data_1KGC
# 
_entry.id   1KGC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KGC         
RCSB  RCSB014928   
WWPDB D_1000014928 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KGC 
_pdbx_database_status.recvd_initial_deposition_date   2001-11-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kjer-Nielsen, L.' 1 
'Clements, C.S.'   2 
'Brooks, A.G.'     3 
'Purcell, A.W.'    4 
'McCluskey, J.'    5 
'Rossjohn, J.'     6 
# 
_citation.id                        primary 
_citation.title                     
;The 1.5 A crystal structure of a highly selected antiviral T cell receptor provides evidence for a structural basis of immunodominance
;
_citation.journal_abbrev            STRUCTURE 
_citation.journal_volume            10 
_citation.page_first                1521 
_citation.page_last                 1532 
_citation.year                      2002 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12429093 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(02)00878-X' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kjer-Nielsen, L.' 1 
primary 'Clements, C.S.'   2 
primary 'Brooks, A.G.'     3 
primary 'Purcell, A.W.'    4 
primary 'McCluskey, J.'    5 
primary 'Rossjohn, J.'     6 
# 
_cell.entry_id           1KGC 
_cell.length_a           45.796 
_cell.length_b           68.110 
_cell.length_c           160.497 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KGC 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'T-cell receptor alpha chain' 22849.299 1   ? ? ? ? 
2 polymer man 'T-cell receptor beta chain'  27316.295 1   ? ? ? ? 
3 water   nat water                         18.015    686 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MKTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLR
DAAVYYCILPLAGGTSYGKLTFGQGTILTVHPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKT
VLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESS
;
;MKTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLR
DAAVYYCILPLAGGTSYGKLTFGQGTILTVHPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKT
VLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESS
;
D ? 
2 'polypeptide(L)' no no 
;MGVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQR
TQQEDSAVYLCASSLGQAYEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVN
GKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
AD
;
;MGVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQR
TQQEDSAVYLCASSLGQAYEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVN
GKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
AD
;
E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   THR n 
1 4   THR n 
1 5   GLN n 
1 6   PRO n 
1 7   ASN n 
1 8   SER n 
1 9   MET n 
1 10  GLU n 
1 11  SER n 
1 12  ASN n 
1 13  GLU n 
1 14  GLU n 
1 15  GLU n 
1 16  PRO n 
1 17  VAL n 
1 18  HIS n 
1 19  LEU n 
1 20  PRO n 
1 21  CYS n 
1 22  ASN n 
1 23  HIS n 
1 24  SER n 
1 25  THR n 
1 26  ILE n 
1 27  SER n 
1 28  GLY n 
1 29  THR n 
1 30  ASP n 
1 31  TYR n 
1 32  ILE n 
1 33  HIS n 
1 34  TRP n 
1 35  TYR n 
1 36  ARG n 
1 37  GLN n 
1 38  LEU n 
1 39  PRO n 
1 40  SER n 
1 41  GLN n 
1 42  GLY n 
1 43  PRO n 
1 44  GLU n 
1 45  TYR n 
1 46  VAL n 
1 47  ILE n 
1 48  HIS n 
1 49  GLY n 
1 50  LEU n 
1 51  THR n 
1 52  SER n 
1 53  ASN n 
1 54  VAL n 
1 55  ASN n 
1 56  ASN n 
1 57  ARG n 
1 58  MET n 
1 59  ALA n 
1 60  SER n 
1 61  LEU n 
1 62  ALA n 
1 63  ILE n 
1 64  ALA n 
1 65  GLU n 
1 66  ASP n 
1 67  ARG n 
1 68  LYS n 
1 69  SER n 
1 70  SER n 
1 71  THR n 
1 72  LEU n 
1 73  ILE n 
1 74  LEU n 
1 75  HIS n 
1 76  ARG n 
1 77  ALA n 
1 78  THR n 
1 79  LEU n 
1 80  ARG n 
1 81  ASP n 
1 82  ALA n 
1 83  ALA n 
1 84  VAL n 
1 85  TYR n 
1 86  TYR n 
1 87  CYS n 
1 88  ILE n 
1 89  LEU n 
1 90  PRO n 
1 91  LEU n 
1 92  ALA n 
1 93  GLY n 
1 94  GLY n 
1 95  THR n 
1 96  SER n 
1 97  TYR n 
1 98  GLY n 
1 99  LYS n 
1 100 LEU n 
1 101 THR n 
1 102 PHE n 
1 103 GLY n 
1 104 GLN n 
1 105 GLY n 
1 106 THR n 
1 107 ILE n 
1 108 LEU n 
1 109 THR n 
1 110 VAL n 
1 111 HIS n 
1 112 PRO n 
1 113 ASN n 
1 114 ILE n 
1 115 GLN n 
1 116 ASN n 
1 117 PRO n 
1 118 ASP n 
1 119 PRO n 
1 120 ALA n 
1 121 VAL n 
1 122 TYR n 
1 123 GLN n 
1 124 LEU n 
1 125 ARG n 
1 126 ASP n 
1 127 SER n 
1 128 LYS n 
1 129 SER n 
1 130 SER n 
1 131 ASP n 
1 132 LYS n 
1 133 SER n 
1 134 VAL n 
1 135 CYS n 
1 136 LEU n 
1 137 PHE n 
1 138 THR n 
1 139 ASP n 
1 140 PHE n 
1 141 ASP n 
1 142 SER n 
1 143 GLN n 
1 144 THR n 
1 145 ASN n 
1 146 VAL n 
1 147 SER n 
1 148 GLN n 
1 149 SER n 
1 150 LYS n 
1 151 ASP n 
1 152 SER n 
1 153 ASP n 
1 154 VAL n 
1 155 TYR n 
1 156 ILE n 
1 157 THR n 
1 158 ASP n 
1 159 LYS n 
1 160 THR n 
1 161 VAL n 
1 162 LEU n 
1 163 ASP n 
1 164 MET n 
1 165 ARG n 
1 166 SER n 
1 167 MET n 
1 168 ASP n 
1 169 PHE n 
1 170 LYS n 
1 171 SER n 
1 172 ASN n 
1 173 SER n 
1 174 ALA n 
1 175 VAL n 
1 176 ALA n 
1 177 TRP n 
1 178 SER n 
1 179 ASN n 
1 180 LYS n 
1 181 SER n 
1 182 ASP n 
1 183 PHE n 
1 184 ALA n 
1 185 CYS n 
1 186 ALA n 
1 187 ASN n 
1 188 ALA n 
1 189 PHE n 
1 190 ASN n 
1 191 ASN n 
1 192 SER n 
1 193 ILE n 
1 194 ILE n 
1 195 PRO n 
1 196 GLU n 
1 197 ASP n 
1 198 THR n 
1 199 PHE n 
1 200 PHE n 
1 201 PRO n 
1 202 SER n 
1 203 PRO n 
1 204 GLU n 
1 205 SER n 
1 206 SER n 
2 1   MET n 
2 2   GLY n 
2 3   VAL n 
2 4   SER n 
2 5   GLN n 
2 6   SER n 
2 7   PRO n 
2 8   ARG n 
2 9   TYR n 
2 10  LYS n 
2 11  VAL n 
2 12  ALA n 
2 13  LYS n 
2 14  ARG n 
2 15  GLY n 
2 16  GLN n 
2 17  ASP n 
2 18  VAL n 
2 19  ALA n 
2 20  LEU n 
2 21  ARG n 
2 22  CYS n 
2 23  ASP n 
2 24  PRO n 
2 25  ILE n 
2 26  SER n 
2 27  GLY n 
2 28  HIS n 
2 29  VAL n 
2 30  SER n 
2 31  LEU n 
2 32  PHE n 
2 33  TRP n 
2 34  TYR n 
2 35  GLN n 
2 36  GLN n 
2 37  ALA n 
2 38  LEU n 
2 39  GLY n 
2 40  GLN n 
2 41  GLY n 
2 42  PRO n 
2 43  GLU n 
2 44  PHE n 
2 45  LEU n 
2 46  THR n 
2 47  TYR n 
2 48  PHE n 
2 49  GLN n 
2 50  ASN n 
2 51  GLU n 
2 52  ALA n 
2 53  GLN n 
2 54  LEU n 
2 55  ASP n 
2 56  LYS n 
2 57  SER n 
2 58  GLY n 
2 59  LEU n 
2 60  PRO n 
2 61  SER n 
2 62  ASP n 
2 63  ARG n 
2 64  PHE n 
2 65  PHE n 
2 66  ALA n 
2 67  GLU n 
2 68  ARG n 
2 69  PRO n 
2 70  GLU n 
2 71  GLY n 
2 72  SER n 
2 73  VAL n 
2 74  SER n 
2 75  THR n 
2 76  LEU n 
2 77  LYS n 
2 78  ILE n 
2 79  GLN n 
2 80  ARG n 
2 81  THR n 
2 82  GLN n 
2 83  GLN n 
2 84  GLU n 
2 85  ASP n 
2 86  SER n 
2 87  ALA n 
2 88  VAL n 
2 89  TYR n 
2 90  LEU n 
2 91  CYS n 
2 92  ALA n 
2 93  SER n 
2 94  SER n 
2 95  LEU n 
2 96  GLY n 
2 97  GLN n 
2 98  ALA n 
2 99  TYR n 
2 100 GLU n 
2 101 GLN n 
2 102 TYR n 
2 103 PHE n 
2 104 GLY n 
2 105 PRO n 
2 106 GLY n 
2 107 THR n 
2 108 ARG n 
2 109 LEU n 
2 110 THR n 
2 111 VAL n 
2 112 THR n 
2 113 GLU n 
2 114 ASP n 
2 115 LEU n 
2 116 LYS n 
2 117 ASN n 
2 118 VAL n 
2 119 PHE n 
2 120 PRO n 
2 121 PRO n 
2 122 GLU n 
2 123 VAL n 
2 124 ALA n 
2 125 VAL n 
2 126 PHE n 
2 127 GLU n 
2 128 PRO n 
2 129 SER n 
2 130 GLU n 
2 131 ALA n 
2 132 GLU n 
2 133 ILE n 
2 134 SER n 
2 135 HIS n 
2 136 THR n 
2 137 GLN n 
2 138 LYS n 
2 139 ALA n 
2 140 THR n 
2 141 LEU n 
2 142 VAL n 
2 143 CYS n 
2 144 LEU n 
2 145 ALA n 
2 146 THR n 
2 147 GLY n 
2 148 PHE n 
2 149 TYR n 
2 150 PRO n 
2 151 ASP n 
2 152 HIS n 
2 153 VAL n 
2 154 GLU n 
2 155 LEU n 
2 156 SER n 
2 157 TRP n 
2 158 TRP n 
2 159 VAL n 
2 160 ASN n 
2 161 GLY n 
2 162 LYS n 
2 163 GLU n 
2 164 VAL n 
2 165 HIS n 
2 166 SER n 
2 167 GLY n 
2 168 VAL n 
2 169 SER n 
2 170 THR n 
2 171 ASP n 
2 172 PRO n 
2 173 GLN n 
2 174 PRO n 
2 175 LEU n 
2 176 LYS n 
2 177 GLU n 
2 178 GLN n 
2 179 PRO n 
2 180 ALA n 
2 181 LEU n 
2 182 ASN n 
2 183 ASP n 
2 184 SER n 
2 185 ARG n 
2 186 TYR n 
2 187 CYS n 
2 188 LEU n 
2 189 SER n 
2 190 SER n 
2 191 ARG n 
2 192 LEU n 
2 193 ARG n 
2 194 VAL n 
2 195 SER n 
2 196 ALA n 
2 197 THR n 
2 198 PHE n 
2 199 TRP n 
2 200 GLN n 
2 201 ASN n 
2 202 PRO n 
2 203 ARG n 
2 204 ASN n 
2 205 HIS n 
2 206 PHE n 
2 207 ARG n 
2 208 CYS n 
2 209 GLN n 
2 210 VAL n 
2 211 GLN n 
2 212 PHE n 
2 213 TYR n 
2 214 GLY n 
2 215 LEU n 
2 216 SER n 
2 217 GLU n 
2 218 ASN n 
2 219 ASP n 
2 220 GLU n 
2 221 TRP n 
2 222 THR n 
2 223 GLN n 
2 224 ASP n 
2 225 ARG n 
2 226 ALA n 
2 227 LYS n 
2 228 PRO n 
2 229 VAL n 
2 230 THR n 
2 231 GLN n 
2 232 ILE n 
2 233 VAL n 
2 234 SER n 
2 235 ALA n 
2 236 GLU n 
2 237 ALA n 
2 238 TRP n 
2 239 GLY n 
2 240 ARG n 
2 241 ALA n 
2 242 ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP TCA_HUMAN 1 
;KTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLRD
AAVYYCILPLAGGTSYGKLTFGQGTILTVHPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTV
LDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESS
;
1 P01848 ? 
2 UNP TCB_HUMAN 2 
;GVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRT
QQEDSAVYLCASSLGQAYEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNG
KEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
D
;
1 P01850 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KGC D 2 ? 206 ? P01848 1 ? 205 ? 2 210 
2 2 1KGC E 2 ? 242 ? P01850 1 ? 241 ? 3 247 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1KGC MET D 1 ? UNP P01848 ? ? 'initiating met' 1 1 
2 1KGC MET E 1 ? UNP P01850 ? ? 'initiating met' 2 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1KGC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   50.67 
_exptl_crystal.density_Matthews      2.49 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2001-06-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-BM-D' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-BM-D 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_refine.entry_id                                 1KGC 
_refine.ls_number_reflns_obs                     75362 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            1.5 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2113 
_refine.ls_R_factor_R_free                       0.2337 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3485 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             686 
_refine_hist.number_atoms_total               4171 
_refine_hist.d_res_high                       1.5 
_refine_hist.d_res_low                        50.0 
# 
_struct.entry_id                  1KGC 
_struct.title                     'Immune Receptor' 
_struct.pdbx_descriptor           'T-cell receptor alpha chain/ T-cell receptor beta chain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KGC 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'T-cell receptor, LC13 clone, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 78  ? ALA A 82  ? THR D 81  ALA D 85  5 ? 5 
HELX_P HELX_P2 2 ARG A 165 ? ASP A 168 ? ARG D 169 ASP D 172 5 ? 4 
HELX_P HELX_P3 3 ALA A 184 ? PHE A 189 ? ALA D 188 PHE D 193 1 ? 6 
HELX_P HELX_P4 4 GLN B 82  ? SER B 86  ? GLN E 83  SER E 87  5 ? 5 
HELX_P HELX_P5 5 ASP B 114 ? VAL B 118 ? ASP E 119 VAL E 123 5 ? 5 
HELX_P HELX_P6 6 SER B 129 ? GLN B 137 ? SER E 134 GLN E 142 1 ? 9 
HELX_P HELX_P7 7 ALA B 196 ? GLN B 200 ? ALA E 201 GLN E 205 1 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 21  SG ? ? ? 1_555 A CYS 87  SG ? ? D CYS 22  D CYS 90  1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf2 disulf ? ? A CYS 135 SG ? ? ? 1_555 A CYS 185 SG ? ? D CYS 139 D CYS 189 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf3 disulf ? ? B CYS 22  SG ? ? ? 1_555 B CYS 91  SG ? ? E CYS 23  E CYS 92  1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf4 disulf ? ? B CYS 143 SG ? ? ? 1_555 B CYS 208 SG ? ? E CYS 148 E CYS 213 1_555 ? ? ? ? ? ? ? 2.017 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 6   B . ? SER 7   E PRO 7   B ? PRO 8   E 1 -0.38 
2 TYR 149 B . ? TYR 154 E PRO 150 B ? PRO 155 E 1 0.16  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 5 ? 
G ? 6 ? 
H ? 4 ? 
I ? 4 ? 
J ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 3   ? THR A 4   ? THR D 3   THR D 4   
A 2 VAL A 17  ? HIS A 23  ? VAL D 18  HIS D 24  
A 3 SER A 69  ? LEU A 74  ? SER D 72  LEU D 77  
A 4 ALA A 59  ? ILE A 63  ? ALA D 62  ILE D 66  
A 5 VAL A 54  ? ASN A 55  ? VAL D 55  ASN D 56  
B 1 SER A 8   ? ASN A 12  ? SER D 9   ASN D 13  
B 2 THR A 106 ? HIS A 111 ? THR D 110 HIS D 115 
B 3 ALA A 83  ? ILE A 88  ? ALA D 86  ILE D 91  
B 4 ILE A 32  ? GLN A 37  ? ILE D 32  GLN D 37  
B 5 GLU A 44  ? GLY A 49  ? GLU D 44  GLY D 49  
C 1 ALA A 120 ? GLN A 123 ? ALA D 124 GLN D 127 
C 2 SER A 133 ? THR A 138 ? SER D 137 THR D 142 
C 3 PHE A 169 ? SER A 178 ? PHE D 173 SER D 182 
C 4 TYR A 155 ? ILE A 156 ? TYR D 159 ILE D 160 
D 1 ALA A 120 ? GLN A 123 ? ALA D 124 GLN D 127 
D 2 SER A 133 ? THR A 138 ? SER D 137 THR D 142 
D 3 PHE A 169 ? SER A 178 ? PHE D 173 SER D 182 
D 4 THR A 160 ? MET A 164 ? THR D 164 MET D 168 
E 1 SER B 4   ? SER B 6   ? SER E 5   SER E 7   
E 2 VAL B 18  ? ASP B 23  ? VAL E 19  ASP E 24  
E 3 SER B 74  ? ILE B 78  ? SER E 75  ILE E 79  
E 4 PHE B 64  ? GLU B 67  ? PHE E 65  GLU E 68  
F 1 ALA B 52  ? ASP B 55  ? ALA E 53  ASP E 56  
F 2 GLU B 43  ? GLN B 49  ? GLU E 44  GLN E 50  
F 3 SER B 30  ? GLN B 36  ? SER E 31  GLN E 37  
F 4 ALA B 87  ? SER B 94  ? ALA E 88  SER E 95  
F 5 TYR B 102 ? PHE B 103 ? TYR E 107 PHE E 108 
G 1 ALA B 52  ? ASP B 55  ? ALA E 53  ASP E 56  
G 2 GLU B 43  ? GLN B 49  ? GLU E 44  GLN E 50  
G 3 SER B 30  ? GLN B 36  ? SER E 31  GLN E 37  
G 4 ALA B 87  ? SER B 94  ? ALA E 88  SER E 95  
G 5 THR B 107 ? THR B 112 ? THR E 112 THR E 117 
G 6 TYR B 9   ? LYS B 13  ? TYR E 10  LYS E 14  
H 1 GLU B 122 ? PHE B 126 ? GLU E 127 PHE E 131 
H 2 LYS B 138 ? PHE B 148 ? LYS E 143 PHE E 153 
H 3 TYR B 186 ? SER B 195 ? TYR E 191 SER E 200 
H 4 VAL B 168 ? THR B 170 ? VAL E 173 THR E 175 
I 1 GLU B 122 ? PHE B 126 ? GLU E 127 PHE E 131 
I 2 LYS B 138 ? PHE B 148 ? LYS E 143 PHE E 153 
I 3 TYR B 186 ? SER B 195 ? TYR E 191 SER E 200 
I 4 LEU B 175 ? LYS B 176 ? LEU E 180 LYS E 181 
J 1 LYS B 162 ? VAL B 164 ? LYS E 167 VAL E 169 
J 2 VAL B 153 ? VAL B 159 ? VAL E 158 VAL E 164 
J 3 HIS B 205 ? PHE B 212 ? HIS E 210 PHE E 217 
J 4 GLN B 231 ? TRP B 238 ? GLN E 236 TRP E 243 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 4   ? N THR D 4   O ASN A 22  ? O ASN D 23  
A 2 3 N LEU A 19  ? N LEU D 20  O LEU A 72  ? O LEU D 75  
A 3 4 O ILE A 73  ? O ILE D 76  N SER A 60  ? N SER D 63  
A 4 5 O LEU A 61  ? O LEU D 64  N VAL A 54  ? N VAL D 55  
B 1 2 N SER A 11  ? N SER D 12  O HIS A 111 ? O HIS D 115 
B 2 3 O LEU A 108 ? O LEU D 112 N ALA A 83  ? N ALA D 86  
B 3 4 O ILE A 88  ? O ILE D 91  N HIS A 33  ? N HIS D 33  
B 4 5 N TRP A 34  ? N TRP D 34  O ILE A 47  ? O ILE D 47  
C 1 2 N TYR A 122 ? N TYR D 126 O LEU A 136 ? O LEU D 140 
C 2 3 N CYS A 135 ? N CYS D 139 O ALA A 176 ? O ALA D 180 
C 3 4 O TRP A 177 ? O TRP D 181 N TYR A 155 ? N TYR D 159 
D 1 2 N TYR A 122 ? N TYR D 126 O LEU A 136 ? O LEU D 140 
D 2 3 N CYS A 135 ? N CYS D 139 O ALA A 176 ? O ALA D 180 
D 3 4 O PHE A 169 ? O PHE D 173 N MET A 164 ? N MET D 168 
E 1 2 N SER B 6   ? N SER E 7   O ARG B 21  ? O ARG E 22  
E 2 3 N LEU B 20  ? N LEU E 21  O LEU B 76  ? O LEU E 77  
E 3 4 O LYS B 77  ? O LYS E 78  N PHE B 65  ? N PHE E 66  
F 1 2 O ALA B 52  ? O ALA E 53  N GLN B 49  ? N GLN E 50  
F 2 3 O LEU B 45  ? O LEU E 46  N TRP B 33  ? N TRP E 34  
F 3 4 N PHE B 32  ? N PHE E 33  O ALA B 92  ? O ALA E 93  
F 4 5 N SER B 93  ? N SER E 94  O TYR B 102 ? O TYR E 107 
G 1 2 O ALA B 52  ? O ALA E 53  N GLN B 49  ? N GLN E 50  
G 2 3 O LEU B 45  ? O LEU E 46  N TRP B 33  ? N TRP E 34  
G 3 4 N PHE B 32  ? N PHE E 33  O ALA B 92  ? O ALA E 93  
G 4 5 N ALA B 87  ? N ALA E 88  O LEU B 109 ? O LEU E 114 
G 5 6 O THR B 112 ? O THR E 117 N ALA B 12  ? N ALA E 13  
H 1 2 N PHE B 126 ? N PHE E 131 O VAL B 142 ? O VAL E 147 
H 2 3 N ALA B 145 ? N ALA E 150 O LEU B 188 ? O LEU E 193 
H 3 4 O ARG B 191 ? O ARG E 196 N SER B 169 ? N SER E 174 
I 1 2 N PHE B 126 ? N PHE E 131 O VAL B 142 ? O VAL E 147 
I 2 3 N ALA B 145 ? N ALA E 150 O LEU B 188 ? O LEU E 193 
J 1 2 O LYS B 162 ? O LYS E 167 N VAL B 159 ? N VAL E 164 
J 2 3 N SER B 156 ? N SER E 161 O GLN B 209 ? O GLN E 214 
J 3 4 N PHE B 212 ? N PHE E 217 O GLN B 231 ? O GLN E 236 
# 
_database_PDB_matrix.entry_id          1KGC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KGC 
_atom_sites.fract_transf_matrix[1][1]   0.021836 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014682 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006231 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 2   ? 25.562  -12.342 56.213 1.00 34.16 ? 2   LYS D N   1 
ATOM   2    C CA  . LYS A 1 2   ? 25.233  -11.129 57.014 1.00 32.06 ? 2   LYS D CA  1 
ATOM   3    C C   . LYS A 1 2   ? 25.535  -9.839  56.255 1.00 29.46 ? 2   LYS D C   1 
ATOM   4    O O   . LYS A 1 2   ? 26.575  -9.709  55.611 1.00 31.09 ? 2   LYS D O   1 
ATOM   5    C CB  . LYS A 1 2   ? 26.013  -11.141 58.332 1.00 34.81 ? 2   LYS D CB  1 
ATOM   6    C CG  . LYS A 1 2   ? 25.888  -9.862  59.144 1.00 38.04 ? 2   LYS D CG  1 
ATOM   7    C CD  . LYS A 1 2   ? 24.437  -9.545  59.485 1.00 40.30 ? 2   LYS D CD  1 
ATOM   8    C CE  . LYS A 1 2   ? 24.327  -8.232  60.248 1.00 40.20 ? 2   LYS D CE  1 
ATOM   9    N NZ  . LYS A 1 2   ? 22.922  -7.919  60.632 1.00 41.61 ? 2   LYS D NZ  1 
ATOM   10   N N   . THR A 1 3   ? 24.610  -8.889  56.335 1.00 25.09 ? 3   THR D N   1 
ATOM   11   C CA  . THR A 1 3   ? 24.769  -7.603  55.670 1.00 20.66 ? 3   THR D CA  1 
ATOM   12   C C   . THR A 1 3   ? 24.343  -6.496  56.623 1.00 19.03 ? 3   THR D C   1 
ATOM   13   O O   . THR A 1 3   ? 23.649  -6.742  57.607 1.00 17.94 ? 3   THR D O   1 
ATOM   14   C CB  . THR A 1 3   ? 23.870  -7.481  54.416 1.00 20.37 ? 3   THR D CB  1 
ATOM   15   O OG1 . THR A 1 3   ? 22.494  -7.454  54.823 1.00 21.98 ? 3   THR D OG1 1 
ATOM   16   C CG2 . THR A 1 3   ? 24.098  -8.650  53.463 1.00 21.33 ? 3   THR D CG2 1 
ATOM   17   N N   . THR A 1 4   ? 24.781  -5.276  56.337 1.00 17.02 ? 4   THR D N   1 
ATOM   18   C CA  . THR A 1 4   ? 24.388  -4.130  57.141 1.00 15.96 ? 4   THR D CA  1 
ATOM   19   C C   . THR A 1 4   ? 24.063  -2.986  56.198 1.00 15.23 ? 4   THR D C   1 
ATOM   20   O O   . THR A 1 4   ? 24.629  -2.880  55.107 1.00 15.91 ? 4   THR D O   1 
ATOM   21   C CB  . THR A 1 4   ? 25.485  -3.675  58.132 1.00 16.12 ? 4   THR D CB  1 
ATOM   22   O OG1 . THR A 1 4   ? 26.663  -3.292  57.415 1.00 17.90 ? 4   THR D OG1 1 
ATOM   23   C CG2 . THR A 1 4   ? 25.810  -4.793  59.116 1.00 17.46 ? 4   THR D CG2 1 
ATOM   24   N N   . GLN A 1 5   ? 23.138  -2.140  56.628 1.00 15.13 ? 5   GLN D N   1 
ATOM   25   C CA  . GLN A 1 5   ? 22.685  -1.003  55.845 1.00 14.32 ? 5   GLN D CA  1 
ATOM   26   C C   . GLN A 1 5   ? 22.453  0.162   56.785 1.00 14.68 ? 5   GLN D C   1 
ATOM   27   O O   . GLN A 1 5   ? 22.270  -0.035  57.990 1.00 15.88 ? 5   GLN D O   1 
ATOM   28   C CB  . GLN A 1 5   ? 21.344  -1.320  55.180 1.00 14.59 ? 5   GLN D CB  1 
ATOM   29   C CG  . GLN A 1 5   ? 21.329  -2.496  54.220 1.00 14.09 ? 5   GLN D CG  1 
ATOM   30   C CD  . GLN A 1 5   ? 19.906  -2.904  53.858 1.00 14.01 ? 5   GLN D CD  1 
ATOM   31   O OE1 . GLN A 1 5   ? 19.435  -3.974  54.257 1.00 13.95 ? 5   GLN D OE1 1 
ATOM   32   N NE2 . GLN A 1 5   ? 19.210  -2.045  53.114 1.00 13.44 ? 5   GLN D NE2 1 
ATOM   33   N N   . PRO A 1 6   ? 22.462  1.393   56.251 1.00 15.37 ? 7   PRO D N   1 
ATOM   34   C CA  . PRO A 1 6   ? 22.221  2.544   57.124 1.00 15.85 ? 7   PRO D CA  1 
ATOM   35   C C   . PRO A 1 6   ? 20.797  2.390   57.661 1.00 15.22 ? 7   PRO D C   1 
ATOM   36   O O   . PRO A 1 6   ? 19.942  1.795   57.001 1.00 15.79 ? 7   PRO D O   1 
ATOM   37   C CB  . PRO A 1 6   ? 22.387  3.743   56.186 1.00 15.56 ? 7   PRO D CB  1 
ATOM   38   C CG  . PRO A 1 6   ? 22.121  3.192   54.831 1.00 18.31 ? 7   PRO D CG  1 
ATOM   39   C CD  . PRO A 1 6   ? 22.733  1.816   54.866 1.00 15.51 ? 7   PRO D CD  1 
ATOM   40   N N   . ASN A 1 7   ? 20.541  2.906   58.857 1.00 16.17 ? 8   ASN D N   1 
ATOM   41   C CA  . ASN A 1 7   ? 19.222  2.767   59.458 1.00 16.96 ? 8   ASN D CA  1 
ATOM   42   C C   . ASN A 1 7   ? 18.105  3.412   58.648 1.00 16.96 ? 8   ASN D C   1 
ATOM   43   O O   . ASN A 1 7   ? 17.005  2.863   58.538 1.00 16.13 ? 8   ASN D O   1 
ATOM   44   C CB  . ASN A 1 7   ? 19.230  3.344   60.877 1.00 19.98 ? 8   ASN D CB  1 
ATOM   45   C CG  . ASN A 1 7   ? 20.288  2.703   61.755 1.00 23.84 ? 8   ASN D CG  1 
ATOM   46   O OD1 . ASN A 1 7   ? 20.485  1.489   61.717 1.00 26.92 ? 8   ASN D OD1 1 
ATOM   47   N ND2 . ASN A 1 7   ? 20.967  3.515   62.558 1.00 26.84 ? 8   ASN D ND2 1 
ATOM   48   N N   . SER A 1 8   ? 18.391  4.570   58.071 1.00 17.47 ? 9   SER D N   1 
ATOM   49   C CA  . SER A 1 8   ? 17.392  5.284   57.295 1.00 16.88 ? 9   SER D CA  1 
ATOM   50   C C   . SER A 1 8   ? 18.037  6.141   56.221 1.00 16.79 ? 9   SER D C   1 
ATOM   51   O O   . SER A 1 8   ? 19.255  6.337   56.207 1.00 17.80 ? 9   SER D O   1 
ATOM   52   C CB  . SER A 1 8   ? 16.560  6.172   58.224 1.00 18.32 ? 9   SER D CB  1 
ATOM   53   O OG  . SER A 1 8   ? 17.390  7.102   58.906 1.00 19.47 ? 9   SER D OG  1 
ATOM   54   N N   . MET A 1 9   ? 17.208  6.647   55.317 1.00 16.02 ? 10  MET D N   1 
ATOM   55   C CA  . MET A 1 9   ? 17.682  7.500   54.243 1.00 16.72 ? 10  MET D CA  1 
ATOM   56   C C   . MET A 1 9   ? 16.535  8.381   53.780 1.00 16.96 ? 10  MET D C   1 
ATOM   57   O O   . MET A 1 9   ? 15.380  7.947   53.763 1.00 15.89 ? 10  MET D O   1 
ATOM   58   C CB  . MET A 1 9   ? 18.180  6.656   53.077 1.00 18.22 ? 10  MET D CB  1 
ATOM   59   C CG  . MET A 1 9   ? 18.912  7.454   52.024 1.00 21.02 ? 10  MET D CG  1 
ATOM   60   S SD  . MET A 1 9   ? 19.463  6.389   50.707 1.00 24.25 ? 10  MET D SD  1 
ATOM   61   C CE  . MET A 1 9   ? 20.583  5.346   51.549 1.00 23.10 ? 10  MET D CE  1 
ATOM   62   N N   . GLU A 1 10  ? 16.857  9.616   53.414 1.00 17.55 ? 11  GLU D N   1 
ATOM   63   C CA  . GLU A 1 10  ? 15.855  10.565  52.944 1.00 18.44 ? 11  GLU D CA  1 
ATOM   64   C C   . GLU A 1 10  ? 16.143  10.925  51.494 1.00 19.14 ? 11  GLU D C   1 
ATOM   65   O O   . GLU A 1 10  ? 17.303  11.033  51.095 1.00 20.78 ? 11  GLU D O   1 
ATOM   66   C CB  . GLU A 1 10  ? 15.898  11.850  53.781 1.00 20.13 ? 11  GLU D CB  1 
ATOM   67   C CG  . GLU A 1 10  ? 16.013  11.623  55.275 1.00 22.78 ? 11  GLU D CG  1 
ATOM   68   C CD  . GLU A 1 10  ? 14.830  10.872  55.847 1.00 25.00 ? 11  GLU D CD  1 
ATOM   69   O OE1 . GLU A 1 10  ? 15.050  9.994   56.710 1.00 24.68 ? 11  GLU D OE1 1 
ATOM   70   O OE2 . GLU A 1 10  ? 13.684  11.165  55.444 1.00 26.33 ? 11  GLU D OE2 1 
ATOM   71   N N   . SER A 1 11  ? 15.089  11.105  50.706 1.00 17.57 ? 12  SER D N   1 
ATOM   72   C CA  . SER A 1 11  ? 15.240  11.492  49.310 1.00 18.94 ? 12  SER D CA  1 
ATOM   73   C C   . SER A 1 11  ? 14.020  12.307  48.898 1.00 19.52 ? 12  SER D C   1 
ATOM   74   O O   . SER A 1 11  ? 12.979  12.254  49.555 1.00 18.61 ? 12  SER D O   1 
ATOM   75   C CB  . SER A 1 11  ? 15.368  10.261  48.407 1.00 21.10 ? 12  SER D CB  1 
ATOM   76   O OG  . SER A 1 11  ? 14.144  9.555   48.320 1.00 25.44 ? 12  SER D OG  1 
ATOM   77   N N   . ASN A 1 12  ? 14.160  13.080  47.828 1.00 20.13 ? 13  ASN D N   1 
ATOM   78   C CA  . ASN A 1 12  ? 13.053  13.886  47.325 1.00 20.56 ? 13  ASN D CA  1 
ATOM   79   C C   . ASN A 1 12  ? 12.472  13.194  46.102 1.00 20.35 ? 13  ASN D C   1 
ATOM   80   O O   . ASN A 1 12  ? 13.184  12.500  45.374 1.00 19.67 ? 13  ASN D O   1 
ATOM   81   C CB  . ASN A 1 12  ? 13.521  15.290  46.924 1.00 22.67 ? 13  ASN D CB  1 
ATOM   82   C CG  . ASN A 1 12  ? 14.021  16.103  48.098 1.00 26.32 ? 13  ASN D CG  1 
ATOM   83   O OD1 . ASN A 1 12  ? 13.584  15.921  49.233 1.00 28.05 ? 13  ASN D OD1 1 
ATOM   84   N ND2 . ASN A 1 12  ? 14.934  17.026  47.823 1.00 30.69 ? 13  ASN D ND2 1 
ATOM   85   N N   . GLU A 1 13  ? 11.179  13.378  45.868 1.00 21.23 ? 14  GLU D N   1 
ATOM   86   C CA  . GLU A 1 13  ? 10.545  12.755  44.716 1.00 23.52 ? 14  GLU D CA  1 
ATOM   87   C C   . GLU A 1 13  ? 11.287  13.148  43.437 1.00 24.09 ? 14  GLU D C   1 
ATOM   88   O O   . GLU A 1 13  ? 11.835  14.246  43.341 1.00 24.24 ? 14  GLU D O   1 
ATOM   89   C CB  . GLU A 1 13  ? 9.061   13.154  44.639 1.00 24.99 ? 14  GLU D CB  1 
ATOM   90   C CG  . GLU A 1 13  ? 8.778   14.637  44.417 1.00 28.41 ? 14  GLU D CG  1 
ATOM   91   C CD  . GLU A 1 13  ? 7.294   14.975  44.550 1.00 29.96 ? 14  GLU D CD  1 
ATOM   92   O OE1 . GLU A 1 13  ? 6.459   14.053  44.406 1.00 31.66 ? 14  GLU D OE1 1 
ATOM   93   O OE2 . GLU A 1 13  ? 6.959   16.159  44.788 1.00 25.51 ? 14  GLU D OE2 1 
ATOM   94   N N   . GLU A 1 14  ? 11.320  12.227  42.477 1.00 26.13 ? 15  GLU D N   1 
ATOM   95   C CA  . GLU A 1 14  ? 11.985  12.429  41.186 1.00 27.46 ? 15  GLU D CA  1 
ATOM   96   C C   . GLU A 1 14  ? 13.500  12.240  41.195 1.00 27.59 ? 15  GLU D C   1 
ATOM   97   O O   . GLU A 1 14  ? 14.116  12.102  40.138 1.00 29.75 ? 15  GLU D O   1 
ATOM   98   C CB  . GLU A 1 14  ? 11.656  13.814  40.615 1.00 30.43 ? 15  GLU D CB  1 
ATOM   99   C CG  . GLU A 1 14  ? 10.263  13.927  40.029 1.00 34.65 ? 15  GLU D CG  1 
ATOM   100  C CD  . GLU A 1 14  ? 10.036  15.248  39.316 1.00 37.70 ? 15  GLU D CD  1 
ATOM   101  O OE1 . GLU A 1 14  ? 10.895  15.638  38.495 1.00 39.50 ? 15  GLU D OE1 1 
ATOM   102  O OE2 . GLU A 1 14  ? 8.996   15.893  39.570 1.00 38.29 ? 15  GLU D OE2 1 
ATOM   103  N N   . GLU A 1 15  ? 14.107  12.237  42.376 1.00 27.23 ? 16  GLU D N   1 
ATOM   104  C CA  . GLU A 1 15  ? 15.552  12.055  42.466 1.00 27.12 ? 16  GLU D CA  1 
ATOM   105  C C   . GLU A 1 15  ? 15.910  10.575  42.415 1.00 26.53 ? 16  GLU D C   1 
ATOM   106  O O   . GLU A 1 15  ? 15.103  9.715   42.779 1.00 24.69 ? 16  GLU D O   1 
ATOM   107  C CB  . GLU A 1 15  ? 16.104  12.607  43.787 1.00 29.36 ? 16  GLU D CB  1 
ATOM   108  C CG  . GLU A 1 15  ? 15.862  14.077  44.084 1.00 32.79 ? 16  GLU D CG  1 
ATOM   109  C CD  . GLU A 1 15  ? 16.544  14.507  45.378 1.00 36.43 ? 16  GLU D CD  1 
ATOM   110  O OE1 . GLU A 1 15  ? 16.378  13.806  46.400 1.00 36.76 ? 16  GLU D OE1 1 
ATOM   111  O OE2 . GLU A 1 15  ? 17.248  15.540  45.381 1.00 38.96 ? 16  GLU D OE2 1 
ATOM   112  N N   . PRO A 1 16  ? 17.120  10.255  41.932 1.00 26.08 ? 17  PRO D N   1 
ATOM   113  C CA  . PRO A 1 16  ? 17.498  8.844   41.898 1.00 23.70 ? 17  PRO D CA  1 
ATOM   114  C C   . PRO A 1 16  ? 17.907  8.571   43.345 1.00 20.89 ? 17  PRO D C   1 
ATOM   115  O O   . PRO A 1 16  ? 18.229  9.509   44.080 1.00 20.79 ? 17  PRO D O   1 
ATOM   116  C CB  . PRO A 1 16  ? 18.687  8.829   40.943 1.00 24.92 ? 17  PRO D CB  1 
ATOM   117  C CG  . PRO A 1 16  ? 19.335  10.159  41.207 1.00 27.19 ? 17  PRO D CG  1 
ATOM   118  C CD  . PRO A 1 16  ? 18.140  11.095  41.279 1.00 26.51 ? 17  PRO D CD  1 
ATOM   119  N N   . VAL A 1 17  ? 17.882  7.314   43.761 1.00 18.93 ? 18  VAL D N   1 
ATOM   120  C CA  . VAL A 1 17  ? 18.253  6.972   45.129 1.00 17.11 ? 18  VAL D CA  1 
ATOM   121  C C   . VAL A 1 17  ? 19.236  5.817   45.126 1.00 16.11 ? 18  VAL D C   1 
ATOM   122  O O   . VAL A 1 17  ? 19.010  4.810   44.461 1.00 17.12 ? 18  VAL D O   1 
ATOM   123  C CB  . VAL A 1 17  ? 17.023  6.534   45.958 1.00 17.31 ? 18  VAL D CB  1 
ATOM   124  C CG1 . VAL A 1 17  ? 17.444  6.214   47.392 1.00 18.74 ? 18  VAL D CG1 1 
ATOM   125  C CG2 . VAL A 1 17  ? 15.969  7.623   45.942 1.00 18.16 ? 18  VAL D CG2 1 
ATOM   126  N N   . HIS A 1 18  ? 20.323  5.969   45.873 1.00 14.60 ? 19  HIS D N   1 
ATOM   127  C CA  . HIS A 1 18  ? 21.334  4.924   45.985 1.00 13.95 ? 19  HIS D CA  1 
ATOM   128  C C   . HIS A 1 18  ? 21.291  4.371   47.406 1.00 13.96 ? 19  HIS D C   1 
ATOM   129  O O   . HIS A 1 18  ? 21.686  5.049   48.349 1.00 14.77 ? 19  HIS D O   1 
ATOM   130  C CB  . HIS A 1 18  ? 22.730  5.491   45.690 1.00 15.56 ? 19  HIS D CB  1 
ATOM   131  C CG  . HIS A 1 18  ? 22.952  5.823   44.247 1.00 18.08 ? 19  HIS D CG  1 
ATOM   132  N ND1 . HIS A 1 18  ? 22.201  6.763   43.576 1.00 22.10 ? 19  HIS D ND1 1 
ATOM   133  C CD2 . HIS A 1 18  ? 23.821  5.318   43.340 1.00 19.57 ? 19  HIS D CD2 1 
ATOM   134  C CE1 . HIS A 1 18  ? 22.596  6.821   42.316 1.00 20.98 ? 19  HIS D CE1 1 
ATOM   135  N NE2 . HIS A 1 18  ? 23.577  5.953   42.147 1.00 22.20 ? 19  HIS D NE2 1 
ATOM   136  N N   . LEU A 1 19  ? 20.794  3.145   47.553 1.00 11.94 ? 20  LEU D N   1 
ATOM   137  C CA  . LEU A 1 19  ? 20.698  2.495   48.861 1.00 13.26 ? 20  LEU D CA  1 
ATOM   138  C C   . LEU A 1 19  ? 21.881  1.531   49.004 1.00 12.46 ? 20  LEU D C   1 
ATOM   139  O O   . LEU A 1 19  ? 21.931  0.498   48.341 1.00 12.39 ? 20  LEU D O   1 
ATOM   140  C CB  . LEU A 1 19  ? 19.368  1.739   48.946 1.00 14.66 ? 20  LEU D CB  1 
ATOM   141  C CG  . LEU A 1 19  ? 18.137  2.642   48.801 1.00 15.14 ? 20  LEU D CG  1 
ATOM   142  C CD1 . LEU A 1 19  ? 16.916  1.825   48.378 1.00 18.43 ? 20  LEU D CD1 1 
ATOM   143  C CD2 . LEU A 1 19  ? 17.880  3.352   50.115 1.00 19.06 ? 20  LEU D CD2 1 
ATOM   144  N N   . PRO A 1 20  ? 22.845  1.855   49.883 1.00 13.13 ? 21  PRO D N   1 
ATOM   145  C CA  . PRO A 1 20  ? 24.027  1.017   50.092 1.00 13.87 ? 21  PRO D CA  1 
ATOM   146  C C   . PRO A 1 20  ? 23.888  -0.168  51.039 1.00 13.77 ? 21  PRO D C   1 
ATOM   147  O O   . PRO A 1 20  ? 23.058  -0.177  51.948 1.00 14.19 ? 21  PRO D O   1 
ATOM   148  C CB  . PRO A 1 20  ? 25.056  2.018   50.589 1.00 14.66 ? 21  PRO D CB  1 
ATOM   149  C CG  . PRO A 1 20  ? 24.224  2.874   51.479 1.00 14.05 ? 21  PRO D CG  1 
ATOM   150  C CD  . PRO A 1 20  ? 22.971  3.116   50.639 1.00 14.08 ? 21  PRO D CD  1 
ATOM   151  N N   . CYS A 1 21  ? 24.750  -1.153  50.821 1.00 13.58 ? 22  CYS D N   1 
ATOM   152  C CA  . CYS A 1 21  ? 24.762  -2.372  51.609 1.00 13.60 ? 22  CYS D CA  1 
ATOM   153  C C   . CYS A 1 21  ? 26.195  -2.861  51.802 1.00 15.44 ? 22  CYS D C   1 
ATOM   154  O O   . CYS A 1 21  ? 26.966  -2.912  50.841 1.00 15.41 ? 22  CYS D O   1 
ATOM   155  C CB  . CYS A 1 21  ? 23.963  -3.431  50.863 1.00 14.26 ? 22  CYS D CB  1 
ATOM   156  S SG  . CYS A 1 21  ? 23.796  -5.034  51.696 1.00 18.71 ? 22  CYS D SG  1 
ATOM   157  N N   . ASN A 1 22  ? 26.547  -3.211  53.039 1.00 15.04 ? 23  ASN D N   1 
ATOM   158  C CA  . ASN A 1 22  ? 27.877  -3.728  53.350 1.00 16.95 ? 23  ASN D CA  1 
ATOM   159  C C   . ASN A 1 22  ? 27.779  -5.232  53.593 1.00 19.05 ? 23  ASN D C   1 
ATOM   160  O O   . ASN A 1 22  ? 26.793  -5.711  54.150 1.00 17.29 ? 23  ASN D O   1 
ATOM   161  C CB  . ASN A 1 22  ? 28.436  -3.113  54.633 1.00 17.35 ? 23  ASN D CB  1 
ATOM   162  C CG  . ASN A 1 22  ? 28.360  -1.609  54.653 1.00 18.84 ? 23  ASN D CG  1 
ATOM   163  O OD1 . ASN A 1 22  ? 28.999  -0.928  53.850 1.00 16.89 ? 23  ASN D OD1 1 
ATOM   164  N ND2 . ASN A 1 22  ? 27.585  -1.076  55.588 1.00 18.34 ? 23  ASN D ND2 1 
ATOM   165  N N   . HIS A 1 23  ? 28.809  -5.964  53.193 1.00 19.37 ? 24  HIS D N   1 
ATOM   166  C CA  . HIS A 1 23  ? 28.844  -7.405  53.404 1.00 22.22 ? 24  HIS D CA  1 
ATOM   167  C C   . HIS A 1 23  ? 30.258  -7.941  53.223 1.00 24.02 ? 24  HIS D C   1 
ATOM   168  O O   . HIS A 1 23  ? 31.113  -7.268  52.650 1.00 26.00 ? 24  HIS D O   1 
ATOM   169  C CB  . HIS A 1 23  ? 27.864  -8.115  52.455 1.00 19.79 ? 24  HIS D CB  1 
ATOM   170  C CG  . HIS A 1 23  ? 27.901  -7.616  51.040 1.00 19.18 ? 24  HIS D CG  1 
ATOM   171  N ND1 . HIS A 1 23  ? 28.943  -7.884  50.178 1.00 19.27 ? 24  HIS D ND1 1 
ATOM   172  C CD2 . HIS A 1 23  ? 27.012  -6.876  50.335 1.00 18.09 ? 24  HIS D CD2 1 
ATOM   173  C CE1 . HIS A 1 23  ? 28.692  -7.333  49.003 1.00 19.56 ? 24  HIS D CE1 1 
ATOM   174  N NE2 . HIS A 1 23  ? 27.527  -6.715  49.072 1.00 20.07 ? 24  HIS D NE2 1 
ATOM   175  N N   . SER A 1 24  ? 30.516  -9.134  53.751 1.00 26.81 ? 25  SER D N   1 
ATOM   176  C CA  . SER A 1 24  ? 31.831  -9.744  53.606 1.00 28.75 ? 25  SER D CA  1 
ATOM   177  C C   . SER A 1 24  ? 32.009  -10.020 52.117 1.00 29.78 ? 25  SER D C   1 
ATOM   178  O O   . SER A 1 24  ? 31.027  -10.079 51.377 1.00 30.58 ? 25  SER D O   1 
ATOM   179  C CB  . SER A 1 24  ? 31.905  -11.055 54.392 1.00 28.85 ? 25  SER D CB  1 
ATOM   180  O OG  . SER A 1 24  ? 31.661  -10.837 55.773 1.00 32.97 ? 25  SER D OG  1 
ATOM   181  N N   . THR A 1 25  ? 33.253  -10.181 51.676 1.00 29.73 ? 26  THR D N   1 
ATOM   182  C CA  . THR A 1 25  ? 33.520  -10.445 50.266 1.00 30.60 ? 26  THR D CA  1 
ATOM   183  C C   . THR A 1 25  ? 32.692  -11.627 49.771 1.00 30.60 ? 26  THR D C   1 
ATOM   184  O O   . THR A 1 25  ? 32.783  -12.728 50.313 1.00 31.04 ? 26  THR D O   1 
ATOM   185  C CB  . THR A 1 25  ? 35.013  -10.760 50.022 1.00 30.21 ? 26  THR D CB  1 
ATOM   186  O OG1 . THR A 1 25  ? 35.811  -9.632  50.402 1.00 32.59 ? 26  THR D OG1 1 
ATOM   187  C CG2 . THR A 1 25  ? 35.257  -11.068 48.551 1.00 31.46 ? 26  THR D CG2 1 
ATOM   188  N N   . ILE A 1 26  ? 31.884  -11.395 48.742 1.00 30.84 ? 27  ILE D N   1 
ATOM   189  C CA  . ILE A 1 26  ? 31.052  -12.453 48.185 1.00 30.76 ? 27  ILE D CA  1 
ATOM   190  C C   . ILE A 1 26  ? 31.674  -13.007 46.908 1.00 31.18 ? 27  ILE D C   1 
ATOM   191  O O   . ILE A 1 26  ? 32.229  -12.261 46.099 1.00 29.72 ? 27  ILE D O   1 
ATOM   192  C CB  . ILE A 1 26  ? 29.628  -11.949 47.877 1.00 31.41 ? 27  ILE D CB  1 
ATOM   193  C CG1 . ILE A 1 26  ? 29.683  -10.771 46.903 1.00 31.28 ? 27  ILE D CG1 1 
ATOM   194  C CG2 . ILE A 1 26  ? 28.942  -11.532 49.165 1.00 31.78 ? 27  ILE D CG2 1 
ATOM   195  C CD1 . ILE A 1 26  ? 28.319  -10.245 46.507 1.00 32.27 ? 27  ILE D CD1 1 
ATOM   196  N N   . SER A 1 27  ? 31.578  -14.322 46.739 1.00 31.66 ? 28  SER D N   1 
ATOM   197  C CA  . SER A 1 27  ? 32.138  -14.994 45.573 1.00 31.49 ? 28  SER D CA  1 
ATOM   198  C C   . SER A 1 27  ? 31.429  -14.579 44.292 1.00 31.25 ? 28  SER D C   1 
ATOM   199  O O   . SER A 1 27  ? 30.332  -14.018 44.329 1.00 31.72 ? 28  SER D O   1 
ATOM   200  C CB  . SER A 1 27  ? 32.034  -16.512 45.733 1.00 32.24 ? 28  SER D CB  1 
ATOM   201  O OG  . SER A 1 27  ? 30.683  -16.936 45.684 1.00 34.62 ? 28  SER D OG  1 
ATOM   202  N N   . GLY A 1 28  ? 32.062  -14.869 43.159 1.00 29.51 ? 29  GLY D N   1 
ATOM   203  C CA  . GLY A 1 28  ? 31.485  -14.528 41.875 1.00 28.72 ? 29  GLY D CA  1 
ATOM   204  C C   . GLY A 1 28  ? 30.232  -15.327 41.574 1.00 29.26 ? 29  GLY D C   1 
ATOM   205  O O   . GLY A 1 28  ? 29.573  -15.098 40.559 1.00 28.62 ? 29  GLY D O   1 
ATOM   206  N N   . THR A 1 29  ? 29.898  -16.267 42.452 1.00 29.72 ? 30  THR D N   1 
ATOM   207  C CA  . THR A 1 29  ? 28.708  -17.086 42.264 1.00 30.59 ? 30  THR D CA  1 
ATOM   208  C C   . THR A 1 29  ? 27.605  -16.759 43.272 1.00 31.37 ? 30  THR D C   1 
ATOM   209  O O   . THR A 1 29  ? 26.506  -17.309 43.192 1.00 32.36 ? 30  THR D O   1 
ATOM   210  C CB  . THR A 1 29  ? 29.039  -18.591 42.359 1.00 30.81 ? 30  THR D CB  1 
ATOM   211  O OG1 . THR A 1 29  ? 29.762  -18.849 43.569 1.00 32.68 ? 30  THR D OG1 1 
ATOM   212  C CG2 . THR A 1 29  ? 29.874  -19.028 41.161 1.00 31.21 ? 30  THR D CG2 1 
ATOM   213  N N   . ASP A 1 30  A 27.898  -15.867 44.216 1.00 30.54 ? 30  ASP D N   1 
ATOM   214  C CA  . ASP A 1 30  A 26.910  -15.467 45.217 1.00 29.35 ? 30  ASP D CA  1 
ATOM   215  C C   . ASP A 1 30  A 26.020  -14.347 44.678 1.00 27.63 ? 30  ASP D C   1 
ATOM   216  O O   . ASP A 1 30  A 26.494  -13.456 43.971 1.00 27.81 ? 30  ASP D O   1 
ATOM   217  C CB  . ASP A 1 30  A 27.592  -14.973 46.500 1.00 31.58 ? 30  ASP D CB  1 
ATOM   218  C CG  . ASP A 1 30  A 28.291  -16.082 47.262 1.00 33.97 ? 30  ASP D CG  1 
ATOM   219  O OD1 . ASP A 1 30  A 27.714  -17.183 47.382 1.00 35.46 ? 30  ASP D OD1 1 
ATOM   220  O OD2 . ASP A 1 30  A 29.413  -15.844 47.761 1.00 35.57 ? 30  ASP D OD2 1 
ATOM   221  N N   . TYR A 1 31  ? 24.735  -14.393 45.020 1.00 24.97 ? 31  TYR D N   1 
ATOM   222  C CA  . TYR A 1 31  ? 23.784  -13.374 44.582 1.00 23.76 ? 31  TYR D CA  1 
ATOM   223  C C   . TYR A 1 31  ? 23.383  -12.432 45.704 1.00 20.81 ? 31  TYR D C   1 
ATOM   224  O O   . TYR A 1 31  ? 23.375  -12.813 46.873 1.00 21.85 ? 31  TYR D O   1 
ATOM   225  C CB  . TYR A 1 31  ? 22.489  -14.003 44.067 1.00 24.98 ? 31  TYR D CB  1 
ATOM   226  C CG  . TYR A 1 31  ? 22.590  -14.740 42.762 1.00 26.91 ? 31  TYR D CG  1 
ATOM   227  C CD1 . TYR A 1 31  ? 23.160  -16.009 42.695 1.00 28.28 ? 31  TYR D CD1 1 
ATOM   228  C CD2 . TYR A 1 31  ? 22.080  -14.181 41.594 1.00 28.02 ? 31  TYR D CD2 1 
ATOM   229  C CE1 . TYR A 1 31  ? 23.214  -16.705 41.495 1.00 28.84 ? 31  TYR D CE1 1 
ATOM   230  C CE2 . TYR A 1 31  ? 22.130  -14.865 40.390 1.00 30.17 ? 31  TYR D CE2 1 
ATOM   231  C CZ  . TYR A 1 31  ? 22.695  -16.125 40.347 1.00 29.66 ? 31  TYR D CZ  1 
ATOM   232  O OH  . TYR A 1 31  ? 22.732  -16.804 39.156 1.00 30.83 ? 31  TYR D OH  1 
ATOM   233  N N   . ILE A 1 32  ? 23.045  -11.203 45.328 1.00 20.48 ? 32  ILE D N   1 
ATOM   234  C CA  . ILE A 1 32  ? 22.570  -10.197 46.270 1.00 17.38 ? 32  ILE D CA  1 
ATOM   235  C C   . ILE A 1 32  ? 21.097  -10.002 45.908 1.00 16.11 ? 32  ILE D C   1 
ATOM   236  O O   . ILE A 1 32  ? 20.758  -9.852  44.733 1.00 15.68 ? 32  ILE D O   1 
ATOM   237  C CB  . ILE A 1 32  ? 23.321  -8.845  46.103 1.00 19.48 ? 32  ILE D CB  1 
ATOM   238  C CG1 . ILE A 1 32  ? 24.691  -8.917  46.778 1.00 21.03 ? 32  ILE D CG1 1 
ATOM   239  C CG2 . ILE A 1 32  ? 22.499  -7.705  46.697 1.00 20.96 ? 32  ILE D CG2 1 
ATOM   240  C CD1 . ILE A 1 32  ? 24.631  -9.054  48.293 1.00 24.29 ? 32  ILE D CD1 1 
ATOM   241  N N   . HIS A 1 33  ? 20.222  -10.040 46.909 1.00 13.79 ? 33  HIS D N   1 
ATOM   242  C CA  . HIS A 1 33  ? 18.793  -9.857  46.675 1.00 14.13 ? 33  HIS D CA  1 
ATOM   243  C C   . HIS A 1 33  ? 18.298  -8.623  47.416 1.00 13.45 ? 33  HIS D C   1 
ATOM   244  O O   . HIS A 1 33  ? 18.786  -8.307  48.505 1.00 15.10 ? 33  HIS D O   1 
ATOM   245  C CB  . HIS A 1 33  ? 17.984  -11.053 47.200 1.00 15.05 ? 33  HIS D CB  1 
ATOM   246  C CG  . HIS A 1 33  ? 18.222  -12.337 46.471 1.00 15.50 ? 33  HIS D CG  1 
ATOM   247  N ND1 . HIS A 1 33  ? 19.460  -12.935 46.392 1.00 18.13 ? 33  HIS D ND1 1 
ATOM   248  C CD2 . HIS A 1 33  ? 17.362  -13.165 45.832 1.00 16.40 ? 33  HIS D CD2 1 
ATOM   249  C CE1 . HIS A 1 33  ? 19.354  -14.077 45.737 1.00 17.24 ? 33  HIS D CE1 1 
ATOM   250  N NE2 . HIS A 1 33  ? 18.091  -14.240 45.386 1.00 19.30 ? 33  HIS D NE2 1 
ATOM   251  N N   . TRP A 1 34  ? 17.332  -7.930  46.822 1.00 12.42 ? 34  TRP D N   1 
ATOM   252  C CA  . TRP A 1 34  ? 16.720  -6.775  47.462 1.00 12.37 ? 34  TRP D CA  1 
ATOM   253  C C   . TRP A 1 34  ? 15.207  -6.940  47.482 1.00 12.54 ? 34  TRP D C   1 
ATOM   254  O O   . TRP A 1 34  ? 14.590  -7.238  46.453 1.00 12.42 ? 34  TRP D O   1 
ATOM   255  C CB  . TRP A 1 34  ? 17.044  -5.473  46.730 1.00 13.42 ? 34  TRP D CB  1 
ATOM   256  C CG  . TRP A 1 34  ? 18.424  -4.957  46.951 1.00 12.79 ? 34  TRP D CG  1 
ATOM   257  C CD1 . TRP A 1 34  ? 19.542  -5.294  46.254 1.00 13.14 ? 34  TRP D CD1 1 
ATOM   258  C CD2 . TRP A 1 34  ? 18.829  -3.973  47.915 1.00 12.58 ? 34  TRP D CD2 1 
ATOM   259  N NE1 . TRP A 1 34  ? 20.624  -4.579  46.715 1.00 13.34 ? 34  TRP D NE1 1 
ATOM   260  C CE2 . TRP A 1 34  ? 20.213  -3.760  47.734 1.00 13.68 ? 34  TRP D CE2 1 
ATOM   261  C CE3 . TRP A 1 34  ? 18.155  -3.250  48.907 1.00 12.58 ? 34  TRP D CE3 1 
ATOM   262  C CZ2 . TRP A 1 34  ? 20.942  -2.849  48.512 1.00 12.88 ? 34  TRP D CZ2 1 
ATOM   263  C CZ3 . TRP A 1 34  ? 18.879  -2.342  49.683 1.00 14.57 ? 34  TRP D CZ3 1 
ATOM   264  C CH2 . TRP A 1 34  ? 20.259  -2.151  49.478 1.00 12.92 ? 34  TRP D CH2 1 
ATOM   265  N N   . TYR A 1 35  ? 14.624  -6.755  48.661 1.00 12.68 ? 35  TYR D N   1 
ATOM   266  C CA  . TYR A 1 35  ? 13.179  -6.818  48.840 1.00 12.77 ? 35  TYR D CA  1 
ATOM   267  C C   . TYR A 1 35  ? 12.793  -5.513  49.516 1.00 14.05 ? 35  TYR D C   1 
ATOM   268  O O   . TYR A 1 35  ? 13.639  -4.847  50.103 1.00 12.82 ? 35  TYR D O   1 
ATOM   269  C CB  . TYR A 1 35  ? 12.780  -7.982  49.755 1.00 12.43 ? 35  TYR D CB  1 
ATOM   270  C CG  . TYR A 1 35  ? 12.677  -9.305  49.044 1.00 11.75 ? 35  TYR D CG  1 
ATOM   271  C CD1 . TYR A 1 35  ? 13.814  -9.939  48.548 1.00 11.80 ? 35  TYR D CD1 1 
ATOM   272  C CD2 . TYR A 1 35  ? 11.434  -9.902  48.821 1.00 11.06 ? 35  TYR D CD2 1 
ATOM   273  C CE1 . TYR A 1 35  ? 13.718  -11.132 47.841 1.00 13.64 ? 35  TYR D CE1 1 
ATOM   274  C CE2 . TYR A 1 35  ? 11.327  -11.097 48.114 1.00 12.73 ? 35  TYR D CE2 1 
ATOM   275  C CZ  . TYR A 1 35  ? 12.473  -11.703 47.623 1.00 12.82 ? 35  TYR D CZ  1 
ATOM   276  O OH  . TYR A 1 35  ? 12.377  -12.848 46.872 1.00 13.87 ? 35  TYR D OH  1 
ATOM   277  N N   . ARG A 1 36  ? 11.530  -5.126  49.418 1.00 12.87 ? 36  ARG D N   1 
ATOM   278  C CA  . ARG A 1 36  ? 11.097  -3.915  50.090 1.00 13.20 ? 36  ARG D CA  1 
ATOM   279  C C   . ARG A 1 36  ? 9.777   -4.208  50.765 1.00 12.50 ? 36  ARG D C   1 
ATOM   280  O O   . ARG A 1 36  ? 9.119   -5.200  50.456 1.00 14.43 ? 36  ARG D O   1 
ATOM   281  C CB  . ARG A 1 36  ? 10.942  -2.747  49.110 1.00 14.41 ? 36  ARG D CB  1 
ATOM   282  C CG  . ARG A 1 36  ? 9.813   -2.863  48.118 1.00 14.36 ? 36  ARG D CG  1 
ATOM   283  C CD  . ARG A 1 36  ? 9.797   -1.604  47.266 1.00 19.15 ? 36  ARG D CD  1 
ATOM   284  N NE  . ARG A 1 36  ? 8.668   -1.561  46.349 1.00 22.35 ? 36  ARG D NE  1 
ATOM   285  C CZ  . ARG A 1 36  ? 8.452   -0.571  45.490 1.00 25.71 ? 36  ARG D CZ  1 
ATOM   286  N NH1 . ARG A 1 36  ? 9.292   0.456   45.433 1.00 25.06 ? 36  ARG D NH1 1 
ATOM   287  N NH2 . ARG A 1 36  ? 7.395   -0.608  44.691 1.00 27.34 ? 36  ARG D NH2 1 
ATOM   288  N N   . GLN A 1 37  ? 9.398   -3.363  51.712 1.00 12.15 ? 37  GLN D N   1 
ATOM   289  C CA  . GLN A 1 37  ? 8.145   -3.572  52.405 1.00 12.94 ? 37  GLN D CA  1 
ATOM   290  C C   . GLN A 1 37  ? 7.466   -2.233  52.641 1.00 14.11 ? 37  GLN D C   1 
ATOM   291  O O   . GLN A 1 37  ? 7.962   -1.399  53.397 1.00 14.31 ? 37  GLN D O   1 
ATOM   292  C CB  . GLN A 1 37  ? 8.401   -4.300  53.728 1.00 12.94 ? 37  GLN D CB  1 
ATOM   293  C CG  . GLN A 1 37  ? 7.153   -4.604  54.542 1.00 13.46 ? 37  GLN D CG  1 
ATOM   294  C CD  . GLN A 1 37  ? 7.463   -5.489  55.734 1.00 14.74 ? 37  GLN D CD  1 
ATOM   295  O OE1 . GLN A 1 37  ? 8.595   -5.518  56.215 1.00 15.20 ? 37  GLN D OE1 1 
ATOM   296  N NE2 . GLN A 1 37  ? 6.457   -6.207  56.222 1.00 12.73 ? 37  GLN D NE2 1 
ATOM   297  N N   . LEU A 1 38  ? 6.348   -2.012  51.956 1.00 16.90 ? 38  LEU D N   1 
ATOM   298  C CA  . LEU A 1 38  ? 5.603   -0.772  52.131 1.00 17.59 ? 38  LEU D CA  1 
ATOM   299  C C   . LEU A 1 38  ? 4.812   -0.851  53.432 1.00 19.03 ? 38  LEU D C   1 
ATOM   300  O O   . LEU A 1 38  ? 4.588   -1.935  53.971 1.00 18.38 ? 38  LEU D O   1 
ATOM   301  C CB  . LEU A 1 38  ? 4.656   -0.526  50.951 1.00 18.57 ? 38  LEU D CB  1 
ATOM   302  C CG  . LEU A 1 38  ? 5.271   0.120   49.703 1.00 20.67 ? 38  LEU D CG  1 
ATOM   303  C CD1 . LEU A 1 38  ? 6.294   -0.809  49.083 1.00 20.23 ? 38  LEU D CD1 1 
ATOM   304  C CD2 . LEU A 1 38  ? 4.169   0.443   48.699 1.00 21.90 ? 38  LEU D CD2 1 
ATOM   305  N N   . PRO A 1 39  ? 4.382   0.303   53.958 1.00 19.37 ? 39  PRO D N   1 
ATOM   306  C CA  . PRO A 1 39  ? 3.617   0.356   55.207 1.00 20.59 ? 39  PRO D CA  1 
ATOM   307  C C   . PRO A 1 39  ? 2.433   -0.608  55.279 1.00 21.45 ? 39  PRO D C   1 
ATOM   308  O O   . PRO A 1 39  ? 1.579   -0.625  54.391 1.00 21.88 ? 39  PRO D O   1 
ATOM   309  C CB  . PRO A 1 39  ? 3.186   1.819   55.273 1.00 19.43 ? 39  PRO D CB  1 
ATOM   310  C CG  . PRO A 1 39  ? 4.349   2.523   54.648 1.00 19.71 ? 39  PRO D CG  1 
ATOM   311  C CD  . PRO A 1 39  ? 4.617   1.661   53.433 1.00 19.88 ? 39  PRO D CD  1 
ATOM   312  N N   . SER A 1 40  ? 2.405   -1.405  56.346 1.00 22.30 ? 40  SER D N   1 
ATOM   313  C CA  . SER A 1 40  ? 1.352   -2.385  56.606 1.00 23.90 ? 40  SER D CA  1 
ATOM   314  C C   . SER A 1 40  ? 1.134   -3.426  55.511 1.00 23.50 ? 40  SER D C   1 
ATOM   315  O O   . SER A 1 40  ? 0.064   -4.032  55.424 1.00 23.64 ? 40  SER D O   1 
ATOM   316  C CB  . SER A 1 40  ? 0.030   -1.671  56.907 1.00 25.25 ? 40  SER D CB  1 
ATOM   317  O OG  . SER A 1 40  ? 0.081   -1.035  58.174 1.00 27.24 ? 40  SER D OG  1 
ATOM   318  N N   . GLN A 1 41  ? 2.147   -3.634  54.680 1.00 21.64 ? 41  GLN D N   1 
ATOM   319  C CA  . GLN A 1 41  ? 2.059   -4.617  53.609 1.00 21.31 ? 41  GLN D CA  1 
ATOM   320  C C   . GLN A 1 41  ? 3.123   -5.683  53.842 1.00 19.62 ? 41  GLN D C   1 
ATOM   321  O O   . GLN A 1 41  ? 4.024   -5.503  54.662 1.00 19.13 ? 41  GLN D O   1 
ATOM   322  C CB  . GLN A 1 41  ? 2.304   -3.953  52.250 1.00 23.15 ? 41  GLN D CB  1 
ATOM   323  C CG  . GLN A 1 41  ? 1.325   -2.841  51.896 1.00 29.72 ? 41  GLN D CG  1 
ATOM   324  C CD  . GLN A 1 41  ? -0.101  -3.339  51.759 1.00 33.42 ? 41  GLN D CD  1 
ATOM   325  O OE1 . GLN A 1 41  ? -0.399  -4.178  50.909 1.00 36.03 ? 41  GLN D OE1 1 
ATOM   326  N NE2 . GLN A 1 41  ? -0.993  -2.821  52.598 1.00 36.75 ? 41  GLN D NE2 1 
ATOM   327  N N   . GLY A 1 42  ? 3.004   -6.804  53.139 1.00 18.41 ? 42  GLY D N   1 
ATOM   328  C CA  . GLY A 1 42  ? 4.006   -7.840  53.272 1.00 16.29 ? 42  GLY D CA  1 
ATOM   329  C C   . GLY A 1 42  ? 5.153   -7.468  52.347 1.00 14.98 ? 42  GLY D C   1 
ATOM   330  O O   . GLY A 1 42  ? 4.969   -6.641  51.447 1.00 16.84 ? 42  GLY D O   1 
ATOM   331  N N   . PRO A 1 43  ? 6.350   -8.039  52.542 1.00 13.22 ? 43  PRO D N   1 
ATOM   332  C CA  . PRO A 1 43  ? 7.504   -7.735  51.689 1.00 12.57 ? 43  PRO D CA  1 
ATOM   333  C C   . PRO A 1 43  ? 7.253   -8.076  50.221 1.00 13.77 ? 43  PRO D C   1 
ATOM   334  O O   . PRO A 1 43  ? 6.367   -8.864  49.903 1.00 13.71 ? 43  PRO D O   1 
ATOM   335  C CB  . PRO A 1 43  ? 8.606   -8.612  52.279 1.00 12.80 ? 43  PRO D CB  1 
ATOM   336  C CG  . PRO A 1 43  ? 8.238   -8.697  53.714 1.00 12.19 ? 43  PRO D CG  1 
ATOM   337  C CD  . PRO A 1 43  ? 6.750   -8.898  53.671 1.00 12.89 ? 43  PRO D CD  1 
ATOM   338  N N   . GLU A 1 44  ? 8.039   -7.471  49.336 1.00 14.80 ? 44  GLU D N   1 
ATOM   339  C CA  . GLU A 1 44  ? 7.934   -7.747  47.908 1.00 15.06 ? 44  GLU D CA  1 
ATOM   340  C C   . GLU A 1 44  ? 9.315   -7.707  47.260 1.00 14.43 ? 44  GLU D C   1 
ATOM   341  O O   . GLU A 1 44  ? 10.167  -6.893  47.619 1.00 14.93 ? 44  GLU D O   1 
ATOM   342  C CB  . GLU A 1 44  ? 7.007   -6.742  47.218 1.00 17.88 ? 44  GLU D CB  1 
ATOM   343  C CG  . GLU A 1 44  ? 7.450   -5.301  47.322 1.00 23.75 ? 44  GLU D CG  1 
ATOM   344  C CD  . GLU A 1 44  ? 6.469   -4.351  46.662 1.00 28.14 ? 44  GLU D CD  1 
ATOM   345  O OE1 . GLU A 1 44  ? 5.254   -4.472  46.933 1.00 31.34 ? 44  GLU D OE1 1 
ATOM   346  O OE2 . GLU A 1 44  ? 6.909   -3.482  45.879 1.00 30.00 ? 44  GLU D OE2 1 
ATOM   347  N N   . TYR A 1 45  ? 9.532   -8.609  46.313 1.00 13.29 ? 45  TYR D N   1 
ATOM   348  C CA  . TYR A 1 45  ? 10.793  -8.702  45.588 1.00 14.51 ? 45  TYR D CA  1 
ATOM   349  C C   . TYR A 1 45  ? 11.045  -7.441  44.763 1.00 14.13 ? 45  TYR D C   1 
ATOM   350  O O   . TYR A 1 45  ? 10.113  -6.861  44.206 1.00 14.15 ? 45  TYR D O   1 
ATOM   351  C CB  . TYR A 1 45  ? 10.741  -9.917  44.656 1.00 13.80 ? 45  TYR D CB  1 
ATOM   352  C CG  . TYR A 1 45  ? 11.847  -9.989  43.630 1.00 14.89 ? 45  TYR D CG  1 
ATOM   353  C CD1 . TYR A 1 45  ? 13.113  -10.463 43.969 1.00 14.82 ? 45  TYR D CD1 1 
ATOM   354  C CD2 . TYR A 1 45  ? 11.612  -9.616  42.306 1.00 16.98 ? 45  TYR D CD2 1 
ATOM   355  C CE1 . TYR A 1 45  ? 14.122  -10.576 43.008 1.00 15.16 ? 45  TYR D CE1 1 
ATOM   356  C CE2 . TYR A 1 45  ? 12.614  -9.718  41.342 1.00 16.88 ? 45  TYR D CE2 1 
ATOM   357  C CZ  . TYR A 1 45  ? 13.861  -10.201 41.703 1.00 15.47 ? 45  TYR D CZ  1 
ATOM   358  O OH  . TYR A 1 45  ? 14.846  -10.316 40.753 1.00 17.34 ? 45  TYR D OH  1 
ATOM   359  N N   . VAL A 1 46  ? 12.303  -7.012  44.703 1.00 13.40 ? 46  VAL D N   1 
ATOM   360  C CA  . VAL A 1 46  ? 12.673  -5.844  43.908 1.00 14.20 ? 46  VAL D CA  1 
ATOM   361  C C   . VAL A 1 46  ? 13.630  -6.266  42.796 1.00 14.88 ? 46  VAL D C   1 
ATOM   362  O O   . VAL A 1 46  ? 13.357  -6.043  41.615 1.00 16.63 ? 46  VAL D O   1 
ATOM   363  C CB  . VAL A 1 46  ? 13.356  -4.744  44.758 1.00 13.98 ? 46  VAL D CB  1 
ATOM   364  C CG1 . VAL A 1 46  ? 13.835  -3.616  43.848 1.00 14.66 ? 46  VAL D CG1 1 
ATOM   365  C CG2 . VAL A 1 46  ? 12.381  -4.192  45.789 1.00 12.66 ? 46  VAL D CG2 1 
ATOM   366  N N   . ILE A 1 47  ? 14.747  -6.882  43.172 1.00 14.55 ? 47  ILE D N   1 
ATOM   367  C CA  . ILE A 1 47  ? 15.738  -7.319  42.188 1.00 14.56 ? 47  ILE D CA  1 
ATOM   368  C C   . ILE A 1 47  ? 16.786  -8.212  42.854 1.00 15.68 ? 47  ILE D C   1 
ATOM   369  O O   . ILE A 1 47  ? 16.897  -8.243  44.075 1.00 15.18 ? 47  ILE D O   1 
ATOM   370  C CB  . ILE A 1 47  ? 16.447  -6.087  41.546 1.00 15.48 ? 47  ILE D CB  1 
ATOM   371  C CG1 . ILE A 1 47  ? 17.169  -6.498  40.261 1.00 17.51 ? 47  ILE D CG1 1 
ATOM   372  C CG2 . ILE A 1 47  ? 17.450  -5.479  42.528 1.00 17.57 ? 47  ILE D CG2 1 
ATOM   373  C CD1 . ILE A 1 47  ? 17.643  -5.313  39.433 1.00 19.64 ? 47  ILE D CD1 1 
ATOM   374  N N   . HIS A 1 48  ? 17.531  -8.963  42.048 1.00 15.64 ? 48  HIS D N   1 
ATOM   375  C CA  . HIS A 1 48  ? 18.605  -9.799  42.568 1.00 16.73 ? 48  HIS D CA  1 
ATOM   376  C C   . HIS A 1 48  ? 19.581  -10.045 41.428 1.00 16.75 ? 48  HIS D C   1 
ATOM   377  O O   . HIS A 1 48  ? 19.206  -9.970  40.257 1.00 17.40 ? 48  HIS D O   1 
ATOM   378  C CB  . HIS A 1 48  ? 18.079  -11.123 43.152 1.00 16.24 ? 48  HIS D CB  1 
ATOM   379  C CG  . HIS A 1 48  ? 17.806  -12.185 42.134 1.00 16.60 ? 48  HIS D CG  1 
ATOM   380  N ND1 . HIS A 1 48  ? 16.831  -12.061 41.168 1.00 17.33 ? 48  HIS D ND1 1 
ATOM   381  C CD2 . HIS A 1 48  ? 18.365  -13.406 41.951 1.00 17.88 ? 48  HIS D CD2 1 
ATOM   382  C CE1 . HIS A 1 48  ? 16.800  -13.159 40.434 1.00 19.05 ? 48  HIS D CE1 1 
ATOM   383  N NE2 . HIS A 1 48  ? 17.721  -13.991 40.888 1.00 19.66 ? 48  HIS D NE2 1 
ATOM   384  N N   . GLY A 1 49  ? 20.840  -10.294 41.765 1.00 17.75 ? 49  GLY D N   1 
ATOM   385  C CA  . GLY A 1 49  ? 21.831  -10.525 40.729 1.00 19.63 ? 49  GLY D CA  1 
ATOM   386  C C   . GLY A 1 49  ? 23.215  -10.796 41.284 1.00 21.80 ? 49  GLY D C   1 
ATOM   387  O O   . GLY A 1 49  ? 23.452  -10.632 42.479 1.00 19.89 ? 49  GLY D O   1 
ATOM   388  N N   . LEU A 1 50  ? 24.136  -11.210 40.418 1.00 24.42 ? 50  LEU D N   1 
ATOM   389  C CA  . LEU A 1 50  ? 25.491  -11.499 40.866 1.00 27.18 ? 50  LEU D CA  1 
ATOM   390  C C   . LEU A 1 50  ? 26.523  -10.561 40.246 1.00 27.56 ? 50  LEU D C   1 
ATOM   391  O O   . LEU A 1 50  ? 27.722  -10.727 40.454 1.00 29.03 ? 50  LEU D O   1 
ATOM   392  C CB  . LEU A 1 50  ? 25.856  -12.960 40.569 1.00 30.34 ? 50  LEU D CB  1 
ATOM   393  C CG  . LEU A 1 50  ? 26.197  -13.401 39.143 1.00 32.25 ? 50  LEU D CG  1 
ATOM   394  C CD1 . LEU A 1 50  ? 26.408  -14.906 39.140 1.00 32.68 ? 50  LEU D CD1 1 
ATOM   395  C CD2 . LEU A 1 50  ? 25.095  -13.024 38.177 1.00 32.90 ? 50  LEU D CD2 1 
ATOM   396  N N   . THR A 1 51  ? 26.049  -9.578  39.485 1.00 27.74 ? 51  THR D N   1 
ATOM   397  C CA  . THR A 1 51  ? 26.925  -8.594  38.854 1.00 27.08 ? 51  THR D CA  1 
ATOM   398  C C   . THR A 1 51  ? 26.199  -7.256  38.782 1.00 26.67 ? 51  THR D C   1 
ATOM   399  O O   . THR A 1 51  ? 25.017  -7.159  39.123 1.00 26.08 ? 51  THR D O   1 
ATOM   400  C CB  . THR A 1 51  ? 27.312  -8.993  37.405 1.00 27.34 ? 51  THR D CB  1 
ATOM   401  O OG1 . THR A 1 51  ? 26.218  -8.718  36.521 1.00 28.06 ? 51  THR D OG1 1 
ATOM   402  C CG2 . THR A 1 51  ? 27.651  -10.470 37.325 1.00 28.44 ? 51  THR D CG2 1 
ATOM   403  N N   . SER A 1 52  ? 26.911  -6.223  38.348 1.00 25.33 ? 52  SER D N   1 
ATOM   404  C CA  . SER A 1 52  ? 26.309  -4.907  38.199 1.00 26.07 ? 52  SER D CA  1 
ATOM   405  C C   . SER A 1 52  ? 25.597  -4.898  36.847 1.00 26.93 ? 52  SER D C   1 
ATOM   406  O O   . SER A 1 52  ? 25.610  -5.896  36.126 1.00 27.49 ? 52  SER D O   1 
ATOM   407  C CB  . SER A 1 52  ? 27.381  -3.817  38.230 1.00 25.26 ? 52  SER D CB  1 
ATOM   408  O OG  . SER A 1 52  ? 28.062  -3.813  39.469 1.00 24.33 ? 52  SER D OG  1 
ATOM   409  N N   . ASN A 1 53  ? 24.982  -3.773  36.506 1.00 26.85 ? 54  ASN D N   1 
ATOM   410  C CA  . ASN A 1 53  ? 24.261  -3.644  35.243 1.00 29.44 ? 54  ASN D CA  1 
ATOM   411  C C   . ASN A 1 53  ? 23.079  -4.607  35.132 1.00 28.14 ? 54  ASN D C   1 
ATOM   412  O O   . ASN A 1 53  ? 22.670  -4.984  34.033 1.00 28.06 ? 54  ASN D O   1 
ATOM   413  C CB  . ASN A 1 53  ? 25.201  -3.849  34.053 1.00 32.14 ? 54  ASN D CB  1 
ATOM   414  C CG  . ASN A 1 53  ? 24.591  -3.376  32.746 1.00 36.14 ? 54  ASN D CG  1 
ATOM   415  O OD1 . ASN A 1 53  ? 24.136  -2.235  32.641 1.00 39.31 ? 54  ASN D OD1 1 
ATOM   416  N ND2 . ASN A 1 53  ? 24.578  -4.248  31.741 1.00 37.70 ? 54  ASN D ND2 1 
ATOM   417  N N   . VAL A 1 54  ? 22.553  -5.025  36.277 1.00 25.68 ? 55  VAL D N   1 
