data_1KIL
# 
_entry.id   1KIL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KIL         
RCSB  RCSB014995   
WWPDB D_1000014995 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KIL 
_pdbx_database_status.recvd_initial_deposition_date   2001-12-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chen, X.'     1 
'Tomchick, D.' 2 
'Kovrigin, E.' 3 
'Arac, D.'     4 
'Machius, M.'  5 
'Sudhof, T.C.' 6 
'Rizo, J.'     7 
# 
_citation.id                        primary 
_citation.title                     'Three-dimensional structure of the complexin/SNARE complex.' 
_citation.journal_abbrev            Neuron 
_citation.journal_volume            33 
_citation.page_first                397 
_citation.page_last                 409 
_citation.year                      2002 
_citation.journal_id_ASTM           NERNET 
_citation.country                   US 
_citation.journal_id_ISSN           0896-6273 
_citation.journal_id_CSD            2038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11832227 
_citation.pdbx_database_id_DOI      '10.1016/S0896-6273(02)00583-4' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chen, X.'       1 
primary 'Tomchick, D.R.' 2 
primary 'Kovrigin, E.'   3 
primary 'Arac, D.'       4 
primary 'Machius, M.'    5 
primary 'Sudhof, T.C.'   6 
primary 'Rizo, J.'       7 
# 
_cell.entry_id           1KIL 
_cell.length_a           40.489 
_cell.length_b           60.425 
_cell.length_c           159.787 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KIL 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Synaptobrevin SNARE motif'                7660.553 1   ? ?                       'SNARE motif (29-93)'        ? 
2 polymer     man 'Syntaxin SNARE motif short'               7192.038 1   ? ?                       'SNARE motif (191-253)'      ? 
3 polymer     man 'SNAP-25 N-terminal SNARE motif'           8642.615 1   ? 'W added at C-terminus' 'SNARE motif (11-82)'        ? 
4 polymer     man 'SNAP-25 C-terminal SNARE motif'           7613.459 1   ? 'W added at C-terminus' 'SNARE motif (141-203)'      ? 
5 polymer     man 'Complexin I SNARE-complex binding region' 5766.459 1   ? ?                       'Complexin (residues 26-83)' ? 
6 non-polymer syn 'MAGNESIUM ION'                            24.305   2   ? ?                       ?                            ? 
7 water       nat water                                      18.015   113 ? ?                       ?                            ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'vesicle associated membrane protein 2B'             
2 'synaptotagmin associated associated 35 kDA protein' 
3 'synaptosomal-associated protein 25kD'               
4 'synaptosomal-associated protein 25kD'               
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKN         
GSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKN         A ? 
2 'polypeptide(L)' no no GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSD             
GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSD             B ? 
3 'polypeptide(L)' no no GSLEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLW 
GSLEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLW C ? 
4 'polypeptide(L)' no no GSARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLW         
GSARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLW         D ? 
5 'polypeptide(L)' no no GSKDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREVMRQGIRDKYGI                          
GSKDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREVMRQGIRDKYGI                          E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  ASN n 
1 4  ARG n 
1 5  ARG n 
1 6  LEU n 
1 7  GLN n 
1 8  GLN n 
1 9  THR n 
1 10 GLN n 
1 11 ALA n 
1 12 GLN n 
1 13 VAL n 
1 14 ASP n 
1 15 GLU n 
1 16 VAL n 
1 17 VAL n 
1 18 ASP n 
1 19 ILE n 
1 20 MET n 
1 21 ARG n 
1 22 VAL n 
1 23 ASN n 
1 24 VAL n 
1 25 ASP n 
1 26 LYS n 
1 27 VAL n 
1 28 LEU n 
1 29 GLU n 
1 30 ARG n 
1 31 ASP n 
1 32 GLN n 
1 33 LYS n 
1 34 LEU n 
1 35 SER n 
1 36 GLU n 
1 37 LEU n 
1 38 ASP n 
1 39 ASP n 
1 40 ARG n 
1 41 ALA n 
1 42 ASP n 
1 43 ALA n 
1 44 LEU n 
1 45 GLN n 
1 46 ALA n 
1 47 GLY n 
1 48 ALA n 
1 49 SER n 
1 50 GLN n 
1 51 PHE n 
1 52 GLU n 
1 53 THR n 
1 54 SER n 
1 55 ALA n 
1 56 ALA n 
1 57 LYS n 
1 58 LEU n 
1 59 LYS n 
1 60 ARG n 
1 61 LYS n 
1 62 TYR n 
1 63 TRP n 
1 64 TRP n 
1 65 LYS n 
1 66 ASN n 
2 1  GLY n 
2 2  SER n 
2 3  ALA n 
2 4  LEU n 
2 5  SER n 
2 6  GLU n 
2 7  ILE n 
2 8  GLU n 
2 9  THR n 
2 10 ARG n 
2 11 HIS n 
2 12 SER n 
2 13 GLU n 
2 14 ILE n 
2 15 ILE n 
2 16 LYS n 
2 17 LEU n 
2 18 GLU n 
2 19 ASN n 
2 20 SER n 
2 21 ILE n 
2 22 ARG n 
2 23 GLU n 
2 24 LEU n 
2 25 HIS n 
2 26 ASP n 
2 27 MET n 
2 28 PHE n 
2 29 MET n 
2 30 ASP n 
2 31 MET n 
2 32 ALA n 
2 33 MET n 
2 34 LEU n 
2 35 VAL n 
2 36 GLU n 
2 37 SER n 
2 38 GLN n 
2 39 GLY n 
2 40 GLU n 
2 41 MET n 
2 42 ILE n 
2 43 ASP n 
2 44 ARG n 
2 45 ILE n 
2 46 GLU n 
2 47 TYR n 
2 48 ASN n 
2 49 VAL n 
2 50 GLU n 
2 51 HIS n 
2 52 ALA n 
2 53 VAL n 
2 54 ASP n 
2 55 TYR n 
2 56 VAL n 
2 57 GLU n 
2 58 ARG n 
2 59 ALA n 
2 60 VAL n 
2 61 SER n 
2 62 ASP n 
3 1  GLY n 
3 2  SER n 
3 3  LEU n 
3 4  GLU n 
3 5  GLU n 
3 6  MET n 
3 7  GLN n 
3 8  ARG n 
3 9  ARG n 
3 10 ALA n 
3 11 ASP n 
3 12 GLN n 
3 13 LEU n 
3 14 ALA n 
3 15 ASP n 
3 16 GLU n 
3 17 SER n 
3 18 LEU n 
3 19 GLU n 
3 20 SER n 
3 21 THR n 
3 22 ARG n 
3 23 ARG n 
3 24 MET n 
3 25 LEU n 
3 26 GLN n 
3 27 LEU n 
3 28 VAL n 
3 29 GLU n 
3 30 GLU n 
3 31 SER n 
3 32 LYS n 
3 33 ASP n 
3 34 ALA n 
3 35 GLY n 
3 36 ILE n 
3 37 ARG n 
3 38 THR n 
3 39 LEU n 
3 40 VAL n 
3 41 MET n 
3 42 LEU n 
3 43 ASP n 
3 44 GLU n 
3 45 GLN n 
3 46 GLY n 
3 47 GLU n 
3 48 GLN n 
3 49 LEU n 
3 50 ASP n 
3 51 ARG n 
3 52 VAL n 
3 53 GLU n 
3 54 GLU n 
3 55 GLY n 
3 56 MET n 
3 57 ASN n 
3 58 HIS n 
3 59 ILE n 
3 60 ASN n 
3 61 GLN n 
3 62 ASP n 
3 63 MET n 
3 64 LYS n 
3 65 GLU n 
3 66 ALA n 
3 67 GLU n 
3 68 LYS n 
3 69 ASN n 
3 70 LEU n 
3 71 LYS n 
3 72 ASP n 
3 73 LEU n 
3 74 TRP n 
4 1  GLY n 
4 2  SER n 
4 3  ALA n 
4 4  ARG n 
4 5  GLU n 
4 6  ASN n 
4 7  GLU n 
4 8  MET n 
4 9  ASP n 
4 10 GLU n 
4 11 ASN n 
4 12 LEU n 
4 13 GLU n 
4 14 GLN n 
4 15 VAL n 
4 16 SER n 
4 17 GLY n 
4 18 ILE n 
4 19 ILE n 
4 20 GLY n 
4 21 ASN n 
4 22 LEU n 
4 23 ARG n 
4 24 HIS n 
4 25 MET n 
4 26 ALA n 
4 27 LEU n 
4 28 ASP n 
4 29 MET n 
4 30 GLY n 
4 31 ASN n 
4 32 GLU n 
4 33 ILE n 
4 34 ASP n 
4 35 THR n 
4 36 GLN n 
4 37 ASN n 
4 38 ARG n 
4 39 GLN n 
4 40 ILE n 
4 41 ASP n 
4 42 ARG n 
4 43 ILE n 
4 44 MET n 
4 45 GLU n 
4 46 LYS n 
4 47 ALA n 
4 48 ASP n 
4 49 SER n 
4 50 ASN n 
4 51 LYS n 
4 52 THR n 
4 53 ARG n 
4 54 ILE n 
4 55 ASP n 
4 56 GLU n 
4 57 ALA n 
4 58 ASN n 
4 59 GLN n 
4 60 ARG n 
4 61 ALA n 
4 62 THR n 
4 63 LYS n 
4 64 MET n 
4 65 LEU n 
4 66 TRP n 
5 1  GLY n 
5 2  SER n 
5 3  LYS n 
5 4  ASP n 
5 5  PRO n 
5 6  ASP n 
5 7  ALA n 
5 8  ALA n 
5 9  LYS n 
5 10 LYS n 
5 11 GLU n 
5 12 GLU n 
5 13 GLU n 
5 14 ARG n 
5 15 GLN n 
5 16 GLU n 
5 17 ALA n 
5 18 LEU n 
5 19 ARG n 
5 20 GLN n 
5 21 ALA n 
5 22 GLU n 
5 23 GLU n 
5 24 GLU n 
5 25 ARG n 
5 26 LYS n 
5 27 ALA n 
5 28 LYS n 
5 29 TYR n 
5 30 ALA n 
5 31 LYS n 
5 32 MET n 
5 33 GLU n 
5 34 ALA n 
5 35 GLU n 
5 36 ARG n 
5 37 GLU n 
5 38 VAL n 
5 39 MET n 
5 40 ARG n 
5 41 GLN n 
5 42 GLY n 
5 43 ILE n 
5 44 ARG n 
5 45 ASP n 
5 46 LYS n 
5 47 TYR n 
5 48 GLY n 
5 49 ILE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'Norway rat' Rattus 'Synaptobrevin 2' ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pGEX-KT ? ? 
2 1 sample ? ? ? 'Norway rat' Rattus 'Syntaxin 1A'     ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pGEX-KT ? ? 
3 1 sample ? ? ? human        Homo   SNAP-25           ? ? ? ? ? ? 'Homo sapiens'      9606  ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pGEX-KT ? ? 
4 1 sample ? ? ? human        Homo   SNAP-25           ? ? ? ? ? ? 'Homo sapiens'      9606  ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pGEX-KT ? ? 
5 1 sample ? ? ? 'Norway rat' Rattus 'Complexin 1'     ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pGEX-KT ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP VAMP2_RAT  1 
;MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETS
AAKLKRKYWWKNLKMMIILGVICAIILIIIIGEWSRSGQGPFPGEVEGFPVGSGL
;
1 P63045 ? 
2 UNP STX1A_RAT  2 
;MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMS
DIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTT
TSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHA
VDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG
;
1 P32851 ? 
3 UNP SN25_HUMAN 3 
;MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKD
LGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNL
RHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG
;
1 P60880 ? 
4 UNP SN25_HUMAN 4 
;MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTD
LGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNL
RHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG
;
1 P60880 ? 
5 UNP CPLX1_RAT  5 
;MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREVMRQGIRDKYGIKKKEEREA
EAQAAMEANSEGSLTRPKKAIPPGCGDEPEEEDESILDTVIKYLPGPLQDMFKK
;
1 P63041 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KIL A 2 ? 66 ? P63045 28  ? 92  ? 28  92  
2 2 1KIL B 4 ? 62 ? P32851 192 ? 250 ? 192 250 
3 3 1KIL C 2 ? 73 ? P60880 10  ? 81  ? 10  81  
4 4 1KIL D 1 ? 66 ? P60880 139 ? 204 ? 139 204 
5 5 1KIL E 9 ? 49 ? P63041 32  ? 72  ? 32  72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 1KIL SER C 2  ? UNP P60880 GLU 10  'SEE REMARK 999' 10  1 
4 1KIL GLY D 1  ? UNP P60880 ASN 139 'SEE REMARK 999' 139 2 
4 1KIL SER D 2  ? UNP P60880 ASP 140 'SEE REMARK 999' 140 3 
4 1KIL TRP D 66 ? UNP P60880 GLY 204 'SEE REMARK 999' 204 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1KIL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.65 
_exptl_crystal.density_percent_sol   53.59 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'27%(v/v) Iso-Propanol, 200mM MgCl2, 100mM Hepes, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   CUSTOM-MADE 
_diffrn_detector.pdbx_collection_date   2001-09-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double-crystal monochrmator Si (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0332 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0332 
# 
_reflns.entry_id                     1KIL 
_reflns.observed_criterion_sigma_I   -3.00 
_reflns.observed_criterion_sigma_F   -3.00 
_reflns.d_resolution_low             32.2 
_reflns.d_resolution_high            2.30 
_reflns.number_obs                   17624 
_reflns.number_all                   18098 
_reflns.percent_possible_obs         97.4 
_reflns.pdbx_Rmerge_I_obs            0.051 
_reflns.pdbx_Rsym_value              0.051 
_reflns.pdbx_netI_over_sigmaI        24.8 
_reflns.B_iso_Wilson_estimate        45.8 
_reflns.pdbx_redundancy              5.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.34 
_reflns_shell.percent_possible_all   82.4 
_reflns_shell.Rmerge_I_obs           0.265 
_reflns_shell.pdbx_Rsym_value        0.265 
_reflns_shell.meanI_over_sigI_obs    4.3 
_reflns_shell.pdbx_redundancy        3.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      728 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1KIL 
_refine.ls_number_reflns_obs                     15857 
_refine.ls_number_reflns_all                     15857 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1536401.45 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             32.23 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    87.3 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          0.287 
_refine.ls_R_factor_R_work                       0.245 
_refine.ls_R_factor_R_free                       0.305 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 6.3 
_refine.ls_number_reflns_R_free                  1005 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               65.7 
_refine.aniso_B[1][1]                            36.42 
_refine.aniso_B[2][2]                            -4.39 
_refine.aniso_B[3][3]                            -32.03 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.32352 
_refine.solvent_model_param_bsol                 61.1732 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1SFC' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           1536401.45 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1KIL 
_refine_analyze.Luzzati_coordinate_error_obs    0.34 
_refine_analyze.Luzzati_sigma_a_obs             0.52 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.43 
_refine_analyze.Luzzati_sigma_a_free            0.46 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2495 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             113 
_refine_hist.number_atoms_total               2610 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        32.23 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.011 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 16.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.80  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.46  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.46  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.52  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.93  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.44 
_refine_ls_shell.number_reflns_R_work             1920 
_refine_ls_shell.R_factor_R_work                  0.361 
_refine_ls_shell.percent_reflns_obs               69.2 
_refine_ls_shell.R_factor_R_free                  0.368 
_refine_ls_shell.R_factor_R_free_error            0.033 
_refine_ls_shell.percent_reflns_R_free            5.7 
_refine_ls_shell.number_reflns_R_free             116 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN_REP. 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER_REP.   'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.         'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1KIL 
_struct.title                     'Three-dimensional structure of the complexin/SNARE complex' 
_struct.pdbx_descriptor           
;Synaptobrevin SNARE motif, Syntaxin SNARE motif short, SNAP-25 N-terminal SNARE motif, SNAP-25 C-terminal SNARE motif, Complexin I SNARE-complex binding region
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KIL 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            'Helix bound to four helix bundle, MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 7 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
L N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 2 LEU B 4  ? VAL B 60 ? LEU B 192 VAL B 248 1 ? 57 
HELX_P HELX_P2 3 SER C 2  ? ASP C 72 ? SER C 10  ASP C 80  1 ? 71 
HELX_P HELX_P3 4 SER D 2  ? MET D 64 ? SER D 140 MET D 202 1 ? 63 
HELX_P HELX_P4 5 GLU E 11 ? GLY E 48 ? GLU E 34  GLY E 71  1 ? 38 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? F MG . MG ? ? ? 1_555 A ASP 42 OD1 ? ? A MG 301 A ASP 68  1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc2  metalc ? ? F MG . MG ? ? ? 1_555 H HOH .  O   ? ? A MG 301 A HOH 302 1_555 ? ? ? ? ? ? ? 1.983 ? 
metalc3  metalc ? ? F MG . MG ? ? ? 1_555 H HOH .  O   ? ? A MG 301 A HOH 304 1_555 ? ? ? ? ? ? ? 2.242 ? 
metalc4  metalc ? ? F MG . MG ? ? ? 1_555 I HOH .  O   ? ? A MG 301 B HOH 4   1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc5  metalc ? ? F MG . MG ? ? ? 1_555 H HOH .  O   ? ? A MG 301 A HOH 303 1_555 ? ? ? ? ? ? ? 2.266 ? 
metalc6  metalc ? ? F MG . MG ? ? ? 1_555 I HOH .  O   ? ? A MG 301 B HOH 2   1_555 ? ? ? ? ? ? ? 2.010 ? 
metalc7  metalc ? ? G MG . MG ? ? ? 1_555 J HOH .  O   ? ? C MG 302 C HOH 303 1_555 ? ? ? ? ? ? ? 2.676 ? 
metalc8  metalc ? ? G MG . MG ? ? ? 1_555 J HOH .  O   ? ? C MG 302 C HOH 306 1_555 ? ? ? ? ? ? ? 2.610 ? 
metalc9  metalc ? ? G MG . MG ? ? ? 1_555 J HOH .  O   ? ? C MG 302 C HOH 305 1_555 ? ? ? ? ? ? ? 2.010 ? 
metalc10 metalc ? ? G MG . MG ? ? ? 1_555 K HOH .  O   ? ? C MG 302 D HOH 6   1_555 ? ? ? ? ? ? ? 1.908 ? 
metalc11 metalc ? ? G MG . MG ? ? ? 1_555 K HOH .  O   ? ? C MG 302 D HOH 8   1_555 ? ? ? ? ? ? ? 1.920 ? 
metalc12 metalc ? ? G MG . MG ? ? ? 1_555 K HOH .  O   ? ? C MG 302 D HOH 10  1_555 ? ? ? ? ? ? ? 1.987 ? 
metalc13 metalc ? ? G MG . MG ? ? ? 1_555 J HOH .  O   ? ? C MG 302 C HOH 304 1_555 ? ? ? ? ? ? ? 2.473 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 301' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG C 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 42 ? ASP A 68  . ? 1_555 ? 
2  AC1 6 HOH H .  ? HOH A 302 . ? 1_555 ? 
3  AC1 6 HOH H .  ? HOH A 303 . ? 1_555 ? 
4  AC1 6 HOH H .  ? HOH A 304 . ? 1_555 ? 
5  AC1 6 HOH I .  ? HOH B 2   . ? 1_555 ? 
6  AC1 6 HOH I .  ? HOH B 4   . ? 1_555 ? 
7  AC2 7 HOH J .  ? HOH C 303 . ? 1_555 ? 
8  AC2 7 HOH J .  ? HOH C 304 . ? 1_555 ? 
9  AC2 7 HOH J .  ? HOH C 305 . ? 1_555 ? 
10 AC2 7 HOH J .  ? HOH C 306 . ? 1_555 ? 
11 AC2 7 HOH K .  ? HOH D 6   . ? 1_555 ? 
12 AC2 7 HOH K .  ? HOH D 8   . ? 1_555 ? 
13 AC2 7 HOH K .  ? HOH D 10  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1KIL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KIL 
_atom_sites.fract_transf_matrix[1][1]   0.024698 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016549 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006258 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 2  ? 17.527  47.854  100.195 1.00 114.38 ? 28  SER A N   1 
ATOM   2    C  CA  . SER A 1 2  ? 16.637  49.006  99.853  1.00 114.78 ? 28  SER A CA  1 
ATOM   3    C  C   . SER A 1 2  ? 15.668  48.661  98.737  1.00 114.95 ? 28  SER A C   1 
ATOM   4    O  O   . SER A 1 2  ? 15.650  47.523  98.252  1.00 114.85 ? 28  SER A O   1 
ATOM   5    N  N   . ASN A 1 3  ? 14.848  49.633  98.341  1.00 114.43 ? 29  ASN A N   1 
ATOM   6    C  CA  . ASN A 1 3  ? 13.892  49.434  97.253  1.00 113.67 ? 29  ASN A CA  1 
ATOM   7    C  C   . ASN A 1 3  ? 14.723  49.547  95.988  1.00 112.95 ? 29  ASN A C   1 
ATOM   8    O  O   . ASN A 1 3  ? 14.273  49.251  94.880  1.00 112.68 ? 29  ASN A O   1 
ATOM   9    C  CB  . ASN A 1 3  ? 12.827  50.529  97.273  1.00 113.99 ? 29  ASN A CB  1 
ATOM   10   C  CG  . ASN A 1 3  ? 12.115  50.616  98.600  1.00 114.27 ? 29  ASN A CG  1 
ATOM   11   O  OD1 . ASN A 1 3  ? 11.406  49.695  99.002  1.00 114.56 ? 29  ASN A OD1 1 
ATOM   12   N  ND2 . ASN A 1 3  ? 12.307  51.725  99.296  1.00 115.11 ? 29  ASN A ND2 1 
ATOM   13   N  N   . ARG A 1 4  ? 15.958  49.988  96.196  1.00 112.39 ? 30  ARG A N   1 
ATOM   14   C  CA  . ARG A 1 4  ? 16.938  50.173  95.144  1.00 111.29 ? 30  ARG A CA  1 
ATOM   15   C  C   . ARG A 1 4  ? 17.157  48.875  94.390  1.00 109.83 ? 30  ARG A C   1 
ATOM   16   O  O   . ARG A 1 4  ? 17.713  48.876  93.297  1.00 110.62 ? 30  ARG A O   1 
ATOM   17   C  CB  . ARG A 1 4  ? 18.260  50.634  95.759  1.00 112.72 ? 30  ARG A CB  1 
ATOM   18   C  CG  . ARG A 1 4  ? 18.141  51.910  96.577  0.00 113.57 ? 30  ARG A CG  1 
ATOM   19   C  CD  . ARG A 1 4  ? 18.823  51.762  97.928  0.00 114.55 ? 30  ARG A CD  1 
ATOM   20   N  NE  . ARG A 1 4  ? 20.210  51.327  97.796  0.00 115.36 ? 30  ARG A NE  1 
ATOM   21   C  CZ  . ARG A 1 4  ? 21.154  52.015  97.163  0.00 115.78 ? 30  ARG A CZ  1 
ATOM   22   N  NH1 . ARG A 1 4  ? 20.866  53.180  96.599  0.00 116.06 ? 30  ARG A NH1 1 
ATOM   23   N  NH2 . ARG A 1 4  ? 22.388  51.536  97.091  0.00 116.06 ? 30  ARG A NH2 1 
ATOM   24   N  N   . ARG A 1 5  ? 16.725  47.768  94.981  1.00 107.36 ? 31  ARG A N   1 
