 14.77  ? 885  ALA A C     1 
ATOM   6737  O  O     . ALA A 1 884  ? 6.085   -59.905  22.787  1.00 13.14  ? 885  ALA A O     1 
ATOM   6738  C  CB    . ALA A 1 884  ? 3.040   -59.095  23.876  1.00 17.34  ? 885  ALA A CB    1 
ATOM   6739  N  N     . ARG A 1 885  ? 4.468   -61.450  22.366  1.00 13.20  ? 886  ARG A N     1 
ATOM   6740  C  CA    . ARG A 1 885  ? 5.433   -62.564  22.500  1.00 14.73  ? 886  ARG A CA    1 
ATOM   6741  C  C     . ARG A 1 885  ? 6.367   -62.628  21.301  1.00 15.74  ? 886  ARG A C     1 
ATOM   6742  O  O     . ARG A 1 885  ? 7.581   -62.940  21.511  1.00 18.62  ? 886  ARG A O     1 
ATOM   6743  C  CB    . ARG A 1 885  ? 4.630   -63.889  22.690  1.00 15.54  ? 886  ARG A CB    1 
ATOM   6744  C  CG    . ARG A 1 885  ? 3.943   -63.888  24.108  1.00 15.60  ? 886  ARG A CG    1 
ATOM   6745  C  CD    . ARG A 1 885  ? 3.052   -65.114  24.250  1.00 17.51  ? 886  ARG A CD    1 
ATOM   6746  N  NE    . ARG A 1 885  ? 3.905   -66.321  24.373  1.00 17.57  ? 886  ARG A NE    1 
ATOM   6747  C  CZ    . ARG A 1 885  ? 3.504   -67.544  24.030  1.00 19.76  ? 886  ARG A CZ    1 
ATOM   6748  N  NH1   . ARG A 1 885  ? 2.267   -67.768  23.608  1.00 18.72  ? 886  ARG A NH1   1 
ATOM   6749  N  NH2   . ARG A 1 885  ? 4.385   -68.558  24.150  1.00 19.33  ? 886  ARG A NH2   1 
ATOM   6750  N  N     . ARG A 1 886  ? 5.831   -62.287  20.140  1.00 17.31  ? 887  ARG A N     1 
ATOM   6751  C  CA    . ARG A 1 886  ? 6.712   -62.361  18.923  1.00 17.28  ? 887  ARG A CA    1 
ATOM   6752  C  C     . ARG A 1 886  ? 7.634   -61.175  18.825  1.00 16.68  ? 887  ARG A C     1 
ATOM   6753  O  O     . ARG A 1 886  ? 8.733   -61.190  18.230  1.00 15.84  ? 887  ARG A O     1 
ATOM   6754  C  CB    . ARG A 1 886  ? 5.844   -62.551  17.698  1.00 15.97  ? 887  ARG A CB    1 
ATOM   6755  C  CG    . ARG A 1 886  ? 5.199   -63.932  17.602  1.00 18.64  ? 887  ARG A CG    1 
ATOM   6756  C  CD    . ARG A 1 886  ? 4.546   -64.098  16.210  1.00 18.77  ? 887  ARG A CD    1 
ATOM   6757  N  NE    . ARG A 1 886  ? 5.391   -64.801  15.245  1.00 19.99  ? 887  ARG A NE    1 
ATOM   6758  C  CZ    . ARG A 1 886  ? 5.736   -64.299  14.066  1.00 20.00  ? 887  ARG A CZ    1 
ATOM   6759  N  NH1   . ARG A 1 886  ? 5.339   -63.060  13.809  1.00 18.13  ? 887  ARG A NH1   1 
ATOM   6760  N  NH2   . ARG A 1 886  ? 6.444   -64.932  13.131  1.00 17.27  ? 887  ARG A NH2   1 
ATOM   6761  N  N     . THR A 1 887  ? 7.239   -60.085  19.504  1.00 14.68  ? 888  THR A N     1 
ATOM   6762  C  CA    . THR A 1 887  ? 8.087   -58.909  19.629  1.00 17.74  ? 888  THR A CA    1 
ATOM   6763  C  C     . THR A 1 887  ? 9.225   -59.214  20.592  1.00 19.66  ? 888  THR A C     1 
ATOM   6764  O  O     . THR A 1 887  ? 10.386  -58.839  20.285  1.00 19.77  ? 888  THR A O     1 
ATOM   6765  C  CB    . THR A 1 887  ? 7.270   -57.702  20.101  1.00 16.86  ? 888  THR A CB    1 
ATOM   6766  O  OG1   . THR A 1 887  ? 6.434   -57.340  19.002  1.00 17.48  ? 888  THR A OG1   1 
ATOM   6767  C  CG2   . THR A 1 887  ? 8.182   -56.541  20.495  1.00 22.91  ? 888  THR A CG2   1 
ATOM   6768  N  N     . HIS A 1 888  ? 8.871   -59.940  21.650  1.00 16.73  ? 889  HIS A N     1 
ATOM   6769  C  CA    . HIS A 1 888  ? 9.888   -60.377  22.622  1.00 18.51  ? 889  HIS A CA    1 
ATOM   6770  C  C     . HIS A 1 888  ? 10.859  -61.316  21.879  1.00 19.17  ? 889  HIS A C     1 
ATOM   6771  O  O     . HIS A 1 888  ? 12.057  -61.033  21.953  1.00 19.49  ? 889  HIS A O     1 
ATOM   6772  C  CB    . HIS A 1 888  ? 9.282   -61.046  23.832  1.00 18.96  ? 889  HIS A CB    1 
ATOM   6773  C  CG    . HIS A 1 888  ? 10.150  -61.583  24.948  1.00 19.07  ? 889  HIS A CG    1 
ATOM   6774  N  ND1   . HIS A 1 888  ? 9.615   -62.384  25.913  1.00 20.64  ? 889  HIS A ND1   1 
ATOM   6775  C  CD2   . HIS A 1 888  ? 11.438  -61.401  25.334  1.00 21.79  ? 889  HIS A CD2   1 
ATOM   6776  C  CE1   . HIS A 1 888  ? 10.523  -62.715  26.838  1.00 22.40  ? 889  HIS A CE1   1 
ATOM   6777  N  NE2   . HIS A 1 888  ? 11.637  -62.104  26.489  1.00 20.15  ? 889  HIS A NE2   1 
ATOM   6778  N  N     . LEU A 1 889  ? 10.401  -62.283  21.116  1.00 18.55  ? 890  LEU A N     1 
ATOM   6779  C  CA    . LEU A 1 889  ? 11.297  -63.110  20.325  1.00 20.27  ? 890  LEU A CA    1 
ATOM   6780  C  C     . LEU A 1 889  ? 12.165  -62.289  19.359  1.00 19.98  ? 890  LEU A C     1 
ATOM   6781  O  O     . LEU A 1 889  ? 13.380  -62.524  19.301  1.00 19.16  ? 890  LEU A O     1 
ATOM   6782  C  CB    . LEU A 1 889  ? 10.453  -64.155  19.570  1.00 19.58  ? 890  LEU A CB    1 
ATOM   6783  C  CG    . LEU A 1 889  ? 11.183  -65.017  18.547  1.00 21.64  ? 890  LEU A CG    1 
ATOM   6784  C  CD1   . LEU A 1 889  ? 12.241  -65.879  19.257  1.00 21.55  ? 890  LEU A CD1   1 
ATOM   6785  C  CD2   . LEU A 1 889  ? 10.231  -65.855  17.738  1.00 22.47  ? 890  LEU A CD2   1 
ATOM   6786  N  N     . ALA A 1 890  ? 11.615  -61.278  18.657  1.00 20.07  ? 891  ALA A N     1 
ATOM   6787  C  CA    . ALA A 1 890  ? 12.382  -60.438  17.772  1.00 21.07  ? 891  ALA A CA    1 
ATOM   6788  C  C     . ALA A 1 890  ? 13.501  -59.701  18.505  1.00 24.70  ? 891  ALA A C     1 
ATOM   6789  O  O     . ALA A 1 890  ? 14.634  -59.534  18.045  1.00 22.47  ? 891  ALA A O     1 
ATOM   6790  C  CB    . ALA A 1 890  ? 11.471  -59.457  17.055  1.00 23.05  ? 891  ALA A CB    1 
ATOM   6791  N  N     . ASP A 1 891  ? 13.233  -59.299  19.738  1.00 24.48  ? 892  ASP A N     1 
ATOM   6792  C  CA    . ASP A 1 891  ? 14.161  -58.541  20.572  1.00 26.98  ? 892  ASP A CA    1 
ATOM   6793  C  C     . ASP A 1 891  ? 15.332  -59.419  21.002  1.00 24.83  ? 892  ASP A C     1 
ATOM   6794  O  O     . ASP A 1 891  ? 16.509  -59.017  20.893  1.00 19.86  ? 892  ASP A O     1 
ATOM   6795  C  CB    . ASP A 1 891  ? 13.424  -57.912  21.752  1.00 32.24  ? 892  ASP A CB    1 
ATOM   6796  C  CG    . ASP A 1 891  ? 13.025  -56.456  21.594  1.00 39.30  ? 892  ASP A CG    1 
ATOM   6797  O  OD1   . ASP A 1 891  ? 13.477  -55.777  20.616  1.00 41.62  ? 892  ASP A OD1   1 
ATOM   6798  O  OD2   . ASP A 1 891  ? 12.221  -55.909  22.442  1.00 41.48  ? 892  ASP A OD2   1 
ATOM   6799  N  N     . LEU A 1 892  ? 15.022  -60.681  21.318  1.00 22.24  ? 893  LEU A N     1 
ATOM   6800  C  CA    . LEU A 1 892  ? 16.050  -61.649  21.652  1.00 23.94  ? 893  LEU A CA    1 
ATOM   6801  C  C     . LEU A 1 892  ? 16.897  -61.991  20.408  1.00 22.13  ? 893  LEU A C     1 
ATOM   6802  O  O     . LEU A 1 892  ? 18.119  -62.196  20.496  1.00 22.40  ? 893  LEU A O     1 
ATOM   6803  C  CB    . LEU A 1 892  ? 15.426  -62.934  22.153  1.00 23.88  ? 893  LEU A CB    1 
ATOM   6804  C  CG    . LEU A 1 892  ? 15.138  -63.156  23.627  1.00 25.29  ? 893  LEU A CG    1 
ATOM   6805  C  CD1   . LEU A 1 892  ? 15.185  -61.948  24.530  1.00 25.65  ? 893  LEU A CD1   1 
ATOM   6806  C  CD2   . LEU A 1 892  ? 13.861  -63.934  23.863  1.00 22.18  ? 893  LEU A CD2   1 
ATOM   6807  N  N     . ALA A 1 893  ? 16.273  -62.060  19.260  1.00 19.94  ? 894  ALA A N     1 
ATOM   6808  C  CA    . ALA A 1 893  ? 16.949  -62.381  18.011  1.00 22.55  ? 894  ALA A CA    1 
ATOM   6809  C  C     . ALA A 1 893  ? 17.925  -61.267  17.668  1.00 25.86  ? 894  ALA A C     1 
ATOM   6810  O  O     . ALA A 1 893  ? 19.068  -61.510  17.296  1.00 28.44  ? 894  ALA A O     1 
ATOM   6811  C  CB    . ALA A 1 893  ? 15.899  -62.520  16.900  1.00 22.52  ? 894  ALA A CB    1 
ATOM   6812  N  N     . ALA A 1 894  ? 17.519  -60.012  17.896  1.00 26.06  ? 895  ALA A N     1 
ATOM   6813  C  CA    . ALA A 1 894  ? 18.380  -58.856  17.653  1.00 26.88  ? 895  ALA A CA    1 
ATOM   6814  C  C     . ALA A 1 894  ? 19.573  -58.854  18.611  1.00 27.57  ? 895  ALA A C     1 
ATOM   6815  O  O     . ALA A 1 894  ? 20.710  -58.569  18.233  1.00 26.11  ? 895  ALA A O     1 
ATOM   6816  C  CB    . ALA A 1 894  ? 17.593  -57.559  17.884  1.00 25.64  ? 895  ALA A CB    1 
ATOM   6817  N  N     . LYS A 1 895  ? 19.320  -59.244  19.865  1.00 26.70  ? 896  LYS A N     1 
ATOM   6818  C  CA    . LYS A 1 895  ? 20.396  -59.366  20.828  1.00 28.97  ? 896  LYS A CA    1 
ATOM   6819  C  C     . LYS A 1 895  ? 21.401  -60.459  20.420  1.00 28.32  ? 896  LYS A C     1 
ATOM   6820  O  O     . LYS A 1 895  ? 22.604  -60.252  20.591  1.00 27.31  ? 896  LYS A O     1 
ATOM   6821  C  CB    . LYS A 1 895  ? 19.937  -59.701  22.259  1.00 30.53  ? 896  LYS A CB    1 
ATOM   6822  C  CG    . LYS A 1 895  ? 19.347  -58.509  22.982  1.00 33.90  ? 896  LYS A CG    1 
ATOM   6823  C  CD    . LYS A 1 895  ? 18.671  -58.888  24.287  1.00 37.05  ? 896  LYS A CD    1 
ATOM   6824  C  CE    . LYS A 1 895  ? 18.465  -57.640  25.134  1.00 38.29  ? 896  LYS A CE    1 
ATOM   6825  N  NZ    . LYS A 1 895  ? 17.181  -56.964  24.806  1.00 39.89  ? 896  LYS A NZ    1 
ATOM   6826  N  N     . ALA A 1 896  ? 20.903  -61.584  19.947  1.00 27.72  ? 897  ALA A N     1 
ATOM   6827  C  CA    . ALA A 1 896  ? 21.746  -62.718  19.590  1.00 28.59  ? 897  ALA A CA    1 
ATOM   6828  C  C     . ALA A 1 896  ? 22.655  -62.394  18.400  1.00 30.39  ? 897  ALA A C     1 
ATOM   6829  O  O     . ALA A 1 896  ? 23.733  -62.971  18.257  1.00 29.72  ? 897  ALA A O     1 
ATOM   6830  C  CB    . ALA A 1 896  ? 20.883  -63.936  19.292  1.00 28.22  ? 897  ALA A CB    1 
ATOM   6831  N  N     . LEU A 1 897  ? 22.186  -61.453  17.562  1.00 30.51  ? 898  LEU A N     1 
ATOM   6832  C  CA    . LEU A 1 897  ? 22.964  -60.993  16.425  1.00 32.44  ? 898  LEU A CA    1 
ATOM   6833  C  C     . LEU A 1 897  ? 24.155  -60.168  16.915  1.00 33.97  ? 898  LEU A C     1 
ATOM   6834  O  O     . LEU A 1 897  ? 25.155  -60.053  16.175  1.00 33.47  ? 898  LEU A O     1 
ATOM   6835  C  CB    . LEU A 1 897  ? 22.157  -60.195  15.406  1.00 32.49  ? 898  LEU A CB    1 
ATOM   6836  C  CG    . LEU A 1 897  ? 21.165  -60.992  14.542  1.00 32.72  ? 898  LEU A CG    1 
ATOM   6837  C  CD1   . LEU A 1 897  ? 20.394  -60.008  13.651  1.00 33.33  ? 898  LEU A CD1   1 
ATOM   6838  C  CD2   . LEU A 1 897  ? 21.846  -61.995  13.640  1.00 32.60  ? 898  LEU A CD2   1 
ATOM   6839  N  N     . GLU A 1 898  ? 24.052  -59.667  18.150  1.00 32.47  ? 899  GLU A N     1 
ATOM   6840  C  CA    . GLU A 1 898  ? 25.218  -58.957  18.694  1.00 35.43  ? 899  GLU A CA    1 
ATOM   6841  C  C     . GLU A 1 898  ? 25.842  -59.822  19.807  1.00 33.52  ? 899  GLU A C     1 
ATOM   6842  O  O     . GLU A 1 898  ? 26.042  -59.411  20.942  1.00 33.08  ? 899  GLU A O     1 
ATOM   6843  C  CB    . GLU A 1 898  ? 24.928  -57.600  19.258  1.00 40.31  ? 899  GLU A CB    1 
ATOM   6844  C  CG    . GLU A 1 898  ? 24.125  -56.532  18.569  1.00 46.09  ? 899  GLU A CG    1 
ATOM   6845  C  CD    . GLU A 1 898  ? 23.812  -55.491  19.656  1.00 50.14  ? 899  GLU A CD    1 
ATOM   6846  O  OE1   . GLU A 1 898  ? 22.785  -55.633  20.375  1.00 51.69  ? 899  GLU A OE1   1 
ATOM   6847  O  OE2   . GLU A 1 898  ? 24.627  -54.555  19.831  1.00 52.59  ? 899  GLU A OE2   1 
ATOM   6848  N  N     . SER A 1 899  ? 26.076  -61.084  19.491  1.00 32.06  ? 900  SER A N     1 
ATOM   6849  C  CA    . SER A 1 899  ? 26.672  -62.027  20.424  1.00 30.31  ? 900  SER A CA    1 
ATOM   6850  C  C     . SER A 1 899  ? 27.605  -62.926  19.617  1.00 28.85  ? 900  SER A C     1 
ATOM   6851  O  O     . SER A 1 899  ? 27.766  -62.635  18.441  1.00 27.52  ? 900  SER A O     1 
ATOM   6852  C  CB    . SER A 1 899  ? 25.652  -62.916  21.115  1.00 28.05  ? 900  SER A CB    1 
ATOM   6853  O  OG    . SER A 1 899  ? 25.043  -63.722  20.103  1.00 27.49  ? 900  SER A OG    1 
ATOM   6854  N  N     . ASP A 1 900  ? 28.152  -63.939  20.268  1.00 29.96  ? 901  ASP A N     1 
ATOM   6855  C  CA    . ASP A 1 900  ? 29.113  -64.814  19.591  1.00 31.40  ? 901  ASP A CA    1 
ATOM   6856  C  C     . ASP A 1 900  ? 28.416  -66.025  18.990  1.00 32.14  ? 901  ASP A C     1 
ATOM   6857  O  O     . ASP A 1 900  ? 29.040  -67.049  18.701  1.00 32.87  ? 901  ASP A O     1 
ATOM   6858  C  CB    . ASP A 1 900  ? 30.220  -65.244  20.563  1.00 31.83  ? 901  ASP A CB    1 
ATOM   6859  C  CG    . ASP A 1 900  ? 29.640  -65.904  21.799  1.00 33.70  ? 901  ASP A CG    1 
ATOM   6860  O  OD1   . ASP A 1 900  ? 30.405  -66.476  22.604  1.00 33.07  ? 901  ASP A OD1   1 
ATOM   6861  O  OD2   . ASP A 1 900  ? 28.399  -65.864  22.013  1.00 31.94  ? 901  ASP A OD2   1 
ATOM   6862  N  N     . ALA A 1 901  ? 27.098  -65.920  18.733  1.00 31.19  ? 902  ALA A N     1 
ATOM   6863  C  CA    . ALA A 1 901  ? 26.356  -66.961  18.066  1.00 30.13  ? 902  ALA A CA    1 
ATOM   6864  C  C     . ALA A 1 901  ? 27.014  -67.298  16.717  1.00 28.18  ? 902  ALA A C     1 
ATOM   6865  O  O     . ALA A 1 901  ? 27.518  -66.388  16.056  1.00 28.46  ? 902  ALA A O     1 
ATOM   6866  C  CB    . ALA A 1 901  ? 24.898  -66.569  17.823  1.00 29.17  ? 902  ALA A CB    1 
ATOM   6867  N  N     . SER A 1 902  ? 26.980  -68.556  16.316  1.00 28.24  ? 903  SER A N     1 
ATOM   6868  C  CA    . SER A 1 902  ? 27.559  -68.943  15.040  1.00 27.86  ? 903  SER A CA    1 
ATOM   6869  C  C     . SER A 1 902  ? 26.957  -68.245  13.839  1.00 28.04  ? 903  SER A C     1 
ATOM   6870  O  O     . SER A 1 902  ? 25.841  -67.725  13.849  1.00 27.27  ? 903  SER A O     1 
ATOM   6871  C  CB    . SER A 1 902  ? 27.366  -70.477  14.858  1.00 29.27  ? 903  SER A CB    1 
ATOM   6872  O  OG    . SER A 1 902  ? 26.004  -70.650  14.450  1.00 30.82  ? 903  SER A OG    1 
ATOM   6873  N  N     . GLY A 1 903  ? 27.728  -68.208  12.741  1.00 27.57  ? 904  GLY A N     1 
ATOM   6874  C  CA    . GLY A 1 903  ? 27.273  -67.605  11.495  1.00 28.46  ? 904  GLY A CA    1 
ATOM   6875  C  C     . GLY A 1 903  ? 25.976  -68.198  10.944  1.00 27.66  ? 904  GLY A C     1 
ATOM   6876  O  O     . GLY A 1 903  ? 25.078  -67.500  10.419  1.00 28.59  ? 904  GLY A O     1 
ATOM   6877  N  N     . ASP A 1 904  ? 25.811  -69.513  11.097  1.00 28.22  ? 905  ASP A N     1 
ATOM   6878  C  CA    . ASP A 1 904  ? 24.635  -70.187  10.565  1.00 28.83  ? 905  ASP A CA    1 
ATOM   6879  C  C     . ASP A 1 904  ? 23.417  -69.690  11.388  1.00 28.40  ? 905  ASP A C     1 
ATOM   6880  O  O     . ASP A 1 904  ? 22.411  -69.247  10.838  1.00 26.78  ? 905  ASP A O     1 
ATOM   6881  C  CB    . ASP A 1 904  ? 24.727  -71.708  10.638  1.00 30.22  ? 905  ASP A CB    1 
ATOM   6882  C  CG    . ASP A 1 904  ? 25.601  -72.375  9.580   1.00 32.07  ? 905  ASP A CG    1 
ATOM   6883  O  OD1   . ASP A 1 904  ? 25.966  -73.550  9.792   1.00 33.42  ? 905  ASP A OD1   1 
ATOM   6884  O  OD2   . ASP A 1 904  ? 25.904  -71.800  8.523   1.00 32.48  ? 905  ASP A OD2   1 
ATOM   6885  N  N     . VAL A 1 905  ? 23.670  -69.598  12.688  1.00 27.64  ? 906  VAL A N     1 
ATOM   6886  C  CA    . VAL A 1 905  ? 22.578  -69.179  13.580  1.00 28.47  ? 906  VAL A CA    1 
ATOM   6887  C  C     . VAL A 1 905  ? 22.245  -67.732  13.295  1.00 28.57  ? 906  VAL A C     1 
ATOM   6888  O  O     . VAL A 1 905  ? 21.070  -67.418  13.103  1.00 27.04  ? 906  VAL A O     1 
ATOM   6889  C  CB    . VAL A 1 905  ? 22.859  -69.432  15.065  1.00 27.88  ? 906  VAL A CB    1 
ATOM   6890  C  CG1   . VAL A 1 905  ? 21.880  -68.765  16.033  1.00 25.70  ? 906  VAL A CG1   1 
ATOM   6891  C  CG2   . VAL A 1 905  ? 22.783  -70.945  15.322  1.00 25.48  ? 906  VAL A CG2   1 
ATOM   6892  N  N     . LYS A 1 906  ? 23.268  -66.881  13.138  1.00 27.22  ? 907  LYS A N     1 
ATOM   6893  C  CA    . LYS A 1 906  ? 22.970  -65.481  12.856  1.00 25.32  ? 907  LYS A CA    1 
ATOM   6894  C  C     . LYS A 1 906  ? 22.337  -65.328  11.494  1.00 24.57  ? 907  LYS A C     1 
ATOM   6895  O  O     . LYS A 1 906  ? 21.500  -64.438  11.368  1.00 23.57  ? 907  LYS A O     1 
ATOM   6896  C  CB    . LYS A 1 906  ? 24.162  -64.504  12.946  1.00 25.56  ? 907  LYS A CB    1 
ATOM   6897  C  CG    . LYS A 1 906  ? 24.715  -64.344  14.336  1.00 24.39  ? 907  LYS A CG    1 
ATOM   6898  C  CD    . LYS A 1 906  ? 25.725  -63.197  14.476  1.00 27.55  ? 907  LYS A CD    1 
ATOM   6899  C  CE    . LYS A 1 906  ? 26.333  -63.263  15.882  1.00 26.63  ? 907  LYS A CE    1 
ATOM   6900  N  NZ    . LYS A 1 906  ? 27.814  -63.299  15.868  1.00 29.60  ? 907  LYS A NZ    1 
ATOM   6901  N  N     . GLU A 1 907  ? 22.703  -66.106  10.482  1.00 25.97  ? 908  GLU A N     1 
ATOM   6902  C  CA    . GLU A 1 907  ? 22.059  -65.980  9.166   1.00 24.34  ? 908  GLU A CA    1 
ATOM   6903  C  C     . GLU A 1 907  ? 20.555  -66.254  9.262   1.00 23.53  ? 908  GLU A C     1 
ATOM   6904  O  O     . GLU A 1 907  ? 19.737  -65.574  8.649   1.00 22.42  ? 908  GLU A O     1 
ATOM   6905  C  CB    . GLU A 1 907  ? 22.658  -66.961  8.138   1.00 27.01  ? 908  GLU A CB    1 
ATOM   6906  C  CG    . GLU A 1 907  ? 23.102  -66.800  6.880   0.00 18.51  ? 908  GLU A CG    1 
ATOM   6907  C  CD    . GLU A 1 907  ? 23.700  -67.960  6.100   0.00 18.21  ? 908  GLU A CD    1 
ATOM   6908  O  OE1   . GLU A 1 907  ? 24.732  -68.515  6.536   0.00 17.89  ? 908  GLU A OE1   1 
ATOM   6909  O  OE2   . GLU A 1 907  ? 23.121  -68.332  5.058   0.00 17.96  ? 908  GLU A OE2   1 
ATOM   6910  N  N     . ALA A 1 908  ? 20.217  -67.301  9.996   1.00 24.39  ? 909  ALA A N     1 
ATOM   6911  C  CA    . ALA A 1 908  ? 18.794  -67.714  10.123  1.00 24.98  ? 909  ALA A CA    1 
ATOM   6912  C  C     . ALA A 1 908  ? 17.989  -66.692  10.896  1.00 25.11  ? 909  ALA A C     1 
ATOM   6913  O  O     . ALA A 1 908  ? 16.853  -66.309  10.581  1.00 26.31  ? 909  ALA A O     1 
ATOM   6914  C  CB    . ALA A 1 908  ? 18.804  -69.048  10.854  1.00 21.62  ? 909  ALA A CB    1 
ATOM   6915  N  N     . LEU A 1 909  ? 18.611  -66.246  12.005  1.00 22.77  ? 910  LEU A N     1 
ATOM   6916  C  CA    . LEU A 1 909  ? 18.000  -65.175  12.804  1.00 23.59  ? 910  LEU A CA    1 
ATOM   6917  C  C     . LEU A 1 909  ? 17.718  -63.920  12.003  1.00 25.11  ? 910  LEU A C     1 
ATOM   6918  O  O     . LEU A 1 909  ? 16.686  -63.235  12.032  1.00 24.21  ? 910  LEU A O     1 
ATOM   6919  C  CB    . LEU A 1 909  ? 19.024  -64.883  13.888  1.00 22.28  ? 910  LEU A CB    1 
ATOM   6920  C  CG    . LEU A 1 909  ? 18.762  -65.009  15.356  1.00 25.16  ? 910  LEU A CG    1 
ATOM   6921  C  CD1   . LEU A 1 909  ? 17.704  -66.050  15.744  1.00 24.18  ? 910  LEU A CD1   1 
ATOM   6922  C  CD2   . LEU A 1 909  ? 20.053  -65.113  16.142  1.00 24.13  ? 910  LEU A CD2   1 
ATOM   6923  N  N     . GLN A 1 910  ? 18.666  -63.592  11.108  1.00 25.58  ? 911  GLN A N     1 
ATOM   6924  C  CA    . GLN A 1 910  ? 18.539  -62.409  10.242  1.00 27.66  ? 911  GLN A CA    1 
ATOM   6925  C  C     . GLN A 1 910  ? 17.443  -62.567  9.199   1.00 25.11  ? 911  GLN A C     1 
ATOM   6926  O  O     . GLN A 1 910  ? 16.648  -61.646  8.938   1.00 25.40  ? 911  GLN A O     1 
ATOM   6927  C  CB    . GLN A 1 910  ? 19.889  -62.150  9.548   1.00 31.34  ? 911  GLN A CB    1 
ATOM   6928  C  CG    . GLN A 1 910  ? 20.083  -60.778  8.963   1.00 37.57  ? 911  GLN A CG    1 
ATOM   6929  C  CD    . GLN A 1 910  ? 19.448  -59.632  9.728   1.00 41.90  ? 911  GLN A CD    1 
ATOM   6930  O  OE1   . GLN A 1 910  ? 19.959  -59.217  10.775  1.00 44.36  ? 911  GLN A OE1   1 
ATOM   6931  N  NE2   . GLN A 1 910  ? 18.300  -59.100  9.261   1.00 44.31  ? 911  GLN A NE2   1 
ATOM   6932  N  N     . GLY A 1 911  ? 17.284  -63.751  8.682   1.00 23.77  ? 912  GLY A N     1 
ATOM   6933  C  CA    . GLY A 1 911  ? 16.265  -64.065  7.656   1.00 22.35  ? 912  GLY A CA    1 
ATOM   6934  C  C     . GLY A 1 911  ? 14.897  -64.107  8.395   1.00 21.03  ? 912  GLY A C     1 
ATOM   6935  O  O     . GLY A 1 911  ? 13.897  -63.707  7.817   1.00 20.54  ? 912  GLY A O     1 
ATOM   6936  N  N     . TRP A 1 912  ? 14.934  -64.604  9.621   1.00 21.57  ? 913  TRP A N     1 
ATOM   6937  C  CA    . TRP A 1 912  ? 13.680  -64.696  10.395  1.00 23.27  ? 913  TRP A CA    1 
ATOM   6938  C  C     . TRP A 1 912  ? 13.195  -63.288  10.674  1.00 23.84  ? 913  TRP A C     1 
ATOM   6939  O  O     . TRP A 1 912  ? 12.023  -62.984  10.446  1.00 25.74  ? 913  TRP A O     1 
ATOM   6940  C  CB    . TRP A 1 912  ? 13.810  -65.493  11.704  1.00 22.95  ? 913  TRP A CB    1 
ATOM   6941  C  CG    . TRP A 1 912  ? 12.428  -65.534  12.393  1.00 23.28  ? 913  TRP A CG    1 
ATOM   6942  C  CD1   . TRP A 1 912  ? 11.430  -66.404  12.123  1.00 22.98  ? 913  TRP A CD1   1 
ATOM   6943  C  CD2   . TRP A 1 912  ? 11.924  -64.609  13.345  1.00 22.11  ? 913  TRP A CD2   1 
ATOM   6944  N  NE1   . TRP A 1 912  ? 10.311  -66.083  12.883  1.00 21.60  ? 913  TRP A NE1   1 
ATOM   6945  C  CE2   . TRP A 1 912  ? 10.599  -64.994  13.641  1.00 22.91  ? 913  TRP A CE2   1 
ATOM   6946  C  CE3   . TRP A 1 912  ? 12.451  -63.506  14.012  1.00 22.78  ? 913  TRP A CE3   1 
ATOM   6947  C  CZ2   . TRP A 1 912  ? 9.807   -64.302  14.569  1.00 22.14  ? 913  TRP A CZ2   1 
ATOM   6948  C  CZ3   . TRP A 1 912  ? 11.668  -62.815  14.926  1.00 22.37  ? 913  TRP A CZ3   1 
ATOM   6949  C  CH2   . TRP A 1 912  ? 10.350  -63.215  15.195  1.00 23.18  ? 913  TRP A CH2   1 
ATOM   6950  N  N     . LEU A 1 913  ? 14.085  -62.429  11.114  1.00 24.18  ? 914  LEU A N     1 
ATOM   6951  C  CA    . LEU A 1 913  ? 13.731  -61.048  11.497  1.00 24.23  ? 914  LEU A CA    1 
ATOM   6952  C  C     . LEU A 1 913  ? 13.205  -60.300  10.299  1.00 27.68  ? 914  LEU A C     1 
ATOM   6953  O  O     . LEU A 1 913  ? 12.219  -59.546  10.301  1.00 26.89  ? 914  LEU A O     1 
ATOM   6954  C  CB    . LEU A 1 913  ? 14.987  -60.477  12.112  1.00 25.93  ? 914  LEU A CB    1 
ATOM   6955  C  CG    . LEU A 1 913  ? 15.243  -59.900  13.463  1.00 26.69  ? 914  LEU A CG    1 
ATOM   6956  C  CD1   . LEU A 1 913  ? 14.107  -60.092  14.478  1.00 22.61  ? 914  LEU A CD1   1 
ATOM   6957  C  CD2   . LEU A 1 913  ? 16.592  -60.327  14.071  1.00 26.56  ? 914  LEU A CD2   1 
ATOM   6958  N  N     . ALA A 1 914  ? 13.816  -60.593  9.143   1.00 28.35  ? 915  ALA A N     1 
ATOM   6959  C  CA    . ALA A 1 914  ? 13.399  -59.909  7.910   1.00 28.82  ? 915  ALA A CA    1 
ATOM   6960  C  C     . ALA A 1 914  ? 12.058  -60.404  7.424   1.00 27.51  ? 915  ALA A C     1 
ATOM   6961  O  O     . ALA A 1 914  ? 11.380  -59.641  6.740   1.00 29.09  ? 915  ALA A O     1 
ATOM   6962  C  CB    . ALA A 1 914  ? 14.492  -60.062  6.834   1.00 29.07  ? 915  ALA A CB    1 
ATOM   6963  N  N     . GLY A 1 915  ? 11.644  -61.639  7.665   1.00 26.81  ? 916  GLY A N     1 
ATOM   6964  C  CA    . GLY A 1 915  ? 10.379  -62.117  7.136   1.00 24.19  ? 916  GLY A CA    1 
ATOM   6965  C  C     . GLY A 1 915  ? 9.424   -62.555  8.233   1.00 24.97  ? 916  GLY A C     1 
ATOM   6966  O  O     . GLY A 1 915  ? 8.582   -63.434  7.974   1.00 22.86  ? 916  GLY A O     1 
ATOM   6967  N  N     . LYS A 1 916  ? 9.623   -62.033  9.455   1.00 22.02  ? 917  LYS A N     1 
ATOM   6968  C  CA    . LYS A 1 916  ? 8.815   -62.584  10.583  1.00 23.92  ? 917  LYS A CA    1 
ATOM   6969  C  C     . LYS A 1 916  ? 7.308   -62.458  10.397  1.00 23.47  ? 917  LYS A C     1 
ATOM   6970  O  O     . LYS A 1 916  ? 6.565   -63.207  11.031  1.00 21.63  ? 917  LYS A O     1 
ATOM   6971  C  CB    . LYS A 1 916  ? 9.209   -61.823  11.858  1.00 26.06  ? 917  LYS A CB    1 
ATOM   6972  C  CG    . LYS A 1 916  ? 9.396   -60.357  11.543  1.00 30.71  ? 917  LYS A CG    1 
ATOM   6973  C  CD    . LYS A 1 916  ? 8.666   -59.342  12.361  1.00 34.83  ? 917  LYS A CD    1 
ATOM   6974  C  CE    . LYS A 1 916  ? 9.639   -58.739  13.375  1.00 36.61  ? 917  LYS A CE    1 
ATOM   6975  N  NZ    . LYS A 1 916  ? 10.298  -59.913  14.054  1.00 37.73  ? 917  LYS A NZ    1 
ATOM   6976  N  N     . ASN A 1 917  ? 6.839   -61.499  9.606   1.00 22.48  ? 918  ASN A N     1 
ATOM   6977  C  CA    . ASN A 1 917  ? 5.393   -61.352  9.405   1.00 25.28  ? 918  ASN A CA    1 
ATOM   6978  C  C     . ASN A 1 917  ? 4.957   -62.004  8.103   1.00 26.15  ? 918  ASN A C     1 
ATOM   6979  O  O     . ASN A 1 917  ? 3.802   -61.881  7.678   1.00 24.68  ? 918  ASN A O     1 
ATOM   6980  C  CB    . ASN A 1 917  ? 4.930   -59.909  9.590   1.00 27.49  ? 918  ASN A CB    1 
ATOM   6981  C  CG    . ASN A 1 917  ? 4.933   -59.562  11.081  1.00 29.66  ? 918  ASN A CG    1 
ATOM   6982  O  OD1   . ASN A 1 917  ? 5.234   -58.417  11.459  1.00 33.60  ? 918  ASN A OD1   1 
ATOM   6983  N  ND2   . ASN A 1 917  ? 4.664   -60.515  11.961  1.00 27.42  ? 918  ASN A ND2   1 
ATOM   6984  N  N     . ASP A 1 918  ? 5.890   -62.735  7.496   1.00 23.77  ? 919  ASP A N     1 
ATOM   6985  C  CA    . ASP A 1 918  ? 5.562   -63.471  6.257   1.00 27.25  ? 919  ASP A CA    1 
ATOM   6986  C  C     . ASP A 1 918  ? 5.437   -64.951  6.564   1.00 25.22  ? 919  ASP A C     1 
ATOM   6987  O  O     . ASP A 1 918  ? 6.396   -65.565  7.053   1.00 23.81  ? 919  ASP A O     1 
ATOM   6988  C  CB    . ASP A 1 918  ? 6.683   -63.200  5.235   1.00 31.34  ? 919  ASP A CB    1 
ATOM   6989  C  CG    . ASP A 1 918  ? 6.602   -63.980  3.942   1.00 34.20  ? 919  ASP A CG    1 
ATOM   6990  O  OD1   . ASP A 1 918  ? 7.497   -64.657  3.419   1.00 36.07  ? 919  ASP A OD1   1 
ATOM   6991  O  OD2   . ASP A 1 918  ? 5.540   -63.984  3.295   1.00 40.33  ? 919  ASP A OD2   1 
ATOM   6992  N  N     . PRO A 1 919  ? 4.310   -65.578  6.232   1.00 23.02  ? 920  PRO A N     1 
ATOM   6993  C  CA    . PRO A 1 919  ? 4.102   -66.984  6.425   1.00 26.03  ? 920  PRO A CA    1 
ATOM   6994  C  C     . PRO A 1 919  ? 5.181   -67.905  5.835   1.00 25.56  ? 920  PRO A C     1 
ATOM   6995  O  O     . PRO A 1 919  ? 5.490   -68.939  6.417   1.00 25.66  ? 920  PRO A O     1 
ATOM   6996  C  CB    . PRO A 1 919  ? 2.822   -67.302  5.664   1.00 24.74  ? 920  PRO A CB    1 
ATOM   6997  C  CG    . PRO A 1 919  ? 2.128   -65.986  5.559   1.00 26.09  ? 920  PRO A CG    1 
ATOM   6998  C  CD    . PRO A 1 919  ? 3.174   -64.925  5.570   1.00 25.90  ? 920  PRO A CD    1 
ATOM   6999  N  N     . ILE A 1 920  ? 5.664   -67.525  4.670   1.00 26.12  ? 921  ILE A N     1 
ATOM   7000  C  CA    . ILE A 1 920  ? 6.616   -68.424  3.971   1.00 26.88  ? 921  ILE A CA    1 
ATOM   7001  C  C     . ILE A 1 920  ? 8.026   -68.213  4.513   1.00 25.84  ? 921  ILE A C     1 
ATOM   7002  O  O     . ILE A 1 920  ? 8.640   -69.176  4.948   1.00 26.08  ? 921  ILE A O     1 
ATOM   7003  C  CB    . ILE A 1 920  ? 6.574   -68.203  2.451   1.00 29.49  ? 921  ILE A CB    1 
ATOM   7004  C  CG1   . ILE A 1 920  ? 5.202   -68.621  1.891   1.00 31.13  ? 921  ILE A CG1   1 
ATOM   7005  C  CG2   . ILE A 1 920  ? 7.644   -69.026  1.726   1.00 31.51  ? 921  ILE A CG2   1 
ATOM   7006  C  CD1   . ILE A 1 920  ? 4.631   -67.488  1.026   1.00 32.46  ? 921  ILE A CD1   1 
ATOM   7007  N  N     . LYS A 1 921  ? 8.471   -66.966  4.583   1.00 24.38  ? 922  LYS A N     1 
ATOM   7008  C  CA    . LYS A 1 921  ? 9.804   -66.703  5.104   1.00 25.91  ? 922  LYS A CA    1 
ATOM   7009  C  C     . LYS A 1 921  ? 9.931   -66.968  6.589   1.00 25.46  ? 922  LYS A C     1 
ATOM   7010  O  O     . LYS A 1 921  ? 10.950  -67.511  6.977   1.00 24.20  ? 922  LYS A O     1 
ATOM   7011  C  CB    . LYS A 1 921  ? 10.258  -65.273  4.746   1.00 26.27  ? 922  LYS A CB    1 
ATOM   7012  C  CG    . LYS A 1 921  ? 10.473  -65.084  3.257   1.00 29.65  ? 922  LYS A CG    1 
ATOM   7013  C  CD    . LYS A 1 921  ? 11.415  -66.085  2.588   1.00 33.10  ? 922  LYS A CD    1 
ATOM   7014  C  CE    . LYS A 1 921  ? 11.676  -66.195  1.167   0.00 15.22  ? 922  LYS A CE    1 
ATOM   7015  N  NZ    . LYS A 1 921  ? 12.260  -64.914  0.685   0.00 15.17  ? 922  LYS A NZ    1 
ATOM   7016  N  N     . SER A 1 922  ? 8.884   -66.695  7.405   1.00 21.82  ? 923  SER A N     1 
ATOM   7017  C  CA    . SER A 1 922  ? 9.078   -66.972  8.840   1.00 20.04  ? 923  SER A CA    1 
ATOM   7018  C  C     . SER A 1 922  ? 9.111   -68.453  9.115   1.00 18.25  ? 923  SER A C     1 
ATOM   7019  O  O     . SER A 1 922  ? 9.889   -68.908  9.955   1.00 19.83  ? 923  SER A O     1 
ATOM   7020  C  CB    . SER A 1 922  ? 7.976   -66.254  9.659   1.00 18.69  ? 923  SER A CB    1 
ATOM   7021  O  OG    . SER A 1 922  ? 6.729   -66.860  9.316   1.00 17.51  ? 923  SER A OG    1 
ATOM   7022  N  N     . LYS A 1 923  ? 8.441   -69.281  8.305   1.00 18.45  ? 924  LYS A N     1 
ATOM   7023  C  CA    . LYS A 1 923  ? 8.546   -70.733  8.542   1.00 21.12  ? 924  LYS A CA    1 
ATOM   7024  C  C     . LYS A 1 923  ? 9.861   -71.268  7.983   1.00 21.53  ? 924  LYS A C     1 
ATOM   7025  O  O     . LYS A 1 923  ? 10.410  -72.199  8.538   1.00 22.21  ? 924  LYS A O     1 
ATOM   7026  C  CB    . LYS A 1 923  ? 7.367   -71.477  7.917   1.00 22.00  ? 924  LYS A CB    1 
ATOM   7027  C  CG    . LYS A 1 923  ? 7.405   -72.979  8.023   1.00 22.86  ? 924  LYS A CG    1 
ATOM   7028  C  CD    . LYS A 1 923  ? 6.277   -73.562  7.192   1.00 24.75  ? 924  LYS A CD    1 
ATOM   7029  C  CE    . LYS A 1 923  ? 6.305   -75.050  7.047   1.00 25.60  ? 924  LYS A CE    1 
ATOM   7030  N  NZ    . LYS A 1 923  ? 7.491   -75.876  7.302   1.00 25.50  ? 924  LYS A NZ    1 
ATOM   7031  N  N     . GLU A 1 924  ? 10.333  -70.702  6.890   1.00 22.89  ? 925  GLU A N     1 
ATOM   7032  C  CA    . GLU A 1 924  ? 11.596  -71.147  6.262   1.00 25.96  ? 925  GLU A CA    1 
ATOM   7033  C  C     . GLU A 1 924  ? 12.752  -70.963  7.248   1.00 24.73  ? 925  GLU A C     1 
ATOM   7034  O  O     . GLU A 1 924  ? 13.474  -71.914  7.578   1.00 25.50  ? 925  GLU A O     1 
ATOM   7035  C  CB    . GLU A 1 924  ? 11.839  -70.393  4.950   1.00 27.16  ? 925  GLU A CB    1 
ATOM   7036  C  CG    . GLU A 1 924  ? 13.177  -70.757  4.284   1.00 33.41  ? 925  GLU A CG    1 
ATOM   7037  C  CD    . GLU A 1 924  ? 13.457  -69.954  3.022   1.00 37.10  ? 925  GLU A CD    1 
ATOM   7038  O  OE1   . GLU A 1 924  ? 12.501  -69.356  2.444   1.00 39.09  ? 925  GLU A OE1   1 
ATOM   7039  O  OE2   . GLU A 1 924  ? 14.629  -69.918  2.571   1.00 37.91  ? 925  GLU A OE2   1 
ATOM   7040  N  N     . TYR A 1 925  ? 12.870  -69.741  7.748   1.00 26.18  ? 926  TYR A N     1 
ATOM   7041  C  CA    . TYR A 1 925  ? 13.934  -69.431  8.686   1.00 26.14  ? 926  TYR A CA    1 
ATOM   7042  C  C     . TYR A 1 925  ? 13.645  -70.040  10.038  1.00 23.97  ? 926  TYR A C     1 
ATOM   7043  O  O     . TYR A 1 925  ? 14.588  -70.518  10.656  1.00 24.53  ? 926  TYR A O     1 
ATOM   7044  C  CB    . TYR A 1 925  ? 14.250  -67.928  8.759   1.00 25.71  ? 926  TYR A CB    1 
ATOM   7045  C  CG    . TYR A 1 925  ? 14.979  -67.545  7.481   1.00 28.76  ? 926  TYR A CG    1 
ATOM   7046  C  CD1   . TYR A 1 925  ? 14.272  -66.885  6.500   1.00 28.33  ? 926  TYR A CD1   1 
ATOM   7047  C  CD2   . TYR A 1 925  ? 16.311  -67.880  7.260   1.00 28.66  ? 926  TYR A CD2   1 
ATOM   7048  C  CE1   . TYR A 1 925  ? 14.887  -66.536  5.307   1.00 31.51  ? 926  TYR A CE1   1 
ATOM   7049  C  CE2   . TYR A 1 925  ? 16.935  -67.534  6.063   1.00 29.06  ? 926  TYR A CE2   1 
ATOM   7050  C  CZ    . TYR A 1 925  ? 16.221  -66.847  5.113   1.00 30.37  ? 926  TYR A CZ    1 
ATOM   7051  O  OH    . TYR A 1 925  ? 16.755  -66.489  3.895   1.00 32.79  ? 926  TYR A OH    1 
ATOM   7052  N  N     . GLY A 1 926  ? 12.378  -70.123  10.455  1.00 23.65  ? 927  GLY A N     1 
ATOM   7053  C  CA    . GLY A 1 926  ? 12.094  -70.752  11.764  1.00 23.33  ? 927  GLY A CA    1 
ATOM   7054  C  C     . GLY A 1 926  ? 12.430  -72.231  11.747  1.00 21.65  ? 927  GLY A C     1 
ATOM   7055  O  O     . GLY A 1 926  ? 12.880  -72.759  12.757  1.00 22.77  ? 927  GLY A O     1 
ATOM   7056  N  N     . ASP A 1 927  ? 12.148  -72.952  10.681  1.00 21.93  ? 928  ASP A N     1 
ATOM   7057  C  CA    . ASP A 1 927  ? 12.555  -74.350  10.529  1.00 21.95  ? 928  ASP A CA    1 
ATOM   7058  C  C     . ASP A 1 927  ? 14.087  -74.513  10.559  1.00 20.97  ? 928  ASP A C     1 
ATOM   7059  O  O     . ASP A 1 927  ? 14.563  -75.415  11.234  1.00 22.33  ? 928  ASP A O     1 
ATOM   7060  C  CB    . ASP A 1 927  ? 11.987  -74.940  9.250   1.00 21.70  ? 928  ASP A CB    1 
ATOM   7061  C  CG    . ASP A 1 927  ? 10.482  -75.143  9.346   1.00 23.68  ? 928  ASP A CG    1 
ATOM   7062  O  OD1   . ASP A 1 927  ? 9.896   -74.805  10.404  1.00 25.58  ? 928  ASP A OD1   1 
ATOM   7063  O  OD2   . ASP A 1 927  ? 9.894   -75.632  8.367   1.00 27.31  ? 928  ASP A OD2   1 
ATOM   7064  N  N     . LYS A 1 928  ? 14.843  -73.569  10.023  1.00 21.89  ? 929  LYS A N     1 
ATOM   7065  C  CA    . LYS A 1 928  ? 16.299  -73.674  10.191  1.00 26.30  ? 929  LYS A CA    1 
ATOM   7066  C  C     . LYS A 1 928  ? 16.730  -73.492  11.640  1.00 25.26  ? 929  LYS A C     1 
ATOM   7067  O  O     . LYS A 1 928  ? 17.564  -74.237  12.140  1.00 27.32  ? 929  LYS A O     1 
ATOM   7068  C  CB    . LYS A 1 928  ? 17.076  -72.648  9.383   1.00 28.70  ? 929  LYS A CB    1 
ATOM   7069  C  CG    . LYS A 1 928  ? 16.845  -72.824  7.878   1.00 32.20  ? 929  LYS A CG    1 
ATOM   7070  C  CD    . LYS A 1 928  ? 17.641  -71.705  7.200   1.00 32.87  ? 929  LYS A CD    1 
ATOM   7071  C  CE    . LYS A 1 928  ? 17.526  -71.812  5.682   1.00 34.34  ? 929  LYS A CE    1 
ATOM   7072  N  NZ    . LYS A 1 928  ? 18.184  -70.590  5.110   1.00 36.68  ? 929  LYS A NZ    1 
ATOM   7073  N  N     . LEU A 1 929  ? 16.107  -72.541  12.335  1.00 24.10  ? 930  LEU A N     1 
ATOM   7074  C  CA    . LEU A 1 929  ? 16.419  -72.288  13.739  1.00 24.20  ? 930  LEU A CA    1 
ATOM   7075  C  C     . LEU A 1 929  ? 16.043  -73.463  14.603  1.00 23.90  ? 930  LEU A C     1 
ATOM   7076  O  O     . LEU A 1 929  ? 16.687  -73.818  15.598  1.00 25.52  ? 930  LEU A O     1 
ATOM   7077  C  CB    . LEU A 1 929  ? 15.639  -71.038  14.119  1.00 25.61  ? 930  LEU A CB    1 
ATOM   7078  C  CG    . LEU A 1 929  ? 16.236  -69.694  14.393  1.00 27.31  ? 930  LEU A CG    1 
ATOM   7079  C  CD1   . LEU A 1 929  ? 17.634  -69.428  13.924  1.00 24.02  ? 930  LEU A CD1   1 
ATOM   7080  C  CD2   . LEU A 1 929  ? 15.366  -68.523  13.924  1.00 25.83  ? 930  LEU A CD2   1 
ATOM   7081  N  N     . LYS A 1 930  ? 14.955  -74.154  14.240  1.00 26.08  ? 931  LYS A N     1 
ATOM   7082  C  CA    . LYS A 1 930  ? 14.499  -75.335  14.980  1.00 26.78  ? 931  LYS A CA    1 
ATOM   7083  C  C     . LYS A 1 930  ? 15.570  -76.428  14.925  1.00 27.56  ? 931  LYS A C     1 
ATOM   7084  O  O     . LYS A 1 930  ? 15.826  -77.093  15.909  1.00 27.62  ? 931  LYS A O     1 
ATOM   7085  C  CB    . LYS A 1 930  ? 13.152  -75.851  14.492  1.00 28.75  ? 931  LYS A CB    1 
ATOM   7086  C  CG    . LYS A 1 930  ? 12.024  -74.842  14.750  1.00 28.50  ? 931  LYS A CG    1 
ATOM   7087  C  CD    . LYS A 1 930  ? 10.648  -75.328  14.320  1.00 30.05  ? 931  LYS A CD    1 
ATOM   7088  C  CE    . LYS A 1 930  ? 9.510   -74.500  14.953  1.00 30.44  ? 931  LYS A CE    1 
ATOM   7089  N  NZ    . LYS A 1 930  ? 8.241   -74.688  14.169  1.00 30.78  ? 931  LYS A NZ    1 
ATOM   7090  N  N     . LYS A 1 931  ? 16.237  -76.492  13.786  1.00 26.34  ? 932  LYS A N     1 
ATOM   7091  C  CA    . LYS A 1 931  ? 17.313  -77.438  13.565  1.00 29.47  ? 932  LYS A CA    1 
ATOM   7092  C  C     . LYS A 1 931  ? 18.591  -77.015  14.290  1.00 27.24  ? 932  LYS A C     1 
ATOM   7093  O  O     . LYS A 1 931  ? 19.123  -77.752  15.125  1.00 30.10  ? 932  LYS A O     1 
ATOM   7094  C  CB    . LYS A 1 931  ? 17.597  -77.518  12.045  1.00 34.06  ? 932  LYS A CB    1 
ATOM   7095  C  CG    . LYS A 1 931  ? 16.413  -78.175  11.327  1.00 38.86  ? 932  LYS A CG    1 
ATOM   7096  C  CD    . LYS A 1 931  ? 16.732  -78.642  9.910   1.00 43.02  ? 932  LYS A CD    1 
ATOM   7097  C  CE    . LYS A 1 931  ? 15.541  -79.437  9.360   1.00 45.10  ? 932  LYS A CE    1 
ATOM   7098  N  NZ    . LYS A 1 931  ? 15.345  -79.266  7.898   1.00 46.97  ? 932  LYS A NZ    1 
ATOM   7099  N  N     . LEU A 1 932  ? 19.036  -75.821  14.024  1.00 26.14  ? 933  LEU A N     1 
ATOM   7100  C  CA    . LEU A 1 932  ? 20.282  -75.247  14.519  1.00 26.90  ? 933  LEU A CA    1 
ATOM   7101  C  C     . LEU A 1 932  ? 20.316  -75.109  16.021  1.00 28.68  ? 933  LEU A C     1 
ATOM   7102  O  O     . LEU A 1 932  ? 21.373  -75.331  16.639  1.00 28.36  ? 933  LEU A O     1 
ATOM   7103  C  CB    . LEU A 1 932  ? 20.479  -73.877  13.853  1.00 26.99  ? 933  LEU A CB    1 
ATOM   7104  C  CG    . LEU A 1 932  ? 20.781  -73.890  12.351  1.00 27.22  ? 933  LEU A CG    1 
ATOM   7105  C  CD1   . LEU A 1 932  ? 20.718  -72.493  11.762  1.00 26.55  ? 933  LEU A CD1   1 
ATOM   7106  C  CD2   . LEU A 1 932  ? 22.174  -74.486  12.136  1.00 29.41  ? 933  LEU A CD2   1 
ATOM   7107  N  N     . LEU A 1 933  ? 19.151  -74.740  16.596  1.00 26.92  ? 934  LEU A N     1 
ATOM   7108  C  CA    . LEU A 1 933  ? 19.125  -74.603  18.045  1.00 27.80  ? 934  LEU A CA    1 
ATOM   7109  C  C     . LEU A 1 933  ? 18.528  -75.798  18.763  1.00 28.82  ? 934  LEU A C     1 
ATOM   7110  O  O     . LEU A 1 933  ? 18.238  -75.722  19.973  1.00 26.06  ? 934  LEU A O     1 
ATOM   7111  C  CB    . LEU A 1 933  ? 18.401  -73.309  18.456  1.00 28.51  ? 934  LEU A CB    1 
ATOM   7112  C  CG    . LEU A 1 933  ? 18.846  -72.018  17.758  1.00 28.55  ? 934  LEU A CG    1 
ATOM   7113  C  CD1   . LEU A 1 933  ? 17.817  -70.931  18.093  1.00 29.49  ? 934  LEU A CD1   1 
ATOM   7114  C  CD2   . LEU A 1 933  ? 20.233  -71.577  18.239  1.00 28.55  ? 934  LEU A CD2   1 
ATOM   7115  N  N     . ALA A 1 934  ? 18.411  -76.966  18.137  1.00 30.84  ? 935  ALA A N     1 
ATOM   7116  C  CA    . ALA A 1 934  ? 17.864  -78.125  18.834  1.00 36.16  ? 935  ALA A CA    1 
ATOM   7117  C  C     . ALA A 1 934  ? 18.750  -78.522  20.019  1.00 39.40  ? 935  ALA A C     1 
ATOM   7118  O  O     . ALA A 1 934  ? 19.972  -78.576  19.919  1.00 42.03  ? 935  ALA A O     1 
ATOM   7119  C  CB    . ALA A 1 934  ? 17.692  -79.318  17.908  1.00 36.42  ? 935  ALA A CB    1 
ATOM   7120  N  N     . GLY A 1 935  ? 18.149  -78.746  21.171  1.00 43.22  ? 936  GLY A N     1 
ATOM   7121  C  CA    . GLY A 1 935  ? 18.872  -79.112  22.377  1.00 45.62  ? 936  GLY A CA    1 
ATOM   7122  C  C     . GLY A 1 935  ? 19.410  -77.943  23.191  1.00 47.46  ? 936  GLY A C     1 
ATOM   7123  O  O     . GLY A 1 935  ? 19.814  -78.108  24.355  1.00 47.40  ? 936  GLY A O     1 
ATOM   7124  N  N     . GLN A 1 936  ? 19.445  -76.748  22.613  1.00 48.44  ? 937  GLN A N     1 
ATOM   7125  C  CA    . GLN A 1 936  ? 19.956  -75.561  23.296  1.00 49.61  ? 937  GLN A CA    1 
ATOM   7126  C  C     . GLN A 1 936  ? 19.095  -75.172  24.490  1.00 50.69  ? 937  GLN A C     1 
ATOM   7127  O  O     . GLN A 1 936  ? 17.905  -74.862  24.353  1.00 48.34  ? 937  GLN A O     1 
ATOM   7128  C  CB    . GLN A 1 936  ? 20.032  -74.449  22.268  1.00 51.36  ? 937  GLN A CB    1 
ATOM   7129  C  CG    . GLN A 1 936  ? 20.819  -73.220  22.619  1.00 52.86  ? 937  GLN A CG    1 
ATOM   7130  C  CD    . GLN A 1 936  ? 22.320  -73.486  22.585  1.00 53.82  ? 937  GLN A CD    1 
ATOM   7131  O  OE1   . GLN A 1 936  ? 22.893  -73.954  21.611  1.00 54.03  ? 937  GLN A OE1   1 