ATOM   418  C CA  . VAL A 1 54  ? 21.382  -5.887  36.302 1.00 24.18 ? 55  VAL D CA  1 
ATOM   419  C C   . VAL A 1 54  ? 20.253  -4.906  36.592 1.00 24.72 ? 55  VAL D C   1 
ATOM   420  O O   . VAL A 1 54  ? 20.323  -4.159  37.566 1.00 22.48 ? 55  VAL D O   1 
ATOM   421  C CB  . VAL A 1 54  ? 21.446  -6.925  37.449 1.00 24.67 ? 55  VAL D CB  1 
ATOM   422  C CG1 . VAL A 1 54  ? 20.104  -7.629  37.587 1.00 21.29 ? 55  VAL D CG1 1 
ATOM   423  C CG2 . VAL A 1 54  ? 22.545  -7.940  37.176 1.00 22.91 ? 55  VAL D CG2 1 
ATOM   424  N N   . ASN A 1 55  ? 19.225  -4.872  35.753 1.00 24.96 ? 56  ASN D N   1 
ATOM   425  C CA  . ASN A 1 55  ? 18.143  -3.934  36.012 1.00 28.43 ? 56  ASN D CA  1 
ATOM   426  C C   . ASN A 1 55  ? 16.778  -4.224  35.415 1.00 30.40 ? 56  ASN D C   1 
ATOM   427  O O   . ASN A 1 55  ? 16.590  -5.179  34.664 1.00 30.70 ? 56  ASN D O   1 
ATOM   428  C CB  . ASN A 1 55  ? 18.573  -2.519  35.610 1.00 31.11 ? 56  ASN D CB  1 
ATOM   429  C CG  . ASN A 1 55  ? 19.624  -2.507  34.520 1.00 32.74 ? 56  ASN D CG  1 
ATOM   430  O OD1 . ASN A 1 55  ? 19.385  -2.949  33.395 1.00 35.25 ? 56  ASN D OD1 1 
ATOM   431  N ND2 . ASN A 1 55  ? 20.804  -1.996  34.851 1.00 34.17 ? 56  ASN D ND2 1 
ATOM   432  N N   . ASN A 1 56  ? 15.822  -3.381  35.794 1.00 31.91 ? 57  ASN D N   1 
ATOM   433  C CA  . ASN A 1 56  ? 14.444  -3.458  35.322 1.00 33.19 ? 57  ASN D CA  1 
ATOM   434  C C   . ASN A 1 56  ? 13.876  -2.038  35.316 1.00 35.25 ? 57  ASN D C   1 
ATOM   435  O O   . ASN A 1 56  ? 14.620  -1.073  35.488 1.00 35.30 ? 57  ASN D O   1 
ATOM   436  C CB  . ASN A 1 56  ? 13.611  -4.370  36.232 1.00 31.03 ? 57  ASN D CB  1 
ATOM   437  C CG  . ASN A 1 56  ? 13.774  -4.039  37.699 1.00 29.67 ? 57  ASN D CG  1 
ATOM   438  O OD1 . ASN A 1 56  ? 13.646  -2.888  38.104 1.00 26.68 ? 57  ASN D OD1 1 
ATOM   439  N ND2 . ASN A 1 56  ? 14.052  -5.058  38.508 1.00 32.41 ? 57  ASN D ND2 1 
ATOM   440  N N   . ARG A 1 57  ? 12.569  -1.904  35.118 1.00 37.18 ? 58  ARG D N   1 
ATOM   441  C CA  . ARG A 1 57  ? 11.941  -0.582  35.085 1.00 39.87 ? 58  ARG D CA  1 
ATOM   442  C C   . ARG A 1 57  ? 12.414  0.298   36.233 1.00 39.05 ? 58  ARG D C   1 
ATOM   443  O O   . ARG A 1 57  ? 13.173  1.251   36.056 1.00 40.23 ? 58  ARG D O   1 
ATOM   444  C CB  . ARG A 1 57  ? 10.419  -0.695  35.205 1.00 42.63 ? 58  ARG D CB  1 
ATOM   445  C CG  . ARG A 1 57  ? 9.731   -1.540  34.164 1.00 45.91 ? 58  ARG D CG  1 
ATOM   446  C CD  . ARG A 1 57  ? 8.257   -1.688  34.516 1.00 48.11 ? 58  ARG D CD  1 
ATOM   447  N NE  . ARG A 1 57  ? 8.084   -2.178  35.884 1.00 49.71 ? 58  ARG D NE  1 
ATOM   448  C CZ  . ARG A 1 57  ? 6.908   -2.345  36.483 1.00 50.53 ? 58  ARG D CZ  1 
ATOM   449  N NH1 . ARG A 1 57  ? 5.783   -2.062  35.839 1.00 50.33 ? 58  ARG D NH1 1 
ATOM   450  N NH2 . ARG A 1 57  ? 6.859   -2.792  37.732 1.00 51.77 ? 58  ARG D NH2 1 
ATOM   451  N N   . MET A 1 58  ? 11.936  -0.054  37.416 1.00 37.54 ? 61  MET D N   1 
ATOM   452  C CA  . MET A 1 58  ? 12.214  0.668   38.640 1.00 36.38 ? 61  MET D CA  1 
ATOM   453  C C   . MET A 1 58  ? 13.664  0.809   39.081 1.00 33.22 ? 61  MET D C   1 
ATOM   454  O O   . MET A 1 58  ? 14.129  1.921   39.352 1.00 32.84 ? 61  MET D O   1 
ATOM   455  C CB  . MET A 1 58  ? 11.420  0.030   39.782 1.00 39.57 ? 61  MET D CB  1 
ATOM   456  C CG  . MET A 1 58  ? 11.634  0.686   41.135 1.00 43.38 ? 61  MET D CG  1 
ATOM   457  S SD  . MET A 1 58  ? 11.001  -0.322  42.489 1.00 49.93 ? 61  MET D SD  1 
ATOM   458  C CE  . MET A 1 58  ? 9.238   -0.073  42.301 1.00 48.94 ? 61  MET D CE  1 
ATOM   459  N N   . ALA A 1 59  ? 14.391  -0.300  39.145 1.00 27.90 ? 62  ALA D N   1 
ATOM   460  C CA  . ALA A 1 59  ? 15.746  -0.215  39.662 1.00 25.10 ? 62  ALA D CA  1 
ATOM   461  C C   . ALA A 1 59  ? 16.857  -0.998  38.995 1.00 23.24 ? 62  ALA D C   1 
ATOM   462  O O   . ALA A 1 59  ? 16.644  -1.791  38.078 1.00 23.44 ? 62  ALA D O   1 
ATOM   463  C CB  . ALA A 1 59  ? 15.718  -0.563  41.141 1.00 25.10 ? 62  ALA D CB  1 
ATOM   464  N N   . SER A 1 60  ? 18.063  -0.744  39.490 1.00 20.54 ? 63  SER D N   1 
ATOM   465  C CA  . SER A 1 60  ? 19.271  -1.398  39.017 1.00 20.51 ? 63  SER D CA  1 
ATOM   466  C C   . SER A 1 60  ? 20.070  -1.854  40.229 1.00 19.88 ? 63  SER D C   1 
ATOM   467  O O   . SER A 1 60  ? 19.944  -1.293  41.319 1.00 18.85 ? 63  SER D O   1 
ATOM   468  C CB  . SER A 1 60  ? 20.117  -0.433  38.190 1.00 21.09 ? 63  SER D CB  1 
ATOM   469  O OG  . SER A 1 60  ? 19.494  -0.129  36.956 1.00 24.28 ? 63  SER D OG  1 
ATOM   470  N N   . LEU A 1 61  ? 20.885  -2.880  40.033 1.00 18.82 ? 64  LEU D N   1 
ATOM   471  C CA  . LEU A 1 61  ? 21.716  -3.414  41.094 1.00 19.42 ? 64  LEU D CA  1 
ATOM   472  C C   . LEU A 1 61  ? 23.170  -3.169  40.738 1.00 21.06 ? 64  LEU D C   1 
ATOM   473  O O   . LEU A 1 61  ? 23.576  -3.356  39.592 1.00 20.53 ? 64  LEU D O   1 
ATOM   474  C CB  . LEU A 1 61  ? 21.482  -4.920  41.250 1.00 19.99 ? 64  LEU D CB  1 
ATOM   475  C CG  . LEU A 1 61  ? 22.453  -5.661  42.173 1.00 21.16 ? 64  LEU D CG  1 
ATOM   476  C CD1 . LEU A 1 61  ? 22.207  -5.239  43.612 1.00 20.03 ? 64  LEU D CD1 1 
ATOM   477  C CD2 . LEU A 1 61  ? 22.266  -7.162  42.022 1.00 20.12 ? 64  LEU D CD2 1 
ATOM   478  N N   . ALA A 1 62  ? 23.949  -2.729  41.717 1.00 21.39 ? 65  ALA D N   1 
ATOM   479  C CA  . ALA A 1 62  ? 25.362  -2.494  41.490 1.00 21.99 ? 65  ALA D CA  1 
ATOM   480  C C   . ALA A 1 62  ? 26.134  -3.221  42.575 1.00 22.99 ? 65  ALA D C   1 
ATOM   481  O O   . ALA A 1 62  ? 25.731  -3.225  43.739 1.00 22.48 ? 65  ALA D O   1 
ATOM   482  C CB  . ALA A 1 62  ? 25.668  -1.007  41.529 1.00 21.88 ? 65  ALA D CB  1 
ATOM   483  N N   . ILE A 1 63  ? 27.226  -3.867  42.185 1.00 22.43 ? 66  ILE D N   1 
ATOM   484  C CA  . ILE A 1 63  ? 28.068  -4.579  43.131 1.00 23.53 ? 66  ILE D CA  1 
ATOM   485  C C   . ILE A 1 63  ? 29.482  -4.041  42.976 1.00 23.77 ? 66  ILE D C   1 
ATOM   486  O O   . ILE A 1 63  ? 30.035  -4.047  41.875 1.00 25.99 ? 66  ILE D O   1 
ATOM   487  C CB  . ILE A 1 63  ? 28.063  -6.097  42.864 1.00 24.15 ? 66  ILE D CB  1 
ATOM   488  C CG1 . ILE A 1 63  ? 26.633  -6.636  42.958 1.00 24.83 ? 66  ILE D CG1 1 
ATOM   489  C CG2 . ILE A 1 63  ? 28.957  -6.800  43.872 1.00 24.68 ? 66  ILE D CG2 1 
ATOM   490  C CD1 . ILE A 1 63  ? 26.521  -8.141  42.794 1.00 24.32 ? 66  ILE D CD1 1 
ATOM   491  N N   . ALA A 1 64  ? 30.059  -3.565  44.074 1.00 22.81 ? 67  ALA D N   1 
ATOM   492  C CA  . ALA A 1 64  ? 31.409  -3.008  44.048 1.00 23.53 ? 67  ALA D CA  1 
ATOM   493  C C   . ALA A 1 64  ? 32.405  -3.997  43.451 1.00 23.38 ? 67  ALA D C   1 
ATOM   494  O O   . ALA A 1 64  ? 32.180  -5.209  43.460 1.00 22.76 ? 67  ALA D O   1 
ATOM   495  C CB  . ALA A 1 64  ? 31.841  -2.614  45.453 1.00 20.82 ? 67  ALA D CB  1 
ATOM   496  N N   . GLU A 1 65  ? 33.512  -3.467  42.940 1.00 26.31 ? 68  GLU D N   1 
ATOM   497  C CA  . GLU A 1 65  ? 34.543  -4.289  42.323 1.00 27.83 ? 68  GLU D CA  1 
ATOM   498  C C   . GLU A 1 65  ? 35.132  -5.300  43.301 1.00 27.41 ? 68  GLU D C   1 
ATOM   499  O O   . GLU A 1 65  ? 35.438  -6.429  42.913 1.00 27.14 ? 68  GLU D O   1 
ATOM   500  C CB  . GLU A 1 65  ? 35.653  -3.396  41.762 1.00 32.00 ? 68  GLU D CB  1 
ATOM   501  C CG  . GLU A 1 65  ? 36.565  -4.091  40.762 1.00 37.38 ? 68  GLU D CG  1 
ATOM   502  C CD  . GLU A 1 65  ? 37.622  -3.158  40.195 1.00 41.21 ? 68  GLU D CD  1 
ATOM   503  O OE1 . GLU A 1 65  ? 38.500  -2.714  40.966 1.00 43.28 ? 68  GLU D OE1 1 
ATOM   504  O OE2 . GLU A 1 65  ? 37.572  -2.865  38.981 1.00 43.46 ? 68  GLU D OE2 1 
ATOM   505  N N   . ASP A 1 66  ? 35.290  -4.907  44.564 1.00 26.82 ? 69  ASP D N   1 
ATOM   506  C CA  . ASP A 1 66  ? 35.839  -5.825  45.559 1.00 26.97 ? 69  ASP D CA  1 
ATOM   507  C C   . ASP A 1 66  ? 34.771  -6.738  46.157 1.00 26.17 ? 69  ASP D C   1 
ATOM   508  O O   . ASP A 1 66  ? 35.057  -7.537  47.044 1.00 25.61 ? 69  ASP D O   1 
ATOM   509  C CB  . ASP A 1 66  ? 36.562  -5.072  46.685 1.00 28.20 ? 69  ASP D CB  1 
ATOM   510  C CG  . ASP A 1 66  ? 35.645  -4.146  47.468 1.00 30.46 ? 69  ASP D CG  1 
ATOM   511  O OD1 . ASP A 1 66  ? 34.426  -4.409  47.537 1.00 29.63 ? 69  ASP D OD1 1 
ATOM   512  O OD2 . ASP A 1 66  ? 36.161  -3.158  48.034 1.00 30.42 ? 69  ASP D OD2 1 
ATOM   513  N N   . ARG A 1 67  ? 33.542  -6.609  45.668 1.00 26.01 ? 70  ARG D N   1 
ATOM   514  C CA  . ARG A 1 67  ? 32.437  -7.446  46.128 1.00 26.23 ? 70  ARG D CA  1 
ATOM   515  C C   . ARG A 1 67  ? 32.155  -7.330  47.627 1.00 25.47 ? 70  ARG D C   1 
ATOM   516  O O   . ARG A 1 67  ? 31.576  -8.242  48.219 1.00 24.94 ? 70  ARG D O   1 
ATOM   517  C CB  . ARG A 1 67  ? 32.731  -8.912  45.788 1.00 27.32 ? 70  ARG D CB  1 
ATOM   518  C CG  . ARG A 1 67  ? 33.248  -9.144  44.373 1.00 29.62 ? 70  ARG D CG  1 
ATOM   519  C CD  . ARG A 1 67  ? 32.133  -9.191  43.350 1.00 29.74 ? 70  ARG D CD  1 
ATOM   520  N NE  . ARG A 1 67  ? 31.291  -10.375 43.506 1.00 30.21 ? 70  ARG D NE  1 
ATOM   521  C CZ  . ARG A 1 67  ? 30.209  -10.615 42.774 1.00 30.16 ? 70  ARG D CZ  1 
ATOM   522  N NH1 . ARG A 1 67  ? 29.842  -9.752  41.835 1.00 29.95 ? 70  ARG D NH1 1 
ATOM   523  N NH2 . ARG A 1 67  ? 29.482  -11.704 42.990 1.00 30.24 ? 70  ARG D NH2 1 
ATOM   524  N N   . LYS A 1 68  ? 32.563  -6.222  48.239 1.00 24.90 ? 71  LYS D N   1 
ATOM   525  C CA  . LYS A 1 68  ? 32.340  -6.013  49.668 1.00 24.05 ? 71  LYS D CA  1 
ATOM   526  C C   . LYS A 1 68  ? 31.170  -5.078  49.961 1.00 21.65 ? 71  LYS D C   1 
ATOM   527  O O   . LYS A 1 68  ? 30.874  -4.779  51.120 1.00 21.41 ? 71  LYS D O   1 
ATOM   528  C CB  . LYS A 1 68  ? 33.605  -5.471  50.337 1.00 27.62 ? 71  LYS D CB  1 
ATOM   529  C CG  . LYS A 1 68  ? 34.712  -6.505  50.503 1.00 31.41 ? 71  LYS D CG  1 
ATOM   530  C CD  . LYS A 1 68  ? 35.814  -5.975  51.408 1.00 35.20 ? 71  LYS D CD  1 
ATOM   531  C CE  . LYS A 1 68  ? 36.843  -7.046  51.724 1.00 38.08 ? 71  LYS D CE  1 
ATOM   532  N NZ  . LYS A 1 68  ? 37.856  -6.559  52.708 1.00 39.66 ? 71  LYS D NZ  1 
ATOM   533  N N   . SER A 1 69  ? 30.516  -4.604  48.910 1.00 20.21 ? 72  SER D N   1 
ATOM   534  C CA  . SER A 1 69  ? 29.363  -3.729  49.074 1.00 19.63 ? 72  SER D CA  1 
ATOM   535  C C   . SER A 1 69  ? 28.525  -3.767  47.809 1.00 18.51 ? 72  SER D C   1 
ATOM   536  O O   . SER A 1 69  ? 29.038  -4.033  46.722 1.00 17.72 ? 72  SER D O   1 
ATOM   537  C CB  . SER A 1 69  ? 29.797  -2.289  49.372 1.00 20.07 ? 72  SER D CB  1 
ATOM   538  O OG  . SER A 1 69  ? 30.422  -1.694  48.251 1.00 21.54 ? 72  SER D OG  1 
ATOM   539  N N   . SER A 1 70  ? 27.228  -3.522  47.966 1.00 18.23 ? 73  SER D N   1 
ATOM   540  C CA  . SER A 1 70  ? 26.287  -3.522  46.853 1.00 18.39 ? 73  SER D CA  1 
ATOM   541  C C   . SER A 1 70  ? 25.366  -2.319  47.004 1.00 17.55 ? 73  SER D C   1 
ATOM   542  O O   . SER A 1 70  ? 25.264  -1.734  48.082 1.00 17.26 ? 73  SER D O   1 
ATOM   543  C CB  . SER A 1 70  ? 25.456  -4.811  46.857 1.00 20.62 ? 73  SER D CB  1 
ATOM   544  O OG  . SER A 1 70  ? 26.275  -5.959  46.714 1.00 23.73 ? 73  SER D OG  1 
ATOM   545  N N   . THR A 1 71  ? 24.691  -1.950  45.924 1.00 16.93 ? 74  THR D N   1 
ATOM   546  C CA  . THR A 1 71  ? 23.796  -0.810  45.968 1.00 17.31 ? 74  THR D CA  1 
ATOM   547  C C   . THR A 1 71  ? 22.541  -1.023  45.141 1.00 17.26 ? 74  THR D C   1 
ATOM   548  O O   . THR A 1 71  ? 22.606  -1.538  44.027 1.00 17.97 ? 74  THR D O   1 
ATOM   549  C CB  . THR A 1 71  ? 24.497  0.450   45.429 1.00 18.47 ? 74  THR D CB  1 
ATOM   550  O OG1 . THR A 1 71  ? 25.691  0.686   46.184 1.00 23.28 ? 74  THR D OG1 1 
ATOM   551  C CG2 . THR A 1 71  ? 23.582  1.662   45.529 1.00 18.69 ? 74  THR D CG2 1 
ATOM   552  N N   . LEU A 1 72  ? 21.398  -0.647  45.700 1.00 15.19 ? 75  LEU D N   1 
ATOM   553  C CA  . LEU A 1 72  ? 20.149  -0.728  44.957 1.00 14.55 ? 75  LEU D CA  1 
ATOM   554  C C   . LEU A 1 72  ? 19.955  0.700   44.472 1.00 15.35 ? 75  LEU D C   1 
ATOM   555  O O   . LEU A 1 72  ? 19.962  1.638   45.267 1.00 14.18 ? 75  LEU D O   1 
ATOM   556  C CB  . LEU A 1 72  ? 18.973  -1.128  45.856 1.00 14.33 ? 75  LEU D CB  1 
ATOM   557  C CG  . LEU A 1 72  ? 17.599  -1.027  45.172 1.00 14.37 ? 75  LEU D CG  1 
ATOM   558  C CD1 . LEU A 1 72  ? 17.516  -1.999  44.001 1.00 16.52 ? 75  LEU D CD1 1 
ATOM   559  C CD2 . LEU A 1 72  ? 16.507  -1.335  46.186 1.00 13.52 ? 75  LEU D CD2 1 
ATOM   560  N N   . ILE A 1 73  ? 19.812  0.870   43.166 1.00 15.20 ? 76  ILE D N   1 
ATOM   561  C CA  . ILE A 1 73  ? 19.621  2.197   42.609 1.00 15.81 ? 76  ILE D CA  1 
ATOM   562  C C   . ILE A 1 73  ? 18.204  2.351   42.078 1.00 16.50 ? 76  ILE D C   1 
ATOM   563  O O   . ILE A 1 73  ? 17.806  1.648   41.147 1.00 19.02 ? 76  ILE D O   1 
ATOM   564  C CB  . ILE A 1 73  ? 20.603  2.467   41.444 1.00 16.82 ? 76  ILE D CB  1 
ATOM   565  C CG1 . ILE A 1 73  ? 22.048  2.276   41.915 1.00 18.06 ? 76  ILE D CG1 1 
ATOM   566  C CG2 . ILE A 1 73  ? 20.387  3.872   40.899 1.00 18.39 ? 76  ILE D CG2 1 
ATOM   567  C CD1 . ILE A 1 73  ? 23.078  2.490   40.821 1.00 21.62 ? 76  ILE D CD1 1 
ATOM   568  N N   . LEU A 1 74  ? 17.436  3.246   42.690 1.00 16.38 ? 77  LEU D N   1 
ATOM   569  C CA  . LEU A 1 74  ? 16.081  3.521   42.226 1.00 16.91 ? 77  LEU D CA  1 
ATOM   570  C C   . LEU A 1 74  ? 16.270  4.700   41.276 1.00 18.83 ? 77  LEU D C   1 
ATOM   571  O O   . LEU A 1 74  ? 16.718  5.766   41.680 1.00 18.43 ? 77  LEU D O   1 
ATOM   572  C CB  . LEU A 1 74  ? 15.164  3.910   43.392 1.00 18.22 ? 77  LEU D CB  1 
ATOM   573  C CG  . LEU A 1 74  ? 15.022  2.878   44.518 1.00 18.31 ? 77  LEU D CG  1 
ATOM   574  C CD1 . LEU A 1 74  ? 14.008  3.386   45.546 1.00 18.48 ? 77  LEU D CD1 1 
ATOM   575  C CD2 . LEU A 1 74  ? 14.581  1.530   43.946 1.00 20.61 ? 77  LEU D CD2 1 
ATOM   576  N N   . HIS A 1 75  ? 15.939  4.504   40.007 1.00 21.38 ? 78  HIS D N   1 
ATOM   577  C CA  . HIS A 1 75  ? 16.132  5.552   39.013 1.00 23.66 ? 78  HIS D CA  1 
ATOM   578  C C   . HIS A 1 75  ? 15.350  6.844   39.204 1.00 23.77 ? 78  HIS D C   1 
ATOM   579  O O   . HIS A 1 75  ? 15.872  7.929   38.944 1.00 23.30 ? 78  HIS D O   1 
ATOM   580  C CB  . HIS A 1 75  ? 15.857  4.988   37.619 1.00 26.55 ? 78  HIS D CB  1 
ATOM   581  C CG  . HIS A 1 75  ? 16.717  3.816   37.275 1.00 29.96 ? 78  HIS D CG  1 
ATOM   582  N ND1 . HIS A 1 75  ? 18.094  3.867   37.325 1.00 32.39 ? 78  HIS D ND1 1 
ATOM   583  C CD2 . HIS A 1 75  ? 16.401  2.552   36.906 1.00 30.73 ? 78  HIS D CD2 1 
ATOM   584  C CE1 . HIS A 1 75  ? 18.588  2.685   37.004 1.00 31.30 ? 78  HIS D CE1 1 
ATOM   585  N NE2 . HIS A 1 75  ? 17.582  1.870   36.745 1.00 32.34 ? 78  HIS D NE2 1 
ATOM   586  N N   . ARG A 1 76  ? 14.105  6.735   39.651 1.00 24.34 ? 79  ARG D N   1 
ATOM   587  C CA  . ARG A 1 76  ? 13.269  7.916   39.847 1.00 25.94 ? 79  ARG D CA  1 
ATOM   588  C C   . ARG A 1 76  ? 12.277  7.641   40.970 1.00 26.14 ? 79  ARG D C   1 
ATOM   589  O O   . ARG A 1 76  ? 11.198  7.094   40.745 1.00 26.01 ? 79  ARG D O   1 
ATOM   590  C CB  . ARG A 1 76  ? 12.519  8.234   38.551 1.00 27.33 ? 79  ARG D CB  1 
ATOM   591  C CG  . ARG A 1 76  ? 11.794  9.570   38.529 1.00 29.59 ? 79  ARG D CG  1 
ATOM   592  C CD  . ARG A 1 76  ? 10.972  9.697   37.247 1.00 33.72 ? 79  ARG D CD  1 
ATOM   593  N NE  . ARG A 1 76  ? 10.332  11.003  37.109 1.00 36.32 ? 79  ARG D NE  1 
ATOM   594  C CZ  . ARG A 1 76  ? 10.969  12.120  36.766 1.00 37.95 ? 79  ARG D CZ  1 
ATOM   595  N NH1 . ARG A 1 76  ? 12.273  12.098  36.522 1.00 37.74 ? 79  ARG D NH1 1 
ATOM   596  N NH2 . ARG A 1 76  ? 10.301  13.262  36.666 1.00 39.37 ? 79  ARG D NH2 1 
ATOM   597  N N   . ALA A 1 77  ? 12.654  8.030   42.181 1.00 26.39 ? 80  ALA D N   1 
ATOM   598  C CA  . ALA A 1 77  ? 11.819  7.809   43.353 1.00 25.66 ? 80  ALA D CA  1 
ATOM   599  C C   . ALA A 1 77  ? 10.519  8.599   43.345 1.00 24.22 ? 80  ALA D C   1 
ATOM   600  O O   . ALA A 1 77  ? 10.483  9.765   42.956 1.00 23.88 ? 80  ALA D O   1 
ATOM   601  C CB  . ALA A 1 77  ? 12.610  8.136   44.613 1.00 26.44 ? 80  ALA D CB  1 
ATOM   602  N N   . THR A 1 78  ? 9.448   7.942   43.772 1.00 22.79 ? 81  THR D N   1 
ATOM   603  C CA  . THR A 1 78  ? 8.138   8.574   43.866 1.00 22.37 ? 81  THR D CA  1 
ATOM   604  C C   . THR A 1 78  ? 7.684   8.330   45.298 1.00 20.74 ? 81  THR D C   1 
ATOM   605  O O   . THR A 1 78  ? 8.312   7.562   46.029 1.00 17.36 ? 81  THR D O   1 
ATOM   606  C CB  . THR A 1 78  ? 7.119   7.933   42.902 1.00 22.64 ? 81  THR D CB  1 
ATOM   607  O OG1 . THR A 1 78  ? 6.877   6.577   43.292 1.00 26.78 ? 81  THR D OG1 1 
ATOM   608  C CG2 . THR A 1 78  ? 7.650   7.959   41.476 1.00 24.08 ? 81  THR D CG2 1 
ATOM   609  N N   . LEU A 1 79  ? 6.602   8.978   45.707 1.00 20.40 ? 82  LEU D N   1 
ATOM   610  C CA  . LEU A 1 79  ? 6.103   8.795   47.064 1.00 22.00 ? 82  LEU D CA  1 
ATOM   611  C C   . LEU A 1 79  ? 5.853   7.324   47.389 1.00 22.33 ? 82  LEU D C   1 
ATOM   612  O O   . LEU A 1 79  ? 6.140   6.876   48.497 1.00 21.76 ? 82  LEU D O   1 
ATOM   613  C CB  . LEU A 1 79  ? 4.817   9.601   47.273 1.00 22.58 ? 82  LEU D CB  1 
ATOM   614  C CG  . LEU A 1 79  ? 4.989   11.120  47.230 1.00 24.82 ? 82  LEU D CG  1 
ATOM   615  C CD1 . LEU A 1 79  ? 3.654   11.797  47.509 1.00 25.32 ? 82  LEU D CD1 1 
ATOM   616  C CD2 . LEU A 1 79  ? 6.025   11.549  48.261 1.00 24.02 ? 82  LEU D CD2 1 
ATOM   617  N N   . ARG A 1 80  ? 5.335   6.571   46.422 1.00 22.93 ? 83  ARG D N   1 
ATOM   618  C CA  . ARG A 1 80  ? 5.051   5.155   46.646 1.00 24.64 ? 83  ARG D CA  1 
ATOM   619  C C   . ARG A 1 80  ? 6.285   4.293   46.885 1.00 24.00 ? 83  ARG D C   1 
ATOM   620  O O   . ARG A 1 80  ? 6.166   3.138   47.298 1.00 25.19 ? 83  ARG D O   1 
ATOM   621  C CB  . ARG A 1 80  ? 4.251   4.575   45.479 1.00 28.14 ? 83  ARG D CB  1 
ATOM   622  C CG  . ARG A 1 80  ? 2.745   4.712   45.639 1.00 33.27 ? 83  ARG D CG  1 
ATOM   623  C CD  . ARG A 1 80  ? 2.007   3.952   44.544 1.00 37.97 ? 83  ARG D CD  1 
ATOM   624  N NE  . ARG A 1 80  ? 2.480   2.574   44.414 1.00 41.36 ? 83  ARG D NE  1 
ATOM   625  C CZ  . ARG A 1 80  ? 2.418   1.659   45.378 1.00 42.32 ? 83  ARG D CZ  1 
ATOM   626  N NH1 . ARG A 1 80  ? 1.901   1.965   46.561 1.00 43.13 ? 83  ARG D NH1 1 
ATOM   627  N NH2 . ARG A 1 80  ? 2.878   0.433   45.159 1.00 42.94 ? 83  ARG D NH2 1 
ATOM   628  N N   . ASP A 1 81  ? 7.467   4.840   46.623 1.00 22.14 ? 84  ASP D N   1 
ATOM   629  C CA  . ASP A 1 81  ? 8.695   4.082   46.834 1.00 19.80 ? 84  ASP D CA  1 
ATOM   630  C C   . ASP A 1 81  ? 9.151   4.136   48.289 1.00 19.21 ? 84  ASP D C   1 
ATOM   631  O O   . ASP A 1 81  ? 10.102  3.453   48.668 1.00 16.94 ? 84  ASP D O   1 
ATOM   632  C CB  . ASP A 1 81  ? 9.804   4.598   45.915 1.00 20.98 ? 84  ASP D CB  1 
ATOM   633  C CG  . ASP A 1 81  ? 9.574   4.225   44.458 1.00 24.90 ? 84  ASP D CG  1 
ATOM   634  O OD1 . ASP A 1 81  ? 10.052  4.965   43.573 1.00 26.23 ? 84  ASP D OD1 1 
ATOM   635  O OD2 . ASP A 1 81  ? 8.927   3.184   44.199 1.00 25.83 ? 84  ASP D OD2 1 
ATOM   636  N N   . ALA A 1 82  ? 8.481   4.949   49.102 1.00 17.82 ? 85  ALA D N   1 
ATOM   637  C CA  . ALA A 1 82  ? 8.830   5.058   50.517 1.00 17.17 ? 85  ALA D CA  1 
ATOM   638  C C   . ALA A 1 82  ? 8.514   3.710   51.145 1.00 17.78 ? 85  ALA D C   1 
ATOM   639  O O   . ALA A 1 82  ? 7.377   3.240   51.082 1.00 18.17 ? 85  ALA D O   1 
ATOM   640  C CB  . ALA A 1 82  ? 8.016   6.157   51.180 1.00 17.68 ? 85  ALA D CB  1 
ATOM   641  N N   . ALA A 1 83  ? 9.520   3.089   51.749 1.00 15.45 ? 86  ALA D N   1 
ATOM   642  C CA  . ALA A 1 83  ? 9.343   1.770   52.337 1.00 14.35 ? 86  ALA D CA  1 
ATOM   643  C C   . ALA A 1 83  ? 10.637  1.316   52.993 1.00 13.41 ? 86  ALA D C   1 
ATOM   644  O O   . ALA A 1 83  ? 11.628  2.044   52.997 1.00 14.19 ? 86  ALA D O   1 
ATOM   645  C CB  . ALA A 1 83  ? 8.961   0.786   51.244 1.00 15.29 ? 86  ALA D CB  1 
ATOM   646  N N   . VAL A 1 84  ? 10.620  0.114   53.558 1.00 12.76 ? 87  VAL D N   1 
ATOM   647  C CA  . VAL A 1 84  ? 11.819  -0.439  54.165 1.00 12.49 ? 87  VAL D CA  1 
ATOM   648  C C   . VAL A 1 84  ? 12.447  -1.311  53.086 1.00 11.95 ? 87  VAL D C   1 
ATOM   649  O O   . VAL A 1 84  ? 11.764  -2.126  52.469 1.00 13.24 ? 87  VAL D O   1 
ATOM   650  C CB  . VAL A 1 84  ? 11.494  -1.305  55.398 1.00 14.10 ? 87  VAL D CB  1 
ATOM   651  C CG1 . VAL A 1 84  ? 12.767  -1.938  55.938 1.00 13.63 ? 87  VAL D CG1 1 
ATOM   652  C CG2 . VAL A 1 84  ? 10.852  -0.444  56.472 1.00 13.82 ? 87  VAL D CG2 1 
ATOM   653  N N   . TYR A 1 85  ? 13.739  -1.116  52.844 1.00 11.41 ? 88  TYR D N   1 
ATOM   654  C CA  . TYR A 1 85  ? 14.460  -1.880  51.833 1.00 11.53 ? 88  TYR D CA  1 
ATOM   655  C C   . TYR A 1 85  ? 15.459  -2.808  52.499 1.00 12.60 ? 88  TYR D C   1 
ATOM   656  O O   . TYR A 1 85  ? 16.271  -2.374  53.320 1.00 13.67 ? 88  TYR D O   1 
ATOM   657  C CB  . TYR A 1 85  ? 15.180  -0.937  50.867 1.00 10.72 ? 88  TYR D CB  1 
ATOM   658  C CG  . TYR A 1 85  ? 14.233  -0.224  49.934 1.00 12.16 ? 88  TYR D CG  1 
ATOM   659  C CD1 . TYR A 1 85  ? 14.011  -0.698  48.644 1.00 12.48 ? 88  TYR D CD1 1 
ATOM   660  C CD2 . TYR A 1 85  ? 13.506  0.885   50.363 1.00 12.04 ? 88  TYR D CD2 1 
ATOM   661  C CE1 . TYR A 1 85  ? 13.085  -0.091  47.802 1.00 13.04 ? 88  TYR D CE1 1 
ATOM   662  C CE2 . TYR A 1 85  ? 12.573  1.497   49.533 1.00 13.36 ? 88  TYR D CE2 1 
ATOM   663  C CZ  . TYR A 1 85  ? 12.366  1.003   48.253 1.00 14.41 ? 88  TYR D CZ  1 
ATOM   664  O OH  . TYR A 1 85  ? 11.428  1.590   47.432 1.00 14.50 ? 88  TYR D OH  1 
ATOM   665  N N   . TYR A 1 86  ? 15.393  -4.085  52.125 1.00 12.03 ? 89  TYR D N   1 
ATOM   666  C CA  . TYR A 1 86  ? 16.256  -5.114  52.688 1.00 11.49 ? 89  TYR D CA  1 
ATOM   667  C C   . TYR A 1 86  ? 17.267  -5.676  51.700 1.00 12.24 ? 89  TYR D C   1 
ATOM   668  O O   . TYR A 1 86  ? 16.901  -6.133  50.615 1.00 12.49 ? 89  TYR D O   1 
ATOM   669  C CB  . TYR A 1 86  ? 15.421  -6.292  53.200 1.00 11.81 ? 89  TYR D CB  1 
ATOM   670  C CG  . TYR A 1 86  ? 14.309  -5.933  54.157 1.00 12.24 ? 89  TYR D CG  1 
ATOM   671  C CD1 . TYR A 1 86  ? 13.017  -5.683  53.691 1.00 13.61 ? 89  TYR D CD1 1 
ATOM   672  C CD2 . TYR A 1 86  ? 14.538  -5.885  55.530 1.00 12.00 ? 89  TYR D CD2 1 
ATOM   673  C CE1 . TYR A 1 86  ? 11.976  -5.403  54.575 1.00 14.38 ? 89  TYR D CE1 1 
ATOM   674  C CE2 . TYR A 1 86  ? 13.505  -5.603  56.423 1.00 13.98 ? 89  TYR D CE2 1 
ATOM   675  C CZ  . TYR A 1 86  ? 12.228  -5.367  55.938 1.00 14.95 ? 89  TYR D CZ  1 
ATOM   676  O OH  . TYR A 1 86  ? 11.202  -5.113  56.823 1.00 15.43 ? 89  TYR D OH  1 
ATOM   677  N N   . CYS A 1 87  ? 18.536  -5.648  52.091 1.00 12.96 ? 90  CYS D N   1 
ATOM   678  C CA  . CYS A 1 87  ? 19.616  -6.208  51.286 1.00 14.37 ? 90  CYS D CA  1 
ATOM   679  C C   . CYS A 1 87  ? 19.861  -7.591  51.892 1.00 14.36 ? 90  CYS D C   1 
ATOM   680  O O   . CYS A 1 87  ? 20.151  -7.719  53.088 1.00 15.76 ? 90  CYS D O   1 
ATOM   681  C CB  . CYS A 1 87  ? 20.855  -5.328  51.409 1.00 15.16 ? 90  CYS D CB  1 
ATOM   682  S SG  . CYS A 1 87  ? 22.350  -5.946  50.587 1.00 19.00 ? 90  CYS D SG  1 
ATOM   683  N N   . ILE A 1 88  ? 19.737  -8.623  51.067 1.00 13.73 ? 91  ILE D N   1 
ATOM   684  C CA  . ILE A 1 88  ? 19.880  -9.994  51.533 1.00 14.87 ? 91  ILE D CA  1 
ATOM   685  C C   . ILE A 1 88  ? 20.946  -10.780 50.774 1.00 16.01 ? 91  ILE D C   1 
ATOM   686  O O   . ILE A 1 88  ? 20.993  -10.751 49.548 1.00 15.90 ? 91  ILE D O   1 
ATOM   687  C CB  . ILE A 1 88  ? 18.524  -10.722 51.398 1.00 15.61 ? 91  ILE D CB  1 
ATOM   688  C CG1 . ILE A 1 88  ? 17.457  -9.969  52.199 1.00 16.42 ? 91  ILE D CG1 1 
ATOM   689  C CG2 . ILE A 1 88  ? 18.652  -12.170 51.851 1.00 15.43 ? 91  ILE D CG2 1 
ATOM   690  C CD1 . ILE A 1 88  ? 16.035  -10.438 51.940 1.00 17.58 ? 91  ILE D CD1 1 
ATOM   691  N N   . LEU A 1 89  ? 21.797  -11.482 51.516 1.00 17.97 ? 92  LEU D N   1 
ATOM   692  C CA  . LEU A 1 89  ? 22.852  -12.295 50.921 1.00 20.71 ? 92  LEU D CA  1 
ATOM   693  C C   . LEU A 1 89  ? 22.615  -13.749 51.316 1.00 23.03 ? 92  LEU D C   1 
ATOM   694  O O   . LEU A 1 89  ? 23.041  -14.191 52.383 1.00 21.94 ? 92  LEU D O   1 
ATOM   695  C CB  . LEU A 1 89  ? 24.224  -11.843 51.425 1.00 22.94 ? 92  LEU D CB  1 
ATOM   696  C CG  . LEU A 1 89  ? 25.421  -12.649 50.915 1.00 25.16 ? 92  LEU D CG  1 
ATOM   697  C CD1 . LEU A 1 89  ? 25.512  -12.535 49.404 1.00 26.25 ? 92  LEU D CD1 1 
ATOM   698  C CD2 . LEU A 1 89  ? 26.696  -12.132 51.570 1.00 28.16 ? 92  LEU D CD2 1 
ATOM   699  N N   . PRO A 1 90  ? 21.921  -14.511 50.460 1.00 25.31 ? 93  PRO D N   1 
ATOM   700  C CA  . PRO A 1 90  ? 21.627  -15.919 50.733 1.00 29.64 ? 93  PRO D CA  1 
ATOM   701  C C   . PRO A 1 90  ? 22.776  -16.868 50.416 1.00 33.79 ? 93  PRO D C   1 
ATOM   702  O O   . PRO A 1 90  ? 23.771  -16.482 49.802 1.00 34.03 ? 93  PRO D O   1 
ATOM   703  C CB  . PRO A 1 90  ? 20.408  -16.180 49.860 1.00 29.07 ? 93  PRO D CB  1 
ATOM   704  C CG  . PRO A 1 90  ? 20.703  -15.355 48.657 1.00 28.41 ? 93  PRO D CG  1 
ATOM   705  C CD  . PRO A 1 90  ? 21.223  -14.058 49.242 1.00 26.22 ? 93  PRO D CD  1 
ATOM   706  N N   . LEU A 1 91  ? 22.622  -18.116 50.847 1.00 38.73 ? 94  LEU D N   1 
ATOM   707  C CA  . LEU A 1 91  ? 23.619  -19.152 50.611 1.00 42.56 ? 94  LEU D CA  1 
ATOM   708  C C   . LEU A 1 91  ? 23.376  -19.760 49.233 1.00 44.54 ? 94  LEU D C   1 
ATOM   709  O O   . LEU A 1 91  ? 22.233  -19.878 48.790 1.00 45.31 ? 94  LEU D O   1 
ATOM   710  C CB  . LEU A 1 91  ? 23.508  -20.239 51.684 1.00 44.11 ? 94  LEU D CB  1 
ATOM   711  C CG  . LEU A 1 91  ? 24.405  -21.473 51.549 1.00 46.05 ? 94  LEU D CG  1 
ATOM   712  C CD1 . LEU A 1 91  ? 25.868  -21.071 51.658 1.00 46.81 ? 94  LEU D CD1 1 
ATOM   713  C CD2 . LEU A 1 91  ? 24.046  -22.477 52.635 1.00 47.24 ? 94  LEU D CD2 1 
ATOM   714  N N   . ALA A 1 92  ? 24.453  -20.139 48.555 1.00 46.30 ? 95  ALA D N   1 
ATOM   715  C CA  . ALA A 1 92  ? 24.346  -20.735 47.229 1.00 47.93 ? 95  ALA D CA  1 
ATOM   716  C C   . ALA A 1 92  ? 25.134  -22.038 47.176 1.00 48.91 ? 95  ALA D C   1 
ATOM   717  O O   . ALA A 1 92  ? 26.346  -22.050 47.394 1.00 50.24 ? 95  ALA D O   1 
ATOM   718  C CB  . ALA A 1 92  ? 24.865  -19.763 46.174 1.00 48.33 ? 95  ALA D CB  1 
ATOM   719  N N   . GLY A 1 93  ? 24.439  -23.133 46.886 1.00 49.23 ? 96  GLY D N   1 
ATOM   720  C CA  . GLY A 1 93  ? 25.092  -24.427 46.815 1.00 48.82 ? 96  GLY D CA  1 
ATOM   721  C C   . GLY A 1 93  ? 24.959  -25.205 48.109 1.00 49.06 ? 96  GLY D C   1 
ATOM   722  O O   . GLY A 1 93  ? 24.216  -24.808 49.009 1.00 48.82 ? 96  GLY D O   1 
ATOM   723  N N   . GLY A 1 94  ? 25.683  -26.316 48.206 1.00 48.77 ? 97  GLY D N   1 
ATOM   724  C CA  . GLY A 1 94  ? 25.624  -27.133 49.404 1.00 47.99 ? 97  GLY D CA  1 
ATOM   725  C C   . GLY A 1 94  ? 24.223  -27.642 49.676 1.00 47.70 ? 97  GLY D C   1 
ATOM   726  O O   . GLY A 1 94  ? 23.648  -28.363 48.859 1.00 48.17 ? 97  GLY D O   1 
ATOM   727  N N   . THR A 1 95  ? 23.670  -27.263 50.824 1.00 46.36 ? 98  THR D N   1 
ATOM   728  C CA  . THR A 1 95  ? 22.327  -27.683 51.205 1.00 45.25 ? 98  THR D CA  1 
ATOM   729  C C   . THR A 1 95  ? 21.371  -26.489 51.191 1.00 43.39 ? 98  THR D C   1 
ATOM   730  O O   . THR A 1 95  ? 20.341  -26.497 51.865 1.00 43.60 ? 98  THR D O   1 
ATOM   731  C CB  . THR A 1 95  ? 22.325  -28.312 52.616 1.00 46.53 ? 98  THR D CB  1 
ATOM   732  O OG1 . THR A 1 95  ? 23.376  -29.282 52.708 1.00 47.98 ? 98  THR D OG1 1 
ATOM   733  C CG2 . THR A 1 95  ? 20.994  -29.005 52.894 1.00 46.87 ? 98  THR D CG2 1 
ATOM   734  N N   . SER A 1 96  ? 21.719  -25.462 50.421 1.00 40.42 ? 99  SER D N   1 
ATOM   735  C CA  . SER A 1 96  ? 20.886  -24.267 50.328 1.00 37.33 ? 99  SER D CA  1 
ATOM   736  C C   . SER A 1 96  ? 19.589  -24.590 49.594 1.00 35.16 ? 99  SER D C   1 
ATOM   737  O O   . SER A 1 96  ? 19.570  -25.423 48.687 1.00 34.49 ? 99  SER D O   1 
ATOM   738  C CB  . SER A 1 96  ? 21.634  -23.153 49.588 1.00 37.82 ? 99  SER D CB  1 
ATOM   739  O OG  . SER A 1 96  ? 21.862  -23.501 48.234 1.00 38.46 ? 99  SER D OG  1 
ATOM   740  N N   . TYR A 1 97  ? 18.506  -23.927 49.989 1.00 31.46 ? 100 TYR D N   1 
ATOM   741  C CA  . TYR A 1 97  ? 17.205  -24.156 49.370 1.00 28.71 ? 100 TYR D CA  1 
ATOM   742  C C   . TYR A 1 97  ? 16.490  -22.851 49.025 1.00 26.71 ? 100 TYR D C   1 
ATOM   743  O O   . TYR A 1 97  ? 15.343  -22.865 48.580 1.00 26.28 ? 100 TYR D O   1 
ATOM   744  C CB  . TYR A 1 97  ? 16.329  -24.998 50.303 1.00 27.85 ? 100 TYR D CB  1 
ATOM   745  C CG  . TYR A 1 97  ? 16.088  -24.364 51.656 1.00 26.17 ? 100 TYR D CG  1 
ATOM   746  C CD1 . TYR A 1 97  ? 15.220  -23.284 51.793 1.00 25.73 ? 100 TYR D CD1 1 
ATOM   747  C CD2 . TYR A 1 97  ? 16.743  -24.832 52.796 1.00 25.60 ? 100 TYR D CD2 1 
ATOM   748  C CE1 . TYR A 1 97  ? 15.008  -22.683 53.029 1.00 26.19 ? 100 TYR D CE1 1 
ATOM   749  C CE2 . TYR A 1 97  ? 16.539  -24.237 54.040 1.00 24.41 ? 100 TYR D CE2 1 
ATOM   750  C CZ  . TYR A 1 97  ? 15.670  -23.163 54.147 1.00 25.47 ? 100 TYR D CZ  1 
ATOM   751  O OH  . TYR A 1 97  ? 15.461  -22.558 55.364 1.00 24.71 ? 100 TYR D OH  1 
ATOM   752  N N   . GLY A 1 98  ? 17.167  -21.728 49.237 1.00 24.11 ? 102 GLY D N   1 
ATOM   753  C CA  . GLY A 1 98  ? 16.565  -20.441 48.933 1.00 21.96 ? 102 GLY D CA  1 
ATOM   754  C C   . GLY A 1 98  ? 16.226  -19.611 50.159 1.00 20.19 ? 102 GLY D C   1 
ATOM   755  O O   . GLY A 1 98  ? 15.539  -18.595 50.062 1.00 18.56 ? 102 GLY D O   1 
ATOM   756  N N   . LYS A 1 99  ? 16.704  -20.039 51.319 1.00 18.31 ? 103 LYS D N   1 
ATOM   757  C CA  . LYS A 1 99  ? 16.432  -19.306 52.546 1.00 18.55 ? 103 LYS D CA  1 
ATOM   758  C C   . LYS A 1 99  ? 16.922  -17.870 52.428 1.00 19.56 ? 103 LYS D C   1 
ATOM   759  O O   . LYS A 1 99  ? 18.035  -17.621 51.952 1.00 20.83 ? 103 LYS D O   1 
ATOM   760  C CB  . LYS A 1 99  ? 17.123  -19.973 53.732 1.00 18.06 ? 103 LYS D CB  1 
ATOM   761  C CG  . LYS A 1 99  ? 16.783  -19.355 55.078 1.00 20.63 ? 103 LYS D CG  1 
ATOM   762  C CD  . LYS A 1 99  ? 17.550  -20.048 56.195 1.00 24.60 ? 103 LYS D CD  1 
ATOM   763  C CE  . LYS A 1 99  ? 17.138  -19.526 57.556 1.00 26.95 ? 103 LYS D CE  1 
ATOM   764  N NZ  . LYS A 1 99  ? 17.915  -20.180 58.646 1.00 31.70 ? 103 LYS D NZ  1 
ATOM   765  N N   . LEU A 1 100 ? 16.079  -16.933 52.847 1.00 18.42 ? 104 LEU D N   1 
ATOM   766  C CA  . LEU A 1 100 ? 16.418  -15.516 52.823 1.00 18.04 ? 104 LEU D CA  1 
ATOM   767  C C   . LEU A 1 100 ? 16.406  -15.013 54.255 1.00 18.62 ? 104 LEU D C   1 
ATOM   768  O O   . LEU A 1 100 ? 15.451  -15.250 54.993 1.00 18.85 ? 104 LEU D O   1 
ATOM   769  C CB  . LEU A 1 100 ? 15.388  -14.716 52.021 1.00 19.33 ? 104 LEU D CB  1 
ATOM   770  C CG  . LEU A 1 100 ? 15.182  -15.078 50.550 1.00 19.63 ? 104 LEU D CG  1 
ATOM   771  C CD1 . LEU A 1 100 ? 14.170  -14.124 49.936 1.00 20.56 ? 104 LEU D CD1 1 
ATOM   772  C CD2 . LEU A 1 100 ? 16.497  -15.012 49.802 1.00 21.46 ? 104 LEU D CD2 1 
ATOM   773  N N   . THR A 1 101 ? 17.471  -14.324 54.644 1.00 16.88 ? 105 THR D N   1 
ATOM   774  C CA  . THR A 1 101 ? 17.559  -13.766 55.982 1.00 17.81 ? 105 THR D CA  1 
ATOM   775  C C   . THR A 1 101 ? 17.416  -12.254 55.893 1.00 17.76 ? 105 THR D C   1 
ATOM   776  O O   . THR A 1 101 ? 18.330  -11.564 55.436 1.00 18.34 ? 105 THR D O   1 
ATOM   777  C CB  . THR A 1 101 ? 18.907  -14.110 56.646 1.00 18.75 ? 105 THR D CB  1 
ATOM   778  O OG1 . THR A 1 101 ? 18.991  -15.527 56.831 1.00 19.97 ? 105 THR D OG1 1 
ATOM   779  C CG2 . THR A 1 101 ? 19.036  -13.413 57.999 1.00 20.90 ? 105 THR D CG2 1 
ATOM   780  N N   . PHE A 1 102 ? 16.255  -11.745 56.297 1.00 20.07 ? 106 PHE D N   1 
ATOM   781  C CA  . PHE A 1 102 ? 16.012  -10.307 56.281 1.00 22.06 ? 106 PHE D CA  1 
ATOM   782  C C   . PHE A 1 102 ? 16.687  -9.698  57.504 1.00 22.92 ? 106 PHE D C   1 
ATOM   783  O O   . PHE A 1 102 ? 16.603  -10.234 58.608 1.00 24.03 ? 106 PHE D O   1 
ATOM   784  C CB  . PHE A 1 102 ? 14.511  -9.981  56.366 1.00 21.98 ? 106 PHE D CB  1 
ATOM   785  C CG  . PHE A 1 102 ? 13.725  -10.335 55.135 1.00 20.45 ? 106 PHE D CG  1 
ATOM   786  C CD1 . PHE A 1 102 ? 13.452  -11.660 54.820 1.00 20.52 ? 106 PHE D CD1 1 
ATOM   787  C CD2 . PHE A 1 102 ? 13.237  -9.335  54.300 1.00 19.92 ? 106 PHE D CD2 1 
ATOM   788  C CE1 . PHE A 1 102 ? 12.704  -11.986 53.690 1.00 19.58 ? 106 PHE D CE1 1 
ATOM   789  C CE2 . PHE A 1 102 ? 12.490  -9.646  53.167 1.00 20.09 ? 106 PHE D CE2 1 
ATOM   790  C CZ  . PHE A 1 102 ? 12.223  -10.975 52.863 1.00 20.87 ? 106 PHE D CZ  1 
ATOM   791  N N   . GLY A 1 103 ? 17.377  -8.589  57.301 1.00 22.94 ? 107 GLY D N   1 
ATOM   792  C CA  . GLY A 1 103 ? 18.002  -7.920  58.422 1.00 19.73 ? 107 GLY D CA  1 
ATOM   793  C C   . GLY A 1 103 ? 17.019  -6.841  58.826 1.00 19.79 ? 107 GLY D C   1 
ATOM   794  O O   . GLY A 1 103 ? 15.811  -6.994  58.624 1.00 19.82 ? 107 GLY D O   1 
ATOM   795  N N   . GLN A 1 104 ? 17.531  -5.744  59.370 1.00 18.91 ? 108 GLN D N   1 
ATOM   796  C CA  . GLN A 1 104 ? 16.696  -4.626  59.797 1.00 19.27 ? 108 GLN D CA  1 
ATOM   797  C C   . GLN A 1 104 ? 16.287  -3.767  58.604 1.00 17.82 ? 108 GLN D C   1 
ATOM   798  O O   . GLN A 1 104 ? 15.232  -3.126  58.621 1.00 17.23 ? 108 GLN D O   1 
ATOM   799  C CB  . GLN A 1 104 ? 17.462  -3.760  60.802 1.00 22.06 ? 108 GLN D CB  1 
ATOM   800  C CG  . GLN A 1 104 ? 16.694  -2.551  61.313 1.00 27.07 ? 108 GLN D CG  1 
ATOM   801  C CD  . GLN A 1 104 ? 15.534  -2.925  62.216 1.00 30.83 ? 108 GLN D CD  1 
ATOM   802  O OE1 . GLN A 1 104 ? 15.705  -3.646  63.201 1.00 33.81 ? 108 GLN D OE1 1 
ATOM   803  N NE2 . GLN A 1 104 ? 14.346  -2.428  61.890 1.00 32.73 ? 108 GLN D NE2 1 
ATOM   804  N N   . GLY A 1 105 ? 17.133  -3.754  57.578 1.00 16.20 ? 109 GLY D N   1 
ATOM   805  C CA  . GLY A 1 105 ? 16.860  -2.961  56.391 1.00 16.47 ? 109 GLY D CA  1 
ATOM   806  C C   . GLY A 1 105 ? 17.068  -1.469  56.600 1.00 15.82 ? 109 GLY D C   1 
ATOM   807  O O   . GLY A 1 105 ? 17.517  -1.038  57.665 1.00 17.25 ? 109 GLY D O   1 
ATOM   808  N N   . THR A 1 106 ? 16.751  -0.680  55.578 1.00 15.69 ? 110 THR D N   1 
ATOM   809  C CA  . THR A 1 106 ? 16.886  0.773   55.657 1.00 16.24 ? 110 THR D CA  1 
ATOM   810  C C   . THR A 1 106 ? 15.522  1.399   55.399 1.00 16.04 ? 110 THR D C   1 
ATOM   811  O O   . THR A 1 106 ? 14.823  0.995   54.473 1.00 16.66 ? 110 THR D O   1 
ATOM   812  C CB  . THR A 1 106 ? 17.844  1.342   54.583 1.00 17.19 ? 110 THR D CB  1 
ATOM   813  O OG1 . THR A 1 106 ? 19.135  0.733   54.687 1.00 19.62 ? 110 THR D OG1 1 
ATOM   814  C CG2 . THR A 1 106 ? 17.991  2.843   54.772 1.00 17.73 ? 110 THR D CG2 1 
ATOM   815  N N   . ILE A 1 107 ? 15.144  2.379   56.213 1.00 15.16 ? 111 ILE D N   1 
ATOM   816  C CA  . ILE A 1 107 ? 13.867  3.057   56.031 1.00 14.14 ? 111 ILE D CA  1 
ATOM   817  C C   . ILE A 1 107 ? 14.039  4.220   55.061 1.00 13.62 ? 111 ILE D C   1 
ATOM   818  O O   . ILE A 1 107 ? 14.751  5.180   55.355 1.00 14.03 ? 111 ILE D O   1 
ATOM   819  C CB  . ILE A 1 107 ? 13.326  3.623   57.365 1.00 14.93 ? 111 ILE D CB  1 
ATOM   820  C CG1 . ILE A 1 107 ? 13.189  2.498   58.393 1.00 15.55 ? 111 ILE D CG1 1 
ATOM   821  C CG2 . ILE A 1 107 ? 11.981  4.310   57.130 1.00 15.82 ? 111 ILE D CG2 1 
ATOM   822  C CD1 . ILE A 1 107 ? 12.851  2.982   59.801 1.00 16.98 ? 111 ILE D CD1 1 
ATOM   823  N N   . LEU A 1 108 ? 13.393  4.134   53.904 1.00 13.05 ? 112 LEU D N   1 
ATOM   824  C CA  . LEU A 1 108 ? 13.481  5.206   52.925 1.00 13.94 ? 112 LEU D CA  1 
ATOM   825  C C   . LEU A 1 108 ? 12.234  6.079   52.989 1.00 14.68 ? 112 LEU D C   1 
ATOM   826  O O   . LEU A 1 108 ? 11.110  5.587   52.850 1.00 14.71 ? 112 LEU D O   1 
ATOM   827  C CB  . LEU A 1 108 ? 13.628  4.649   51.504 1.00 13.61 ? 112 LEU D CB  1 
ATOM   828  C CG  . LEU A 1 108 ? 13.603  5.734   50.415 1.00 12.88 ? 112 LEU D CG  1 
ATOM   829  C CD1 . LEU A 1 108 ? 14.871  6.577   50.494 1.00 13.60 ? 112 LEU D CD1 1 
ATOM   830  C CD2 . LEU A 1 108 ? 13.485  5.094   49.042 1.00 13.42 ? 112 LEU D CD2 1 
ATOM   831  N N   . THR A 1 109 ? 12.441  7.371   53.223 1.00 14.90 ? 113 THR D N   1 
ATOM   832  C CA  . THR A 1 109 ? 11.351  8.334   53.266 1.00 15.57 ? 113 THR D CA  1 
ATOM   833  C C   . THR A 1 109 ? 11.523  9.193   52.018 1.00 16.26 ? 113 THR D C   1 
ATOM   834  O O   . THR A 1 109 ? 12.627  9.661   51.733 1.00 16.97 ? 113 THR D O   1 
ATOM   835  C CB  . THR A 1 109 ? 11.435  9.238   54.515 1.00 17.28 ? 113 THR D CB  1 
ATOM   836  O OG1 . THR A 1 109 ? 11.361  8.431   55.699 1.00 19.21 ? 113 THR D OG1 1 
ATOM   837  C CG2 . THR A 1 109 ? 10.285  10.233  54.522 1.00 18.31 ? 113 THR D CG2 1 
ATOM   838  N N   . VAL A 1 110 ? 10.449  9.377   51.260 1.00 15.33 ? 114 VAL D N   1 
ATOM   839  C CA  . VAL A 1 110 ? 10.519  10.191  50.051 1.00 16.49 ? 114 VAL D CA  1 
ATOM   840  C C   . VAL A 1 110 ? 9.702   11.450  50.294 1.00 18.19 ? 114 VAL D C   1 
ATOM   841  O O   . VAL A 1 110 ? 8.491   11.380  50.499 1.00 19.38 ? 114 VAL D O   1 
ATOM   842  C CB  . VAL A 1 110 ? 9.940   9.444   48.828 1.00 16.02 ? 114 VAL D CB  1 
ATOM   843  C CG1 . VAL A 1 110 ? 10.117  10.292  47.579 1.00 18.29 ? 114 VAL D CG1 1 
ATOM   844  C CG2 . VAL A 1 110 ? 10.630  8.095   48.657 1.00 16.91 ? 114 VAL D CG2 1 
ATOM   845  N N   . HIS A 1 111 ? 10.368  12.600  50.273 1.00 17.76 ? 115 HIS D N   1 
ATOM   846  C CA  . HIS A 1 111 ? 9.690   13.867  50.515 1.00 17.79 ? 115 HIS D CA  1 
ATOM   847  C C   . HIS A 1 111 ? 9.194   14.523  49.240 1.00 17.26 ? 115 HIS D C   1 
ATOM   848  O O   . HIS A 1 111 ? 9.836   14.440  48.196 1.00 17.53 ? 115 HIS D O   1 
ATOM   849  C CB  . HIS A 1 111 ? 10.619  14.845  51.232 1.00 18.72 ? 115 HIS D CB  1 
ATOM   850  C CG  . HIS A 1 111 ? 11.111  14.351  52.553 1.00 21.13 ? 115 HIS D CG  1 
ATOM   851  N ND1 . HIS A 1 111 ? 12.167  13.473  52.674 1.00 24.62 ? 115 HIS D ND1 1 
ATOM   852  C CD2 . HIS A 1 111 ? 10.667  14.582  53.811 1.00 21.88 ? 115 HIS D CD2 1 
ATOM   853  C CE1 . HIS A 1 111 ? 12.351  13.185  53.950 1.00 23.59 ? 115 HIS D CE1 1 
ATOM   854  N NE2 . HIS A 1 111 ? 11.454  13.845  54.661 1.00 24.21 ? 115 HIS D NE2 1 
ATOM   855  N N   . PRO A 1 112 ? 8.034   15.185  49.315 1.00 16.36 ? 116 PRO D N   1 
ATOM   856  C CA  . PRO A 1 112 ? 7.463   15.864  48.154 1.00 16.53 ? 116 PRO D CA  1 
ATOM   857  C C   . PRO A 1 112 ? 8.187   17.189  47.942 1.00 17.48 ? 116 PRO D C   1 
ATOM   858  O O   . PRO A 1 112 ? 8.715   17.776  48.892 1.00 17.79 ? 116 PRO D O   1 
ATOM   859  C CB  . PRO A 1 112 ? 6.008   16.064  48.564 1.00 16.00 ? 116 PRO D CB  1 
ATOM   860  C CG  . PRO A 1 112 ? 6.130   16.315  50.035 1.00 15.82 ? 116 PRO D CG  1 
ATOM   861  C CD  . PRO A 1 112 ? 7.109   15.245  50.463 1.00 16.24 ? 116 PRO D CD  1 
ATOM   862  N N   . ASN A 1 113 ? 8.233   17.652  46.698 1.00 17.21 ? 117 ASN D N   1 
ATOM   863  C CA  . ASN A 1 113 ? 8.873   18.926  46.409 1.00 19.13 ? 117 ASN D CA  1 
ATOM   864  C C   . ASN A 1 113 ? 7.790   19.997  46.462 1.00 18.83 ? 117 ASN D C   1 
ATOM   865  O O   . ASN A 1 113 ? 7.000   20.146  45.534 1.00 20.47 ? 117 ASN D O   1 
ATOM   866  C CB  . ASN A 1 113 ? 9.544   18.886  45.035 1.00 20.36 ? 117 ASN D CB  1 
ATOM   867  C CG  . ASN A 1 113 ? 10.659  17.860  44.968 1.00 21.68 ? 117 ASN D CG  1 
ATOM   868  O OD1 . ASN A 1 113 ? 11.546  17.840  45.822 1.00 24.21 ? 117 ASN D OD1 1 
ATOM   869  N ND2 . ASN A 1 113 ? 10.622  17.005  43.956 1.00 22.78 ? 117 ASN D ND2 1 
ATOM   870  N N   . ILE A 1 114 ? 7.753   20.732  47.568 1.00 19.27 ? 118 ILE D N   1 
ATOM   871  C CA  . ILE A 1 114 ? 6.752   21.773  47.765 1.00 19.45 ? 118 ILE D CA  1 
ATOM   872  C C   . ILE A 1 114 ? 7.156   23.046  47.029 1.00 21.07 ? 118 ILE D C   1 
ATOM   873  O O   . ILE A 1 114 ? 8.045   23.772  47.467 1.00 22.24 ? 118 ILE D O   1 
ATOM   874  C CB  . ILE A 1 114 ? 6.565   22.074  49.275 1.00 17.37 ? 118 ILE D CB  1 
ATOM   875  C CG1 . ILE A 1 114 ? 6.328   20.765  50.041 1.00 17.57 ? 118 ILE D CG1 1 
ATOM   876  C CG2 . ILE A 1 114 ? 5.378   23.007  49.483 1.00 18.10 ? 118 ILE D CG2 1 
ATOM   877  C CD1 . ILE A 1 114 ? 5.121   19.966  49.562 1.00 17.82 ? 118 ILE D CD1 1 
ATOM   878  N N   . GLN A 1 115 ? 6.488   23.302  45.908 1.00 24.23 ? 119 GLN D N   1 
ATOM   879  C CA  . GLN A 1 115 ? 6.773   24.468  45.081 1.00 27.11 ? 119 GLN D CA  1 
ATOM   880  C C   . GLN A 1 115 ? 6.457   25.797  45.756 1.00 26.06 ? 119 GLN D C   1 
ATOM   881  O O   . GLN A 1 115 ? 7.213   26.759  45.623 1.00 27.65 ? 119 GLN D O   1 
ATOM   882  C CB  . GLN A 1 115 ? 6.005   24.365  43.761 1.00 30.72 ? 119 GLN D CB  1 
ATOM   883  C CG  . GLN A 1 115 ? 6.189   25.560  42.838 1.00 36.32 ? 119 GLN D CG  1 
ATOM   884  C CD  . GLN A 1 115 ? 5.576   25.340  41.468 1.00 39.25 ? 119 GLN D CD  1 
ATOM   885  O OE1 . GLN A 1 115 ? 6.009   24.467  40.716 1.00 40.70 ? 119 GLN D OE1 1 
ATOM   886  N NE2 . GLN A 1 115 ? 4.559   26.131  41.138 1.00 40.18 ? 119 GLN D NE2 1 
ATOM   887  N N   . ASN A 1 116 ? 5.348   25.853  46.483 1.00 24.21 ? 120 ASN D N   1 
ATOM   888  C CA  . ASN A 1 116 ? 4.964   27.088  47.155 1.00 24.35 ? 120 ASN D CA  1 
ATOM   889  C C   . ASN A 1 116 ? 4.587   26.879  48.620 1.00 21.18 ? 120 ASN D C   1 
ATOM   890  O O   . ASN A 1 116 ? 3.406   26.829  48.961 1.00 21.54 ? 120 ASN D O   1 
ATOM   891  C CB  . ASN A 1 116 ? 3.797   27.737  46.406 1.00 26.05 ? 120 ASN D CB  1 
ATOM   892  C CG  . ASN A 1 116 ? 4.154   28.094  44.974 1.00 29.37 ? 120 ASN D CG  1 
ATOM   893  O OD1 . ASN A 1 116 ? 5.028   28.927  44.730 1.00 30.61 ? 120 ASN D OD1 1 
ATOM   894  N ND2 . ASN A 1 116 ? 3.485   27.458  44.019 1.00 29.90 ? 120 ASN D ND2 1 
ATOM   895  N N   . PRO A 1 117 ? 5.590   26.758  49.507 1.00 20.97 ? 121 PRO D N   1 
ATOM   896  C CA  . PRO A 1 117 ? 5.317   26.558  50.934 1.00 19.89 ? 121 PRO D CA  1 
ATOM   897  C C   . PRO A 1 117 ? 4.347   27.621  51.454 1.00 18.91 ? 121 PRO D C   1 
ATOM   898  O O   . PRO A 1 117 ? 4.447   28.796  51.098 1.00 19.81 ? 121 PRO D O   1 
ATOM   899  C CB  . PRO A 1 117 ? 6.699   26.676  51.571 1.00 19.83 ? 121 PRO D CB  1 
ATOM   900  C CG  . PRO A 1 117 ? 7.604   26.167  50.492 1.00 21.26 ? 121 PRO D CG  1 
ATOM   901  C CD  . PRO A 1 117 ? 7.041   26.821  49.255 1.00 19.74 ? 121 PRO D CD  1 
ATOM   902  N N   . ASP A 1 118 ? 3.420   27.205  52.309 1.00 18.21 ? 122 ASP D N   1 
ATOM   903  C CA  . ASP A 1 118 ? 2.423   28.109  52.861 1.00 16.69 ? 122 ASP D CA  1 
ATOM   904  C C   . ASP A 1 118 ? 2.128   27.633  54.287 1.00 15.49 ? 122 ASP D C   1 
ATOM   905  O O   . ASP A 1 118 ? 0.975   27.413  54.661 1.00 14.99 ? 122 ASP D O   1 
ATOM   906  C CB  . ASP A 1 118 ? 1.177   28.045  51.970 1.00 18.24 ? 122 ASP D CB  1 
ATOM   907  C CG  . ASP A 1 118 ? 0.143   29.084  52.320 1.00 19.56 ? 122 ASP D CG  1 
ATOM   908  O OD1 . ASP A 1 118 ? 0.510   30.120  52.914 1.00 22.39 ? 122 ASP D OD1 1 
ATOM   909  O OD2 . ASP A 1 118 ? -1.041  28.869  51.979 1.00 22.93 ? 122 ASP D OD2 1 
ATOM   910  N N   . PRO A 1 119 ? 3.183   27.487  55.108 1.00 14.13 ? 123 PRO D N   1 
ATOM   911  C CA  . PRO A 1 119 ? 3.028   27.024  56.490 1.00 14.48 ? 123 PRO D CA  1 
ATOM   912  C C   . PRO A 1 119 ? 1.973   27.756  57.304 1.00 14.42 ? 123 PRO D C   1 
ATOM   913  O O   . PRO A 1 119 ? 1.921   28.983  57.323 1.00 14.30 ? 123 PRO D O   1 
ATOM   914  C CB  . PRO A 1 119 ? 4.435   27.175  57.070 1.00 13.36 ? 123 PRO D CB  1 
ATOM   915  C CG  . PRO A 1 119 ? 5.026   28.299  56.262 1.00 13.00 ? 123 PRO D CG  1 
ATOM   916  C CD  . PRO A 1 119 ? 4.566   27.942  54.867 1.00 15.23 ? 123 PRO D CD  1 
ATOM   917  N N   . ALA A 1 120 ? 1.130   26.987  57.982 1.00 13.79 ? 124 ALA D N   1 
ATOM   918  C CA  . ALA A 1 120 ? 0.076   27.563  58.799 1.00 13.53 ? 124 ALA D CA  1 
ATOM   919  C C   . ALA A 1 120 ? -0.419  26.562  59.829 1.00 13.72 ? 124 ALA D C   1 
ATOM   920  O O   . ALA A 1 120 ? -0.270  25.353  59.657 1.00 12.36 ? 124 ALA D O   1 
ATOM   921  C CB  . ALA A 1 120 ? -1.081  28.013  57.917 1.00 13.96 ? 124 ALA D CB  1 
ATOM   922  N N   . VAL A 1 121 ? -0.987  27.081  60.911 1.00 13.78 ? 125 VAL D N   1 
ATOM   923  C CA  . VAL A 1 121 ? -1.545  26.253  61.972 1.00 13.75 ? 125 VAL D CA  1 
ATOM   924  C C   . VAL A 1 121 ? -3.007  26.654  62.113 1.00 14.50 ? 125 VAL D C   1 
ATOM   925  O O   . VAL A 1 121 ? -3.322  27.802  62.430 1.00 14.98 ? 125 VAL D O   1 
ATOM   926  C CB  . VAL A 1 121 ? -0.817  26.473  63.313 1.00 14.37 ? 125 VAL D CB  1 
ATOM   927  C CG1 . VAL A 1 121 ? -1.542  25.723  64.428 1.00 15.78 ? 125 VAL D CG1 1 
ATOM   928  C CG2 . VAL A 1 121 ? 0.615   25.969  63.204 1.00 13.35 ? 125 VAL D CG2 1 
ATOM   929  N N   . TYR A 1 122 ? -3.891  25.695  61.865 1.00 15.43 ? 126 TYR D N   1 
ATOM   930  C CA  . TYR A 1 122 ? -5.326  25.927  61.923 1.00 15.30 ? 126 TYR D CA  1 
ATOM   931  C C   . TYR A 1 122 ? -5.995  25.136  63.033 1.00 16.05 ? 126 TYR D C   1 
ATOM   932  O O   . TYR A 1 122 ? -5.540  24.056  63.400 1.00 18.07 ? 126 TYR D O   1 
ATOM   933  C CB  . TYR A 1 122 ? -5.967  25.511  60.601 1.00 15.43 ? 126 TYR D CB  1 
ATOM   934  C CG  . TYR A 1 122 ? -5.390  26.189  59.382 1.00 14.91 ? 126 TYR D CG  1 
ATOM   935  C CD1 . TYR A 1 122 ? -5.596  27.548  59.153 1.00 15.00 ? 126 TYR D CD1 1 
ATOM   936  C CD2 . TYR A 1 122 ? -4.657  25.466  58.443 1.00 15.08 ? 126 TYR D CD2 1 
ATOM   937  C CE1 . TYR A 1 122 ? -5.090  28.169  58.014 1.00 15.02 ? 126 TYR D CE1 1 
ATOM   938  C CE2 . TYR A 1 122 ? -4.143  26.078  57.299 1.00 14.71 ? 126 TYR D CE2 1 
ATOM   939  C CZ  . TYR A 1 122 ? -4.367  27.431  57.093 1.00 13.04 ? 126 TYR D CZ  1 
ATOM   940  O OH  . TYR A 1 122 ? -3.873  28.043  55.963 1.00 14.28 ? 126 TYR D OH  1 
ATOM   941  N N   . GLN A 1 123 ? -7.085  25.681  63.558 1.00 18.05 ? 127 GLN D N   1 
ATOM   942  C CA  . GLN A 1 123 ? -7.843  24.991  64.590 1.00 20.05 ? 127 GLN D CA  1 
ATOM   943  C C   . GLN A 1 123 ? -9.097  24.484  63.904 1.00 20.18 ? 127 GLN D C   1 
ATOM   944  O O   . GLN A 1 123 ? -9.796  25.247  63.248 1.00 18.56 ? 127 GLN D O   1 
ATOM   945  C CB  . GLN A 1 123 ? -8.231  25.938  65.729 1.00 23.09 ? 127 GLN D CB  1 
ATOM   946  C CG  . GLN A 1 123 ? -9.162  25.287  66.747 1.00 28.16 ? 127 GLN D CG  1 
ATOM   947  C CD  . GLN A 1 123 ? -9.374  26.125  67.993 1.00 32.63 ? 127 GLN D CD  1 
ATOM   948  O OE1 . GLN A 1 123 ? -10.213 25.801  68.834 1.00 36.01 ? 127 GLN D OE1 1 
ATOM   949  N NE2 . GLN A 1 123 ? -8.612  27.204  68.121 1.00 34.14 ? 127 GLN D NE2 1 
ATOM   950  N N   . LEU A 1 124 ? -9.376  23.194  64.024 1.00 20.50 ? 128 LEU D N   1 
ATOM   951  C CA  . LEU A 1 124 ? -10.568 22.660  63.390 1.00 23.10 ? 128 LEU D CA  1 
ATOM   952  C C   . LEU A 1 124 ? -11.765 22.755  64.321 1.00 25.15 ? 128 LEU D C   1 
ATOM   953  O O   . LEU A 1 124 ? -11.607 22.872  65.535 1.00 26.79 ? 128 LEU D O   1 
ATOM   954  C CB  . LEU A 1 124 ? -10.340 21.212  62.944 1.00 24.48 ? 128 LEU D CB  1 
ATOM   955  C CG  . LEU A 1 124 ? -9.572  21.094  61.622 1.00 27.33 ? 128 LEU D CG  1 
ATOM   956  C CD1 . LEU A 1 124 ? -8.130  21.538  61.818 1.00 28.08 ? 128 LEU D CD1 1 
ATOM   957  C CD2 . LEU A 1 124 ? -9.628  19.665  61.118 1.00 26.80 ? 128 LEU D CD2 1 
ATOM   958  N N   . ARG A 1 125 ? -12.960 22.733  63.745 1.00 26.58 ? 129 ARG D N   1 
ATOM   959  C CA  . ARG A 1 125 ? -14.184 22.819  64.526 1.00 29.57 ? 129 ARG D CA  1 
ATOM   960  C C   . ARG A 1 125 ? -14.271 21.641  65.479 1.00 29.50 ? 129 ARG D C   1 
ATOM   961  O O   . ARG A 1 125 ? -14.064 20.497  65.080 1.00 28.70 ? 129 ARG D O   1 
ATOM   962  C CB  . ARG A 1 125 ? -15.409 22.824  63.604 1.00 31.90 ? 129 ARG D CB  1 
ATOM   963  C CG  . ARG A 1 125 ? -15.767 24.188  63.037 1.00 37.32 ? 129 ARG D CG  1 
ATOM   964  C CD  . ARG A 1 125 ? -16.312 25.110  64.123 1.00 42.11 ? 129 ARG D CD  1 
ATOM   965  N NE  . ARG A 1 125 ? -16.486 26.482  63.654 1.00 46.05 ? 129 ARG D NE  1 
ATOM   966  C CZ  . ARG A 1 125 ? -17.225 26.833  62.605 1.00 47.92 ? 129 ARG D CZ  1 
ATOM   967  N NH1 . ARG A 1 125 ? -17.869 25.912  61.900 1.00 49.58 ? 129 ARG D NH1 1 
ATOM   968  N NH2 . ARG A 1 125 ? -17.317 28.110  62.257 1.00 48.35 ? 129 ARG D NH2 1 
ATOM   969  N N   . ASP A 1 126 ? -14.578 21.920  66.740 1.00 30.83 ? 130 ASP D N   1 
ATOM   970  C CA  . ASP A 1 126 ? -14.697 20.859  67.729 1.00 32.46 ? 130 ASP D CA  1 
ATOM   971  C C   . ASP A 1 126 ? -15.796 19.891  67.310 1.00 32.84 ? 130 ASP D C   1 
ATOM   972  O O   . ASP A 1 126 ? -16.632 20.210  66.462 1.00 32.22 ? 130 ASP D O   1 
ATOM   973  C CB  . ASP A 1 126 ? -15.037 21.435  69.107 1.00 33.69 ? 130 ASP D CB  1 
ATOM   974  C CG  . ASP A 1 126 ? -13.974 22.379  69.625 1.00 36.45 ? 130 ASP D CG  1 
ATOM   975  O OD1 . ASP A 1 126 ? -12.782 22.008  69.598 1.00 37.27 ? 130 ASP D OD1 1 
ATOM   976  O OD2 . ASP A 1 126 ? -14.333 23.490  70.071 1.00 39.19 ? 130 ASP D OD2 1 
ATOM   977  N N   . SER A 1 127 ? -15.781 18.706  67.907 1.00 33.66 ? 131 SER D N   1 
ATOM   978  C CA  . SER A 1 127 ? -16.781 17.687  67.631 1.00 35.23 ? 131 SER D CA  1 
ATOM   979  C C   . SER A 1 127 ? -17.648 17.537  68.877 1.00 36.46 ? 131 SER D C   1 
ATOM   980  O O   . SER A 1 127 ? -17.141 17.535  69.999 1.00 36.42 ? 131 SER D O   1 
ATOM   981  C CB  . SER A 1 127 ? -16.112 16.352  67.304 1.00 34.73 ? 131 SER D CB  1 
ATOM   982  O OG  . SER A 1 127 ? -17.080 15.331  67.145 1.00 37.39 ? 131 SER D OG  1 
ATOM   983  N N   . LYS A 1 128 ? -18.955 17.417  68.673 1.00 38.18 ? 132 LYS D N   1 
ATOM   984  C CA  . LYS A 1 128 ? -19.901 17.277  69.774 1.00 39.39 ? 132 LYS D CA  1 
ATOM   985  C C   . LYS A 1 128 ? -19.624 16.076  70.676 1.00 39.92 ? 132 LYS D C   1 
ATOM   986  O O   . LYS A 1 128 ? -19.790 16.157  71.893 1.00 40.24 ? 132 LYS D O   1 
ATOM   987  C CB  . LYS A 1 128 ? -21.324 17.171  69.223 1.00 40.20 ? 132 LYS D CB  1 
ATOM   988  C CG  . LYS A 1 128 ? -21.809 18.409  68.488 1.00 41.00 ? 132 LYS D CG  1 
ATOM   989  C CD  . LYS A 1 128 ? -21.951 19.593  69.432 1.00 42.66 ? 132 LYS D CD  1 
ATOM   990  C CE  . LYS A 1 128 ? -22.522 20.805  68.714 1.00 43.67 ? 132 LYS D CE  1 
ATOM   991  N NZ  . LYS A 1 128 ? -22.725 21.953  69.641 1.00 44.74 ? 132 LYS D NZ  1 
ATOM   992  N N   . SER A 1 129 ? -19.202 14.964  70.083 1.00 40.49 ? 133 SER D N   1 
ATOM   993  C CA  . SER A 1 129 ? -18.934 13.751  70.851 1.00 41.30 ? 133 SER D CA  1 
ATOM   994  C C   . SER A 1 129 ? -17.504 13.641  71.368 1.00 41.01 ? 133 SER D C   1 
ATOM   995  O O   . SER A 1 129 ? -17.145 12.650  72.007 1.00 41.46 ? 133 SER D O   1 
ATOM   996  C CB  . SER A 1 129 ? -19.260 12.517  70.008 1.00 42.56 ? 133 SER D CB  1 
ATOM   997  O OG  . SER A 1 129 ? -18.435 12.463  68.858 1.00 44.64 ? 133 SER D OG  1 
ATOM   998  N N   . SER A 1 130 ? -16.687 14.655  71.101 1.00 40.03 ? 134 SER D N   1 
ATOM   999  C CA  . SER A 1 130 ? -15.301 14.633  71.550 1.00 39.83 ? 134 SER D CA  1 
ATOM   1000 C C   . SER A 1 130 ? -14.959 15.808  72.458 1.00 40.44 ? 134 SER D C   1 
ATOM   1001 O O   . SER A 1 130 ? -15.446 16.923  72.264 1.00 40.15 ? 134 SER D O   1 
ATOM   1002 C CB  . SER A 1 130 ? -14.359 14.628  70.345 1.00 38.33 ? 134 SER D CB  1 
ATOM   1003 O OG  . SER A 1 130 ? -13.008 14.554  70.763 1.00 38.21 ? 134 SER D OG  1 
ATOM   1004 N N   . ASP A 1 131 ? -14.117 15.545  73.452 1.00 40.99 ? 135 ASP D N   1 
ATOM   1005 C CA  . ASP A 1 131 ? -13.694 16.572  74.396 1.00 41.72 ? 135 ASP D CA  1 
ATOM   1006 C C   . ASP A 1 131 ? -12.339 17.110  73.956 1.00 40.69 ? 135 ASP D C   1 
ATOM   1007 O O   . ASP A 1 131 ? -11.724 17.924  74.644 1.00 40.87 ? 135 ASP D O   1 
ATOM   1008 C CB  . ASP A 1 131 ? -13.579 15.977  75.800 1.00 43.92 ? 135 ASP D CB  1 
ATOM   1009 C CG  . ASP A 1 131 ? -14.792 15.151  76.181 1.00 47.27 ? 135 ASP D CG  1 
ATOM   1010 O OD1 . ASP A 1 131 ? -15.918 15.690  76.144 1.00 49.22 ? 135 ASP D OD1 1 
ATOM   1011 O OD2 . ASP A 1 131 ? -14.618 13.960  76.518 1.00 49.48 ? 135 ASP D OD2 1 
ATOM   1012 N N   . LYS A 1 132 ? -11.884 16.645  72.797 1.00 39.56 ? 136 LYS D N   1 
ATOM   1013 C CA  . LYS A 1 132 ? -10.598 17.053  72.249 1.00 38.33 ? 136 LYS D CA  1 
ATOM   1014 C C   . LYS A 1 132 ? -10.694 18.255  71.322 1.00 36.91 ? 136 LYS D C   1 
ATOM   1015 O O   . LYS A 1 132 ? -11.722 18.493  70.689 1.00 37.62 ? 136 LYS D O   1 
ATOM   1016 C CB  . LYS A 1 132 ? -9.964  15.892  71.478 1.00 38.92 ? 136 LYS D CB  1 
ATOM   1017 C CG  . LYS A 1 132 ? -9.503  14.730  72.340 1.00 39.68 ? 136 LYS D CG  1 
ATOM   1018 C CD  . LYS A 1 132 ? -9.188  13.512  71.485 1.00 41.28 ? 136 LYS D CD  1 
ATOM   1019 C CE  . LYS A 1 132 ? -8.515  12.418  72.300 1.00 42.33 ? 136 LYS D CE  1 
ATOM   1020 N NZ  . LYS A 1 132 ? -9.291  12.066  73.520 1.00 44.11 ? 136 LYS D NZ  1 
ATOM   1021 N N   . SER A 1 133 ? -9.607  19.014  71.263 1.00 34.62 ? 137 SER D N   1 