ATOM   25   C  CA  . ARG A 1 5  ? 16.884  46.461  94.362  1.00 104.29 ? 31  ARG A CA  1 
ATOM   26   C  C   . ARG A 1 5  ? 15.536  45.754  94.304  1.00 101.49 ? 31  ARG A C   1 
ATOM   27   O  O   . ARG A 1 5  ? 15.263  44.997  93.376  1.00 100.78 ? 31  ARG A O   1 
ATOM   28   C  CB  . ARG A 1 5  ? 17.878  45.623  95.170  1.00 105.00 ? 31  ARG A CB  1 
ATOM   29   C  CG  . ARG A 1 5  ? 19.206  46.317  95.444  0.00 106.18 ? 31  ARG A CG  1 
ATOM   30   C  CD  . ARG A 1 5  ? 20.029  45.550  96.471  0.00 107.13 ? 31  ARG A CD  1 
ATOM   31   N  NE  . ARG A 1 5  ? 21.302  46.205  96.761  0.00 107.97 ? 31  ARG A NE  1 
ATOM   32   C  CZ  . ARG A 1 5  ? 22.163  45.794  97.687  0.00 108.40 ? 31  ARG A CZ  1 
ATOM   33   N  NH1 . ARG A 1 5  ? 21.890  44.723  98.420  0.00 108.68 ? 31  ARG A NH1 1 
ATOM   34   N  NH2 . ARG A 1 5  ? 23.299  46.451  97.879  0.00 108.68 ? 31  ARG A NH2 1 
ATOM   35   N  N   . LEU A 1 6  ? 14.693  46.013  95.298  1.00 98.55  ? 32  LEU A N   1 
ATOM   36   C  CA  . LEU A 1 6  ? 13.377  45.392  95.366  1.00 96.03  ? 32  LEU A CA  1 
ATOM   37   C  C   . LEU A 1 6  ? 12.475  45.854  94.238  1.00 95.13  ? 32  LEU A C   1 
ATOM   38   O  O   . LEU A 1 6  ? 11.810  45.046  93.601  1.00 94.84  ? 32  LEU A O   1 
ATOM   39   C  CB  . LEU A 1 6  ? 12.705  45.700  96.703  1.00 94.93  ? 32  LEU A CB  1 
ATOM   40   C  CG  . LEU A 1 6  ? 11.341  45.042  96.899  1.00 93.67  ? 32  LEU A CG  1 
ATOM   41   C  CD1 . LEU A 1 6  ? 11.504  43.539  96.885  1.00 93.46  ? 32  LEU A CD1 1 
ATOM   42   C  CD2 . LEU A 1 6  ? 10.735  45.481  98.214  1.00 94.45  ? 32  LEU A CD2 1 
ATOM   43   N  N   . GLN A 1 7  ? 12.439  47.159  93.998  1.00 94.39  ? 33  GLN A N   1 
ATOM   44   C  CA  . GLN A 1 7  ? 11.610  47.701  92.931  1.00 93.02  ? 33  GLN A CA  1 
ATOM   45   C  C   . GLN A 1 7  ? 12.180  47.297  91.574  1.00 90.84  ? 33  GLN A C   1 
ATOM   46   O  O   . GLN A 1 7  ? 11.439  47.117  90.612  1.00 89.78  ? 33  GLN A O   1 
ATOM   47   C  CB  . GLN A 1 7  ? 11.536  49.225  93.039  1.00 95.18  ? 33  GLN A CB  1 
ATOM   48   C  CG  . GLN A 1 7  ? 10.647  49.737  94.165  1.00 97.85  ? 33  GLN A CG  1 
ATOM   49   C  CD  . GLN A 1 7  ? 10.639  51.264  94.260  1.00 100.13 ? 33  GLN A CD  1 
ATOM   50   O  OE1 . GLN A 1 7  ? 9.764   51.862  94.899  1.00 100.80 ? 33  GLN A OE1 1 
ATOM   51   N  NE2 . GLN A 1 7  ? 11.624  51.900  93.629  1.00 100.94 ? 33  GLN A NE2 1 
ATOM   52   N  N   . GLN A 1 8  ? 13.500  47.160  91.499  1.00 89.10  ? 34  GLN A N   1 
ATOM   53   C  CA  . GLN A 1 8  ? 14.150  46.751  90.253  1.00 87.69  ? 34  GLN A CA  1 
ATOM   54   C  C   . GLN A 1 8  ? 13.748  45.314  89.895  1.00 85.34  ? 34  GLN A C   1 
ATOM   55   O  O   . GLN A 1 8  ? 13.458  44.994  88.741  1.00 84.56  ? 34  GLN A O   1 
ATOM   56   C  CB  . GLN A 1 8  ? 15.678  46.823  90.393  1.00 89.62  ? 34  GLN A CB  1 
ATOM   57   C  CG  . GLN A 1 8  ? 16.261  48.230  90.495  1.00 92.27  ? 34  GLN A CG  1 
ATOM   58   C  CD  . GLN A 1 8  ? 17.790  48.234  90.512  1.00 93.60  ? 34  GLN A CD  1 
ATOM   59   O  OE1 . GLN A 1 8  ? 18.414  47.644  91.401  1.00 94.80  ? 34  GLN A OE1 1 
ATOM   60   N  NE2 . GLN A 1 8  ? 18.398  48.901  89.528  1.00 93.41  ? 34  GLN A NE2 1 
ATOM   61   N  N   . THR A 1 9  ? 13.752  44.455  90.909  1.00 82.18  ? 35  THR A N   1 
ATOM   62   C  CA  . THR A 1 9  ? 13.395  43.058  90.758  1.00 77.99  ? 35  THR A CA  1 
ATOM   63   C  C   . THR A 1 9  ? 11.919  42.919  90.412  1.00 75.48  ? 35  THR A C   1 
ATOM   64   O  O   . THR A 1 9  ? 11.542  42.102  89.585  1.00 75.00  ? 35  THR A O   1 
ATOM   65   C  CB  . THR A 1 9  ? 13.683  42.293  92.063  1.00 77.48  ? 35  THR A CB  1 
ATOM   66   O  OG1 . THR A 1 9  ? 15.095  42.149  92.227  1.00 76.98  ? 35  THR A OG1 1 
ATOM   67   C  CG2 . THR A 1 9  ? 13.034  40.933  92.042  1.00 76.76  ? 35  THR A CG2 1 
ATOM   68   N  N   . GLN A 1 10 ? 11.087  43.718  91.058  1.00 73.12  ? 36  GLN A N   1 
ATOM   69   C  CA  . GLN A 1 10 ? 9.655   43.670  90.813  1.00 72.53  ? 36  GLN A CA  1 
ATOM   70   C  C   . GLN A 1 10 ? 9.368   44.045  89.377  1.00 71.96  ? 36  GLN A C   1 
ATOM   71   O  O   . GLN A 1 10 ? 8.522   43.449  88.714  1.00 72.47  ? 36  GLN A O   1 
ATOM   72   C  CB  . GLN A 1 10 ? 8.928   44.647  91.721  1.00 72.39  ? 36  GLN A CB  1 
ATOM   73   C  CG  . GLN A 1 10 ? 7.502   44.886  91.307  1.00 73.41  ? 36  GLN A CG  1 
ATOM   74   C  CD  . GLN A 1 10 ? 6.616   43.718  91.651  1.00 75.48  ? 36  GLN A CD  1 
ATOM   75   O  OE1 . GLN A 1 10 ? 6.660   43.207  92.775  1.00 75.80  ? 36  GLN A OE1 1 
ATOM   76   N  NE2 . GLN A 1 10 ? 5.794   43.288  90.694  1.00 74.73  ? 36  GLN A NE2 1 
ATOM   77   N  N   . ALA A 1 11 ? 10.083  45.052  88.909  1.00 70.44  ? 37  ALA A N   1 
ATOM   78   C  CA  . ALA A 1 11 ? 9.920   45.525  87.560  1.00 69.63  ? 37  ALA A CA  1 
ATOM   79   C  C   . ALA A 1 11 ? 10.309  44.450  86.550  1.00 69.81  ? 37  ALA A C   1 
ATOM   80   O  O   . ALA A 1 11 ? 9.604   44.254  85.554  1.00 68.44  ? 37  ALA A O   1 
ATOM   81   C  CB  . ALA A 1 11 ? 10.766  46.778  87.347  1.00 68.67  ? 37  ALA A CB  1 
ATOM   82   N  N   . GLN A 1 12 ? 11.423  43.755  86.798  1.00 69.37  ? 38  GLN A N   1 
ATOM   83   C  CA  . GLN A 1 12 ? 11.879  42.728  85.861  1.00 70.78  ? 38  GLN A CA  1 
ATOM   84   C  C   . GLN A 1 12 ? 11.008  41.453  85.888  1.00 69.78  ? 38  GLN A C   1 
ATOM   85   O  O   . GLN A 1 12 ? 11.174  40.571  85.047  1.00 70.28  ? 38  GLN A O   1 
ATOM   86   C  CB  . GLN A 1 12 ? 13.381  42.417  86.087  1.00 70.32  ? 38  GLN A CB  1 
ATOM   87   C  CG  . GLN A 1 12 ? 13.703  41.228  86.979  1.00 73.30  ? 38  GLN A CG  1 
ATOM   88   C  CD  . GLN A 1 12 ? 15.209  41.022  87.219  1.00 73.60  ? 38  GLN A CD  1 
ATOM   89   O  OE1 . GLN A 1 12 ? 15.840  41.772  87.957  1.00 76.28  ? 38  GLN A OE1 1 
ATOM   90   N  NE2 . GLN A 1 12 ? 15.776  39.994  86.601  1.00 73.36  ? 38  GLN A NE2 1 
ATOM   91   N  N   . VAL A 1 13 ? 10.077  41.394  86.838  1.00 68.73  ? 39  VAL A N   1 
ATOM   92   C  CA  . VAL A 1 13 ? 9.141   40.283  86.990  1.00 68.66  ? 39  VAL A CA  1 
ATOM   93   C  C   . VAL A 1 13 ? 7.887   40.596  86.184  1.00 68.76  ? 39  VAL A C   1 
ATOM   94   O  O   . VAL A 1 13 ? 7.323   39.707  85.531  1.00 68.81  ? 39  VAL A O   1 
ATOM   95   C  CB  . VAL A 1 13 ? 8.717   40.059  88.480  1.00 68.50  ? 39  VAL A CB  1 
ATOM   96   C  CG1 . VAL A 1 13 ? 7.360   39.365  88.556  1.00 66.30  ? 39  VAL A CG1 1 
ATOM   97   C  CG2 . VAL A 1 13 ? 9.753   39.212  89.199  1.00 69.38  ? 39  VAL A CG2 1 
ATOM   98   N  N   . ASP A 1 14 ? 7.451   41.850  86.232  1.00 68.19  ? 40  ASP A N   1 
ATOM   99   C  CA  . ASP A 1 14 ? 6.259   42.264  85.487  1.00 67.74  ? 40  ASP A CA  1 
ATOM   100  C  C   . ASP A 1 14 ? 6.500   42.146  83.982  1.00 65.84  ? 40  ASP A C   1 
ATOM   101  O  O   . ASP A 1 14 ? 5.572   41.898  83.219  1.00 64.74  ? 40  ASP A O   1 
ATOM   102  C  CB  . ASP A 1 14 ? 5.886   43.697  85.834  1.00 69.01  ? 40  ASP A CB  1 
ATOM   103  C  CG  . ASP A 1 14 ? 5.808   43.938  87.328  1.00 71.55  ? 40  ASP A CG  1 
ATOM   104  O  OD1 . ASP A 1 14 ? 5.134   43.148  88.030  1.00 72.88  ? 40  ASP A OD1 1 
ATOM   105  O  OD2 . ASP A 1 14 ? 6.413   44.929  87.802  1.00 74.67  ? 40  ASP A OD2 1 
ATOM   106  N  N   . GLU A 1 15 ? 7.748   42.318  83.563  1.00 64.49  ? 41  GLU A N   1 
ATOM   107  C  CA  . GLU A 1 15 ? 8.085   42.214  82.159  1.00 64.81  ? 41  GLU A CA  1 
ATOM   108  C  C   . GLU A 1 15 ? 7.996   40.761  81.710  1.00 64.03  ? 41  GLU A C   1 
ATOM   109  O  O   . GLU A 1 15 ? 7.331   40.453  80.708  1.00 64.12  ? 41  GLU A O   1 
ATOM   110  C  CB  . GLU A 1 15 ? 9.497   42.727  81.889  1.00 67.08  ? 41  GLU A CB  1 
ATOM   111  C  CG  . GLU A 1 15 ? 9.885   42.612  80.422  1.00 71.46  ? 41  GLU A CG  1 
ATOM   112  C  CD  . GLU A 1 15 ? 11.380  42.677  80.202  1.00 74.72  ? 41  GLU A CD  1 
ATOM   113  O  OE1 . GLU A 1 15 ? 12.113  42.263  81.124  1.00 75.87  ? 41  GLU A OE1 1 
ATOM   114  O  OE2 . GLU A 1 15 ? 11.825  43.111  79.107  1.00 75.54  ? 41  GLU A OE2 1 
ATOM   115  N  N   . VAL A 1 16 ? 8.668   39.876  82.450  1.00 62.27  ? 42  VAL A N   1 
ATOM   116  C  CA  . VAL A 1 16 ? 8.665   38.459  82.110  1.00 61.48  ? 42  VAL A CA  1 
ATOM   117  C  C   . VAL A 1 16 ? 7.239   37.925  82.187  1.00 60.87  ? 42  VAL A C   1 
ATOM   118  O  O   . VAL A 1 16 ? 6.912   36.917  81.567  1.00 60.00  ? 42  VAL A O   1 
ATOM   119  C  CB  . VAL A 1 16 ? 9.589   37.637  83.029  1.00 61.19  ? 42  VAL A CB  1 
ATOM   120  C  CG1 . VAL A 1 16 ? 9.692   36.198  82.508  1.00 61.50  ? 42  VAL A CG1 1 
ATOM   121  C  CG2 . VAL A 1 16 ? 10.972  38.260  83.070  1.00 60.11  ? 42  VAL A CG2 1 
ATOM   122  N  N   . VAL A 1 17 ? 6.386   38.626  82.929  1.00 60.36  ? 43  VAL A N   1 
ATOM   123  C  CA  . VAL A 1 17 ? 4.991   38.234  83.051  1.00 59.19  ? 43  VAL A CA  1 
ATOM   124  C  C   . VAL A 1 17 ? 4.268   38.671  81.784  1.00 60.44  ? 43  VAL A C   1 
ATOM   125  O  O   . VAL A 1 17 ? 3.439   37.936  81.238  1.00 59.39  ? 43  VAL A O   1 
ATOM   126  C  CB  . VAL A 1 17 ? 4.333   38.895  84.269  1.00 59.71  ? 43  VAL A CB  1 
ATOM   127  C  CG1 . VAL A 1 17 ? 2.800   38.731  84.214  1.00 58.58  ? 43  VAL A CG1 1 
ATOM   128  C  CG2 . VAL A 1 17 ? 4.883   38.259  85.539  1.00 57.98  ? 43  VAL A CG2 1 
ATOM   129  N  N   . ASP A 1 18 ? 4.598   39.867  81.307  1.00 60.26  ? 44  ASP A N   1 
ATOM   130  C  CA  . ASP A 1 18 ? 3.969   40.376  80.097  1.00 59.76  ? 44  ASP A CA  1 
ATOM   131  C  C   . ASP A 1 18 ? 4.362   39.522  78.901  1.00 58.86  ? 44  ASP A C   1 
ATOM   132  O  O   . ASP A 1 18 ? 3.519   39.182  78.076  1.00 59.76  ? 44  ASP A O   1 
ATOM   133  C  CB  . ASP A 1 18 ? 4.363   41.839  79.849  1.00 62.12  ? 44  ASP A CB  1 
ATOM   134  C  CG  . ASP A 1 18 ? 3.632   42.814  80.780  1.00 64.60  ? 44  ASP A CG  1 
ATOM   135  O  OD1 . ASP A 1 18 ? 2.583   42.426  81.356  1.00 67.26  ? 44  ASP A OD1 1 
ATOM   136  O  OD2 . ASP A 1 18 ? 4.099   43.967  80.925  1.00 64.35  ? 44  ASP A OD2 1 
ATOM   137  N  N   . ILE A 1 19 ? 5.647   39.187  78.811  1.00 56.69  ? 45  ILE A N   1 
ATOM   138  C  CA  . ILE A 1 19 ? 6.170   38.353  77.728  1.00 54.37  ? 45  ILE A CA  1 
ATOM   139  C  C   . ILE A 1 19 ? 5.517   36.964  77.733  1.00 54.01  ? 45  ILE A C   1 
ATOM   140  O  O   . ILE A 1 19 ? 5.150   36.441  76.690  1.00 52.74  ? 45  ILE A O   1 
ATOM   141  C  CB  . ILE A 1 19 ? 7.704   38.169  77.867  1.00 53.79  ? 45  ILE A CB  1 
ATOM   142  C  CG1 . ILE A 1 19 ? 8.379   39.541  77.949  1.00 51.69  ? 45  ILE A CG1 1 
ATOM   143  C  CG2 . ILE A 1 19 ? 8.252   37.326  76.712  1.00 49.09  ? 45  ILE A CG2 1 
ATOM   144  C  CD1 . ILE A 1 19 ? 9.885   39.483  78.008  1.00 49.61  ? 45  ILE A CD1 1 
ATOM   145  N  N   . MET A 1 20 ? 5.371   36.382  78.916  1.00 54.65  ? 46  MET A N   1 
ATOM   146  C  CA  . MET A 1 20 ? 4.779   35.054  79.049  1.00 56.99  ? 46  MET A CA  1 
ATOM   147  C  C   . MET A 1 20 ? 3.271   35.014  78.786  1.00 57.37  ? 46  MET A C   1 
ATOM   148  O  O   . MET A 1 20 ? 2.753   33.988  78.342  1.00 57.59  ? 46  MET A O   1 
ATOM   149  C  CB  . MET A 1 20 ? 5.083   34.475  80.435  1.00 53.39  ? 46  MET A CB  1 
ATOM   150  C  CG  . MET A 1 20 ? 6.488   33.942  80.565  1.00 55.26  ? 46  MET A CG  1 
ATOM   151  S  SD  . MET A 1 20 ? 6.711   32.288  79.857  1.00 56.71  ? 46  MET A SD  1 
ATOM   152  C  CE  . MET A 1 20 ? 7.270   32.727  78.429  1.00 55.25  ? 46  MET A CE  1 
ATOM   153  N  N   . ARG A 1 21 ? 2.561   36.108  79.056  1.00 58.22  ? 47  ARG A N   1 
ATOM   154  C  CA  . ARG A 1 21 ? 1.127   36.098  78.801  1.00 58.46  ? 47  ARG A CA  1 
ATOM   155  C  C   . ARG A 1 21 ? 0.906   36.075  77.300  1.00 57.97  ? 47  ARG A C   1 
ATOM   156  O  O   . ARG A 1 21 ? -0.081  35.516  76.820  1.00 57.59  ? 47  ARG A O   1 
ATOM   157  C  CB  . ARG A 1 21 ? 0.436   37.318  79.385  1.00 60.17  ? 47  ARG A CB  1 
ATOM   158  C  CG  . ARG A 1 21 ? -1.045  37.285  79.067  1.00 61.26  ? 47  ARG A CG  1 
ATOM   159  C  CD  . ARG A 1 21 ? -1.781  38.503  79.586  1.00 64.17  ? 47  ARG A CD  1 
ATOM   160  N  NE  . ARG A 1 21 ? -1.834  38.562  81.043  1.00 62.62  ? 47  ARG A NE  1 
ATOM   161  C  CZ  . ARG A 1 21 ? -0.937  39.193  81.786  1.00 65.76  ? 47  ARG A CZ  1 
ATOM   162  N  NH1 . ARG A 1 21 ? 0.085   39.820  81.197  1.00 64.80  ? 47  ARG A NH1 1 
ATOM   163  N  NH2 . ARG A 1 21 ? -1.069  39.208  83.114  1.00 65.72  ? 47  ARG A NH2 1 
ATOM   164  N  N   . VAL A 1 22 ? 1.839   36.694  76.574  1.00 56.58  ? 48  VAL A N   1 
ATOM   165  C  CA  . VAL A 1 22 ? 1.808   36.734  75.111  1.00 56.60  ? 48  VAL A CA  1 
ATOM   166  C  C   . VAL A 1 22 ? 2.142   35.323  74.590  1.00 55.86  ? 48  VAL A C   1 
ATOM   167  O  O   . VAL A 1 22 ? 1.510   34.821  73.656  1.00 54.96  ? 48  VAL A O   1 
ATOM   168  C  CB  . VAL A 1 22 ? 2.859   37.760  74.562  1.00 56.52  ? 48  VAL A CB  1 
ATOM   169  C  CG1 . VAL A 1 22 ? 3.226   37.452  73.088  1.00 54.62  ? 48  VAL A CG1 1 
ATOM   170  C  CG2 . VAL A 1 22 ? 2.307   39.179  74.694  1.00 55.54  ? 48  VAL A CG2 1 
ATOM   171  N  N   . ASN A 1 23 ? 3.146   34.700  75.205  1.00 54.97  ? 49  ASN A N   1 
ATOM   172  C  CA  . ASN A 1 23 ? 3.563   33.359  74.836  1.00 54.27  ? 49  ASN A CA  1 
ATOM   173  C  C   . ASN A 1 23 ? 2.412   32.421  75.086  1.00 54.13  ? 49  ASN A C   1 
ATOM   174  O  O   . ASN A 1 23 ? 2.120   31.571  74.253  1.00 54.72  ? 49  ASN A O   1 
ATOM   175  C  CB  . ASN A 1 23 ? 4.796   32.918  75.635  1.00 52.53  ? 49  ASN A CB  1 
ATOM   176  C  CG  . ASN A 1 23 ? 6.071   33.507  75.078  1.00 50.64  ? 49  ASN A CG  1 
ATOM   177  O  OD1 . ASN A 1 23 ? 6.077   34.037  73.981  1.00 53.27  ? 49  ASN A OD1 1 
ATOM   178  N  ND2 . ASN A 1 23 ? 7.148   33.412  75.819  1.00 50.52  ? 49  ASN A ND2 1 
ATOM   179  N  N   . VAL A 1 24 ? 1.732   32.582  76.212  1.00 55.44  ? 50  VAL A N   1 
ATOM   180  C  CA  . VAL A 1 24 ? 0.588   31.708  76.481  1.00 57.97  ? 50  VAL A CA  1 
ATOM   181  C  C   . VAL A 1 24 ? -0.484  31.889  75.390  1.00 57.96  ? 50  VAL A C   1 
ATOM   182  O  O   . VAL A 1 24 ? -1.178  30.936  75.023  1.00 58.07  ? 50  VAL A O   1 
ATOM   183  C  CB  . VAL A 1 24 ? -0.050  31.975  77.878  1.00 57.18  ? 50  VAL A CB  1 
ATOM   184  C  CG1 . VAL A 1 24 ? -1.253  31.033  78.100  1.00 57.39  ? 50  VAL A CG1 1 
ATOM   185  C  CG2 . VAL A 1 24 ? 0.965   31.732  78.965  1.00 55.20  ? 50  VAL A CG2 1 
ATOM   186  N  N   . ASP A 1 25 ? -0.610  33.107  74.867  1.00 58.97  ? 51  ASP A N   1 
ATOM   187  C  CA  . ASP A 1 25 ? -1.594  33.376  73.823  1.00 58.38  ? 51  ASP A CA  1 
ATOM   188  C  C   . ASP A 1 25 ? -1.173  32.707  72.522  1.00 57.18  ? 51  ASP A C   1 
ATOM   189  O  O   . ASP A 1 25 ? -2.015  32.248  71.737  1.00 55.21  ? 51  ASP A O   1 
ATOM   190  C  CB  . ASP A 1 25 ? -1.740  34.877  73.601  1.00 60.91  ? 51  ASP A CB  1 
ATOM   191  C  CG  . ASP A 1 25 ? -2.927  35.215  72.727  1.00 63.77  ? 51  ASP A CG  1 
ATOM   192  O  OD1 . ASP A 1 25 ? -2.742  35.990  71.760  1.00 64.99  ? 51  ASP A OD1 1 
ATOM   193  O  OD2 . ASP A 1 25 ? -4.044  34.703  73.009  1.00 64.32  ? 51  ASP A OD2 1 
ATOM   194  N  N   . LYS A 1 26 ? 0.139   32.654  72.294  1.00 55.30  ? 52  LYS A N   1 
ATOM   195  C  CA  . LYS A 1 26 ? 0.656   32.022  71.101  1.00 53.58  ? 52  LYS A CA  1 
ATOM   196  C  C   . LYS A 1 26 ? 0.523   30.498  71.154  1.00 54.63  ? 52  LYS A C   1 
ATOM   197  O  O   . LYS A 1 26 ? 0.231   29.874  70.137  1.00 54.01  ? 52  LYS A O   1 
ATOM   198  C  CB  . LYS A 1 26 ? 2.115   32.404  70.882  1.00 55.17  ? 52  LYS A CB  1 
ATOM   199  C  CG  . LYS A 1 26 ? 2.315   33.879  70.618  1.00 59.18  ? 52  LYS A CG  1 
ATOM   200  C  CD  . LYS A 1 26 ? 3.691   34.175  70.073  1.00 58.80  ? 52  LYS A CD  1 
ATOM   201  C  CE  . LYS A 1 26 ? 3.906   35.676  69.955  1.00 59.41  ? 52  LYS A CE  1 
ATOM   202  N  NZ  . LYS A 1 26 ? 5.337   36.001  69.653  1.00 56.29  ? 52  LYS A NZ  1 
ATOM   203  N  N   . VAL A 1 27 ? 0.738   29.886  72.320  1.00 53.20  ? 53  VAL A N   1 
ATOM   204  C  CA  . VAL A 1 27 ? 0.616   28.441  72.389  1.00 54.14  ? 53  VAL A CA  1 
ATOM   205  C  C   . VAL A 1 27 ? -0.833  28.025  72.326  1.00 53.89  ? 53  VAL A C   1 
ATOM   206  O  O   . VAL A 1 27 ? -1.127  26.855  72.114  1.00 53.91  ? 53  VAL A O   1 
ATOM   207  C  CB  . VAL A 1 27 ? 1.244   27.824  73.672  1.00 55.59  ? 53  VAL A CB  1 
ATOM   208  C  CG1 . VAL A 1 27 ? 2.703   28.176  73.721  1.00 58.16  ? 53  VAL A CG1 1 
ATOM   209  C  CG2 . VAL A 1 27 ? 0.492   28.283  74.932  1.00 52.34  ? 53  VAL A CG2 1 
ATOM   210  N  N   . LEU A 1 28 ? -1.745  28.962  72.539  1.00 53.22  ? 54  LEU A N   1 
ATOM   211  C  CA  . LEU A 1 28 ? -3.150  28.601  72.441  1.00 54.16  ? 54  LEU A CA  1 
ATOM   212  C  C   . LEU A 1 28 ? -3.503  28.613  70.941  1.00 55.40  ? 54  LEU A C   1 
ATOM   213  O  O   . LEU A 1 28 ? -4.436  27.933  70.500  1.00 55.43  ? 54  LEU A O   1 
ATOM   214  C  CB  . LEU A 1 28 ? -4.015  29.575  73.239  1.00 52.44  ? 54  LEU A CB  1 
ATOM   215  C  CG  . LEU A 1 28 ? -3.872  29.442  74.754  1.00 50.56  ? 54  LEU A CG  1 
ATOM   216  C  CD1 . LEU A 1 28 ? -4.589  30.602  75.444  1.00 49.52  ? 54  LEU A CD1 1 
ATOM   217  C  CD2 . LEU A 1 28 ? -4.450  28.088  75.205  1.00 49.31  ? 54  LEU A CD2 1 
ATOM   218  N  N   . GLU A 1 29 ? -2.748  29.380  70.154  1.00 55.47  ? 55  GLU A N   1 
ATOM   219  C  CA  . GLU A 1 29 ? -2.969  29.392  68.716  1.00 56.40  ? 55  GLU A CA  1 
ATOM   220  C  C   . GLU A 1 29 ? -2.375  28.078  68.191  1.00 54.76  ? 55  GLU A C   1 
ATOM   221  O  O   . GLU A 1 29 ? -2.982  27.381  67.366  1.00 53.80  ? 55  GLU A O   1 
ATOM   222  C  CB  . GLU A 1 29 ? -2.285  30.595  68.071  1.00 60.42  ? 55  GLU A CB  1 
ATOM   223  C  CG  . GLU A 1 29 ? -2.820  31.915  68.606  1.00 70.64  ? 55  GLU A CG  1 
ATOM   224  C  CD  . GLU A 1 29 ? -2.497  33.120  67.721  1.00 76.75  ? 55  GLU A CD  1 
ATOM   225  O  OE1 . GLU A 1 29 ? -1.298  33.345  67.397  1.00 79.13  ? 55  GLU A OE1 1 
ATOM   226  O  OE2 . GLU A 1 29 ? -3.457  33.855  67.364  1.00 81.12  ? 55  GLU A OE2 1 
ATOM   227  N  N   . ARG A 1 30 ? -1.197  27.735  68.710  1.00 51.64  ? 56  ARG A N   1 
ATOM   228  C  CA  . ARG A 1 30 ? -0.528  26.506  68.341  1.00 49.90  ? 56  ARG A CA  1 
ATOM   229  C  C   . ARG A 1 30 ? -1.487  25.348  68.609  1.00 49.74  ? 56  ARG A C   1 
ATOM   230  O  O   . ARG A 1 30 ? -1.608  24.421  67.802  1.00 49.50  ? 56  ARG A O   1 
ATOM   231  C  CB  . ARG A 1 30 ? 0.749   26.329  69.175  1.00 49.71  ? 56  ARG A CB  1 
ATOM   232  C  CG  . ARG A 1 30 ? 1.623   25.135  68.763  1.00 48.53  ? 56  ARG A CG  1 
ATOM   233  C  CD  . ARG A 1 30 ? 2.980   25.128  69.513  1.00 47.86  ? 56  ARG A CD  1 
ATOM   234  N  NE  . ARG A 1 30 ? 3.879   24.056  69.056  1.00 40.64  ? 56  ARG A NE  1 
ATOM   235  C  CZ  . ARG A 1 30 ? 4.020   22.884  69.676  1.00 41.56  ? 56  ARG A CZ  1 
ATOM   236  N  NH1 . ARG A 1 30 ? 3.330   22.622  70.786  1.00 40.94  ? 56  ARG A NH1 1 
ATOM   237  N  NH2 . ARG A 1 30 ? 4.844   21.964  69.187  1.00 39.18  ? 56  ARG A NH2 1 
ATOM   238  N  N   . ASP A 1 31 ? -2.183  25.433  69.738  1.00 49.70  ? 57  ASP A N   1 
ATOM   239  C  CA  . ASP A 1 31 ? -3.129  24.407  70.167  1.00 50.69  ? 57  ASP A CA  1 
ATOM   240  C  C   . ASP A 1 31 ? -4.259  24.196  69.162  1.00 51.67  ? 57  ASP A C   1 
ATOM   241  O  O   . ASP A 1 31 ? -4.619  23.056  68.829  1.00 51.52  ? 57  ASP A O   1 
ATOM   242  C  CB  . ASP A 1 31 ? -3.717  24.790  71.526  1.00 49.83  ? 57  ASP A CB  1 
ATOM   243  C  CG  . ASP A 1 31 ? -4.338  23.612  72.255  1.00 52.80  ? 57  ASP A CG  1 