ATOM   7132  N  NE2   . GLN A 1 936  ? 22.917  -73.141  23.722  1.00 53.93  ? 937  GLN A NE2   1 
ATOM   7133  N  N     . LYS A 1 937  ? 19.706  -75.228  25.671  1.00 51.94  ? 938  LYS A N     1 
ATOM   7134  C  CA    . LYS A 1 937  ? 19.000  -74.943  26.906  1.00 54.45  ? 938  LYS A CA    1 
ATOM   7135  C  C     . LYS A 1 937  ? 19.562  -73.783  27.711  1.00 54.29  ? 938  LYS A C     1 
ATOM   7136  O  O     . LYS A 1 937  ? 18.936  -73.386  28.699  1.00 55.49  ? 938  LYS A O     1 
ATOM   7137  C  CB    . LYS A 1 937  ? 18.993  -76.185  27.809  1.00 56.24  ? 938  LYS A CB    1 
ATOM   7138  C  CG    . LYS A 1 937  ? 17.702  -76.979  27.760  1.00 59.27  ? 938  LYS A CG    1 
ATOM   7139  C  CD    . LYS A 1 937  ? 17.947  -78.483  27.728  1.00 60.82  ? 938  LYS A CD    1 
ATOM   7140  C  CE    . LYS A 1 937  ? 16.817  -79.240  27.044  1.00 62.13  ? 938  LYS A CE    1 
ATOM   7141  N  NZ    . LYS A 1 937  ? 16.008  -78.383  26.124  1.00 62.41  ? 938  LYS A NZ    1 
ATOM   7142  N  N     . ASP A 1 938  ? 20.713  -73.235  27.342  1.00 53.86  ? 939  ASP A N     1 
ATOM   7143  C  CA    . ASP A 1 938  ? 21.281  -72.151  28.141  1.00 53.16  ? 939  ASP A CA    1 
ATOM   7144  C  C     . ASP A 1 938  ? 21.258  -70.809  27.437  1.00 49.46  ? 939  ASP A C     1 
ATOM   7145  O  O     . ASP A 1 938  ? 21.300  -70.665  26.215  1.00 48.99  ? 939  ASP A O     1 
ATOM   7146  C  CB    . ASP A 1 938  ? 22.708  -72.542  28.589  1.00 56.44  ? 939  ASP A CB    1 
ATOM   7147  C  CG    . ASP A 1 938  ? 22.725  -73.614  29.666  1.00 58.79  ? 939  ASP A CG    1 
ATOM   7148  O  OD1   . ASP A 1 938  ? 23.106  -74.764  29.353  1.00 59.76  ? 939  ASP A OD1   1 
ATOM   7149  O  OD2   . ASP A 1 938  ? 22.375  -73.358  30.845  1.00 60.40  ? 939  ASP A OD2   1 
ATOM   7150  N  N     . GLY A 1 939  ? 21.212  -69.736  28.221  1.00 45.92  ? 940  GLY A N     1 
ATOM   7151  C  CA    . GLY A 1 939  ? 21.259  -68.382  27.749  1.00 41.85  ? 940  GLY A CA    1 
ATOM   7152  C  C     . GLY A 1 939  ? 20.233  -67.938  26.714  1.00 38.11  ? 940  GLY A C     1 
ATOM   7153  O  O     . GLY A 1 939  ? 19.145  -68.484  26.564  1.00 37.34  ? 940  GLY A O     1 
ATOM   7154  N  N     . LEU A 1 940  ? 20.612  -66.931  25.947  1.00 35.23  ? 941  LEU A N     1 
ATOM   7155  C  CA    . LEU A 1 940  ? 19.816  -66.305  24.927  1.00 34.25  ? 941  LEU A CA    1 
ATOM   7156  C  C     . LEU A 1 940  ? 19.314  -67.293  23.881  1.00 32.38  ? 941  LEU A C     1 
ATOM   7157  O  O     . LEU A 1 940  ? 18.141  -67.314  23.501  1.00 30.05  ? 941  LEU A O     1 
ATOM   7158  C  CB    . LEU A 1 940  ? 20.625  -65.267  24.165  1.00 35.83  ? 941  LEU A CB    1 
ATOM   7159  C  CG    . LEU A 1 940  ? 20.357  -63.786  24.156  1.00 37.47  ? 941  LEU A CG    1 
ATOM   7160  C  CD1   . LEU A 1 940  ? 21.070  -63.165  22.956  1.00 36.63  ? 941  LEU A CD1   1 
ATOM   7161  C  CD2   . LEU A 1 940  ? 18.886  -63.386  24.174  1.00 36.76  ? 941  LEU A CD2   1 
ATOM   7162  N  N     . LEU A 1 941  ? 20.249  -68.118  23.425  1.00 30.33  ? 942  LEU A N     1 
ATOM   7163  C  CA    . LEU A 1 941  ? 19.878  -69.074  22.372  1.00 29.84  ? 942  LEU A CA    1 
ATOM   7164  C  C     . LEU A 1 941  ? 18.881  -70.089  22.929  1.00 26.80  ? 942  LEU A C     1 
ATOM   7165  O  O     . LEU A 1 941  ? 17.992  -70.526  22.206  1.00 27.60  ? 942  LEU A O     1 
ATOM   7166  C  CB    . LEU A 1 941  ? 21.146  -69.702  21.798  1.00 30.53  ? 942  LEU A CB    1 
ATOM   7167  C  CG    . LEU A 1 941  ? 21.688  -69.220  20.475  1.00 32.08  ? 942  LEU A CG    1 
ATOM   7168  C  CD1   . LEU A 1 941  ? 21.785  -67.729  20.328  1.00 32.27  ? 942  LEU A CD1   1 
ATOM   7169  C  CD2   . LEU A 1 941  ? 23.067  -69.823  20.143  1.00 31.58  ? 942  LEU A CD2   1 
ATOM   7170  N  N     . GLY A 1 942  ? 18.980  -70.334  24.229  1.00 25.77  ? 943  GLY A N     1 
ATOM   7171  C  CA    . GLY A 1 942  ? 18.076  -71.273  24.896  1.00 24.96  ? 943  GLY A CA    1 
ATOM   7172  C  C     . GLY A 1 942  ? 16.660  -70.690  25.038  1.00 26.86  ? 943  GLY A C     1 
ATOM   7173  O  O     . GLY A 1 942  ? 15.659  -71.422  25.004  1.00 25.91  ? 943  GLY A O     1 
ATOM   7174  N  N     . GLN A 1 943  ? 16.614  -69.371  25.180  1.00 25.02  ? 944  GLN A N     1 
ATOM   7175  C  CA    . GLN A 1 943  ? 15.371  -68.617  25.317  1.00 25.54  ? 944  GLN A CA    1 
ATOM   7176  C  C     . GLN A 1 943  ? 14.679  -68.603  23.940  1.00 23.15  ? 944  GLN A C     1 
ATOM   7177  O  O     . GLN A 1 943  ? 13.509  -68.904  23.817  1.00 19.39  ? 944  GLN A O     1 
ATOM   7178  C  CB    . GLN A 1 943  ? 15.579  -67.145  25.679  1.00 27.55  ? 944  GLN A CB    1 
ATOM   7179  C  CG    . GLN A 1 943  ? 15.760  -66.924  27.186  1.00 32.75  ? 944  GLN A CG    1 
ATOM   7180  C  CD    . GLN A 1 943  ? 15.829  -65.440  27.534  1.00 34.53  ? 944  GLN A CD    1 
ATOM   7181  O  OE1   . GLN A 1 943  ? 14.814  -64.745  27.716  1.00 39.10  ? 944  GLN A OE1   1 
ATOM   7182  N  NE2   . GLN A 1 943  ? 17.020  -64.902  27.638  1.00 35.14  ? 944  GLN A NE2   1 
ATOM   7183  N  N     . ILE A 1 944  ? 15.467  -68.238  22.938  1.00 20.52  ? 945  ILE A N     1 
ATOM   7184  C  CA    . ILE A 1 944  ? 14.948  -68.285  21.561  1.00 20.02  ? 945  ILE A CA    1 
ATOM   7185  C  C     . ILE A 1 944  ? 14.451  -69.681  21.189  1.00 21.63  ? 945  ILE A C     1 
ATOM   7186  O  O     . ILE A 1 944  ? 13.388  -69.835  20.555  1.00 20.35  ? 945  ILE A O     1 
ATOM   7187  C  CB    . ILE A 1 944  ? 16.066  -67.781  20.630  1.00 19.74  ? 945  ILE A CB    1 
ATOM   7188  C  CG1   . ILE A 1 944  ? 16.200  -66.248  20.750  1.00 19.49  ? 945  ILE A CG1   1 
ATOM   7189  C  CG2   . ILE A 1 944  ? 15.840  -68.187  19.192  1.00 20.19  ? 945  ILE A CG2   1 
ATOM   7190  C  CD1   . ILE A 1 944  ? 17.530  -65.677  20.255  1.00 18.47  ? 945  ILE A CD1   1 
ATOM   7191  N  N     . ALA A 1 945  ? 15.220  -70.729  21.535  1.00 21.59  ? 946  ALA A N     1 
ATOM   7192  C  CA    . ALA A 1 945  ? 14.803  -72.092  21.174  1.00 22.91  ? 946  ALA A CA    1 
ATOM   7193  C  C     . ALA A 1 945  ? 13.499  -72.515  21.832  1.00 22.64  ? 946  ALA A C     1 
ATOM   7194  O  O     . ALA A 1 945  ? 12.704  -73.213  21.220  1.00 23.52  ? 946  ALA A O     1 
ATOM   7195  C  CB    . ALA A 1 945  ? 15.935  -73.030  21.603  1.00 23.96  ? 946  ALA A CB    1 
ATOM   7196  N  N     . ALA A 1 946  ? 13.209  -72.007  23.020  1.00 23.17  ? 947  ALA A N     1 
ATOM   7197  C  CA    . ALA A 1 946  ? 11.960  -72.394  23.710  1.00 23.70  ? 947  ALA A CA    1 
ATOM   7198  C  C     . ALA A 1 946  ? 10.777  -71.618  23.140  1.00 22.42  ? 947  ALA A C     1 
ATOM   7199  O  O     . ALA A 1 946  ? 9.639   -71.975  23.457  1.00 21.07  ? 947  ALA A O     1 
ATOM   7200  C  CB    . ALA A 1 946  ? 12.114  -72.200  25.210  1.00 24.51  ? 947  ALA A CB    1 
ATOM   7201  N  N     . MET A 1 947  ? 11.033  -70.684  22.218  1.00 22.76  ? 948  MET A N     1 
ATOM   7202  C  CA    . MET A 1 947  ? 9.933   -69.932  21.582  1.00 20.85  ? 948  MET A CA    1 
ATOM   7203  C  C     . MET A 1 947  ? 9.605   -70.391  20.176  1.00 20.43  ? 948  MET A C     1 
ATOM   7204  O  O     . MET A 1 947  ? 9.026   -69.641  19.341  1.00 16.74  ? 948  MET A O     1 
ATOM   7205  C  CB    . MET A 1 947  ? 10.305  -68.449  21.561  1.00 24.15  ? 948  MET A CB    1 
ATOM   7206  C  CG    . MET A 1 947  ? 10.301  -67.819  22.957  1.00 27.01  ? 948  MET A CG    1 
ATOM   7207  S  SD    . MET A 1 947  ? 10.997  -66.130  22.915  1.00 29.96  ? 948  MET A SD    1 
ATOM   7208  C  CE    . MET A 1 947  ? 9.954   -65.354  24.114  1.00 30.50  ? 948  MET A CE    1 
ATOM   7209  N  N     . SER A 1 948  ? 10.024  -71.633  19.850  1.00 20.56  ? 949  SER A N     1 
ATOM   7210  C  CA    . SER A 1 948  ? 9.888   -72.106  18.489  1.00 22.30  ? 949  SER A CA    1 
ATOM   7211  C  C     . SER A 1 948  ? 8.453   -72.217  17.989  1.00 20.35  ? 949  SER A C     1 
ATOM   7212  O  O     . SER A 1 948  ? 8.282   -72.117  16.784  1.00 18.55  ? 949  SER A O     1 
ATOM   7213  C  CB    . SER A 1 948  ? 10.645  -73.412  18.209  1.00 22.92  ? 949  SER A CB    1 
ATOM   7214  O  OG    . SER A 1 948  ? 10.039  -74.433  18.936  1.00 25.05  ? 949  SER A OG    1 
ATOM   7215  N  N     . ASP A 1 949  ? 7.502   -72.387  18.894  1.00 21.25  ? 950  ASP A N     1 
ATOM   7216  C  CA    . ASP A 1 949  ? 6.102   -72.416  18.461  1.00 20.93  ? 950  ASP A CA    1 
ATOM   7217  C  C     . ASP A 1 949  ? 5.629   -71.030  18.074  1.00 17.26  ? 950  ASP A C     1 
ATOM   7218  O  O     . ASP A 1 949  ? 4.483   -70.895  17.645  1.00 18.17  ? 950  ASP A O     1 
ATOM   7219  C  CB    . ASP A 1 949  ? 5.173   -73.037  19.497  1.00 22.40  ? 950  ASP A CB    1 
ATOM   7220  C  CG    . ASP A 1 949  ? 5.155   -72.335  20.834  1.00 22.53  ? 950  ASP A CG    1 
ATOM   7221  O  OD1   . ASP A 1 949  ? 5.890   -71.341  21.012  1.00 22.97  ? 950  ASP A OD1   1 
ATOM   7222  O  OD2   . ASP A 1 949  ? 4.467   -72.782  21.796  1.00 21.54  ? 950  ASP A OD2   1 
ATOM   7223  N  N     . LEU A 1 950  ? 6.437   -69.987  18.181  1.00 17.72  ? 951  LEU A N     1 
ATOM   7224  C  CA    . LEU A 1 950  ? 6.117   -68.641  17.714  1.00 18.84  ? 951  LEU A CA    1 
ATOM   7225  C  C     . LEU A 1 950  ? 6.866   -68.270  16.428  1.00 20.70  ? 951  LEU A C     1 
ATOM   7226  O  O     . LEU A 1 950  ? 6.606   -67.198  15.873  1.00 21.50  ? 951  LEU A O     1 
ATOM   7227  C  CB    . LEU A 1 950  ? 6.539   -67.618  18.801  1.00 17.90  ? 951  LEU A CB    1 
ATOM   7228  C  CG    . LEU A 1 950  ? 5.863   -67.849  20.174  1.00 17.84  ? 951  LEU A CG    1 
ATOM   7229  C  CD1   . LEU A 1 950  ? 6.455   -66.924  21.198  1.00 19.03  ? 951  LEU A CD1   1 
ATOM   7230  C  CD2   . LEU A 1 950  ? 4.335   -67.671  20.083  1.00 16.29  ? 951  LEU A CD2   1 
ATOM   7231  N  N     . TYR A 1 951  ? 7.812   -69.081  15.946  1.00 20.05  ? 952  TYR A N     1 
ATOM   7232  C  CA    . TYR A 1 951  ? 8.570   -68.693  14.746  1.00 20.53  ? 952  TYR A CA    1 
ATOM   7233  C  C     . TYR A 1 951  ? 7.710   -68.463  13.519  1.00 18.58  ? 952  TYR A C     1 
ATOM   7234  O  O     . TYR A 1 951  ? 7.748   -67.353  12.954  1.00 18.78  ? 952  TYR A O     1 
ATOM   7235  C  CB    . TYR A 1 951  ? 9.591   -69.824  14.411  1.00 21.04  ? 952  TYR A CB    1 
ATOM   7236  C  CG    . TYR A 1 951  ? 10.714  -70.032  15.406  1.00 21.53  ? 952  TYR A CG    1 
ATOM   7237  C  CD1   . TYR A 1 951  ? 11.472  -71.220  15.309  1.00 23.36  ? 952  TYR A CD1   1 
ATOM   7238  C  CD2   . TYR A 1 951  ? 11.052  -69.157  16.404  1.00 21.93  ? 952  TYR A CD2   1 
ATOM   7239  C  CE1   . TYR A 1 951  ? 12.490  -71.482  16.183  1.00 21.49  ? 952  TYR A CE1   1 
ATOM   7240  C  CE2   . TYR A 1 951  ? 12.098  -69.382  17.305  1.00 22.80  ? 952  TYR A CE2   1 
ATOM   7241  C  CZ    . TYR A 1 951  ? 12.820  -70.564  17.149  1.00 22.99  ? 952  TYR A CZ    1 
ATOM   7242  O  OH    . TYR A 1 951  ? 13.843  -70.879  18.011  1.00 23.20  ? 952  TYR A OH    1 
ATOM   7243  N  N     . THR A 1 952  ? 6.804   -69.391  13.212  1.00 16.30  ? 953  THR A N     1 
ATOM   7244  C  CA    . THR A 1 952  ? 6.016   -69.141  11.984  1.00 21.66  ? 953  THR A CA    1 
ATOM   7245  C  C     . THR A 1 952  ? 4.869   -68.187  12.279  1.00 21.08  ? 953  THR A C     1 
ATOM   7246  O  O     . THR A 1 952  ? 4.242   -68.218  13.347  1.00 18.42  ? 953  THR A O     1 
ATOM   7247  C  CB    . THR A 1 952  ? 5.735   -70.320  11.076  1.00 24.16  ? 953  THR A CB    1 
ATOM   7248  O  OG1   . THR A 1 952  ? 4.408   -70.532  10.550  1.00 27.30  ? 953  THR A OG1   1 
ATOM   7249  C  CG2   . THR A 1 952  ? 6.393   -71.588  11.477  1.00 20.22  ? 953  THR A CG2   1 
ATOM   7250  N  N     . LYS A 1 953  ? 4.737   -67.204  11.388  1.00 18.06  ? 954  LYS A N     1 
ATOM   7251  C  CA    . LYS A 1 953  ? 3.676   -66.214  11.501  1.00 18.97  ? 954  LYS A CA    1 
ATOM   7252  C  C     . LYS A 1 953  ? 2.308   -66.911  11.667  1.00 18.84  ? 954  LYS A C     1 
ATOM   7253  O  O     . LYS A 1 953  ? 1.972   -67.774  10.853  1.00 18.22  ? 954  LYS A O     1 
ATOM   7254  C  CB    . LYS A 1 953  ? 3.538   -65.287  10.255  1.00 19.02  ? 954  LYS A CB    1 
ATOM   7255  C  CG    . LYS A 1 953  ? 2.623   -64.157  10.761  1.00 23.72  ? 954  LYS A CG    1 
ATOM   7256  C  CD    . LYS A 1 953  ? 2.079   -63.201  9.789   1.00 26.35  ? 954  LYS A CD    1 
ATOM   7257  C  CE    . LYS A 1 953  ? 1.193   -62.224  10.597  1.00 23.79  ? 954  LYS A CE    1 
ATOM   7258  N  NZ    . LYS A 1 953  ? -0.195  -62.737  10.446  1.00 23.48  ? 954  LYS A NZ    1 
ATOM   7259  N  N     . LYS A 1 954  ? 1.556   -66.519  12.677  1.00 21.25  ? 955  LYS A N     1 
ATOM   7260  C  CA    . LYS A 1 954  ? 0.241   -67.069  12.927  1.00 20.37  ? 955  LYS A CA    1 
ATOM   7261  C  C     . LYS A 1 954  ? -0.860  -66.287  12.216  1.00 19.28  ? 955  LYS A C     1 
ATOM   7262  O  O     . LYS A 1 954  ? -0.695  -65.138  11.827  1.00 19.89  ? 955  LYS A O     1 
ATOM   7263  C  CB    . LYS A 1 954  ? -0.120  -67.194  14.419  1.00 20.19  ? 955  LYS A CB    1 
ATOM   7264  C  CG    . LYS A 1 954  ? 0.993   -67.863  15.219  1.00 21.36  ? 955  LYS A CG    1 
ATOM   7265  C  CD    . LYS A 1 954  ? 1.136   -69.324  14.847  1.00 20.42  ? 955  LYS A CD    1 
ATOM   7266  C  CE    . LYS A 1 954  ? 2.158   -69.921  15.824  1.00 22.50  ? 955  LYS A CE    1 
ATOM   7267  N  NZ    . LYS A 1 954  ? 3.345   -70.364  15.033  1.00 22.73  ? 955  LYS A NZ    1 
ATOM   7268  N  N     . SER A 1 955  ? -2.010  -66.929  12.097  1.00 17.83  ? 956  SER A N     1 
ATOM   7269  C  CA    . SER A 1 955  ? -3.162  -66.384  11.380  1.00 17.92  ? 956  SER A CA    1 
ATOM   7270  C  C     . SER A 1 955  ? -4.364  -66.400  12.327  1.00 16.76  ? 956  SER A C     1 
ATOM   7271  O  O     . SER A 1 955  ? -4.871  -67.464  12.660  1.00 16.23  ? 956  SER A O     1 
ATOM   7272  C  CB    . SER A 1 955  ? -3.404  -67.256  10.125  1.00 15.34  ? 956  SER A CB    1 
ATOM   7273  O  OG    . SER A 1 955  ? -4.361  -66.618  9.302   1.00 17.72  ? 956  SER A OG    1 
ATOM   7274  N  N     . VAL A 1 956  ? -4.682  -65.241  12.905  1.00 16.77  ? 957  VAL A N     1 
ATOM   7275  C  CA    . VAL A 1 956  ? -5.783  -65.186  13.895  1.00 16.41  ? 957  VAL A CA    1 
ATOM   7276  C  C     . VAL A 1 956  ? -7.132  -64.983  13.227  1.00 14.39  ? 957  VAL A C     1 
ATOM   7277  O  O     . VAL A 1 956  ? -7.249  -64.012  12.502  1.00 12.92  ? 957  VAL A O     1 
ATOM   7278  C  CB    . VAL A 1 956  ? -5.467  -64.070  14.903  1.00 18.15  ? 957  VAL A CB    1 
ATOM   7279  C  CG1   . VAL A 1 956  ? -6.595  -63.880  15.931  1.00 18.65  ? 957  VAL A CG1   1 
ATOM   7280  C  CG2   . VAL A 1 956  ? -4.168  -64.391  15.688  1.00 15.47  ? 957  VAL A CG2   1 
ATOM   7281  N  N     . TRP A 1 957  ? -8.068  -65.906  13.402  1.00 14.31  ? 958  TRP A N     1 
ATOM   7282  C  CA    . TRP A 1 957  ? -9.387  -65.757  12.789  1.00 13.27  ? 958  TRP A CA    1 
ATOM   7283  C  C     . TRP A 1 957  ? -10.487 -65.651  13.854  1.00 13.82  ? 958  TRP A C     1 
ATOM   7284  O  O     . TRP A 1 957  ? -10.284 -66.153  14.949  1.00 15.49  ? 958  TRP A O     1 
ATOM   7285  C  CB    . TRP A 1 957  ? -9.734  -66.929  11.903  1.00 13.31  ? 958  TRP A CB    1 
ATOM   7286  C  CG    . TRP A 1 957  ? -8.868  -66.855  10.647  1.00 15.29  ? 958  TRP A CG    1 
ATOM   7287  C  CD1   . TRP A 1 957  ? -7.549  -67.189  10.552  1.00 18.49  ? 958  TRP A CD1   1 
ATOM   7288  C  CD2   . TRP A 1 957  ? -9.342  -66.585  9.335   1.00 16.15  ? 958  TRP A CD2   1 
ATOM   7289  N  NE1   . TRP A 1 957  ? -7.173  -67.074  9.236   1.00 18.25  ? 958  TRP A NE1   1 
ATOM   7290  C  CE2   . TRP A 1 957  ? -8.236  -66.697  8.471   1.00 17.96  ? 958  TRP A CE2   1 
ATOM   7291  C  CE3   . TRP A 1 957  ? -10.600 -66.226  8.806   1.00 16.94  ? 958  TRP A CE3   1 
ATOM   7292  C  CZ2   . TRP A 1 957  ? -8.315  -66.452  7.098   1.00 18.92  ? 958  TRP A CZ2   1 
ATOM   7293  C  CZ3   . TRP A 1 957  ? -10.686 -65.971  7.450   1.00 17.63  ? 958  TRP A CZ3   1 
ATOM   7294  C  CH2   . TRP A 1 957  ? -9.541  -66.104  6.613   1.00 20.28  ? 958  TRP A CH2   1 
ATOM   7295  N  N     . ILE A 1 958  ? -11.483 -64.882  13.512  1.00 13.84  ? 959  ILE A N     1 
ATOM   7296  C  CA    . ILE A 1 958  ? -12.648 -64.678  14.387  1.00 13.97  ? 959  ILE A CA    1 
ATOM   7297  C  C     . ILE A 1 958  ? -13.789 -65.186  13.506  1.00 14.82  ? 959  ILE A C     1 
ATOM   7298  O  O     . ILE A 1 958  ? -13.985 -64.664  12.412  1.00 15.38  ? 959  ILE A O     1 
ATOM   7299  C  CB    . ILE A 1 958  ? -12.857 -63.191  14.730  1.00 13.10  ? 959  ILE A CB    1 
ATOM   7300  C  CG1   . ILE A 1 958  ? -11.677 -62.691  15.601  1.00 16.18  ? 959  ILE A CG1   1 
ATOM   7301  C  CG2   . ILE A 1 958  ? -14.198 -63.025  15.473  1.00 11.94  ? 959  ILE A CG2   1 
ATOM   7302  C  CD1   . ILE A 1 958  ? -11.406 -61.228  15.388  1.00 15.56  ? 959  ILE A CD1   1 
ATOM   7303  N  N     . PHE A 1 959  ? -14.422 -66.253  13.945  1.00 15.62  ? 960  PHE A N     1 
ATOM   7304  C  CA    . PHE A 1 959  ? -15.531 -66.848  13.215  1.00 14.93  ? 960  PHE A CA    1 
ATOM   7305  C  C     . PHE A 1 959  ? -16.843 -66.571  13.961  1.00 16.25  ? 960  PHE A C     1 
ATOM   7306  O  O     . PHE A 1 959  ? -16.869 -66.711  15.185  1.00 14.97  ? 960  PHE A O     1 
ATOM   7307  C  CB    . PHE A 1 959  ? -15.441 -68.398  13.249  1.00 14.74  ? 960  PHE A CB    1 
ATOM   7308  C  CG    . PHE A 1 959  ? -14.450 -69.010  12.264  1.00 15.51  ? 960  PHE A CG    1 
ATOM   7309  C  CD1   . PHE A 1 959  ? -14.413 -70.366  12.189  1.00 16.83  ? 960  PHE A CD1   1 
ATOM   7310  C  CD2   . PHE A 1 959  ? -13.634 -68.251  11.453  1.00 15.27  ? 960  PHE A CD2   1 
ATOM   7311  C  CE1   . PHE A 1 959  ? -13.530 -71.008  11.304  1.00 18.95  ? 960  PHE A CE1   1 
ATOM   7312  C  CE2   . PHE A 1 959  ? -12.761 -68.881  10.569  1.00 20.03  ? 960  PHE A CE2   1 
ATOM   7313  C  CZ    . PHE A 1 959  ? -12.720 -70.251  10.499  1.00 19.08  ? 960  PHE A CZ    1 
ATOM   7314  N  N     . GLY A 1 960  ? -17.948 -66.348  13.255  1.00 17.12  ? 961  GLY A N     1 
ATOM   7315  C  CA    . GLY A 1 960  ? -19.234 -66.183  13.972  1.00 15.76  ? 961  GLY A CA    1 
ATOM   7316  C  C     . GLY A 1 960  ? -20.351 -65.999  12.934  1.00 17.43  ? 961  GLY A C     1 
ATOM   7317  O  O     . GLY A 1 960  ? -20.061 -65.881  11.733  1.00 17.99  ? 961  GLY A O     1 
ATOM   7318  N  N     . GLY A 1 961  ? -21.596 -66.034  13.423  1.00 16.77  ? 962  GLY A N     1 
ATOM   7319  C  CA    . GLY A 1 961  ? -22.740 -65.932  12.520  1.00 16.25  ? 962  GLY A CA    1 
ATOM   7320  C  C     . GLY A 1 961  ? -23.222 -64.498  12.473  1.00 15.98  ? 962  GLY A C     1 
ATOM   7321  O  O     . GLY A 1 961  ? -22.586 -63.606  13.039  1.00 13.05  ? 962  GLY A O     1 
ATOM   7322  N  N     . ASP A 1 962  ? -24.313 -64.282  11.717  1.00 14.83  ? 963  ASP A N     1 
ATOM   7323  C  CA    . ASP A 1 962  ? -24.804 -62.927  11.524  1.00 15.73  ? 963  ASP A CA    1 
ATOM   7324  C  C     . ASP A 1 962  ? -25.394 -62.312  12.804  1.00 15.61  ? 963  ASP A C     1 
ATOM   7325  O  O     . ASP A 1 962  ? -25.349 -61.075  13.023  1.00 16.13  ? 963  ASP A O     1 
ATOM   7326  C  CB    . ASP A 1 962  ? -25.880 -62.960  10.390  1.00 16.59  ? 963  ASP A CB    1 
ATOM   7327  C  CG    . ASP A 1 962  ? -26.965 -63.987  10.692  1.00 17.68  ? 963  ASP A CG    1 
ATOM   7328  O  OD1   . ASP A 1 962  ? -26.756 -65.232  10.634  1.00 19.39  ? 963  ASP A OD1   1 
ATOM   7329  O  OD2   . ASP A 1 962  ? -28.088 -63.527  11.013  1.00 17.85  ? 963  ASP A OD2   1 
ATOM   7330  N  N     . GLY A 1 963  ? -26.030 -63.122  13.648  1.00 14.02  ? 964  GLY A N     1 
ATOM   7331  C  CA    . GLY A 1 963  ? -26.617 -62.607  14.897  1.00 13.60  ? 964  GLY A CA    1 
ATOM   7332  C  C     . GLY A 1 963  ? -25.470 -62.026  15.734  1.00 15.61  ? 964  GLY A C     1 
ATOM   7333  O  O     . GLY A 1 963  ? -25.556 -60.907  16.249  1.00 17.21  ? 964  GLY A O     1 
ATOM   7334  N  N     . TRP A 1 964  ? -24.356 -62.780  15.813  1.00 14.68  ? 965  TRP A N     1 
ATOM   7335  C  CA    . TRP A 1 964  ? -23.155 -62.259  16.450  1.00 14.65  ? 965  TRP A CA    1 
ATOM   7336  C  C     . TRP A 1 964  ? -22.715 -60.960  15.750  1.00 16.68  ? 965  TRP A C     1 
ATOM   7337  O  O     . TRP A 1 964  ? -22.568 -59.896  16.394  1.00 15.32  ? 965  TRP A O     1 
ATOM   7338  C  CB    . TRP A 1 964  ? -21.978 -63.273  16.419  1.00 13.62  ? 965  TRP A CB    1 
ATOM   7339  C  CG    . TRP A 1 964  ? -20.669 -62.621  16.833  1.00 14.13  ? 965  TRP A CG    1 
ATOM   7340  C  CD1   . TRP A 1 964  ? -20.328 -62.105  18.047  1.00 12.18  ? 965  TRP A CD1   1 
ATOM   7341  C  CD2   . TRP A 1 964  ? -19.599 -62.307  15.927  1.00 14.40  ? 965  TRP A CD2   1 
ATOM   7342  N  NE1   . TRP A 1 964  ? -19.084 -61.520  17.971  1.00 15.48  ? 965  TRP A NE1   1 
ATOM   7343  C  CE2   . TRP A 1 964  ? -18.628 -61.627  16.652  1.00 14.19  ? 965  TRP A CE2   1 
ATOM   7344  C  CE3   . TRP A 1 964  ? -19.391 -62.523  14.552  1.00 15.85  ? 965  TRP A CE3   1 
ATOM   7345  C  CZ2   . TRP A 1 964  ? -17.458 -61.184  16.059  1.00 13.57  ? 965  TRP A CZ2   1 
ATOM   7346  C  CZ3   . TRP A 1 964  ? -18.223 -62.064  13.943  1.00 16.73  ? 965  TRP A CZ3   1 
ATOM   7347  C  CH2   . TRP A 1 964  ? -17.272 -61.385  14.715  1.00 14.45  ? 965  TRP A CH2   1 
ATOM   7348  N  N     . ALA A 1 965  ? -22.352 -61.019  14.453  1.00 11.53  ? 966  ALA A N     1 
ATOM   7349  C  CA    . ALA A 1 965  ? -21.734 -59.856  13.843  1.00 12.20  ? 966  ALA A CA    1 
ATOM   7350  C  C     . ALA A 1 965  ? -22.587 -58.624  13.639  1.00 12.25  ? 966  ALA A C     1 
ATOM   7351  O  O     . ALA A 1 965  ? -22.024 -57.479  13.671  1.00 12.43  ? 966  ALA A O     1 
ATOM   7352  C  CB    . ALA A 1 965  ? -21.129 -60.301  12.474  1.00 9.38   ? 966  ALA A CB    1 
ATOM   7353  N  N     . TYR A 1 966  ? -23.876 -58.782  13.370  1.00 11.33  ? 967  TYR A N     1 
ATOM   7354  C  CA    . TYR A 1 966  ? -24.742 -57.625  13.111  1.00 14.90  ? 967  TYR A CA    1 
ATOM   7355  C  C     . TYR A 1 966  ? -25.403 -57.099  14.382  1.00 14.06  ? 967  TYR A C     1 
ATOM   7356  O  O     . TYR A 1 966  ? -25.891 -55.968  14.391  1.00 14.16  ? 967  TYR A O     1 
ATOM   7357  C  CB    . TYR A 1 966  ? -25.840 -58.081  12.137  1.00 12.20  ? 967  TYR A CB    1 
ATOM   7358  C  CG    . TYR A 1 966  ? -25.395 -58.411  10.715  1.00 15.78  ? 967  TYR A CG    1 
ATOM   7359  C  CD1   . TYR A 1 966  ? -24.606 -59.499  10.380  1.00 15.54  ? 967  TYR A CD1   1 
ATOM   7360  C  CD2   . TYR A 1 966  ? -25.865 -57.612  9.675   1.00 15.21  ? 967  TYR A CD2   1 
ATOM   7361  C  CE1   . TYR A 1 966  ? -24.290 -59.785  9.056   1.00 16.95  ? 967  TYR A CE1   1 
ATOM   7362  C  CE2   . TYR A 1 966  ? -25.546 -57.864  8.355   1.00 16.04  ? 967  TYR A CE2   1 
ATOM   7363  C  CZ    . TYR A 1 966  ? -24.760 -58.952  8.053   1.00 18.34  ? 967  TYR A CZ    1 
ATOM   7364  O  OH    . TYR A 1 966  ? -24.459 -59.185  6.728   1.00 21.16  ? 967  TYR A OH    1 
ATOM   7365  N  N     . ASP A 1 967  ? -25.551 -57.980  15.391  1.00 13.68  ? 968  ASP A N     1 
ATOM   7366  C  CA    . ASP A 1 967  ? -26.268 -57.560  16.599  1.00 14.35  ? 968  ASP A CA    1 
ATOM   7367  C  C     . ASP A 1 967  ? -25.397 -57.530  17.851  1.00 13.82  ? 968  ASP A C     1 
ATOM   7368  O  O     . ASP A 1 967  ? -24.684 -56.553  18.101  1.00 14.81  ? 968  ASP A O     1 
ATOM   7369  C  CB    . ASP A 1 967  ? -27.467 -58.508  16.800  1.00 15.35  ? 968  ASP A CB    1 
ATOM   7370  C  CG    . ASP A 1 967  ? -28.587 -58.351  15.762  1.00 18.34  ? 968  ASP A CG    1 
ATOM   7371  O  OD1   . ASP A 1 967  ? -29.555 -59.165  15.768  1.00 14.92  ? 968  ASP A OD1   1 
ATOM   7372  O  OD2   . ASP A 1 967  ? -28.564 -57.430  14.921  1.00 19.59  ? 968  ASP A OD2   1 
ATOM   7373  N  N     . ILE A 1 968  ? -25.428 -58.572  18.684  1.00 13.74  ? 969  ILE A N     1 
ATOM   7374  C  CA    . ILE A 1 968  ? -24.758 -58.540  19.997  1.00 13.99  ? 969  ILE A CA    1 
ATOM   7375  C  C     . ILE A 1 968  ? -23.280 -58.230  19.946  1.00 14.23  ? 969  ILE A C     1 
ATOM   7376  O  O     . ILE A 1 968  ? -22.730 -57.554  20.799  1.00 12.94  ? 969  ILE A O     1 
ATOM   7377  C  CB    . ILE A 1 968  ? -25.044 -59.881  20.711  1.00 14.87  ? 969  ILE A CB    1 
ATOM   7378  C  CG1   . ILE A 1 968  ? -24.627 -59.766  22.217  1.00 16.20  ? 969  ILE A CG1   1 
ATOM   7379  C  CG2   . ILE A 1 968  ? -24.357 -61.078  20.068  1.00 14.53  ? 969  ILE A CG2   1 
ATOM   7380  C  CD1   . ILE A 1 968  ? -25.317 -60.901  22.995  1.00 13.54  ? 969  ILE A CD1   1 
ATOM   7381  N  N     . GLY A 1 969  ? -22.562 -58.817  18.981  1.00 13.72  ? 970  GLY A N     1 
ATOM   7382  C  CA    . GLY A 1 969  ? -21.114 -58.592  18.958  1.00 15.52  ? 970  GLY A CA    1 
ATOM   7383  C  C     . GLY A 1 969  ? -20.663 -57.479  18.033  1.00 12.72  ? 970  GLY A C     1 
ATOM   7384  O  O     . GLY A 1 969  ? -19.455 -57.254  17.830  1.00 12.41  ? 970  GLY A O     1 
ATOM   7385  N  N     . TYR A 1 970  ? -21.596 -56.711  17.508  1.00 14.72  ? 971  TYR A N     1 
ATOM   7386  C  CA    . TYR A 1 970  ? -21.233 -55.684  16.507  1.00 13.36  ? 971  TYR A CA    1 
ATOM   7387  C  C     . TYR A 1 970  ? -20.343 -54.619  17.045  1.00 12.44  ? 971  TYR A C     1 
ATOM   7388  O  O     . TYR A 1 970  ? -19.346 -54.186  16.425  1.00 14.52  ? 971  TYR A O     1 
ATOM   7389  C  CB    . TYR A 1 970  ? -22.541 -55.112  15.863  1.00 13.09  ? 971  TYR A CB    1 
ATOM   7390  C  CG    . TYR A 1 970  ? -22.305 -53.957  14.905  1.00 16.83  ? 971  TYR A CG    1 
ATOM   7391  C  CD1   . TYR A 1 970  ? -21.486 -54.135  13.796  1.00 14.74  ? 971  TYR A CD1   1 
ATOM   7392  C  CD2   . TYR A 1 970  ? -22.858 -52.701  15.113  1.00 13.58  ? 971  TYR A CD2   1 
ATOM   7393  C  CE1   . TYR A 1 970  ? -21.201 -53.114  12.939  1.00 17.13  ? 971  TYR A CE1   1 
ATOM   7394  C  CE2   . TYR A 1 970  ? -22.630 -51.650  14.202  1.00 14.91  ? 971  TYR A CE2   1 
ATOM   7395  C  CZ    . TYR A 1 970  ? -21.778 -51.858  13.150  1.00 16.05  ? 971  TYR A CZ    1 
ATOM   7396  O  OH    . TYR A 1 970  ? -21.420 -50.882  12.278  1.00 17.58  ? 971  TYR A OH    1 
ATOM   7397  N  N     . GLY A 1 971  ? -20.638 -54.125  18.247  1.00 12.50  ? 972  GLY A N     1 
ATOM   7398  C  CA    . GLY A 1 971  ? -19.831 -53.074  18.875  1.00 12.00  ? 972  GLY A CA    1 
ATOM   7399  C  C     . GLY A 1 971  ? -18.379 -53.499  19.014  1.00 15.06  ? 972  GLY A C     1 
ATOM   7400  O  O     . GLY A 1 971  ? -17.459 -52.734  18.720  1.00 14.16  ? 972  GLY A O     1 
ATOM   7401  N  N     . GLY A 1 972  ? -18.139 -54.727  19.475  1.00 16.02  ? 973  GLY A N     1 
ATOM   7402  C  CA    . GLY A 1 972  ? -16.766 -55.233  19.640  1.00 15.50  ? 973  GLY A CA    1 
ATOM   7403  C  C     . GLY A 1 972  ? -16.178 -55.492  18.228  1.00 16.20  ? 973  GLY A C     1 
ATOM   7404  O  O     . GLY A 1 972  ? -14.993 -55.280  17.941  1.00 14.90  ? 973  GLY A O     1 
ATOM   7405  N  N     . LEU A 1 973  ? -16.968 -56.086  17.335  1.00 14.34  ? 974  LEU A N     1 
ATOM   7406  C  CA    . LEU A 1 973  ? -16.490 -56.292  15.947  1.00 14.58  ? 974  LEU A CA    1 
ATOM   7407  C  C     . LEU A 1 973  ? -15.992 -54.975  15.318  1.00 16.44  ? 974  LEU A C     1 
ATOM   7408  O  O     . LEU A 1 973  ? -14.898 -54.942  14.751  1.00 18.17  ? 974  LEU A O     1 
ATOM   7409  C  CB    . LEU A 1 973  ? -17.620 -56.823  15.071  1.00 13.11  ? 974  LEU A CB    1 
ATOM   7410  C  CG    . LEU A 1 973  ? -17.236 -56.978  13.571  1.00 14.70  ? 974  LEU A CG    1 
ATOM   7411  C  CD1   . LEU A 1 973  ? -15.881 -57.662  13.395  1.00 15.68  ? 974  LEU A CD1   1 
ATOM   7412  C  CD2   . LEU A 1 973  ? -18.384 -57.767  12.959  1.00 15.76  ? 974  LEU A CD2   1 
ATOM   7413  N  N     . ASP A 1 974  ? -16.826 -53.948  15.397  1.00 13.84  ? 975  ASP A N     1 
ATOM   7414  C  CA    . ASP A 1 974  ? -16.497 -52.662  14.821  1.00 15.10  ? 975  ASP A CA    1 
ATOM   7415  C  C     . ASP A 1 974  ? -15.240 -52.086  15.502  1.00 16.24  ? 975  ASP A C     1 
ATOM   7416  O  O     . ASP A 1 974  ? -14.366 -51.578  14.803  1.00 13.73  ? 975  ASP A O     1 
ATOM   7417  C  CB    . ASP A 1 974  ? -17.682 -51.714  15.000  1.00 15.04  ? 975  ASP A CB    1 
ATOM   7418  C  CG    . ASP A 1 974  ? -17.461 -50.261  14.670  1.00 17.97  ? 975  ASP A CG    1 
ATOM   7419  O  OD1   . ASP A 1 974  ? -17.454 -49.453  15.640  1.00 17.50  ? 975  ASP A OD1   1 
ATOM   7420  O  OD2   . ASP A 1 974  ? -17.373 -49.942  13.490  1.00 16.77  ? 975  ASP A OD2   1 
ATOM   7421  N  N     . HIS A 1 975  ? -15.142 -52.190  16.830  1.00 13.04  ? 976  HIS A N     1 
ATOM   7422  C  CA    . HIS A 1 975  ? -13.917 -51.671  17.487  1.00 13.50  ? 976  HIS A CA    1 
ATOM   7423  C  C     . HIS A 1 975  ? -12.636 -52.397  17.050  1.00 13.30  ? 976  HIS A C     1 
ATOM   7424  O  O     . HIS A 1 975  ? -11.580 -51.791  16.781  1.00 9.70   ? 976  HIS A O     1 
ATOM   7425  C  CB    . HIS A 1 975  ? -14.062 -51.917  19.013  1.00 13.72  ? 976  HIS A CB    1 
ATOM   7426  C  CG    . HIS A 1 975  ? -13.060 -51.000  19.718  1.00 13.54  ? 976  HIS A CG    1 
ATOM   7427  N  ND1   . HIS A 1 975  ? -11.879 -51.491  20.230  1.00 16.12  ? 976  HIS A ND1   1 
ATOM   7428  C  CD2   . HIS A 1 975  ? -13.082 -49.701  19.954  1.00 13.57  ? 976  HIS A CD2   1 
ATOM   7429  C  CE1   . HIS A 1 975  ? -11.207 -50.472  20.785  1.00 14.39  ? 976  HIS A CE1   1 
ATOM   7430  N  NE2   . HIS A 1 975  ? -11.937 -49.401  20.629  1.00 16.14  ? 976  HIS A NE2   1 
ATOM   7431  N  N     . VAL A 1 976  ? -12.752 -53.727  16.923  1.00 11.25  ? 977  VAL A N     1 
ATOM   7432  C  CA    . VAL A 1 976  ? -11.559 -54.557  16.601  1.00 11.79  ? 977  VAL A CA    1 
ATOM   7433  C  C     . VAL A 1 976  ? -11.136 -54.265  15.149  1.00 11.52  ? 977  VAL A C     1 
ATOM   7434  O  O     . VAL A 1 976  ? -9.953  -54.155  14.820  1.00 11.95  ? 977  VAL A O     1 
ATOM   7435  C  CB    . VAL A 1 976  ? -11.919 -56.047  16.806  1.00 13.30  ? 977  VAL A CB    1 
ATOM   7436  C  CG1   . VAL A 1 976  ? -10.931 -56.974  16.071  1.00 13.22  ? 977  VAL A CG1   1 
ATOM   7437  C  CG2   . VAL A 1 976  ? -12.000 -56.335  18.316  1.00 10.06  ? 977  VAL A CG2   1 
ATOM   7438  N  N     . LEU A 1 977  ? -12.117 -54.142  14.260  1.00 11.04  ? 978  LEU A N     1 
ATOM   7439  C  CA    . LEU A 1 977  ? -11.716 -53.778  12.863  1.00 14.87  ? 978  LEU A CA    1 
ATOM   7440  C  C     . LEU A 1 977  ? -11.116 -52.364  12.797  1.00 14.93  ? 978  LEU A C     1 
ATOM   7441  O  O     . LEU A 1 977  ? -10.131 -52.112  12.060  1.00 14.91  ? 978  LEU A O     1 
ATOM   7442  C  CB    . LEU A 1 977  ? -12.896 -53.881  11.914  1.00 15.27  ? 978  LEU A CB    1 
ATOM   7443  C  CG    . LEU A 1 977  ? -13.562 -55.251  11.827  1.00 14.54  ? 978  LEU A CG    1 
ATOM   7444  C  CD1   . LEU A 1 977  ? -14.881 -55.151  11.063  1.00 14.75  ? 978  LEU A CD1   1 
ATOM   7445  C  CD2   . LEU A 1 977  ? -12.599 -56.202  11.113  1.00 15.42  ? 978  LEU A CD2   1 
ATOM   7446  N  N     . ALA A 1 978  ? -11.707 -51.438  13.571  1.00 12.26  ? 979  ALA A N     1 
ATOM   7447  C  CA    . ALA A 1 978  ? -11.149 -50.092  13.616  1.00 14.22  ? 979  ALA A CA    1 
ATOM   7448  C  C     . ALA A 1 978  ? -9.754  -50.027  14.236  1.00 15.82  ? 979  ALA A C     1 
ATOM   7449  O  O     . ALA A 1 978  ? -9.001  -49.087  13.963  1.00 14.35  ? 979  ALA A O     1 
ATOM   7450  C  CB    . ALA A 1 978  ? -12.091 -49.185  14.380  1.00 13.66  ? 979  ALA A CB    1 
ATOM   7451  N  N     . SER A 1 979  ? -9.349  -51.110  14.911  1.00 16.03  ? 980  SER A N     1 
ATOM   7452  C  CA    . SER A 1 979  ? -8.045  -51.130  15.550  1.00 17.68  ? 980  SER A CA    1 
ATOM   7453  C  C     . SER A 1 979  ? -6.886  -51.104  14.550  1.00 18.14  ? 980  SER A C     1 
ATOM   7454  O  O     . SER A 1 979  ? -5.739  -50.746  14.931  1.00 17.92  ? 980  SER A O     1 
ATOM   7455  C  CB    . SER A 1 979  ? -7.834  -52.320  16.498  1.00 20.79  ? 980  SER A CB    1 
ATOM   7456  O  OG    . SER A 1 979  ? -7.597  -53.507  15.675  1.00 23.67  ? 980  SER A OG    1 
ATOM   7457  N  N     . GLY A 1 980  ? -7.155  -51.541  13.332  1.00 18.19  ? 981  GLY A N     1 
ATOM   7458  C  CA    . GLY A 1 980  ? -6.093  -51.607  12.342  1.00 17.98  ? 981  GLY A CA    1 
ATOM   7459  C  C     . GLY A 1 980  ? -5.184  -52.823  12.518  1.00 20.57  ? 981  GLY A C     1 
ATOM   7460  O  O     . GLY A 1 980  ? -4.263  -52.981  11.691  1.00 20.52  ? 981  GLY A O     1 
ATOM   7461  N  N     . GLU A 1 981  ? -5.390  -53.732  13.468  1.00 19.54  ? 982  GLU A N     1 
ATOM   7462  C  CA    . GLU A 1 981  ? -4.497  -54.890  13.587  1.00 21.06  ? 982  GLU A CA    1 
ATOM   7463  C  C     . GLU A 1 981  ? -4.802  -56.059  12.683  1.00 17.29  ? 982  GLU A C     1 
ATOM   7464  O  O     . GLU A 1 981  ? -5.902  -56.212  12.173  1.00 15.92  ? 982  GLU A O     1 
ATOM   7465  C  CB    . GLU A 1 981  ? -4.465  -55.319  15.075  1.00 24.31  ? 982  GLU A CB    1 
ATOM   7466  C  CG    . GLU A 1 981  ? -4.332  -54.020  15.883  1.00 30.50  ? 982  GLU A CG    1 
ATOM   7467  C  CD    . GLU A 1 981  ? -3.710  -54.218  17.229  1.00 35.74  ? 982  GLU A CD    1 
ATOM   7468  O  OE1   . GLU A 1 981  ? -3.611  -53.231  18.013  1.00 40.15  ? 982  GLU A OE1   1 
ATOM   7469  O  OE2   . GLU A 1 981  ? -3.320  -55.366  17.505  1.00 37.38  ? 982  GLU A OE2   1 
ATOM   7470  N  N     . ASP A 1 982  ? -3.861  -56.992  12.518  1.00 17.62  ? 983  ASP A N     1 
ATOM   7471  C  CA    . ASP A 1 982  ? -3.999  -58.122  11.614  1.00 17.39  ? 983  ASP A CA    1 
ATOM   7472  C  C     . ASP A 1 982  ? -4.800  -59.278  12.201  1.00 17.73  ? 983  ASP A C     1 
ATOM   7473  O  O     . ASP A 1 982  ? -4.236  -60.240  12.708  1.00 17.79  ? 983  ASP A O     1 
ATOM   7474  C  CB    . ASP A 1 982  ? -2.612  -58.595  11.189  1.00 19.61  ? 983  ASP A CB    1 
ATOM   7475  C  CG    . ASP A 1 982  ? -2.542  -59.674  10.142  1.00 19.56  ? 983  ASP A CG    1 
ATOM   7476  O  OD1   . ASP A 1 982  ? -1.374  -60.066  9.889   1.00 21.61  ? 983  ASP A OD1   1 
ATOM   7477  O  OD2   . ASP A 1 982  ? -3.567  -60.124  9.622   1.00 18.53  ? 983  ASP A OD2   1 
ATOM   7478  N  N     . VAL A 1 983  ? -6.114  -59.211  12.031  1.00 17.17  ? 984  VAL A N     1 
ATOM   7479  C  CA    . VAL A 1 983  ? -7.009  -60.304  12.376  1.00 16.32  ? 984  VAL A CA    1 
ATOM   7480  C  C     . VAL A 1 983  ? -7.953  -60.485  11.186  1.00 16.05  ? 984  VAL A C     1 
ATOM   7481  O  O     . VAL A 1 983  ? -8.141  -59.491  10.454  1.00 17.37  ? 984  VAL A O     1 
ATOM   7482  C  CB    . VAL A 1 983  ? -7.815  -60.015  13.651  1.00 17.73  ? 984  VAL A CB    1 
ATOM   7483  C  CG1   . VAL A 1 983  ? -6.817  -59.731  14.789  1.00 16.55  ? 984  VAL A CG1   1 
ATOM   7484  C  CG2   . VAL A 1 983  ? -8.669  -58.759  13.528  1.00 17.64  ? 984  VAL A CG2   1 
ATOM   7485  N  N     . ASN A 1 984  ? -8.501  -61.682  11.083  1.00 14.80  ? 985  ASN A N     1 
ATOM   7486  C  CA    . ASN A 1 984  ? -9.361  -61.989  9.948   1.00 16.69  ? 985  ASN A CA    1 
ATOM   7487  C  C     . ASN A 1 984  ? -10.766 -62.385  10.492  1.00 17.99  ? 985  ASN A C     1 
ATOM   7488  O  O     . ASN A 1 984  ? -10.842 -63.352  11.271  1.00 22.19  ? 985  ASN A O     1 
ATOM   7489  C  CB    . ASN A 1 984  ? -8.706  -63.192  9.285   1.00 14.98  ? 985  ASN A CB    1 
ATOM   7490  C  CG    . ASN A 1 984  ? -7.267  -62.851  8.868   1.00 16.17  ? 985  ASN A CG    1 
ATOM   7491  O  OD1   . ASN A 1 984  ? -7.137  -61.977  8.012   1.00 15.31  ? 985  ASN A OD1   1 
ATOM   7492  N  ND2   . ASN A 1 984  ? -6.265  -63.451  9.454   1.00 13.93  ? 985  ASN A ND2   1 
ATOM   7493  N  N     . VAL A 1 985  ? -11.789 -61.701  10.020  1.00 17.28  ? 986  VAL A N     1 
ATOM   7494  C  CA    . VAL A 1 985  ? -13.120 -62.021  10.531  1.00 17.22  ? 986  VAL A CA    1 
ATOM   7495  C  C     . VAL A 1 985  ? -13.953 -62.675  9.439   1.00 17.29  ? 986  VAL A C     1 
ATOM   7496  O  O     . VAL A 1 985  ? -14.009 -62.138  8.340   1.00 17.89  ? 986  VAL A O     1 
ATOM   7497  C  CB    . VAL A 1 985  ? -13.873 -61.025  11.387  1.00 18.66  ? 986  VAL A CB    1 
ATOM   7498  C  CG1   . VAL A 1 985  ? -13.206 -59.737  11.769  1.00 20.56  ? 986  VAL A CG1   1 
ATOM   7499  C  CG2   . VAL A 1 985  ? -15.376 -60.963  11.276  1.00 14.38  ? 986  VAL A CG2   1 
ATOM   7500  N  N     . PHE A 1 986  ? -14.483 -63.852  9.806   1.00 17.48  ? 987  PHE A N     1 
ATOM   7501  C  CA    . PHE A 1 986  ? -15.280 -64.551  8.765   1.00 16.12  ? 987  PHE A CA    1 
ATOM   7502  C  C     . PHE A 1 986  ? -16.674 -64.702  9.350   1.00 17.43  ? 987  PHE A C     1 
ATOM   7503  O  O     . PHE A 1 986  ? -16.849 -65.430  10.317  1.00 16.86  ? 987  PHE A O     1 
ATOM   7504  C  CB    . PHE A 1 986  ? -14.637 -65.895  8.410   1.00 17.47  ? 987  PHE A CB    1 
ATOM   7505  C  CG    . PHE A 1 986  ? -15.374 -66.667  7.345   1.00 20.79  ? 987  PHE A CG    1 
ATOM   7506  C  CD1   . PHE A 1 986  ? -15.294 -66.225  6.020   1.00 19.66  ? 987  PHE A CD1   1 
ATOM   7507  C  CD2   . PHE A 1 986  ? -16.102 -67.812  7.633   1.00 20.99  ? 987  PHE A CD2   1 
ATOM   7508  C  CE1   . PHE A 1 986  ? -15.942 -66.887  4.981   1.00 21.04  ? 987  PHE A CE1   1 
ATOM   7509  C  CE2   . PHE A 1 986  ? -16.752 -68.473  6.597   1.00 21.65  ? 987  PHE A CE2   1 
ATOM   7510  C  CZ    . PHE A 1 986  ? -16.690 -68.008  5.306   1.00 19.51  ? 987  PHE A CZ    1 
ATOM   7511  N  N     . VAL A 1 987  ? -17.660 -64.095  8.703   1.00 16.44  ? 988  VAL A N     1 
ATOM   7512  C  CA    . VAL A 1 987  ? -19.044 -64.168  9.170   1.00 16.71  ? 988  VAL A CA    1 
ATOM   7513  C  C     . VAL A 1 987  ? -19.817 -65.125  8.263   1.00 17.72  ? 988  VAL A C     1 
ATOM   7514  O  O     . VAL A 1 987  ? -19.854 -64.943  7.050   1.00 16.82  ? 988  VAL A O     1 
ATOM   7515  C  CB    . VAL A 1 987  ? -19.691 -62.765  9.067   1.00 15.84  ? 988  VAL A CB    1 
ATOM   7516  C  CG1   . VAL A 1 987  ? -21.168 -62.762  9.410   1.00 12.64  ? 988  VAL A CG1   1 
ATOM   7517  C  CG2   . VAL A 1 987  ? -18.908 -61.729  9.946   1.00 13.64  ? 988  VAL A CG2   1 
ATOM   7518  N  N     . MET A 1 988  ? -20.389 -66.142  8.895   1.00 17.65  ? 989  MET A N     1 
ATOM   7519  C  CA    . MET A 1 988  ? -21.293 -67.039  8.181   1.00 17.84  ? 989  MET A CA    1 
ATOM   7520  C  C     . MET A 1 988  ? -22.675 -66.417  8.340   1.00 19.54  ? 989  MET A C     1 
ATOM   7521  O  O     . MET A 1 988  ? -23.271 -66.542  9.406   1.00 18.91  ? 989  MET A O     1 
ATOM   7522  C  CB    . MET A 1 988  ? -21.161 -68.412  8.837   1.00 18.50  ? 989  MET A CB    1 
ATOM   7523  C  CG    . MET A 1 988  ? -19.897 -69.149  8.344   1.00 22.37  ? 989  MET A CG    1 
ATOM   7524  S  SD    . MET A 1 988  ? -19.263 -70.263  9.614   1.00 25.95  ? 989  MET A SD    1 
ATOM   7525  C  CE    . MET A 1 988  ? -20.343 -70.109  11.005  1.00 32.97  ? 989  MET A CE    1 
ATOM   7526  N  N     . ASP A 1 989  ? -23.167 -65.754  7.322   1.00 19.47  ? 990  ASP A N     1 