ATOM   1022 C CA  . SER A 1 133 ? -9.503  20.174  70.390 1.00 32.01 ? 137 SER D CA  1 
ATOM   1023 C C   . SER A 1 133 ? -8.403  19.767  69.415 1.00 28.66 ? 137 SER D C   1 
ATOM   1024 O O   . SER A 1 133 ? -7.362  19.267  69.841 1.00 28.79 ? 137 SER D O   1 
ATOM   1025 C CB  . SER A 1 133 ? -9.076  21.408  71.189 1.00 33.03 ? 137 SER D CB  1 
ATOM   1026 O OG  . SER A 1 133 ? -8.944  22.542  70.350 1.00 35.57 ? 137 SER D OG  1 
ATOM   1027 N N   . VAL A 1 134 ? -8.627  19.968  68.119 1.00 25.04 ? 138 VAL D N   1 
ATOM   1028 C CA  . VAL A 1 134 ? -7.639  19.579  67.115 1.00 21.72 ? 138 VAL D CA  1 
ATOM   1029 C C   . VAL A 1 134 ? -6.979  20.736  66.364 1.00 19.27 ? 138 VAL D C   1 
ATOM   1030 O O   . VAL A 1 134 ? -7.654  21.637  65.868 1.00 17.69 ? 138 VAL D O   1 
ATOM   1031 C CB  . VAL A 1 134 ? -8.264  18.617  66.073 1.00 21.69 ? 138 VAL D CB  1 
ATOM   1032 C CG1 . VAL A 1 134 ? -7.274  18.336  64.957 1.00 22.05 ? 138 VAL D CG1 1 
ATOM   1033 C CG2 . VAL A 1 134 ? -8.676  17.318  66.748 1.00 21.70 ? 138 VAL D CG2 1 
ATOM   1034 N N   . CYS A 1 135 ? -5.651  20.692  66.291 1.00 17.59 ? 139 CYS D N   1 
ATOM   1035 C CA  . CYS A 1 135 ? -4.864  21.701  65.588 1.00 18.30 ? 139 CYS D CA  1 
ATOM   1036 C C   . CYS A 1 135 ? -4.149  21.039  64.413 1.00 16.49 ? 139 CYS D C   1 
ATOM   1037 O O   . CYS A 1 135 ? -3.627  19.926  64.524 1.00 15.75 ? 139 CYS D O   1 
ATOM   1038 C CB  . CYS A 1 135 ? -3.827  22.330  66.519 1.00 22.48 ? 139 CYS D CB  1 
ATOM   1039 S SG  . CYS A 1 135 ? -4.530  23.196  67.959 1.00 29.05 ? 139 CYS D SG  1 
ATOM   1040 N N   . LEU A 1 136 ? -4.125  21.737  63.287 1.00 14.11 ? 140 LEU D N   1 
ATOM   1041 C CA  . LEU A 1 136 ? -3.501  21.229  62.079 1.00 13.53 ? 140 LEU D CA  1 
ATOM   1042 C C   . LEU A 1 136 ? -2.360  22.124  61.602 1.00 12.90 ? 140 LEU D C   1 
ATOM   1043 O O   . LEU A 1 136 ? -2.574  23.294  61.301 1.00 13.99 ? 140 LEU D O   1 
ATOM   1044 C CB  . LEU A 1 136 ? -4.559  21.122  60.975 1.00 14.04 ? 140 LEU D CB  1 
ATOM   1045 C CG  . LEU A 1 136 ? -4.096  20.835  59.544 1.00 13.14 ? 140 LEU D CG  1 
ATOM   1046 C CD1 . LEU A 1 136 ? -3.588  19.414  59.450 1.00 15.36 ? 140 LEU D CD1 1 
ATOM   1047 C CD2 . LEU A 1 136 ? -5.257  21.049  58.577 1.00 13.92 ? 140 LEU D CD2 1 
ATOM   1048 N N   . PHE A 1 137 ? -1.153  21.569  61.550 1.00 12.62 ? 141 PHE D N   1 
ATOM   1049 C CA  . PHE A 1 137 ? 0.016   22.296  61.055 1.00 12.86 ? 141 PHE D CA  1 
ATOM   1050 C C   . PHE A 1 137 ? 0.161   21.752  59.638 1.00 14.07 ? 141 PHE D C   1 
ATOM   1051 O O   . PHE A 1 137 ? 0.383   20.556  59.448 1.00 14.84 ? 141 PHE D O   1 
ATOM   1052 C CB  . PHE A 1 137 ? 1.240   21.960  61.914 1.00 13.51 ? 141 PHE D CB  1 
ATOM   1053 C CG  . PHE A 1 137 ? 2.526   22.581  61.433 1.00 13.66 ? 141 PHE D CG  1 
ATOM   1054 C CD1 . PHE A 1 137 ? 2.532   23.823  60.805 1.00 13.87 ? 141 PHE D CD1 1 
ATOM   1055 C CD2 . PHE A 1 137 ? 3.738   21.936  61.653 1.00 15.32 ? 141 PHE D CD2 1 
ATOM   1056 C CE1 . PHE A 1 137 ? 3.731   24.413  60.406 1.00 15.94 ? 141 PHE D CE1 1 
ATOM   1057 C CE2 . PHE A 1 137 ? 4.944   22.520  61.257 1.00 15.56 ? 141 PHE D CE2 1 
ATOM   1058 C CZ  . PHE A 1 137 ? 4.937   23.762  60.632 1.00 16.64 ? 141 PHE D CZ  1 
ATOM   1059 N N   . THR A 1 138 ? 0.027   22.619  58.639 1.00 13.96 ? 142 THR D N   1 
ATOM   1060 C CA  . THR A 1 138 ? 0.076   22.146  57.265 1.00 14.13 ? 142 THR D CA  1 
ATOM   1061 C C   . THR A 1 138 ? 0.741   23.068  56.250 1.00 14.40 ? 142 THR D C   1 
ATOM   1062 O O   . THR A 1 138 ? 1.001   24.246  56.519 1.00 14.25 ? 142 THR D O   1 
ATOM   1063 C CB  . THR A 1 138 ? -1.369  21.845  56.782 1.00 15.31 ? 142 THR D CB  1 
ATOM   1064 O OG1 . THR A 1 138 ? -1.338  21.158  55.530 1.00 16.36 ? 142 THR D OG1 1 
ATOM   1065 C CG2 . THR A 1 138 ? -2.161  23.142  56.627 1.00 16.02 ? 142 THR D CG2 1 
ATOM   1066 N N   . ASP A 1 139 ? 1.031   22.488  55.087 1.00 14.35 ? 143 ASP D N   1 
ATOM   1067 C CA  . ASP A 1 139 ? 1.618   23.187  53.949 1.00 15.00 ? 143 ASP D CA  1 
ATOM   1068 C C   . ASP A 1 139 ? 3.049   23.702  54.094 1.00 15.14 ? 143 ASP D C   1 
ATOM   1069 O O   . ASP A 1 139 ? 3.475   24.590  53.353 1.00 14.81 ? 143 ASP D O   1 
ATOM   1070 C CB  . ASP A 1 139 ? 0.683   24.330  53.527 1.00 15.46 ? 143 ASP D CB  1 
ATOM   1071 C CG  . ASP A 1 139 ? -0.711  23.829  53.149 1.00 17.84 ? 143 ASP D CG  1 
ATOM   1072 O OD1 . ASP A 1 139 ? -0.870  22.600  52.969 1.00 21.38 ? 143 ASP D OD1 1 
ATOM   1073 O OD2 . ASP A 1 139 ? -1.645  24.654  53.026 1.00 17.01 ? 143 ASP D OD2 1 
ATOM   1074 N N   . PHE A 1 140 ? 3.792   23.132  55.036 1.00 15.70 ? 144 PHE D N   1 
ATOM   1075 C CA  . PHE A 1 140 ? 5.179   23.530  55.248 1.00 15.72 ? 144 PHE D CA  1 
ATOM   1076 C C   . PHE A 1 140 ? 6.135   22.748  54.338 1.00 16.32 ? 144 PHE D C   1 
ATOM   1077 O O   . PHE A 1 140 ? 5.794   21.669  53.837 1.00 14.89 ? 144 PHE D O   1 
ATOM   1078 C CB  . PHE A 1 140 ? 5.552   23.336  56.727 1.00 15.57 ? 144 PHE D CB  1 
ATOM   1079 C CG  . PHE A 1 140 ? 5.210   21.976  57.273 1.00 14.59 ? 144 PHE D CG  1 
ATOM   1080 C CD1 . PHE A 1 140 ? 6.078   20.902  57.099 1.00 12.04 ? 144 PHE D CD1 1 
ATOM   1081 C CD2 . PHE A 1 140 ? 4.023   21.771  57.970 1.00 13.13 ? 144 PHE D CD2 1 
ATOM   1082 C CE1 . PHE A 1 140 ? 5.773   19.648  57.614 1.00 14.39 ? 144 PHE D CE1 1 
ATOM   1083 C CE2 . PHE A 1 140 ? 3.704   20.509  58.492 1.00 14.19 ? 144 PHE D CE2 1 
ATOM   1084 C CZ  . PHE A 1 140 ? 4.584   19.448  58.312 1.00 13.42 ? 144 PHE D CZ  1 
ATOM   1085 N N   . ASP A 1 141 ? 7.319   23.315  54.108 1.00 17.30 ? 145 ASP D N   1 
ATOM   1086 C CA  . ASP A 1 141 ? 8.335   22.686  53.266 1.00 19.74 ? 145 ASP D CA  1 
ATOM   1087 C C   . ASP A 1 141 ? 8.780   21.369  53.893 1.00 20.49 ? 145 ASP D C   1 
ATOM   1088 O O   . ASP A 1 141 ? 8.717   21.195  55.109 1.00 20.04 ? 145 ASP D O   1 
ATOM   1089 C CB  . ASP A 1 141 ? 9.546   23.609  53.114 1.00 24.30 ? 145 ASP D CB  1 
ATOM   1090 C CG  . ASP A 1 141 ? 10.330  23.765  54.408 1.00 30.13 ? 145 ASP D CG  1 
ATOM   1091 O OD1 . ASP A 1 141 ? 9.777   24.302  55.393 1.00 34.02 ? 145 ASP D OD1 1 
ATOM   1092 O OD2 . ASP A 1 141 ? 11.506  23.344  54.443 1.00 34.56 ? 145 ASP D OD2 1 
ATOM   1093 N N   . SER A 1 142 ? 9.252   20.449  53.060 1.00 19.66 ? 146 SER D N   1 
ATOM   1094 C CA  . SER A 1 142 ? 9.676   19.139  53.540 1.00 21.75 ? 146 SER D CA  1 
ATOM   1095 C C   . SER A 1 142 ? 10.871  19.136  54.491 1.00 23.88 ? 146 SER D C   1 
ATOM   1096 O O   . SER A 1 142 ? 11.140  18.129  55.148 1.00 24.97 ? 146 SER D O   1 
ATOM   1097 C CB  . SER A 1 142 ? 9.949   18.225  52.345 1.00 20.31 ? 146 SER D CB  1 
ATOM   1098 O OG  . SER A 1 142 ? 8.756   18.034  51.600 1.00 19.57 ? 146 SER D OG  1 
ATOM   1099 N N   . GLN A 1 143 ? 11.583  20.254  54.575 1.00 27.37 ? 147 GLN D N   1 
ATOM   1100 C CA  . GLN A 1 143 ? 12.739  20.335  55.465 1.00 29.31 ? 147 GLN D CA  1 
ATOM   1101 C C   . GLN A 1 143 ? 12.318  20.512  56.922 1.00 29.84 ? 147 GLN D C   1 
ATOM   1102 O O   . GLN A 1 143 ? 13.085  20.216  57.840 1.00 29.59 ? 147 GLN D O   1 
ATOM   1103 C CB  . GLN A 1 143 ? 13.651  21.488  55.041 1.00 32.43 ? 147 GLN D CB  1 
ATOM   1104 C CG  . GLN A 1 143 ? 14.156  21.371  53.612 1.00 37.40 ? 147 GLN D CG  1 
ATOM   1105 C CD  . GLN A 1 143 ? 14.803  20.027  53.333 1.00 40.72 ? 147 GLN D CD  1 
ATOM   1106 O OE1 . GLN A 1 143 ? 15.794  19.657  53.964 1.00 42.97 ? 147 GLN D OE1 1 
ATOM   1107 N NE2 . GLN A 1 143 ? 14.240  19.287  52.383 1.00 42.26 ? 147 GLN D NE2 1 
ATOM   1108 N N   . THR A 1 144 ? 11.096  20.992  57.127 1.00 28.64 ? 148 THR D N   1 
ATOM   1109 C CA  . THR A 1 144 ? 10.569  21.198  58.472 1.00 27.87 ? 148 THR D CA  1 
ATOM   1110 C C   . THR A 1 144 ? 10.293  19.867  59.162 1.00 28.50 ? 148 THR D C   1 
ATOM   1111 O O   . THR A 1 144 ? 9.713   18.955  58.569 1.00 27.37 ? 148 THR D O   1 
ATOM   1112 C CB  . THR A 1 144 ? 9.256   22.016  58.442 1.00 27.38 ? 148 THR D CB  1 
ATOM   1113 O OG1 . THR A 1 144 ? 9.540   23.363  58.043 1.00 27.99 ? 148 THR D OG1 1 
ATOM   1114 C CG2 . THR A 1 144 ? 8.597   22.029  59.820 1.00 25.20 ? 148 THR D CG2 1 
ATOM   1115 N N   . ASN A 1 145 ? 10.718  19.762  60.417 1.00 28.61 ? 149 ASN D N   1 
ATOM   1116 C CA  . ASN A 1 145 ? 10.504  18.553  61.200 1.00 29.10 ? 149 ASN D CA  1 
ATOM   1117 C C   . ASN A 1 145 ? 9.517   18.839  62.321 1.00 28.52 ? 149 ASN D C   1 
ATOM   1118 O O   . ASN A 1 145 ? 9.525   19.922  62.906 1.00 29.18 ? 149 ASN D O   1 
ATOM   1119 C CB  . ASN A 1 145 ? 11.824  18.060  61.801 1.00 31.63 ? 149 ASN D CB  1 
ATOM   1120 C CG  . ASN A 1 145 ? 12.837  17.668  60.744 1.00 34.50 ? 149 ASN D CG  1 
ATOM   1121 O OD1 . ASN A 1 145 ? 12.554  16.845  59.872 1.00 36.43 ? 149 ASN D OD1 1 
ATOM   1122 N ND2 . ASN A 1 145 ? 14.028  18.253  60.820 1.00 34.72 ? 149 ASN D ND2 1 
ATOM   1123 N N   . VAL A 1 146 ? 8.655   17.871  62.610 1.00 27.01 ? 150 VAL D N   1 
ATOM   1124 C CA  . VAL A 1 146 ? 7.679   18.031  63.676 1.00 25.95 ? 150 VAL D CA  1 
ATOM   1125 C C   . VAL A 1 146 ? 8.116   17.166  64.849 1.00 26.94 ? 150 VAL D C   1 
ATOM   1126 O O   . VAL A 1 146 ? 8.336   15.966  64.697 1.00 27.94 ? 150 VAL D O   1 
ATOM   1127 C CB  . VAL A 1 146 ? 6.270   17.606  63.219 1.00 24.56 ? 150 VAL D CB  1 
ATOM   1128 C CG1 . VAL A 1 146 ? 5.275   17.807  64.348 1.00 23.75 ? 150 VAL D CG1 1 
ATOM   1129 C CG2 . VAL A 1 146 ? 5.856   18.421  62.000 1.00 24.04 ? 150 VAL D CG2 1 
ATOM   1130 N N   . SER A 1 147 ? 8.256   17.786  66.014 1.00 27.79 ? 151 SER D N   1 
ATOM   1131 C CA  . SER A 1 147 ? 8.683   17.071  67.210 1.00 29.91 ? 151 SER D CA  1 
ATOM   1132 C C   . SER A 1 147 ? 7.493   16.693  68.086 1.00 31.47 ? 151 SER D C   1 
ATOM   1133 O O   . SER A 1 147 ? 6.388   17.201  67.901 1.00 30.52 ? 151 SER D O   1 
ATOM   1134 C CB  . SER A 1 147 ? 9.650   17.944  68.013 1.00 29.71 ? 151 SER D CB  1 
ATOM   1135 O OG  . SER A 1 147 ? 10.746  18.362  67.217 1.00 29.06 ? 151 SER D OG  1 
ATOM   1136 N N   . GLN A 1 148 ? 7.720   15.790  69.036 1.00 34.49 ? 152 GLN D N   1 
ATOM   1137 C CA  . GLN A 1 148 ? 6.665   15.381  69.953 1.00 36.67 ? 152 GLN D CA  1 
ATOM   1138 C C   . GLN A 1 148 ? 6.515   16.484  70.991 1.00 37.86 ? 152 GLN D C   1 
ATOM   1139 O O   . GLN A 1 148 ? 7.428   17.283  71.178 1.00 37.77 ? 152 GLN D O   1 
ATOM   1140 C CB  . GLN A 1 148 ? 7.028   14.061  70.636 1.00 38.75 ? 152 GLN D CB  1 
ATOM   1141 C CG  . GLN A 1 148 ? 6.980   12.858  69.712 1.00 41.14 ? 152 GLN D CG  1 
ATOM   1142 C CD  . GLN A 1 148 ? 5.584   12.593  69.182 1.00 42.17 ? 152 GLN D CD  1 
ATOM   1143 O OE1 . GLN A 1 148 ? 4.659   12.329  69.950 1.00 42.75 ? 152 GLN D OE1 1 
ATOM   1144 N NE2 . GLN A 1 148 ? 5.423   12.665  67.864 1.00 42.37 ? 152 GLN D NE2 1 
ATOM   1145 N N   . SER A 1 149 ? 5.367   16.538  71.660 1.00 39.41 ? 153 SER D N   1 
ATOM   1146 C CA  . SER A 1 149 ? 5.141   17.570  72.666 1.00 41.03 ? 153 SER D CA  1 
ATOM   1147 C C   . SER A 1 149 ? 5.849   17.242  73.971 1.00 41.70 ? 153 SER D C   1 
ATOM   1148 O O   . SER A 1 149 ? 6.253   16.104  74.202 1.00 41.29 ? 153 SER D O   1 
ATOM   1149 C CB  . SER A 1 149 ? 3.645   17.745  72.937 1.00 41.30 ? 153 SER D CB  1 
ATOM   1150 O OG  . SER A 1 149 ? 3.424   18.757  73.906 1.00 40.60 ? 153 SER D OG  1 
ATOM   1151 N N   . LYS A 1 150 ? 5.997   18.255  74.818 1.00 43.14 ? 154 LYS D N   1 
ATOM   1152 C CA  . LYS A 1 150 ? 6.643   18.087  76.113 1.00 44.51 ? 154 LYS D CA  1 
ATOM   1153 C C   . LYS A 1 150 ? 5.580   17.764  77.154 1.00 44.64 ? 154 LYS D C   1 
ATOM   1154 O O   . LYS A 1 150 ? 5.854   17.759  78.355 1.00 44.57 ? 154 LYS D O   1 
ATOM   1155 C CB  . LYS A 1 150 ? 7.374   19.372  76.513 1.00 45.06 ? 154 LYS D CB  1 
ATOM   1156 C CG  . LYS A 1 150 ? 8.455   19.815  75.537 1.00 45.60 ? 154 LYS D CG  1 
ATOM   1157 C CD  . LYS A 1 150 ? 9.153   21.082  76.020 1.00 47.08 ? 154 LYS D CD  1 
ATOM   1158 C CE  . LYS A 1 150 ? 8.190   22.261  76.114 1.00 47.13 ? 154 LYS D CE  1 
ATOM   1159 N NZ  . LYS A 1 150 ? 7.625   22.643  74.786 1.00 47.56 ? 154 LYS D NZ  1 
ATOM   1160 N N   . ASP A 1 151 ? 4.366   17.493  76.684 1.00 44.63 ? 155 ASP D N   1 
ATOM   1161 C CA  . ASP A 1 151 ? 3.251   17.185  77.572 1.00 44.30 ? 155 ASP D CA  1 
ATOM   1162 C C   . ASP A 1 151 ? 2.661   15.812  77.262 1.00 43.70 ? 155 ASP D C   1 
ATOM   1163 O O   . ASP A 1 151 ? 2.444   15.467  76.099 1.00 43.70 ? 155 ASP D O   1 
ATOM   1164 C CB  . ASP A 1 151 ? 2.165   18.253  77.424 1.00 45.62 ? 155 ASP D CB  1 
ATOM   1165 C CG  . ASP A 1 151 ? 1.156   18.221  78.554 1.00 47.08 ? 155 ASP D CG  1 
ATOM   1166 O OD1 . ASP A 1 151 ? 0.643   17.128  78.872 1.00 47.93 ? 155 ASP D OD1 1 
ATOM   1167 O OD2 . ASP A 1 151 ? 0.874   19.296  79.121 1.00 48.01 ? 155 ASP D OD2 1 
ATOM   1168 N N   . SER A 1 152 ? 2.394   15.036  78.309 1.00 41.95 ? 156 SER D N   1 
ATOM   1169 C CA  . SER A 1 152 ? 1.831   13.701  78.149 1.00 40.64 ? 156 SER D CA  1 
ATOM   1170 C C   . SER A 1 152 ? 0.352   13.754  77.787 1.00 38.28 ? 156 SER D C   1 
ATOM   1171 O O   . SER A 1 152 ? -0.222  12.759  77.343 1.00 38.72 ? 156 SER D O   1 
ATOM   1172 C CB  . SER A 1 152 ? 2.016   12.894  79.436 1.00 42.38 ? 156 SER D CB  1 
ATOM   1173 O OG  . SER A 1 152 ? 3.389   12.752  79.753 1.00 44.32 ? 156 SER D OG  1 
ATOM   1174 N N   . ASP A 1 153 ? -0.259  14.918  77.981 1.00 35.48 ? 157 ASP D N   1 
ATOM   1175 C CA  . ASP A 1 153 ? -1.672  15.109  77.676 1.00 33.46 ? 157 ASP D CA  1 
ATOM   1176 C C   . ASP A 1 153 ? -1.885  15.718  76.292 1.00 29.70 ? 157 ASP D C   1 
ATOM   1177 O O   . ASP A 1 153 ? -3.017  15.991  75.896 1.00 28.57 ? 157 ASP D O   1 
ATOM   1178 C CB  . ASP A 1 153 ? -2.326  15.998  78.737 1.00 35.34 ? 157 ASP D CB  1 
ATOM   1179 C CG  . ASP A 1 153 ? -2.481  15.294  80.072 1.00 39.26 ? 157 ASP D CG  1 
ATOM   1180 O OD1 . ASP A 1 153 ? -2.840  15.968  81.062 1.00 40.68 ? 157 ASP D OD1 1 
ATOM   1181 O OD2 . ASP A 1 153 ? -2.254  14.066  80.129 1.00 40.31 ? 157 ASP D OD2 1 
ATOM   1182 N N   . VAL A 1 154 ? -0.795  15.942  75.567 1.00 26.68 ? 158 VAL D N   1 
ATOM   1183 C CA  . VAL A 1 154 ? -0.880  16.496  74.220 1.00 25.26 ? 158 VAL D CA  1 
ATOM   1184 C C   . VAL A 1 154 ? -0.335  15.475  73.229 1.00 23.77 ? 158 VAL D C   1 
ATOM   1185 O O   . VAL A 1 154 ? 0.818   15.053  73.323 1.00 23.33 ? 158 VAL D O   1 
ATOM   1186 C CB  . VAL A 1 154 ? -0.068  17.802  74.078 1.00 24.73 ? 158 VAL D CB  1 
ATOM   1187 C CG1 . VAL A 1 154 ? -0.139  18.299  72.643 1.00 24.87 ? 158 VAL D CG1 1 
ATOM   1188 C CG2 . VAL A 1 154 ? -0.611  18.861  75.024 1.00 25.57 ? 158 VAL D CG2 1 
ATOM   1189 N N   . TYR A 1 155 ? -1.172  15.081  72.278 1.00 20.70 ? 159 TYR D N   1 
ATOM   1190 C CA  . TYR A 1 155 ? -0.781  14.105  71.274 1.00 20.23 ? 159 TYR D CA  1 
ATOM   1191 C C   . TYR A 1 155 ? -0.447  14.802  69.968 1.00 19.79 ? 159 TYR D C   1 
ATOM   1192 O O   . TYR A 1 155 ? -1.219  15.630  69.487 1.00 20.38 ? 159 TYR D O   1 
ATOM   1193 C CB  . TYR A 1 155 ? -1.920  13.110  71.060 1.00 20.60 ? 159 TYR D CB  1 
ATOM   1194 C CG  . TYR A 1 155 ? -2.287  12.378  72.329 1.00 22.71 ? 159 TYR D CG  1 
ATOM   1195 C CD1 . TYR A 1 155 ? -1.569  11.255  72.742 1.00 23.46 ? 159 TYR D CD1 1 
ATOM   1196 C CD2 . TYR A 1 155 ? -3.311  12.846  73.151 1.00 23.81 ? 159 TYR D CD2 1 
ATOM   1197 C CE1 . TYR A 1 155 ? -1.863  10.616  73.948 1.00 24.24 ? 159 TYR D CE1 1 
ATOM   1198 C CE2 . TYR A 1 155 ? -3.613  12.217  74.361 1.00 24.95 ? 159 TYR D CE2 1 
ATOM   1199 C CZ  . TYR A 1 155 ? -2.884  11.104  74.752 1.00 25.52 ? 159 TYR D CZ  1 
ATOM   1200 O OH  . TYR A 1 155 ? -3.173  10.490  75.953 1.00 27.19 ? 159 TYR D OH  1 
ATOM   1201 N N   . ILE A 1 156 ? 0.712   14.471  69.408 1.00 18.07 ? 160 ILE D N   1 
ATOM   1202 C CA  . ILE A 1 156 ? 1.147   15.058  68.149 1.00 18.74 ? 160 ILE D CA  1 
ATOM   1203 C C   . ILE A 1 156 ? 1.644   13.948  67.230 1.00 18.81 ? 160 ILE D C   1 
ATOM   1204 O O   . ILE A 1 156 ? 2.492   13.147  67.615 1.00 18.83 ? 160 ILE D O   1 
ATOM   1205 C CB  . ILE A 1 156 ? 2.288   16.083  68.360 1.00 17.82 ? 160 ILE D CB  1 
ATOM   1206 C CG1 . ILE A 1 156 ? 1.859   17.135  69.386 1.00 18.12 ? 160 ILE D CG1 1 
ATOM   1207 C CG2 . ILE A 1 156 ? 2.633   16.754  67.035 1.00 18.62 ? 160 ILE D CG2 1 
ATOM   1208 C CD1 . ILE A 1 156 ? 2.862   18.277  69.580 1.00 18.37 ? 160 ILE D CD1 1 
ATOM   1209 N N   . THR A 1 157 ? 1.107   13.897  66.017 1.00 18.30 ? 161 THR D N   1 
ATOM   1210 C CA  . THR A 1 157 ? 1.503   12.878  65.052 1.00 20.25 ? 161 THR D CA  1 
ATOM   1211 C C   . THR A 1 157 ? 2.755   13.330  64.317 1.00 21.76 ? 161 THR D C   1 
ATOM   1212 O O   . THR A 1 157 ? 3.083   14.512  64.321 1.00 22.76 ? 161 THR D O   1 
ATOM   1213 C CB  . THR A 1 157 ? 0.406   12.658  64.001 1.00 19.47 ? 161 THR D CB  1 
ATOM   1214 O OG1 . THR A 1 157 ? 0.284   13.835  63.191 1.00 19.53 ? 161 THR D OG1 1 
ATOM   1215 C CG2 . THR A 1 157 ? -0.927  12.375  64.674 1.00 21.00 ? 161 THR D CG2 1 
ATOM   1216 N N   . ASP A 1 158 ? 3.467   12.399  63.688 1.00 24.47 ? 162 ASP D N   1 
ATOM   1217 C CA  . ASP A 1 158 ? 4.646   12.808  62.938 1.00 27.03 ? 162 ASP D CA  1 
ATOM   1218 C C   . ASP A 1 158 ? 4.093   13.305  61.613 1.00 25.37 ? 162 ASP D C   1 
ATOM   1219 O O   . ASP A 1 158 ? 2.946   13.020  61.275 1.00 26.56 ? 162 ASP D O   1 
ATOM   1220 C CB  . ASP A 1 158 ? 5.602   11.643  62.688 1.00 30.93 ? 162 ASP D CB  1 
ATOM   1221 C CG  . ASP A 1 158 ? 7.023   12.113  62.415 1.00 34.53 ? 162 ASP D CG  1 
ATOM   1222 O OD1 . ASP A 1 158 ? 7.212   12.996  61.548 1.00 35.74 ? 162 ASP D OD1 1 
ATOM   1223 O OD2 . ASP A 1 158 ? 7.957   11.604  63.071 1.00 38.13 ? 162 ASP D OD2 1 
ATOM   1224 N N   . LYS A 1 159 ? 4.898   14.041  60.861 1.00 24.44 ? 163 LYS D N   1 
ATOM   1225 C CA  . LYS A 1 159 ? 4.429   14.568  59.590 1.00 22.65 ? 163 LYS D CA  1 
ATOM   1226 C C   . LYS A 1 159 ? 4.198   13.476  58.557 1.00 21.62 ? 163 LYS D C   1 
ATOM   1227 O O   . LYS A 1 159 ? 4.894   12.459  58.532 1.00 20.81 ? 163 LYS D O   1 
ATOM   1228 C CB  . LYS A 1 159 ? 5.410   15.604  59.041 1.00 24.15 ? 163 LYS D CB  1 
ATOM   1229 C CG  . LYS A 1 159 ? 6.793   15.076  58.735 1.00 25.57 ? 163 LYS D CG  1 
ATOM   1230 C CD  . LYS A 1 159 ? 7.644   16.151  58.073 1.00 25.72 ? 163 LYS D CD  1 
ATOM   1231 C CE  . LYS A 1 159 ? 9.018   15.616  57.710 1.00 27.41 ? 163 LYS D CE  1 
ATOM   1232 N NZ  . LYS A 1 159 ? 9.851   16.639  57.029 1.00 27.92 ? 163 LYS D NZ  1 
ATOM   1233 N N   . THR A 1 160 ? 3.195   13.693  57.715 1.00 19.70 ? 164 THR D N   1 
ATOM   1234 C CA  . THR A 1 160 ? 2.854   12.757  56.658 1.00 19.15 ? 164 THR D CA  1 
ATOM   1235 C C   . THR A 1 160 ? 2.501   13.579  55.432 1.00 16.86 ? 164 THR D C   1 
ATOM   1236 O O   . THR A 1 160 ? 2.186   14.767  55.541 1.00 16.72 ? 164 THR D O   1 
ATOM   1237 C CB  . THR A 1 160 ? 1.642   11.874  57.036 1.00 20.70 ? 164 THR D CB  1 
ATOM   1238 O OG1 . THR A 1 160 ? 0.494   12.701  57.258 1.00 25.23 ? 164 THR D OG1 1 
ATOM   1239 C CG2 . THR A 1 160 ? 1.935   11.074  58.301 1.00 24.50 ? 164 THR D CG2 1 
ATOM   1240 N N   . VAL A 1 161 ? 2.562   12.944  54.268 1.00 15.09 ? 165 VAL D N   1 
ATOM   1241 C CA  . VAL A 1 161 ? 2.251   13.620  53.018 1.00 15.68 ? 165 VAL D CA  1 
ATOM   1242 C C   . VAL A 1 161 ? 0.833   13.295  52.568 1.00 15.51 ? 165 VAL D C   1 
ATOM   1243 O O   . VAL A 1 161 ? 0.386   12.146  52.647 1.00 15.63 ? 165 VAL D O   1 
ATOM   1244 C CB  . VAL A 1 161 ? 3.231   13.199  51.903 1.00 17.75 ? 165 VAL D CB  1 
ATOM   1245 C CG1 . VAL A 1 161 ? 2.958   13.999  50.633 1.00 17.64 ? 165 VAL D CG1 1 
ATOM   1246 C CG2 . VAL A 1 161 ? 4.663   13.405  52.371 1.00 17.79 ? 165 VAL D CG2 1 
ATOM   1247 N N   . LEU A 1 162 ? 0.130   14.322  52.108 1.00 14.61 ? 166 LEU D N   1 
ATOM   1248 C CA  . LEU A 1 162 ? -1.228  14.174  51.613 1.00 15.11 ? 166 LEU D CA  1 
ATOM   1249 C C   . LEU A 1 162 ? -1.191  14.565  50.137 1.00 14.35 ? 166 LEU D C   1 
ATOM   1250 O O   . LEU A 1 162 ? -0.787  15.677  49.792 1.00 13.29 ? 166 LEU D O   1 
ATOM   1251 C CB  . LEU A 1 162 ? -2.176  15.094  52.392 1.00 17.71 ? 166 LEU D CB  1 
ATOM   1252 C CG  . LEU A 1 162 ? -3.674  15.001  52.091 1.00 21.40 ? 166 LEU D CG  1 
ATOM   1253 C CD1 . LEU A 1 162 ? -4.049  15.742  50.816 1.00 19.60 ? 166 LEU D CD1 1 
ATOM   1254 C CD2 . LEU A 1 162 ? -4.035  13.554  51.990 1.00 22.25 ? 166 LEU D CD2 1 
ATOM   1255 N N   . ASP A 1 163 ? -1.615  13.651  49.273 1.00 13.87 ? 167 ASP D N   1 
ATOM   1256 C CA  . ASP A 1 163 ? -1.596  13.899  47.833 1.00 14.00 ? 167 ASP D CA  1 
ATOM   1257 C C   . ASP A 1 163 ? -2.988  14.082  47.225 1.00 14.63 ? 167 ASP D C   1 
ATOM   1258 O O   . ASP A 1 163 ? -3.770  13.138  47.156 1.00 16.13 ? 167 ASP D O   1 
ATOM   1259 C CB  . ASP A 1 163 ? -0.853  12.739  47.148 1.00 14.42 ? 167 ASP D CB  1 
ATOM   1260 C CG  . ASP A 1 163 ? -0.723  12.915  45.645 1.00 16.83 ? 167 ASP D CG  1 
ATOM   1261 O OD1 . ASP A 1 163 ? -0.832  14.059  45.163 1.00 17.13 ? 167 ASP D OD1 1 
ATOM   1262 O OD2 . ASP A 1 163 ? -0.489  11.900  44.949 1.00 18.84 ? 167 ASP D OD2 1 
ATOM   1263 N N   . MET A 1 164 ? -3.301  15.309  46.814 1.00 13.58 ? 168 MET D N   1 
ATOM   1264 C CA  . MET A 1 164 ? -4.581  15.594  46.166 1.00 12.14 ? 168 MET D CA  1 
ATOM   1265 C C   . MET A 1 164 ? -4.288  15.426  44.680 1.00 12.36 ? 168 MET D C   1 
ATOM   1266 O O   . MET A 1 164 ? -4.012  16.397  43.976 1.00 14.44 ? 168 MET D O   1 
ATOM   1267 C CB  . MET A 1 164 ? -5.036  17.028  46.449 1.00 12.98 ? 168 MET D CB  1 
ATOM   1268 C CG  . MET A 1 164 ? -5.434  17.293  47.893 1.00 14.48 ? 168 MET D CG  1 
ATOM   1269 S SD  . MET A 1 164 ? -5.913  19.013  48.168 1.00 17.45 ? 168 MET D SD  1 
ATOM   1270 C CE  . MET A 1 164 ? -7.591  19.027  47.505 1.00 18.27 ? 168 MET D CE  1 
ATOM   1271 N N   . ARG A 1 165 ? -4.340  14.185  44.212 1.00 14.30 ? 169 ARG D N   1 
ATOM   1272 C CA  . ARG A 1 165 ? -4.031  13.882  42.821 1.00 13.43 ? 169 ARG D CA  1 
ATOM   1273 C C   . ARG A 1 165 ? -4.920  14.628  41.830 1.00 14.79 ? 169 ARG D C   1 
ATOM   1274 O O   . ARG A 1 165 ? -4.487  14.937  40.724 1.00 15.23 ? 169 ARG D O   1 
ATOM   1275 C CB  . ARG A 1 165 ? -4.127  12.368  42.579 1.00 13.79 ? 169 ARG D CB  1 
ATOM   1276 C CG  . ARG A 1 165 ? -3.403  11.896  41.317 1.00 15.00 ? 169 ARG D CG  1 
ATOM   1277 C CD  . ARG A 1 165 ? -1.973  11.455  41.620 1.00 15.01 ? 169 ARG D CD  1 
ATOM   1278 N NE  . ARG A 1 165 ? -1.226  12.487  42.328 1.00 14.39 ? 169 ARG D NE  1 
ATOM   1279 C CZ  . ARG A 1 165 ? -0.599  13.501  41.741 1.00 15.72 ? 169 ARG D CZ  1 
ATOM   1280 N NH1 . ARG A 1 165 ? -0.612  13.624  40.420 1.00 16.34 ? 169 ARG D NH1 1 
ATOM   1281 N NH2 . ARG A 1 165 ? 0.020   14.409  42.482 1.00 15.62 ? 169 ARG D NH2 1 
ATOM   1282 N N   . SER A 1 166 ? -6.155  14.921  42.224 1.00 14.55 ? 170 SER D N   1 
ATOM   1283 C CA  . SER A 1 166 ? -7.086  15.628  41.344 1.00 16.87 ? 170 SER D CA  1 
ATOM   1284 C C   . SER A 1 166 ? -6.539  16.982  40.901 1.00 17.42 ? 170 SER D C   1 
ATOM   1285 O O   . SER A 1 166 ? -6.797  17.430  39.783 1.00 18.06 ? 170 SER D O   1 
ATOM   1286 C CB  . SER A 1 166 ? -8.421  15.839  42.054 1.00 17.28 ? 170 SER D CB  1 
ATOM   1287 O OG  . SER A 1 166 ? -8.261  16.670  43.188 1.00 20.41 ? 170 SER D OG  1 
ATOM   1288 N N   . MET A 1 167 ? -5.786  17.630  41.783 1.00 16.85 ? 171 MET D N   1 
ATOM   1289 C CA  . MET A 1 167 ? -5.204  18.935  41.493 1.00 17.40 ? 171 MET D CA  1 
ATOM   1290 C C   . MET A 1 167 ? -3.683  18.874  41.403 1.00 16.90 ? 171 MET D C   1 
ATOM   1291 O O   . MET A 1 167 ? -3.019  19.913  41.397 1.00 16.29 ? 171 MET D O   1 
ATOM   1292 C CB  . MET A 1 167 ? -5.596  19.934  42.582 1.00 20.69 ? 171 MET D CB  1 
ATOM   1293 C CG  . MET A 1 167 ? -7.082  20.205  42.670 1.00 24.56 ? 171 MET D CG  1 
ATOM   1294 S SD  . MET A 1 167 ? -7.445  21.434  43.932 1.00 29.63 ? 171 MET D SD  1 
ATOM   1295 C CE  . MET A 1 167 ? -6.985  22.935  43.079 1.00 28.25 ? 171 MET D CE  1 
ATOM   1296 N N   . ASP A 1 168 ? -3.136  17.660  41.342 1.00 15.30 ? 172 ASP D N   1 
ATOM   1297 C CA  . ASP A 1 168 ? -1.689  17.464  41.268 1.00 15.74 ? 172 ASP D CA  1 
ATOM   1298 C C   . ASP A 1 168 ? -1.038  18.336  42.336 1.00 15.57 ? 172 ASP D C   1 
ATOM   1299 O O   . ASP A 1 168 ? -0.085  19.067  42.068 1.00 15.86 ? 172 ASP D O   1 
ATOM   1300 C CB  . ASP A 1 168 ? -1.175  17.851  39.872 1.00 17.11 ? 172 ASP D CB  1 
ATOM   1301 C CG  . ASP A 1 168 ? 0.263   17.420  39.635 1.00 18.72 ? 172 ASP D CG  1 
ATOM   1302 O OD1 . ASP A 1 168 ? 0.676   16.395  40.215 1.00 18.44 ? 172 ASP D OD1 1 
ATOM   1303 O OD2 . ASP A 1 168 ? 0.974   18.096  38.851 1.00 19.62 ? 172 ASP D OD2 1 
ATOM   1304 N N   . PHE A 1 169 ? -1.555  18.235  43.557 1.00 14.84 ? 173 PHE D N   1 
ATOM   1305 C CA  . PHE A 1 169 ? -1.074  19.040  44.673 1.00 14.95 ? 173 PHE D CA  1 
ATOM   1306 C C   . PHE A 1 169 ? -0.736  18.213  45.916 1.00 14.40 ? 173 PHE D C   1 
ATOM   1307 O O   . PHE A 1 169 ? -1.601  17.541  46.474 1.00 15.08 ? 173 PHE D O   1 
ATOM   1308 C CB  . PHE A 1 169 ? -2.141  20.074  45.035 1.00 14.29 ? 173 PHE D CB  1 
ATOM   1309 C CG  . PHE A 1 169 ? -1.795  20.907  46.231 1.00 17.44 ? 173 PHE D CG  1 
ATOM   1310 C CD1 . PHE A 1 169 ? -0.848  21.918  46.138 1.00 18.29 ? 173 PHE D CD1 1 
ATOM   1311 C CD2 . PHE A 1 169 ? -2.406  20.667  47.458 1.00 16.18 ? 173 PHE D CD2 1 
ATOM   1312 C CE1 . PHE A 1 169 ? -0.510  22.682  47.253 1.00 19.80 ? 173 PHE D CE1 1 
ATOM   1313 C CE2 . PHE A 1 169 ? -2.075  21.426  48.580 1.00 17.92 ? 173 PHE D CE2 1 
ATOM   1314 C CZ  . PHE A 1 169 ? -1.127  22.432  48.475 1.00 18.40 ? 173 PHE D CZ  1 
ATOM   1315 N N   . LYS A 1 170 ? 0.516   18.287  46.352 1.00 12.44 ? 174 LYS D N   1 
ATOM   1316 C CA  . LYS A 1 170 ? 0.961   17.554  47.535 1.00 13.50 ? 174 LYS D CA  1 
ATOM   1317 C C   . LYS A 1 170 ? 1.228   18.513  48.681 1.00 14.57 ? 174 LYS D C   1 
ATOM   1318 O O   . LYS A 1 170 ? 1.601   19.666  48.463 1.00 15.29 ? 174 LYS D O   1 
ATOM   1319 C CB  . LYS A 1 170 ? 2.246   16.773  47.233 1.00 15.55 ? 174 LYS D CB  1 
ATOM   1320 C CG  . LYS A 1 170 ? 2.124   15.799  46.069 1.00 16.27 ? 174 LYS D CG  1 
ATOM   1321 C CD  . LYS A 1 170 ? 3.356   14.911  45.954 1.00 19.20 ? 174 LYS D CD  1 
ATOM   1322 C CE  . LYS A 1 170 ? 3.270   13.975  44.747 1.00 21.12 ? 174 LYS D CE  1 
ATOM   1323 N NZ  . LYS A 1 170 ? 3.683   14.651  43.487 1.00 23.46 ? 174 LYS D NZ  1 
ATOM   1324 N N   . SER A 1 171 ? 1.035   18.035  49.905 1.00 13.91 ? 175 SER D N   1 
ATOM   1325 C CA  . SER A 1 171 ? 1.288   18.865  51.075 1.00 14.90 ? 175 SER D CA  1 
ATOM   1326 C C   . SER A 1 171 ? 1.679   18.029  52.286 1.00 16.15 ? 175 SER D C   1 
ATOM   1327 O O   . SER A 1 171 ? 1.279   16.874  52.417 1.00 16.86 ? 175 SER D O   1 
ATOM   1328 C CB  . SER A 1 171 ? 0.063   19.735  51.413 1.00 16.93 ? 175 SER D CB  1 
ATOM   1329 O OG  . SER A 1 171 ? -1.095  18.963  51.680 1.00 18.11 ? 175 SER D OG  1 
ATOM   1330 N N   . ASN A 1 172 ? 2.494   18.623  53.151 1.00 15.24 ? 176 ASN D N   1 
ATOM   1331 C CA  . ASN A 1 172 ? 2.939   17.980  54.380 1.00 15.55 ? 176 ASN D CA  1 
ATOM   1332 C C   . ASN A 1 172 ? 2.052   18.501  55.502 1.00 14.86 ? 176 ASN D C   1 
ATOM   1333 O O   . ASN A 1 172 ? 1.619   19.656  55.474 1.00 15.59 ? 176 ASN D O   1 
ATOM   1334 C CB  . ASN A 1 172 ? 4.387   18.365  54.712 1.00 14.66 ? 176 ASN D CB  1 
ATOM   1335 C CG  . ASN A 1 172 ? 5.389   17.809  53.730 1.00 15.49 ? 176 ASN D CG  1 
ATOM   1336 O OD1 . ASN A 1 172 ? 5.473   16.600  53.530 1.00 15.04 ? 176 ASN D OD1 1 
ATOM   1337 N ND2 . ASN A 1 172 ? 6.172   18.693  53.121 1.00 14.41 ? 176 ASN D ND2 1 
ATOM   1338 N N   . SER A 1 173 ? 1.779   17.658  56.490 1.00 14.38 ? 177 SER D N   1 
ATOM   1339 C CA  . SER A 1 173 ? 0.972   18.093  57.620 1.00 16.00 ? 177 SER D CA  1 
ATOM   1340 C C   . SER A 1 173 ? 1.127   17.193  58.836 1.00 15.81 ? 177 SER D C   1 
ATOM   1341 O O   . SER A 1 173 ? 1.612   16.067  58.738 1.00 17.95 ? 177 SER D O   1 
ATOM   1342 C CB  . SER A 1 173 ? -0.507  18.203  57.224 1.00 18.97 ? 177 SER D CB  1 
ATOM   1343 O OG  . SER A 1 173 ? -1.010  16.990  56.695 1.00 26.30 ? 177 SER D OG  1 
ATOM   1344 N N   . ALA A 1 174 ? 0.734   17.725  59.986 1.00 14.16 ? 178 ALA D N   1 
ATOM   1345 C CA  . ALA A 1 174 ? 0.784   16.999  61.247 1.00 14.65 ? 178 ALA D CA  1 
ATOM   1346 C C   . ALA A 1 174 ? -0.390  17.495  62.071 1.00 13.69 ? 178 ALA D C   1 
ATOM   1347 O O   . ALA A 1 174 ? -0.846  18.623  61.897 1.00 12.98 ? 178 ALA D O   1 
ATOM   1348 C CB  . ALA A 1 174 ? 2.093   17.275  61.973 1.00 15.39 ? 178 ALA D CB  1 
ATOM   1349 N N   . VAL A 1 175 ? -0.878  16.652  62.970 1.00 13.93 ? 179 VAL D N   1 
ATOM   1350 C CA  . VAL A 1 175 ? -2.015  17.019  63.798 1.00 15.25 ? 179 VAL D CA  1 
ATOM   1351 C C   . VAL A 1 175 ? -1.675  16.935  65.280 1.00 16.28 ? 179 VAL D C   1 
ATOM   1352 O O   . VAL A 1 175 ? -0.858  16.115  65.692 1.00 15.78 ? 179 VAL D O   1 
ATOM   1353 C CB  . VAL A 1 175 ? -3.216  16.088  63.504 1.00 17.20 ? 179 VAL D CB  1 
ATOM   1354 C CG1 . VAL A 1 175 ? -4.407  16.466  64.369 1.00 19.59 ? 179 VAL D CG1 1 
ATOM   1355 C CG2 . VAL A 1 175 ? -3.578  16.167  62.027 1.00 19.47 ? 179 VAL D CG2 1 
ATOM   1356 N N   . ALA A 1 176 ? -2.293  17.809  66.066 1.00 15.14 ? 180 ALA D N   1 
ATOM   1357 C CA  . ALA A 1 176 ? -2.094  17.816  67.512 1.00 16.96 ? 180 ALA D CA  1 
ATOM   1358 C C   . ALA A 1 176 ? -3.461  17.946  68.170 1.00 18.09 ? 180 ALA D C   1 
ATOM   1359 O O   . ALA A 1 176 ? -4.313  18.698  67.703 1.00 18.17 ? 180 ALA D O   1 
ATOM   1360 C CB  . ALA A 1 176 ? -1.201  18.986  67.924 1.00 16.36 ? 180 ALA D CB  1 
ATOM   1361 N N   . TRP A 1 177 ? -3.681  17.205  69.251 1.00 18.20 ? 181 TRP D N   1 
ATOM   1362 C CA  . TRP A 1 177 ? -4.956  17.293  69.947 1.00 20.75 ? 181 TRP D CA  1 
ATOM   1363 C C   . TRP A 1 177 ? -4.761  17.081  71.438 1.00 21.40 ? 181 TRP D C   1 
ATOM   1364 O O   . TRP A 1 177 ? -3.761  16.507  71.870 1.00 20.43 ? 181 TRP D O   1 
ATOM   1365 C CB  . TRP A 1 177 ? -5.962  16.281  69.375 1.00 21.20 ? 181 TRP D CB  1 
ATOM   1366 C CG  . TRP A 1 177 ? -5.671  14.833  69.663 1.00 23.30 ? 181 TRP D CG  1 
ATOM   1367 C CD1 . TRP A 1 177 ? -6.012  14.132  70.787 1.00 24.30 ? 181 TRP D CD1 1 
ATOM   1368 C CD2 . TRP A 1 177 ? -5.013  13.903  68.797 1.00 23.52 ? 181 TRP D CD2 1 
ATOM   1369 N NE1 . TRP A 1 177 ? -5.614  12.822  70.669 1.00 25.46 ? 181 TRP D NE1 1 
ATOM   1370 C CE2 . TRP A 1 177 ? -4.997  12.653  69.458 1.00 25.12 ? 181 TRP D CE2 1 
ATOM   1371 C CE3 . TRP A 1 177 ? -4.436  14.003  67.524 1.00 24.21 ? 181 TRP D CE3 1 
ATOM   1372 C CZ2 . TRP A 1 177 ? -4.425  11.511  68.888 1.00 24.63 ? 181 TRP D CZ2 1 
ATOM   1373 C CZ3 . TRP A 1 177 ? -3.866  12.866  66.957 1.00 24.50 ? 181 TRP D CZ3 1 
ATOM   1374 C CH2 . TRP A 1 177 ? -3.867  11.636  67.641 1.00 24.94 ? 181 TRP D CH2 1 
ATOM   1375 N N   . SER A 1 178 ? -5.721  17.564  72.219 1.00 24.00 ? 182 SER D N   1 
ATOM   1376 C CA  . SER A 1 178 ? -5.660  17.452  73.671 1.00 27.12 ? 182 SER D CA  1 
ATOM   1377 C C   . SER A 1 178 ? -6.961  17.954  74.277 1.00 30.19 ? 182 SER D C   1 
ATOM   1378 O O   . SER A 1 178 ? -7.682  18.735  73.657 1.00 31.03 ? 182 SER D O   1 
ATOM   1379 C CB  . SER A 1 178 ? -4.495  18.288  74.208 1.00 26.12 ? 182 SER D CB  1 
ATOM   1380 O OG  . SER A 1 178 ? -4.462  18.288  75.627 1.00 26.26 ? 182 SER D OG  1 
ATOM   1381 N N   . ASN A 1 179 ? -7.263  17.503  75.489 1.00 33.44 ? 183 ASN D N   1 
ATOM   1382 C CA  . ASN A 1 179 ? -8.476  17.939  76.165 1.00 36.79 ? 183 ASN D CA  1 
ATOM   1383 C C   . ASN A 1 179 ? -8.145  18.951  77.261 1.00 38.67 ? 183 ASN D C   1 
ATOM   1384 O O   . ASN A 1 179 ? -9.035  19.434  77.962 1.00 39.49 ? 183 ASN D O   1 
ATOM   1385 C CB  . ASN A 1 179 ? -9.223  16.738  76.759 1.00 37.97 ? 183 ASN D CB  1 
ATOM   1386 C CG  . ASN A 1 179 ? -8.401  15.973  77.784 1.00 38.98 ? 183 ASN D CG  1 
ATOM   1387 O OD1 . ASN A 1 179 ? -8.844  14.947  78.304 1.00 40.01 ? 183 ASN D OD1 1 
ATOM   1388 N ND2 . ASN A 1 179 ? -7.207  16.468  78.083 1.00 39.51 ? 183 ASN D ND2 1 
ATOM   1389 N N   . LYS A 1 180 ? -6.862  19.275  77.401 1.00 40.84 ? 184 LYS D N   1 
ATOM   1390 C CA  . LYS A 1 180 ? -6.421  20.239  78.407 1.00 42.34 ? 184 LYS D CA  1 
ATOM   1391 C C   . LYS A 1 180 ? -6.998  21.619  78.112 1.00 43.65 ? 184 LYS D C   1 
ATOM   1392 O O   . LYS A 1 180 ? -7.283  21.953  76.961 1.00 43.67 ? 184 LYS D O   1 
ATOM   1393 C CB  . LYS A 1 180 ? -4.895  20.333  78.432 1.00 42.84 ? 184 LYS D CB  1 
ATOM   1394 C CG  . LYS A 1 180 ? -4.189  19.027  78.742 1.00 44.08 ? 184 LYS D CG  1 
ATOM   1395 C CD  . LYS A 1 180 ? -2.708  19.254  79.010 1.00 45.41 ? 184 LYS D CD  1 
ATOM   1396 C CE  . LYS A 1 180 ? -2.497  20.066  80.282 1.00 47.50 ? 184 LYS D CE  1 
ATOM   1397 N NZ  . LYS A 1 180 ? -1.056  20.224  80.624 1.00 47.91 ? 184 LYS D NZ  1 
ATOM   1398 N N   . SER A 1 181 ? -7.160  22.422  79.159 1.00 44.30 ? 185 SER D N   1 
ATOM   1399 C CA  . SER A 1 181 ? -7.703  23.767  79.016 1.00 44.79 ? 185 SER D CA  1 
ATOM   1400 C C   . SER A 1 181 ? -6.664  24.748  78.478 1.00 44.61 ? 185 SER D C   1 
ATOM   1401 O O   . SER A 1 181 ? -6.994  25.645  77.704 1.00 45.03 ? 185 SER D O   1 
ATOM   1402 C CB  . SER A 1 181 ? -8.229  24.264  80.365 1.00 44.90 ? 185 SER D CB  1 
ATOM   1403 O OG  . SER A 1 181 ? -7.221  24.195  81.358 1.00 45.84 ? 185 SER D OG  1 
ATOM   1404 N N   . ASP A 1 182 ? -5.412  24.570  78.889 1.00 44.43 ? 186 ASP D N   1 
ATOM   1405 C CA  . ASP A 1 182 ? -4.328  25.445  78.454 1.00 44.27 ? 186 ASP D CA  1 
ATOM   1406 C C   . ASP A 1 182 ? -3.879  25.159  77.024 1.00 42.92 ? 186 ASP D C   1 
ATOM   1407 O O   . ASP A 1 182 ? -2.994  25.835  76.498 1.00 43.57 ? 186 ASP D O   1 
ATOM   1408 C CB  . ASP A 1 182 ? -3.125  25.303  79.390 1.00 45.99 ? 186 ASP D CB  1 
ATOM   1409 C CG  . ASP A 1 182 ? -3.446  25.697  80.817 1.00 48.71 ? 186 ASP D CG  1 
ATOM   1410 O OD1 . ASP A 1 182 ? -3.851  26.859  81.041 1.00 49.86 ? 186 ASP D OD1 1 
ATOM   1411 O OD2 . ASP A 1 182 ? -3.293  24.843  81.718 1.00 50.46 ? 186 ASP D OD2 1 
ATOM   1412 N N   . PHE A 1 183 ? -4.488  24.159  76.396 1.00 40.20 ? 187 PHE D N   1 
ATOM   1413 C CA  . PHE A 1 183 ? -4.122  23.804  75.032 1.00 36.71 ? 187 PHE D CA  1 
ATOM   1414 C C   . PHE A 1 183 ? -4.719  24.757  74.003 1.00 34.75 ? 187 PHE D C   1 
ATOM   1415 O O   . PHE A 1 183 ? -5.925  24.993  73.979 1.00 35.49 ? 187 PHE D O   1 
ATOM   1416 C CB  . PHE A 1 183 ? -4.552  22.367  74.722 1.00 34.47 ? 187 PHE D CB  1 
ATOM   1417 C CG  . PHE A 1 183 ? -4.121  21.887  73.366 1.00 32.12 ? 187 PHE D CG  1 
ATOM   1418 C CD1 . PHE A 1 183 ? -5.008  21.889  72.296 1.00 31.50 ? 187 PHE D CD1 1 
ATOM   1419 C CD2 . PHE A 1 183 ? -2.821  21.443  73.157 1.00 30.39 ? 187 PHE D CD2 1 
ATOM   1420 C CE1 . PHE A 1 183 ? -4.606  21.453  71.038 1.00 31.47 ? 187 PHE D CE1 1 
ATOM   1421 C CE2 . PHE A 1 183 ? -2.409  21.007  71.904 1.00 30.61 ? 187 PHE D CE2 1 
ATOM   1422 C CZ  . PHE A 1 183 ? -3.303  21.011  70.842 1.00 29.48 ? 187 PHE D CZ  1 
ATOM   1423 N N   . ALA A 1 184 ? -3.850  25.301  73.158 1.00 32.70 ? 188 ALA D N   1 
ATOM   1424 C CA  . ALA A 1 184 ? -4.247  26.227  72.106 1.00 30.61 ? 188 ALA D CA  1 
ATOM   1425 C C   . ALA A 1 184 ? -3.329  25.973  70.923 1.00 29.14 ? 188 ALA D C   1 
ATOM   1426 O O   . ALA A 1 184 ? -2.183  25.574  71.101 1.00 27.90 ? 188 ALA D O   1 
ATOM   1427 C CB  . ALA A 1 184 ? -4.101  27.665  72.584 1.00 30.89 ? 188 ALA D CB  1 
ATOM   1428 N N   . CYS A 1 185 ? -3.827  26.197  69.714 1.00 28.29 ? 189 CYS D N   1 
ATOM   1429 C CA  . CYS A 1 185 ? -3.010  25.961  68.534 1.00 28.54 ? 189 CYS D CA  1 
ATOM   1430 C C   . CYS A 1 185 ? -1.798  26.890  68.486 1.00 26.85 ? 189 CYS D C   1 
ATOM   1431 O O   . CYS A 1 185 ? -0.788  26.573  67.861 1.00 25.77 ? 189 CYS D O   1 
ATOM   1432 C CB  . CYS A 1 185 ? -3.860  26.104  67.272 1.00 30.69 ? 189 CYS D CB  1 
ATOM   1433 S SG  . CYS A 1 185 ? -5.262  24.935  67.199 1.00 35.39 ? 189 CYS D SG  1 
ATOM   1434 N N   . ALA A 1 186 ? -1.888  28.028  69.168 1.00 25.84 ? 190 ALA D N   1 
ATOM   1435 C CA  . ALA A 1 186 ? -0.784  28.979  69.197 1.00 24.87 ? 190 ALA D CA  1 
ATOM   1436 C C   . ALA A 1 186 ? 0.464   28.370  69.836 1.00 24.85 ? 190 ALA D C   1 
ATOM   1437 O O   . ALA A 1 186 ? 1.588   28.748  69.500 1.00 24.51 ? 190 ALA D O   1 
ATOM   1438 C CB  . ALA A 1 186 ? -1.197  30.231  69.962 1.00 25.66 ? 190 ALA D CB  1 
ATOM   1439 N N   . ASN A 1 187 ? 0.267   27.427  70.754 1.00 23.69 ? 191 ASN D N   1 
ATOM   1440 C CA  . ASN A 1 187 ? 1.391   26.794  71.439 1.00 24.20 ? 191 ASN D CA  1 
ATOM   1441 C C   . ASN A 1 187 ? 1.506   25.289  71.203 1.00 22.53 ? 191 ASN D C   1 
ATOM   1442 O O   . ASN A 1 187 ? 2.472   24.660  71.633 1.00 21.87 ? 191 ASN D O   1 
ATOM   1443 C CB  . ASN A 1 187 ? 1.302   27.075  72.947 1.00 28.01 ? 191 ASN D CB  1 
ATOM   1444 C CG  . ASN A 1 187 ? 0.027   26.531  73.577 1.00 31.05 ? 191 ASN D CG  1 
ATOM   1445 O OD1 . ASN A 1 187 ? -0.611  27.206  74.386 1.00 34.46 ? 191 ASN D OD1 1 
ATOM   1446 N ND2 . ASN A 1 187 ? -0.338  25.302  73.223 1.00 32.43 ? 191 ASN D ND2 1 
ATOM   1447 N N   . ALA A 1 188 ? 0.525   24.717  70.513 1.00 21.65 ? 192 ALA D N   1 
ATOM   1448 C CA  . ALA A 1 188 ? 0.516   23.282  70.242 1.00 20.48 ? 192 ALA D CA  1 
ATOM   1449 C C   . ALA A 1 188 ? 1.844   22.725  69.726 1.00 20.05 ? 192 ALA D C   1 
ATOM   1450 O O   . ALA A 1 188 ? 2.303   21.684  70.191 1.00 19.97 ? 192 ALA D O   1 
ATOM   1451 C CB  . ALA A 1 188 ? -0.608  22.945  69.260 1.00 20.84 ? 192 ALA D CB  1 
ATOM   1452 N N   . PHE A 1 189 ? 2.460   23.417  68.771 1.00 19.91 ? 193 PHE D N   1 
ATOM   1453 C CA  . PHE A 1 189 ? 3.721   22.956  68.194 1.00 19.88 ? 193 PHE D CA  1 
ATOM   1454 C C   . PHE A 1 189 ? 4.953   23.731  68.675 1.00 21.92 ? 193 PHE D C   1 
ATOM   1455 O O   . PHE A 1 189 ? 5.945   23.845  67.954 1.00 22.51 ? 193 PHE D O   1 
ATOM   1456 C CB  . PHE A 1 189 ? 3.639   23.002  66.660 1.00 19.25 ? 193 PHE D CB  1 
ATOM   1457 C CG  . PHE A 1 189 ? 2.531   22.155  66.087 1.00 17.91 ? 193 PHE D CG  1 
ATOM   1458 C CD1 . PHE A 1 189 ? 1.256   22.684  65.899 1.00 17.55 ? 193 PHE D CD1 1 
ATOM   1459 C CD2 . PHE A 1 189 ? 2.753   20.816  65.771 1.00 17.89 ? 193 PHE D CD2 1 
ATOM   1460 C CE1 . PHE A 1 189 ? 0.219   21.894  65.409 1.00 15.73 ? 193 PHE D CE1 1 
ATOM   1461 C CE2 . PHE A 1 189 ? 1.719   20.016  65.280 1.00 18.14 ? 193 PHE D CE2 1 
ATOM   1462 C CZ  . PHE A 1 189 ? 0.451   20.559  65.100 1.00 15.12 ? 193 PHE D CZ  1 
ATOM   1463 N N   . ASN A 1 190 ? 4.895   24.243  69.901 1.00 23.97 ? 194 ASN D N   1 
ATOM   1464 C CA  . ASN A 1 190 ? 6.009   25.005  70.461 1.00 26.80 ? 194 ASN D CA  1 
ATOM   1465 C C   . ASN A 1 190 ? 7.311   24.219  70.588 1.00 27.29 ? 194 ASN D C   1 
ATOM   1466 O O   . ASN A 1 190 ? 8.390   24.810  70.606 1.00 28.31 ? 194 ASN D O   1 
ATOM   1467 C CB  . ASN A 1 190 ? 5.641   25.575  71.836 1.00 28.04 ? 194 ASN D CB  1 
ATOM   1468 C CG  . ASN A 1 190 ? 4.808   26.841  71.746 1.00 30.92 ? 194 ASN D CG  1 
ATOM   1469 O OD1 . ASN A 1 190 ? 4.704   27.464  70.686 1.00 32.15 ? 194 ASN D OD1 1 
ATOM   1470 N ND2 . ASN A 1 190 ? 4.224   27.240  72.870 1.00 31.98 ? 194 ASN D ND2 1 
ATOM   1471 N N   . ASN A 1 191 ? 7.222   22.896  70.680 1.00 26.90 ? 195 ASN D N   1 
ATOM   1472 C CA  . ASN A 1 191 ? 8.429   22.086  70.814 1.00 27.23 ? 195 ASN D CA  1 
ATOM   1473 C C   . ASN A 1 191 ? 9.068   21.774  69.463 1.00 26.07 ? 195 ASN D C   1 
ATOM   1474 O O   . ASN A 1 191 ? 10.089  21.089  69.392 1.00 26.16 ? 195 ASN D O   1 
ATOM   1475 C CB  . ASN A 1 191 ? 8.125   20.785  71.567 1.00 28.74 ? 195 ASN D CB  1 
ATOM   1476 C CG  . ASN A 1 191 ? 9.389   20.021  71.939 1.00 30.44 ? 195 ASN D CG  1 
ATOM   1477 O OD1 . ASN A 1 191 ? 10.331  20.590  72.493 1.00 31.48 ? 195 ASN D OD1 1 
ATOM   1478 N ND2 . ASN A 1 191 ? 9.411   18.728  71.639 1.00 31.95 ? 195 ASN D ND2 1 
ATOM   1479 N N   . SER A 1 192 ? 8.464   22.280  68.391 1.00 24.68 ? 196 SER D N   1 
ATOM   1480 C CA  . SER A 1 192 ? 8.995   22.069  67.049 1.00 23.18 ? 196 SER D CA  1 
ATOM   1481 C C   . SER A 1 192 ? 9.591   23.362  66.516 1.00 22.44 ? 196 SER D C   1 
ATOM   1482 O O   . SER A 1 192 ? 9.179   24.453  66.912 1.00 23.96 ? 196 SER D O   1 
ATOM   1483 C CB  . SER A 1 192 ? 7.892   21.623  66.083 1.00 23.55 ? 196 SER D CB  1 
ATOM   1484 O OG  . SER A 1 192 ? 7.353   20.368  66.445 1.00 23.56 ? 196 SER D OG  1 
ATOM   1485 N N   . ILE A 1 193 ? 10.569  23.236  65.628 1.00 21.59 ? 197 ILE D N   1 
ATOM   1486 C CA  . ILE A 1 193 ? 11.175  24.404  65.004 1.00 21.54 ? 197 ILE D CA  1 
ATOM   1487 C C   . ILE A 1 193 ? 10.363  24.609  63.727 1.00 21.58 ? 197 ILE D C   1 
ATOM   1488 O O   . ILE A 1 193 ? 10.527  23.873  62.755 1.00 21.58 ? 197 ILE D O   1 
ATOM   1489 C CB  . ILE A 1 193 ? 12.653  24.152  64.640 1.00 23.01 ? 197 ILE D CB  1 
ATOM   1490 C CG1 . ILE A 1 193 ? 13.475  23.953  65.917 1.00 24.01 ? 197 ILE D CG1 1 
ATOM   1491 C CG2 . ILE A 1 193 ? 13.200  25.327  63.838 1.00 23.41 ? 197 ILE D CG2 1 
ATOM   1492 C CD1 . ILE A 1 193 ? 14.928  23.613  65.658 1.00 26.45 ? 197 ILE D CD1 1 
ATOM   1493 N N   . ILE A 1 194 ? 9.467   25.590  63.742 1.00 21.96 ? 198 ILE D N   1 
ATOM   1494 C CA  . ILE A 1 194 ? 8.625   25.856  62.578 1.00 21.40 ? 198 ILE D CA  1 
ATOM   1495 C C   . ILE A 1 194 ? 9.025   27.156  61.888 1.00 20.96 ? 198 ILE D C   1 
ATOM   1496 O O   . ILE A 1 194 ? 9.677   28.012  62.489 1.00 21.01 ? 198 ILE D O   1 
ATOM   1497 C CB  . ILE A 1 194 ? 7.128   25.929  62.976 1.00 21.94 ? 198 ILE D CB  1 
ATOM   1498 C CG1 . ILE A 1 194 ? 6.869   27.168  63.837 1.00 21.96 ? 198 ILE D CG1 1 
ATOM   1499 C CG2 . ILE A 1 194 ? 6.732   24.667  63.741 1.00 22.46 ? 198 ILE D CG2 1 
ATOM   1500 C CD1 . ILE A 1 194 ? 5.410   27.351  64.216 1.00 23.81 ? 198 ILE D CD1 1 
ATOM   1501 N N   . PRO A 1 195 ? 8.639   27.319  60.610 1.00 20.34 ? 199 PRO D N   1 
ATOM   1502 C CA  . PRO A 1 195 ? 8.971   28.529  59.849 1.00 20.62 ? 199 PRO D CA  1 
ATOM   1503 C C   . PRO A 1 195 ? 8.539   29.780  60.604 1.00 20.49 ? 199 PRO D C   1 
ATOM   1504 O O   . PRO A 1 195 ? 7.452   29.821  61.173 1.00 18.44 ? 199 PRO D O   1 
ATOM   1505 C CB  . PRO A 1 195 ? 8.193   28.344  58.548 1.00 19.81 ? 199 PRO D CB  1 
ATOM   1506 C CG  . PRO A 1 195 ? 8.167   26.857  58.382 1.00 20.57 ? 199 PRO D CG  1 
ATOM   1507 C CD  . PRO A 1 195 ? 7.860   26.378  59.785 1.00 19.24 ? 199 PRO D CD  1 
ATOM   1508 N N   . GLU A 1 196 ? 9.388   30.800  60.615 1.00 22.87 ? 200 GLU D N   1 
ATOM   1509 C CA  . GLU A 1 196 ? 9.051   32.022  61.331 1.00 24.61 ? 200 GLU D CA  1 
ATOM   1510 C C   . GLU A 1 196 ? 7.848   32.727  60.717 1.00 22.90 ? 200 GLU D C   1 
ATOM   1511 O O   . GLU A 1 196 ? 7.126   33.444  61.411 1.00 24.26 ? 200 GLU D O   1 
ATOM   1512 C CB  . GLU A 1 196 ? 10.249  32.975  61.369 1.00 30.11 ? 200 GLU D CB  1 
ATOM   1513 C CG  . GLU A 1 196 ? 10.738  33.435  60.009 1.00 37.36 ? 200 GLU D CG  1 
ATOM   1514 C CD  . GLU A 1 196 ? 11.867  34.444  60.118 1.00 41.72 ? 200 GLU D CD  1 
ATOM   1515 O OE1 . GLU A 1 196 ? 12.929  34.091  60.676 1.00 44.20 ? 200 GLU D OE1 1 
ATOM   1516 O OE2 . GLU A 1 196 ? 11.689  35.590  59.651 1.00 44.22 ? 200 GLU D OE2 1 
ATOM   1517 N N   . ASP A 1 197 ? 7.627   32.514  59.421 1.00 20.13 ? 201 ASP D N   1 
ATOM   1518 C CA  . ASP A 1 197 ? 6.502   33.139  58.730 1.00 18.11 ? 201 ASP D CA  1 
ATOM   1519 C C   . ASP A 1 197 ? 5.242   32.273  58.750 1.00 16.46 ? 201 ASP D C   1 
ATOM   1520 O O   . ASP A 1 197 ? 4.316   32.491  57.967 1.00 16.17 ? 201 ASP D O   1 
ATOM   1521 C CB  . ASP A 1 197 ? 6.884   33.469  57.279 1.00 18.09 ? 201 ASP D CB  1 
ATOM   1522 C CG  . ASP A 1 197 ? 8.022   34.477  57.189 1.00 19.23 ? 201 ASP D CG  1 
ATOM   1523 O OD1 . ASP A 1 197 ? 7.919   35.552  57.814 1.00 20.36 ? 201 ASP D OD1 1 
ATOM   1524 O OD2 . ASP A 1 197 ? 9.019   34.202  56.491 1.00 22.15 ? 201 ASP D OD2 1 
ATOM   1525 N N   . THR A 1 198 ? 5.209   31.284  59.638 1.00 15.00 ? 202 THR D N   1 
ATOM   1526 C CA  . THR A 1 198 ? 4.043   30.416  59.740 1.00 15.01 ? 202 THR D CA  1 
ATOM   1527 C C   . THR A 1 198 ? 2.824   31.275  60.050 1.00 15.33 ? 202 THR D C   1 
ATOM   1528 O O   . THR A 1 198 ? 2.870   32.157  60.912 1.00 14.90 ? 202 THR D O   1 
ATOM   1529 C CB  . THR A 1 198 ? 4.221   29.353  60.843 1.00 14.05 ? 202 THR D CB  1 
ATOM   1530 O OG1 . THR A 1 198 ? 5.306   28.489  60.492 1.00 14.98 ? 202 THR D OG1 1 
ATOM   1531 C CG2 . THR A 1 198 ? 2.952   28.512  60.992 1.00 15.37 ? 202 THR D CG2 1 
ATOM   1532 N N   . PHE A 1 199 ? 1.737   31.014  59.333 1.00 14.66 ? 203 PHE D N   1 
ATOM   1533 C CA  . PHE A 1 199 ? 0.499   31.766  59.495 1.00 14.83 ? 203 PHE D CA  1 
ATOM   1534 C C   . PHE A 1 199 ? -0.367  31.238  60.635 1.00 15.12 ? 203 PHE D C   1 
ATOM   1535 O O   . PHE A 1 199 ? -0.706  30.052  60.669 1.00 15.40 ? 203 PHE D O   1 
ATOM   1536 C CB  . PHE A 1 199 ? -0.287  31.721  58.176 1.00 15.75 ? 203 PHE D CB  1 
ATOM   1537 C CG  . PHE A 1 199 ? -1.620  32.430  58.217 1.00 17.68 ? 203 PHE D CG  1 
ATOM   1538 C CD1 . PHE A 1 199 ? -1.718  33.744  58.660 1.00 18.11 ? 203 PHE D CD1 1 
ATOM   1539 C CD2 . PHE A 1 199 ? -2.775  31.787  57.769 1.00 17.77 ? 203 PHE D CD2 1 
ATOM   1540 C CE1 . PHE A 1 199 ? -2.944  34.413  58.657 1.00 17.83 ? 203 PHE D CE1 1 
ATOM   1541 C CE2 . PHE A 1 199 ? -4.006  32.448  57.762 1.00 19.60 ? 203 PHE D CE2 1 
ATOM   1542 C CZ  . PHE A 1 199 ? -4.089  33.762  58.205 1.00 18.52 ? 203 PHE D CZ  1 
ATOM   1543 N N   . PHE A 1 200 ? -0.695  32.120  61.576 1.00 15.92 ? 204 PHE D N   1 
ATOM   1544 C CA  . PHE A 1 200 ? -1.563  31.773  62.698 1.00 16.99 ? 204 PHE D CA  1 
ATOM   1545 C C   . PHE A 1 200 ? -2.768  32.701  62.580 1.00 18.87 ? 204 PHE D C   1 
ATOM   1546 O O   . PHE A 1 200 ? -2.694  33.876  62.939 1.00 19.61 ? 204 PHE D O   1 
ATOM   1547 C CB  . PHE A 1 200 ? -0.864  32.003  64.045 1.00 17.16 ? 204 PHE D CB  1 
ATOM   1548 C CG  . PHE A 1 200 ? 0.168   30.963  64.390 1.00 16.71 ? 204 PHE D CG  1 
ATOM   1549 C CD1 . PHE A 1 200 ? 1.485   31.096  63.958 1.00 17.55 ? 204 PHE D CD1 1 
ATOM   1550 C CD2 . PHE A 1 200 ? -0.179  29.845  65.151 1.00 17.74 ? 204 PHE D CD2 1 
ATOM   1551 C CE1 . PHE A 1 200 ? 2.446   30.129  64.280 1.00 16.62 ? 204 PHE D CE1 1 
ATOM   1552 C CE2 . PHE A 1 200 ? 0.775   28.875  65.476 1.00 16.24 ? 204 PHE D CE2 1 
ATOM   1553 C CZ  . PHE A 1 200 ? 2.086   29.019  65.040 1.00 16.34 ? 204 PHE D CZ  1 
ATOM   1554 N N   . PRO A 1 201 ? -3.888  32.193  62.051 1.00 19.68 ? 205 PRO D N   1 
ATOM   1555 C CA  . PRO A 1 201 ? -5.102  33.004  61.890 1.00 21.22 ? 205 PRO D CA  1 
ATOM   1556 C C   . PRO A 1 201 ? -5.522  33.659  63.197 1.00 23.67 ? 205 PRO D C   1 
ATOM   1557 O O   . PRO A 1 201 ? -5.316  33.096  64.271 1.00 25.19 ? 205 PRO D O   1 
ATOM   1558 C CB  . PRO A 1 201 ? -6.134  31.987  61.406 1.00 21.59 ? 205 PRO D CB  1 
ATOM   1559 C CG  . PRO A 1 201 ? -5.298  30.988  60.660 1.00 20.51 ? 205 PRO D CG  1 
ATOM   1560 C CD  . PRO A 1 201 ? -4.100  30.820  61.555 1.00 20.81 ? 205 PRO D CD  1 
ATOM   1561 N N   . SER A 1 202 ? -6.108  34.847  63.106 1.00 25.86 ? 206 SER D N   1 
ATOM   1562 C CA  . SER A 1 202 ? -6.558  35.553  64.299 1.00 29.82 ? 206 SER D CA  1 
ATOM   1563 C C   . SER A 1 202 ? -7.926  36.189  64.086 1.00 31.39 ? 206 SER D C   1 
ATOM   1564 O O   . SER A 1 202 ? -8.390  36.223  62.926 1.00 33.22 ? 206 SER D O   1 
ATOM   1565 C CB  . SER A 1 202 ? -5.542  36.628  64.691 1.00 30.32 ? 206 SER D CB  1 
ATOM   1566 O OG  . SER A 1 202 ? -5.344  37.553  63.638 1.00 30.23 ? 206 SER D OG  1 
ATOM   1567 N N   . GLY B 2 2   ? -2.793  -13.806 44.637 1.00 25.02 ? 3   GLY E N   1 
ATOM   1568 C CA  . GLY B 2 2   ? -1.482  -14.193 45.223 1.00 23.47 ? 3   GLY E CA  1 
ATOM   1569 C C   . GLY B 2 2   ? -1.654  -15.036 46.470 1.00 21.44 ? 3   GLY E C   1 
ATOM   1570 O O   . GLY B 2 2   ? -2.623  -15.777 46.606 1.00 23.52 ? 3   GLY E O   1 
ATOM   1571 N N   . VAL B 2 3   ? -0.700  -14.922 47.382 1.00 18.89 ? 4   VAL E N   1 
ATOM   1572 C CA  . VAL B 2 3   ? -0.736  -15.669 48.632 1.00 16.81 ? 4   VAL E CA  1 
ATOM   1573 C C   . VAL B 2 3   ? -1.774  -15.049 49.558 1.00 15.23 ? 4   VAL E C   1 
ATOM   1574 O O   . VAL B 2 3   ? -1.845  -13.831 49.672 1.00 16.67 ? 4   VAL E O   1 
ATOM   1575 C CB  . VAL B 2 3   ? 0.636   -15.612 49.331 1.00 16.01 ? 4   VAL E CB  1 
ATOM   1576 C CG1 . VAL B 2 3   ? 0.568   -16.316 50.686 1.00 13.95 ? 4   VAL E CG1 1 
ATOM   1577 C CG2 . VAL B 2 3   ? 1.701   -16.251 48.445 1.00 15.88 ? 4   VAL E CG2 1 
ATOM   1578 N N   . SER B 2 4   ? -2.581  -15.883 50.208 1.00 15.15 ? 5   SER E N   1 
ATOM   1579 C CA  . SER B 2 4   ? -3.574  -15.370 51.143 1.00 15.18 ? 5   SER E CA  1 
ATOM   1580 C C   . SER B 2 4   ? -3.338  -15.949 52.531 1.00 14.48 ? 5   SER E C   1 
ATOM   1581 O O   . SER B 2 4   ? -2.749  -17.021 52.681 1.00 13.86 ? 5   SER E O   1 
ATOM   1582 C CB  . SER B 2 4   ? -4.997  -15.697 50.674 1.00 19.02 ? 5   SER E CB  1 
ATOM   1583 O OG  . SER B 2 4   ? -5.217  -17.090 50.593 1.00 25.76 ? 5   SER E OG  1 
ATOM   1584 N N   . GLN B 2 5   ? -3.786  -15.217 53.541 1.00 13.50 ? 6   GLN E N   1 
ATOM   1585 C CA  . GLN B 2 5   ? -3.642  -15.644 54.926 1.00 13.75 ? 6   GLN E CA  1 
ATOM   1586 C C   . GLN B 2 5   ? -4.901  -15.325 55.707 1.00 13.95 ? 6   GLN E C   1 
ATOM   1587 O O   . GLN B 2 5   ? -5.624  -14.378 55.387 1.00 16.23 ? 6   GLN E O   1 
ATOM   1588 C CB  . GLN B 2 5   ? -2.459  -14.944 55.593 1.00 11.93 ? 6   GLN E CB  1 
ATOM   1589 C CG  . GLN B 2 5   ? -1.095  -15.444 55.141 1.00 12.41 ? 6   GLN E CG  1 
ATOM   1590 C CD  . GLN B 2 5   ? 0.035   -14.685 55.812 1.00 13.15 ? 6   GLN E CD  1 
ATOM   1591 O OE1 . GLN B 2 5   ? 0.665   -13.812 55.207 1.00 14.96 ? 6   GLN E OE1 1 
ATOM   1592 N NE2 . GLN B 2 5   ? 0.290   -15.003 57.080 1.00 12.07 ? 6   GLN E NE2 1 
ATOM   1593 N N   . SER B 2 6   ? -5.150  -16.120 56.740 1.00 13.86 ? 7   SER E N   1 
ATOM   1594 C CA  . SER B 2 6   ? -6.315  -15.932 57.588 1.00 14.69 ? 7   SER E CA  1 
ATOM   1595 C C   . SER B 2 6   ? -6.034  -16.529 58.964 1.00 14.21 ? 7   SER E C   1 
ATOM   1596 O O   . SER B 2 6   ? -5.345  -17.542 59.080 1.00 15.57 ? 7   SER E O   1 
ATOM   1597 C CB  . SER B 2 6   ? -7.541  -16.607 56.962 1.00 15.84 ? 7   SER E CB  1 
ATOM   1598 O OG  . SER B 2 6   ? -7.340  -18.004 56.816 1.00 19.39 ? 7   SER E OG  1 
ATOM   1599 N N   . PRO B 2 7   ? -6.514  -15.872 60.031 1.00 15.30 ? 8   PRO E N   1 
ATOM   1600 C CA  . PRO B 2 7   ? -7.278  -14.622 59.949 1.00 14.09 ? 8   PRO E CA  1 
ATOM   1601 C C   . PRO B 2 7   ? -6.300  -13.477 59.709 1.00 14.80 ? 8   PRO E C   1 
ATOM   1602 O O   . PRO B 2 7   ? -5.112  -13.611 59.993 1.00 17.05 ? 8   PRO E O   1 
ATOM   1603 C CB  . PRO B 2 7   ? -7.920  -14.528 61.326 1.00 14.57 ? 8   PRO E CB  1 
ATOM   1604 C CG  . PRO B 2 7   ? -6.838  -15.093 62.212 1.00 15.27 ? 8   PRO E CG  1 
ATOM   1605 C CD  . PRO B 2 7   ? -6.379  -16.315 61.432 1.00 14.52 ? 8   PRO E CD  1 
ATOM   1606 N N   . ARG B 2 8   ? -6.787  -12.359 59.188 1.00 14.01 ? 9   ARG E N   1 
ATOM   1607 C CA  . ARG B 2 8   ? -5.913  -11.218 58.955 1.00 13.46 ? 9   ARG E CA  1 
ATOM   1608 C C   . ARG B 2 8   ? -5.511  -10.577 60.287 1.00 12.97 ? 9   ARG E C   1 
ATOM   1609 O O   . ARG B 2 8   ? -4.420  -10.022 60.413 1.00 12.78 ? 9   ARG E O   1 
ATOM   1610 C CB  . ARG B 2 8   ? -6.609  -10.192 58.056 1.00 15.61 ? 9   ARG E CB  1 
ATOM   1611 C CG  . ARG B 2 8   ? -6.754  -10.648 56.605 1.00 18.25 ? 9   ARG E CG  1 
ATOM   1612 C CD  . ARG B 2 8   ? -5.387  -10.838 55.967 1.00 23.40 ? 9   ARG E CD  1 
ATOM   1613 N NE  . ARG B 2 8   ? -4.531  -9.678  56.206 1.00 27.84 ? 9   ARG E NE  1 
ATOM   1614 C CZ  . ARG B 2 8   ? -4.770  -8.460  55.732 1.00 29.90 ? 9   ARG E CZ  1 
ATOM   1615 N NH1 . ARG B 2 8   ? -5.838  -8.238  54.977 1.00 32.06 ? 9   ARG E NH1 1 
ATOM   1616 N NH2 . ARG B 2 8   ? -3.953  -7.459  56.033 1.00 31.26 ? 9   ARG E NH2 1 
ATOM   1617 N N   . TYR B 2 9   ? -6.405  -10.647 61.272 1.00 12.61 ? 10  TYR E N   1 
ATOM   1618 C CA  . TYR B 2 9   ? -6.147  -10.095 62.604 1.00 14.11 ? 10  TYR E CA  1 
ATOM   1619 C C   . TYR B 2 9   ? -6.635  -11.084 63.650 1.00 13.70 ? 10  TYR E C   1 
ATOM   1620 O O   . TYR B 2 9   ? -7.619  -11.792 63.436 1.00 15.13 ? 10  TYR E O   1 
ATOM   1621 C CB  . TYR B 2 9   ? -6.877  -8.766  62.810 1.00 12.92 ? 10  TYR E CB  1 
ATOM   1622 C CG  . TYR B 2 9   ? -6.524  -7.700  61.804 1.00 13.61 ? 10  TYR E CG  1 
ATOM   1623 C CD1 . TYR B 2 9   ? -7.119  -7.682  60.544 1.00 15.19 ? 10  TYR E CD1 1 
ATOM   1624 C CD2 . TYR B 2 9   ? -5.589  -6.712  62.108 1.00 14.62 ? 10  TYR E CD2 1 
ATOM   1625 C CE1 . TYR B 2 9   ? -6.791  -6.699  59.607 1.00 16.38 ? 10  TYR E CE1 1 