ATOM   244  O  OD1 . ASP A 1 31 ? -5.494  23.224  71.953  1.00 50.82  ? 57  ASP A OD1 1 
ATOM   245  O  OD2 . ASP A 1 31 ? -3.646  23.055  73.135  1.00 52.54  ? 57  ASP A OD2 1 
ATOM   246  N  N   . GLN A 1 32 ? -4.800  25.295  68.656  1.00 52.06  ? 58  GLN A N   1 
ATOM   247  C  CA  . GLN A 1 32 ? -5.910  25.212  67.725  1.00 52.88  ? 58  GLN A CA  1 
ATOM   248  C  C   . GLN A 1 32 ? -5.433  24.732  66.363  1.00 51.08  ? 58  GLN A C   1 
ATOM   249  O  O   . GLN A 1 32 ? -6.115  23.949  65.696  1.00 49.52  ? 58  GLN A O   1 
ATOM   250  C  CB  . GLN A 1 32 ? -6.569  26.583  67.610  1.00 58.45  ? 58  GLN A CB  1 
ATOM   251  C  CG  . GLN A 1 32 ? -8.051  26.569  67.260  1.00 64.66  ? 58  GLN A CG  1 
ATOM   252  C  CD  . GLN A 1 32 ? -8.635  27.969  67.284  1.00 68.18  ? 58  GLN A CD  1 
ATOM   253  O  OE1 . GLN A 1 32 ? -8.519  28.689  68.286  1.00 71.34  ? 58  GLN A OE1 1 
ATOM   254  N  NE2 . GLN A 1 32 ? -9.257  28.374  66.178  1.00 70.99  ? 58  GLN A NE2 1 
ATOM   255  N  N   . LYS A 1 33 ? -4.260  25.206  65.945  1.00 48.95  ? 59  LYS A N   1 
ATOM   256  C  CA  . LYS A 1 33 ? -3.719  24.785  64.668  1.00 46.01  ? 59  LYS A CA  1 
ATOM   257  C  C   . LYS A 1 33 ? -3.421  23.294  64.707  1.00 43.71  ? 59  LYS A C   1 
ATOM   258  O  O   . LYS A 1 33 ? -3.767  22.575  63.785  1.00 43.02  ? 59  LYS A O   1 
ATOM   259  C  CB  . LYS A 1 33 ? -2.444  25.551  64.331  1.00 48.21  ? 59  LYS A CB  1 
ATOM   260  C  CG  . LYS A 1 33 ? -2.607  27.025  64.012  1.00 48.33  ? 59  LYS A CG  1 
ATOM   261  C  CD  . LYS A 1 33 ? -1.217  27.640  63.824  1.00 51.63  ? 59  LYS A CD  1 
ATOM   262  C  CE  . LYS A 1 33 ? -1.230  29.146  63.857  1.00 50.65  ? 59  LYS A CE  1 
ATOM   263  N  NZ  . LYS A 1 33 ? -1.985  29.634  62.666  1.00 55.69  ? 59  LYS A NZ  1 
ATOM   264  N  N   . LEU A 1 34 ? -2.787  22.824  65.777  1.00 43.54  ? 60  LEU A N   1 
ATOM   265  C  CA  . LEU A 1 34 ? -2.461  21.411  65.885  1.00 43.79  ? 60  LEU A CA  1 
ATOM   266  C  C   . LEU A 1 34 ? -3.725  20.561  65.919  1.00 46.51  ? 60  LEU A C   1 
ATOM   267  O  O   . LEU A 1 34 ? -3.782  19.444  65.374  1.00 45.45  ? 60  LEU A O   1 
ATOM   268  C  CB  . LEU A 1 34 ? -1.604  21.174  67.130  1.00 44.54  ? 60  LEU A CB  1 
ATOM   269  C  CG  . LEU A 1 34 ? -0.118  21.539  66.915  1.00 45.96  ? 60  LEU A CG  1 
ATOM   270  C  CD1 . LEU A 1 34 ? 0.701   21.371  68.206  1.00 41.43  ? 60  LEU A CD1 1 
ATOM   271  C  CD2 . LEU A 1 34 ? 0.438   20.661  65.776  1.00 41.77  ? 60  LEU A CD2 1 
ATOM   272  N  N   . SER A 1 35 ? -4.753  21.104  66.555  1.00 48.34  ? 61  SER A N   1 
ATOM   273  C  CA  . SER A 1 35 ? -6.007  20.393  66.650  1.00 49.12  ? 61  SER A CA  1 
ATOM   274  C  C   . SER A 1 35 ? -6.611  20.222  65.261  1.00 47.31  ? 61  SER A C   1 
ATOM   275  O  O   . SER A 1 35 ? -7.233  19.220  64.936  1.00 45.52  ? 61  SER A O   1 
ATOM   276  C  CB  . SER A 1 35 ? -6.971  21.161  67.532  1.00 49.71  ? 61  SER A CB  1 
ATOM   277  O  OG  . SER A 1 35 ? -8.136  20.398  67.679  1.00 54.11  ? 61  SER A OG  1 
ATOM   278  N  N   . GLU A 1 36 ? -6.403  21.217  64.427  1.00 46.21  ? 62  GLU A N   1 
ATOM   279  C  CA  . GLU A 1 36 ? -6.928  21.151  63.085  1.00 48.62  ? 62  GLU A CA  1 
ATOM   280  C  C   . GLU A 1 36 ? -6.122  20.189  62.205  1.00 47.19  ? 62  GLU A C   1 
ATOM   281  O  O   . GLU A 1 36 ? -6.667  19.496  61.352  1.00 47.17  ? 62  GLU A O   1 
ATOM   282  C  CB  . GLU A 1 36 ? -6.911  22.550  62.491  1.00 49.46  ? 62  GLU A CB  1 
ATOM   283  C  CG  . GLU A 1 36 ? -7.332  22.613  61.043  1.00 56.14  ? 62  GLU A CG  1 
ATOM   284  C  CD  . GLU A 1 36 ? -7.298  24.036  60.506  1.00 60.56  ? 62  GLU A CD  1 
ATOM   285  O  OE1 . GLU A 1 36 ? -7.303  24.182  59.266  1.00 62.32  ? 62  GLU A OE1 1 
ATOM   286  O  OE2 . GLU A 1 36 ? -7.267  25.005  61.318  1.00 64.12  ? 62  GLU A OE2 1 
ATOM   287  N  N   . LEU A 1 37 ? -4.814  20.165  62.428  1.00 47.34  ? 63  LEU A N   1 
ATOM   288  C  CA  . LEU A 1 37 ? -3.899  19.338  61.671  1.00 44.69  ? 63  LEU A CA  1 
ATOM   289  C  C   . LEU A 1 37 ? -4.056  17.881  62.064  1.00 43.88  ? 63  LEU A C   1 
ATOM   290  O  O   . LEU A 1 37 ? -3.875  16.986  61.259  1.00 46.20  ? 63  LEU A O   1 
ATOM   291  C  CB  . LEU A 1 37 ? -2.485  19.824  61.927  1.00 41.99  ? 63  LEU A CB  1 
ATOM   292  C  CG  . LEU A 1 37 ? -1.362  19.001  61.296  1.00 41.09  ? 63  LEU A CG  1 
ATOM   293  C  CD1 . LEU A 1 37 ? -1.622  18.898  59.822  1.00 34.68  ? 63  LEU A CD1 1 
ATOM   294  C  CD2 . LEU A 1 37 ? 0.009   19.670  61.583  1.00 38.02  ? 63  LEU A CD2 1 
ATOM   295  N  N   . ASP A 1 38 ? -4.390  17.648  63.315  1.00 45.27  ? 64  ASP A N   1 
ATOM   296  C  CA  . ASP A 1 38 ? -4.595  16.299  63.806  1.00 47.17  ? 64  ASP A CA  1 
ATOM   297  C  C   . ASP A 1 38 ? -5.828  15.716  63.087  1.00 47.76  ? 64  ASP A C   1 
ATOM   298  O  O   . ASP A 1 38 ? -5.890  14.519  62.801  1.00 48.71  ? 64  ASP A O   1 
ATOM   299  C  CB  . ASP A 1 38 ? -4.803  16.370  65.329  1.00 48.77  ? 64  ASP A CB  1 
ATOM   300  C  CG  . ASP A 1 38 ? -4.970  14.999  65.993  1.00 48.94  ? 64  ASP A CG  1 
ATOM   301  O  OD1 . ASP A 1 38 ? -4.649  13.940  65.407  1.00 50.24  ? 64  ASP A OD1 1 
ATOM   302  O  OD2 . ASP A 1 38 ? -5.418  14.999  67.145  1.00 46.61  ? 64  ASP A OD2 1 
ATOM   303  N  N   . ASP A 1 39 ? -6.804  16.570  62.792  1.00 48.86  ? 65  ASP A N   1 
ATOM   304  C  CA  . ASP A 1 39 ? -8.028  16.155  62.094  1.00 48.16  ? 65  ASP A CA  1 
ATOM   305  C  C   . ASP A 1 39 ? -7.639  15.899  60.631  1.00 47.15  ? 65  ASP A C   1 
ATOM   306  O  O   . ASP A 1 39 ? -7.906  14.832  60.078  1.00 46.03  ? 65  ASP A O   1 
ATOM   307  C  CB  . ASP A 1 39 ? -9.079  17.276  62.209  1.00 50.22  ? 65  ASP A CB  1 
ATOM   308  C  CG  . ASP A 1 39 ? -10.380 16.968  61.465  1.00 54.16  ? 65  ASP A CG  1 
ATOM   309  O  OD1 . ASP A 1 39 ? -11.254 17.856  61.463  1.00 58.72  ? 65  ASP A OD1 1 
ATOM   310  O  OD2 . ASP A 1 39 ? -10.557 15.866  60.885  1.00 55.33  ? 65  ASP A OD2 1 
ATOM   311  N  N   . ARG A 1 40 ? -7.000  16.885  60.010  1.00 46.98  ? 66  ARG A N   1 
ATOM   312  C  CA  . ARG A 1 40 ? -6.536  16.738  58.631  1.00 48.83  ? 66  ARG A CA  1 
ATOM   313  C  C   . ARG A 1 40 ? -5.622  15.515  58.400  1.00 46.57  ? 66  ARG A C   1 
ATOM   314  O  O   . ARG A 1 40 ? -5.782  14.806  57.419  1.00 47.31  ? 66  ARG A O   1 
ATOM   315  C  CB  . ARG A 1 40 ? -5.748  17.968  58.172  1.00 51.49  ? 66  ARG A CB  1 
ATOM   316  C  CG  . ARG A 1 40 ? -6.544  19.197  57.795  1.00 58.28  ? 66  ARG A CG  1 
ATOM   317  C  CD  . ARG A 1 40 ? -5.568  20.305  57.408  1.00 63.81  ? 66  ARG A CD  1 
ATOM   318  N  NE  . ARG A 1 40 ? -6.203  21.613  57.324  1.00 68.77  ? 66  ARG A NE  1 
ATOM   319  C  CZ  . ARG A 1 40 ? -7.042  21.963  56.358  1.00 72.40  ? 66  ARG A CZ  1 
ATOM   320  N  NH1 . ARG A 1 40 ? -7.342  21.094  55.393  1.00 73.83  ? 66  ARG A NH1 1 
ATOM   321  N  NH2 . ARG A 1 40 ? -7.581  23.178  56.360  1.00 74.15  ? 66  ARG A NH2 1 
ATOM   322  N  N   . ALA A 1 41 ? -4.663  15.265  59.277  1.00 44.22  ? 67  ALA A N   1 
ATOM   323  C  CA  . ALA A 1 41 ? -3.772  14.140  59.030  1.00 44.20  ? 67  ALA A CA  1 
ATOM   324  C  C   . ALA A 1 41 ? -4.484  12.824  59.181  1.00 42.38  ? 67  ALA A C   1 
ATOM   325  O  O   . ALA A 1 41 ? -4.092  11.832  58.591  1.00 42.66  ? 67  ALA A O   1 
ATOM   326  C  CB  . ALA A 1 41 ? -2.563  14.189  59.965  1.00 45.92  ? 67  ALA A CB  1 
ATOM   327  N  N   . ASP A 1 42 ? -5.535  12.807  59.984  1.00 44.98  ? 68  ASP A N   1 
ATOM   328  C  CA  . ASP A 1 42 ? -6.287  11.578  60.189  1.00 45.67  ? 68  ASP A CA  1 
ATOM   329  C  C   . ASP A 1 42 ? -7.202  11.302  58.979  1.00 46.79  ? 68  ASP A C   1 
ATOM   330  O  O   . ASP A 1 42 ? -7.400  10.147  58.600  1.00 47.10  ? 68  ASP A O   1 
ATOM   331  C  CB  . ASP A 1 42 ? -7.120  11.689  61.450  1.00 47.81  ? 68  ASP A CB  1 
ATOM   332  C  CG  . ASP A 1 42 ? -7.878  10.432  61.735  1.00 49.49  ? 68  ASP A CG  1 
ATOM   333  O  OD1 . ASP A 1 42 ? -7.297  9.512   62.361  1.00 51.47  ? 68  ASP A OD1 1 
ATOM   334  O  OD2 . ASP A 1 42 ? -9.047  10.359  61.311  1.00 51.15  ? 68  ASP A OD2 1 
ATOM   335  N  N   . ALA A 1 43 ? -7.726  12.360  58.357  1.00 45.56  ? 69  ALA A N   1 
ATOM   336  C  CA  . ALA A 1 43 ? -8.580  12.189  57.189  1.00 47.76  ? 69  ALA A CA  1 
ATOM   337  C  C   . ALA A 1 43 ? -7.688  11.703  56.050  1.00 49.70  ? 69  ALA A C   1 
ATOM   338  O  O   . ALA A 1 43 ? -8.054  10.792  55.285  1.00 49.52  ? 69  ALA A O   1 
ATOM   339  C  CB  . ALA A 1 43 ? -9.254  13.517  56.809  1.00 44.37  ? 69  ALA A CB  1 
ATOM   340  N  N   . LEU A 1 44 ? -6.507  12.325  55.971  1.00 49.47  ? 70  LEU A N   1 
ATOM   341  C  CA  . LEU A 1 44 ? -5.473  12.025  54.980  1.00 48.43  ? 70  LEU A CA  1 
ATOM   342  C  C   . LEU A 1 44 ? -5.056  10.542  55.006  1.00 48.08  ? 70  LEU A C   1 
ATOM   343  O  O   . LEU A 1 44 ? -4.920  9.897   53.990  1.00 47.19  ? 70  LEU A O   1 
ATOM   344  C  CB  . LEU A 1 44 ? -4.253  12.891  55.266  1.00 47.00  ? 70  LEU A CB  1 
ATOM   345  C  CG  . LEU A 1 44 ? -3.195  12.849  54.180  1.00 48.59  ? 70  LEU A CG  1 
ATOM   346  C  CD1 . LEU A 1 44 ? -3.758  13.441  52.905  1.00 44.81  ? 70  LEU A CD1 1 
ATOM   347  C  CD2 . LEU A 1 44 ? -1.961  13.612  54.652  1.00 52.70  ? 70  LEU A CD2 1 
ATOM   348  N  N   . GLN A 1 45 ? -4.853  10.019  56.193  1.00 48.40  ? 71  GLN A N   1 
ATOM   349  C  CA  . GLN A 1 45 ? -4.470  8.643   56.363  1.00 50.99  ? 71  GLN A CA  1 
ATOM   350  C  C   . GLN A 1 45 ? -5.633  7.787   55.894  1.00 51.62  ? 71  GLN A C   1 
ATOM   351  O  O   . GLN A 1 45 ? -5.451  6.739   55.289  1.00 54.43  ? 71  GLN A O   1 
ATOM   352  C  CB  . GLN A 1 45 ? -4.206  8.396   57.846  1.00 50.60  ? 71  GLN A CB  1 
ATOM   353  C  CG  . GLN A 1 45 ? -3.628  7.058   58.182  1.00 55.85  ? 71  GLN A CG  1 
ATOM   354  C  CD  . GLN A 1 45 ? -4.652  5.964   58.312  1.00 57.53  ? 71  GLN A CD  1 
ATOM   355  O  OE1 . GLN A 1 45 ? -5.854  6.172   58.102  1.00 61.10  ? 71  GLN A OE1 1 
ATOM   356  N  NE2 . GLN A 1 45 ? -4.180  4.770   58.664  1.00 57.55  ? 71  GLN A NE2 1 
ATOM   357  N  N   . ALA A 1 46 ? -6.845  8.229   56.193  1.00 51.92  ? 72  ALA A N   1 
ATOM   358  C  CA  . ALA A 1 46 ? -8.030  7.467   55.805  1.00 49.35  ? 72  ALA A CA  1 
ATOM   359  C  C   . ALA A 1 46 ? -8.178  7.512   54.291  1.00 47.91  ? 72  ALA A C   1 
ATOM   360  O  O   . ALA A 1 46 ? -8.436  6.481   53.665  1.00 48.47  ? 72  ALA A O   1 
ATOM   361  C  CB  . ALA A 1 46 ? -9.284  8.034   56.498  1.00 48.04  ? 72  ALA A CB  1 
ATOM   362  N  N   . GLY A 1 47 ? -7.997  8.695   53.701  1.00 45.66  ? 73  GLY A N   1 
ATOM   363  C  CA  . GLY A 1 47 ? -8.114  8.822   52.254  1.00 45.78  ? 73  GLY A CA  1 
ATOM   364  C  C   . GLY A 1 47 ? -7.017  8.120   51.442  1.00 47.28  ? 73  GLY A C   1 
ATOM   365  O  O   . GLY A 1 47 ? -7.266  7.626   50.346  1.00 46.17  ? 73  GLY A O   1 
ATOM   366  N  N   . ALA A 1 48 ? -5.802  8.073   51.985  1.00 46.50  ? 74  ALA A N   1 
ATOM   367  C  CA  . ALA A 1 48 ? -4.675  7.444   51.309  1.00 45.61  ? 74  ALA A CA  1 
ATOM   368  C  C   . ALA A 1 48 ? -4.870  5.941   51.342  1.00 45.47  ? 74  ALA A C   1 
ATOM   369  O  O   . ALA A 1 48 ? -4.517  5.236   50.410  1.00 46.81  ? 74  ALA A O   1 
ATOM   370  C  CB  . ALA A 1 48 ? -3.334  7.834   52.012  1.00 41.93  ? 74  ALA A CB  1 
ATOM   371  N  N   . SER A 1 49 ? -5.435  5.462   52.438  1.00 46.72  ? 75  SER A N   1 
ATOM   372  C  CA  . SER A 1 49 ? -5.697  4.052   52.639  1.00 47.22  ? 75  SER A CA  1 
ATOM   373  C  C   . SER A 1 49 ? -6.646  3.557   51.555  1.00 50.17  ? 75  SER A C   1 
ATOM   374  O  O   . SER A 1 49 ? -6.440  2.527   50.920  1.00 49.84  ? 75  SER A O   1 
ATOM   375  C  CB  . SER A 1 49 ? -6.328  3.879   54.007  1.00 46.82  ? 75  SER A CB  1 
ATOM   376  O  OG  . SER A 1 49 ? -6.296  2.515   54.369  1.00 55.22  ? 75  SER A OG  1 
ATOM   377  N  N   . GLN A 1 50 ? -7.701  4.319   51.334  1.00 53.46  ? 76  GLN A N   1 
ATOM   378  C  CA  . GLN A 1 50 ? -8.682  3.973   50.318  1.00 55.53  ? 76  GLN A CA  1 
ATOM   379  C  C   . GLN A 1 50 ? -8.090  4.050   48.898  1.00 54.89  ? 76  GLN A C   1 
ATOM   380  O  O   . GLN A 1 50 ? -8.403  3.213   48.044  1.00 54.24  ? 76  GLN A O   1 
ATOM   381  C  CB  . GLN A 1 50 ? -9.873  4.912   50.493  1.00 59.28  ? 76  GLN A CB  1 
ATOM   382  C  CG  . GLN A 1 50 ? -10.938 4.854   49.440  1.00 67.26  ? 76  GLN A CG  1 
ATOM   383  C  CD  . GLN A 1 50 ? -12.052 5.848   49.735  1.00 71.61  ? 76  GLN A CD  1 
ATOM   384  O  OE1 . GLN A 1 50 ? -12.919 6.111   48.884  1.00 74.46  ? 76  GLN A OE1 1 
ATOM   385  N  NE2 . GLN A 1 50 ? -12.036 6.408   50.955  1.00 70.37  ? 76  GLN A NE2 1 
ATOM   386  N  N   . PHE A 1 51 ? -7.239  5.047   48.646  1.00 52.16  ? 77  PHE A N   1 
ATOM   387  C  CA  . PHE A 1 51 ? -6.613  5.182   47.334  1.00 51.77  ? 77  PHE A CA  1 
ATOM   388  C  C   . PHE A 1 51 ? -5.734  3.954   47.051  1.00 50.79  ? 77  PHE A C   1 
ATOM   389  O  O   . PHE A 1 51 ? -5.698  3.450   45.937  1.00 50.43  ? 77  PHE A O   1 
ATOM   390  C  CB  . PHE A 1 51 ? -5.760  6.466   47.277  1.00 52.97  ? 77  PHE A CB  1 
ATOM   391  C  CG  . PHE A 1 51 ? -4.970  6.634   45.990  1.00 52.39  ? 77  PHE A CG  1 
ATOM   392  C  CD1 . PHE A 1 51 ? -5.603  6.524   44.739  1.00 50.46  ? 77  PHE A CD1 1 
ATOM   393  C  CD2 . PHE A 1 51 ? -3.599  6.940   46.031  1.00 51.45  ? 77  PHE A CD2 1 
ATOM   394  C  CE1 . PHE A 1 51 ? -4.894  6.708   43.550  1.00 50.43  ? 77  PHE A CE1 1 
ATOM   395  C  CE2 . PHE A 1 51 ? -2.862  7.133   44.837  1.00 49.47  ? 77  PHE A CE2 1 
ATOM   396  C  CZ  . PHE A 1 51 ? -3.512  7.016   43.598  1.00 51.18  ? 77  PHE A CZ  1 
ATOM   397  N  N   . GLU A 1 52 ? -5.051  3.468   48.079  1.00 48.93  ? 78  GLU A N   1 
ATOM   398  C  CA  . GLU A 1 52 ? -4.185  2.311   47.948  1.00 49.78  ? 78  GLU A CA  1 
ATOM   399  C  C   . GLU A 1 52 ? -4.993  1.064   47.605  1.00 50.39  ? 78  GLU A C   1 
ATOM   400  O  O   . GLU A 1 52 ? -4.488  0.156   46.934  1.00 49.72  ? 78  GLU A O   1 
ATOM   401  C  CB  . GLU A 1 52 ? -3.410  2.094   49.253  1.00 49.84  ? 78  GLU A CB  1 
ATOM   402  C  CG  . GLU A 1 52 ? -2.317  1.025   49.214  1.00 53.32  ? 78  GLU A CG  1 
ATOM   403  C  CD  . GLU A 1 52 ? -2.857  -0.378  49.307  1.00 55.54  ? 78  GLU A CD  1 
ATOM   404  O  OE1 . GLU A 1 52 ? -3.972  -0.561  49.838  1.00 60.44  ? 78  GLU A OE1 1 
ATOM   405  O  OE2 . GLU A 1 52 ? -2.159  -1.312  48.864  1.00 59.68  ? 78  GLU A OE2 1 
ATOM   406  N  N   . THR A 1 53 ? -6.237  0.996   48.077  1.00 50.48  ? 79  THR A N   1 
ATOM   407  C  CA  . THR A 1 53 ? -7.070  -0.161  47.757  1.00 50.43  ? 79  THR A CA  1 
ATOM   408  C  C   . THR A 1 53 ? -7.560  -0.041  46.308  1.00 49.64  ? 79  THR A C   1 
ATOM   409  O  O   . THR A 1 53 ? -7.659  -1.047  45.604  1.00 50.00  ? 79  THR A O   1 
ATOM   410  C  CB  . THR A 1 53 ? -8.290  -0.306  48.714  1.00 49.57  ? 79  THR A CB  1 
ATOM   411  O  OG1 . THR A 1 53 ? -7.838  -0.777  49.990  1.00 51.56  ? 79  THR A OG1 1 
ATOM   412  C  CG2 . THR A 1 53 ? -9.306  -1.304  48.157  1.00 47.68  ? 79  THR A CG2 1 
ATOM   413  N  N   . SER A 1 54 ? -7.842  1.180   45.864  1.00 48.71  ? 80  SER A N   1 
ATOM   414  C  CA  . SER A 1 54 ? -8.317  1.399   44.497  1.00 50.20  ? 80  SER A CA  1 
ATOM   415  C  C   . SER A 1 54 ? -7.221  1.077   43.498  1.00 49.63  ? 80  SER A C   1 
ATOM   416  O  O   . SER A 1 54 ? -7.474  0.451   42.470  1.00 50.34  ? 80  SER A O   1 
ATOM   417  C  CB  . SER A 1 54 ? -8.752  2.851   44.293  1.00 51.27  ? 80  SER A CB  1 
ATOM   418  O  OG  . SER A 1 54 ? -9.941  3.121   45.011  1.00 54.95  ? 80  SER A OG  1 
ATOM   419  N  N   . ALA A 1 55 ? -6.009  1.533   43.803  1.00 48.07  ? 81  ALA A N   1 
ATOM   420  C  CA  . ALA A 1 55 ? -4.844  1.283   42.964  1.00 46.20  ? 81  ALA A CA  1 
ATOM   421  C  C   . ALA A 1 55 ? -4.619  -0.226  42.878  1.00 44.73  ? 81  ALA A C   1 
ATOM   422  O  O   . ALA A 1 55 ? -4.406  -0.747  41.814  1.00 46.48  ? 81  ALA A O   1 
ATOM   423  C  CB  . ALA A 1 55 ? -3.596  1.979   43.561  1.00 43.17  ? 81  ALA A CB  1 
ATOM   424  N  N   . ALA A 1 56 ? -4.668  -0.926  44.003  1.00 44.69  ? 82  ALA A N   1 
ATOM   425  C  CA  . ALA A 1 56 ? -4.466  -2.363  43.979  1.00 46.79  ? 82  ALA A CA  1 
ATOM   426  C  C   . ALA A 1 56 ? -5.456  -3.040  43.019  1.00 49.64  ? 82  ALA A C   1 
ATOM   427  O  O   . ALA A 1 56 ? -5.096  -3.982  42.312  1.00 50.84  ? 82  ALA A O   1 
ATOM   428  C  CB  . ALA A 1 56 ? -4.620  -2.941  45.398  1.00 44.54  ? 82  ALA A CB  1 
ATOM   429  N  N   . LYS A 1 57 ? -6.700  -2.557  43.002  1.00 50.67  ? 83  LYS A N   1 
ATOM   430  C  CA  . LYS A 1 57 ? -7.748  -3.112  42.148  1.00 50.65  ? 83  LYS A CA  1 
ATOM   431  C  C   . LYS A 1 57 ? -7.487  -2.766  40.699  1.00 49.13  ? 83  LYS A C   1 
ATOM   432  O  O   . LYS A 1 57 ? -7.630  -3.579  39.790  1.00 48.80  ? 83  LYS A O   1 
ATOM   433  C  CB  . LYS A 1 57 ? -9.115  -2.557  42.567  1.00 52.26  ? 83  LYS A CB  1 
ATOM   434  C  CG  . LYS A 1 57 ? -9.705  -3.235  43.806  1.00 53.40  ? 83  LYS A CG  1 
ATOM   435  C  CD  . LYS A 1 57 ? -10.978 -2.525  44.302  1.00 54.60  ? 83  LYS A CD  1 
ATOM   436  C  CE  . LYS A 1 57 ? -11.560 -3.259  45.508  1.00 56.49  ? 83  LYS A CE  1 
ATOM   437  N  NZ  . LYS A 1 57 ? -12.416 -2.399  46.372  1.00 60.01  ? 83  LYS A NZ  1 
ATOM   438  N  N   . LEU A 1 58 ? -7.098  -1.530  40.499  1.00 47.87  ? 84  LEU A N   1 
ATOM   439  C  CA  . LEU A 1 58 ? -6.806  -1.037  39.186  1.00 48.66  ? 84  LEU A CA  1 
ATOM   440  C  C   . LEU A 1 58 ? -5.644  -1.845  38.579  1.00 48.60  ? 84  LEU A C   1 
ATOM   441  O  O   . LEU A 1 58 ? -5.681  -2.204  37.411  1.00 49.23  ? 84  LEU A O   1 
ATOM   442  C  CB  . LEU A 1 58 ? -6.457  0.439   39.325  1.00 49.85  ? 84  LEU A CB  1 
ATOM   443  C  CG  . LEU A 1 58 ? -6.446  1.380   38.123  1.00 54.33  ? 84  LEU A CG  1 
ATOM   444  C  CD1 . LEU A 1 58 ? -7.836  1.478   37.462  1.00 53.76  ? 84  LEU A CD1 1 
ATOM   445  C  CD2 . LEU A 1 58 ? -5.988  2.744   38.641  1.00 54.48  ? 84  LEU A CD2 1 
ATOM   446  N  N   . LYS A 1 59 ? -4.622  -2.151  39.373  1.00 47.75  ? 85  LYS A N   1 
ATOM   447  C  CA  . LYS A 1 59 ? -3.481  -2.887  38.854  1.00 49.00  ? 85  LYS A CA  1 
ATOM   448  C  C   . LYS A 1 59 ? -3.889  -4.289  38.475  1.00 48.78  ? 85  LYS A C   1 
ATOM   449  O  O   . LYS A 1 59 ? -3.355  -4.840  37.527  1.00 47.48  ? 85  LYS A O   1 
ATOM   450  C  CB  . LYS A 1 59 ? -2.333  -2.933  39.870  1.00 50.68  ? 85  LYS A CB  1 
ATOM   451  C  CG  . LYS A 1 59 ? -1.771  -1.569  40.281  1.00 52.34  ? 85  LYS A CG  1 
ATOM   452  C  CD  . LYS A 1 59 ? -0.794  -1.761  41.424  1.00 52.84  ? 85  LYS A CD  1 
ATOM   453  C  CE  . LYS A 1 59 ? -0.425  -0.452  42.092  1.00 53.28  ? 85  LYS A CE  1 
ATOM   454  N  NZ  . LYS A 1 59 ? 0.243   -0.737  43.396  1.00 53.72  ? 85  LYS A NZ  1 
ATOM   455  N  N   . ARG A 1 60 ? -4.814  -4.887  39.223  1.00 48.68  ? 86  ARG A N   1 
ATOM   456  C  CA  . ARG A 1 60 ? -5.281  -6.218  38.856  1.00 47.54  ? 86  ARG A CA  1 
ATOM   457  C  C   . ARG A 1 60 ? -6.105  -6.102  37.568  1.00 47.88  ? 86  ARG A C   1 
ATOM   458  O  O   . ARG A 1 60 ? -5.981  -6.931  36.660  1.00 44.94  ? 86  ARG A O   1 
ATOM   459  C  CB  . ARG A 1 60 ? -6.127  -6.843  39.964  1.00 48.35  ? 86  ARG A CB  1 
ATOM   460  C  CG  . ARG A 1 60 ? -5.377  -6.959  41.270  1.00 52.97  ? 86  ARG A CG  1 
ATOM   461  C  CD  . ARG A 1 60 ? -6.111  -7.825  42.272  1.00 58.60  ? 86  ARG A CD  1 
ATOM   462  N  NE  . ARG A 1 60 ? -7.498  -7.409  42.449  1.00 60.66  ? 86  ARG A NE  1 