ATOM   7527  C  CA    . ASP A 1 989  ? -24.463 -65.080  7.368   1.00 20.11  ? 990  ASP A CA    1 
ATOM   7528  C  C     . ASP A 1 989  ? -25.575 -66.059  6.996   1.00 20.27  ? 990  ASP A C     1 
ATOM   7529  O  O     . ASP A 1 989  ? -25.687 -66.378  5.798   1.00 21.23  ? 990  ASP A O     1 
ATOM   7530  C  CB    . ASP A 1 989  ? -24.453 -63.885  6.417   1.00 19.98  ? 990  ASP A CB    1 
ATOM   7531  C  CG    . ASP A 1 989  ? -25.606 -62.925  6.669   1.00 20.97  ? 990  ASP A CG    1 
ATOM   7532  O  OD1   . ASP A 1 989  ? -26.558 -63.343  7.391   1.00 20.91  ? 990  ASP A OD1   1 
ATOM   7533  O  OD2   . ASP A 1 989  ? -25.532 -61.789  6.182   1.00 20.47  ? 990  ASP A OD2   1 
ATOM   7534  N  N     . THR A 1 990  ? -26.347 -66.476  7.982   1.00 19.02  ? 991  THR A N     1 
ATOM   7535  C  CA    . THR A 1 990  ? -27.483 -67.355  7.714   1.00 19.62  ? 991  THR A CA    1 
ATOM   7536  C  C     . THR A 1 990  ? -28.748 -66.532  7.718   1.00 19.12  ? 991  THR A C     1 
ATOM   7537  O  O     . THR A 1 990  ? -29.847 -67.057  7.560   1.00 16.40  ? 991  THR A O     1 
ATOM   7538  C  CB    . THR A 1 990  ? -27.661 -68.504  8.738   1.00 19.47  ? 991  THR A CB    1 
ATOM   7539  O  OG1   . THR A 1 990  ? -28.039 -67.966  10.014  1.00 18.89  ? 991  THR A OG1   1 
ATOM   7540  C  CG2   . THR A 1 990  ? -26.429 -69.393  8.826   1.00 21.17  ? 991  THR A CG2   1 
ATOM   7541  N  N     . GLU A 1 991  ? -28.600 -65.196  7.805   1.00 19.77  ? 992  GLU A N     1 
ATOM   7542  C  CA    . GLU A 1 991  ? -29.732 -64.259  7.783   1.00 18.69  ? 992  GLU A CA    1 
ATOM   7543  C  C     . GLU A 1 991  ? -30.811 -64.519  8.823   1.00 18.98  ? 992  GLU A C     1 
ATOM   7544  O  O     . GLU A 1 991  ? -31.952 -64.061  8.730   1.00 17.18  ? 992  GLU A O     1 
ATOM   7545  C  CB    . GLU A 1 991  ? -30.344 -64.098  6.373   1.00 19.43  ? 992  GLU A CB    1 
ATOM   7546  C  CG    . GLU A 1 991  ? -29.286 -63.711  5.369   1.00 21.42  ? 992  GLU A CG    1 
ATOM   7547  C  CD    . GLU A 1 991  ? -29.793 -63.186  4.029   1.00 25.23  ? 992  GLU A CD    1 
ATOM   7548  O  OE1   . GLU A 1 991  ? -30.747 -63.807  3.450   1.00 24.20  ? 992  GLU A OE1   1 
ATOM   7549  O  OE2   . GLU A 1 991  ? -29.288 -62.117  3.588   1.00 21.53  ? 992  GLU A OE2   1 
ATOM   7550  N  N     . VAL A 1 992  ? -30.399 -65.177  9.904   1.00 17.37  ? 993  VAL A N     1 
ATOM   7551  C  CA    . VAL A 1 992  ? -31.198 -65.504  11.093  1.00 18.52  ? 993  VAL A CA    1 
ATOM   7552  C  C     . VAL A 1 992  ? -30.260 -65.961  12.209  1.00 19.34  ? 993  VAL A C     1 
ATOM   7553  O  O     . VAL A 1 992  ? -29.112 -66.375  11.977  1.00 17.58  ? 993  VAL A O     1 
ATOM   7554  C  CB    . VAL A 1 992  ? -32.200 -66.576  10.588  1.00 23.05  ? 993  VAL A CB    1 
ATOM   7555  C  CG1   . VAL A 1 992  ? -31.701 -68.012  10.743  1.00 19.80  ? 993  VAL A CG1   1 
ATOM   7556  C  CG2   . VAL A 1 992  ? -33.643 -66.369  10.974  1.00 20.48  ? 993  VAL A CG2   1 
ATOM   7557  N  N     . TYR A 1 993  ? -30.683 -65.916  13.488  1.00 17.64  ? 994  TYR A N     1 
ATOM   7558  C  CA    . TYR A 1 993  ? -30.013 -66.566  14.580  1.00 18.36  ? 994  TYR A CA    1 
ATOM   7559  C  C     . TYR A 1 993  ? -30.453 -68.045  14.405  1.00 18.08  ? 994  TYR A C     1 
ATOM   7560  O  O     . TYR A 1 993  ? -31.621 -68.327  14.756  1.00 17.96  ? 994  TYR A O     1 
ATOM   7561  C  CB    . TYR A 1 993  ? -30.534 -66.129  15.971  1.00 20.60  ? 994  TYR A CB    1 
ATOM   7562  C  CG    . TYR A 1 993  ? -30.175 -64.746  16.427  1.00 22.05  ? 994  TYR A CG    1 
ATOM   7563  C  CD1   . TYR A 1 993  ? -30.976 -63.667  16.166  1.00 24.97  ? 994  TYR A CD1   1 
ATOM   7564  C  CD2   . TYR A 1 993  ? -29.017 -64.488  17.189  1.00 25.50  ? 994  TYR A CD2   1 
ATOM   7565  C  CE1   . TYR A 1 993  ? -30.664 -62.368  16.586  1.00 22.95  ? 994  TYR A CE1   1 
ATOM   7566  C  CE2   . TYR A 1 993  ? -28.679 -63.203  17.621  1.00 22.34  ? 994  TYR A CE2   1 
ATOM   7567  C  CZ    . TYR A 1 993  ? -29.547 -62.151  17.308  1.00 23.29  ? 994  TYR A CZ    1 
ATOM   7568  O  OH    . TYR A 1 993  ? -29.300 -60.878  17.726  1.00 23.01  ? 994  TYR A OH    1 
ATOM   7569  N  N     . SER A 1 994  ? -29.577 -68.862  13.841  1.00 16.53  ? 995  SER A N     1 
ATOM   7570  C  CA    . SER A 1 994  ? -30.040 -70.238  13.533  1.00 17.93  ? 995  SER A CA    1 
ATOM   7571  C  C     . SER A 1 994  ? -30.071 -71.190  14.702  1.00 16.36  ? 995  SER A C     1 
ATOM   7572  O  O     . SER A 1 994  ? -31.106 -71.838  14.981  1.00 20.53  ? 995  SER A O     1 
ATOM   7573  C  CB    . SER A 1 994  ? -29.096 -70.818  12.471  1.00 17.65  ? 995  SER A CB    1 
ATOM   7574  O  OG    . SER A 1 994  ? -29.137 -70.086  11.249  1.00 18.09  ? 995  SER A OG    1 
ATOM   7575  N  N     . ASN A 1 995  ? -28.969 -71.366  15.433  1.00 16.50  ? 996  ASN A N     1 
ATOM   7576  C  CA    . ASN A 1 995  ? -28.893 -72.340  16.498  1.00 18.69  ? 996  ASN A CA    1 
ATOM   7577  C  C     . ASN A 1 995  ? -30.011 -72.263  17.519  1.00 19.92  ? 996  ASN A C     1 
ATOM   7578  O  O     . ASN A 1 995  ? -30.538 -73.302  18.016  1.00 18.42  ? 996  ASN A O     1 
ATOM   7579  C  CB    . ASN A 1 995  ? -27.528 -72.257  17.207  1.00 21.29  ? 996  ASN A CB    1 
ATOM   7580  C  CG    . ASN A 1 995  ? -27.340 -73.460  18.109  1.00 25.79  ? 996  ASN A CG    1 
ATOM   7581  O  OD1   . ASN A 1 995  ? -27.073 -74.542  17.614  1.00 27.99  ? 996  ASN A OD1   1 
ATOM   7582  N  ND2   . ASN A 1 995  ? -27.553 -73.313  19.422  1.00 31.06  ? 996  ASN A ND2   1 
ATOM   7583  N  N     . THR A 1 996  ? -30.358 -71.035  17.902  1.00 16.81  ? 997  THR A N     1 
ATOM   7584  C  CA    . THR A 1 996  ? -31.438 -70.829  18.885  1.00 18.67  ? 997  THR A CA    1 
ATOM   7585  C  C     . THR A 1 996  ? -32.860 -70.995  18.367  1.00 19.15  ? 997  THR A C     1 
ATOM   7586  O  O     . THR A 1 996  ? -33.846 -70.769  19.106  1.00 19.79  ? 997  THR A O     1 
ATOM   7587  C  CB    . THR A 1 996  ? -31.437 -69.371  19.457  1.00 19.97  ? 997  THR A CB    1 
ATOM   7588  O  OG1   . THR A 1 996  ? -30.964 -68.473  18.459  1.00 21.44  ? 997  THR A OG1   1 
ATOM   7589  C  CG2   . THR A 1 996  ? -30.473 -69.247  20.631  1.00 19.55  ? 997  THR A CG2   1 
ATOM   7590  N  N     . GLY A 1 997  ? -32.999 -71.254  17.052  1.00 17.87  ? 998  GLY A N     1 
ATOM   7591  C  CA    . GLY A 1 997  ? -34.320 -71.464  16.524  1.00 17.43  ? 998  GLY A CA    1 
ATOM   7592  C  C     . GLY A 1 997  ? -34.939 -70.492  15.560  1.00 18.16  ? 998  GLY A C     1 
ATOM   7593  O  O     . GLY A 1 997  ? -36.172 -70.361  15.478  1.00 18.90  ? 998  GLY A O     1 
ATOM   7594  N  N     . GLY A 1 998  ? -34.109 -69.846  14.741  1.00 20.12  ? 999  GLY A N     1 
ATOM   7595  C  CA    . GLY A 1 998  ? -34.600 -69.048  13.636  1.00 20.28  ? 999  GLY A CA    1 
ATOM   7596  C  C     . GLY A 1 998  ? -35.161 -67.688  13.992  1.00 22.26  ? 999  GLY A C     1 
ATOM   7597  O  O     . GLY A 1 998  ? -36.089 -67.327  13.264  1.00 20.02  ? 999  GLY A O     1 
ATOM   7598  N  N     . GLN A 1 999  ? -34.511 -66.942  14.925  1.00 18.93  ? 1000 GLN A N     1 
ATOM   7599  C  CA    . GLN A 1 999  ? -35.026 -65.594  15.152  1.00 19.02  ? 1000 GLN A CA    1 
ATOM   7600  C  C     . GLN A 1 999  ? -34.440 -64.596  14.167  1.00 18.24  ? 1000 GLN A C     1 
ATOM   7601  O  O     . GLN A 1 999  ? -33.307 -64.709  13.716  1.00 19.26  ? 1000 GLN A O     1 
ATOM   7602  C  CB    . GLN A 1 999  ? -34.707 -65.129  16.572  1.00 20.53  ? 1000 GLN A CB    1 
ATOM   7603  C  CG    . GLN A 1 999  ? -35.388 -66.043  17.609  1.00 19.27  ? 1000 GLN A CG    1 
ATOM   7604  C  CD    . GLN A 1 999  ? -34.561 -67.283  17.914  1.00 20.27  ? 1000 GLN A CD    1 
ATOM   7605  O  OE1   . GLN A 1 999  ? -35.165 -68.262  18.433  1.00 23.94  ? 1000 GLN A OE1   1 
ATOM   7606  N  NE2   . GLN A 1 999  ? -33.278 -67.362  17.654  1.00 15.05  ? 1000 GLN A NE2   1 
ATOM   7607  N  N     . SER A 1 1000 ? -35.190 -63.533  13.880  1.00 17.61  ? 1001 SER A N     1 
ATOM   7608  C  CA    . SER A 1 1000 ? -34.785 -62.418  13.056  1.00 17.84  ? 1001 SER A CA    1 
ATOM   7609  C  C     . SER A 1 1000 ? -33.531 -61.747  13.641  1.00 18.66  ? 1001 SER A C     1 
ATOM   7610  O  O     . SER A 1 1000 ? -33.471 -61.601  14.876  1.00 19.00  ? 1001 SER A O     1 
ATOM   7611  C  CB    . SER A 1 1000 ? -35.862 -61.286  13.143  1.00 17.92  ? 1001 SER A CB    1 
ATOM   7612  O  OG    . SER A 1 1000 ? -35.416 -60.293  12.219  1.00 24.13  ? 1001 SER A OG    1 
ATOM   7613  N  N     . SER A 1 1001 ? -32.597 -61.399  12.796  1.00 17.40  ? 1002 SER A N     1 
ATOM   7614  C  CA    . SER A 1 1001 ? -31.429 -60.627  13.186  1.00 20.10  ? 1002 SER A CA    1 
ATOM   7615  C  C     . SER A 1 1001 ? -31.368 -59.372  12.322  1.00 19.41  ? 1002 SER A C     1 
ATOM   7616  O  O     . SER A 1 1001 ? -32.150 -59.277  11.348  1.00 19.64  ? 1002 SER A O     1 
ATOM   7617  C  CB    . SER A 1 1001 ? -30.131 -61.425  13.036  1.00 19.63  ? 1002 SER A CB    1 
ATOM   7618  O  OG    . SER A 1 1001 ? -29.664 -61.307  11.711  1.00 20.88  ? 1002 SER A OG    1 
ATOM   7619  N  N     . LYS A 1 1002 ? -30.488 -58.406  12.596  1.00 18.61  ? 1003 LYS A N     1 
ATOM   7620  C  CA    . LYS A 1 1002 ? -30.490 -57.235  11.687  1.00 18.04  ? 1003 LYS A CA    1 
ATOM   7621  C  C     . LYS A 1 1002 ? -29.972 -57.680  10.323  1.00 16.19  ? 1003 LYS A C     1 
ATOM   7622  O  O     . LYS A 1 1002 ? -30.091 -56.952  9.353   1.00 17.42  ? 1003 LYS A O     1 
ATOM   7623  C  CB    . LYS A 1 1002 ? -29.796 -55.996  12.236  1.00 15.23  ? 1003 LYS A CB    1 
ATOM   7624  C  CG    . LYS A 1 1002 ? -30.598 -55.328  13.376  1.00 16.22  ? 1003 LYS A CG    1 
ATOM   7625  C  CD    . LYS A 1 1002 ? -30.018 -53.952  13.668  1.00 14.15  ? 1003 LYS A CD    1 
ATOM   7626  C  CE    . LYS A 1 1002 ? -28.595 -54.022  14.204  1.00 18.04  ? 1003 LYS A CE    1 
ATOM   7627  N  NZ    . LYS A 1 1002 ? -28.541 -54.562  15.590  1.00 15.83  ? 1003 LYS A NZ    1 
ATOM   7628  N  N     . ALA A 1 1003 ? -29.436 -58.918  10.196  1.00 14.83  ? 1004 ALA A N     1 
ATOM   7629  C  CA    . ALA A 1 1003 ? -29.027 -59.344  8.857   1.00 17.96  ? 1004 ALA A CA    1 
ATOM   7630  C  C     . ALA A 1 1003 ? -30.225 -59.947  8.090   1.00 17.41  ? 1004 ALA A C     1 
ATOM   7631  O  O     . ALA A 1 1003 ? -30.048 -60.320  6.928   1.00 18.25  ? 1004 ALA A O     1 
ATOM   7632  C  CB    . ALA A 1 1003 ? -27.842 -60.300  8.866   1.00 16.76  ? 1004 ALA A CB    1 
ATOM   7633  N  N     . THR A 1 1004 ? -31.361 -60.124  8.800   1.00 16.43  ? 1005 THR A N     1 
ATOM   7634  C  CA    . THR A 1 1004 ? -32.499 -60.774  8.104   1.00 19.72  ? 1005 THR A CA    1 
ATOM   7635  C  C     . THR A 1 1004 ? -33.034 -59.785  7.059   1.00 18.64  ? 1005 THR A C     1 
ATOM   7636  O  O     . THR A 1 1004 ? -33.056 -58.607  7.399   1.00 18.59  ? 1005 THR A O     1 
ATOM   7637  C  CB    . THR A 1 1004 ? -33.584 -61.152  9.122   1.00 16.73  ? 1005 THR A CB    1 
ATOM   7638  O  OG1   . THR A 1 1004 ? -33.004 -62.114  10.063  1.00 15.24  ? 1005 THR A OG1   1 
ATOM   7639  C  CG2   . THR A 1 1004 ? -34.853 -61.763  8.513   1.00 16.19  ? 1005 THR A CG2   1 
ATOM   7640  N  N     . PRO A 1 1005 ? -33.417 -60.251  5.883   1.00 20.06  ? 1006 PRO A N     1 
ATOM   7641  C  CA    . PRO A 1 1005 ? -33.843 -59.317  4.849   1.00 20.57  ? 1006 PRO A CA    1 
ATOM   7642  C  C     . PRO A 1 1005 ? -35.322 -58.953  4.861   1.00 19.90  ? 1006 PRO A C     1 
ATOM   7643  O  O     . PRO A 1 1005 ? -36.176 -59.635  5.440   1.00 19.95  ? 1006 PRO A O     1 
ATOM   7644  C  CB    . PRO A 1 1005 ? -33.466 -60.074  3.558   1.00 20.33  ? 1006 PRO A CB    1 
ATOM   7645  C  CG    . PRO A 1 1005 ? -33.881 -61.481  3.945   1.00 20.82  ? 1006 PRO A CG    1 
ATOM   7646  C  CD    . PRO A 1 1005 ? -33.355 -61.633  5.392   1.00 21.21  ? 1006 PRO A CD    1 
ATOM   7647  N  N     . THR A 1 1006 ? -35.618 -57.866  4.174   1.00 21.98  ? 1007 THR A N     1 
ATOM   7648  C  CA    . THR A 1 1006 ? -37.034 -57.442  4.025   1.00 23.53  ? 1007 THR A CA    1 
ATOM   7649  C  C     . THR A 1 1006 ? -37.911 -58.596  3.585   1.00 22.10  ? 1007 THR A C     1 
ATOM   7650  O  O     . THR A 1 1006 ? -37.474 -59.306  2.667   1.00 22.55  ? 1007 THR A O     1 
ATOM   7651  C  CB    . THR A 1 1006 ? -37.100 -56.384  2.909   1.00 24.65  ? 1007 THR A CB    1 
ATOM   7652  O  OG1   . THR A 1 1006 ? -36.528 -55.159  3.349   1.00 25.19  ? 1007 THR A OG1   1 
ATOM   7653  C  CG2   . THR A 1 1006 ? -38.540 -56.115  2.417   1.00 26.27  ? 1007 THR A CG2   1 
ATOM   7654  N  N     . GLY A 1 1007 ? -39.028 -58.804  4.255   1.00 25.01  ? 1008 GLY A N     1 
ATOM   7655  C  CA    . GLY A 1 1007 ? -40.012 -59.772  3.799   1.00 24.42  ? 1008 GLY A CA    1 
ATOM   7656  C  C     . GLY A 1 1007 ? -39.747 -61.205  4.221   1.00 23.67  ? 1008 GLY A C     1 
ATOM   7657  O  O     . GLY A 1 1007 ? -40.553 -62.088  3.936   1.00 21.82  ? 1008 GLY A O     1 
ATOM   7658  N  N     . ALA A 1 1008 ? -38.549 -61.449  4.788   1.00 21.94  ? 1009 ALA A N     1 
ATOM   7659  C  CA    . ALA A 1 1008 ? -38.283 -62.812  5.248   1.00 23.71  ? 1009 ALA A CA    1 
ATOM   7660  C  C     . ALA A 1 1008 ? -39.082 -63.104  6.522   1.00 22.54  ? 1009 ALA A C     1 
ATOM   7661  O  O     . ALA A 1 1008 ? -39.141 -62.228  7.406   1.00 24.60  ? 1009 ALA A O     1 
ATOM   7662  C  CB    . ALA A 1 1008 ? -36.805 -63.048  5.538   1.00 24.11  ? 1009 ALA A CB    1 
ATOM   7663  N  N     . VAL A 1 1009 ? -39.623 -64.323  6.603   1.00 22.32  ? 1010 VAL A N     1 
ATOM   7664  C  CA    . VAL A 1 1009 ? -40.348 -64.746  7.782   1.00 19.45  ? 1010 VAL A CA    1 
ATOM   7665  C  C     . VAL A 1 1009 ? -39.344 -65.431  8.727   1.00 20.79  ? 1010 VAL A C     1 
ATOM   7666  O  O     . VAL A 1 1009 ? -38.634 -66.389  8.385   1.00 18.68  ? 1010 VAL A O     1 
ATOM   7667  C  CB    . VAL A 1 1009 ? -41.504 -65.703  7.439   1.00 20.64  ? 1010 VAL A CB    1 
ATOM   7668  C  CG1   . VAL A 1 1009 ? -42.206 -66.255  8.679   1.00 19.89  ? 1010 VAL A CG1   1 
ATOM   7669  C  CG2   . VAL A 1 1009 ? -42.518 -64.902  6.606   1.00 20.47  ? 1010 VAL A CG2   1 
ATOM   7670  N  N     . ALA A 1 1010 ? -39.358 -64.946  9.953   1.00 20.92  ? 1011 ALA A N     1 
ATOM   7671  C  CA    . ALA A 1 1010 ? -38.487 -65.492  11.005  1.00 21.90  ? 1011 ALA A CA    1 
ATOM   7672  C  C     . ALA A 1 1010 ? -39.129 -65.204  12.358  1.00 21.22  ? 1011 ALA A C     1 
ATOM   7673  O  O     . ALA A 1 1010 ? -40.073 -64.366  12.382  1.00 19.29  ? 1011 ALA A O     1 
ATOM   7674  C  CB    . ALA A 1 1010 ? -37.140 -64.774  10.875  1.00 20.93  ? 1011 ALA A CB    1 
ATOM   7675  N  N     . LYS A 1 1011 ? -38.676 -65.805  13.469  1.00 20.35  ? 1012 LYS A N     1 
ATOM   7676  C  CA    . LYS A 1 1011 ? -39.345 -65.468  14.762  1.00 20.75  ? 1012 LYS A CA    1 
ATOM   7677  C  C     . LYS A 1 1011 ? -39.078 -63.999  15.060  1.00 20.98  ? 1012 LYS A C     1 
ATOM   7678  O  O     . LYS A 1 1011 ? -38.002 -63.515  14.728  1.00 22.27  ? 1012 LYS A O     1 
ATOM   7679  C  CB    . LYS A 1 1011 ? -38.911 -66.349  15.933  1.00 20.00  ? 1012 LYS A CB    1 
ATOM   7680  C  CG    . LYS A 1 1011 ? -38.928 -67.854  15.696  1.00 22.62  ? 1012 LYS A CG    1 
ATOM   7681  C  CD    . LYS A 1 1011 ? -40.263 -68.378  15.154  1.00 23.96  ? 1012 LYS A CD    1 
ATOM   7682  C  CE    . LYS A 1 1011 ? -41.360 -68.412  16.174  1.00 23.14  ? 1012 LYS A CE    1 
ATOM   7683  N  NZ    . LYS A 1 1011 ? -42.569 -69.231  15.695  1.00 20.66  ? 1012 LYS A NZ    1 
ATOM   7684  N  N     . PHE A 1 1012 ? -40.092 -63.227  15.461  1.00 20.37  ? 1013 PHE A N     1 
ATOM   7685  C  CA    . PHE A 1 1012 ? -40.043 -61.799  15.719  1.00 22.27  ? 1013 PHE A CA    1 
ATOM   7686  C  C     . PHE A 1 1012 ? -40.114 -60.970  14.449  1.00 22.97  ? 1013 PHE A C     1 
ATOM   7687  O  O     . PHE A 1 1012 ? -40.056 -59.732  14.452  1.00 23.47  ? 1013 PHE A O     1 
ATOM   7688  C  CB    . PHE A 1 1012 ? -38.888 -61.410  16.648  1.00 21.98  ? 1013 PHE A CB    1 
ATOM   7689  C  CG    . PHE A 1 1012 ? -38.962 -62.232  17.919  1.00 24.69  ? 1013 PHE A CG    1 
ATOM   7690  C  CD1   . PHE A 1 1012 ? -37.958 -63.120  18.275  1.00 23.90  ? 1013 PHE A CD1   1 
ATOM   7691  C  CD2   . PHE A 1 1012 ? -40.082 -62.112  18.746  1.00 24.43  ? 1013 PHE A CD2   1 
ATOM   7692  C  CE1   . PHE A 1 1012 ? -38.089 -63.879  19.431  1.00 24.53  ? 1013 PHE A CE1   1 
ATOM   7693  C  CE2   . PHE A 1 1012 ? -40.186 -62.841  19.919  1.00 23.18  ? 1013 PHE A CE2   1 
ATOM   7694  C  CZ    . PHE A 1 1012 ? -39.178 -63.726  20.254  1.00 24.61  ? 1013 PHE A CZ    1 
ATOM   7695  N  N     . ALA A 1 1013 ? -40.326 -61.650  13.320  1.00 23.03  ? 1014 ALA A N     1 
ATOM   7696  C  CA    . ALA A 1 1013 ? -40.553 -61.075  12.001  1.00 22.94  ? 1014 ALA A CA    1 
ATOM   7697  C  C     . ALA A 1 1013 ? -41.517 -62.033  11.265  1.00 24.96  ? 1014 ALA A C     1 
ATOM   7698  O  O     . ALA A 1 1013 ? -41.358 -62.456  10.120  1.00 27.21  ? 1014 ALA A O     1 
ATOM   7699  C  CB    . ALA A 1 1013 ? -39.306 -60.816  11.186  1.00 23.44  ? 1014 ALA A CB    1 
ATOM   7700  N  N     . ALA A 1 1014 ? -42.552 -62.449  11.998  1.00 22.35  ? 1015 ALA A N     1 
ATOM   7701  C  CA    . ALA A 1 1014 ? -43.527 -63.434  11.614  1.00 25.12  ? 1015 ALA A CA    1 
ATOM   7702  C  C     . ALA A 1 1014 ? -44.534 -62.926  10.571  1.00 26.87  ? 1015 ALA A C     1 
ATOM   7703  O  O     . ALA A 1 1014 ? -45.371 -63.691  10.071  1.00 29.55  ? 1015 ALA A O     1 
ATOM   7704  C  CB    . ALA A 1 1014 ? -44.250 -63.948  12.862  1.00 21.90  ? 1015 ALA A CB    1 
ATOM   7705  N  N     . ALA A 1 1015 ? -44.495 -61.648  10.220  1.00 24.47  ? 1016 ALA A N     1 
ATOM   7706  C  CA    . ALA A 1 1015 ? -45.334 -61.175  9.134   1.00 26.19  ? 1016 ALA A CA    1 
ATOM   7707  C  C     . ALA A 1 1015 ? -44.382 -60.696  8.022   1.00 26.37  ? 1016 ALA A C     1 
ATOM   7708  O  O     . ALA A 1 1015 ? -44.861 -60.021  7.134   1.00 26.30  ? 1016 ALA A O     1 
ATOM   7709  C  CB    . ALA A 1 1015 ? -46.301 -60.080  9.501   1.00 26.46  ? 1016 ALA A CB    1 
ATOM   7710  N  N     . GLY A 1 1016 ? -43.131 -61.168  8.069   1.00 25.37  ? 1017 GLY A N     1 
ATOM   7711  C  CA    . GLY A 1 1016 ? -42.143 -60.771  7.069   1.00 23.51  ? 1017 GLY A CA    1 
ATOM   7712  C  C     . GLY A 1 1016 ? -41.449 -59.532  7.691   1.00 24.32  ? 1017 GLY A C     1 
ATOM   7713  O  O     . GLY A 1 1016 ? -42.137 -58.628  8.178   1.00 22.66  ? 1017 GLY A O     1 
ATOM   7714  N  N     . LYS A 1 1017 ? -40.106 -59.556  7.757   1.00 22.32  ? 1018 LYS A N     1 
ATOM   7715  C  CA    . LYS A 1 1017 ? -39.420 -58.388  8.324   1.00 22.35  ? 1018 LYS A CA    1 
ATOM   7716  C  C     . LYS A 1 1017 ? -39.688 -57.110  7.548   1.00 21.83  ? 1018 LYS A C     1 
ATOM   7717  O  O     . LYS A 1 1017 ? -39.664 -57.067  6.301   1.00 21.17  ? 1018 LYS A O     1 
ATOM   7718  C  CB    . LYS A 1 1017 ? -37.909 -58.694  8.392   1.00 21.65  ? 1018 LYS A CB    1 
ATOM   7719  C  CG    . LYS A 1 1017 ? -37.043 -57.645  9.073   1.00 21.42  ? 1018 LYS A CG    1 
ATOM   7720  C  CD    . LYS A 1 1017 ? -35.699 -58.329  9.505   1.00 18.28  ? 1018 LYS A CD    1 
ATOM   7721  C  CE    . LYS A 1 1017 ? -34.757 -57.216  10.038  1.00 17.69  ? 1018 LYS A CE    1 
ATOM   7722  N  NZ    . LYS A 1 1017 ? -33.998 -56.620  8.869   1.00 15.97  ? 1018 LYS A NZ    1 
ATOM   7723  N  N     . ARG A 1 1018 ? -39.927 -56.023  8.287   1.00 21.72  ? 1019 ARG A N     1 
ATOM   7724  C  CA    . ARG A 1 1018 ? -40.325 -54.744  7.750   1.00 22.80  ? 1019 ARG A CA    1 
ATOM   7725  C  C     . ARG A 1 1018 ? -39.255 -53.671  7.783   1.00 24.86  ? 1019 ARG A C     1 
ATOM   7726  O  O     . ARG A 1 1018 ? -39.496 -52.491  7.559   1.00 24.91  ? 1019 ARG A O     1 
ATOM   7727  C  CB    . ARG A 1 1018 ? -41.626 -54.222  8.431   1.00 22.43  ? 1019 ARG A CB    1 
ATOM   7728  C  CG    . ARG A 1 1018 ? -42.639 -55.378  8.486   1.00 22.11  ? 1019 ARG A CG    1 
ATOM   7729  C  CD    . ARG A 1 1018 ? -43.200 -55.628  7.078   1.00 23.05  ? 1019 ARG A CD    1 
ATOM   7730  N  NE    . ARG A 1 1018 ? -44.210 -56.686  7.104   1.00 22.43  ? 1019 ARG A NE    1 
ATOM   7731  C  CZ    . ARG A 1 1018 ? -45.500 -56.505  6.790   1.00 23.96  ? 1019 ARG A CZ    1 
ATOM   7732  N  NH1   . ARG A 1 1018 ? -45.915 -55.289  6.454   1.00 25.20  ? 1019 ARG A NH1   1 
ATOM   7733  N  NH2   . ARG A 1 1018 ? -46.350 -57.510  6.814   1.00 21.54  ? 1019 ARG A NH2   1 
ATOM   7734  N  N     . THR A 1 1019 ? -38.001 -54.079  7.975   1.00 23.44  ? 1020 THR A N     1 
ATOM   7735  C  CA    . THR A 1 1019 ? -36.858 -53.192  7.818   1.00 24.11  ? 1020 THR A CA    1 
ATOM   7736  C  C     . THR A 1 1019 ? -35.893 -54.025  6.980   1.00 23.84  ? 1020 THR A C     1 
ATOM   7737  O  O     . THR A 1 1019 ? -35.870 -55.245  7.171   1.00 24.10  ? 1020 THR A O     1 
ATOM   7738  C  CB    . THR A 1 1019 ? -36.144 -52.761  9.092   1.00 23.78  ? 1020 THR A CB    1 
ATOM   7739  O  OG1   . THR A 1 1019 ? -35.939 -53.925  9.896   1.00 24.47  ? 1020 THR A OG1   1 
ATOM   7740  C  CG2   . THR A 1 1019 ? -36.992 -51.752  9.895   1.00 23.12  ? 1020 THR A CG2   1 
ATOM   7741  N  N     . GLY A 1 1020 ? -35.156 -53.360  6.108   1.00 24.18  ? 1021 GLY A N     1 
ATOM   7742  C  CA    . GLY A 1 1020 ? -34.188 -54.064  5.282   1.00 22.81  ? 1021 GLY A CA    1 
ATOM   7743  C  C     . GLY A 1 1020 ? -32.989 -54.574  6.086   1.00 24.30  ? 1021 GLY A C     1 
ATOM   7744  O  O     . GLY A 1 1020 ? -32.782 -54.238  7.264   1.00 21.59  ? 1021 GLY A O     1 
ATOM   7745  N  N     . LYS A 1 1021 ? -32.200 -55.413  5.398   1.00 20.52  ? 1022 LYS A N     1 
ATOM   7746  C  CA    . LYS A 1 1021 ? -30.989 -55.995  5.950   1.00 19.88  ? 1022 LYS A CA    1 
ATOM   7747  C  C     . LYS A 1 1021 ? -29.987 -54.892  6.257   1.00 20.15  ? 1022 LYS A C     1 
ATOM   7748  O  O     . LYS A 1 1021 ? -29.850 -54.028  5.378   1.00 20.01  ? 1022 LYS A O     1 
ATOM   7749  C  CB    . LYS A 1 1021 ? -30.380 -56.909  4.881   1.00 21.29  ? 1022 LYS A CB    1 
ATOM   7750  C  CG    . LYS A 1 1021 ? -29.074 -57.587  5.230   1.00 20.57  ? 1022 LYS A CG    1 
ATOM   7751  C  CD    . LYS A 1 1021 ? -28.566 -58.418  4.037   1.00 21.01  ? 1022 LYS A CD    1 
ATOM   7752  C  CE    . LYS A 1 1021 ? -27.351 -59.231  4.445   1.00 19.30  ? 1022 LYS A CE    1 
ATOM   7753  N  NZ    . LYS A 1 1021 ? -27.721 -60.510  5.119   1.00 18.85  ? 1022 LYS A NZ    1 
ATOM   7754  N  N     . LYS A 1 1022 ? -29.343 -54.897  7.417   1.00 17.79  ? 1023 LYS A N     1 
ATOM   7755  C  CA    . LYS A 1 1022 ? -28.308 -53.908  7.689   1.00 17.20  ? 1023 LYS A CA    1 
ATOM   7756  C  C     . LYS A 1 1022 ? -27.088 -54.113  6.778   1.00 15.41  ? 1023 LYS A C     1 
ATOM   7757  O  O     . LYS A 1 1022 ? -26.731 -55.290  6.543   1.00 19.17  ? 1023 LYS A O     1 
ATOM   7758  C  CB    . LYS A 1 1022 ? -27.968 -54.041  9.177   1.00 16.94  ? 1023 LYS A CB    1 
ATOM   7759  C  CG    . LYS A 1 1022 ? -26.636 -53.429  9.639   1.00 15.23  ? 1023 LYS A CG    1 
ATOM   7760  C  CD    . LYS A 1 1022 ? -26.386 -53.920  11.111  1.00 14.94  ? 1023 LYS A CD    1 
ATOM   7761  C  CE    . LYS A 1 1022 ? -24.996 -53.401  11.543  1.00 15.34  ? 1023 LYS A CE    1 
ATOM   7762  N  NZ    . LYS A 1 1022 ? -24.863 -53.732  13.030  1.00 17.82  ? 1023 LYS A NZ    1 
ATOM   7763  N  N     . ASP A 1 1023 ? -26.506 -53.009  6.295   1.00 16.83  ? 1024 ASP A N     1 
ATOM   7764  C  CA    . ASP A 1 1023 ? -25.389 -53.191  5.300   1.00 16.16  ? 1024 ASP A CA    1 
ATOM   7765  C  C     . ASP A 1 1023 ? -24.098 -53.143  6.057   1.00 15.52  ? 1024 ASP A C     1 
ATOM   7766  O  O     . ASP A 1 1023 ? -23.378 -52.153  6.051   1.00 13.60  ? 1024 ASP A O     1 
ATOM   7767  C  CB    . ASP A 1 1023 ? -25.588 -52.101  4.218   1.00 18.99  ? 1024 ASP A CB    1 
ATOM   7768  C  CG    . ASP A 1 1023 ? -24.789 -52.389  2.935   1.00 21.93  ? 1024 ASP A CG    1 
ATOM   7769  O  OD1   . ASP A 1 1023 ? -23.815 -53.151  3.037   1.00 18.59  ? 1024 ASP A OD1   1 
ATOM   7770  O  OD2   . ASP A 1 1023 ? -25.119 -51.893  1.840   1.00 22.29  ? 1024 ASP A OD2   1 
ATOM   7771  N  N     . LEU A 1 1024 ? -23.756 -54.242  6.755   1.00 16.49  ? 1025 LEU A N     1 
ATOM   7772  C  CA    . LEU A 1 1024 ? -22.506 -54.293  7.535   1.00 18.03  ? 1025 LEU A CA    1 
ATOM   7773  C  C     . LEU A 1 1024 ? -21.308 -53.979  6.648   1.00 18.06  ? 1025 LEU A C     1 
ATOM   7774  O  O     . LEU A 1 1024 ? -20.419 -53.226  7.007   1.00 17.95  ? 1025 LEU A O     1 
ATOM   7775  C  CB    . LEU A 1 1024 ? -22.386 -55.671  8.158   1.00 19.24  ? 1025 LEU A CB    1 
ATOM   7776  C  CG    . LEU A 1 1024 ? -21.082 -56.048  8.915   1.00 18.37  ? 1025 LEU A CG    1 
ATOM   7777  C  CD1   . LEU A 1 1024 ? -20.961 -55.087  10.106  1.00 18.83  ? 1025 LEU A CD1   1 
ATOM   7778  C  CD2   . LEU A 1 1024 ? -21.259 -57.459  9.417   1.00 17.51  ? 1025 LEU A CD2   1 
ATOM   7779  N  N     . ALA A 1 1025 ? -21.283 -54.620  5.468   1.00 16.99  ? 1026 ALA A N     1 
ATOM   7780  C  CA    . ALA A 1 1025 ? -20.179 -54.431  4.533   1.00 16.29  ? 1026 ALA A CA    1 
ATOM   7781  C  C     . ALA A 1 1025 ? -19.931 -52.975  4.205   1.00 17.38  ? 1026 ALA A C     1 
ATOM   7782  O  O     . ALA A 1 1025 ? -18.778 -52.531  4.381   1.00 15.69  ? 1026 ALA A O     1 
ATOM   7783  C  CB    . ALA A 1 1025 ? -20.451 -55.224  3.252   1.00 17.43  ? 1026 ALA A CB    1 
ATOM   7784  N  N     . ARG A 1 1026 ? -20.969 -52.193  3.910   1.00 15.78  ? 1027 ARG A N     1 
ATOM   7785  C  CA    . ARG A 1 1026 ? -20.718 -50.786  3.518   1.00 16.30  ? 1027 ARG A CA    1 
ATOM   7786  C  C     . ARG A 1 1026 ? -20.426 -49.884  4.695   1.00 17.49  ? 1027 ARG A C     1 
ATOM   7787  O  O     . ARG A 1 1026 ? -19.675 -48.918  4.620   1.00 17.31  ? 1027 ARG A O     1 
ATOM   7788  C  CB    . ARG A 1 1026 ? -21.914 -50.190  2.742   1.00 19.90  ? 1027 ARG A CB    1 
ATOM   7789  C  CG    . ARG A 1 1026 ? -22.025 -50.776  1.337   1.00 24.52  ? 1027 ARG A CG    1 
ATOM   7790  C  CD    . ARG A 1 1026 ? -22.721 -49.862  0.356   1.00 25.56  ? 1027 ARG A CD    1 
ATOM   7791  N  NE    . ARG A 1 1026 ? -24.050 -49.485  0.749   1.00 29.30  ? 1027 ARG A NE    1 
ATOM   7792  C  CZ    . ARG A 1 1026 ? -24.606 -48.299  0.969   1.00 31.55  ? 1027 ARG A CZ    1 
ATOM   7793  N  NH1   . ARG A 1 1026 ? -23.939 -47.155  0.825   1.00 33.30  ? 1027 ARG A NH1   1 
ATOM   7794  N  NH2   . ARG A 1 1026 ? -25.891 -48.149  1.292   1.00 30.52  ? 1027 ARG A NH2   1 
ATOM   7795  N  N     . MET A 1 1027 ? -20.958 -50.274  5.898   1.00 14.22  ? 1028 MET A N     1 
ATOM   7796  C  CA    . MET A 1 1027 ? -20.573 -49.574  7.099   1.00 14.77  ? 1028 MET A CA    1 
ATOM   7797  C  C     . MET A 1 1027 ? -19.104 -49.735  7.393   1.00 16.48  ? 1028 MET A C     1 
ATOM   7798  O  O     . MET A 1 1027 ? -18.423 -48.738  7.761   1.00 18.47  ? 1028 MET A O     1 
ATOM   7799  C  CB    . MET A 1 1027 ? -21.430 -50.220  8.235   1.00 16.92  ? 1028 MET A CB    1 
ATOM   7800  C  CG    . MET A 1 1027 ? -22.846 -49.623  8.145   1.00 21.35  ? 1028 MET A CG    1 
ATOM   7801  S  SD    . MET A 1 1027 ? -23.819 -50.304  9.568   1.00 28.20  ? 1028 MET A SD    1 
ATOM   7802  C  CE    . MET A 1 1027 ? -23.327 -49.226  10.801  1.00 26.75  ? 1028 MET A CE    1 
ATOM   7803  N  N     . VAL A 1 1028 ? -18.557 -50.943  7.149   1.00 17.23  ? 1029 VAL A N     1 
ATOM   7804  C  CA    . VAL A 1 1028 ? -17.131 -51.091  7.505   1.00 18.52  ? 1029 VAL A CA    1 
ATOM   7805  C  C     . VAL A 1 1028 ? -16.226 -50.565  6.411   1.00 19.15  ? 1029 VAL A C     1 
ATOM   7806  O  O     . VAL A 1 1028 ? -15.165 -50.008  6.785   1.00 17.81  ? 1029 VAL A O     1 
ATOM   7807  C  CB    . VAL A 1 1028 ? -16.634 -52.311  8.247   1.00 19.16  ? 1029 VAL A CB    1 
ATOM   7808  C  CG1   . VAL A 1 1028 ? -17.703 -53.195  8.850   1.00 19.30  ? 1029 VAL A CG1   1 
ATOM   7809  C  CG2   . VAL A 1 1028 ? -15.456 -53.084  7.649   1.00 20.08  ? 1029 VAL A CG2   1 
ATOM   7810  N  N     . MET A 1 1029 ? -16.677 -50.473  5.174   1.00 16.63  ? 1030 MET A N     1 
ATOM   7811  C  CA    . MET A 1 1029 ? -15.873 -49.850  4.125   1.00 16.90  ? 1030 MET A CA    1 
ATOM   7812  C  C     . MET A 1 1029 ? -15.734 -48.365  4.360   1.00 18.42  ? 1030 MET A C     1 
ATOM   7813  O  O     . MET A 1 1029 ? -14.784 -47.785  3.793   1.00 18.30  ? 1030 MET A O     1 
ATOM   7814  C  CB    . MET A 1 1029 ? -16.481 -50.115  2.720   1.00 18.93  ? 1030 MET A CB    1 
ATOM   7815  C  CG    . MET A 1 1029 ? -16.313 -51.569  2.272   1.00 20.84  ? 1030 MET A CG    1 
ATOM   7816  S  SD    . MET A 1 1029 ? -16.994 -51.804  0.576   1.00 26.31  ? 1030 MET A SD    1 
ATOM   7817  C  CE    . MET A 1 1029 ? -18.297 -52.916  0.982   1.00 27.13  ? 1030 MET A CE    1 
ATOM   7818  N  N     . THR A 1 1030 ? -16.462 -47.771  5.328   1.00 15.56  ? 1031 THR A N     1 
ATOM   7819  C  CA    . THR A 1 1030 ? -16.234 -46.341  5.564   1.00 14.93  ? 1031 THR A CA    1 
ATOM   7820  C  C     . THR A 1 1030 ? -14.904 -46.082  6.273   1.00 15.19  ? 1031 THR A C     1 
ATOM   7821  O  O     . THR A 1 1030 ? -14.421 -44.943  6.320   1.00 15.70  ? 1031 THR A O     1 
ATOM   7822  C  CB    . THR A 1 1030 ? -17.388 -45.693  6.354   1.00 18.10  ? 1031 THR A CB    1 
ATOM   7823  O  OG1   . THR A 1 1030 ? -17.295 -46.208  7.671   1.00 17.11  ? 1031 THR A OG1   1 
ATOM   7824  C  CG2   . THR A 1 1030 ? -18.757 -45.989  5.733   1.00 15.81  ? 1031 THR A CG2   1 
ATOM   7825  N  N     . TYR A 1 1031 ? -14.288 -47.109  6.889   1.00 15.53  ? 1032 TYR A N     1 
ATOM   7826  C  CA    . TYR A 1 1031 ? -13.021 -46.943  7.568   1.00 14.65  ? 1032 TYR A CA    1 
ATOM   7827  C  C     . TYR A 1 1031 ? -11.880 -46.643  6.552   1.00 16.95  ? 1032 TYR A C     1 
ATOM   7828  O  O     . TYR A 1 1031 ? -11.030 -45.794  6.833   1.00 17.20  ? 1032 TYR A O     1 
ATOM   7829  C  CB    . TYR A 1 1031 ? -12.598 -48.143  8.419   1.00 13.60  ? 1032 TYR A CB    1 
ATOM   7830  C  CG    . TYR A 1 1031 ? -13.387 -48.186  9.729   1.00 14.28  ? 1032 TYR A CG    1 
ATOM   7831  C  CD1   . TYR A 1 1031 ? -13.111 -47.222  10.722  1.00 14.54  ? 1032 TYR A CD1   1 
ATOM   7832  C  CD2   . TYR A 1 1031 ? -14.345 -49.158  9.940   1.00 14.59  ? 1032 TYR A CD2   1 
ATOM   7833  C  CE1   . TYR A 1 1031 ? -13.793 -47.208  11.923  1.00 14.81  ? 1032 TYR A CE1   1 
ATOM   7834  C  CE2   . TYR A 1 1031 ? -15.018 -49.143  11.177  1.00 16.11  ? 1032 TYR A CE2   1 
ATOM   7835  C  CZ    . TYR A 1 1031 ? -14.752 -48.198  12.133  1.00 15.74  ? 1032 TYR A CZ    1 
ATOM   7836  O  OH    . TYR A 1 1031 ? -15.430 -48.215  13.338  1.00 12.73  ? 1032 TYR A OH    1 
ATOM   7837  N  N     . GLY A 1 1032 ? -11.943 -47.298  5.408   1.00 16.73  ? 1033 GLY A N     1 
ATOM   7838  C  CA    . GLY A 1 1032 ? -10.926 -47.050  4.358   1.00 18.33  ? 1033 GLY A CA    1 
ATOM   7839  C  C     . GLY A 1 1032 ? -9.749  -48.006  4.540   1.00 19.09  ? 1033 GLY A C     1 
ATOM   7840  O  O     . GLY A 1 1032 ? -9.030  -48.308  3.578   1.00 21.70  ? 1033 GLY A O     1 
ATOM   7841  N  N     . TYR A 1 1033 ? -9.451  -48.410  5.784   1.00 19.79  ? 1034 TYR A N     1 
ATOM   7842  C  CA    . TYR A 1 1033 ? -8.256  -49.230  6.024   1.00 19.02  ? 1034 TYR A CA    1 
ATOM   7843  C  C     . TYR A 1 1033 ? -8.487  -50.691  6.380   1.00 19.05  ? 1034 TYR A C     1 
ATOM   7844  O  O     . TYR A 1 1033 ? -7.599  -51.443  6.841   1.00 18.28  ? 1034 TYR A O     1 
ATOM   7845  C  CB    . TYR A 1 1033 ? -7.365  -48.537  7.089   1.00 19.77  ? 1034 TYR A CB    1 
ATOM   7846  C  CG    . TYR A 1 1033 ? -8.004  -48.251  8.438   1.00 18.18  ? 1034 TYR A CG    1 
ATOM   7847  C  CD1   . TYR A 1 1033 ? -8.101  -49.215  9.455   1.00 18.12  ? 1034 TYR A CD1   1 
ATOM   7848  C  CD2   . TYR A 1 1033 ? -8.445  -46.964  8.718   1.00 17.62  ? 1034 TYR A CD2   1 
ATOM   7849  C  CE1   . TYR A 1 1033 ? -8.672  -48.873  10.681  1.00 17.25  ? 1034 TYR A CE1   1 
ATOM   7850  C  CE2   . TYR A 1 1033 ? -9.015  -46.628  9.952   1.00 16.08  ? 1034 TYR A CE2   1 
ATOM   7851  C  CZ    . TYR A 1 1033 ? -9.070  -47.576  10.938  1.00 14.98  ? 1034 TYR A CZ    1 
ATOM   7852  O  OH    . TYR A 1 1033 ? -9.659  -47.248  12.141  1.00 13.23  ? 1034 TYR A OH    1 
ATOM   7853  N  N     . VAL A 1 1034 ? -9.720  -51.128  6.254   1.00 16.51  ? 1035 VAL A N     1 
ATOM   7854  C  CA    . VAL A 1 1034 ? -10.136 -52.468  6.506   1.00 16.31  ? 1035 VAL A CA    1 
ATOM   7855  C  C     . VAL A 1 1034 ? -10.390 -53.173  5.182   1.00 18.46  ? 1035 VAL A C     1 
ATOM   7856  O  O     . VAL A 1 1034 ? -11.107 -52.569  4.344   1.00 18.19  ? 1035 VAL A O     1 
ATOM   7857  C  CB    . VAL A 1 1034 ? -11.470 -52.403  7.334   1.00 16.29  ? 1035 VAL A CB    1 
ATOM   7858  C  CG1   . VAL A 1 1034 ? -11.921 -53.819  7.575   1.00 14.29  ? 1035 VAL A CG1   1 
ATOM   7859  C  CG2   . VAL A 1 1034 ? -11.127 -51.708  8.645   1.00 16.09  ? 1035 VAL A CG2   1 
ATOM   7860  N  N     . TYR A 1 1035 ? -9.860  -54.382  5.005   1.00 18.22  ? 1036 TYR A N     1 
ATOM   7861  C  CA    . TYR A 1 1035 ? -10.230 -55.112  3.789   1.00 17.17  ? 1036 TYR A CA    1 
ATOM   7862  C  C     . TYR A 1 1035 ? -11.640 -55.681  3.993   1.00 18.28  ? 1036 TYR A C     1 
ATOM   7863  O  O     . TYR A 1 1035 ? -11.850 -56.341  5.037   1.00 18.91  ? 1036 TYR A O     1 
ATOM   7864  C  CB    . TYR A 1 1035 ? -9.267  -56.299  3.631   1.00 19.54  ? 1036 TYR A CB    1 
ATOM   7865  C  CG    . TYR A 1 1035 ? -9.532  -57.178  2.405   1.00 19.63  ? 1036 TYR A CG    1 
ATOM   7866  C  CD1   . TYR A 1 1035 ? -8.789  -56.907  1.240   1.00 17.84  ? 1036 TYR A CD1   1 
ATOM   7867  C  CD2   . TYR A 1 1035 ? -10.392 -58.279  2.428   1.00 17.61  ? 1036 TYR A CD2   1 
ATOM   7868  C  CE1   . TYR A 1 1035 ? -8.990  -57.676  0.122   1.00 19.04  ? 1036 TYR A CE1   1 
ATOM   7869  C  CE2   . TYR A 1 1035 ? -10.560 -59.045  1.292   1.00 20.73  ? 1036 TYR A CE2   1 
ATOM   7870  C  CZ    . TYR A 1 1035 ? -9.861  -58.753  0.142   1.00 20.85  ? 1036 TYR A CZ    1 
ATOM   7871  O  OH    . TYR A 1 1035 ? -10.069 -59.523  -1.007  1.00 20.21  ? 1036 TYR A OH    1 
ATOM   7872  N  N     . VAL A 1 1036 ? -12.532 -55.551  3.018   1.00 13.76  ? 1037 VAL A N     1 
ATOM   7873  C  CA    . VAL A 1 1036 ? -13.871 -56.111  3.163   1.00 16.85  ? 1037 VAL A CA    1 
ATOM   7874  C  C     . VAL A 1 1036 ? -14.186 -56.890  1.877   1.00 17.02  ? 1037 VAL A C     1 
ATOM   7875  O  O     . VAL A 1 1036 ? -13.998 -56.307  0.822   1.00 18.29  ? 1037 VAL A O     1 
ATOM   7876  C  CB    . VAL A 1 1036 ? -14.885 -54.960  3.287   1.00 16.16  ? 1037 VAL A CB    1 
ATOM   7877  C  CG1   . VAL A 1 1036 ? -16.350 -55.435  3.412   1.00 16.07  ? 1037 VAL A CG1   1 
ATOM   7878  C  CG2   . VAL A 1 1036 ? -14.540 -54.047  4.476   1.00 17.34  ? 1037 VAL A CG2   1 
ATOM   7879  N  N     . ALA A 1 1037 ? -14.840 -58.046  2.006   1.00 16.09  ? 1038 ALA A N     1 
ATOM   7880  C  CA    . ALA A 1 1037 ? -15.293 -58.778  0.829   1.00 17.01  ? 1038 ALA A CA    1 
ATOM   7881  C  C     . ALA A 1 1037 ? -16.529 -59.611  1.120   1.00 16.81  ? 1038 ALA A C     1 
ATOM   7882  O  O     . ALA A 1 1037 ? -16.784 -59.989  2.288   1.00 17.67  ? 1038 ALA A O     1 
ATOM   7883  C  CB    . ALA A 1 1037 ? -14.170 -59.692  0.354   1.00 15.39  ? 1038 ALA A CB    1 
ATOM   7884  N  N     . THR A 1 1038 ? -17.232 -59.931  0.044   1.00 17.26  ? 1039 THR A N     1 
ATOM   7885  C  CA    . THR A 1 1038 ? -18.379 -60.827  0.198   1.00 19.19  ? 1039 THR A CA    1 
ATOM   7886  C  C     . THR A 1 1038 ? -18.141 -62.044  -0.684  1.00 19.44  ? 1039 THR A C     1 
ATOM   7887  O  O     . THR A 1 1038 ? -17.514 -61.863  -1.748  1.00 18.90  ? 1039 THR A O     1 
ATOM   7888  C  CB    . THR A 1 1038 ? -19.727 -60.184  -0.157  1.00 20.86  ? 1039 THR A CB    1 
ATOM   7889  O  OG1   . THR A 1 1038 ? -19.659 -59.634  -1.503  1.00 21.10  ? 1039 THR A OG1   1 
ATOM   7890  C  CG2   . THR A 1 1038 ? -20.105 -59.077  0.829   1.00 19.48  ? 1039 THR A CG2   1 
ATOM   7891  N  N     . VAL A 1 1039 ? -18.606 -63.200  -0.240  1.00 19.67  ? 1040 VAL A N     1 
ATOM   7892  C  CA    . VAL A 1 1039 ? -18.378 -64.425  -1.010  1.00 20.03  ? 1040 VAL A CA    1 
ATOM   7893  C  C     . VAL A 1 1039 ? -19.651 -65.256  -1.098  1.00 21.24  ? 1040 VAL A C     1 
ATOM   7894  O  O     . VAL A 1 1039 ? -20.544 -65.072  -0.265  1.00 23.04  ? 1040 VAL A O     1 
ATOM   7895  C  CB    . VAL A 1 1039 ? -17.268 -65.314  -0.424  1.00 19.06  ? 1040 VAL A CB    1 
ATOM   7896  C  CG1   . VAL A 1 1039 ? -15.910 -64.647  -0.411  1.00 19.46  ? 1040 VAL A CG1   1 
ATOM   7897  C  CG2   . VAL A 1 1039 ? -17.597 -65.873  0.973   1.00 18.88  ? 1040 VAL A CG2   1 
ATOM   7898  N  N     . SER A 1 1040 ? -19.715 -66.159  -2.048  1.00 22.56  ? 1041 SER A N     1 
ATOM   7899  C  CA    . SER A 1 1040 ? -20.829 -67.119  -2.172  1.00 23.31  ? 1041 SER A CA    1 
ATOM   7900  C  C     . SER A 1 1040 ? -20.257 -68.343  -2.893  1.00 24.91  ? 1041 SER A C     1 
ATOM   7901  O  O     . SER A 1 1040 ? -20.065 -68.237  -4.124  1.00 27.15  ? 1041 SER A O     1 
ATOM   7902  C  CB    . SER A 1 1040 ? -22.020 -66.541  -2.928  1.00 22.69  ? 1041 SER A CB    1 
ATOM   7903  O  OG    . SER A 1 1040 ? -23.050 -67.554  -2.983  1.00 26.08  ? 1041 SER A OG    1 
ATOM   7904  N  N     . MET A 1 1041 ? -20.016 -69.442  -2.204  1.00 22.41  ? 1042 MET A N     1 
ATOM   7905  C  CA    . MET A 1 1041 ? -19.357 -70.596  -2.765  1.00 21.81  ? 1042 MET A CA    1 
ATOM   7906  C  C     . MET A 1 1041 ? -20.020 -71.142  -4.032  1.00 22.99  ? 1042 MET A C     1 
ATOM   7907  O  O     . MET A 1 1041 ? -19.306 -71.445  -5.011  1.00 23.43  ? 1042 MET A O     1 
ATOM   7908  C  CB    . MET A 1 1041 ? -19.218 -71.706  -1.706  1.00 21.82  ? 1042 MET A CB    1 
ATOM   7909  C  CG    . MET A 1 1041 ? -18.360 -72.889  -2.222  1.00 23.07  ? 1042 MET A CG    1 
ATOM   7910  S  SD    . MET A 1 1041 ? -18.256 -74.238  -1.091  1.00 22.92  ? 1042 MET A SD    1 
ATOM   7911  C  CE    . MET A 1 1041 ? -17.238 -73.561  0.235   1.00 23.60  ? 1042 MET A CE    1 
ATOM   7912  N  N     . GLY A 1 1042 ? -21.322 -71.303  -4.022  1.00 22.34  ? 1043 GLY A N     1 
ATOM   7913  C  CA    . GLY A 1 1042 ? -22.038 -71.850  -5.184  1.00 22.56  ? 1043 GLY A CA    1 
ATOM   7914  C  C     . GLY A 1 1042 ? -21.867 -70.992  -6.431  1.00 23.36  ? 1043 GLY A C     1 
ATOM   7915  O  O     . GLY A 1 1042 ? -21.881 -71.596  -7.505  1.00 21.38  ? 1043 GLY A O     1 
ATOM   7916  N  N     . TYR A 1 1043 ? -21.649 -69.701  -6.319  1.00 20.91  ? 1044 TYR A N     1 
ATOM   7917  C  CA    . TYR A 1 1043 ? -21.443 -68.790  -7.432  1.00 22.17  ? 1044 TYR A CA    1 
ATOM   7918  C  C     . TYR A 1 1043 ? -20.036 -68.894  -8.013  1.00 23.96  ? 1044 TYR A C     1 
ATOM   7919  O  O     . TYR A 1 1043 ? -19.873 -69.008  -9.226  1.00 23.76  ? 1044 TYR A O     1 
ATOM   7920  C  CB    . TYR A 1 1043 ? -21.677 -67.305  -7.064  1.00 22.39  ? 1044 TYR A CB    1 
ATOM   7921  C  CG    . TYR A 1 1043 ? -21.486 -66.347  -8.232  1.00 22.23  ? 1044 TYR A CG    1 