ATOM   1626 C CE2 . TYR B 2 9   ? -5.251  -5.727  61.180 1.00 16.15 ? 10  TYR E CE2 1 
ATOM   1627 C CZ  . TYR B 2 9   ? -5.858  -5.727  59.933 1.00 16.68 ? 10  TYR E CZ  1 
ATOM   1628 O OH  . TYR B 2 9   ? -5.542  -4.748  59.018 1.00 18.69 ? 10  TYR E OH  1 
ATOM   1629 N N   . LYS B 2 10  ? -5.944  -11.126 64.784 1.00 14.03 ? 11  LYS E N   1 
ATOM   1630 C CA  . LYS B 2 10  ? -6.313  -12.042 65.853 1.00 14.69 ? 11  LYS E CA  1 
ATOM   1631 C C   . LYS B 2 10  ? -5.870  -11.515 67.203 1.00 14.79 ? 11  LYS E C   1 
ATOM   1632 O O   . LYS B 2 10  ? -4.722  -11.114 67.373 1.00 16.41 ? 11  LYS E O   1 
ATOM   1633 C CB  . LYS B 2 10  ? -5.659  -13.408 65.611 1.00 15.91 ? 11  LYS E CB  1 
ATOM   1634 C CG  . LYS B 2 10  ? -5.933  -14.462 66.689 1.00 17.10 ? 11  LYS E CG  1 
ATOM   1635 C CD  . LYS B 2 10  ? -7.391  -14.892 66.686 1.00 19.58 ? 11  LYS E CD  1 
ATOM   1636 C CE  . LYS B 2 10  ? -7.653  -15.977 67.722 1.00 22.12 ? 11  LYS E CE  1 
ATOM   1637 N NZ  . LYS B 2 10  ? -9.058  -16.464 67.656 1.00 22.07 ? 11  LYS E NZ  1 
ATOM   1638 N N   . VAL B 2 11  ? -6.789  -11.496 68.160 1.00 14.04 ? 12  VAL E N   1 
ATOM   1639 C CA  . VAL B 2 11  ? -6.440  -11.080 69.508 1.00 15.80 ? 12  VAL E CA  1 
ATOM   1640 C C   . VAL B 2 11  ? -6.712  -12.324 70.340 1.00 15.98 ? 12  VAL E C   1 
ATOM   1641 O O   . VAL B 2 11  ? -7.758  -12.961 70.205 1.00 17.28 ? 12  VAL E O   1 
ATOM   1642 C CB  . VAL B 2 11  ? -7.280  -9.871  69.999 1.00 15.31 ? 12  VAL E CB  1 
ATOM   1643 C CG1 . VAL B 2 11  ? -8.765  -10.171 69.897 1.00 18.30 ? 12  VAL E CG1 1 
ATOM   1644 C CG2 . VAL B 2 11  ? -6.888  -9.528  71.440 1.00 16.80 ? 12  VAL E CG2 1 
ATOM   1645 N N   . ALA B 2 12  ? -5.749  -12.694 71.170 1.00 15.57 ? 13  ALA E N   1 
ATOM   1646 C CA  . ALA B 2 12  ? -5.886  -13.891 71.983 1.00 16.06 ? 13  ALA E CA  1 
ATOM   1647 C C   . ALA B 2 12  ? -5.502  -13.625 73.424 1.00 17.40 ? 13  ALA E C   1 
ATOM   1648 O O   . ALA B 2 12  ? -4.705  -12.739 73.707 1.00 16.92 ? 13  ALA E O   1 
ATOM   1649 C CB  . ALA B 2 12  ? -5.010  -14.992 71.413 1.00 16.23 ? 13  ALA E CB  1 
ATOM   1650 N N   . LYS B 2 13  ? -6.090  -14.398 74.329 1.00 18.08 ? 14  LYS E N   1 
ATOM   1651 C CA  . LYS B 2 13  ? -5.800  -14.273 75.750 1.00 19.94 ? 14  LYS E CA  1 
ATOM   1652 C C   . LYS B 2 13  ? -4.573  -15.134 76.029 1.00 19.07 ? 14  LYS E C   1 
ATOM   1653 O O   . LYS B 2 13  ? -4.437  -16.221 75.466 1.00 19.33 ? 14  LYS E O   1 
ATOM   1654 C CB  . LYS B 2 13  ? -6.990  -14.777 76.570 1.00 23.21 ? 14  LYS E CB  1 
ATOM   1655 C CG  . LYS B 2 13  ? -6.735  -14.860 78.064 1.00 28.21 ? 14  LYS E CG  1 
ATOM   1656 C CD  . LYS B 2 13  ? -7.956  -15.393 78.811 1.00 31.22 ? 14  LYS E CD  1 
ATOM   1657 C CE  . LYS B 2 13  ? -8.343  -16.788 78.341 1.00 34.26 ? 14  LYS E CE  1 
ATOM   1658 N NZ  . LYS B 2 13  ? -9.510  -17.333 79.098 1.00 37.29 ? 14  LYS E NZ  1 
ATOM   1659 N N   . ARG B 2 14  ? -3.676  -14.646 76.879 1.00 20.43 ? 15  ARG E N   1 
ATOM   1660 C CA  . ARG B 2 14  ? -2.477  -15.402 77.214 1.00 21.84 ? 15  ARG E CA  1 
ATOM   1661 C C   . ARG B 2 14  ? -2.868  -16.805 77.663 1.00 20.54 ? 15  ARG E C   1 
ATOM   1662 O O   . ARG B 2 14  ? -3.798  -16.971 78.453 1.00 19.20 ? 15  ARG E O   1 
ATOM   1663 C CB  . ARG B 2 14  ? -1.698  -14.716 78.341 1.00 24.35 ? 15  ARG E CB  1 
ATOM   1664 C CG  . ARG B 2 14  ? -0.480  -15.513 78.778 1.00 28.72 ? 15  ARG E CG  1 
ATOM   1665 C CD  . ARG B 2 14  ? 0.187   -14.943 80.019 1.00 34.64 ? 15  ARG E CD  1 
ATOM   1666 N NE  . ARG B 2 14  ? 1.361   -15.735 80.380 1.00 39.15 ? 15  ARG E NE  1 
ATOM   1667 C CZ  . ARG B 2 14  ? 2.163   -15.475 81.407 1.00 41.52 ? 15  ARG E CZ  1 
ATOM   1668 N NH1 . ARG B 2 14  ? 1.925   -14.433 82.194 1.00 42.38 ? 15  ARG E NH1 1 
ATOM   1669 N NH2 . ARG B 2 14  ? 3.207   -16.260 81.645 1.00 41.83 ? 15  ARG E NH2 1 
ATOM   1670 N N   . GLY B 2 15  ? -2.164  -17.806 77.146 1.00 20.04 ? 16  GLY E N   1 
ATOM   1671 C CA  . GLY B 2 15  ? -2.445  -19.182 77.519 1.00 21.39 ? 16  GLY E CA  1 
ATOM   1672 C C   . GLY B 2 15  ? -3.342  -19.950 76.567 1.00 21.77 ? 16  GLY E C   1 
ATOM   1673 O O   . GLY B 2 15  ? -3.439  -21.174 76.660 1.00 22.89 ? 16  GLY E O   1 
ATOM   1674 N N   . GLN B 2 16  ? -4.004  -19.250 75.650 1.00 21.85 ? 17  GLN E N   1 
ATOM   1675 C CA  . GLN B 2 16  ? -4.884  -19.922 74.702 1.00 21.59 ? 17  GLN E CA  1 
ATOM   1676 C C   . GLN B 2 16  ? -4.102  -20.307 73.451 1.00 20.92 ? 17  GLN E C   1 
ATOM   1677 O O   . GLN B 2 16  ? -3.049  -19.733 73.167 1.00 21.18 ? 17  GLN E O   1 
ATOM   1678 C CB  . GLN B 2 16  ? -6.062  -19.018 74.311 1.00 24.19 ? 17  GLN E CB  1 
ATOM   1679 C CG  . GLN B 2 16  ? -5.795  -18.107 73.116 1.00 27.69 ? 17  GLN E CG  1 
ATOM   1680 C CD  . GLN B 2 16  ? -7.061  -17.473 72.556 1.00 28.78 ? 17  GLN E CD  1 
ATOM   1681 O OE1 . GLN B 2 16  ? -7.664  -16.601 73.181 1.00 26.14 ? 17  GLN E OE1 1 
ATOM   1682 N NE2 . GLN B 2 16  ? -7.472  -17.919 71.370 1.00 30.46 ? 17  GLN E NE2 1 
ATOM   1683 N N   . ASP B 2 17  ? -4.620  -21.279 72.707 1.00 18.62 ? 18  ASP E N   1 
ATOM   1684 C CA  . ASP B 2 17  ? -3.964  -21.727 71.482 1.00 18.54 ? 18  ASP E CA  1 
ATOM   1685 C C   . ASP B 2 17  ? -4.543  -20.990 70.277 1.00 17.61 ? 18  ASP E C   1 
ATOM   1686 O O   . ASP B 2 17  ? -5.698  -20.571 70.298 1.00 18.40 ? 18  ASP E O   1 
ATOM   1687 C CB  . ASP B 2 17  ? -4.163  -23.233 71.280 1.00 19.96 ? 18  ASP E CB  1 
ATOM   1688 C CG  . ASP B 2 17  ? -3.666  -24.062 72.456 1.00 22.47 ? 18  ASP E CG  1 
ATOM   1689 O OD1 . ASP B 2 17  ? -2.847  -23.558 73.253 1.00 23.38 ? 18  ASP E OD1 1 
ATOM   1690 O OD2 . ASP B 2 17  ? -4.088  -25.235 72.570 1.00 24.42 ? 18  ASP E OD2 1 
ATOM   1691 N N   . VAL B 2 18  ? -3.730  -20.817 69.237 1.00 16.57 ? 19  VAL E N   1 
ATOM   1692 C CA  . VAL B 2 18  ? -4.189  -20.160 68.013 1.00 15.70 ? 19  VAL E CA  1 
ATOM   1693 C C   . VAL B 2 18  ? -3.639  -20.882 66.786 1.00 15.41 ? 19  VAL E C   1 
ATOM   1694 O O   . VAL B 2 18  ? -2.596  -21.536 66.855 1.00 16.10 ? 19  VAL E O   1 
ATOM   1695 C CB  . VAL B 2 18  ? -3.758  -18.670 67.935 1.00 16.96 ? 19  VAL E CB  1 
ATOM   1696 C CG1 . VAL B 2 18  ? -4.297  -17.907 69.136 1.00 18.02 ? 19  VAL E CG1 1 
ATOM   1697 C CG2 . VAL B 2 18  ? -2.247  -18.556 67.839 1.00 16.57 ? 19  VAL E CG2 1 
ATOM   1698 N N   . ALA B 2 19  ? -4.357  -20.762 65.672 1.00 14.52 ? 20  ALA E N   1 
ATOM   1699 C CA  . ALA B 2 19  ? -3.960  -21.388 64.416 1.00 14.25 ? 20  ALA E CA  1 
ATOM   1700 C C   . ALA B 2 19  ? -3.995  -20.352 63.295 1.00 13.87 ? 20  ALA E C   1 
ATOM   1701 O O   . ALA B 2 19  ? -5.013  -19.683 63.086 1.00 16.23 ? 20  ALA E O   1 
ATOM   1702 C CB  . ALA B 2 19  ? -4.899  -22.549 64.090 1.00 12.97 ? 20  ALA E CB  1 
ATOM   1703 N N   . LEU B 2 20  ? -2.878  -20.212 62.585 1.00 12.77 ? 21  LEU E N   1 
ATOM   1704 C CA  . LEU B 2 20  ? -2.779  -19.242 61.500 1.00 13.29 ? 21  LEU E CA  1 
ATOM   1705 C C   . LEU B 2 20  ? -2.678  -20.000 60.187 1.00 13.34 ? 21  LEU E C   1 
ATOM   1706 O O   . LEU B 2 20  ? -1.874  -20.916 60.054 1.00 14.09 ? 21  LEU E O   1 
ATOM   1707 C CB  . LEU B 2 20  ? -1.552  -18.352 61.709 1.00 14.16 ? 21  LEU E CB  1 
ATOM   1708 C CG  . LEU B 2 20  ? -1.450  -17.770 63.125 1.00 16.34 ? 21  LEU E CG  1 
ATOM   1709 C CD1 . LEU B 2 20  ? -0.307  -16.763 63.183 1.00 18.17 ? 21  LEU E CD1 1 
ATOM   1710 C CD2 . LEU B 2 20  ? -2.761  -17.095 63.511 1.00 18.06 ? 21  LEU E CD2 1 
ATOM   1711 N N   . ARG B 2 21  ? -3.499  -19.615 59.218 1.00 12.63 ? 22  ARG E N   1 
ATOM   1712 C CA  . ARG B 2 21  ? -3.518  -20.310 57.940 1.00 12.84 ? 22  ARG E CA  1 
ATOM   1713 C C   . ARG B 2 21  ? -2.898  -19.548 56.775 1.00 12.40 ? 22  ARG E C   1 
ATOM   1714 O O   . ARG B 2 21  ? -3.002  -18.324 56.683 1.00 12.61 ? 22  ARG E O   1 
ATOM   1715 C CB  . ARG B 2 21  ? -4.964  -20.693 57.602 1.00 15.98 ? 22  ARG E CB  1 
ATOM   1716 C CG  . ARG B 2 21  ? -5.136  -21.428 56.289 1.00 20.12 ? 22  ARG E CG  1 
ATOM   1717 C CD  . ARG B 2 21  ? -6.559  -21.936 56.120 1.00 25.66 ? 22  ARG E CD  1 
ATOM   1718 N NE  . ARG B 2 21  ? -6.773  -22.484 54.783 1.00 29.77 ? 22  ARG E NE  1 
ATOM   1719 C CZ  . ARG B 2 21  ? -7.854  -23.160 54.412 1.00 32.58 ? 22  ARG E CZ  1 
ATOM   1720 N NH1 . ARG B 2 21  ? -8.834  -23.380 55.279 1.00 35.04 ? 22  ARG E NH1 1 
ATOM   1721 N NH2 . ARG B 2 21  ? -7.954  -23.620 53.171 1.00 31.73 ? 22  ARG E NH2 1 
ATOM   1722 N N   . CYS B 2 22  ? -2.249  -20.298 55.891 1.00 12.90 ? 23  CYS E N   1 
ATOM   1723 C CA  . CYS B 2 22  ? -1.625  -19.747 54.693 1.00 14.03 ? 23  CYS E CA  1 
ATOM   1724 C C   . CYS B 2 22  ? -2.042  -20.549 53.465 1.00 13.74 ? 23  CYS E C   1 
ATOM   1725 O O   . CYS B 2 22  ? -1.890  -21.768 53.435 1.00 13.96 ? 23  CYS E O   1 
ATOM   1726 C CB  . CYS B 2 22  ? -0.109  -19.817 54.786 1.00 15.65 ? 23  CYS E CB  1 
ATOM   1727 S SG  . CYS B 2 22  ? 0.708   -19.137 53.302 1.00 18.70 ? 23  CYS E SG  1 
ATOM   1728 N N   . ASP B 2 23  ? -2.558  -19.855 52.455 1.00 14.28 ? 24  ASP E N   1 
ATOM   1729 C CA  . ASP B 2 23  ? -2.967  -20.491 51.206 1.00 15.23 ? 24  ASP E CA  1 
ATOM   1730 C C   . ASP B 2 23  ? -2.003  -19.928 50.158 1.00 14.85 ? 24  ASP E C   1 
ATOM   1731 O O   . ASP B 2 23  ? -2.239  -18.854 49.598 1.00 14.40 ? 24  ASP E O   1 
ATOM   1732 C CB  . ASP B 2 23  ? -4.407  -20.105 50.860 1.00 18.85 ? 24  ASP E CB  1 
ATOM   1733 C CG  . ASP B 2 23  ? -5.005  -20.985 49.777 1.00 25.04 ? 24  ASP E CG  1 
ATOM   1734 O OD1 . ASP B 2 23  ? -4.285  -21.310 48.811 1.00 27.46 ? 24  ASP E OD1 1 
ATOM   1735 O OD2 . ASP B 2 23  ? -6.198  -21.348 49.891 1.00 29.14 ? 24  ASP E OD2 1 
ATOM   1736 N N   . PRO B 2 24  ? -0.900  -20.644 49.887 1.00 14.15 ? 25  PRO E N   1 
ATOM   1737 C CA  . PRO B 2 24  ? 0.109   -20.208 48.915 1.00 13.76 ? 25  PRO E CA  1 
ATOM   1738 C C   . PRO B 2 24  ? -0.329  -20.260 47.460 1.00 14.65 ? 25  PRO E C   1 
ATOM   1739 O O   . PRO B 2 24  ? -1.399  -20.778 47.134 1.00 15.88 ? 25  PRO E O   1 
ATOM   1740 C CB  . PRO B 2 24  ? 1.266   -21.158 49.189 1.00 14.78 ? 25  PRO E CB  1 
ATOM   1741 C CG  . PRO B 2 24  ? 0.551   -22.429 49.483 1.00 13.43 ? 25  PRO E CG  1 
ATOM   1742 C CD  . PRO B 2 24  ? -0.575  -21.988 50.400 1.00 13.94 ? 25  PRO E CD  1 
ATOM   1743 N N   . ILE B 2 25  ? 0.514   -19.722 46.586 1.00 14.40 ? 26  ILE E N   1 
ATOM   1744 C CA  . ILE B 2 25  ? 0.211   -19.730 45.159 1.00 13.32 ? 26  ILE E CA  1 
ATOM   1745 C C   . ILE B 2 25  ? 0.271   -21.161 44.647 1.00 13.51 ? 26  ILE E C   1 
ATOM   1746 O O   . ILE B 2 25  ? 1.166   -21.924 45.004 1.00 14.57 ? 26  ILE E O   1 
ATOM   1747 C CB  . ILE B 2 25  ? 1.203   -18.838 44.385 1.00 12.53 ? 26  ILE E CB  1 
ATOM   1748 C CG1 . ILE B 2 25  ? 0.909   -17.371 44.709 1.00 13.59 ? 26  ILE E CG1 1 
ATOM   1749 C CG2 . ILE B 2 25  ? 1.104   -19.110 42.877 1.00 11.96 ? 26  ILE E CG2 1 
ATOM   1750 C CD1 . ILE B 2 25  ? 2.005   -16.419 44.316 1.00 14.59 ? 26  ILE E CD1 1 
ATOM   1751 N N   . SER B 2 26  ? -0.697  -21.525 43.814 1.00 14.37 ? 27  SER E N   1 
ATOM   1752 C CA  . SER B 2 26  ? -0.748  -22.874 43.269 1.00 16.41 ? 27  SER E CA  1 
ATOM   1753 C C   . SER B 2 26  ? 0.527   -23.247 42.526 1.00 15.61 ? 27  SER E C   1 
ATOM   1754 O O   . SER B 2 26  ? 1.052   -22.455 41.743 1.00 16.68 ? 27  SER E O   1 
ATOM   1755 C CB  . SER B 2 26  ? -1.943  -23.012 42.327 1.00 18.10 ? 27  SER E CB  1 
ATOM   1756 O OG  . SER B 2 26  ? -1.986  -24.313 41.767 1.00 24.02 ? 27  SER E OG  1 
ATOM   1757 N N   . GLY B 2 27  ? 1.027   -24.452 42.787 1.00 16.15 ? 28  GLY E N   1 
ATOM   1758 C CA  . GLY B 2 27  ? 2.227   -24.916 42.116 1.00 15.72 ? 28  GLY E CA  1 
ATOM   1759 C C   . GLY B 2 27  ? 3.539   -24.448 42.712 1.00 15.53 ? 28  GLY E C   1 
ATOM   1760 O O   . GLY B 2 27  ? 4.606   -24.832 42.236 1.00 18.00 ? 28  GLY E O   1 
ATOM   1761 N N   . HIS B 2 28  ? 3.480   -23.607 43.738 1.00 14.83 ? 29  HIS E N   1 
ATOM   1762 C CA  . HIS B 2 28  ? 4.709   -23.147 44.374 1.00 14.46 ? 29  HIS E CA  1 
ATOM   1763 C C   . HIS B 2 28  ? 5.191   -24.216 45.354 1.00 14.16 ? 29  HIS E C   1 
ATOM   1764 O O   . HIS B 2 28  ? 4.544   -24.484 46.365 1.00 14.38 ? 29  HIS E O   1 
ATOM   1765 C CB  . HIS B 2 28  ? 4.471   -21.817 45.096 1.00 13.62 ? 29  HIS E CB  1 
ATOM   1766 C CG  . HIS B 2 28  ? 4.652   -20.614 44.222 1.00 11.82 ? 29  HIS E CG  1 
ATOM   1767 N ND1 . HIS B 2 28  ? 4.599   -20.671 42.844 1.00 13.83 ? 29  HIS E ND1 1 
ATOM   1768 C CD2 . HIS B 2 28  ? 4.884   -19.318 44.535 1.00 9.66  ? 29  HIS E CD2 1 
ATOM   1769 C CE1 . HIS B 2 28  ? 4.794   -19.461 42.349 1.00 10.03 ? 29  HIS E CE1 1 
ATOM   1770 N NE2 . HIS B 2 28  ? 4.971   -18.622 43.353 1.00 14.91 ? 29  HIS E NE2 1 
ATOM   1771 N N   . VAL B 2 29  ? 6.335   -24.819 45.046 1.00 13.12 ? 30  VAL E N   1 
ATOM   1772 C CA  . VAL B 2 29  ? 6.905   -25.882 45.869 1.00 13.68 ? 30  VAL E CA  1 
ATOM   1773 C C   . VAL B 2 29  ? 7.403   -25.416 47.236 1.00 13.44 ? 30  VAL E C   1 
ATOM   1774 O O   . VAL B 2 29  ? 7.288   -26.143 48.227 1.00 12.65 ? 30  VAL E O   1 
ATOM   1775 C CB  . VAL B 2 29  ? 8.077   -26.571 45.132 1.00 14.61 ? 30  VAL E CB  1 
ATOM   1776 C CG1 . VAL B 2 29  ? 8.735   -27.600 46.035 1.00 15.67 ? 30  VAL E CG1 1 
ATOM   1777 C CG2 . VAL B 2 29  ? 7.572   -27.223 43.852 1.00 16.88 ? 30  VAL E CG2 1 
ATOM   1778 N N   . SER B 2 30  ? 7.949   -24.205 47.291 1.00 11.54 ? 31  SER E N   1 
ATOM   1779 C CA  . SER B 2 30  ? 8.485   -23.674 48.543 1.00 12.61 ? 31  SER E CA  1 
ATOM   1780 C C   . SER B 2 30  ? 7.527   -22.772 49.308 1.00 12.26 ? 31  SER E C   1 
ATOM   1781 O O   . SER B 2 30  ? 6.851   -21.932 48.715 1.00 13.01 ? 31  SER E O   1 
ATOM   1782 C CB  . SER B 2 30  ? 9.766   -22.875 48.275 1.00 13.79 ? 31  SER E CB  1 
ATOM   1783 O OG  . SER B 2 30  ? 10.787  -23.686 47.724 1.00 14.11 ? 31  SER E OG  1 
ATOM   1784 N N   . LEU B 2 31  ? 7.480   -22.949 50.627 1.00 11.80 ? 32  LEU E N   1 
ATOM   1785 C CA  . LEU B 2 31  ? 6.646   -22.113 51.483 1.00 10.64 ? 32  LEU E CA  1 
ATOM   1786 C C   . LEU B 2 31  ? 7.474   -21.728 52.702 1.00 11.71 ? 32  LEU E C   1 
ATOM   1787 O O   . LEU B 2 31  ? 8.130   -22.579 53.308 1.00 12.01 ? 32  LEU E O   1 
ATOM   1788 C CB  . LEU B 2 31  ? 5.373   -22.852 51.909 1.00 10.75 ? 32  LEU E CB  1 
ATOM   1789 C CG  . LEU B 2 31  ? 4.368   -22.004 52.702 1.00 10.67 ? 32  LEU E CG  1 
ATOM   1790 C CD1 . LEU B 2 31  ? 2.944   -22.456 52.388 1.00 11.71 ? 32  LEU E CD1 1 
ATOM   1791 C CD2 . LEU B 2 31  ? 4.662   -22.110 54.195 1.00 12.14 ? 32  LEU E CD2 1 
ATOM   1792 N N   . PHE B 2 32  ? 7.435   -20.447 53.053 1.00 10.64 ? 33  PHE E N   1 
ATOM   1793 C CA  . PHE B 2 32  ? 8.193   -19.923 54.187 1.00 10.83 ? 33  PHE E CA  1 
ATOM   1794 C C   . PHE B 2 32  ? 7.301   -19.203 55.190 1.00 11.68 ? 33  PHE E C   1 
ATOM   1795 O O   . PHE B 2 32  ? 6.354   -18.515 54.802 1.00 13.47 ? 33  PHE E O   1 
ATOM   1796 C CB  . PHE B 2 32  ? 9.245   -18.903 53.717 1.00 11.80 ? 33  PHE E CB  1 
ATOM   1797 C CG  . PHE B 2 32  ? 10.145  -19.388 52.611 1.00 12.13 ? 33  PHE E CG  1 
ATOM   1798 C CD1 . PHE B 2 32  ? 9.687   -19.464 51.299 1.00 13.36 ? 33  PHE E CD1 1 
ATOM   1799 C CD2 . PHE B 2 32  ? 11.467  -19.732 52.877 1.00 12.60 ? 33  PHE E CD2 1 
ATOM   1800 C CE1 . PHE B 2 32  ? 10.540  -19.874 50.263 1.00 15.68 ? 33  PHE E CE1 1 
ATOM   1801 C CE2 . PHE B 2 32  ? 12.323  -20.144 51.852 1.00 14.75 ? 33  PHE E CE2 1 
ATOM   1802 C CZ  . PHE B 2 32  ? 11.858  -20.213 50.545 1.00 14.77 ? 33  PHE E CZ  1 
ATOM   1803 N N   . TRP B 2 33  ? 7.604   -19.362 56.477 1.00 9.66  ? 34  TRP E N   1 
ATOM   1804 C CA  . TRP B 2 33  ? 6.882   -18.646 57.527 1.00 10.61 ? 34  TRP E CA  1 
ATOM   1805 C C   . TRP B 2 33  ? 7.885   -17.728 58.226 1.00 11.81 ? 34  TRP E C   1 
ATOM   1806 O O   . TRP B 2 33  ? 9.044   -18.113 58.431 1.00 12.00 ? 34  TRP E O   1 
ATOM   1807 C CB  . TRP B 2 33  ? 6.302   -19.585 58.584 1.00 11.41 ? 34  TRP E CB  1 
ATOM   1808 C CG  . TRP B 2 33  ? 4.987   -20.223 58.241 1.00 12.24 ? 34  TRP E CG  1 
ATOM   1809 C CD1 . TRP B 2 33  ? 4.792   -21.496 57.794 1.00 12.29 ? 34  TRP E CD1 1 
ATOM   1810 C CD2 . TRP B 2 33  ? 3.682   -19.637 58.372 1.00 11.95 ? 34  TRP E CD2 1 
ATOM   1811 N NE1 . TRP B 2 33  ? 3.449   -21.746 57.641 1.00 11.59 ? 34  TRP E NE1 1 
ATOM   1812 C CE2 . TRP B 2 33  ? 2.744   -20.624 57.986 1.00 11.12 ? 34  TRP E CE2 1 
ATOM   1813 C CE3 . TRP B 2 33  ? 3.214   -18.378 58.776 1.00 12.39 ? 34  TRP E CE3 1 
ATOM   1814 C CZ2 . TRP B 2 33  ? 1.359   -20.392 57.994 1.00 11.62 ? 34  TRP E CZ2 1 
ATOM   1815 C CZ3 . TRP B 2 33  ? 1.833   -18.144 58.783 1.00 14.41 ? 34  TRP E CZ3 1 
ATOM   1816 C CH2 . TRP B 2 33  ? 0.923   -19.151 58.394 1.00 12.52 ? 34  TRP E CH2 1 
ATOM   1817 N N   . TYR B 2 34  ? 7.428   -16.533 58.589 1.00 10.48 ? 35  TYR E N   1 
ATOM   1818 C CA  . TYR B 2 34  ? 8.255   -15.543 59.281 1.00 11.40 ? 35  TYR E CA  1 
ATOM   1819 C C   . TYR B 2 34  ? 7.454   -14.897 60.393 1.00 11.92 ? 35  TYR E C   1 
ATOM   1820 O O   . TYR B 2 34  ? 6.223   -14.850 60.332 1.00 9.46  ? 35  TYR E O   1 
ATOM   1821 C CB  . TYR B 2 34  ? 8.681   -14.405 58.350 1.00 12.12 ? 35  TYR E CB  1 
ATOM   1822 C CG  . TYR B 2 34  ? 9.431   -14.802 57.105 1.00 12.40 ? 35  TYR E CG  1 
ATOM   1823 C CD1 . TYR B 2 34  ? 8.756   -15.272 55.976 1.00 13.15 ? 35  TYR E CD1 1 
ATOM   1824 C CD2 . TYR B 2 34  ? 10.817  -14.652 57.033 1.00 13.06 ? 35  TYR E CD2 1 
ATOM   1825 C CE1 . TYR B 2 34  ? 9.448   -15.574 54.802 1.00 14.23 ? 35  TYR E CE1 1 
ATOM   1826 C CE2 . TYR B 2 34  ? 11.515  -14.954 55.868 1.00 12.76 ? 35  TYR E CE2 1 
ATOM   1827 C CZ  . TYR B 2 34  ? 10.825  -15.407 54.757 1.00 14.12 ? 35  TYR E CZ  1 
ATOM   1828 O OH  . TYR B 2 34  ? 11.514  -15.647 53.593 1.00 14.07 ? 35  TYR E OH  1 
ATOM   1829 N N   . GLN B 2 35  ? 8.166   -14.382 61.393 1.00 10.31 ? 36  GLN E N   1 
ATOM   1830 C CA  . GLN B 2 35  ? 7.566   -13.665 62.512 1.00 12.80 ? 36  GLN E CA  1 
ATOM   1831 C C   . GLN B 2 35  ? 8.168   -12.260 62.441 1.00 13.14 ? 36  GLN E C   1 
ATOM   1832 O O   . GLN B 2 35  ? 9.387   -12.117 62.402 1.00 14.08 ? 36  GLN E O   1 
ATOM   1833 C CB  . GLN B 2 35  ? 7.961   -14.324 63.837 1.00 12.42 ? 36  GLN E CB  1 
ATOM   1834 C CG  . GLN B 2 35  ? 7.419   -13.633 65.078 1.00 15.12 ? 36  GLN E CG  1 
ATOM   1835 C CD  . GLN B 2 35  ? 8.045   -14.184 66.346 1.00 17.85 ? 36  GLN E CD  1 
ATOM   1836 O OE1 . GLN B 2 35  ? 9.255   -14.080 66.537 1.00 19.48 ? 36  GLN E OE1 1 
ATOM   1837 N NE2 . GLN B 2 35  ? 7.229   -14.782 67.211 1.00 17.53 ? 36  GLN E NE2 1 
ATOM   1838 N N   . GLN B 2 36  ? 7.333   -11.223 62.403 1.00 12.51 ? 37  GLN E N   1 
ATOM   1839 C CA  . GLN B 2 36  ? 7.867   -9.867  62.340 1.00 13.27 ? 37  GLN E CA  1 
ATOM   1840 C C   . GLN B 2 36  ? 7.376   -9.021  63.507 1.00 15.01 ? 37  GLN E C   1 
ATOM   1841 O O   . GLN B 2 36  ? 6.203   -8.665  63.581 1.00 14.37 ? 37  GLN E O   1 
ATOM   1842 C CB  . GLN B 2 36  ? 7.493   -9.200  61.006 1.00 12.96 ? 37  GLN E CB  1 
ATOM   1843 C CG  . GLN B 2 36  ? 7.989   -7.764  60.873 1.00 12.87 ? 37  GLN E CG  1 
ATOM   1844 C CD  . GLN B 2 36  ? 7.899   -7.240  59.455 1.00 14.06 ? 37  GLN E CD  1 
ATOM   1845 O OE1 . GLN B 2 36  ? 6.935   -7.511  58.744 1.00 15.38 ? 37  GLN E OE1 1 
ATOM   1846 N NE2 . GLN B 2 36  ? 8.904   -6.470  59.041 1.00 14.97 ? 37  GLN E NE2 1 
ATOM   1847 N N   . ALA B 2 37  ? 8.282   -8.716  64.428 1.00 17.26 ? 38  ALA E N   1 
ATOM   1848 C CA  . ALA B 2 37  ? 7.930   -7.900  65.582 1.00 21.47 ? 38  ALA E CA  1 
ATOM   1849 C C   . ALA B 2 37  ? 7.958   -6.430  65.162 1.00 23.74 ? 38  ALA E C   1 
ATOM   1850 O O   . ALA B 2 37  ? 8.644   -6.063  64.203 1.00 24.24 ? 38  ALA E O   1 
ATOM   1851 C CB  . ALA B 2 37  ? 8.917   -8.149  66.722 1.00 21.64 ? 38  ALA E CB  1 
ATOM   1852 N N   . LEU B 2 38  ? 7.209   -5.594  65.875 1.00 26.49 ? 39  LEU E N   1 
ATOM   1853 C CA  . LEU B 2 38  ? 7.144   -4.167  65.564 1.00 28.88 ? 39  LEU E CA  1 
ATOM   1854 C C   . LEU B 2 38  ? 8.517   -3.530  65.388 1.00 28.85 ? 39  LEU E C   1 
ATOM   1855 O O   . LEU B 2 38  ? 9.406   -3.708  66.220 1.00 30.04 ? 39  LEU E O   1 
ATOM   1856 C CB  . LEU B 2 38  ? 6.377   -3.417  66.661 1.00 31.36 ? 39  LEU E CB  1 
ATOM   1857 C CG  . LEU B 2 38  ? 4.855   -3.573  66.693 1.00 33.89 ? 39  LEU E CG  1 
ATOM   1858 C CD1 . LEU B 2 38  ? 4.287   -2.848  67.907 1.00 35.77 ? 39  LEU E CD1 1 
ATOM   1859 C CD2 . LEU B 2 38  ? 4.262   -3.013  65.411 1.00 34.64 ? 39  LEU E CD2 1 
ATOM   1860 N N   . GLY B 2 39  ? 8.675   -2.789  64.293 1.00 29.21 ? 40  GLY E N   1 
ATOM   1861 C CA  . GLY B 2 39  ? 9.926   -2.108  64.008 1.00 28.75 ? 40  GLY E CA  1 
ATOM   1862 C C   . GLY B 2 39  ? 11.108  -2.999  63.685 1.00 28.39 ? 40  GLY E C   1 
ATOM   1863 O O   . GLY B 2 39  ? 12.241  -2.522  63.605 1.00 28.83 ? 40  GLY E O   1 
ATOM   1864 N N   . GLN B 2 40  ? 10.851  -4.290  63.497 1.00 26.37 ? 41  GLN E N   1 
ATOM   1865 C CA  . GLN B 2 40  ? 11.902  -5.253  63.188 1.00 24.65 ? 41  GLN E CA  1 
ATOM   1866 C C   . GLN B 2 40  ? 11.655  -5.860  61.812 1.00 22.17 ? 41  GLN E C   1 
ATOM   1867 O O   . GLN B 2 40  ? 10.549  -5.778  61.284 1.00 21.97 ? 41  GLN E O   1 
ATOM   1868 C CB  . GLN B 2 40  ? 11.896  -6.382  64.221 1.00 27.08 ? 41  GLN E CB  1 
ATOM   1869 C CG  . GLN B 2 40  ? 12.003  -5.934  65.665 1.00 32.54 ? 41  GLN E CG  1 
ATOM   1870 C CD  . GLN B 2 40  ? 13.423  -5.623  66.068 1.00 35.36 ? 41  GLN E CD  1 
ATOM   1871 O OE1 . GLN B 2 40  ? 14.036  -4.686  65.559 1.00 38.19 ? 41  GLN E OE1 1 
ATOM   1872 N NE2 . GLN B 2 40  ? 13.962  -6.417  66.989 1.00 37.65 ? 41  GLN E NE2 1 
ATOM   1873 N N   . GLY B 2 41  ? 12.689  -6.462  61.234 1.00 19.65 ? 42  GLY E N   1 
ATOM   1874 C CA  . GLY B 2 41  ? 12.527  -7.104  59.942 1.00 18.13 ? 42  GLY E CA  1 
ATOM   1875 C C   . GLY B 2 41  ? 11.947  -8.494  60.157 1.00 16.84 ? 42  GLY E C   1 
ATOM   1876 O O   . GLY B 2 41  ? 11.916  -8.978  61.291 1.00 16.26 ? 42  GLY E O   1 
ATOM   1877 N N   . PRO B 2 42  ? 11.464  -9.161  59.100 1.00 15.58 ? 43  PRO E N   1 
ATOM   1878 C CA  . PRO B 2 42  ? 10.893  -10.507 59.244 1.00 15.85 ? 43  PRO E CA  1 
ATOM   1879 C C   . PRO B 2 42  ? 11.947  -11.509 59.709 1.00 16.63 ? 43  PRO E C   1 
ATOM   1880 O O   . PRO B 2 42  ? 13.060  -11.516 59.191 1.00 18.20 ? 43  PRO E O   1 
ATOM   1881 C CB  . PRO B 2 42  ? 10.407  -10.832 57.832 1.00 15.31 ? 43  PRO E CB  1 
ATOM   1882 C CG  . PRO B 2 42  ? 10.151  -9.484  57.227 1.00 15.48 ? 43  PRO E CG  1 
ATOM   1883 C CD  . PRO B 2 42  ? 11.318  -8.674  57.720 1.00 15.62 ? 43  PRO E CD  1 
ATOM   1884 N N   . GLU B 2 43  ? 11.603  -12.341 60.688 1.00 14.34 ? 44  GLU E N   1 
ATOM   1885 C CA  . GLU B 2 43  ? 12.530  -13.355 61.186 1.00 14.87 ? 44  GLU E CA  1 
ATOM   1886 C C   . GLU B 2 43  ? 12.033  -14.722 60.726 1.00 13.32 ? 44  GLU E C   1 
ATOM   1887 O O   . GLU B 2 43  ? 10.875  -15.076 60.945 1.00 14.46 ? 44  GLU E O   1 
ATOM   1888 C CB  . GLU B 2 43  ? 12.601  -13.322 62.718 1.00 18.14 ? 44  GLU E CB  1 
ATOM   1889 C CG  . GLU B 2 43  ? 13.747  -14.143 63.300 1.00 25.40 ? 44  GLU E CG  1 
ATOM   1890 C CD  . GLU B 2 43  ? 13.770  -14.140 64.821 1.00 30.55 ? 44  GLU E CD  1 
ATOM   1891 O OE1 . GLU B 2 43  ? 13.595  -13.061 65.424 1.00 33.15 ? 44  GLU E OE1 1 
ATOM   1892 O OE2 . GLU B 2 43  ? 13.977  -15.219 65.416 1.00 34.58 ? 44  GLU E OE2 1 
ATOM   1893 N N   . PHE B 2 44  ? 12.918  -15.487 60.094 1.00 12.07 ? 45  PHE E N   1 
ATOM   1894 C CA  . PHE B 2 44  ? 12.584  -16.813 59.581 1.00 12.93 ? 45  PHE E CA  1 
ATOM   1895 C C   . PHE B 2 44  ? 12.140  -17.769 60.685 1.00 13.88 ? 45  PHE E C   1 
ATOM   1896 O O   . PHE B 2 44  ? 12.765  -17.834 61.745 1.00 13.96 ? 45  PHE E O   1 
ATOM   1897 C CB  . PHE B 2 44  ? 13.801  -17.413 58.874 1.00 12.82 ? 45  PHE E CB  1 
ATOM   1898 C CG  . PHE B 2 44  ? 13.620  -18.847 58.458 1.00 12.01 ? 45  PHE E CG  1 
ATOM   1899 C CD1 . PHE B 2 44  ? 13.016  -19.165 57.247 1.00 12.82 ? 45  PHE E CD1 1 
ATOM   1900 C CD2 . PHE B 2 44  ? 14.061  -19.879 59.279 1.00 12.90 ? 45  PHE E CD2 1 
ATOM   1901 C CE1 . PHE B 2 44  ? 12.855  -20.495 56.854 1.00 13.64 ? 45  PHE E CE1 1 
ATOM   1902 C CE2 . PHE B 2 44  ? 13.906  -21.214 58.899 1.00 12.42 ? 45  PHE E CE2 1 
ATOM   1903 C CZ  . PHE B 2 44  ? 13.301  -21.524 57.681 1.00 14.04 ? 45  PHE E CZ  1 
ATOM   1904 N N   . LEU B 2 45  ? 11.066  -18.510 60.421 1.00 13.98 ? 46  LEU E N   1 
ATOM   1905 C CA  . LEU B 2 45  ? 10.549  -19.497 61.364 1.00 13.88 ? 46  LEU E CA  1 
ATOM   1906 C C   . LEU B 2 45  ? 10.754  -20.909 60.826 1.00 14.18 ? 46  LEU E C   1 
ATOM   1907 O O   . LEU B 2 45  ? 11.458  -21.725 61.429 1.00 14.32 ? 46  LEU E O   1 
ATOM   1908 C CB  . LEU B 2 45  ? 9.059   -19.271 61.617 1.00 14.39 ? 46  LEU E CB  1 
ATOM   1909 C CG  . LEU B 2 45  ? 8.658   -18.022 62.399 1.00 13.84 ? 46  LEU E CG  1 
ATOM   1910 C CD1 . LEU B 2 45  ? 7.147   -17.884 62.384 1.00 15.12 ? 46  LEU E CD1 1 
ATOM   1911 C CD2 . LEU B 2 45  ? 9.181   -18.114 63.833 1.00 14.31 ? 46  LEU E CD2 1 
ATOM   1912 N N   . THR B 2 46  ? 10.152  -21.200 59.675 1.00 13.48 ? 47  THR E N   1 
ATOM   1913 C CA  . THR B 2 46  ? 10.273  -22.534 59.117 1.00 13.15 ? 47  THR E CA  1 
ATOM   1914 C C   . THR B 2 46  ? 10.075  -22.562 57.605 1.00 13.23 ? 47  THR E C   1 
ATOM   1915 O O   . THR B 2 46  ? 9.540   -21.617 57.016 1.00 13.38 ? 47  THR E O   1 
ATOM   1916 C CB  . THR B 2 46  ? 9.268   -23.493 59.817 1.00 14.00 ? 47  THR E CB  1 
ATOM   1917 O OG1 . THR B 2 46  ? 9.578   -24.846 59.475 1.00 14.05 ? 47  THR E OG1 1 
ATOM   1918 C CG2 . THR B 2 46  ? 7.839   -23.180 59.398 1.00 14.82 ? 47  THR E CG2 1 
ATOM   1919 N N   . TYR B 2 47  ? 10.523  -23.652 56.989 1.00 13.09 ? 48  TYR E N   1 
ATOM   1920 C CA  . TYR B 2 47  ? 10.438  -23.836 55.547 1.00 14.11 ? 48  TYR E CA  1 
ATOM   1921 C C   . TYR B 2 47  ? 9.895   -25.204 55.137 1.00 13.73 ? 48  TYR E C   1 
ATOM   1922 O O   . TYR B 2 47  ? 10.214  -26.224 55.750 1.00 13.49 ? 48  TYR E O   1 
ATOM   1923 C CB  . TYR B 2 47  ? 11.825  -23.656 54.929 1.00 13.31 ? 48  TYR E CB  1 
ATOM   1924 C CG  . TYR B 2 47  ? 11.920  -24.122 53.496 1.00 13.19 ? 48  TYR E CG  1 
ATOM   1925 C CD1 . TYR B 2 47  ? 11.351  -23.377 52.464 1.00 13.56 ? 48  TYR E CD1 1 
ATOM   1926 C CD2 . TYR B 2 47  ? 12.551  -25.325 53.172 1.00 14.46 ? 48  TYR E CD2 1 
ATOM   1927 C CE1 . TYR B 2 47  ? 11.403  -23.815 51.142 1.00 13.74 ? 48  TYR E CE1 1 
ATOM   1928 C CE2 . TYR B 2 47  ? 12.607  -25.774 51.851 1.00 13.53 ? 48  TYR E CE2 1 
ATOM   1929 C CZ  . TYR B 2 47  ? 12.028  -25.014 50.846 1.00 14.18 ? 48  TYR E CZ  1 
ATOM   1930 O OH  . TYR B 2 47  ? 12.057  -25.457 49.545 1.00 16.61 ? 48  TYR E OH  1 
ATOM   1931 N N   . PHE B 2 48  ? 9.091   -25.208 54.076 1.00 12.96 ? 49  PHE E N   1 
ATOM   1932 C CA  . PHE B 2 48  ? 8.513   -26.431 53.522 1.00 13.59 ? 49  PHE E CA  1 
ATOM   1933 C C   . PHE B 2 48  ? 8.838   -26.574 52.038 1.00 12.82 ? 49  PHE E C   1 
ATOM   1934 O O   . PHE B 2 48  ? 8.780   -25.600 51.282 1.00 12.48 ? 49  PHE E O   1 
ATOM   1935 C CB  . PHE B 2 48  ? 6.981   -26.441 53.613 1.00 13.27 ? 49  PHE E CB  1 
ATOM   1936 C CG  . PHE B 2 48  ? 6.436   -26.587 54.998 1.00 13.83 ? 49  PHE E CG  1 
ATOM   1937 C CD1 . PHE B 2 48  ? 6.155   -25.467 55.773 1.00 12.44 ? 49  PHE E CD1 1 
ATOM   1938 C CD2 . PHE B 2 48  ? 6.160   -27.850 55.518 1.00 13.41 ? 49  PHE E CD2 1 
ATOM   1939 C CE1 . PHE B 2 48  ? 5.603   -25.594 57.045 1.00 14.03 ? 49  PHE E CE1 1 
ATOM   1940 C CE2 . PHE B 2 48  ? 5.609   -27.990 56.785 1.00 12.52 ? 49  PHE E CE2 1 
ATOM   1941 C CZ  . PHE B 2 48  ? 5.329   -26.860 57.554 1.00 14.02 ? 49  PHE E CZ  1 
ATOM   1942 N N   . GLN B 2 49  ? 9.177   -27.794 51.639 1.00 13.31 ? 50  GLN E N   1 
ATOM   1943 C CA  . GLN B 2 49  ? 9.422   -28.136 50.238 1.00 14.82 ? 50  GLN E CA  1 
ATOM   1944 C C   . GLN B 2 49  ? 8.286   -29.135 50.073 1.00 14.23 ? 50  GLN E C   1 
ATOM   1945 O O   . GLN B 2 49  ? 8.379   -30.261 50.564 1.00 15.91 ? 50  GLN E O   1 
ATOM   1946 C CB  . GLN B 2 49  ? 10.762  -28.843 50.059 1.00 16.58 ? 50  GLN E CB  1 
ATOM   1947 C CG  . GLN B 2 49  ? 11.088  -29.139 48.606 1.00 20.65 ? 50  GLN E CG  1 
ATOM   1948 C CD  . GLN B 2 49  ? 12.224  -30.126 48.460 1.00 21.60 ? 50  GLN E CD  1 
ATOM   1949 O OE1 . GLN B 2 49  ? 12.053  -31.324 48.686 1.00 25.91 ? 50  GLN E OE1 1 
ATOM   1950 N NE2 . GLN B 2 49  ? 13.393  -29.627 48.092 1.00 23.83 ? 50  GLN E NE2 1 
ATOM   1951 N N   . ASN B 2 50  ? 7.212   -28.723 49.409 1.00 15.66 ? 51  ASN E N   1 
ATOM   1952 C CA  . ASN B 2 50  ? 6.043   -29.581 49.279 1.00 14.90 ? 51  ASN E CA  1 
ATOM   1953 C C   . ASN B 2 50  ? 5.588   -29.816 50.724 1.00 15.53 ? 51  ASN E C   1 
ATOM   1954 O O   . ASN B 2 50  ? 5.487   -28.856 51.489 1.00 14.29 ? 51  ASN E O   1 
ATOM   1955 C CB  . ASN B 2 50  ? 6.403   -30.891 48.575 1.00 15.79 ? 51  ASN E CB  1 
ATOM   1956 C CG  . ASN B 2 50  ? 6.735   -30.682 47.107 1.00 16.96 ? 51  ASN E CG  1 
ATOM   1957 O OD1 . ASN B 2 50  ? 7.694   -31.251 46.589 1.00 19.71 ? 51  ASN E OD1 1 
ATOM   1958 N ND2 . ASN B 2 50  ? 5.937   -29.865 46.430 1.00 15.97 ? 51  ASN E ND2 1 
ATOM   1959 N N   . GLU B 2 51  ? 5.341   -31.061 51.121 1.00 14.64 ? 52  GLU E N   1 
ATOM   1960 C CA  . GLU B 2 51  ? 4.880   -31.312 52.485 1.00 15.37 ? 52  GLU E CA  1 
ATOM   1961 C C   . GLU B 2 51  ? 6.000   -31.442 53.520 1.00 15.21 ? 52  GLU E C   1 
ATOM   1962 O O   . GLU B 2 51  ? 5.738   -31.438 54.726 1.00 16.55 ? 52  GLU E O   1 
ATOM   1963 C CB  . GLU B 2 51  ? 4.018   -32.585 52.534 1.00 16.69 ? 52  GLU E CB  1 
ATOM   1964 C CG  . GLU B 2 51  ? 4.802   -33.888 52.697 1.00 19.82 ? 52  GLU E CG  1 
ATOM   1965 C CD  . GLU B 2 51  ? 5.564   -34.310 51.451 1.00 21.84 ? 52  GLU E CD  1 
ATOM   1966 O OE1 . GLU B 2 51  ? 6.339   -35.287 51.546 1.00 25.91 ? 52  GLU E OE1 1 
ATOM   1967 O OE2 . GLU B 2 51  ? 5.392   -33.685 50.382 1.00 22.77 ? 52  GLU E OE2 1 
ATOM   1968 N N   . ALA B 2 52  ? 7.241   -31.546 53.049 1.00 15.56 ? 53  ALA E N   1 
ATOM   1969 C CA  . ALA B 2 52  ? 8.392   -31.734 53.934 1.00 14.07 ? 53  ALA E CA  1 
ATOM   1970 C C   . ALA B 2 52  ? 8.938   -30.461 54.565 1.00 14.19 ? 53  ALA E C   1 
ATOM   1971 O O   . ALA B 2 52  ? 9.357   -29.539 53.872 1.00 13.77 ? 53  ALA E O   1 
ATOM   1972 C CB  . ALA B 2 52  ? 9.506   -32.452 53.176 1.00 14.36 ? 53  ALA E CB  1 
ATOM   1973 N N   . GLN B 2 53  ? 8.943   -30.428 55.894 1.00 13.36 ? 54  GLN E N   1 
ATOM   1974 C CA  . GLN B 2 53  ? 9.438   -29.271 56.630 1.00 14.14 ? 54  GLN E CA  1 
ATOM   1975 C C   . GLN B 2 53  ? 10.943  -29.468 56.810 1.00 15.30 ? 54  GLN E C   1 
ATOM   1976 O O   . GLN B 2 53  ? 11.403  -29.903 57.871 1.00 17.55 ? 54  GLN E O   1 
ATOM   1977 C CB  . GLN B 2 53  ? 8.739   -29.201 57.986 1.00 14.59 ? 54  GLN E CB  1 
ATOM   1978 C CG  . GLN B 2 53  ? 8.663   -27.816 58.580 1.00 14.84 ? 54  GLN E CG  1 
ATOM   1979 C CD  . GLN B 2 53  ? 7.790   -27.771 59.814 1.00 15.22 ? 54  GLN E CD  1 
ATOM   1980 O OE1 . GLN B 2 53  ? 6.945   -28.649 60.029 1.00 17.54 ? 54  GLN E OE1 1 
ATOM   1981 N NE2 . GLN B 2 53  ? 7.974   -26.746 60.628 1.00 11.10 ? 54  GLN E NE2 1 
ATOM   1982 N N   . LEU B 2 54  ? 11.703  -29.130 55.772 1.00 16.03 ? 55  LEU E N   1 
ATOM   1983 C CA  . LEU B 2 54  ? 13.151  -29.318 55.775 1.00 16.60 ? 55  LEU E CA  1 
ATOM   1984 C C   . LEU B 2 54  ? 13.986  -28.448 56.708 1.00 18.11 ? 55  LEU E C   1 
ATOM   1985 O O   . LEU B 2 54  ? 15.073  -28.855 57.117 1.00 20.05 ? 55  LEU E O   1 
ATOM   1986 C CB  . LEU B 2 54  ? 13.692  -29.191 54.350 1.00 17.10 ? 55  LEU E CB  1 
ATOM   1987 C CG  . LEU B 2 54  ? 13.067  -30.158 53.337 1.00 18.72 ? 55  LEU E CG  1 
ATOM   1988 C CD1 . LEU B 2 54  ? 13.823  -30.067 52.017 1.00 20.06 ? 55  LEU E CD1 1 
ATOM   1989 C CD2 . LEU B 2 54  ? 13.119  -31.582 53.875 1.00 21.48 ? 55  LEU E CD2 1 
ATOM   1990 N N   . ASP B 2 55  ? 13.496  -27.260 57.046 1.00 17.93 ? 56  ASP E N   1 
ATOM   1991 C CA  . ASP B 2 55  ? 14.236  -26.379 57.941 1.00 18.48 ? 56  ASP E CA  1 
ATOM   1992 C C   . ASP B 2 55  ? 13.298  -25.663 58.894 1.00 18.63 ? 56  ASP E C   1 
ATOM   1993 O O   . ASP B 2 55  ? 12.560  -24.772 58.486 1.00 19.60 ? 56  ASP E O   1 
ATOM   1994 C CB  . ASP B 2 55  ? 15.030  -25.342 57.137 1.00 18.49 ? 56  ASP E CB  1 
ATOM   1995 C CG  . ASP B 2 55  ? 15.890  -24.446 58.018 1.00 20.07 ? 56  ASP E CG  1 
ATOM   1996 O OD1 . ASP B 2 55  ? 15.769  -24.515 59.259 1.00 20.79 ? 56  ASP E OD1 1 
ATOM   1997 O OD2 . ASP B 2 55  ? 16.684  -23.658 57.461 1.00 20.39 ? 56  ASP E OD2 1 
ATOM   1998 N N   . LYS B 2 56  ? 13.321  -26.059 60.163 1.00 19.08 ? 57  LYS E N   1 
ATOM   1999 C CA  . LYS B 2 56  ? 12.470  -25.418 61.158 1.00 19.96 ? 57  LYS E CA  1 
ATOM   2000 C C   . LYS B 2 56  ? 13.313  -24.812 62.270 1.00 19.60 ? 57  LYS E C   1 
ATOM   2001 O O   . LYS B 2 56  ? 12.865  -24.680 63.407 1.00 20.24 ? 57  LYS E O   1 
ATOM   2002 C CB  . LYS B 2 56  ? 11.465  -26.424 61.733 1.00 24.71 ? 57  LYS E CB  1 
ATOM   2003 C CG  . LYS B 2 56  ? 12.074  -27.702 62.266 1.00 26.65 ? 57  LYS E CG  1 
ATOM   2004 C CD  . LYS B 2 56  ? 10.985  -28.676 62.696 1.00 30.44 ? 57  LYS E CD  1 
ATOM   2005 C CE  . LYS B 2 56  ? 11.571  -30.013 63.116 1.00 32.47 ? 57  LYS E CE  1 
ATOM   2006 N NZ  . LYS B 2 56  ? 12.333  -30.641 62.001 1.00 34.62 ? 57  LYS E NZ  1 
ATOM   2007 N N   . SER B 2 57  ? 14.530  -24.412 61.917 1.00 20.26 ? 58  SER E N   1 
ATOM   2008 C CA  . SER B 2 57  ? 15.462  -23.831 62.876 1.00 20.99 ? 58  SER E CA  1 
ATOM   2009 C C   . SER B 2 57  ? 15.043  -22.490 63.473 1.00 20.09 ? 58  SER E C   1 
ATOM   2010 O O   . SER B 2 57  ? 15.651  -22.026 64.435 1.00 21.16 ? 58  SER E O   1 
ATOM   2011 C CB  . SER B 2 57  ? 16.847  -23.692 62.234 1.00 20.58 ? 58  SER E CB  1 
ATOM   2012 O OG  . SER B 2 57  ? 16.812  -22.847 61.099 1.00 22.40 ? 58  SER E OG  1 
ATOM   2013 N N   . GLY B 2 58  ? 14.011  -21.868 62.911 1.00 19.35 ? 59  GLY E N   1 
ATOM   2014 C CA  . GLY B 2 58  ? 13.560  -20.586 63.420 1.00 17.60 ? 59  GLY E CA  1 
ATOM   2015 C C   . GLY B 2 58  ? 12.435  -20.642 64.441 1.00 16.94 ? 59  GLY E C   1 
ATOM   2016 O O   . GLY B 2 58  ? 12.100  -19.624 65.041 1.00 17.65 ? 59  GLY E O   1 
ATOM   2017 N N   . LEU B 2 59  ? 11.839  -21.812 64.650 1.00 18.80 ? 60  LEU E N   1 
ATOM   2018 C CA  . LEU B 2 59  ? 10.753  -21.911 65.622 1.00 20.64 ? 60  LEU E CA  1 
ATOM   2019 C C   . LEU B 2 59  ? 11.307  -21.613 67.014 1.00 22.16 ? 60  LEU E C   1 
ATOM   2020 O O   . LEU B 2 59  ? 12.211  -22.299 67.488 1.00 23.18 ? 60  LEU E O   1 
ATOM   2021 C CB  . LEU B 2 59  ? 10.120  -23.304 65.577 1.00 20.93 ? 60  LEU E CB  1 
ATOM   2022 C CG  . LEU B 2 59  ? 9.467   -23.674 64.239 1.00 19.74 ? 60  LEU E CG  1 
ATOM   2023 C CD1 . LEU B 2 59  ? 8.864   -25.065 64.337 1.00 23.92 ? 60  LEU E CD1 1 
ATOM   2024 C CD2 . LEU B 2 59  ? 8.387   -22.656 63.886 1.00 20.88 ? 60  LEU E CD2 1 
ATOM   2025 N N   . PRO B 2 60  ? 10.764  -20.579 67.685 1.00 22.84 ? 61  PRO E N   1 
ATOM   2026 C CA  . PRO B 2 60  ? 11.174  -20.140 69.025 1.00 24.55 ? 61  PRO E CA  1 
ATOM   2027 C C   . PRO B 2 60  ? 11.198  -21.218 70.103 1.00 25.99 ? 61  PRO E C   1 
ATOM   2028 O O   . PRO B 2 60  ? 12.165  -21.331 70.858 1.00 27.88 ? 61  PRO E O   1 
ATOM   2029 C CB  . PRO B 2 60  ? 10.170  -19.035 69.347 1.00 24.23 ? 61  PRO E CB  1 
ATOM   2030 C CG  . PRO B 2 60  ? 9.837   -18.477 68.006 1.00 24.97 ? 61  PRO E CG  1 
ATOM   2031 C CD  . PRO B 2 60  ? 9.666   -19.733 67.185 1.00 22.48 ? 61  PRO E CD  1 
ATOM   2032 N N   . SER B 2 61  ? 10.128  -21.998 70.185 1.00 26.91 ? 62  SER E N   1 
ATOM   2033 C CA  . SER B 2 61  ? 10.041  -23.054 71.185 1.00 27.24 ? 62  SER E CA  1 
ATOM   2034 C C   . SER B 2 61  ? 9.076   -24.130 70.720 1.00 27.78 ? 62  SER E C   1 
ATOM   2035 O O   . SER B 2 61  ? 8.516   -24.043 69.627 1.00 26.70 ? 62  SER E O   1 
ATOM   2036 C CB  . SER B 2 61  ? 9.557   -22.481 72.519 1.00 28.05 ? 62  SER E CB  1 
ATOM   2037 O OG  . SER B 2 61  ? 8.227   -22.003 72.410 1.00 29.04 ? 62  SER E OG  1 
ATOM   2038 N N   . ASP B 2 62  ? 8.875   -25.137 71.563 1.00 27.74 ? 63  ASP E N   1 
ATOM   2039 C CA  . ASP B 2 62  ? 7.979   -26.238 71.242 1.00 26.99 ? 63  ASP E CA  1 
ATOM   2040 C C   . ASP B 2 62  ? 6.519   -25.795 71.180 1.00 23.29 ? 63  ASP E C   1 
ATOM   2041 O O   . ASP B 2 62  ? 5.657   -26.565 70.759 1.00 23.03 ? 63  ASP E O   1 
ATOM   2042 C CB  . ASP B 2 62  ? 8.125   -27.355 72.276 1.00 31.58 ? 63  ASP E CB  1 
ATOM   2043 C CG  . ASP B 2 62  ? 7.527   -26.986 73.616 1.00 36.24 ? 63  ASP E CG  1 
ATOM   2044 O OD1 . ASP B 2 62  ? 7.955   -25.969 74.202 1.00 39.65 ? 63  ASP E OD1 1 
ATOM   2045 O OD2 . ASP B 2 62  ? 6.625   -27.714 74.081 1.00 41.17 ? 63  ASP E OD2 1 
ATOM   2046 N N   . ARG B 2 63  ? 6.238   -24.568 71.612 1.00 19.75 ? 64  ARG E N   1 
ATOM   2047 C CA  . ARG B 2 63  ? 4.869   -24.056 71.565 1.00 16.78 ? 64  ARG E CA  1 
ATOM   2048 C C   . ARG B 2 63  ? 4.468   -23.788 70.116 1.00 16.81 ? 64  ARG E C   1 
ATOM   2049 O O   . ARG B 2 63  ? 3.280   -23.683 69.803 1.00 16.48 ? 64  ARG E O   1 
ATOM   2050 C CB  . ARG B 2 63  ? 4.733   -22.766 72.386 1.00 15.51 ? 64  ARG E CB  1 
ATOM   2051 C CG  . ARG B 2 63  ? 4.817   -22.990 73.896 1.00 14.69 ? 64  ARG E CG  1 
ATOM   2052 C CD  . ARG B 2 63  ? 4.462   -21.746 74.696 1.00 16.18 ? 64  ARG E CD  1 
ATOM   2053 N NE  . ARG B 2 63  ? 5.335   -20.615 74.392 1.00 18.10 ? 64  ARG E NE  1 
ATOM   2054 C CZ  . ARG B 2 63  ? 5.007   -19.611 73.585 1.00 17.77 ? 64  ARG E CZ  1 
ATOM   2055 N NH1 . ARG B 2 63  ? 3.817   -19.588 72.998 1.00 17.07 ? 64  ARG E NH1 1 
ATOM   2056 N NH2 . ARG B 2 63  ? 5.871   -18.630 73.360 1.00 18.89 ? 64  ARG E NH2 1 
ATOM   2057 N N   . PHE B 2 64  ? 5.469   -23.687 69.242 1.00 16.08 ? 65  PHE E N   1 
ATOM   2058 C CA  . PHE B 2 64  ? 5.239   -23.437 67.818 1.00 17.01 ? 65  PHE E CA  1 
ATOM   2059 C C   . PHE B 2 64  ? 5.337   -24.721 67.000 1.00 17.35 ? 65  PHE E C   1 
ATOM   2060 O O   . PHE B 2 64  ? 6.310   -25.471 67.109 1.00 18.08 ? 65  PHE E O   1 
ATOM   2061 C CB  . PHE B 2 64  ? 6.255   -22.421 67.273 1.00 18.25 ? 65  PHE E CB  1 
ATOM   2062 C CG  . PHE B 2 64  ? 6.026   -21.014 67.746 1.00 18.75 ? 65  PHE E CG  1 
ATOM   2063 C CD1 . PHE B 2 64  ? 6.199   -20.672 69.084 1.00 20.11 ? 65  PHE E CD1 1 
ATOM   2064 C CD2 . PHE B 2 64  ? 5.633   -20.025 66.848 1.00 19.97 ? 65  PHE E CD2 1 
ATOM   2065 C CE1 . PHE B 2 64  ? 5.984   -19.365 69.519 1.00 19.06 ? 65  PHE E CE1 1 
ATOM   2066 C CE2 . PHE B 2 64  ? 5.416   -18.720 67.273 1.00 19.83 ? 65  PHE E CE2 1 
ATOM   2067 C CZ  . PHE B 2 64  ? 5.592   -18.388 68.611 1.00 22.00 ? 65  PHE E CZ  1 
ATOM   2068 N N   . PHE B 2 65  ? 4.326   -24.966 66.173 1.00 16.04 ? 66  PHE E N   1 
ATOM   2069 C CA  . PHE B 2 65  ? 4.291   -26.156 65.328 1.00 17.43 ? 66  PHE E CA  1 
ATOM   2070 C C   . PHE B 2 65  ? 3.669   -25.784 63.982 1.00 15.45 ? 66  PHE E C   1 
ATOM   2071 O O   . PHE B 2 65  ? 2.711   -25.024 63.936 1.00 16.43 ? 66  PHE E O   1 
ATOM   2072 C CB  . PHE B 2 65  ? 3.446   -27.247 65.996 1.00 19.51 ? 66  PHE E CB  1 
ATOM   2073 C CG  . PHE B 2 65  ? 3.142   -28.412 65.098 1.00 23.03 ? 66  PHE E CG  1 
ATOM   2074 C CD1 . PHE B 2 65  ? 4.078   -29.422 64.902 1.00 24.83 ? 66  PHE E CD1 1 
ATOM   2075 C CD2 . PHE B 2 65  ? 1.925   -28.486 64.427 1.00 25.59 ? 66  PHE E CD2 1 
ATOM   2076 C CE1 . PHE B 2 65  ? 3.805   -30.493 64.046 1.00 27.73 ? 66  PHE E CE1 1 
ATOM   2077 C CE2 . PHE B 2 65  ? 1.640   -29.552 63.569 1.00 25.92 ? 66  PHE E CE2 1 
ATOM   2078 C CZ  . PHE B 2 65  ? 2.584   -30.556 63.379 1.00 25.59 ? 66  PHE E CZ  1 
ATOM   2079 N N   . ALA B 2 66  ? 4.207   -26.317 62.891 1.00 14.34 ? 67  ALA E N   1 
ATOM   2080 C CA  . ALA B 2 66  ? 3.654   -26.018 61.573 1.00 13.64 ? 67  ALA E CA  1 
ATOM   2081 C C   . ALA B 2 66  ? 3.469   -27.299 60.773 1.00 13.49 ? 67  ALA E C   1 
ATOM   2082 O O   . ALA B 2 66  ? 4.158   -28.290 60.999 1.00 13.34 ? 67  ALA E O   1 
ATOM   2083 C CB  . ALA B 2 66  ? 4.571   -25.056 60.817 1.00 14.26 ? 67  ALA E CB  1 
ATOM   2084 N N   . GLU B 2 67  ? 2.525   -27.266 59.841 1.00 13.77 ? 68  GLU E N   1 
ATOM   2085 C CA  . GLU B 2 67  ? 2.245   -28.410 58.985 1.00 14.22 ? 68  GLU E CA  1 
ATOM   2086 C C   . GLU B 2 67  ? 1.804   -27.909 57.609 1.00 12.79 ? 68  GLU E C   1 
ATOM   2087 O O   . GLU B 2 67  ? 1.364   -26.773 57.465 1.00 13.78 ? 68  GLU E O   1 
ATOM   2088 C CB  . GLU B 2 67  ? 1.124   -29.264 59.590 1.00 16.72 ? 68  GLU E CB  1 
ATOM   2089 C CG  . GLU B 2 67  ? -0.235  -28.576 59.541 1.00 19.98 ? 68  GLU E CG  1 
ATOM   2090 C CD  . GLU B 2 67  ? -1.377  -29.454 60.020 1.00 24.27 ? 68  GLU E CD  1 
ATOM   2091 O OE1 . GLU B 2 67  ? -2.545  -29.076 59.776 1.00 24.84 ? 68  GLU E OE1 1 
ATOM   2092 O OE2 . GLU B 2 67  ? -1.116  -30.507 60.644 1.00 25.77 ? 68  GLU E OE2 1 
ATOM   2093 N N   . ARG B 2 68  ? 1.944   -28.764 56.600 1.00 13.31 ? 69  ARG E N   1 
ATOM   2094 C CA  . ARG B 2 68  ? 1.535   -28.457 55.227 1.00 12.48 ? 69  ARG E CA  1 
ATOM   2095 C C   . ARG B 2 68  ? 1.288   -29.858 54.673 1.00 13.92 ? 69  ARG E C   1 
ATOM   2096 O O   . ARG B 2 68  ? 1.975   -30.314 53.762 1.00 13.72 ? 69  ARG E O   1 
ATOM   2097 C CB  . ARG B 2 68  ? 2.675   -27.762 54.471 1.00 11.41 ? 69  ARG E CB  1 
ATOM   2098 C CG  . ARG B 2 68  ? 2.263   -27.150 53.137 1.00 11.78 ? 69  ARG E CG  1 
ATOM   2099 C CD  . ARG B 2 68  ? 3.477   -26.617 52.385 1.00 12.08 ? 69  ARG E CD  1 
ATOM   2100 N NE  . ARG B 2 68  ? 3.119   -25.951 51.132 1.00 12.48 ? 69  ARG E NE  1 
ATOM   2101 C CZ  . ARG B 2 68  ? 3.976   -25.740 50.137 1.00 14.69 ? 69  ARG E CZ  1 
ATOM   2102 N NH1 . ARG B 2 68  ? 5.235   -26.153 50.242 1.00 14.75 ? 69  ARG E NH1 1 
ATOM   2103 N NH2 . ARG B 2 68  ? 3.588   -25.085 49.050 1.00 14.93 ? 69  ARG E NH2 1 
ATOM   2104 N N   . PRO B 2 69  ? 0.284   -30.555 55.234 1.00 15.95 ? 70  PRO E N   1 
ATOM   2105 C CA  . PRO B 2 69  ? -0.140  -31.922 54.908 1.00 15.26 ? 70  PRO E CA  1 
ATOM   2106 C C   . PRO B 2 69  ? -0.216  -32.369 53.462 1.00 15.89 ? 70  PRO E C   1 
ATOM   2107 O O   . PRO B 2 69  ? 0.159   -33.499 53.148 1.00 16.01 ? 70  PRO E O   1 
ATOM   2108 C CB  . PRO B 2 69  ? -1.493  -32.043 55.612 1.00 16.86 ? 70  PRO E CB  1 
ATOM   2109 C CG  . PRO B 2 69  ? -1.346  -31.127 56.782 1.00 17.45 ? 70  PRO E CG  1 
ATOM   2110 C CD  . PRO B 2 69  ? -0.701  -29.925 56.132 1.00 15.73 ? 70  PRO E CD  1 
ATOM   2111 N N   . GLU B 2 70  ? -0.703  -31.503 52.584 1.00 16.21 ? 71  GLU E N   1 
ATOM   2112 C CA  . GLU B 2 70  ? -0.824  -31.868 51.179 1.00 17.90 ? 71  GLU E CA  1 
ATOM   2113 C C   . GLU B 2 70  ? 0.096   -31.074 50.259 1.00 17.93 ? 71  GLU E C   1 
ATOM   2114 O O   . GLU B 2 70  ? -0.088  -31.070 49.041 1.00 19.45 ? 71  GLU E O   1 
ATOM   2115 C CB  . GLU B 2 70  ? -2.280  -31.713 50.729 1.00 20.76 ? 71  GLU E CB  1 
ATOM   2116 C CG  . GLU B 2 70  ? -3.250  -32.614 51.486 1.00 26.85 ? 71  GLU E CG  1 
ATOM   2117 C CD  . GLU B 2 70  ? -4.648  -32.583 50.905 1.00 31.71 ? 71  GLU E CD  1 
ATOM   2118 O OE1 . GLU B 2 70  ? -4.786  -32.811 49.684 1.00 35.45 ? 71  GLU E OE1 1 
ATOM   2119 O OE2 . GLU B 2 70  ? -5.607  -32.339 51.667 1.00 35.17 ? 71  GLU E OE2 1 
ATOM   2120 N N   . GLY B 2 71  ? 1.091   -30.410 50.841 1.00 16.32 ? 72  GLY E N   1 
ATOM   2121 C CA  . GLY B 2 71  ? 2.016   -29.633 50.037 1.00 16.02 ? 72  GLY E CA  1 
ATOM   2122 C C   . GLY B 2 71  ? 1.444   -28.333 49.500 1.00 15.90 ? 72  GLY E C   1 
ATOM   2123 O O   . GLY B 2 71  ? 2.028   -27.722 48.606 1.00 15.68 ? 72  GLY E O   1 
ATOM   2124 N N   . SER B 2 72  ? 0.296   -27.911 50.019 1.00 15.60 ? 73  SER E N   1 
ATOM   2125 C CA  . SER B 2 72  ? -0.304  -26.660 49.577 1.00 16.43 ? 73  SER E CA  1 
ATOM   2126 C C   . SER B 2 72  ? -0.564  -25.760 50.780 1.00 15.62 ? 73  SER E C   1 
ATOM   2127 O O   . SER B 2 72  ? 0.338   -25.055 51.222 1.00 14.71 ? 73  SER E O   1 
ATOM   2128 C CB  . SER B 2 72  ? -1.598  -26.919 48.790 1.00 17.43 ? 73  SER E CB  1 
ATOM   2129 O OG  . SER B 2 72  ? -2.538  -27.658 49.547 1.00 23.76 ? 73  SER E OG  1 
ATOM   2130 N N   . VAL B 2 73  ? -1.782  -25.791 51.312 1.00 13.94 ? 74  VAL E N   1 
ATOM   2131 C CA  . VAL B 2 73  ? -2.139  -24.976 52.472 1.00 15.19 ? 74  VAL E CA  1 
ATOM   2132 C C   . VAL B 2 73  ? -1.282  -25.334 53.686 1.00 14.26 ? 74  VAL E C   1 
ATOM   2133 O O   . VAL B 2 73  ? -1.021  -26.504 53.952 1.00 14.25 ? 74  VAL E O   1 
ATOM   2134 C CB  . VAL B 2 73  ? -3.626  -25.175 52.854 1.00 15.80 ? 74  VAL E CB  1 
ATOM   2135 C CG1 . VAL B 2 73  ? -3.948  -24.424 54.141 1.00 17.64 ? 74  VAL E CG1 1 
ATOM   2136 C CG2 . VAL B 2 73  ? -4.521  -24.690 51.728 1.00 18.66 ? 74  VAL E CG2 1 
ATOM   2137 N N   . SER B 2 74  ? -0.847  -24.320 54.425 1.00 13.68 ? 75  SER E N   1 
ATOM   2138 C CA  . SER B 2 74  ? -0.037  -24.565 55.612 1.00 13.09 ? 75  SER E CA  1 
ATOM   2139 C C   . SER B 2 74  ? -0.652  -23.888 56.821 1.00 13.05 ? 75  SER E C   1 
ATOM   2140 O O   . SER B 2 74  ? -1.244  -22.814 56.713 1.00 13.05 ? 75  SER E O   1 
ATOM   2141 C CB  . SER B 2 74  ? 1.389   -24.042 55.406 1.00 14.68 ? 75  SER E CB  1 
ATOM   2142 O OG  . SER B 2 74  ? 2.172   -24.228 56.576 1.00 16.20 ? 75  SER E OG  1 
ATOM   2143 N N   . THR B 2 75  ? -0.520  -24.523 57.977 1.00 11.23 ? 76  THR E N   1 
ATOM   2144 C CA  . THR B 2 75  ? -1.045  -23.949 59.200 1.00 13.15 ? 76  THR E CA  1 
ATOM   2145 C C   . THR B 2 75  ? 0.060   -23.843 60.234 1.00 13.94 ? 76  THR E C   1 
ATOM   2146 O O   . THR B 2 75  ? 0.811   -24.798 60.454 1.00 16.64 ? 76  THR E O   1 
ATOM   2147 C CB  . THR B 2 75  ? -2.189  -24.807 59.779 1.00 15.36 ? 76  THR E CB  1 
ATOM   2148 O OG1 . THR B 2 75  ? -3.224  -24.936 58.797 1.00 18.32 ? 76  THR E OG1 1 
ATOM   2149 C CG2 . THR B 2 75  ? -2.772  -24.157 61.031 1.00 17.54 ? 76  THR E CG2 1 
ATOM   2150 N N   . LEU B 2 76  ? 0.173   -22.664 60.836 1.00 13.14 ? 77  LEU E N   1 
ATOM   2151 C CA  . LEU B 2 76  ? 1.149   -22.425 61.890 1.00 14.36 ? 77  LEU E CA  1 
ATOM   2152 C C   . LEU B 2 76  ? 0.343   -22.344 63.175 1.00 13.91 ? 77  LEU E C   1 
ATOM   2153 O O   . LEU B 2 76  ? -0.531  -21.482 63.318 1.00 13.60 ? 77  LEU E O   1 
ATOM   2154 C CB  . LEU B 2 76  ? 1.898   -21.103 61.673 1.00 14.41 ? 77  LEU E CB  1 
ATOM   2155 C CG  . LEU B 2 76  ? 2.839   -20.701 62.818 1.00 15.43 ? 77  LEU E CG  1 
ATOM   2156 C CD1 . LEU B 2 76  ? 3.955   -21.722 62.951 1.00 16.31 ? 77  LEU E CD1 1 
ATOM   2157 C CD2 . LEU B 2 76  ? 3.404   -19.310 62.555 1.00 15.24 ? 77  LEU E CD2 1 
ATOM   2158 N N   . LYS B 2 77  ? 0.632   -23.243 64.110 1.00 12.99 ? 78  LYS E N   1 
ATOM   2159 C CA  . LYS B 2 77  ? -0.081  -23.264 65.375 1.00 14.13 ? 78  LYS E CA  1 
ATOM   2160 C C   . LYS B 2 77  ? 0.808   -22.819 66.521 1.00 14.00 ? 78  LYS E C   1 
ATOM   2161 O O   . LYS B 2 77  ? 1.974   -23.195 66.597 1.00 15.30 ? 78  LYS E O   1 
ATOM   2162 C CB  . LYS B 2 77  ? -0.608  -24.673 65.648 1.00 14.66 ? 78  LYS E CB  1 
ATOM   2163 C CG  . LYS B 2 77  ? -1.605  -25.141 64.608 1.00 18.06 ? 78  LYS E CG  1 
ATOM   2164 C CD  . LYS B 2 77  ? -2.098  -26.551 64.874 1.00 19.88 ? 78  LYS E CD  1 
ATOM   2165 C CE  . LYS B 2 77  ? -3.046  -26.992 63.768 1.00 21.27 ? 78  LYS E CE  1 
ATOM   2166 N NZ  . LYS B 2 77  ? -3.622  -28.342 64.024 1.00 24.80 ? 78  LYS E NZ  1 
ATOM   2167 N N   . ILE B 2 78  ? 0.252   -21.991 67.396 1.00 14.50 ? 79  ILE E N   1 
ATOM   2168 C CA  . ILE B 2 78  ? 0.988   -21.519 68.556 1.00 14.77 ? 79  ILE E CA  1 
ATOM   2169 C C   . ILE B 2 78  ? 0.165   -21.891 69.776 1.00 15.09 ? 79  ILE E C   1 
ATOM   2170 O O   . ILE B 2 78  ? -0.951  -21.405 69.952 1.00 15.92 ? 79  ILE E O   1 
ATOM   2171 C CB  . ILE B 2 78  ? 1.182   -19.994 68.535 1.00 15.16 ? 79  ILE E CB  1 
ATOM   2172 C CG1 . ILE B 2 78  ? 1.836   -19.571 67.219 1.00 15.11 ? 79  ILE E CG1 1 
ATOM   2173 C CG2 . ILE B 2 78  ? 2.066   -19.574 69.705 1.00 16.40 ? 79  ILE E CG2 1 
ATOM   2174 C CD1 . ILE B 2 78  ? 1.927   -18.057 67.041 1.00 17.36 ? 79  ILE E CD1 1 
ATOM   2175 N N   . GLN B 2 79  ? 0.708   -22.775 70.603 1.00 15.84 ? 80  GLN E N   1 
ATOM   2176 C CA  . GLN B 2 79  ? 0.003   -23.193 71.805 1.00 17.24 ? 80  GLN E CA  1 
ATOM   2177 C C   . GLN B 2 79  ? 0.400   -22.310 72.977 1.00 17.17 ? 80  GLN E C   1 
ATOM   2178 O O   . GLN B 2 79  ? 1.484   -21.726 72.982 1.00 17.00 ? 80  GLN E O   1 
ATOM   2179 C CB  . GLN B 2 79  ? 0.322   -24.656 72.138 1.00 19.14 ? 80  GLN E CB  1 
ATOM   2180 C CG  . GLN B 2 79  ? -0.292  -25.664 71.170 1.00 23.72 ? 80  GLN E CG  1 
ATOM   2181 C CD  . GLN B 2 79  ? 0.036   -27.106 71.519 1.00 27.66 ? 80  GLN E CD  1 
ATOM   2182 O OE1 . GLN B 2 79  ? -0.470  -28.037 70.889 1.00 29.76 ? 80  GLN E OE1 1 
ATOM   2183 N NE2 . GLN B 2 79  ? 0.885   -27.298 72.521 1.00 29.62 ? 80  GLN E NE2 1 
ATOM   2184 N N   . ARG B 2 80  ? -0.491  -22.209 73.960 1.00 17.73 ? 81  ARG E N   1 
ATOM   2185 C CA  . ARG B 2 80  ? -0.234  -21.426 75.162 1.00 17.34 ? 81  ARG E CA  1 
ATOM   2186 C C   . ARG B 2 80  ? 0.440   -20.092 74.831 1.00 17.40 ? 81  ARG E C   1 
ATOM   2187 O O   . ARG B 2 80  ? 1.535   -19.796 75.309 1.00 16.52 ? 81  ARG E O   1 
ATOM   2188 C CB  . ARG B 2 80  ? 0.635   -22.257 76.113 1.00 18.85 ? 81  ARG E CB  1 
ATOM   2189 C CG  . ARG B 2 80  ? -0.017  -23.580 76.517 1.00 19.43 ? 81  ARG E CG  1 
ATOM   2190 C CD  . ARG B 2 80  ? 0.937   -24.470 77.314 1.00 20.35 ? 81  ARG E CD  1 
ATOM   2191 N NE  . ARG B 2 80  ? 2.050   -24.958 76.501 1.00 21.70 ? 81  ARG E NE  1 
ATOM   2192 C CZ  . ARG B 2 80  ? 1.944   -25.899 75.566 1.00 23.24 ? 81  ARG E CZ  1 
ATOM   2193 N NH1 . ARG B 2 80  ? 0.772   -26.468 75.322 1.00 23.75 ? 81  ARG E NH1 1 
ATOM   2194 N NH2 . ARG B 2 80  ? 3.009   -26.272 74.870 1.00 23.38 ? 81  ARG E NH2 1 
ATOM   2195 N N   . THR B 2 81  ? -0.237  -19.287 74.016 1.00 17.18 ? 82  THR E N   1 
ATOM   2196 C CA  . THR B 2 81  ? 0.296   -17.996 73.589 1.00 17.79 ? 82  THR E CA  1 
ATOM   2197 C C   . THR B 2 81  ? 0.741   -17.089 74.724 1.00 17.46 ? 82  THR E C   1 
ATOM   2198 O O   . THR B 2 81  ? 0.091   -17.000 75.765 1.00 16.83 ? 82  THR E O   1 
ATOM   2199 C CB  . THR B 2 81  ? -0.720  -17.220 72.723 1.00 18.45 ? 82  THR E CB  1 
ATOM   2200 O OG1 . THR B 2 81  ? -1.940  -17.036 73.451 1.00 19.73 ? 82  THR E OG1 1 
ATOM   2201 C CG2 . THR B 2 81  ? -1.005  -17.978 71.443 1.00 18.73 ? 82  THR E CG2 1 
ATOM   2202 N N   . GLN B 2 82  ? 1.862   -16.413 74.492 1.00 17.28 ? 83  GLN E N   1 
ATOM   2203 C CA  . GLN B 2 82  ? 2.454   -15.491 75.453 1.00 18.70 ? 83  GLN E CA  1 
ATOM   2204 C C   . GLN B 2 82  ? 2.508   -14.106 74.815 1.00 18.47 ? 83  GLN E C   1 
ATOM   2205 O O   . GLN B 2 82  ? 2.462   -13.983 73.593 1.00 16.87 ? 83  GLN E O   1 
ATOM   2206 C CB  . GLN B 2 82  ? 3.869   -15.950 75.806 1.00 18.33 ? 83  GLN E CB  1 
ATOM   2207 C CG  . GLN B 2 82  ? 3.938   -17.348 76.409 1.00 19.92 ? 83  GLN E CG  1 
ATOM   2208 C CD  . GLN B 2 82  ? 3.131   -17.459 77.686 1.00 20.94 ? 83  GLN E CD  1 
ATOM   2209 O OE1 . GLN B 2 82  ? 3.257   -16.626 78.584 1.00 22.87 ? 83  GLN E OE1 1 
ATOM   2210 N NE2 . GLN B 2 82  ? 2.297   -18.489 77.775 1.00 23.10 ? 83  GLN E NE2 1 
ATOM   2211 N N   . GLN B 2 83  ? 2.610   -13.067 75.636 1.00 20.65 ? 84  GLN E N   1 
ATOM   2212 C CA  . GLN B 2 83  ? 2.666   -11.702 75.119 1.00 21.79 ? 84  GLN E CA  1 
ATOM   2213 C C   . GLN B 2 83  ? 3.778   -11.526 74.087 1.00 20.91 ? 84  GLN E C   1 
ATOM   2214 O O   . GLN B 2 83  ? 3.614   -10.804 73.100 1.00 19.52 ? 84  GLN E O   1 
ATOM   2215 C CB  . GLN B 2 83  ? 2.861   -10.706 76.268 1.00 24.73 ? 84  GLN E CB  1 
ATOM   2216 C CG  . GLN B 2 83  ? 1.570   -10.265 76.957 1.00 31.39 ? 84  GLN E CG  1 
ATOM   2217 C CD  . GLN B 2 83  ? 0.828   -11.408 77.629 1.00 35.17 ? 84  GLN E CD  1 
ATOM   2218 O OE1 . GLN B 2 83  ? 0.466   -12.393 76.985 1.00 40.67 ? 84  GLN E OE1 1 
ATOM   2219 N NE2 . GLN B 2 83  ? 0.590   -11.276 78.930 1.00 36.14 ? 84  GLN E NE2 1 
ATOM   2220 N N   . GLU B 2 84  ? 4.902   -12.199 74.310 1.00 20.99 ? 85  GLU E N   1 
ATOM   2221 C CA  . GLU B 2 84  ? 6.044   -12.110 73.409 1.00 21.70 ? 85  GLU E CA  1 
ATOM   2222 C C   . GLU B 2 84  ? 5.739   -12.641 72.010 1.00 20.61 ? 85  GLU E C   1 
ATOM   2223 O O   . GLU B 2 84  ? 6.508   -12.407 71.078 1.00 21.09 ? 85  GLU E O   1 
ATOM   2224 C CB  . GLU B 2 84  ? 7.236   -12.870 73.992 1.00 25.27 ? 85  GLU E CB  1 
ATOM   2225 C CG  . GLU B 2 84  ? 7.033   -14.376 74.070 1.00 31.04 ? 85  GLU E CG  1 
ATOM   2226 C CD  . GLU B 2 84  ? 8.117   -15.071 74.871 1.00 36.06 ? 85  GLU E CD  1 
ATOM   2227 O OE1 . GLU B 2 84  ? 8.218   -14.810 76.090 1.00 38.77 ? 85  GLU E OE1 1 
ATOM   2228 O OE2 . GLU B 2 84  ? 8.869   -15.876 74.283 1.00 39.25 ? 85  GLU E OE2 1 
ATOM   2229 N N   . ASP B 2 85  ? 4.630   -13.362 71.865 1.00 18.36 ? 86  ASP E N   1 
ATOM   2230 C CA  . ASP B 2 85  ? 4.255   -13.902 70.559 1.00 16.68 ? 86  ASP E CA  1 