ATOM   463  C  CZ  . ARG A 1 60 ? -8.021  -7.049  43.618  1.00 62.16  ? 86  ARG A CZ  1 
ATOM   464  N  NH1 . ARG A 1 60 ? -7.260  -7.056  44.717  1.00 58.04  ? 86  ARG A NH1 1 
ATOM   465  N  NH2 . ARG A 1 60 ? -9.306  -6.691  43.681  1.00 62.73  ? 86  ARG A NH2 1 
ATOM   466  N  N   . LYS A 1 61 ? -6.918  -5.058  37.456  1.00 47.78  ? 87  LYS A N   1 
ATOM   467  C  CA  . LYS A 1 61 ? -7.711  -4.934  36.254  1.00 50.42  ? 87  LYS A CA  1 
ATOM   468  C  C   . LYS A 1 61 ? -6.865  -4.764  34.993  1.00 50.82  ? 87  LYS A C   1 
ATOM   469  O  O   . LYS A 1 61 ? -7.103  -5.432  33.999  1.00 51.60  ? 87  LYS A O   1 
ATOM   470  C  CB  . LYS A 1 61 ? -8.706  -3.789  36.359  1.00 52.22  ? 87  LYS A CB  1 
ATOM   471  C  CG  . LYS A 1 61 ? -9.491  -3.649  35.067  1.00 56.59  ? 87  LYS A CG  1 
ATOM   472  C  CD  . LYS A 1 61 ? -10.801 -2.918  35.259  1.00 60.31  ? 87  LYS A CD  1 
ATOM   473  C  CE  . LYS A 1 61 ? -11.297 -2.415  33.911  1.00 63.35  ? 87  LYS A CE  1 
ATOM   474  N  NZ  . LYS A 1 61 ? -12.653 -1.819  33.985  1.00 65.55  ? 87  LYS A NZ  1 
ATOM   475  N  N   . TYR A 1 62 ? -5.895  -3.860  35.028  1.00 51.56  ? 88  TYR A N   1 
ATOM   476  C  CA  . TYR A 1 62 ? -5.004  -3.625  33.884  1.00 52.29  ? 88  TYR A CA  1 
ATOM   477  C  C   . TYR A 1 62 ? -3.670  -4.289  34.222  1.00 49.93  ? 88  TYR A C   1 
ATOM   478  O  O   . TYR A 1 62 ? -2.650  -3.617  34.322  1.00 47.12  ? 88  TYR A O   1 
ATOM   479  C  CB  . TYR A 1 62 ? -4.785  -2.117  33.665  1.00 56.99  ? 88  TYR A CB  1 
ATOM   480  C  CG  . TYR A 1 62 ? -6.063  -1.364  33.383  1.00 62.52  ? 88  TYR A CG  1 
ATOM   481  C  CD1 . TYR A 1 62 ? -6.952  -1.054  34.415  1.00 64.80  ? 88  TYR A CD1 1 
ATOM   482  C  CD2 . TYR A 1 62 ? -6.432  -1.039  32.074  1.00 65.74  ? 88  TYR A CD2 1 
ATOM   483  C  CE1 . TYR A 1 62 ? -8.189  -0.448  34.156  1.00 67.82  ? 88  TYR A CE1 1 
ATOM   484  C  CE2 . TYR A 1 62 ? -7.671  -0.431  31.796  1.00 69.06  ? 88  TYR A CE2 1 
ATOM   485  C  CZ  . TYR A 1 62 ? -8.548  -0.141  32.847  1.00 70.02  ? 88  TYR A CZ  1 
ATOM   486  O  OH  . TYR A 1 62 ? -9.785  0.427   32.592  1.00 71.57  ? 88  TYR A OH  1 
ATOM   487  N  N   . TRP A 1 63 ? -3.702  -5.611  34.385  1.00 47.89  ? 89  TRP A N   1 
ATOM   488  C  CA  . TRP A 1 63 ? -2.535  -6.396  34.769  1.00 49.54  ? 89  TRP A CA  1 
ATOM   489  C  C   . TRP A 1 63 ? -1.398  -6.451  33.761  1.00 50.90  ? 89  TRP A C   1 
ATOM   490  O  O   . TRP A 1 63 ? -0.332  -7.008  34.067  1.00 53.11  ? 89  TRP A O   1 
ATOM   491  C  CB  . TRP A 1 63 ? -2.961  -7.827  35.116  1.00 45.09  ? 89  TRP A CB  1 
ATOM   492  C  CG  . TRP A 1 63 ? -3.838  -8.417  34.070  1.00 47.96  ? 89  TRP A CG  1 
ATOM   493  C  CD1 . TRP A 1 63 ? -5.198  -8.298  33.979  1.00 47.85  ? 89  TRP A CD1 1 
ATOM   494  C  CD2 . TRP A 1 63 ? -3.425  -9.184  32.921  1.00 49.90  ? 89  TRP A CD2 1 
ATOM   495  N  NE1 . TRP A 1 63 ? -5.662  -8.939  32.851  1.00 49.62  ? 89  TRP A NE1 1 
ATOM   496  C  CE2 . TRP A 1 63 ? -4.600  -9.490  32.179  1.00 50.25  ? 89  TRP A CE2 1 
ATOM   497  C  CE3 . TRP A 1 63 ? -2.182  -9.644  32.444  1.00 47.72  ? 89  TRP A CE3 1 
ATOM   498  C  CZ2 . TRP A 1 63 ? -4.564  -10.234 30.982  1.00 47.38  ? 89  TRP A CZ2 1 
ATOM   499  C  CZ3 . TRP A 1 63 ? -2.150  -10.387 31.252  1.00 46.54  ? 89  TRP A CZ3 1 
ATOM   500  C  CH2 . TRP A 1 63 ? -3.333  -10.671 30.541  1.00 46.03  ? 89  TRP A CH2 1 
ATOM   501  N  N   . TRP A 1 64 ? -1.614  -5.904  32.568  1.00 51.26  ? 90  TRP A N   1 
ATOM   502  C  CA  . TRP A 1 64 ? -0.581  -5.908  31.538  1.00 52.48  ? 90  TRP A CA  1 
ATOM   503  C  C   . TRP A 1 64 ? 0.141   -4.578  31.463  1.00 54.65  ? 90  TRP A C   1 
ATOM   504  O  O   . TRP A 1 64 ? 1.026   -4.389  30.633  1.00 56.45  ? 90  TRP A O   1 
ATOM   505  C  CB  . TRP A 1 64 ? -1.183  -6.237  30.184  1.00 49.05  ? 90  TRP A CB  1 
ATOM   506  C  CG  . TRP A 1 64 ? -2.239  -5.280  29.764  1.00 48.29  ? 90  TRP A CG  1 
ATOM   507  C  CD1 . TRP A 1 64 ? -2.075  -4.148  29.011  1.00 45.64  ? 90  TRP A CD1 1 
ATOM   508  C  CD2 . TRP A 1 64 ? -3.634  -5.364  30.068  1.00 45.53  ? 90  TRP A CD2 1 
ATOM   509  N  NE1 . TRP A 1 64 ? -3.278  -3.530  28.829  1.00 44.37  ? 90  TRP A NE1 1 
ATOM   510  C  CE2 . TRP A 1 64 ? -4.259  -4.255  29.461  1.00 46.66  ? 90  TRP A CE2 1 
ATOM   511  C  CE3 . TRP A 1 64 ? -4.423  -6.275  30.795  1.00 45.18  ? 90  TRP A CE3 1 
ATOM   512  C  CZ2 . TRP A 1 64 ? -5.647  -4.027  29.550  1.00 47.21  ? 90  TRP A CZ2 1 
ATOM   513  C  CZ3 . TRP A 1 64 ? -5.798  -6.055  30.889  1.00 43.77  ? 90  TRP A CZ3 1 
ATOM   514  C  CH2 . TRP A 1 64 ? -6.397  -4.938  30.268  1.00 46.05  ? 90  TRP A CH2 1 
ATOM   515  N  N   . LYS A 1 65 ? -0.261  -3.655  32.329  1.00 57.15  ? 91  LYS A N   1 
ATOM   516  C  CA  . LYS A 1 65 ? 0.359   -2.342  32.415  1.00 59.90  ? 91  LYS A CA  1 
ATOM   517  C  C   . LYS A 1 65 ? 1.352   -2.360  33.566  1.00 62.60  ? 91  LYS A C   1 
ATOM   518  O  O   . LYS A 1 65 ? 1.055   -2.848  34.660  1.00 61.92  ? 91  LYS A O   1 
ATOM   519  C  CB  . LYS A 1 65 ? -0.691  -1.259  32.681  1.00 59.69  ? 91  LYS A CB  1 
ATOM   520  C  CG  . LYS A 1 65 ? -1.594  -0.941  31.510  1.00 58.08  ? 91  LYS A CG  1 
ATOM   521  C  CD  . LYS A 1 65 ? -0.770  -0.536  30.312  1.00 58.07  ? 91  LYS A CD  1 
ATOM   522  C  CE  . LYS A 1 65 ? -1.615  -0.105  29.122  1.00 59.49  ? 91  LYS A CE  1 
ATOM   523  N  NZ  . LYS A 1 65 ? -0.725  0.132   27.927  1.00 60.23  ? 91  LYS A NZ  1 
ATOM   524  N  N   . ASN A 1 66 ? 2.542   -1.838  33.311  1.00 67.32  ? 92  ASN A N   1 
ATOM   525  C  CA  . ASN A 1 66 ? 3.574   -1.771  34.337  1.00 71.71  ? 92  ASN A CA  1 
ATOM   526  C  C   . ASN A 1 66 ? 3.291   -0.515  35.164  1.00 73.86  ? 92  ASN A C   1 
ATOM   527  O  O   . ASN A 1 66 ? 3.973   0.520   34.954  1.00 76.08  ? 92  ASN A O   1 
ATOM   528  C  CB  . ASN A 1 66 ? 4.962   -1.691  33.696  1.00 73.92  ? 92  ASN A CB  1 
ATOM   529  C  CG  . ASN A 1 66 ? 5.188   -2.782  32.645  1.00 77.53  ? 92  ASN A CG  1 
ATOM   530  O  OD1 . ASN A 1 66 ? 4.634   -2.726  31.544  1.00 80.76  ? 92  ASN A OD1 1 
ATOM   531  N  ND2 . ASN A 1 66 ? 5.995   -3.781  32.987  1.00 78.03  ? 92  ASN A ND2 1 
ATOM   532  O  OXT . ASN A 1 66 ? 2.352   -0.577  35.995  1.00 75.22  ? 92  ASN A OXT 1 
ATOM   533  N  N   . LEU B 2 4  ? 9.211   50.891  111.973 1.00 102.92 ? 192 LEU B N   1 
ATOM   534  C  CA  . LEU B 2 4  ? 8.015   50.021  111.813 1.00 103.31 ? 192 LEU B CA  1 
ATOM   535  C  C   . LEU B 2 4  ? 7.261   50.381  110.544 1.00 104.19 ? 192 LEU B C   1 
ATOM   536  O  O   . LEU B 2 4  ? 6.596   49.538  109.949 1.00 105.04 ? 192 LEU B O   1 
ATOM   537  C  CB  . LEU B 2 4  ? 7.093   50.163  113.023 1.00 102.70 ? 192 LEU B CB  1 
ATOM   538  C  CG  . LEU B 2 4  ? 5.778   49.379  112.993 1.00 102.80 ? 192 LEU B CG  1 
ATOM   539  C  CD1 . LEU B 2 4  ? 6.019   47.946  112.562 1.00 102.85 ? 192 LEU B CD1 1 
ATOM   540  C  CD2 . LEU B 2 4  ? 5.142   49.414  114.368 1.00 102.64 ? 192 LEU B CD2 1 
ATOM   541  N  N   . SER B 2 5  ? 7.362   51.641  110.137 1.00 104.59 ? 193 SER B N   1 
ATOM   542  C  CA  . SER B 2 5  ? 6.701   52.109  108.925 1.00 104.02 ? 193 SER B CA  1 
ATOM   543  C  C   . SER B 2 5  ? 7.474   51.539  107.750 1.00 103.53 ? 193 SER B C   1 
ATOM   544  O  O   . SER B 2 5  ? 6.897   50.892  106.881 1.00 103.60 ? 193 SER B O   1 
ATOM   545  C  CB  . SER B 2 5  ? 6.713   53.639  108.871 1.00 104.37 ? 193 SER B CB  1 
ATOM   546  O  OG  . SER B 2 5  ? 6.089   54.118  107.693 1.00 104.43 ? 193 SER B OG  1 
ATOM   547  N  N   . GLU B 2 6  ? 8.781   51.788  107.733 1.00 103.24 ? 194 GLU B N   1 
ATOM   548  C  CA  . GLU B 2 6  ? 9.649   51.272  106.676 1.00 103.50 ? 194 GLU B CA  1 
ATOM   549  C  C   . GLU B 2 6  ? 9.465   49.764  106.639 1.00 102.75 ? 194 GLU B C   1 
ATOM   550  O  O   . GLU B 2 6  ? 9.472   49.153  105.575 1.00 103.10 ? 194 GLU B O   1 
ATOM   551  C  CB  . GLU B 2 6  ? 11.122  51.602  106.968 1.00 103.93 ? 194 GLU B CB  1 
ATOM   552  C  CG  . GLU B 2 6  ? 12.153  50.939  106.036 1.00 104.23 ? 194 GLU B CG  1 
ATOM   553  C  CD  . GLU B 2 6  ? 12.298  49.444  106.265 0.00 104.89 ? 194 GLU B CD  1 
ATOM   554  O  OE1 . GLU B 2 6  ? 12.638  49.043  107.398 0.00 105.13 ? 194 GLU B OE1 1 
ATOM   555  O  OE2 . GLU B 2 6  ? 12.075  48.671  105.309 0.00 105.13 ? 194 GLU B OE2 1 
ATOM   556  N  N   . ILE B 2 7  ? 9.297   49.174  107.813 1.00 101.29 ? 195 ILE B N   1 
ATOM   557  C  CA  . ILE B 2 7  ? 9.113   47.744  107.912 1.00 100.49 ? 195 ILE B CA  1 
ATOM   558  C  C   . ILE B 2 7  ? 7.704   47.356  107.482 1.00 99.86  ? 195 ILE B C   1 
ATOM   559  O  O   . ILE B 2 7  ? 7.498   46.328  106.846 1.00 100.25 ? 195 ILE B O   1 
ATOM   560  C  CB  . ILE B 2 7  ? 9.374   47.270  109.353 1.00 100.84 ? 195 ILE B CB  1 
ATOM   561  C  CG1 . ILE B 2 7  ? 10.817  47.606  109.732 1.00 101.24 ? 195 ILE B CG1 1 
ATOM   562  C  CG2 . ILE B 2 7  ? 9.109   45.773  109.483 1.00 99.47  ? 195 ILE B CG2 1 
ATOM   563  C  CD1 . ILE B 2 7  ? 11.217  47.133  111.103 1.00 102.14 ? 195 ILE B CD1 1 
ATOM   564  N  N   . GLU B 2 8  ? 6.735   48.193  107.811 1.00 98.61  ? 196 GLU B N   1 
ATOM   565  C  CA  . GLU B 2 8  ? 5.356   47.907  107.461 1.00 97.59  ? 196 GLU B CA  1 
ATOM   566  C  C   . GLU B 2 8  ? 5.181   47.858  105.941 1.00 96.68  ? 196 GLU B C   1 
ATOM   567  O  O   . GLU B 2 8  ? 4.616   46.906  105.396 1.00 96.02  ? 196 GLU B O   1 
ATOM   568  C  CB  . GLU B 2 8  ? 4.454   48.988  108.049 1.00 98.93  ? 196 GLU B CB  1 
ATOM   569  C  CG  . GLU B 2 8  ? 3.009   48.577  108.246 1.00 100.38 ? 196 GLU B CG  1 
ATOM   570  C  CD  . GLU B 2 8  ? 2.828   47.622  109.403 1.00 100.86 ? 196 GLU B CD  1 
ATOM   571  O  OE1 . GLU B 2 8  ? 3.297   47.935  110.518 1.00 100.83 ? 196 GLU B OE1 1 
ATOM   572  O  OE2 . GLU B 2 8  ? 2.207   46.561  109.199 1.00 102.17 ? 196 GLU B OE2 1 
ATOM   573  N  N   . THR B 2 9  ? 5.681   48.890  105.266 1.00 95.11  ? 197 THR B N   1 
ATOM   574  C  CA  . THR B 2 9  ? 5.567   49.008  103.815 1.00 93.58  ? 197 THR B CA  1 
ATOM   575  C  C   . THR B 2 9  ? 6.470   48.034  103.073 1.00 92.09  ? 197 THR B C   1 
ATOM   576  O  O   . THR B 2 9  ? 6.031   47.306  102.184 1.00 92.58  ? 197 THR B O   1 
ATOM   577  C  CB  . THR B 2 9  ? 5.907   50.446  103.336 1.00 93.24  ? 197 THR B CB  1 
ATOM   578  O  OG1 . THR B 2 9  ? 7.317   50.662  103.423 1.00 93.28  ? 197 THR B OG1 1 
ATOM   579  C  CG2 . THR B 2 9  ? 5.197   51.478  104.198 1.00 93.52  ? 197 THR B CG2 1 
ATOM   580  N  N   . ARG B 2 10 ? 7.742   48.035  103.436 1.00 90.34  ? 198 ARG B N   1 
ATOM   581  C  CA  . ARG B 2 10 ? 8.699   47.156  102.803 1.00 87.81  ? 198 ARG B CA  1 
ATOM   582  C  C   . ARG B 2 10 ? 8.148   45.750  102.740 1.00 85.40  ? 198 ARG B C   1 
ATOM   583  O  O   . ARG B 2 10 ? 8.356   45.057  101.756 1.00 85.06  ? 198 ARG B O   1 
ATOM   584  C  CB  . ARG B 2 10 ? 9.995   47.134  103.591 1.00 88.32  ? 198 ARG B CB  1 
ATOM   585  C  CG  . ARG B 2 10 ? 11.154  46.672  102.784 1.00 89.86  ? 198 ARG B CG  1 
ATOM   586  C  CD  . ARG B 2 10 ? 11.422  47.675  101.693 1.00 92.24  ? 198 ARG B CD  1 
ATOM   587  N  NE  . ARG B 2 10 ? 12.762  47.497  101.164 1.00 95.65  ? 198 ARG B NE  1 
ATOM   588  C  CZ  . ARG B 2 10 ? 13.863  47.577  101.903 1.00 97.51  ? 198 ARG B CZ  1 
ATOM   589  N  NH1 . ARG B 2 10 ? 13.783  47.836  103.203 1.00 99.28  ? 198 ARG B NH1 1 
ATOM   590  N  NH2 . ARG B 2 10 ? 15.047  47.388  101.344 1.00 98.94  ? 198 ARG B NH2 1 
ATOM   591  N  N   . HIS B 2 11 ? 7.453   45.336  103.796 1.00 82.87  ? 199 HIS B N   1 
ATOM   592  C  CA  . HIS B 2 11 ? 6.877   43.994  103.868 1.00 81.93  ? 199 HIS B CA  1 
ATOM   593  C  C   . HIS B 2 11 ? 5.822   43.782  102.787 1.00 82.10  ? 199 HIS B C   1 
ATOM   594  O  O   . HIS B 2 11 ? 5.743   42.707  102.176 1.00 81.40  ? 199 HIS B O   1 
ATOM   595  C  CB  . HIS B 2 11 ? 6.244   43.754  105.234 1.00 80.13  ? 199 HIS B CB  1 
ATOM   596  C  CG  . HIS B 2 11 ? 5.569   42.425  105.359 1.00 79.54  ? 199 HIS B CG  1 
ATOM   597  N  ND1 . HIS B 2 11 ? 6.265   41.237  105.415 1.00 79.84  ? 199 HIS B ND1 1 
ATOM   598  C  CD2 . HIS B 2 11 ? 4.258   42.093  105.419 1.00 79.68  ? 199 HIS B CD2 1 
ATOM   599  C  CE1 . HIS B 2 11 ? 5.413   40.231  105.505 1.00 78.37  ? 199 HIS B CE1 1 
ATOM   600  N  NE2 . HIS B 2 11 ? 4.188   40.724  105.509 1.00 78.42  ? 199 HIS B NE2 1 
ATOM   601  N  N   . SER B 2 12 ? 5.002   44.806  102.568 1.00 80.70  ? 200 SER B N   1 
ATOM   602  C  CA  . SER B 2 12 ? 3.962   44.739  101.554 1.00 79.58  ? 200 SER B CA  1 
ATOM   603  C  C   . SER B 2 12 ? 4.640   44.607  100.206 1.00 77.51  ? 200 SER B C   1 
ATOM   604  O  O   . SER B 2 12 ? 4.243   43.794  99.380  1.00 78.26  ? 200 SER B O   1 
ATOM   605  C  CB  . SER B 2 12 ? 3.100   46.002  101.580 1.00 79.59  ? 200 SER B CB  1 
ATOM   606  O  OG  . SER B 2 12 ? 2.279   46.025  102.733 1.00 83.00  ? 200 SER B OG  1 
ATOM   607  N  N   . GLU B 2 13 ? 5.663   45.420  99.990  1.00 74.86  ? 201 GLU B N   1 
ATOM   608  C  CA  . GLU B 2 13 ? 6.399   45.371  98.746  1.00 74.02  ? 201 GLU B CA  1 
ATOM   609  C  C   . GLU B 2 13 ? 6.815   43.921  98.500  1.00 71.66  ? 201 GLU B C   1 
ATOM   610  O  O   . GLU B 2 13 ? 6.500   43.342  97.460  1.00 70.46  ? 201 GLU B O   1 
ATOM   611  C  CB  . GLU B 2 13 ? 7.638   46.269  98.832  1.00 78.04  ? 201 GLU B CB  1 
ATOM   612  C  CG  . GLU B 2 13 ? 7.334   47.754  99.122  1.00 83.50  ? 201 GLU B CG  1 
ATOM   613  C  CD  . GLU B 2 13 ? 8.066   48.707  98.163  1.00 86.73  ? 201 GLU B CD  1 
ATOM   614  O  OE1 . GLU B 2 13 ? 9.319   48.701  98.130  1.00 86.61  ? 201 GLU B OE1 1 
ATOM   615  O  OE2 . GLU B 2 13 ? 7.382   49.462  97.433  1.00 89.98  ? 201 GLU B OE2 1 
ATOM   616  N  N   . ILE B 2 14 ? 7.501   43.346  99.489  1.00 68.99  ? 202 ILE B N   1 
ATOM   617  C  CA  . ILE B 2 14 ? 7.994   41.977  99.450  1.00 65.51  ? 202 ILE B CA  1 
ATOM   618  C  C   . ILE B 2 14 ? 6.947   40.965  99.017  1.00 64.87  ? 202 ILE B C   1 
ATOM   619  O  O   . ILE B 2 14 ? 7.224   40.115  98.171  1.00 63.59  ? 202 ILE B O   1 
ATOM   620  C  CB  . ILE B 2 14 ? 8.560   41.562  100.833 1.00 65.71  ? 202 ILE B CB  1 
ATOM   621  C  CG1 . ILE B 2 14 ? 10.030  41.963  100.924 1.00 65.56  ? 202 ILE B CG1 1 
ATOM   622  C  CG2 . ILE B 2 14 ? 8.468   40.053  101.031 1.00 62.59  ? 202 ILE B CG2 1 
ATOM   623  C  CD1 . ILE B 2 14 ? 10.910  41.094  100.060 1.00 64.81  ? 202 ILE B CD1 1 
ATOM   624  N  N   . ILE B 2 15 ? 5.753   41.057  99.600  1.00 63.92  ? 203 ILE B N   1 
ATOM   625  C  CA  . ILE B 2 15 ? 4.653   40.149  99.295  1.00 63.31  ? 203 ILE B CA  1 
ATOM   626  C  C   . ILE B 2 15 ? 4.095   40.454  97.914  1.00 63.95  ? 203 ILE B C   1 
ATOM   627  O  O   . ILE B 2 15 ? 3.717   39.541  97.161  1.00 63.35  ? 203 ILE B O   1 
ATOM   628  C  CB  . ILE B 2 15 ? 3.538   40.286  100.338 1.00 63.90  ? 203 ILE B CB  1 
ATOM   629  C  CG1 . ILE B 2 15 ? 4.085   39.908  101.717 1.00 63.53  ? 203 ILE B CG1 1 
ATOM   630  C  CG2 . ILE B 2 15 ? 2.343   39.445  99.952  1.00 65.02  ? 203 ILE B CG2 1 
ATOM   631  C  CD1 . ILE B 2 15 ? 4.754   38.555  101.784 1.00 64.20  ? 203 ILE B CD1 1 
ATOM   632  N  N   . LYS B 2 16 ? 4.053   41.743  97.585  1.00 62.86  ? 204 LYS B N   1 
ATOM   633  C  CA  . LYS B 2 16 ? 3.569   42.177  96.290  1.00 61.51  ? 204 LYS B CA  1 
ATOM   634  C  C   . LYS B 2 16 ? 4.422   41.443  95.258  1.00 60.80  ? 204 LYS B C   1 
ATOM   635  O  O   . LYS B 2 16 ? 3.900   40.883  94.293  1.00 61.63  ? 204 LYS B O   1 
ATOM   636  C  CB  . LYS B 2 16 ? 3.734   43.697  96.141  1.00 62.74  ? 204 LYS B CB  1 
ATOM   637  C  CG  . LYS B 2 16 ? 3.517   44.231  94.700  1.00 64.92  ? 204 LYS B CG  1 
ATOM   638  C  CD  . LYS B 2 16 ? 3.833   45.739  94.573  1.00 66.50  ? 204 LYS B CD  1 
ATOM   639  C  CE  . LYS B 2 16 ? 2.942   46.560  95.496  0.00 66.16  ? 204 LYS B CE  1 
ATOM   640  N  NZ  . LYS B 2 16 ? 3.242   48.017  95.438  0.00 66.41  ? 204 LYS B NZ  1 
ATOM   641  N  N   . LEU B 2 17 ? 5.734   41.429  95.491  1.00 57.34  ? 205 LEU B N   1 
ATOM   642  C  CA  . LEU B 2 17 ? 6.680   40.783  94.598  1.00 54.47  ? 205 LEU B CA  1 
ATOM   643  C  C   . LEU B 2 17 ? 6.467   39.277  94.542  1.00 53.99  ? 205 LEU B C   1 
ATOM   644  O  O   . LEU B 2 17 ? 6.472   38.677  93.483  1.00 52.68  ? 205 LEU B O   1 
ATOM   645  C  CB  . LEU B 2 17 ? 8.108   41.070  95.051  1.00 53.89  ? 205 LEU B CB  1 
ATOM   646  C  CG  . LEU B 2 17 ? 9.209   40.459  94.173  1.00 55.18  ? 205 LEU B CG  1 
ATOM   647  C  CD1 . LEU B 2 17 ? 9.054   40.972  92.754  1.00 54.02  ? 205 LEU B CD1 1 
ATOM   648  C  CD2 . LEU B 2 17 ? 10.598  40.809  94.727  1.00 52.95  ? 205 LEU B CD2 1 
ATOM   649  N  N   . GLU B 2 18 ? 6.272   38.661  95.693  1.00 54.68  ? 206 GLU B N   1 
ATOM   650  C  CA  . GLU B 2 18 ? 6.071   37.238  95.718  1.00 54.72  ? 206 GLU B CA  1 
ATOM   651  C  C   . GLU B 2 18 ? 4.848   36.895  94.878  1.00 56.17  ? 206 GLU B C   1 
ATOM   652  O  O   . GLU B 2 18 ? 4.912   36.008  94.026  1.00 55.62  ? 206 GLU B O   1 
ATOM   653  C  CB  . GLU B 2 18 ? 5.865   36.761  97.137  1.00 51.61  ? 206 GLU B CB  1 
ATOM   654  C  CG  . GLU B 2 18 ? 5.821   35.266  97.218  1.00 51.80  ? 206 GLU B CG  1 
ATOM   655  C  CD  . GLU B 2 18 ? 5.307   34.776  98.537  1.00 52.46  ? 206 GLU B CD  1 
ATOM   656  O  OE1 . GLU B 2 18 ? 5.504   35.464  99.571  1.00 49.29  ? 206 GLU B OE1 1 
ATOM   657  O  OE2 . GLU B 2 18 ? 4.715   33.679  98.540  1.00 53.38  ? 206 GLU B OE2 1 
ATOM   658  N  N   . ASN B 2 19 ? 3.739   37.603  95.122  1.00 58.95  ? 207 ASN B N   1 
ATOM   659  C  CA  . ASN B 2 19 ? 2.491   37.378  94.376  1.00 60.92  ? 207 ASN B CA  1 
ATOM   660  C  C   . ASN B 2 19 ? 2.687   37.495  92.875  1.00 60.00  ? 207 ASN B C   1 
ATOM   661  O  O   . ASN B 2 19 ? 2.075   36.759  92.099  1.00 59.88  ? 207 ASN B O   1 
ATOM   662  C  CB  . ASN B 2 19 ? 1.414   38.353  94.831  1.00 62.54  ? 207 ASN B CB  1 
ATOM   663  C  CG  . ASN B 2 19 ? 0.911   38.025  96.204  1.00 65.76  ? 207 ASN B CG  1 
ATOM   664  O  OD1 . ASN B 2 19 ? 0.798   36.849  96.558  1.00 69.34  ? 207 ASN B OD1 1 
ATOM   665  N  ND2 . ASN B 2 19 ? 0.592   39.046  96.990  1.00 67.66  ? 207 ASN B ND2 1 
ATOM   666  N  N   . SER B 2 20 ? 3.540   38.430  92.477  1.00 58.42  ? 208 SER B N   1 
ATOM   667  C  CA  . SER B 2 20 ? 3.851   38.625  91.073  1.00 58.63  ? 208 SER B CA  1 
ATOM   668  C  C   . SER B 2 20 ? 4.615   37.405  90.625  1.00 58.52  ? 208 SER B C   1 
ATOM   669  O  O   . SER B 2 20 ? 4.528   36.989  89.472  1.00 58.55  ? 208 SER B O   1 
ATOM   670  C  CB  . SER B 2 20 ? 4.762   39.832  90.868  1.00 58.20  ? 208 SER B CB  1 
ATOM   671  O  OG  . SER B 2 20 ? 4.125   41.027  91.270  1.00 65.28  ? 208 SER B OG  1 
ATOM   672  N  N   . ILE B 2 21 ? 5.389   36.837  91.538  1.00 57.53  ? 209 ILE B N   1 
ATOM   673  C  CA  . ILE B 2 21 ? 6.180   35.686  91.178  1.00 58.14  ? 209 ILE B CA  1 
ATOM   674  C  C   . ILE B 2 21 ? 5.316   34.444  91.130  1.00 57.97  ? 209 ILE B C   1 
ATOM   675  O  O   . ILE B 2 21 ? 5.559   33.558  90.332  1.00 56.94  ? 209 ILE B O   1 
ATOM   676  C  CB  . ILE B 2 21 ? 7.409   35.564  92.108  1.00 57.12  ? 209 ILE B CB  1 
ATOM   677  C  CG1 . ILE B 2 21 ? 8.445   36.603  91.653  1.00 53.37  ? 209 ILE B CG1 1 
ATOM   678  C  CG2 . ILE B 2 21 ? 8.011   34.156  92.038  1.00 56.63  ? 209 ILE B CG2 1 
ATOM   679  C  CD1 . ILE B 2 21 ? 9.688   36.661  92.476  1.00 53.55  ? 209 ILE B CD1 1 
ATOM   680  N  N   . ARG B 2 22 ? 4.279   34.395  91.954  1.00 60.35  ? 210 ARG B N   1 