ATOM   7922  C  CD1   . TYR A 1 1043 ? -22.400 -66.313  -9.283  1.00 25.05  ? 1044 TYR A CD1   1 
ATOM   7923  C  CD2   . TYR A 1 1043 ? -20.351 -65.583  -8.349  1.00 24.53  ? 1044 TYR A CD2   1 
ATOM   7924  C  CE1   . TYR A 1 1043 ? -22.239 -65.466  -10.375 1.00 26.36  ? 1044 TYR A CE1   1 
ATOM   7925  C  CE2   . TYR A 1 1043 ? -20.132 -64.740  -9.426  1.00 26.53  ? 1044 TYR A CE2   1 
ATOM   7926  C  CZ    . TYR A 1 1043 ? -21.096 -64.681  -10.414 1.00 27.62  ? 1044 TYR A CZ    1 
ATOM   7927  O  OH    . TYR A 1 1043 ? -20.843 -63.829  -11.480 1.00 28.63  ? 1044 TYR A OH    1 
ATOM   7928  N  N     . SER A 1 1044 ? -18.987 -68.879  -7.180  1.00 25.31  ? 1045 SER A N     1 
ATOM   7929  C  CA    . SER A 1 1044 ? -17.612 -69.010  -7.594  1.00 24.85  ? 1045 SER A CA    1 
ATOM   7930  C  C     . SER A 1 1044 ? -16.685 -69.427  -6.451  1.00 26.97  ? 1045 SER A C     1 
ATOM   7931  O  O     . SER A 1 1044 ? -16.504 -68.640  -5.525  1.00 23.76  ? 1045 SER A O     1 
ATOM   7932  C  CB    . SER A 1 1044 ? -17.067 -67.700  -8.144  1.00 23.60  ? 1045 SER A CB    1 
ATOM   7933  O  OG    . SER A 1 1044 ? -15.686 -67.717  -8.394  1.00 24.49  ? 1045 SER A OG    1 
ATOM   7934  N  N     . LYS A 1 1045 ? -16.104 -70.625  -6.582  1.00 24.25  ? 1046 LYS A N     1 
ATOM   7935  C  CA    . LYS A 1 1045 ? -15.187 -71.153  -5.606  1.00 28.30  ? 1046 LYS A CA    1 
ATOM   7936  C  C     . LYS A 1 1045 ? -13.879 -70.383  -5.748  1.00 29.59  ? 1046 LYS A C     1 
ATOM   7937  O  O     . LYS A 1 1045 ? -13.156 -70.078  -4.806  1.00 29.25  ? 1046 LYS A O     1 
ATOM   7938  C  CB    . LYS A 1 1045 ? -14.950 -72.652  -5.905  1.00 27.94  ? 1046 LYS A CB    1 
ATOM   7939  C  CG    . LYS A 1 1045 ? -16.261 -73.399  -5.945  1.00 28.16  ? 1046 LYS A CG    1 
ATOM   7940  C  CD    . LYS A 1 1045 ? -16.127 -74.918  -5.944  1.00 28.74  ? 1046 LYS A CD    1 
ATOM   7941  C  CE    . LYS A 1 1045 ? -17.543 -75.485  -6.030  1.00 29.79  ? 1046 LYS A CE    1 
ATOM   7942  N  NZ    . LYS A 1 1045 ? -18.163 -75.153  -7.375  1.00 32.06  ? 1046 LYS A NZ    1 
ATOM   7943  N  N     . GLN A 1 1046 ? -13.712 -69.965  -7.005  1.00 30.53  ? 1047 GLN A N     1 
ATOM   7944  C  CA    . GLN A 1 1046 ? -12.525 -69.198  -7.418  1.00 30.64  ? 1047 GLN A CA    1 
ATOM   7945  C  C     . GLN A 1 1046 ? -12.466 -67.863  -6.697  1.00 28.64  ? 1047 GLN A C     1 
ATOM   7946  O  O     . GLN A 1 1046 ? -11.409 -67.470  -6.159  1.00 27.94  ? 1047 GLN A O     1 
ATOM   7947  C  CB    . GLN A 1 1046 ? -12.586 -69.029  -8.952  1.00 33.75  ? 1047 GLN A CB    1 
ATOM   7948  C  CG    . GLN A 1 1046 ? -13.196 -70.261  -9.654  1.00 38.55  ? 1047 GLN A CG    1 
ATOM   7949  C  CD    . GLN A 1 1046 ? -14.665 -70.344  -9.954  1.00 39.06  ? 1047 GLN A CD    1 
ATOM   7950  O  OE1   . GLN A 1 1046 ? -15.443 -71.223  -9.524  1.00 40.73  ? 1047 GLN A OE1   1 
ATOM   7951  N  NE2   . GLN A 1 1046 ? -15.160 -69.396  -10.775 1.00 40.90  ? 1047 GLN A NE2   1 
ATOM   7952  N  N     . GLN A 1 1047 ? -13.601 -67.116  -6.718  1.00 25.15  ? 1048 GLN A N     1 
ATOM   7953  C  CA    . GLN A 1 1047 ? -13.565 -65.809  -6.036  1.00 22.82  ? 1048 GLN A CA    1 
ATOM   7954  C  C     . GLN A 1 1047 ? -13.377 -66.019  -4.524  1.00 22.20  ? 1048 GLN A C     1 
ATOM   7955  O  O     . GLN A 1 1047 ? -12.715 -65.238  -3.876  1.00 23.22  ? 1048 GLN A O     1 
ATOM   7956  C  CB    . GLN A 1 1047 ? -14.855 -65.047  -6.316  1.00 23.34  ? 1048 GLN A CB    1 
ATOM   7957  C  CG    . GLN A 1 1047 ? -14.851 -63.533  -5.983  1.00 22.93  ? 1048 GLN A CG    1 
ATOM   7958  C  CD    . GLN A 1 1047 ? -15.512 -63.296  -4.617  1.00 20.87  ? 1048 GLN A CD    1 
ATOM   7959  O  OE1   . GLN A 1 1047 ? -15.798 -62.160  -4.183  1.00 22.65  ? 1048 GLN A OE1   1 
ATOM   7960  N  NE2   . GLN A 1 1047 ? -15.852 -64.335  -3.894  1.00 17.53  ? 1048 GLN A NE2   1 
ATOM   7961  N  N     . PHE A 1 1048 ? -13.939 -67.117  -3.990  1.00 21.91  ? 1049 PHE A N     1 
ATOM   7962  C  CA    . PHE A 1 1048 ? -13.866 -67.393  -2.553  1.00 22.06  ? 1049 PHE A CA    1 
ATOM   7963  C  C     . PHE A 1 1048 ? -12.421 -67.533  -2.137  1.00 22.94  ? 1049 PHE A C     1 
ATOM   7964  O  O     . PHE A 1 1048 ? -11.889 -66.878  -1.250  1.00 21.61  ? 1049 PHE A O     1 
ATOM   7965  C  CB    . PHE A 1 1048 ? -14.743 -68.628  -2.206  1.00 20.97  ? 1049 PHE A CB    1 
ATOM   7966  C  CG    . PHE A 1 1048 ? -14.594 -69.120  -0.785  1.00 22.80  ? 1049 PHE A CG    1 
ATOM   7967  C  CD1   . PHE A 1 1048 ? -14.705 -68.250  0.284   1.00 20.62  ? 1049 PHE A CD1   1 
ATOM   7968  C  CD2   . PHE A 1 1048 ? -14.289 -70.441  -0.517  1.00 23.77  ? 1049 PHE A CD2   1 
ATOM   7969  C  CE1   . PHE A 1 1048 ? -14.512 -68.680  1.604   1.00 20.88  ? 1049 PHE A CE1   1 
ATOM   7970  C  CE2   . PHE A 1 1048 ? -14.123 -70.891  0.791   1.00 22.00  ? 1049 PHE A CE2   1 
ATOM   7971  C  CZ    . PHE A 1 1048 ? -14.231 -69.997  1.825   1.00 19.98  ? 1049 PHE A CZ    1 
ATOM   7972  N  N     . LEU A 1 1049 ? -11.721 -68.400  -2.916  1.00 22.09  ? 1050 LEU A N     1 
ATOM   7973  C  CA    . LEU A 1 1049 ? -10.308 -68.660  -2.595  1.00 21.35  ? 1050 LEU A CA    1 
ATOM   7974  C  C     . LEU A 1 1049 ? -9.455  -67.398  -2.709  1.00 20.34  ? 1050 LEU A C     1 
ATOM   7975  O  O     . LEU A 1 1049 ? -8.493  -67.146  -1.964  1.00 20.21  ? 1050 LEU A O     1 
ATOM   7976  C  CB    . LEU A 1 1049 ? -9.796  -69.726  -3.578  1.00 22.05  ? 1050 LEU A CB    1 
ATOM   7977  C  CG    . LEU A 1 1049 ? -10.342 -71.145  -3.433  1.00 20.98  ? 1050 LEU A CG    1 
ATOM   7978  C  CD1   . LEU A 1 1049 ? -9.932  -72.021  -4.614  1.00 21.70  ? 1050 LEU A CD1   1 
ATOM   7979  C  CD2   . LEU A 1 1049 ? -9.897  -71.807  -2.135  1.00 16.77  ? 1050 LEU A CD2   1 
ATOM   7980  N  N     . LYS A 1 1050 ? -9.748  -66.621  -3.738  1.00 18.83  ? 1051 LYS A N     1 
ATOM   7981  C  CA    . LYS A 1 1050 ? -9.027  -65.366  -3.972  1.00 21.50  ? 1051 LYS A CA    1 
ATOM   7982  C  C     . LYS A 1 1050 ? -9.250  -64.419  -2.774  1.00 19.25  ? 1051 LYS A C     1 
ATOM   7983  O  O     . LYS A 1 1050 ? -8.325  -63.885  -2.198  1.00 18.99  ? 1051 LYS A O     1 
ATOM   7984  C  CB    . LYS A 1 1050 ? -9.527  -64.724  -5.258  1.00 23.57  ? 1051 LYS A CB    1 
ATOM   7985  C  CG    . LYS A 1 1050 ? -8.819  -63.405  -5.612  1.00 28.36  ? 1051 LYS A CG    1 
ATOM   7986  C  CD    . LYS A 1 1050 ? -9.355  -62.880  -6.950  1.00 31.99  ? 1051 LYS A CD    1 
ATOM   7987  C  CE    . LYS A 1 1050 ? -8.777  -61.500  -7.239  1.00 36.86  ? 1051 LYS A CE    1 
ATOM   7988  N  NZ    . LYS A 1 1050 ? -7.684  -61.420  -8.251  1.00 41.18  ? 1051 LYS A NZ    1 
ATOM   7989  N  N     . VAL A 1 1051 ? -10.514 -64.315  -2.342  1.00 19.39  ? 1052 VAL A N     1 
ATOM   7990  C  CA    . VAL A 1 1051 ? -10.854 -63.509  -1.158  1.00 17.89  ? 1052 VAL A CA    1 
ATOM   7991  C  C     . VAL A 1 1051 ? -10.107 -64.041  0.090   1.00 18.46  ? 1052 VAL A C     1 
ATOM   7992  O  O     . VAL A 1 1051 ? -9.545  -63.191  0.800   1.00 17.69  ? 1052 VAL A O     1 
ATOM   7993  C  CB    . VAL A 1 1051 ? -12.345 -63.433  -0.848  1.00 17.41  ? 1052 VAL A CB    1 
ATOM   7994  C  CG1   . VAL A 1 1051 ? -12.643 -62.798  0.540   1.00 15.82  ? 1052 VAL A CG1   1 
ATOM   7995  C  CG2   . VAL A 1 1051 ? -13.060 -62.540  -1.921  1.00 15.93  ? 1052 VAL A CG2   1 
ATOM   7996  N  N     . LEU A 1 1052 ? -10.081 -65.364  0.232   1.00 18.43  ? 1053 LEU A N     1 
ATOM   7997  C  CA    . LEU A 1 1052 ? -9.360  -65.865  1.420   1.00 19.86  ? 1053 LEU A CA    1 
ATOM   7998  C  C     . LEU A 1 1052 ? -7.900  -65.447  1.408   1.00 19.04  ? 1053 LEU A C     1 
ATOM   7999  O  O     . LEU A 1 1052 ? -7.425  -64.869  2.378   1.00 17.63  ? 1053 LEU A O     1 
ATOM   8000  C  CB    . LEU A 1 1052 ? -9.437  -67.381  1.523   1.00 17.63  ? 1053 LEU A CB    1 
ATOM   8001  C  CG    . LEU A 1 1052 ? -10.829 -67.920  1.890   1.00 17.86  ? 1053 LEU A CG    1 
ATOM   8002  C  CD1   . LEU A 1 1052 ? -10.766 -69.429  1.995   1.00 18.25  ? 1053 LEU A CD1   1 
ATOM   8003  C  CD2   . LEU A 1 1052 ? -11.380 -67.281  3.186   1.00 18.85  ? 1053 LEU A CD2   1 
ATOM   8004  N  N     . LYS A 1 1053 ? -7.247  -65.634  0.251   1.00 21.00  ? 1054 LYS A N     1 
ATOM   8005  C  CA    . LYS A 1 1053 ? -5.847  -65.227  0.153   1.00 21.84  ? 1054 LYS A CA    1 
ATOM   8006  C  C     . LYS A 1 1053 ? -5.596  -63.731  0.333   1.00 21.04  ? 1054 LYS A C     1 
ATOM   8007  O  O     . LYS A 1 1053 ? -4.709  -63.228  1.048   1.00 20.05  ? 1054 LYS A O     1 
ATOM   8008  C  CB    . LYS A 1 1053 ? -5.313  -65.731  -1.225  1.00 25.19  ? 1054 LYS A CB    1 
ATOM   8009  C  CG    . LYS A 1 1053 ? -3.827  -65.442  -1.356  1.00 32.92  ? 1054 LYS A CG    1 
ATOM   8010  C  CD    . LYS A 1 1053 ? -3.149  -65.898  -2.643  1.00 37.22  ? 1054 LYS A CD    1 
ATOM   8011  C  CE    . LYS A 1 1053 ? -1.770  -65.290  -2.840  1.00 40.43  ? 1054 LYS A CE    1 
ATOM   8012  N  NZ    . LYS A 1 1053 ? -1.162  -64.685  -1.593  1.00 43.71  ? 1054 LYS A NZ    1 
ATOM   8013  N  N     . GLU A 1 1054 ? -6.463  -62.907  -0.202  1.00 17.56  ? 1055 GLU A N     1 
ATOM   8014  C  CA    . GLU A 1 1054 ? -6.313  -61.452  -0.173  1.00 19.37  ? 1055 GLU A CA    1 
ATOM   8015  C  C     . GLU A 1 1054 ? -6.600  -60.940  1.254   1.00 19.15  ? 1055 GLU A C     1 
ATOM   8016  O  O     . GLU A 1 1054 ? -5.856  -60.090  1.761   1.00 18.63  ? 1055 GLU A O     1 
ATOM   8017  C  CB    . GLU A 1 1054 ? -7.291  -60.848  -1.176  1.00 21.76  ? 1055 GLU A CB    1 
ATOM   8018  C  CG    . GLU A 1 1054 ? -6.778  -60.937  -2.635  1.00 26.58  ? 1055 GLU A CG    1 
ATOM   8019  C  CD    . GLU A 1 1054 ? -7.599  -60.011  -3.540  1.00 28.06  ? 1055 GLU A CD    1 
ATOM   8020  O  OE1   . GLU A 1 1054 ? -7.238  -59.891  -4.746  1.00 29.42  ? 1055 GLU A OE1   1 
ATOM   8021  O  OE2   . GLU A 1 1054 ? -8.572  -59.371  -3.110  1.00 27.19  ? 1055 GLU A OE2   1 
ATOM   8022  N  N     . ALA A 1 1055 ? -7.652  -61.533  1.854   1.00 18.51  ? 1056 ALA A N     1 
ATOM   8023  C  CA    . ALA A 1 1055 ? -8.007  -61.150  3.211   1.00 18.67  ? 1056 ALA A CA    1 
ATOM   8024  C  C     . ALA A 1 1055 ? -6.931  -61.520  4.203   1.00 16.94  ? 1056 ALA A C     1 
ATOM   8025  O  O     . ALA A 1 1055 ? -6.518  -60.690  5.027   1.00 17.57  ? 1056 ALA A O     1 
ATOM   8026  C  CB    . ALA A 1 1055 ? -9.363  -61.696  3.666   1.00 16.87  ? 1056 ALA A CB    1 
ATOM   8027  N  N     . GLU A 1 1056 ? -6.442  -62.751  4.123   1.00 20.10  ? 1057 GLU A N     1 
ATOM   8028  C  CA    . GLU A 1 1056 ? -5.452  -63.180  5.138   1.00 19.27  ? 1057 GLU A CA    1 
ATOM   8029  C  C     . GLU A 1 1056 ? -4.145  -62.443  4.993   1.00 18.80  ? 1057 GLU A C     1 
ATOM   8030  O  O     . GLU A 1 1056 ? -3.533  -62.096  6.016   1.00 16.56  ? 1057 GLU A O     1 
ATOM   8031  C  CB    . GLU A 1 1056 ? -5.379  -64.710  5.078   1.00 18.59  ? 1057 GLU A CB    1 
ATOM   8032  C  CG    . GLU A 1 1056 ? -4.733  -65.398  6.238   1.00 18.66  ? 1057 GLU A CG    1 
ATOM   8033  C  CD    . GLU A 1 1056 ? -3.253  -65.266  6.423   1.00 23.41  ? 1057 GLU A CD    1 
ATOM   8034  O  OE1   . GLU A 1 1056 ? -2.557  -65.121  5.390   1.00 23.58  ? 1057 GLU A OE1   1 
ATOM   8035  O  OE2   . GLU A 1 1056 ? -2.823  -65.239  7.604   1.00 25.05  ? 1057 GLU A OE2   1 
ATOM   8036  N  N     . SER A 1 1057 ? -3.683  -62.190  3.762   1.00 17.96  ? 1058 SER A N     1 
ATOM   8037  C  CA    . SER A 1 1057 ? -2.405  -61.517  3.579   1.00 18.49  ? 1058 SER A CA    1 
ATOM   8038  C  C     . SER A 1 1057 ? -2.455  -60.007  3.787   1.00 18.85  ? 1058 SER A C     1 
ATOM   8039  O  O     . SER A 1 1057 ? -1.411  -59.349  3.921   1.00 15.66  ? 1058 SER A O     1 
ATOM   8040  C  CB    . SER A 1 1057 ? -1.900  -61.780  2.135   1.00 18.23  ? 1058 SER A CB    1 
ATOM   8041  O  OG    . SER A 1 1057 ? -2.821  -61.286  1.198   1.00 19.92  ? 1058 SER A OG    1 
ATOM   8042  N  N     . PHE A 1 1058 ? -3.659  -59.424  3.943   1.00 16.66  ? 1059 PHE A N     1 
ATOM   8043  C  CA    . PHE A 1 1058 ? -3.769  -58.005  4.198   1.00 18.69  ? 1059 PHE A CA    1 
ATOM   8044  C  C     . PHE A 1 1058 ? -3.156  -57.718  5.568   1.00 21.03  ? 1059 PHE A C     1 
ATOM   8045  O  O     . PHE A 1 1058 ? -3.608  -58.338  6.501   1.00 19.53  ? 1059 PHE A O     1 
ATOM   8046  C  CB    . PHE A 1 1058 ? -5.226  -57.543  4.118   1.00 18.92  ? 1059 PHE A CB    1 
ATOM   8047  C  CG    . PHE A 1 1058 ? -5.432  -56.059  4.405   1.00 21.44  ? 1059 PHE A CG    1 
ATOM   8048  C  CD1   . PHE A 1 1058 ? -5.005  -55.105  3.486   1.00 19.97  ? 1059 PHE A CD1   1 
ATOM   8049  C  CD2   . PHE A 1 1058 ? -6.102  -55.637  5.527   1.00 18.36  ? 1059 PHE A CD2   1 
ATOM   8050  C  CE1   . PHE A 1 1058 ? -5.191  -53.760  3.773   1.00 22.41  ? 1059 PHE A CE1   1 
ATOM   8051  C  CE2   . PHE A 1 1058 ? -6.332  -54.292  5.799   1.00 18.41  ? 1059 PHE A CE2   1 
ATOM   8052  C  CZ    . PHE A 1 1058 ? -5.867  -53.327  4.922   1.00 20.84  ? 1059 PHE A CZ    1 
ATOM   8053  N  N     . PRO A 1 1059 ? -2.180  -56.850  5.705   1.00 22.49  ? 1060 PRO A N     1 
ATOM   8054  C  CA    . PRO A 1 1059 ? -1.527  -56.557  6.971   1.00 26.27  ? 1060 PRO A CA    1 
ATOM   8055  C  C     . PRO A 1 1059 ? -2.305  -55.527  7.774   1.00 27.29  ? 1060 PRO A C     1 
ATOM   8056  O  O     . PRO A 1 1059 ? -1.892  -54.374  7.980   1.00 31.69  ? 1060 PRO A O     1 
ATOM   8057  C  CB    . PRO A 1 1059 ? -0.160  -55.999  6.540   1.00 25.03  ? 1060 PRO A CB    1 
ATOM   8058  C  CG    . PRO A 1 1059 ? -0.424  -55.366  5.218   1.00 25.12  ? 1060 PRO A CG    1 
ATOM   8059  C  CD    . PRO A 1 1059 ? -1.554  -56.134  4.553   1.00 24.48  ? 1060 PRO A CD    1 
ATOM   8060  N  N     . GLY A 1 1060 ? -3.566  -55.835  8.012   1.00 26.29  ? 1061 GLY A N     1 
ATOM   8061  C  CA    . GLY A 1 1060 ? -4.511  -54.952  8.691   1.00 20.85  ? 1061 GLY A CA    1 
ATOM   8062  C  C     . GLY A 1 1060 ? -5.755  -55.861  8.879   1.00 18.87  ? 1061 GLY A C     1 
ATOM   8063  O  O     . GLY A 1 1060 ? -5.665  -57.065  8.722   1.00 17.44  ? 1061 GLY A O     1 
ATOM   8064  N  N     . PRO A 1 1061 ? -6.831  -55.239  9.299   1.00 17.63  ? 1062 PRO A N     1 
ATOM   8065  C  CA    . PRO A 1 1061 ? -8.048  -56.006  9.594   1.00 17.04  ? 1062 PRO A CA    1 
ATOM   8066  C  C     . PRO A 1 1061 ? -8.758  -56.405  8.321   1.00 15.08  ? 1062 PRO A C     1 
ATOM   8067  O  O     . PRO A 1 1061 ? -8.814  -55.598  7.386   1.00 17.57  ? 1062 PRO A O     1 
ATOM   8068  C  CB    . PRO A 1 1061 ? -8.894  -55.056  10.417  1.00 18.43  ? 1062 PRO A CB    1 
ATOM   8069  C  CG    . PRO A 1 1061 ? -8.078  -53.853  10.660  1.00 18.20  ? 1062 PRO A CG    1 
ATOM   8070  C  CD    . PRO A 1 1061 ? -6.975  -53.808  9.595   1.00 16.86  ? 1062 PRO A CD    1 
ATOM   8071  N  N     . SER A 1 1062 ? -9.366  -57.536  8.347   1.00 16.18  ? 1063 SER A N     1 
ATOM   8072  C  CA    . SER A 1 1062 ? -10.143 -58.084  7.240   1.00 17.95  ? 1063 SER A CA    1 
ATOM   8073  C  C     . SER A 1 1062 ? -11.509 -58.561  7.744   1.00 17.71  ? 1063 SER A C     1 
ATOM   8074  O  O     . SER A 1 1062 ? -11.605 -59.232  8.774   1.00 16.70  ? 1063 SER A O     1 
ATOM   8075  C  CB    . SER A 1 1062 ? -9.416  -59.299  6.636   1.00 18.20  ? 1063 SER A CB    1 
ATOM   8076  O  OG    . SER A 1 1062 ? -8.168  -58.756  6.161   1.00 25.13  ? 1063 SER A OG    1 
ATOM   8077  N  N     . LEU A 1 1063 ? -12.524 -58.343  6.887   1.00 15.59  ? 1064 LEU A N     1 
ATOM   8078  C  CA    . LEU A 1 1063 ? -13.857 -58.842  7.134   1.00 16.96  ? 1064 LEU A CA    1 
ATOM   8079  C  C     . LEU A 1 1063 ? -14.346 -59.570  5.869   1.00 15.41  ? 1064 LEU A C     1 
ATOM   8080  O  O     . LEU A 1 1063 ? -14.414 -58.906  4.820   1.00 16.86  ? 1064 LEU A O     1 
ATOM   8081  C  CB    . LEU A 1 1063 ? -14.861 -57.697  7.281   1.00 17.58  ? 1064 LEU A CB    1 
ATOM   8082  C  CG    . LEU A 1 1063 ? -16.135 -57.762  8.100   1.00 21.80  ? 1064 LEU A CG    1 
ATOM   8083  C  CD1   . LEU A 1 1063 ? -17.174 -56.774  7.637   1.00 20.41  ? 1064 LEU A CD1   1 
ATOM   8084  C  CD2   . LEU A 1 1063 ? -16.607 -59.129  8.534   1.00 19.15  ? 1064 LEU A CD2   1 
ATOM   8085  N  N     . VAL A 1 1064 ? -14.759 -60.791  5.985   1.00 16.15  ? 1065 VAL A N     1 
ATOM   8086  C  CA    . VAL A 1 1064 ? -15.319 -61.551  4.866   1.00 17.70  ? 1065 VAL A CA    1 
ATOM   8087  C  C     . VAL A 1 1064 ? -16.723 -62.027  5.238   1.00 17.32  ? 1065 VAL A C     1 
ATOM   8088  O  O     . VAL A 1 1064 ? -16.839 -62.706  6.265   1.00 19.23  ? 1065 VAL A O     1 
ATOM   8089  C  CB    . VAL A 1 1064 ? -14.409 -62.739  4.539   1.00 17.49  ? 1065 VAL A CB    1 
ATOM   8090  C  CG1   . VAL A 1 1064 ? -15.017 -63.596  3.428   1.00 21.52  ? 1065 VAL A CG1   1 
ATOM   8091  C  CG2   . VAL A 1 1064 ? -12.997 -62.264  4.134   1.00 16.52  ? 1065 VAL A CG2   1 
ATOM   8092  N  N     . ILE A 1 1065 ? -17.735 -61.724  4.413   1.00 17.46  ? 1066 ILE A N     1 
ATOM   8093  C  CA    . ILE A 1 1065 ? -19.095 -62.172  4.745   1.00 17.48  ? 1066 ILE A CA    1 
ATOM   8094  C  C     . ILE A 1 1065 ? -19.567 -63.207  3.719   1.00 19.39  ? 1066 ILE A C     1 
ATOM   8095  O  O     . ILE A 1 1065 ? -19.538 -62.877  2.527   1.00 22.99  ? 1066 ILE A O     1 
ATOM   8096  C  CB    . ILE A 1 1065 ? -20.051 -60.980  4.791   1.00 17.11  ? 1066 ILE A CB    1 
ATOM   8097  C  CG1   . ILE A 1 1065 ? -19.461 -59.854  5.692   1.00 16.36  ? 1066 ILE A CG1   1 
ATOM   8098  C  CG2   . ILE A 1 1065 ? -21.459 -61.322  5.260   1.00 15.75  ? 1066 ILE A CG2   1 
ATOM   8099  C  CD1   . ILE A 1 1065 ? -20.332 -58.569  5.605   1.00 18.35  ? 1066 ILE A CD1   1 
ATOM   8100  N  N     . ALA A 1 1066 ? -19.853 -64.412  4.160   1.00 19.26  ? 1067 ALA A N     1 
ATOM   8101  C  CA    . ALA A 1 1066 ? -20.284 -65.482  3.275   1.00 18.01  ? 1067 ALA A CA    1 
ATOM   8102  C  C     . ALA A 1 1066 ? -21.775 -65.724  3.313   1.00 17.53  ? 1067 ALA A C     1 
ATOM   8103  O  O     . ALA A 1 1066 ? -22.454 -65.772  4.369   1.00 17.51  ? 1067 ALA A O     1 
ATOM   8104  C  CB    . ALA A 1 1066 ? -19.582 -66.820  3.653   1.00 17.37  ? 1067 ALA A CB    1 
ATOM   8105  N  N     . TYR A 1 1067 ? -22.316 -66.007  2.118   1.00 19.55  ? 1068 TYR A N     1 
ATOM   8106  C  CA    . TYR A 1 1067 ? -23.754 -66.379  2.118   1.00 21.26  ? 1068 TYR A CA    1 
ATOM   8107  C  C     . TYR A 1 1067 ? -23.868 -67.819  2.584   1.00 19.60  ? 1068 TYR A C     1 
ATOM   8108  O  O     . TYR A 1 1067 ? -23.379 -68.733  1.906   1.00 19.74  ? 1068 TYR A O     1 
ATOM   8109  C  CB    . TYR A 1 1067 ? -24.364 -66.195  0.735   1.00 22.46  ? 1068 TYR A CB    1 
ATOM   8110  C  CG    . TYR A 1 1067 ? -25.868 -66.473  0.744   1.00 25.65  ? 1068 TYR A CG    1 
ATOM   8111  C  CD1   . TYR A 1 1067 ? -26.757 -65.469  1.140   1.00 27.55  ? 1068 TYR A CD1   1 
ATOM   8112  C  CD2   . TYR A 1 1067 ? -26.408 -67.688  0.390   1.00 26.37  ? 1068 TYR A CD2   1 
ATOM   8113  C  CE1   . TYR A 1 1067 ? -28.133 -65.672  1.173   1.00 27.06  ? 1068 TYR A CE1   1 
ATOM   8114  C  CE2   . TYR A 1 1067 ? -27.781 -67.913  0.394   1.00 26.17  ? 1068 TYR A CE2   1 
ATOM   8115  C  CZ    . TYR A 1 1067 ? -28.627 -66.914  0.792   1.00 27.45  ? 1068 TYR A CZ    1 
ATOM   8116  O  OH    . TYR A 1 1067 ? -29.993 -67.135  0.814   1.00 27.60  ? 1068 TYR A OH    1 
ATOM   8117  N  N     . ALA A 1 1068 ? -24.502 -68.081  3.723   1.00 20.80  ? 1069 ALA A N     1 
ATOM   8118  C  CA    . ALA A 1 1068 ? -24.647 -69.458  4.241   1.00 20.76  ? 1069 ALA A CA    1 
ATOM   8119  C  C     . ALA A 1 1068 ? -26.084 -69.946  4.278   1.00 22.06  ? 1069 ALA A C     1 
ATOM   8120  O  O     . ALA A 1 1068 ? -26.949 -69.366  4.961   1.00 20.68  ? 1069 ALA A O     1 
ATOM   8121  C  CB    . ALA A 1 1068 ? -24.105 -69.501  5.683   1.00 21.19  ? 1069 ALA A CB    1 
ATOM   8122  N  N     . THR A 1 1069 ? -26.369 -71.062  3.545   1.00 19.58  ? 1070 THR A N     1 
ATOM   8123  C  CA    . THR A 1 1069 ? -27.741 -71.577  3.528   1.00 20.22  ? 1070 THR A CA    1 
ATOM   8124  C  C     . THR A 1 1069 ? -27.998 -72.357  4.792   1.00 20.06  ? 1070 THR A C     1 
ATOM   8125  O  O     . THR A 1 1069 ? -27.013 -72.820  5.373   1.00 23.09  ? 1070 THR A O     1 
ATOM   8126  C  CB    . THR A 1 1069 ? -27.959 -72.521  2.318   1.00 20.71  ? 1070 THR A CB    1 
ATOM   8127  O  OG1   . THR A 1 1069 ? -26.842 -73.413  2.378   1.00 22.49  ? 1070 THR A OG1   1 
ATOM   8128  C  CG2   . THR A 1 1069 ? -27.909 -71.693  1.051   1.00 19.92  ? 1070 THR A CG2   1 
ATOM   8129  N  N     . CYS A 1 1070 ? -29.247 -72.406  5.243   1.00 19.44  ? 1071 CYS A N     1 
ATOM   8130  C  CA    . CYS A 1 1070 ? -29.521 -73.052  6.525   1.00 19.60  ? 1071 CYS A CA    1 
ATOM   8131  C  C     . CYS A 1 1070 ? -30.889 -73.733  6.440   1.00 19.40  ? 1071 CYS A C     1 
ATOM   8132  O  O     . CYS A 1 1070 ? -31.748 -73.290  5.690   1.00 21.24  ? 1071 CYS A O     1 
ATOM   8133  C  CB    . CYS A 1 1070 ? -29.541 -71.945  7.591   1.00 16.34  ? 1071 CYS A CB    1 
ATOM   8134  S  SG    . CYS A 1 1070 ? -30.049 -72.457  9.249   1.00 19.62  ? 1071 CYS A SG    1 
ATOM   8135  N  N     . ILE A 1 1071 ? -31.083 -74.765  7.258   1.00 20.03  ? 1072 ILE A N     1 
ATOM   8136  C  CA    . ILE A 1 1071 ? -32.442 -75.374  7.219   1.00 19.89  ? 1072 ILE A CA    1 
ATOM   8137  C  C     . ILE A 1 1071 ? -33.566 -74.393  7.512   1.00 20.26  ? 1072 ILE A C     1 
ATOM   8138  O  O     . ILE A 1 1071 ? -34.724 -74.582  7.096   1.00 17.99  ? 1072 ILE A O     1 
ATOM   8139  C  CB    . ILE A 1 1071 ? -32.471 -76.576  8.160   1.00 24.24  ? 1072 ILE A CB    1 
ATOM   8140  C  CG1   . ILE A 1 1071 ? -32.199 -76.170  9.631   1.00 22.72  ? 1072 ILE A CG1   1 
ATOM   8141  C  CG2   . ILE A 1 1071 ? -31.461 -77.634  7.649   1.00 23.56  ? 1072 ILE A CG2   1 
ATOM   8142  C  CD1   . ILE A 1 1071 ? -32.443 -77.392  10.543  1.00 25.64  ? 1072 ILE A CD1   1 
ATOM   8143  N  N     . ASN A 1 1072 ? -33.229 -73.352  8.335   1.00 19.21  ? 1073 ASN A N     1 
ATOM   8144  C  CA    . ASN A 1 1072 ? -34.259 -72.402  8.778   1.00 21.10  ? 1073 ASN A CA    1 
ATOM   8145  C  C     . ASN A 1 1072 ? -34.810 -71.583  7.621   1.00 20.51  ? 1073 ASN A C     1 
ATOM   8146  O  O     . ASN A 1 1072 ? -35.927 -71.095  7.644   1.00 20.65  ? 1073 ASN A O     1 
ATOM   8147  C  CB    . ASN A 1 1072 ? -33.732 -71.391  9.837   1.00 21.11  ? 1073 ASN A CB    1 
ATOM   8148  C  CG    . ASN A 1 1072 ? -33.407 -71.922  11.213  1.00 23.09  ? 1073 ASN A CG    1 
ATOM   8149  O  OD1   . ASN A 1 1072 ? -32.692 -71.234  11.965  1.00 23.92  ? 1073 ASN A OD1   1 
ATOM   8150  N  ND2   . ASN A 1 1072 ? -33.801 -73.123  11.662  1.00 20.97  ? 1073 ASN A ND2   1 
ATOM   8151  N  N     . GLN A 1 1073 ? -34.082 -71.520  6.491   1.00 22.08  ? 1074 GLN A N     1 
ATOM   8152  C  CA    . GLN A 1 1073 ? -34.541 -70.733  5.352   1.00 21.82  ? 1074 GLN A CA    1 
ATOM   8153  C  C     . GLN A 1 1073 ? -35.552 -71.494  4.479   1.00 22.04  ? 1074 GLN A C     1 
ATOM   8154  O  O     . GLN A 1 1073 ? -36.135 -70.917  3.561   1.00 21.84  ? 1074 GLN A O     1 
ATOM   8155  C  CB    . GLN A 1 1073 ? -33.323 -70.397  4.481   1.00 22.56  ? 1074 GLN A CB    1 
ATOM   8156  C  CG    . GLN A 1 1073 ? -32.333 -69.534  5.248   1.00 22.31  ? 1074 GLN A CG    1 
ATOM   8157  C  CD    . GLN A 1 1073 ? -30.922 -69.604  4.663   1.00 24.59  ? 1074 GLN A CD    1 
ATOM   8158  O  OE1   . GLN A 1 1073 ? -30.720 -70.342  3.700   1.00 22.71  ? 1074 GLN A OE1   1 
ATOM   8159  N  NE2   . GLN A 1 1073 ? -29.953 -68.868  5.229   1.00 20.77  ? 1074 GLN A NE2   1 
ATOM   8160  N  N     . GLY A 1 1074 ? -35.728 -72.761  4.772   1.00 22.95  ? 1075 GLY A N     1 
ATOM   8161  C  CA    . GLY A 1 1074 ? -36.730 -73.606  4.078   1.00 23.40  ? 1075 GLY A CA    1 
ATOM   8162  C  C     . GLY A 1 1074 ? -36.490 -73.832  2.587   1.00 25.67  ? 1075 GLY A C     1 
ATOM   8163  O  O     . GLY A 1 1074 ? -37.470 -73.754  1.827   1.00 26.01  ? 1075 GLY A O     1 
ATOM   8164  N  N     . LEU A 1 1075 ? -35.292 -74.201  2.169   1.00 24.64  ? 1076 LEU A N     1 
ATOM   8165  C  CA    . LEU A 1 1075 ? -34.950 -74.560  0.798   1.00 24.53  ? 1076 LEU A CA    1 
ATOM   8166  C  C     . LEU A 1 1075 ? -35.918 -75.659  0.327   1.00 25.97  ? 1076 LEU A C     1 
ATOM   8167  O  O     . LEU A 1 1075 ? -35.986 -76.726  0.917   1.00 24.55  ? 1076 LEU A O     1 
ATOM   8168  C  CB    . LEU A 1 1075 ? -33.521 -75.061  0.634   1.00 26.92  ? 1076 LEU A CB    1 
ATOM   8169  C  CG    . LEU A 1 1075 ? -32.276 -74.245  0.964   1.00 30.74  ? 1076 LEU A CG    1 
ATOM   8170  C  CD1   . LEU A 1 1075 ? -31.038 -74.583  0.126   1.00 28.65  ? 1076 LEU A CD1   1 
ATOM   8171  C  CD2   . LEU A 1 1075 ? -32.476 -72.763  0.935   1.00 28.95  ? 1076 LEU A CD2   1 
ATOM   8172  N  N     . ARG A 1 1076 ? -36.752 -75.325  -0.650  1.00 28.34  ? 1077 ARG A N     1 
ATOM   8173  C  CA    . ARG A 1 1076 ? -37.831 -76.197  -1.112  1.00 32.21  ? 1077 ARG A CA    1 
ATOM   8174  C  C     . ARG A 1 1076 ? -37.460 -77.530  -1.732  1.00 30.22  ? 1077 ARG A C     1 
ATOM   8175  O  O     . ARG A 1 1076 ? -38.296 -78.422  -1.642  1.00 28.29  ? 1077 ARG A O     1 
ATOM   8176  C  CB    . ARG A 1 1076 ? -38.680 -75.427  -2.147  1.00 36.26  ? 1077 ARG A CB    1 
ATOM   8177  C  CG    . ARG A 1 1076 ? -40.004 -76.042  -2.507  1.00 42.20  ? 1077 ARG A CG    1 
ATOM   8178  C  CD    . ARG A 1 1076 ? -40.689 -75.417  -3.709  1.00 45.40  ? 1077 ARG A CD    1 
ATOM   8179  N  NE    . ARG A 1 1076 ? -41.772 -74.516  -3.357  1.00 50.66  ? 1077 ARG A NE    1 
ATOM   8180  C  CZ    . ARG A 1 1076 ? -41.912 -73.638  -2.367  1.00 51.86  ? 1077 ARG A CZ    1 
ATOM   8181  N  NH1   . ARG A 1 1076 ? -40.984 -73.464  -1.427  1.00 51.90  ? 1077 ARG A NH1   1 
ATOM   8182  N  NH2   . ARG A 1 1076 ? -43.042 -72.928  -2.331  1.00 52.11  ? 1077 ARG A NH2   1 
ATOM   8183  N  N     . LYS A 1 1077 ? -36.340 -77.620  -2.407  1.00 29.96  ? 1078 LYS A N     1 
ATOM   8184  C  CA    . LYS A 1 1077 ? -35.908 -78.846  -3.057  1.00 33.76  ? 1078 LYS A CA    1 
ATOM   8185  C  C     . LYS A 1 1077 ? -34.895 -79.615  -2.214  1.00 31.85  ? 1078 LYS A C     1 
ATOM   8186  O  O     . LYS A 1 1077 ? -34.410 -80.656  -2.662  1.00 31.84  ? 1078 LYS A O     1 
ATOM   8187  C  CB    . LYS A 1 1077 ? -35.287 -78.535  -4.420  1.00 36.90  ? 1078 LYS A CB    1 
ATOM   8188  C  CG    . LYS A 1 1077 ? -36.191 -77.776  -5.383  1.00 41.33  ? 1078 LYS A CG    1 
ATOM   8189  C  CD    . LYS A 1 1077 ? -35.294 -77.098  -6.429  1.00 44.67  ? 1078 LYS A CD    1 
ATOM   8190  C  CE    . LYS A 1 1077 ? -35.136 -77.977  -7.657  1.00 46.22  ? 1078 LYS A CE    1 
ATOM   8191  N  NZ    . LYS A 1 1077 ? -34.438 -77.270  -8.777  1.00 48.24  ? 1078 LYS A NZ    1 
ATOM   8192  N  N     . GLY A 1 1078 ? -34.563 -79.080  -1.037  1.00 28.96  ? 1079 GLY A N     1 
ATOM   8193  C  CA    . GLY A 1 1078 ? -33.611 -79.746  -0.136  1.00 24.41  ? 1079 GLY A CA    1 
ATOM   8194  C  C     . GLY A 1 1078 ? -32.302 -78.974  -0.021  1.00 24.72  ? 1079 GLY A C     1 
ATOM   8195  O  O     . GLY A 1 1078 ? -32.004 -78.087  -0.814  1.00 23.10  ? 1079 GLY A O     1 
ATOM   8196  N  N     . MET A 1 1079 ? -31.575 -79.209  1.073   1.00 26.12  ? 1080 MET A N     1 
ATOM   8197  C  CA    . MET A 1 1079 ? -30.302 -78.560  1.357   1.00 26.92  ? 1080 MET A CA    1 
ATOM   8198  C  C     . MET A 1 1079 ? -29.231 -78.978  0.355   1.00 27.32  ? 1080 MET A C     1 
ATOM   8199  O  O     . MET A 1 1079 ? -28.205 -78.327  0.209   1.00 27.00  ? 1080 MET A O     1 
ATOM   8200  C  CB    . MET A 1 1079 ? -29.882 -78.877  2.813   1.00 26.28  ? 1080 MET A CB    1 
ATOM   8201  C  CG    . MET A 1 1079 ? -30.743 -78.080  3.802   1.00 25.44  ? 1080 MET A CG    1 
ATOM   8202  S  SD    . MET A 1 1079 ? -30.534 -76.297  3.754   1.00 24.88  ? 1080 MET A SD    1 
ATOM   8203  C  CE    . MET A 1 1079 ? -28.926 -76.079  4.508   1.00 22.74  ? 1080 MET A CE    1 
ATOM   8204  N  N     . GLY A 1 1080 ? -29.465 -80.051  -0.390  1.00 27.15  ? 1081 GLY A N     1 
ATOM   8205  C  CA    . GLY A 1 1080 ? -28.639 -80.516  -1.488  1.00 25.36  ? 1081 GLY A CA    1 
ATOM   8206  C  C     . GLY A 1 1080 ? -28.623 -79.530  -2.652  1.00 24.24  ? 1081 GLY A C     1 
ATOM   8207  O  O     . GLY A 1 1080 ? -27.787 -79.605  -3.551  1.00 23.69  ? 1081 GLY A O     1 
ATOM   8208  N  N     . LYS A 1 1081 ? -29.535 -78.567  -2.665  1.00 26.53  ? 1082 LYS A N     1 
ATOM   8209  C  CA    . LYS A 1 1081 ? -29.555 -77.465  -3.613  1.00 27.66  ? 1082 LYS A CA    1 
ATOM   8210  C  C     . LYS A 1 1081 ? -28.839 -76.218  -3.093  1.00 27.30  ? 1082 LYS A C     1 
ATOM   8211  O  O     . LYS A 1 1081 ? -28.756 -75.159  -3.757  1.00 26.05  ? 1082 LYS A O     1 
ATOM   8212  C  CB    . LYS A 1 1081 ? -31.021 -77.119  -3.978  1.00 29.39  ? 1082 LYS A CB    1 
ATOM   8213  C  CG    . LYS A 1 1081 ? -31.594 -78.303  -4.806  1.00 31.38  ? 1082 LYS A CG    1 
ATOM   8214  C  CD    . LYS A 1 1081 ? -31.744 -77.918  -6.270  1.00 34.67  ? 1082 LYS A CD    1 
ATOM   8215  C  CE    . LYS A 1 1081 ? -30.535 -77.982  -7.155  1.00 34.12  ? 1082 LYS A CE    1 
ATOM   8216  N  NZ    . LYS A 1 1081 ? -30.881 -78.343  -8.561  1.00 34.75  ? 1082 LYS A NZ    1 
ATOM   8217  N  N     . SER A 1 1082 ? -28.236 -76.295  -1.890  1.00 27.55  ? 1083 SER A N     1 
ATOM   8218  C  CA    . SER A 1 1082 ? -27.557 -75.125  -1.313  1.00 24.03  ? 1083 SER A CA    1 
ATOM   8219  C  C     . SER A 1 1082 ? -26.591 -74.444  -2.280  1.00 24.62  ? 1083 SER A C     1 
ATOM   8220  O  O     . SER A 1 1082 ? -26.624 -73.216  -2.459  1.00 24.32  ? 1083 SER A O     1 
ATOM   8221  C  CB    . SER A 1 1082 ? -26.738 -75.401  -0.039  1.00 24.36  ? 1083 SER A CB    1 
ATOM   8222  O  OG    . SER A 1 1082 ? -27.541 -75.799  1.042   1.00 23.78  ? 1083 SER A OG    1 
ATOM   8223  N  N     . GLN A 1 1083 ? -25.723 -75.207  -2.962  1.00 23.85  ? 1084 GLN A N     1 
ATOM   8224  C  CA    . GLN A 1 1083 ? -24.751 -74.586  -3.853  1.00 23.13  ? 1084 GLN A CA    1 
ATOM   8225  C  C     . GLN A 1 1083 ? -25.472 -73.839  -4.980  1.00 22.50  ? 1084 GLN A C     1 
ATOM   8226  O  O     . GLN A 1 1083 ? -25.064 -72.778  -5.423  1.00 20.96  ? 1084 GLN A O     1 
ATOM   8227  C  CB    . GLN A 1 1083 ? -23.811 -75.619  -4.467  1.00 24.40  ? 1084 GLN A CB    1 
ATOM   8228  C  CG    . GLN A 1 1083 ? -22.828 -76.268  -3.504  1.00 25.04  ? 1084 GLN A CG    1 
ATOM   8229  C  CD    . GLN A 1 1083 ? -21.814 -75.278  -2.947  1.00 25.70  ? 1084 GLN A CD    1 
ATOM   8230  O  OE1   . GLN A 1 1083 ? -21.613 -75.220  -1.701  1.00 27.92  ? 1084 GLN A OE1   1 
ATOM   8231  N  NE2   . GLN A 1 1083 ? -21.200 -74.515  -3.811  1.00 21.61  ? 1084 GLN A NE2   1 
ATOM   8232  N  N     . ASP A 1 1084 ? -26.535 -74.477  -5.499  1.00 24.72  ? 1085 ASP A N     1 
ATOM   8233  C  CA    . ASP A 1 1084 ? -27.283 -73.795  -6.562  1.00 25.79  ? 1085 ASP A CA    1 
ATOM   8234  C  C     . ASP A 1 1084 ? -27.931 -72.519  -6.036  1.00 24.77  ? 1085 ASP A C     1 
ATOM   8235  O  O     . ASP A 1 1084 ? -28.018 -71.502  -6.745  1.00 24.13  ? 1085 ASP A O     1 
ATOM   8236  C  CB    . ASP A 1 1084 ? -28.355 -74.753  -7.131  1.00 30.00  ? 1085 ASP A CB    1 
ATOM   8237  C  CG    . ASP A 1 1084 ? -28.936 -74.214  -8.425  1.00 33.23  ? 1085 ASP A CG    1 
ATOM   8238  O  OD1   . ASP A 1 1084 ? -28.147 -73.802  -9.325  1.00 36.22  ? 1085 ASP A OD1   1 
ATOM   8239  O  OD2   . ASP A 1 1084 ? -30.177 -74.178  -8.538  1.00 34.73  ? 1085 ASP A OD2   1 
ATOM   8240  N  N     . VAL A 1 1085 ? -28.456 -72.551  -4.825  1.00 23.61  ? 1086 VAL A N     1 
ATOM   8241  C  CA    . VAL A 1 1085 ? -29.114 -71.393  -4.200  1.00 20.92  ? 1086 VAL A CA    1 
ATOM   8242  C  C     . VAL A 1 1085 ? -28.098 -70.294  -3.948  1.00 21.47  ? 1086 VAL A C     1 
ATOM   8243  O  O     . VAL A 1 1085 ? -28.396 -69.146  -4.216  1.00 19.27  ? 1086 VAL A O     1 
ATOM   8244  C  CB    . VAL A 1 1085 ? -29.797 -71.812  -2.870  1.00 22.01  ? 1086 VAL A CB    1 
ATOM   8245  C  CG1   . VAL A 1 1085 ? -30.229 -70.604  -1.999  1.00 18.63  ? 1086 VAL A CG1   1 
ATOM   8246  C  CG2   . VAL A 1 1085 ? -31.038 -72.620  -3.221  1.00 18.02  ? 1086 VAL A CG2   1 
ATOM   8247  N  N     . MET A 1 1086 ? -26.867 -70.700  -3.616  1.00 21.48  ? 1087 MET A N     1 
ATOM   8248  C  CA    . MET A 1 1086 ? -25.774 -69.727  -3.441  1.00 22.28  ? 1087 MET A CA    1 
ATOM   8249  C  C     . MET A 1 1086 ? -25.392 -69.074  -4.766  1.00 23.71  ? 1087 MET A C     1 
ATOM   8250  O  O     . MET A 1 1086 ? -25.223 -67.843  -4.848  1.00 23.45  ? 1087 MET A O     1 
ATOM   8251  C  CB    . MET A 1 1086 ? -24.584 -70.447  -2.873  1.00 20.79  ? 1087 MET A CB    1 
ATOM   8252  C  CG    . MET A 1 1086 ? -24.661 -70.799  -1.370  1.00 22.13  ? 1087 MET A CG    1 
ATOM   8253  S  SD    . MET A 1 1086 ? -23.244 -71.892  -1.028  1.00 24.65  ? 1087 MET A SD    1 
ATOM   8254  C  CE    . MET A 1 1086 ? -23.391 -72.060  0.762   1.00 25.94  ? 1087 MET A CE    1 
ATOM   8255  N  N     . ASN A 1 1087 ? -25.474 -69.865  -5.855  1.00 23.99  ? 1088 ASN A N     1 
ATOM   8256  C  CA    . ASN A 1 1087 ? -25.223 -69.275  -7.185  1.00 23.04  ? 1088 ASN A CA    1 
ATOM   8257  C  C     . ASN A 1 1087 ? -26.308 -68.256  -7.522  1.00 23.38  ? 1088 ASN A C     1 
ATOM   8258  O  O     . ASN A 1 1087 ? -26.027 -67.177  -8.043  1.00 24.00  ? 1088 ASN A O     1 
ATOM   8259  C  CB    . ASN A 1 1087 ? -25.295 -70.392  -8.223  1.00 25.46  ? 1088 ASN A CB    1 
ATOM   8260  C  CG    . ASN A 1 1087 ? -24.563 -70.130  -9.513  1.00 27.98  ? 1088 ASN A CG    1 
ATOM   8261  O  OD1   . ASN A 1 1087 ? -24.460 -71.041  -10.374 1.00 33.27  ? 1088 ASN A OD1   1 
ATOM   8262  N  ND2   . ASN A 1 1087 ? -24.065 -68.942  -9.759  1.00 27.38  ? 1088 ASN A ND2   1 
ATOM   8263  N  N     . THR A 1 1088 ? -27.563 -68.662  -7.334  1.00 23.70  ? 1089 THR A N     1 
ATOM   8264  C  CA    . THR A 1 1088 ? -28.689 -67.779  -7.675  1.00 25.44  ? 1089 THR A CA    1 
ATOM   8265  C  C     . THR A 1 1088 ? -28.748 -66.533  -6.812  1.00 24.12  ? 1089 THR A C     1 
ATOM   8266  O  O     . THR A 1 1088 ? -29.100 -65.416  -7.267  1.00 24.82  ? 1089 THR A O     1 
ATOM   8267  C  CB    . THR A 1 1088 ? -30.002 -68.589  -7.660  1.00 27.40  ? 1089 THR A CB    1 
ATOM   8268  O  OG1   . THR A 1 1088 ? -29.913 -69.568  -8.710  1.00 27.50  ? 1089 THR A OG1   1 
ATOM   8269  C  CG2   . THR A 1 1088 ? -31.220 -67.731  -8.032  1.00 28.57  ? 1089 THR A CG2   1 
ATOM   8270  N  N     . ALA A 1 1089 ? -28.367 -66.652  -5.538  1.00 23.66  ? 1090 ALA A N     1 
ATOM   8271  C  CA    . ALA A 1 1089 ? -28.339 -65.472  -4.657  1.00 22.23  ? 1090 ALA A CA    1 
ATOM   8272  C  C     . ALA A 1 1089 ? -27.440 -64.410  -5.262  1.00 22.05  ? 1090 ALA A C     1 
ATOM   8273  O  O     . ALA A 1 1089 ? -27.845 -63.240  -5.302  1.00 24.52  ? 1090 ALA A O     1 
ATOM   8274  C  CB    . ALA A 1 1089 ? -27.819 -65.792  -3.270  1.00 22.86  ? 1090 ALA A CB    1 
ATOM   8275  N  N     . VAL A 1 1090 ? -26.392 -64.860  -5.957  1.00 21.70  ? 1091 VAL A N     1 
ATOM   8276  C  CA    . VAL A 1 1090 ? -25.508 -63.898  -6.631  1.00 22.82  ? 1091 VAL A CA    1 
ATOM   8277  C  C     . VAL A 1 1090 ? -26.052 -63.482  -8.001  1.00 23.95  ? 1091 VAL A C     1 
ATOM   8278  O  O     . VAL A 1 1090 ? -26.141 -62.281  -8.232  1.00 25.77  ? 1091 VAL A O     1 
ATOM   8279  C  CB    . VAL A 1 1090 ? -24.049 -64.357  -6.739  1.00 22.81  ? 1091 VAL A CB    1 
ATOM   8280  C  CG1   . VAL A 1 1090 ? -23.135 -63.270  -7.325  1.00 22.05  ? 1091 VAL A CG1   1 
ATOM   8281  C  CG2   . VAL A 1 1090 ? -23.495 -64.752  -5.368  1.00 21.68  ? 1091 VAL A CG2   1 
ATOM   8282  N  N     . LYS A 1 1091 ? -26.491 -64.413  -8.860  1.00 24.59  ? 1092 LYS A N     1 
ATOM   8283  C  CA    . LYS A 1 1091 ? -26.973 -64.012  -10.194 1.00 26.27  ? 1092 LYS A CA    1 
ATOM   8284  C  C     . LYS A 1 1091 ? -28.160 -63.082  -10.195 1.00 25.78  ? 1092 LYS A C     1 
ATOM   8285  O  O     . LYS A 1 1091 ? -28.286 -62.187  -11.030 1.00 25.25  ? 1092 LYS A O     1 
ATOM   8286  C  CB    . LYS A 1 1091 ? -27.319 -65.271  -11.022 1.00 29.07  ? 1092 LYS A CB    1 
ATOM   8287  C  CG    . LYS A 1 1091 ? -26.088 -66.180  -11.163 1.00 31.75  ? 1092 LYS A CG    1 
ATOM   8288  C  CD    . LYS A 1 1091 ? -26.292 -67.179  -12.296 1.00 34.39  ? 1092 LYS A CD    1 
ATOM   8289  C  CE    . LYS A 1 1091 ? -26.562 -68.577  -11.762 1.00 37.31  ? 1092 LYS A CE    1 
ATOM   8290  N  NZ    . LYS A 1 1091 ? -27.643 -69.307  -12.527 1.00 39.92  ? 1092 LYS A NZ    1 
ATOM   8291  N  N     . SER A 1 1092 ? -29.049 -63.252  -9.220  1.00 25.42  ? 1093 SER A N     1 
ATOM   8292  C  CA    . SER A 1 1092 ? -30.240 -62.472  -9.047  1.00 23.27  ? 1093 SER A CA    1 
ATOM   8293  C  C     . SER A 1 1092 ? -29.970 -61.051  -8.567  1.00 25.46  ? 1093 SER A C     1 
ATOM   8294  O  O     . SER A 1 1092 ? -30.862 -60.198  -8.567  1.00 24.29  ? 1093 SER A O     1 
ATOM   8295  C  CB    . SER A 1 1092 ? -31.149 -63.172  -8.019  1.00 24.69  ? 1093 SER A CB    1 
ATOM   8296  O  OG    . SER A 1 1092 ? -30.570 -63.173  -6.702  1.00 24.07  ? 1093 SER A OG    1 
ATOM   8297  N  N     . GLY A 1 1093 ? -28.732 -60.851  -8.120  1.00 24.33  ? 1094 GLY A N     1 
ATOM   8298  C  CA    . GLY A 1 1093 ? -28.307 -59.590  -7.542  1.00 24.42  ? 1094 GLY A CA    1 
ATOM   8299  C  C     . GLY A 1 1093 ? -28.629 -59.524  -6.039  1.00 22.93  ? 1094 GLY A C     1 
ATOM   8300  O  O     . GLY A 1 1093 ? -28.405 -58.465  -5.440  1.00 22.17  ? 1094 GLY A O     1 
ATOM   8301  N  N     . TYR A 1 1094 ? -29.275 -60.516  -5.456  1.00 19.54  ? 1095 TYR A N     1 
ATOM   8302  C  CA    . TYR A 1 1094 ? -29.626 -60.503  -4.018  1.00 20.51  ? 1095 TYR A CA    1 
ATOM   8303  C  C     . TYR A 1 1094 ? -28.359 -60.402  -3.135  1.00 20.51  ? 1095 TYR A C     1 
ATOM   8304  O  O     . TYR A 1 1094 ? -28.385 -59.699  -2.135  1.00 21.41  ? 1095 TYR A O     1 
ATOM   8305  C  CB    . TYR A 1 1094 ? -30.369 -61.793  -3.709  1.00 20.03  ? 1095 TYR A CB    1 
ATOM   8306  C  CG    . TYR A 1 1094 ? -30.813 -62.090  -2.301  1.00 21.86  ? 1095 TYR A CG    1 
ATOM   8307  C  CD1   . TYR A 1 1094 ? -32.026 -61.605  -1.856  1.00 20.14  ? 1095 TYR A CD1   1 
ATOM   8308  C  CD2   . TYR A 1 1094 ? -30.027 -62.830  -1.417  1.00 22.26  ? 1095 TYR A CD2   1 
ATOM   8309  C  CE1   . TYR A 1 1094 ? -32.501 -61.886  -0.593  1.00 23.93  ? 1095 TYR A CE1   1 
ATOM   8310  C  CE2   . TYR A 1 1094 ? -30.473 -63.095  -0.124  1.00 24.26  ? 1095 TYR A CE2   1 
ATOM   8311  C  CZ    . TYR A 1 1094 ? -31.699 -62.620  0.271   1.00 23.69  ? 1095 TYR A CZ    1 
ATOM   8312  O  OH    . TYR A 1 1094 ? -32.201 -62.864  1.536   1.00 24.90  ? 1095 TYR A OH    1 
ATOM   8313  N  N     . TRP A 1 1095 ? -27.313 -61.148  -3.510  1.00 21.48  ? 1096 TRP A N     1 
ATOM   8314  C  CA    . TRP A 1 1095 ? -26.026 -61.157  -2.789  1.00 20.81  ? 1096 TRP A CA    1 
ATOM   8315  C  C     . TRP A 1 1095 ? -24.874 -60.876  -3.738  1.00 21.85  ? 1096 TRP A C     1 
ATOM   8316  O  O     . TRP A 1 1095 ? -24.141 -61.782  -4.175  1.00 23.45  ? 1096 TRP A O     1 