ATOM   2231 C C   . ASP B 2 85  ? 3.584   -12.843 69.685 1.00 17.10 ? 86  ASP E C   1 
ATOM   2232 O O   . ASP B 2 85  ? 3.388   -13.058 68.485 1.00 15.37 ? 86  ASP E O   1 
ATOM   2233 C CB  . ASP B 2 85  ? 3.297   -15.092 70.703 1.00 18.23 ? 86  ASP E CB  1 
ATOM   2234 C CG  . ASP B 2 85  ? 3.898   -16.248 71.485 1.00 19.70 ? 86  ASP E CG  1 
ATOM   2235 O OD1 . ASP B 2 85  ? 5.141   -16.383 71.515 1.00 20.26 ? 86  ASP E OD1 1 
ATOM   2236 O OD2 . ASP B 2 85  ? 3.116   -17.036 72.052 1.00 19.08 ? 86  ASP E OD2 1 
ATOM   2237 N N   . SER B 2 86  ? 3.225   -11.710 70.284 1.00 14.91 ? 87  SER E N   1 
ATOM   2238 C CA  . SER B 2 86  ? 2.571   -10.629 69.549 1.00 14.90 ? 87  SER E CA  1 
ATOM   2239 C C   . SER B 2 86  ? 3.462   -10.171 68.399 1.00 15.54 ? 87  SER E C   1 
ATOM   2240 O O   . SER B 2 86  ? 4.594   -9.727  68.605 1.00 16.05 ? 87  SER E O   1 
ATOM   2241 C CB  . SER B 2 86  ? 2.260   -9.458  70.488 1.00 17.67 ? 87  SER E CB  1 
ATOM   2242 O OG  . SER B 2 86  ? 1.353   -9.858  71.505 1.00 16.04 ? 87  SER E OG  1 
ATOM   2243 N N   . ALA B 2 87  ? 2.941   -10.286 67.183 1.00 13.83 ? 88  ALA E N   1 
ATOM   2244 C CA  . ALA B 2 87  ? 3.699   -9.925  65.996 1.00 13.93 ? 88  ALA E CA  1 
ATOM   2245 C C   . ALA B 2 87  ? 2.851   -10.164 64.766 1.00 11.99 ? 88  ALA E C   1 
ATOM   2246 O O   . ALA B 2 87  ? 1.710   -10.610 64.861 1.00 14.48 ? 88  ALA E O   1 
ATOM   2247 C CB  . ALA B 2 87  ? 4.955   -10.785 65.912 1.00 14.70 ? 88  ALA E CB  1 
ATOM   2248 N N   . VAL B 2 88  ? 3.419   -9.850  63.608 1.00 12.37 ? 89  VAL E N   1 
ATOM   2249 C CA  . VAL B 2 88  ? 2.748   -10.097 62.345 1.00 12.29 ? 89  VAL E CA  1 
ATOM   2250 C C   . VAL B 2 88  ? 3.422   -11.349 61.815 1.00 12.56 ? 89  VAL E C   1 
ATOM   2251 O O   . VAL B 2 88  ? 4.648   -11.407 61.711 1.00 13.28 ? 89  VAL E O   1 
ATOM   2252 C CB  . VAL B 2 88  ? 2.956   -8.940  61.342 1.00 12.67 ? 89  VAL E CB  1 
ATOM   2253 C CG1 . VAL B 2 88  ? 2.443   -9.351  59.957 1.00 14.66 ? 89  VAL E CG1 1 
ATOM   2254 C CG2 . VAL B 2 88  ? 2.218   -7.706  61.824 1.00 13.66 ? 89  VAL E CG2 1 
ATOM   2255 N N   . TYR B 2 89  ? 2.625   -12.368 61.524 1.00 11.82 ? 90  TYR E N   1 
ATOM   2256 C CA  . TYR B 2 89  ? 3.160   -13.604 60.993 1.00 10.82 ? 90  TYR E CA  1 
ATOM   2257 C C   . TYR B 2 89  ? 2.963   -13.584 59.493 1.00 11.93 ? 90  TYR E C   1 
ATOM   2258 O O   . TYR B 2 89  ? 1.853   -13.408 58.999 1.00 13.05 ? 90  TYR E O   1 
ATOM   2259 C CB  . TYR B 2 89  ? 2.477   -14.805 61.653 1.00 11.35 ? 90  TYR E CB  1 
ATOM   2260 C CG  . TYR B 2 89  ? 2.903   -14.941 63.102 1.00 10.58 ? 90  TYR E CG  1 
ATOM   2261 C CD1 . TYR B 2 89  ? 2.318   -14.161 64.097 1.00 11.36 ? 90  TYR E CD1 1 
ATOM   2262 C CD2 . TYR B 2 89  ? 3.967   -15.772 63.457 1.00 10.62 ? 90  TYR E CD2 1 
ATOM   2263 C CE1 . TYR B 2 89  ? 2.789   -14.199 65.411 1.00 11.78 ? 90  TYR E CE1 1 
ATOM   2264 C CE2 . TYR B 2 89  ? 4.449   -15.814 64.762 1.00 12.10 ? 90  TYR E CE2 1 
ATOM   2265 C CZ  . TYR B 2 89  ? 3.856   -15.024 65.729 1.00 12.13 ? 90  TYR E CZ  1 
ATOM   2266 O OH  . TYR B 2 89  ? 4.341   -15.039 67.014 1.00 13.22 ? 90  TYR E OH  1 
ATOM   2267 N N   . LEU B 2 90  ? 4.074   -13.716 58.777 1.00 11.44 ? 91  LEU E N   1 
ATOM   2268 C CA  . LEU B 2 90  ? 4.066   -13.682 57.325 1.00 11.58 ? 91  LEU E CA  1 
ATOM   2269 C C   . LEU B 2 90  ? 4.321   -15.039 56.714 1.00 12.38 ? 91  LEU E C   1 
ATOM   2270 O O   . LEU B 2 90  ? 5.079   -15.844 57.248 1.00 11.39 ? 91  LEU E O   1 
ATOM   2271 C CB  . LEU B 2 90  ? 5.136   -12.711 56.820 1.00 13.85 ? 91  LEU E CB  1 
ATOM   2272 C CG  . LEU B 2 90  ? 4.991   -11.258 57.270 1.00 14.80 ? 91  LEU E CG  1 
ATOM   2273 C CD1 . LEU B 2 90  ? 6.300   -10.523 57.040 1.00 14.72 ? 91  LEU E CD1 1 
ATOM   2274 C CD2 . LEU B 2 90  ? 3.850   -10.599 56.507 1.00 14.55 ? 91  LEU E CD2 1 
ATOM   2275 N N   . CYS B 2 91  ? 3.670   -15.286 55.585 1.00 11.56 ? 92  CYS E N   1 
ATOM   2276 C CA  . CYS B 2 91  ? 3.848   -16.520 54.846 1.00 13.33 ? 92  CYS E CA  1 
ATOM   2277 C C   . CYS B 2 91  ? 4.219   -16.107 53.431 1.00 12.94 ? 92  CYS E C   1 
ATOM   2278 O O   . CYS B 2 91  ? 3.729   -15.097 52.928 1.00 12.36 ? 92  CYS E O   1 
ATOM   2279 C CB  . CYS B 2 91  ? 2.547   -17.312 54.823 1.00 17.02 ? 92  CYS E CB  1 
ATOM   2280 S SG  . CYS B 2 91  ? 2.618   -18.903 53.939 1.00 26.36 ? 92  CYS E SG  1 
ATOM   2281 N N   . ALA B 2 92  ? 5.101   -16.874 52.800 1.00 12.02 ? 93  ALA E N   1 
ATOM   2282 C CA  . ALA B 2 92  ? 5.504   -16.575 51.432 1.00 11.44 ? 93  ALA E CA  1 
ATOM   2283 C C   . ALA B 2 92  ? 5.708   -17.873 50.676 1.00 11.42 ? 93  ALA E C   1 
ATOM   2284 O O   . ALA B 2 92  ? 5.986   -18.914 51.266 1.00 12.35 ? 93  ALA E O   1 
ATOM   2285 C CB  . ALA B 2 92  ? 6.798   -15.765 51.425 1.00 13.61 ? 93  ALA E CB  1 
ATOM   2286 N N   . SER B 2 93  ? 5.552   -17.820 49.360 1.00 11.18 ? 94  SER E N   1 
ATOM   2287 C CA  . SER B 2 93  ? 5.767   -19.013 48.564 1.00 11.60 ? 94  SER E CA  1 
ATOM   2288 C C   . SER B 2 93  ? 6.574   -18.664 47.331 1.00 12.23 ? 94  SER E C   1 
ATOM   2289 O O   . SER B 2 93  ? 6.611   -17.512 46.904 1.00 11.52 ? 94  SER E O   1 
ATOM   2290 C CB  . SER B 2 93  ? 4.430   -19.656 48.151 1.00 11.02 ? 94  SER E CB  1 
ATOM   2291 O OG  . SER B 2 93  ? 3.754   -18.895 47.169 1.00 13.26 ? 94  SER E OG  1 
ATOM   2292 N N   . SER B 2 94  ? 7.246   -19.666 46.776 1.00 11.80 ? 95  SER E N   1 
ATOM   2293 C CA  . SER B 2 94  ? 8.031   -19.468 45.564 1.00 12.60 ? 95  SER E CA  1 
ATOM   2294 C C   . SER B 2 94  ? 8.029   -20.763 44.770 1.00 13.32 ? 95  SER E C   1 
ATOM   2295 O O   . SER B 2 94  ? 7.848   -21.849 45.328 1.00 12.86 ? 95  SER E O   1 
ATOM   2296 C CB  . SER B 2 94  ? 9.471   -19.067 45.899 1.00 13.11 ? 95  SER E CB  1 
ATOM   2297 O OG  . SER B 2 94  ? 10.149  -20.103 46.581 1.00 16.86 ? 95  SER E OG  1 
ATOM   2298 N N   . LEU B 2 95  ? 8.211   -20.651 43.460 1.00 11.83 ? 96  LEU E N   1 
ATOM   2299 C CA  . LEU B 2 95  ? 8.228   -21.839 42.622 1.00 13.88 ? 96  LEU E CA  1 
ATOM   2300 C C   . LEU B 2 95  ? 9.380   -22.746 43.047 1.00 14.76 ? 96  LEU E C   1 
ATOM   2301 O O   . LEU B 2 95  ? 9.234   -23.963 43.102 1.00 15.10 ? 96  LEU E O   1 
ATOM   2302 C CB  . LEU B 2 95  ? 8.385   -21.454 41.151 1.00 14.43 ? 96  LEU E CB  1 
ATOM   2303 C CG  . LEU B 2 95  ? 8.433   -22.641 40.182 1.00 14.50 ? 96  LEU E CG  1 
ATOM   2304 C CD1 . LEU B 2 95  ? 7.157   -23.470 40.320 1.00 16.73 ? 96  LEU E CD1 1 
ATOM   2305 C CD2 . LEU B 2 95  ? 8.595   -22.137 38.757 1.00 14.32 ? 96  LEU E CD2 1 
ATOM   2306 N N   . GLY B 2 96  ? 10.519  -22.133 43.348 1.00 16.31 ? 97  GLY E N   1 
ATOM   2307 C CA  . GLY B 2 96  ? 11.693  -22.879 43.768 1.00 17.69 ? 97  GLY E CA  1 
ATOM   2308 C C   . GLY B 2 96  ? 12.835  -21.947 44.134 1.00 17.55 ? 97  GLY E C   1 
ATOM   2309 O O   . GLY B 2 96  ? 12.689  -20.730 44.071 1.00 17.48 ? 97  GLY E O   1 
ATOM   2310 N N   . GLN B 2 97  ? 13.983  -22.518 44.488 1.00 20.11 ? 98  GLN E N   1 
ATOM   2311 C CA  . GLN B 2 97  ? 15.152  -21.733 44.890 1.00 21.23 ? 98  GLN E CA  1 
ATOM   2312 C C   . GLN B 2 97  ? 15.626  -20.666 43.901 1.00 21.03 ? 98  GLN E C   1 
ATOM   2313 O O   . GLN B 2 97  ? 16.134  -19.620 44.307 1.00 21.51 ? 98  GLN E O   1 
ATOM   2314 C CB  . GLN B 2 97  ? 16.313  -22.677 45.226 1.00 24.04 ? 98  GLN E CB  1 
ATOM   2315 C CG  . GLN B 2 97  ? 17.625  -21.970 45.552 1.00 28.96 ? 98  GLN E CG  1 
ATOM   2316 C CD  . GLN B 2 97  ? 18.665  -22.913 46.128 1.00 32.00 ? 98  GLN E CD  1 
ATOM   2317 O OE1 . GLN B 2 97  ? 18.897  -23.998 45.595 1.00 35.32 ? 98  GLN E OE1 1 
ATOM   2318 N NE2 . GLN B 2 97  ? 19.303  -22.499 47.217 1.00 34.00 ? 98  GLN E NE2 1 
ATOM   2319 N N   . ALA B 2 98  ? 15.464  -20.920 42.607 1.00 19.93 ? 99  ALA E N   1 
ATOM   2320 C CA  . ALA B 2 98  ? 15.903  -19.963 41.599 1.00 19.02 ? 99  ALA E CA  1 
ATOM   2321 C C   . ALA B 2 98  ? 14.909  -18.825 41.403 1.00 17.89 ? 99  ALA E C   1 
ATOM   2322 O O   . ALA B 2 98  ? 15.144  -17.919 40.602 1.00 19.11 ? 99  ALA E O   1 
ATOM   2323 C CB  . ALA B 2 98  ? 16.140  -20.680 40.270 1.00 20.60 ? 99  ALA E CB  1 
ATOM   2324 N N   . TYR B 2 99  ? 13.802  -18.865 42.140 1.00 17.70 ? 100 TYR E N   1 
ATOM   2325 C CA  . TYR B 2 99  ? 12.786  -17.837 41.993 1.00 17.89 ? 100 TYR E CA  1 
ATOM   2326 C C   . TYR B 2 99  ? 12.488  -17.022 43.241 1.00 15.10 ? 100 TYR E C   1 
ATOM   2327 O O   . TYR B 2 99  ? 12.844  -17.405 44.355 1.00 15.10 ? 100 TYR E O   1 
ATOM   2328 C CB  . TYR B 2 99  ? 11.500  -18.452 41.442 1.00 20.03 ? 100 TYR E CB  1 
ATOM   2329 C CG  . TYR B 2 99  ? 11.665  -18.906 40.012 1.00 24.30 ? 100 TYR E CG  1 
ATOM   2330 C CD1 . TYR B 2 99  ? 12.035  -20.214 39.712 1.00 25.39 ? 100 TYR E CD1 1 
ATOM   2331 C CD2 . TYR B 2 99  ? 11.503  -18.008 38.960 1.00 25.89 ? 100 TYR E CD2 1 
ATOM   2332 C CE1 . TYR B 2 99  ? 12.242  -20.617 38.387 1.00 27.13 ? 100 TYR E CE1 1 
ATOM   2333 C CE2 . TYR B 2 99  ? 11.708  -18.396 37.639 1.00 28.16 ? 100 TYR E CE2 1 
ATOM   2334 C CZ  . TYR B 2 99  ? 12.077  -19.700 37.362 1.00 27.75 ? 100 TYR E CZ  1 
ATOM   2335 O OH  . TYR B 2 99  ? 12.282  -20.072 36.054 1.00 32.93 ? 100 TYR E OH  1 
ATOM   2336 N N   . GLU B 2 100 ? 11.816  -15.898 43.022 1.00 15.92 ? 105 GLU E N   1 
ATOM   2337 C CA  . GLU B 2 100 ? 11.479  -14.965 44.081 1.00 15.81 ? 105 GLU E CA  1 
ATOM   2338 C C   . GLU B 2 100 ? 10.299  -15.371 44.943 1.00 14.21 ? 105 GLU E C   1 
ATOM   2339 O O   . GLU B 2 100 ? 9.424   -16.125 44.518 1.00 14.62 ? 105 GLU E O   1 
ATOM   2340 C CB  . GLU B 2 100 ? 11.225  -13.571 43.491 1.00 16.56 ? 105 GLU E CB  1 
ATOM   2341 C CG  . GLU B 2 100 ? 9.943   -13.418 42.670 1.00 21.75 ? 105 GLU E CG  1 
ATOM   2342 C CD  . GLU B 2 100 ? 10.093  -13.822 41.209 1.00 25.03 ? 105 GLU E CD  1 
ATOM   2343 O OE1 . GLU B 2 100 ? 9.165   -13.527 40.424 1.00 28.23 ? 105 GLU E OE1 1 
ATOM   2344 O OE2 . GLU B 2 100 ? 11.121  -14.432 40.841 1.00 26.28 ? 105 GLU E OE2 1 
ATOM   2345 N N   . GLN B 2 101 ? 10.293  -14.857 46.167 1.00 12.29 ? 106 GLN E N   1 
ATOM   2346 C CA  . GLN B 2 101 ? 9.224   -15.137 47.108 1.00 12.35 ? 106 GLN E CA  1 
ATOM   2347 C C   . GLN B 2 101 ? 8.086   -14.133 46.992 1.00 11.10 ? 106 GLN E C   1 
ATOM   2348 O O   . GLN B 2 101 ? 8.314   -12.935 46.821 1.00 12.94 ? 106 GLN E O   1 
ATOM   2349 C CB  . GLN B 2 101 ? 9.762   -15.113 48.539 1.00 11.69 ? 106 GLN E CB  1 
ATOM   2350 C CG  . GLN B 2 101 ? 10.563  -16.338 48.918 1.00 12.79 ? 106 GLN E CG  1 
ATOM   2351 C CD  . GLN B 2 101 ? 11.023  -16.296 50.360 1.00 13.33 ? 106 GLN E CD  1 
ATOM   2352 O OE1 . GLN B 2 101 ? 10.296  -15.833 51.239 1.00 14.33 ? 106 GLN E OE1 1 
ATOM   2353 N NE2 . GLN B 2 101 ? 12.228  -16.788 50.613 1.00 13.71 ? 106 GLN E NE2 1 
ATOM   2354 N N   . TYR B 2 102 ? 6.861   -14.645 47.073 1.00 9.83  ? 107 TYR E N   1 
ATOM   2355 C CA  . TYR B 2 102 ? 5.654   -13.827 47.034 1.00 11.31 ? 107 TYR E CA  1 
ATOM   2356 C C   . TYR B 2 102 ? 5.039   -13.931 48.421 1.00 12.05 ? 107 TYR E C   1 
ATOM   2357 O O   . TYR B 2 102 ? 4.774   -15.029 48.903 1.00 12.13 ? 107 TYR E O   1 
ATOM   2358 C CB  . TYR B 2 102 ? 4.672   -14.348 45.986 1.00 12.10 ? 107 TYR E CB  1 
ATOM   2359 C CG  . TYR B 2 102 ? 5.085   -14.004 44.582 1.00 14.67 ? 107 TYR E CG  1 
ATOM   2360 C CD1 . TYR B 2 102 ? 6.109   -14.697 43.947 1.00 15.74 ? 107 TYR E CD1 1 
ATOM   2361 C CD2 . TYR B 2 102 ? 4.491   -12.943 43.909 1.00 16.92 ? 107 TYR E CD2 1 
ATOM   2362 C CE1 . TYR B 2 102 ? 6.540   -14.336 42.670 1.00 16.62 ? 107 TYR E CE1 1 
ATOM   2363 C CE2 . TYR B 2 102 ? 4.910   -12.576 42.638 1.00 18.92 ? 107 TYR E CE2 1 
ATOM   2364 C CZ  . TYR B 2 102 ? 5.936   -13.276 42.028 1.00 18.29 ? 107 TYR E CZ  1 
ATOM   2365 O OH  . TYR B 2 102 ? 6.361   -12.895 40.778 1.00 23.45 ? 107 TYR E OH  1 
ATOM   2366 N N   . PHE B 2 103 ? 4.821   -12.787 49.059 1.00 11.85 ? 108 PHE E N   1 
ATOM   2367 C CA  . PHE B 2 103 ? 4.277   -12.760 50.413 1.00 13.58 ? 108 PHE E CA  1 
ATOM   2368 C C   . PHE B 2 103 ? 2.782   -12.548 50.551 1.00 14.51 ? 108 PHE E C   1 
ATOM   2369 O O   . PHE B 2 103 ? 2.146   -11.891 49.727 1.00 14.70 ? 108 PHE E O   1 
ATOM   2370 C CB  . PHE B 2 103 ? 4.972   -11.674 51.239 1.00 12.21 ? 108 PHE E CB  1 
ATOM   2371 C CG  . PHE B 2 103 ? 6.369   -12.020 51.648 1.00 13.85 ? 108 PHE E CG  1 
ATOM   2372 C CD1 . PHE B 2 103 ? 7.408   -11.982 50.725 1.00 13.78 ? 108 PHE E CD1 1 
ATOM   2373 C CD2 . PHE B 2 103 ? 6.645   -12.393 52.960 1.00 13.99 ? 108 PHE E CD2 1 
ATOM   2374 C CE1 . PHE B 2 103 ? 8.708   -12.309 51.105 1.00 13.06 ? 108 PHE E CE1 1 
ATOM   2375 C CE2 . PHE B 2 103 ? 7.946   -12.724 53.349 1.00 13.39 ? 108 PHE E CE2 1 
ATOM   2376 C CZ  . PHE B 2 103 ? 8.975   -12.681 52.420 1.00 12.69 ? 108 PHE E CZ  1 
ATOM   2377 N N   . GLY B 2 104 ? 2.238   -13.110 51.626 1.00 14.89 ? 109 GLY E N   1 
ATOM   2378 C CA  . GLY B 2 104 ? 0.833   -12.934 51.933 1.00 14.97 ? 109 GLY E CA  1 
ATOM   2379 C C   . GLY B 2 104 ? 0.685   -11.581 52.611 1.00 15.16 ? 109 GLY E C   1 
ATOM   2380 O O   . GLY B 2 104 ? 1.674   -10.868 52.795 1.00 14.71 ? 109 GLY E O   1 
ATOM   2381 N N   . PRO B 2 105 ? -0.537  -11.192 52.998 1.00 15.37 ? 110 PRO E N   1 
ATOM   2382 C CA  . PRO B 2 105 ? -0.793  -9.907  53.655 1.00 16.81 ? 110 PRO E CA  1 
ATOM   2383 C C   . PRO B 2 105 ? -0.440  -9.928  55.139 1.00 17.39 ? 110 PRO E C   1 
ATOM   2384 O O   . PRO B 2 105 ? -0.402  -8.881  55.795 1.00 19.60 ? 110 PRO E O   1 
ATOM   2385 C CB  . PRO B 2 105 ? -2.281  -9.699  53.409 1.00 16.82 ? 110 PRO E CB  1 
ATOM   2386 C CG  . PRO B 2 105 ? -2.811  -11.082 53.502 1.00 17.30 ? 110 PRO E CG  1 
ATOM   2387 C CD  . PRO B 2 105 ? -1.801  -11.894 52.712 1.00 16.64 ? 110 PRO E CD  1 
ATOM   2388 N N   . GLY B 2 106 ? -0.188  -11.129 55.652 1.00 15.45 ? 111 GLY E N   1 
ATOM   2389 C CA  . GLY B 2 106 ? 0.175   -11.301 57.046 1.00 15.67 ? 111 GLY E CA  1 
ATOM   2390 C C   . GLY B 2 106 ? -0.990  -11.421 58.008 1.00 15.72 ? 111 GLY E C   1 
ATOM   2391 O O   . GLY B 2 106 ? -2.116  -11.022 57.704 1.00 15.98 ? 111 GLY E O   1 
ATOM   2392 N N   . THR B 2 107 ? -0.711  -12.004 59.170 1.00 14.68 ? 112 THR E N   1 
ATOM   2393 C CA  . THR B 2 107 ? -1.706  -12.150 60.224 1.00 14.96 ? 112 THR E CA  1 
ATOM   2394 C C   . THR B 2 107 ? -1.145  -11.398 61.416 1.00 13.81 ? 112 THR E C   1 
ATOM   2395 O O   . THR B 2 107 ? -0.098  -11.761 61.938 1.00 14.47 ? 112 THR E O   1 
ATOM   2396 C CB  . THR B 2 107 ? -1.912  -13.613 60.647 1.00 16.91 ? 112 THR E CB  1 
ATOM   2397 O OG1 . THR B 2 107 ? -2.562  -14.334 59.595 1.00 18.60 ? 112 THR E OG1 1 
ATOM   2398 C CG2 . THR B 2 107 ? -2.763  -13.683 61.910 1.00 17.03 ? 112 THR E CG2 1 
ATOM   2399 N N   . ARG B 2 108 ? -1.837  -10.349 61.840 1.00 14.02 ? 113 ARG E N   1 
ATOM   2400 C CA  . ARG B 2 108 ? -1.379  -9.565  62.976 1.00 15.44 ? 113 ARG E CA  1 
ATOM   2401 C C   . ARG B 2 108 ? -1.951  -10.160 64.254 1.00 15.41 ? 113 ARG E C   1 
ATOM   2402 O O   . ARG B 2 108 ? -3.158  -10.112 64.481 1.00 15.58 ? 113 ARG E O   1 
ATOM   2403 C CB  . ARG B 2 108 ? -1.830  -8.111  62.819 1.00 18.19 ? 113 ARG E CB  1 
ATOM   2404 C CG  . ARG B 2 108 ? -1.254  -7.162  63.857 1.00 25.03 ? 113 ARG E CG  1 
ATOM   2405 C CD  . ARG B 2 108 ? -1.507  -5.733  63.429 1.00 29.67 ? 113 ARG E CD  1 
ATOM   2406 N NE  . ARG B 2 108 ? -0.834  -4.762  64.281 1.00 34.52 ? 113 ARG E NE  1 
ATOM   2407 C CZ  . ARG B 2 108 ? -0.729  -3.471  63.986 1.00 35.71 ? 113 ARG E CZ  1 
ATOM   2408 N NH1 . ARG B 2 108 ? -1.252  -3.002  62.859 1.00 38.70 ? 113 ARG E NH1 1 
ATOM   2409 N NH2 . ARG B 2 108 ? -0.101  -2.649  64.814 1.00 38.16 ? 113 ARG E NH2 1 
ATOM   2410 N N   . LEU B 2 109 ? -1.074  -10.730 65.078 1.00 14.40 ? 114 LEU E N   1 
ATOM   2411 C CA  . LEU B 2 109 ? -1.488  -11.344 66.337 1.00 14.74 ? 114 LEU E CA  1 
ATOM   2412 C C   . LEU B 2 109 ? -1.113  -10.493 67.539 1.00 12.84 ? 114 LEU E C   1 
ATOM   2413 O O   . LEU B 2 109 ? 0.026   -10.040 67.653 1.00 15.70 ? 114 LEU E O   1 
ATOM   2414 C CB  . LEU B 2 109 ? -0.833  -12.720 66.501 1.00 14.42 ? 114 LEU E CB  1 
ATOM   2415 C CG  . LEU B 2 109 ? -1.059  -13.417 67.851 1.00 13.46 ? 114 LEU E CG  1 
ATOM   2416 C CD1 . LEU B 2 109 ? -2.525  -13.815 67.990 1.00 13.54 ? 114 LEU E CD1 1 
ATOM   2417 C CD2 . LEU B 2 109 ? -0.166  -14.646 67.953 1.00 12.16 ? 114 LEU E CD2 1 
ATOM   2418 N N   . THR B 2 110 ? -2.080  -10.266 68.422 1.00 12.80 ? 115 THR E N   1 
ATOM   2419 C CA  . THR B 2 110 ? -1.841  -9.526  69.655 1.00 13.61 ? 115 THR E CA  1 
ATOM   2420 C C   . THR B 2 110 ? -2.306  -10.433 70.786 1.00 14.37 ? 115 THR E C   1 
ATOM   2421 O O   . THR B 2 110 ? -3.454  -10.870 70.805 1.00 14.97 ? 115 THR E O   1 
ATOM   2422 C CB  . THR B 2 110 ? -2.639  -8.208  69.732 1.00 14.87 ? 115 THR E CB  1 
ATOM   2423 O OG1 . THR B 2 110 ? -2.150  -7.292  68.742 1.00 17.83 ? 115 THR E OG1 1 
ATOM   2424 C CG2 . THR B 2 110 ? -2.482  -7.580  71.112 1.00 17.14 ? 115 THR E CG2 1 
ATOM   2425 N N   . VAL B 2 111 ? -1.398  -10.740 71.704 1.00 14.23 ? 116 VAL E N   1 
ATOM   2426 C CA  . VAL B 2 111 ? -1.725  -11.588 72.845 1.00 16.09 ? 116 VAL E CA  1 
ATOM   2427 C C   . VAL B 2 111 ? -1.834  -10.660 74.049 1.00 16.50 ? 116 VAL E C   1 
ATOM   2428 O O   . VAL B 2 111 ? -0.915  -9.889  74.339 1.00 17.56 ? 116 VAL E O   1 
ATOM   2429 C CB  . VAL B 2 111 ? -0.625  -12.652 73.082 1.00 16.34 ? 116 VAL E CB  1 
ATOM   2430 C CG1 . VAL B 2 111 ? -0.973  -13.517 74.286 1.00 16.36 ? 116 VAL E CG1 1 
ATOM   2431 C CG2 . VAL B 2 111 ? -0.483  -13.527 71.845 1.00 16.63 ? 116 VAL E CG2 1 
ATOM   2432 N N   . THR B 2 112 ? -2.970  -10.724 74.734 1.00 17.60 ? 117 THR E N   1 
ATOM   2433 C CA  . THR B 2 112 ? -3.214  -9.871  75.887 1.00 18.78 ? 117 THR E CA  1 
ATOM   2434 C C   . THR B 2 112 ? -3.536  -10.717 77.120 1.00 19.13 ? 117 THR E C   1 
ATOM   2435 O O   . THR B 2 112 ? -3.996  -11.852 77.006 1.00 19.24 ? 117 THR E O   1 
ATOM   2436 C CB  . THR B 2 112 ? -4.373  -8.885  75.590 1.00 19.90 ? 117 THR E CB  1 
ATOM   2437 O OG1 . THR B 2 112 ? -4.469  -7.920  76.644 1.00 22.09 ? 117 THR E OG1 1 
ATOM   2438 C CG2 . THR B 2 112 ? -5.693  -9.633  75.453 1.00 19.24 ? 117 THR E CG2 1 
ATOM   2439 N N   . GLU B 2 113 ? -3.296  -10.158 78.299 1.00 20.76 ? 118 GLU E N   1 
ATOM   2440 C CA  . GLU B 2 113 ? -3.538  -10.889 79.536 1.00 22.55 ? 118 GLU E CA  1 
ATOM   2441 C C   . GLU B 2 113 ? -5.003  -11.252 79.768 1.00 21.24 ? 118 GLU E C   1 
ATOM   2442 O O   . GLU B 2 113 ? -5.314  -12.349 80.236 1.00 21.93 ? 118 GLU E O   1 
ATOM   2443 C CB  . GLU B 2 113 ? -3.026  -10.074 80.725 1.00 25.28 ? 118 GLU E CB  1 
ATOM   2444 C CG  . GLU B 2 113 ? -2.976  -10.857 82.020 1.00 31.26 ? 118 GLU E CG  1 
ATOM   2445 C CD  . GLU B 2 113 ? -2.043  -12.047 81.927 1.00 34.75 ? 118 GLU E CD  1 
ATOM   2446 O OE1 . GLU B 2 113 ? -0.848  -11.839 81.627 1.00 37.15 ? 118 GLU E OE1 1 
ATOM   2447 O OE2 . GLU B 2 113 ? -2.503  -13.187 82.150 1.00 38.20 ? 118 GLU E OE2 1 
ATOM   2448 N N   . ASP B 2 114 ? -5.901  -10.334 79.435 1.00 20.52 ? 119 ASP E N   1 
ATOM   2449 C CA  . ASP B 2 114 ? -7.327  -10.550 79.645 1.00 20.77 ? 119 ASP E CA  1 
ATOM   2450 C C   . ASP B 2 114 ? -8.098  -9.876  78.513 1.00 19.76 ? 119 ASP E C   1 
ATOM   2451 O O   . ASP B 2 114 ? -7.769  -8.757  78.120 1.00 19.66 ? 119 ASP E O   1 
ATOM   2452 C CB  . ASP B 2 114 ? -7.730  -9.938  80.991 1.00 23.72 ? 119 ASP E CB  1 
ATOM   2453 C CG  . ASP B 2 114 ? -9.108  -10.370 81.452 1.00 26.61 ? 119 ASP E CG  1 
ATOM   2454 O OD1 . ASP B 2 114 ? -10.080 -10.219 80.685 1.00 29.14 ? 119 ASP E OD1 1 
ATOM   2455 O OD2 . ASP B 2 114 ? -9.219  -10.856 82.599 1.00 30.97 ? 119 ASP E OD2 1 
ATOM   2456 N N   . LEU B 2 115 ? -9.120  -10.549 77.994 1.00 19.44 ? 120 LEU E N   1 
ATOM   2457 C CA  . LEU B 2 115 ? -9.905  -9.984  76.903 1.00 19.49 ? 120 LEU E CA  1 
ATOM   2458 C C   . LEU B 2 115 ? -10.696 -8.740  77.291 1.00 19.38 ? 120 LEU E C   1 
ATOM   2459 O O   . LEU B 2 115 ? -11.252 -8.064  76.423 1.00 18.99 ? 120 LEU E O   1 
ATOM   2460 C CB  . LEU B 2 115 ? -10.844 -11.040 76.310 1.00 19.92 ? 120 LEU E CB  1 
ATOM   2461 C CG  . LEU B 2 115 ? -10.160 -12.226 75.618 1.00 22.09 ? 120 LEU E CG  1 
ATOM   2462 C CD1 . LEU B 2 115 ? -11.208 -13.072 74.913 1.00 24.35 ? 120 LEU E CD1 1 
ATOM   2463 C CD2 . LEU B 2 115 ? -9.129  -11.728 74.615 1.00 22.71 ? 120 LEU E CD2 1 
ATOM   2464 N N   . LYS B 2 116 ? -10.755 -8.432  78.587 1.00 18.49 ? 121 LYS E N   1 
ATOM   2465 C CA  . LYS B 2 116 ? -11.469 -7.234  79.024 1.00 17.77 ? 121 LYS E CA  1 
ATOM   2466 C C   . LYS B 2 116 ? -10.651 -6.002  78.637 1.00 18.08 ? 121 LYS E C   1 
ATOM   2467 O O   . LYS B 2 116 ? -11.089 -4.863  78.819 1.00 18.67 ? 121 LYS E O   1 
ATOM   2468 C CB  . LYS B 2 116 ? -11.706 -7.256  80.541 1.00 20.38 ? 121 LYS E CB  1 
ATOM   2469 C CG  . LYS B 2 116 ? -10.444 -7.235  81.385 1.00 23.42 ? 121 LYS E CG  1 
ATOM   2470 C CD  . LYS B 2 116 ? -10.770 -7.422  82.865 1.00 27.35 ? 121 LYS E CD  1 
ATOM   2471 C CE  . LYS B 2 116 ? -9.510  -7.425  83.715 1.00 28.33 ? 121 LYS E CE  1 
ATOM   2472 N NZ  . LYS B 2 116 ? -9.798  -7.755  85.143 1.00 33.16 ? 121 LYS E NZ  1 
ATOM   2473 N N   . ASN B 2 117 ? -9.459  -6.246  78.099 1.00 17.39 ? 122 ASN E N   1 
ATOM   2474 C CA  . ASN B 2 117 ? -8.565  -5.179  77.658 1.00 16.74 ? 122 ASN E CA  1 
ATOM   2475 C C   . ASN B 2 117 ? -8.978  -4.706  76.265 1.00 15.86 ? 122 ASN E C   1 
ATOM   2476 O O   . ASN B 2 117 ? -8.535  -3.657  75.801 1.00 16.05 ? 122 ASN E O   1 
ATOM   2477 C CB  . ASN B 2 117 ? -7.120  -5.687  77.592 1.00 19.18 ? 122 ASN E CB  1 
ATOM   2478 C CG  . ASN B 2 117 ? -6.528  -5.973  78.960 1.00 23.22 ? 122 ASN E CG  1 
ATOM   2479 O OD1 . ASN B 2 117 ? -5.520  -6.677  79.076 1.00 25.83 ? 122 ASN E OD1 1 
ATOM   2480 N ND2 . ASN B 2 117 ? -7.135  -5.418  79.997 1.00 21.10 ? 122 ASN E ND2 1 
ATOM   2481 N N   . VAL B 2 118 ? -9.819  -5.492  75.601 1.00 15.34 ? 123 VAL E N   1 
ATOM   2482 C CA  . VAL B 2 118 ? -10.265 -5.174  74.245 1.00 15.05 ? 123 VAL E CA  1 
ATOM   2483 C C   . VAL B 2 118 ? -11.393 -4.144  74.212 1.00 15.16 ? 123 VAL E C   1 
ATOM   2484 O O   . VAL B 2 118 ? -12.420 -4.313  74.869 1.00 16.62 ? 123 VAL E O   1 
ATOM   2485 C CB  . VAL B 2 118 ? -10.718 -6.458  73.522 1.00 15.93 ? 123 VAL E CB  1 
ATOM   2486 C CG1 . VAL B 2 118 ? -11.131 -6.140  72.096 1.00 15.86 ? 123 VAL E CG1 1 
ATOM   2487 C CG2 . VAL B 2 118 ? -9.579  -7.477  73.531 1.00 16.03 ? 123 VAL E CG2 1 
ATOM   2488 N N   . PHE B 2 119 ? -11.185 -3.081  73.439 1.00 14.23 ? 124 PHE E N   1 
ATOM   2489 C CA  . PHE B 2 119 ? -12.147 -1.987  73.298 1.00 14.91 ? 124 PHE E CA  1 
ATOM   2490 C C   . PHE B 2 119 ? -12.246 -1.507  71.851 1.00 14.66 ? 124 PHE E C   1 
ATOM   2491 O O   . PHE B 2 119 ? -11.233 -1.371  71.173 1.00 14.94 ? 124 PHE E O   1 
ATOM   2492 C CB  . PHE B 2 119 ? -11.708 -0.782  74.130 1.00 15.73 ? 124 PHE E CB  1 
ATOM   2493 C CG  . PHE B 2 119 ? -11.812 -0.981  75.609 1.00 16.01 ? 124 PHE E CG  1 
ATOM   2494 C CD1 . PHE B 2 119 ? -12.985 -0.657  76.285 1.00 17.33 ? 124 PHE E CD1 1 
ATOM   2495 C CD2 . PHE B 2 119 ? -10.726 -1.456  76.335 1.00 16.86 ? 124 PHE E CD2 1 
ATOM   2496 C CE1 . PHE B 2 119 ? -13.074 -0.800  77.671 1.00 17.90 ? 124 PHE E CE1 1 
ATOM   2497 C CE2 . PHE B 2 119 ? -10.805 -1.603  77.722 1.00 18.80 ? 124 PHE E CE2 1 
ATOM   2498 C CZ  . PHE B 2 119 ? -11.981 -1.272  78.388 1.00 18.28 ? 124 PHE E CZ  1 
ATOM   2499 N N   . PRO B 2 120 ? -13.468 -1.224  71.370 1.00 15.18 ? 125 PRO E N   1 
ATOM   2500 C CA  . PRO B 2 120 ? -13.631 -0.744  69.995 1.00 15.48 ? 125 PRO E CA  1 
ATOM   2501 C C   . PRO B 2 120 ? -13.307 0.755   69.986 1.00 14.97 ? 125 PRO E C   1 
ATOM   2502 O O   . PRO B 2 120 ? -13.291 1.401   71.031 1.00 15.43 ? 125 PRO E O   1 
ATOM   2503 C CB  . PRO B 2 120 ? -15.102 -1.028  69.709 1.00 16.73 ? 125 PRO E CB  1 
ATOM   2504 C CG  . PRO B 2 120 ? -15.736 -0.749  71.045 1.00 17.41 ? 125 PRO E CG  1 
ATOM   2505 C CD  . PRO B 2 120 ? -14.777 -1.411  72.023 1.00 16.15 ? 125 PRO E CD  1 
ATOM   2506 N N   . PRO B 2 121 ? -13.028 1.325   68.811 1.00 13.95 ? 126 PRO E N   1 
ATOM   2507 C CA  . PRO B 2 121 ? -12.713 2.753   68.776 1.00 13.56 ? 126 PRO E CA  1 
ATOM   2508 C C   . PRO B 2 121 ? -13.937 3.649   68.878 1.00 14.58 ? 126 PRO E C   1 
ATOM   2509 O O   . PRO B 2 121 ? -15.057 3.222   68.605 1.00 14.46 ? 126 PRO E O   1 
ATOM   2510 C CB  . PRO B 2 121 ? -12.047 2.919   67.415 1.00 15.21 ? 126 PRO E CB  1 
ATOM   2511 C CG  . PRO B 2 121 ? -12.816 1.934   66.570 1.00 13.63 ? 126 PRO E CG  1 
ATOM   2512 C CD  . PRO B 2 121 ? -12.902 0.718   67.472 1.00 14.04 ? 126 PRO E CD  1 
ATOM   2513 N N   . GLU B 2 122 ? -13.706 4.884   69.308 1.00 15.78 ? 127 GLU E N   1 
ATOM   2514 C CA  . GLU B 2 122 ? -14.750 5.896   69.333 1.00 17.33 ? 127 GLU E CA  1 
ATOM   2515 C C   . GLU B 2 122 ? -14.245 6.733   68.164 1.00 16.65 ? 127 GLU E C   1 
ATOM   2516 O O   . GLU B 2 122 ? -13.034 6.897   67.999 1.00 16.46 ? 127 GLU E O   1 
ATOM   2517 C CB  . GLU B 2 122 ? -14.741 6.701   70.631 1.00 21.14 ? 127 GLU E CB  1 
ATOM   2518 C CG  . GLU B 2 122 ? -15.420 5.985   71.787 1.00 27.63 ? 127 GLU E CG  1 
ATOM   2519 C CD  . GLU B 2 122 ? -15.701 6.903   72.962 1.00 31.64 ? 127 GLU E CD  1 
ATOM   2520 O OE1 . GLU B 2 122 ? -16.421 7.908   72.777 1.00 35.73 ? 127 GLU E OE1 1 
ATOM   2521 O OE2 . GLU B 2 122 ? -15.207 6.619   74.071 1.00 36.31 ? 127 GLU E OE2 1 
ATOM   2522 N N   . VAL B 2 123 ? -15.150 7.237   67.337 1.00 14.90 ? 128 VAL E N   1 
ATOM   2523 C CA  . VAL B 2 123 ? -14.727 7.992   66.167 1.00 14.09 ? 128 VAL E CA  1 
ATOM   2524 C C   . VAL B 2 123 ? -15.364 9.376   66.092 1.00 13.46 ? 128 VAL E C   1 
ATOM   2525 O O   . VAL B 2 123 ? -16.553 9.535   66.343 1.00 15.12 ? 128 VAL E O   1 
ATOM   2526 C CB  . VAL B 2 123 ? -15.059 7.185   64.881 1.00 13.60 ? 128 VAL E CB  1 
ATOM   2527 C CG1 . VAL B 2 123 ? -14.586 7.933   63.644 1.00 12.47 ? 128 VAL E CG1 1 
ATOM   2528 C CG2 . VAL B 2 123 ? -14.398 5.805   64.950 1.00 14.59 ? 128 VAL E CG2 1 
ATOM   2529 N N   . ALA B 2 124 ? -14.558 10.380  65.755 1.00 14.54 ? 129 ALA E N   1 
ATOM   2530 C CA  . ALA B 2 124 ? -15.053 11.747  65.638 1.00 13.87 ? 129 ALA E CA  1 
ATOM   2531 C C   . ALA B 2 124 ? -14.455 12.452  64.425 1.00 14.36 ? 129 ALA E C   1 
ATOM   2532 O O   . ALA B 2 124 ? -13.292 12.231  64.073 1.00 14.49 ? 129 ALA E O   1 
ATOM   2533 C CB  . ALA B 2 124 ? -14.736 12.539  66.910 1.00 15.26 ? 129 ALA E CB  1 
ATOM   2534 N N   . VAL B 2 125 ? -15.262 13.286  63.779 1.00 12.37 ? 130 VAL E N   1 
ATOM   2535 C CA  . VAL B 2 125 ? -14.808 14.045  62.620 1.00 14.81 ? 130 VAL E CA  1 
ATOM   2536 C C   . VAL B 2 125 ? -14.779 15.513  63.007 1.00 15.91 ? 130 VAL E C   1 
ATOM   2537 O O   . VAL B 2 125 ? -15.698 16.009  63.662 1.00 16.91 ? 130 VAL E O   1 
ATOM   2538 C CB  . VAL B 2 125 ? -15.747 13.853  61.408 1.00 14.14 ? 130 VAL E CB  1 
ATOM   2539 C CG1 . VAL B 2 125 ? -15.399 14.856  60.309 1.00 16.65 ? 130 VAL E CG1 1 
ATOM   2540 C CG2 . VAL B 2 125 ? -15.607 12.437  60.875 1.00 17.61 ? 130 VAL E CG2 1 
ATOM   2541 N N   . PHE B 2 126 ? -13.706 16.193  62.618 1.00 15.35 ? 131 PHE E N   1 
ATOM   2542 C CA  . PHE B 2 126 ? -13.536 17.605  62.911 1.00 15.94 ? 131 PHE E CA  1 
ATOM   2543 C C   . PHE B 2 126 ? -13.612 18.364  61.591 1.00 17.02 ? 131 PHE E C   1 
ATOM   2544 O O   . PHE B 2 126 ? -12.837 18.108  60.665 1.00 15.91 ? 131 PHE E O   1 
ATOM   2545 C CB  . PHE B 2 126 ? -12.194 17.828  63.614 1.00 15.48 ? 131 PHE E CB  1 
ATOM   2546 C CG  . PHE B 2 126 ? -12.093 17.131  64.943 1.00 16.49 ? 131 PHE E CG  1 
ATOM   2547 C CD1 . PHE B 2 126 ? -11.902 15.752  65.012 1.00 16.54 ? 131 PHE E CD1 1 
ATOM   2548 C CD2 . PHE B 2 126 ? -12.248 17.844  66.130 1.00 17.08 ? 131 PHE E CD2 1 
ATOM   2549 C CE1 . PHE B 2 126 ? -11.873 15.093  66.245 1.00 18.15 ? 131 PHE E CE1 1 
ATOM   2550 C CE2 . PHE B 2 126 ? -12.220 17.193  67.364 1.00 17.01 ? 131 PHE E CE2 1 
ATOM   2551 C CZ  . PHE B 2 126 ? -12.034 15.817  67.422 1.00 17.37 ? 131 PHE E CZ  1 
ATOM   2552 N N   . GLU B 2 127 ? -14.568 19.284  61.509 1.00 16.07 ? 132 GLU E N   1 
ATOM   2553 C CA  . GLU B 2 127 ? -14.789 20.062  60.296 1.00 16.78 ? 132 GLU E CA  1 
ATOM   2554 C C   . GLU B 2 127 ? -13.673 21.069  60.028 1.00 15.84 ? 132 GLU E C   1 
ATOM   2555 O O   . GLU B 2 127 ? -13.007 21.533  60.954 1.00 15.98 ? 132 GLU E O   1 
ATOM   2556 C CB  . GLU B 2 127 ? -16.162 20.742  60.362 1.00 16.97 ? 132 GLU E CB  1 
ATOM   2557 C CG  . GLU B 2 127 ? -17.321 19.751  60.177 1.00 22.20 ? 132 GLU E CG  1 
ATOM   2558 C CD  . GLU B 2 127 ? -18.697 20.388  60.315 1.00 26.43 ? 132 GLU E CD  1 
ATOM   2559 O OE1 . GLU B 2 127 ? -18.849 21.580  59.978 1.00 29.10 ? 132 GLU E OE1 1 
ATOM   2560 O OE2 . GLU B 2 127 ? -19.636 19.684  60.745 1.00 31.28 ? 132 GLU E OE2 1 
ATOM   2561 N N   . PRO B 2 128 ? -13.451 21.410  58.748 1.00 15.30 ? 133 PRO E N   1 
ATOM   2562 C CA  . PRO B 2 128 ? -12.417 22.350  58.302 1.00 16.38 ? 133 PRO E CA  1 
ATOM   2563 C C   . PRO B 2 128 ? -12.417 23.729  58.932 1.00 17.42 ? 133 PRO E C   1 
ATOM   2564 O O   . PRO B 2 128 ? -13.457 24.262  59.312 1.00 18.60 ? 133 PRO E O   1 
ATOM   2565 C CB  . PRO B 2 128 ? -12.647 22.433  56.791 1.00 16.44 ? 133 PRO E CB  1 
ATOM   2566 C CG  . PRO B 2 128 ? -13.252 21.103  56.460 1.00 17.80 ? 133 PRO E CG  1 
ATOM   2567 C CD  . PRO B 2 128 ? -14.221 20.908  57.594 1.00 16.68 ? 133 PRO E CD  1 
ATOM   2568 N N   . SER B 2 129 ? -11.221 24.300  59.021 1.00 17.39 ? 134 SER E N   1 
ATOM   2569 C CA  . SER B 2 129 ? -11.024 25.639  59.553 1.00 17.87 ? 134 SER E CA  1 
ATOM   2570 C C   . SER B 2 129 ? -11.495 26.648  58.512 1.00 17.63 ? 134 SER E C   1 
ATOM   2571 O O   . SER B 2 129 ? -11.147 26.543  57.337 1.00 16.27 ? 134 SER E O   1 
ATOM   2572 C CB  . SER B 2 129 ? -9.541  25.866  59.835 1.00 19.38 ? 134 SER E CB  1 
ATOM   2573 O OG  . SER B 2 129 ? -9.257  27.245  59.992 1.00 21.69 ? 134 SER E OG  1 
ATOM   2574 N N   . GLU B 2 130 ? -12.284 27.628  58.936 1.00 18.41 ? 135 GLU E N   1 
ATOM   2575 C CA  . GLU B 2 130 ? -12.763 28.640  58.004 1.00 20.81 ? 135 GLU E CA  1 
ATOM   2576 C C   . GLU B 2 130 ? -11.557 29.447  57.508 1.00 18.55 ? 135 GLU E C   1 
ATOM   2577 O O   . GLU B 2 130 ? -11.550 29.957  56.387 1.00 18.48 ? 135 GLU E O   1 
ATOM   2578 C CB  . GLU B 2 130 ? -13.768 29.559  58.699 1.00 24.19 ? 135 GLU E CB  1 
ATOM   2579 C CG  . GLU B 2 130 ? -14.782 30.186  57.761 1.00 31.90 ? 135 GLU E CG  1 
ATOM   2580 C CD  . GLU B 2 130 ? -15.621 29.144  57.042 1.00 35.47 ? 135 GLU E CD  1 
ATOM   2581 O OE1 . GLU B 2 130 ? -16.207 28.277  57.726 1.00 39.52 ? 135 GLU E OE1 1 
ATOM   2582 O OE2 . GLU B 2 130 ? -15.696 29.192  55.796 1.00 37.54 ? 135 GLU E OE2 1 
ATOM   2583 N N   . ALA B 2 131 ? -10.533 29.546  58.350 1.00 18.04 ? 136 ALA E N   1 
ATOM   2584 C CA  . ALA B 2 131 ? -9.320  30.273  57.992 1.00 16.90 ? 136 ALA E CA  1 
ATOM   2585 C C   . ALA B 2 131 ? -8.549  29.538  56.895 1.00 16.71 ? 136 ALA E C   1 
ATOM   2586 O O   . ALA B 2 131 ? -8.000  30.166  55.991 1.00 16.61 ? 136 ALA E O   1 
ATOM   2587 C CB  . ALA B 2 131 ? -8.440  30.459  59.220 1.00 16.03 ? 136 ALA E CB  1 
ATOM   2588 N N   . GLU B 2 132 ? -8.495  28.208  56.965 1.00 15.40 ? 137 GLU E N   1 
ATOM   2589 C CA  . GLU B 2 132 ? -7.788  27.465  55.922 1.00 15.18 ? 137 GLU E CA  1 
ATOM   2590 C C   . GLU B 2 132 ? -8.505  27.683  54.595 1.00 15.39 ? 137 GLU E C   1 
ATOM   2591 O O   . GLU B 2 132 ? -7.875  27.914  53.567 1.00 15.05 ? 137 GLU E O   1 
ATOM   2592 C CB  . GLU B 2 132 ? -7.750  25.961  56.221 1.00 16.37 ? 137 GLU E CB  1 
ATOM   2593 C CG  . GLU B 2 132 ? -7.274  25.144  55.013 1.00 17.40 ? 137 GLU E CG  1 
ATOM   2594 C CD  . GLU B 2 132 ? -7.350  23.637  55.215 1.00 18.06 ? 137 GLU E CD  1 
ATOM   2595 O OE1 . GLU B 2 132 ? -8.219  23.171  55.981 1.00 19.49 ? 137 GLU E OE1 1 
ATOM   2596 O OE2 . GLU B 2 132 ? -6.547  22.916  54.584 1.00 19.04 ? 137 GLU E OE2 1 
ATOM   2597 N N   . ILE B 2 133 ? -9.830  27.592  54.629 1.00 15.48 ? 138 ILE E N   1 
ATOM   2598 C CA  . ILE B 2 133 ? -10.650 27.779  53.437 1.00 16.75 ? 138 ILE E CA  1 
ATOM   2599 C C   . ILE B 2 133 ? -10.391 29.135  52.776 1.00 16.96 ? 138 ILE E C   1 
ATOM   2600 O O   . ILE B 2 133 ? -10.232 29.221  51.562 1.00 17.73 ? 138 ILE E O   1 
ATOM   2601 C CB  . ILE B 2 133 ? -12.154 27.653  53.790 1.00 16.37 ? 138 ILE E CB  1 
ATOM   2602 C CG1 . ILE B 2 133 ? -12.469 26.203  54.177 1.00 17.56 ? 138 ILE E CG1 1 
ATOM   2603 C CG2 . ILE B 2 133 ? -13.015 28.105  52.617 1.00 17.73 ? 138 ILE E CG2 1 
ATOM   2604 C CD1 . ILE B 2 133 ? -13.875 25.989  54.694 1.00 17.48 ? 138 ILE E CD1 1 
ATOM   2605 N N   . SER B 2 134 ? -10.331 30.188  53.581 1.00 18.29 ? 139 SER E N   1 
ATOM   2606 C CA  . SER B 2 134 ? -10.107 31.533  53.062 1.00 20.02 ? 139 SER E CA  1 
ATOM   2607 C C   . SER B 2 134 ? -8.682  31.732  52.544 1.00 19.42 ? 139 SER E C   1 
ATOM   2608 O O   . SER B 2 134 ? -8.457  32.380  51.519 1.00 19.99 ? 139 SER E O   1 
ATOM   2609 C CB  . SER B 2 134 ? -10.406 32.559  54.162 1.00 20.84 ? 139 SER E CB  1 
ATOM   2610 O OG  . SER B 2 134 ? -10.277 33.882  53.675 1.00 29.14 ? 139 SER E OG  1 
ATOM   2611 N N   . HIS B 2 135 ? -7.726  31.149  53.253 1.00 17.91 ? 140 HIS E N   1 
ATOM   2612 C CA  . HIS B 2 135 ? -6.316  31.277  52.920 1.00 18.47 ? 140 HIS E CA  1 
ATOM   2613 C C   . HIS B 2 135 ? -5.813  30.407  51.774 1.00 18.42 ? 140 HIS E C   1 
ATOM   2614 O O   . HIS B 2 135 ? -4.986  30.848  50.969 1.00 18.65 ? 140 HIS E O   1 
ATOM   2615 C CB  . HIS B 2 135 ? -5.478  30.975  54.171 1.00 17.82 ? 140 HIS E CB  1 
ATOM   2616 C CG  . HIS B 2 135 ? -4.020  31.279  54.016 1.00 19.29 ? 140 HIS E CG  1 
ATOM   2617 N ND1 . HIS B 2 135 ? -3.536  32.565  53.900 1.00 20.64 ? 140 HIS E ND1 1 
ATOM   2618 C CD2 . HIS B 2 135 ? -2.939  30.465  53.961 1.00 19.92 ? 140 HIS E CD2 1 
ATOM   2619 C CE1 . HIS B 2 135 ? -2.221  32.530  53.779 1.00 21.15 ? 140 HIS E CE1 1 
ATOM   2620 N NE2 . HIS B 2 135 ? -1.833  31.268  53.812 1.00 20.26 ? 140 HIS E NE2 1 
ATOM   2621 N N   . THR B 2 136 ? -6.324  29.182  51.687 1.00 17.32 ? 141 THR E N   1 
ATOM   2622 C CA  . THR B 2 136 ? -5.860  28.234  50.680 1.00 16.29 ? 141 THR E CA  1 
ATOM   2623 C C   . THR B 2 136 ? -6.871  27.756  49.641 1.00 17.25 ? 141 THR E C   1 
ATOM   2624 O O   . THR B 2 136 ? -6.484  27.157  48.635 1.00 16.32 ? 141 THR E O   1 
ATOM   2625 C CB  . THR B 2 136 ? -5.313  26.970  51.361 1.00 16.90 ? 141 THR E CB  1 
ATOM   2626 O OG1 . THR B 2 136 ? -6.407  26.237  51.925 1.00 15.02 ? 141 THR E OG1 1 
ATOM   2627 C CG2 . THR B 2 136 ? -4.340  27.337  52.479 1.00 17.79 ? 141 THR E CG2 1 
ATOM   2628 N N   . GLN B 2 137 ? -8.153  27.999  49.883 1.00 17.85 ? 142 GLN E N   1 
ATOM   2629 C CA  . GLN B 2 137 ? -9.198  27.547  48.966 1.00 18.27 ? 142 GLN E CA  1 
ATOM   2630 C C   . GLN B 2 137 ? -9.287  26.025  49.032 1.00 17.47 ? 142 GLN E C   1 
ATOM   2631 O O   . GLN B 2 137 ? -9.793  25.381  48.112 1.00 16.34 ? 142 GLN E O   1 
ATOM   2632 C CB  . GLN B 2 137 ? -8.894  27.968  47.524 1.00 21.71 ? 142 GLN E CB  1 
ATOM   2633 C CG  . GLN B 2 137 ? -8.575  29.441  47.361 1.00 29.27 ? 142 GLN E CG  1 
ATOM   2634 C CD  . GLN B 2 137 ? -9.547  30.331  48.100 1.00 32.45 ? 142 GLN E CD  1 
ATOM   2635 O OE1 . GLN B 2 137 ? -10.762 30.197  47.956 1.00 37.05 ? 142 GLN E OE1 1 
ATOM   2636 N NE2 . GLN B 2 137 ? -9.015  31.259  48.890 1.00 34.80 ? 142 GLN E NE2 1 
ATOM   2637 N N   . LYS B 2 138 ? -8.760  25.460  50.115 1.00 16.62 ? 143 LYS E N   1 
ATOM   2638 C CA  . LYS B 2 138 ? -8.790  24.018  50.349 1.00 16.47 ? 143 LYS E CA  1 
ATOM   2639 C C   . LYS B 2 138 ? -9.430  23.808  51.719 1.00 15.80 ? 143 LYS E C   1 
ATOM   2640 O O   . LYS B 2 138 ? -9.463  24.721  52.547 1.00 14.04 ? 143 LYS E O   1 
ATOM   2641 C CB  . LYS B 2 138 ? -7.379  23.429  50.368 1.00 18.06 ? 143 LYS E CB  1 
ATOM   2642 C CG  . LYS B 2 138 ? -6.512  23.724  49.153 1.00 22.91 ? 143 LYS E CG  1 
ATOM   2643 C CD  . LYS B 2 138 ? -6.834  22.831  47.974 1.00 28.02 ? 143 LYS E CD  1 
ATOM   2644 C CE  . LYS B 2 138 ? -5.641  22.725  47.025 1.00 29.53 ? 143 LYS E CE  1 
ATOM   2645 N NZ  . LYS B 2 138 ? -5.159  24.052  46.545 1.00 31.82 ? 143 LYS E NZ  1 
ATOM   2646 N N   . ALA B 2 139 ? -9.928  22.601  51.961 1.00 13.96 ? 144 ALA E N   1 
ATOM   2647 C CA  . ALA B 2 139 ? -10.577 22.293  53.231 1.00 13.55 ? 144 ALA E CA  1 
ATOM   2648 C C   . ALA B 2 139 ? -10.126 20.929  53.731 1.00 13.92 ? 144 ALA E C   1 
ATOM   2649 O O   . ALA B 2 139 ? -10.350 19.919  53.069 1.00 14.63 ? 144 ALA E O   1 
ATOM   2650 C CB  . ALA B 2 139 ? -12.092 22.315  53.054 1.00 14.31 ? 144 ALA E CB  1 
ATOM   2651 N N   . THR B 2 140 ? -9.494  20.904  54.902 1.00 14.21 ? 145 THR E N   1 
ATOM   2652 C CA  . THR B 2 140 ? -9.014  19.654  55.478 1.00 14.72 ? 145 THR E CA  1 
ATOM   2653 C C   . THR B 2 140 ? -9.895  19.174  56.622 1.00 14.21 ? 145 THR E C   1 
ATOM   2654 O O   . THR B 2 140 ? -10.113 19.900  57.596 1.00 15.64 ? 145 THR E O   1 
ATOM   2655 C CB  . THR B 2 140 ? -7.573  19.789  56.042 1.00 14.62 ? 145 THR E CB  1 
ATOM   2656 O OG1 . THR B 2 140 ? -6.701  20.306  55.030 1.00 14.69 ? 145 THR E OG1 1 
ATOM   2657 C CG2 . THR B 2 140 ? -7.047  18.428  56.501 1.00 14.76 ? 145 THR E CG2 1 
ATOM   2658 N N   . LEU B 2 141 ? -10.420 17.957  56.487 1.00 13.86 ? 146 LEU E N   1 
ATOM   2659 C CA  . LEU B 2 141 ? -11.222 17.355  57.545 1.00 14.98 ? 146 LEU E CA  1 
ATOM   2660 C C   . LEU B 2 141 ? -10.289 16.402  58.282 1.00 13.40 ? 146 LEU E C   1 
ATOM   2661 O O   . LEU B 2 141 ? -9.373  15.832  57.683 1.00 13.27 ? 146 LEU E O   1 
ATOM   2662 C CB  . LEU B 2 141 ? -12.392 16.537  56.986 1.00 14.95 ? 146 LEU E CB  1 
ATOM   2663 C CG  . LEU B 2 141 ? -13.576 17.229  56.310 1.00 15.48 ? 146 LEU E CG  1 
ATOM   2664 C CD1 . LEU B 2 141 ? -13.208 17.604  54.879 1.00 17.76 ? 146 LEU E CD1 1 
ATOM   2665 C CD2 . LEU B 2 141 ? -14.773 16.279  56.310 1.00 19.19 ? 146 LEU E CD2 1 
ATOM   2666 N N   . VAL B 2 142 ? -10.514 16.231  59.577 1.00 12.39 ? 147 VAL E N   1 
ATOM   2667 C CA  . VAL B 2 142 ? -9.690  15.322  60.356 1.00 13.90 ? 147 VAL E CA  1 
ATOM   2668 C C   . VAL B 2 142 ? -10.568 14.302  61.056 1.00 13.19 ? 147 VAL E C   1 
ATOM   2669 O O   . VAL B 2 142 ? -11.630 14.635  61.580 1.00 14.20 ? 147 VAL E O   1 
ATOM   2670 C CB  . VAL B 2 142 ? -8.856  16.073  61.420 1.00 13.94 ? 147 VAL E CB  1 
ATOM   2671 C CG1 . VAL B 2 142 ? -8.217  15.077  62.383 1.00 15.46 ? 147 VAL E CG1 1 
ATOM   2672 C CG2 . VAL B 2 142 ? -7.786  16.908  60.741 1.00 17.13 ? 147 VAL E CG2 1 
ATOM   2673 N N   . CYS B 2 143 ? -10.128 13.052  61.030 1.00 13.93 ? 148 CYS E N   1 
ATOM   2674 C CA  . CYS B 2 143 ? -10.847 11.983  61.703 1.00 15.01 ? 148 CYS E CA  1 
ATOM   2675 C C   . CYS B 2 143 ? -9.948  11.477  62.812 1.00 14.80 ? 148 CYS E C   1 
ATOM   2676 O O   . CYS B 2 143 ? -8.759  11.253  62.593 1.00 15.46 ? 148 CYS E O   1 
ATOM   2677 C CB  . CYS B 2 143 ? -11.132 10.820  60.758 1.00 16.82 ? 148 CYS E CB  1 
ATOM   2678 S SG  . CYS B 2 143 ? -12.124 9.503   61.535 1.00 17.75 ? 148 CYS E SG  1 
ATOM   2679 N N   . LEU B 2 144 ? -10.517 11.306  63.998 1.00 14.56 ? 149 LEU E N   1 
ATOM   2680 C CA  . LEU B 2 144 ? -9.764  10.796  65.131 1.00 15.87 ? 149 LEU E CA  1 
ATOM   2681 C C   . LEU B 2 144 ? -10.448 9.544   65.672 1.00 15.10 ? 149 LEU E C   1 
ATOM   2682 O O   . LEU B 2 144 ? -11.619 9.590   66.041 1.00 15.49 ? 149 LEU E O   1 
ATOM   2683 C CB  . LEU B 2 144 ? -9.689  11.849  66.236 1.00 18.84 ? 149 LEU E CB  1 
ATOM   2684 C CG  . LEU B 2 144 ? -8.304  12.369  66.634 1.00 23.90 ? 149 LEU E CG  1 
ATOM   2685 C CD1 . LEU B 2 144 ? -7.611  12.977  65.432 1.00 23.25 ? 149 LEU E CD1 1 
ATOM   2686 C CD2 . LEU B 2 144 ? -8.444  13.399  67.752 1.00 23.48 ? 149 LEU E CD2 1 
ATOM   2687 N N   . ALA B 2 145 ? -9.718  8.433   65.688 1.00 13.71 ? 150 ALA E N   1 
ATOM   2688 C CA  . ALA B 2 145 ? -10.216 7.169   66.222 1.00 14.41 ? 150 ALA E CA  1 
ATOM   2689 C C   . ALA B 2 145 ? -9.463  7.006   67.536 1.00 14.75 ? 150 ALA E C   1 
ATOM   2690 O O   . ALA B 2 145 ? -8.230  7.002   67.548 1.00 15.19 ? 150 ALA E O   1 
ATOM   2691 C CB  . ALA B 2 145 ? -9.887  6.018   65.275 1.00 13.48 ? 150 ALA E CB  1 
ATOM   2692 N N   . THR B 2 146 ? -10.192 6.858   68.637 1.00 15.10 ? 151 THR E N   1 
ATOM   2693 C CA  . THR B 2 146 ? -9.540  6.755   69.937 1.00 15.85 ? 151 THR E CA  1 
ATOM   2694 C C   . THR B 2 146 ? -10.051 5.657   70.855 1.00 15.28 ? 151 THR E C   1 
ATOM   2695 O O   . THR B 2 146 ? -11.130 5.099   70.657 1.00 16.35 ? 151 THR E O   1 
ATOM   2696 C CB  . THR B 2 146 ? -9.668  8.083   70.715 1.00 17.59 ? 151 THR E CB  1 
ATOM   2697 O OG1 . THR B 2 146 ? -11.055 8.387   70.908 1.00 17.91 ? 151 THR E OG1 1 
ATOM   2698 C CG2 . THR B 2 146 ? -9.010  9.223   69.949 1.00 17.95 ? 151 THR E CG2 1 
ATOM   2699 N N   . GLY B 2 147 ? -9.244  5.361   71.867 1.00 14.94 ? 152 GLY E N   1 
ATOM   2700 C CA  . GLY B 2 147 ? -9.605  4.371   72.862 1.00 15.72 ? 152 GLY E CA  1 
ATOM   2701 C C   . GLY B 2 147 ? -9.753  2.927   72.444 1.00 16.02 ? 152 GLY E C   1 
ATOM   2702 O O   . GLY B 2 147 ? -10.451 2.170   73.122 1.00 16.74 ? 152 GLY E O   1 
ATOM   2703 N N   . PHE B 2 148 ? -9.105  2.518   71.359 1.00 15.29 ? 153 PHE E N   1 
ATOM   2704 C CA  . PHE B 2 148 ? -9.227  1.131   70.938 1.00 13.51 ? 153 PHE E CA  1 
ATOM   2705 C C   . PHE B 2 148 ? -8.041  0.243   71.305 1.00 14.54 ? 153 PHE E C   1 
ATOM   2706 O O   . PHE B 2 148 ? -6.925  0.713   71.530 1.00 14.26 ? 153 PHE E O   1 
ATOM   2707 C CB  . PHE B 2 148 ? -9.496  1.036   69.426 1.00 14.51 ? 153 PHE E CB  1 
ATOM   2708 C CG  . PHE B 2 148 ? -8.438  1.674   68.564 1.00 14.65 ? 153 PHE E CG  1 
ATOM   2709 C CD1 . PHE B 2 148 ? -8.503  3.029   68.247 1.00 15.16 ? 153 PHE E CD1 1 
ATOM   2710 C CD2 . PHE B 2 148 ? -7.397  0.912   68.035 1.00 13.62 ? 153 PHE E CD2 1 
ATOM   2711 C CE1 . PHE B 2 148 ? -7.548  3.618   67.408 1.00 16.55 ? 153 PHE E CE1 1 
ATOM   2712 C CE2 . PHE B 2 148 ? -6.439  1.487   67.199 1.00 15.55 ? 153 PHE E CE2 1 
ATOM   2713 C CZ  . PHE B 2 148 ? -6.517  2.847   66.883 1.00 14.89 ? 153 PHE E CZ  1 
ATOM   2714 N N   . TYR B 2 149 ? -8.320  -1.052  71.390 1.00 13.49 ? 154 TYR E N   1 
ATOM   2715 C CA  . TYR B 2 149 ? -7.322  -2.063  71.693 1.00 13.42 ? 154 TYR E CA  1 
ATOM   2716 C C   . TYR B 2 149 ? -7.911  -3.392  71.249 1.00 13.54 ? 154 TYR E C   1 
ATOM   2717 O O   . TYR B 2 149 ? -9.069  -3.687  71.546 1.00 14.04 ? 154 TYR E O   1 
ATOM   2718 C CB  . TYR B 2 149 ? -7.024  -2.125  73.194 1.00 13.85 ? 154 TYR E CB  1 
ATOM   2719 C CG  . TYR B 2 149 ? -5.937  -3.125  73.529 1.00 15.21 ? 154 TYR E CG  1 
ATOM   2720 C CD1 . TYR B 2 149 ? -4.595  -2.744  73.571 1.00 15.60 ? 154 TYR E CD1 1 
ATOM   2721 C CD2 . TYR B 2 149 ? -6.247  -4.465  73.746 1.00 15.50 ? 154 TYR E CD2 1 
ATOM   2722 C CE1 . TYR B 2 149 ? -3.585  -3.684  73.823 1.00 18.04 ? 154 TYR E CE1 1 
ATOM   2723 C CE2 . TYR B 2 149 ? -5.255  -5.405  73.995 1.00 17.40 ? 154 TYR E CE2 1 
ATOM   2724 C CZ  . TYR B 2 149 ? -3.929  -5.014  74.032 1.00 18.97 ? 154 TYR E CZ  1 
ATOM   2725 O OH  . TYR B 2 149 ? -2.958  -5.963  74.275 1.00 22.67 ? 154 TYR E OH  1 
ATOM   2726 N N   . PRO B 2 150 ? -7.130  -4.211  70.529 1.00 12.43 ? 155 PRO E N   1 
ATOM   2727 C CA  . PRO B 2 150 ? -5.744  -4.004  70.097 1.00 14.35 ? 155 PRO E CA  1 
ATOM   2728 C C   . PRO B 2 150 ? -5.653  -3.008  68.944 1.00 14.71 ? 155 PRO E C   1 
ATOM   2729 O O   . PRO B 2 150 ? -6.667  -2.475  68.494 1.00 13.96 ? 155 PRO E O   1 
ATOM   2730 C CB  . PRO B 2 150 ? -5.314  -5.403  69.673 1.00 15.24 ? 155 PRO E CB  1 
ATOM   2731 C CG  . PRO B 2 150 ? -6.563  -5.939  69.068 1.00 13.80 ? 155 PRO E CG  1 
ATOM   2732 C CD  . PRO B 2 150 ? -7.628  -5.517  70.062 1.00 12.70 ? 155 PRO E CD  1 
ATOM   2733 N N   . ASP B 2 151 ? -4.436  -2.756  68.474 1.00 16.56 ? 156 ASP E N   1 
ATOM   2734 C CA  . ASP B 2 151 ? -4.249  -1.826  67.366 1.00 18.90 ? 156 ASP E CA  1 
ATOM   2735 C C   . ASP B 2 151 ? -4.514  -2.550  66.048 1.00 18.37 ? 156 ASP E C   1 
ATOM   2736 O O   . ASP B 2 151 ? -3.628  -2.677  65.203 1.00 20.53 ? 156 ASP E O   1 
ATOM   2737 C CB  . ASP B 2 151 ? -2.829  -1.244  67.378 1.00 21.63 ? 156 ASP E CB  1 
ATOM   2738 C CG  . ASP B 2 151 ? -1.754  -2.311  67.348 1.00 28.14 ? 156 ASP E CG  1 
ATOM   2739 O OD1 . ASP B 2 151 ? -2.051  -3.455  66.947 1.00 32.31 ? 156 ASP E OD1 1 
ATOM   2740 O OD2 . ASP B 2 151 ? -0.602  -1.999  67.718 1.00 30.35 ? 156 ASP E OD2 1 
ATOM   2741 N N   . HIS B 2 152 ? -5.744  -3.024  65.886 1.00 16.27 ? 157 HIS E N   1 
ATOM   2742 C CA  . HIS B 2 152 ? -6.158  -3.742  64.684 1.00 15.31 ? 157 HIS E CA  1 
ATOM   2743 C C   . HIS B 2 152 ? -7.298  -2.967  64.033 1.00 15.19 ? 157 HIS E C   1 
ATOM   2744 O O   . HIS B 2 152 ? -8.470  -3.284  64.247 1.00 15.27 ? 157 HIS E O   1 
ATOM   2745 C CB  . HIS B 2 152 ? -6.671  -5.145  65.034 1.00 15.52 ? 157 HIS E CB  1 
ATOM   2746 C CG  . HIS B 2 152 ? -5.644  -6.047  65.648 1.00 15.67 ? 157 HIS E CG  1 
ATOM   2747 N ND1 . HIS B 2 152 ? -4.332  -5.673  65.842 1.00 17.58 ? 157 HIS E ND1 1 
ATOM   2748 C CD2 . HIS B 2 152 ? -5.741  -7.323  66.091 1.00 15.40 ? 157 HIS E CD2 1 
ATOM   2749 C CE1 . HIS B 2 152 ? -3.664  -6.681  66.379 1.00 16.94 ? 157 HIS E CE1 1 
ATOM   2750 N NE2 . HIS B 2 152 ? -4.496  -7.693  66.541 1.00 16.88 ? 157 HIS E NE2 1 
ATOM   2751 N N   . VAL B 2 153 ? -6.961  -1.954  63.242 1.00 14.14 ? 158 VAL E N   1 
ATOM   2752 C CA  . VAL B 2 153 ? -7.978  -1.138  62.589 1.00 14.66 ? 158 VAL E CA  1 
ATOM   2753 C C   . VAL B 2 153 ? -7.597  -0.758  61.168 1.00 14.18 ? 158 VAL E C   1 
ATOM   2754 O O   . VAL B 2 153 ? -6.427  -0.797  60.792 1.00 13.34 ? 158 VAL E O   1 
ATOM   2755 C CB  . VAL B 2 153 ? -8.222  0.189   63.353 1.00 15.32 ? 158 VAL E CB  1 
ATOM   2756 C CG1 . VAL B 2 153 ? -8.764  -0.087  64.755 1.00 16.61 ? 158 VAL E CG1 1 
ATOM   2757 C CG2 . VAL B 2 153 ? -6.928  0.986   63.430 1.00 17.56 ? 158 VAL E CG2 1 
ATOM   2758 N N   . GLU B 2 154 ? -8.607  -0.401  60.383 1.00 12.64 ? 159 GLU E N   1 
ATOM   2759 C CA  . GLU B 2 154 ? -8.400  0.050   59.012 1.00 14.24 ? 159 GLU E CA  1 
ATOM   2760 C C   . GLU B 2 154 ? -9.358  1.216   58.839 1.00 13.18 ? 159 GLU E C   1 
ATOM   2761 O O   . GLU B 2 154 ? -10.571 1.064   58.963 1.00 13.66 ? 159 GLU E O   1 
ATOM   2762 C CB  . GLU B 2 154 ? -8.713  -1.062  58.013 1.00 17.54 ? 159 GLU E CB  1 
ATOM   2763 C CG  . GLU B 2 154 ? -7.905  -2.324  58.260 1.00 21.48 ? 159 GLU E CG  1 
ATOM   2764 C CD  . GLU B 2 154 ? -8.247  -3.448  57.303 1.00 25.67 ? 159 GLU E CD  1 
ATOM   2765 O OE1 . GLU B 2 154 ? -9.429  -3.560  56.907 1.00 29.36 ? 159 GLU E OE1 1 
ATOM   2766 O OE2 . GLU B 2 154 ? -7.335  -4.229  56.961 1.00 24.69 ? 159 GLU E OE2 1 
ATOM   2767 N N   . LEU B 2 155 ? -8.800  2.387   58.567 1.00 12.74 ? 160 LEU E N   1 
ATOM   2768 C CA  . LEU B 2 155 ? -9.594  3.593   58.407 1.00 12.90 ? 160 LEU E CA  1 
ATOM   2769 C C   . LEU B 2 155 ? -9.749  3.969   56.939 1.00 12.45 ? 160 LEU E C   1 
ATOM   2770 O O   . LEU B 2 155 ? -8.808  3.850   56.160 1.00 13.36 ? 160 LEU E O   1 
ATOM   2771 C CB  . LEU B 2 155 ? -8.933  4.731   59.191 1.00 13.72 ? 160 LEU E CB  1 
ATOM   2772 C CG  . LEU B 2 155 ? -9.622  6.092   59.284 1.00 13.21 ? 160 LEU E CG  1 
ATOM   2773 C CD1 . LEU B 2 155 ? -9.107  6.835   60.517 1.00 14.58 ? 160 LEU E CD1 1 
ATOM   2774 C CD2 . LEU B 2 155 ? -9.354  6.893   58.015 1.00 14.36 ? 160 LEU E CD2 1 
ATOM   2775 N N   . SER B 2 156 ? -10.948 4.410   56.571 1.00 11.79 ? 161 SER E N   1 
ATOM   2776 C CA  . SER B 2 156 ? -11.236 4.814   55.199 1.00 11.77 ? 161 SER E CA  1 
ATOM   2777 C C   . SER B 2 156 ? -12.225 5.974   55.181 1.00 12.85 ? 161 SER E C   1 
ATOM   2778 O O   . SER B 2 156 ? -12.961 6.193   56.146 1.00 13.77 ? 161 SER E O   1 
ATOM   2779 C CB  . SER B 2 156 ? -11.815 3.639   54.403 1.00 14.09 ? 161 SER E CB  1 
ATOM   2780 O OG  . SER B 2 156 ? -12.973 3.105   55.030 1.00 13.82 ? 161 SER E OG  1 
ATOM   2781 N N   . TRP B 2 157 ? -12.224 6.728   54.088 1.00 12.03 ? 162 TRP E N   1 
ATOM   2782 C CA  . TRP B 2 157 ? -13.133 7.854   53.943 1.00 11.77 ? 162 TRP E CA  1 
ATOM   2783 C C   . TRP B 2 157 ? -14.113 7.571   52.820 1.00 12.39 ? 162 TRP E C   1 
ATOM   2784 O O   . TRP B 2 157 ? -13.743 7.014   51.785 1.00 12.76 ? 162 TRP E O   1 
ATOM   2785 C CB  . TRP B 2 157 ? -12.387 9.143   53.609 1.00 11.74 ? 162 TRP E CB  1 
ATOM   2786 C CG  . TRP B 2 157 ? -11.600 9.731   54.729 1.00 10.97 ? 162 TRP E CG  1 
ATOM   2787 C CD1 . TRP B 2 157 ? -10.298 9.471   55.043 1.00 13.45 ? 162 TRP E CD1 1 
ATOM   2788 C CD2 . TRP B 2 157 ? -12.038 10.747  55.638 1.00 11.39 ? 162 TRP E CD2 1 
ATOM   2789 N NE1 . TRP B 2 157 ? -9.891  10.273  56.084 1.00 11.89 ? 162 TRP E NE1 1 
ATOM   2790 C CE2 . TRP B 2 157 ? -10.939 11.066  56.469 1.00 11.88 ? 162 TRP E CE2 1 
ATOM   2791 C CE3 . TRP B 2 157 ? -13.250 11.422  55.828 1.00 12.00 ? 162 TRP E CE3 1 
ATOM   2792 C CZ2 . TRP B 2 157 ? -11.017 12.037  57.476 1.00 14.01 ? 162 TRP E CZ2 1 
ATOM   2793 C CZ3 . TRP B 2 157 ? -13.328 12.390  56.830 1.00 12.15 ? 162 TRP E CZ3 1 
ATOM   2794 C CH2 . TRP B 2 157 ? -12.216 12.686  57.640 1.00 13.05 ? 162 TRP E CH2 1 
ATOM   2795 N N   . TRP B 2 158 ? -15.356 7.989   53.030 1.00 12.17 ? 163 TRP E N   1 
ATOM   2796 C CA  . TRP B 2 158 ? -16.414 7.778   52.053 1.00 12.93 ? 163 TRP E CA  1 
ATOM   2797 C C   . TRP B 2 158 ? -17.146 9.079   51.804 1.00 13.84 ? 163 TRP E C   1 
ATOM   2798 O O   . TRP B 2 158 ? -17.626 9.723   52.739 1.00 13.32 ? 163 TRP E O   1 
ATOM   2799 C CB  . TRP B 2 158 ? -17.387 6.717   52.568 1.00 14.23 ? 163 TRP E CB  1 
ATOM   2800 C CG  . TRP B 2 158 ? -16.702 5.424   52.858 1.00 13.14 ? 163 TRP E CG  1 
ATOM   2801 C CD1 . TRP B 2 158 ? -15.855 5.161   53.902 1.00 13.56 ? 163 TRP E CD1 1 
ATOM   2802 C CD2 . TRP B 2 158 ? -16.739 4.234   52.062 1.00 13.42 ? 163 TRP E CD2 1 
ATOM   2803 N NE1 . TRP B 2 158 ? -15.361 3.885   53.798 1.00 13.93 ? 163 TRP E NE1 1 
ATOM   2804 C CE2 . TRP B 2 158 ? -15.884 3.293   52.679 1.00 12.93 ? 163 TRP E CE2 1 
ATOM   2805 C CE3 . TRP B 2 158 ? -17.408 3.871   50.883 1.00 12.32 ? 163 TRP E CE3 1 
ATOM   2806 C CZ2 . TRP B 2 158 ? -15.681 2.012   52.159 1.00 13.69 ? 163 TRP E CZ2 1 
ATOM   2807 C CZ3 . TRP B 2 158 ? -17.203 2.598   50.366 1.00 13.50 ? 163 TRP E CZ3 1 
ATOM   2808 C CH2 . TRP B 2 158 ? -16.345 1.682   51.004 1.00 13.51 ? 163 TRP E CH2 1 
ATOM   2809 N N   . VAL B 2 159 ? -17.228 9.468   50.536 1.00 12.74 ? 164 VAL E N   1 
ATOM   2810 C CA  . VAL B 2 159 ? -17.900 10.695  50.165 1.00 14.10 ? 164 VAL E CA  1 
ATOM   2811 C C   . VAL B 2 159 ? -19.087 10.344  49.280 1.00 14.91 ? 164 VAL E C   1 
ATOM   2812 O O   . VAL B 2 159 ? -18.925 9.742   48.220 1.00 14.58 ? 164 VAL E O   1 
ATOM   2813 C CB  . VAL B 2 159 ? -16.935 11.637  49.413 1.00 16.06 ? 164 VAL E CB  1 
ATOM   2814 C CG1 . VAL B 2 159 ? -17.659 12.902  48.991 1.00 15.95 ? 164 VAL E CG1 1 
ATOM   2815 C CG2 . VAL B 2 159 ? -15.745 11.973  50.315 1.00 16.45 ? 164 VAL E CG2 1 
ATOM   2816 N N   . ASN B 2 160 ? -20.276 10.714  49.741 1.00 15.48 ? 165 ASN E N   1 
ATOM   2817 C CA  . ASN B 2 160 ? -21.513 10.428  49.026 1.00 15.31 ? 165 ASN E CA  1 
ATOM   2818 C C   . ASN B 2 160 ? -21.641 8.939   48.708 1.00 15.29 ? 165 ASN E C   1 
ATOM   2819 O O   . ASN B 2 160 ? -22.093 8.553   47.626 1.00 15.19 ? 165 ASN E O   1 
ATOM   2820 C CB  . ASN B 2 160 ? -21.593 11.271  47.747 1.00 15.28 ? 165 ASN E CB  1 
ATOM   2821 C CG  . ASN B 2 160 ? -21.634 12.759  48.040 1.00 15.61 ? 165 ASN E CG  1 
ATOM   2822 O OD1 . ASN B 2 160 ? -22.219 13.184  49.041 1.00 17.14 ? 165 ASN E OD1 1 
ATOM   2823 N ND2 . ASN B 2 160 ? -21.024 13.560  47.169 1.00 16.95 ? 165 ASN E ND2 1 
ATOM   2824 N N   . GLY B 2 161 ? -21.220 8.109   49.659 1.00 14.21 ? 166 GLY E N   1 
ATOM   2825 C CA  . GLY B 2 161 ? -21.320 6.670   49.491 1.00 13.01 ? 166 GLY E CA  1 
ATOM   2826 C C   . GLY B 2 161 ? -20.221 5.994   48.694 1.00 13.68 ? 166 GLY E C   1 
ATOM   2827 O O   . GLY B 2 161 ? -20.290 4.791   48.456 1.00 14.81 ? 166 GLY E O   1 
ATOM   2828 N N   . LYS B 2 162 ? -19.208 6.754   48.288 1.00 14.12 ? 167 LYS E N   1 
ATOM   2829 C CA  . LYS B 2 162 ? -18.105 6.207   47.503 1.00 15.02 ? 167 LYS E CA  1 
ATOM   2830 C C   . LYS B 2 162 ? -16.772 6.389   48.221 1.00 14.59 ? 167 LYS E C   1 
ATOM   2831 O O   . LYS B 2 162 ? -16.457 7.483   48.685 1.00 15.76 ? 167 LYS E O   1 
ATOM   2832 C CB  . LYS B 2 162 ? -18.049 6.899   46.140 1.00 18.06 ? 167 LYS E CB  1 
ATOM   2833 C CG  . LYS B 2 162 ? -19.268 6.644   45.265 1.00 22.82 ? 167 LYS E CG  1 
ATOM   2834 C CD  . LYS B 2 162 ? -19.285 7.568   44.056 1.00 25.45 ? 167 LYS E CD  1 