ATOM   681  C  CA  . ARG B 2 22 ? 3.370   33.257  91.920  1.00 63.46  ? 210 ARG B CA  1 
ATOM   682  C  C   . ARG B 2 22 ? 2.734   33.207  90.547  1.00 62.39  ? 210 ARG B C   1 
ATOM   683  O  O   . ARG B 2 22 ? 2.575   32.137  89.963  1.00 63.37  ? 210 ARG B O   1 
ATOM   684  C  CB  . ARG B 2 22 ? 2.265   33.404  92.956  1.00 65.44  ? 210 ARG B CB  1 
ATOM   685  C  CG  . ARG B 2 22 ? 2.676   32.952  94.319  1.00 71.61  ? 210 ARG B CG  1 
ATOM   686  C  CD  . ARG B 2 22 ? 2.619   31.442  94.437  1.00 77.59  ? 210 ARG B CD  1 
ATOM   687  N  NE  . ARG B 2 22 ? 3.135   30.974  95.728  1.00 80.39  ? 210 ARG B NE  1 
ATOM   688  C  CZ  . ARG B 2 22 ? 2.832   31.522  96.902  1.00 81.78  ? 210 ARG B CZ  1 
ATOM   689  N  NH1 . ARG B 2 22 ? 2.013   32.573  96.964  1.00 82.18  ? 210 ARG B NH1 1 
ATOM   690  N  NH2 . ARG B 2 22 ? 3.338   31.010  98.021  1.00 82.73  ? 210 ARG B NH2 1 
ATOM   691  N  N   . GLU B 2 23 ? 2.366   34.374  90.033  1.00 60.68  ? 211 GLU B N   1 
ATOM   692  C  CA  . GLU B 2 23 ? 1.745   34.432  88.725  1.00 59.19  ? 211 GLU B CA  1 
ATOM   693  C  C   . GLU B 2 23 ? 2.713   33.925  87.647  1.00 57.06  ? 211 GLU B C   1 
ATOM   694  O  O   . GLU B 2 23 ? 2.389   32.994  86.917  1.00 56.79  ? 211 GLU B O   1 
ATOM   695  C  CB  . GLU B 2 23 ? 1.289   35.851  88.422  1.00 59.53  ? 211 GLU B CB  1 
ATOM   696  C  CG  . GLU B 2 23 ? 0.296   35.914  87.278  1.00 66.04  ? 211 GLU B CG  1 
ATOM   697  C  CD  . GLU B 2 23 ? -0.175  37.329  86.994  1.00 67.32  ? 211 GLU B CD  1 
ATOM   698  O  OE1 . GLU B 2 23 ? -0.592  38.000  87.954  1.00 69.71  ? 211 GLU B OE1 1 
ATOM   699  O  OE2 . GLU B 2 23 ? -0.133  37.765  85.821  1.00 69.23  ? 211 GLU B OE2 1 
ATOM   700  N  N   . LEU B 2 24 ? 3.895   34.522  87.540  1.00 54.77  ? 212 LEU B N   1 
ATOM   701  C  CA  . LEU B 2 24 ? 4.865   34.057  86.557  1.00 54.98  ? 212 LEU B CA  1 
ATOM   702  C  C   . LEU B 2 24 ? 5.082   32.527  86.691  1.00 55.61  ? 212 LEU B C   1 
ATOM   703  O  O   . LEU B 2 24 ? 5.189   31.830  85.693  1.00 56.66  ? 212 LEU B O   1 
ATOM   704  C  CB  . LEU B 2 24 ? 6.196   34.781  86.739  1.00 54.75  ? 212 LEU B CB  1 
ATOM   705  C  CG  . LEU B 2 24 ? 7.337   34.427  85.779  1.00 58.26  ? 212 LEU B CG  1 
ATOM   706  C  CD1 . LEU B 2 24 ? 6.980   34.820  84.337  1.00 57.51  ? 212 LEU B CD1 1 
ATOM   707  C  CD2 . LEU B 2 24 ? 8.608   35.167  86.207  1.00 59.06  ? 212 LEU B CD2 1 
ATOM   708  N  N   . HIS B 2 25 ? 5.128   32.004  87.915  1.00 55.15  ? 213 HIS B N   1 
ATOM   709  C  CA  . HIS B 2 25 ? 5.339   30.567  88.110  1.00 54.45  ? 213 HIS B CA  1 
ATOM   710  C  C   . HIS B 2 25 ? 4.201   29.832  87.434  1.00 55.28  ? 213 HIS B C   1 
ATOM   711  O  O   . HIS B 2 25 ? 4.424   28.867  86.704  1.00 55.62  ? 213 HIS B O   1 
ATOM   712  C  CB  . HIS B 2 25 ? 5.388   30.234  89.603  1.00 50.66  ? 213 HIS B CB  1 
ATOM   713  C  CG  . HIS B 2 25 ? 5.460   28.769  89.908  1.00 49.80  ? 213 HIS B CG  1 
ATOM   714  N  ND1 . HIS B 2 25 ? 4.340   28.009  90.188  1.00 50.46  ? 213 HIS B ND1 1 
ATOM   715  C  CD2 . HIS B 2 25 ? 6.523   27.943  90.081  1.00 50.84  ? 213 HIS B CD2 1 
ATOM   716  C  CE1 . HIS B 2 25 ? 4.710   26.786  90.536  1.00 49.18  ? 213 HIS B CE1 1 
ATOM   717  N  NE2 . HIS B 2 25 ? 6.030   26.719  90.479  1.00 51.29  ? 213 HIS B NE2 1 
ATOM   718  N  N   . ASP B 2 26 ? 2.985   30.313  87.683  1.00 55.32  ? 214 ASP B N   1 
ATOM   719  C  CA  . ASP B 2 26 ? 1.777   29.764  87.106  1.00 55.58  ? 214 ASP B CA  1 
ATOM   720  C  C   . ASP B 2 26 ? 1.881   29.583  85.589  1.00 53.21  ? 214 ASP B C   1 
ATOM   721  O  O   . ASP B 2 26 ? 1.627   28.504  85.060  1.00 50.89  ? 214 ASP B O   1 
ATOM   722  C  CB  . ASP B 2 26 ? 0.605   30.693  87.401  1.00 61.63  ? 214 ASP B CB  1 
ATOM   723  C  CG  . ASP B 2 26 ? -0.388  30.089  88.370  1.00 68.42  ? 214 ASP B CG  1 
ATOM   724  O  OD1 . ASP B 2 26 ? -0.911  28.980  88.081  1.00 72.07  ? 214 ASP B OD1 1 
ATOM   725  O  OD2 . ASP B 2 26 ? -0.652  30.726  89.417  1.00 71.08  ? 214 ASP B OD2 1 
ATOM   726  N  N   . MET B 2 27 ? 2.238   30.661  84.903  1.00 52.12  ? 215 MET B N   1 
ATOM   727  C  CA  . MET B 2 27 ? 2.361   30.666  83.453  1.00 51.23  ? 215 MET B CA  1 
ATOM   728  C  C   . MET B 2 27 ? 3.423   29.713  82.955  1.00 50.03  ? 215 MET B C   1 
ATOM   729  O  O   . MET B 2 27 ? 3.228   29.045  81.945  1.00 47.80  ? 215 MET B O   1 
ATOM   730  C  CB  . MET B 2 27 ? 2.661   32.072  82.961  1.00 54.86  ? 215 MET B CB  1 
ATOM   731  C  CG  . MET B 2 27 ? 1.703   33.109  83.478  1.00 55.94  ? 215 MET B CG  1 
ATOM   732  S  SD  . MET B 2 27 ? 2.168   34.692  82.801  1.00 63.57  ? 215 MET B SD  1 
ATOM   733  C  CE  . MET B 2 27 ? 0.631   35.634  83.093  1.00 60.51  ? 215 MET B CE  1 
ATOM   734  N  N   . PHE B 2 28 ? 4.554   29.647  83.645  1.00 47.67  ? 216 PHE B N   1 
ATOM   735  C  CA  . PHE B 2 28 ? 5.574   28.711  83.236  1.00 48.59  ? 216 PHE B CA  1 
ATOM   736  C  C   . PHE B 2 28 ? 5.026   27.276  83.376  1.00 49.25  ? 216 PHE B C   1 
ATOM   737  O  O   . PHE B 2 28 ? 5.229   26.443  82.491  1.00 51.45  ? 216 PHE B O   1 
ATOM   738  C  CB  . PHE B 2 28 ? 6.831   28.897  84.084  1.00 49.33  ? 216 PHE B CB  1 
ATOM   739  C  CG  . PHE B 2 28 ? 7.828   29.840  83.476  1.00 48.36  ? 216 PHE B CG  1 
ATOM   740  C  CD1 . PHE B 2 28 ? 8.654   29.424  82.432  1.00 48.99  ? 216 PHE B CD1 1 
ATOM   741  C  CD2 . PHE B 2 28 ? 7.920   31.159  83.917  1.00 48.87  ? 216 PHE B CD2 1 
ATOM   742  C  CE1 . PHE B 2 28 ? 9.550   30.316  81.832  1.00 48.17  ? 216 PHE B CE1 1 
ATOM   743  C  CE2 . PHE B 2 28 ? 8.824   32.068  83.314  1.00 45.85  ? 216 PHE B CE2 1 
ATOM   744  C  CZ  . PHE B 2 28 ? 9.628   31.650  82.286  1.00 47.27  ? 216 PHE B CZ  1 
ATOM   745  N  N   . MET B 2 29 ? 4.328   26.986  84.468  1.00 47.93  ? 217 MET B N   1 
ATOM   746  C  CA  . MET B 2 29 ? 3.773   25.638  84.670  1.00 50.36  ? 217 MET B CA  1 
ATOM   747  C  C   . MET B 2 29 ? 2.702   25.312  83.619  1.00 51.00  ? 217 MET B C   1 
ATOM   748  O  O   . MET B 2 29 ? 2.744   24.230  83.023  1.00 49.07  ? 217 MET B O   1 
ATOM   749  C  CB  . MET B 2 29 ? 3.174   25.491  86.076  1.00 50.01  ? 217 MET B CB  1 
ATOM   750  C  CG  . MET B 2 29 ? 4.159   25.710  87.219  1.00 51.32  ? 217 MET B CG  1 
ATOM   751  S  SD  . MET B 2 29 ? 5.487   24.470  87.219  1.00 53.65  ? 217 MET B SD  1 
ATOM   752  C  CE  . MET B 2 29 ? 6.917   25.488  87.105  1.00 53.97  ? 217 MET B CE  1 
ATOM   753  N  N   . ASP B 2 30 ? 1.757   26.236  83.395  1.00 50.59  ? 218 ASP B N   1 
ATOM   754  C  CA  . ASP B 2 30 ? 0.704   26.036  82.383  1.00 52.94  ? 218 ASP B CA  1 
ATOM   755  C  C   . ASP B 2 30 ? 1.291   25.935  80.968  1.00 53.07  ? 218 ASP B C   1 
ATOM   756  O  O   . ASP B 2 30 ? 0.827   25.131  80.155  1.00 54.31  ? 218 ASP B O   1 
ATOM   757  C  CB  . ASP B 2 30 ? -0.350  27.167  82.406  1.00 53.83  ? 218 ASP B CB  1 
ATOM   758  C  CG  . ASP B 2 30 ? -1.291  27.089  83.625  1.00 56.35  ? 218 ASP B CG  1 
ATOM   759  O  OD1 . ASP B 2 30 ? -1.562  25.977  84.131  1.00 56.82  ? 218 ASP B OD1 1 
ATOM   760  O  OD2 . ASP B 2 30 ? -1.783  28.150  84.076  1.00 58.60  ? 218 ASP B OD2 1 
ATOM   761  N  N   . MET B 2 31 ? 2.296   26.751  80.659  1.00 52.36  ? 219 MET B N   1 
ATOM   762  C  CA  . MET B 2 31 ? 2.925   26.671  79.341  1.00 52.50  ? 219 MET B CA  1 
ATOM   763  C  C   . MET B 2 31 ? 3.480   25.272  79.110  1.00 50.89  ? 219 MET B C   1 
ATOM   764  O  O   . MET B 2 31 ? 3.314   24.714  78.041  1.00 48.55  ? 219 MET B O   1 
ATOM   765  C  CB  . MET B 2 31 ? 4.087   27.637  79.215  1.00 55.12  ? 219 MET B CB  1 
ATOM   766  C  CG  . MET B 2 31 ? 4.794   27.561  77.850  1.00 59.83  ? 219 MET B CG  1 
ATOM   767  S  SD  . MET B 2 31 ? 3.885   28.361  76.473  1.00 61.25  ? 219 MET B SD  1 
ATOM   768  C  CE  . MET B 2 31 ? 3.088   29.658  77.382  1.00 60.57  ? 219 MET B CE  1 
ATOM   769  N  N   . ALA B 2 32 ? 4.156   24.723  80.120  1.00 51.79  ? 220 ALA B N   1 
ATOM   770  C  CA  . ALA B 2 32 ? 4.751   23.387  80.023  1.00 51.57  ? 220 ALA B CA  1 
ATOM   771  C  C   . ALA B 2 32 ? 3.675   22.307  79.897  1.00 50.99  ? 220 ALA B C   1 
ATOM   772  O  O   . ALA B 2 32 ? 3.833   21.357  79.132  1.00 49.60  ? 220 ALA B O   1 
ATOM   773  C  CB  . ALA B 2 32 ? 5.647   23.114  81.236  1.00 49.98  ? 220 ALA B CB  1 
ATOM   774  N  N   . MET B 2 33 ? 2.583   22.456  80.646  1.00 51.55  ? 221 MET B N   1 
ATOM   775  C  CA  . MET B 2 33 ? 1.484   21.500  80.572  1.00 50.99  ? 221 MET B CA  1 
ATOM   776  C  C   . MET B 2 33 ? 0.850   21.515  79.196  1.00 50.51  ? 221 MET B C   1 
ATOM   777  O  O   . MET B 2 33 ? 0.524   20.458  78.640  1.00 47.39  ? 221 MET B O   1 
ATOM   778  C  CB  . MET B 2 33 ? 0.444   21.806  81.633  1.00 54.31  ? 221 MET B CB  1 
ATOM   779  C  CG  . MET B 2 33 ? 0.851   21.231  82.990  1.00 60.55  ? 221 MET B CG  1 
ATOM   780  S  SD  . MET B 2 33 ? -0.367  21.427  84.293  1.00 66.65  ? 221 MET B SD  1 
ATOM   781  C  CE  . MET B 2 33 ? -0.025  23.126  84.834  1.00 64.11  ? 221 MET B CE  1 
ATOM   782  N  N   . LEU B 2 34 ? 0.719   22.717  78.635  1.00 49.25  ? 222 LEU B N   1 
ATOM   783  C  CA  . LEU B 2 34 ? 0.141   22.895  77.318  1.00 48.73  ? 222 LEU B CA  1 
ATOM   784  C  C   . LEU B 2 34 ? 0.948   22.250  76.191  1.00 48.64  ? 222 LEU B C   1 
ATOM   785  O  O   . LEU B 2 34 ? 0.373   21.578  75.327  1.00 49.24  ? 222 LEU B O   1 
ATOM   786  C  CB  . LEU B 2 34 ? -0.037  24.385  77.054  1.00 51.42  ? 222 LEU B CB  1 
ATOM   787  C  CG  . LEU B 2 34 ? -1.218  25.040  77.779  1.00 52.71  ? 222 LEU B CG  1 
ATOM   788  C  CD1 . LEU B 2 34 ? -0.986  26.548  77.881  1.00 54.69  ? 222 LEU B CD1 1 
ATOM   789  C  CD2 . LEU B 2 34 ? -2.507  24.725  77.028  1.00 50.94  ? 222 LEU B CD2 1 
ATOM   790  N  N   . VAL B 2 35 ? 2.269   22.458  76.192  1.00 47.97  ? 223 VAL B N   1 
ATOM   791  C  CA  . VAL B 2 35 ? 3.171   21.887  75.184  1.00 46.07  ? 223 VAL B CA  1 
ATOM   792  C  C   . VAL B 2 35 ? 3.278   20.361  75.356  1.00 46.18  ? 223 VAL B C   1 
ATOM   793  O  O   . VAL B 2 35 ? 3.469   19.626  74.395  1.00 47.60  ? 223 VAL B O   1 
ATOM   794  C  CB  . VAL B 2 35 ? 4.583   22.575  75.250  1.00 46.74  ? 223 VAL B CB  1 
ATOM   795  C  CG1 . VAL B 2 35 ? 5.617   21.842  74.411  1.00 43.12  ? 223 VAL B CG1 1 
ATOM   796  C  CG2 . VAL B 2 35 ? 4.449   24.011  74.749  1.00 45.55  ? 223 VAL B CG2 1 
ATOM   797  N  N   . GLU B 2 36 ? 3.159   19.863  76.572  1.00 47.43  ? 224 GLU B N   1 
ATOM   798  C  CA  . GLU B 2 36 ? 3.198   18.411  76.729  1.00 49.26  ? 224 GLU B CA  1 
ATOM   799  C  C   . GLU B 2 36 ? 1.885   17.888  76.140  1.00 48.74  ? 224 GLU B C   1 
ATOM   800  O  O   . GLU B 2 36 ? 1.868   16.935  75.392  1.00 51.65  ? 224 GLU B O   1 
ATOM   801  C  CB  . GLU B 2 36 ? 3.304   18.032  78.198  1.00 48.89  ? 224 GLU B CB  1 
ATOM   802  C  CG  . GLU B 2 36 ? 2.940   16.611  78.490  1.00 51.57  ? 224 GLU B CG  1 
ATOM   803  C  CD  . GLU B 2 36 ? 3.262   16.230  79.926  1.00 56.38  ? 224 GLU B CD  1 
ATOM   804  O  OE1 . GLU B 2 36 ? 2.905   16.993  80.855  1.00 60.34  ? 224 GLU B OE1 1 
ATOM   805  O  OE2 . GLU B 2 36 ? 3.875   15.164  80.136  1.00 57.87  ? 224 GLU B OE2 1 
ATOM   806  N  N   . SER B 2 37 ? 0.784   18.534  76.484  1.00 48.14  ? 225 SER B N   1 
ATOM   807  C  CA  . SER B 2 37 ? -0.522  18.160  75.975  1.00 46.91  ? 225 SER B CA  1 
ATOM   808  C  C   . SER B 2 37 ? -0.513  18.222  74.445  1.00 47.12  ? 225 SER B C   1 
ATOM   809  O  O   . SER B 2 37 ? -0.916  17.290  73.765  1.00 46.04  ? 225 SER B O   1 
ATOM   810  C  CB  . SER B 2 37 ? -1.569  19.139  76.524  1.00 46.38  ? 225 SER B CB  1 
ATOM   811  O  OG  . SER B 2 37 ? -2.848  18.914  75.962  1.00 48.88  ? 225 SER B OG  1 
ATOM   812  N  N   . GLN B 2 38 ? -0.049  19.330  73.889  1.00 47.75  ? 226 GLN B N   1 
ATOM   813  C  CA  . GLN B 2 38 ? -0.046  19.448  72.435  1.00 47.39  ? 226 GLN B CA  1 
ATOM   814  C  C   . GLN B 2 38 ? 0.790   18.367  71.774  1.00 48.53  ? 226 GLN B C   1 
ATOM   815  O  O   . GLN B 2 38 ? 0.549   18.013  70.614  1.00 48.22  ? 226 GLN B O   1 
ATOM   816  C  CB  . GLN B 2 38 ? 0.428   20.847  72.022  1.00 44.54  ? 226 GLN B CB  1 
ATOM   817  C  CG  . GLN B 2 38 ? -0.584  21.899  72.425  1.00 43.84  ? 226 GLN B CG  1 
ATOM   818  C  CD  . GLN B 2 38 ? -0.052  23.319  72.363  1.00 43.83  ? 226 GLN B CD  1 
ATOM   819  O  OE1 . GLN B 2 38 ? 0.985   23.601  71.738  1.00 38.36  ? 226 GLN B OE1 1 
ATOM   820  N  NE2 . GLN B 2 38 ? -0.784  24.234  72.985  1.00 41.31  ? 226 GLN B NE2 1 
ATOM   821  N  N   . GLY B 2 39 ? 1.764   17.838  72.520  1.00 49.96  ? 227 GLY B N   1 
ATOM   822  C  CA  . GLY B 2 39 ? 2.626   16.785  72.004  1.00 49.30  ? 227 GLY B CA  1 
ATOM   823  C  C   . GLY B 2 39 ? 1.884   15.486  71.737  1.00 50.51  ? 227 GLY B C   1 
ATOM   824  O  O   . GLY B 2 39 ? 2.367   14.660  70.962  1.00 49.77  ? 227 GLY B O   1 
ATOM   825  N  N   . GLU B 2 40 ? 0.722   15.309  72.382  1.00 50.96  ? 228 GLU B N   1 
ATOM   826  C  CA  . GLU B 2 40 ? -0.117  14.117  72.203  1.00 51.58  ? 228 GLU B CA  1 
ATOM   827  C  C   . GLU B 2 40 ? -0.686  14.105  70.814  1.00 48.13  ? 228 GLU B C   1 
ATOM   828  O  O   . GLU B 2 40 ? -0.786  13.062  70.191  1.00 47.12  ? 228 GLU B O   1 
ATOM   829  C  CB  . GLU B 2 40 ? -1.299  14.109  73.173  1.00 54.19  ? 228 GLU B CB  1 
ATOM   830  C  CG  . GLU B 2 40 ? -0.894  14.196  74.622  1.00 62.25  ? 228 GLU B CG  1 
ATOM   831  C  CD  . GLU B 2 40 ? -0.236  12.930  75.153  1.00 67.27  ? 228 GLU B CD  1 
ATOM   832  O  OE1 . GLU B 2 40 ? 0.600   12.310  74.439  1.00 68.52  ? 228 GLU B OE1 1 
ATOM   833  O  OE2 . GLU B 2 40 ? -0.553  12.571  76.313  1.00 72.57  ? 228 GLU B OE2 1 
ATOM   834  N  N   . MET B 2 41 ? -1.078  15.283  70.351  1.00 46.58  ? 229 MET B N   1 
ATOM   835  C  CA  . MET B 2 41 ? -1.656  15.458  69.019  1.00 47.56  ? 229 MET B CA  1 
ATOM   836  C  C   . MET B 2 41 ? -0.582  15.317  67.939  1.00 48.49  ? 229 MET B C   1 
ATOM   837  O  O   . MET B 2 41 ? -0.796  14.703  66.881  1.00 49.00  ? 229 MET B O   1 
ATOM   838  C  CB  . MET B 2 41 ? -2.293  16.855  68.898  1.00 46.90  ? 229 MET B CB  1 
ATOM   839  C  CG  . MET B 2 41 ? -3.517  17.101  69.776  1.00 45.31  ? 229 MET B CG  1 
ATOM   840  S  SD  . MET B 2 41 ? -4.282  18.695  69.387  1.00 45.71  ? 229 MET B SD  1 
ATOM   841  C  CE  . MET B 2 41 ? -3.278  19.748  70.455  1.00 38.60  ? 229 MET B CE  1 
ATOM   842  N  N   . ILE B 2 42 ? 0.574   15.910  68.212  1.00 47.45  ? 230 ILE B N   1 
ATOM   843  C  CA  . ILE B 2 42 ? 1.655   15.861  67.279  1.00 46.31  ? 230 ILE B CA  1 
ATOM   844  C  C   . ILE B 2 42 ? 2.076   14.434  67.001  1.00 48.14  ? 230 ILE B C   1 
ATOM   845  O  O   . ILE B 2 42 ? 2.326   14.112  65.833  1.00 48.74  ? 230 ILE B O   1 
ATOM   846  C  CB  . ILE B 2 42 ? 2.843   16.715  67.754  1.00 45.86  ? 230 ILE B CB  1 
ATOM   847  C  CG1 . ILE B 2 42 ? 2.455   18.202  67.690  1.00 44.38  ? 230 ILE B CG1 1 
ATOM   848  C  CG2 . ILE B 2 42 ? 4.072   16.450  66.887  1.00 45.13  ? 230 ILE B CG2 1 
ATOM   849  C  CD1 . ILE B 2 42 ? 3.582   19.171  68.133  1.00 44.77  ? 230 ILE B CD1 1 
ATOM   850  N  N   . ASP B 2 43 ? 2.151   13.539  67.989  1.00 48.89  ? 231 ASP B N   1 
ATOM   851  C  CA  . ASP B 2 43 ? 2.567   12.227  67.526  1.00 50.96  ? 231 ASP B CA  1 
ATOM   852  C  C   . ASP B 2 43 ? 1.461   11.384  66.933  1.00 48.93  ? 231 ASP B C   1 
ATOM   853  O  O   . ASP B 2 43 ? 1.720   10.355  66.346  1.00 48.41  ? 231 ASP B O   1 
ATOM   854  C  CB  . ASP B 2 43 ? 3.449   11.442  68.521  1.00 56.92  ? 231 ASP B CB  1 
ATOM   855  C  CG  . ASP B 2 43 ? 2.915   11.398  69.913  1.00 60.20  ? 231 ASP B CG  1 
ATOM   856  O  OD1 . ASP B 2 43 ? 1.718   11.071  70.081  1.00 65.35  ? 231 ASP B OD1 1 
ATOM   857  O  OD2 . ASP B 2 43 ? 3.722   11.658  70.838  1.00 58.28  ? 231 ASP B OD2 1 
ATOM   858  N  N   . ARG B 2 44 ? 0.228   11.858  67.037  1.00 48.52  ? 232 ARG B N   1 
ATOM   859  C  CA  . ARG B 2 44 ? -0.905  11.187  66.403  1.00 47.78  ? 232 ARG B CA  1 
ATOM   860  C  C   . ARG B 2 44 ? -0.834  11.687  64.954  1.00 46.67  ? 232 ARG B C   1 
ATOM   861  O  O   . ARG B 2 44 ? -1.027  10.931  64.015  1.00 46.90  ? 232 ARG B O   1 
ATOM   862  C  CB  . ARG B 2 44 ? -2.207  11.607  67.068  1.00 50.60  ? 232 ARG B CB  1 
ATOM   863  C  CG  . ARG B 2 44 ? -3.450  11.141  66.362  1.00 54.52  ? 232 ARG B CG  1 
ATOM   864  C  CD  . ARG B 2 44 ? -4.716  11.643  67.092  1.00 56.13  ? 232 ARG B CD  1 
ATOM   865  N  NE  . ARG B 2 44 ? -4.646  11.355  68.516  1.00 53.29  ? 232 ARG B NE  1 
ATOM   866  C  CZ  . ARG B 2 44 ? -4.711  12.287  69.464  1.00 54.63  ? 232 ARG B CZ  1 
ATOM   867  N  NH1 . ARG B 2 44 ? -4.862  13.561  69.145  1.00 53.52  ? 232 ARG B NH1 1 
ATOM   868  N  NH2 . ARG B 2 44 ? -4.565  11.960  70.739  1.00 56.33  ? 232 ARG B NH2 1 
ATOM   869  N  N   . ILE B 2 45 ? -0.500  12.961  64.771  1.00 45.38  ? 233 ILE B N   1 
ATOM   870  C  CA  . ILE B 2 45 ? -0.346  13.532  63.426  1.00 44.21  ? 233 ILE B CA  1 
ATOM   871  C  C   . ILE B 2 45 ? 0.806   12.861  62.673  1.00 45.66  ? 233 ILE B C   1 
ATOM   872  O  O   . ILE B 2 45 ? 0.675   12.507  61.496  1.00 43.93  ? 233 ILE B O   1 
ATOM   873  C  CB  . ILE B 2 45 ? -0.033  15.051  63.482  1.00 43.34  ? 233 ILE B CB  1 
ATOM   874  C  CG1 . ILE B 2 45 ? -1.249  15.821  64.024  1.00 44.30  ? 233 ILE B CG1 1 
ATOM   875  C  CG2 . ILE B 2 45 ? 0.370   15.549  62.102  1.00 41.78  ? 233 ILE B CG2 1 
ATOM   876  C  CD1 . ILE B 2 45 ? -0.950  17.263  64.454  1.00 42.05  ? 233 ILE B CD1 1 
ATOM   877  N  N   . GLU B 2 46 ? 1.948   12.724  63.349  1.00 46.62  ? 234 GLU B N   1 
ATOM   878  C  CA  . GLU B 2 46 ? 3.126   12.101  62.752  1.00 45.93  ? 234 GLU B CA  1 
ATOM   879  C  C   . GLU B 2 46 ? 2.811   10.643  62.414  1.00 45.84  ? 234 GLU B C   1 
ATOM   880  O  O   . GLU B 2 46 ? 3.224   10.129  61.374  1.00 47.65  ? 234 GLU B O   1 
ATOM   881  C  CB  . GLU B 2 46 ? 4.301   12.178  63.725  1.00 45.28  ? 234 GLU B CB  1 
ATOM   882  C  CG  . GLU B 2 46 ? 5.553   11.483  63.233  1.00 46.94  ? 234 GLU B CG  1 
ATOM   883  C  CD  . GLU B 2 46 ? 6.702   11.575  64.233  1.00 49.28  ? 234 GLU B CD  1 
ATOM   884  O  OE1 . GLU B 2 46 ? 6.431   11.663  65.452  1.00 50.70  ? 234 GLU B OE1 1 
ATOM   885  O  OE2 . GLU B 2 46 ? 7.880   11.539  63.812  1.00 45.25  ? 234 GLU B OE2 1 
ATOM   886  N  N   . TYR B 2 47 ? 2.078   9.976   63.293  1.00 45.11  ? 235 TYR B N   1 
ATOM   887  C  CA  . TYR B 2 47 ? 1.691   8.590   63.060  1.00 46.40  ? 235 TYR B CA  1 
ATOM   888  C  C   . TYR B 2 47 ? 0.797   8.483   61.808  1.00 45.46  ? 235 TYR B C   1 
ATOM   889  O  O   . TYR B 2 47 ? 1.045   7.649   60.928  1.00 44.51  ? 235 TYR B O   1 
ATOM   890  C  CB  . TYR B 2 47 ? 0.933   8.060   64.273  1.00 49.73  ? 235 TYR B CB  1 
ATOM   891  C  CG  . TYR B 2 47 ? 0.528   6.605   64.170  1.00 55.81  ? 235 TYR B CG  1 
ATOM   892  C  CD1 . TYR B 2 47 ? 1.436   5.588   64.459  1.00 57.79  ? 235 TYR B CD1 1 
ATOM   893  C  CD2 . TYR B 2 47 ? -0.771  6.242   63.801  1.00 56.59  ? 235 TYR B CD2 1 
ATOM   894  C  CE1 . TYR B 2 47 ? 1.067   4.245   64.386  1.00 60.48  ? 235 TYR B CE1 1 
ATOM   895  C  CE2 . TYR B 2 47 ? -1.147  4.906   63.721  1.00 60.69  ? 235 TYR B CE2 1 
ATOM   896  C  CZ  . TYR B 2 47 ? -0.225  3.907   64.015  1.00 62.19  ? 235 TYR B CZ  1 
ATOM   897  O  OH  . TYR B 2 47 ? -0.580  2.569   63.928  1.00 65.87  ? 235 TYR B OH  1 
ATOM   898  N  N   . ASN B 2 48 ? -0.246  9.317   61.730  1.00 45.10  ? 236 ASN B N   1 
ATOM   899  C  CA  . ASN B 2 48 ? -1.146  9.287   60.561  1.00 45.19  ? 236 ASN B CA  1 