ATOM   8317  C  CB    . TRP A 1 1095 ? -25.901 -62.517  -2.109  1.00 20.86  ? 1096 TRP A CB    1 
ATOM   8318  C  CG    . TRP A 1 1095 ? -24.768 -62.621  -1.118  1.00 21.06  ? 1096 TRP A CG    1 
ATOM   8319  C  CD1   . TRP A 1 1095 ? -23.469 -62.920  -1.414  1.00 20.37  ? 1096 TRP A CD1   1 
ATOM   8320  C  CD2   . TRP A 1 1095 ? -24.853 -62.461  0.311   1.00 21.40  ? 1096 TRP A CD2   1 
ATOM   8321  N  NE1   . TRP A 1 1095 ? -22.724 -62.937  -0.230  1.00 20.86  ? 1096 TRP A NE1   1 
ATOM   8322  C  CE2   . TRP A 1 1095 ? -23.566 -62.693  0.827   1.00 21.79  ? 1096 TRP A CE2   1 
ATOM   8323  C  CE3   . TRP A 1 1095 ? -25.913 -62.234  1.192   1.00 21.22  ? 1096 TRP A CE3   1 
ATOM   8324  C  CZ2   . TRP A 1 1095 ? -23.282 -62.641  2.196   1.00 22.38  ? 1096 TRP A CZ2   1 
ATOM   8325  C  CZ3   . TRP A 1 1095 ? -25.628 -62.181  2.573   1.00 21.79  ? 1096 TRP A CZ3   1 
ATOM   8326  C  CH2   . TRP A 1 1095 ? -24.314 -62.352  3.048   1.00 20.17  ? 1096 TRP A CH2   1 
ATOM   8327  N  N     . PRO A 1 1096 ? -24.602 -59.623  -4.053  1.00 22.36  ? 1097 PRO A N     1 
ATOM   8328  C  CA    . PRO A 1 1096 ? -23.538 -59.267  -4.978  1.00 23.81  ? 1097 PRO A CA    1 
ATOM   8329  C  C     . PRO A 1 1096 ? -22.178 -59.500  -4.340  1.00 23.86  ? 1097 PRO A C     1 
ATOM   8330  O  O     . PRO A 1 1096 ? -22.067 -59.587  -3.102  1.00 24.02  ? 1097 PRO A O     1 
ATOM   8331  C  CB    . PRO A 1 1096 ? -23.863 -57.833  -5.315  1.00 23.10  ? 1097 PRO A CB    1 
ATOM   8332  C  CG    . PRO A 1 1096 ? -24.569 -57.319  -4.107  1.00 23.06  ? 1097 PRO A CG    1 
ATOM   8333  C  CD    . PRO A 1 1096 ? -25.373 -58.459  -3.566  1.00 22.22  ? 1097 PRO A CD    1 
ATOM   8334  N  N     . LEU A 1 1097 ? -21.194 -59.804  -5.170  1.00 23.37  ? 1098 LEU A N     1 
ATOM   8335  C  CA    . LEU A 1 1097 ? -19.866 -60.108  -4.675  1.00 20.94  ? 1098 LEU A CA    1 
ATOM   8336  C  C     . LEU A 1 1097 ? -18.902 -58.981  -5.008  1.00 23.49  ? 1098 LEU A C     1 
ATOM   8337  O  O     . LEU A 1 1097 ? -18.871 -58.488  -6.162  1.00 21.50  ? 1098 LEU A O     1 
ATOM   8338  C  CB    . LEU A 1 1097 ? -19.329 -61.427  -5.249  1.00 20.56  ? 1098 LEU A CB    1 
ATOM   8339  C  CG    . LEU A 1 1097 ? -20.065 -62.711  -4.870  1.00 19.26  ? 1098 LEU A CG    1 
ATOM   8340  C  CD1   . LEU A 1 1097 ? -19.265 -63.953  -5.310  1.00 21.34  ? 1098 LEU A CD1   1 
ATOM   8341  C  CD2   . LEU A 1 1097 ? -20.487 -62.797  -3.412  1.00 17.42  ? 1098 LEU A CD2   1 
ATOM   8342  N  N     . PHE A 1 1098 ? -18.106 -58.599  -3.984  1.00 21.10  ? 1099 PHE A N     1 
ATOM   8343  C  CA    . PHE A 1 1098 ? -17.163 -57.522  -4.181  1.00 21.29  ? 1099 PHE A CA    1 
ATOM   8344  C  C     . PHE A 1 1098 ? -15.957 -57.676  -3.255  1.00 21.92  ? 1099 PHE A C     1 
ATOM   8345  O  O     . PHE A 1 1098 ? -16.044 -58.469  -2.296  1.00 23.95  ? 1099 PHE A O     1 
ATOM   8346  C  CB    . PHE A 1 1098 ? -17.794 -56.127  -3.953  1.00 22.11  ? 1099 PHE A CB    1 
ATOM   8347  C  CG    . PHE A 1 1098 ? -18.663 -55.993  -2.726  1.00 21.17  ? 1099 PHE A CG    1 
ATOM   8348  C  CD1   . PHE A 1 1098 ? -18.080 -55.729  -1.500  1.00 23.21  ? 1099 PHE A CD1   1 
ATOM   8349  C  CD2   . PHE A 1 1098 ? -20.035 -56.171  -2.811  1.00 22.87  ? 1099 PHE A CD2   1 
ATOM   8350  C  CE1   . PHE A 1 1098 ? -18.895 -55.634  -0.375  1.00 23.06  ? 1099 PHE A CE1   1 
ATOM   8351  C  CE2   . PHE A 1 1098 ? -20.846 -56.088  -1.683  1.00 22.36  ? 1099 PHE A CE2   1 
ATOM   8352  C  CZ    . PHE A 1 1098 ? -20.247 -55.813  -0.450  1.00 20.44  ? 1099 PHE A CZ    1 
ATOM   8353  N  N     . ARG A 1 1099 ? -14.923 -56.891  -3.503  1.00 21.70  ? 1100 ARG A N     1 
ATOM   8354  C  CA    . ARG A 1 1099 ? -13.760 -56.853  -2.617  1.00 21.72  ? 1100 ARG A CA    1 
ATOM   8355  C  C     . ARG A 1 1099 ? -13.309 -55.397  -2.487  1.00 23.09  ? 1100 ARG A C     1 
ATOM   8356  O  O     . ARG A 1 1099 ? -13.254 -54.627  -3.451  1.00 24.21  ? 1100 ARG A O     1 
ATOM   8357  C  CB    . ARG A 1 1099 ? -12.578 -57.682  -3.120  1.00 22.11  ? 1100 ARG A CB    1 
ATOM   8358  C  CG    . ARG A 1 1099 ? -12.885 -59.189  -3.193  1.00 21.28  ? 1100 ARG A CG    1 
ATOM   8359  C  CD    . ARG A 1 1099 ? -11.758 -59.764  -4.036  1.00 24.24  ? 1100 ARG A CD    1 
ATOM   8360  N  NE    . ARG A 1 1099 ? -12.060 -59.381  -5.436  1.00 25.32  ? 1100 ARG A NE    1 
ATOM   8361  C  CZ    . ARG A 1 1099 ? -11.107 -58.996  -6.283  1.00 28.46  ? 1100 ARG A CZ    1 
ATOM   8362  N  NH1   . ARG A 1 1099 ? -9.831  -58.971  -5.933  1.00 28.89  ? 1100 ARG A NH1   1 
ATOM   8363  N  NH2   . ARG A 1 1099 ? -11.436 -58.663  -7.536  1.00 28.43  ? 1100 ARG A NH2   1 
ATOM   8364  N  N     . TYR A 1 1100 ? -13.072 -54.977  -1.247  1.00 22.38  ? 1101 TYR A N     1 
ATOM   8365  C  CA    . TYR A 1 1100 ? -12.587 -53.612  -0.967  1.00 21.08  ? 1101 TYR A CA    1 
ATOM   8366  C  C     . TYR A 1 1100 ? -11.181 -53.758  -0.469  1.00 22.24  ? 1101 TYR A C     1 
ATOM   8367  O  O     . TYR A 1 1100 ? -11.017 -54.318  0.666   1.00 20.90  ? 1101 TYR A O     1 
ATOM   8368  C  CB    . TYR A 1 1100 ? -13.563 -52.902  0.028   1.00 20.86  ? 1101 TYR A CB    1 
ATOM   8369  C  CG    . TYR A 1 1100 ? -13.171 -51.452  0.268   1.00 18.37  ? 1101 TYR A CG    1 
ATOM   8370  C  CD1   . TYR A 1 1100 ? -13.655 -50.419  -0.496  1.00 20.63  ? 1101 TYR A CD1   1 
ATOM   8371  C  CD2   . TYR A 1 1100 ? -12.222 -51.132  1.229   1.00 21.76  ? 1101 TYR A CD2   1 
ATOM   8372  C  CE1   . TYR A 1 1100 ? -13.258 -49.107  -0.301  1.00 21.29  ? 1101 TYR A CE1   1 
ATOM   8373  C  CE2   . TYR A 1 1100 ? -11.802 -49.831  1.446   1.00 22.68  ? 1101 TYR A CE2   1 
ATOM   8374  C  CZ    . TYR A 1 1100 ? -12.323 -48.800  0.670   1.00 23.62  ? 1101 TYR A CZ    1 
ATOM   8375  O  OH    . TYR A 1 1100 ? -11.895 -47.513  0.882   1.00 23.40  ? 1101 TYR A OH    1 
ATOM   8376  N  N     . ASP A 1 1101 ? -10.144 -53.374  -1.224  1.00 21.55  ? 1102 ASP A N     1 
ATOM   8377  C  CA    . ASP A 1 1101 ? -8.767  -53.583  -0.785  1.00 21.53  ? 1102 ASP A CA    1 
ATOM   8378  C  C     . ASP A 1 1101 ? -7.952  -52.336  -0.651  1.00 23.31  ? 1102 ASP A C     1 
ATOM   8379  O  O     . ASP A 1 1101 ? -7.477  -51.718  -1.627  1.00 23.16  ? 1102 ASP A O     1 
ATOM   8380  C  CB    . ASP A 1 1101 ? -8.128  -54.651  -1.695  1.00 20.85  ? 1102 ASP A CB    1 
ATOM   8381  C  CG    . ASP A 1 1101 ? -6.753  -55.150  -1.345  1.00 20.93  ? 1102 ASP A CG    1 
ATOM   8382  O  OD1   . ASP A 1 1101 ? -6.071  -54.602  -0.467  1.00 21.66  ? 1102 ASP A OD1   1 
ATOM   8383  O  OD2   . ASP A 1 1101 ? -6.284  -56.174  -1.924  1.00 19.20  ? 1102 ASP A OD2   1 
ATOM   8384  N  N     . PRO A 1 1102 ? -7.760  -51.836  0.585   1.00 21.70  ? 1103 PRO A N     1 
ATOM   8385  C  CA    . PRO A 1 1102 ? -6.989  -50.663  0.854   1.00 19.70  ? 1103 PRO A CA    1 
ATOM   8386  C  C     . PRO A 1 1102 ? -5.584  -50.682  0.252   1.00 22.34  ? 1103 PRO A C     1 
ATOM   8387  O  O     . PRO A 1 1102 ? -5.048  -49.566  -0.007  1.00 19.70  ? 1103 PRO A O     1 
ATOM   8388  C  CB    . PRO A 1 1102 ? -6.839  -50.625  2.387   1.00 21.44  ? 1103 PRO A CB    1 
ATOM   8389  C  CG    . PRO A 1 1102 ? -7.996  -51.423  2.892   1.00 21.34  ? 1103 PRO A CG    1 
ATOM   8390  C  CD    . PRO A 1 1102 ? -8.314  -52.451  1.828   1.00 22.63  ? 1103 PRO A CD    1 
ATOM   8391  N  N     . ARG A 1 1103 ? -5.002  -51.859  -0.033  1.00 21.97  ? 1104 ARG A N     1 
ATOM   8392  C  CA    . ARG A 1 1103 ? -3.663  -51.688  -0.653  1.00 24.01  ? 1104 ARG A CA    1 
ATOM   8393  C  C     . ARG A 1 1103 ? -3.698  -51.195  -2.106  1.00 24.55  ? 1104 ARG A C     1 
ATOM   8394  O  O     . ARG A 1 1103 ? -2.721  -50.521  -2.483  1.00 24.09  ? 1104 ARG A O     1 
ATOM   8395  C  CB    . ARG A 1 1103 ? -2.693  -52.798  -0.465  1.00 25.07  ? 1104 ARG A CB    1 
ATOM   8396  C  CG    . ARG A 1 1103 ? -3.206  -54.150  -0.563  1.00 24.73  ? 1104 ARG A CG    1 
ATOM   8397  C  CD    . ARG A 1 1103 ? -2.670  -55.165  0.472   1.00 22.35  ? 1104 ARG A CD    1 
ATOM   8398  N  NE    . ARG A 1 1103 ? -3.736  -56.158  0.283   1.00 18.26  ? 1104 ARG A NE    1 
ATOM   8399  C  CZ    . ARG A 1 1103 ? -3.871  -57.450  0.408   1.00 19.52  ? 1104 ARG A CZ    1 
ATOM   8400  N  NH1   . ARG A 1 1103 ? -5.079  -57.905  0.148   1.00 16.78  ? 1104 ARG A NH1   1 
ATOM   8401  N  NH2   . ARG A 1 1103 ? -2.943  -58.290  0.806   1.00 18.51  ? 1104 ARG A NH2   1 
ATOM   8402  N  N     . LEU A 1 1104 ? -4.833  -51.301  -2.774  1.00 23.84  ? 1105 LEU A N     1 
ATOM   8403  C  CA    . LEU A 1 1104 ? -4.936  -50.692  -4.096  1.00 25.96  ? 1105 LEU A CA    1 
ATOM   8404  C  C     . LEU A 1 1104 ? -4.945  -49.171  -4.006  1.00 27.41  ? 1105 LEU A C     1 
ATOM   8405  O  O     . LEU A 1 1104 ? -4.235  -48.536  -4.778  1.00 28.50  ? 1105 LEU A O     1 
ATOM   8406  C  CB    . LEU A 1 1104 ? -6.146  -51.223  -4.818  1.00 24.56  ? 1105 LEU A CB    1 
ATOM   8407  C  CG    . LEU A 1 1104 ? -6.213  -52.716  -5.124  1.00 26.31  ? 1105 LEU A CG    1 
ATOM   8408  C  CD1   . LEU A 1 1104 ? -7.509  -53.019  -5.873  1.00 26.21  ? 1105 LEU A CD1   1 
ATOM   8409  C  CD2   . LEU A 1 1104 ? -5.014  -53.168  -5.932  1.00 28.87  ? 1105 LEU A CD2   1 
ATOM   8410  N  N     . ALA A 1 1105 ? -5.613  -48.585  -3.009  1.00 30.58  ? 1106 ALA A N     1 
ATOM   8411  C  CA    . ALA A 1 1105 ? -5.675  -47.144  -2.815  1.00 33.52  ? 1106 ALA A CA    1 
ATOM   8412  C  C     . ALA A 1 1105 ? -4.317  -46.548  -2.457  1.00 35.68  ? 1106 ALA A C     1 
ATOM   8413  O  O     . ALA A 1 1105 ? -3.875  -45.487  -2.935  1.00 34.67  ? 1106 ALA A O     1 
ATOM   8414  C  CB    . ALA A 1 1105 ? -6.709  -46.730  -1.774  1.00 34.29  ? 1106 ALA A CB    1 
ATOM   8415  N  N     . ALA A 1 1106 ? -3.565  -47.337  -1.680  1.00 35.86  ? 1107 ALA A N     1 
ATOM   8416  C  CA    . ALA A 1 1106 ? -2.187  -46.963  -1.350  1.00 36.75  ? 1107 ALA A CA    1 
ATOM   8417  C  C     . ALA A 1 1106 ? -1.338  -46.808  -2.618  1.00 37.60  ? 1107 ALA A C     1 
ATOM   8418  O  O     . ALA A 1 1106 ? -0.399  -46.006  -2.621  1.00 37.19  ? 1107 ALA A O     1 
ATOM   8419  C  CB    . ALA A 1 1106 ? -1.551  -47.993  -0.416  1.00 37.54  ? 1107 ALA A CB    1 
ATOM   8420  N  N     . GLN A 1 1107 ? -1.733  -47.493  -3.689  1.00 37.98  ? 1108 GLN A N     1 
ATOM   8421  C  CA    . GLN A 1 1107 ? -0.997  -47.375  -4.949  1.00 38.23  ? 1108 GLN A CA    1 
ATOM   8422  C  C     . GLN A 1 1107 ? -1.791  -46.533  -5.929  1.00 39.14  ? 1108 GLN A C     1 
ATOM   8423  O  O     . GLN A 1 1107 ? -1.669  -46.648  -7.152  1.00 40.32  ? 1108 GLN A O     1 
ATOM   8424  C  CB    . GLN A 1 1107 ? -0.644  -48.725  -5.505  1.00 39.25  ? 1108 GLN A CB    1 
ATOM   8425  C  CG    . GLN A 1 1107 ? -1.615  -49.684  -6.141  1.00 42.07  ? 1108 GLN A CG    1 
ATOM   8426  C  CD    . GLN A 1 1107 ? -1.162  -51.124  -5.889  1.00 44.59  ? 1108 GLN A CD    1 
ATOM   8427  O  OE1   . GLN A 1 1107 ? -0.475  -51.405  -4.894  1.00 45.48  ? 1108 GLN A OE1   1 
ATOM   8428  N  NE2   . GLN A 1 1107 ? -1.513  -52.067  -6.757  1.00 45.80  ? 1108 GLN A NE2   1 
ATOM   8429  N  N     . GLY A 1 1108 ? -2.680  -45.696  -5.371  1.00 39.11  ? 1109 GLY A N     1 
ATOM   8430  C  CA    . GLY A 1 1108 ? -3.482  -44.827  -6.211  1.00 37.01  ? 1109 GLY A CA    1 
ATOM   8431  C  C     . GLY A 1 1108 ? -4.451  -45.483  -7.157  1.00 37.88  ? 1109 GLY A C     1 
ATOM   8432  O  O     . GLY A 1 1108 ? -4.819  -44.841  -8.141  1.00 37.04  ? 1109 GLY A O     1 
ATOM   8433  N  N     . LYS A 1 1109 ? -4.909  -46.710  -6.890  1.00 36.47  ? 1110 LYS A N     1 
ATOM   8434  C  CA    . LYS A 1 1109 ? -5.937  -47.402  -7.651  1.00 34.07  ? 1110 LYS A CA    1 
ATOM   8435  C  C     . LYS A 1 1109 ? -7.194  -47.545  -6.756  1.00 32.77  ? 1110 LYS A C     1 
ATOM   8436  O  O     . LYS A 1 1109 ? -7.084  -47.604  -5.519  1.00 31.27  ? 1110 LYS A O     1 
ATOM   8437  C  CB    . LYS A 1 1109 ? -5.550  -48.800  -8.108  1.00 36.98  ? 1110 LYS A CB    1 
ATOM   8438  C  CG    . LYS A 1 1109 ? -4.415  -48.817  -9.134  1.00 39.77  ? 1110 LYS A CG    1 
ATOM   8439  C  CD    . LYS A 1 1109 ? -4.430  -50.113  -9.943  1.00 41.70  ? 1110 LYS A CD    1 
ATOM   8440  C  CE    . LYS A 1 1109 ? -3.071  -50.461  -10.528 1.00 44.25  ? 1110 LYS A CE    1 
ATOM   8441  N  NZ    . LYS A 1 1109 ? -1.903  -49.826  -9.841  1.00 44.72  ? 1110 LYS A NZ    1 
ATOM   8442  N  N     . ASN A 1 1110 ? -8.375  -47.650  -7.348  1.00 29.57  ? 1111 ASN A N     1 
ATOM   8443  C  CA    . ASN A 1 1110 ? -9.586  -47.746  -6.534  1.00 29.18  ? 1111 ASN A CA    1 
ATOM   8444  C  C     . ASN A 1 1110 ? -9.666  -49.099  -5.812  1.00 26.33  ? 1111 ASN A C     1 
ATOM   8445  O  O     . ASN A 1 1110 ? -9.641  -50.163  -6.409  1.00 24.61  ? 1111 ASN A O     1 
ATOM   8446  C  CB    . ASN A 1 1110 ? -10.840 -47.469  -7.326  1.00 31.39  ? 1111 ASN A CB    1 
ATOM   8447  C  CG    . ASN A 1 1110 ? -12.027 -47.244  -6.394  1.00 33.69  ? 1111 ASN A CG    1 
ATOM   8448  O  OD1   . ASN A 1 1110 ? -12.574 -48.151  -5.796  1.00 32.31  ? 1111 ASN A OD1   1 
ATOM   8449  N  ND2   . ASN A 1 1110 ? -12.468 -45.989  -6.317  1.00 37.17  ? 1111 ASN A ND2   1 
ATOM   8450  N  N     . PRO A 1 1111 ? -9.792  -49.035  -4.494  1.00 24.58  ? 1112 PRO A N     1 
ATOM   8451  C  CA    . PRO A 1 1111 ? -9.851  -50.253  -3.683  1.00 23.63  ? 1112 PRO A CA    1 
ATOM   8452  C  C     . PRO A 1 1111 ? -11.101 -51.082  -3.867  1.00 21.52  ? 1112 PRO A C     1 
ATOM   8453  O  O     . PRO A 1 1111 ? -11.130 -52.290  -3.538  1.00 21.17  ? 1112 PRO A O     1 
ATOM   8454  C  CB    . PRO A 1 1111 ? -9.675  -49.665  -2.284  1.00 24.02  ? 1112 PRO A CB    1 
ATOM   8455  C  CG    . PRO A 1 1111 ? -10.246 -48.309  -2.357  1.00 25.02  ? 1112 PRO A CG    1 
ATOM   8456  C  CD    . PRO A 1 1111 ? -9.820  -47.776  -3.706  1.00 24.68  ? 1112 PRO A CD    1 
ATOM   8457  N  N     . PHE A 1 1112 ? -12.179 -50.507  -4.395  1.00 22.24  ? 1113 PHE A N     1 
ATOM   8458  C  CA    . PHE A 1 1112 ? -13.438 -51.221  -4.590  1.00 23.55  ? 1113 PHE A CA    1 
ATOM   8459  C  C     . PHE A 1 1112 ? -13.505 -51.975  -5.924  1.00 26.18  ? 1113 PHE A C     1 
ATOM   8460  O  O     . PHE A 1 1112 ? -13.486 -51.278  -6.957  1.00 24.40  ? 1113 PHE A O     1 
ATOM   8461  C  CB    . PHE A 1 1112 ? -14.682 -50.308  -4.475  1.00 25.15  ? 1113 PHE A CB    1 
ATOM   8462  C  CG    . PHE A 1 1112 ? -15.945 -51.144  -4.413  1.00 27.22  ? 1113 PHE A CG    1 
ATOM   8463  C  CD1   . PHE A 1 1112 ? -16.309 -51.803  -3.252  1.00 25.81  ? 1113 PHE A CD1   1 
ATOM   8464  C  CD2   . PHE A 1 1112 ? -16.750 -51.283  -5.541  1.00 27.42  ? 1113 PHE A CD2   1 
ATOM   8465  C  CE1   . PHE A 1 1112 ? -17.435 -52.601  -3.157  1.00 24.36  ? 1113 PHE A CE1   1 
ATOM   8466  C  CE2   . PHE A 1 1112 ? -17.883 -52.092  -5.460  1.00 26.56  ? 1113 PHE A CE2   1 
ATOM   8467  C  CZ    . PHE A 1 1112 ? -18.211 -52.735  -4.276  1.00 26.78  ? 1113 PHE A CZ    1 
ATOM   8468  N  N     . GLN A 1 1113 ? -13.769 -53.274  -5.861  1.00 24.18  ? 1114 GLN A N     1 
ATOM   8469  C  CA    . GLN A 1 1113 ? -13.887 -54.095  -7.062  1.00 26.67  ? 1114 GLN A CA    1 
ATOM   8470  C  C     . GLN A 1 1113 ? -15.147 -54.953  -7.000  1.00 27.53  ? 1114 GLN A C     1 
ATOM   8471  O  O     . GLN A 1 1113 ? -15.398 -55.718  -6.052  1.00 26.23  ? 1114 GLN A O     1 
ATOM   8472  C  CB    . GLN A 1 1113 ? -12.659 -55.020  -7.156  1.00 26.42  ? 1114 GLN A CB    1 
ATOM   8473  C  CG    . GLN A 1 1113 ? -11.369 -54.253  -6.851  1.00 26.93  ? 1114 GLN A CG    1 
ATOM   8474  C  CD    . GLN A 1 1113 ? -10.311 -55.221  -6.322  1.00 30.60  ? 1114 GLN A CD    1 
ATOM   8475  O  OE1   . GLN A 1 1113 ? -9.688  -55.967  -7.112  1.00 28.39  ? 1114 GLN A OE1   1 
ATOM   8476  N  NE2   . GLN A 1 1113 ? -10.133 -55.204  -4.989  1.00 27.64  ? 1114 GLN A NE2   1 
ATOM   8477  N  N     . LEU A 1 1114 ? -15.950 -54.873  -8.061  1.00 28.93  ? 1115 LEU A N     1 
ATOM   8478  C  CA    . LEU A 1 1114 ? -17.174 -55.650  -8.175  1.00 29.38  ? 1115 LEU A CA    1 
ATOM   8479  C  C     . LEU A 1 1114 ? -16.889 -56.997  -8.832  1.00 30.84  ? 1115 LEU A C     1 
ATOM   8480  O  O     . LEU A 1 1114 ? -16.376 -57.026  -9.965  1.00 31.40  ? 1115 LEU A O     1 
ATOM   8481  C  CB    . LEU A 1 1114 ? -18.191 -54.873  -8.989  1.00 30.73  ? 1115 LEU A CB    1 
ATOM   8482  C  CG    . LEU A 1 1114 ? -19.542 -54.396  -8.480  1.00 30.53  ? 1115 LEU A CG    1 
ATOM   8483  C  CD1   . LEU A 1 1114 ? -20.452 -53.957  -9.631  1.00 27.45  ? 1115 LEU A CD1   1 
ATOM   8484  C  CD2   . LEU A 1 1114 ? -20.255 -55.388  -7.591  1.00 30.10  ? 1115 LEU A CD2   1 
ATOM   8485  N  N     . ASP A 1 1115 ? -17.215 -58.108  -8.201  1.00 29.09  ? 1116 ASP A N     1 
ATOM   8486  C  CA    . ASP A 1 1115 ? -16.933 -59.430  -8.766  1.00 30.46  ? 1116 ASP A CA    1 
ATOM   8487  C  C     . ASP A 1 1115 ? -18.129 -60.179  -9.305  1.00 29.87  ? 1116 ASP A C     1 
ATOM   8488  O  O     . ASP A 1 1115 ? -18.013 -61.363  -9.675  1.00 32.75  ? 1116 ASP A O     1 
ATOM   8489  C  CB    . ASP A 1 1115 ? -16.339 -60.313  -7.661  1.00 29.22  ? 1116 ASP A CB    1 
ATOM   8490  C  CG    . ASP A 1 1115 ? -14.975 -59.835  -7.215  1.00 30.14  ? 1116 ASP A CG    1 
ATOM   8491  O  OD1   . ASP A 1 1115 ? -14.261 -59.210  -8.031  1.00 30.37  ? 1116 ASP A OD1   1 
ATOM   8492  O  OD2   . ASP A 1 1115 ? -14.604 -60.141  -6.053  1.00 27.10  ? 1116 ASP A OD2   1 
ATOM   8493  N  N     . SER A 1 1116 ? -19.317 -59.621  -9.200  1.00 27.90  ? 1117 SER A N     1 
ATOM   8494  C  CA    . SER A 1 1116 ? -20.524 -60.322  -9.703  1.00 26.70  ? 1117 SER A CA    1 
ATOM   8495  C  C     . SER A 1 1116 ? -21.192 -59.344  -10.667 1.00 26.53  ? 1117 SER A C     1 
ATOM   8496  O  O     . SER A 1 1116 ? -20.631 -58.241  -10.858 1.00 25.84  ? 1117 SER A O     1 
ATOM   8497  C  CB    . SER A 1 1116 ? -21.427 -60.715  -8.533  1.00 25.89  ? 1117 SER A CB    1 
ATOM   8498  O  OG    . SER A 1 1116 ? -21.982 -59.523  -8.000  1.00 25.20  ? 1117 SER A OG    1 
ATOM   8499  N  N     . LYS A 1 1117 ? -22.242 -59.686  -11.356 1.00 28.74  ? 1118 LYS A N     1 
ATOM   8500  C  CA    . LYS A 1 1117 ? -22.839 -58.874  -12.394 1.00 30.62  ? 1118 LYS A CA    1 
ATOM   8501  C  C     . LYS A 1 1117 ? -24.199 -58.325  -12.004 1.00 30.96  ? 1118 LYS A C     1 
ATOM   8502  O  O     . LYS A 1 1117 ? -24.821 -58.776  -11.050 1.00 28.17  ? 1118 LYS A O     1 
ATOM   8503  C  CB    . LYS A 1 1117 ? -23.089 -59.667  -13.690 1.00 33.12  ? 1118 LYS A CB    1 
ATOM   8504  C  CG    . LYS A 1 1117 ? -21.885 -60.402  -14.265 1.00 35.34  ? 1118 LYS A CG    1 
ATOM   8505  C  CD    . LYS A 1 1117 ? -22.427 -61.700  -14.913 1.00 40.05  ? 1118 LYS A CD    1 
ATOM   8506  C  CE    . LYS A 1 1117 ? -22.660 -62.736  -13.811 1.00 42.00  ? 1118 LYS A CE    1 
ATOM   8507  N  NZ    . LYS A 1 1117 ? -22.913 -64.130  -14.204 1.00 42.73  ? 1118 LYS A NZ    1 
ATOM   8508  N  N     . ALA A 1 1118 ? -24.714 -57.483  -12.897 1.00 30.18  ? 1119 ALA A N     1 
ATOM   8509  C  CA    . ALA A 1 1118 ? -26.015 -56.848  -12.673 1.00 32.30  ? 1119 ALA A CA    1 
ATOM   8510  C  C     . ALA A 1 1118 ? -27.096 -57.891  -12.459 1.00 31.90  ? 1119 ALA A C     1 
ATOM   8511  O  O     . ALA A 1 1118 ? -26.980 -59.028  -12.951 1.00 32.61  ? 1119 ALA A O     1 
ATOM   8512  C  CB    . ALA A 1 1118 ? -26.323 -55.874  -13.790 1.00 33.51  ? 1119 ALA A CB    1 
ATOM   8513  N  N     . PRO A 1 1119 ? -28.081 -57.609  -11.624 1.00 28.99  ? 1120 PRO A N     1 
ATOM   8514  C  CA    . PRO A 1 1119 ? -29.123 -58.535  -11.265 1.00 29.90  ? 1120 PRO A CA    1 
ATOM   8515  C  C     . PRO A 1 1119 ? -29.713 -59.165  -12.528 1.00 32.61  ? 1120 PRO A C     1 
ATOM   8516  O  O     . PRO A 1 1119 ? -29.956 -58.369  -13.463 1.00 33.12  ? 1120 PRO A O     1 
ATOM   8517  C  CB    . PRO A 1 1119 ? -30.158 -57.668  -10.547 1.00 28.20  ? 1120 PRO A CB    1 
ATOM   8518  C  CG    . PRO A 1 1119 ? -29.429 -56.474  -10.072 1.00 27.36  ? 1120 PRO A CG    1 
ATOM   8519  C  CD    . PRO A 1 1119 ? -28.275 -56.261  -11.009 1.00 30.55  ? 1120 PRO A CD    1 
ATOM   8520  N  N     . ASP A 1 1120 ? -29.889 -60.463  -12.593 1.00 30.52  ? 1121 ASP A N     1 
ATOM   8521  C  CA    . ASP A 1 1120 ? -30.357 -61.016  -13.879 1.00 30.55  ? 1121 ASP A CA    1 
ATOM   8522  C  C     . ASP A 1 1120 ? -31.858 -61.121  -14.006 1.00 32.26  ? 1121 ASP A C     1 
ATOM   8523  O  O     . ASP A 1 1120 ? -32.297 -61.944  -14.827 1.00 32.60  ? 1121 ASP A O     1 
ATOM   8524  C  CB    . ASP A 1 1120 ? -29.637 -62.361  -14.080 1.00 28.49  ? 1121 ASP A CB    1 
ATOM   8525  C  CG    . ASP A 1 1120 ? -30.123 -63.460  -13.175 1.00 28.42  ? 1121 ASP A CG    1 
ATOM   8526  O  OD1   . ASP A 1 1120 ? -30.961 -63.250  -12.268 1.00 28.18  ? 1121 ASP A OD1   1 
ATOM   8527  O  OD2   . ASP A 1 1120 ? -29.676 -64.615  -13.370 1.00 29.33  ? 1121 ASP A OD2   1 
ATOM   8528  N  N     . GLY A 1 1121 ? -32.627 -60.525  -13.093 1.00 32.85  ? 1122 GLY A N     1 
ATOM   8529  C  CA    . GLY A 1 1121 ? -34.072 -60.706  -13.142 1.00 32.73  ? 1122 GLY A CA    1 
ATOM   8530  C  C     . GLY A 1 1121 ? -34.629 -61.942  -12.461 1.00 31.06  ? 1122 GLY A C     1 
ATOM   8531  O  O     . GLY A 1 1121 ? -35.872 -62.053  -12.500 1.00 32.55  ? 1122 GLY A O     1 
ATOM   8532  N  N     . SER A 1 1122 ? -33.882 -62.895  -11.938 1.00 29.85  ? 1123 SER A N     1 
ATOM   8533  C  CA    . SER A 1 1122 ? -34.430 -64.069  -11.285 1.00 30.54  ? 1123 SER A CA    1 
ATOM   8534  C  C     . SER A 1 1122 ? -34.762 -63.927  -9.810  1.00 30.25  ? 1123 SER A C     1 
ATOM   8535  O  O     . SER A 1 1122 ? -35.049 -64.981  -9.179  1.00 30.70  ? 1123 SER A O     1 
ATOM   8536  C  CB    . SER A 1 1122 ? -33.441 -65.269  -11.400 1.00 31.25  ? 1123 SER A CB    1 
ATOM   8537  O  OG    . SER A 1 1122 ? -32.163 -64.916  -10.857 1.00 32.80  ? 1123 SER A OG    1 
ATOM   8538  N  N     . VAL A 1 1123 ? -34.768 -62.744  -9.195  1.00 29.54  ? 1124 VAL A N     1 
ATOM   8539  C  CA    . VAL A 1 1123 ? -34.979 -62.640  -7.753  1.00 30.06  ? 1124 VAL A CA    1 
ATOM   8540  C  C     . VAL A 1 1123 ? -36.218 -63.389  -7.231  1.00 29.60  ? 1124 VAL A C     1 
ATOM   8541  O  O     . VAL A 1 1123 ? -36.257 -63.996  -6.158  1.00 26.86  ? 1124 VAL A O     1 
ATOM   8542  C  CB    . VAL A 1 1123 ? -35.299 -61.315  -7.033  1.00 32.71  ? 1124 VAL A CB    1 
ATOM   8543  C  CG1   . VAL A 1 1123 ? -34.359 -61.189  -5.820  1.00 32.34  ? 1124 VAL A CG1   1 
ATOM   8544  C  CG2   . VAL A 1 1123 ? -35.479 -60.104  -7.883  1.00 33.25  ? 1124 VAL A CG2   1 
ATOM   8545  N  N     . GLU A 1 1124 ? -37.298 -63.103  -8.001  1.00 29.85  ? 1125 GLU A N     1 
ATOM   8546  C  CA    . GLU A 1 1124 ? -38.601 -63.644  -7.603  1.00 30.24  ? 1125 GLU A CA    1 
ATOM   8547  C  C     . GLU A 1 1124 ? -38.552 -65.163  -7.489  1.00 30.16  ? 1125 GLU A C     1 
ATOM   8548  O  O     . GLU A 1 1124 ? -39.119 -65.674  -6.522  1.00 30.51  ? 1125 GLU A O     1 
ATOM   8549  C  CB    . GLU A 1 1124 ? -39.710 -63.167  -8.543  1.00 31.60  ? 1125 GLU A CB    1 
ATOM   8550  C  CG    . GLU A 1 1124 ? -41.036 -63.905  -8.453  1.00 32.37  ? 1125 GLU A CG    1 
ATOM   8551  C  CD    . GLU A 1 1124 ? -41.916 -63.413  -7.326  1.00 34.84  ? 1125 GLU A CD    1 
ATOM   8552  O  OE1   . GLU A 1 1124 ? -43.084 -63.828  -7.191  1.00 35.99  ? 1125 GLU A OE1   1 
ATOM   8553  O  OE2   . GLU A 1 1124 ? -41.496 -62.553  -6.508  1.00 36.08  ? 1125 GLU A OE2   1 
ATOM   8554  N  N     . GLU A 1 1125 ? -37.871 -65.852  -8.399  1.00 31.15  ? 1126 GLU A N     1 
ATOM   8555  C  CA    . GLU A 1 1125 ? -37.824 -67.306  -8.284  1.00 33.77  ? 1126 GLU A CA    1 
ATOM   8556  C  C     . GLU A 1 1125 ? -36.823 -67.744  -7.219  1.00 31.74  ? 1126 GLU A C     1 
ATOM   8557  O  O     . GLU A 1 1125 ? -36.894 -68.851  -6.662  1.00 30.12  ? 1126 GLU A O     1 
ATOM   8558  C  CB    . GLU A 1 1125 ? -37.567 -67.976  -9.634  1.00 37.29  ? 1126 GLU A CB    1 
ATOM   8559  C  CG    . GLU A 1 1125 ? -36.422 -67.340  -10.400 1.00 42.73  ? 1126 GLU A CG    1 
ATOM   8560  C  CD    . GLU A 1 1125 ? -36.935 -66.589  -11.633 1.00 46.11  ? 1126 GLU A CD    1 
ATOM   8561  O  OE1   . GLU A 1 1125 ? -37.720 -65.616  -11.478 1.00 46.30  ? 1126 GLU A OE1   1 
ATOM   8562  O  OE2   . GLU A 1 1125 ? -36.472 -67.036  -12.717 1.00 46.55  ? 1126 GLU A OE2   1 
ATOM   8563  N  N     . PHE A 1 1126 ? -35.911 -66.827  -6.888  1.00 29.41  ? 1127 PHE A N     1 
ATOM   8564  C  CA    . PHE A 1 1126 ? -34.927 -67.129  -5.830  1.00 26.82  ? 1127 PHE A CA    1 
ATOM   8565  C  C     . PHE A 1 1126 ? -35.667 -67.103  -4.499  1.00 25.34  ? 1127 PHE A C     1 
ATOM   8566  O  O     . PHE A 1 1126 ? -35.525 -68.013  -3.662  1.00 25.73  ? 1127 PHE A O     1 
ATOM   8567  C  CB    . PHE A 1 1126 ? -33.810 -66.098  -5.849  1.00 27.44  ? 1127 PHE A CB    1 
ATOM   8568  C  CG    . PHE A 1 1126 ? -32.882 -66.160  -4.664  1.00 26.77  ? 1127 PHE A CG    1 
ATOM   8569  C  CD1   . PHE A 1 1126 ? -31.976 -67.186  -4.524  1.00 26.66  ? 1127 PHE A CD1   1 
ATOM   8570  C  CD2   . PHE A 1 1126 ? -32.987 -65.177  -3.673  1.00 27.39  ? 1127 PHE A CD2   1 
ATOM   8571  C  CE1   . PHE A 1 1126 ? -31.143 -67.251  -3.418  1.00 26.01  ? 1127 PHE A CE1   1 
ATOM   8572  C  CE2   . PHE A 1 1126 ? -32.127 -65.231  -2.583  1.00 26.28  ? 1127 PHE A CE2   1 
ATOM   8573  C  CZ    . PHE A 1 1126 ? -31.234 -66.268  -2.445  1.00 24.83  ? 1127 PHE A CZ    1 
ATOM   8574  N  N     . LEU A 1 1127 ? -36.480 -66.049  -4.349  1.00 23.19  ? 1128 LEU A N     1 
ATOM   8575  C  CA    . LEU A 1 1127 ? -37.227 -65.875  -3.132  1.00 25.01  ? 1128 LEU A CA    1 
ATOM   8576  C  C     . LEU A 1 1127 ? -38.285 -66.946  -2.915  1.00 26.70  ? 1128 LEU A C     1 
ATOM   8577  O  O     . LEU A 1 1127 ? -38.448 -67.442  -1.798  1.00 26.78  ? 1128 LEU A O     1 
ATOM   8578  C  CB    . LEU A 1 1127 ? -37.940 -64.514  -3.106  1.00 23.51  ? 1128 LEU A CB    1 
ATOM   8579  C  CG    . LEU A 1 1127 ? -37.010 -63.280  -3.126  1.00 24.24  ? 1128 LEU A CG    1 
ATOM   8580  C  CD1   . LEU A 1 1127 ? -37.827 -62.018  -3.340  1.00 25.17  ? 1128 LEU A CD1   1 
ATOM   8581  C  CD2   . LEU A 1 1127 ? -36.227 -63.205  -1.807  1.00 22.74  ? 1128 LEU A CD2   1 
ATOM   8582  N  N     . MET A 1 1128 ? -39.061 -67.216  -3.961  1.00 25.86  ? 1129 MET A N     1 
ATOM   8583  C  CA    . MET A 1 1128 ? -40.171 -68.160  -3.864  1.00 28.61  ? 1129 MET A CA    1 
ATOM   8584  C  C     . MET A 1 1128 ? -39.748 -69.600  -3.740  1.00 26.83  ? 1129 MET A C     1 
ATOM   8585  O  O     . MET A 1 1128 ? -40.515 -70.510  -3.374  1.00 28.01  ? 1129 MET A O     1 
ATOM   8586  C  CB    . MET A 1 1128 ? -41.083 -67.877  -5.079  1.00 29.39  ? 1129 MET A CB    1 
ATOM   8587  C  CG    . MET A 1 1128 ? -41.923 -66.621  -4.821  1.00 34.14  ? 1129 MET A CG    1 
ATOM   8588  S  SD    . MET A 1 1128 ? -43.098 -66.717  -3.496  1.00 35.24  ? 1129 MET A SD    1 
ATOM   8589  C  CE    . MET A 1 1128 ? -42.539 -65.870  -2.083  1.00 38.93  ? 1129 MET A CE    1 
ATOM   8590  N  N     . ALA A 1 1129 ? -38.484 -69.892  -3.942  1.00 27.28  ? 1130 ALA A N     1 
ATOM   8591  C  CA    . ALA A 1 1129 ? -37.959 -71.252  -3.816  1.00 24.97  ? 1130 ALA A CA    1 
ATOM   8592  C  C     . ALA A 1 1129 ? -37.474 -71.523  -2.376  1.00 25.89  ? 1130 ALA A C     1 
ATOM   8593  O  O     . ALA A 1 1129 ? -36.916 -72.583  -2.130  1.00 25.58  ? 1130 ALA A O     1 
ATOM   8594  C  CB    . ALA A 1 1129 ? -36.803 -71.425  -4.766  1.00 24.73  ? 1130 ALA A CB    1 
ATOM   8595  N  N     . GLN A 1 1130 ? -37.731 -70.608  -1.460  1.00 23.32  ? 1131 GLN A N     1 
ATOM   8596  C  CA    . GLN A 1 1130 ? -37.434 -70.786  -0.046  1.00 24.24  ? 1131 GLN A CA    1 
ATOM   8597  C  C     . GLN A 1 1130 ? -38.674 -70.578  0.814   1.00 22.23  ? 1131 GLN A C     1 
ATOM   8598  O  O     . GLN A 1 1130 ? -39.332 -69.552  0.677   1.00 23.86  ? 1131 GLN A O     1 
ATOM   8599  C  CB    . GLN A 1 1130 ? -36.403 -69.695  0.355   1.00 23.73  ? 1131 GLN A CB    1 
ATOM   8600  C  CG    . GLN A 1 1130 ? -35.077 -69.825  -0.385  1.00 24.90  ? 1131 GLN A CG    1 
ATOM   8601  C  CD    . GLN A 1 1130 ? -34.086 -68.737  -0.033  1.00 25.21  ? 1131 GLN A CD    1 
ATOM   8602  O  OE1   . GLN A 1 1130 ? -33.714 -68.494  1.098   1.00 24.92  ? 1131 GLN A OE1   1 
ATOM   8603  N  NE2   . GLN A 1 1130 ? -33.629 -67.955  -1.015  1.00 26.34  ? 1131 GLN A NE2   1 
ATOM   8604  N  N     . ASN A 1 1131 ? -38.973 -71.403  1.799   1.00 24.35  ? 1132 ASN A N     1 
ATOM   8605  C  CA    . ASN A 1 1131 ? -40.158 -71.208  2.634   1.00 23.41  ? 1132 ASN A CA    1 
ATOM   8606  C  C     . ASN A 1 1131 ? -40.183 -69.909  3.421   1.00 23.51  ? 1132 ASN A C     1 
ATOM   8607  O  O     . ASN A 1 1131 ? -41.289 -69.420  3.679   1.00 24.16  ? 1132 ASN A O     1 
ATOM   8608  C  CB    . ASN A 1 1131 ? -40.340 -72.386  3.606   1.00 24.83  ? 1132 ASN A CB    1 
ATOM   8609  C  CG    . ASN A 1 1131 ? -41.794 -72.537  3.994   1.00 25.33  ? 1132 ASN A CG    1 
ATOM   8610  O  OD1   . ASN A 1 1131 ? -42.204 -72.439  5.178   1.00 26.70  ? 1132 ASN A OD1   1 
ATOM   8611  N  ND2   . ASN A 1 1131 ? -42.620 -72.793  2.993   1.00 18.82  ? 1132 ASN A ND2   1 
ATOM   8612  N  N     . ARG A 1 1132 ? -39.037 -69.334  3.807   1.00 21.59  ? 1133 ARG A N     1 
ATOM   8613  C  CA    . ARG A 1 1132 ? -39.035 -68.105  4.573   1.00 21.96  ? 1133 ARG A CA    1 
ATOM   8614  C  C     . ARG A 1 1132 ? -39.685 -66.962  3.806   1.00 21.63  ? 1133 ARG A C     1 
ATOM   8615  O  O     . ARG A 1 1132 ? -40.115 -65.996  4.429   1.00 22.17  ? 1133 ARG A O     1 
ATOM   8616  C  CB    . ARG A 1 1132 ? -37.642 -67.661  5.058   1.00 21.48  ? 1133 ARG A CB    1 
ATOM   8617  C  CG    . ARG A 1 1132 ? -36.522 -67.790  4.064   1.00 19.73  ? 1133 ARG A CG    1 
ATOM   8618  C  CD    . ARG A 1 1132 ? -35.295 -66.921  4.512   1.00 20.97  ? 1133 ARG A CD    1 
ATOM   8619  N  NE    . ARG A 1 1132 ? -34.323 -66.947  3.414   1.00 19.14  ? 1133 ARG A NE    1 
ATOM   8620  C  CZ    . ARG A 1 1132 ? -33.285 -66.141  3.401   1.00 22.13  ? 1133 ARG A CZ    1 
ATOM   8621  N  NH1   . ARG A 1 1132 ? -33.095 -65.254  4.415   1.00 20.73  ? 1133 ARG A NH1   1 
ATOM   8622  N  NH2   . ARG A 1 1132 ? -32.419 -66.208  2.395   1.00 21.92  ? 1133 ARG A NH2   1 
ATOM   8623  N  N     . PHE A 1 1133 ? -39.715 -67.096  2.469   1.00 22.38  ? 1134 PHE A N     1 
ATOM   8624  C  CA    . PHE A 1 1133 ? -40.457 -66.107  1.677   1.00 23.10  ? 1134 PHE A CA    1 
ATOM   8625  C  C     . PHE A 1 1133 ? -41.799 -66.659  1.214   1.00 24.69  ? 1134 PHE A C     1 
ATOM   8626  O  O     . PHE A 1 1133 ? -42.856 -66.011  1.307   1.00 25.67  ? 1134 PHE A O     1 
ATOM   8627  C  CB    . PHE A 1 1133 ? -39.618 -65.626  0.469   1.00 23.67  ? 1134 PHE A CB    1 
ATOM   8628  C  CG    . PHE A 1 1133 ? -38.380 -64.880  0.895   1.00 22.98  ? 1134 PHE A CG    1 
ATOM   8629  C  CD1   . PHE A 1 1133 ? -37.147 -65.490  0.819   1.00 24.22  ? 1134 PHE A CD1   1 
ATOM   8630  C  CD2   . PHE A 1 1133 ? -38.447 -63.579  1.361   1.00 24.28  ? 1134 PHE A CD2   1 
ATOM   8631  C  CE1   . PHE A 1 1133 ? -35.985 -64.837  1.206   1.00 23.77  ? 1134 PHE A CE1   1 
ATOM   8632  C  CE2   . PHE A 1 1133 ? -37.301 -62.907  1.775   1.00 24.02  ? 1134 PHE A CE2   1 
ATOM   8633  C  CZ    . PHE A 1 1133 ? -36.074 -63.559  1.709   1.00 23.42  ? 1134 PHE A CZ    1 
ATOM   8634  N  N     . ALA A 1 1134 ? -41.797 -67.934  0.787   1.00 25.54  ? 1135 ALA A N     1 
ATOM   8635  C  CA    . ALA A 1 1134 ? -43.006 -68.578  0.262   1.00 26.82  ? 1135 ALA A CA    1 
ATOM   8636  C  C     . ALA A 1 1134 ? -44.137 -68.766  1.259   1.00 28.64  ? 1135 ALA A C     1 
ATOM   8637  O  O     . ALA A 1 1134 ? -45.319 -68.608  0.819   1.00 27.69  ? 1135 ALA A O     1 
ATOM   8638  C  CB    . ALA A 1 1134 ? -42.640 -69.880  -0.428  1.00 25.58  ? 1135 ALA A CB    1 
ATOM   8639  N  N     . VAL A 1 1135 ? -43.884 -68.964  2.557   1.00 27.95  ? 1136 VAL A N     1 
ATOM   8640  C  CA    . VAL A 1 1135 ? -44.973 -69.073  3.517   1.00 27.61  ? 1136 VAL A CA    1 
ATOM   8641  C  C     . VAL A 1 1135 ? -45.774 -67.754  3.542   1.00 27.10  ? 1136 VAL A C     1 
ATOM   8642  O  O     . VAL A 1 1135 ? -46.950 -67.821  3.906   1.00 27.94  ? 1136 VAL A O     1 
ATOM   8643  C  CB    . VAL A 1 1135 ? -44.745 -69.115  5.042   1.00 29.53  ? 1136 VAL A CB    1 
ATOM   8644  C  CG1   . VAL A 1 1135 ? -45.154 -70.388  5.719   1.00 30.18  ? 1136 VAL A CG1   1 
ATOM   8645  C  CG2   . VAL A 1 1135 ? -43.392 -68.555  5.438   1.00 29.64  ? 1136 VAL A CG2   1 
ATOM   8646  N  N     . LEU A 1 1136 ? -45.039 -66.645  3.422   1.00 26.07  ? 1137 LEU A N     1 
ATOM   8647  C  CA    . LEU A 1 1136 ? -45.705 -65.338  3.504   1.00 27.66  ? 1137 LEU A CA    1 
ATOM   8648  C  C     . LEU A 1 1136 ? -46.653 -65.173  2.293   1.00 27.05  ? 1137 LEU A C     1 
ATOM   8649  O  O     . LEU A 1 1136 ? -47.757 -64.649  2.417   1.00 27.42  ? 1137 LEU A O     1 
ATOM   8650  C  CB    . LEU A 1 1136 ? -44.744 -64.158  3.430   1.00 27.11  ? 1137 LEU A CB    1 
ATOM   8651  C  CG    . LEU A 1 1136 ? -44.662 -63.010  4.401   1.00 31.86  ? 1137 LEU A CG    1 
ATOM   8652  C  CD1   . LEU A 1 1136 ? -44.486 -61.656  3.733   1.00 28.83  ? 1137 LEU A CD1   1 
ATOM   8653  C  CD2   . LEU A 1 1136 ? -45.755 -62.956  5.461   1.00 31.13  ? 1137 LEU A CD2   1 
ATOM   8654  N  N     . ASP A 1 1137 ? -46.136 -65.564  1.138   1.00 27.06  ? 1138 ASP A N     1 
ATOM   8655  C  CA    . ASP A 1 1137 ? -46.931 -65.457  -0.103  1.00 29.24  ? 1138 ASP A CA    1 
ATOM   8656  C  C     . ASP A 1 1137 ? -48.219 -66.276  0.017   1.00 30.86  ? 1138 ASP A C     1 
ATOM   8657  O  O     . ASP A 1 1137 ? -49.275 -65.797  -0.384  1.00 31.66  ? 1138 ASP A O     1 
ATOM   8658  C  CB    . ASP A 1 1137 ? -46.181 -65.902  -1.336  1.00 27.79  ? 1138 ASP A CB    1 
ATOM   8659  C  CG    . ASP A 1 1137 ? -46.910 -65.477  -2.624  1.00 28.76  ? 1138 ASP A CG    1 
ATOM   8660  O  OD1   . ASP A 1 1137 ? -46.969 -64.279  -2.961  1.00 27.39  ? 1138 ASP A OD1   1 
ATOM   8661  O  OD2   . ASP A 1 1137 ? -47.408 -66.421  -3.284  1.00 30.65  ? 1138 ASP A OD2   1 
ATOM   8662  N  N     . ARG A 1 1138 ? -48.137 -67.412  0.663   1.00 30.73  ? 1139 ARG A N     1 
ATOM   8663  C  CA    . ARG A 1 1138 ? -49.307 -68.241  0.896   1.00 33.16  ? 1139 ARG A CA    1 
ATOM   8664  C  C     . ARG A 1 1138 ? -50.258 -67.629  1.906   1.00 34.81  ? 1139 ARG A C     1 
ATOM   8665  O  O     . ARG A 1 1138 ? -51.477 -67.724  1.706   1.00 35.78  ? 1139 ARG A O     1 
ATOM   8666  C  CB    . ARG A 1 1138 ? -48.882 -69.650  1.300   1.00 31.83  ? 1139 ARG A CB    1 
ATOM   8667  C  CG    . ARG A 1 1138 ? -48.274 -70.454  0.156   1.00 32.16  ? 1139 ARG A CG    1 
ATOM   8668  C  CD    . ARG A 1 1138 ? -48.126 -71.939  0.430   1.00 32.64  ? 1139 ARG A CD    1 
ATOM   8669  N  NE    . ARG A 1 1138 ? -47.359 -72.284  1.627   1.00 32.53  ? 1139 ARG A NE    1 
ATOM   8670  C  CZ    . ARG A 1 1138 ? -46.033 -72.381  1.741   1.00 30.67  ? 1139 ARG A CZ    1 
ATOM   8671  N  NH1   . ARG A 1 1138 ? -45.506 -72.704  2.925   1.00 28.89  ? 1139 ARG A NH1   1 
ATOM   8672  N  NH2   . ARG A 1 1138 ? -45.194 -72.144  0.748   1.00 27.73  ? 1139 ARG A NH2   1 
ATOM   8673  N  N     . SER A 1 1139 ? -49.768 -67.037  3.004   1.00 35.04  ? 1140 SER A N     1 
ATOM   8674  C  CA    . SER A 1 1139 ? -50.711 -66.542  4.002   1.00 34.04  ? 1140 SER A CA    1 
ATOM   8675  C  C     . SER A 1 1139 ? -51.037 -65.069  3.953   1.00 33.48  ? 1140 SER A C     1 
ATOM   8676  O  O     . SER A 1 1139 ? -52.134 -64.746  4.412   1.00 33.99  ? 1140 SER A O     1 
ATOM   8677  C  CB    . SER A 1 1139 ? -50.234 -66.892  5.433   1.00 37.05  ? 1140 SER A CB    1 
ATOM   8678  O  OG    . SER A 1 1139 ? -48.825 -66.878  5.430   1.00 39.72  ? 1140 SER A OG    1 
ATOM   8679  N  N     . PHE A 1 1140 ? -50.216 -64.199  3.400   1.00 33.16  ? 1141 PHE A N     1 
ATOM   8680  C  CA    . PHE A 1 1140 ? -50.522 -62.767  3.330   1.00 33.55  ? 1141 PHE A CA    1 
ATOM   8681  C  C     . PHE A 1 1140 ? -50.100 -62.271  1.952   1.00 34.06  ? 1141 PHE A C     1 
ATOM   8682  O  O     . PHE A 1 1140 ? -49.116 -61.552  1.801   1.00 31.48  ? 1141 PHE A O     1 
ATOM   8683  C  CB    . PHE A 1 1140 ? -49.761 -61.985  4.394   1.00 35.96  ? 1141 PHE A CB    1 
ATOM   8684  C  CG    . PHE A 1 1140 ? -50.050 -62.431  5.790   1.00 37.74  ? 1141 PHE A CG    1 
ATOM   8685  C  CD1   . PHE A 1 1140 ? -49.150 -63.216  6.475   1.00 39.24  ? 1141 PHE A CD1   1 
ATOM   8686  C  CD2   . PHE A 1 1140 ? -51.248 -62.079  6.410   1.00 39.67  ? 1141 PHE A CD2   1 
ATOM   8687  C  CE1   . PHE A 1 1140 ? -49.414 -63.640  7.762   1.00 38.53  ? 1141 PHE A CE1   1 
ATOM   8688  C  CE2   . PHE A 1 1140 ? -51.523 -62.497  7.698   1.00 40.36  ? 1141 PHE A CE2   1 
ATOM   8689  C  CZ    . PHE A 1 1140 ? -50.603 -63.285  8.358   1.00 40.48  ? 1141 PHE A CZ    1 
ATOM   8690  N  N     . PRO A 1 1141 ? -50.772 -62.773  0.923   1.00 34.58  ? 1142 PRO A N     1 
ATOM   8691  C  CA    . PRO A 1 1141 ? -50.329 -62.589  -0.450  1.00 35.62  ? 1142 PRO A CA    1 
ATOM   8692  C  C     . PRO A 1 1141 ? -50.163 -61.140  -0.842  1.00 35.97  ? 1142 PRO A C     1 
ATOM   8693  O  O     . PRO A 1 1141 ? -49.271 -60.837  -1.639  1.00 35.98  ? 1142 PRO A O     1 
ATOM   8694  C  CB    . PRO A 1 1141 ? -51.368 -63.301  -1.302  1.00 34.88  ? 1142 PRO A CB    1 
ATOM   8695  C  CG    . PRO A 1 1141 ? -52.436 -63.763  -0.390  1.00 36.25  ? 1142 PRO A CG    1 
ATOM   8696  C  CD    . PRO A 1 1141 ? -51.863 -63.785  1.014   1.00 35.50  ? 1142 PRO A CD    1 
ATOM   8697  N  N     . GLU A 1 1142 ? -51.016 -60.292  -0.274  1.00 35.99  ? 1143 GLU A N     1 
ATOM   8698  C  CA    . GLU A 1 1142 ? -50.973 -58.864  -0.544  1.00 40.57  ? 1143 GLU A CA    1 
ATOM   8699  C  C     . GLU A 1 1142 ? -49.644 -58.292  -0.022  1.00 39.54  ? 1143 GLU A C     1 
ATOM   8700  O  O     . GLU A 1 1142 ? -48.897 -57.669  -0.776  1.00 40.23  ? 1143 GLU A O     1 
ATOM   8701  C  CB    . GLU A 1 1142 ? -52.126 -58.079  0.081   1.00 43.95  ? 1143 GLU A CB    1 
ATOM   8702  C  CG    . GLU A 1 1142 ? -53.454 -58.783  0.339   1.00 50.01  ? 1143 GLU A CG    1 
ATOM   8703  C  CD    . GLU A 1 1142 ? -54.611 -57.816  0.574   1.00 53.59  ? 1143 GLU A CD    1 
ATOM   8704  O  OE1   . GLU A 1 1142 ? -54.423 -56.581  0.366   1.00 54.83  ? 1143 GLU A OE1   1 
ATOM   8705  O  OE2   . GLU A 1 1142 ? -55.741 -58.211  0.982   1.00 55.65  ? 1143 GLU A OE2   1 
ATOM   8706  N  N     . ASP A 1 1143 ? -49.342 -58.614  1.228   1.00 37.51  ? 1144 ASP A N     1 
ATOM   8707  C  CA    . ASP A 1 1143 ? -48.118 -58.130  1.868   1.00 37.51  ? 1144 ASP A CA    1 
ATOM   8708  C  C     . ASP A 1 1143 ? -46.870 -58.716  1.227   1.00 34.46  ? 1144 ASP A C     1 
ATOM   8709  O  O     . ASP A 1 1143 ? -45.918 -57.982  0.907   1.00 34.36  ? 1144 ASP A O     1 
ATOM   8710  C  CB    . ASP A 1 1143 ? -48.136 -58.392  3.376   1.00 40.10  ? 1144 ASP A CB    1 
ATOM   8711  C  CG    . ASP A 1 1143 ? -49.122 -57.423  4.043   1.00 43.94  ? 1144 ASP A CG    1 
ATOM   8712  O  OD1   . ASP A 1 1143 ? -48.865 -57.030  5.207   1.00 45.59  ? 1144 ASP A OD1   1 