ATOM   2835 C CE  . LYS B 2 162 ? -19.660 8.987   44.453 1.00 29.75 ? 167 LYS E CE  1 
ATOM   2836 N NZ  . LYS B 2 162 ? -21.058 9.072   44.975 1.00 30.81 ? 167 LYS E NZ  1 
ATOM   2837 N N   . GLU B 2 163 ? -15.985 5.322   48.304 1.00 15.36 ? 168 GLU E N   1 
ATOM   2838 C CA  . GLU B 2 163 ? -14.695 5.415   48.979 1.00 14.69 ? 168 GLU E CA  1 
ATOM   2839 C C   . GLU B 2 163 ? -13.731 6.285   48.183 1.00 15.46 ? 168 GLU E C   1 
ATOM   2840 O O   . GLU B 2 163 ? -13.664 6.195   46.957 1.00 15.33 ? 168 GLU E O   1 
ATOM   2841 C CB  . GLU B 2 163 ? -14.077 4.026   49.186 1.00 15.14 ? 168 GLU E CB  1 
ATOM   2842 C CG  . GLU B 2 163 ? -12.677 4.089   49.797 1.00 18.91 ? 168 GLU E CG  1 
ATOM   2843 C CD  . GLU B 2 163 ? -12.161 2.745   50.274 1.00 20.29 ? 168 GLU E CD  1 
ATOM   2844 O OE1 . GLU B 2 163 ? -12.676 1.701   49.818 1.00 20.30 ? 168 GLU E OE1 1 
ATOM   2845 O OE2 . GLU B 2 163 ? -11.223 2.739   51.103 1.00 23.15 ? 168 GLU E OE2 1 
ATOM   2846 N N   . VAL B 2 164 ? -12.994 7.143   48.880 1.00 15.87 ? 169 VAL E N   1 
ATOM   2847 C CA  . VAL B 2 164 ? -12.033 8.007   48.205 1.00 19.59 ? 169 VAL E CA  1 
ATOM   2848 C C   . VAL B 2 164 ? -10.616 7.639   48.604 1.00 20.66 ? 169 VAL E C   1 
ATOM   2849 O O   . VAL B 2 164 ? -10.367 7.209   49.727 1.00 20.87 ? 169 VAL E O   1 
ATOM   2850 C CB  . VAL B 2 164 ? -12.267 9.497   48.532 1.00 21.83 ? 169 VAL E CB  1 
ATOM   2851 C CG1 . VAL B 2 164 ? -13.572 9.967   47.913 1.00 22.95 ? 169 VAL E CG1 1 
ATOM   2852 C CG2 . VAL B 2 164 ? -12.284 9.703   50.029 1.00 22.02 ? 169 VAL E CG2 1 
ATOM   2853 N N   . HIS B 2 165 ? -9.684  7.797   47.674 1.00 22.72 ? 170 HIS E N   1 
ATOM   2854 C CA  . HIS B 2 165 ? -8.295  7.485   47.966 1.00 25.73 ? 170 HIS E CA  1 
ATOM   2855 C C   . HIS B 2 165 ? -7.460  8.749   47.797 1.00 25.23 ? 170 HIS E C   1 
ATOM   2856 O O   . HIS B 2 165 ? -6.575  9.042   48.605 1.00 26.63 ? 170 HIS E O   1 
ATOM   2857 C CB  . HIS B 2 165 ? -7.816  6.368   47.042 1.00 29.71 ? 170 HIS E CB  1 
ATOM   2858 C CG  . HIS B 2 165 ? -8.611  5.105   47.172 1.00 33.29 ? 170 HIS E CG  1 
ATOM   2859 N ND1 . HIS B 2 165 ? -8.589  4.326   48.310 1.00 34.80 ? 170 HIS E ND1 1 
ATOM   2860 C CD2 . HIS B 2 165 ? -9.484  4.507   46.326 1.00 34.08 ? 170 HIS E CD2 1 
ATOM   2861 C CE1 . HIS B 2 165 ? -9.414  3.305   48.159 1.00 34.87 ? 170 HIS E CE1 1 
ATOM   2862 N NE2 . HIS B 2 165 ? -9.970  3.392   46.964 1.00 35.91 ? 170 HIS E NE2 1 
ATOM   2863 N N   . SER B 2 166 ? -7.759  9.513   46.755 1.00 22.81 ? 171 SER E N   1 
ATOM   2864 C CA  . SER B 2 166 ? -7.036  10.752  46.510 1.00 20.92 ? 171 SER E CA  1 
ATOM   2865 C C   . SER B 2 166 ? -7.354  11.754  47.615 1.00 20.63 ? 171 SER E C   1 
ATOM   2866 O O   . SER B 2 166 ? -8.486  11.821  48.102 1.00 20.89 ? 171 SER E O   1 
ATOM   2867 C CB  . SER B 2 166 ? -7.434  11.342  45.153 1.00 22.68 ? 171 SER E CB  1 
ATOM   2868 O OG  . SER B 2 166 ? -6.791  12.586  44.921 1.00 24.11 ? 171 SER E OG  1 
ATOM   2869 N N   . GLY B 2 167 ? -6.347  12.519  48.022 1.00 17.58 ? 172 GLY E N   1 
ATOM   2870 C CA  . GLY B 2 167 ? -6.555  13.526  49.046 1.00 16.68 ? 172 GLY E CA  1 
ATOM   2871 C C   . GLY B 2 167 ? -6.645  13.038  50.481 1.00 15.42 ? 172 GLY E C   1 
ATOM   2872 O O   . GLY B 2 167 ? -7.011  13.808  51.366 1.00 14.49 ? 172 GLY E O   1 
ATOM   2873 N N   . VAL B 2 168 ? -6.292  11.778  50.718 1.00 16.15 ? 173 VAL E N   1 
ATOM   2874 C CA  . VAL B 2 168 ? -6.340  11.202  52.061 1.00 16.26 ? 173 VAL E CA  1 
ATOM   2875 C C   . VAL B 2 168 ? -4.952  10.849  52.584 1.00 16.00 ? 173 VAL E C   1 
ATOM   2876 O O   . VAL B 2 168 ? -4.096  10.393  51.830 1.00 17.89 ? 173 VAL E O   1 
ATOM   2877 C CB  . VAL B 2 168 ? -7.178  9.902   52.085 1.00 16.33 ? 173 VAL E CB  1 
ATOM   2878 C CG1 . VAL B 2 168 ? -7.056  9.227   53.445 1.00 17.37 ? 173 VAL E CG1 1 
ATOM   2879 C CG2 . VAL B 2 168 ? -8.635  10.210  51.767 1.00 18.11 ? 173 VAL E CG2 1 
ATOM   2880 N N   . SER B 2 169 ? -4.727  11.089  53.874 1.00 17.38 ? 174 SER E N   1 
ATOM   2881 C CA  . SER B 2 169 ? -3.461  10.735  54.506 1.00 16.44 ? 174 SER E CA  1 
ATOM   2882 C C   . SER B 2 169 ? -3.766  10.247  55.915 1.00 15.99 ? 174 SER E C   1 
ATOM   2883 O O   . SER B 2 169 ? -4.215  11.010  56.764 1.00 16.23 ? 174 SER E O   1 
ATOM   2884 C CB  . SER B 2 169 ? -2.507  11.928  54.567 1.00 18.09 ? 174 SER E CB  1 
ATOM   2885 O OG  . SER B 2 169 ? -1.248  11.514  55.078 1.00 23.56 ? 174 SER E OG  1 
ATOM   2886 N N   . THR B 2 170 ? -3.523  8.963   56.147 1.00 15.68 ? 175 THR E N   1 
ATOM   2887 C CA  . THR B 2 170 ? -3.784  8.351   57.443 1.00 16.43 ? 175 THR E CA  1 
ATOM   2888 C C   . THR B 2 170 ? -2.474  7.972   58.121 1.00 16.23 ? 175 THR E C   1 
ATOM   2889 O O   . THR B 2 170 ? -1.536  7.537   57.456 1.00 17.45 ? 175 THR E O   1 
ATOM   2890 C CB  . THR B 2 170 ? -4.654  7.104   57.251 1.00 15.37 ? 175 THR E CB  1 
ATOM   2891 O OG1 . THR B 2 170 ? -5.887  7.496   56.637 1.00 16.29 ? 175 THR E OG1 1 
ATOM   2892 C CG2 . THR B 2 170 ? -4.941  6.421   58.581 1.00 16.87 ? 175 THR E CG2 1 
ATOM   2893 N N   . ASP B 2 171 ? -2.406  8.145   59.440 1.00 17.91 ? 176 ASP E N   1 
ATOM   2894 C CA  . ASP B 2 171 ? -1.187  7.807   60.171 1.00 18.17 ? 176 ASP E CA  1 
ATOM   2895 C C   . ASP B 2 171 ? -0.811  6.352   59.904 1.00 17.77 ? 176 ASP E C   1 
ATOM   2896 O O   . ASP B 2 171 ? -1.673  5.472   59.868 1.00 17.21 ? 176 ASP E O   1 
ATOM   2897 C CB  . ASP B 2 171 ? -1.369  8.003   61.682 1.00 19.68 ? 176 ASP E CB  1 
ATOM   2898 C CG  . ASP B 2 171 ? -1.788  9.415   62.052 1.00 21.48 ? 176 ASP E CG  1 
ATOM   2899 O OD1 . ASP B 2 171 ? -1.474  10.361  61.298 1.00 23.40 ? 176 ASP E OD1 1 
ATOM   2900 O OD2 . ASP B 2 171 ? -2.422  9.578   63.117 1.00 21.51 ? 176 ASP E OD2 1 
ATOM   2901 N N   . PRO B 2 172 ? 0.488   6.079   59.717 1.00 19.55 ? 177 PRO E N   1 
ATOM   2902 C CA  . PRO B 2 172 ? 0.982   4.724   59.453 1.00 22.30 ? 177 PRO E CA  1 
ATOM   2903 C C   . PRO B 2 172 ? 0.690   3.737   60.585 1.00 23.35 ? 177 PRO E C   1 
ATOM   2904 O O   . PRO B 2 172 ? 0.418   2.564   60.336 1.00 23.48 ? 177 PRO E O   1 
ATOM   2905 C CB  . PRO B 2 172 ? 2.483   4.936   59.260 1.00 21.35 ? 177 PRO E CB  1 
ATOM   2906 C CG  . PRO B 2 172 ? 2.565   6.324   58.726 1.00 23.52 ? 177 PRO E CG  1 
ATOM   2907 C CD  . PRO B 2 172 ? 1.577   7.062   59.590 1.00 21.57 ? 177 PRO E CD  1 
ATOM   2908 N N   . GLN B 2 173 ? 0.744   4.218   61.822 1.00 26.52 ? 178 GLN E N   1 
ATOM   2909 C CA  . GLN B 2 173 ? 0.498   3.363   62.975 1.00 30.01 ? 178 GLN E CA  1 
ATOM   2910 C C   . GLN B 2 173 ? -0.170  4.075   64.144 1.00 30.42 ? 178 GLN E C   1 
ATOM   2911 O O   . GLN B 2 173 ? 0.143   5.225   64.450 1.00 30.33 ? 178 GLN E O   1 
ATOM   2912 C CB  . GLN B 2 173 ? 1.813   2.734   63.445 1.00 33.68 ? 178 GLN E CB  1 
ATOM   2913 C CG  . GLN B 2 173 ? 2.211   1.491   62.665 1.00 37.56 ? 178 GLN E CG  1 
ATOM   2914 C CD  . GLN B 2 173 ? 1.261   0.334   62.910 1.00 40.76 ? 178 GLN E CD  1 
ATOM   2915 O OE1 . GLN B 2 173 ? 1.075   -0.095  64.049 1.00 43.57 ? 178 GLN E OE1 1 
ATOM   2916 N NE2 . GLN B 2 173 ? 0.653   -0.176  61.844 1.00 42.44 ? 178 GLN E NE2 1 
ATOM   2917 N N   . PRO B 2 174 ? -1.116  3.390   64.805 1.00 30.47 ? 179 PRO E N   1 
ATOM   2918 C CA  . PRO B 2 174 ? -1.844  3.938   65.952 1.00 31.14 ? 179 PRO E CA  1 
ATOM   2919 C C   . PRO B 2 174 ? -0.902  4.295   67.095 1.00 31.31 ? 179 PRO E C   1 
ATOM   2920 O O   . PRO B 2 174 ? 0.054   3.569   67.379 1.00 31.50 ? 179 PRO E O   1 
ATOM   2921 C CB  . PRO B 2 174 ? -2.811  2.816   66.308 1.00 31.10 ? 179 PRO E CB  1 
ATOM   2922 C CG  . PRO B 2 174 ? -3.109  2.227   64.954 1.00 32.52 ? 179 PRO E CG  1 
ATOM   2923 C CD  . PRO B 2 174 ? -1.730  2.129   64.356 1.00 31.28 ? 179 PRO E CD  1 
ATOM   2924 N N   . LEU B 2 175 ? -1.195  5.417   67.742 1.00 30.94 ? 180 LEU E N   1 
ATOM   2925 C CA  . LEU B 2 175 ? -0.403  5.947   68.845 1.00 29.89 ? 180 LEU E CA  1 
ATOM   2926 C C   . LEU B 2 175 ? -0.940  5.453   70.191 1.00 27.40 ? 180 LEU E C   1 
ATOM   2927 O O   . LEU B 2 175 ? -2.138  5.235   70.337 1.00 25.80 ? 180 LEU E O   1 
ATOM   2928 C CB  . LEU B 2 175 ? -0.463  7.472   68.781 1.00 32.84 ? 180 LEU E CB  1 
ATOM   2929 C CG  . LEU B 2 175 ? 0.362   8.347   69.720 1.00 35.03 ? 180 LEU E CG  1 
ATOM   2930 C CD1 . LEU B 2 175 ? 1.844   8.131   69.460 1.00 36.51 ? 180 LEU E CD1 1 
ATOM   2931 C CD2 . LEU B 2 175 ? -0.007  9.806   69.488 1.00 35.95 ? 180 LEU E CD2 1 
ATOM   2932 N N   . LYS B 2 176 ? -0.053  5.266   71.168 1.00 26.75 ? 181 LYS E N   1 
ATOM   2933 C CA  . LYS B 2 176 ? -0.475  4.809   72.495 1.00 25.40 ? 181 LYS E CA  1 
ATOM   2934 C C   . LYS B 2 176 ? -0.949  5.985   73.339 1.00 24.73 ? 181 LYS E C   1 
ATOM   2935 O O   . LYS B 2 176 ? -0.222  6.961   73.526 1.00 24.30 ? 181 LYS E O   1 
ATOM   2936 C CB  . LYS B 2 176 ? 0.674   4.106   73.230 1.00 25.71 ? 181 LYS E CB  1 
ATOM   2937 C CG  . LYS B 2 176 ? 1.066   2.753   72.669 1.00 27.89 ? 181 LYS E CG  1 
ATOM   2938 C CD  . LYS B 2 176 ? 2.088   2.075   73.578 1.00 30.16 ? 181 LYS E CD  1 
ATOM   2939 C CE  . LYS B 2 176 ? 2.457   0.688   73.078 1.00 31.53 ? 181 LYS E CE  1 
ATOM   2940 N NZ  . LYS B 2 176 ? 3.419   0.006   73.989 1.00 33.17 ? 181 LYS E NZ  1 
ATOM   2941 N N   . GLU B 2 177 ? -2.169  5.889   73.858 1.00 23.80 ? 182 GLU E N   1 
ATOM   2942 C CA  . GLU B 2 177 ? -2.716  6.955   74.684 1.00 25.96 ? 182 GLU E CA  1 
ATOM   2943 C C   . GLU B 2 177 ? -2.026  7.002   76.043 1.00 26.84 ? 182 GLU E C   1 
ATOM   2944 O O   . GLU B 2 177 ? -1.940  8.060   76.663 1.00 26.80 ? 182 GLU E O   1 
ATOM   2945 C CB  . GLU B 2 177 ? -4.228  6.773   74.848 1.00 27.04 ? 182 GLU E CB  1 
ATOM   2946 C CG  . GLU B 2 177 ? -4.987  6.999   73.542 1.00 28.10 ? 182 GLU E CG  1 
ATOM   2947 C CD  . GLU B 2 177 ? -6.487  6.765   73.647 1.00 30.24 ? 182 GLU E CD  1 
ATOM   2948 O OE1 . GLU B 2 177 ? -7.213  7.206   72.728 1.00 32.24 ? 182 GLU E OE1 1 
ATOM   2949 O OE2 . GLU B 2 177 ? -6.943  6.139   74.626 1.00 29.84 ? 182 GLU E OE2 1 
ATOM   2950 N N   . GLN B 2 178 ? -1.528  5.855   76.493 1.00 27.68 ? 183 GLN E N   1 
ATOM   2951 C CA  . GLN B 2 178 ? -0.824  5.753   77.773 1.00 29.83 ? 183 GLN E CA  1 
ATOM   2952 C C   . GLN B 2 178 ? 0.447   4.929   77.569 1.00 29.71 ? 183 GLN E C   1 
ATOM   2953 O O   . GLN B 2 178 ? 0.493   3.745   77.899 1.00 29.67 ? 183 GLN E O   1 
ATOM   2954 C CB  . GLN B 2 178 ? -1.714  5.078   78.820 1.00 31.35 ? 183 GLN E CB  1 
ATOM   2955 C CG  . GLN B 2 178 ? -2.970  5.852   79.169 1.00 35.92 ? 183 GLN E CG  1 
ATOM   2956 C CD  . GLN B 2 178 ? -2.665  7.227   79.728 1.00 39.99 ? 183 GLN E CD  1 
ATOM   2957 O OE1 . GLN B 2 178 ? -1.918  7.363   80.698 1.00 42.41 ? 183 GLN E OE1 1 
ATOM   2958 N NE2 . GLN B 2 178 ? -3.244  8.256   79.119 1.00 42.02 ? 183 GLN E NE2 1 
ATOM   2959 N N   . PRO B 2 179 ? 1.501   5.555   77.027 1.00 30.85 ? 184 PRO E N   1 
ATOM   2960 C CA  . PRO B 2 179 ? 2.797   4.926   76.749 1.00 32.57 ? 184 PRO E CA  1 
ATOM   2961 C C   . PRO B 2 179 ? 3.368   4.044   77.860 1.00 34.40 ? 184 PRO E C   1 
ATOM   2962 O O   . PRO B 2 179 ? 4.026   3.041   77.583 1.00 35.25 ? 184 PRO E O   1 
ATOM   2963 C CB  . PRO B 2 179 ? 3.699   6.121   76.445 1.00 32.26 ? 184 PRO E CB  1 
ATOM   2964 C CG  . PRO B 2 179 ? 2.751   7.094   75.821 1.00 32.30 ? 184 PRO E CG  1 
ATOM   2965 C CD  . PRO B 2 179 ? 1.556   6.999   76.735 1.00 30.39 ? 184 PRO E CD  1 
ATOM   2966 N N   . ALA B 2 180 ? 3.111   4.416   79.109 1.00 36.28 ? 185 ALA E N   1 
ATOM   2967 C CA  . ALA B 2 180 ? 3.623   3.668   80.254 1.00 37.87 ? 185 ALA E CA  1 
ATOM   2968 C C   . ALA B 2 180 ? 2.951   2.314   80.474 1.00 39.04 ? 185 ALA E C   1 
ATOM   2969 O O   . ALA B 2 180 ? 3.584   1.379   80.968 1.00 39.96 ? 185 ALA E O   1 
ATOM   2970 C CB  . ALA B 2 180 ? 3.505   4.517   81.515 1.00 37.63 ? 185 ALA E CB  1 
ATOM   2971 N N   . LEU B 2 181 ? 1.677   2.208   80.110 1.00 39.16 ? 186 LEU E N   1 
ATOM   2972 C CA  . LEU B 2 181 ? 0.927   0.965   80.283 1.00 39.35 ? 186 LEU E CA  1 
ATOM   2973 C C   . LEU B 2 181 ? 1.145   -0.005  79.125 1.00 39.44 ? 186 LEU E C   1 
ATOM   2974 O O   . LEU B 2 181 ? 1.163   0.397   77.963 1.00 39.60 ? 186 LEU E O   1 
ATOM   2975 C CB  . LEU B 2 181 ? -0.565  1.272   80.420 1.00 40.48 ? 186 LEU E CB  1 
ATOM   2976 C CG  . LEU B 2 181 ? -0.948  2.254   81.530 1.00 41.22 ? 186 LEU E CG  1 
ATOM   2977 C CD1 . LEU B 2 181 ? -2.439  2.539   81.471 1.00 41.49 ? 186 LEU E CD1 1 
ATOM   2978 C CD2 . LEU B 2 181 ? -0.563  1.675   82.884 1.00 42.20 ? 186 LEU E CD2 1 
ATOM   2979 N N   . ASN B 2 182 ? 1.298   -1.287  79.446 1.00 39.60 ? 187 ASN E N   1 
ATOM   2980 C CA  . ASN B 2 182 ? 1.523   -2.309  78.427 1.00 39.77 ? 187 ASN E CA  1 
ATOM   2981 C C   . ASN B 2 182 ? 0.246   -2.633  77.650 1.00 38.22 ? 187 ASN E C   1 
ATOM   2982 O O   . ASN B 2 182 ? 0.304   -3.040  76.489 1.00 39.50 ? 187 ASN E O   1 
ATOM   2983 C CB  . ASN B 2 182 ? 2.075   -3.585  79.072 1.00 42.32 ? 187 ASN E CB  1 
ATOM   2984 C CG  . ASN B 2 182 ? 2.616   -4.574  78.050 1.00 44.13 ? 187 ASN E CG  1 
ATOM   2985 O OD1 . ASN B 2 182 ? 3.044   -5.674  78.402 1.00 45.80 ? 187 ASN E OD1 1 
ATOM   2986 N ND2 . ASN B 2 182 ? 2.605   -4.183  76.780 1.00 44.51 ? 187 ASN E ND2 1 
ATOM   2987 N N   . ASP B 2 183 ? -0.904  -2.457  78.293 1.00 35.23 ? 188 ASP E N   1 
ATOM   2988 C CA  . ASP B 2 183 ? -2.188  -2.722  77.647 1.00 32.56 ? 188 ASP E CA  1 
ATOM   2989 C C   . ASP B 2 183 ? -2.856  -1.412  77.234 1.00 29.16 ? 188 ASP E C   1 
ATOM   2990 O O   . ASP B 2 183 ? -4.078  -1.336  77.111 1.00 28.43 ? 188 ASP E O   1 
ATOM   2991 C CB  . ASP B 2 183 ? -3.116  -3.492  78.593 1.00 35.06 ? 188 ASP E CB  1 
ATOM   2992 C CG  . ASP B 2 183 ? -3.183  -2.873  79.979 1.00 37.99 ? 188 ASP E CG  1 
ATOM   2993 O OD1 . ASP B 2 183 ? -3.294  -1.631  80.078 1.00 38.67 ? 188 ASP E OD1 1 
ATOM   2994 O OD2 . ASP B 2 183 ? -3.133  -3.631  80.973 1.00 39.94 ? 188 ASP E OD2 1 
ATOM   2995 N N   . SER B 2 184 ? -2.044  -0.382  77.021 1.00 25.23 ? 189 SER E N   1 
ATOM   2996 C CA  . SER B 2 184 ? -2.555  0.927   76.633 1.00 22.28 ? 189 SER E CA  1 
ATOM   2997 C C   . SER B 2 184 ? -3.432  0.895   75.393 1.00 20.43 ? 189 SER E C   1 
ATOM   2998 O O   . SER B 2 184 ? -3.157  0.160   74.443 1.00 20.56 ? 189 SER E O   1 
ATOM   2999 C CB  . SER B 2 184 ? -1.401  1.895   76.374 1.00 21.08 ? 189 SER E CB  1 
ATOM   3000 O OG  . SER B 2 184 ? -1.874  3.095   75.780 1.00 19.83 ? 189 SER E OG  1 
ATOM   3001 N N   . ARG B 2 185 ? -4.488  1.702   75.412 1.00 19.60 ? 190 ARG E N   1 
ATOM   3002 C CA  . ARG B 2 185 ? -5.378  1.807   74.269 1.00 18.76 ? 190 ARG E CA  1 
ATOM   3003 C C   . ARG B 2 185 ? -4.682  2.706   73.254 1.00 18.85 ? 190 ARG E C   1 
ATOM   3004 O O   . ARG B 2 185 ? -3.691  3.367   73.571 1.00 17.79 ? 190 ARG E O   1 
ATOM   3005 C CB  . ARG B 2 185 ? -6.715  2.423   74.662 1.00 19.84 ? 190 ARG E CB  1 
ATOM   3006 C CG  . ARG B 2 185 ? -7.554  1.592   75.611 1.00 24.26 ? 190 ARG E CG  1 
ATOM   3007 C CD  . ARG B 2 185 ? -8.979  2.106   75.546 1.00 27.32 ? 190 ARG E CD  1 
ATOM   3008 N NE  . ARG B 2 185 ? -9.711  1.919   76.784 1.00 31.19 ? 190 ARG E NE  1 
ATOM   3009 C CZ  . ARG B 2 185 ? -10.982 2.263   76.947 1.00 29.52 ? 190 ARG E CZ  1 
ATOM   3010 N NH1 . ARG B 2 185 ? -11.659 2.806   75.942 1.00 26.76 ? 190 ARG E NH1 1 
ATOM   3011 N NH2 . ARG B 2 185 ? -11.568 2.074   78.117 1.00 31.04 ? 190 ARG E NH2 1 
ATOM   3012 N N   . TYR B 2 186 ? -5.229  2.758   72.046 1.00 16.97 ? 191 TYR E N   1 
ATOM   3013 C CA  . TYR B 2 186 ? -4.627  3.527   70.966 1.00 16.97 ? 191 TYR E CA  1 
ATOM   3014 C C   . TYR B 2 186 ? -5.500  4.612   70.361 1.00 16.07 ? 191 TYR E C   1 
ATOM   3015 O O   . TYR B 2 186 ? -6.713  4.647   70.564 1.00 16.09 ? 191 TYR E O   1 
ATOM   3016 C CB  . TYR B 2 186 ? -4.231  2.576   69.843 1.00 15.71 ? 191 TYR E CB  1 
ATOM   3017 C CG  . TYR B 2 186 ? -3.179  1.561   70.218 1.00 16.14 ? 191 TYR E CG  1 
ATOM   3018 C CD1 . TYR B 2 186 ? -1.827  1.865   70.102 1.00 16.70 ? 191 TYR E CD1 1 
ATOM   3019 C CD2 . TYR B 2 186 ? -3.537  0.289   70.663 1.00 16.37 ? 191 TYR E CD2 1 
ATOM   3020 C CE1 . TYR B 2 186 ? -0.850  0.923   70.408 1.00 17.43 ? 191 TYR E CE1 1 
ATOM   3021 C CE2 . TYR B 2 186 ? -2.564  -0.663  70.980 1.00 16.93 ? 191 TYR E CE2 1 
ATOM   3022 C CZ  . TYR B 2 186 ? -1.224  -0.336  70.844 1.00 18.47 ? 191 TYR E CZ  1 
ATOM   3023 O OH  . TYR B 2 186 ? -0.252  -1.272  71.122 1.00 21.05 ? 191 TYR E OH  1 
ATOM   3024 N N   . CYS B 2 187 ? -4.848  5.483   69.598 1.00 16.02 ? 192 CYS E N   1 
ATOM   3025 C CA  . CYS B 2 187 ? -5.512  6.568   68.884 1.00 16.90 ? 192 CYS E CA  1 
ATOM   3026 C C   . CYS B 2 187 ? -4.904  6.627   67.484 1.00 17.85 ? 192 CYS E C   1 
ATOM   3027 O O   . CYS B 2 187 ? -3.722  6.336   67.302 1.00 18.12 ? 192 CYS E O   1 
ATOM   3028 C CB  . CYS B 2 187 ? -5.302  7.891   69.603 1.00 16.80 ? 192 CYS E CB  1 
ATOM   3029 N N   . LEU B 2 188 ? -5.716  6.991   66.496 1.00 17.18 ? 193 LEU E N   1 
ATOM   3030 C CA  . LEU B 2 188 ? -5.249  7.086   65.117 1.00 17.34 ? 193 LEU E CA  1 
ATOM   3031 C C   . LEU B 2 188 ? -5.927  8.271   64.453 1.00 16.53 ? 193 LEU E C   1 
ATOM   3032 O O   . LEU B 2 188 ? -7.117  8.507   64.665 1.00 16.94 ? 193 LEU E O   1 
ATOM   3033 C CB  . LEU B 2 188 ? -5.595  5.809   64.345 1.00 17.80 ? 193 LEU E CB  1 
ATOM   3034 C CG  . LEU B 2 188 ? -5.154  5.757   62.880 1.00 18.46 ? 193 LEU E CG  1 
ATOM   3035 C CD1 . LEU B 2 188 ? -3.641  5.632   62.810 1.00 20.07 ? 193 LEU E CD1 1 
ATOM   3036 C CD2 . LEU B 2 188 ? -5.811  4.573   62.187 1.00 20.02 ? 193 LEU E CD2 1 
ATOM   3037 N N   . SER B 2 189 ? -5.179  9.019   63.648 1.00 15.54 ? 194 SER E N   1 
ATOM   3038 C CA  . SER B 2 189 ? -5.765  10.162  62.971 1.00 14.88 ? 194 SER E CA  1 
ATOM   3039 C C   . SER B 2 189 ? -5.637  10.034  61.465 1.00 14.88 ? 194 SER E C   1 
ATOM   3040 O O   . SER B 2 189 ? -4.768  9.326   60.949 1.00 14.38 ? 194 SER E O   1 
ATOM   3041 C CB  . SER B 2 189 ? -5.107  11.472  63.434 1.00 16.25 ? 194 SER E CB  1 
ATOM   3042 O OG  . SER B 2 189 ? -3.799  11.623  62.907 1.00 19.08 ? 194 SER E OG  1 
ATOM   3043 N N   . SER B 2 190 ? -6.526  10.722  60.766 1.00 13.22 ? 195 SER E N   1 
ATOM   3044 C CA  . SER B 2 190 ? -6.514  10.725  59.315 1.00 14.28 ? 195 SER E CA  1 
ATOM   3045 C C   . SER B 2 190 ? -7.008  12.073  58.822 1.00 13.72 ? 195 SER E C   1 
ATOM   3046 O O   . SER B 2 190 ? -7.793  12.744  59.486 1.00 14.11 ? 195 SER E O   1 
ATOM   3047 C CB  . SER B 2 190 ? -7.411  9.619   58.759 1.00 12.85 ? 195 SER E CB  1 
ATOM   3048 O OG  . SER B 2 190 ? -7.386  9.638   57.340 1.00 13.84 ? 195 SER E OG  1 
ATOM   3049 N N   . ARG B 2 191 ? -6.537  12.462  57.647 1.00 12.78 ? 196 ARG E N   1 
ATOM   3050 C CA  . ARG B 2 191 ? -6.925  13.725  57.053 1.00 14.63 ? 196 ARG E CA  1 
ATOM   3051 C C   . ARG B 2 191 ? -7.482  13.509  55.655 1.00 12.89 ? 196 ARG E C   1 
ATOM   3052 O O   . ARG B 2 191 ? -7.013  12.648  54.920 1.00 14.29 ? 196 ARG E O   1 
ATOM   3053 C CB  . ARG B 2 191 ? -5.707  14.648  56.975 1.00 15.52 ? 196 ARG E CB  1 
ATOM   3054 C CG  . ARG B 2 191 ? -5.208  15.127  58.326 1.00 19.95 ? 196 ARG E CG  1 
ATOM   3055 C CD  . ARG B 2 191 ? -3.693  15.216  58.353 1.00 23.42 ? 196 ARG E CD  1 
ATOM   3056 N NE  . ARG B 2 191 ? -3.072  13.896  58.253 1.00 26.44 ? 196 ARG E NE  1 
ATOM   3057 C CZ  . ARG B 2 191 ? -3.121  12.964  59.200 1.00 29.01 ? 196 ARG E CZ  1 
ATOM   3058 N NH1 . ARG B 2 191 ? -2.524  11.794  59.007 1.00 29.70 ? 196 ARG E NH1 1 
ATOM   3059 N NH2 . ARG B 2 191 ? -3.755  13.198  60.344 1.00 29.97 ? 196 ARG E NH2 1 
ATOM   3060 N N   . LEU B 2 192 ? -8.512  14.274  55.314 1.00 13.57 ? 197 LEU E N   1 
ATOM   3061 C CA  . LEU B 2 192 ? -9.098  14.226  53.977 1.00 13.13 ? 197 LEU E CA  1 
ATOM   3062 C C   . LEU B 2 192 ? -9.147  15.676  53.533 1.00 13.00 ? 197 LEU E C   1 
ATOM   3063 O O   . LEU B 2 192 ? -9.770  16.506  54.189 1.00 12.95 ? 197 LEU E O   1 
ATOM   3064 C CB  . LEU B 2 192 ? -10.519 13.648  53.989 1.00 13.85 ? 197 LEU E CB  1 
ATOM   3065 C CG  . LEU B 2 192 ? -11.317 13.923  52.703 1.00 13.97 ? 197 LEU E CG  1 
ATOM   3066 C CD1 . LEU B 2 192 ? -10.639 13.262  51.509 1.00 13.25 ? 197 LEU E CD1 1 
ATOM   3067 C CD2 . LEU B 2 192 ? -12.741 13.413  52.864 1.00 13.62 ? 197 LEU E CD2 1 
ATOM   3068 N N   . ARG B 2 193 ? -8.474  15.994  52.434 1.00 11.96 ? 198 ARG E N   1 
ATOM   3069 C CA  . ARG B 2 193 ? -8.471  17.366  51.952 1.00 13.52 ? 198 ARG E CA  1 
ATOM   3070 C C   . ARG B 2 193 ? -9.173  17.470  50.603 1.00 13.29 ? 198 ARG E C   1 
ATOM   3071 O O   . ARG B 2 193 ? -8.900  16.691  49.690 1.00 14.08 ? 198 ARG E O   1 
ATOM   3072 C CB  . ARG B 2 193 ? -7.034  17.883  51.837 1.00 13.21 ? 198 ARG E CB  1 
ATOM   3073 C CG  . ARG B 2 193 ? -6.946  19.404  51.781 1.00 13.57 ? 198 ARG E CG  1 
ATOM   3074 C CD  . ARG B 2 193 ? -5.505  19.884  51.854 1.00 14.42 ? 198 ARG E CD  1 
ATOM   3075 N NE  . ARG B 2 193 ? -5.421  21.269  52.314 1.00 14.92 ? 198 ARG E NE  1 
ATOM   3076 C CZ  . ARG B 2 193 ? -4.286  21.951  52.407 1.00 15.90 ? 198 ARG E CZ  1 
ATOM   3077 N NH1 . ARG B 2 193 ? -4.295  23.206  52.843 1.00 15.77 ? 198 ARG E NH1 1 
ATOM   3078 N NH2 . ARG B 2 193 ? -3.144  21.381  52.048 1.00 15.03 ? 198 ARG E NH2 1 
ATOM   3079 N N   . VAL B 2 194 ? -10.083 18.433  50.498 1.00 11.88 ? 199 VAL E N   1 
ATOM   3080 C CA  . VAL B 2 194 ? -10.841 18.661  49.272 1.00 13.45 ? 199 VAL E CA  1 
ATOM   3081 C C   . VAL B 2 194 ? -10.797 20.150  48.930 1.00 13.62 ? 199 VAL E C   1 
ATOM   3082 O O   . VAL B 2 194 ? -10.276 20.953  49.698 1.00 15.14 ? 199 VAL E O   1 
ATOM   3083 C CB  . VAL B 2 194 ? -12.320 18.241  49.449 1.00 13.53 ? 199 VAL E CB  1 
ATOM   3084 C CG1 . VAL B 2 194 ? -12.413 16.742  49.742 1.00 14.16 ? 199 VAL E CG1 1 
ATOM   3085 C CG2 . VAL B 2 194 ? -12.951 19.039  50.579 1.00 15.32 ? 199 VAL E CG2 1 
ATOM   3086 N N   . SER B 2 195 ? -11.337 20.520  47.778 1.00 14.61 ? 200 SER E N   1 
ATOM   3087 C CA  . SER B 2 195 ? -11.356 21.931  47.401 1.00 15.57 ? 200 SER E CA  1 
ATOM   3088 C C   . SER B 2 195 ? -12.398 22.627  48.274 1.00 15.02 ? 200 SER E C   1 
ATOM   3089 O O   . SER B 2 195 ? -13.342 21.992  48.745 1.00 15.63 ? 200 SER E O   1 
ATOM   3090 C CB  . SER B 2 195 ? -11.746 22.085  45.934 1.00 15.96 ? 200 SER E CB  1 
ATOM   3091 O OG  . SER B 2 195 ? -13.112 21.758  45.756 1.00 19.01 ? 200 SER E OG  1 
ATOM   3092 N N   . ALA B 2 196 ? -12.239 23.929  48.482 1.00 16.40 ? 201 ALA E N   1 
ATOM   3093 C CA  . ALA B 2 196 ? -13.187 24.679  49.297 1.00 15.74 ? 201 ALA E CA  1 
ATOM   3094 C C   . ALA B 2 196 ? -14.596 24.606  48.708 1.00 16.85 ? 201 ALA E C   1 
ATOM   3095 O O   . ALA B 2 196 ? -15.574 24.470  49.440 1.00 15.37 ? 201 ALA E O   1 
ATOM   3096 C CB  . ALA B 2 196 ? -12.743 26.133  49.416 1.00 16.98 ? 201 ALA E CB  1 
ATOM   3097 N N   . THR B 2 197 ? -14.702 24.695  47.386 1.00 16.48 ? 202 THR E N   1 
ATOM   3098 C CA  . THR B 2 197 ? -16.010 24.640  46.746 1.00 17.41 ? 202 THR E CA  1 
ATOM   3099 C C   . THR B 2 197 ? -16.708 23.300  46.989 1.00 17.10 ? 202 THR E C   1 
ATOM   3100 O O   . THR B 2 197 ? -17.931 23.248  47.126 1.00 17.30 ? 202 THR E O   1 
ATOM   3101 C CB  . THR B 2 197 ? -15.902 24.918  45.224 1.00 18.24 ? 202 THR E CB  1 
ATOM   3102 O OG1 . THR B 2 197 ? -15.148 23.881  44.584 1.00 24.72 ? 202 THR E OG1 1 
ATOM   3103 C CG2 . THR B 2 197 ? -15.207 26.254  44.992 1.00 16.42 ? 202 THR E CG2 1 
ATOM   3104 N N   . PHE B 2 198 ? -15.937 22.221  47.069 1.00 15.64 ? 203 PHE E N   1 
ATOM   3105 C CA  . PHE B 2 198 ? -16.534 20.907  47.302 1.00 15.53 ? 203 PHE E CA  1 
ATOM   3106 C C   . PHE B 2 198 ? -17.079 20.833  48.725 1.00 16.03 ? 203 PHE E C   1 
ATOM   3107 O O   . PHE B 2 198 ? -18.170 20.316  48.955 1.00 15.99 ? 203 PHE E O   1 
ATOM   3108 C CB  . PHE B 2 198 ? -15.503 19.803  47.060 1.00 15.81 ? 203 PHE E CB  1 
ATOM   3109 C CG  . PHE B 2 198 ? -16.099 18.428  46.981 1.00 16.23 ? 203 PHE E CG  1 
ATOM   3110 C CD1 . PHE B 2 198 ? -16.165 17.617  48.108 1.00 15.21 ? 203 PHE E CD1 1 
ATOM   3111 C CD2 . PHE B 2 198 ? -16.608 17.947  45.778 1.00 16.84 ? 203 PHE E CD2 1 
ATOM   3112 C CE1 . PHE B 2 198 ? -16.725 16.343  48.038 1.00 16.34 ? 203 PHE E CE1 1 
ATOM   3113 C CE2 . PHE B 2 198 ? -17.173 16.676  45.697 1.00 18.24 ? 203 PHE E CE2 1 
ATOM   3114 C CZ  . PHE B 2 198 ? -17.230 15.871  46.831 1.00 18.38 ? 203 PHE E CZ  1 
ATOM   3115 N N   . TRP B 2 199 ? -16.325 21.361  49.684 1.00 15.05 ? 204 TRP E N   1 
ATOM   3116 C CA  . TRP B 2 199 ? -16.776 21.346  51.069 1.00 15.56 ? 204 TRP E CA  1 
ATOM   3117 C C   . TRP B 2 199 ? -17.977 22.261  51.291 1.00 15.66 ? 204 TRP E C   1 
ATOM   3118 O O   . TRP B 2 199 ? -18.830 21.982  52.131 1.00 16.22 ? 204 TRP E O   1 
ATOM   3119 C CB  . TRP B 2 199 ? -15.643 21.768  52.011 1.00 15.50 ? 204 TRP E CB  1 
ATOM   3120 C CG  . TRP B 2 199 ? -16.125 22.109  53.399 1.00 15.63 ? 204 TRP E CG  1 
ATOM   3121 C CD1 . TRP B 2 199 ? -16.236 23.358  53.945 1.00 15.10 ? 204 TRP E CD1 1 
ATOM   3122 C CD2 . TRP B 2 199 ? -16.646 21.197  54.378 1.00 15.70 ? 204 TRP E CD2 1 
ATOM   3123 N NE1 . TRP B 2 199 ? -16.799 23.281  55.200 1.00 16.84 ? 204 TRP E NE1 1 
ATOM   3124 C CE2 . TRP B 2 199 ? -17.061 21.967  55.489 1.00 15.86 ? 204 TRP E CE2 1 
ATOM   3125 C CE3 . TRP B 2 199 ? -16.808 19.805  54.421 1.00 16.36 ? 204 TRP E CE3 1 
ATOM   3126 C CZ2 . TRP B 2 199 ? -17.628 21.391  56.632 1.00 16.95 ? 204 TRP E CZ2 1 
ATOM   3127 C CZ3 . TRP B 2 199 ? -17.373 19.233  55.557 1.00 16.40 ? 204 TRP E CZ3 1 
ATOM   3128 C CH2 . TRP B 2 199 ? -17.776 20.027  56.646 1.00 16.14 ? 204 TRP E CH2 1 
ATOM   3129 N N   . GLN B 2 200 ? -18.042 23.352  50.535 1.00 17.31 ? 205 GLN E N   1 
ATOM   3130 C CA  . GLN B 2 200 ? -19.125 24.317  50.686 1.00 17.85 ? 205 GLN E CA  1 
ATOM   3131 C C   . GLN B 2 200 ? -20.471 23.849  50.142 1.00 18.40 ? 205 GLN E C   1 
ATOM   3132 O O   . GLN B 2 200 ? -21.486 24.515  50.337 1.00 19.34 ? 205 GLN E O   1 
ATOM   3133 C CB  . GLN B 2 200 ? -18.723 25.640  50.034 1.00 20.27 ? 205 GLN E CB  1 
ATOM   3134 C CG  . GLN B 2 200 ? -17.458 26.212  50.642 1.00 21.92 ? 205 GLN E CG  1 
ATOM   3135 C CD  . GLN B 2 200 ? -16.919 27.414  49.895 1.00 23.10 ? 205 GLN E CD  1 
ATOM   3136 O OE1 . GLN B 2 200 ? -17.098 27.549  48.683 1.00 24.18 ? 205 GLN E OE1 1 
ATOM   3137 N NE2 . GLN B 2 200 ? -16.232 28.285  50.617 1.00 21.87 ? 205 GLN E NE2 1 
ATOM   3138 N N   . ASN B 2 201 ? -20.479 22.710  49.460 1.00 18.64 ? 206 ASN E N   1 
ATOM   3139 C CA  . ASN B 2 201 ? -21.720 22.166  48.920 1.00 19.07 ? 206 ASN E CA  1 
ATOM   3140 C C   . ASN B 2 201 ? -22.386 21.323  50.008 1.00 19.92 ? 206 ASN E C   1 
ATOM   3141 O O   . ASN B 2 201 ? -21.879 20.261  50.374 1.00 18.27 ? 206 ASN E O   1 
ATOM   3142 C CB  . ASN B 2 201 ? -21.436 21.288  47.702 1.00 18.60 ? 206 ASN E CB  1 
ATOM   3143 C CG  . ASN B 2 201 ? -22.705 20.776  47.050 1.00 17.44 ? 206 ASN E CG  1 
ATOM   3144 O OD1 . ASN B 2 201 ? -23.796 20.903  47.608 1.00 20.87 ? 206 ASN E OD1 1 
ATOM   3145 N ND2 . ASN B 2 201 ? -22.569 20.186  45.870 1.00 21.28 ? 206 ASN E ND2 1 
ATOM   3146 N N   . PRO B 2 202 ? -23.537 21.782  50.530 1.00 20.54 ? 207 PRO E N   1 
ATOM   3147 C CA  . PRO B 2 202 ? -24.264 21.063  51.583 1.00 21.31 ? 207 PRO E CA  1 
ATOM   3148 C C   . PRO B 2 202 ? -24.761 19.688  51.147 1.00 21.98 ? 207 PRO E C   1 
ATOM   3149 O O   . PRO B 2 202 ? -25.154 18.869  51.981 1.00 23.76 ? 207 PRO E O   1 
ATOM   3150 C CB  . PRO B 2 202 ? -25.404 22.017  51.921 1.00 21.78 ? 207 PRO E CB  1 
ATOM   3151 C CG  . PRO B 2 202 ? -25.698 22.643  50.595 1.00 20.55 ? 207 PRO E CG  1 
ATOM   3152 C CD  . PRO B 2 202 ? -24.316 22.945  50.063 1.00 20.57 ? 207 PRO E CD  1 
ATOM   3153 N N   . ARG B 2 203 ? -24.745 19.438  49.843 1.00 21.39 ? 208 ARG E N   1 
ATOM   3154 C CA  . ARG B 2 203 ? -25.182 18.155  49.314 1.00 22.88 ? 208 ARG E CA  1 
ATOM   3155 C C   . ARG B 2 203 ? -24.105 17.086  49.477 1.00 21.09 ? 208 ARG E C   1 
ATOM   3156 O O   . ARG B 2 203 ? -24.387 15.891  49.353 1.00 22.19 ? 208 ARG E O   1 
ATOM   3157 C CB  . ARG B 2 203 ? -25.551 18.285  47.831 1.00 26.52 ? 208 ARG E CB  1 
ATOM   3158 C CG  . ARG B 2 203 ? -26.861 19.024  47.570 1.00 30.83 ? 208 ARG E CG  1 
ATOM   3159 C CD  . ARG B 2 203 ? -28.045 18.233  48.106 1.00 34.61 ? 208 ARG E CD  1 
ATOM   3160 N NE  . ARG B 2 203 ? -28.071 18.189  49.565 1.00 39.00 ? 208 ARG E NE  1 
ATOM   3161 C CZ  . ARG B 2 203 ? -28.597 17.195  50.275 1.00 39.63 ? 208 ARG E CZ  1 
ATOM   3162 N NH1 . ARG B 2 203 ? -29.140 16.153  49.661 1.00 40.81 ? 208 ARG E NH1 1 
ATOM   3163 N NH2 . ARG B 2 203 ? -28.581 17.243  51.601 1.00 40.13 ? 208 ARG E NH2 1 
ATOM   3164 N N   . ASN B 2 204 ? -22.871 17.506  49.747 1.00 17.55 ? 209 ASN E N   1 
ATOM   3165 C CA  . ASN B 2 204 ? -21.790 16.540  49.909 1.00 15.98 ? 209 ASN E CA  1 
ATOM   3166 C C   . ASN B 2 204 ? -21.710 15.985  51.321 1.00 15.34 ? 209 ASN E C   1 
ATOM   3167 O O   . ASN B 2 204 ? -21.623 16.725  52.301 1.00 15.65 ? 209 ASN E O   1 
ATOM   3168 C CB  . ASN B 2 204 ? -20.448 17.146  49.489 1.00 16.12 ? 209 ASN E CB  1 
ATOM   3169 C CG  . ASN B 2 204 ? -20.346 17.323  47.986 1.00 16.46 ? 209 ASN E CG  1 
ATOM   3170 O OD1 . ASN B 2 204 ? -20.859 16.505  47.221 1.00 16.58 ? 209 ASN E OD1 1 
ATOM   3171 N ND2 . ASN B 2 204 ? -19.674 18.381  47.555 1.00 17.20 ? 209 ASN E ND2 1 
ATOM   3172 N N   . HIS B 2 205 ? -21.742 14.659  51.396 1.00 15.13 ? 210 HIS E N   1 
ATOM   3173 C CA  . HIS B 2 205 ? -21.703 13.930  52.654 1.00 15.58 ? 210 HIS E CA  1 
ATOM   3174 C C   . HIS B 2 205 ? -20.359 13.228  52.834 1.00 13.96 ? 210 HIS E C   1 
ATOM   3175 O O   . HIS B 2 205 ? -19.911 12.480  51.960 1.00 15.78 ? 210 HIS E O   1 
ATOM   3176 C CB  . HIS B 2 205 ? -22.835 12.901  52.669 1.00 16.86 ? 210 HIS E CB  1 
ATOM   3177 C CG  . HIS B 2 205 ? -22.746 11.922  53.795 1.00 20.66 ? 210 HIS E CG  1 
ATOM   3178 N ND1 . HIS B 2 205 ? -22.974 12.274  55.108 1.00 23.47 ? 210 HIS E ND1 1 
ATOM   3179 C CD2 . HIS B 2 205 ? -22.412 10.610  53.809 1.00 21.63 ? 210 HIS E CD2 1 
ATOM   3180 C CE1 . HIS B 2 205 ? -22.783 11.221  55.881 1.00 21.83 ? 210 HIS E CE1 1 
ATOM   3181 N NE2 . HIS B 2 205 ? -22.442 10.198  55.118 1.00 23.52 ? 210 HIS E NE2 1 
ATOM   3182 N N   . PHE B 2 206 ? -19.726 13.469  53.978 1.00 13.88 ? 211 PHE E N   1 
ATOM   3183 C CA  . PHE B 2 206 ? -18.431 12.881  54.283 1.00 12.98 ? 211 PHE E CA  1 
ATOM   3184 C C   . PHE B 2 206 ? -18.548 11.935  55.466 1.00 13.65 ? 211 PHE E C   1 
ATOM   3185 O O   . PHE B 2 206 ? -19.188 12.263  56.465 1.00 14.83 ? 211 PHE E O   1 
ATOM   3186 C CB  . PHE B 2 206 ? -17.411 13.974  54.633 1.00 13.85 ? 211 PHE E CB  1 
ATOM   3187 C CG  . PHE B 2 206 ? -17.285 15.053  53.592 1.00 11.84 ? 211 PHE E CG  1 
ATOM   3188 C CD1 . PHE B 2 206 ? -18.252 16.049  53.478 1.00 13.77 ? 211 PHE E CD1 1 
ATOM   3189 C CD2 . PHE B 2 206 ? -16.205 15.065  52.714 1.00 11.95 ? 211 PHE E CD2 1 
ATOM   3190 C CE1 . PHE B 2 206 ? -18.146 17.042  52.502 1.00 14.55 ? 211 PHE E CE1 1 
ATOM   3191 C CE2 . PHE B 2 206 ? -16.090 16.057  51.731 1.00 13.73 ? 211 PHE E CE2 1 
ATOM   3192 C CZ  . PHE B 2 206 ? -17.064 17.044  51.628 1.00 14.13 ? 211 PHE E CZ  1 
ATOM   3193 N N   . ARG B 2 207 ? -17.928 10.766  55.354 1.00 13.64 ? 212 ARG E N   1 
ATOM   3194 C CA  . ARG B 2 207 ? -17.956 9.795   56.441 1.00 13.56 ? 212 ARG E CA  1 
ATOM   3195 C C   . ARG B 2 207 ? -16.603 9.147   56.651 1.00 13.37 ? 212 ARG E C   1 
ATOM   3196 O O   . ARG B 2 207 ? -15.973 8.674   55.707 1.00 14.45 ? 212 ARG E O   1 
ATOM   3197 C CB  . ARG B 2 207 ? -18.993 8.692   56.179 1.00 12.94 ? 212 ARG E CB  1 
ATOM   3198 C CG  . ARG B 2 207 ? -19.036 7.604   57.281 1.00 12.77 ? 212 ARG E CG  1 
ATOM   3199 C CD  . ARG B 2 207 ? -20.222 6.657   57.109 1.00 13.26 ? 212 ARG E CD  1 
ATOM   3200 N NE  . ARG B 2 207 ? -20.130 5.870   55.881 1.00 16.03 ? 212 ARG E NE  1 
ATOM   3201 C CZ  . ARG B 2 207 ? -19.538 4.682   55.784 1.00 16.56 ? 212 ARG E CZ  1 
ATOM   3202 N NH1 . ARG B 2 207 ? -19.510 4.056   54.614 1.00 18.22 ? 212 ARG E NH1 1 
ATOM   3203 N NH2 . ARG B 2 207 ? -18.992 4.107   56.851 1.00 16.72 ? 212 ARG E NH2 1 
ATOM   3204 N N   . CYS B 2 208 ? -16.156 9.144   57.902 1.00 13.08 ? 213 CYS E N   1 
ATOM   3205 C CA  . CYS B 2 208 ? -14.907 8.499   58.266 1.00 13.78 ? 213 CYS E CA  1 
ATOM   3206 C C   . CYS B 2 208 ? -15.329 7.160   58.855 1.00 13.22 ? 213 CYS E C   1 
ATOM   3207 O O   . CYS B 2 208 ? -16.109 7.115   59.807 1.00 14.13 ? 213 CYS E O   1 
ATOM   3208 C CB  . CYS B 2 208 ? -14.164 9.297   59.328 1.00 17.70 ? 213 CYS E CB  1 
ATOM   3209 S SG  . CYS B 2 208 ? -12.682 8.423   59.925 1.00 21.12 ? 213 CYS E SG  1 
ATOM   3210 N N   . GLN B 2 209 ? -14.823 6.078   58.284 1.00 11.84 ? 214 GLN E N   1 
ATOM   3211 C CA  . GLN B 2 209 ? -15.168 4.741   58.748 1.00 12.99 ? 214 GLN E CA  1 
ATOM   3212 C C   . GLN B 2 209 ? -13.959 4.026   59.319 1.00 12.74 ? 214 GLN E C   1 
ATOM   3213 O O   . GLN B 2 209 ? -12.898 3.987   58.702 1.00 13.90 ? 214 GLN E O   1 
ATOM   3214 C CB  . GLN B 2 209 ? -15.734 3.924   57.581 1.00 13.41 ? 214 GLN E CB  1 
ATOM   3215 C CG  . GLN B 2 209 ? -15.878 2.439   57.865 1.00 14.21 ? 214 GLN E CG  1 
ATOM   3216 C CD  . GLN B 2 209 ? -16.372 1.675   56.651 1.00 15.15 ? 214 GLN E CD  1 
ATOM   3217 O OE1 . GLN B 2 209 ? -17.536 1.794   56.260 1.00 15.04 ? 214 GLN E OE1 1 
ATOM   3218 N NE2 . GLN B 2 209 ? -15.485 0.897   56.039 1.00 14.66 ? 214 GLN E NE2 1 
ATOM   3219 N N   . VAL B 2 210 ? -14.118 3.458   60.506 1.00 12.80 ? 215 VAL E N   1 
ATOM   3220 C CA  . VAL B 2 210 ? -13.026 2.723   61.104 1.00 12.72 ? 215 VAL E CA  1 
ATOM   3221 C C   . VAL B 2 210 ? -13.457 1.288   61.317 1.00 12.26 ? 215 VAL E C   1 
ATOM   3222 O O   . VAL B 2 210 ? -14.364 1.013   62.107 1.00 13.18 ? 215 VAL E O   1 
ATOM   3223 C CB  . VAL B 2 210 ? -12.591 3.320   62.458 1.00 12.80 ? 215 VAL E CB  1 
ATOM   3224 C CG1 . VAL B 2 210 ? -11.464 2.475   63.053 1.00 14.37 ? 215 VAL E CG1 1 
ATOM   3225 C CG2 . VAL B 2 210 ? -12.129 4.757   62.269 1.00 13.32 ? 215 VAL E CG2 1 
ATOM   3226 N N   . GLN B 2 211 ? -12.819 0.381   60.584 1.00 11.95 ? 216 GLN E N   1 
ATOM   3227 C CA  . GLN B 2 211 ? -13.089 -1.039  60.720 1.00 12.25 ? 216 GLN E CA  1 
ATOM   3228 C C   . GLN B 2 211 ? -12.207 -1.517  61.859 1.00 14.25 ? 216 GLN E C   1 
ATOM   3229 O O   . GLN B 2 211 ? -10.987 -1.341  61.829 1.00 14.23 ? 216 GLN E O   1 
ATOM   3230 C CB  . GLN B 2 211 ? -12.721 -1.788  59.438 1.00 13.86 ? 216 GLN E CB  1 
ATOM   3231 C CG  . GLN B 2 211 ? -12.724 -3.305  59.583 1.00 15.07 ? 216 GLN E CG  1 
ATOM   3232 C CD  . GLN B 2 211 ? -14.116 -3.881  59.738 1.00 16.98 ? 216 GLN E CD  1 
ATOM   3233 O OE1 . GLN B 2 211 ? -14.499 -4.350  60.817 1.00 16.22 ? 216 GLN E OE1 1 
ATOM   3234 N NE2 . GLN B 2 211 ? -14.883 -3.849  58.659 1.00 14.43 ? 216 GLN E NE2 1 
ATOM   3235 N N   . PHE B 2 212 ? -12.839 -2.090  62.875 1.00 11.90 ? 217 PHE E N   1 
ATOM   3236 C CA  . PHE B 2 212 ? -12.136 -2.609  64.040 1.00 13.23 ? 217 PHE E CA  1 
ATOM   3237 C C   . PHE B 2 212 ? -12.211 -4.129  64.023 1.00 12.56 ? 217 PHE E C   1 
ATOM   3238 O O   . PHE B 2 212 ? -13.260 -4.703  63.725 1.00 12.32 ? 217 PHE E O   1 
ATOM   3239 C CB  . PHE B 2 212 ? -12.793 -2.082  65.320 1.00 11.46 ? 217 PHE E CB  1 
ATOM   3240 C CG  . PHE B 2 212 ? -12.266 -2.708  66.587 1.00 13.20 ? 217 PHE E CG  1 
ATOM   3241 C CD1 . PHE B 2 212 ? -10.967 -2.453  67.022 1.00 13.20 ? 217 PHE E CD1 1 
ATOM   3242 C CD2 . PHE B 2 212 ? -13.080 -3.537  67.358 1.00 12.95 ? 217 PHE E CD2 1 
ATOM   3243 C CE1 . PHE B 2 212 ? -10.485 -3.011  68.209 1.00 13.25 ? 217 PHE E CE1 1 
ATOM   3244 C CE2 . PHE B 2 212 ? -12.607 -4.102  68.552 1.00 12.16 ? 217 PHE E CE2 1 
ATOM   3245 C CZ  . PHE B 2 212 ? -11.311 -3.838  68.975 1.00 13.27 ? 217 PHE E CZ  1 
ATOM   3246 N N   . TYR B 2 213 ? -11.096 -4.779  64.329 1.00 13.02 ? 218 TYR E N   1 
ATOM   3247 C CA  . TYR B 2 213 ? -11.075 -6.231  64.380 1.00 13.60 ? 218 TYR E CA  1 
ATOM   3248 C C   . TYR B 2 213 ? -10.916 -6.622  65.840 1.00 14.46 ? 218 TYR E C   1 
ATOM   3249 O O   . TYR B 2 213 ? -9.912  -6.306  66.472 1.00 14.40 ? 218 TYR E O   1 
ATOM   3250 C CB  . TYR B 2 213 ? -9.931  -6.783  63.535 1.00 13.97 ? 218 TYR E CB  1 
ATOM   3251 C CG  . TYR B 2 213 ? -10.111 -6.495  62.065 1.00 14.43 ? 218 TYR E CG  1 
ATOM   3252 C CD1 . TYR B 2 213 ? -9.606  -5.328  61.497 1.00 15.22 ? 218 TYR E CD1 1 
ATOM   3253 C CD2 . TYR B 2 213 ? -10.820 -7.374  61.250 1.00 15.27 ? 218 TYR E CD2 1 
ATOM   3254 C CE1 . TYR B 2 213 ? -9.802  -5.042  60.146 1.00 17.49 ? 218 TYR E CE1 1 
ATOM   3255 C CE2 . TYR B 2 213 ? -11.023 -7.098  59.899 1.00 16.73 ? 218 TYR E CE2 1 
ATOM   3256 C CZ  . TYR B 2 213 ? -10.511 -5.932  59.357 1.00 17.20 ? 218 TYR E CZ  1 
ATOM   3257 O OH  . TYR B 2 213 ? -10.705 -5.658  58.022 1.00 20.62 ? 218 TYR E OH  1 
ATOM   3258 N N   . GLY B 2 214 ? -11.926 -7.296  66.374 1.00 15.08 ? 219 GLY E N   1 
ATOM   3259 C CA  . GLY B 2 214 ? -11.882 -7.682  67.767 1.00 16.05 ? 219 GLY E CA  1 
ATOM   3260 C C   . GLY B 2 214 ? -12.270 -9.120  68.006 1.00 18.44 ? 219 GLY E C   1 
ATOM   3261 O O   . GLY B 2 214 ? -11.803 -10.029 67.318 1.00 19.49 ? 219 GLY E O   1 
ATOM   3262 N N   . LEU B 2 215 ? -13.142 -9.321  68.985 1.00 19.32 ? 220 LEU E N   1 
ATOM   3263 C CA  . LEU B 2 215 ? -13.593 -10.656 69.359 1.00 21.87 ? 220 LEU E CA  1 
ATOM   3264 C C   . LEU B 2 215 ? -14.549 -11.303 68.367 1.00 23.49 ? 220 LEU E C   1 
ATOM   3265 O O   . LEU B 2 215 ? -15.240 -10.620 67.610 1.00 24.27 ? 220 LEU E O   1 
ATOM   3266 C CB  . LEU B 2 215 ? -14.255 -10.608 70.738 1.00 20.32 ? 220 LEU E CB  1 
ATOM   3267 C CG  . LEU B 2 215 ? -13.354 -10.362 71.951 1.00 22.40 ? 220 LEU E CG  1 
ATOM   3268 C CD1 . LEU B 2 215 ? -12.485 -9.147  71.742 1.00 24.43 ? 220 LEU E CD1 1 
ATOM   3269 C CD2 . LEU B 2 215 ? -14.225 -10.187 73.186 1.00 18.60 ? 220 LEU E CD2 1 
ATOM   3270 N N   . SER B 2 216 ? -14.578 -12.632 68.383 1.00 27.07 ? 221 SER E N   1 
ATOM   3271 C CA  . SER B 2 216 ? -15.454 -13.402 67.511 1.00 30.90 ? 221 SER E CA  1 
ATOM   3272 C C   . SER B 2 216 ? -16.471 -14.147 68.370 1.00 32.51 ? 221 SER E C   1 
ATOM   3273 O O   . SER B 2 216 ? -16.405 -14.103 69.598 1.00 31.74 ? 221 SER E O   1 
ATOM   3274 C CB  . SER B 2 216 ? -14.638 -14.395 66.678 1.00 32.09 ? 221 SER E CB  1 
ATOM   3275 O OG  . SER B 2 216 ? -13.817 -15.205 67.501 1.00 36.62 ? 221 SER E OG  1 
ATOM   3276 N N   . GLU B 2 217 ? -17.410 -14.829 67.724 1.00 34.24 ? 222 GLU E N   1 
ATOM   3277 C CA  . GLU B 2 217 ? -18.439 -15.571 68.443 1.00 36.25 ? 222 GLU E CA  1 
ATOM   3278 C C   . GLU B 2 217 ? -17.858 -16.641 69.364 1.00 35.97 ? 222 GLU E C   1 
ATOM   3279 O O   . GLU B 2 217 ? -18.456 -16.973 70.387 1.00 37.25 ? 222 GLU E O   1 
ATOM   3280 C CB  . GLU B 2 217 ? -19.407 -16.218 67.448 1.00 39.47 ? 222 GLU E CB  1 
ATOM   3281 C CG  . GLU B 2 217 ? -20.116 -15.221 66.547 1.00 43.92 ? 222 GLU E CG  1 
ATOM   3282 C CD  . GLU B 2 217 ? -21.107 -15.886 65.611 1.00 47.35 ? 222 GLU E CD  1 
ATOM   3283 O OE1 . GLU B 2 217 ? -20.680 -16.722 64.787 1.00 49.44 ? 222 GLU E OE1 1 
ATOM   3284 O OE2 . GLU B 2 217 ? -22.314 -15.572 65.701 1.00 49.10 ? 222 GLU E OE2 1 
ATOM   3285 N N   . ASN B 2 218 ? -16.694 -17.172 69.004 1.00 34.54 ? 223 ASN E N   1 
ATOM   3286 C CA  . ASN B 2 218 ? -16.045 -18.210 69.801 1.00 34.09 ? 223 ASN E CA  1 
ATOM   3287 C C   . ASN B 2 218 ? -15.396 -17.686 71.078 1.00 32.08 ? 223 ASN E C   1 
ATOM   3288 O O   . ASN B 2 218 ? -15.030 -18.465 71.958 1.00 32.90 ? 223 ASN E O   1 
ATOM   3289 C CB  . ASN B 2 218 ? -14.997 -18.940 68.957 1.00 37.27 ? 223 ASN E CB  1 
ATOM   3290 C CG  . ASN B 2 218 ? -15.617 -19.842 67.904 1.00 39.98 ? 223 ASN E CG  1 
ATOM   3291 O OD1 . ASN B 2 218 ? -14.918 -20.395 67.054 1.00 41.84 ? 223 ASN E OD1 1 
ATOM   3292 N ND2 . ASN B 2 218 ? -16.936 -20.002 67.962 1.00 41.49 ? 223 ASN E ND2 1 
ATOM   3293 N N   . ASP B 2 219 ? -15.246 -16.371 71.180 1.00 29.30 ? 224 ASP E N   1 
ATOM   3294 C CA  . ASP B 2 219 ? -14.641 -15.768 72.364 1.00 28.00 ? 224 ASP E CA  1 
ATOM   3295 C C   . ASP B 2 219 ? -15.694 -15.556 73.442 1.00 27.06 ? 224 ASP E C   1 
ATOM   3296 O O   . ASP B 2 219 ? -16.796 -15.094 73.157 1.00 27.03 ? 224 ASP E O   1 
ATOM   3297 C CB  . ASP B 2 219 ? -14.003 -14.424 72.005 1.00 27.29 ? 224 ASP E CB  1 
ATOM   3298 C CG  . ASP B 2 219 ? -12.761 -14.579 71.153 1.00 28.03 ? 224 ASP E CG  1 
ATOM   3299 O OD1 . ASP B 2 219 ? -12.519 -13.709 70.290 1.00 28.92 ? 224 ASP E OD1 1 
ATOM   3300 O OD2 . ASP B 2 219 ? -12.021 -15.566 71.356 1.00 28.25 ? 224 ASP E OD2 1 
ATOM   3301 N N   . GLU B 2 220 ? -15.359 -15.903 74.679 1.00 27.05 ? 225 GLU E N   1 
ATOM   3302 C CA  . GLU B 2 220 ? -16.294 -15.716 75.779 1.00 27.63 ? 225 GLU E CA  1 
ATOM   3303 C C   . GLU B 2 220 ? -16.290 -14.256 76.205 1.00 25.63 ? 225 GLU E C   1 
ATOM   3304 O O   . GLU B 2 220 ? -15.306 -13.544 76.005 1.00 26.18 ? 225 GLU E O   1 
ATOM   3305 C CB  . GLU B 2 220 ? -15.912 -16.596 76.969 1.00 31.42 ? 225 GLU E CB  1 
ATOM   3306 C CG  . GLU B 2 220 ? -16.259 -18.064 76.788 1.00 37.77 ? 225 GLU E CG  1 
ATOM   3307 C CD  . GLU B 2 220 ? -15.935 -18.893 78.017 1.00 42.28 ? 225 GLU E CD  1 
ATOM   3308 O OE1 . GLU B 2 220 ? -16.386 -18.522 79.122 1.00 45.19 ? 225 GLU E OE1 1 
ATOM   3309 O OE2 . GLU B 2 220 ? -15.234 -19.918 77.877 1.00 44.71 ? 225 GLU E OE2 1 
ATOM   3310 N N   . TRP B 2 221 ? -17.396 -13.805 76.784 1.00 22.94 ? 226 TRP E N   1 
ATOM   3311 C CA  . TRP B 2 221 ? -17.491 -12.427 77.238 1.00 20.07 ? 226 TRP E CA  1 
ATOM   3312 C C   . TRP B 2 221 ? -18.348 -12.385 78.492 1.00 19.99 ? 226 TRP E C   1 
ATOM   3313 O O   . TRP B 2 221 ? -19.511 -12.780 78.469 1.00 21.28 ? 226 TRP E O   1 
ATOM   3314 C CB  . TRP B 2 221 ? -18.103 -11.540 76.153 1.00 18.40 ? 226 TRP E CB  1 
ATOM   3315 C CG  . TRP B 2 221 ? -17.998 -10.083 76.480 1.00 16.48 ? 226 TRP E CG  1 
ATOM   3316 C CD1 . TRP B 2 221 ? -19.022 -9.230  76.774 1.00 15.15 ? 226 TRP E CD1 1 
ATOM   3317 C CD2 . TRP B 2 221 ? -16.793 -9.312  76.570 1.00 15.86 ? 226 TRP E CD2 1 
ATOM   3318 N NE1 . TRP B 2 221 ? -18.532 -7.975  77.044 1.00 16.26 ? 226 TRP E NE1 1 
ATOM   3319 C CE2 . TRP B 2 221 ? -17.166 -7.996  76.927 1.00 15.25 ? 226 TRP E CE2 1 
ATOM   3320 C CE3 . TRP B 2 221 ? -15.434 -9.604  76.386 1.00 15.43 ? 226 TRP E CE3 1 
ATOM   3321 C CZ2 . TRP B 2 221 ? -16.230 -6.972  77.102 1.00 14.60 ? 226 TRP E CZ2 1 
ATOM   3322 C CZ3 . TRP B 2 221 ? -14.500 -8.585  76.560 1.00 15.05 ? 226 TRP E CZ3 1 
ATOM   3323 C CH2 . TRP B 2 221 ? -14.905 -7.283  76.914 1.00 15.16 ? 226 TRP E CH2 1 
ATOM   3324 N N   . THR B 2 222 ? -17.767 -11.908 79.586 1.00 20.28 ? 227 THR E N   1 
ATOM   3325 C CA  . THR B 2 222 ? -18.492 -11.850 80.848 1.00 20.81 ? 227 THR E CA  1 
ATOM   3326 C C   . THR B 2 222 ? -18.485 -10.464 81.484 1.00 21.44 ? 227 THR E C   1 
ATOM   3327 O O   . THR B 2 222 ? -18.723 -10.324 82.686 1.00 22.91 ? 227 THR E O   1 
ATOM   3328 C CB  . THR B 2 222 ? -17.914 -12.876 81.849 1.00 20.34 ? 227 THR E CB  1 
ATOM   3329 O OG1 . THR B 2 222 ? -16.559 -12.536 82.169 1.00 21.09 ? 227 THR E OG1 1 
ATOM   3330 C CG2 . THR B 2 222 ? -17.943 -14.274 81.239 1.00 19.22 ? 227 THR E CG2 1 
ATOM   3331 N N   . GLN B 2 223 ? -18.215 -9.440  80.679 1.00 20.35 ? 228 GLN E N   1 
ATOM   3332 C CA  . GLN B 2 223 ? -18.196 -8.071  81.179 1.00 21.24 ? 228 GLN E CA  1 
ATOM   3333 C C   . GLN B 2 223 ? -19.592 -7.486  81.033 1.00 22.03 ? 228 GLN E C   1 
ATOM   3334 O O   . GLN B 2 223 ? -20.426 -8.029  80.312 1.00 21.52 ? 228 GLN E O   1 
ATOM   3335 C CB  . GLN B 2 223 ? -17.201 -7.217  80.393 1.00 21.08 ? 228 GLN E CB  1 
ATOM   3336 C CG  . GLN B 2 223 ? -15.775 -7.737  80.391 1.00 22.55 ? 228 GLN E CG  1 
ATOM   3337 C CD  . GLN B 2 223 ? -15.231 -7.971  81.780 1.00 24.58 ? 228 GLN E CD  1 
ATOM   3338 O OE1 . GLN B 2 223 ? -15.018 -9.112  82.190 1.00 27.50 ? 228 GLN E OE1 1 
ATOM   3339 N NE2 . GLN B 2 223 ? -15.004 -6.891  82.518 1.00 25.81 ? 228 GLN E NE2 1 
ATOM   3340 N N   . ASP B 2 224 ? -19.843 -6.371  81.708 1.00 24.15 ? 229 ASP E N   1 
ATOM   3341 C CA  . ASP B 2 224 ? -21.153 -5.739  81.646 1.00 26.93 ? 229 ASP E CA  1 
ATOM   3342 C C   . ASP B 2 224 ? -21.382 -5.007  80.320 1.00 27.20 ? 229 ASP E C   1 
ATOM   3343 O O   . ASP B 2 224 ? -22.502 -4.961  79.811 1.00 28.99 ? 229 ASP E O   1 
ATOM   3344 C CB  . ASP B 2 224 ? -21.312 -4.762  82.814 1.00 29.38 ? 229 ASP E CB  1 
ATOM   3345 C CG  . ASP B 2 224 ? -22.749 -4.625  83.261 1.00 33.77 ? 229 ASP E CG  1 
ATOM   3346 O OD1 . ASP B 2 224 ? -23.618 -4.354  82.406 1.00 34.78 ? 229 ASP E OD1 1 
ATOM   3347 O OD2 . ASP B 2 224 ? -23.012 -4.790  84.474 1.00 39.44 ? 229 ASP E OD2 1 
ATOM   3348 N N   . ARG B 2 225 ? -20.314 -4.443  79.767 1.00 25.51 ? 230 ARG E N   1 
ATOM   3349 C CA  . ARG B 2 225 ? -20.379 -3.703  78.509 1.00 24.78 ? 230 ARG E CA  1 
ATOM   3350 C C   . ARG B 2 225 ? -20.579 -4.608  77.297 1.00 22.88 ? 230 ARG E C   1 
ATOM   3351 O O   . ARG B 2 225 ? -20.380 -5.820  77.373 1.00 21.68 ? 230 ARG E O   1 
ATOM   3352 C CB  . ARG B 2 225 ? -19.094 -2.889  78.330 1.00 26.68 ? 230 ARG E CB  1 
ATOM   3353 C CG  . ARG B 2 225 ? -17.829 -3.696  78.589 1.00 30.80 ? 230 ARG E CG  1 
ATOM   3354 C CD  . ARG B 2 225 ? -16.569 -2.853  78.474 1.00 33.20 ? 230 ARG E CD  1 
ATOM   3355 N NE  . ARG B 2 225 ? -16.089 -2.787  77.102 1.00 35.30 ? 230 ARG E NE  1 
ATOM   3356 C CZ  . ARG B 2 225 ? -14.975 -3.369  76.668 1.00 35.06 ? 230 ARG E CZ  1 
ATOM   3357 N NH1 . ARG B 2 225 ? -14.209 -4.067  77.497 1.00 31.81 ? 230 ARG E NH1 1 
ATOM   3358 N NH2 . ARG B 2 225 ? -14.630 -3.256  75.398 1.00 34.50 ? 230 ARG E NH2 1 
ATOM   3359 N N   . ALA B 2 226 ? -20.973 -4.008  76.178 1.00 21.98 ? 231 ALA E N   1 
ATOM   3360 C CA  . ALA B 2 226 ? -21.188 -4.751  74.942 1.00 20.90 ? 231 ALA E CA  1 
ATOM   3361 C C   . ALA B 2 226 ? -19.899 -5.461  74.529 1.00 20.33 ? 231 ALA E C   1 
ATOM   3362 O O   . ALA B 2 226 ? -18.808 -4.911  74.673 1.00 21.27 ? 231 ALA E O   1 
ATOM   3363 C CB  . ALA B 2 226 ? -21.636 -3.797  73.828 1.00 22.69 ? 231 ALA E CB  1 
ATOM   3364 N N   . LYS B 2 227 ? -20.030 -6.682  74.019 1.00 19.51 ? 232 LYS E N   1 
ATOM   3365 C CA  . LYS B 2 227 ? -18.874 -7.456  73.576 1.00 18.57 ? 232 LYS E CA  1 
ATOM   3366 C C   . LYS B 2 227 ? -18.180 -6.681  72.453 1.00 18.03 ? 232 LYS E C   1 
ATOM   3367 O O   . LYS B 2 227 ? -18.826 -6.271  71.488 1.00 19.64 ? 232 LYS E O   1 
ATOM   3368 C CB  . LYS B 2 227 ? -19.331 -8.824  73.069 1.00 19.10 ? 232 LYS E CB  1 
ATOM   3369 C CG  . LYS B 2 227 ? -18.202 -9.777  72.701 1.00 19.54 ? 232 LYS E CG  1 
ATOM   3370 C CD  . LYS B 2 227 ? -18.764 -11.123 72.270 1.00 19.31 ? 232 LYS E CD  1 
ATOM   3371 C CE  . LYS B 2 227 ? -17.663 -12.149 72.056 1.00 20.78 ? 232 LYS E CE  1 
ATOM   3372 N NZ  . LYS B 2 227 ? -18.216 -13.465 71.633 1.00 21.87 ? 232 LYS E NZ  1 
ATOM   3373 N N   . PRO B 2 228 ? -16.858 -6.465  72.569 1.00 16.73 ? 233 PRO E N   1 
ATOM   3374 C CA  . PRO B 2 228 ? -16.091 -5.728  71.555 1.00 16.76 ? 233 PRO E CA  1 
ATOM   3375 C C   . PRO B 2 228 ? -15.752 -6.569  70.323 1.00 16.12 ? 233 PRO E C   1 
ATOM   3376 O O   . PRO B 2 228 ? -14.591 -6.907  70.076 1.00 15.47 ? 233 PRO E O   1 
ATOM   3377 C CB  . PRO B 2 228 ? -14.855 -5.286  72.328 1.00 15.60 ? 233 PRO E CB  1 
ATOM   3378 C CG  . PRO B 2 228 ? -14.609 -6.465  73.221 1.00 16.50 ? 233 PRO E CG  1 
ATOM   3379 C CD  . PRO B 2 228 ? -16.003 -6.816  73.718 1.00 17.08 ? 233 PRO E CD  1 
ATOM   3380 N N   . VAL B 2 229 ? -16.780 -6.896  69.553 1.00 15.77 ? 234 VAL E N   1 
ATOM   3381 C CA  . VAL B 2 229 ? -16.610 -7.703  68.354 1.00 15.80 ? 234 VAL E CA  1 
ATOM   3382 C C   . VAL B 2 229 ? -16.143 -6.874  67.170 1.00 14.51 ? 234 VAL E C   1 
ATOM   3383 O O   . VAL B 2 229 ? -16.124 -5.644  67.216 1.00 16.00 ? 234 VAL E O   1 
ATOM   3384 C CB  . VAL B 2 229 ? -17.930 -8.397  67.954 1.00 17.09 ? 234 VAL E CB  1 
ATOM   3385 C CG1 . VAL B 2 229 ? -18.367 -9.360  69.049 1.00 18.05 ? 234 VAL E CG1 1 
ATOM   3386 C CG2 . VAL B 2 229 ? -19.012 -7.353  67.698 1.00 16.95 ? 234 VAL E CG2 1 
ATOM   3387 N N   . THR B 2 230 ? -15.750 -7.570  66.116 1.00 14.46 ? 235 THR E N   1 
ATOM   3388 C CA  . THR B 2 230 ? -15.329 -6.917  64.887 1.00 14.19 ? 235 THR E CA  1 
ATOM   3389 C C   . THR B 2 230 ? -16.529 -6.083  64.449 1.00 14.37 ? 235 THR E C   1 
ATOM   3390 O O   . THR B 2 230 ? -17.668 -6.561  64.453 1.00 15.17 ? 235 THR E O   1 
ATOM   3391 C CB  . THR B 2 230 ? -14.961 -7.978  63.850 1.00 15.18 ? 235 THR E CB  1 
ATOM   3392 O OG1 . THR B 2 230 ? -13.799 -8.681  64.312 1.00 15.75 ? 235 THR E OG1 1 
ATOM   3393 C CG2 . THR B 2 230 ? -14.692 -7.352  62.492 1.00 14.76 ? 235 THR E CG2 1 
ATOM   3394 N N   . GLN B 2 231 ? -16.273 -4.840  64.059 1.00 12.93 ? 236 GLN E N   1 
ATOM   3395 C CA  . GLN B 2 231 ? -17.359 -3.934  63.710 1.00 12.71 ? 236 GLN E CA  1 
ATOM   3396 C C   . GLN B 2 231 ? -16.804 -2.672  63.076 1.00 12.84 ? 236 GLN E C   1 
ATOM   3397 O O   . GLN B 2 231 ? -15.601 -2.431  63.118 1.00 12.83 ? 236 GLN E O   1 
ATOM   3398 C CB  . GLN B 2 231 ? -18.085 -3.530  64.999 1.00 11.99 ? 236 GLN E CB  1 
ATOM   3399 C CG  . GLN B 2 231 ? -17.187 -2.729  65.958 1.00 15.01 ? 236 GLN E CG  1 
ATOM   3400 C CD  . GLN B 2 231 ? -17.772 -2.564  67.351 1.00 16.88 ? 236 GLN E CD  1 
ATOM   3401 O OE1 . GLN B 2 231 ? -17.594 -3.424  68.221 1.00 19.14 ? 236 GLN E OE1 1 
ATOM   3402 N NE2 . GLN B 2 231 ? -18.476 -1.464  67.569 1.00 14.83 ? 236 GLN E NE2 1 
ATOM   3403 N N   . ILE B 2 232 ? -17.680 -1.874  62.474 1.00 12.28 ? 237 ILE E N   1 
ATOM   3404 C CA  . ILE B 2 232 ? -17.233 -0.598  61.937 1.00 12.06 ? 237 ILE E CA  1 
ATOM   3405 C C   . ILE B 2 232 ? -17.844 0.489   62.810 1.00 12.57 ? 237 ILE E C   1 
ATOM   3406 O O   . ILE B 2 232 ? -18.958 0.346   63.308 1.00 13.52 ? 237 ILE E O   1 
ATOM   3407 C CB  . ILE B 2 232 ? -17.676 -0.344  60.468 1.00 14.22 ? 237 ILE E CB  1 
ATOM   3408 C CG1 . ILE B 2 232 ? -19.184 -0.548  60.315 1.00 14.64 ? 237 ILE E CG1 1 
ATOM   3409 C CG2 . ILE B 2 232 ? -16.870 -1.226  59.528 1.00 13.96 ? 237 ILE E CG2 1 
ATOM   3410 C CD1 . ILE B 2 232 ? -19.721 -0.109  58.952 1.00 17.35 ? 237 ILE E CD1 1 
ATOM   3411 N N   . VAL B 2 233 ? -17.097 1.565   63.016 1.00 12.40 ? 238 VAL E N   1 
ATOM   3412 C CA  . VAL B 2 233 ? -17.582 2.701   63.788 1.00 12.76 ? 238 VAL E CA  1 
ATOM   3413 C C   . VAL B 2 233 ? -17.289 3.886   62.884 1.00 12.43 ? 238 VAL E C   1 
ATOM   3414 O O   . VAL B 2 233 ? -16.164 4.039   62.411 1.00 13.58 ? 238 VAL E O   1 
ATOM   3415 C CB  . VAL B 2 233 ? -16.826 2.864   65.122 1.00 13.49 ? 238 VAL E CB  1 
ATOM   3416 C CG1 . VAL B 2 233 ? -17.402 4.035   65.897 1.00 13.83 ? 238 VAL E CG1 1 
ATOM   3417 C CG2 . VAL B 2 233 ? -16.932 1.574   65.940 1.00 13.54 ? 238 VAL E CG2 1 
ATOM   3418 N N   . SER B 2 234 ? -18.303 4.707   62.626 1.00 12.51 ? 239 SER E N   1 
ATOM   3419 C CA  . SER B 2 234 ? -18.139 5.845   61.731 1.00 13.57 ? 239 SER E CA  1 
ATOM   3420 C C   . SER B 2 234 ? -18.567 7.173   62.334 1.00 12.97 ? 239 SER E C   1 
ATOM   3421 O O   . SER B 2 234 ? -19.279 7.218   63.334 1.00 13.93 ? 239 SER E O   1 
ATOM   3422 C CB  . SER B 2 234 ? -18.953 5.624   60.450 1.00 14.39 ? 239 SER E CB  1 
ATOM   3423 O OG  . SER B 2 234 ? -18.657 4.384   59.832 1.00 17.68 ? 239 SER E OG  1 
ATOM   3424 N N   . ALA B 2 235 ? -18.118 8.250   61.701 1.00 13.09 ? 240 ALA E N   1 
ATOM   3425 C CA  . ALA B 2 235 ? -18.469 9.608   62.101 1.00 12.97 ? 240 ALA E CA  1 
ATOM   3426 C C   . ALA B 2 235 ? -18.704 10.349  60.790 1.00 14.31 ? 240 ALA E C   1 
ATOM   3427 O O   . ALA B 2 235 ? -18.025 10.080  59.793 1.00 12.83 ? 240 ALA E O   1 
ATOM   3428 C CB  . ALA B 2 235 ? -17.335 10.249  62.887 1.00 14.73 ? 240 ALA E CB  1 
ATOM   3429 N N   . GLU B 2 236 ? -19.658 11.276  60.784 1.00 14.86 ? 241 GLU E N   1 
ATOM   3430 C CA  . GLU B 2 236 ? -19.984 11.993  59.554 1.00 18.44 ? 241 GLU E CA  1 
ATOM   3431 C C   . GLU B 2 236 ? -20.031 13.513  59.669 1.00 17.47 ? 241 GLU E C   1 
ATOM   3432 O O   . GLU B 2 236 ? -20.061 14.078  60.762 1.00 17.02 ? 241 GLU E O   1 
ATOM   3433 C CB  . GLU B 2 236 ? -21.335 11.497  59.026 1.00 21.34 ? 241 GLU E CB  1 
ATOM   3434 C CG  . GLU B 2 236 ? -22.498 11.795  59.964 1.00 26.58 ? 241 GLU E CG  1 
ATOM   3435 C CD  . GLU B 2 236 ? -23.836 11.266  59.460 1.00 29.96 ? 241 GLU E CD  1 
ATOM   3436 O OE1 . GLU B 2 236 ? -24.848 11.449  60.172 1.00 32.08 ? 241 GLU E OE1 1 
ATOM   3437 O OE2 . GLU B 2 236 ? -23.882 10.671  58.361 1.00 30.15 ? 241 GLU E OE2 1 
ATOM   3438 N N   . ALA B 2 237 ? -20.050 14.164  58.511 1.00 16.74 ? 242 ALA E N   1 
ATOM   3439 C CA  . ALA B 2 237 ? -20.124 15.614  58.438 1.00 16.69 ? 242 ALA E CA  1 