ATOM   900  C  C   . ASN B 2 48 ? -0.455  9.664   59.251  1.00 44.23  ? 236 ASN B C   1 
ATOM   901  O  O   . ASN B 2 48 ? -0.751  9.064   58.212  1.00 43.42  ? 236 ASN B O   1 
ATOM   902  C  CB  . ASN B 2 48 ? -2.388  10.170  60.781  1.00 42.13  ? 236 ASN B CB  1 
ATOM   903  C  CG  . ASN B 2 48 ? -3.374  9.543   61.786  1.00 46.35  ? 236 ASN B CG  1 
ATOM   904  O  OD1 . ASN B 2 48 ? -3.641  8.341   61.738  1.00 45.52  ? 236 ASN B OD1 1 
ATOM   905  N  ND2 . ASN B 2 48 ? -3.925  10.352  62.677  1.00 42.70  ? 236 ASN B ND2 1 
ATOM   906  N  N   . VAL B 2 49 ? 0.479   10.617  59.285  1.00 42.17  ? 237 VAL B N   1 
ATOM   907  C  CA  . VAL B 2 49 ? 1.170   10.999  58.055  1.00 41.38  ? 237 VAL B CA  1 
ATOM   908  C  C   . VAL B 2 49 ? 2.126   9.901   57.599  1.00 42.79  ? 237 VAL B C   1 
ATOM   909  O  O   . VAL B 2 49 ? 2.305   9.655   56.423  1.00 43.95  ? 237 VAL B O   1 
ATOM   910  C  CB  . VAL B 2 49 ? 1.946   12.274  58.231  1.00 40.26  ? 237 VAL B CB  1 
ATOM   911  C  CG1 . VAL B 2 49 ? 2.698   12.604  56.955  1.00 39.98  ? 237 VAL B CG1 1 
ATOM   912  C  CG2 . VAL B 2 49 ? 0.987   13.412  58.601  1.00 40.64  ? 237 VAL B CG2 1 
ATOM   913  N  N   . GLU B 2 50 ? 2.728   9.226   58.547  1.00 45.70  ? 238 GLU B N   1 
ATOM   914  C  CA  . GLU B 2 50 ? 3.639   8.151   58.238  1.00 48.79  ? 238 GLU B CA  1 
ATOM   915  C  C   . GLU B 2 50 ? 2.877   7.051   57.495  1.00 48.01  ? 238 GLU B C   1 
ATOM   916  O  O   . GLU B 2 50 ? 3.362   6.493   56.508  1.00 46.31  ? 238 GLU B O   1 
ATOM   917  C  CB  . GLU B 2 50 ? 4.213   7.633   59.542  1.00 53.30  ? 238 GLU B CB  1 
ATOM   918  C  CG  . GLU B 2 50 ? 5.237   6.566   59.408  1.00 60.72  ? 238 GLU B CG  1 
ATOM   919  C  CD  . GLU B 2 50 ? 6.130   6.544   60.631  1.00 67.72  ? 238 GLU B CD  1 
ATOM   920  O  OE1 . GLU B 2 50 ? 5.746   7.172   61.652  1.00 66.63  ? 238 GLU B OE1 1 
ATOM   921  O  OE2 . GLU B 2 50 ? 7.207   5.899   60.573  1.00 71.60  ? 238 GLU B OE2 1 
ATOM   922  N  N   . HIS B 2 51 ? 1.674   6.741   57.954  1.00 46.93  ? 239 HIS B N   1 
ATOM   923  C  CA  . HIS B 2 51 ? 0.892   5.728   57.248  1.00 47.67  ? 239 HIS B CA  1 
ATOM   924  C  C   . HIS B 2 51 ? 0.353   6.254   55.930  1.00 44.61  ? 239 HIS B C   1 
ATOM   925  O  O   . HIS B 2 51 ? 0.290   5.523   54.946  1.00 44.83  ? 239 HIS B O   1 
ATOM   926  C  CB  . HIS B 2 51 ? -0.218  5.215   58.144  1.00 52.46  ? 239 HIS B CB  1 
ATOM   927  C  CG  . HIS B 2 51 ? 0.315   4.474   59.321  1.00 60.48  ? 239 HIS B CG  1 
ATOM   928  N  ND1 . HIS B 2 51 ? -0.225  3.291   59.774  1.00 64.87  ? 239 HIS B ND1 1 
ATOM   929  C  CD2 . HIS B 2 51 ? 1.387   4.732   60.110  1.00 63.39  ? 239 HIS B CD2 1 
ATOM   930  C  CE1 . HIS B 2 51 ? 0.491   2.851   60.794  1.00 67.06  ? 239 HIS B CE1 1 
ATOM   931  N  NE2 . HIS B 2 51 ? 1.475   3.708   61.019  1.00 66.38  ? 239 HIS B NE2 1 
ATOM   932  N  N   . ALA B 2 52 ? -0.013  7.532   55.898  1.00 42.43  ? 240 ALA B N   1 
ATOM   933  C  CA  . ALA B 2 52 ? -0.495  8.129   54.660  1.00 41.12  ? 240 ALA B CA  1 
ATOM   934  C  C   . ALA B 2 52 ? 0.622   8.038   53.631  1.00 40.99  ? 240 ALA B C   1 
ATOM   935  O  O   . ALA B 2 52 ? 0.378   7.693   52.484  1.00 40.13  ? 240 ALA B O   1 
ATOM   936  C  CB  . ALA B 2 52 ? -0.874  9.582   54.884  1.00 40.29  ? 240 ALA B CB  1 
ATOM   937  N  N   . VAL B 2 53 ? 1.855   8.352   54.046  1.00 42.98  ? 241 VAL B N   1 
ATOM   938  C  CA  . VAL B 2 53 ? 3.000   8.294   53.129  1.00 42.18  ? 241 VAL B CA  1 
ATOM   939  C  C   . VAL B 2 53 ? 3.174   6.886   52.579  1.00 42.64  ? 241 VAL B C   1 
ATOM   940  O  O   . VAL B 2 53 ? 3.346   6.700   51.392  1.00 46.92  ? 241 VAL B O   1 
ATOM   941  C  CB  . VAL B 2 53 ? 4.321   8.677   53.830  1.00 43.15  ? 241 VAL B CB  1 
ATOM   942  C  CG1 . VAL B 2 53 ? 5.523   8.401   52.898  1.00 40.04  ? 241 VAL B CG1 1 
ATOM   943  C  CG2 . VAL B 2 53 ? 4.283   10.138  54.258  1.00 39.75  ? 241 VAL B CG2 1 
ATOM   944  N  N   . ASP B 2 54 ? 3.117   5.891   53.447  1.00 44.97  ? 242 ASP B N   1 
ATOM   945  C  CA  . ASP B 2 54 ? 3.290   4.513   53.018  1.00 46.72  ? 242 ASP B CA  1 
ATOM   946  C  C   . ASP B 2 54 ? 2.140   4.005   52.126  1.00 49.11  ? 242 ASP B C   1 
ATOM   947  O  O   . ASP B 2 54 ? 2.401   3.266   51.160  1.00 48.87  ? 242 ASP B O   1 
ATOM   948  C  CB  . ASP B 2 54 ? 3.491   3.617   54.239  1.00 48.20  ? 242 ASP B CB  1 
ATOM   949  C  CG  . ASP B 2 54 ? 3.488   2.131   53.886  1.00 56.19  ? 242 ASP B CG  1 
ATOM   950  O  OD1 . ASP B 2 54 ? 2.448   1.471   54.163  1.00 60.37  ? 242 ASP B OD1 1 
ATOM   951  O  OD2 . ASP B 2 54 ? 4.501   1.620   53.323  1.00 54.03  ? 242 ASP B OD2 1 
ATOM   952  N  N   . TYR B 2 55 ? 0.887   4.400   52.412  1.00 49.32  ? 243 TYR B N   1 
ATOM   953  C  CA  . TYR B 2 55 ? -0.251  3.971   51.569  1.00 48.50  ? 243 TYR B CA  1 
ATOM   954  C  C   . TYR B 2 55 ? -0.113  4.518   50.149  1.00 48.21  ? 243 TYR B C   1 
ATOM   955  O  O   . TYR B 2 55 ? -0.381  3.825   49.168  1.00 47.97  ? 243 TYR B O   1 
ATOM   956  C  CB  . TYR B 2 55 ? -1.597  4.434   52.156  1.00 47.45  ? 243 TYR B CB  1 
ATOM   957  C  CG  . TYR B 2 55 ? -2.092  3.570   53.299  1.00 46.45  ? 243 TYR B CG  1 
ATOM   958  C  CD1 . TYR B 2 55 ? -2.009  2.166   53.216  1.00 49.47  ? 243 TYR B CD1 1 
ATOM   959  C  CD2 . TYR B 2 55 ? -2.648  4.131   54.452  1.00 45.16  ? 243 TYR B CD2 1 
ATOM   960  C  CE1 . TYR B 2 55 ? -2.463  1.338   54.248  1.00 46.27  ? 243 TYR B CE1 1 
ATOM   961  C  CE2 . TYR B 2 55 ? -3.107  3.304   55.500  1.00 47.12  ? 243 TYR B CE2 1 
ATOM   962  C  CZ  . TYR B 2 55 ? -3.002  1.914   55.378  1.00 49.17  ? 243 TYR B CZ  1 
ATOM   963  O  OH  . TYR B 2 55 ? -3.393  1.078   56.391  1.00 52.86  ? 243 TYR B OH  1 
ATOM   964  N  N   . VAL B 2 56 ? 0.334   5.761   50.043  1.00 48.59  ? 244 VAL B N   1 
ATOM   965  C  CA  . VAL B 2 56 ? 0.514   6.392   48.744  1.00 47.86  ? 244 VAL B CA  1 
ATOM   966  C  C   . VAL B 2 56 ? 1.704   5.797   47.990  1.00 49.46  ? 244 VAL B C   1 
ATOM   967  O  O   . VAL B 2 56 ? 1.636   5.614   46.788  1.00 49.23  ? 244 VAL B O   1 
ATOM   968  C  CB  . VAL B 2 56 ? 0.702   7.923   48.903  1.00 47.50  ? 244 VAL B CB  1 
ATOM   969  C  CG1 . VAL B 2 56 ? 1.096   8.566   47.566  1.00 45.90  ? 244 VAL B CG1 1 
ATOM   970  C  CG2 . VAL B 2 56 ? -0.582  8.538   49.473  1.00 44.32  ? 244 VAL B CG2 1 
ATOM   971  N  N   . GLU B 2 57 ? 2.797   5.502   48.681  1.00 51.84  ? 245 GLU B N   1 
ATOM   972  C  CA  . GLU B 2 57 ? 3.953   4.910   48.012  1.00 54.60  ? 245 GLU B CA  1 
ATOM   973  C  C   . GLU B 2 57 ? 3.526   3.621   47.373  1.00 53.77  ? 245 GLU B C   1 
ATOM   974  O  O   . GLU B 2 57 ? 3.933   3.313   46.260  1.00 55.13  ? 245 GLU B O   1 
ATOM   975  C  CB  . GLU B 2 57 ? 5.054   4.552   48.995  1.00 59.99  ? 245 GLU B CB  1 
ATOM   976  C  CG  . GLU B 2 57 ? 6.081   5.615   49.262  1.00 68.10  ? 245 GLU B CG  1 
ATOM   977  C  CD  . GLU B 2 57 ? 7.073   5.138   50.295  1.00 71.93  ? 245 GLU B CD  1 
ATOM   978  O  OE1 . GLU B 2 57 ? 7.638   4.036   50.088  1.00 74.38  ? 245 GLU B OE1 1 
ATOM   979  O  OE2 . GLU B 2 57 ? 7.279   5.852   51.304  1.00 74.87  ? 245 GLU B OE2 1 
ATOM   980  N  N   . ARG B 2 58 ? 2.729   2.847   48.104  1.00 53.32  ? 246 ARG B N   1 
ATOM   981  C  CA  . ARG B 2 58 ? 2.250   1.574   47.598  1.00 50.77  ? 246 ARG B CA  1 
ATOM   982  C  C   . ARG B 2 58 ? 1.306   1.780   46.441  1.00 52.54  ? 246 ARG B C   1 
ATOM   983  O  O   . ARG B 2 58 ? 1.326   1.011   45.473  1.00 52.57  ? 246 ARG B O   1 
ATOM   984  C  CB  . ARG B 2 58 ? 1.516   0.813   48.680  1.00 50.75  ? 246 ARG B CB  1 
ATOM   985  C  CG  . ARG B 2 58 ? 2.360   0.319   49.808  1.00 51.39  ? 246 ARG B CG  1 
ATOM   986  C  CD  . ARG B 2 58 ? 1.622   -0.811  50.425  1.00 53.03  ? 246 ARG B CD  1 
ATOM   987  N  NE  . ARG B 2 58 ? 1.453   -0.634  51.845  1.00 56.99  ? 246 ARG B NE  1 
ATOM   988  C  CZ  . ARG B 2 58 ? 0.447   -1.159  52.528  1.00 57.78  ? 246 ARG B CZ  1 
ATOM   989  N  NH1 . ARG B 2 58 ? -0.477  -1.885  51.901  1.00 58.39  ? 246 ARG B NH1 1 
ATOM   990  N  NH2 . ARG B 2 58 ? 0.377   -0.964  53.833  1.00 59.48  ? 246 ARG B NH2 1 
ATOM   991  N  N   . ALA B 2 59 ? 0.462   2.804   46.526  1.00 52.48  ? 247 ALA B N   1 
ATOM   992  C  CA  . ALA B 2 59 ? -0.480  3.039   45.436  1.00 57.72  ? 247 ALA B CA  1 
ATOM   993  C  C   . ALA B 2 59 ? 0.178   3.282   44.064  1.00 59.80  ? 247 ALA B C   1 
ATOM   994  O  O   . ALA B 2 59 ? -0.346  2.849   43.039  1.00 61.82  ? 247 ALA B O   1 
ATOM   995  C  CB  . ALA B 2 59 ? -1.419  4.213   45.782  1.00 56.47  ? 247 ALA B CB  1 
ATOM   996  N  N   . VAL B 2 60 ? 1.315   3.966   44.031  1.00 62.64  ? 248 VAL B N   1 
ATOM   997  C  CA  . VAL B 2 60 ? 1.957   4.262   42.751  1.00 64.80  ? 248 VAL B CA  1 
ATOM   998  C  C   . VAL B 2 60 ? 3.251   3.519   42.512  1.00 67.46  ? 248 VAL B C   1 
ATOM   999  O  O   . VAL B 2 60 ? 4.012   3.899   41.637  1.00 68.39  ? 248 VAL B O   1 
ATOM   1000 C  CB  . VAL B 2 60 ? 2.281   5.740   42.620  1.00 63.30  ? 248 VAL B CB  1 
ATOM   1001 C  CG1 . VAL B 2 60 ? 1.033   6.573   42.835  1.00 62.47  ? 248 VAL B CG1 1 
ATOM   1002 C  CG2 . VAL B 2 60 ? 3.352   6.102   43.620  1.00 62.45  ? 248 VAL B CG2 1 
ATOM   1003 N  N   . SER B 2 61 ? 3.515   2.476   43.288  1.00 71.51  ? 249 SER B N   1 
ATOM   1004 C  CA  . SER B 2 61 ? 4.744   1.716   43.108  1.00 76.18  ? 249 SER B CA  1 
ATOM   1005 C  C   . SER B 2 61 ? 4.420   0.268   42.830  1.00 79.45  ? 249 SER B C   1 
ATOM   1006 O  O   . SER B 2 61 ? 4.556   -0.589  43.707  1.00 80.64  ? 249 SER B O   1 
ATOM   1007 C  CB  . SER B 2 61 ? 5.647   1.808   44.347  1.00 76.82  ? 249 SER B CB  1 
ATOM   1008 O  OG  . SER B 2 61 ? 6.269   3.083   44.458  1.00 76.91  ? 249 SER B OG  1 
ATOM   1009 N  N   . ASP B 2 62 ? 3.978   0.008   41.605  1.00 82.15  ? 250 ASP B N   1 
ATOM   1010 C  CA  . ASP B 2 62 ? 3.643   -1.339  41.172  1.00 85.40  ? 250 ASP B CA  1 
ATOM   1011 C  C   . ASP B 2 62 ? 4.754   -1.882  40.268  1.00 86.67  ? 250 ASP B C   1 
ATOM   1012 O  O   . ASP B 2 62 ? 5.556   -1.063  39.751  1.00 87.69  ? 250 ASP B O   1 
ATOM   1013 C  CB  . ASP B 2 62 ? 2.309   -1.312  40.422  1.00 86.54  ? 250 ASP B CB  1 
ATOM   1014 C  CG  . ASP B 2 62 ? 2.220   -0.162  39.441  1.00 88.01  ? 250 ASP B CG  1 
ATOM   1015 O  OD1 . ASP B 2 62 ? 2.740   -0.299  38.316  1.00 90.17  ? 250 ASP B OD1 1 
ATOM   1016 O  OD2 . ASP B 2 62 ? 1.646   0.888   39.800  1.00 88.24  ? 250 ASP B OD2 1 
ATOM   1017 O  OXT . ASP B 2 62 ? 4.807   -3.119  40.086  1.00 87.74  ? 250 ASP B OXT 1 
ATOM   1018 N  N   . SER C 3 2  ? 4.964   50.472  125.141 1.00 105.83 ? 10  SER C N   1 
ATOM   1019 C  CA  . SER C 3 2  ? 4.473   49.623  124.012 1.00 105.92 ? 10  SER C CA  1 
ATOM   1020 C  C   . SER C 3 2  ? 5.580   49.390  122.980 1.00 105.81 ? 10  SER C C   1 
ATOM   1021 O  O   . SER C 3 2  ? 5.336   48.818  121.909 1.00 105.51 ? 10  SER C O   1 
ATOM   1022 C  CB  . SER C 3 2  ? 3.260   50.279  123.337 1.00 106.03 ? 10  SER C CB  1 
ATOM   1023 O  OG  . SER C 3 2  ? 2.542   49.346  122.540 1.00 106.18 ? 10  SER C OG  1 
ATOM   1024 N  N   . LEU C 3 3  ? 6.791   49.853  123.299 1.00 104.99 ? 11  LEU C N   1 
ATOM   1025 C  CA  . LEU C 3 3  ? 7.942   49.652  122.423 1.00 103.10 ? 11  LEU C CA  1 
ATOM   1026 C  C   . LEU C 3 3  ? 8.096   48.142  122.303 1.00 102.66 ? 11  LEU C C   1 
ATOM   1027 O  O   . LEU C 3 3  ? 8.561   47.632  121.286 1.00 102.43 ? 11  LEU C O   1 
ATOM   1028 C  CB  . LEU C 3 3  ? 9.218   50.237  123.030 1.00 102.25 ? 11  LEU C CB  1 
ATOM   1029 C  CG  . LEU C 3 3  ? 10.493  49.871  122.256 1.00 101.87 ? 11  LEU C CG  1 
ATOM   1030 C  CD1 . LEU C 3 3  ? 10.414  50.479  120.873 1.00 101.37 ? 11  LEU C CD1 1 
ATOM   1031 C  CD2 . LEU C 3 3  ? 11.738  50.354  122.982 1.00 100.89 ? 11  LEU C CD2 1 
ATOM   1032 N  N   . GLU C 3 4  ? 7.708   47.437  123.363 1.00 101.69 ? 12  GLU C N   1 
ATOM   1033 C  CA  . GLU C 3 4  ? 7.763   45.986  123.380 1.00 100.38 ? 12  GLU C CA  1 
ATOM   1034 C  C   . GLU C 3 4  ? 6.866   45.507  122.248 1.00 99.39  ? 12  GLU C C   1 
ATOM   1035 O  O   . GLU C 3 4  ? 7.276   44.709  121.408 1.00 99.67  ? 12  GLU C O   1 
ATOM   1036 C  CB  . GLU C 3 4  ? 7.227   45.442  124.706 0.00 101.29 ? 12  GLU C CB  1 
ATOM   1037 C  CG  . GLU C 3 4  ? 7.948   45.957  125.933 0.00 102.07 ? 12  GLU C CG  1 
ATOM   1038 C  CD  . GLU C 3 4  ? 7.472   45.301  127.215 0.00 102.54 ? 12  GLU C CD  1 
ATOM   1039 O  OE1 . GLU C 3 4  ? 6.334   45.583  127.643 0.00 102.81 ? 12  GLU C OE1 1 
ATOM   1040 O  OE2 . GLU C 3 4  ? 8.235   44.498  127.793 0.00 102.81 ? 12  GLU C OE2 1 
ATOM   1041 N  N   . GLU C 3 5  ? 5.641   46.024  122.232 1.00 97.75  ? 13  GLU C N   1 
ATOM   1042 C  CA  . GLU C 3 5  ? 4.650   45.659  121.233 1.00 95.84  ? 13  GLU C CA  1 
ATOM   1043 C  C   . GLU C 3 5  ? 5.116   45.922  119.808 1.00 94.22  ? 13  GLU C C   1 
ATOM   1044 O  O   . GLU C 3 5  ? 5.072   45.037  118.963 1.00 93.70  ? 13  GLU C O   1 
ATOM   1045 C  CB  . GLU C 3 5  ? 3.340   46.403  121.513 0.00 96.87  ? 13  GLU C CB  1 
ATOM   1046 C  CG  . GLU C 3 5  ? 2.690   45.999  122.831 0.00 97.77  ? 13  GLU C CG  1 
ATOM   1047 C  CD  . GLU C 3 5  ? 1.472   46.834  123.173 0.00 98.30  ? 13  GLU C CD  1 
ATOM   1048 O  OE1 . GLU C 3 5  ? 0.545   46.909  122.340 0.00 98.61  ? 13  GLU C OE1 1 
ATOM   1049 O  OE2 . GLU C 3 5  ? 1.440   47.413  124.280 0.00 98.61  ? 13  GLU C OE2 1 
ATOM   1050 N  N   . MET C 3 6  ? 5.570   47.135  119.535 1.00 92.58  ? 14  MET C N   1 
ATOM   1051 C  CA  . MET C 3 6  ? 6.028   47.463  118.189 1.00 91.07  ? 14  MET C CA  1 
ATOM   1052 C  C   . MET C 3 6  ? 7.189   46.589  117.735 1.00 89.09  ? 14  MET C C   1 
ATOM   1053 O  O   . MET C 3 6  ? 7.245   46.187  116.581 1.00 87.73  ? 14  MET C O   1 
ATOM   1054 C  CB  . MET C 3 6  ? 6.445   48.926  118.117 1.00 91.47  ? 14  MET C CB  1 
ATOM   1055 C  CG  . MET C 3 6  ? 5.333   49.886  118.478 1.00 93.13  ? 14  MET C CG  1 
ATOM   1056 S  SD  . MET C 3 6  ? 5.928   51.578  118.491 1.00 94.81  ? 14  MET C SD  1 
ATOM   1057 C  CE  . MET C 3 6  ? 5.797   51.995  116.738 1.00 95.62  ? 14  MET C CE  1 
ATOM   1058 N  N   . GLN C 3 7  ? 8.109   46.302  118.651 1.00 87.67  ? 15  GLN C N   1 
ATOM   1059 C  CA  . GLN C 3 7  ? 9.282   45.487  118.354 1.00 85.81  ? 15  GLN C CA  1 
ATOM   1060 C  C   . GLN C 3 7  ? 8.899   44.072  117.995 1.00 84.46  ? 15  GLN C C   1 
ATOM   1061 O  O   . GLN C 3 7  ? 9.424   43.511  117.043 1.00 82.17  ? 15  GLN C O   1 
ATOM   1062 C  CB  . GLN C 3 7  ? 10.240  45.457  119.553 1.00 85.58  ? 15  GLN C CB  1 
ATOM   1063 C  CG  . GLN C 3 7  ? 11.380  46.465  119.473 1.00 86.50  ? 15  GLN C CG  1 
ATOM   1064 C  CD  . GLN C 3 7  ? 12.144  46.615  120.787 1.00 86.01  ? 15  GLN C CD  1 
ATOM   1065 O  OE1 . GLN C 3 7  ? 13.158  47.305  120.843 1.00 85.83  ? 15  GLN C OE1 1 
ATOM   1066 N  NE2 . GLN C 3 7  ? 11.655  45.978  121.846 1.00 84.87  ? 15  GLN C NE2 1 
ATOM   1067 N  N   . ARG C 3 8  ? 7.984   43.498  118.764 1.00 84.19  ? 16  ARG C N   1 
ATOM   1068 C  CA  . ARG C 3 8  ? 7.559   42.134  118.523 1.00 85.33  ? 16  ARG C CA  1 
ATOM   1069 C  C   . ARG C 3 8  ? 6.850   42.087  117.183 1.00 84.74  ? 16  ARG C C   1 
ATOM   1070 O  O   . ARG C 3 8  ? 6.769   41.041  116.551 1.00 84.35  ? 16  ARG C O   1 
ATOM   1071 C  CB  . ARG C 3 8  ? 6.628   41.668  119.642 1.00 87.88  ? 16  ARG C CB  1 
ATOM   1072 C  CG  . ARG C 3 8  ? 6.673   40.170  119.909 1.00 92.88  ? 16  ARG C CG  1 
ATOM   1073 C  CD  . ARG C 3 8  ? 5.951   39.808  121.209 1.00 96.66  ? 16  ARG C CD  1 
ATOM   1074 N  NE  . ARG C 3 8  ? 6.045   38.382  121.513 1.00 100.46 ? 16  ARG C NE  1 
ATOM   1075 C  CZ  . ARG C 3 8  ? 7.159   37.768  121.906 1.00 103.33 ? 16  ARG C CZ  1 
ATOM   1076 N  NH1 . ARG C 3 8  ? 8.284   38.459  122.051 1.00 104.67 ? 16  ARG C NH1 1 
ATOM   1077 N  NH2 . ARG C 3 8  ? 7.156   36.457  122.146 1.00 104.71 ? 16  ARG C NH2 1 
ATOM   1078 N  N   . ARG C 3 9  ? 6.367   43.248  116.752 1.00 83.90  ? 17  ARG C N   1 
ATOM   1079 C  CA  . ARG C 3 9  ? 5.646   43.403  115.494 1.00 82.86  ? 17  ARG C CA  1 
ATOM   1080 C  C   . ARG C 3 9  ? 6.590   43.465  114.295 1.00 80.76  ? 17  ARG C C   1 
ATOM   1081 O  O   . ARG C 3 9  ? 6.360   42.825  113.265 1.00 80.07  ? 17  ARG C O   1 
ATOM   1082 C  CB  . ARG C 3 9  ? 4.805   44.679  115.565 1.00 85.85  ? 17  ARG C CB  1 
ATOM   1083 C  CG  . ARG C 3 9  ? 4.238   45.163  114.244 1.00 88.96  ? 17  ARG C CG  1 
ATOM   1084 C  CD  . ARG C 3 9  ? 3.278   44.156  113.666 1.00 93.99  ? 17  ARG C CD  1 
ATOM   1085 N  NE  . ARG C 3 9  ? 2.608   44.668  112.475 1.00 98.06  ? 17  ARG C NE  1 
ATOM   1086 C  CZ  . ARG C 3 9  ? 1.799   43.940  111.713 1.00 100.76 ? 17  ARG C CZ  1 
ATOM   1087 N  NH1 . ARG C 3 9  ? 1.562   42.666  112.020 1.00 101.79 ? 17  ARG C NH1 1 
ATOM   1088 N  NH2 . ARG C 3 9  ? 1.222   44.488  110.649 1.00 101.86 ? 17  ARG C NH2 1 
ATOM   1089 N  N   . ALA C 3 10 ? 7.650   44.252  114.436 1.00 78.02  ? 18  ALA C N   1 
ATOM   1090 C  CA  . ALA C 3 10 ? 8.634   44.406  113.380 1.00 74.81  ? 18  ALA C CA  1 
ATOM   1091 C  C   . ALA C 3 10 ? 9.407   43.105  113.198 1.00 72.96  ? 18  ALA C C   1 
ATOM   1092 O  O   . ALA C 3 10 ? 9.883   42.815  112.107 1.00 72.11  ? 18  ALA C O   1 
ATOM   1093 C  CB  . ALA C 3 10 ? 9.589   45.560  113.713 1.00 73.05  ? 18  ALA C CB  1 
ATOM   1094 N  N   . ASP C 3 11 ? 9.536   42.326  114.267 1.00 71.57  ? 19  ASP C N   1 
ATOM   1095 C  CA  . ASP C 3 11 ? 10.240  41.059  114.178 1.00 71.35  ? 19  ASP C CA  1 
ATOM   1096 C  C   . ASP C 3 11 ? 9.424   40.073  113.365 1.00 70.51  ? 19  ASP C C   1 
ATOM   1097 O  O   . ASP C 3 11 ? 9.949   39.390  112.490 1.00 69.26  ? 19  ASP C O   1 
ATOM   1098 C  CB  . ASP C 3 11 ? 10.511  40.481  115.565 1.00 71.36  ? 19  ASP C CB  1 
ATOM   1099 C  CG  . ASP C 3 11 ? 11.642  41.194  116.270 1.00 73.36  ? 19  ASP C CG  1 
ATOM   1100 O  OD1 . ASP C 3 11 ? 12.601  41.599  115.567 1.00 72.87  ? 19  ASP C OD1 1 
ATOM   1101 O  OD2 . ASP C 3 11 ? 11.579  41.346  117.517 1.00 74.77  ? 19  ASP C OD2 1 
ATOM   1102 N  N   . GLN C 3 12 ? 8.134   40.020  113.664 1.00 70.31  ? 20  GLN C N   1 
ATOM   1103 C  CA  . GLN C 3 12 ? 7.201   39.143  112.978 1.00 70.80  ? 20  GLN C CA  1 
ATOM   1104 C  C   . GLN C 3 12 ? 7.179   39.461  111.480 1.00 69.58  ? 20  GLN C C   1 
ATOM   1105 O  O   . GLN C 3 12 ? 7.243   38.571  110.640 1.00 69.04  ? 20  GLN C O   1 
ATOM   1106 C  CB  . GLN C 3 12 ? 5.813   39.331  113.572 1.00 73.02  ? 20  GLN C CB  1 
ATOM   1107 C  CG  . GLN C 3 12 ? 4.776   38.445  112.967 1.00 78.96  ? 20  GLN C CG  1 
ATOM   1108 C  CD  . GLN C 3 12 ? 3.394   38.884  113.350 1.00 82.42  ? 20  GLN C CD  1 
ATOM   1109 O  OE1 . GLN C 3 12 ? 3.004   40.033  113.091 1.00 83.94  ? 20  GLN C OE1 1 
ATOM   1110 N  NE2 . GLN C 3 12 ? 2.632   37.981  113.977 1.00 82.71  ? 20  GLN C NE2 1 
ATOM   1111 N  N   . LEU C 3 13 ? 7.094   40.738  111.144 1.00 68.61  ? 21  LEU C N   1 
ATOM   1112 C  CA  . LEU C 3 13 ? 7.089   41.123  109.749 1.00 68.45  ? 21  LEU C CA  1 
ATOM   1113 C  C   . LEU C 3 13 ? 8.452   40.880  109.057 1.00 68.66  ? 21  LEU C C   1 
ATOM   1114 O  O   . LEU C 3 13 ? 8.510   40.676  107.837 1.00 68.08  ? 21  LEU C O   1 
ATOM   1115 C  CB  . LEU C 3 13 ? 6.676   42.590  109.621 1.00 69.61  ? 21  LEU C CB  1 
ATOM   1116 C  CG  . LEU C 3 13 ? 5.279   43.003  110.119 1.00 71.26  ? 21  LEU C CG  1 
ATOM   1117 C  CD1 . LEU C 3 13 ? 5.038   44.447  109.717 1.00 70.99  ? 21  LEU C CD1 1 
ATOM   1118 C  CD2 . LEU C 3 13 ? 4.185   42.124  109.506 1.00 71.45  ? 21  LEU C CD2 1 