ATOM   8713  O  OD2   . ASP A 1 1143 ? -50.121 -57.061  3.385   1.00 45.22  ? 1144 ASP A OD2   1 
ATOM   8714  N  N     . ALA A 1 1144 ? -46.887 -60.009  0.964   1.00 31.51  ? 1145 ALA A N     1 
ATOM   8715  C  CA    . ALA A 1 1144 ? -45.785 -60.713  0.353   1.00 31.86  ? 1145 ALA A CA    1 
ATOM   8716  C  C     . ALA A 1 1144 ? -45.387 -60.196  -1.019  1.00 33.18  ? 1145 ALA A C     1 
ATOM   8717  O  O     . ALA A 1 1144 ? -44.198 -59.986  -1.325  1.00 31.77  ? 1145 ALA A O     1 
ATOM   8718  C  CB    . ALA A 1 1144 ? -46.172 -62.193  0.220   1.00 31.99  ? 1145 ALA A CB    1 
ATOM   8719  N  N     . LYS A 1 1145 ? -46.364 -59.901  -1.883  1.00 31.31  ? 1146 LYS A N     1 
ATOM   8720  C  CA    . LYS A 1 1145 ? -46.057 -59.356  -3.203  1.00 32.48  ? 1146 LYS A CA    1 
ATOM   8721  C  C     . LYS A 1 1145 ? -45.347 -58.018  -3.093  1.00 31.29  ? 1146 LYS A C     1 
ATOM   8722  O  O     . LYS A 1 1145 ? -44.270 -57.860  -3.672  1.00 30.69  ? 1146 LYS A O     1 
ATOM   8723  C  CB    . LYS A 1 1145 ? -47.319 -59.310  -4.045  1.00 35.43  ? 1146 LYS A CB    1 
ATOM   8724  C  CG    . LYS A 1 1145 ? -47.397 -58.357  -5.214  1.00 40.89  ? 1146 LYS A CG    1 
ATOM   8725  C  CD    . LYS A 1 1145 ? -48.814 -57.744  -5.276  1.00 44.64  ? 1146 LYS A CD    1 
ATOM   8726  C  CE    . LYS A 1 1145 ? -49.814 -58.837  -5.650  1.00 47.55  ? 1146 LYS A CE    1 
ATOM   8727  N  NZ    . LYS A 1 1145 ? -51.136 -58.792  -4.959  1.00 48.20  ? 1146 LYS A NZ    1 
ATOM   8728  N  N     . ARG A 1 1146 ? -45.869 -57.084  -2.319  1.00 30.41  ? 1147 ARG A N     1 
ATOM   8729  C  CA    . ARG A 1 1146 ? -45.209 -55.807  -2.048  1.00 30.72  ? 1147 ARG A CA    1 
ATOM   8730  C  C     . ARG A 1 1146 ? -43.809 -55.979  -1.416  1.00 29.82  ? 1147 ARG A C     1 
ATOM   8731  O  O     . ARG A 1 1146 ? -42.864 -55.316  -1.831  1.00 29.43  ? 1147 ARG A O     1 
ATOM   8732  C  CB    . ARG A 1 1146 ? -46.100 -55.001  -1.121  1.00 29.97  ? 1147 ARG A CB    1 
ATOM   8733  C  CG    . ARG A 1 1146 ? -45.712 -53.578  -0.762  1.00 32.89  ? 1147 ARG A CG    1 
ATOM   8734  C  CD    . ARG A 1 1146 ? -46.891 -53.106  0.447   0.00 21.55  ? 1147 ARG A CD    1 
ATOM   8735  N  NE    . ARG A 1 1146 ? -46.025 -52.957  1.615   0.00 21.38  ? 1147 ARG A NE    1 
ATOM   8736  C  CZ    . ARG A 1 1146 ? -46.124 -53.669  2.734   0.00 21.23  ? 1147 ARG A CZ    1 
ATOM   8737  N  NH1   . ARG A 1 1146 ? -47.053 -54.606  2.860   0.00 21.34  ? 1147 ARG A NH1   1 
ATOM   8738  N  NH2   . ARG A 1 1146 ? -45.314 -53.409  3.753   0.00 21.39  ? 1147 ARG A NH2   1 
ATOM   8739  N  N     . LEU A 1 1147 ? -43.648 -56.925  -0.494  1.00 28.63  ? 1148 LEU A N     1 
ATOM   8740  C  CA    . LEU A 1 1147 ? -42.325 -57.118  0.138   1.00 27.16  ? 1148 LEU A CA    1 
ATOM   8741  C  C     . LEU A 1 1147 ? -41.298 -57.722  -0.780  1.00 27.77  ? 1148 LEU A C     1 
ATOM   8742  O  O     . LEU A 1 1147 ? -40.091 -57.438  -0.684  1.00 27.57  ? 1148 LEU A O     1 
ATOM   8743  C  CB    . LEU A 1 1147 ? -42.507 -57.971  1.421   1.00 25.91  ? 1148 LEU A CB    1 
ATOM   8744  C  CG    . LEU A 1 1147 ? -43.209 -57.155  2.509   1.00 23.99  ? 1148 LEU A CG    1 
ATOM   8745  C  CD1   . LEU A 1 1147 ? -43.706 -58.060  3.619   1.00 26.78  ? 1148 LEU A CD1   1 
ATOM   8746  C  CD2   . LEU A 1 1147 ? -42.319 -55.997  2.998   1.00 25.49  ? 1148 LEU A CD2   1 
ATOM   8747  N  N     . ARG A 1 1148 ? -41.713 -58.585  -1.708  1.00 26.71  ? 1149 ARG A N     1 
ATOM   8748  C  CA    . ARG A 1 1148 ? -40.753 -59.173  -2.662  1.00 28.76  ? 1149 ARG A CA    1 
ATOM   8749  C  C     . ARG A 1 1148 ? -40.364 -58.103  -3.680  1.00 30.74  ? 1149 ARG A C     1 
ATOM   8750  O  O     . ARG A 1 1148 ? -39.220 -57.959  -4.115  1.00 30.84  ? 1149 ARG A O     1 
ATOM   8751  C  CB    . ARG A 1 1148 ? -41.322 -60.422  -3.304  1.00 27.74  ? 1149 ARG A CB    1 
ATOM   8752  C  CG    . ARG A 1 1148 ? -41.642 -61.527  -2.307  1.00 29.23  ? 1149 ARG A CG    1 
ATOM   8753  C  CD    . ARG A 1 1148 ? -41.599 -62.911  -2.968  1.00 31.06  ? 1149 ARG A CD    1 
ATOM   8754  N  NE    . ARG A 1 1148 ? -42.606 -62.982  -4.041  1.00 29.87  ? 1149 ARG A NE    1 
ATOM   8755  C  CZ    . ARG A 1 1148 ? -43.901 -63.123  -3.790  1.00 31.27  ? 1149 ARG A CZ    1 
ATOM   8756  N  NH1   . ARG A 1 1148 ? -44.401 -63.223  -2.553  1.00 26.49  ? 1149 ARG A NH1   1 
ATOM   8757  N  NH2   . ARG A 1 1148 ? -44.708 -63.138  -4.880  1.00 32.54  ? 1149 ARG A NH2   1 
ATOM   8758  N  N     . ALA A 1 1149 ? -41.325 -57.209  -3.966  1.00 29.74  ? 1150 ALA A N     1 
ATOM   8759  C  CA    . ALA A 1 1149 ? -41.103 -56.075  -4.837  1.00 30.10  ? 1150 ALA A CA    1 
ATOM   8760  C  C     . ALA A 1 1149 ? -40.077 -55.120  -4.214  1.00 30.61  ? 1150 ALA A C     1 
ATOM   8761  O  O     . ALA A 1 1149 ? -39.187 -54.601  -4.903  1.00 29.50  ? 1150 ALA A O     1 
ATOM   8762  C  CB    . ALA A 1 1149 ? -42.402 -55.320  -5.137  1.00 29.94  ? 1150 ALA A CB    1 
ATOM   8763  N  N     . GLN A 1 1150 ? -40.185 -54.953  -2.891  1.00 29.85  ? 1151 GLN A N     1 
ATOM   8764  C  CA    . GLN A 1 1150 ? -39.259 -54.099  -2.161  1.00 31.37  ? 1151 GLN A CA    1 
ATOM   8765  C  C     . GLN A 1 1150 ? -37.810 -54.606  -2.221  1.00 30.20  ? 1151 GLN A C     1 
ATOM   8766  O  O     . GLN A 1 1150 ? -36.892 -53.863  -2.606  1.00 30.94  ? 1151 GLN A O     1 
ATOM   8767  C  CB    . GLN A 1 1150 ? -39.660 -53.933  -0.696  1.00 32.65  ? 1151 GLN A CB    1 
ATOM   8768  C  CG    . GLN A 1 1150 ? -38.892 -52.801  -0.022  1.00 35.89  ? 1151 GLN A CG    1 
ATOM   8769  C  CD    . GLN A 1 1150 ? -39.387 -52.510  1.377   1.00 39.02  ? 1151 GLN A CD    1 
ATOM   8770  O  OE1   . GLN A 1 1150 ? -40.589 -52.591  1.666   1.00 39.20  ? 1151 GLN A OE1   1 
ATOM   8771  N  NE2   . GLN A 1 1150 ? -38.464 -52.182  2.287   1.00 40.57  ? 1151 GLN A NE2   1 
ATOM   8772  N  N     . VAL A 1 1151 ? -37.632 -55.890  -1.959  1.00 28.46  ? 1152 VAL A N     1 
ATOM   8773  C  CA    . VAL A 1 1151 ? -36.352 -56.560  -2.057  1.00 27.84  ? 1152 VAL A CA    1 
ATOM   8774  C  C     . VAL A 1 1151 ? -35.827 -56.319  -3.472  1.00 27.99  ? 1152 VAL A C     1 
ATOM   8775  O  O     . VAL A 1 1151 ? -34.668 -55.922  -3.561  1.00 28.97  ? 1152 VAL A O     1 
ATOM   8776  C  CB    . VAL A 1 1151 ? -36.439 -58.082  -1.800  1.00 28.73  ? 1152 VAL A CB    1 
ATOM   8777  C  CG1   . VAL A 1 1151 ? -35.209 -58.858  -2.282  1.00 30.06  ? 1152 VAL A CG1   1 
ATOM   8778  C  CG2   . VAL A 1 1151 ? -36.559 -58.349  -0.302  1.00 28.78  ? 1152 VAL A CG2   1 
ATOM   8779  N  N     . ALA A 1 1152 ? -36.690 -56.492  -4.482  1.00 25.99  ? 1153 ALA A N     1 
ATOM   8780  C  CA    . ALA A 1 1152 ? -36.218 -56.254  -5.852  1.00 25.73  ? 1153 ALA A CA    1 
ATOM   8781  C  C     . ALA A 1 1152 ? -35.692 -54.821  -6.024  1.00 25.93  ? 1153 ALA A C     1 
ATOM   8782  O  O     . ALA A 1 1152 ? -34.671 -54.580  -6.680  1.00 25.83  ? 1153 ALA A O     1 
ATOM   8783  C  CB    . ALA A 1 1152 ? -37.333 -56.440  -6.863  1.00 25.08  ? 1153 ALA A CB    1 
ATOM   8784  N  N     . HIS A 1 1153 ? -36.404 -53.892  -5.390  1.00 25.79  ? 1154 HIS A N     1 
ATOM   8785  C  CA    . HIS A 1 1153 ? -35.958 -52.496  -5.488  1.00 27.67  ? 1154 HIS A CA    1 
ATOM   8786  C  C     . HIS A 1 1153 ? -34.683 -52.289  -4.695  1.00 27.10  ? 1154 HIS A C     1 
ATOM   8787  O  O     . HIS A 1 1153 ? -33.724 -51.679  -5.156  1.00 26.66  ? 1154 HIS A O     1 
ATOM   8788  C  CB    . HIS A 1 1153 ? -37.087 -51.585  -5.004  1.00 29.51  ? 1154 HIS A CB    1 
ATOM   8789  C  CG    . HIS A 1 1153 ? -36.771 -50.137  -5.081  1.00 31.43  ? 1154 HIS A CG    1 
ATOM   8790  N  ND1   . HIS A 1 1153 ? -36.807 -49.318  -3.960  1.00 32.31  ? 1154 HIS A ND1   1 
ATOM   8791  C  CD2   . HIS A 1 1153 ? -36.339 -49.370  -6.123  1.00 31.06  ? 1154 HIS A CD2   1 
ATOM   8792  C  CE1   . HIS A 1 1153 ? -36.455 -48.087  -4.333  1.00 31.94  ? 1154 HIS A CE1   1 
ATOM   8793  N  NE2   . HIS A 1 1153 ? -36.184 -48.103  -5.632  1.00 31.46  ? 1154 HIS A NE2   1 
ATOM   8794  N  N     . GLU A 1 1154 ? -34.631 -52.861  -3.474  1.00 27.23  ? 1155 GLU A N     1 
ATOM   8795  C  CA    . GLU A 1 1154 ? -33.419 -52.670  -2.666  1.00 26.90  ? 1155 GLU A CA    1 
ATOM   8796  C  C     . GLU A 1 1154 ? -32.183 -53.164  -3.379  1.00 25.61  ? 1155 GLU A C     1 
ATOM   8797  O  O     . GLU A 1 1154 ? -31.180 -52.451  -3.367  1.00 27.89  ? 1155 GLU A O     1 
ATOM   8798  C  CB    . GLU A 1 1154 ? -33.569 -53.429  -1.339  1.00 27.16  ? 1155 GLU A CB    1 
ATOM   8799  C  CG    . GLU A 1 1154 ? -34.565 -52.847  -0.373  1.00 28.31  ? 1155 GLU A CG    1 
ATOM   8800  C  CD    . GLU A 1 1154 ? -34.937 -53.734  0.796   1.00 30.27  ? 1155 GLU A CD    1 
ATOM   8801  O  OE1   . GLU A 1 1154 ? -34.486 -54.886  0.915   1.00 31.56  ? 1155 GLU A OE1   1 
ATOM   8802  O  OE2   . GLU A 1 1154 ? -35.737 -53.339  1.663   1.00 33.76  ? 1155 GLU A OE2   1 
ATOM   8803  N  N     . LEU A 1 1155 ? -32.227 -54.370  -3.971  1.00 26.87  ? 1156 LEU A N     1 
ATOM   8804  C  CA    . LEU A 1 1155 ? -30.997 -54.918  -4.568  1.00 28.45  ? 1156 LEU A CA    1 
ATOM   8805  C  C     . LEU A 1 1155 ? -30.596 -54.160  -5.827  1.00 28.39  ? 1156 LEU A C     1 
ATOM   8806  O  O     . LEU A 1 1155 ? -29.422 -54.059  -6.190  1.00 28.66  ? 1156 LEU A O     1 
ATOM   8807  C  CB    . LEU A 1 1155 ? -31.130 -56.417  -4.810  1.00 25.91  ? 1156 LEU A CB    1 
ATOM   8808  C  CG    . LEU A 1 1155 ? -32.124 -56.904  -5.863  1.00 27.54  ? 1156 LEU A CG    1 
ATOM   8809  C  CD1   . LEU A 1 1155 ? -31.509 -57.071  -7.251  1.00 27.76  ? 1156 LEU A CD1   1 
ATOM   8810  C  CD2   . LEU A 1 1155 ? -32.738 -58.220  -5.451  1.00 27.13  ? 1156 LEU A CD2   1 
ATOM   8811  N  N     . ASP A 1 1156 ? -31.612 -53.584  -6.468  1.00 30.04  ? 1157 ASP A N     1 
ATOM   8812  C  CA    . ASP A 1 1156 ? -31.358 -52.841  -7.714  1.00 31.33  ? 1157 ASP A CA    1 
ATOM   8813  C  C     . ASP A 1 1156 ? -30.635 -51.552  -7.381  1.00 29.42  ? 1157 ASP A C     1 
ATOM   8814  O  O     . ASP A 1 1156 ? -29.637 -51.196  -8.010  1.00 28.15  ? 1157 ASP A O     1 
ATOM   8815  C  CB    . ASP A 1 1156 ? -32.673 -52.651  -8.480  1.00 34.04  ? 1157 ASP A CB    1 
ATOM   8816  C  CG    . ASP A 1 1156 ? -32.520 -51.741  -9.683  1.00 37.79  ? 1157 ASP A CG    1 
ATOM   8817  O  OD1   . ASP A 1 1156 ? -31.608 -52.027  -10.496 1.00 37.99  ? 1157 ASP A OD1   1 
ATOM   8818  O  OD2   . ASP A 1 1156 ? -33.283 -50.739  -9.758  1.00 41.44  ? 1157 ASP A OD2   1 
ATOM   8819  N  N     . VAL A 1 1157 ? -31.065 -50.856  -6.321  1.00 29.13  ? 1158 VAL A N     1 
ATOM   8820  C  CA    . VAL A 1 1157 ? -30.412 -49.614  -5.931  1.00 27.77  ? 1158 VAL A CA    1 
ATOM   8821  C  C     . VAL A 1 1157 ? -29.023 -49.906  -5.369  1.00 26.47  ? 1158 VAL A C     1 
ATOM   8822  O  O     . VAL A 1 1157 ? -28.064 -49.173  -5.632  1.00 26.19  ? 1158 VAL A O     1 
ATOM   8823  C  CB    . VAL A 1 1157 ? -31.278 -48.853  -4.918  1.00 28.14  ? 1158 VAL A CB    1 
ATOM   8824  C  CG1   . VAL A 1 1157 ? -30.553 -47.742  -4.159  1.00 28.83  ? 1158 VAL A CG1   1 
ATOM   8825  C  CG2   . VAL A 1 1157 ? -32.483 -48.261  -5.677  1.00 27.64  ? 1158 VAL A CG2   1 
ATOM   8826  N  N     . ARG A 1 1158 ? -28.934 -51.024  -4.620  1.00 24.69  ? 1159 ARG A N     1 
ATOM   8827  C  CA    . ARG A 1 1158 ? -27.629 -51.304  -4.002  1.00 23.46  ? 1159 ARG A CA    1 
ATOM   8828  C  C     . ARG A 1 1158 ? -26.638 -51.763  -5.047  1.00 23.37  ? 1159 ARG A C     1 
ATOM   8829  O  O     . ARG A 1 1158 ? -25.482 -51.322  -4.957  1.00 24.90  ? 1159 ARG A O     1 
ATOM   8830  C  CB    . ARG A 1 1158 ? -27.755 -52.299  -2.859  1.00 23.67  ? 1159 ARG A CB    1 
ATOM   8831  C  CG    . ARG A 1 1158 ? -26.410 -52.418  -2.105  1.00 22.10  ? 1159 ARG A CG    1 
ATOM   8832  C  CD    . ARG A 1 1158 ? -26.649 -53.354  -0.928  1.00 20.48  ? 1159 ARG A CD    1 
ATOM   8833  N  NE    . ARG A 1 1158 ? -25.443 -53.623  -0.140  1.00 20.29  ? 1159 ARG A NE    1 
ATOM   8834  C  CZ    . ARG A 1 1158 ? -24.935 -54.885  -0.075  1.00 18.52  ? 1159 ARG A CZ    1 
ATOM   8835  N  NH1   . ARG A 1 1158 ? -25.507 -55.834  -0.787  1.00 16.80  ? 1159 ARG A NH1   1 
ATOM   8836  N  NH2   . ARG A 1 1158 ? -23.868 -55.083  0.692   1.00 16.67  ? 1159 ARG A NH2   1 
ATOM   8837  N  N     . PHE A 1 1159 ? -27.080 -52.467  -6.109  1.00 24.17  ? 1160 PHE A N     1 
ATOM   8838  C  CA    . PHE A 1 1159 ? -26.109 -52.801  -7.157  1.00 24.53  ? 1160 PHE A CA    1 
ATOM   8839  C  C     . PHE A 1 1159 ? -25.609 -51.552  -7.869  1.00 26.35  ? 1160 PHE A C     1 
ATOM   8840  O  O     . PHE A 1 1159 ? -24.432 -51.416  -8.208  1.00 26.66  ? 1160 PHE A O     1 
ATOM   8841  C  CB    . PHE A 1 1159 ? -26.686 -53.768  -8.224  1.00 26.40  ? 1160 PHE A CB    1 
ATOM   8842  C  CG    . PHE A 1 1159 ? -25.566 -54.463  -8.965  1.00 28.05  ? 1160 PHE A CG    1 
ATOM   8843  C  CD1   . PHE A 1 1159 ? -25.007 -55.621  -8.463  1.00 28.74  ? 1160 PHE A CD1   1 
ATOM   8844  C  CD2   . PHE A 1 1159 ? -25.065 -53.936  -10.161 1.00 28.66  ? 1160 PHE A CD2   1 
ATOM   8845  C  CE1   . PHE A 1 1159 ? -23.966 -56.260  -9.099  1.00 29.53  ? 1160 PHE A CE1   1 
ATOM   8846  C  CE2   . PHE A 1 1159 ? -24.015 -54.569  -10.790 1.00 28.05  ? 1160 PHE A CE2   1 
ATOM   8847  C  CZ    . PHE A 1 1159 ? -23.464 -55.718  -10.281 1.00 29.45  ? 1160 PHE A CZ    1 
ATOM   8848  N  N     . LYS A 1 1160 ? -26.496 -50.586  -8.089  1.00 28.59  ? 1161 LYS A N     1 
ATOM   8849  C  CA    . LYS A 1 1160 ? -26.132 -49.359  -8.793  1.00 31.14  ? 1161 LYS A CA    1 
ATOM   8850  C  C     . LYS A 1 1160 ? -25.191 -48.530  -7.918  1.00 33.28  ? 1161 LYS A C     1 
ATOM   8851  O  O     . LYS A 1 1160 ? -24.322 -47.839  -8.440  1.00 31.67  ? 1161 LYS A O     1 
ATOM   8852  C  CB    . LYS A 1 1160 ? -27.359 -48.540  -9.181  1.00 32.88  ? 1161 LYS A CB    1 
ATOM   8853  C  CG    . LYS A 1 1160 ? -28.287 -49.272  -10.141 1.00 35.51  ? 1161 LYS A CG    1 
ATOM   8854  C  CD    . LYS A 1 1160 ? -29.740 -48.838  -9.976  1.00 36.77  ? 1161 LYS A CD    1 
ATOM   8855  C  CE    . LYS A 1 1160 ? -30.304 -48.402  -11.321 1.00 39.70  ? 1161 LYS A CE    1 
ATOM   8856  N  NZ    . LYS A 1 1160 ? -30.320 -49.571  -12.250 1.00 40.85  ? 1161 LYS A NZ    1 
ATOM   8857  N  N     . GLU A 1 1161 ? -25.325 -48.655  -6.587  1.00 33.31  ? 1162 GLU A N     1 
ATOM   8858  C  CA    . GLU A 1 1161 ? -24.421 -47.926  -5.706  1.00 35.26  ? 1162 GLU A CA    1 
ATOM   8859  C  C     . GLU A 1 1161 ? -23.016 -48.530  -5.785  1.00 33.53  ? 1162 GLU A C     1 
ATOM   8860  O  O     . GLU A 1 1161 ? -22.011 -47.821  -5.838  1.00 31.85  ? 1162 GLU A O     1 
ATOM   8861  C  CB    . GLU A 1 1161 ? -24.906 -47.910  -4.247  1.00 39.63  ? 1162 GLU A CB    1 
ATOM   8862  C  CG    . GLU A 1 1161 ? -25.474 -46.577  -3.814  1.00 46.03  ? 1162 GLU A CG    1 
ATOM   8863  C  CD    . GLU A 1 1161 ? -26.629 -46.589  -2.841  1.00 48.75  ? 1162 GLU A CD    1 
ATOM   8864  O  OE1   . GLU A 1 1161 ? -26.940 -47.661  -2.270  1.00 49.89  ? 1162 GLU A OE1   1 
ATOM   8865  O  OE2   . GLU A 1 1161 ? -27.267 -45.515  -2.622  1.00 49.13  ? 1162 GLU A OE2   1 
ATOM   8866  N  N     . LEU A 1 1162 ? -22.984 -49.868  -5.840  1.00 31.82  ? 1163 LEU A N     1 
ATOM   8867  C  CA    . LEU A 1 1162 ? -21.731 -50.611  -5.918  1.00 32.32  ? 1163 LEU A CA    1 
ATOM   8868  C  C     . LEU A 1 1162 ? -21.056 -50.288  -7.257  1.00 33.31  ? 1163 LEU A C     1 
ATOM   8869  O  O     . LEU A 1 1162 ? -19.873 -49.987  -7.285  1.00 31.76  ? 1163 LEU A O     1 
ATOM   8870  C  CB    . LEU A 1 1162 ? -21.865 -52.112  -5.687  1.00 33.11  ? 1163 LEU A CB    1 
ATOM   8871  C  CG    . LEU A 1 1162 ? -22.585 -52.563  -4.399  1.00 32.77  ? 1163 LEU A CG    1 
ATOM   8872  C  CD1   . LEU A 1 1162 ? -22.816 -54.056  -4.362  1.00 32.69  ? 1163 LEU A CD1   1 
ATOM   8873  C  CD2   . LEU A 1 1162 ? -21.814 -52.101  -3.171  1.00 32.12  ? 1163 LEU A CD2   1 
ATOM   8874  N  N     . GLU A 1 1163 ? -21.855 -50.097  -8.303  1.00 35.51  ? 1164 GLU A N     1 
ATOM   8875  C  CA    . GLU A 1 1163 ? -21.336 -49.643  -9.599  1.00 36.10  ? 1164 GLU A CA    1 
ATOM   8876  C  C     . GLU A 1 1163 ? -20.739 -48.245  -9.562  1.00 34.84  ? 1164 GLU A C     1 
ATOM   8877  O  O     . GLU A 1 1163 ? -19.594 -48.122  -10.042 1.00 33.63  ? 1164 GLU A O     1 
ATOM   8878  C  CB    . GLU A 1 1163 ? -22.407 -49.672  -10.695 1.00 36.66  ? 1164 GLU A CB    1 
ATOM   8879  C  CG    . GLU A 1 1163 ? -22.685 -51.096  -11.171 1.00 39.77  ? 1164 GLU A CG    1 
ATOM   8880  C  CD    . GLU A 1 1163 ? -23.880 -51.085  -12.119 1.00 41.74  ? 1164 GLU A CD    1 
ATOM   8881  O  OE1   . GLU A 1 1163 ? -24.828 -50.308  -11.864 1.00 42.52  ? 1164 GLU A OE1   1 
ATOM   8882  O  OE2   . GLU A 1 1163 ? -23.802 -51.839  -13.109 1.00 43.48  ? 1164 GLU A OE2   1 
ATOM   8883  N  N     . HIS A 1 1164 ? -21.351 -47.237  -8.929  1.00 37.12  ? 1165 HIS A N     1 
ATOM   8884  C  CA    . HIS A 1 1164 ? -20.675 -45.944  -8.892  1.00 40.51  ? 1165 HIS A CA    1 
ATOM   8885  C  C     . HIS A 1 1164 ? -19.442 -46.055  -7.980  1.00 38.75  ? 1165 HIS A C     1 
ATOM   8886  O  O     . HIS A 1 1164 ? -18.461 -45.372  -8.268  1.00 36.80  ? 1165 HIS A O     1 
ATOM   8887  C  CB    . HIS A 1 1164 ? -21.386 -44.622  -8.562  1.00 46.15  ? 1165 HIS A CB    1 
ATOM   8888  C  CG    . HIS A 1 1164 ? -20.429 -43.483  -8.915  1.00 52.43  ? 1165 HIS A CG    1 
ATOM   8889  N  ND1   . HIS A 1 1164 ? -19.956 -43.261  -10.197 1.00 53.85  ? 1165 HIS A ND1   1 
ATOM   8890  C  CD2   . HIS A 1 1164 ? -19.789 -42.587  -8.124  1.00 54.30  ? 1165 HIS A CD2   1 
ATOM   8891  C  CE1   . HIS A 1 1164 ? -19.099 -42.245  -10.169 1.00 55.13  ? 1165 HIS A CE1   1 
ATOM   8892  N  NE2   . HIS A 1 1164 ? -18.980 -41.813  -8.928  1.00 54.88  ? 1165 HIS A NE2   1 
ATOM   8893  N  N     . MET A 1 1165 ? -19.525 -46.931  -6.978  1.00 36.66  ? 1166 MET A N     1 
ATOM   8894  C  CA    . MET A 1 1165 ? -18.344 -47.113  -6.127  1.00 36.09  ? 1166 MET A CA    1 
ATOM   8895  C  C     . MET A 1 1165 ? -17.146 -47.607  -6.967  1.00 35.90  ? 1166 MET A C     1 
ATOM   8896  O  O     . MET A 1 1165 ? -16.073 -47.058  -6.804  1.00 34.79  ? 1166 MET A O     1 
ATOM   8897  C  CB    . MET A 1 1165 ? -18.581 -48.109  -4.986  1.00 34.92  ? 1166 MET A CB    1 
ATOM   8898  C  CG    . MET A 1 1165 ? -19.409 -47.483  -3.855  1.00 37.34  ? 1166 MET A CG    1 
ATOM   8899  S  SD    . MET A 1 1165 ? -19.709 -48.705  -2.533  1.00 41.88  ? 1166 MET A SD    1 
ATOM   8900  C  CE    . MET A 1 1165 ? -18.036 -48.894  -1.933  1.00 38.05  ? 1166 MET A CE    1 
ATOM   8901  N  N     . ALA A 1 1166 ? -17.416 -48.563  -7.855  1.00 34.73  ? 1167 ALA A N     1 
ATOM   8902  C  CA    . ALA A 1 1166 ? -16.361 -49.149  -8.664  1.00 36.62  ? 1167 ALA A CA    1 
ATOM   8903  C  C     . ALA A 1 1166 ? -15.914 -48.222  -9.795  1.00 38.93  ? 1167 ALA A C     1 
ATOM   8904  O  O     . ALA A 1 1166 ? -14.881 -48.454  -10.422 1.00 36.46  ? 1167 ALA A O     1 
ATOM   8905  C  CB    . ALA A 1 1166 ? -16.795 -50.492  -9.218  1.00 35.33  ? 1167 ALA A CB    1 
ATOM   8906  N  N     . ALA A 1 1167 ? -16.647 -47.128  -9.975  1.00 42.39  ? 1168 ALA A N     1 
ATOM   8907  C  CA    . ALA A 1 1167 ? -16.315 -46.154  -10.997 1.00 46.01  ? 1168 ALA A CA    1 
ATOM   8908  C  C     . ALA A 1 1167 ? -15.687 -44.891  -10.426 1.00 49.90  ? 1168 ALA A C     1 
ATOM   8909  O  O     . ALA A 1 1167 ? -15.177 -44.100  -11.230 1.00 48.60  ? 1168 ALA A O     1 
ATOM   8910  C  CB    . ALA A 1 1167 ? -17.528 -45.750  -11.819 1.00 46.27  ? 1168 ALA A CB    1 
ATOM   8911  N  N     . THR A 1 1168 ? -15.649 -44.727  -9.108  1.00 53.65  ? 1169 THR A N     1 
ATOM   8912  C  CA    . THR A 1 1168 ? -15.115 -43.523  -8.507  1.00 58.36  ? 1169 THR A CA    1 
ATOM   8913  C  C     . THR A 1 1168 ? -13.606 -43.348  -8.607  1.00 62.07  ? 1169 THR A C     1 
ATOM   8914  O  O     . THR A 1 1168 ? -12.830 -44.295  -8.718  1.00 61.79  ? 1169 THR A O     1 
ATOM   8915  C  CB    . THR A 1 1168 ? -15.537 -43.382  -7.028  1.00 59.18  ? 1169 THR A CB    1 
ATOM   8916  O  OG1   . THR A 1 1168 ? -15.192 -42.056  -6.567  1.00 58.89  ? 1169 THR A OG1   1 
ATOM   8917  C  CG2   . THR A 1 1168 ? -14.897 -44.379  -6.086  1.00 58.18  ? 1169 THR A CG2   1 
ATOM   8918  N  N     . ASN A 1 1169 ? -13.179 -42.091  -8.535  1.00 66.27  ? 1170 ASN A N     1 
ATOM   8919  C  CA    . ASN A 1 1169 ? -11.763 -41.755  -8.520  1.00 71.89  ? 1170 ASN A CA    1 
ATOM   8920  C  C     . ASN A 1 1169 ? -11.434 -41.105  -7.173  1.00 74.39  ? 1170 ASN A C     1 
ATOM   8921  O  O     . ASN A 1 1169 ? -10.306 -40.698  -6.936  1.00 74.65  ? 1170 ASN A O     1 
ATOM   8922  C  CB    . ASN A 1 1169 ? -11.304 -40.835  -9.639  1.00 73.93  ? 1170 ASN A CB    1 
ATOM   8923  C  CG    . ASN A 1 1169 ? -12.385 -40.237  -10.513 1.00 76.04  ? 1170 ASN A CG    1 
ATOM   8924  O  OD1   . ASN A 1 1169 ? -13.035 -39.243  -10.152 1.00 76.68  ? 1170 ASN A OD1   1 
ATOM   8925  N  ND2   . ASN A 1 1169 ? -12.557 -40.874  -11.675 1.00 76.41  ? 1170 ASN A ND2   1 
ATOM   8926  N  N     . ILE A 1 1170 ? -12.439 -40.995  -6.317  1.00 77.81  ? 1171 ILE A N     1 
ATOM   8927  C  CA    . ILE A 1 1170 ? -12.320 -40.410  -4.992  1.00 81.28  ? 1171 ILE A CA    1 
ATOM   8928  C  C     . ILE A 1 1170 ? -12.127 -41.531  -3.974  1.00 83.92  ? 1171 ILE A C     1 
ATOM   8929  O  O     . ILE A 1 1170 ? -13.106 -42.192  -3.612  1.00 84.38  ? 1171 ILE A O     1 
ATOM   8930  C  CB    . ILE A 1 1170 ? -13.564 -39.584  -4.620  1.00 81.27  ? 1171 ILE A CB    1 
ATOM   8931  C  CG1   . ILE A 1 1170 ? -13.786 -38.451  -5.621  1.00 81.40  ? 1171 ILE A CG1   1 
ATOM   8932  C  CG2   . ILE A 1 1170 ? -13.471 -38.996  -3.214  1.00 81.23  ? 1171 ILE A CG2   1 
ATOM   8933  C  CD1   . ILE A 1 1170 ? -14.603 -38.809  -6.836  1.00 81.77  ? 1171 ILE A CD1   1 
ATOM   8934  N  N     . PHE A 1 1171 ? -10.895 -41.746  -3.518  1.00 86.99  ? 1172 PHE A N     1 
ATOM   8935  C  CA    . PHE A 1 1171 ? -10.671 -42.829  -2.571  1.00 89.78  ? 1172 PHE A CA    1 
ATOM   8936  C  C     . PHE A 1 1171 ? -9.701  -42.483  -1.451  1.00 91.89  ? 1172 PHE A C     1 
ATOM   8937  O  O     . PHE A 1 1171 ? -8.663  -41.843  -1.536  1.00 91.38  ? 1172 PHE A O     1 
ATOM   8938  C  CB    . PHE A 1 1171 ? -10.240 -44.134  -3.234  1.00 89.73  ? 1172 PHE A CB    1 
ATOM   8939  C  CG    . PHE A 1 1171 ? -9.173  -44.036  -4.279  1.00 89.73  ? 1172 PHE A CG    1 
ATOM   8940  C  CD1   . PHE A 1 1171 ? -9.489  -43.774  -5.599  1.00 89.39  ? 1172 PHE A CD1   1 
ATOM   8941  C  CD2   . PHE A 1 1171 ? -7.842  -44.231  -3.935  1.00 89.69  ? 1172 PHE A CD2   1 
ATOM   8942  C  CE1   . PHE A 1 1171 ? -8.493  -43.693  -6.555  1.00 89.53  ? 1172 PHE A CE1   1 
ATOM   8943  C  CE2   . PHE A 1 1171 ? -6.846  -44.155  -4.888  1.00 89.61  ? 1172 PHE A CE2   1 
ATOM   8944  C  CZ    . PHE A 1 1171 ? -7.172  -43.883  -6.200  1.00 89.63  ? 1172 PHE A CZ    1 
ATOM   8945  N  N     . GLU A 1 1172 ? -10.097 -43.023  -0.303  1.00 94.80  ? 1173 GLU A N     1 
ATOM   8946  C  CA    . GLU A 1 1172 ? -9.379  -42.911  0.962   1.00 97.21  ? 1173 GLU A CA    1 
ATOM   8947  C  C     . GLU A 1 1172 ? -8.081  -43.694  0.827   1.00 98.68  ? 1173 GLU A C     1 
ATOM   8948  O  O     . GLU A 1 1172 ? -8.136  -44.890  0.527   1.00 99.10  ? 1173 GLU A O     1 
ATOM   8949  C  CB    . GLU A 1 1172 ? -10.328 -43.416  2.063   1.00 97.26  ? 1173 GLU A CB    1 
ATOM   8950  C  CG    . GLU A 1 1172 ? -11.799 -43.197  1.731   1.00 97.40  ? 1173 GLU A CG    1 
ATOM   8951  C  CD    . GLU A 1 1172 ? -12.738 -42.876  2.868   1.00 97.42  ? 1173 GLU A CD    1 
ATOM   8952  O  OE1   . GLU A 1 1172 ? -13.044 -41.681  3.111   1.00 97.00  ? 1173 GLU A OE1   1 
ATOM   8953  O  OE2   . GLU A 1 1172 ? -13.206 -43.833  3.525   1.00 96.94  ? 1173 GLU A OE2   1 
ATOM   8954  N  N     . SER A 1 1173 ? -6.925  -43.053  0.924   1.00 99.69  ? 1174 SER A N     1 
ATOM   8955  C  CA    . SER A 1 1173 ? -5.609  -43.678  0.763   1.00 100.14 ? 1174 SER A CA    1 
ATOM   8956  C  C     . SER A 1 1173 ? -5.194  -44.638  1.876   1.00 100.62 ? 1174 SER A C     1 
ATOM   8957  O  O     . SER A 1 1173 ? -5.870  -44.773  2.901   1.00 100.61 ? 1174 SER A O     1 
ATOM   8958  C  CB    . SER A 1 1173 ? -4.596  -42.542  0.608   1.00 99.98  ? 1174 SER A CB    1 
ATOM   8959  O  OG    . SER A 1 1173 ? -3.298  -42.876  0.188   1.00 99.24  ? 1174 SER A OG    1 
ATOM   8960  N  N     . PHE A 1 1174 ? -4.081  -45.363  1.691   1.00 100.86 ? 1175 PHE A N     1 
ATOM   8961  C  CA    . PHE A 1 1174 ? -3.640  -46.353  2.666   1.00 101.34 ? 1175 PHE A CA    1 
ATOM   8962  C  C     . PHE A 1 1174 ? -2.175  -46.284  3.098   1.00 101.54 ? 1175 PHE A C     1 
ATOM   8963  O  O     . PHE A 1 1174 ? -1.209  -46.103  2.372   1.00 101.34 ? 1175 PHE A O     1 
ATOM   8964  C  CB    . PHE A 1 1174 ? -3.944  -47.774  2.174   1.00 100.96 ? 1175 PHE A CB    1 
ATOM   8965  C  CG    . PHE A 1 1174 ? -3.557  -48.945  3.032   1.00 100.64 ? 1175 PHE A CG    1 
ATOM   8966  C  CD1   . PHE A 1 1174 ? -3.962  -49.013  4.356   1.00 100.54 ? 1175 PHE A CD1   1 
ATOM   8967  C  CD2   . PHE A 1 1174 ? -2.795  -49.991  2.531   1.00 100.27 ? 1175 PHE A CD2   1 
ATOM   8968  C  CE1   . PHE A 1 1174 ? -3.613  -50.085  5.153   1.00 100.29 ? 1175 PHE A CE1   1 
ATOM   8969  C  CE2   . PHE A 1 1174 ? -2.439  -51.068  3.314   1.00 99.99  ? 1175 PHE A CE2   1 
ATOM   8970  C  CZ    . PHE A 1 1174 ? -2.852  -51.114  4.631   1.00 100.34 ? 1175 PHE A CZ    1 
ATOM   8971  N  N     . ALA A 1 1175 ? -2.026  -46.565  4.388   1.00 101.96 ? 1176 ALA A N     1 
ATOM   8972  C  CA    . ALA A 1 1175 ? -0.786  -46.647  5.130   1.00 102.43 ? 1176 ALA A CA    1 
ATOM   8973  C  C     . ALA A 1 1175 ? -0.956  -47.655  6.270   1.00 102.62 ? 1176 ALA A C     1 
ATOM   8974  O  O     . ALA A 1 1175 ? -1.702  -47.405  7.219   1.00 102.86 ? 1176 ALA A O     1 
ATOM   8975  C  CB    . ALA A 1 1175 ? -0.382  -45.292  5.700   1.00 102.16 ? 1176 ALA A CB    1 
ATOM   8976  N  N     . PRO A 1 1176 ? -0.278  -48.793  6.185   1.00 102.69 ? 1177 PRO A N     1 
ATOM   8977  C  CA    . PRO A 1 1176 ? -0.343  -49.846  7.181   1.00 102.56 ? 1177 PRO A CA    1 
ATOM   8978  C  C     . PRO A 1 1176 ? 0.056   -49.418  8.585   1.00 102.61 ? 1177 PRO A C     1 
ATOM   8979  O  O     . PRO A 1 1176 ? -0.486  -49.893  9.586   1.00 102.40 ? 1177 PRO A O     1 
ATOM   8980  C  CB    . PRO A 1 1176 ? 0.626   -50.909  6.663   1.00 102.59 ? 1177 PRO A CB    1 
ATOM   8981  C  CG    . PRO A 1 1176 ? 0.738   -50.642  5.202   1.00 102.64 ? 1177 PRO A CG    1 
ATOM   8982  C  CD    . PRO A 1 1176 ? 0.621   -49.148  5.053   1.00 102.60 ? 1177 PRO A CD    1 
ATOM   8983  N  N     . ALA A 1 1177 ? 1.037   -48.521  8.662   1.00 102.43 ? 1178 ALA A N     1 
ATOM   8984  C  CA    . ALA A 1 1177 ? 1.547   -47.974  9.912   1.00 102.40 ? 1178 ALA A CA    1 
ATOM   8985  C  C     . ALA A 1 1177 ? 2.704   -47.013  9.615   1.00 102.35 ? 1178 ALA A C     1 
ATOM   8986  O  O     . ALA A 1 1177 ? 2.736   -46.393  8.547   1.00 102.23 ? 1178 ALA A O     1 
ATOM   8987  C  CB    . ALA A 1 1177 ? 2.010   -49.062  10.874  1.00 102.27 ? 1178 ALA A CB    1 
ATOM   8988  N  N     . GLY A 1 1178 ? 3.643   -46.889  10.554  1.00 101.92 ? 1179 GLY A N     1 
ATOM   8989  C  CA    . GLY A 1 1178 ? 4.826   -46.080  10.378  1.00 101.00 ? 1179 GLY A CA    1 
ATOM   8990  C  C     . GLY A 1 1178 ? 4.925   -44.767  11.129  1.00 99.99  ? 1179 GLY A C     1 
ATOM   8991  O  O     . GLY A 1 1178 ? 4.251   -43.792  10.783  1.00 99.62  ? 1179 GLY A O     1 
ATOM   8992  N  N     . GLY A 1 1179 ? 5.809   -44.704  12.124  1.00 99.01  ? 1180 GLY A N     1 
ATOM   8993  C  CA    . GLY A 1 1179 ? 6.025   -43.487  12.894  1.00 97.88  ? 1180 GLY A CA    1 
ATOM   8994  C  C     . GLY A 1 1179 ? 6.302   -43.741  14.366  1.00 97.01  ? 1180 GLY A C     1 
ATOM   8995  O  O     . GLY A 1 1179 ? 7.281   -44.376  14.770  1.00 97.26  ? 1180 GLY A O     1 
ATOM   8996  N  N     . LYS A 1 1180 ? 5.445   -43.203  15.220  1.00 95.55  ? 1181 LYS A N     1 
ATOM   8997  C  CA    . LYS A 1 1180 ? 5.463   -43.323  16.662  1.00 94.04  ? 1181 LYS A CA    1 
ATOM   8998  C  C     . LYS A 1 1180 ? 6.796   -43.073  17.355  1.00 91.68  ? 1181 LYS A C     1 
ATOM   8999  O  O     . LYS A 1 1180 ? 7.093   -41.937  17.741  1.00 91.81  ? 1181 LYS A O     1 
ATOM   9000  C  CB    . LYS A 1 1180 ? 4.902   -44.667  17.152  1.00 95.03  ? 1181 LYS A CB    1 
ATOM   9001  C  CG    . LYS A 1 1180 ? 4.237   -45.536  16.104  1.00 96.29  ? 1181 LYS A CG    1 
ATOM   9002  C  CD    . LYS A 1 1180 ? 4.755   -46.966  16.149  1.00 97.01  ? 1181 LYS A CD    1 
ATOM   9003  C  CE    . LYS A 1 1180 ? 5.171   -47.464  14.777  1.00 97.67  ? 1181 LYS A CE    1 
ATOM   9004  N  NZ    . LYS A 1 1180 ? 6.431   -46.824  14.308  1.00 97.68  ? 1181 LYS A NZ    1 
ATOM   9005  N  N     . ALA A 1 1181 ? 7.578   -44.116  17.606  1.00 87.91  ? 1182 ALA A N     1 
ATOM   9006  C  CA    . ALA A 1 1181 ? 8.860   -44.070  18.294  1.00 83.92  ? 1182 ALA A CA    1 
ATOM   9007  C  C     . ALA A 1 1181 ? 8.734   -43.757  19.786  1.00 80.29  ? 1182 ALA A C     1 
ATOM   9008  O  O     . ALA A 1 1181 ? 7.611   -43.587  20.263  1.00 80.49  ? 1182 ALA A O     1 
ATOM   9009  C  CB    . ALA A 1 1181 ? 9.848   -43.137  17.616  1.00 84.40  ? 1182 ALA A CB    1 
ATOM   9010  N  N     . ASP A 1 1182 ? 9.837   -43.697  20.528  1.00 74.50  ? 1183 ASP A N     1 
ATOM   9011  C  CA    . ASP A 1 1182 ? 9.832   -43.538  21.966  1.00 68.85  ? 1183 ASP A CA    1 
ATOM   9012  C  C     . ASP A 1 1182 ? 9.513   -42.188  22.599  1.00 62.67  ? 1183 ASP A C     1 
ATOM   9013  O  O     . ASP A 1 1182 ? 10.168  -41.184  22.338  1.00 61.22  ? 1183 ASP A O     1 
ATOM   9014  C  CB    . ASP A 1 1182 ? 11.198  -43.906  22.578  1.00 70.51  ? 1183 ASP A CB    1 
ATOM   9015  C  CG    . ASP A 1 1182 ? 11.298  -45.384  22.890  1.00 71.59  ? 1183 ASP A CG    1 
ATOM   9016  O  OD1   . ASP A 1 1182 ? 11.085  -46.174  21.946  1.00 72.87  ? 1183 ASP A OD1   1 
ATOM   9017  O  OD2   . ASP A 1 1182 ? 11.610  -45.730  24.045  1.00 70.76  ? 1183 ASP A OD2   1 
ATOM   9018  N  N     . GLY A 1 1183 ? 8.587   -42.213  23.556  1.00 54.62  ? 1184 GLY A N     1 
ATOM   9019  C  CA    . GLY A 1 1183 ? 8.243   -41.009  24.292  1.00 46.85  ? 1184 GLY A CA    1 
ATOM   9020  C  C     . GLY A 1 1183 ? 6.744   -40.734  24.294  1.00 41.55  ? 1184 GLY A C     1 
ATOM   9021  O  O     . GLY A 1 1183 ? 6.030   -41.163  23.395  1.00 40.09  ? 1184 GLY A O     1 
ATOM   9022  N  N     . SER A 1 1184 ? 6.293   -39.991  25.295  1.00 35.14  ? 1185 SER A N     1 
ATOM   9023  C  CA    . SER A 1 1184 ? 4.847   -39.706  25.327  1.00 32.89  ? 1185 SER A CA    1 
ATOM   9024  C  C     . SER A 1 1184 ? 4.617   -38.215  25.559  1.00 27.86  ? 1185 SER A C     1 
ATOM   9025  O  O     . SER A 1 1184 ? 5.569   -37.573  26.005  1.00 24.59  ? 1185 SER A O     1 
ATOM   9026  C  CB    . SER A 1 1184 ? 4.189   -40.458  26.497  1.00 29.95  ? 1185 SER A CB    1 
ATOM   9027  O  OG    . SER A 1 1184 ? 4.885   -40.110  27.707  1.00 32.42  ? 1185 SER A OG    1 
ATOM   9028  N  N     . VAL A 1 1185 ? 3.376   -37.779  25.358  1.00 22.74  ? 1186 VAL A N     1 
ATOM   9029  C  CA    . VAL A 1 1185 ? 3.081   -36.381  25.705  1.00 22.79  ? 1186 VAL A CA    1 
ATOM   9030  C  C     . VAL A 1 1185 ? 1.647   -36.310  26.249  1.00 22.29  ? 1186 VAL A C     1 
ATOM   9031  O  O     . VAL A 1 1185 ? 0.768   -36.999  25.726  1.00 21.19  ? 1186 VAL A O     1 
ATOM   9032  C  CB    . VAL A 1 1185 ? 3.368   -35.415  24.541  1.00 25.14  ? 1186 VAL A CB    1 
ATOM   9033  C  CG1   . VAL A 1 1185 ? 2.386   -35.469  23.390  1.00 25.26  ? 1186 VAL A CG1   1 
ATOM   9034  C  CG2   . VAL A 1 1185 ? 3.502   -34.000  25.019  1.00 26.83  ? 1186 VAL A CG2   1 
ATOM   9035  N  N     . ASP A 1 1186 ? 1.421   -35.548  27.296  1.00 18.93  ? 1187 ASP A N     1 
ATOM   9036  C  CA    . ASP A 1 1186 ? 0.048   -35.371  27.810  1.00 18.25  ? 1187 ASP A CA    1 
ATOM   9037  C  C     . ASP A 1 1186 ? -0.613  -34.251  27.006  1.00 18.38  ? 1187 ASP A C     1 
ATOM   9038  O  O     . ASP A 1 1186 ? 0.075   -33.246  26.743  1.00 17.03  ? 1187 ASP A O     1 
ATOM   9039  C  CB    . ASP A 1 1186 ? 0.158   -35.002  29.302  1.00 20.31  ? 1187 ASP A CB    1 
ATOM   9040  C  CG    . ASP A 1 1186 ? -1.265  -34.800  29.863  1.00 23.36  ? 1187 ASP A CG    1 
ATOM   9041  O  OD1   . ASP A 1 1186 ? -1.636  -33.655  30.150  1.00 23.40  ? 1187 ASP A OD1   1 
ATOM   9042  O  OD2   . ASP A 1 1186 ? -1.941  -35.848  29.897  1.00 22.28  ? 1187 ASP A OD2   1 
ATOM   9043  N  N     . PHE A 1 1187 ? -1.908  -34.328  26.767  1.00 17.46  ? 1188 PHE A N     1 
ATOM   9044  C  CA    . PHE A 1 1187 ? -2.636  -33.360  25.956  1.00 17.40  ? 1188 PHE A CA    1 
ATOM   9045  C  C     . PHE A 1 1187 ? -2.561  -31.978  26.585  1.00 17.76  ? 1188 PHE A C     1 
ATOM   9046  O  O     . PHE A 1 1187 ? -2.860  -30.942  25.977  1.00 18.36  ? 1188 PHE A O     1 
ATOM   9047  C  CB    . PHE A 1 1187 ? -4.088  -33.850  25.721  1.00 17.55  ? 1188 PHE A CB    1 
ATOM   9048  C  CG    . PHE A 1 1187 ? -4.968  -34.000  26.956  1.00 16.74  ? 1188 PHE A CG    1 
ATOM   9049  C  CD1   . PHE A 1 1187 ? -5.608  -32.905  27.507  1.00 15.98  ? 1188 PHE A CD1   1 
ATOM   9050  C  CD2   . PHE A 1 1187 ? -5.109  -35.249  27.594  1.00 14.46  ? 1188 PHE A CD2   1 
ATOM   9051  C  CE1   . PHE A 1 1187 ? -6.413  -33.050  28.631  1.00 17.49  ? 1188 PHE A CE1   1 
ATOM   9052  C  CE2   . PHE A 1 1187 ? -5.928  -35.378  28.705  1.00 15.34  ? 1188 PHE A CE2   1 
ATOM   9053  C  CZ    . PHE A 1 1187 ? -6.572  -34.291  29.264  1.00 14.07  ? 1188 PHE A CZ    1 
ATOM   9054  N  N     . GLY A 1 1188 ? -2.335  -31.979  27.903  1.00 17.99  ? 1189 GLY A N     1 
ATOM   9055  C  CA    . GLY A 1 1188 ? -2.419  -30.734  28.678  1.00 17.86  ? 1189 GLY A CA    1 
ATOM   9056  C  C     . GLY A 1 1188 ? -1.044  -30.044  28.699  1.00 20.07  ? 1189 GLY A C     1 
ATOM   9057  O  O     . GLY A 1 1188 ? -1.026  -28.880  29.082  1.00 18.45  ? 1189 GLY A O     1 
ATOM   9058  N  N     . GLU A 1 1189 ? 0.036   -30.686  28.300  1.00 18.64  ? 1190 GLU A N     1 
ATOM   9059  C  CA    . GLU A 1 1189 ? 1.381   -30.081  28.395  1.00 18.96  ? 1190 GLU A CA    1 
ATOM   9060  C  C     . GLU A 1 1189 ? 1.530   -28.759  27.644  1.00 20.31  ? 1190 GLU A C     1 
ATOM   9061  O  O     . GLU A 1 1189 ? 1.290   -28.719  26.423  1.00 17.99  ? 1190 GLU A O     1 
ATOM   9062  C  CB    . GLU A 1 1189 ? 2.453   -31.038  27.810  1.00 20.76  ? 1190 GLU A CB    1 
ATOM   9063  C  CG    . GLU A 1 1189 ? 2.836   -32.111  28.827  1.00 30.24  ? 1190 GLU A CG    1 
ATOM   9064  C  CD    . GLU A 1 1189 ? 3.722   -33.260  28.341  1.00 32.73  ? 1190 GLU A CD    1 
ATOM   9065  O  OE1   . GLU A 1 1189 ? 4.615   -32.942  27.514  1.00 35.53  ? 1190 GLU A OE1   1 
ATOM   9066  O  OE2   . GLU A 1 1189 ? 3.563   -34.431  28.799  1.00 31.39  ? 1190 GLU A OE2   1 
ATOM   9067  N  N     . GLY A 1 1190 ? 1.911   -27.702  28.362  1.00 19.21  ? 1191 GLY A N     1 
ATOM   9068  C  CA    . GLY A 1 1190 ? 2.113   -26.385  27.814  1.00 16.66  ? 1191 GLY A CA    1 
ATOM   9069  C  C     . GLY A 1 1190 ? 0.890   -25.640  27.317  1.00 21.87  ? 1191 GLY A C     1 
ATOM   9070  O  O     . GLY A 1 1190 ? 1.020   -24.620  26.625  1.00 21.82  ? 1191 GLY A O     1 
ATOM   9071  N  N     . ALA A 1 1191 ? -0.340  -26.075  27.654  1.00 18.66  ? 1192 ALA A N     1 
ATOM   9072  C  CA    . ALA A 1 1191 ? -1.553  -25.383  27.246  1.00 20.18  ? 1192 ALA A CA    1 
ATOM   9073  C  C     . ALA A 1 1191 ? -1.668  -23.994  27.845  1.00 19.91  ? 1192 ALA A C     1 
ATOM   9074  O  O     . ALA A 1 1191 ? -1.199  -23.749  29.001  1.00 19.79  ? 1192 ALA A O     1 
ATOM   9075  C  CB    . ALA A 1 1191 ? -2.765  -26.246  27.693  1.00 18.24  ? 1192 ALA A CB    1 
ATOM   9076  N  N     . GLU A 1 1192 ? -2.310  -23.092  27.115  1.00 20.69  ? 1193 GLU A N     1 
ATOM   9077  C  CA    . GLU A 1 1192 ? -2.446  -21.711  27.571  1.00 24.49  ? 1193 GLU A CA    1 
ATOM   9078  C  C     . GLU A 1 1192 ? -3.481  -21.560  28.679  1.00 22.97  ? 1193 GLU A C     1 
ATOM   9079  O  O     . GLU A 1 1192 ? -3.463  -20.639  29.484  1.00 23.06  ? 1193 GLU A O     1 
ATOM   9080  C  CB    . GLU A 1 1192 ? -2.773  -20.806  26.372  1.00 26.48  ? 1193 GLU A CB    1 
ATOM   9081  C  CG    . GLU A 1 1192 ? -1.620  -20.393  25.500  1.00 33.22  ? 1193 GLU A CG    1 
ATOM   9082  C  CD    . GLU A 1 1192 ? -1.117  -21.395  24.496  1.00 38.34  ? 1193 GLU A CD    1 
ATOM   9083  O  OE1   . GLU A 1 1192 ? -0.324  -21.062  23.555  1.00 40.85  ? 1193 GLU A OE1   1 
ATOM   9084  O  OE2   . GLU A 1 1192 ? -1.491  -22.583  24.608  1.00 38.16  ? 1193 GLU A OE2   1 
ATOM   9085  N  N     . PHE A 1 1193 ? -4.459  -22.460  28.725  1.00 21.85  ? 1194 PHE A N     1 
ATOM   9086  C  CA    . PHE A 1 1193 ? -5.537  -22.451  29.700  1.00 18.34  ? 1194 PHE A CA    1 
ATOM   9087  C  C     . PHE A 1 1193 ? -5.598  -23.827  30.354  1.00 19.13  ? 1194 PHE A C     1 
ATOM   9088  O  O     . PHE A 1 1193 ? -5.089  -24.810  29.800  1.00 17.14  ? 1194 PHE A O     1 
ATOM   9089  C  CB    . PHE A 1 1193 ? -6.904  -22.121  29.014  1.00 17.21  ? 1194 PHE A CB    1 
ATOM   9090  C  CG    . PHE A 1 1193 ? -6.976  -20.690  28.512  1.00 19.03  ? 1194 PHE A CG    1 
ATOM   9091  C  CD1   . PHE A 1 1193 ? -6.298  -20.312  27.366  1.00 18.17  ? 1194 PHE A CD1   1 
ATOM   9092  C  CD2   . PHE A 1 1193 ? -7.650  -19.709  29.223  1.00 19.19  ? 1194 PHE A CD2   1 
ATOM   9093  C  CE1   . PHE A 1 1193 ? -6.335  -19.000  26.923  1.00 17.58  ? 1194 PHE A CE1   1 
ATOM   9094  C  CE2   . PHE A 1 1193 ? -7.704  -18.389  28.782  1.00 22.37  ? 1194 PHE A CE2   1 
ATOM   9095  C  CZ    . PHE A 1 1193 ? -7.047  -18.039  27.623  1.00 18.15  ? 1194 PHE A CZ    1 
ATOM   9096  N  N     . CYS A 1 1194 ? -6.358  -23.938  31.464  1.00 18.33  ? 1195 CYS A N     1 
ATOM   9097  C  CA    . CYS A 1 1194 ? -6.561  -25.265  32.049  1.00 17.34  ? 1195 CYS A CA    1 
ATOM   9098  C  C     . CYS A 1 1194 ? -7.205  -26.192  30.995  1.00 18.07  ? 1195 CYS A C     1 
ATOM   9099  O  O     . CYS A 1 1194 ? -8.118  -25.855  30.245  1.00 15.64  ? 1195 CYS A O     1 
ATOM   9100  C  CB    . CYS A 1 1194 ? -7.536  -25.160  33.224  1.00 18.58  ? 1195 CYS A CB    1 
ATOM   9101  S  SG    . CYS A 1 1194 ? -7.069  -24.033  34.554  1.00 21.57  ? 1195 CYS A SG    1 
ATOM   9102  N  N     . THR A 1 1195 ? -6.805  -27.440  31.092  1.00 17.59  ? 1196 THR A N     1 
ATOM   9103  C  CA    . THR A 1 1195 ? -7.286  -28.496  30.149  1.00 17.86  ? 1196 THR A CA    1 
ATOM   9104  C  C     . THR A 1 1195 ? -7.985  -29.572  30.957  1.00 18.36  ? 1196 THR A C     1 
ATOM   9105  O  O     . THR A 1 1195 ? -8.467  -30.550  30.426  1.00 15.63  ? 1196 THR A O     1 
ATOM   9106  C  CB    . THR A 1 1195 ? -5.898  -28.764  29.554  1.00 20.49  ? 1196 THR A CB    1 
ATOM   9107  O  OG1   . THR A 1 1195 ? -5.723  -28.516  28.161  1.00 26.22  ? 1196 THR A OG1   1 