ATOM   3440 C C   . ALA B 2 237 ? -20.676 15.967  57.068 1.00 17.87 ? 242 ALA E C   1 
ATOM   3441 O O   . ALA B 2 237 ? -20.358 15.303  56.083 1.00 17.55 ? 242 ALA E O   1 
ATOM   3442 C CB  . ALA B 2 237 ? -18.736 16.231  58.621 1.00 17.60 ? 242 ALA E CB  1 
ATOM   3443 N N   . TRP B 2 238 ? -21.522 16.989  57.008 1.00 17.52 ? 243 TRP E N   1 
ATOM   3444 C CA  . TRP B 2 238 ? -22.081 17.430  55.734 1.00 17.71 ? 243 TRP E CA  1 
ATOM   3445 C C   . TRP B 2 238 ? -21.428 18.741  55.332 1.00 17.02 ? 243 TRP E C   1 
ATOM   3446 O O   . TRP B 2 238 ? -21.018 19.524  56.189 1.00 16.40 ? 243 TRP E O   1 
ATOM   3447 C CB  . TRP B 2 238 ? -23.590 17.658  55.835 1.00 19.34 ? 243 TRP E CB  1 
ATOM   3448 C CG  . TRP B 2 238 ? -24.412 16.414  55.858 1.00 23.77 ? 243 TRP E CG  1 
ATOM   3449 C CD1 . TRP B 2 238 ? -24.716 15.651  56.945 1.00 25.09 ? 243 TRP E CD1 1 
ATOM   3450 C CD2 . TRP B 2 238 ? -25.050 15.792  54.737 1.00 25.44 ? 243 TRP E CD2 1 
ATOM   3451 N NE1 . TRP B 2 238 ? -25.509 14.591  56.573 1.00 26.72 ? 243 TRP E NE1 1 
ATOM   3452 C CE2 . TRP B 2 238 ? -25.729 14.654  55.222 1.00 27.07 ? 243 TRP E CE2 1 
ATOM   3453 C CE3 . TRP B 2 238 ? -25.114 16.087  53.367 1.00 24.08 ? 243 TRP E CE3 1 
ATOM   3454 C CZ2 . TRP B 2 238 ? -26.465 13.807  54.386 1.00 27.48 ? 243 TRP E CZ2 1 
ATOM   3455 C CZ3 . TRP B 2 238 ? -25.845 15.246  52.536 1.00 26.31 ? 243 TRP E CZ3 1 
ATOM   3456 C CH2 . TRP B 2 238 ? -26.511 14.119  53.050 1.00 27.27 ? 243 TRP E CH2 1 
ATOM   3457 N N   . GLY B 2 239 ? -21.337 18.970  54.026 1.00 18.55 ? 244 GLY E N   1 
ATOM   3458 C CA  . GLY B 2 239 ? -20.762 20.202  53.523 1.00 21.01 ? 244 GLY E CA  1 
ATOM   3459 C C   . GLY B 2 239 ? -21.508 21.371  54.131 1.00 23.48 ? 244 GLY E C   1 
ATOM   3460 O O   . GLY B 2 239 ? -22.670 21.236  54.523 1.00 23.30 ? 244 GLY E O   1 
ATOM   3461 N N   . ARG B 2 240 ? -20.852 22.523  54.195 1.00 26.08 ? 245 ARG E N   1 
ATOM   3462 C CA  . ARG B 2 240 ? -21.447 23.704  54.804 1.00 30.20 ? 245 ARG E CA  1 
ATOM   3463 C C   . ARG B 2 240 ? -21.141 24.948  53.980 1.00 31.03 ? 245 ARG E C   1 
ATOM   3464 O O   . ARG B 2 240 ? -19.991 25.198  53.628 1.00 30.02 ? 245 ARG E O   1 
ATOM   3465 C CB  . ARG B 2 240 ? -20.877 23.847  56.216 1.00 32.09 ? 245 ARG E CB  1 
ATOM   3466 C CG  . ARG B 2 240 ? -21.654 24.714  57.175 1.00 36.67 ? 245 ARG E CG  1 
ATOM   3467 C CD  . ARG B 2 240 ? -21.065 24.525  58.562 1.00 40.34 ? 245 ARG E CD  1 
ATOM   3468 N NE  . ARG B 2 240 ? -21.775 25.266  59.596 1.00 44.24 ? 245 ARG E NE  1 
ATOM   3469 C CZ  . ARG B 2 240 ? -21.502 25.170  60.893 1.00 45.55 ? 245 ARG E CZ  1 
ATOM   3470 N NH1 . ARG B 2 240 ? -20.533 24.362  61.306 1.00 45.98 ? 245 ARG E NH1 1 
ATOM   3471 N NH2 . ARG B 2 240 ? -22.194 25.880  61.774 1.00 47.04 ? 245 ARG E NH2 1 
ATOM   3472 N N   . ALA B 2 241 ? -22.175 25.725  53.674 1.00 33.44 ? 246 ALA E N   1 
ATOM   3473 C CA  . ALA B 2 241 ? -22.002 26.943  52.892 1.00 37.45 ? 246 ALA E CA  1 
ATOM   3474 C C   . ALA B 2 241 ? -21.348 28.033  53.737 1.00 40.60 ? 246 ALA E C   1 
ATOM   3475 O O   . ALA B 2 241 ? -20.341 28.619  53.337 1.00 41.00 ? 246 ALA E O   1 
ATOM   3476 C CB  . ALA B 2 241 ? -23.351 27.423  52.369 1.00 36.48 ? 246 ALA E CB  1 
ATOM   3477 N N   . ASP B 2 242 ? -21.922 28.291  54.908 1.00 43.88 ? 247 ASP E N   1 
ATOM   3478 C CA  . ASP B 2 242 ? -21.414 29.312  55.822 1.00 47.90 ? 247 ASP E CA  1 
ATOM   3479 C C   . ASP B 2 242 ? -21.366 30.700  55.188 1.00 49.16 ? 247 ASP E C   1 
ATOM   3480 O O   . ASP B 2 242 ? -22.079 31.596  55.691 1.00 50.09 ? 247 ASP E O   1 
ATOM   3481 C CB  . ASP B 2 242 ? -20.021 28.928  56.328 1.00 49.83 ? 247 ASP E CB  1 
ATOM   3482 C CG  . ASP B 2 242 ? -20.053 27.760  57.295 1.00 52.07 ? 247 ASP E CG  1 
ATOM   3483 O OD1 . ASP B 2 242 ? -20.719 27.877  58.347 1.00 53.26 ? 247 ASP E OD1 1 
ATOM   3484 O OD2 . ASP B 2 242 ? -19.414 26.728  57.006 1.00 53.56 ? 247 ASP E OD2 1 
ATOM   3485 O OXT . ASP B 2 242 ? -20.619 30.882  54.203 1.00 50.04 ? 247 ASP E OXT 1 
HETATM 3486 O O   . HOH C 3 .   ? -8.261  16.215  37.658 1.00 13.03 ? 211 HOH D O   1 
HETATM 3487 O O   . HOH C 3 .   ? 5.295   -10.289 47.711 1.00 13.98 ? 212 HOH D O   1 
HETATM 3488 O O   . HOH C 3 .   ? 14.564  -13.543 45.520 1.00 13.70 ? 213 HOH D O   1 
HETATM 3489 O O   . HOH C 3 .   ? 13.725  -17.692 48.386 1.00 13.98 ? 214 HOH D O   1 
HETATM 3490 O O   . HOH C 3 .   ? -1.809  26.901  54.645 1.00 16.71 ? 215 HOH D O   1 
HETATM 3491 O O   . HOH C 3 .   ? 3.370   21.209  52.286 1.00 13.52 ? 216 HOH D O   1 
HETATM 3492 O O   . HOH C 3 .   ? -17.784 13.644  65.256 1.00 18.08 ? 217 HOH D O   1 
HETATM 3493 O O   . HOH C 3 .   ? 7.773   26.077  55.118 1.00 20.72 ? 218 HOH D O   1 
HETATM 3494 O O   . HOH C 3 .   ? 20.382  0.548   52.191 1.00 13.93 ? 219 HOH D O   1 
HETATM 3495 O O   . HOH C 3 .   ? 5.741   36.998  58.521 1.00 19.97 ? 220 HOH D O   1 
HETATM 3496 O O   . HOH C 3 .   ? 21.682  -3.111  59.020 1.00 18.44 ? 221 HOH D O   1 
HETATM 3497 O O   . HOH C 3 .   ? 9.053   4.931   54.734 1.00 21.49 ? 222 HOH D O   1 
HETATM 3498 O O   . HOH C 3 .   ? 2.035   22.131  50.160 1.00 21.34 ? 223 HOH D O   1 
HETATM 3499 O O   . HOH C 3 .   ? 13.640  7.591   56.591 1.00 19.00 ? 224 HOH D O   1 
HETATM 3500 O O   . HOH C 3 .   ? 19.828  -1.297  59.064 1.00 19.73 ? 225 HOH D O   1 
HETATM 3501 O O   . HOH C 3 .   ? 2.080   30.691  55.043 1.00 21.30 ? 226 HOH D O   1 
HETATM 3502 O O   . HOH C 3 .   ? 1.838   25.911  67.562 1.00 19.04 ? 227 HOH D O   1 
HETATM 3503 O O   . HOH C 3 .   ? 5.503   -4.156  50.216 1.00 16.10 ? 228 HOH D O   1 
HETATM 3504 O O   . HOH C 3 .   ? 2.192   16.814  42.661 1.00 27.17 ? 229 HOH D O   1 
HETATM 3505 O O   . HOH C 3 .   ? -2.070  18.046  54.075 1.00 24.50 ? 230 HOH D O   1 
HETATM 3506 O O   . HOH C 3 .   ? 19.435  -5.097  56.642 1.00 22.29 ? 231 HOH D O   1 
HETATM 3507 O O   . HOH C 3 .   ? -18.461 11.406  66.675 1.00 21.07 ? 232 HOH D O   1 
HETATM 3508 O O   . HOH C 3 .   ? 9.931   20.965  49.974 1.00 21.53 ? 233 HOH D O   1 
HETATM 3509 O O   . HOH C 3 .   ? 3.057   12.736  41.358 1.00 23.72 ? 234 HOH D O   1 
HETATM 3510 O O   . HOH C 3 .   ? 2.378   34.825  57.411 1.00 22.26 ? 235 HOH D O   1 
HETATM 3511 O O   . HOH C 3 .   ? 28.696  -4.949  57.924 1.00 22.26 ? 236 HOH D O   1 
HETATM 3512 O O   . HOH C 3 .   ? 19.662  10.361  54.010 1.00 19.76 ? 237 HOH D O   1 
HETATM 3513 O O   . HOH C 3 .   ? 5.031   4.004   50.119 1.00 25.10 ? 238 HOH D O   1 
HETATM 3514 O O   . HOH C 3 .   ? 22.710  -11.731 37.572 1.00 25.62 ? 239 HOH D O   1 
HETATM 3515 O O   . HOH C 3 .   ? 3.635   10.220  54.172 1.00 20.62 ? 240 HOH D O   1 
HETATM 3516 O O   . HOH C 3 .   ? 31.097  0.928   47.791 1.00 23.69 ? 241 HOH D O   1 
HETATM 3517 O O   . HOH C 3 .   ? 21.858  -9.701  57.414 1.00 36.36 ? 242 HOH D O   1 
HETATM 3518 O O   . HOH C 3 .   ? 1.543   24.852  49.601 1.00 21.27 ? 243 HOH D O   1 
HETATM 3519 O O   . HOH C 3 .   ? 7.196   0.315   55.460 1.00 21.29 ? 244 HOH D O   1 
HETATM 3520 O O   . HOH C 3 .   ? 3.126   21.407  46.712 1.00 24.53 ? 245 HOH D O   1 
HETATM 3521 O O   . HOH C 3 .   ? 11.179  20.530  64.833 1.00 26.01 ? 246 HOH D O   1 
HETATM 3522 O O   . HOH C 3 .   ? 0.255   34.990  61.406 1.00 22.45 ? 247 HOH D O   1 
HETATM 3523 O O   . HOH C 3 .   ? 26.659  2.985   46.806 1.00 24.46 ? 248 HOH D O   1 
HETATM 3524 O O   . HOH C 3 .   ? 12.135  21.866  61.601 1.00 23.55 ? 249 HOH D O   1 
HETATM 3525 O O   . HOH C 3 .   ? 28.056  -0.881  45.343 1.00 26.04 ? 250 HOH D O   1 
HETATM 3526 O O   . HOH C 3 .   ? -14.290 18.292  70.256 1.00 27.78 ? 251 HOH D O   1 
HETATM 3527 O O   . HOH C 3 .   ? 23.033  0.859   60.644 1.00 23.82 ? 252 HOH D O   1 
HETATM 3528 O O   . HOH C 3 .   ? 17.425  9.464   57.529 1.00 25.91 ? 253 HOH D O   1 
HETATM 3529 O O   . HOH C 3 .   ? 4.488   31.704  55.093 1.00 26.94 ? 254 HOH D O   1 
HETATM 3530 O O   . HOH C 3 .   ? -2.381  18.052  49.416 1.00 19.93 ? 255 HOH D O   1 
HETATM 3531 O O   . HOH C 3 .   ? 21.503  -11.805 54.246 1.00 25.98 ? 256 HOH D O   1 
HETATM 3532 O O   . HOH C 3 .   ? 0.831   -7.490  51.259 1.00 24.83 ? 257 HOH D O   1 
HETATM 3533 O O   . HOH C 3 .   ? 1.885   21.020  72.838 1.00 28.67 ? 258 HOH D O   1 
HETATM 3534 O O   . HOH C 3 .   ? 6.399   10.276  54.269 1.00 27.11 ? 259 HOH D O   1 
HETATM 3535 O O   . HOH C 3 .   ? 2.750   14.802  39.673 1.00 23.62 ? 260 HOH D O   1 
HETATM 3536 O O   . HOH C 3 .   ? 3.087   24.127  46.760 1.00 26.71 ? 261 HOH D O   1 
HETATM 3537 O O   . HOH C 3 .   ? -2.320  30.631  50.444 1.00 31.58 ? 262 HOH D O   1 
HETATM 3538 O O   . HOH C 3 .   ? 4.773   32.723  62.904 1.00 28.51 ? 263 HOH D O   1 
HETATM 3539 O O   . HOH C 3 .   ? 9.087   15.386  61.284 1.00 26.89 ? 264 HOH D O   1 
HETATM 3540 O O   . HOH C 3 .   ? 2.719   18.994  44.454 1.00 23.90 ? 265 HOH D O   1 
HETATM 3541 O O   . HOH C 3 .   ? 33.026  -2.099  48.355 1.00 31.65 ? 266 HOH D O   1 
HETATM 3542 O O   . HOH C 3 .   ? 18.901  -22.148 52.111 1.00 27.93 ? 267 HOH D O   1 
HETATM 3543 O O   . HOH C 3 .   ? 4.831   20.980  70.731 1.00 25.08 ? 268 HOH D O   1 
HETATM 3544 O O   . HOH C 3 .   ? 5.767   19.763  68.290 1.00 30.38 ? 269 HOH D O   1 
HETATM 3545 O O   . HOH C 3 .   ? 6.889   -9.732  43.345 1.00 27.28 ? 270 HOH D O   1 
HETATM 3546 O O   . HOH C 3 .   ? 7.317   9.408   51.929 1.00 25.65 ? 271 HOH D O   1 
HETATM 3547 O O   . HOH C 3 .   ? 28.615  -7.467  57.287 1.00 42.26 ? 272 HOH D O   1 
HETATM 3548 O O   . HOH C 3 .   ? 12.577  4.374   40.117 1.00 30.23 ? 273 HOH D O   1 
HETATM 3549 O O   . HOH C 3 .   ? 16.184  0.670   59.975 1.00 26.31 ? 274 HOH D O   1 
HETATM 3550 O O   . HOH C 3 .   ? 3.903   7.476   44.064 1.00 36.63 ? 275 HOH D O   1 
HETATM 3551 O O   . HOH C 3 .   ? 10.996  24.871  60.038 1.00 24.46 ? 276 HOH D O   1 
HETATM 3552 O O   . HOH C 3 .   ? -20.011 17.346  65.750 1.00 32.79 ? 277 HOH D O   1 
HETATM 3553 O O   . HOH C 3 .   ? 20.372  6.513   59.217 1.00 25.74 ? 278 HOH D O   1 
HETATM 3554 O O   . HOH C 3 .   ? -6.469  36.112  60.317 1.00 31.95 ? 279 HOH D O   1 
HETATM 3555 O O   . HOH C 3 .   ? 13.913  16.477  42.484 1.00 33.27 ? 280 HOH D O   1 
HETATM 3556 O O   . HOH C 3 .   ? 5.306   8.126   50.751 1.00 28.50 ? 281 HOH D O   1 
HETATM 3557 O O   . HOH C 3 .   ? 12.191  11.554  57.611 1.00 38.51 ? 282 HOH D O   1 
HETATM 3558 O O   . HOH C 3 .   ? 18.174  -7.117  55.232 1.00 30.71 ? 283 HOH D O   1 
HETATM 3559 O O   . HOH C 3 .   ? 7.273   26.542  67.547 1.00 30.20 ? 284 HOH D O   1 
HETATM 3560 O O   . HOH C 3 .   ? 4.138   -1.766  58.557 1.00 25.94 ? 285 HOH D O   1 
HETATM 3561 O O   . HOH C 3 .   ? 22.424  6.520   53.160 1.00 30.47 ? 286 HOH D O   1 
HETATM 3562 O O   . HOH C 3 .   ? 21.391  7.810   55.348 1.00 34.08 ? 287 HOH D O   1 
HETATM 3563 O O   . HOH C 3 .   ? 24.445  -10.358 35.617 1.00 27.88 ? 288 HOH D O   1 
HETATM 3564 O O   . HOH C 3 .   ? -5.559  15.086  76.048 1.00 26.56 ? 289 HOH D O   1 
HETATM 3565 O O   . HOH C 3 .   ? 2.656   34.986  60.205 1.00 25.22 ? 290 HOH D O   1 
HETATM 3566 O O   . HOH C 3 .   ? 34.684  -0.413  46.902 1.00 30.50 ? 291 HOH D O   1 
HETATM 3567 O O   . HOH C 3 .   ? -9.727  18.758  44.085 1.00 31.49 ? 292 HOH D O   1 
HETATM 3568 O O   . HOH C 3 .   ? 4.305   -8.903  43.751 1.00 38.52 ? 293 HOH D O   1 
HETATM 3569 O O   . HOH C 3 .   ? 6.599   -0.450  57.828 1.00 28.99 ? 294 HOH D O   1 
HETATM 3570 O O   . HOH C 3 .   ? 8.670   2.567   55.967 1.00 28.26 ? 295 HOH D O   1 
HETATM 3571 O O   . HOH C 3 .   ? 12.940  7.365   59.102 1.00 30.49 ? 296 HOH D O   1 
HETATM 3572 O O   . HOH C 3 .   ? 22.966  4.519   59.818 1.00 24.45 ? 297 HOH D O   1 
HETATM 3573 O O   . HOH C 3 .   ? 20.142  -14.653 53.626 1.00 23.81 ? 298 HOH D O   1 
HETATM 3574 O O   . HOH C 3 .   ? 20.505  -16.723 45.268 1.00 26.49 ? 299 HOH D O   1 
HETATM 3575 O O   . HOH C 3 .   ? 1.623   25.069  44.722 1.00 34.02 ? 300 HOH D O   1 
HETATM 3576 O O   . HOH C 3 .   ? 4.501   27.227  67.826 1.00 27.86 ? 301 HOH D O   1 
HETATM 3577 O O   . HOH C 3 .   ? -1.476  26.084  50.653 1.00 26.03 ? 302 HOH D O   1 
HETATM 3578 O O   . HOH C 3 .   ? -17.768 9.336   69.570 1.00 31.87 ? 303 HOH D O   1 
HETATM 3579 O O   . HOH C 3 .   ? 9.036   -4.153  44.169 1.00 29.63 ? 304 HOH D O   1 
HETATM 3580 O O   . HOH C 3 .   ? 3.994   10.177  43.663 1.00 36.11 ? 305 HOH D O   1 
HETATM 3581 O O   . HOH C 3 .   ? 21.416  -5.719  31.621 1.00 33.92 ? 306 HOH D O   1 
HETATM 3582 O O   . HOH C 3 .   ? 2.811   17.553  36.880 1.00 38.90 ? 307 HOH D O   1 
HETATM 3583 O O   . HOH C 3 .   ? 6.083   30.620  64.646 1.00 35.92 ? 308 HOH D O   1 
HETATM 3584 O O   . HOH C 3 .   ? 4.529   21.627  44.406 1.00 35.12 ? 309 HOH D O   1 
HETATM 3585 O O   . HOH C 3 .   ? -1.140  -6.387  54.462 1.00 30.57 ? 310 HOH D O   1 
HETATM 3586 O O   . HOH C 3 .   ? 8.792   2.803   58.538 1.00 33.94 ? 311 HOH D O   1 
HETATM 3587 O O   . HOH C 3 .   ? -16.377 19.764  63.853 1.00 36.34 ? 312 HOH D O   1 
HETATM 3588 O O   . HOH C 3 .   ? 8.190   28.664  54.090 1.00 33.02 ? 313 HOH D O   1 
HETATM 3589 O O   . HOH C 3 .   ? 6.190   30.530  49.950 1.00 38.04 ? 314 HOH D O   1 
HETATM 3590 O O   . HOH C 3 .   ? 11.812  30.239  59.369 1.00 42.48 ? 315 HOH D O   1 
HETATM 3591 O O   . HOH C 3 .   ? 6.590   12.131  65.498 1.00 47.84 ? 316 HOH D O   1 
HETATM 3592 O O   . HOH C 3 .   ? -20.761 10.239  65.844 1.00 32.19 ? 317 HOH D O   1 
HETATM 3593 O O   . HOH C 3 .   ? -2.919  34.823  65.587 1.00 32.10 ? 318 HOH D O   1 
HETATM 3594 O O   . HOH C 3 .   ? 0.987   -4.312  59.505 1.00 41.34 ? 319 HOH D O   1 
HETATM 3595 O O   . HOH C 3 .   ? 35.682  -1.982  44.945 1.00 28.99 ? 320 HOH D O   1 
HETATM 3596 O O   . HOH C 3 .   ? 29.794  -12.482 39.520 1.00 34.87 ? 321 HOH D O   1 
HETATM 3597 O O   . HOH C 3 .   ? 12.489  17.726  40.783 1.00 42.66 ? 322 HOH D O   1 
HETATM 3598 O O   . HOH C 3 .   ? -0.057  22.794  74.476 1.00 36.56 ? 323 HOH D O   1 
HETATM 3599 O O   . HOH C 3 .   ? 9.813   27.534  65.918 1.00 26.62 ? 324 HOH D O   1 
HETATM 3600 O O   . HOH C 3 .   ? 7.936   15.551  54.403 1.00 35.53 ? 325 HOH D O   1 
HETATM 3601 O O   . HOH C 3 .   ? -10.913 21.763  67.832 1.00 41.61 ? 326 HOH D O   1 
HETATM 3602 O O   . HOH C 3 .   ? 11.384  35.085  57.137 1.00 31.47 ? 327 HOH D O   1 
HETATM 3603 O O   . HOH C 3 .   ? 24.357  -1.162  37.923 1.00 32.46 ? 328 HOH D O   1 
HETATM 3604 O O   . HOH C 3 .   ? 31.198  -7.388  57.679 1.00 47.92 ? 329 HOH D O   1 
HETATM 3605 O O   . HOH C 3 .   ? 7.208   12.660  55.365 1.00 29.38 ? 330 HOH D O   1 
HETATM 3606 O O   . HOH C 3 .   ? 0.699   20.673  37.961 1.00 33.44 ? 331 HOH D O   1 
HETATM 3607 O O   . HOH C 3 .   ? -11.791 12.104  70.327 1.00 47.37 ? 332 HOH D O   1 
HETATM 3608 O O   . HOH C 3 .   ? -0.373  15.772  54.691 1.00 41.08 ? 333 HOH D O   1 
HETATM 3609 O O   . HOH C 3 .   ? 10.794  -3.722  58.933 1.00 31.15 ? 334 HOH D O   1 
HETATM 3610 O O   . HOH C 3 .   ? 8.179   17.222  42.090 1.00 40.43 ? 335 HOH D O   1 
HETATM 3611 O O   . HOH C 3 .   ? 2.133   20.728  42.412 1.00 44.22 ? 336 HOH D O   1 
HETATM 3612 O O   . HOH C 3 .   ? 36.132  -10.132 53.683 1.00 41.03 ? 337 HOH D O   1 
HETATM 3613 O O   . HOH C 3 .   ? 2.644   31.100  49.927 1.00 52.86 ? 338 HOH D O   1 
HETATM 3614 O O   . HOH C 3 .   ? 4.992   18.100  45.226 1.00 34.74 ? 339 HOH D O   1 
HETATM 3615 O O   . HOH C 3 .   ? -1.590  -5.087  59.341 1.00 47.73 ? 340 HOH D O   1 
HETATM 3616 O O   . HOH C 3 .   ? 17.767  10.988  46.454 1.00 39.15 ? 341 HOH D O   1 
HETATM 3617 O O   . HOH C 3 .   ? 31.436  -1.492  52.813 1.00 33.11 ? 342 HOH D O   1 
HETATM 3618 O O   . HOH C 3 .   ? 15.283  -6.316  62.507 1.00 32.62 ? 343 HOH D O   1 
HETATM 3619 O O   . HOH C 3 .   ? -7.132  13.689  74.584 1.00 47.13 ? 344 HOH D O   1 
HETATM 3620 O O   . HOH C 3 .   ? 4.492   6.211   52.502 1.00 33.17 ? 345 HOH D O   1 
HETATM 3621 O O   . HOH C 3 .   ? 2.553   -5.701  57.696 1.00 38.74 ? 346 HOH D O   1 
HETATM 3622 O O   . HOH C 3 .   ? 5.670   29.962  70.439 1.00 52.79 ? 347 HOH D O   1 
HETATM 3623 O O   . HOH C 3 .   ? 8.781   11.582  60.048 1.00 47.65 ? 348 HOH D O   1 
HETATM 3624 O O   . HOH C 3 .   ? 27.039  -18.496 49.855 1.00 55.06 ? 349 HOH D O   1 
HETATM 3625 O O   . HOH C 3 .   ? -4.386  29.787  69.486 1.00 32.45 ? 350 HOH D O   1 
HETATM 3626 O O   . HOH C 3 .   ? 9.567   4.511   60.344 1.00 39.78 ? 351 HOH D O   1 
HETATM 3627 O O   . HOH C 3 .   ? -0.583  35.630  63.956 1.00 34.72 ? 352 HOH D O   1 
HETATM 3628 O O   . HOH C 3 .   ? 9.128   7.061   56.450 1.00 29.09 ? 353 HOH D O   1 
HETATM 3629 O O   . HOH C 3 .   ? 32.054  -3.995  53.449 1.00 35.92 ? 354 HOH D O   1 
HETATM 3630 O O   . HOH C 3 .   ? 23.673  -16.882 46.349 1.00 38.10 ? 355 HOH D O   1 
HETATM 3631 O O   . HOH C 3 .   ? 20.036  -17.999 53.490 1.00 46.55 ? 356 HOH D O   1 
HETATM 3632 O O   . HOH C 3 .   ? 8.385   -2.591  59.116 1.00 36.11 ? 357 HOH D O   1 
HETATM 3633 O O   . HOH C 3 .   ? 19.656  10.444  48.066 1.00 46.34 ? 358 HOH D O   1 
HETATM 3634 O O   . HOH C 3 .   ? 8.595   11.920  57.469 1.00 43.56 ? 359 HOH D O   1 
HETATM 3635 O O   . HOH C 3 .   ? 22.142  8.168   57.800 1.00 33.47 ? 360 HOH D O   1 
HETATM 3636 O O   . HOH C 3 .   ? 0.540   32.809  67.536 1.00 38.87 ? 361 HOH D O   1 
HETATM 3637 O O   . HOH C 3 .   ? -3.597  10.153  45.383 1.00 41.67 ? 362 HOH D O   1 
HETATM 3638 O O   . HOH C 3 .   ? 10.372  25.698  69.016 1.00 43.42 ? 363 HOH D O   1 
HETATM 3639 O O   . HOH C 3 .   ? 10.232  3.752   41.031 1.00 43.63 ? 364 HOH D O   1 
HETATM 3640 O O   . HOH C 3 .   ? 11.153  18.312  37.128 1.00 38.98 ? 365 HOH D O   1 
HETATM 3641 O O   . HOH C 3 .   ? 9.467   6.666   59.047 1.00 40.44 ? 366 HOH D O   1 
HETATM 3642 O O   . HOH C 3 .   ? 14.947  -5.370  32.673 1.00 46.89 ? 367 HOH D O   1 
HETATM 3643 O O   . HOH C 3 .   ? 6.485   5.380   54.372 1.00 50.18 ? 368 HOH D O   1 
HETATM 3644 O O   . HOH C 3 .   ? 31.530  -7.028  41.279 1.00 35.80 ? 369 HOH D O   1 
HETATM 3645 O O   . HOH C 3 .   ? -3.515  31.004  66.488 1.00 50.64 ? 370 HOH D O   1 
HETATM 3646 O O   . HOH C 3 .   ? 14.656  10.185  45.291 1.00 44.72 ? 371 HOH D O   1 
HETATM 3647 O O   . HOH C 3 .   ? 0.958   0.923   52.119 1.00 32.28 ? 372 HOH D O   1 
HETATM 3648 O O   . HOH C 3 .   ? 19.035  -3.660  30.467 1.00 49.37 ? 373 HOH D O   1 
HETATM 3649 O O   . HOH C 3 .   ? 21.209  -5.888  58.505 1.00 36.62 ? 374 HOH D O   1 
HETATM 3650 O O   . HOH C 3 .   ? 2.775   -7.730  49.242 1.00 42.11 ? 375 HOH D O   1 
HETATM 3651 O O   . HOH C 3 .   ? 34.886  -12.585 45.267 1.00 35.40 ? 376 HOH D O   1 
HETATM 3652 O O   . HOH C 3 .   ? -4.579  28.597  64.578 1.00 38.74 ? 377 HOH D O   1 
HETATM 3653 O O   . HOH C 3 .   ? 1.783   9.425   64.326 1.00 43.19 ? 378 HOH D O   1 
HETATM 3654 O O   . HOH C 3 .   ? 20.367  -9.801  55.358 1.00 38.52 ? 379 HOH D O   1 
HETATM 3655 O O   . HOH C 3 .   ? 3.303   -9.198  46.303 1.00 32.59 ? 380 HOH D O   1 
HETATM 3656 O O   . HOH C 3 .   ? 9.051   10.893  40.556 1.00 44.60 ? 381 HOH D O   1 
HETATM 3657 O O   . HOH C 3 .   ? 28.934  -10.890 55.112 1.00 33.21 ? 382 HOH D O   1 
HETATM 3658 O O   . HOH C 3 .   ? 37.601  -8.690  47.243 1.00 44.70 ? 383 HOH D O   1 
HETATM 3659 O O   . HOH C 3 .   ? 20.312  -21.711 56.321 1.00 44.67 ? 384 HOH D O   1 
HETATM 3660 O O   . HOH C 3 .   ? 1.552   11.203  43.055 1.00 39.36 ? 385 HOH D O   1 
HETATM 3661 O O   . HOH C 3 .   ? 20.047  -19.466 51.430 1.00 43.90 ? 386 HOH D O   1 
HETATM 3662 O O   . HOH C 3 .   ? 14.228  7.813   35.103 1.00 41.67 ? 387 HOH D O   1 
HETATM 3663 O O   . HOH C 3 .   ? -7.656  21.204  74.412 1.00 45.16 ? 388 HOH D O   1 
HETATM 3664 O O   . HOH C 3 .   ? 21.677  7.163   39.515 1.00 43.47 ? 389 HOH D O   1 
HETATM 3665 O O   . HOH C 3 .   ? -5.886  13.131  77.921 1.00 43.96 ? 390 HOH D O   1 
HETATM 3666 O O   . HOH C 3 .   ? 13.252  -7.861  37.907 1.00 40.33 ? 391 HOH D O   1 
HETATM 3667 O O   . HOH C 3 .   ? 5.120   15.390  40.965 1.00 45.15 ? 392 HOH D O   1 
HETATM 3668 O O   . HOH C 3 .   ? 33.866  -0.696  42.540 1.00 38.94 ? 393 HOH D O   1 
HETATM 3669 O O   . HOH C 3 .   ? -13.315 21.021  72.801 1.00 40.79 ? 394 HOH D O   1 
HETATM 3670 O O   . HOH C 3 .   ? -17.919 10.379  73.418 1.00 47.76 ? 395 HOH D O   1 
HETATM 3671 O O   . HOH C 3 .   ? -12.280 26.182  63.448 1.00 42.28 ? 396 HOH D O   1 
HETATM 3672 O O   . HOH C 3 .   ? 18.897  -0.486  61.448 1.00 40.14 ? 397 HOH D O   1 
HETATM 3673 O O   . HOH C 3 .   ? 5.078   17.981  39.529 1.00 48.99 ? 398 HOH D O   1 
HETATM 3674 O O   . HOH C 3 .   ? -14.075 19.070  78.423 1.00 51.25 ? 399 HOH D O   1 
HETATM 3675 O O   . HOH C 3 .   ? 4.568   13.693  74.873 1.00 39.94 ? 400 HOH D O   1 
HETATM 3676 O O   . HOH C 3 .   ? 29.181  0.082   43.228 1.00 38.10 ? 401 HOH D O   1 
HETATM 3677 O O   . HOH C 3 .   ? 15.915  10.782  38.570 1.00 38.14 ? 402 HOH D O   1 
HETATM 3678 O O   . HOH C 3 .   ? 10.551  14.628  68.769 1.00 46.05 ? 403 HOH D O   1 
HETATM 3679 O O   . HOH C 3 .   ? 26.699  -16.219 51.475 1.00 46.83 ? 404 HOH D O   1 
HETATM 3680 O O   . HOH C 3 .   ? 7.162   4.817   41.375 1.00 49.74 ? 405 HOH D O   1 
HETATM 3681 O O   . HOH C 3 .   ? -2.907  28.913  48.137 1.00 40.92 ? 406 HOH D O   1 
HETATM 3682 O O   . HOH C 3 .   ? 7.563   -7.116  43.384 1.00 29.71 ? 407 HOH D O   1 
HETATM 3683 O O   . HOH C 3 .   ? 13.670  25.576  59.654 1.00 46.28 ? 408 HOH D O   1 
HETATM 3684 O O   . HOH C 3 .   ? 0.219   10.040  77.335 1.00 46.88 ? 409 HOH D O   1 
HETATM 3685 O O   . HOH C 3 .   ? 24.948  9.877   41.405 1.00 52.77 ? 410 HOH D O   1 
HETATM 3686 O O   . HOH C 3 .   ? 19.504  -18.467 47.066 1.00 46.36 ? 411 HOH D O   1 
HETATM 3687 O O   . HOH C 3 .   ? -2.068  33.174  67.718 1.00 46.48 ? 412 HOH D O   1 
HETATM 3688 O O   . HOH C 3 .   ? 17.045  20.393  51.320 1.00 44.19 ? 413 HOH D O   1 
HETATM 3689 O O   . HOH C 3 .   ? 4.277   17.438  81.188 1.00 48.16 ? 414 HOH D O   1 
HETATM 3690 O O   . HOH C 3 .   ? 16.996  16.958  41.546 1.00 49.56 ? 415 HOH D O   1 
HETATM 3691 O O   . HOH C 3 .   ? 18.213  17.974  44.248 1.00 40.70 ? 416 HOH D O   1 
HETATM 3692 O O   . HOH C 3 .   ? 37.961  -1.564  53.990 1.00 46.44 ? 417 HOH D O   1 
HETATM 3693 O O   . HOH C 3 .   ? 4.147   10.558  77.040 1.00 43.16 ? 418 HOH D O   1 
HETATM 3694 O O   . HOH C 3 .   ? 5.179   9.482   74.609 1.00 48.42 ? 419 HOH D O   1 
HETATM 3695 O O   . HOH C 3 .   ? 4.593   -1.773  45.595 1.00 56.71 ? 420 HOH D O   1 
HETATM 3696 O O   . HOH C 3 .   ? 24.816  -15.710 35.592 1.00 36.21 ? 421 HOH D O   1 
HETATM 3697 O O   . HOH C 3 .   ? 15.955  5.541   62.155 1.00 51.62 ? 422 HOH D O   1 
HETATM 3698 O O   . HOH C 3 .   ? 23.413  7.841   62.782 1.00 49.60 ? 423 HOH D O   1 
HETATM 3699 O O   . HOH C 3 .   ? 15.021  17.640  57.533 1.00 46.07 ? 424 HOH D O   1 
HETATM 3700 O O   . HOH C 3 .   ? 2.029   12.833  74.174 1.00 44.15 ? 425 HOH D O   1 
HETATM 3701 O O   . HOH C 3 .   ? 35.539  -2.148  50.629 1.00 35.95 ? 426 HOH D O   1 
HETATM 3702 O O   . HOH C 3 .   ? -18.235 12.464  75.611 1.00 50.97 ? 427 HOH D O   1 
HETATM 3703 O O   . HOH C 3 .   ? 19.343  11.117  56.912 1.00 44.28 ? 428 HOH D O   1 
HETATM 3704 O O   . HOH C 3 .   ? 10.510  -5.839  40.324 1.00 47.89 ? 429 HOH D O   1 
HETATM 3705 O O   . HOH C 3 .   ? 31.745  0.881   43.415 1.00 40.60 ? 430 HOH D O   1 
HETATM 3706 O O   . HOH C 3 .   ? 24.024  -18.927 38.970 1.00 42.44 ? 431 HOH D O   1 
HETATM 3707 O O   . HOH C 3 .   ? 1.915   6.760   48.587 1.00 46.21 ? 432 HOH D O   1 
HETATM 3708 O O   . HOH C 3 .   ? 34.768  -12.725 42.078 1.00 48.20 ? 433 HOH D O   1 
HETATM 3709 O O   . HOH C 3 .   ? 13.024  -3.377  59.863 1.00 37.31 ? 434 HOH D O   1 
HETATM 3710 O O   . HOH C 3 .   ? 16.196  -11.855 60.508 1.00 47.91 ? 435 HOH D O   1 
HETATM 3711 O O   . HOH C 3 .   ? -9.926  38.797  64.070 1.00 43.56 ? 436 HOH D O   1 
HETATM 3712 O O   . HOH C 3 .   ? 22.921  -14.879 37.204 1.00 32.29 ? 437 HOH D O   1 
HETATM 3713 O O   . HOH C 3 .   ? 7.228   1.972   42.602 1.00 45.51 ? 438 HOH D O   1 
HETATM 3714 O O   . HOH C 3 .   ? 2.328   12.458  70.961 1.00 41.00 ? 439 HOH D O   1 
HETATM 3715 O O   . HOH C 3 .   ? 6.989   8.900   56.492 1.00 35.36 ? 440 HOH D O   1 
HETATM 3716 O O   . HOH C 3 .   ? -11.179 36.612  64.885 1.00 48.62 ? 441 HOH D O   1 
HETATM 3717 O O   . HOH C 3 .   ? 11.617  -0.464  60.142 1.00 39.92 ? 442 HOH D O   1 
HETATM 3718 O O   . HOH C 3 .   ? 15.016  -2.022  32.343 1.00 49.48 ? 443 HOH D O   1 
HETATM 3719 O O   . HOH C 3 .   ? -5.176  13.958  80.668 1.00 49.93 ? 444 HOH D O   1 
HETATM 3720 O O   . HOH C 3 .   ? -3.461  33.655  70.070 1.00 48.61 ? 445 HOH D O   1 
HETATM 3721 O O   . HOH C 3 .   ? 9.043   29.221  47.951 1.00 54.67 ? 446 HOH D O   1 
HETATM 3722 O O   . HOH C 3 .   ? 20.939  -16.665 55.421 1.00 45.67 ? 447 HOH D O   1 
HETATM 3723 O O   . HOH C 3 .   ? -3.922  -2.503  56.474 1.00 41.36 ? 448 HOH D O   1 
HETATM 3724 O O   . HOH C 3 .   ? 9.009   26.666  43.539 1.00 48.21 ? 449 HOH D O   1 
HETATM 3725 O O   . HOH C 3 .   ? 32.373  -11.438 39.767 1.00 51.02 ? 450 HOH D O   1 
HETATM 3726 O O   . HOH C 3 .   ? 12.458  28.744  61.995 1.00 43.13 ? 451 HOH D O   1 
HETATM 3727 O O   . HOH C 3 .   ? 4.327   13.085  82.370 1.00 49.25 ? 452 HOH D O   1 
HETATM 3728 O O   . HOH C 3 .   ? -15.727 20.243  73.191 1.00 49.48 ? 453 HOH D O   1 
HETATM 3729 O O   . HOH C 3 .   ? 2.603   31.125  68.078 1.00 43.87 ? 454 HOH D O   1 
HETATM 3730 O O   . HOH C 3 .   ? 19.155  -11.330 60.829 1.00 40.15 ? 455 HOH D O   1 
HETATM 3731 O O   . HOH C 3 .   ? -5.902  10.457  72.212 1.00 41.20 ? 456 HOH D O   1 
HETATM 3732 O O   . HOH C 3 .   ? 2.849   1.458   41.300 1.00 46.41 ? 457 HOH D O   1 
HETATM 3733 O O   . HOH C 3 .   ? 9.289   31.217  57.368 1.00 37.85 ? 458 HOH D O   1 
HETATM 3734 O O   . HOH C 3 .   ? 11.957  27.473  67.436 1.00 45.25 ? 459 HOH D O   1 
HETATM 3735 O O   . HOH C 3 .   ? 8.727   29.895  64.259 1.00 39.28 ? 460 HOH D O   1 
HETATM 3736 O O   . HOH C 3 .   ? 19.983  -6.341  60.716 1.00 39.30 ? 461 HOH D O   1 
HETATM 3737 O O   . HOH C 3 .   ? -7.939  11.367  77.144 1.00 50.74 ? 462 HOH D O   1 
HETATM 3738 O O   . HOH C 3 .   ? 18.090  8.228   37.151 1.00 32.42 ? 463 HOH D O   1 
HETATM 3739 O O   . HOH C 3 .   ? -1.852  37.299  68.285 1.00 44.38 ? 464 HOH D O   1 
HETATM 3740 O O   . HOH C 3 .   ? -8.243  18.222  81.452 1.00 51.80 ? 465 HOH D O   1 
HETATM 3741 O O   . HOH C 3 .   ? 11.976  9.880   33.476 1.00 46.60 ? 466 HOH D O   1 
HETATM 3742 O O   . HOH C 3 .   ? 9.356   22.532  43.516 1.00 47.56 ? 467 HOH D O   1 
HETATM 3743 O O   . HOH C 3 .   ? 23.330  -17.979 35.252 1.00 51.47 ? 468 HOH D O   1 
HETATM 3744 O O   . HOH C 3 .   ? 5.758   11.638  73.004 1.00 41.07 ? 469 HOH D O   1 
HETATM 3745 O O   . HOH C 3 .   ? -2.216  31.614  73.316 1.00 50.57 ? 470 HOH D O   1 
HETATM 3746 O O   . HOH C 3 .   ? 9.032   29.695  50.717 1.00 50.40 ? 471 HOH D O   1 
HETATM 3747 O O   . HOH C 3 .   ? -13.218 24.311  61.895 1.00 42.21 ? 472 HOH D O   1 
HETATM 3748 O O   . HOH C 3 .   ? 19.713  -20.369 49.177 1.00 42.30 ? 473 HOH D O   1 
HETATM 3749 O O   . HOH C 3 .   ? 6.142   11.406  44.049 1.00 36.82 ? 474 HOH D O   1 
HETATM 3750 O O   . HOH C 3 .   ? 20.030  2.996   52.901 1.00 39.55 ? 475 HOH D O   1 
HETATM 3751 O O   . HOH C 3 .   ? 16.911  -0.222  35.643 1.00 40.39 ? 476 HOH D O   1 
HETATM 3752 O O   . HOH C 3 .   ? 3.120   8.447   56.187 1.00 40.30 ? 477 HOH D O   1 
HETATM 3753 O O   . HOH C 3 .   ? -1.318  14.226  56.355 1.00 43.78 ? 478 HOH D O   1 
HETATM 3754 O O   . HOH C 3 .   ? 1.516   20.968  44.843 1.00 43.60 ? 479 HOH D O   1 
HETATM 3755 O O   . HOH C 3 .   ? -1.576  -6.233  51.902 1.00 42.22 ? 480 HOH D O   1 
HETATM 3756 O O   . HOH C 3 .   ? 9.704   -2.976  41.522 1.00 42.22 ? 481 HOH D O   1 
HETATM 3757 O O   . HOH C 3 .   ? 20.642  -15.901 37.700 1.00 41.97 ? 482 HOH D O   1 
HETATM 3758 O O   . HOH C 3 .   ? 4.572   9.458   59.015 1.00 40.80 ? 483 HOH D O   1 
HETATM 3759 O O   . HOH C 3 .   ? 14.143  -0.634  59.383 1.00 41.15 ? 484 HOH D O   1 
HETATM 3760 O O   . HOH C 3 .   ? 15.778  17.125  43.991 1.00 42.94 ? 485 HOH D O   1 
HETATM 3761 O O   . HOH C 3 .   ? 28.844  -6.945  34.446 1.00 45.07 ? 486 HOH D O   1 
HETATM 3762 O O   . HOH C 3 .   ? -2.523  -1.422  58.430 1.00 41.42 ? 487 HOH D O   1 
HETATM 3763 O O   . HOH C 3 .   ? 18.531  -13.150 49.111 1.00 43.83 ? 488 HOH D O   1 
HETATM 3764 O O   . HOH C 3 .   ? 12.574  16.527  56.994 1.00 41.92 ? 489 HOH D O   1 
HETATM 3765 O O   . HOH C 3 .   ? 8.042   9.334   38.082 1.00 39.86 ? 490 HOH D O   1 
HETATM 3766 O O   . HOH C 3 .   ? 29.573  -6.089  37.744 1.00 40.67 ? 491 HOH D O   1 
HETATM 3767 O O   . HOH C 3 .   ? 9.940   21.995  45.996 1.00 44.05 ? 492 HOH D O   1 
HETATM 3768 O O   . HOH C 3 .   ? -6.676  27.481  69.924 1.00 40.28 ? 493 HOH D O   1 
HETATM 3769 O O   . HOH C 3 .   ? 27.835  -4.617  33.456 1.00 45.13 ? 494 HOH D O   1 
HETATM 3770 O O   . HOH C 3 .   ? 5.680   14.948  55.606 1.00 38.43 ? 495 HOH D O   1 
HETATM 3771 O O   . HOH C 3 .   ? 12.993  -4.514  31.045 1.00 41.36 ? 496 HOH D O   1 
HETATM 3772 O O   . HOH C 3 .   ? -11.770 11.521  72.879 1.00 44.32 ? 497 HOH D O   1 
HETATM 3773 O O   . HOH C 3 .   ? 6.073   8.967   64.076 1.00 44.63 ? 498 HOH D O   1 
HETATM 3774 O O   . HOH D 3 .   ? -7.960  28.508  62.246 1.00 12.94 ? 248 HOH E O   1 
HETATM 3775 O O   . HOH D 3 .   ? 3.698   -31.123 56.621 1.00 12.66 ? 249 HOH E O   1 
HETATM 3776 O O   . HOH D 3 .   ? -20.934 6.322   53.113 1.00 13.50 ? 250 HOH E O   1 
HETATM 3777 O O   . HOH D 3 .   ? -12.553 1.025   56.861 1.00 13.97 ? 251 HOH E O   1 
HETATM 3778 O O   . HOH D 3 .   ? 13.602  -17.252 54.045 1.00 15.96 ? 252 HOH E O   1 
HETATM 3779 O O   . HOH D 3 .   ? -20.447 -3.077  62.565 1.00 16.83 ? 253 HOH E O   1 
HETATM 3780 O O   . HOH D 3 .   ? -1.553  -16.681 58.588 1.00 14.50 ? 254 HOH E O   1 
HETATM 3781 O O   . HOH D 3 .   ? 14.370  -13.481 57.607 1.00 19.59 ? 255 HOH E O   1 
HETATM 3782 O O   . HOH D 3 .   ? -20.362 8.995   52.477 1.00 13.18 ? 256 HOH E O   1 
HETATM 3783 O O   . HOH D 3 .   ? -6.040  2.459   58.249 1.00 19.04 ? 257 HOH E O   1 
HETATM 3784 O O   . HOH D 3 .   ? 15.836  -14.560 59.872 1.00 19.84 ? 258 HOH E O   1 
HETATM 3785 O O   . HOH D 3 .   ? -6.575  5.373   55.251 1.00 19.03 ? 259 HOH E O   1 
HETATM 3786 O O   . HOH D 3 .   ? 7.415   -10.525 45.968 1.00 13.75 ? 260 HOH E O   1 
HETATM 3787 O O   . HOH D 3 .   ? -12.497 9.969   68.844 1.00 19.31 ? 261 HOH E O   1 
HETATM 3788 O O   . HOH D 3 .   ? 12.803  -19.477 46.685 1.00 18.12 ? 262 HOH E O   1 
HETATM 3789 O O   . HOH D 3 .   ? -9.392  -11.114 60.495 1.00 20.15 ? 263 HOH E O   1 
HETATM 3790 O O   . HOH D 3 .   ? -24.471 8.635   46.577 1.00 23.59 ? 264 HOH E O   1 
HETATM 3791 O O   . HOH D 3 .   ? 14.530  -16.218 46.194 1.00 16.71 ? 265 HOH E O   1 
HETATM 3792 O O   . HOH D 3 .   ? 12.946  -22.138 47.466 1.00 18.59 ? 266 HOH E O   1 
HETATM 3793 O O   . HOH D 3 .   ? -1.442  -28.767 52.447 1.00 13.98 ? 267 HOH E O   1 
HETATM 3794 O O   . HOH D 3 .   ? -10.363 5.718   51.942 1.00 19.78 ? 268 HOH E O   1 
HETATM 3795 O O   . HOH D 3 .   ? 6.859   -27.575 63.044 1.00 20.07 ? 269 HOH E O   1 
HETATM 3796 O O   . HOH D 3 .   ? -20.994 3.960   63.830 1.00 19.20 ? 270 HOH E O   1 
HETATM 3797 O O   . HOH D 3 .   ? -7.791  14.860  45.289 1.00 21.89 ? 271 HOH E O   1 
HETATM 3798 O O   . HOH D 3 .   ? -18.901 0.490   69.444 1.00 21.10 ? 272 HOH E O   1 
HETATM 3799 O O   . HOH D 3 .   ? -19.263 27.370  46.854 1.00 21.16 ? 273 HOH E O   1 
HETATM 3800 O O   . HOH D 3 .   ? -17.413 2.693   70.006 1.00 19.20 ? 274 HOH E O   1 
HETATM 3801 O O   . HOH D 3 .   ? -20.030 -0.268  65.700 1.00 20.81 ? 275 HOH E O   1 
HETATM 3802 O O   . HOH D 3 .   ? -6.821  -1.855  77.187 1.00 19.67 ? 276 HOH E O   1 
HETATM 3803 O O   . HOH D 3 .   ? -5.888  -18.309 54.148 1.00 18.66 ? 277 HOH E O   1 
HETATM 3804 O O   . HOH D 3 .   ? -16.511 2.884   46.832 1.00 18.40 ? 278 HOH E O   1 
HETATM 3805 O O   . HOH D 3 .   ? -2.221  10.913  50.004 1.00 19.65 ? 279 HOH E O   1 
HETATM 3806 O O   . HOH D 3 .   ? 14.862  -14.432 42.954 1.00 15.93 ? 280 HOH E O   1 
HETATM 3807 O O   . HOH D 3 .   ? -17.821 7.002   68.063 1.00 19.61 ? 281 HOH E O   1 
HETATM 3808 O O   . HOH D 3 .   ? -21.274 11.391  63.297 1.00 24.87 ? 282 HOH E O   1 
HETATM 3809 O O   . HOH D 3 .   ? -19.999 24.693  46.234 1.00 21.90 ? 283 HOH E O   1 
HETATM 3810 O O   . HOH D 3 .   ? 4.613   -6.387  59.482 1.00 25.37 ? 284 HOH E O   1 
HETATM 3811 O O   . HOH D 3 .   ? -22.306 -2.008  60.984 1.00 28.61 ? 285 HOH E O   1 
HETATM 3812 O O   . HOH D 3 .   ? -8.964  22.560  58.505 1.00 21.48 ? 286 HOH E O   1 
HETATM 3813 O O   . HOH D 3 .   ? 11.032  -9.652  63.945 1.00 19.36 ? 287 HOH E O   1 
HETATM 3814 O O   . HOH D 3 .   ? -3.946  19.709  55.193 1.00 19.09 ? 288 HOH E O   1 
HETATM 3815 O O   . HOH D 3 .   ? -14.217 -4.043  80.816 1.00 24.21 ? 289 HOH E O   1 
HETATM 3816 O O   . HOH D 3 .   ? -20.761 2.756   61.166 1.00 20.20 ? 290 HOH E O   1 
HETATM 3817 O O   . HOH D 3 .   ? 1.887   -24.116 46.795 1.00 20.58 ? 291 HOH E O   1 
HETATM 3818 O O   . HOH D 3 .   ? -5.107  3.210   78.001 1.00 22.49 ? 292 HOH E O   1 
HETATM 3819 O O   . HOH D 3 .   ? -17.369 -5.569  60.834 1.00 19.71 ? 293 HOH E O   1 
HETATM 3820 O O   . HOH D 3 .   ? -11.899 18.237  45.955 1.00 20.84 ? 294 HOH E O   1 
HETATM 3821 O O   . HOH D 3 .   ? -18.753 1.593   53.431 1.00 20.60 ? 295 HOH E O   1 
HETATM 3822 O O   . HOH D 3 .   ? -19.550 7.631   65.979 1.00 24.82 ? 296 HOH E O   1 
HETATM 3823 O O   . HOH D 3 .   ? -8.194  -19.278 59.241 1.00 22.53 ? 297 HOH E O   1 
HETATM 3824 O O   . HOH D 3 .   ? -9.607  -12.193 67.258 1.00 20.93 ? 298 HOH E O   1 
HETATM 3825 O O   . HOH D 3 .   ? -0.774  -1.357  74.004 1.00 20.70 ? 299 HOH E O   1 
HETATM 3826 O O   . HOH D 3 .   ? -25.914 22.013  46.146 1.00 28.80 ? 300 HOH E O   1 
HETATM 3827 O O   . HOH D 3 .   ? -3.959  -1.613  62.823 1.00 21.04 ? 301 HOH E O   1 
HETATM 3828 O O   . HOH D 3 .   ? -5.206  34.645  54.279 1.00 23.96 ? 302 HOH E O   1 
HETATM 3829 O O   . HOH D 3 .   ? -9.757  -13.277 64.272 1.00 25.15 ? 303 HOH E O   1 
HETATM 3830 O O   . HOH D 3 .   ? -6.969  -22.452 73.603 1.00 27.89 ? 304 HOH E O   1 
HETATM 3831 O O   . HOH D 3 .   ? -15.230 10.348  69.848 1.00 26.99 ? 305 HOH E O   1 
HETATM 3832 O O   . HOH D 3 .   ? -18.961 4.825   69.483 1.00 21.34 ? 306 HOH E O   1 
HETATM 3833 O O   . HOH D 3 .   ? -22.736 24.422  46.605 1.00 24.78 ? 307 HOH E O   1 
HETATM 3834 O O   . HOH D 3 .   ? 0.995   -7.294  67.335 1.00 25.62 ? 308 HOH E O   1 
HETATM 3835 O O   . HOH D 3 .   ? -10.877 13.007  47.713 1.00 24.40 ? 309 HOH E O   1 
HETATM 3836 O O   . HOH D 3 .   ? -12.235 25.928  45.774 1.00 21.79 ? 310 HOH E O   1 
HETATM 3837 O O   . HOH D 3 .   ? -5.483  -12.851 52.360 1.00 21.36 ? 311 HOH E O   1 
HETATM 3838 O O   . HOH D 3 .   ? -14.855 -11.132 79.730 1.00 27.42 ? 312 HOH E O   1 
HETATM 3839 O O   . HOH D 3 .   ? 10.985  -12.006 65.697 1.00 21.13 ? 313 HOH E O   1 
HETATM 3840 O O   . HOH D 3 .   ? -8.214  -8.454  66.557 1.00 24.67 ? 314 HOH E O   1 
HETATM 3841 O O   . HOH D 3 .   ? -2.759  -19.557 43.300 1.00 20.24 ? 315 HOH E O   1 
HETATM 3842 O O   . HOH D 3 .   ? -2.566  7.271   53.910 1.00 27.28 ? 316 HOH E O   1 
HETATM 3843 O O   . HOH D 3 .   ? -2.359  -4.442  69.297 1.00 34.68 ? 317 HOH E O   1 
HETATM 3844 O O   . HOH D 3 .   ? -9.469  -12.884 57.825 1.00 26.96 ? 318 HOH E O   1 
HETATM 3845 O O   . HOH D 3 .   ? -6.567  -20.644 61.035 1.00 25.72 ? 319 HOH E O   1 
HETATM 3846 O O   . HOH D 3 .   ? -13.113 27.996  61.542 1.00 31.29 ? 320 HOH E O   1 
HETATM 3847 O O   . HOH D 3 .   ? -0.675  8.245   65.051 1.00 31.37 ? 321 HOH E O   1 
HETATM 3848 O O   . HOH D 3 .   ? 16.663  -16.761 43.407 1.00 21.90 ? 322 HOH E O   1 
HETATM 3849 O O   . HOH D 3 .   ? -1.614  -7.655  78.616 1.00 25.10 ? 323 HOH E O   1 
HETATM 3850 O O   . HOH D 3 .   ? -13.610 2.987   73.264 1.00 27.34 ? 324 HOH E O   1 
HETATM 3851 O O   . HOH D 3 .   ? -19.722 19.860  44.671 1.00 25.59 ? 325 HOH E O   1 
HETATM 3852 O O   . HOH D 3 .   ? 4.448   -31.255 60.910 1.00 25.83 ? 326 HOH E O   1 
HETATM 3853 O O   . HOH D 3 .   ? -10.004 -13.076 78.997 1.00 24.43 ? 327 HOH E O   1 
HETATM 3854 O O   . HOH D 3 .   ? -2.588  -27.146 57.269 1.00 23.43 ? 328 HOH E O   1 
HETATM 3855 O O   . HOH D 3 .   ? -19.950 -0.950  71.647 1.00 27.63 ? 329 HOH E O   1 
HETATM 3856 O O   . HOH D 3 .   ? 5.775   -25.710 75.609 1.00 24.15 ? 330 HOH E O   1 
HETATM 3857 O O   . HOH D 3 .   ? 14.488  -23.634 41.230 1.00 27.84 ? 331 HOH E O   1 
HETATM 3858 O O   . HOH D 3 .   ? 0.625   -19.050 80.389 1.00 29.79 ? 332 HOH E O   1 
HETATM 3859 O O   . HOH D 3 .   ? -24.663 12.589  49.557 1.00 32.79 ? 333 HOH E O   1 
HETATM 3860 O O   . HOH D 3 .   ? -7.111  -19.700 66.320 1.00 23.75 ? 334 HOH E O   1 
HETATM 3861 O O   . HOH D 3 .   ? -3.205  -31.722 61.899 1.00 21.92 ? 335 HOH E O   1 
HETATM 3862 O O   . HOH D 3 .   ? 10.164  -25.996 41.604 1.00 23.53 ? 336 HOH E O   1 
HETATM 3863 O O   . HOH D 3 .   ? -3.087  -8.217  58.764 1.00 24.81 ? 337 HOH E O   1 
HETATM 3864 O O   . HOH D 3 .   ? 17.127  -20.127 61.509 1.00 33.11 ? 338 HOH E O   1 
HETATM 3865 O O   . HOH D 3 .   ? -13.732 30.925  54.926 1.00 29.61 ? 339 HOH E O   1 
HETATM 3866 O O   . HOH D 3 .   ? -17.942 17.566  63.970 1.00 33.82 ? 340 HOH E O   1 
HETATM 3867 O O   . HOH D 3 .   ? 1.420   -12.879 47.076 1.00 30.05 ? 341 HOH E O   1 
HETATM 3868 O O   . HOH D 3 .   ? -20.170 -12.720 69.285 1.00 29.01 ? 342 HOH E O   1 
HETATM 3869 O O   . HOH D 3 .   ? -11.287 -14.241 67.985 1.00 36.34 ? 343 HOH E O   1 
HETATM 3870 O O   . HOH D 3 .   ? 13.644  -14.210 40.483 1.00 28.48 ? 344 HOH E O   1 
HETATM 3871 O O   . HOH D 3 .   ? 5.241   -26.829 40.568 1.00 26.04 ? 345 HOH E O   1 
HETATM 3872 O O   . HOH D 3 .   ? 1.389   -34.920 55.366 1.00 23.78 ? 346 HOH E O   1 
HETATM 3873 O O   . HOH D 3 .   ? -6.759  5.491   77.062 1.00 33.04 ? 347 HOH E O   1 
HETATM 3874 O O   . HOH D 3 .   ? -2.362  -23.234 47.591 1.00 40.19 ? 348 HOH E O   1 
HETATM 3875 O O   . HOH D 3 .   ? 4.835   -6.270  64.024 1.00 30.56 ? 349 HOH E O   1 
HETATM 3876 O O   . HOH D 3 .   ? 6.417   -34.388 47.790 1.00 28.44 ? 350 HOH E O   1 
HETATM 3877 O O   . HOH D 3 .   ? 15.334  -28.143 61.041 1.00 27.72 ? 351 HOH E O   1 
HETATM 3878 O O   . HOH D 3 .   ? 7.694   -15.623 70.101 1.00 28.95 ? 352 HOH E O   1 
HETATM 3879 O O   . HOH D 3 .   ? -9.892  -10.022 65.414 1.00 23.04 ? 353 HOH E O   1 
HETATM 3880 O O   . HOH D 3 .   ? -21.420 -1.116  76.040 1.00 28.46 ? 354 HOH E O   1 
HETATM 3881 O O   . HOH D 3 .   ? -9.771  15.702  47.342 1.00 22.56 ? 355 HOH E O   1 
HETATM 3882 O O   . HOH D 3 .   ? -4.747  3.595   55.964 1.00 29.11 ? 356 HOH E O   1 
HETATM 3883 O O   . HOH D 3 .   ? -16.644 -10.881 65.507 1.00 32.63 ? 357 HOH E O   1 
HETATM 3884 O O   . HOH D 3 .   ? -12.576 -11.140 80.909 1.00 40.54 ? 358 HOH E O   1 
HETATM 3885 O O   . HOH D 3 .   ? -17.118 2.725   72.727 1.00 36.64 ? 359 HOH E O   1 
HETATM 3886 O O   . HOH D 3 .   ? -10.057 -17.295 60.233 1.00 33.88 ? 360 HOH E O   1 
HETATM 3887 O O   . HOH D 3 .   ? -19.670 5.766   71.997 1.00 31.33 ? 361 HOH E O   1 
HETATM 3888 O O   . HOH D 3 .   ? -18.255 -5.304  83.729 1.00 34.97 ? 362 HOH E O   1 
HETATM 3889 O O   . HOH D 3 .   ? 15.475  -17.826 62.310 1.00 29.93 ? 363 HOH E O   1 
HETATM 3890 O O   . HOH D 3 .   ? -13.625 13.695  47.857 1.00 28.36 ? 364 HOH E O   1 
HETATM 3891 O O   . HOH D 3 .   ? -11.163 -3.354  81.233 1.00 29.40 ? 365 HOH E O   1 
HETATM 3892 O O   . HOH D 3 .   ? -21.606 -6.697  70.645 1.00 26.30 ? 366 HOH E O   1 
HETATM 3893 O O   . HOH D 3 .   ? 2.988   6.037   71.143 1.00 36.06 ? 367 HOH E O   1 
HETATM 3894 O O   . HOH D 3 .   ? 5.726   -13.071 76.861 1.00 25.33 ? 368 HOH E O   1 
HETATM 3895 O O   . HOH D 3 .   ? 8.166   -11.015 41.120 1.00 36.08 ? 369 HOH E O   1 
HETATM 3896 O O   . HOH D 3 .   ? -7.350  -0.962  79.558 1.00 27.98 ? 370 HOH E O   1 
HETATM 3897 O O   . HOH D 3 .   ? -4.235  -29.052 52.616 1.00 37.80 ? 371 HOH E O   1 
HETATM 3898 O O   . HOH D 3 .   ? -20.300 22.935  44.097 1.00 32.19 ? 372 HOH E O   1 
HETATM 3899 O O   . HOH D 3 .   ? -9.105  1.126   79.977 1.00 28.62 ? 373 HOH E O   1 
HETATM 3900 O O   . HOH D 3 .   ? -21.656 -2.371  65.012 1.00 30.55 ? 374 HOH E O   1 
HETATM 3901 O O   . HOH D 3 .   ? -18.894 -9.028  64.067 1.00 30.44 ? 375 HOH E O   1 
HETATM 3902 O O   . HOH D 3 .   ? 9.861   -32.815 48.885 1.00 38.65 ? 376 HOH E O   1 
HETATM 3903 O O   . HOH D 3 .   ? -3.035  -26.763 68.485 1.00 38.26 ? 377 HOH E O   1 
HETATM 3904 O O   . HOH D 3 .   ? -13.284 21.986  43.050 1.00 40.82 ? 378 HOH E O   1 
HETATM 3905 O O   . HOH D 3 .   ? 0.163   0.717   66.793 1.00 34.74 ? 379 HOH E O   1 
HETATM 3906 O O   . HOH D 3 .   ? 5.234   -7.027  68.029 1.00 25.65 ? 380 HOH E O   1 
HETATM 3907 O O   . HOH D 3 .   ? -19.384 16.900  61.840 1.00 26.50 ? 381 HOH E O   1 
HETATM 3908 O O   . HOH D 3 .   ? 1.230   1.340   58.288 1.00 27.47 ? 382 HOH E O   1 
HETATM 3909 O O   . HOH D 3 .   ? -0.599  -4.013  71.198 1.00 36.55 ? 383 HOH E O   1 
HETATM 3910 O O   . HOH D 3 .   ? -12.854 -0.879  50.767 1.00 33.90 ? 384 HOH E O   1 
HETATM 3911 O O   . HOH D 3 .   ? -7.329  33.023  56.505 1.00 32.95 ? 385 HOH E O   1 
HETATM 3912 O O   . HOH D 3 .   ? -12.498 28.633  46.696 1.00 33.63 ? 386 HOH E O   1 
HETATM 3913 O O   . HOH D 3 .   ? 4.008   -2.447  61.916 1.00 35.03 ? 387 HOH E O   1 
HETATM 3914 O O   . HOH D 3 .   ? 15.302  -17.777 37.803 1.00 38.03 ? 388 HOH E O   1 
HETATM 3915 O O   . HOH D 3 .   ? -10.309 9.296   45.017 1.00 32.40 ? 389 HOH E O   1 
HETATM 3916 O O   . HOH D 3 .   ? -22.087 7.493   60.205 1.00 36.94 ? 390 HOH E O   1 
HETATM 3917 O O   . HOH D 3 .   ? -16.583 28.228  53.338 1.00 34.22 ? 391 HOH E O   1 
HETATM 3918 O O   . HOH D 3 .   ? -18.921 -3.298  70.836 1.00 26.90 ? 392 HOH E O   1 
HETATM 3919 O O   . HOH D 3 .   ? -14.794 23.983  42.050 1.00 36.75 ? 393 HOH E O   1 
HETATM 3920 O O   . HOH D 3 .   ? -4.679  -28.491 61.289 1.00 30.49 ? 394 HOH E O   1 
HETATM 3921 O O   . HOH D 3 .   ? -21.314 20.172  58.677 1.00 39.11 ? 395 HOH E O   1 
HETATM 3922 O O   . HOH D 3 .   ? -17.141 -2.843  74.348 1.00 31.54 ? 396 HOH E O   1 
HETATM 3923 O O   . HOH D 3 .   ? -14.223 31.795  52.518 1.00 38.22 ? 397 HOH E O   1 
HETATM 3924 O O   . HOH D 3 .   ? -19.909 13.951  63.485 1.00 27.26 ? 398 HOH E O   1 
HETATM 3925 O O   . HOH D 3 .   ? 3.525   -13.879 78.456 1.00 35.11 ? 399 HOH E O   1 
HETATM 3926 O O   . HOH D 3 .   ? -4.736  -30.590 58.604 1.00 34.88 ? 400 HOH E O   1 
HETATM 3927 O O   . HOH D 3 .   ? 15.825  -20.293 36.597 1.00 35.36 ? 401 HOH E O   1 
HETATM 3928 O O   . HOH D 3 .   ? -16.245 21.216  43.444 1.00 31.36 ? 402 HOH E O   1 
HETATM 3929 O O   . HOH D 3 .   ? 16.637  -18.140 46.470 1.00 32.51 ? 403 HOH E O   1 
HETATM 3930 O O   . HOH D 3 .   ? 12.914  -8.731  65.984 1.00 32.90 ? 404 HOH E O   1 
HETATM 3931 O O   . HOH D 3 .   ? 0.181   -21.530 79.663 1.00 30.47 ? 405 HOH E O   1 
HETATM 3932 O O   . HOH D 3 .   ? -3.969  -0.755  60.588 1.00 28.72 ? 406 HOH E O   1 
HETATM 3933 O O   . HOH D 3 .   ? -21.699 -4.761  66.319 1.00 31.99 ? 407 HOH E O   1 
HETATM 3934 O O   . HOH D 3 .   ? -12.348 -6.923  56.454 1.00 41.21 ? 408 HOH E O   1 
HETATM 3935 O O   . HOH D 3 .   ? -10.071 -16.024 65.054 1.00 34.12 ? 409 HOH E O   1 
HETATM 3936 O O   . HOH D 3 .   ? -23.069 26.207  48.990 1.00 34.79 ? 410 HOH E O   1 
HETATM 3937 O O   . HOH D 3 .   ? -21.198 2.194   65.922 1.00 29.10 ? 411 HOH E O   1 
HETATM 3938 O O   . HOH D 3 .   ? -10.726 -10.674 63.035 1.00 38.12 ? 412 HOH E O   1 
HETATM 3939 O O   . HOH D 3 .   ? 5.233   -4.954  61.733 1.00 33.99 ? 413 HOH E O   1 
HETATM 3940 O O   . HOH D 3 .   ? 7.937   -4.098  61.695 1.00 31.13 ? 414 HOH E O   1 
HETATM 3941 O O   . HOH D 3 .   ? -8.118  -6.868  55.795 1.00 36.16 ? 415 HOH E O   1 
HETATM 3942 O O   . HOH D 3 .   ? -20.382 -6.289  64.449 1.00 33.97 ? 416 HOH E O   1 
HETATM 3943 O O   . HOH D 3 .   ? 17.913  -16.961 40.310 1.00 32.21 ? 417 HOH E O   1 
HETATM 3944 O O   . HOH D 3 .   ? 3.239   -6.455  66.117 1.00 34.02 ? 418 HOH E O   1 
HETATM 3945 O O   . HOH D 3 .   ? -17.213 10.462  46.041 1.00 32.82 ? 419 HOH E O   1 
HETATM 3946 O O   . HOH D 3 .   ? 4.067   1.208   58.601 1.00 36.53 ? 420 HOH E O   1 
HETATM 3947 O O   . HOH D 3 .   ? -7.570  5.587   52.551 1.00 30.18 ? 421 HOH E O   1 
HETATM 3948 O O   . HOH D 3 .   ? -4.120  -29.617 48.245 1.00 32.09 ? 422 HOH E O   1 
HETATM 3949 O O   . HOH D 3 .   ? -20.126 -14.286 73.715 1.00 33.57 ? 423 HOH E O   1 
HETATM 3950 O O   . HOH D 3 .   ? -17.948 26.541  54.832 1.00 34.66 ? 424 HOH E O   1 
HETATM 3951 O O   . HOH D 3 .   ? -26.863 14.012  49.131 1.00 44.69 ? 425 HOH E O   1 
HETATM 3952 O O   . HOH D 3 .   ? 6.766   -31.608 62.423 1.00 51.83 ? 426 HOH E O   1 
HETATM 3953 O O   . HOH D 3 .   ? -3.480  -24.268 67.911 1.00 27.92 ? 427 HOH E O   1 
HETATM 3954 O O   . HOH D 3 .   ? 2.904   -32.991 49.114 1.00 36.09 ? 428 HOH E O   1 
HETATM 3955 O O   . HOH D 3 .   ? 0.682   -7.678  73.947 1.00 30.37 ? 429 HOH E O   1 
HETATM 3956 O O   . HOH D 3 .   ? -17.834 -3.698  81.605 1.00 29.63 ? 430 HOH E O   1 
HETATM 3957 O O   . HOH D 3 .   ? 7.947   -27.397 40.096 1.00 30.10 ? 431 HOH E O   1 
HETATM 3958 O O   . HOH D 3 .   ? -15.199 12.373  46.126 1.00 28.18 ? 432 HOH E O   1 
HETATM 3959 O O   . HOH D 3 .   ? 3.524   -18.260 83.365 1.00 32.83 ? 433 HOH E O   1 
HETATM 3960 O O   . HOH D 3 .   ? 13.466  -13.497 68.187 1.00 37.97 ? 434 HOH E O   1 
HETATM 3961 O O   . HOH D 3 .   ? 5.723   3.653   58.008 1.00 35.39 ? 435 HOH E O   1 
HETATM 3962 O O   . HOH D 3 .   ? 1.478   6.636   80.133 1.00 33.86 ? 436 HOH E O   1 
HETATM 3963 O O   . HOH D 3 .   ? -3.269  1.412   61.456 1.00 35.02 ? 437 HOH E O   1 
HETATM 3964 O O   . HOH D 3 .   ? -2.213  -26.284 76.696 1.00 41.21 ? 438 HOH E O   1 
HETATM 3965 O O   . HOH D 3 .   ? 4.166   -27.821 46.811 1.00 33.90 ? 439 HOH E O   1 
HETATM 3966 O O   . HOH D 3 .   ? -5.465  -19.036 79.277 1.00 32.60 ? 440 HOH E O   1 
HETATM 3967 O O   . HOH D 3 .   ? -13.936 -3.203  56.208 1.00 26.68 ? 441 HOH E O   1 
HETATM 3968 O O   . HOH D 3 .   ? 12.739  -18.296 34.013 1.00 33.53 ? 442 HOH E O   1 
HETATM 3969 O O   . HOH D 3 .   ? -3.526  -19.362 47.337 1.00 29.75 ? 443 HOH E O   1 
HETATM 3970 O O   . HOH D 3 .   ? 0.076   -26.185 44.794 1.00 34.87 ? 444 HOH E O   1 
HETATM 3971 O O   . HOH D 3 .   ? 1.984   -1.260  69.728 1.00 30.97 ? 445 HOH E O   1 
HETATM 3972 O O   . HOH D 3 .   ? -26.550 19.280  54.330 1.00 37.43 ? 446 HOH E O   1 
HETATM 3973 O O   . HOH D 3 .   ? -22.329 17.926  59.534 1.00 29.58 ? 447 HOH E O   1 
HETATM 3974 O O   . HOH D 3 .   ? -19.184 12.376  44.943 1.00 33.34 ? 448 HOH E O   1 
HETATM 3975 O O   . HOH D 3 .   ? 3.925   -34.175 65.068 1.00 33.34 ? 449 HOH E O   1 
HETATM 3976 O O   . HOH D 3 .   ? -4.012  -23.831 75.911 1.00 32.75 ? 450 HOH E O   1 
HETATM 3977 O O   . HOH D 3 .   ? -1.661  -30.159 64.866 1.00 31.52 ? 451 HOH E O   1 
HETATM 3978 O O   . HOH D 3 .   ? 2.558   -31.902 46.822 1.00 40.52 ? 452 HOH E O   1 
HETATM 3979 O O   . HOH D 3 .   ? -12.459 -12.438 65.696 1.00 35.85 ? 453 HOH E O   1 
HETATM 3980 O O   . HOH D 3 .   ? -1.130  -24.517 39.219 1.00 46.11 ? 454 HOH E O   1 
HETATM 3981 O O   . HOH D 3 .   ? -8.510  24.460  45.684 1.00 26.82 ? 455 HOH E O   1 
HETATM 3982 O O   . HOH D 3 .   ? 1.791   -25.836 68.289 1.00 33.43 ? 456 HOH E O   1 
HETATM 3983 O O   . HOH D 3 .   ? 1.962   8.749   72.667 1.00 35.75 ? 457 HOH E O   1 
HETATM 3984 O O   . HOH D 3 .   ? -10.043 -8.547  55.916 1.00 42.19 ? 458 HOH E O   1 
HETATM 3985 O O   . HOH D 3 .   ? 0.730   -4.186  66.777 1.00 41.99 ? 459 HOH E O   1 
HETATM 3986 O O   . HOH D 3 .   ? -18.014 -0.191  74.050 1.00 40.87 ? 460 HOH E O   1 
HETATM 3987 O O   . HOH D 3 .   ? -13.312 -11.020 62.969 1.00 37.97 ? 461 HOH E O   1 
HETATM 3988 O O   . HOH D 3 .   ? 4.721   5.452   56.424 1.00 36.22 ? 462 HOH E O   1 
HETATM 3989 O O   . HOH D 3 .   ? 9.312   -5.174  69.158 1.00 40.55 ? 463 HOH E O   1 
HETATM 3990 O O   . HOH D 3 .   ? -14.346 8.141   44.793 1.00 33.72 ? 464 HOH E O   1 
HETATM 3991 O O   . HOH D 3 .   ? 3.817   -25.679 38.275 1.00 45.59 ? 465 HOH E O   1 
HETATM 3992 O O   . HOH D 3 .   ? -10.855 29.477  61.738 1.00 38.61 ? 466 HOH E O   1 
HETATM 3993 O O   . HOH D 3 .   ? -10.525 -10.421 58.227 1.00 31.59 ? 467 HOH E O   1 
HETATM 3994 O O   . HOH D 3 .   ? -5.722  7.955   78.036 1.00 39.00 ? 468 HOH E O   1 
HETATM 3995 O O   . HOH D 3 .   ? 0.159   -27.855 67.744 1.00 43.51 ? 469 HOH E O   1 
HETATM 3996 O O   . HOH D 3 .   ? -5.028  -31.194 56.017 1.00 38.49 ? 470 HOH E O   1 
HETATM 3997 O O   . HOH D 3 .   ? 14.127  -25.227 44.404 1.00 32.35 ? 471 HOH E O   1 
HETATM 3998 O O   . HOH D 3 .   ? -19.488 -1.624  81.881 1.00 47.24 ? 472 HOH E O   1 
HETATM 3999 O O   . HOH D 3 .   ? -2.688  -22.470 79.143 1.00 33.60 ? 473 HOH E O   1 
HETATM 4000 O O   . HOH D 3 .   ? 6.743   -36.834 53.728 1.00 32.58 ? 474 HOH E O   1 
HETATM 4001 O O   . HOH D 3 .   ? -26.752 26.229  51.995 1.00 43.05 ? 475 HOH E O   1 
HETATM 4002 O O   . HOH D 3 .   ? 8.092   -28.543 65.253 1.00 29.71 ? 476 HOH E O   1 
HETATM 4003 O O   . HOH D 3 .   ? -3.915  0.765   58.559 1.00 36.82 ? 477 HOH E O   1 
HETATM 4004 O O   . HOH D 3 .   ? 8.635   -34.972 49.986 1.00 39.08 ? 478 HOH E O   1 
HETATM 4005 O O   . HOH D 3 .   ? 3.053   -27.427 70.461 1.00 41.80 ? 479 HOH E O   1 
HETATM 4006 O O   . HOH D 3 .   ? -19.494 3.731   43.926 1.00 29.95 ? 480 HOH E O   1 
HETATM 4007 O O   . HOH D 3 .   ? 13.780  -27.048 48.488 1.00 37.28 ? 481 HOH E O   1 
HETATM 4008 O O   . HOH D 3 .   ? -21.646 -10.296 79.568 1.00 39.88 ? 482 HOH E O   1 
HETATM 4009 O O   . HOH D 3 .   ? 3.649   -28.451 42.084 1.00 40.97 ? 483 HOH E O   1 
HETATM 4010 O O   . HOH D 3 .   ? 1.462   -33.256 65.732 1.00 32.72 ? 484 HOH E O   1 
HETATM 4011 O O   . HOH D 3 .   ? -14.773 10.250  72.442 1.00 36.67 ? 485 HOH E O   1 
HETATM 4012 O O   . HOH D 3 .   ? -3.343  -24.366 45.195 1.00 48.35 ? 486 HOH E O   1 
HETATM 4013 O O   . HOH D 3 .   ? -4.351  -28.671 66.664 1.00 37.66 ? 487 HOH E O   1 
HETATM 4014 O O   . HOH D 3 .   ? 6.031   -9.002  70.700 1.00 37.99 ? 488 HOH E O   1 
HETATM 4015 O O   . HOH D 3 .   ? -15.913 -10.777 84.197 1.00 38.48 ? 489 HOH E O   1 
HETATM 4016 O O   . HOH D 3 .   ? -26.122 23.651  55.755 1.00 46.18 ? 490 HOH E O   1 
HETATM 4017 O O   . HOH D 3 .   ? -3.915  -3.015  59.700 1.00 40.12 ? 491 HOH E O   1 
HETATM 4018 O O   . HOH D 3 .   ? -10.849 -0.170  81.713 1.00 38.54 ? 492 HOH E O   1 
HETATM 4019 O O   . HOH D 3 .   ? -7.936  34.186  58.776 1.00 36.52 ? 493 HOH E O   1 
HETATM 4020 O O   . HOH D 3 .   ? -0.452  -5.074  73.701 1.00 36.34 ? 494 HOH E O   1 
HETATM 4021 O O   . HOH D 3 .   ? -11.789 -1.590  55.897 1.00 38.57 ? 495 HOH E O   1 
HETATM 4022 O O   . HOH D 3 .   ? -22.710 -7.923  77.216 1.00 46.03 ? 496 HOH E O   1 
HETATM 4023 O O   . HOH D 3 .   ? -20.756 16.267  44.509 1.00 34.85 ? 497 HOH E O   1 
HETATM 4024 O O   . HOH D 3 .   ? -21.574 -4.187  69.189 1.00 43.46 ? 498 HOH E O   1 
HETATM 4025 O O   . HOH D 3 .   ? -22.113 -11.218 70.391 1.00 39.08 ? 499 HOH E O   1 
HETATM 4026 O O   . HOH D 3 .   ? 5.013   -8.146  73.023 1.00 42.36 ? 500 HOH E O   1 
HETATM 4027 O O   . HOH D 3 .   ? 2.946   -12.371 80.703 1.00 49.58 ? 501 HOH E O   1 
HETATM 4028 O O   . HOH D 3 .   ? 0.398   8.303   55.686 1.00 48.83 ? 502 HOH E O   1 
HETATM 4029 O O   . HOH D 3 .   ? 1.508   -34.714 50.609 1.00 35.03 ? 503 HOH E O   1 
HETATM 4030 O O   . HOH D 3 .   ? -25.750 11.003  51.269 1.00 50.60 ? 504 HOH E O   1 
HETATM 4031 O O   . HOH D 3 .   ? -1.891  -30.114 47.004 1.00 42.92 ? 505 HOH E O   1 
HETATM 4032 O O   . HOH D 3 .   ? -22.457 -8.118  74.552 1.00 35.69 ? 506 HOH E O   1 
HETATM 4033 O O   . HOH D 3 .   ? 14.902  -21.749 67.007 1.00 47.06 ? 507 HOH E O   1 
HETATM 4034 O O   . HOH D 3 .   ? 3.057   -26.910 44.547 1.00 37.98 ? 508 HOH E O   1 
HETATM 4035 O O   . HOH D 3 .   ? -2.284  4.277   57.201 1.00 37.51 ? 509 HOH E O   1 
HETATM 4036 O O   . HOH D 3 .   ? -3.684  23.560  43.933 1.00 37.20 ? 510 HOH E O   1 
HETATM 4037 O O   . HOH D 3 .   ? -1.454  -1.401  60.690 1.00 37.70 ? 511 HOH E O   1 
HETATM 4038 O O   . HOH D 3 .   ? -13.233 1.309   45.789 1.00 30.61 ? 512 HOH E O   1 
HETATM 4039 O O   . HOH D 3 .   ? -6.698  -17.839 64.517 1.00 37.74 ? 513 HOH E O   1 
HETATM 4040 O O   . HOH D 3 .   ? -18.391 22.623  42.269 1.00 43.38 ? 514 HOH E O   1 
HETATM 4041 O O   . HOH D 3 .   ? -21.167 -5.796  62.089 1.00 40.78 ? 515 HOH E O   1 
HETATM 4042 O O   . HOH D 3 .   ? 18.168  -16.842 37.732 1.00 51.29 ? 516 HOH E O   1 
HETATM 4043 O O   . HOH D 3 .   ? 3.210   1.035   69.578 1.00 47.63 ? 517 HOH E O   1 