ATOM   1119 N  N   . ALA C 3 14 ? 9.548   40.902  109.818 1.00 66.83  ? 22  ALA C N   1 
ATOM   1120 C  CA  . ALA C 3 14 ? 10.862  40.663  109.224 1.00 64.86  ? 22  ALA C CA  1 
ATOM   1121 C  C   . ALA C 3 14 ? 11.016  39.174  108.995 1.00 63.78  ? 22  ALA C C   1 
ATOM   1122 O  O   . ALA C 3 14 ? 11.602  38.754  107.998 1.00 63.73  ? 22  ALA C O   1 
ATOM   1123 C  CB  . ALA C 3 14 ? 11.962  41.154  110.127 1.00 64.48  ? 22  ALA C CB  1 
ATOM   1124 N  N   . ASP C 3 15 ? 10.486  38.380  109.920 1.00 61.48  ? 23  ASP C N   1 
ATOM   1125 C  CA  . ASP C 3 15 ? 10.567  36.939  109.796 1.00 60.81  ? 23  ASP C CA  1 
ATOM   1126 C  C   . ASP C 3 15 ? 9.769   36.490  108.573 1.00 60.55  ? 23  ASP C C   1 
ATOM   1127 O  O   . ASP C 3 15 ? 10.190  35.603  107.823 1.00 58.35  ? 23  ASP C O   1 
ATOM   1128 C  CB  . ASP C 3 15 ? 10.002  36.241  111.034 1.00 61.82  ? 23  ASP C CB  1 
ATOM   1129 C  CG  . ASP C 3 15 ? 10.844  36.461  112.291 1.00 64.03  ? 23  ASP C CG  1 
ATOM   1130 O  OD1 . ASP C 3 15 ? 12.092  36.584  112.196 1.00 61.94  ? 23  ASP C OD1 1 
ATOM   1131 O  OD2 . ASP C 3 15 ? 10.237  36.481  113.392 1.00 63.54  ? 23  ASP C OD2 1 
ATOM   1132 N  N   . GLU C 3 16 ? 8.617   37.123  108.374 1.00 60.35  ? 24  GLU C N   1 
ATOM   1133 C  CA  . GLU C 3 16 ? 7.743   36.785  107.263 1.00 58.99  ? 24  GLU C CA  1 
ATOM   1134 C  C   . GLU C 3 16 ? 8.274   37.262  105.922 1.00 57.79  ? 24  GLU C C   1 
ATOM   1135 O  O   . GLU C 3 16 ? 8.011   36.650  104.893 1.00 58.42  ? 24  GLU C O   1 
ATOM   1136 C  CB  . GLU C 3 16 ? 6.340   37.316  107.547 1.00 59.42  ? 24  GLU C CB  1 
ATOM   1137 C  CG  . GLU C 3 16 ? 5.800   36.704  108.834 1.00 64.34  ? 24  GLU C CG  1 
ATOM   1138 C  CD  . GLU C 3 16 ? 4.297   36.841  108.998 1.00 66.79  ? 24  GLU C CD  1 
ATOM   1139 O  OE1 . GLU C 3 16 ? 3.800   37.944  109.326 1.00 68.90  ? 24  GLU C OE1 1 
ATOM   1140 O  OE2 . GLU C 3 16 ? 3.610   35.825  108.792 1.00 70.08  ? 24  GLU C OE2 1 
ATOM   1141 N  N   . SER C 3 17 ? 9.047   38.334  105.931 1.00 56.44  ? 25  SER C N   1 
ATOM   1142 C  CA  . SER C 3 17 ? 9.627   38.830  104.693 1.00 58.01  ? 25  SER C CA  1 
ATOM   1143 C  C   . SER C 3 17 ? 10.717  37.878  104.234 1.00 57.47  ? 25  SER C C   1 
ATOM   1144 O  O   . SER C 3 17 ? 10.929  37.697  103.041 1.00 59.18  ? 25  SER C O   1 
ATOM   1145 C  CB  . SER C 3 17 ? 10.204  40.227  104.900 1.00 56.61  ? 25  SER C CB  1 
ATOM   1146 O  OG  . SER C 3 17 ? 9.202   41.074  105.438 1.00 60.57  ? 25  SER C OG  1 
ATOM   1147 N  N   . LEU C 3 18 ? 11.421  37.289  105.192 1.00 56.95  ? 26  LEU C N   1 
ATOM   1148 C  CA  . LEU C 3 18 ? 12.470  36.339  104.888 1.00 57.35  ? 26  LEU C CA  1 
ATOM   1149 C  C   . LEU C 3 18 ? 11.800  35.067  104.369 1.00 57.90  ? 26  LEU C C   1 
ATOM   1150 O  O   . LEU C 3 18 ? 12.276  34.456  103.409 1.00 59.07  ? 26  LEU C O   1 
ATOM   1151 C  CB  . LEU C 3 18 ? 13.283  36.026  106.144 1.00 55.93  ? 26  LEU C CB  1 
ATOM   1152 C  CG  . LEU C 3 18 ? 14.420  34.999  106.058 1.00 57.21  ? 26  LEU C CG  1 
ATOM   1153 C  CD1 . LEU C 3 18 ? 15.427  35.403  104.998 1.00 53.46  ? 26  LEU C CD1 1 
ATOM   1154 C  CD2 . LEU C 3 18 ? 15.113  34.881  107.419 1.00 54.94  ? 26  LEU C CD2 1 
ATOM   1155 N  N   . GLU C 3 19 ? 10.705  34.672  105.014 1.00 57.49  ? 27  GLU C N   1 
ATOM   1156 C  CA  . GLU C 3 19 ? 9.956   33.488  104.617 1.00 58.50  ? 27  GLU C CA  1 
ATOM   1157 C  C   . GLU C 3 19 ? 9.480   33.644  103.177 1.00 58.23  ? 27  GLU C C   1 
ATOM   1158 O  O   . GLU C 3 19 ? 9.514   32.705  102.371 1.00 56.89  ? 27  GLU C O   1 
ATOM   1159 C  CB  . GLU C 3 19 ? 8.733   33.292  105.508 1.00 60.86  ? 27  GLU C CB  1 
ATOM   1160 C  CG  . GLU C 3 19 ? 9.024   32.798  106.898 1.00 67.91  ? 27  GLU C CG  1 
ATOM   1161 C  CD  . GLU C 3 19 ? 9.835   31.524  106.898 1.00 72.89  ? 27  GLU C CD  1 
ATOM   1162 O  OE1 . GLU C 3 19 ? 10.039  30.930  105.802 1.00 75.52  ? 27  GLU C OE1 1 
ATOM   1163 O  OE2 . GLU C 3 19 ? 10.262  31.111  108.003 1.00 75.48  ? 27  GLU C OE2 1 
ATOM   1164 N  N   . SER C 3 20 ? 9.023   34.851  102.873 1.00 57.13  ? 28  SER C N   1 
ATOM   1165 C  CA  . SER C 3 20 ? 8.542   35.163  101.553 1.00 55.54  ? 28  SER C CA  1 
ATOM   1166 C  C   . SER C 3 20 ? 9.658   34.992  100.530 1.00 53.74  ? 28  SER C C   1 
ATOM   1167 O  O   . SER C 3 20 ? 9.442   34.374  99.492  1.00 54.18  ? 28  SER C O   1 
ATOM   1168 C  CB  . SER C 3 20 ? 8.000   36.589  101.538 1.00 56.51  ? 28  SER C CB  1 
ATOM   1169 O  OG  . SER C 3 20 ? 7.392   36.891  100.300 1.00 58.44  ? 28  SER C OG  1 
ATOM   1170 N  N   . THR C 3 21 ? 10.857  35.504  100.811 1.00 51.44  ? 29  THR C N   1 
ATOM   1171 C  CA  . THR C 3 21 ? 11.939  35.364  99.828  1.00 50.18  ? 29  THR C CA  1 
ATOM   1172 C  C   . THR C 3 21 ? 12.353  33.936  99.649  1.00 48.79  ? 29  THR C C   1 
ATOM   1173 O  O   . THR C 3 21 ? 12.870  33.589  98.607  1.00 49.64  ? 29  THR C O   1 
ATOM   1174 C  CB  . THR C 3 21 ? 13.219  36.147  100.181 1.00 51.14  ? 29  THR C CB  1 
ATOM   1175 O  OG1 . THR C 3 21 ? 13.835  35.595  101.363 1.00 48.40  ? 29  THR C OG1 1 
ATOM   1176 C  CG2 . THR C 3 21 ? 12.880  37.591  100.394 1.00 51.91  ? 29  THR C CG2 1 
ATOM   1177 N  N   . ARG C 3 22 ? 12.145  33.107  100.660 1.00 47.84  ? 30  ARG C N   1 
ATOM   1178 C  CA  . ARG C 3 22 ? 12.518  31.712  100.533 1.00 49.85  ? 30  ARG C CA  1 
ATOM   1179 C  C   . ARG C 3 22 ? 11.556  31.057  99.556  1.00 51.92  ? 30  ARG C C   1 
ATOM   1180 O  O   . ARG C 3 22 ? 11.959  30.220  98.746  1.00 53.14  ? 30  ARG C O   1 
ATOM   1181 C  CB  . ARG C 3 22 ? 12.446  31.000  101.880 1.00 51.93  ? 30  ARG C CB  1 
ATOM   1182 C  CG  . ARG C 3 22 ? 13.588  31.357  102.831 1.00 49.63  ? 30  ARG C CG  1 
ATOM   1183 C  CD  . ARG C 3 22 ? 13.336  30.751  104.185 1.00 51.25  ? 30  ARG C CD  1 
ATOM   1184 N  NE  . ARG C 3 22 ? 14.437  31.031  105.083 1.00 52.03  ? 30  ARG C NE  1 
ATOM   1185 C  CZ  . ARG C 3 22 ? 14.426  30.797  106.387 1.00 53.35  ? 30  ARG C CZ  1 
ATOM   1186 N  NH1 . ARG C 3 22 ? 13.351  30.270  106.970 1.00 50.62  ? 30  ARG C NH1 1 
ATOM   1187 N  NH2 . ARG C 3 22 ? 15.505  31.097  107.108 1.00 53.81  ? 30  ARG C NH2 1 
ATOM   1188 N  N   . ARG C 3 23 ? 10.284  31.437  99.628  1.00 51.42  ? 31  ARG C N   1 
ATOM   1189 C  CA  . ARG C 3 23 ? 9.296   30.881  98.719  1.00 52.80  ? 31  ARG C CA  1 
ATOM   1190 C  C   . ARG C 3 23 ? 9.547   31.395  97.295  1.00 53.57  ? 31  ARG C C   1 
ATOM   1191 O  O   . ARG C 3 23 ? 9.475   30.637  96.330  1.00 55.02  ? 31  ARG C O   1 
ATOM   1192 C  CB  . ARG C 3 23 ? 7.897   31.237  99.200  1.00 50.05  ? 31  ARG C CB  1 
ATOM   1193 C  CG  . ARG C 3 23 ? 7.600   30.602  100.561 1.00 48.52  ? 31  ARG C CG  1 
ATOM   1194 C  CD  . ARG C 3 23 ? 6.124   30.733  100.931 1.00 47.21  ? 31  ARG C CD  1 
ATOM   1195 N  NE  . ARG C 3 23 ? 5.718   32.124  101.127 1.00 48.69  ? 31  ARG C NE  1 
ATOM   1196 C  CZ  . ARG C 3 23 ? 5.511   32.679  102.318 1.00 47.46  ? 31  ARG C CZ  1 
ATOM   1197 N  NH1 . ARG C 3 23 ? 5.669   31.958  103.414 1.00 49.33  ? 31  ARG C NH1 1 
ATOM   1198 N  NH2 . ARG C 3 23 ? 5.154   33.949  102.415 1.00 48.27  ? 31  ARG C NH2 1 
ATOM   1199 N  N   . MET C 3 24 ? 9.859   32.679  97.168  1.00 53.88  ? 32  MET C N   1 
ATOM   1200 C  CA  . MET C 3 24 ? 10.143  33.266  95.862  1.00 53.05  ? 32  MET C CA  1 
ATOM   1201 C  C   . MET C 3 24 ? 11.213  32.466  95.113  1.00 53.72  ? 32  MET C C   1 
ATOM   1202 O  O   . MET C 3 24 ? 11.137  32.287  93.887  1.00 51.54  ? 32  MET C O   1 
ATOM   1203 C  CB  . MET C 3 24 ? 10.675  34.680  96.018  1.00 53.01  ? 32  MET C CB  1 
ATOM   1204 C  CG  . MET C 3 24 ? 9.773   35.629  96.716  1.00 52.99  ? 32  MET C CG  1 
ATOM   1205 S  SD  . MET C 3 24 ? 10.570  37.189  96.576  1.00 55.21  ? 32  MET C SD  1 
ATOM   1206 C  CE  . MET C 3 24 ? 9.438   38.204  97.469  1.00 52.99  ? 32  MET C CE  1 
ATOM   1207 N  N   . LEU C 3 25 ? 12.226  32.043  95.867  1.00 53.28  ? 33  LEU C N   1 
ATOM   1208 C  CA  . LEU C 3 25 ? 13.350  31.280  95.347  1.00 53.73  ? 33  LEU C CA  1 
ATOM   1209 C  C   . LEU C 3 25 ? 12.861  29.933  94.859  1.00 52.67  ? 33  LEU C C   1 
ATOM   1210 O  O   . LEU C 3 25 ? 13.159  29.530  93.744  1.00 53.59  ? 33  LEU C O   1 
ATOM   1211 C  CB  . LEU C 3 25 ? 14.383  31.087  96.450  1.00 56.15  ? 33  LEU C CB  1 
ATOM   1212 C  CG  . LEU C 3 25 ? 15.851  31.048  96.037  1.00 57.31  ? 33  LEU C CG  1 
ATOM   1213 C  CD1 . LEU C 3 25 ? 16.095  31.926  94.823  1.00 57.51  ? 33  LEU C CD1 1 
ATOM   1214 C  CD2 . LEU C 3 25 ? 16.689  31.518  97.216  1.00 59.67  ? 33  LEU C CD2 1 
ATOM   1215 N  N   . GLN C 3 26 ? 12.117  29.233  95.700  1.00 52.31  ? 34  GLN C N   1 
ATOM   1216 C  CA  . GLN C 3 26 ? 11.560  27.954  95.308  1.00 54.99  ? 34  GLN C CA  1 
ATOM   1217 C  C   . GLN C 3 26 ? 10.680  28.126  94.045  1.00 56.80  ? 34  GLN C C   1 
ATOM   1218 O  O   . GLN C 3 26 ? 10.827  27.378  93.075  1.00 56.61  ? 34  GLN C O   1 
ATOM   1219 C  CB  . GLN C 3 26 ? 10.702  27.379  96.427  1.00 56.71  ? 34  GLN C CB  1 
ATOM   1220 C  CG  . GLN C 3 26 ? 10.318  25.934  96.165  1.00 65.10  ? 34  GLN C CG  1 
ATOM   1221 C  CD  . GLN C 3 26 ? 9.072   25.483  96.910  1.00 67.88  ? 34  GLN C CD  1 
ATOM   1222 O  OE1 . GLN C 3 26 ? 7.972   25.437  96.336  1.00 71.01  ? 34  GLN C OE1 1 
ATOM   1223 N  NE2 . GLN C 3 26 ? 9.233   25.151  98.193  1.00 68.25  ? 34  GLN C NE2 1 
ATOM   1224 N  N   . LEU C 3 27 ? 9.775   29.113  94.055  1.00 55.44  ? 35  LEU C N   1 
ATOM   1225 C  CA  . LEU C 3 27 ? 8.884   29.333  92.916  1.00 56.74  ? 35  LEU C CA  1 
ATOM   1226 C  C   . LEU C 3 27 ? 9.650   29.596  91.624  1.00 57.36  ? 35  LEU C C   1 
ATOM   1227 O  O   . LEU C 3 27 ? 9.338   29.039  90.557  1.00 57.75  ? 35  LEU C O   1 
ATOM   1228 C  CB  . LEU C 3 27 ? 7.920   30.509  93.190  1.00 55.81  ? 35  LEU C CB  1 
ATOM   1229 C  CG  . LEU C 3 27 ? 6.808   30.327  94.244  1.00 56.22  ? 35  LEU C CG  1 
ATOM   1230 C  CD1 . LEU C 3 27 ? 6.284   31.690  94.642  1.00 57.19  ? 35  LEU C CD1 1 
ATOM   1231 C  CD2 . LEU C 3 27 ? 5.674   29.439  93.712  1.00 52.77  ? 35  LEU C CD2 1 
ATOM   1232 N  N   . VAL C 3 28 ? 10.660  30.441  91.719  1.00 57.29  ? 36  VAL C N   1 
ATOM   1233 C  CA  . VAL C 3 28 ? 11.438  30.789  90.554  1.00 58.08  ? 36  VAL C CA  1 
ATOM   1234 C  C   . VAL C 3 28 ? 12.258  29.601  90.080  1.00 58.15  ? 36  VAL C C   1 
ATOM   1235 O  O   . VAL C 3 28 ? 12.603  29.513  88.913  1.00 57.99  ? 36  VAL C O   1 
ATOM   1236 C  CB  . VAL C 3 28 ? 12.306  32.010  90.859  1.00 58.07  ? 36  VAL C CB  1 
ATOM   1237 C  CG1 . VAL C 3 28 ? 13.174  32.336  89.711  1.00 61.72  ? 36  VAL C CG1 1 
ATOM   1238 C  CG2 . VAL C 3 28 ? 11.410  33.200  91.108  1.00 61.13  ? 36  VAL C CG2 1 
ATOM   1239 N  N   . GLU C 3 29 ? 12.544  28.669  90.979  1.00 58.74  ? 37  GLU C N   1 
ATOM   1240 C  CA  . GLU C 3 29 ? 13.295  27.476  90.604  1.00 59.97  ? 37  GLU C CA  1 
ATOM   1241 C  C   . GLU C 3 29 ? 12.450  26.499  89.776  1.00 58.12  ? 37  GLU C C   1 
ATOM   1242 O  O   . GLU C 3 29 ? 12.919  25.939  88.783  1.00 58.21  ? 37  GLU C O   1 
ATOM   1243 C  CB  . GLU C 3 29 ? 13.821  26.769  91.852  1.00 64.70  ? 37  GLU C CB  1 
ATOM   1244 C  CG  . GLU C 3 29 ? 15.137  27.329  92.370  1.00 71.80  ? 37  GLU C CG  1 
ATOM   1245 C  CD  . GLU C 3 29 ? 16.237  27.300  91.305  1.00 76.83  ? 37  GLU C CD  1 
ATOM   1246 O  OE1 . GLU C 3 29 ? 16.353  26.291  90.566  1.00 78.18  ? 37  GLU C OE1 1 
ATOM   1247 O  OE2 . GLU C 3 29 ? 17.000  28.286  91.213  1.00 80.61  ? 37  GLU C OE2 1 
ATOM   1248 N  N   . GLU C 3 30 ? 11.214  26.271  90.187  1.00 57.16  ? 38  GLU C N   1 
ATOM   1249 C  CA  . GLU C 3 30 ? 10.349  25.372  89.430  1.00 58.84  ? 38  GLU C CA  1 
ATOM   1250 C  C   . GLU C 3 30 ? 10.100  25.962  88.033  1.00 56.55  ? 38  GLU C C   1 
ATOM   1251 O  O   . GLU C 3 30 ? 10.151  25.251  87.022  1.00 55.94  ? 38  GLU C O   1 
ATOM   1252 C  CB  . GLU C 3 30 ? 9.021   25.180  90.162  1.00 61.46  ? 38  GLU C CB  1 
ATOM   1253 C  CG  . GLU C 3 30 ? 9.125   24.340  91.410  1.00 66.33  ? 38  GLU C CG  1 
ATOM   1254 C  CD  . GLU C 3 30 ? 7.818   24.292  92.164  1.00 69.45  ? 38  GLU C CD  1 
ATOM   1255 O  OE1 . GLU C 3 30 ? 6.766   24.229  91.487  1.00 70.11  ? 38  GLU C OE1 1 
ATOM   1256 O  OE2 . GLU C 3 30 ? 7.842   24.313  93.423  1.00 70.56  ? 38  GLU C OE2 1 
ATOM   1257 N  N   . SER C 3 31 ? 9.842   27.271  88.004  1.00 54.38  ? 39  SER C N   1 
ATOM   1258 C  CA  . SER C 3 31 ? 9.603   28.019  86.773  1.00 52.08  ? 39  SER C CA  1 
ATOM   1259 C  C   . SER C 3 31 ? 10.760  27.764  85.801  1.00 50.75  ? 39  SER C C   1 
ATOM   1260 O  O   . SER C 3 31 ? 10.540  27.421  84.630  1.00 48.14  ? 39  SER C O   1 
ATOM   1261 C  CB  . SER C 3 31 ? 9.508   29.528  87.068  1.00 50.98  ? 39  SER C CB  1 
ATOM   1262 O  OG  . SER C 3 31 ? 8.344   29.850  87.822  1.00 49.48  ? 39  SER C OG  1 
ATOM   1263 N  N   . LYS C 3 32 ? 11.987  27.918  86.294  1.00 48.37  ? 40  LYS C N   1 
ATOM   1264 C  CA  . LYS C 3 32 ? 13.140  27.696  85.451  1.00 48.81  ? 40  LYS C CA  1 
ATOM   1265 C  C   . LYS C 3 32 ? 13.060  26.262  84.969  1.00 48.36  ? 40  LYS C C   1 
ATOM   1266 O  O   . LYS C 3 32 ? 13.164  25.994  83.778  1.00 47.03  ? 40  LYS C O   1 
ATOM   1267 C  CB  . LYS C 3 32 ? 14.432  27.925  86.233  1.00 52.92  ? 40  LYS C CB  1 
ATOM   1268 C  CG  . LYS C 3 32 ? 15.671  27.571  85.447  1.00 54.89  ? 40  LYS C CG  1 
ATOM   1269 C  CD  . LYS C 3 32 ? 16.926  28.018  86.132  1.00 58.24  ? 40  LYS C CD  1 
ATOM   1270 C  CE  . LYS C 3 32 ? 18.132  27.602  85.302  1.00 61.66  ? 40  LYS C CE  1 
ATOM   1271 N  NZ  . LYS C 3 32 ? 19.319  28.452  85.580  1.00 65.17  ? 40  LYS C NZ  1 
ATOM   1272 N  N   . ASP C 3 33 ? 12.859  25.343  85.903  1.00 49.25  ? 41  ASP C N   1 
ATOM   1273 C  CA  . ASP C 3 33 ? 12.739  23.933  85.559  1.00 50.53  ? 41  ASP C CA  1 
ATOM   1274 C  C   . ASP C 3 33 ? 11.646  23.726  84.488  1.00 49.71  ? 41  ASP C C   1 
ATOM   1275 O  O   . ASP C 3 33 ? 11.852  23.021  83.485  1.00 47.32  ? 41  ASP C O   1 
ATOM   1276 C  CB  . ASP C 3 33 ? 12.389  23.108  86.810  1.00 56.80  ? 41  ASP C CB  1 
ATOM   1277 C  CG  . ASP C 3 33 ? 13.603  22.389  87.420  1.00 61.36  ? 41  ASP C CG  1 
ATOM   1278 O  OD1 . ASP C 3 33 ? 14.298  21.674  86.666  1.00 66.36  ? 41  ASP C OD1 1 
ATOM   1279 O  OD2 . ASP C 3 33 ? 13.850  22.513  88.648  1.00 60.68  ? 41  ASP C OD2 1 
ATOM   1280 N  N   . ALA C 3 34 ? 10.483  24.336  84.694  1.00 49.14  ? 42  ALA C N   1 
ATOM   1281 C  CA  . ALA C 3 34 ? 9.388   24.175  83.739  1.00 50.46  ? 42  ALA C CA  1 
ATOM   1282 C  C   . ALA C 3 34 ? 9.760   24.779  82.393  1.00 51.34  ? 42  ALA C C   1 
ATOM   1283 O  O   . ALA C 3 34 ? 9.415   24.231  81.331  1.00 52.43  ? 42  ALA C O   1 
ATOM   1284 C  CB  . ALA C 3 34 ? 8.106   24.819  84.280  1.00 48.30  ? 42  ALA C CB  1 
ATOM   1285 N  N   . GLY C 3 35 ? 10.469  25.905  82.441  1.00 50.84  ? 43  GLY C N   1 
ATOM   1286 C  CA  . GLY C 3 35 ? 10.885  26.566  81.218  1.00 50.11  ? 43  GLY C CA  1 
ATOM   1287 C  C   . GLY C 3 35 ? 11.825  25.690  80.410  1.00 50.38  ? 43  GLY C C   1 
ATOM   1288 O  O   . GLY C 3 35 ? 11.612  25.497  79.214  1.00 49.60  ? 43  GLY C O   1 
ATOM   1289 N  N   . ILE C 3 36 ? 12.863  25.144  81.046  1.00 50.74  ? 44  ILE C N   1 
ATOM   1290 C  CA  . ILE C 3 36 ? 13.792  24.291  80.315  1.00 52.97  ? 44  ILE C CA  1 
ATOM   1291 C  C   . ILE C 3 36 ? 13.032  23.106  79.712  1.00 54.96  ? 44  ILE C C   1 
ATOM   1292 O  O   . ILE C 3 36 ? 13.238  22.754  78.537  1.00 56.96  ? 44  ILE C O   1 
ATOM   1293 C  CB  . ILE C 3 36 ? 14.931  23.766  81.221  1.00 52.11  ? 44  ILE C CB  1 
ATOM   1294 C  CG1 . ILE C 3 36 ? 15.915  24.907  81.529  1.00 54.25  ? 44  ILE C CG1 1 
ATOM   1295 C  CG2 . ILE C 3 36 ? 15.702  22.671  80.511  1.00 50.36  ? 44  ILE C CG2 1 
ATOM   1296 C  CD1 . ILE C 3 36 ? 16.829  24.626  82.708  1.00 51.55  ? 44  ILE C CD1 1 
ATOM   1297 N  N   . ARG C 3 37 ? 12.149  22.500  80.503  1.00 53.82  ? 45  ARG C N   1 
ATOM   1298 C  CA  . ARG C 3 37 ? 11.368  21.363  80.026  1.00 54.21  ? 45  ARG C CA  1 
ATOM   1299 C  C   . ARG C 3 37 ? 10.548  21.743  78.773  1.00 52.62  ? 45  ARG C C   1 
ATOM   1300 O  O   . ARG C 3 37 ? 10.433  20.942  77.828  1.00 51.03  ? 45  ARG C O   1 
ATOM   1301 C  CB  . ARG C 3 37 ? 10.450  20.832  81.149  1.00 56.89  ? 45  ARG C CB  1 
ATOM   1302 C  CG  . ARG C 3 37 ? 9.492   19.721  80.708  1.00 63.84  ? 45  ARG C CG  1 
ATOM   1303 C  CD  . ARG C 3 37 ? 9.498   18.550  81.695  1.00 71.94  ? 45  ARG C CD  1 
ATOM   1304 N  NE  . ARG C 3 37 ? 8.637   17.419  81.305  1.00 73.30  ? 45  ARG C NE  1 
ATOM   1305 C  CZ  . ARG C 3 37 ? 7.307   17.473  81.228  1.00 74.32  ? 45  ARG C CZ  1 
ATOM   1306 N  NH1 . ARG C 3 37 ? 6.657   18.603  81.501  1.00 73.84  ? 45  ARG C NH1 1 
ATOM   1307 N  NH2 . ARG C 3 37 ? 6.621   16.385  80.907  1.00 75.76  ? 45  ARG C NH2 1 
ATOM   1308 N  N   . THR C 3 38 ? 10.014  22.964  78.759  1.00 50.10  ? 46  THR C N   1 
ATOM   1309 C  CA  . THR C 3 38 ? 9.229   23.455  77.626  1.00 51.34  ? 46  THR C CA  1 
ATOM   1310 C  C   . THR C 3 38 ? 10.107  23.621  76.369  1.00 50.78  ? 46  THR C C   1 
ATOM   1311 O  O   . THR C 3 38 ? 9.757   23.169  75.273  1.00 51.67  ? 46  THR C O   1 
ATOM   1312 C  CB  . THR C 3 38 ? 8.537   24.827  77.968  1.00 51.86  ? 46  THR C CB  1 
ATOM   1313 O  OG1 . THR C 3 38 ? 7.710   24.690  79.132  1.00 50.23  ? 46  THR C OG1 1 
ATOM   1314 C  CG2 . THR C 3 38 ? 7.657   25.281  76.821  1.00 51.46  ? 46  THR C CG2 1 
ATOM   1315 N  N   . LEU C 3 39 ? 11.266  24.252  76.519  1.00 50.44  ? 47  LEU C N   1 
ATOM   1316 C  CA  . LEU C 3 39 ? 12.136  24.447  75.364  1.00 49.57  ? 47  LEU C CA  1 
ATOM   1317 C  C   . LEU C 3 39 ? 12.567  23.094  74.789  1.00 49.43  ? 47  LEU C C   1 
ATOM   1318 O  O   . LEU C 3 39 ? 12.700  22.929  73.569  1.00 47.51  ? 47  LEU C O   1 
ATOM   1319 C  CB  . LEU C 3 39 ? 13.347  25.318  75.747  1.00 47.98  ? 47  LEU C CB  1 
ATOM   1320 C  CG  . LEU C 3 39 ? 12.986  26.787  76.053  1.00 49.11  ? 47  LEU C CG  1 
ATOM   1321 C  CD1 . LEU C 3 39 ? 14.188  27.521  76.608  1.00 49.08  ? 47  LEU C CD1 1 
ATOM   1322 C  CD2 . LEU C 3 39 ? 12.493  27.476  74.785  1.00 48.28  ? 47  LEU C CD2 1 
ATOM   1323 N  N   . VAL C 3 40 ? 12.753  22.111  75.659  1.00 48.96  ? 48  VAL C N   1 
ATOM   1324 C  CA  . VAL C 3 40 ? 13.145  20.789  75.182  1.00 48.11  ? 48  VAL C CA  1 
ATOM   1325 C  C   . VAL C 3 40 ? 12.007  20.124  74.381  1.00 48.76  ? 48  VAL C C   1 
ATOM   1326 O  O   . VAL C 3 40 ? 12.244  19.585  73.295  1.00 50.00  ? 48  VAL C O   1 
ATOM   1327 C  CB  . VAL C 3 40 ? 13.569  19.905  76.355  1.00 47.91  ? 48  VAL C CB  1 
ATOM   1328 C  CG1 . VAL C 3 40 ? 13.849  18.504  75.882  1.00 48.08  ? 48  VAL C CG1 1 
ATOM   1329 C  CG2 . VAL C 3 40 ? 14.809  20.478  76.998  1.00 48.48  ? 48  VAL C CG2 1 
ATOM   1330 N  N   . MET C 3 41 ? 10.776  20.156  74.892  1.00 48.53  ? 49  MET C N   1 
ATOM   1331 C  CA  . MET C 3 41 ? 9.656   19.571  74.156  1.00 46.64  ? 49  MET C CA  1 
ATOM   1332 C  C   . MET C 3 41 ? 9.410   20.312  72.824  1.00 46.62  ? 49  MET C C   1 
ATOM   1333 O  O   . MET C 3 41 ? 9.068   19.678  71.833  1.00 45.57  ? 49  MET C O   1 
ATOM   1334 C  CB  . MET C 3 41 ? 8.384   19.604  74.992  1.00 48.83  ? 49  MET C CB  1 
ATOM   1335 C  CG  . MET C 3 41 ? 8.377   18.644  76.137  1.00 49.35  ? 49  MET C CG  1 
ATOM   1336 S  SD  . MET C 3 41 ? 6.951   18.955  77.141  1.00 55.88  ? 49  MET C SD  1 
ATOM   1337 C  CE  . MET C 3 41 ? 6.153   17.395  76.993  1.00 55.27  ? 49  MET C CE  1 