ATOM   9108  C  CG2   . THR A 1 1195 ? -5.200  -29.904  30.134  1.00 12.59  ? 1196 THR A CG2   1 
ATOM   9109  N  N     . ARG A 1 1196 ? -7.992  -29.454  32.291  1.00 18.49  ? 1197 ARG A N     1 
ATOM   9110  C  CA    . ARG A 1 1196 ? -8.663  -30.369  33.194  1.00 17.50  ? 1197 ARG A CA    1 
ATOM   9111  C  C     . ARG A 1 1196 ? -9.585  -29.567  34.147  1.00 17.02  ? 1197 ARG A C     1 
ATOM   9112  O  O     . ARG A 1 1196 ? -9.257  -28.399  34.381  1.00 17.14  ? 1197 ARG A O     1 
ATOM   9113  C  CB    . ARG A 1 1196 ? -7.675  -31.246  34.002  1.00 18.66  ? 1197 ARG A CB    1 
ATOM   9114  C  CG    . ARG A 1 1196 ? -7.107  -32.336  33.073  1.00 20.56  ? 1197 ARG A CG    1 
ATOM   9115  C  CD    . ARG A 1 1196 ? -5.854  -32.914  33.677  1.00 24.57  ? 1197 ARG A CD    1 
ATOM   9116  N  NE    . ARG A 1 1196 ? -5.555  -34.249  33.094  1.00 23.44  ? 1197 ARG A NE    1 
ATOM   9117  C  CZ    . ARG A 1 1196 ? -4.591  -34.325  32.148  1.00 23.17  ? 1197 ARG A CZ    1 
ATOM   9118  N  NH1   . ARG A 1 1196 ? -3.926  -33.223  31.761  1.00 21.20  ? 1197 ARG A NH1   1 
ATOM   9119  N  NH2   . ARG A 1 1196 ? -4.308  -35.527  31.669  1.00 19.22  ? 1197 ARG A NH2   1 
ATOM   9120  N  N     . ASP A 1 1197 ? -10.689 -30.158  34.584  1.00 15.86  ? 1198 ASP A N     1 
ATOM   9121  C  CA    . ASP A 1 1197 ? -11.636 -29.383  35.425  1.00 17.40  ? 1198 ASP A CA    1 
ATOM   9122  C  C     . ASP A 1 1197 ? -11.304 -29.515  36.912  1.00 18.23  ? 1198 ASP A C     1 
ATOM   9123  O  O     . ASP A 1 1197 ? -10.282 -30.091  37.301  1.00 15.95  ? 1198 ASP A O     1 
ATOM   9124  C  CB    . ASP A 1 1197 ? -13.058 -29.859  35.102  1.00 17.60  ? 1198 ASP A CB    1 
ATOM   9125  C  CG    . ASP A 1 1197 ? -13.351 -31.306  35.429  1.00 19.98  ? 1198 ASP A CG    1 
ATOM   9126  O  OD1   . ASP A 1 1197 ? -14.269 -31.952  34.852  1.00 19.75  ? 1198 ASP A OD1   1 
ATOM   9127  O  OD2   . ASP A 1 1197 ? -12.681 -31.866  36.336  1.00 18.75  ? 1198 ASP A OD2   1 
ATOM   9128  N  N     . ASP A 1 1198 ? -12.224 -29.043  37.758  1.00 19.38  ? 1199 ASP A N     1 
ATOM   9129  C  CA    . ASP A 1 1198 ? -12.005 -29.040  39.198  1.00 20.09  ? 1199 ASP A CA    1 
ATOM   9130  C  C     . ASP A 1 1198 ? -12.675 -30.224  39.879  1.00 20.19  ? 1199 ASP A C     1 
ATOM   9131  O  O     . ASP A 1 1198 ? -12.873 -30.168  41.094  1.00 19.72  ? 1199 ASP A O     1 
ATOM   9132  C  CB    . ASP A 1 1198 ? -12.750 -27.809  39.789  1.00 22.11  ? 1199 ASP A CB    1 
ATOM   9133  C  CG    . ASP A 1 1198 ? -11.996 -26.552  39.456  1.00 24.90  ? 1199 ASP A CG    1 
ATOM   9134  O  OD1   . ASP A 1 1198 ? -10.799 -26.628  39.034  1.00 25.57  ? 1199 ASP A OD1   1 
ATOM   9135  O  OD2   . ASP A 1 1198 ? -12.667 -25.514  39.591  1.00 24.80  ? 1199 ASP A OD2   1 
ATOM   9136  N  N     . THR A 1 1199 ? -12.875 -31.316  39.183  1.00 17.67  ? 1200 THR A N     1 
ATOM   9137  C  CA    . THR A 1 1199 ? -13.573 -32.491  39.799  1.00 17.84  ? 1200 THR A CA    1 
ATOM   9138  C  C     . THR A 1 1199 ? -12.669 -33.605  40.245  1.00 16.36  ? 1200 THR A C     1 
ATOM   9139  O  O     . THR A 1 1199 ? -11.549 -33.842  39.756  1.00 15.62  ? 1200 THR A O     1 
ATOM   9140  C  CB    . THR A 1 1199 ? -14.315 -32.734  38.461  1.00 21.81  ? 1200 THR A CB    1 
ATOM   9141  O  OG1   . THR A 1 1199 ? -15.636 -32.183  38.358  1.00 24.20  ? 1200 THR A OG1   1 
ATOM   9142  C  CG2   . THR A 1 1199 ? -14.022 -33.987  37.747  1.00 13.34  ? 1200 THR A CG2   1 
ATOM   9143  N  N     . PRO A 1 1200 ? -13.183 -34.576  41.026  1.00 16.89  ? 1201 PRO A N     1 
ATOM   9144  C  CA    . PRO A 1 1200 ? -12.453 -35.782  41.401  1.00 16.44  ? 1201 PRO A CA    1 
ATOM   9145  C  C     . PRO A 1 1200 ? -12.167 -36.708  40.211  1.00 17.24  ? 1201 PRO A C     1 
ATOM   9146  O  O     . PRO A 1 1200 ? -11.277 -37.570  40.226  1.00 15.46  ? 1201 PRO A O     1 
ATOM   9147  C  CB    . PRO A 1 1200 ? -13.386 -36.510  42.365  1.00 15.42  ? 1201 PRO A CB    1 
ATOM   9148  C  CG    . PRO A 1 1200 ? -14.516 -35.616  42.653  1.00 18.21  ? 1201 PRO A CG    1 
ATOM   9149  C  CD    . PRO A 1 1200 ? -14.543 -34.503  41.614  1.00 15.68  ? 1201 PRO A CD    1 
ATOM   9150  N  N     . MET A 1 1201 ? -13.007 -36.557  39.170  1.00 16.45  ? 1202 MET A N     1 
ATOM   9151  C  CA    . MET A 1 1201 ? -12.853 -37.448  38.001  1.00 18.59  ? 1202 MET A CA    1 
ATOM   9152  C  C     . MET A 1 1201 ? -11.618 -37.210  37.155  1.00 16.69  ? 1202 MET A C     1 
ATOM   9153  O  O     . MET A 1 1201 ? -11.061 -38.214  36.647  1.00 16.16  ? 1202 MET A O     1 
ATOM   9154  C  CB    . MET A 1 1201 ? -14.127 -37.282  37.094  1.00 20.69  ? 1202 MET A CB    1 
ATOM   9155  C  CG    . MET A 1 1201 ? -15.214 -38.184  37.716  1.00 25.24  ? 1202 MET A CG    1 
ATOM   9156  S  SD    . MET A 1 1201 ? -16.866 -37.450  37.746  1.00 32.30  ? 1202 MET A SD    1 
ATOM   9157  C  CE    . MET A 1 1201 ? -16.395 -36.021  38.716  1.00 27.71  ? 1202 MET A CE    1 
ATOM   9158  N  N     . MET A 1 1202 ? -11.212 -35.980  37.041  1.00 15.61  ? 1203 MET A N     1 
ATOM   9159  C  CA    . MET A 1 1202 ? -10.052 -35.639  36.217  1.00 15.51  ? 1203 MET A CA    1 
ATOM   9160  C  C     . MET A 1 1202 ? -8.816  -35.475  37.104  1.00 14.68  ? 1203 MET A C     1 
ATOM   9161  O  O     . MET A 1 1202 ? -7.710  -35.308  36.574  1.00 15.47  ? 1203 MET A O     1 
ATOM   9162  C  CB    . MET A 1 1202 ? -10.215 -34.324  35.450  1.00 13.40  ? 1203 MET A CB    1 
ATOM   9163  C  CG    . MET A 1 1202 ? -11.415 -34.407  34.434  1.00 14.57  ? 1203 MET A CG    1 
ATOM   9164  S  SD    . MET A 1 1202 ? -10.987 -33.248  33.107  1.00 15.25  ? 1203 MET A SD    1 
ATOM   9165  C  CE    . MET A 1 1202 ? -12.636 -32.958  32.373  1.00 13.73  ? 1203 MET A CE    1 
ATOM   9166  N  N     . ALA A 1 1203 ? -8.969  -35.625  38.407  1.00 13.79  ? 1204 ALA A N     1 
ATOM   9167  C  CA    . ALA A 1 1203 ? -7.767  -35.469  39.266  1.00 14.88  ? 1204 ALA A CA    1 
ATOM   9168  C  C     . ALA A 1 1203 ? -6.762  -36.600  39.009  1.00 14.84  ? 1204 ALA A C     1 
ATOM   9169  O  O     . ALA A 1 1203 ? -7.107  -37.791  38.753  1.00 15.30  ? 1204 ALA A O     1 
ATOM   9170  C  CB    . ALA A 1 1203 ? -8.176  -35.335  40.749  1.00 15.71  ? 1204 ALA A CB    1 
ATOM   9171  N  N     . ARG A 1 1204 ? -5.486  -36.217  38.971  1.00 14.05  ? 1205 ARG A N     1 
ATOM   9172  C  CA    . ARG A 1 1204 ? -4.390  -37.181  38.696  1.00 17.79  ? 1205 ARG A CA    1 
ATOM   9173  C  C     . ARG A 1 1204 ? -3.199  -36.898  39.582  1.00 17.57  ? 1205 ARG A C     1 
ATOM   9174  O  O     . ARG A 1 1204 ? -3.067  -35.786  40.123  1.00 17.85  ? 1205 ARG A O     1 
ATOM   9175  C  CB    . ARG A 1 1204 ? -3.901  -37.117  37.240  1.00 17.78  ? 1205 ARG A CB    1 
ATOM   9176  C  CG    . ARG A 1 1204 ? -4.989  -37.578  36.265  1.00 17.50  ? 1205 ARG A CG    1 
ATOM   9177  C  CD    . ARG A 1 1204 ? -5.253  -39.088  36.369  1.00 15.43  ? 1205 ARG A CD    1 
ATOM   9178  N  NE    . ARG A 1 1204 ? -6.176  -39.527  35.278  1.00 15.19  ? 1205 ARG A NE    1 
ATOM   9179  C  CZ    . ARG A 1 1204 ? -7.473  -39.307  35.350  1.00 15.09  ? 1205 ARG A CZ    1 
ATOM   9180  N  NH1   . ARG A 1 1204 ? -8.170  -39.761  34.295  1.00 16.02  ? 1205 ARG A NH1   1 
ATOM   9181  N  NH2   . ARG A 1 1204 ? -8.114  -38.753  36.412  1.00 12.36  ? 1205 ARG A NH2   1 
ATOM   9182  N  N     . PRO A 1 1205 ? -2.288  -37.856  39.739  1.00 20.59  ? 1206 PRO A N     1 
ATOM   9183  C  CA    . PRO A 1 1205 ? -1.143  -37.700  40.654  1.00 21.44  ? 1206 PRO A CA    1 
ATOM   9184  C  C     . PRO A 1 1205 ? -0.427  -36.391  40.407  1.00 22.74  ? 1206 PRO A C     1 
ATOM   9185  O  O     . PRO A 1 1205 ? -0.171  -35.681  41.353  1.00 27.02  ? 1206 PRO A O     1 
ATOM   9186  C  CB    . PRO A 1 1205 ? -0.244  -38.896  40.369  1.00 21.64  ? 1206 PRO A CB    1 
ATOM   9187  C  CG    . PRO A 1 1205 ? -1.241  -39.948  39.971  1.00 21.78  ? 1206 PRO A CG    1 
ATOM   9188  C  CD    . PRO A 1 1205 ? -2.298  -39.201  39.175  1.00 21.41  ? 1206 PRO A CD    1 
ATOM   9189  N  N     . ASP A 1 1206 ? -0.238  -36.020  39.167  1.00 23.73  ? 1207 ASP A N     1 
ATOM   9190  C  CA    . ASP A 1 1206 ? 0.447   -34.778  38.856  1.00 29.77  ? 1207 ASP A CA    1 
ATOM   9191  C  C     . ASP A 1 1206 ? -0.445  -33.581  38.551  1.00 28.70  ? 1207 ASP A C     1 
ATOM   9192  O  O     . ASP A 1 1206 ? 0.160   -32.564  38.187  1.00 28.58  ? 1207 ASP A O     1 
ATOM   9193  C  CB    . ASP A 1 1206 ? 1.437   -34.996  37.689  1.00 34.77  ? 1207 ASP A CB    1 
ATOM   9194  C  CG    . ASP A 1 1206 ? 2.709   -35.660  38.202  1.00 40.74  ? 1207 ASP A CG    1 
ATOM   9195  O  OD1   . ASP A 1 1206 ? 3.119   -35.489  39.379  1.00 42.83  ? 1207 ASP A OD1   1 
ATOM   9196  O  OD2   . ASP A 1 1206 ? 3.354   -36.417  37.423  1.00 44.93  ? 1207 ASP A OD2   1 
ATOM   9197  N  N     . SER A 1 1207 ? -1.748  -33.633  38.785  1.00 23.48  ? 1208 SER A N     1 
ATOM   9198  C  CA    . SER A 1 1207 ? -2.565  -32.438  38.496  1.00 24.19  ? 1208 SER A CA    1 
ATOM   9199  C  C     . SER A 1 1207 ? -2.559  -31.472  39.681  1.00 24.14  ? 1208 SER A C     1 
ATOM   9200  O  O     . SER A 1 1207 ? -2.186  -31.816  40.817  1.00 24.61  ? 1208 SER A O     1 
ATOM   9201  C  CB    . SER A 1 1207 ? -3.970  -32.943  38.072  1.00 20.04  ? 1208 SER A CB    1 
ATOM   9202  O  OG    . SER A 1 1207 ? -4.649  -33.361  39.245  1.00 24.15  ? 1208 SER A OG    1 
ATOM   9203  N  N     . GLY A 1 1208 ? -3.025  -30.256  39.536  1.00 24.15  ? 1209 GLY A N     1 
ATOM   9204  C  CA    . GLY A 1 1208 ? -3.182  -29.270  40.588  1.00 23.82  ? 1209 GLY A CA    1 
ATOM   9205  C  C     . GLY A 1 1208 ? -2.407  -27.982  40.492  1.00 25.22  ? 1209 GLY A C     1 
ATOM   9206  O  O     . GLY A 1 1208 ? -2.489  -27.090  41.341  1.00 22.93  ? 1209 GLY A O     1 
ATOM   9207  N  N     . GLU A 1 1209 ? -1.619  -27.854  39.435  1.00 25.33  ? 1210 GLU A N     1 
ATOM   9208  C  CA    . GLU A 1 1209 ? -0.904  -26.630  39.089  1.00 25.24  ? 1210 GLU A CA    1 
ATOM   9209  C  C     . GLU A 1 1209 ? -1.871  -25.498  38.785  1.00 24.49  ? 1210 GLU A C     1 
ATOM   9210  O  O     . GLU A 1 1209 ? -2.984  -25.817  38.340  1.00 25.80  ? 1210 GLU A O     1 
ATOM   9211  C  CB    . GLU A 1 1209 ? -0.070  -26.846  37.830  1.00 29.10  ? 1210 GLU A CB    1 
ATOM   9212  C  CG    . GLU A 1 1209 ? 0.937   -25.729  37.598  1.00 37.34  ? 1210 GLU A CG    1 
ATOM   9213  C  CD    . GLU A 1 1209 ? 1.911   -26.070  36.480  1.00 42.85  ? 1210 GLU A CD    1 
ATOM   9214  O  OE1   . GLU A 1 1209 ? 3.132   -25.891  36.713  1.00 47.97  ? 1210 GLU A OE1   1 
ATOM   9215  O  OE2   . GLU A 1 1209 ? 1.479   -26.521  35.392  1.00 44.52  ? 1210 GLU A OE2   1 
ATOM   9216  N  N     . ALA A 1 1210 ? -1.548  -24.240  39.088  1.00 21.58  ? 1211 ALA A N     1 
ATOM   9217  C  CA    . ALA A 1 1210 ? -2.482  -23.143  38.804  1.00 19.70  ? 1211 ALA A CA    1 
ATOM   9218  C  C     . ALA A 1 1210 ? -2.571  -22.941  37.296  1.00 19.26  ? 1211 ALA A C     1 
ATOM   9219  O  O     . ALA A 1 1210 ? -1.557  -23.240  36.634  1.00 14.93  ? 1211 ALA A O     1 
ATOM   9220  C  CB    . ALA A 1 1210 ? -1.971  -21.835  39.413  1.00 22.39  ? 1211 ALA A CB    1 
ATOM   9221  N  N     . CYS A 1 1211 ? -3.745  -22.568  36.786  1.00 19.45  ? 1212 CYS A N     1 
ATOM   9222  C  CA    . CYS A 1 1211 ? -3.858  -22.298  35.335  1.00 19.08  ? 1212 CYS A CA    1 
ATOM   9223  C  C     . CYS A 1 1211 ? -5.034  -21.368  35.096  1.00 18.28  ? 1212 CYS A C     1 
ATOM   9224  O  O     . CYS A 1 1211 ? -5.836  -21.210  36.011  1.00 18.37  ? 1212 CYS A O     1 
ATOM   9225  C  CB    . CYS A 1 1211 ? -4.049  -23.581  34.506  1.00 19.54  ? 1212 CYS A CB    1 
ATOM   9226  S  SG    . CYS A 1 1211 ? -5.304  -24.645  35.291  1.00 21.85  ? 1212 CYS A SG    1 
ATOM   9227  N  N     . ASP A 1 1212 ? -5.261  -20.876  33.911  1.00 18.43  ? 1213 ASP A N     1 
ATOM   9228  C  CA    . ASP A 1 1212 ? -6.367  -19.948  33.640  1.00 19.14  ? 1213 ASP A CA    1 
ATOM   9229  C  C     . ASP A 1 1212 ? -7.571  -20.821  33.220  1.00 18.83  ? 1213 ASP A C     1 
ATOM   9230  O  O     . ASP A 1 1212 ? -7.550  -21.485  32.189  1.00 18.26  ? 1213 ASP A O     1 
ATOM   9231  C  CB    . ASP A 1 1212 ? -6.003  -19.019  32.482  1.00 19.85  ? 1213 ASP A CB    1 
ATOM   9232  C  CG    . ASP A 1 1212 ? -7.028  -17.947  32.204  1.00 18.34  ? 1213 ASP A CG    1 
ATOM   9233  O  OD1   . ASP A 1 1212 ? -8.237  -18.140  32.456  1.00 19.07  ? 1213 ASP A OD1   1 
ATOM   9234  O  OD2   . ASP A 1 1212 ? -6.656  -16.823  31.770  1.00 21.38  ? 1213 ASP A OD2   1 
ATOM   9235  N  N     . GLN A 1 1213 ? -8.554  -20.736  34.099  1.00 19.64  ? 1214 GLN A N     1 
ATOM   9236  C  CA    . GLN A 1 1213 ? -9.773  -21.512  33.997  1.00 21.71  ? 1214 GLN A CA    1 
ATOM   9237  C  C     . GLN A 1 1213 ? -10.896 -20.942  33.167  1.00 20.74  ? 1214 GLN A C     1 
ATOM   9238  O  O     . GLN A 1 1213 ? -12.057 -21.349  33.364  1.00 17.21  ? 1214 GLN A O     1 
ATOM   9239  C  CB    . GLN A 1 1213 ? -10.310 -21.556  35.491  1.00 24.03  ? 1214 GLN A CB    1 
ATOM   9240  C  CG    . GLN A 1 1213 ? -10.579 -23.021  35.757  1.00 25.88  ? 1214 GLN A CG    1 
ATOM   9241  C  CD    . GLN A 1 1213 ? -11.266 -23.278  37.092  1.00 22.77  ? 1214 GLN A CD    1 
ATOM   9242  O  OE1   . GLN A 1 1213 ? -11.784 -22.425  37.819  1.00 21.54  ? 1214 GLN A OE1   1 
ATOM   9243  N  NE2   . GLN A 1 1213 ? -11.225 -24.578  37.351  1.00 21.82  ? 1214 GLN A NE2   1 
ATOM   9244  N  N     . ASN A 1 1214 ? -10.630 -19.969  32.310  1.00 18.93  ? 1215 ASN A N     1 
ATOM   9245  C  CA    . ASN A 1 1214 ? -11.639 -19.400  31.404  1.00 18.90  ? 1215 ASN A CA    1 
ATOM   9246  C  C     . ASN A 1 1214 ? -12.751 -18.654  32.122  1.00 19.52  ? 1215 ASN A C     1 
ATOM   9247  O  O     . ASN A 1 1214 ? -13.861 -18.492  31.608  1.00 18.77  ? 1215 ASN A O     1 
ATOM   9248  C  CB    . ASN A 1 1214 ? -12.143 -20.516  30.468  1.00 19.51  ? 1215 ASN A CB    1 
ATOM   9249  C  CG    . ASN A 1 1214 ? -11.145 -20.826  29.376  1.00 21.17  ? 1215 ASN A CG    1 
ATOM   9250  O  OD1   . ASN A 1 1214 ? -10.507 -21.928  29.413  1.00 25.05  ? 1215 ASN A OD1   1 
ATOM   9251  N  ND2   . ASN A 1 1214 ? -10.945 -19.925  28.430  1.00 15.24  ? 1215 ASN A ND2   1 
ATOM   9252  N  N     . ARG A 1 1215 ? -12.457 -18.116  33.316  1.00 19.13  ? 1216 ARG A N     1 
ATOM   9253  C  CA    . ARG A 1 1215 ? -13.458 -17.339  34.047  1.00 18.40  ? 1216 ARG A CA    1 
ATOM   9254  C  C     . ARG A 1 1215 ? -13.186 -15.828  33.918  1.00 21.01  ? 1216 ARG A C     1 
ATOM   9255  O  O     . ARG A 1 1215 ? -13.920 -14.987  34.482  1.00 17.65  ? 1216 ARG A O     1 
ATOM   9256  C  CB    . ARG A 1 1215 ? -13.527 -17.751  35.524  1.00 20.05  ? 1216 ARG A CB    1 
ATOM   9257  C  CG    . ARG A 1 1215 ? -14.191 -19.108  35.747  1.00 23.06  ? 1216 ARG A CG    1 
ATOM   9258  C  CD    . ARG A 1 1215 ? -14.480 -19.441  37.203  1.00 21.82  ? 1216 ARG A CD    1 
ATOM   9259  N  NE    . ARG A 1 1215 ? -13.224 -19.719  37.943  1.00 25.31  ? 1216 ARG A NE    1 
ATOM   9260  C  CZ    . ARG A 1 1215 ? -12.618 -18.917  38.796  1.00 26.04  ? 1216 ARG A CZ    1 
ATOM   9261  N  NH1   . ARG A 1 1215 ? -11.474 -19.244  39.396  1.00 27.70  ? 1216 ARG A NH1   1 
ATOM   9262  N  NH2   . ARG A 1 1215 ? -13.074 -17.709  39.107  1.00 26.71  ? 1216 ARG A NH2   1 
ATOM   9263  N  N     . ALA A 1 1216 ? -12.151 -15.545  33.148  1.00 19.74  ? 1217 ALA A N     1 
ATOM   9264  C  CA    . ALA A 1 1216 ? -11.771 -14.127  32.988  1.00 22.30  ? 1217 ALA A CA    1 
ATOM   9265  C  C     . ALA A 1 1216 ? -11.830 -13.694  31.554  1.00 20.92  ? 1217 ALA A C     1 
ATOM   9266  O  O     . ALA A 1 1216 ? -11.356 -12.602  31.203  1.00 24.10  ? 1217 ALA A O     1 
ATOM   9267  C  CB    . ALA A 1 1216 ? -10.380 -13.913  33.592  1.00 22.61  ? 1217 ALA A CB    1 
ATOM   9268  N  N     . GLY A 1 1217 ? -12.361 -14.531  30.683  1.00 19.39  ? 1218 GLY A N     1 
ATOM   9269  C  CA    . GLY A 1 1217 ? -12.507 -14.241  29.256  1.00 18.68  ? 1218 GLY A CA    1 
ATOM   9270  C  C     . GLY A 1 1217 ? -11.328 -14.699  28.429  1.00 20.35  ? 1218 GLY A C     1 
ATOM   9271  O  O     . GLY A 1 1217 ? -10.371 -15.356  28.858  1.00 19.13  ? 1218 GLY A O     1 
ATOM   9272  N  N     . THR A 1 1218 ? -11.373 -14.329  27.158  1.00 18.44  ? 1219 THR A N     1 
ATOM   9273  C  CA    . THR A 1 1218 ? -10.375 -14.800  26.149  1.00 19.08  ? 1219 THR A CA    1 
ATOM   9274  C  C     . THR A 1 1218 ? -9.036  -14.147  26.365  1.00 20.17  ? 1219 THR A C     1 
ATOM   9275  O  O     . THR A 1 1218 ? -9.008  -13.122  27.027  1.00 18.55  ? 1219 THR A O     1 
ATOM   9276  C  CB    . THR A 1 1218 ? -11.179 -14.274  24.926  1.00 23.09  ? 1219 THR A CB    1 
ATOM   9277  O  OG1   . THR A 1 1218 ? -11.832 -15.361  24.256  1.00 26.98  ? 1219 THR A OG1   1 
ATOM   9278  C  CG2   . THR A 1 1218 ? -10.592 -13.182  24.198  1.00 20.21  ? 1219 THR A CG2   1 
ATOM   9279  N  N     . SER A 1 1219 ? -7.945  -14.624  25.791  1.00 20.86  ? 1220 SER A N     1 
ATOM   9280  C  CA    . SER A 1 1219 ? -6.656  -13.969  25.866  1.00 23.62  ? 1220 SER A CA    1 
ATOM   9281  C  C     . SER A 1 1219 ? -6.787  -12.504  25.397  1.00 25.52  ? 1220 SER A C     1 
ATOM   9282  O  O     . SER A 1 1219 ? -6.264  -11.606  26.056  1.00 22.93  ? 1220 SER A O     1 
ATOM   9283  C  CB    . SER A 1 1219 ? -5.672  -14.628  24.889  1.00 26.58  ? 1220 SER A CB    1 
ATOM   9284  O  OG    . SER A 1 1219 ? -5.523  -16.008  25.200  1.00 30.57  ? 1220 SER A OG    1 
ATOM   9285  N  N     . GLU A 1 1220 ? -7.522  -12.353  24.296  1.00 27.03  ? 1221 GLU A N     1 
ATOM   9286  C  CA    . GLU A 1 1220 ? -7.672  -11.032  23.697  1.00 29.11  ? 1221 GLU A CA    1 
ATOM   9287  C  C     . GLU A 1 1220 ? -8.549  -10.107  24.505  1.00 27.04  ? 1221 GLU A C     1 
ATOM   9288  O  O     . GLU A 1 1220 ? -8.264  -8.888   24.629  1.00 22.49  ? 1221 GLU A O     1 
ATOM   9289  C  CB    . GLU A 1 1220 ? -7.915  -11.122  22.203  1.00 34.76  ? 1221 GLU A CB    1 
ATOM   9290  C  CG    . GLU A 1 1220 ? -9.103  -11.726  21.562  1.00 43.66  ? 1221 GLU A CG    1 
ATOM   9291  C  CD    . GLU A 1 1220 ? -9.008  -12.420  20.222  1.00 47.90  ? 1221 GLU A CD    1 
ATOM   9292  O  OE1   . GLU A 1 1220 ? -9.634  -13.501  20.062  1.00 48.65  ? 1221 GLU A OE1   1 
ATOM   9293  O  OE2   . GLU A 1 1220 ? -8.328  -11.972  19.265  1.00 51.57  ? 1221 GLU A OE2   1 
ATOM   9294  N  N     . GLN A 1 1221 ? -9.600  -10.604  25.152  1.00 23.68  ? 1222 GLN A N     1 
ATOM   9295  C  CA    . GLN A 1 1221 ? -10.469 -9.784   26.010  1.00 23.44  ? 1222 GLN A CA    1 
ATOM   9296  C  C     . GLN A 1 1221 ? -9.727  -9.347   27.277  1.00 24.08  ? 1222 GLN A C     1 
ATOM   9297  O  O     . GLN A 1 1221 ? -9.807  -8.223   27.782  1.00 20.70  ? 1222 GLN A O     1 
ATOM   9298  C  CB    . GLN A 1 1221 ? -11.712 -10.606  26.438  1.00 22.43  ? 1222 GLN A CB    1 
ATOM   9299  C  CG    . GLN A 1 1221 ? -12.665 -10.726  25.251  1.00 22.25  ? 1222 GLN A CG    1 
ATOM   9300  C  CD    . GLN A 1 1221 ? -13.697 -11.830  25.431  1.00 22.41  ? 1222 GLN A CD    1 
ATOM   9301  O  OE1   . GLN A 1 1221 ? -13.605 -12.647  26.340  1.00 20.50  ? 1222 GLN A OE1   1 
ATOM   9302  N  NE2   . GLN A 1 1221 ? -14.661 -11.853  24.506  1.00 18.55  ? 1222 GLN A NE2   1 
ATOM   9303  N  N     . GLN A 1 1222 ? -8.899  -10.299  27.759  1.00 22.50  ? 1223 GLN A N     1 
ATOM   9304  C  CA    . GLN A 1 1222 ? -8.105  -10.016  28.950  1.00 24.07  ? 1223 GLN A CA    1 
ATOM   9305  C  C     . GLN A 1 1222 ? -7.047  -8.939   28.655  1.00 25.02  ? 1223 GLN A C     1 
ATOM   9306  O  O     . GLN A 1 1222 ? -6.807  -8.077   29.498  1.00 23.72  ? 1223 GLN A O     1 
ATOM   9307  C  CB    . GLN A 1 1222 ? -7.404  -11.277  29.456  1.00 22.38  ? 1223 GLN A CB    1 
ATOM   9308  C  CG    . GLN A 1 1222 ? -8.417  -12.235  30.107  1.00 22.53  ? 1223 GLN A CG    1 
ATOM   9309  C  CD    . GLN A 1 1222 ? -7.711  -13.441  30.715  1.00 23.89  ? 1223 GLN A CD    1 
ATOM   9310  O  OE1   . GLN A 1 1222 ? -6.893  -13.257  31.618  1.00 24.65  ? 1223 GLN A OE1   1 
ATOM   9311  N  NE2   . GLN A 1 1222 ? -8.039  -14.649  30.283  1.00 21.49  ? 1223 GLN A NE2   1 
ATOM   9312  N  N     . GLY A 1 1223 ? -6.415  -9.025   27.492  1.00 26.03  ? 1224 GLY A N     1 
ATOM   9313  C  CA    . GLY A 1 1223 ? -5.387  -8.001   27.146  1.00 29.27  ? 1224 GLY A CA    1 
ATOM   9314  C  C     . GLY A 1 1223 ? -6.032  -6.642   26.869  1.00 31.89  ? 1224 GLY A C     1 
ATOM   9315  O  O     . GLY A 1 1223 ? -5.543  -5.602   27.354  1.00 30.70  ? 1224 GLY A O     1 
ATOM   9316  N  N     . ASP A 1 1224 ? -7.178  -6.590   26.221  1.00 31.94  ? 1225 ASP A N     1 
ATOM   9317  C  CA    . ASP A 1 1224 ? -7.965  -5.384   25.999  1.00 35.99  ? 1225 ASP A CA    1 
ATOM   9318  C  C     . ASP A 1 1224 ? -8.323  -4.738   27.331  1.00 37.15  ? 1225 ASP A C     1 
ATOM   9319  O  O     . ASP A 1 1224 ? -8.086  -3.545   27.587  1.00 35.46  ? 1225 ASP A O     1 
ATOM   9320  C  CB    . ASP A 1 1224 ? -9.198  -5.659   25.151  1.00 39.26  ? 1225 ASP A CB    1 
ATOM   9321  C  CG    . ASP A 1 1224 ? -10.583 -5.328   25.666  1.00 44.00  ? 1225 ASP A CG    1 
ATOM   9322  O  OD1   . ASP A 1 1224 ? -10.925 -4.123   25.610  1.00 42.23  ? 1225 ASP A OD1   1 
ATOM   9323  O  OD2   . ASP A 1 1224 ? -11.348 -6.248   26.146  1.00 46.25  ? 1225 ASP A OD2   1 
ATOM   9324  N  N     . LEU A 1 1225 ? -8.904  -5.537   28.230  1.00 36.87  ? 1226 LEU A N     1 
ATOM   9325  C  CA    . LEU A 1 1225 ? -9.265  -5.020   29.552  1.00 37.53  ? 1226 LEU A CA    1 
ATOM   9326  C  C     . LEU A 1 1225 ? -8.057  -4.379   30.254  1.00 39.69  ? 1226 LEU A C     1 
ATOM   9327  O  O     . LEU A 1 1225 ? -8.105  -3.291   30.852  1.00 35.63  ? 1226 LEU A O     1 
ATOM   9328  C  CB    . LEU A 1 1225 ? -9.819  -6.160   30.388  1.00 38.54  ? 1226 LEU A CB    1 
ATOM   9329  C  CG    . LEU A 1 1225 ? -10.174 -5.901   31.846  1.00 37.39  ? 1226 LEU A CG    1 
ATOM   9330  C  CD1   . LEU A 1 1225 ? -11.132 -4.719   31.933  1.00 35.85  ? 1226 LEU A CD1   1 
ATOM   9331  C  CD2   . LEU A 1 1225 ? -10.831 -7.147   32.452  1.00 37.40  ? 1226 LEU A CD2   1 
ATOM   9332  N  N     . SER A 1 1226 ? -6.940  -5.091   30.174  1.00 40.52  ? 1227 SER A N     1 
ATOM   9333  C  CA    . SER A 1 1226 ? -5.681  -4.635   30.740  1.00 46.10  ? 1227 SER A CA    1 
ATOM   9334  C  C     . SER A 1 1226 ? -5.223  -3.299   30.152  1.00 48.86  ? 1227 SER A C     1 
ATOM   9335  O  O     . SER A 1 1226 ? -4.839  -2.379   30.870  1.00 48.13  ? 1227 SER A O     1 
ATOM   9336  C  CB    . SER A 1 1226 ? -4.653  -5.735   30.499  1.00 46.02  ? 1227 SER A CB    1 
ATOM   9337  O  OG    . SER A 1 1226 ? -3.491  -5.508   31.243  1.00 45.53  ? 1227 SER A OG    1 
ATOM   9338  N  N     . LYS A 1 1227 ? -5.355  -3.156   28.841  1.00 52.79  ? 1228 LYS A N     1 
ATOM   9339  C  CA    . LYS A 1 1227 ? -5.007  -1.917   28.153  1.00 58.78  ? 1228 LYS A CA    1 
ATOM   9340  C  C     . LYS A 1 1227 ? -5.983  -0.820   28.566  1.00 60.61  ? 1228 LYS A C     1 
ATOM   9341  O  O     . LYS A 1 1227 ? -5.577  0.321    28.712  1.00 60.12  ? 1228 LYS A O     1 
ATOM   9342  C  CB    . LYS A 1 1227 ? -4.965  -2.162   26.652  1.00 60.57  ? 1228 LYS A CB    1 
ATOM   9343  C  CG    . LYS A 1 1227 ? -4.911  -0.953   25.746  1.00 63.67  ? 1228 LYS A CG    1 
ATOM   9344  C  CD    . LYS A 1 1227 ? -5.563  -1.192   24.392  1.00 65.04  ? 1228 LYS A CD    1 
ATOM   9345  C  CE    . LYS A 1 1227 ? -4.751  -0.572   23.265  1.00 66.26  ? 1228 LYS A CE    1 
ATOM   9346  N  NZ    . LYS A 1 1227 ? -3.911  -1.562   22.531  1.00 66.54  ? 1228 LYS A NZ    1 
ATOM   9347  N  N     . ARG A 1 1228 ? -7.226  -1.173   28.849  1.00 63.32  ? 1229 ARG A N     1 
ATOM   9348  C  CA    . ARG A 1 1228 ? -8.236  -0.223   29.259  1.00 67.01  ? 1229 ARG A CA    1 
ATOM   9349  C  C     . ARG A 1 1228 ? -8.138  0.207    30.714  1.00 70.84  ? 1229 ARG A C     1 
ATOM   9350  O  O     . ARG A 1 1228 ? -8.680  1.260    31.048  1.00 71.48  ? 1229 ARG A O     1 
ATOM   9351  C  CB    . ARG A 1 1228 ? -9.642  -0.802   29.030  1.00 65.05  ? 1229 ARG A CB    1 
ATOM   9352  C  CG    . ARG A 1 1228 ? -10.094 -0.797   27.586  1.00 61.99  ? 1229 ARG A CG    1 
ATOM   9353  C  CD    . ARG A 1 1228 ? -11.558 -1.140   27.450  1.00 59.83  ? 1229 ARG A CD    1 
ATOM   9354  N  NE    . ARG A 1 1228 ? -11.892 -2.550   27.435  1.00 56.90  ? 1229 ARG A NE    1 
ATOM   9355  C  CZ    . ARG A 1 1228 ? -12.486 -3.226   28.416  1.00 55.05  ? 1229 ARG A CZ    1 
ATOM   9356  N  NH1   . ARG A 1 1228 ? -12.819 -2.601   29.541  1.00 53.40  ? 1229 ARG A NH1   1 
ATOM   9357  N  NH2   . ARG A 1 1228 ? -12.752 -4.509   28.254  1.00 51.78  ? 1229 ARG A NH2   1 
ATOM   9358  N  N     . THR A 1 1229 ? -7.515  -0.562   31.583  1.00 75.85  ? 1230 THR A N     1 
ATOM   9359  C  CA    . THR A 1 1229 ? -7.467  -0.203   32.998  1.00 81.45  ? 1230 THR A CA    1 
ATOM   9360  C  C     . THR A 1 1229 ? -6.103  0.318    33.406  1.00 84.68  ? 1230 THR A C     1 
ATOM   9361  O  O     . THR A 1 1229 ? -5.982  1.265    34.176  1.00 85.05  ? 1230 THR A O     1 
ATOM   9362  C  CB    . THR A 1 1229 ? -7.862  -1.413   33.868  1.00 81.92  ? 1230 THR A CB    1 
ATOM   9363  O  OG1   . THR A 1 1229 ? -6.893  -2.455   33.707  1.00 82.36  ? 1230 THR A OG1   1 
ATOM   9364  C  CG2   . THR A 1 1229 ? -9.225  -1.946   33.454  1.00 82.20  ? 1230 THR A CG2   1 
ATOM   9365  N  N     . LYS A 1 1230 ? -5.055  -0.325   32.929  1.00 88.62  ? 1231 LYS A N     1 
ATOM   9366  C  CA    . LYS A 1 1230 ? -3.657  -0.025   33.143  1.00 92.08  ? 1231 LYS A CA    1 
ATOM   9367  C  C     . LYS A 1 1230 ? -3.260  0.402    34.546  1.00 93.92  ? 1231 LYS A C     1 
ATOM   9368  O  O     . LYS A 1 1230 ? -3.107  -0.414   35.460  1.00 94.61  ? 1231 LYS A O     1 
ATOM   9369  C  CB    . LYS A 1 1230 ? -3.177  1.022    32.117  1.00 92.35  ? 1231 LYS A CB    1 
ATOM   9370  C  CG    . LYS A 1 1230 ? -4.192  2.122    31.859  1.00 92.87  ? 1231 LYS A CG    1 
ATOM   9371  C  CD    . LYS A 1 1230 ? -3.555  3.378    31.291  1.00 92.99  ? 1231 LYS A CD    1 
ATOM   9372  C  CE    . LYS A 1 1230 ? -4.165  3.735    29.945  1.00 93.00  ? 1231 LYS A CE    1 
ATOM   9373  N  NZ    . LYS A 1 1230 ? -5.649  3.807    30.004  1.00 92.49  ? 1231 LYS A NZ    1 
ATOM   9374  N  N     . LYS A 1 1231 ? -3.064  1.697    34.748  1.00 95.63  ? 1232 LYS A N     1 
ATOM   9375  C  CA    . LYS A 1 1231 ? -2.670  2.311    35.999  1.00 97.17  ? 1232 LYS A CA    1 
ATOM   9376  C  C     . LYS A 1 1231 ? -1.144  2.409    36.105  1.00 97.60  ? 1232 LYS A C     1 
ATOM   9377  O  O     . LYS A 1 1231 ? -0.426  1.792    35.289  1.00 97.73  ? 1232 LYS A O     1 
ATOM   9378  C  CB    . LYS A 1 1231 ? -3.222  1.620    37.248  1.00 97.86  ? 1232 LYS A CB    1 
ATOM   9379  C  CG    . LYS A 1 1231 ? -4.738  1.536    37.312  1.00 98.65  ? 1232 LYS A CG    1 
ATOM   9380  C  CD    . LYS A 1 1231 ? -5.357  2.849    37.760  1.00 99.28  ? 1232 LYS A CD    1 
ATOM   9381  C  CE    . LYS A 1 1231 ? -5.145  3.093    39.247  1.00 99.79  ? 1232 LYS A CE    1 
ATOM   9382  N  NZ    . LYS A 1 1231 ? -4.018  4.033    39.515  1.00 99.77  ? 1232 LYS A NZ    1 
ATOM   9383  O  OXT   . LYS A 1 1231 ? -0.679  3.102    37.035  1.00 28.42  ? 1232 LYS A OXT   1 
ATOM   9384  N  N     . GLY B 1 1    ? 16.697  -53.517  44.775  1.00 48.50  ? 2    GLY B N     1 
ATOM   9385  C  CA    . GLY B 1 1    ? 16.472  -53.196  46.199  1.00 48.71  ? 2    GLY B CA    1 
ATOM   9386  C  C     . GLY B 1 1    ? 15.123  -52.515  46.418  1.00 49.04  ? 2    GLY B C     1 
ATOM   9387  O  O     . GLY B 1 1    ? 14.235  -52.625  45.581  1.00 45.95  ? 2    GLY B O     1 
ATOM   9388  N  N     . LYS B 1 2    ? 14.985  -51.923  47.588  1.00 50.46  ? 3    LYS B N     1 
ATOM   9389  C  CA    . LYS B 1 2    ? 13.791  -51.210  48.041  1.00 52.10  ? 3    LYS B CA    1 
ATOM   9390  C  C     . LYS B 1 2    ? 13.993  -49.729  47.734  1.00 51.80  ? 3    LYS B C     1 
ATOM   9391  O  O     . LYS B 1 2    ? 15.149  -49.315  47.564  1.00 52.56  ? 3    LYS B O     1 
ATOM   9392  C  CB    . LYS B 1 2    ? 13.594  -51.378  49.549  1.00 53.13  ? 3    LYS B CB    1 
ATOM   9393  C  CG    . LYS B 1 2    ? 13.420  -52.783  50.079  1.00 56.00  ? 3    LYS B CG    1 
ATOM   9394  C  CD    . LYS B 1 2    ? 14.231  -53.102  51.318  1.00 57.59  ? 3    LYS B CD    1 
ATOM   9395  C  CE    . LYS B 1 2    ? 13.745  -52.355  52.552  1.00 59.33  ? 3    LYS B CE    1 
ATOM   9396  N  NZ    . LYS B 1 2    ? 14.696  -52.433  53.702  1.00 58.92  ? 3    LYS B NZ    1 
ATOM   9397  N  N     . LYS B 1 3    ? 12.957  -48.918  47.662  1.00 50.15  ? 4    LYS B N     1 
ATOM   9398  C  CA    . LYS B 1 3    ? 13.081  -47.494  47.354  1.00 47.16  ? 4    LYS B CA    1 
ATOM   9399  C  C     . LYS B 1 3    ? 11.899  -46.680  47.880  1.00 43.42  ? 4    LYS B C     1 
ATOM   9400  O  O     . LYS B 1 3    ? 10.764  -47.078  47.640  1.00 36.79  ? 4    LYS B O     1 
ATOM   9401  C  CB    . LYS B 1 3    ? 13.163  -47.398  45.832  1.00 50.53  ? 4    LYS B CB    1 
ATOM   9402  C  CG    . LYS B 1 3    ? 12.836  -46.071  45.187  1.00 52.83  ? 4    LYS B CG    1 
ATOM   9403  C  CD    . LYS B 1 3    ? 12.833  -46.235  43.673  1.00 55.39  ? 4    LYS B CD    1 
ATOM   9404  C  CE    . LYS B 1 3    ? 11.893  -45.237  43.006  1.00 55.94  ? 4    LYS B CE    1 
ATOM   9405  N  NZ    . LYS B 1 3    ? 11.656  -45.767  41.617  1.00 57.98  ? 4    LYS B NZ    1 
ATOM   9406  N  N     . MET B 1 4    ? 12.160  -45.536  48.506  1.00 39.87  ? 5    MET B N     1 
ATOM   9407  C  CA    . MET B 1 4    ? 11.044  -44.725  48.992  1.00 40.80  ? 5    MET B CA    1 
ATOM   9408  C  C     . MET B 1 4    ? 10.423  -43.833  47.923  1.00 38.76  ? 5    MET B C     1 
ATOM   9409  O  O     . MET B 1 4    ? 11.147  -43.276  47.114  1.00 36.66  ? 5    MET B O     1 
ATOM   9410  C  CB    . MET B 1 4    ? 11.422  -43.758  50.112  1.00 43.98  ? 5    MET B CB    1 
ATOM   9411  C  CG    . MET B 1 4    ? 11.972  -44.478  51.327  1.00 47.68  ? 5    MET B CG    1 
ATOM   9412  S  SD    . MET B 1 4    ? 10.728  -45.360  52.271  1.00 52.12  ? 5    MET B SD    1 
ATOM   9413  C  CE    . MET B 1 4    ? 11.345  -47.031  52.118  1.00 51.12  ? 5    MET B CE    1 
ATOM   9414  N  N     . MET B 1 5    ? 9.105   -43.645  48.002  1.00 34.25  ? 6    MET B N     1 
ATOM   9415  C  CA    . MET B 1 5    ? 8.465   -42.748  47.031  1.00 32.66  ? 6    MET B CA    1 
ATOM   9416  C  C     . MET B 1 5    ? 7.150   -42.235  47.624  1.00 30.37  ? 6    MET B C     1 
ATOM   9417  O  O     . MET B 1 5    ? 6.600   -42.983  48.420  1.00 25.54  ? 6    MET B O     1 
ATOM   9418  C  CB    . MET B 1 5    ? 8.286   -43.411  45.698  1.00 33.86  ? 6    MET B CB    1 
ATOM   9419  C  CG    . MET B 1 5    ? 7.271   -44.492  45.454  1.00 37.66  ? 6    MET B CG    1 
ATOM   9420  S  SD    . MET B 1 5    ? 7.120   -44.771  43.664  1.00 41.90  ? 6    MET B SD    1 
ATOM   9421  C  CE    . MET B 1 5    ? 5.693   -45.824  43.540  1.00 41.35  ? 6    MET B CE    1 
ATOM   9422  N  N     . THR B 1 6    ? 6.778   -40.984  47.326  1.00 28.65  ? 7    THR B N     1 
ATOM   9423  C  CA    . THR B 1 6    ? 5.477   -40.527  47.811  1.00 27.76  ? 7    THR B CA    1 
ATOM   9424  C  C     . THR B 1 6    ? 4.485   -40.702  46.635  1.00 25.76  ? 7    THR B C     1 
ATOM   9425  O  O     . THR B 1 6    ? 4.795   -40.240  45.559  1.00 25.19  ? 7    THR B O     1 
ATOM   9426  C  CB    . THR B 1 6    ? 5.454   -39.120  48.413  1.00 28.48  ? 7    THR B CB    1 
ATOM   9427  O  OG1   . THR B 1 6    ? 5.910   -38.200  47.433  1.00 28.45  ? 7    THR B OG1   1 
ATOM   9428  C  CG2   . THR B 1 6    ? 6.375   -38.996  49.618  1.00 30.22  ? 7    THR B CG2   1 
ATOM   9429  N  N     . THR B 1 7    ? 3.444   -41.534  46.803  1.00 24.64  ? 8    THR B N     1 
ATOM   9430  C  CA    . THR B 1 7    ? 2.602   -41.809  45.638  1.00 23.50  ? 8    THR B CA    1 
ATOM   9431  C  C     . THR B 1 7    ? 1.238   -42.245  46.134  1.00 19.20  ? 8    THR B C     1 
ATOM   9432  O  O     . THR B 1 7    ? 1.067   -42.489  47.331  1.00 15.91  ? 8    THR B O     1 
ATOM   9433  C  CB    . THR B 1 7    ? 3.033   -42.939  44.673  1.00 28.38  ? 8    THR B CB    1 
ATOM   9434  O  OG1   . THR B 1 7    ? 3.251   -44.186  45.356  1.00 28.44  ? 8    THR B OG1   1 
ATOM   9435  C  CG2   . THR B 1 7    ? 4.262   -42.552  43.897  1.00 33.09  ? 8    THR B CG2   1 
ATOM   9436  N  N     . ASP B 1 8    ? 0.288   -42.349  45.202  1.00 18.65  ? 9    ASP B N     1 
ATOM   9437  C  CA    . ASP B 1 8    ? -1.030  -42.847  45.641  1.00 18.16  ? 9    ASP B CA    1 
ATOM   9438  C  C     . ASP B 1 8    ? -1.165  -44.348  45.443  1.00 17.64  ? 9    ASP B C     1 
ATOM   9439  O  O     . ASP B 1 8    ? -0.336  -45.081  44.877  1.00 17.31  ? 9    ASP B O     1 
ATOM   9440  C  CB    . ASP B 1 8    ? -2.185  -42.074  44.958  1.00 19.32  ? 9    ASP B CB    1 
ATOM   9441  C  CG    . ASP B 1 8    ? -2.194  -42.159  43.453  1.00 21.70  ? 9    ASP B CG    1 
ATOM   9442  O  OD1   . ASP B 1 8    ? -2.828  -41.234  42.892  1.00 24.33  ? 9    ASP B OD1   1 
ATOM   9443  O  OD2   . ASP B 1 8    ? -1.614  -43.099  42.841  1.00 21.10  ? 9    ASP B OD2   1 
ATOM   9444  N  N     . GLY B 1 9    ? -2.285  -44.907  45.914  1.00 14.67  ? 10   GLY B N     1 
ATOM   9445  C  CA    . GLY B 1 9    ? -2.526  -46.342  45.754  1.00 13.51  ? 10   GLY B CA    1 
ATOM   9446  C  C     . GLY B 1 9    ? -2.563  -46.798  44.311  1.00 13.64  ? 10   GLY B C     1 
ATOM   9447  O  O     . GLY B 1 9    ? -2.065  -47.906  43.960  1.00 15.14  ? 10   GLY B O     1 
ATOM   9448  N  N     . ASN B 1 10   ? -3.178  -46.039  43.435  1.00 12.24  ? 11   ASN B N     1 
ATOM   9449  C  CA    . ASN B 1 10   ? -3.234  -46.344  42.022  1.00 13.49  ? 11   ASN B CA    1 
ATOM   9450  C  C     . ASN B 1 10   ? -1.823  -46.503  41.429  1.00 14.32  ? 11   ASN B C     1 
ATOM   9451  O  O     . ASN B 1 10   ? -1.545  -47.505  40.760  1.00 12.86  ? 11   ASN B O     1 
ATOM   9452  C  CB    . ASN B 1 10   ? -3.919  -45.210  41.226  1.00 14.00  ? 11   ASN B CB    1 
ATOM   9453  C  CG    . ASN B 1 10   ? -5.413  -45.427  41.162  1.00 13.66  ? 11   ASN B CG    1 
ATOM   9454  O  OD1   . ASN B 1 10   ? -6.166  -44.440  41.007  1.00 15.21  ? 11   ASN B OD1   1 
ATOM   9455  N  ND2   . ASN B 1 10   ? -5.901  -46.638  41.272  1.00 9.66   ? 11   ASN B ND2   1 
ATOM   9456  N  N     . THR B 1 11   ? -0.966  -45.532  41.761  1.00 15.10  ? 12   THR B N     1 
ATOM   9457  C  CA    . THR B 1 11   ? 0.373   -45.705  41.138  1.00 15.36  ? 12   THR B CA    1 
ATOM   9458  C  C     . THR B 1 11   ? 1.232   -46.706  41.869  1.00 13.40  ? 12   THR B C     1 
ATOM   9459  O  O     . THR B 1 11   ? 1.975   -47.325  41.144  1.00 12.26  ? 12   THR B O     1 
ATOM   9460  C  CB    . THR B 1 11   ? 1.068   -44.445  40.679  1.00 20.18  ? 12   THR B CB    1 
ATOM   9461  O  OG1   . THR B 1 11   ? 2.494   -44.373  40.894  1.00 23.32  ? 12   THR B OG1   1 
ATOM   9462  C  CG2   . THR B 1 11   ? 0.301   -43.173  40.824  1.00 14.09  ? 12   THR B CG2   1 
ATOM   9463  N  N     . ALA B 1 12   ? 1.051   -46.946  43.173  1.00 15.07  ? 13   ALA B N     1 
ATOM   9464  C  CA    . ALA B 1 12   ? 1.776   -48.012  43.823  1.00 15.46  ? 13   ALA B CA    1 
ATOM   9465  C  C     . ALA B 1 12   ? 1.402   -49.348  43.199  1.00 16.01  ? 13   ALA B C     1 
ATOM   9466  O  O     . ALA B 1 12   ? 2.269   -50.237  43.047  1.00 17.04  ? 13   ALA B O     1 
ATOM   9467  C  CB    . ALA B 1 12   ? 1.432   -48.013  45.317  1.00 17.85  ? 13   ALA B CB    1 
ATOM   9468  N  N     . THR B 1 13   ? 0.121   -49.486  42.813  1.00 14.38  ? 14   THR B N     1 
ATOM   9469  C  CA    . THR B 1 13   ? -0.229  -50.800  42.190  1.00 16.59  ? 14   THR B CA    1 
ATOM   9470  C  C     . THR B 1 13   ? 0.161   -50.834  40.727  1.00 14.41  ? 14   THR B C     1 
ATOM   9471  O  O     . THR B 1 13   ? 0.594   -51.919  40.309  1.00 16.15  ? 14   THR B O     1 
ATOM   9472  C  CB    . THR B 1 13   ? -1.613  -51.369  42.518  1.00 18.52  ? 14   THR B CB    1 
ATOM   9473  O  OG1   . THR B 1 13   ? -2.409  -51.942  41.479  1.00 18.73  ? 14   THR B OG1   1 
ATOM   9474  C  CG2   . THR B 1 13   ? -2.376  -50.597  43.516  1.00 8.38   ? 14   THR B CG2   1 
ATOM   9475  N  N     . ALA B 1 14   ? 0.025   -49.708  40.026  1.00 14.18  ? 15   ALA B N     1 
ATOM   9476  C  CA    . ALA B 1 14   ? 0.439   -49.739  38.606  1.00 12.44  ? 15   ALA B CA    1 
ATOM   9477  C  C     . ALA B 1 14   ? 1.926   -50.080  38.456  1.00 15.13  ? 15   ALA B C     1 
ATOM   9478  O  O     . ALA B 1 14   ? 2.328   -50.799  37.542  1.00 15.14  ? 15   ALA B O     1 
ATOM   9479  C  CB    . ALA B 1 14   ? 0.182   -48.369  37.971  1.00 12.45  ? 15   ALA B CB    1 
ATOM   9480  N  N     . HIS B 1 15   ? 2.723   -49.551  39.356  1.00 15.30  ? 16   HIS B N     1 
ATOM   9481  C  CA    . HIS B 1 15   ? 4.164   -49.867  39.433  1.00 15.28  ? 16   HIS B CA    1 
ATOM   9482  C  C     . HIS B 1 15   ? 4.423   -51.378  39.335  1.00 17.21  ? 16   HIS B C     1 
ATOM   9483  O  O     . HIS B 1 15   ? 5.206   -51.877  38.525  1.00 14.40  ? 16   HIS B O     1 
ATOM   9484  C  CB    . HIS B 1 15   ? 4.667   -49.292  40.763  1.00 13.05  ? 16   HIS B CB    1 
ATOM   9485  C  CG    . HIS B 1 15   ? 6.133   -49.508  40.971  1.00 16.14  ? 16   HIS B CG    1 
ATOM   9486  N  ND1   . HIS B 1 15   ? 6.590   -50.575  41.755  1.00 19.21  ? 16   HIS B ND1   1 
ATOM   9487  C  CD2   . HIS B 1 15   ? 7.203   -48.883  40.458  1.00 13.71  ? 16   HIS B CD2   1 
ATOM   9488  C  CE1   . HIS B 1 15   ? 7.936   -50.545  41.713  1.00 18.98  ? 16   HIS B CE1   1 
ATOM   9489  N  NE2   . HIS B 1 15   ? 8.313   -49.505  40.958  1.00 18.98  ? 16   HIS B NE2   1 
ATOM   9490  N  N     . VAL B 1 16   ? 3.699   -52.138  40.154  1.00 13.86  ? 17   VAL B N     1 
ATOM   9491  C  CA    . VAL B 1 16   ? 3.822   -53.593  40.107  1.00 14.73  ? 17   VAL B CA    1 
ATOM   9492  C  C     . VAL B 1 16   ? 3.155   -54.241  38.909  1.00 15.06  ? 17   VAL B C     1 
ATOM   9493  O  O     . VAL B 1 16   ? 3.730   -55.075  38.260  1.00 12.12  ? 17   VAL B O     1 
ATOM   9494  C  CB    . VAL B 1 16   ? 3.128   -54.149  41.403  1.00 13.85  ? 17   VAL B CB    1 
ATOM   9495  C  CG1   . VAL B 1 16   ? 3.211   -55.660  41.468  1.00 15.39  ? 17   VAL B CG1   1 
ATOM   9496  C  CG2   . VAL B 1 16   ? 3.898   -53.578  42.614  1.00 14.24  ? 17   VAL B CG2   1 
ATOM   9497  N  N     . ALA B 1 17   ? 1.920   -53.835  38.618  1.00 12.74  ? 18   ALA B N     1 
ATOM   9498  C  CA    . ALA B 1 17   ? 1.213   -54.464  37.468  1.00 11.89  ? 18   ALA B CA    1 
ATOM   9499  C  C     . ALA B 1 17   ? 1.947   -54.282  36.154  1.00 14.52  ? 18   ALA B C     1 
ATOM   9500  O  O     . ALA B 1 17   ? 2.044   -55.178  35.289  1.00 12.06  ? 18   ALA B O     1 
ATOM   9501  C  CB    . ALA B 1 17   ? -0.196  -53.851  37.417  1.00 11.20  ? 18   ALA B CB    1 
ATOM   9502  N  N     . TYR B 1 18   ? 2.623   -53.125  36.010  1.00 12.36  ? 19   TYR B N     1 