HETATM 4044 O O   . HOH D 3 .   ? -18.332 11.359  41.945 1.00 46.83 ? 518 HOH E O   1 
HETATM 4045 O O   . HOH D 3 .   ? -11.894 7.509   73.205 1.00 29.85 ? 519 HOH E O   1 
HETATM 4046 O O   . HOH D 3 .   ? 9.004   -35.755 54.510 1.00 32.56 ? 520 HOH E O   1 
HETATM 4047 O O   . HOH D 3 .   ? 10.973  -11.755 38.195 1.00 41.50 ? 521 HOH E O   1 
HETATM 4048 O O   . HOH D 3 .   ? -3.816  9.854   47.999 1.00 42.74 ? 522 HOH E O   1 
HETATM 4049 O O   . HOH D 3 .   ? -8.275  1.465   54.530 1.00 45.21 ? 523 HOH E O   1 
HETATM 4050 O O   . HOH D 3 .   ? -7.185  -24.921 56.979 1.00 44.64 ? 524 HOH E O   1 
HETATM 4051 O O   . HOH D 3 .   ? -0.564  -7.590  58.414 1.00 50.29 ? 525 HOH E O   1 
HETATM 4052 O O   . HOH D 3 .   ? 4.154   -29.294 72.420 1.00 52.61 ? 526 HOH E O   1 
HETATM 4053 O O   . HOH D 3 .   ? -9.794  0.736   52.260 1.00 43.46 ? 527 HOH E O   1 
HETATM 4054 O O   . HOH D 3 .   ? -15.006 4.721   45.177 1.00 31.55 ? 528 HOH E O   1 
HETATM 4055 O O   . HOH D 3 .   ? -14.989 30.738  50.220 1.00 39.34 ? 529 HOH E O   1 
HETATM 4056 O O   . HOH D 3 .   ? 10.275  -0.810  69.243 1.00 43.83 ? 530 HOH E O   1 
HETATM 4057 O O   . HOH D 3 .   ? -8.322  -13.748 55.045 1.00 37.86 ? 531 HOH E O   1 
HETATM 4058 O O   . HOH D 3 .   ? -23.972 26.631  59.172 1.00 45.24 ? 532 HOH E O   1 
HETATM 4059 O O   . HOH D 3 .   ? 4.161   6.359   68.566 1.00 40.87 ? 533 HOH E O   1 
HETATM 4060 O O   . HOH D 3 .   ? -5.360  -0.079  56.330 1.00 33.97 ? 534 HOH E O   1 
HETATM 4061 O O   . HOH D 3 .   ? 1.103   -26.077 38.750 1.00 51.54 ? 535 HOH E O   1 
HETATM 4062 O O   . HOH D 3 .   ? -5.102  0.259   80.187 1.00 53.34 ? 536 HOH E O   1 
HETATM 4063 O O   . HOH D 3 .   ? 12.730  -26.323 65.662 1.00 37.83 ? 537 HOH E O   1 
HETATM 4064 O O   . HOH D 3 .   ? 10.897  -25.331 73.934 1.00 48.57 ? 538 HOH E O   1 
HETATM 4065 O O   . HOH D 3 .   ? -9.681  -13.669 81.675 1.00 46.56 ? 539 HOH E O   1 
HETATM 4066 O O   . HOH D 3 .   ? -13.100 5.301   74.042 1.00 43.69 ? 540 HOH E O   1 
HETATM 4067 O O   . HOH D 3 .   ? -5.872  -24.936 67.242 1.00 42.96 ? 541 HOH E O   1 
HETATM 4068 O O   . HOH D 3 .   ? -11.488 -15.269 78.056 1.00 40.66 ? 542 HOH E O   1 
HETATM 4069 O O   . HOH D 3 .   ? 0.245   -30.949 71.600 1.00 47.44 ? 543 HOH E O   1 
HETATM 4070 O O   . HOH D 3 .   ? -4.450  -28.440 55.400 1.00 34.90 ? 544 HOH E O   1 
HETATM 4071 O O   . HOH D 3 .   ? -18.602 14.160  43.011 1.00 41.86 ? 545 HOH E O   1 
HETATM 4072 O O   . HOH D 3 .   ? -2.827  2.951   59.481 1.00 51.98 ? 546 HOH E O   1 
HETATM 4073 O O   . HOH D 3 .   ? 8.941   -31.807 60.487 1.00 34.22 ? 547 HOH E O   1 
HETATM 4074 O O   . HOH D 3 .   ? -25.699 26.136  49.501 1.00 42.15 ? 548 HOH E O   1 
HETATM 4075 O O   . HOH D 3 .   ? -22.245 -0.216  79.212 1.00 47.61 ? 549 HOH E O   1 
HETATM 4076 O O   . HOH D 3 .   ? 2.162   5.751   55.174 1.00 49.49 ? 550 HOH E O   1 
HETATM 4077 O O   . HOH D 3 .   ? -4.849  -15.173 80.499 1.00 33.02 ? 551 HOH E O   1 
HETATM 4078 O O   . HOH D 3 .   ? -19.547 0.856   76.218 1.00 43.84 ? 552 HOH E O   1 
HETATM 4079 O O   . HOH D 3 .   ? -13.577 0.648   81.468 1.00 42.70 ? 553 HOH E O   1 
HETATM 4080 O O   . HOH D 3 .   ? 2.905   0.759   65.875 1.00 37.50 ? 554 HOH E O   1 
HETATM 4081 O O   . HOH D 3 .   ? 14.626  -8.930  62.732 1.00 50.24 ? 555 HOH E O   1 
HETATM 4082 O O   . HOH D 3 .   ? -13.879 2.484   79.415 1.00 45.27 ? 556 HOH E O   1 
HETATM 4083 O O   . HOH D 3 .   ? -21.805 -11.081 74.593 1.00 51.10 ? 557 HOH E O   1 
HETATM 4084 O O   . HOH D 3 .   ? -2.195  -1.316  82.635 1.00 48.85 ? 558 HOH E O   1 
HETATM 4085 O O   . HOH D 3 .   ? -1.123  -6.259  80.813 1.00 42.45 ? 559 HOH E O   1 
HETATM 4086 O O   . HOH D 3 .   ? -8.911  -15.050 51.284 1.00 48.01 ? 560 HOH E O   1 
HETATM 4087 O O   . HOH D 3 .   ? 15.640  -22.945 37.893 1.00 41.17 ? 561 HOH E O   1 
HETATM 4088 O O   . HOH D 3 .   ? -6.335  -17.448 44.587 1.00 50.23 ? 562 HOH E O   1 
HETATM 4089 O O   . HOH D 3 .   ? 19.200  -16.873 42.756 1.00 52.95 ? 563 HOH E O   1 
HETATM 4090 O O   . HOH D 3 .   ? -4.757  -25.928 48.083 1.00 47.12 ? 564 HOH E O   1 
HETATM 4091 O O   . HOH D 3 .   ? -23.573 -6.498  72.637 1.00 51.35 ? 565 HOH E O   1 
HETATM 4092 O O   . HOH D 3 .   ? -10.662 6.157   76.601 1.00 40.86 ? 566 HOH E O   1 
HETATM 4093 O O   . HOH D 3 .   ? -8.353  -19.304 68.754 1.00 39.51 ? 567 HOH E O   1 
HETATM 4094 O O   . HOH D 3 .   ? -3.825  -6.464  81.341 1.00 42.92 ? 568 HOH E O   1 
HETATM 4095 O O   . HOH D 3 .   ? -18.561 -1.417  84.768 1.00 46.06 ? 569 HOH E O   1 
HETATM 4096 O O   . HOH D 3 .   ? 16.387  -31.319 56.522 1.00 43.03 ? 570 HOH E O   1 
HETATM 4097 O O   . HOH D 3 .   ? 4.534   -33.311 45.908 1.00 42.82 ? 571 HOH E O   1 
HETATM 4098 O O   . HOH D 3 .   ? 0.900   -0.207  85.888 1.00 45.49 ? 572 HOH E O   1 
HETATM 4099 O O   . HOH D 3 .   ? 0.790   -10.718 45.301 1.00 37.29 ? 573 HOH E O   1 
HETATM 4100 O O   . HOH D 3 .   ? -10.496 33.799  49.788 1.00 53.22 ? 574 HOH E O   1 
HETATM 4101 O O   . HOH D 3 .   ? -15.884 24.221  58.414 1.00 41.77 ? 575 HOH E O   1 
HETATM 4102 O O   . HOH D 3 .   ? -5.123  -17.568 47.948 1.00 44.27 ? 576 HOH E O   1 
HETATM 4103 O O   . HOH D 3 .   ? 15.817  -27.488 63.741 1.00 40.97 ? 577 HOH E O   1 
HETATM 4104 O O   . HOH D 3 .   ? -15.967 1.421   74.574 1.00 37.99 ? 578 HOH E O   1 
HETATM 4105 O O   . HOH D 3 .   ? -17.046 25.899  57.073 1.00 50.68 ? 579 HOH E O   1 
HETATM 4106 O O   . HOH D 3 .   ? -23.751 9.396   51.773 1.00 27.55 ? 580 HOH E O   1 
HETATM 4107 O O   . HOH D 3 .   ? 0.161   -9.904  49.896 1.00 36.23 ? 581 HOH E O   1 
HETATM 4108 O O   . HOH D 3 .   ? 0.018   -3.745  81.147 1.00 53.40 ? 582 HOH E O   1 
HETATM 4109 O O   . HOH D 3 .   ? -9.241  -17.759 63.338 1.00 36.77 ? 583 HOH E O   1 
HETATM 4110 O O   . HOH D 3 .   ? 2.036   -1.893  60.345 1.00 53.16 ? 584 HOH E O   1 
HETATM 4111 O O   . HOH D 3 .   ? -26.862 24.775  47.624 1.00 44.29 ? 585 HOH E O   1 
HETATM 4112 O O   . HOH D 3 .   ? 10.165  -38.726 55.722 1.00 49.46 ? 586 HOH E O   1 
HETATM 4113 O O   . HOH D 3 .   ? -3.788  -18.087 45.131 1.00 51.37 ? 587 HOH E O   1 
HETATM 4114 O O   . HOH D 3 .   ? -21.038 4.110   67.909 1.00 47.68 ? 588 HOH E O   1 
HETATM 4115 O O   . HOH D 3 .   ? -24.786 25.506  54.233 1.00 43.58 ? 589 HOH E O   1 
HETATM 4116 O O   . HOH D 3 .   ? 17.940  -27.370 60.151 1.00 43.53 ? 590 HOH E O   1 
HETATM 4117 O O   . HOH D 3 .   ? -11.000 3.790   81.724 1.00 50.21 ? 591 HOH E O   1 
HETATM 4118 O O   . HOH D 3 .   ? 20.165  -24.873 63.242 1.00 47.14 ? 592 HOH E O   1 
HETATM 4119 O O   . HOH D 3 .   ? 11.133  -19.184 77.633 1.00 46.55 ? 593 HOH E O   1 
HETATM 4120 O O   . HOH D 3 .   ? -15.922 0.523   80.408 1.00 42.98 ? 594 HOH E O   1 
HETATM 4121 O O   . HOH D 3 .   ? -24.646 6.524   61.968 1.00 41.70 ? 595 HOH E O   1 
HETATM 4122 O O   . HOH D 3 .   ? -0.043  -7.842  43.274 1.00 46.03 ? 596 HOH E O   1 
HETATM 4123 O O   . HOH D 3 .   ? -8.568  -3.311  80.893 1.00 41.33 ? 597 HOH E O   1 
HETATM 4124 O O   . HOH D 3 .   ? -23.912 1.606   64.967 1.00 46.88 ? 598 HOH E O   1 
HETATM 4125 O O   . HOH D 3 .   ? -23.288 -0.051  68.378 1.00 52.70 ? 599 HOH E O   1 
HETATM 4126 O O   . HOH D 3 .   ? -4.633  -25.617 41.425 1.00 52.43 ? 600 HOH E O   1 
HETATM 4127 O O   . HOH D 3 .   ? -24.619 -2.862  80.006 1.00 53.43 ? 601 HOH E O   1 
HETATM 4128 O O   . HOH D 3 .   ? -19.283 3.783   74.060 1.00 48.06 ? 602 HOH E O   1 
HETATM 4129 O O   . HOH D 3 .   ? -15.224 33.134  57.286 1.00 47.65 ? 603 HOH E O   1 
HETATM 4130 O O   . HOH D 3 .   ? -14.676 34.672  53.334 1.00 53.18 ? 604 HOH E O   1 
HETATM 4131 O O   . HOH D 3 .   ? -7.521  34.464  52.753 1.00 48.32 ? 605 HOH E O   1 
HETATM 4132 O O   . HOH D 3 .   ? -9.538  -20.375 72.181 1.00 49.40 ? 606 HOH E O   1 
HETATM 4133 O O   . HOH D 3 .   ? 5.773   -8.875  75.550 1.00 46.11 ? 607 HOH E O   1 
HETATM 4134 O O   . HOH D 3 .   ? -24.921 21.272  55.938 1.00 45.46 ? 608 HOH E O   1 
HETATM 4135 O O   . HOH D 3 .   ? -24.496 -4.780  62.427 1.00 50.70 ? 609 HOH E O   1 
HETATM 4136 O O   . HOH D 3 .   ? -3.822  -0.235  64.972 1.00 36.80 ? 610 HOH E O   1 
HETATM 4137 O O   . HOH D 3 .   ? -9.550  7.188   74.548 1.00 39.42 ? 611 HOH E O   1 
HETATM 4138 O O   . HOH D 3 .   ? 2.760   -12.525 54.444 1.00 40.64 ? 612 HOH E O   1 
HETATM 4139 O O   . HOH D 3 .   ? -7.695  -33.144 55.095 1.00 41.21 ? 613 HOH E O   1 
HETATM 4140 O O   . HOH D 3 .   ? -14.774 -12.833 85.119 1.00 37.98 ? 614 HOH E O   1 
HETATM 4141 O O   . HOH D 3 .   ? 18.472  -24.035 65.519 1.00 41.90 ? 615 HOH E O   1 
HETATM 4142 O O   . HOH D 3 .   ? -18.391 -8.056  61.201 1.00 37.70 ? 616 HOH E O   1 
HETATM 4143 O O   . HOH D 3 .   ? 13.209  -25.872 46.510 1.00 43.15 ? 617 HOH E O   1 
HETATM 4144 O O   . HOH D 3 .   ? -6.094  -30.537 49.414 1.00 43.44 ? 618 HOH E O   1 
HETATM 4145 O O   . HOH D 3 .   ? 1.569   -1.335  66.706 1.00 40.93 ? 619 HOH E O   1 
HETATM 4146 O O   . HOH D 3 .   ? -6.346  -20.780 52.866 1.00 43.23 ? 620 HOH E O   1 
HETATM 4147 O O   . HOH D 3 .   ? -6.933  -10.181 52.718 1.00 41.09 ? 621 HOH E O   1 
HETATM 4148 O O   . HOH D 3 .   ? -1.242  -14.893 83.707 1.00 40.22 ? 622 HOH E O   1 
HETATM 4149 O O   . HOH D 3 .   ? 12.954  -17.424 65.848 1.00 42.06 ? 623 HOH E O   1 
HETATM 4150 O O   . HOH D 3 .   ? -0.301  -27.571 41.340 1.00 41.65 ? 624 HOH E O   1 
HETATM 4151 O O   . HOH D 3 .   ? -13.453 19.334  43.447 1.00 42.61 ? 625 HOH E O   1 
HETATM 4152 O O   . HOH D 3 .   ? 15.827  -31.275 48.532 1.00 43.74 ? 626 HOH E O   1 
HETATM 4153 O O   . HOH D 3 .   ? -15.532 2.520   76.852 1.00 41.72 ? 627 HOH E O   1 
HETATM 4154 O O   . HOH D 3 .   ? -28.184 20.652  45.176 1.00 40.04 ? 628 HOH E O   1 
HETATM 4155 O O   . HOH D 3 .   ? -21.114 21.241  62.427 1.00 43.11 ? 629 HOH E O   1 
HETATM 4156 O O   . HOH D 3 .   ? 10.708  -11.473 68.397 1.00 42.08 ? 630 HOH E O   1 
HETATM 4157 O O   . HOH D 3 .   ? -8.929  3.640   51.665 1.00 42.81 ? 631 HOH E O   1 
HETATM 4158 O O   . HOH D 3 .   ? 13.571  -34.506 51.274 1.00 41.29 ? 632 HOH E O   1 
HETATM 4159 O O   . HOH D 3 .   ? -3.425  -31.036 66.508 1.00 41.84 ? 633 HOH E O   1 
HETATM 4160 O O   . HOH D 3 .   ? 5.291   -30.457 43.715 1.00 39.58 ? 634 HOH E O   1 
HETATM 4161 O O   . HOH D 3 .   ? -24.884 12.493  46.798 1.00 42.55 ? 635 HOH E O   1 
HETATM 4162 O O   . HOH D 3 .   ? 11.186  -28.392 43.204 1.00 39.20 ? 636 HOH E O   1 
HETATM 4163 O O   . HOH D 3 .   ? -7.060  -23.113 61.110 1.00 42.67 ? 637 HOH E O   1 
HETATM 4164 O O   . HOH D 3 .   ? 11.829  -22.291 34.933 1.00 41.53 ? 638 HOH E O   1 
HETATM 4165 O O   . HOH D 3 .   ? -6.212  32.248  48.630 1.00 43.34 ? 639 HOH E O   1 
HETATM 4166 O O   . HOH D 3 .   ? 10.072  -31.032 44.499 1.00 41.30 ? 640 HOH E O   1 
HETATM 4167 O O   . HOH D 3 .   ? 10.745  -20.450 75.364 1.00 41.69 ? 641 HOH E O   1 
HETATM 4168 O O   . HOH D 3 .   ? 8.683   -25.819 37.290 1.00 42.24 ? 642 HOH E O   1 
HETATM 4169 O O   . HOH D 3 .   ? -22.406 -0.250  72.548 1.00 39.68 ? 643 HOH E O   1 
HETATM 4170 O O   . HOH D 3 .   ? 2.497   -29.535 46.328 1.00 42.49 ? 644 HOH E O   1 
HETATM 4171 O O   . HOH D 3 .   ? 14.767  -10.882 64.571 1.00 42.00 ? 645 HOH E O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   D . n 
A 1 2   LYS 2   2   2   LYS LYS D . n 
A 1 3   THR 3   3   3   THR THR D . n 
A 1 4   THR 4   4   4   THR THR D . n 
A 1 5   GLN 5   5   5   GLN GLN D . n 
A 1 6   PRO 6   7   7   PRO PRO D . n 
A 1 7   ASN 7   8   8   ASN ASN D . n 
A 1 8   SER 8   9   9   SER SER D . n 
A 1 9   MET 9   10  10  MET MET D . n 
A 1 10  GLU 10  11  11  GLU GLU D . n 
A 1 11  SER 11  12  12  SER SER D . n 
A 1 12  ASN 12  13  13  ASN ASN D . n 
A 1 13  GLU 13  14  14  GLU GLU D . n 
A 1 14  GLU 14  15  15  GLU GLU D . n 
A 1 15  GLU 15  16  16  GLU GLU D . n 
A 1 16  PRO 16  17  17  PRO PRO D . n 
A 1 17  VAL 17  18  18  VAL VAL D . n 
A 1 18  HIS 18  19  19  HIS HIS D . n 
A 1 19  LEU 19  20  20  LEU LEU D . n 
A 1 20  PRO 20  21  21  PRO PRO D . n 
A 1 21  CYS 21  22  22  CYS CYS D . n 
A 1 22  ASN 22  23  23  ASN ASN D . n 
A 1 23  HIS 23  24  24  HIS HIS D . n 
A 1 24  SER 24  25  25  SER SER D . n 
A 1 25  THR 25  26  26  THR THR D . n 
A 1 26  ILE 26  27  27  ILE ILE D . n 
A 1 27  SER 27  28  28  SER SER D . n 
A 1 28  GLY 28  29  29  GLY GLY D . n 
A 1 29  THR 29  30  30  THR THR D . n 
A 1 30  ASP 30  30  30  ASP ASP D A n 
A 1 31  TYR 31  31  31  TYR TYR D . n 
A 1 32  ILE 32  32  32  ILE ILE D . n 
A 1 33  HIS 33  33  33  HIS HIS D . n 
A 1 34  TRP 34  34  34  TRP TRP D . n 
A 1 35  TYR 35  35  35  TYR TYR D . n 
A 1 36  ARG 36  36  36  ARG ARG D . n 
A 1 37  GLN 37  37  37  GLN GLN D . n 
A 1 38  LEU 38  38  38  LEU LEU D . n 
A 1 39  PRO 39  39  39  PRO PRO D . n 
A 1 40  SER 40  40  40  SER SER D . n 
A 1 41  GLN 41  41  41  GLN GLN D . n 
A 1 42  GLY 42  42  42  GLY GLY D . n 
A 1 43  PRO 43  43  43  PRO PRO D . n 
A 1 44  GLU 44  44  44  GLU GLU D . n 
A 1 45  TYR 45  45  45  TYR TYR D . n 
A 1 46  VAL 46  46  46  VAL VAL D . n 
A 1 47  ILE 47  47  47  ILE ILE D . n 
A 1 48  HIS 48  48  48  HIS HIS D . n 
A 1 49  GLY 49  49  49  GLY GLY D . n 
A 1 50  LEU 50  50  50  LEU LEU D . n 
A 1 51  THR 51  51  51  THR THR D . n 
A 1 52  SER 52  52  52  SER SER D . n 
A 1 53  ASN 53  54  54  ASN ASN D . n 
A 1 54  VAL 54  55  55  VAL VAL D . n 
A 1 55  ASN 55  56  56  ASN ASN D . n 
A 1 56  ASN 56  57  57  ASN ASN D . n 
A 1 57  ARG 57  58  58  ARG ARG D . n 
A 1 58  MET 58  61  61  MET MET D . n 
A 1 59  ALA 59  62  62  ALA ALA D . n 
A 1 60  SER 60  63  63  SER SER D . n 
A 1 61  LEU 61  64  64  LEU LEU D . n 
A 1 62  ALA 62  65  65  ALA ALA D . n 
A 1 63  ILE 63  66  66  ILE ILE D . n 
A 1 64  ALA 64  67  67  ALA ALA D . n 
A 1 65  GLU 65  68  68  GLU GLU D . n 
A 1 66  ASP 66  69  69  ASP ASP D . n 
A 1 67  ARG 67  70  70  ARG ARG D . n 
A 1 68  LYS 68  71  71  LYS LYS D . n 
A 1 69  SER 69  72  72  SER SER D . n 
A 1 70  SER 70  73  73  SER SER D . n 
A 1 71  THR 71  74  74  THR THR D . n 
A 1 72  LEU 72  75  75  LEU LEU D . n 
A 1 73  ILE 73  76  76  ILE ILE D . n 
A 1 74  LEU 74  77  77  LEU LEU D . n 
A 1 75  HIS 75  78  78  HIS HIS D . n 
A 1 76  ARG 76  79  79  ARG ARG D . n 
A 1 77  ALA 77  80  80  ALA ALA D . n 
A 1 78  THR 78  81  81  THR THR D . n 
A 1 79  LEU 79  82  82  LEU LEU D . n 
A 1 80  ARG 80  83  83  ARG ARG D . n 
A 1 81  ASP 81  84  84  ASP ASP D . n 
A 1 82  ALA 82  85  85  ALA ALA D . n 
A 1 83  ALA 83  86  86  ALA ALA D . n 
A 1 84  VAL 84  87  87  VAL VAL D . n 
A 1 85  TYR 85  88  88  TYR TYR D . n 
A 1 86  TYR 86  89  89  TYR TYR D . n 
A 1 87  CYS 87  90  90  CYS CYS D . n 
A 1 88  ILE 88  91  91  ILE ILE D . n 
A 1 89  LEU 89  92  92  LEU LEU D . n 
A 1 90  PRO 90  93  93  PRO PRO D . n 
A 1 91  LEU 91  94  94  LEU LEU D . n 
A 1 92  ALA 92  95  95  ALA ALA D . n 
A 1 93  GLY 93  96  96  GLY GLY D . n 
A 1 94  GLY 94  97  97  GLY GLY D . n 
A 1 95  THR 95  98  98  THR THR D . n 
A 1 96  SER 96  99  99  SER SER D . n 
A 1 97  TYR 97  100 100 TYR TYR D . n 
A 1 98  GLY 98  102 102 GLY GLY D . n 
A 1 99  LYS 99  103 103 LYS LYS D . n 
A 1 100 LEU 100 104 104 LEU LEU D . n 
A 1 101 THR 101 105 105 THR THR D . n 
A 1 102 PHE 102 106 106 PHE PHE D . n 
A 1 103 GLY 103 107 107 GLY GLY D . n 
A 1 104 GLN 104 108 108 GLN GLN D . n 
A 1 105 GLY 105 109 109 GLY GLY D . n 
A 1 106 THR 106 110 110 THR THR D . n 
A 1 107 ILE 107 111 111 ILE ILE D . n 
A 1 108 LEU 108 112 112 LEU LEU D . n 
A 1 109 THR 109 113 113 THR THR D . n 
A 1 110 VAL 110 114 114 VAL VAL D . n 
A 1 111 HIS 111 115 115 HIS HIS D . n 
A 1 112 PRO 112 116 116 PRO PRO D . n 
A 1 113 ASN 113 117 117 ASN ASN D . n 
A 1 114 ILE 114 118 118 ILE ILE D . n 
A 1 115 GLN 115 119 119 GLN GLN D . n 
A 1 116 ASN 116 120 120 ASN ASN D . n 
A 1 117 PRO 117 121 121 PRO PRO D . n 
A 1 118 ASP 118 122 122 ASP ASP D . n 
A 1 119 PRO 119 123 123 PRO PRO D . n 
A 1 120 ALA 120 124 124 ALA ALA D . n 
A 1 121 VAL 121 125 125 VAL VAL D . n 
A 1 122 TYR 122 126 126 TYR TYR D . n 
A 1 123 GLN 123 127 127 GLN GLN D . n 
A 1 124 LEU 124 128 128 LEU LEU D . n 
A 1 125 ARG 125 129 129 ARG ARG D . n 
A 1 126 ASP 126 130 130 ASP ASP D . n 
A 1 127 SER 127 131 131 SER SER D . n 
A 1 128 LYS 128 132 132 LYS LYS D . n 
A 1 129 SER 129 133 133 SER SER D . n 
A 1 130 SER 130 134 134 SER SER D . n 
A 1 131 ASP 131 135 135 ASP ASP D . n 
A 1 132 LYS 132 136 136 LYS LYS D . n 
A 1 133 SER 133 137 137 SER SER D . n 
A 1 134 VAL 134 138 138 VAL VAL D . n 
A 1 135 CYS 135 139 139 CYS CYS D . n 
A 1 136 LEU 136 140 140 LEU LEU D . n 
A 1 137 PHE 137 141 141 PHE PHE D . n 
A 1 138 THR 138 142 142 THR THR D . n 
A 1 139 ASP 139 143 143 ASP ASP D . n 
A 1 140 PHE 140 144 144 PHE PHE D . n 
A 1 141 ASP 141 145 145 ASP ASP D . n 
A 1 142 SER 142 146 146 SER SER D . n 
A 1 143 GLN 143 147 147 GLN GLN D . n 
A 1 144 THR 144 148 148 THR THR D . n 
A 1 145 ASN 145 149 149 ASN ASN D . n 
A 1 146 VAL 146 150 150 VAL VAL D . n 
A 1 147 SER 147 151 151 SER SER D . n 
A 1 148 GLN 148 152 152 GLN GLN D . n 
A 1 149 SER 149 153 153 SER SER D . n 
A 1 150 LYS 150 154 154 LYS LYS D . n 
A 1 151 ASP 151 155 155 ASP ASP D . n 
A 1 152 SER 152 156 156 SER SER D . n 
A 1 153 ASP 153 157 157 ASP ASP D . n 
A 1 154 VAL 154 158 158 VAL VAL D . n 
A 1 155 TYR 155 159 159 TYR TYR D . n 
A 1 156 ILE 156 160 160 ILE ILE D . n 
A 1 157 THR 157 161 161 THR THR D . n 
A 1 158 ASP 158 162 162 ASP ASP D . n 
A 1 159 LYS 159 163 163 LYS LYS D . n 
A 1 160 THR 160 164 164 THR THR D . n 
A 1 161 VAL 161 165 165 VAL VAL D . n 
A 1 162 LEU 162 166 166 LEU LEU D . n 
A 1 163 ASP 163 167 167 ASP ASP D . n 
A 1 164 MET 164 168 168 MET MET D . n 
A 1 165 ARG 165 169 169 ARG ARG D . n 
A 1 166 SER 166 170 170 SER SER D . n 
A 1 167 MET 167 171 171 MET MET D . n 
A 1 168 ASP 168 172 172 ASP ASP D . n 
A 1 169 PHE 169 173 173 PHE PHE D . n 
A 1 170 LYS 170 174 174 LYS LYS D . n 
A 1 171 SER 171 175 175 SER SER D . n 
A 1 172 ASN 172 176 176 ASN ASN D . n 
A 1 173 SER 173 177 177 SER SER D . n 
A 1 174 ALA 174 178 178 ALA ALA D . n 
A 1 175 VAL 175 179 179 VAL VAL D . n 
A 1 176 ALA 176 180 180 ALA ALA D . n 
A 1 177 TRP 177 181 181 TRP TRP D . n 
A 1 178 SER 178 182 182 SER SER D . n 
A 1 179 ASN 179 183 183 ASN ASN D . n 
A 1 180 LYS 180 184 184 LYS LYS D . n 
A 1 181 SER 181 185 185 SER SER D . n 
A 1 182 ASP 182 186 186 ASP ASP D . n 
A 1 183 PHE 183 187 187 PHE PHE D . n 
A 1 184 ALA 184 188 188 ALA ALA D . n 
A 1 185 CYS 185 189 189 CYS CYS D . n 
A 1 186 ALA 186 190 190 ALA ALA D . n 
A 1 187 ASN 187 191 191 ASN ASN D . n 
A 1 188 ALA 188 192 192 ALA ALA D . n 
A 1 189 PHE 189 193 193 PHE PHE D . n 
A 1 190 ASN 190 194 194 ASN ASN D . n 
A 1 191 ASN 191 195 195 ASN ASN D . n 
A 1 192 SER 192 196 196 SER SER D . n 
A 1 193 ILE 193 197 197 ILE ILE D . n 
A 1 194 ILE 194 198 198 ILE ILE D . n 
A 1 195 PRO 195 199 199 PRO PRO D . n 
A 1 196 GLU 196 200 200 GLU GLU D . n 
A 1 197 ASP 197 201 201 ASP ASP D . n 
A 1 198 THR 198 202 202 THR THR D . n 
A 1 199 PHE 199 203 203 PHE PHE D . n 
A 1 200 PHE 200 204 204 PHE PHE D . n 
A 1 201 PRO 201 205 205 PRO PRO D . n 
A 1 202 SER 202 206 206 SER SER D . n 
A 1 203 PRO 203 207 ?   ?   ?   D . n 
A 1 204 GLU 204 208 ?   ?   ?   D . n 
A 1 205 SER 205 209 ?   ?   ?   D . n 
A 1 206 SER 206 210 ?   ?   ?   D . n 
B 2 1   MET 1   2   ?   ?   ?   E . n 
B 2 2   GLY 2   3   3   GLY GLY E . n 
B 2 3   VAL 3   4   4   VAL VAL E . n 
B 2 4   SER 4   5   5   SER SER E . n 
B 2 5   GLN 5   6   6   GLN GLN E . n 
B 2 6   SER 6   7   7   SER SER E . n 
B 2 7   PRO 7   8   8   PRO PRO E . n 
B 2 8   ARG 8   9   9   ARG ARG E . n 
B 2 9   TYR 9   10  10  TYR TYR E . n 
B 2 10  LYS 10  11  11  LYS LYS E . n 
B 2 11  VAL 11  12  12  VAL VAL E . n 
B 2 12  ALA 12  13  13  ALA ALA E . n 
B 2 13  LYS 13  14  14  LYS LYS E . n 
B 2 14  ARG 14  15  15  ARG ARG E . n 
B 2 15  GLY 15  16  16  GLY GLY E . n 
B 2 16  GLN 16  17  17  GLN GLN E . n 
B 2 17  ASP 17  18  18  ASP ASP E . n 
B 2 18  VAL 18  19  19  VAL VAL E . n 
B 2 19  ALA 19  20  20  ALA ALA E . n 
B 2 20  LEU 20  21  21  LEU LEU E . n 
B 2 21  ARG 21  22  22  ARG ARG E . n 
B 2 22  CYS 22  23  23  CYS CYS E . n 
B 2 23  ASP 23  24  24  ASP ASP E . n 
B 2 24  PRO 24  25  25  PRO PRO E . n 
B 2 25  ILE 25  26  26  ILE ILE E . n 
B 2 26  SER 26  27  27  SER SER E . n 
B 2 27  GLY 27  28  28  GLY GLY E . n 
B 2 28  HIS 28  29  29  HIS HIS E . n 
B 2 29  VAL 29  30  30  VAL VAL E . n 
B 2 30  SER 30  31  31  SER SER E . n 
B 2 31  LEU 31  32  32  LEU LEU E . n 
B 2 32  PHE 32  33  33  PHE PHE E . n 
B 2 33  TRP 33  34  34  TRP TRP E . n 
B 2 34  TYR 34  35  35  TYR TYR E . n 
B 2 35  GLN 35  36  36  GLN GLN E . n 
B 2 36  GLN 36  37  37  GLN GLN E . n 
B 2 37  ALA 37  38  38  ALA ALA E . n 
B 2 38  LEU 38  39  39  LEU LEU E . n 
B 2 39  GLY 39  40  40  GLY GLY E . n 
B 2 40  GLN 40  41  41  GLN GLN E . n 
B 2 41  GLY 41  42  42  GLY GLY E . n 
B 2 42  PRO 42  43  43  PRO PRO E . n 
B 2 43  GLU 43  44  44  GLU GLU E . n 
B 2 44  PHE 44  45  45  PHE PHE E . n 
B 2 45  LEU 45  46  46  LEU LEU E . n 
B 2 46  THR 46  47  47  THR THR E . n 
B 2 47  TYR 47  48  48  TYR TYR E . n 
B 2 48  PHE 48  49  49  PHE PHE E . n 
B 2 49  GLN 49  50  50  GLN GLN E . n 
B 2 50  ASN 50  51  51  ASN ASN E . n 
B 2 51  GLU 51  52  52  GLU GLU E . n 
B 2 52  ALA 52  53  53  ALA ALA E . n 
B 2 53  GLN 53  54  54  GLN GLN E . n 
B 2 54  LEU 54  55  55  LEU LEU E . n 
B 2 55  ASP 55  56  56  ASP ASP E . n 
B 2 56  LYS 56  57  57  LYS LYS E . n 
B 2 57  SER 57  58  58  SER SER E . n 
B 2 58  GLY 58  59  59  GLY GLY E . n 
B 2 59  LEU 59  60  60  LEU LEU E . n 
B 2 60  PRO 60  61  61  PRO PRO E . n 
B 2 61  SER 61  62  62  SER SER E . n 
B 2 62  ASP 62  63  63  ASP ASP E . n 
B 2 63  ARG 63  64  64  ARG ARG E . n 
B 2 64  PHE 64  65  65  PHE PHE E . n 
B 2 65  PHE 65  66  66  PHE PHE E . n 
B 2 66  ALA 66  67  67  ALA ALA E . n 
B 2 67  GLU 67  68  68  GLU GLU E . n 
B 2 68  ARG 68  69  69  ARG ARG E . n 
B 2 69  PRO 69  70  70  PRO PRO E . n 
B 2 70  GLU 70  71  71  GLU GLU E . n 
B 2 71  GLY 71  72  72  GLY GLY E . n 
B 2 72  SER 72  73  73  SER SER E . n 
B 2 73  VAL 73  74  74  VAL VAL E . n 
B 2 74  SER 74  75  75  SER SER E . n 
B 2 75  THR 75  76  76  THR THR E . n 
B 2 76  LEU 76  77  77  LEU LEU E . n 
B 2 77  LYS 77  78  78  LYS LYS E . n 
B 2 78  ILE 78  79  79  ILE ILE E . n 
B 2 79  GLN 79  80  80  GLN GLN E . n 
B 2 80  ARG 80  81  81  ARG ARG E . n 
B 2 81  THR 81  82  82  THR THR E . n 
B 2 82  GLN 82  83  83  GLN GLN E . n 
B 2 83  GLN 83  84  84  GLN GLN E . n 
B 2 84  GLU 84  85  85  GLU GLU E . n 
B 2 85  ASP 85  86  86  ASP ASP E . n 
B 2 86  SER 86  87  87  SER SER E . n 
B 2 87  ALA 87  88  88  ALA ALA E . n 
B 2 88  VAL 88  89  89  VAL VAL E . n 
B 2 89  TYR 89  90  90  TYR TYR E . n 
B 2 90  LEU 90  91  91  LEU LEU E . n 
B 2 91  CYS 91  92  92  CYS CYS E . n 
B 2 92  ALA 92  93  93  ALA ALA E . n 
B 2 93  SER 93  94  94  SER SER E . n 
B 2 94  SER 94  95  95  SER SER E . n 
B 2 95  LEU 95  96  96  LEU LEU E . n 
B 2 96  GLY 96  97  97  GLY GLY E . n 
B 2 97  GLN 97  98  98  GLN GLN E . n 
B 2 98  ALA 98  99  99  ALA ALA E . n 
B 2 99  TYR 99  100 100 TYR TYR E . n 
B 2 100 GLU 100 105 105 GLU GLU E . n 
B 2 101 GLN 101 106 106 GLN GLN E . n 
B 2 102 TYR 102 107 107 TYR TYR E . n 
B 2 103 PHE 103 108 108 PHE PHE E . n 
B 2 104 GLY 104 109 109 GLY GLY E . n 
B 2 105 PRO 105 110 110 PRO PRO E . n 
B 2 106 GLY 106 111 111 GLY GLY E . n 
B 2 107 THR 107 112 112 THR THR E . n 
B 2 108 ARG 108 113 113 ARG ARG E . n 
B 2 109 LEU 109 114 114 LEU LEU E . n 
B 2 110 THR 110 115 115 THR THR E . n 
B 2 111 VAL 111 116 116 VAL VAL E . n 
B 2 112 THR 112 117 117 THR THR E . n 
B 2 113 GLU 113 118 118 GLU GLU E . n 
B 2 114 ASP 114 119 119 ASP ASP E . n 
B 2 115 LEU 115 120 120 LEU LEU E . n 
B 2 116 LYS 116 121 121 LYS LYS E . n 
B 2 117 ASN 117 122 122 ASN ASN E . n 
B 2 118 VAL 118 123 123 VAL VAL E . n 
B 2 119 PHE 119 124 124 PHE PHE E . n 
B 2 120 PRO 120 125 125 PRO PRO E . n 
B 2 121 PRO 121 126 126 PRO PRO E . n 
B 2 122 GLU 122 127 127 GLU GLU E . n 
B 2 123 VAL 123 128 128 VAL VAL E . n 
B 2 124 ALA 124 129 129 ALA ALA E . n 
B 2 125 VAL 125 130 130 VAL VAL E . n 
B 2 126 PHE 126 131 131 PHE PHE E . n 
B 2 127 GLU 127 132 132 GLU GLU E . n 
B 2 128 PRO 128 133 133 PRO PRO E . n 
B 2 129 SER 129 134 134 SER SER E . n 
B 2 130 GLU 130 135 135 GLU GLU E . n 
B 2 131 ALA 131 136 136 ALA ALA E . n 
B 2 132 GLU 132 137 137 GLU GLU E . n 
B 2 133 ILE 133 138 138 ILE ILE E . n 
B 2 134 SER 134 139 139 SER SER E . n 
B 2 135 HIS 135 140 140 HIS HIS E . n 
B 2 136 THR 136 141 141 THR THR E . n 
B 2 137 GLN 137 142 142 GLN GLN E . n 
B 2 138 LYS 138 143 143 LYS LYS E . n 
B 2 139 ALA 139 144 144 ALA ALA E . n 
B 2 140 THR 140 145 145 THR THR E . n 
B 2 141 LEU 141 146 146 LEU LEU E . n 
B 2 142 VAL 142 147 147 VAL VAL E . n 
B 2 143 CYS 143 148 148 CYS CYS E . n 
B 2 144 LEU 144 149 149 LEU LEU E . n 
B 2 145 ALA 145 150 150 ALA ALA E . n 
B 2 146 THR 146 151 151 THR THR E . n 
B 2 147 GLY 147 152 152 GLY GLY E . n 
B 2 148 PHE 148 153 153 PHE PHE E . n 
B 2 149 TYR 149 154 154 TYR TYR E . n 
B 2 150 PRO 150 155 155 PRO PRO E . n 
B 2 151 ASP 151 156 156 ASP ASP E . n 
B 2 152 HIS 152 157 157 HIS HIS E . n 
B 2 153 VAL 153 158 158 VAL VAL E . n 
B 2 154 GLU 154 159 159 GLU GLU E . n 
B 2 155 LEU 155 160 160 LEU LEU E . n 
B 2 156 SER 156 161 161 SER SER E . n 
B 2 157 TRP 157 162 162 TRP TRP E . n 
B 2 158 TRP 158 163 163 TRP TRP E . n 
B 2 159 VAL 159 164 164 VAL VAL E . n 
B 2 160 ASN 160 165 165 ASN ASN E . n 
B 2 161 GLY 161 166 166 GLY GLY E . n 
B 2 162 LYS 162 167 167 LYS LYS E . n 
B 2 163 GLU 163 168 168 GLU GLU E . n 
B 2 164 VAL 164 169 169 VAL VAL E . n 
B 2 165 HIS 165 170 170 HIS HIS E . n 
B 2 166 SER 166 171 171 SER SER E . n 
B 2 167 GLY 167 172 172 GLY GLY E . n 
B 2 168 VAL 168 173 173 VAL VAL E . n 
B 2 169 SER 169 174 174 SER SER E . n 
B 2 170 THR 170 175 175 THR THR E . n 
B 2 171 ASP 171 176 176 ASP ASP E . n 
B 2 172 PRO 172 177 177 PRO PRO E . n 
B 2 173 GLN 173 178 178 GLN GLN E . n 
B 2 174 PRO 174 179 179 PRO PRO E . n 
B 2 175 LEU 175 180 180 LEU LEU E . n 
B 2 176 LYS 176 181 181 LYS LYS E . n 
B 2 177 GLU 177 182 182 GLU GLU E . n 
B 2 178 GLN 178 183 183 GLN GLN E . n 
B 2 179 PRO 179 184 184 PRO PRO E . n 
B 2 180 ALA 180 185 185 ALA ALA E . n 
B 2 181 LEU 181 186 186 LEU LEU E . n 
B 2 182 ASN 182 187 187 ASN ASN E . n 
B 2 183 ASP 183 188 188 ASP ASP E . n 
B 2 184 SER 184 189 189 SER SER E . n 
B 2 185 ARG 185 190 190 ARG ARG E . n 
B 2 186 TYR 186 191 191 TYR TYR E . n 
B 2 187 CYS 187 192 192 CYS CYS E . n 
B 2 188 LEU 188 193 193 LEU LEU E . n 
B 2 189 SER 189 194 194 SER SER E . n 
B 2 190 SER 190 195 195 SER SER E . n 
B 2 191 ARG 191 196 196 ARG ARG E . n 
B 2 192 LEU 192 197 197 LEU LEU E . n 
B 2 193 ARG 193 198 198 ARG ARG E . n 
B 2 194 VAL 194 199 199 VAL VAL E . n 
B 2 195 SER 195 200 200 SER SER E . n 
B 2 196 ALA 196 201 201 ALA ALA E . n 
B 2 197 THR 197 202 202 THR THR E . n 
B 2 198 PHE 198 203 203 PHE PHE E . n 
B 2 199 TRP 199 204 204 TRP TRP E . n 
B 2 200 GLN 200 205 205 GLN GLN E . n 
B 2 201 ASN 201 206 206 ASN ASN E . n 
B 2 202 PRO 202 207 207 PRO PRO E . n 
B 2 203 ARG 203 208 208 ARG ARG E . n 
B 2 204 ASN 204 209 209 ASN ASN E . n 
B 2 205 HIS 205 210 210 HIS HIS E . n 
B 2 206 PHE 206 211 211 PHE PHE E . n 
B 2 207 ARG 207 212 212 ARG ARG E . n 
B 2 208 CYS 208 213 213 CYS CYS E . n 
B 2 209 GLN 209 214 214 GLN GLN E . n 
B 2 210 VAL 210 215 215 VAL VAL E . n 
B 2 211 GLN 211 216 216 GLN GLN E . n 
B 2 212 PHE 212 217 217 PHE PHE E . n 
B 2 213 TYR 213 218 218 TYR TYR E . n 
B 2 214 GLY 214 219 219 GLY GLY E . n 
B 2 215 LEU 215 220 220 LEU LEU E . n 
B 2 216 SER 216 221 221 SER SER E . n 
B 2 217 GLU 217 222 222 GLU GLU E . n 
B 2 218 ASN 218 223 223 ASN ASN E . n 
B 2 219 ASP 219 224 224 ASP ASP E . n 
B 2 220 GLU 220 225 225 GLU GLU E . n 
B 2 221 TRP 221 226 226 TRP TRP E . n 
B 2 222 THR 222 227 227 THR THR E . n 
B 2 223 GLN 223 228 228 GLN GLN E . n 
B 2 224 ASP 224 229 229 ASP ASP E . n 
B 2 225 ARG 225 230 230 ARG ARG E . n 
B 2 226 ALA 226 231 231 ALA ALA E . n 
B 2 227 LYS 227 232 232 LYS LYS E . n 
B 2 228 PRO 228 233 233 PRO PRO E . n 
B 2 229 VAL 229 234 234 VAL VAL E . n 
B 2 230 THR 230 235 235 THR THR E . n 
B 2 231 GLN 231 236 236 GLN GLN E . n 
B 2 232 ILE 232 237 237 ILE ILE E . n 
B 2 233 VAL 233 238 238 VAL VAL E . n 
B 2 234 SER 234 239 239 SER SER E . n 
B 2 235 ALA 235 240 240 ALA ALA E . n 
B 2 236 GLU 236 241 241 GLU GLU E . n 
B 2 237 ALA 237 242 242 ALA ALA E . n 
B 2 238 TRP 238 243 243 TRP TRP E . n 
B 2 239 GLY 239 244 244 GLY GLY E . n 
B 2 240 ARG 240 245 245 ARG ARG E . n 
B 2 241 ALA 241 246 246 ALA ALA E . n 
B 2 242 ASP 242 247 247 ASP ASP E . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4040  ? 
1 MORE         -22   ? 
1 'SSA (A^2)'  21210 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-12-11 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
CNS       refinement       1.0 ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU D 15  ? ? 80.10   -15.83  
2 1 ARG D 58  ? ? -46.04  -72.33  
3 1 ALA D 86  ? ? -178.37 -179.21 
4 1 ASP D 122 ? ? -146.44 53.71   
5 1 ASN E 51  ? ? 61.03   -130.89 
6 1 ARG E 69  ? ? -154.71 64.59   
7 1 SER E 73  ? ? -125.55 -95.57  
8 1 ALA E 88  ? ? 179.90  178.83  
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     E 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     CYS 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      192 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     SG 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    B 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    CYS 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     187 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    SG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 D MET 1   ? A MET 1   
2 1 Y 1 D PRO 207 ? A PRO 203 
3 1 Y 1 D GLU 208 ? A GLU 204 
4 1 Y 1 D SER 209 ? A SER 205 
5 1 Y 1 D SER 210 ? A SER 206 
6 1 Y 1 E MET 2   ? B MET 1   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   211 2   HOH HOH D . 
C 3 HOH 2   212 4   HOH HOH D . 
C 3 HOH 3   213 7   HOH HOH D . 
C 3 HOH 4   214 9   HOH HOH D . 
C 3 HOH 5   215 11  HOH HOH D . 
C 3 HOH 6   216 12  HOH HOH D . 
C 3 HOH 7   217 13  HOH HOH D . 
C 3 HOH 8   218 16  HOH HOH D . 
C 3 HOH 9   219 17  HOH HOH D . 
C 3 HOH 10  220 19  HOH HOH D . 
C 3 HOH 11  221 23  HOH HOH D . 
C 3 HOH 12  222 29  HOH HOH D . 
C 3 HOH 13  223 41  HOH HOH D . 
C 3 HOH 14  224 42  HOH HOH D . 
C 3 HOH 15  225 44  HOH HOH D . 
C 3 HOH 16  226 48  HOH HOH D . 
C 3 HOH 17  227 51  HOH HOH D . 
C 3 HOH 18  228 52  HOH HOH D . 
C 3 HOH 19  229 56  HOH HOH D . 
C 3 HOH 20  230 57  HOH HOH D . 
C 3 HOH 21  231 58  HOH HOH D . 
C 3 HOH 22  232 59  HOH HOH D . 
C 3 HOH 23  233 60  HOH HOH D . 
C 3 HOH 24  234 65  HOH HOH D . 
C 3 HOH 25  235 68  HOH HOH D . 
C 3 HOH 26  236 70  HOH HOH D . 
C 3 HOH 27  237 71  HOH HOH D . 
C 3 HOH 28  238 72  HOH HOH D . 
C 3 HOH 29  239 75  HOH HOH D . 
C 3 HOH 30  240 80  HOH HOH D . 
C 3 HOH 31  241 83  HOH HOH D . 
C 3 HOH 32  242 84  HOH HOH D . 
C 3 HOH 33  243 89  HOH HOH D . 
C 3 HOH 34  244 91  HOH HOH D . 
C 3 HOH 35  245 93  HOH HOH D . 
C 3 HOH 36  246 95  HOH HOH D . 
C 3 HOH 37  247 104 HOH HOH D . 
C 3 HOH 38  248 107 HOH HOH D . 
C 3 HOH 39  249 108 HOH HOH D . 
C 3 HOH 40  250 111 HOH HOH D . 
C 3 HOH 41  251 112 HOH HOH D . 
C 3 HOH 42  252 116 HOH HOH D . 
C 3 HOH 43  253 117 HOH HOH D . 
C 3 HOH 44  254 118 HOH HOH D . 
C 3 HOH 45  255 124 HOH HOH D . 
C 3 HOH 46  256 127 HOH HOH D . 
C 3 HOH 47  257 128 HOH HOH D . 
C 3 HOH 48  258 130 HOH HOH D . 
C 3 HOH 49  259 132 HOH HOH D . 
C 3 HOH 50  260 138 HOH HOH D . 
C 3 HOH 51  261 141 HOH HOH D . 
C 3 HOH 52  262 142 HOH HOH D . 
C 3 HOH 53  263 144 HOH HOH D . 
C 3 HOH 54  264 146 HOH HOH D . 
C 3 HOH 55  265 153 HOH HOH D . 
C 3 HOH 56  266 154 HOH HOH D . 
C 3 HOH 57  267 156 HOH HOH D . 
C 3 HOH 58  268 158 HOH HOH D . 
C 3 HOH 59  269 159 HOH HOH D . 
C 3 HOH 60  270 161 HOH HOH D . 
C 3 HOH 61  271 162 HOH HOH D . 
C 3 HOH 62  272 165 HOH HOH D . 
C 3 HOH 63  273 167 HOH HOH D . 
C 3 HOH 64  274 170 HOH HOH D . 
C 3 HOH 65  275 175 HOH HOH D . 
C 3 HOH 66  276 178 HOH HOH D . 
C 3 HOH 67  277 180 HOH HOH D . 
C 3 HOH 68  278 181 HOH HOH D . 
C 3 HOH 69  279 183 HOH HOH D . 
C 3 HOH 70  280 190 HOH HOH D . 
C 3 HOH 71  281 193 HOH HOH D . 
C 3 HOH 72  282 195 HOH HOH D . 
C 3 HOH 73  283 196 HOH HOH D . 
C 3 HOH 74  284 198 HOH HOH D . 
C 3 HOH 75  285 201 HOH HOH D . 
C 3 HOH 76  286 208 HOH HOH D . 
C 3 HOH 77  287 209 HOH HOH D . 
C 3 HOH 78  288 211 HOH HOH D . 
C 3 HOH 79  289 215 HOH HOH D . 
C 3 HOH 80  290 224 HOH HOH D . 
C 3 HOH 81  291 225 HOH HOH D . 
C 3 HOH 82  292 226 HOH HOH D . 
C 3 HOH 83  293 228 HOH HOH D . 
C 3 HOH 84  294 231 HOH HOH D . 
C 3 HOH 85  295 232 HOH HOH D . 
C 3 HOH 86  296 233 HOH HOH D . 
C 3 HOH 87  297 235 HOH HOH D . 
C 3 HOH 88  298 238 HOH HOH D . 
C 3 HOH 89  299 239 HOH HOH D . 
C 3 HOH 90  300 240 HOH HOH D . 
C 3 HOH 91  301 242 HOH HOH D . 
C 3 HOH 92  302 245 HOH HOH D . 
C 3 HOH 93  303 248 HOH HOH D . 
C 3 HOH 94  304 250 HOH HOH D . 
C 3 HOH 95  305 251 HOH HOH D . 
C 3 HOH 96  306 252 HOH HOH D . 
C 3 HOH 97  307 255 HOH HOH D . 
C 3 HOH 98  308 256 HOH HOH D . 
C 3 HOH 99  309 260 HOH HOH D . 
C 3 HOH 100 310 263 HOH HOH D . 
C 3 HOH 101 311 266 HOH HOH D . 
C 3 HOH 102 312 267 HOH HOH D . 
C 3 HOH 103 313 269 HOH HOH D . 
C 3 HOH 104 314 274 HOH HOH D . 
C 3 HOH 105 315 276 HOH HOH D . 
C 3 HOH 106 316 277 HOH HOH D . 
C 3 HOH 107 317 279 HOH HOH D . 
C 3 HOH 108 318 281 HOH HOH D . 
C 3 HOH 109 319 284 HOH HOH D . 
C 3 HOH 110 320 285 HOH HOH D . 
C 3 HOH 111 321 286 HOH HOH D . 
C 3 HOH 112 322 289 HOH HOH D . 
C 3 HOH 113 323 290 HOH HOH D . 
C 3 HOH 114 324 293 HOH HOH D . 
C 3 HOH 115 325 294 HOH HOH D . 
C 3 HOH 116 326 300 HOH HOH D . 
C 3 HOH 117 327 302 HOH HOH D . 
C 3 HOH 118 328 308 HOH HOH D . 
C 3 HOH 119 329 310 HOH HOH D . 
C 3 HOH 120 330 312 HOH HOH D . 
C 3 HOH 121 331 313 HOH HOH D . 
C 3 HOH 122 332 314 HOH HOH D . 
C 3 HOH 123 333 322 HOH HOH D . 
C 3 HOH 124 334 325 HOH HOH D . 
C 3 HOH 125 335 326 HOH HOH D . 
C 3 HOH 126 336 327 HOH HOH D . 
C 3 HOH 127 337 329 HOH HOH D . 
C 3 HOH 128 338 330 HOH HOH D . 
C 3 HOH 129 339 331 HOH HOH D . 
C 3 HOH 130 340 332 HOH HOH D . 
C 3 HOH 131 341 335 HOH HOH D . 
C 3 HOH 132 342 336 HOH HOH D . 
C 3 HOH 133 343 338 HOH HOH D . 
C 3 HOH 134 344 343 HOH HOH D . 
C 3 HOH 135 345 345 HOH HOH D . 
C 3 HOH 136 346 346 HOH HOH D . 
C 3 HOH 137 347 349 HOH HOH D . 
C 3 HOH 138 348 350 HOH HOH D . 
C 3 HOH 139 349 351 HOH HOH D . 
C 3 HOH 140 350 354 HOH HOH D . 
C 3 HOH 141 351 355 HOH HOH D . 
C 3 HOH 142 352 356 HOH HOH D . 
C 3 HOH 143 353 358 HOH HOH D . 
C 3 HOH 144 354 361 HOH HOH D . 
C 3 HOH 145 355 365 HOH HOH D . 
C 3 HOH 146 356 371 HOH HOH D . 
C 3 HOH 147 357 372 HOH HOH D . 
C 3 HOH 148 358 375 HOH HOH D . 
C 3 HOH 149 359 376 HOH HOH D . 
C 3 HOH 150 360 377 HOH HOH D . 
C 3 HOH 151 361 378 HOH HOH D . 
C 3 HOH 152 362 380 HOH HOH D . 
C 3 HOH 153 363 387 HOH HOH D . 
C 3 HOH 154 364 388 HOH HOH D . 
C 3 HOH 155 365 391 HOH HOH D . 
C 3 HOH 156 366 392 HOH HOH D . 
C 3 HOH 157 367 393 HOH HOH D . 
C 3 HOH 158 368 395 HOH HOH D . 
C 3 HOH 159 369 397 HOH HOH D . 
C 3 HOH 160 370 398 HOH HOH D . 
C 3 HOH 161 371 401 HOH HOH D . 
C 3 HOH 162 372 402 HOH HOH D . 
C 3 HOH 163 373 404 HOH HOH D . 
C 3 HOH 164 374 409 HOH HOH D . 
C 3 HOH 165 375 410 HOH HOH D . 
C 3 HOH 166 376 411 HOH HOH D . 
C 3 HOH 167 377 412 HOH HOH D . 
C 3 HOH 168 378 414 HOH HOH D . 
C 3 HOH 169 379 420 HOH HOH D . 
C 3 HOH 170 380 427 HOH HOH D . 
C 3 HOH 171 381 432 HOH HOH D . 
C 3 HOH 172 382 434 HOH HOH D . 
C 3 HOH 173 383 440 HOH HOH D . 
C 3 HOH 174 384 441 HOH HOH D . 
C 3 HOH 175 385 442 HOH HOH D . 
C 3 HOH 176 386 444 HOH HOH D . 
C 3 HOH 177 387 445 HOH HOH D . 
C 3 HOH 178 388 446 HOH HOH D . 
C 3 HOH 179 389 447 HOH HOH D . 
C 3 HOH 180 390 450 HOH HOH D . 
C 3 HOH 181 391 452 HOH HOH D . 
C 3 HOH 182 392 456 HOH HOH D . 
C 3 HOH 183 393 459 HOH HOH D . 
C 3 HOH 184 394 460 HOH HOH D . 
C 3 HOH 185 395 464 HOH HOH D . 
C 3 HOH 186 396 467 HOH HOH D . 
C 3 HOH 187 397 468 HOH HOH D . 
C 3 HOH 188 398 472 HOH HOH D . 
C 3 HOH 189 399 476 HOH HOH D . 
C 3 HOH 190 400 477 HOH HOH D . 
C 3 HOH 191 401 484 HOH HOH D . 
C 3 HOH 192 402 486 HOH HOH D . 
C 3 HOH 193 403 487 HOH HOH D . 
C 3 HOH 194 404 488 HOH HOH D . 
C 3 HOH 195 405 490 HOH HOH D . 
C 3 HOH 196 406 492 HOH HOH D . 
C 3 HOH 197 407 493 HOH HOH D . 
C 3 HOH 198 408 494 HOH HOH D . 
C 3 HOH 199 409 497 HOH HOH D . 
C 3 HOH 200 410 499 HOH HOH D . 
C 3 HOH 201 411 502 HOH HOH D . 
C 3 HOH 202 412 504 HOH HOH D . 
C 3 HOH 203 413 505 HOH HOH D . 
C 3 HOH 204 414 507 HOH HOH D . 
C 3 HOH 205 415 508 HOH HOH D . 
C 3 HOH 206 416 510 HOH HOH D . 
C 3 HOH 207 417 512 HOH HOH D . 
C 3 HOH 208 418 514 HOH HOH D . 
C 3 HOH 209 419 515 HOH HOH D . 
C 3 HOH 210 420 521 HOH HOH D . 
C 3 HOH 211 421 523 HOH HOH D . 
C 3 HOH 212 422 524 HOH HOH D . 
C 3 HOH 213 423 525 HOH HOH D . 
C 3 HOH 214 424 527 HOH HOH D . 
C 3 HOH 215 425 529 HOH HOH D . 
C 3 HOH 216 426 531 HOH HOH D . 
C 3 HOH 217 427 535 HOH HOH D . 
C 3 HOH 218 428 536 HOH HOH D . 
C 3 HOH 219 429 537 HOH HOH D . 
C 3 HOH 220 430 538 HOH HOH D . 
C 3 HOH 221 431 545 HOH HOH D . 
C 3 HOH 222 432 546 HOH HOH D . 
C 3 HOH 223 433 550 HOH HOH D . 
C 3 HOH 224 434 552 HOH HOH D . 
C 3 HOH 225 435 553 HOH HOH D . 
C 3 HOH 226 436 557 HOH HOH D . 
C 3 HOH 227 437 560 HOH HOH D . 
C 3 HOH 228 438 561 HOH HOH D . 
C 3 HOH 229 439 562 HOH HOH D . 
C 3 HOH 230 440 563 HOH HOH D . 
C 3 HOH 231 441 565 HOH HOH D . 
C 3 HOH 232 442 566 HOH HOH D . 
C 3 HOH 233 443 568 HOH HOH D . 
C 3 HOH 234 444 570 HOH HOH D . 
C 3 HOH 235 445 572 HOH HOH D . 
C 3 HOH 236 446 574 HOH HOH D . 
C 3 HOH 237 447 575 HOH HOH D . 
C 3 HOH 238 448 576 HOH HOH D . 
C 3 HOH 239 449 577 HOH HOH D . 
C 3 HOH 240 450 578 HOH HOH D . 
C 3 HOH 241 451 579 HOH HOH D . 
C 3 HOH 242 452 580 HOH HOH D . 
C 3 HOH 243 453 583 HOH HOH D . 
C 3 HOH 244 454 587 HOH HOH D . 
C 3 HOH 245 455 589 HOH HOH D . 
C 3 HOH 246 456 590 HOH HOH D . 
C 3 HOH 247 457 593 HOH HOH D . 
C 3 HOH 248 458 594 HOH HOH D . 
C 3 HOH 249 459 597 HOH HOH D . 
C 3 HOH 250 460 601 HOH HOH D . 
C 3 HOH 251 461 602 HOH HOH D . 
C 3 HOH 252 462 606 HOH HOH D . 
C 3 HOH 253 463 607 HOH HOH D . 
C 3 HOH 254 464 609 HOH HOH D . 
C 3 HOH 255 465 610 HOH HOH D . 
C 3 HOH 256 466 611 HOH HOH D . 
C 3 HOH 257 467 613 HOH HOH D . 
C 3 HOH 258 468 618 HOH HOH D . 
C 3 HOH 259 469 621 HOH HOH D . 
C 3 HOH 260 470 622 HOH HOH D . 
C 3 HOH 261 471 623 HOH HOH D . 
C 3 HOH 262 472 625 HOH HOH D . 
C 3 HOH 263 473 627 HOH HOH D . 
C 3 HOH 264 474 628 HOH HOH D . 
C 3 HOH 265 475 629 HOH HOH D . 
C 3 HOH 266 476 632 HOH HOH D . 
C 3 HOH 267 477 633 HOH HOH D . 
C 3 HOH 268 478 634 HOH HOH D . 
C 3 HOH 269 479 635 HOH HOH D . 
C 3 HOH 270 480 636 HOH HOH D . 
C 3 HOH 271 481 638 HOH HOH D . 
C 3 HOH 272 482 639 HOH HOH D . 
C 3 HOH 273 483 640 HOH HOH D . 
C 3 HOH 274 484 645 HOH HOH D . 
C 3 HOH 275 485 646 HOH HOH D . 
C 3 HOH 276 486 647 HOH HOH D . 
C 3 HOH 277 487 650 HOH HOH D . 
C 3 HOH 278 488 651 HOH HOH D . 
C 3 HOH 279 489 652 HOH HOH D . 
C 3 HOH 280 490 655 HOH HOH D . 
C 3 HOH 281 491 661 HOH HOH D . 
C 3 HOH 282 492 663 HOH HOH D . 
C 3 HOH 283 493 669 HOH HOH D . 
C 3 HOH 284 494 670 HOH HOH D . 
C 3 HOH 285 495 671 HOH HOH D . 
C 3 HOH 286 496 678 HOH HOH D . 
C 3 HOH 287 497 682 HOH HOH D . 
C 3 HOH 288 498 683 HOH HOH D . 
D 3 HOH 1   248 1   HOH HOH E . 
D 3 HOH 2   249 3   HOH HOH E . 
D 3 HOH 3   250 5   HOH HOH E . 
D 3 HOH 4   251 6   HOH HOH E . 
D 3 HOH 5   252 8   HOH HOH E . 
D 3 HOH 6   253 10  HOH HOH E . 
D 3 HOH 7   254 14  HOH HOH E . 
D 3 HOH 8   255 15  HOH HOH E . 
D 3 HOH 9   256 18  HOH HOH E . 
D 3 HOH 10  257 20  HOH HOH E . 
D 3 HOH 11  258 21  HOH HOH E . 
D 3 HOH 12  259 22  HOH HOH E . 
D 3 HOH 13  260 24  HOH HOH E . 
D 3 HOH 14  261 25  HOH HOH E . 
D 3 HOH 15  262 26  HOH HOH E . 
D 3 HOH 16  263 27  HOH HOH E . 
D 3 HOH 17  264 28  HOH HOH E . 
D 3 HOH 18  265 30  HOH HOH E . 
D 3 HOH 19  266 31  HOH HOH E . 
D 3 HOH 20  267 32  HOH HOH E . 
D 3 HOH 21  268 33  HOH HOH E . 
D 3 HOH 22  269 34  HOH HOH E . 
D 3 HOH 23  270 35  HOH HOH E . 
D 3 HOH 24  271 36  HOH HOH E . 
D 3 HOH 25  272 37  HOH HOH E . 
D 3 HOH 26  273 38  HOH HOH E . 
D 3 HOH 27  274 39  HOH HOH E . 
D 3 HOH 28  275 40  HOH HOH E . 
D 3 HOH 29  276 43  HOH HOH E . 
D 3 HOH 30  277 45  HOH HOH E . 
D 3 HOH 31  278 46  HOH HOH E . 
D 3 HOH 32  279 47  HOH HOH E . 
D 3 HOH 33  280 49  HOH HOH E . 
D 3 HOH 34  281 50  HOH HOH E . 
D 3 HOH 35  282 53  HOH HOH E . 
D 3 HOH 36  283 54  HOH HOH E . 
D 3 HOH 37  284 55  HOH HOH E . 
D 3 HOH 38  285 61  HOH HOH E . 
D 3 HOH 39  286 62  HOH HOH E . 
D 3 HOH 40  287 63  HOH HOH E . 
D 3 HOH 41  288 64  HOH HOH E . 
D 3 HOH 42  289 66  HOH HOH E . 
D 3 HOH 43  290 67  HOH HOH E . 
D 3 HOH 44  291 69  HOH HOH E . 
D 3 HOH 45  292 73  HOH HOH E . 
D 3 HOH 46  293 74  HOH HOH E . 
D 3 HOH 47  294 76  HOH HOH E . 
D 3 HOH 48  295 77  HOH HOH E . 
D 3 HOH 49  296 78  HOH HOH E . 
D 3 HOH 50  297 79  HOH HOH E . 
D 3 HOH 51  298 81  HOH HOH E . 
D 3 HOH 52  299 82  HOH HOH E . 
D 3 HOH 53  300 85  HOH HOH E . 
D 3 HOH 54  301 86  HOH HOH E . 
D 3 HOH 55  302 87  HOH HOH E . 
D 3 HOH 56  303 88  HOH HOH E . 
D 3 HOH 57  304 90  HOH HOH E . 
D 3 HOH 58  305 92  HOH HOH E . 
D 3 HOH 59  306 94  HOH HOH E . 
D 3 HOH 60  307 96  HOH HOH E . 
D 3 HOH 61  308 97  HOH HOH E . 
D 3 HOH 62  309 98  HOH HOH E . 
D 3 HOH 63  310 99  HOH HOH E . 
D 3 HOH 64  311 100 HOH HOH E . 
D 3 HOH 65  312 101 HOH HOH E . 
D 3 HOH 66  313 102 HOH HOH E . 
D 3 HOH 67  314 103 HOH HOH E . 
D 3 HOH 68  315 105 HOH HOH E . 
D 3 HOH 69  316 106 HOH HOH E . 
D 3 HOH 70  317 109 HOH HOH E . 
D 3 HOH 71  318 110 HOH HOH E . 
D 3 HOH 72  319 113 HOH HOH E . 
D 3 HOH 73  320 114 HOH HOH E . 
D 3 HOH 74  321 115 HOH HOH E . 
D 3 HOH 75  322 119 HOH HOH E . 
D 3 HOH 76  323 120 HOH HOH E . 
D 3 HOH 77  324 121 HOH HOH E . 
D 3 HOH 78  325 122 HOH HOH E . 
D 3 HOH 79  326 123 HOH HOH E . 
D 3 HOH 80  327 125 HOH HOH E . 
D 3 HOH 81  328 126 HOH HOH E . 
D 3 HOH 82  329 129 HOH HOH E . 
D 3 HOH 83  330 131 HOH HOH E . 
D 3 HOH 84  331 133 HOH HOH E . 
D 3 HOH 85  332 134 HOH HOH E . 
D 3 HOH 86  333 135 HOH HOH E . 
D 3 HOH 87  334 136 HOH HOH E . 
D 3 HOH 88  335 137 HOH HOH E . 
D 3 HOH 89  336 139 HOH HOH E . 
D 3 HOH 90  337 140 HOH HOH E . 
D 3 HOH 91  338 143 HOH HOH E . 
D 3 HOH 92  339 145 HOH HOH E . 
D 3 HOH 93  340 147 HOH HOH E . 
D 3 HOH 94  341 148 HOH HOH E . 
D 3 HOH 95  342 149 HOH HOH E . 
D 3 HOH 96  343 150 HOH HOH E . 
D 3 HOH 97  344 151 HOH HOH E . 
D 3 HOH 98  345 152 HOH HOH E . 
D 3 HOH 99  346 155 HOH HOH E . 
D 3 HOH 100 347 157 HOH HOH E . 
D 3 HOH 101 348 160 HOH HOH E . 
D 3 HOH 102 349 163 HOH HOH E . 
D 3 HOH 103 350 164 HOH HOH E . 
D 3 HOH 104 351 166 HOH HOH E . 
D 3 HOH 105 352 168 HOH HOH E . 
D 3 HOH 106 353 169 HOH HOH E . 
D 3 HOH 107 354 171 HOH HOH E . 
D 3 HOH 108 355 172 HOH HOH E . 
D 3 HOH 109 356 173 HOH HOH E . 
D 3 HOH 110 357 174 HOH HOH E . 
D 3 HOH 111 358 176 HOH HOH E . 
D 3 HOH 112 359 177 HOH HOH E . 
D 3 HOH 113 360 179 HOH HOH E . 
D 3 HOH 114 361 182 HOH HOH E . 
D 3 HOH 115 362 184 HOH HOH E . 
D 3 HOH 116 363 185 HOH HOH E . 
D 3 HOH 117 364 186 HOH HOH E . 
D 3 HOH 118 365 187 HOH HOH E . 
D 3 HOH 119 366 188 HOH HOH E . 
D 3 HOH 120 367 189 HOH HOH E . 
D 3 HOH 121 368 191 HOH HOH E . 
D 3 HOH 122 369 192 HOH HOH E . 
D 3 HOH 123 370 194 HOH HOH E . 
D 3 HOH 124 371 197 HOH HOH E . 
D 3 HOH 125 372 199 HOH HOH E . 
D 3 HOH 126 373 200 HOH HOH E . 
D 3 HOH 127 374 202 HOH HOH E . 
D 3 HOH 128 375 203 HOH HOH E . 
D 3 HOH 129 376 204 HOH HOH E . 
D 3 HOH 130 377 205 HOH HOH E . 
D 3 HOH 131 378 206 HOH HOH E . 
D 3 HOH 132 379 207 HOH HOH E . 
D 3 HOH 133 380 210 HOH HOH E . 
D 3 HOH 134 381 212 HOH HOH E . 
D 3 HOH 135 382 213 HOH HOH E . 
D 3 HOH 136 383 214 HOH HOH E . 
D 3 HOH 137 384 216 HOH HOH E . 
D 3 HOH 138 385 217 HOH HOH E . 
D 3 HOH 139 386 218 HOH HOH E . 
D 3 HOH 140 387 219 HOH HOH E . 
D 3 HOH 141 388 220 HOH HOH E . 
D 3 HOH 142 389 221 HOH HOH E . 
D 3 HOH 143 390 222 HOH HOH E . 
D 3 HOH 144 391 223 HOH HOH E . 
D 3 HOH 145 392 227 HOH HOH E . 
D 3 HOH 146 393 229 HOH HOH E . 
D 3 HOH 147 394 230 HOH HOH E . 
D 3 HOH 148 395 234 HOH HOH E . 
D 3 HOH 149 396 236 HOH HOH E . 
D 3 HOH 150 397 237 HOH HOH E . 
D 3 HOH 151 398 241 HOH HOH E . 
D 3 HOH 152 399 243 HOH HOH E . 
D 3 HOH 153 400 244 HOH HOH E . 
D 3 HOH 154 401 246 HOH HOH E . 
D 3 HOH 155 402 247 HOH HOH E . 
D 3 HOH 156 403 249 HOH HOH E . 
D 3 HOH 157 404 253 HOH HOH E . 
D 3 HOH 158 405 254 HOH HOH E . 
D 3 HOH 159 406 257 HOH HOH E . 
D 3 HOH 160 407 258 HOH HOH E . 
D 3 HOH 161 408 259 HOH HOH E . 
D 3 HOH 162 409 261 HOH HOH E . 
D 3 HOH 163 410 262 HOH HOH E . 
D 3 HOH 164 411 264 HOH HOH E . 
D 3 HOH 165 412 265 HOH HOH E . 
D 3 HOH 166 413 268 HOH HOH E . 
D 3 HOH 167 414 270 HOH HOH E . 
D 3 HOH 168 415 271 HOH HOH E . 
D 3 HOH 169 416 272 HOH HOH E . 
D 3 HOH 170 417 273 HOH HOH E . 
D 3 HOH 171 418 275 HOH HOH E . 
D 3 HOH 172 419 278 HOH HOH E . 
D 3 HOH 173 420 280 HOH HOH E . 
D 3 HOH 174 421 282 HOH HOH E . 
D 3 HOH 175 422 283 HOH HOH E . 
D 3 HOH 176 423 287 HOH HOH E . 
D 3 HOH 177 424 288 HOH HOH E . 
D 3 HOH 178 425 291 HOH HOH E . 
D 3 HOH 179 426 292 HOH HOH E . 
D 3 HOH 180 427 295 HOH HOH E . 
D 3 HOH 181 428 296 HOH HOH E . 
D 3 HOH 182 429 297 HOH HOH E . 
D 3 HOH 183 430 298 HOH HOH E . 
D 3 HOH 184 431 299 HOH HOH E . 
D 3 HOH 185 432 301 HOH HOH E . 
D 3 HOH 186 433 303 HOH HOH E . 
D 3 HOH 187 434 304 HOH HOH E . 
D 3 HOH 188 435 305 HOH HOH E . 
D 3 HOH 189 436 306 HOH HOH E . 
D 3 HOH 190 437 307 HOH HOH E . 
D 3 HOH 191 438 309 HOH HOH E . 
D 3 HOH 192 439 311 HOH HOH E . 
D 3 HOH 193 440 315 HOH HOH E . 
D 3 HOH 194 441 316 HOH HOH E . 
D 3 HOH 195 442 317 HOH HOH E . 
D 3 HOH 196 443 318 HOH HOH E . 
D 3 HOH 197 444 319 HOH HOH E . 
D 3 HOH 198 445 320 HOH HOH E . 
D 3 HOH 199 446 321 HOH HOH E . 
D 3 HOH 200 447 323 HOH HOH E . 
D 3 HOH 201 448 324 HOH HOH E . 
D 3 HOH 202 449 328 HOH HOH E . 
D 3 HOH 203 450 333 HOH HOH E . 
D 3 HOH 204 451 334 HOH HOH E . 
D 3 HOH 205 452 337 HOH HOH E . 
D 3 HOH 206 453 339 HOH HOH E . 
D 3 HOH 207 454 340 HOH HOH E . 
D 3 HOH 208 455 341 HOH HOH E . 
D 3 HOH 209 456 342 HOH HOH E . 
D 3 HOH 210 457 344 HOH HOH E . 
D 3 HOH 211 458 347 HOH HOH E . 
D 3 HOH 212 459 348 HOH HOH E . 
D 3 HOH 213 460 352 HOH HOH E . 
D 3 HOH 214 461 353 HOH HOH E . 
D 3 HOH 215 462 357 HOH HOH E . 
D 3 HOH 216 463 359 HOH HOH E . 
D 3 HOH 217 464 360 HOH HOH E . 
D 3 HOH 218 465 362 HOH HOH E . 
D 3 HOH 219 466 363 HOH HOH E . 
D 3 HOH 220 467 364 HOH HOH E . 
D 3 HOH 221 468 366 HOH HOH E . 
D 3 HOH 222 469 367 HOH HOH E . 
D 3 HOH 223 470 368 HOH HOH E . 
D 3 HOH 224 471 369 HOH HOH E . 
D 3 HOH 225 472 370 HOH HOH E . 
D 3 HOH 226 473 373 HOH HOH E . 
D 3 HOH 227 474 374 HOH HOH E . 
D 3 HOH 228 475 379 HOH HOH E . 
D 3 HOH 229 476 381 HOH HOH E . 
D 3 HOH 230 477 382 HOH HOH E . 
D 3 HOH 231 478 383 HOH HOH E . 
D 3 HOH 232 479 384 HOH HOH E . 
D 3 HOH 233 480 385 HOH HOH E . 
D 3 HOH 234 481 386 HOH HOH E . 
D 3 HOH 235 482 389 HOH HOH E . 
D 3 HOH 236 483 390 HOH HOH E . 
D 3 HOH 237 484 394 HOH HOH E . 
D 3 HOH 238 485 396 HOH HOH E . 
D 3 HOH 239 486 399 HOH HOH E . 
D 3 HOH 240 487 400 HOH HOH E . 
D 3 HOH 241 488 403 HOH HOH E . 
D 3 HOH 242 489 405 HOH HOH E . 
D 3 HOH 243 490 406 HOH HOH E . 
D 3 HOH 244 491 407 HOH HOH E . 
D 3 HOH 245 492 408 HOH HOH E . 
D 3 HOH 246 493 413 HOH HOH E . 
D 3 HOH 247 494 415 HOH HOH E . 
D 3 HOH 248 495 416 HOH HOH E . 
D 3 HOH 249 496 417 HOH HOH E . 
D 3 HOH 250 497 418 HOH HOH E . 
D 3 HOH 251 498 419 HOH HOH E . 
D 3 HOH 252 499 421 HOH HOH E . 
D 3 HOH 253 500 422 HOH HOH E . 
D 3 HOH 254 501 423 HOH HOH E . 
D 3 HOH 255 502 424 HOH HOH E . 
D 3 HOH 256 503 425 HOH HOH E . 
D 3 HOH 257 504 426 HOH HOH E . 
D 3 HOH 258 505 428 HOH HOH E . 
D 3 HOH 259 506 429 HOH HOH E . 
D 3 HOH 260 507 430 HOH HOH E . 
D 3 HOH 261 508 431 HOH HOH E . 
D 3 HOH 262 509 433 HOH HOH E . 
D 3 HOH 263 510 435 HOH HOH E . 
D 3 HOH 264 511 436 HOH HOH E . 
D 3 HOH 265 512 437 HOH HOH E . 
D 3 HOH 266 513 438 HOH HOH E . 
D 3 HOH 267 514 439 HOH HOH E . 
D 3 HOH 268 515 443 HOH HOH E . 
D 3 HOH 269 516 448 HOH HOH E . 
D 3 HOH 270 517 449 HOH HOH E . 
D 3 HOH 271 518 451 HOH HOH E . 
D 3 HOH 272 519 453 HOH HOH E . 
D 3 HOH 273 520 454 HOH HOH E . 
D 3 HOH 274 521 455 HOH HOH E . 
D 3 HOH 275 522 457 HOH HOH E . 
D 3 HOH 276 523 458 HOH HOH E . 
D 3 HOH 277 524 461 HOH HOH E . 
D 3 HOH 278 525 462 HOH HOH E . 
D 3 HOH 279 526 463 HOH HOH E . 
D 3 HOH 280 527 465 HOH HOH E . 
D 3 HOH 281 528 466 HOH HOH E . 
D 3 HOH 282 529 469 HOH HOH E . 
D 3 HOH 283 530 470 HOH HOH E . 
D 3 HOH 284 531 471 HOH HOH E . 
D 3 HOH 285 532 473 HOH HOH E . 
D 3 HOH 286 533 474 HOH HOH E . 
D 3 HOH 287 534 475 HOH HOH E . 
D 3 HOH 288 535 478 HOH HOH E . 
D 3 HOH 289 536 479 HOH HOH E . 
D 3 HOH 290 537 480 HOH HOH E . 
D 3 HOH 291 538 481 HOH HOH E . 
D 3 HOH 292 539 482 HOH HOH E . 
D 3 HOH 293 540 483 HOH HOH E . 
D 3 HOH 294 541 485 HOH HOH E . 
D 3 HOH 295 542 489 HOH HOH E . 
D 3 HOH 296 543 491 HOH HOH E . 
D 3 HOH 297 544 495 HOH HOH E . 
D 3 HOH 298 545 496 HOH HOH E . 
D 3 HOH 299 546 498 HOH HOH E . 
D 3 HOH 300 547 500 HOH HOH E . 
D 3 HOH 301 548 501 HOH HOH E . 
D 3 HOH 302 549 503 HOH HOH E . 
D 3 HOH 303 550 506 HOH HOH E . 
D 3 HOH 304 551 509 HOH HOH E . 
D 3 HOH 305 552 511 HOH HOH E . 
D 3 HOH 306 553 513 HOH HOH E . 
D 3 HOH 307 554 516 HOH HOH E . 
D 3 HOH 308 555 517 HOH HOH E . 
D 3 HOH 309 556 518 HOH HOH E . 
D 3 HOH 310 557 519 HOH HOH E . 
D 3 HOH 311 558 520 HOH HOH E . 
D 3 HOH 312 559 522 HOH HOH E . 
D 3 HOH 313 560 526 HOH HOH E . 
D 3 HOH 314 561 528 HOH HOH E . 
D 3 HOH 315 562 530 HOH HOH E . 
D 3 HOH 316 563 532 HOH HOH E . 
D 3 HOH 317 564 533 HOH HOH E . 
D 3 HOH 318 565 534 HOH HOH E . 
D 3 HOH 319 566 539 HOH HOH E . 
D 3 HOH 320 567 540 HOH HOH E . 
D 3 HOH 321 568 541 HOH HOH E . 
D 3 HOH 322 569 542 HOH HOH E . 
D 3 HOH 323 570 543 HOH HOH E . 
D 3 HOH 324 571 544 HOH HOH E . 
D 3 HOH 325 572 547 HOH HOH E . 
D 3 HOH 326 573 548 HOH HOH E . 
D 3 HOH 327 574 549 HOH HOH E . 
D 3 HOH 328 575 551 HOH HOH E . 
D 3 HOH 329 576 554 HOH HOH E . 
D 3 HOH 330 577 555 HOH HOH E . 
D 3 HOH 331 578 556 HOH HOH E . 
D 3 HOH 332 579 558 HOH HOH E . 
D 3 HOH 333 580 559 HOH HOH E . 
D 3 HOH 334 581 564 HOH HOH E . 
D 3 HOH 335 582 567 HOH HOH E . 
D 3 HOH 336 583 569 HOH HOH E . 
D 3 HOH 337 584 571 HOH HOH E . 
D 3 HOH 338 585 573 HOH HOH E . 
D 3 HOH 339 586 581 HOH HOH E . 
D 3 HOH 340 587 582 HOH HOH E . 
D 3 HOH 341 588 584 HOH HOH E . 
D 3 HOH 342 589 585 HOH HOH E . 
D 3 HOH 343 590 586 HOH HOH E . 
D 3 HOH 344 591 588 HOH HOH E . 
D 3 HOH 345 592 591 HOH HOH E . 
D 3 HOH 346 593 592 HOH HOH E . 
D 3 HOH 347 594 595 HOH HOH E . 
D 3 HOH 348 595 596 HOH HOH E . 
D 3 HOH 349 596 598 HOH HOH E . 
D 3 HOH 350 597 599 HOH HOH E . 
D 3 HOH 351 598 600 HOH HOH E . 
D 3 HOH 352 599 603 HOH HOH E . 
D 3 HOH 353 600 604 HOH HOH E . 
D 3 HOH 354 601 605 HOH HOH E . 
D 3 HOH 355 602 608 HOH HOH E . 
D 3 HOH 356 603 612 HOH HOH E . 
D 3 HOH 357 604 614 HOH HOH E . 
D 3 HOH 358 605 615 HOH HOH E . 
D 3 HOH 359 606 616 HOH HOH E . 
D 3 HOH 360 607 617 HOH HOH E . 
D 3 HOH 361 608 619 HOH HOH E . 
D 3 HOH 362 609 620 HOH HOH E . 
D 3 HOH 363 610 624 HOH HOH E . 
D 3 HOH 364 611 626 HOH HOH E . 
D 3 HOH 365 612 631 HOH HOH E . 
D 3 HOH 366 613 637 HOH HOH E . 
D 3 HOH 367 614 641 HOH HOH E . 
D 3 HOH 368 615 642 HOH HOH E . 
D 3 HOH 369 616 643 HOH HOH E . 
D 3 HOH 370 617 644 HOH HOH E . 
D 3 HOH 371 618 648 HOH HOH E . 
D 3 HOH 372 619 649 HOH HOH E . 
D 3 HOH 373 620 653 HOH HOH E . 
D 3 HOH 374 621 656 HOH HOH E . 
D 3 HOH 375 622 657 HOH HOH E . 
D 3 HOH 376 623 658 HOH HOH E . 
D 3 HOH 377 624 659 HOH HOH E . 
D 3 HOH 378 625 660 HOH HOH E . 
D 3 HOH 379 626 662 HOH HOH E . 
D 3 HOH 380 627 664 HOH HOH E . 
D 3 HOH 381 628 665 HOH HOH E . 
D 3 HOH 382 629 666 HOH HOH E . 
D 3 HOH 383 630 667 HOH HOH E . 
D 3 HOH 384 631 668 HOH HOH E . 
D 3 HOH 385 632 672 HOH HOH E . 
D 3 HOH 386 633 673 HOH HOH E . 
D 3 HOH 387 634 674 HOH HOH E . 
D 3 HOH 388 635 675 HOH HOH E . 
D 3 HOH 389 636 676 HOH HOH E . 
D 3 HOH 390 637 677 HOH HOH E . 
D 3 HOH 391 638 679 HOH HOH E . 
D 3 HOH 392 639 680 HOH HOH E . 
D 3 HOH 393 640 681 HOH HOH E . 
D 3 HOH 394 641 684 HOH HOH E . 
D 3 HOH 395 642 685 HOH HOH E . 
D 3 HOH 396 643 686 HOH HOH E . 
D 3 HOH 397 644 687 HOH HOH E . 
D 3 HOH 398 645 688 HOH HOH E . 
#