ATOM   9503  C  CA    . TYR B 1 18   ? 3.381   -52.967  34.707  1.00 12.85  ? 19   TYR B CA    1 
ATOM   9504  C  C     . TYR B 1 18   ? 4.499   -54.000  34.655  1.00 10.34  ? 19   TYR B C     1 
ATOM   9505  O  O     . TYR B 1 18   ? 4.863   -54.560  33.600  1.00 13.33  ? 19   TYR B O     1 
ATOM   9506  C  CB    . TYR B 1 18   ? 4.039   -51.577  34.649  1.00 10.13  ? 19   TYR B CB    1 
ATOM   9507  C  CG    . TYR B 1 18   ? 4.628   -51.282  33.270  1.00 15.22  ? 19   TYR B CG    1 
ATOM   9508  C  CD1   . TYR B 1 18   ? 3.881   -50.605  32.324  1.00 15.01  ? 19   TYR B CD1   1 
ATOM   9509  C  CD2   . TYR B 1 18   ? 5.929   -51.633  32.931  1.00 15.64  ? 19   TYR B CD2   1 
ATOM   9510  C  CE1   . TYR B 1 18   ? 4.421   -50.303  31.071  1.00 15.75  ? 19   TYR B CE1   1 
ATOM   9511  C  CE2   . TYR B 1 18   ? 6.463   -51.365  31.671  1.00 16.29  ? 19   TYR B CE2   1 
ATOM   9512  C  CZ    . TYR B 1 18   ? 5.687   -50.717  30.735  1.00 15.99  ? 19   TYR B CZ    1 
ATOM   9513  O  OH    . TYR B 1 18   ? 6.139   -50.453  29.461  1.00 17.04  ? 19   TYR B OH    1 
ATOM   9514  N  N     . ALA B 1 19   ? 5.178   -54.132  35.804  1.00 12.03  ? 20   ALA B N     1 
ATOM   9515  C  CA    . ALA B 1 19   ? 6.349   -55.039  35.832  1.00 12.92  ? 20   ALA B CA    1 
ATOM   9516  C  C     . ALA B 1 19   ? 6.000   -56.481  35.508  1.00 13.10  ? 20   ALA B C     1 
ATOM   9517  O  O     . ALA B 1 19   ? 6.731   -57.201  34.854  1.00 13.12  ? 20   ALA B O     1 
ATOM   9518  C  CB    . ALA B 1 19   ? 7.009   -55.023  37.205  1.00 12.99  ? 20   ALA B CB    1 
ATOM   9519  N  N     . MET B 1 20   ? 4.852   -56.878  36.060  1.00 13.82  ? 21   MET B N     1 
ATOM   9520  C  CA    . MET B 1 20   ? 4.470   -58.282  36.008  1.00 12.53  ? 21   MET B CA    1 
ATOM   9521  C  C     . MET B 1 20   ? 3.600   -58.654  34.819  1.00 13.82  ? 21   MET B C     1 
ATOM   9522  O  O     . MET B 1 20   ? 3.244   -59.867  34.746  1.00 14.44  ? 21   MET B O     1 
ATOM   9523  C  CB    . MET B 1 20   ? 3.715   -58.634  37.345  1.00 11.66  ? 21   MET B CB    1 
ATOM   9524  C  CG    . MET B 1 20   ? 4.466   -58.247  38.623  1.00 14.37  ? 21   MET B CG    1 
ATOM   9525  S  SD    . MET B 1 20   ? 6.026   -59.165  38.766  1.00 17.93  ? 21   MET B SD    1 
ATOM   9526  C  CE    . MET B 1 20   ? 5.410   -60.844  38.733  1.00 16.57  ? 21   MET B CE    1 
ATOM   9527  N  N     . SER B 1 21   ? 3.323   -57.739  33.899  1.00 13.22  ? 22   SER B N     1 
ATOM   9528  C  CA    . SER B 1 21   ? 2.460   -58.167  32.782  1.00 14.79  ? 22   SER B CA    1 
ATOM   9529  C  C     . SER B 1 21   ? 3.057   -57.962  31.401  1.00 13.39  ? 22   SER B C     1 
ATOM   9530  O  O     . SER B 1 21   ? 3.933   -57.069  31.283  1.00 16.84  ? 22   SER B O     1 
ATOM   9531  C  CB    . SER B 1 21   ? 1.194   -57.272  32.850  1.00 12.30  ? 22   SER B CB    1 
ATOM   9532  O  OG    . SER B 1 21   ? 0.620   -57.322  34.163  1.00 13.83  ? 22   SER B OG    1 
ATOM   9533  N  N     . GLU B 1 22   ? 2.584   -58.679  30.404  1.00 14.01  ? 23   GLU B N     1 
ATOM   9534  C  CA    . GLU B 1 22   ? 3.071   -58.462  29.029  1.00 14.27  ? 23   GLU B CA    1 
ATOM   9535  C  C     . GLU B 1 22   ? 1.993   -57.745  28.250  1.00 14.78  ? 23   GLU B C     1 
ATOM   9536  O  O     . GLU B 1 22   ? 2.318   -57.073  27.262  1.00 14.56  ? 23   GLU B O     1 
ATOM   9537  C  CB    . GLU B 1 22   ? 3.321   -59.848  28.322  1.00 13.65  ? 23   GLU B CB    1 
ATOM   9538  C  CG    . GLU B 1 22   ? 4.357   -60.573  29.161  1.00 14.59  ? 23   GLU B CG    1 
ATOM   9539  C  CD    . GLU B 1 22   ? 4.563   -61.996  28.679  1.00 20.45  ? 23   GLU B CD    1 
ATOM   9540  O  OE1   . GLU B 1 22   ? 5.695   -62.260  28.231  1.00 19.80  ? 23   GLU B OE1   1 
ATOM   9541  O  OE2   . GLU B 1 22   ? 3.621   -62.810  28.753  1.00 17.91  ? 23   GLU B OE2   1 
ATOM   9542  N  N     . VAL B 1 23   ? 0.716   -58.002  28.618  1.00 12.64  ? 24   VAL B N     1 
ATOM   9543  C  CA    . VAL B 1 23   ? -0.390  -57.335  27.874  1.00 14.54  ? 24   VAL B CA    1 
ATOM   9544  C  C     . VAL B 1 23   ? -1.388  -56.693  28.820  1.00 14.91  ? 24   VAL B C     1 
ATOM   9545  O  O     . VAL B 1 23   ? -1.642  -57.204  29.936  1.00 13.56  ? 24   VAL B O     1 
ATOM   9546  C  CB    . VAL B 1 23   ? -1.132  -58.385  27.008  1.00 15.02  ? 24   VAL B CB    1 
ATOM   9547  C  CG1   . VAL B 1 23   ? -2.421  -57.835  26.370  1.00 15.34  ? 24   VAL B CG1   1 
ATOM   9548  C  CG2   . VAL B 1 23   ? -0.193  -58.883  25.870  1.00 15.06  ? 24   VAL B CG2   1 
ATOM   9549  N  N     . ALA B 1 24   ? -1.988  -55.563  28.449  1.00 14.03  ? 25   ALA B N     1 
ATOM   9550  C  CA    . ALA B 1 24   ? -3.063  -54.980  29.281  1.00 15.80  ? 25   ALA B CA    1 
ATOM   9551  C  C     . ALA B 1 24   ? -4.159  -54.494  28.310  1.00 17.26  ? 25   ALA B C     1 
ATOM   9552  O  O     . ALA B 1 24   ? -3.830  -53.929  27.268  1.00 15.19  ? 25   ALA B O     1 
ATOM   9553  C  CB    . ALA B 1 24   ? -2.643  -53.794  30.146  1.00 17.63  ? 25   ALA B CB    1 
ATOM   9554  N  N     . ALA B 1 25   ? -5.421  -54.816  28.573  1.00 15.97  ? 26   ALA B N     1 
ATOM   9555  C  CA    . ALA B 1 25   ? -6.532  -54.286  27.738  1.00 13.54  ? 26   ALA B CA    1 
ATOM   9556  C  C     . ALA B 1 25   ? -7.307  -53.389  28.688  1.00 18.24  ? 26   ALA B C     1 
ATOM   9557  O  O     . ALA B 1 25   ? -7.595  -53.791  29.820  1.00 19.68  ? 26   ALA B O     1 
ATOM   9558  C  CB    . ALA B 1 25   ? -7.381  -55.289  27.039  1.00 14.00  ? 26   ALA B CB    1 
ATOM   9559  N  N     . ILE B 1 26   ? -7.523  -52.144  28.346  1.00 16.45  ? 27   ILE B N     1 
ATOM   9560  C  CA    . ILE B 1 26   ? -7.984  -51.044  29.184  1.00 19.83  ? 27   ILE B CA    1 
ATOM   9561  C  C     . ILE B 1 26   ? -9.236  -50.335  28.726  1.00 17.74  ? 27   ILE B C     1 
ATOM   9562  O  O     . ILE B 1 26   ? -9.578  -50.387  27.528  1.00 18.06  ? 27   ILE B O     1 
ATOM   9563  C  CB    . ILE B 1 26   ? -6.703  -50.155  29.026  1.00 23.38  ? 27   ILE B CB    1 
ATOM   9564  C  CG1   . ILE B 1 26   ? -5.946  -50.082  30.338  1.00 27.05  ? 27   ILE B CG1   1 
ATOM   9565  C  CG2   . ILE B 1 26   ? -6.605  -48.856  28.315  1.00 26.46  ? 27   ILE B CG2   1 
ATOM   9566  C  CD1   . ILE B 1 26   ? -5.522  -51.450  30.777  1.00 27.63  ? 27   ILE B CD1   1 
ATOM   9567  N  N     . TYR B 1 27   ? -9.855  -49.612  29.671  1.00 16.31  ? 28   TYR B N     1 
ATOM   9568  C  CA    . TYR B 1 27   ? -11.058 -48.816  29.431  1.00 14.01  ? 28   TYR B CA    1 
ATOM   9569  C  C     . TYR B 1 27   ? -11.178 -47.858  30.614  1.00 13.90  ? 28   TYR B C     1 
ATOM   9570  O  O     . TYR B 1 27   ? -11.043 -48.269  31.789  1.00 13.76  ? 28   TYR B O     1 
ATOM   9571  C  CB    . TYR B 1 27   ? -12.307 -49.723  29.347  1.00 11.67  ? 28   TYR B CB    1 
ATOM   9572  C  CG    . TYR B 1 27   ? -13.413 -48.908  28.637  1.00 13.62  ? 28   TYR B CG    1 
ATOM   9573  C  CD1   . TYR B 1 27   ? -13.330 -48.673  27.269  1.00 12.89  ? 28   TYR B CD1   1 
ATOM   9574  C  CD2   . TYR B 1 27   ? -14.430 -48.308  29.374  1.00 13.09  ? 28   TYR B CD2   1 
ATOM   9575  C  CE1   . TYR B 1 27   ? -14.258 -47.857  26.614  1.00 10.34  ? 28   TYR B CE1   1 
ATOM   9576  C  CE2   . TYR B 1 27   ? -15.379 -47.542  28.718  1.00 12.82  ? 28   TYR B CE2   1 
ATOM   9577  C  CZ    . TYR B 1 27   ? -15.318 -47.361  27.354  1.00 13.87  ? 28   TYR B CZ    1 
ATOM   9578  O  OH    . TYR B 1 27   ? -16.271 -46.574  26.711  1.00 14.52  ? 28   TYR B OH    1 
ATOM   9579  N  N     . PRO B 1 28   ? -11.465 -46.596  30.360  1.00 15.89  ? 29   PRO B N     1 
ATOM   9580  C  CA    . PRO B 1 28   ? -11.451 -45.602  31.394  1.00 16.13  ? 29   PRO B CA    1 
ATOM   9581  C  C     . PRO B 1 28   ? -12.659 -45.712  32.301  1.00 14.31  ? 29   PRO B C     1 
ATOM   9582  O  O     . PRO B 1 28   ? -13.767 -45.807  31.813  1.00 14.51  ? 29   PRO B O     1 
ATOM   9583  C  CB    . PRO B 1 28   ? -11.460 -44.272  30.627  1.00 16.79  ? 29   PRO B CB    1 
ATOM   9584  C  CG    . PRO B 1 28   ? -12.053 -44.609  29.313  1.00 17.24  ? 29   PRO B CG    1 
ATOM   9585  C  CD    . PRO B 1 28   ? -11.591 -45.996  28.995  1.00 16.24  ? 29   PRO B CD    1 
ATOM   9586  N  N     . ILE B 1 29   ? -12.418 -45.650  33.598  1.00 14.34  ? 30   ILE B N     1 
ATOM   9587  C  CA    . ILE B 1 29   ? -13.509 -45.513  34.573  1.00 11.41  ? 30   ILE B CA    1 
ATOM   9588  C  C     . ILE B 1 29   ? -12.954 -45.034  35.896  1.00 14.58  ? 30   ILE B C     1 
ATOM   9589  O  O     . ILE B 1 29   ? -12.015 -45.575  36.424  1.00 13.18  ? 30   ILE B O     1 
ATOM   9590  C  CB    . ILE B 1 29   ? -14.359 -46.807  34.770  1.00 12.10  ? 30   ILE B CB    1 
ATOM   9591  C  CG1   . ILE B 1 29   ? -15.492 -46.384  35.748  1.00 11.57  ? 30   ILE B CG1   1 
ATOM   9592  C  CG2   . ILE B 1 29   ? -13.558 -48.013  35.205  1.00 12.30  ? 30   ILE B CG2   1 
ATOM   9593  C  CD1   . ILE B 1 29   ? -16.613 -47.433  35.842  1.00 11.40  ? 30   ILE B CD1   1 
ATOM   9594  N  N     . THR B 1 30   ? -13.465 -43.889  36.414  1.00 14.91  ? 31   THR B N     1 
ATOM   9595  C  CA    . THR B 1 30   ? -13.028 -43.359  37.701  1.00 16.12  ? 31   THR B CA    1 
ATOM   9596  C  C     . THR B 1 30   ? -13.291 -44.276  38.862  1.00 14.73  ? 31   THR B C     1 
ATOM   9597  O  O     . THR B 1 30   ? -14.363 -44.803  38.743  1.00 15.04  ? 31   THR B O     1 
ATOM   9598  C  CB    . THR B 1 30   ? -13.735 -42.016  37.942  1.00 16.80  ? 31   THR B CB    1 
ATOM   9599  O  OG1   . THR B 1 30   ? -13.479 -41.026  36.934  1.00 19.54  ? 31   THR B OG1   1 
ATOM   9600  C  CG2   . THR B 1 30   ? -13.321 -41.362  39.290  1.00 17.19  ? 31   THR B CG2   1 
ATOM   9601  N  N     . PRO B 1 31   ? -12.491 -44.529  39.861  1.00 13.85  ? 32   PRO B N     1 
ATOM   9602  C  CA    . PRO B 1 31   ? -11.220 -43.931  40.139  1.00 13.46  ? 32   PRO B CA    1 
ATOM   9603  C  C     . PRO B 1 31   ? -10.029 -44.808  39.699  1.00 14.49  ? 32   PRO B C     1 
ATOM   9604  O  O     . PRO B 1 31   ? -8.946  -44.667  40.292  1.00 15.41  ? 32   PRO B O     1 
ATOM   9605  C  CB    . PRO B 1 31   ? -11.302 -43.687  41.663  1.00 13.51  ? 32   PRO B CB    1 
ATOM   9606  C  CG    . PRO B 1 31   ? -12.038 -44.886  42.207  1.00 10.88  ? 32   PRO B CG    1 
ATOM   9607  C  CD    . PRO B 1 31   ? -12.944 -45.280  41.041  1.00 13.64  ? 32   PRO B CD    1 
ATOM   9608  N  N     . SER B 1 32   ? -10.268 -45.727  38.764  1.00 12.15  ? 33   SER B N     1 
ATOM   9609  C  CA    . SER B 1 32   ? -9.172  -46.610  38.311  1.00 12.29  ? 33   SER B CA    1 
ATOM   9610  C  C     . SER B 1 32   ? -8.377  -46.111  37.095  1.00 14.94  ? 33   SER B C     1 
ATOM   9611  O  O     . SER B 1 32   ? -7.279  -46.664  36.799  1.00 12.30  ? 33   SER B O     1 
ATOM   9612  C  CB    . SER B 1 32   ? -9.696  -48.002  37.954  1.00 16.04  ? 33   SER B CB    1 
ATOM   9613  O  OG    . SER B 1 32   ? -10.477 -48.055  36.758  1.00 14.68  ? 33   SER B OG    1 
ATOM   9614  N  N     . SER B 1 33   ? -8.807  -45.051  36.418  1.00 12.26  ? 34   SER B N     1 
ATOM   9615  C  CA    . SER B 1 33   ? -8.195  -44.599  35.195  1.00 14.10  ? 34   SER B CA    1 
ATOM   9616  C  C     . SER B 1 33   ? -6.707  -44.279  35.271  1.00 15.09  ? 34   SER B C     1 
ATOM   9617  O  O     . SER B 1 33   ? -5.998  -44.478  34.302  1.00 14.21  ? 34   SER B O     1 
ATOM   9618  C  CB    . SER B 1 33   ? -8.852  -43.278  34.680  1.00 15.05  ? 34   SER B CB    1 
ATOM   9619  O  OG    . SER B 1 33   ? -10.169 -43.629  34.385  1.00 16.49  ? 34   SER B OG    1 
ATOM   9620  N  N     . THR B 1 34   ? -6.253  -43.818  36.407  1.00 14.29  ? 35   THR B N     1 
ATOM   9621  C  CA    . THR B 1 34   ? -4.842  -43.458  36.586  1.00 13.95  ? 35   THR B CA    1 
ATOM   9622  C  C     . THR B 1 34   ? -3.916  -44.639  36.312  1.00 16.67  ? 35   THR B C     1 
ATOM   9623  O  O     . THR B 1 34   ? -2.866  -44.454  35.677  1.00 14.96  ? 35   THR B O     1 
ATOM   9624  C  CB    . THR B 1 34   ? -4.601  -42.945  38.047  1.00 14.44  ? 35   THR B CB    1 
ATOM   9625  O  OG1   . THR B 1 34   ? -5.231  -41.663  38.190  1.00 17.11  ? 35   THR B OG1   1 
ATOM   9626  C  CG2   . THR B 1 34   ? -3.116  -42.814  38.375  1.00 14.92  ? 35   THR B CG2   1 
ATOM   9627  N  N     . MET B 1 35   ? -4.317  -45.842  36.810  1.00 12.94  ? 36   MET B N     1 
ATOM   9628  C  CA    . MET B 1 35   ? -3.479  -47.029  36.528  1.00 12.08  ? 36   MET B CA    1 
ATOM   9629  C  C     . MET B 1 35   ? -3.260  -47.262  35.044  1.00 13.16  ? 36   MET B C     1 
ATOM   9630  O  O     . MET B 1 35   ? -2.102  -47.395  34.645  1.00 13.90  ? 36   MET B O     1 
ATOM   9631  C  CB    . MET B 1 35   ? -4.084  -48.292  37.232  1.00 10.41  ? 36   MET B CB    1 
ATOM   9632  C  CG    . MET B 1 35   ? -4.055  -48.134  38.773  1.00 10.63  ? 36   MET B CG    1 
ATOM   9633  S  SD    . MET B 1 35   ? -4.525  -49.674  39.607  1.00 14.49  ? 36   MET B SD    1 
ATOM   9634  C  CE    . MET B 1 35   ? -6.284  -49.600  39.650  1.00 12.81  ? 36   MET B CE    1 
ATOM   9635  N  N     . GLY B 1 36   ? -4.323  -47.352  34.247  1.00 14.57  ? 37   GLY B N     1 
ATOM   9636  C  CA    . GLY B 1 36   ? -4.182  -47.532  32.800  1.00 15.85  ? 37   GLY B CA    1 
ATOM   9637  C  C     . GLY B 1 36   ? -3.375  -46.394  32.154  1.00 17.06  ? 37   GLY B C     1 
ATOM   9638  O  O     . GLY B 1 36   ? -2.576  -46.690  31.257  1.00 16.70  ? 37   GLY B O     1 
ATOM   9639  N  N     . GLU B 1 37   ? -3.657  -45.141  32.554  1.00 15.26  ? 38   GLU B N     1 
ATOM   9640  C  CA    . GLU B 1 37   ? -2.909  -44.028  31.999  1.00 17.65  ? 38   GLU B CA    1 
ATOM   9641  C  C     . GLU B 1 37   ? -1.427  -44.041  32.309  1.00 17.49  ? 38   GLU B C     1 
ATOM   9642  O  O     . GLU B 1 37   ? -0.579  -43.765  31.453  1.00 16.35  ? 38   GLU B O     1 
ATOM   9643  C  CB    . GLU B 1 37   ? -3.500  -42.667  32.466  1.00 15.51  ? 38   GLU B CB    1 
ATOM   9644  C  CG    . GLU B 1 37   ? -4.899  -42.530  31.838  1.00 14.25  ? 38   GLU B CG    1 
ATOM   9645  C  CD    . GLU B 1 37   ? -5.603  -41.293  32.371  1.00 14.72  ? 38   GLU B CD    1 
ATOM   9646  O  OE1   . GLU B 1 37   ? -6.830  -41.214  32.201  1.00 18.51  ? 38   GLU B OE1   1 
ATOM   9647  O  OE2   . GLU B 1 37   ? -4.942  -40.389  32.923  1.00 13.81  ? 38   GLU B OE2   1 
ATOM   9648  N  N     . GLU B 1 38   ? -1.102  -44.414  33.559  1.00 18.46  ? 39   GLU B N     1 
ATOM   9649  C  CA    . GLU B 1 38   ? 0.329   -44.547  33.879  1.00 21.40  ? 39   GLU B CA    1 
ATOM   9650  C  C     . GLU B 1 38   ? 0.990   -45.659  33.104  1.00 19.88  ? 39   GLU B C     1 
ATOM   9651  O  O     . GLU B 1 38   ? 2.087   -45.433  32.567  1.00 20.65  ? 39   GLU B O     1 
ATOM   9652  C  CB    . GLU B 1 38   ? 0.544   -44.892  35.376  1.00 21.12  ? 39   GLU B CB    1 
ATOM   9653  C  CG    . GLU B 1 38   ? -0.039  -43.678  36.061  1.00 27.52  ? 39   GLU B CG    1 
ATOM   9654  C  CD    . GLU B 1 38   ? 0.901   -43.024  37.012  1.00 33.18  ? 39   GLU B CD    1 
ATOM   9655  O  OE1   . GLU B 1 38   ? 2.023   -42.652  36.600  1.00 34.78  ? 39   GLU B OE1   1 
ATOM   9656  O  OE2   . GLU B 1 38   ? 0.376   -42.984  38.143  1.00 36.08  ? 39   GLU B OE2   1 
ATOM   9657  N  N     . ALA B 1 39   ? 0.250   -46.755  32.939  1.00 19.52  ? 40   ALA B N     1 
ATOM   9658  C  CA    . ALA B 1 39   ? 0.852   -47.899  32.223  1.00 18.84  ? 40   ALA B CA    1 
ATOM   9659  C  C     . ALA B 1 39   ? 1.071   -47.546  30.762  1.00 20.59  ? 40   ALA B C     1 
ATOM   9660  O  O     . ALA B 1 39   ? 2.113   -47.849  30.159  1.00 20.68  ? 40   ALA B O     1 
ATOM   9661  C  CB    . ALA B 1 39   ? -0.062  -49.119  32.369  1.00 19.15  ? 40   ALA B CB    1 
ATOM   9662  N  N     . ASP B 1 40   ? 0.121   -46.798  30.185  1.00 20.26  ? 41   ASP B N     1 
ATOM   9663  C  CA    . ASP B 1 40   ? 0.247   -46.385  28.769  1.00 21.48  ? 41   ASP B CA    1 
ATOM   9664  C  C     . ASP B 1 40   ? 1.331   -45.371  28.634  1.00 22.60  ? 41   ASP B C     1 
ATOM   9665  O  O     . ASP B 1 40   ? 2.165   -45.507  27.704  1.00 24.98  ? 41   ASP B O     1 
ATOM   9666  C  CB    . ASP B 1 40   ? -1.132  -45.932  28.250  1.00 22.69  ? 41   ASP B CB    1 
ATOM   9667  C  CG    . ASP B 1 40   ? -1.072  -45.750  26.728  1.00 26.32  ? 41   ASP B CG    1 
ATOM   9668  O  OD1   . ASP B 1 40   ? -0.910  -44.570  26.410  1.00 26.30  ? 41   ASP B OD1   1 
ATOM   9669  O  OD2   . ASP B 1 40   ? -1.176  -46.739  25.965  1.00 25.23  ? 41   ASP B OD2   1 
ATOM   9670  N  N     . ASP B 1 41   ? 1.460   -44.387  29.532  1.00 23.32  ? 42   ASP B N     1 
ATOM   9671  C  CA    . ASP B 1 41   ? 2.550   -43.456  29.511  1.00 27.59  ? 42   ASP B CA    1 
ATOM   9672  C  C     . ASP B 1 41   ? 3.910   -44.193  29.545  1.00 26.63  ? 42   ASP B C     1 
ATOM   9673  O  O     . ASP B 1 41   ? 4.869   -43.959  28.789  1.00 22.75  ? 42   ASP B O     1 
ATOM   9674  C  CB    . ASP B 1 41   ? 2.625   -42.509  30.719  1.00 29.86  ? 42   ASP B CB    1 
ATOM   9675  C  CG    . ASP B 1 41   ? 1.661   -41.347  30.827  1.00 33.62  ? 42   ASP B CG    1 
ATOM   9676  O  OD1   . ASP B 1 41   ? 0.864   -41.102  29.908  1.00 32.83  ? 42   ASP B OD1   1 
ATOM   9677  O  OD2   . ASP B 1 41   ? 1.733   -40.700  31.937  1.00 36.42  ? 42   ASP B OD2   1 
ATOM   9678  N  N     . TRP B 1 42   ? 4.038   -45.036  30.570  1.00 24.49  ? 43   TRP B N     1 
ATOM   9679  C  CA    . TRP B 1 42   ? 5.288   -45.785  30.784  1.00 22.94  ? 43   TRP B CA    1 
ATOM   9680  C  C     . TRP B 1 42   ? 5.638   -46.660  29.564  1.00 22.27  ? 43   TRP B C     1 
ATOM   9681  O  O     . TRP B 1 42   ? 6.795   -46.737  29.157  1.00 23.24  ? 43   TRP B O     1 
ATOM   9682  C  CB    . TRP B 1 42   ? 5.227   -46.610  32.067  1.00 21.23  ? 43   TRP B CB    1 
ATOM   9683  C  CG    . TRP B 1 42   ? 5.007   -45.875  33.330  1.00 20.29  ? 43   TRP B CG    1 
ATOM   9684  C  CD1   . TRP B 1 42   ? 5.176   -44.522  33.546  1.00 20.13  ? 43   TRP B CD1   1 
ATOM   9685  C  CD2   . TRP B 1 42   ? 4.512   -46.415  34.584  1.00 19.23  ? 43   TRP B CD2   1 
ATOM   9686  N  NE1   . TRP B 1 42   ? 4.780   -44.201  34.840  1.00 18.79  ? 43   TRP B NE1   1 
ATOM   9687  C  CE2   . TRP B 1 42   ? 4.386   -45.359  35.481  1.00 17.19  ? 43   TRP B CE2   1 
ATOM   9688  C  CE3   . TRP B 1 42   ? 4.114   -47.700  34.994  1.00 16.53  ? 43   TRP B CE3   1 
ATOM   9689  C  CZ2   . TRP B 1 42   ? 3.926   -45.509  36.803  1.00 17.55  ? 43   TRP B CZ2   1 
ATOM   9690  C  CZ3   . TRP B 1 42   ? 3.648   -47.835  36.291  1.00 15.65  ? 43   TRP B CZ3   1 
ATOM   9691  C  CH2   . TRP B 1 42   ? 3.530   -46.769  37.214  1.00 16.47  ? 43   TRP B CH2   1 
ATOM   9692  N  N     . ALA B 1 43   ? 4.636   -47.242  28.944  1.00 22.88  ? 44   ALA B N     1 
ATOM   9693  C  CA    . ALA B 1 43   ? 4.820   -48.053  27.729  1.00 23.43  ? 44   ALA B CA    1 
ATOM   9694  C  C     . ALA B 1 43   ? 5.361   -47.147  26.607  1.00 27.26  ? 44   ALA B C     1 
ATOM   9695  O  O     . ALA B 1 43   ? 6.438   -47.422  26.064  1.00 24.91  ? 44   ALA B O     1 
ATOM   9696  C  CB    . ALA B 1 43   ? 3.567   -48.730  27.271  1.00 26.33  ? 44   ALA B CB    1 
ATOM   9697  N  N     . ALA B 1 44   ? 4.679   -46.034  26.358  1.00 25.56  ? 45   ALA B N     1 
ATOM   9698  C  CA    . ALA B 1 44   ? 5.108   -45.060  25.368  1.00 28.98  ? 45   ALA B CA    1 
ATOM   9699  C  C     . ALA B 1 44   ? 6.526   -44.601  25.646  1.00 27.73  ? 45   ALA B C     1 
ATOM   9700  O  O     . ALA B 1 44   ? 7.264   -44.415  24.692  1.00 30.74  ? 45   ALA B O     1 
ATOM   9701  C  CB    . ALA B 1 44   ? 4.255   -43.791  25.364  1.00 27.56  ? 45   ALA B CB    1 
ATOM   9702  N  N     . GLN B 1 45   ? 6.856   -44.449  26.916  1.00 28.04  ? 46   GLN B N     1 
ATOM   9703  C  CA    . GLN B 1 45   ? 8.201   -44.067  27.317  1.00 29.06  ? 46   GLN B CA    1 
ATOM   9704  C  C     . GLN B 1 45   ? 9.309   -45.150  27.244  1.00 29.49  ? 46   GLN B C     1 
ATOM   9705  O  O     . GLN B 1 45   ? 10.465  -44.803  27.511  1.00 31.17  ? 46   GLN B O     1 
ATOM   9706  C  CB    . GLN B 1 45   ? 8.229   -43.638  28.781  1.00 28.98  ? 46   GLN B CB    1 
ATOM   9707  C  CG    . GLN B 1 45   ? 7.930   -42.226  29.147  1.00 31.59  ? 46   GLN B CG    1 
ATOM   9708  C  CD    . GLN B 1 45   ? 7.271   -41.994  30.490  1.00 32.96  ? 46   GLN B CD    1 
ATOM   9709  O  OE1   . GLN B 1 45   ? 6.301   -41.207  30.549  1.00 35.66  ? 46   GLN B OE1   1 
ATOM   9710  N  NE2   . GLN B 1 45   ? 7.705   -42.587  31.596  1.00 30.91  ? 46   GLN B NE2   1 
ATOM   9711  N  N     . GLY B 1 46   ? 8.998   -46.410  26.962  1.00 28.56  ? 47   GLY B N     1 
ATOM   9712  C  CA    . GLY B 1 46   ? 10.102  -47.392  26.899  1.00 25.92  ? 47   GLY B CA    1 
ATOM   9713  C  C     . GLY B 1 46   ? 10.367  -48.102  28.196  1.00 24.67  ? 47   GLY B C     1 
ATOM   9714  O  O     . GLY B 1 46   ? 11.293  -48.917  28.332  1.00 20.74  ? 47   GLY B O     1 
ATOM   9715  N  N     . ARG B 1 47   ? 9.519   -47.956  29.265  1.00 20.75  ? 48   ARG B N     1 
ATOM   9716  C  CA    . ARG B 1 47   ? 9.821   -48.709  30.476  1.00 17.86  ? 48   ARG B CA    1 
ATOM   9717  C  C     . ARG B 1 47   ? 9.734   -50.216  30.194  1.00 18.50  ? 48   ARG B C     1 
ATOM   9718  O  O     . ARG B 1 47   ? 8.810   -50.634  29.467  1.00 18.96  ? 48   ARG B O     1 
ATOM   9719  C  CB    . ARG B 1 47   ? 8.720   -48.428  31.502  1.00 18.39  ? 48   ARG B CB    1 
ATOM   9720  C  CG    . ARG B 1 47   ? 9.053   -48.956  32.900  1.00 19.26  ? 48   ARG B CG    1 
ATOM   9721  C  CD    . ARG B 1 47   ? 8.060   -48.202  33.737  1.00 23.08  ? 48   ARG B CD    1 
ATOM   9722  N  NE    . ARG B 1 47   ? 7.963   -47.370  34.773  1.00 21.67  ? 48   ARG B NE    1 
ATOM   9723  C  CZ    . ARG B 1 47   ? 7.733   -46.814  35.911  1.00 22.46  ? 48   ARG B CZ    1 
ATOM   9724  N  NH1   . ARG B 1 47   ? 7.930   -45.496  35.948  1.00 21.51  ? 48   ARG B NH1   1 
ATOM   9725  N  NH2   . ARG B 1 47   ? 7.313   -47.649  36.815  1.00 20.43  ? 48   ARG B NH2   1 
ATOM   9726  N  N     . LYS B 1 48   ? 10.632  -50.999  30.788  1.00 16.43  ? 49   LYS B N     1 
ATOM   9727  C  CA    . LYS B 1 48   ? 10.632  -52.435  30.564  1.00 18.24  ? 49   LYS B CA    1 
ATOM   9728  C  C     . LYS B 1 48   ? 9.944   -53.175  31.714  1.00 18.64  ? 49   LYS B C     1 
ATOM   9729  O  O     . LYS B 1 48   ? 10.210  -52.802  32.860  1.00 15.71  ? 49   LYS B O     1 
ATOM   9730  C  CB    . LYS B 1 48   ? 12.082  -52.948  30.430  1.00 20.79  ? 49   LYS B CB    1 
ATOM   9731  C  CG    . LYS B 1 48   ? 12.777  -52.295  29.214  1.00 23.78  ? 49   LYS B CG    1 
ATOM   9732  C  CD    . LYS B 1 48   ? 11.848  -52.062  28.029  1.00 28.29  ? 49   LYS B CD    1 
ATOM   9733  C  CE    . LYS B 1 48   ? 12.520  -51.263  26.884  1.00 31.67  ? 49   LYS B CE    1 
ATOM   9734  N  NZ    . LYS B 1 48   ? 11.796  -51.623  25.619  1.00 36.95  ? 49   LYS B NZ    1 
ATOM   9735  N  N     . ASN B 1 49   ? 9.243   -54.269  31.364  1.00 14.91  ? 50   ASN B N     1 
ATOM   9736  C  CA    . ASN B 1 49   ? 8.696   -55.089  32.430  1.00 16.93  ? 50   ASN B CA    1 
ATOM   9737  C  C     . ASN B 1 49   ? 9.790   -56.092  32.861  1.00 16.81  ? 50   ASN B C     1 
ATOM   9738  O  O     . ASN B 1 49   ? 10.943  -55.927  32.413  1.00 15.29  ? 50   ASN B O     1 
ATOM   9739  C  CB    . ASN B 1 49   ? 7.447   -55.880  31.960  1.00 14.15  ? 50   ASN B CB    1 
ATOM   9740  C  CG    . ASN B 1 49   ? 7.628   -56.616  30.651  1.00 16.56  ? 50   ASN B CG    1 
ATOM   9741  O  OD1   . ASN B 1 49   ? 8.767   -56.992  30.303  1.00 17.61  ? 50   ASN B OD1   1 
ATOM   9742  N  ND2   . ASN B 1 49   ? 6.523   -56.894  29.930  1.00 15.78  ? 50   ASN B ND2   1 
ATOM   9743  N  N     . ILE B 1 50   ? 9.409   -57.119  33.617  1.00 16.93  ? 51   ILE B N     1 
ATOM   9744  C  CA    . ILE B 1 50   ? 10.432  -58.102  34.060  1.00 16.10  ? 51   ILE B CA    1 
ATOM   9745  C  C     . ILE B 1 50   ? 10.963  -58.906  32.892  1.00 17.61  ? 51   ILE B C     1 
ATOM   9746  O  O     . ILE B 1 50   ? 11.980  -59.534  33.103  1.00 19.84  ? 51   ILE B O     1 
ATOM   9747  C  CB    . ILE B 1 50   ? 9.903   -59.049  35.132  1.00 15.51  ? 51   ILE B CB    1 
ATOM   9748  C  CG1   . ILE B 1 50   ? 8.707   -59.867  34.677  1.00 12.84  ? 51   ILE B CG1   1 
ATOM   9749  C  CG2   . ILE B 1 50   ? 9.520   -58.247  36.389  1.00 15.78  ? 51   ILE B CG2   1 
ATOM   9750  C  CD1   . ILE B 1 50   ? 8.221   -60.931  35.659  1.00 18.83  ? 51   ILE B CD1   1 
ATOM   9751  N  N     . PHE B 1 51   ? 10.419  -58.838  31.689  1.00 16.82  ? 52   PHE B N     1 
ATOM   9752  C  CA    . PHE B 1 51   ? 10.942  -59.522  30.528  1.00 18.51  ? 52   PHE B CA    1 
ATOM   9753  C  C     . PHE B 1 51   ? 11.832  -58.683  29.645  1.00 18.49  ? 52   PHE B C     1 
ATOM   9754  O  O     . PHE B 1 51   ? 12.239  -59.091  28.537  1.00 20.03  ? 52   PHE B O     1 
ATOM   9755  C  CB    . PHE B 1 51   ? 9.695   -59.962  29.675  1.00 20.29  ? 52   PHE B CB    1 
ATOM   9756  C  CG    . PHE B 1 51   ? 8.847   -60.880  30.529  1.00 19.25  ? 52   PHE B CG    1 
ATOM   9757  C  CD1   . PHE B 1 51   ? 7.570   -60.475  30.911  1.00 18.87  ? 52   PHE B CD1   1 
ATOM   9758  C  CD2   . PHE B 1 51   ? 9.338   -62.094  30.961  1.00 20.99  ? 52   PHE B CD2   1 
ATOM   9759  C  CE1   . PHE B 1 51   ? 6.842   -61.304  31.733  1.00 19.51  ? 52   PHE B CE1   1 
ATOM   9760  C  CE2   . PHE B 1 51   ? 8.555   -62.940  31.748  1.00 21.95  ? 52   PHE B CE2   1 
ATOM   9761  C  CZ    . PHE B 1 51   ? 7.284   -62.545  32.135  1.00 19.83  ? 52   PHE B CZ    1 
ATOM   9762  N  N     . GLY B 1 52   ? 12.092  -57.451  30.088  1.00 19.77  ? 53   GLY B N     1 
ATOM   9763  C  CA    . GLY B 1 52   ? 12.884  -56.515  29.239  1.00 18.63  ? 53   GLY B CA    1 
ATOM   9764  C  C     . GLY B 1 52   ? 12.038  -55.893  28.145  1.00 19.48  ? 53   GLY B C     1 
ATOM   9765  O  O     . GLY B 1 52   ? 12.603  -55.271  27.250  1.00 17.67  ? 53   GLY B O     1 
ATOM   9766  N  N     . GLN B 1 53   ? 10.695  -56.023  28.169  1.00 17.01  ? 54   GLN B N     1 
ATOM   9767  C  CA    . GLN B 1 53   ? 9.863   -55.518  27.100  1.00 18.77  ? 54   GLN B CA    1 
ATOM   9768  C  C     . GLN B 1 53   ? 8.926   -54.396  27.557  1.00 18.88  ? 54   GLN B C     1 
ATOM   9769  O  O     . GLN B 1 53   ? 8.528   -54.279  28.731  1.00 17.48  ? 54   GLN B O     1 
ATOM   9770  C  CB    . GLN B 1 53   ? 8.944   -56.653  26.586  1.00 21.71  ? 54   GLN B CB    1 
ATOM   9771  C  CG    . GLN B 1 53   ? 9.607   -57.910  26.132  1.00 24.50  ? 54   GLN B CG    1 
ATOM   9772  C  CD    . GLN B 1 53   ? 10.498  -57.585  24.921  1.00 25.90  ? 54   GLN B CD    1 
ATOM   9773  O  OE1   . GLN B 1 53   ? 9.981   -57.334  23.848  1.00 30.24  ? 54   GLN B OE1   1 
ATOM   9774  N  NE2   . GLN B 1 53   ? 11.785  -57.607  25.124  1.00 28.51  ? 54   GLN B NE2   1 
ATOM   9775  N  N     . THR B 1 54   ? 8.416   -53.625  26.585  1.00 18.73  ? 55   THR B N     1 
ATOM   9776  C  CA    . THR B 1 54   ? 7.431   -52.623  26.943  1.00 18.84  ? 55   THR B CA    1 
ATOM   9777  C  C     . THR B 1 54   ? 6.084   -53.346  26.869  1.00 16.87  ? 55   THR B C     1 
ATOM   9778  O  O     . THR B 1 54   ? 5.904   -54.279  26.088  1.00 18.48  ? 55   THR B O     1 
ATOM   9779  C  CB    . THR B 1 54   ? 7.348   -51.366  26.038  1.00 23.38  ? 55   THR B CB    1 
ATOM   9780  O  OG1   . THR B 1 54   ? 7.170   -51.848  24.705  1.00 25.15  ? 55   THR B OG1   1 
ATOM   9781  C  CG2   . THR B 1 54   ? 8.712   -50.691  26.098  1.00 25.00  ? 55   THR B CG2   1 
ATOM   9782  N  N     . LEU B 1 55   ? 5.201   -52.894  27.762  1.00 16.86  ? 56   LEU B N     1 
ATOM   9783  C  CA    . LEU B 1 55   ? 3.847   -53.467  27.825  1.00 16.83  ? 56   LEU B CA    1 
ATOM   9784  C  C     . LEU B 1 55   ? 3.076   -53.283  26.535  1.00 15.09  ? 56   LEU B C     1 
ATOM   9785  O  O     . LEU B 1 55   ? 3.194   -52.177  25.970  1.00 19.02  ? 56   LEU B O     1 
ATOM   9786  C  CB    . LEU B 1 55   ? 3.102   -52.698  28.914  1.00 19.03  ? 56   LEU B CB    1 
ATOM   9787  C  CG    . LEU B 1 55   ? 1.711   -53.179  29.313  1.00 18.40  ? 56   LEU B CG    1 
ATOM   9788  C  CD1   . LEU B 1 55   ? 1.780   -54.586  29.917  1.00 17.52  ? 56   LEU B CD1   1 
ATOM   9789  C  CD2   . LEU B 1 55   ? 1.134   -52.252  30.387  1.00 18.13  ? 56   LEU B CD2   1 
ATOM   9790  N  N     . THR B 1 56   ? 2.340   -54.292  26.127  1.00 13.86  ? 57   THR B N     1 
ATOM   9791  C  CA    . THR B 1 56   ? 1.471   -54.133  24.955  1.00 15.62  ? 57   THR B CA    1 
ATOM   9792  C  C     . THR B 1 56   ? 0.090   -53.758  25.554  1.00 16.11  ? 57   THR B C     1 
ATOM   9793  O  O     . THR B 1 56   ? -0.512  -54.661  26.167  1.00 14.01  ? 57   THR B O     1 
ATOM   9794  C  CB    . THR B 1 56   ? 1.380   -55.452  24.197  1.00 15.31  ? 57   THR B CB    1 
ATOM   9795  O  OG1   . THR B 1 56   ? 2.715   -55.712  23.702  1.00 15.85  ? 57   THR B OG1   1 
ATOM   9796  C  CG2   . THR B 1 56   ? 0.459   -55.361  22.968  1.00 17.46  ? 57   THR B CG2   1 
ATOM   9797  N  N     . ILE B 1 57   ? -0.360  -52.564  25.316  1.00 16.09  ? 58   ILE B N     1 
ATOM   9798  C  CA    . ILE B 1 57   ? -1.591  -52.040  25.855  1.00 18.15  ? 58   ILE B CA    1 
ATOM   9799  C  C     . ILE B 1 57   ? -2.524  -51.527  24.760  1.00 18.16  ? 58   ILE B C     1 
ATOM   9800  O  O     . ILE B 1 57   ? -2.081  -50.701  23.969  1.00 16.67  ? 58   ILE B O     1 
ATOM   9801  C  CB    . ILE B 1 57   ? -1.372  -50.766  26.708  1.00 23.28  ? 58   ILE B CB    1 
ATOM   9802  C  CG1   . ILE B 1 57   ? -0.052  -50.780  27.421  1.00 26.28  ? 58   ILE B CG1   1 
ATOM   9803  C  CG2   . ILE B 1 57   ? -2.492  -50.525  27.724  1.00 22.74  ? 58   ILE B CG2   1 
ATOM   9804  C  CD1   . ILE B 1 57   ? 0.252   -49.591  28.310  1.00 31.80  ? 58   ILE B CD1   1 
ATOM   9805  N  N     . ARG B 1 58   ? -3.782  -51.897  24.814  1.00 16.63  ? 59   ARG B N     1 
ATOM   9806  C  CA    . ARG B 1 58   ? -4.775  -51.342  23.882  1.00 15.90  ? 59   ARG B CA    1 
ATOM   9807  C  C     . ARG B 1 58   ? -6.039  -51.000  24.638  1.00 17.25  ? 59   ARG B C     1 
ATOM   9808  O  O     . ARG B 1 58   ? -6.463  -51.770  25.515  1.00 11.71  ? 59   ARG B O     1 
ATOM   9809  C  CB    . ARG B 1 58   ? -5.179  -52.401  22.862  1.00 22.06  ? 59   ARG B CB    1 
ATOM   9810  C  CG    . ARG B 1 58   ? -4.040  -52.921  22.015  1.00 26.14  ? 59   ARG B CG    1 
ATOM   9811  C  CD    . ARG B 1 58   ? -3.559  -51.981  20.931  1.00 30.88  ? 59   ARG B CD    1 
ATOM   9812  N  NE    . ARG B 1 58   ? -2.501  -52.642  20.147  1.00 36.16  ? 59   ARG B NE    1 
ATOM   9813  C  CZ    . ARG B 1 58   ? -1.193  -52.644  20.332  1.00 39.14  ? 59   ARG B CZ    1 
ATOM   9814  N  NH1   . ARG B 1 58   ? -0.635  -51.985  21.340  1.00 39.68  ? 59   ARG B NH1   1 
ATOM   9815  N  NH2   . ARG B 1 58   ? -0.388  -53.321  19.497  1.00 40.07  ? 59   ARG B NH2   1 
ATOM   9816  N  N     . GLU B 1 59   ? -6.692  -49.933  24.230  1.00 15.20  ? 60   GLU B N     1 
ATOM   9817  C  CA    . GLU B 1 59   ? -7.972  -49.508  24.801  1.00 16.16  ? 60   GLU B CA    1 
ATOM   9818  C  C     . GLU B 1 59   ? -9.118  -50.183  24.055  1.00 14.64  ? 60   GLU B C     1 
ATOM   9819  O  O     . GLU B 1 59   ? -9.059  -50.094  22.814  1.00 14.78  ? 60   GLU B O     1 
ATOM   9820  C  CB    . GLU B 1 59   ? -8.035  -47.966  24.580  1.00 17.78  ? 60   GLU B CB    1 
ATOM   9821  C  CG    . GLU B 1 59   ? -9.281  -47.324  25.167  1.00 20.71  ? 60   GLU B CG    1 
ATOM   9822  C  CD    . GLU B 1 59   ? -9.404  -45.833  24.807  1.00 24.78  ? 60   GLU B CD    1 
ATOM   9823  O  OE1   . GLU B 1 59   ? -8.777  -45.374  23.820  1.00 25.52  ? 60   GLU B OE1   1 
ATOM   9824  O  OE2   . GLU B 1 59   ? -10.143 -45.123  25.535  1.00 22.69  ? 60   GLU B OE2   1 
ATOM   9825  N  N     . MET B 1 60   ? -10.085 -50.819  24.681  1.00 14.72  ? 61   MET B N     1 
ATOM   9826  C  CA    . MET B 1 60   ? -11.209 -51.423  23.973  1.00 12.71  ? 61   MET B CA    1 
ATOM   9827  C  C     . MET B 1 60   ? -12.404 -50.462  23.903  1.00 13.99  ? 61   MET B C     1 
ATOM   9828  O  O     . MET B 1 60   ? -12.277 -49.312  24.272  1.00 11.14  ? 61   MET B O     1 
ATOM   9829  C  CB    . MET B 1 60   ? -11.592 -52.747  24.684  1.00 14.34  ? 61   MET B CB    1 
ATOM   9830  C  CG    . MET B 1 60   ? -10.409 -53.780  24.644  1.00 14.13  ? 61   MET B CG    1 
ATOM   9831  S  SD    . MET B 1 60   ? -9.791  -54.000  22.934  1.00 16.06  ? 61   MET B SD    1 
ATOM   9832  C  CE    . MET B 1 60   ? -11.056 -54.997  22.255  1.00 11.59  ? 61   MET B CE    1 
ATOM   9833  N  N     . GLN B 1 61   ? -13.561 -50.901  23.414  1.00 13.45  ? 62   GLN B N     1 
ATOM   9834  C  CA    . GLN B 1 61   ? -14.778 -50.124  23.279  1.00 11.08  ? 62   GLN B CA    1 
ATOM   9835  C  C     . GLN B 1 61   ? -15.614 -50.070  24.556  1.00 12.02  ? 62   GLN B C     1 
ATOM   9836  O  O     . GLN B 1 61   ? -16.541 -49.219  24.654  1.00 12.76  ? 62   GLN B O     1 
ATOM   9837  C  CB    . GLN B 1 61   ? -15.672 -50.672  22.154  1.00 11.89  ? 62   GLN B CB    1 
ATOM   9838  C  CG    . GLN B 1 61   ? -16.633 -51.810  22.403  1.00 12.97  ? 62   GLN B CG    1 
ATOM   9839  C  CD    . GLN B 1 61   ? -15.977 -53.167  22.525  1.00 15.17  ? 62   GLN B CD    1 
ATOM   9840  O  OE1   . GLN B 1 61   ? -14.758 -53.258  22.483  1.00 14.78  ? 62   GLN B OE1   1 
ATOM   9841  N  NE2   . GLN B 1 61   ? -16.699 -54.222  22.739  1.00 13.95  ? 62   GLN B NE2   1 
ATOM   9842  N  N     . SER B 1 62   ? -15.313 -50.969  25.479  1.00 10.17  ? 63   SER B N     1 
ATOM   9843  C  CA    . SER B 1 62   ? -16.036 -51.141  26.726  1.00 12.79  ? 63   SER B CA    1 
ATOM   9844  C  C     . SER B 1 62   ? -15.180 -52.039  27.658  1.00 11.03  ? 63   SER B C     1 
ATOM   9845  O  O     . SER B 1 62   ? -14.244 -52.658  27.178  1.00 8.59   ? 63   SER B O     1 
ATOM   9846  C  CB    . SER B 1 62   ? -17.451 -51.748  26.506  1.00 9.37   ? 63   SER B CB    1 
ATOM   9847  O  OG    . SER B 1 62   ? -17.280 -53.172  26.385  1.00 16.77  ? 63   SER B OG    1 
ATOM   9848  N  N     . GLU B 1 63   ? -15.554 -52.222  28.918  1.00 13.83  ? 64   GLU B N     1 
ATOM   9849  C  CA    . GLU B 1 63   ? -14.869 -53.137  29.841  1.00 11.63  ? 64   GLU B CA    1 
ATOM   9850  C  C     . GLU B 1 63   ? -15.255 -54.560  29.470  1.00 12.88  ? 64   GLU B C     1 
ATOM   9851  O  O     . GLU B 1 63   ? -14.441 -55.460  29.673  1.00 12.85  ? 64   GLU B O     1 
ATOM   9852  C  CB    . GLU B 1 63   ? -15.278 -52.877  31.317  1.00 11.74  ? 64   GLU B CB    1 
ATOM   9853  C  CG    . GLU B 1 63   ? -14.688 -51.517  31.789  1.00 14.60  ? 64   GLU B CG    1 
ATOM   9854  C  CD    . GLU B 1 63   ? -15.666 -50.378  31.694  1.00 16.07  ? 64   GLU B CD    1 
ATOM   9855  O  OE1   . GLU B 1 63   ? -15.417 -49.383  32.428  1.00 18.96  ? 64   GLU B OE1   1 
ATOM   9856  O  OE2   . GLU B 1 63   ? -16.624 -50.466  30.875  1.00 17.37  ? 64   GLU B OE2   1 
ATOM   9857  N  N     . ALA B 1 64   ? -16.395 -54.757  28.779  1.00 14.15  ? 65   ALA B N     1 
ATOM   9858  C  CA    . ALA B 1 64   ? -16.737 -56.109  28.310  1.00 13.28  ? 65   ALA B CA    1 
ATOM   9859  C  C     . ALA B 1 64   ? -15.779 -56.528  27.173  1.00 14.08  ? 65   ALA B C     1 
ATOM   9860  O  O     . ALA B 1 64   ? -15.300 -57.669  27.145  1.00 12.71  ? 65   ALA B O     1 
ATOM   9861  C  CB    . ALA B 1 64   ? -18.185 -56.143  27.817  1.00 13.72  ? 65   ALA B CB    1 
ATOM   9862  N  N     . GLY B 1 65   ? -15.407 -55.520  26.368  1.00 12.33  ? 66   GLY B N     1 
ATOM   9863  C  CA    . GLY B 1 65   ? -14.447 -55.701  25.280  1.00 13.31  ? 66   GLY B CA    1 
ATOM   9864  C  C     . GLY B 1 65   ? -13.065 -56.020  25.868  1.00 12.82  ? 66   GLY B C     1 
ATOM   9865  O  O     . GLY B 1 65   ? -12.281 -56.864  25.377  1.00 11.92  ? 66   GLY B O     1 
ATOM   9866  N  N     . ALA B 1 66   ? -12.702 -55.219  26.881  1.00 11.07  ? 67   ALA B N     1 
ATOM   9867  C  CA    . ALA B 1 66   ? -11.456 -55.358  27.606  1.00 14.32  ? 67   ALA B CA    1 
ATOM   9868  C  C     . ALA B 1 66   ? -11.324 -56.740  28.268  1.00 14.05  ? 67   ALA B C     1 
ATOM   9869  O  O     . ALA B 1 66   ? -10.265 -57.339  28.181  1.00 13.68  ? 67   ALA B O     1 
ATOM   9870  C  CB    . ALA B 1 66   ? -11.243 -54.327  28.710  1.00 11.20  ? 67   ALA B CB    1 
ATOM   9871  N  N     . ALA B 1 67   ? -12.413 -57.211  28.871  1.00 12.89  ? 68   ALA B N     1 
ATOM   9872  C  CA    . ALA B 1 67   ? -12.328 -58.536  29.524  1.00 13.58  ? 68   ALA B CA    1 
ATOM   9873  C  C     . ALA B 1 67   ? -12.193 -59.706  28.521  1.00 15.66  ? 68   ALA B C     1 
ATOM   9874  O  O     . ALA B 1 67   ? -11.482 -60.682  28.737  1.00 13.90  ? 68   ALA B O     1 
ATOM   9875  C  CB    . ALA B 1 67   ? -13.587 -58.709  30.399  1.00 12.91  ? 68   ALA B CB    1 
ATOM   9876  N  N     . GLY B 1 68   ? -12.843 -59.582  27.362  1.00 13.23  ? 69   GLY B N     1 
ATOM   9877  C  CA    . GLY B 1 68   ? -12.776 -60.542  26.262  1.00 12.86  ? 69   GLY B CA    1 
ATOM   9878  C  C     . GLY B 1 68   ? -11.332 -60.532  25.690  1.00 12.69  ? 69   GLY B C     1 
ATOM   9879  O  O     . GLY B 1 68   ? -10.760 -61.611  25.439  1.00 10.85  ? 69   GLY B O     1 
ATOM   9880  N  N     . ALA B 1 69   ? -10.787 -59.340  25.507  1.00 11.39  ? 70   ALA B N     1 
ATOM   9881  C  CA    . ALA B 1 69   ? -9.366  -59.269  25.016  1.00 11.75  ? 70   ALA B CA    1 
ATOM   9882  C  C     . ALA B 1 69   ? -8.428  -59.896  26.039  1.00 11.87  ? 70   ALA B C     1 
ATOM   9883  O  O     . ALA B 1 69   ? -7.436  -60.599  25.773  1.00 11.82  ? 70   ALA B O     1 
ATOM   9884  C  CB    . ALA B 1 69   ? -9.011  -57.788  24.857  1.00 13.72  ? 70   ALA B CB    1 
ATOM   9885  N  N     . VAL B 1 70   ? -8.671  -59.603  27.333  1.00 9.84   ? 71   VAL B N     1 
ATOM   9886  C  CA    . VAL B 1 70   ? -7.801  -60.176  28.407  1.00 12.42  ? 71   VAL B CA    1 
ATOM   9887  C  C     . VAL B 1 70   ? -7.853  -61.700  28.338  1.00 13.63  ? 71   VAL B C     1 
ATOM   9888  O  O     . VAL B 1 70   ? -6.855  -62.450  28.375  1.00 12.42  ? 71   VAL B O     1 
ATOM   9889  C  CB    . VAL B 1 70   ? -8.281  -59.714  29.806  1.00 12.01  ? 71   VAL B CB    1 
ATOM   9890  C  CG1   . VAL B 1 70   ? -7.715  -60.577  30.953  1.00 14.20  ? 71   VAL B CG1   1 
ATOM   9891  C  CG2   . VAL B 1 70   ? -7.881  -58.220  29.948  1.00 14.88  ? 71   VAL B CG2   1 
ATOM   9892  N  N     . HIS B 1 71   ? -9.107  -62.196  28.268  1.00 13.28  ? 72   HIS B N     1 
ATOM   9893  C  CA    . HIS B 1 71   ? -9.303  -63.641  28.129  1.00 13.65  ? 72   HIS B CA    1 
ATOM   9894  C  C     . HIS B 1 71   ? -8.508  -64.214  26.946  1.00 13.50  ? 72   HIS B C     1 
ATOM   9895  O  O     . HIS B 1 71   ? -7.835  -65.238  27.098  1.00 12.60  ? 72   HIS B O     1 
ATOM   9896  C  CB    . HIS B 1 71   ? -10.815 -63.941  28.072  1.00 13.52  ? 72   HIS B CB    1 
ATOM   9897  C  CG    . HIS B 1 71   ? -11.144 -65.388  27.957  1.00 14.13  ? 72   HIS B CG    1 
ATOM   9898