ATOM   1338 N  N   . LEU C 3 42 ? 9.552   21.639  72.803  1.00 45.50  ? 50  LEU C N   1 
ATOM   1339 C  CA  . LEU C 3 42 ? 9.378   22.393  71.558  1.00 46.05  ? 50  LEU C CA  1 
ATOM   1340 C  C   . LEU C 3 42 ? 10.399  21.896  70.538  1.00 46.55  ? 50  LEU C C   1 
ATOM   1341 O  O   . LEU C 3 42 ? 10.098  21.765  69.352  1.00 45.24  ? 50  LEU C O   1 
ATOM   1342 C  CB  . LEU C 3 42 ? 9.555   23.901  71.783  1.00 43.17  ? 50  LEU C CB  1 
ATOM   1343 C  CG  . LEU C 3 42 ? 8.388   24.477  72.590  1.00 47.61  ? 50  LEU C CG  1 
ATOM   1344 C  CD1 . LEU C 3 42 ? 8.614   25.953  72.869  1.00 44.60  ? 50  LEU C CD1 1 
ATOM   1345 C  CD2 . LEU C 3 42 ? 7.060   24.245  71.804  1.00 46.28  ? 50  LEU C CD2 1 
ATOM   1346 N  N   . ASP C 3 43 ? 11.605  21.600  71.002  1.00 50.04  ? 51  ASP C N   1 
ATOM   1347 C  CA  . ASP C 3 43 ? 12.653  21.079  70.113  1.00 53.20  ? 51  ASP C CA  1 
ATOM   1348 C  C   . ASP C 3 43 ? 12.285  19.685  69.582  1.00 52.02  ? 51  ASP C C   1 
ATOM   1349 O  O   . ASP C 3 43 ? 12.320  19.424  68.375  1.00 50.91  ? 51  ASP C O   1 
ATOM   1350 C  CB  . ASP C 3 43 ? 13.977  20.986  70.866  1.00 58.34  ? 51  ASP C CB  1 
ATOM   1351 C  CG  . ASP C 3 43 ? 14.989  21.986  70.375  1.00 65.21  ? 51  ASP C CG  1 
ATOM   1352 O  OD1 . ASP C 3 43 ? 14.633  23.190  70.244  1.00 68.13  ? 51  ASP C OD1 1 
ATOM   1353 O  OD2 . ASP C 3 43 ? 16.141  21.566  70.120  1.00 67.95  ? 51  ASP C OD2 1 
ATOM   1354 N  N   . GLU C 3 44 ? 11.928  18.795  70.494  1.00 50.65  ? 52  GLU C N   1 
ATOM   1355 C  CA  . GLU C 3 44 ? 11.554  17.444  70.106  1.00 52.24  ? 52  GLU C CA  1 
ATOM   1356 C  C   . GLU C 3 44 ? 10.377  17.451  69.127  1.00 51.17  ? 52  GLU C C   1 
ATOM   1357 O  O   . GLU C 3 44 ? 10.404  16.742  68.125  1.00 50.59  ? 52  GLU C O   1 
ATOM   1358 C  CB  . GLU C 3 44 ? 11.210  16.640  71.353  1.00 53.44  ? 52  GLU C CB  1 
ATOM   1359 C  CG  . GLU C 3 44 ? 12.348  16.663  72.364  1.00 61.06  ? 52  GLU C CG  1 
ATOM   1360 C  CD  . GLU C 3 44 ? 12.029  15.914  73.640  1.00 65.49  ? 52  GLU C CD  1 
ATOM   1361 O  OE1 . GLU C 3 44 ? 11.058  16.282  74.346  1.00 68.74  ? 52  GLU C OE1 1 
ATOM   1362 O  OE2 . GLU C 3 44 ? 12.758  14.952  73.944  1.00 68.93  ? 52  GLU C OE2 1 
ATOM   1363 N  N   . GLN C 3 45 ? 9.371   18.281  69.419  1.00 49.89  ? 53  GLN C N   1 
ATOM   1364 C  CA  . GLN C 3 45 ? 8.161   18.419  68.600  1.00 49.54  ? 53  GLN C CA  1 
ATOM   1365 C  C   . GLN C 3 45 ? 8.451   19.104  67.264  1.00 49.37  ? 53  GLN C C   1 
ATOM   1366 O  O   . GLN C 3 45 ? 7.848   18.783  66.221  1.00 48.92  ? 53  GLN C O   1 
ATOM   1367 C  CB  . GLN C 3 45 ? 7.102   19.176  69.398  1.00 47.64  ? 53  GLN C CB  1 
ATOM   1368 C  CG  . GLN C 3 45 ? 6.789   18.475  70.709  1.00 45.65  ? 53  GLN C CG  1 
ATOM   1369 C  CD  . GLN C 3 45 ? 5.762   19.216  71.516  1.00 49.59  ? 53  GLN C CD  1 
ATOM   1370 O  OE1 . GLN C 3 45 ? 5.271   20.274  71.088  1.00 51.55  ? 53  GLN C OE1 1 
ATOM   1371 N  NE2 . GLN C 3 45 ? 5.414   18.677  72.685  1.00 43.40  ? 53  GLN C NE2 1 
ATOM   1372 N  N   . GLY C 3 46 ? 9.391   20.038  67.292  1.00 49.80  ? 54  GLY C N   1 
ATOM   1373 C  CA  . GLY C 3 46 ? 9.783   20.705  66.067  1.00 50.45  ? 54  GLY C CA  1 
ATOM   1374 C  C   . GLY C 3 46 ? 10.359  19.674  65.098  1.00 50.96  ? 54  GLY C C   1 
ATOM   1375 O  O   . GLY C 3 46 ? 10.117  19.762  63.896  1.00 52.92  ? 54  GLY C O   1 
ATOM   1376 N  N   . GLU C 3 47 ? 11.101  18.693  65.609  1.00 50.50  ? 55  GLU C N   1 
ATOM   1377 C  CA  . GLU C 3 47 ? 11.690  17.674  64.751  1.00 53.63  ? 55  GLU C CA  1 
ATOM   1378 C  C   . GLU C 3 47 ? 10.570  16.814  64.191  1.00 52.72  ? 55  GLU C C   1 
ATOM   1379 O  O   . GLU C 3 47 ? 10.626  16.393  63.035  1.00 52.01  ? 55  GLU C O   1 
ATOM   1380 C  CB  . GLU C 3 47 ? 12.680  16.774  65.521  1.00 57.77  ? 55  GLU C CB  1 
ATOM   1381 C  CG  . GLU C 3 47 ? 13.896  17.475  66.126  1.00 64.35  ? 55  GLU C CG  1 
ATOM   1382 C  CD  . GLU C 3 47 ? 14.639  18.373  65.136  1.00 69.57  ? 55  GLU C CD  1 
ATOM   1383 O  OE1 . GLU C 3 47 ? 14.984  17.891  64.032  1.00 72.83  ? 55  GLU C OE1 1 
ATOM   1384 O  OE2 . GLU C 3 47 ? 14.884  19.565  65.468  1.00 73.13  ? 55  GLU C OE2 1 
ATOM   1385 N  N   . GLN C 3 48 ? 9.569   16.531  65.027  1.00 51.49  ? 56  GLN C N   1 
ATOM   1386 C  CA  . GLN C 3 48 ? 8.414   15.750  64.591  1.00 50.70  ? 56  GLN C CA  1 
ATOM   1387 C  C   . GLN C 3 48 ? 7.717   16.503  63.447  1.00 49.65  ? 56  GLN C C   1 
ATOM   1388 O  O   . GLN C 3 48 ? 7.330   15.907  62.441  1.00 49.76  ? 56  GLN C O   1 
ATOM   1389 C  CB  . GLN C 3 48 ? 7.433   15.532  65.750  1.00 50.52  ? 56  GLN C CB  1 
ATOM   1390 C  CG  . GLN C 3 48 ? 8.034   14.778  66.925  1.00 50.61  ? 56  GLN C CG  1 
ATOM   1391 C  CD  . GLN C 3 48 ? 6.989   14.307  67.910  1.00 51.87  ? 56  GLN C CD  1 
ATOM   1392 O  OE1 . GLN C 3 48 ? 6.276   13.315  67.671  1.00 50.47  ? 56  GLN C OE1 1 
ATOM   1393 N  NE2 . GLN C 3 48 ? 6.873   15.021  69.022  1.00 50.38  ? 56  GLN C NE2 1 
ATOM   1394 N  N   . LEU C 3 49 ? 7.583   17.817  63.595  1.00 47.81  ? 57  LEU C N   1 
ATOM   1395 C  CA  . LEU C 3 49 ? 6.953   18.618  62.567  1.00 49.27  ? 57  LEU C CA  1 
ATOM   1396 C  C   . LEU C 3 49 ? 7.701   18.572  61.226  1.00 49.41  ? 57  LEU C C   1 
ATOM   1397 O  O   . LEU C 3 49 ? 7.068   18.502  60.163  1.00 50.35  ? 57  LEU C O   1 
ATOM   1398 C  CB  . LEU C 3 49 ? 6.780   20.059  63.065  1.00 49.05  ? 57  LEU C CB  1 
ATOM   1399 C  CG  . LEU C 3 49 ? 5.727   20.130  64.176  1.00 48.32  ? 57  LEU C CG  1 
ATOM   1400 C  CD1 . LEU C 3 49 ? 5.560   21.536  64.649  1.00 50.90  ? 57  LEU C CD1 1 
ATOM   1401 C  CD2 . LEU C 3 49 ? 4.404   19.622  63.655  1.00 47.68  ? 57  LEU C CD2 1 
ATOM   1402 N  N   . ASP C 3 50 ? 9.031   18.568  61.264  1.00 47.95  ? 58  ASP C N   1 
ATOM   1403 C  CA  . ASP C 3 50 ? 9.802   18.498  60.029  1.00 45.92  ? 58  ASP C CA  1 
ATOM   1404 C  C   . ASP C 3 50 ? 9.560   17.155  59.366  1.00 45.98  ? 58  ASP C C   1 
ATOM   1405 O  O   . ASP C 3 50 ? 9.419   17.049  58.136  1.00 45.91  ? 58  ASP C O   1 
ATOM   1406 C  CB  . ASP C 3 50 ? 11.285  18.628  60.310  1.00 49.21  ? 58  ASP C CB  1 
ATOM   1407 C  CG  . ASP C 3 50 ? 11.678  19.996  60.801  1.00 51.36  ? 58  ASP C CG  1 
ATOM   1408 O  OD1 . ASP C 3 50 ? 11.020  21.011  60.457  1.00 54.39  ? 58  ASP C OD1 1 
ATOM   1409 O  OD2 . ASP C 3 50 ? 12.693  20.054  61.518  1.00 54.33  ? 58  ASP C OD2 1 
ATOM   1410 N  N   . ARG C 3 51 ? 9.509   16.110  60.172  1.00 45.06  ? 59  ARG C N   1 
ATOM   1411 C  CA  . ARG C 3 51 ? 9.276   14.797  59.581  1.00 48.63  ? 59  ARG C CA  1 
ATOM   1412 C  C   . ARG C 3 51 ? 7.887   14.793  58.962  1.00 48.05  ? 59  ARG C C   1 
ATOM   1413 O  O   . ARG C 3 51 ? 7.681   14.229  57.904  1.00 50.05  ? 59  ARG C O   1 
ATOM   1414 C  CB  . ARG C 3 51 ? 9.443   13.665  60.630  1.00 46.41  ? 59  ARG C CB  1 
ATOM   1415 C  CG  . ARG C 3 51 ? 10.896  13.518  61.081  1.00 50.62  ? 59  ARG C CG  1 
ATOM   1416 C  CD  . ARG C 3 51 ? 11.239  12.124  61.624  1.00 55.63  ? 59  ARG C CD  1 
ATOM   1417 N  NE  . ARG C 3 51 ? 10.686  11.856  62.956  1.00 55.53  ? 59  ARG C NE  1 
ATOM   1418 C  CZ  . ARG C 3 51 ? 11.111  12.411  64.094  1.00 57.93  ? 59  ARG C CZ  1 
ATOM   1419 N  NH1 . ARG C 3 51 ? 12.128  13.280  64.104  1.00 57.83  ? 59  ARG C NH1 1 
ATOM   1420 N  NH2 . ARG C 3 51 ? 10.481  12.119  65.228  1.00 57.17  ? 59  ARG C NH2 1 
ATOM   1421 N  N   . VAL C 3 52 ? 6.942   15.469  59.602  1.00 46.80  ? 60  VAL C N   1 
ATOM   1422 C  CA  . VAL C 3 52 ? 5.602   15.512  59.065  1.00 44.11  ? 60  VAL C CA  1 
ATOM   1423 C  C   . VAL C 3 52 ? 5.676   16.291  57.755  1.00 44.56  ? 60  VAL C C   1 
ATOM   1424 O  O   . VAL C 3 52 ? 5.194   15.833  56.718  1.00 44.40  ? 60  VAL C O   1 
ATOM   1425 C  CB  . VAL C 3 52 ? 4.615   16.177  60.078  1.00 42.92  ? 60  VAL C CB  1 
ATOM   1426 C  CG1 . VAL C 3 52 ? 3.410   16.761  59.338  1.00 40.23  ? 60  VAL C CG1 1 
ATOM   1427 C  CG2 . VAL C 3 52 ? 4.175   15.141  61.119  1.00 39.23  ? 60  VAL C CG2 1 
ATOM   1428 N  N   . GLU C 3 53 ? 6.284   17.467  57.784  1.00 44.49  ? 61  GLU C N   1 
ATOM   1429 C  CA  . GLU C 3 53 ? 6.386   18.220  56.548  1.00 45.09  ? 61  GLU C CA  1 
ATOM   1430 C  C   . GLU C 3 53 ? 7.102   17.408  55.480  1.00 45.17  ? 61  GLU C C   1 
ATOM   1431 O  O   . GLU C 3 53 ? 6.657   17.372  54.337  1.00 43.69  ? 61  GLU C O   1 
ATOM   1432 C  CB  . GLU C 3 53 ? 7.098   19.570  56.748  1.00 46.90  ? 61  GLU C CB  1 
ATOM   1433 C  CG  . GLU C 3 53 ? 7.157   20.373  55.452  1.00 44.53  ? 61  GLU C CG  1 
ATOM   1434 C  CD  . GLU C 3 53 ? 7.210   21.868  55.687  1.00 47.96  ? 61  GLU C CD  1 
ATOM   1435 O  OE1 . GLU C 3 53 ? 7.450   22.269  56.846  1.00 50.34  ? 61  GLU C OE1 1 
ATOM   1436 O  OE2 . GLU C 3 53 ? 7.017   22.647  54.719  1.00 45.14  ? 61  GLU C OE2 1 
ATOM   1437 N  N   . GLU C 3 54 ? 8.205   16.751  55.829  1.00 46.57  ? 62  GLU C N   1 
ATOM   1438 C  CA  . GLU C 3 54 ? 8.891   15.954  54.806  1.00 48.61  ? 62  GLU C CA  1 
ATOM   1439 C  C   . GLU C 3 54 ? 7.918   14.937  54.185  1.00 45.75  ? 62  GLU C C   1 
ATOM   1440 O  O   . GLU C 3 54 ? 7.953   14.699  52.991  1.00 44.90  ? 62  GLU C O   1 
ATOM   1441 C  CB  . GLU C 3 54 ? 10.127  15.247  55.390  1.00 52.30  ? 62  GLU C CB  1 
ATOM   1442 C  CG  . GLU C 3 54 ? 11.249  16.214  55.830  1.00 59.23  ? 62  GLU C CG  1 
ATOM   1443 C  CD  . GLU C 3 54 ? 12.226  15.571  56.808  1.00 64.23  ? 62  GLU C CD  1 
ATOM   1444 O  OE1 . GLU C 3 54 ? 12.771  16.281  57.699  1.00 67.65  ? 62  GLU C OE1 1 
ATOM   1445 O  OE2 . GLU C 3 54 ? 12.446  14.346  56.683  1.00 65.68  ? 62  GLU C OE2 1 
ATOM   1446 N  N   . GLY C 3 55 ? 7.040   14.362  55.000  1.00 45.25  ? 63  GLY C N   1 
ATOM   1447 C  CA  . GLY C 3 55 ? 6.056   13.414  54.496  1.00 43.09  ? 63  GLY C CA  1 
ATOM   1448 C  C   . GLY C 3 55 ? 5.054   14.044  53.538  1.00 42.51  ? 63  GLY C C   1 
ATOM   1449 O  O   . GLY C 3 55 ? 4.630   13.405  52.587  1.00 41.88  ? 63  GLY C O   1 
ATOM   1450 N  N   . MET C 3 56 ? 4.655   15.285  53.786  1.00 42.61  ? 64  MET C N   1 
ATOM   1451 C  CA  . MET C 3 56 ? 3.734   15.969  52.875  1.00 45.38  ? 64  MET C CA  1 
ATOM   1452 C  C   . MET C 3 56 ? 4.412   16.138  51.501  1.00 45.68  ? 64  MET C C   1 
ATOM   1453 O  O   . MET C 3 56 ? 3.774   15.973  50.455  1.00 44.93  ? 64  MET C O   1 
ATOM   1454 C  CB  . MET C 3 56 ? 3.365   17.351  53.420  1.00 46.88  ? 64  MET C CB  1 
ATOM   1455 C  CG  . MET C 3 56 ? 2.630   17.342  54.754  1.00 50.31  ? 64  MET C CG  1 
ATOM   1456 S  SD  . MET C 3 56 ? 0.985   16.567  54.685  1.00 50.77  ? 64  MET C SD  1 
ATOM   1457 C  CE  . MET C 3 56 ? 1.391   14.897  54.950  1.00 54.00  ? 64  MET C CE  1 
ATOM   1458 N  N   . ASN C 3 57 ? 5.702   16.480  51.510  1.00 47.45  ? 65  ASN C N   1 
ATOM   1459 C  CA  . ASN C 3 57 ? 6.477   16.652  50.286  1.00 48.79  ? 65  ASN C CA  1 
ATOM   1460 C  C   . ASN C 3 57 ? 6.522   15.334  49.505  1.00 52.43  ? 65  ASN C C   1 
ATOM   1461 O  O   . ASN C 3 57 ? 6.335   15.328  48.290  1.00 49.41  ? 65  ASN C O   1 
ATOM   1462 C  CB  . ASN C 3 57 ? 7.919   17.070  50.611  1.00 48.17  ? 65  ASN C CB  1 
ATOM   1463 C  CG  . ASN C 3 57 ? 8.017   18.459  51.233  1.00 49.50  ? 65  ASN C CG  1 
ATOM   1464 O  OD1 . ASN C 3 57 ? 7.069   19.239  51.208  1.00 48.52  ? 65  ASN C OD1 1 
ATOM   1465 N  ND2 . ASN C 3 57 ? 9.188   18.775  51.785  1.00 48.34  ? 65  ASN C ND2 1 
ATOM   1466 N  N   A HIS C 3 58 ? 6.777   14.224  50.191  0.54 56.84  ? 66  HIS C N   1 
ATOM   1467 N  N   B HIS C 3 58 ? 6.762   14.236  50.223  0.46 57.43  ? 66  HIS C N   1 
ATOM   1468 C  CA  A HIS C 3 58 ? 6.835   12.936  49.492  0.54 59.50  ? 66  HIS C CA  1 
ATOM   1469 C  CA  B HIS C 3 58 ? 6.843   12.891  49.625  0.46 60.60  ? 66  HIS C CA  1 
ATOM   1470 C  C   A HIS C 3 58 ? 5.478   12.624  48.877  0.54 59.12  ? 66  HIS C C   1 
ATOM   1471 C  C   B HIS C 3 58 ? 5.518   12.421  49.015  0.46 59.64  ? 66  HIS C C   1 
ATOM   1472 O  O   A HIS C 3 58 ? 5.401   12.271  47.701  0.54 61.89  ? 66  HIS C O   1 
ATOM   1473 O  O   B HIS C 3 58 ? 5.509   11.736  47.992  0.46 61.67  ? 66  HIS C O   1 
ATOM   1474 C  CB  A HIS C 3 58 ? 7.237   11.773  50.432  0.54 60.94  ? 66  HIS C CB  1 
ATOM   1475 C  CB  B HIS C 3 58 ? 7.361   11.890  50.666  0.46 63.49  ? 66  HIS C CB  1 
ATOM   1476 C  CG  A HIS C 3 58 ? 7.694   10.531  49.707  0.54 65.33  ? 66  HIS C CG  1 
ATOM   1477 C  CG  B HIS C 3 58 ? 8.854   11.909  50.813  0.46 70.01  ? 66  HIS C CG  1 
ATOM   1478 N  ND1 A HIS C 3 58 ? 7.319   9.256   50.084  0.54 64.86  ? 66  HIS C ND1 1 
ATOM   1479 N  ND1 B HIS C 3 58 ? 9.698   11.215  49.968  0.46 71.44  ? 66  HIS C ND1 1 
ATOM   1480 C  CD2 A HIS C 3 58 ? 8.525   10.375  48.643  0.54 66.69  ? 66  HIS C CD2 1 
ATOM   1481 C  CD2 B HIS C 3 58 ? 9.659   12.599  51.655  0.46 71.18  ? 66  HIS C CD2 1 
ATOM   1482 C  CE1 A HIS C 3 58 ? 7.894   8.373   49.284  0.54 64.96  ? 66  HIS C CE1 1 
ATOM   1483 C  CE1 B HIS C 3 58 ? 10.954  11.481  50.282  0.46 72.22  ? 66  HIS C CE1 1 
ATOM   1484 N  NE2 A HIS C 3 58 ? 8.631   9.026   48.401  0.54 65.53  ? 66  HIS C NE2 1 
ATOM   1485 N  NE2 B HIS C 3 58 ? 10.956  12.319  51.302  0.46 72.79  ? 66  HIS C NE2 1 
ATOM   1486 N  N   . ILE C 3 59 ? 4.409   12.774  49.665  1.00 57.14  ? 67  ILE C N   1 
ATOM   1487 C  CA  . ILE C 3 59 ? 3.079   12.463  49.170  1.00 52.32  ? 67  ILE C CA  1 
ATOM   1488 C  C   . ILE C 3 59 ? 2.859   13.287  47.909  1.00 51.52  ? 67  ILE C C   1 
ATOM   1489 O  O   . ILE C 3 59 ? 2.407   12.770  46.902  1.00 52.94  ? 67  ILE C O   1 
ATOM   1490 C  CB  . ILE C 3 59 ? 1.980   12.784  50.210  1.00 50.93  ? 67  ILE C CB  1 
ATOM   1491 C  CG1 . ILE C 3 59 ? 1.920   11.662  51.256  1.00 45.80  ? 67  ILE C CG1 1 
ATOM   1492 C  CG2 . ILE C 3 59 ? 0.627   12.938  49.499  1.00 47.95  ? 67  ILE C CG2 1 
ATOM   1493 C  CD1 . ILE C 3 59 ? 1.116   11.972  52.457  1.00 44.98  ? 67  ILE C CD1 1 
ATOM   1494 N  N   . ASN C 3 60 ? 3.217   14.562  47.953  1.00 50.12  ? 68  ASN C N   1 
ATOM   1495 C  CA  . ASN C 3 60 ? 3.075   15.420  46.797  1.00 48.91  ? 68  ASN C CA  1 
ATOM   1496 C  C   . ASN C 3 60 ? 3.769   14.816  45.562  1.00 51.07  ? 68  ASN C C   1 
ATOM   1497 O  O   . ASN C 3 60 ? 3.175   14.711  44.496  1.00 51.49  ? 68  ASN C O   1 
ATOM   1498 C  CB  . ASN C 3 60 ? 3.669   16.786  47.109  1.00 47.28  ? 68  ASN C CB  1 
ATOM   1499 C  CG  . ASN C 3 60 ? 3.678   17.689  45.911  1.00 48.51  ? 68  ASN C CG  1 
ATOM   1500 O  OD1 . ASN C 3 60 ? 2.649   17.906  45.290  1.00 48.88  ? 68  ASN C OD1 1 
ATOM   1501 N  ND2 . ASN C 3 60 ? 4.840   18.221  45.574  1.00 48.74  ? 68  ASN C ND2 1 
ATOM   1502 N  N   . GLN C 3 61 ? 5.023   14.409  45.711  1.00 53.48  ? 69  GLN C N   1 
ATOM   1503 C  CA  . GLN C 3 61 ? 5.781   13.826  44.605  1.00 55.44  ? 69  GLN C CA  1 
ATOM   1504 C  C   . GLN C 3 61 ? 5.168   12.555  44.066  1.00 54.04  ? 69  GLN C C   1 
ATOM   1505 O  O   . GLN C 3 61 ? 5.121   12.346  42.863  1.00 54.16  ? 69  GLN C O   1 
ATOM   1506 C  CB  . GLN C 3 61 ? 7.209   13.528  45.048  1.00 60.00  ? 69  GLN C CB  1 
ATOM   1507 C  CG  . GLN C 3 61 ? 7.887   14.725  45.667  1.00 66.25  ? 69  GLN C CG  1 
ATOM   1508 C  CD  . GLN C 3 61 ? 9.233   14.393  46.288  1.00 70.05  ? 69  GLN C CD  1 
ATOM   1509 O  OE1 . GLN C 3 61 ? 9.782   15.200  47.046  1.00 71.85  ? 69  GLN C OE1 1 
ATOM   1510 N  NE2 . GLN C 3 61 ? 9.779   13.205  45.969  1.00 70.79  ? 69  GLN C NE2 1 
ATOM   1511 N  N   . ASP C 3 62 ? 4.719   11.687  44.963  1.00 54.37  ? 70  ASP C N   1 
ATOM   1512 C  CA  . ASP C 3 62 ? 4.101   10.440  44.550  1.00 53.86  ? 70  ASP C CA  1 
ATOM   1513 C  C   . ASP C 3 62 ? 2.785   10.661  43.812  1.00 53.36  ? 70  ASP C C   1 
ATOM   1514 O  O   . ASP C 3 62 ? 2.531   9.987   42.813  1.00 51.88  ? 70  ASP C O   1 
ATOM   1515 C  CB  . ASP C 3 62 ? 3.892   9.524   45.760  1.00 55.47  ? 70  ASP C CB  1 
ATOM   1516 C  CG  . ASP C 3 62 ? 5.189   8.886   46.231  1.00 57.38  ? 70  ASP C CG  1 
ATOM   1517 O  OD1 . ASP C 3 62 ? 6.158   8.857   45.440  1.00 58.14  ? 70  ASP C OD1 1 
ATOM   1518 O  OD2 . ASP C 3 62 ? 5.250   8.395   47.377  1.00 58.63  ? 70  ASP C OD2 1 
ATOM   1519 N  N   . MET C 3 63 ? 1.967   11.608  44.286  1.00 54.05  ? 71  MET C N   1 
ATOM   1520 C  CA  . MET C 3 63 ? 0.687   11.903  43.640  1.00 55.04  ? 71  MET C CA  1 
ATOM   1521 C  C   . MET C 3 63 ? 0.872   12.392  42.219  1.00 57.53  ? 71  MET C C   1 
ATOM   1522 O  O   . MET C 3 63 ? -0.008  12.214  41.376  1.00 59.09  ? 71  MET C O   1 
ATOM   1523 C  CB  . MET C 3 63 ? -0.115  12.929  44.423  1.00 53.26  ? 71  MET C CB  1 
ATOM   1524 C  CG  . MET C 3 63 ? -0.768  12.334  45.643  1.00 54.13  ? 71  MET C CG  1 
ATOM   1525 S  SD  . MET C 3 63 ? -1.260  10.598  45.367  1.00 56.16  ? 71  MET C SD  1 
ATOM   1526 C  CE  . MET C 3 63 ? -2.927  10.894  44.547  1.00 51.86  ? 71  MET C CE  1 
ATOM   1527 N  N   . LYS C 3 64 ? 2.008   13.015  41.936  1.00 58.46  ? 72  LYS C N   1 
ATOM   1528 C  CA  . LYS C 3 64 ? 2.254   13.449  40.574  1.00 58.14  ? 72  LYS C CA  1 
ATOM   1529 C  C   . LYS C 3 64 ? 2.379   12.210  39.681  1.00 59.11  ? 72  LYS C C   1 
ATOM   1530 O  O   . LYS C 3 64 ? 1.942   12.203  38.524  1.00 58.61  ? 72  LYS C O   1 
ATOM   1531 C  CB  . LYS C 3 64 ? 3.539   14.240  40.507  1.00 59.03  ? 72  LYS C CB  1 
ATOM   1532 C  CG  . LYS C 3 64 ? 3.458   15.614  41.142  1.00 60.31  ? 72  LYS C CG  1 
ATOM   1533 C  CD  . LYS C 3 64 ? 4.821   16.239  41.055  1.00 61.58  ? 72  LYS C CD  1 
ATOM   1534 C  CE  . LYS C 3 64 ? 4.879   17.599  41.674  1.00 60.85  ? 72  LYS C CE  1 
ATOM   1535 N  NZ  . LYS C 3 64 ? 6.306   17.996  41.704  1.00 59.92  ? 72  LYS C NZ  1 
ATOM   1536 N  N   . GLU C 3 65 ? 2.968   11.153  40.235  1.00 59.11  ? 73  GLU C N   1 
ATOM   1537 C  CA  . GLU C 3 65 ? 3.167   9.917   39.491  1.00 58.92  ? 73  GLU C CA  1 
ATOM   1538 C  C   . GLU C 3 65 ? 1.839   9.235   39.273  1.00 58.48  ? 73  GLU C C   1 
ATOM   1539 O  O   . GLU C 3 65 ? 1.597   8.682   38.208  1.00 56.64  ? 73  GLU C O   1 
ATOM   1540 C  CB  . GLU C 3 65 ? 4.094   8.971   40.257  1.00 62.05  ? 73  GLU C CB  1 
ATOM   1541 C  CG  . GLU C 3 65 ? 5.495   9.499   40.483  1.00 66.13  ? 73  GLU C CG  1 
ATOM   1542 C  CD  . GLU C 3 65 ? 6.196   9.812   39.178  1.00 68.85  ? 73  GLU C CD  1 
ATOM   1543 O  OE1 . GLU C 3 65 ? 6.332   8.893   38.333  1.00 70.13  ? 73  GLU C OE1 1 
ATOM   1544 O  OE2 . GLU C 3 65 ? 6.605   10.980  39.000  1.00 70.76  ? 73  GLU C OE2 1 
ATOM   1545 N  N   . ALA C 3 66 ? 0.988   9.253   40.297  1.00 57.70  ? 74  ALA C N   1 
ATOM   1546 C  CA  . ALA C 3 66 ? -0.314  8.630   40.175  1.00 58.19  ? 74  ALA C CA  1 
ATOM   1547 C  C   . ALA C 3 66 ? -1.054  9.393   39.089  1.00 59.03  ? 74  ALA C C   1 
ATOM   1548 O  O   . ALA C 3 66 ? -1.684  8.791   38.221  1.00 55.55  ? 74  ALA C O   1 
ATOM   1549 C  CB  . ALA C 3 66 ? -1.074  8.711   41.482  1.00 56.90  ? 74  ALA C CB  1 
ATOM   1550 N  N   . GLU C 3 67 ? -0.957  10.721  39.135  1.00 60.88  ? 75  GLU C N   1 
ATOM   1551 C  CA  . GLU C 3 67 ? -1.615  11.568  38.146  1.00 64.85  ? 75  GLU C CA  1 
ATOM   1552 C  C   . GLU C 3 67 ? -1.071  11.267  36.730  1.00 66.84  ? 75  GLU C C   1 
ATOM   1553 O  O   . GLU C 3 67 ? -1.833  11.119  35.765  1.00 64.67  ? 75  GLU C O   1 
ATOM   1554 C  CB  . GLU C 3 67 ? -1.459  13.048  38.555  1.00 64.91  ? 75  GLU C CB  1 
ATOM   1555 C  CG  . GLU C 3 67 ? -2.681  13.578  39.381  1.00 69.23  ? 75  GLU C CG  1 
ATOM   1556 C  CD  . GLU C 3 67 ? -2.353  14.354  40.705  1.00 71.88  ? 75  GLU C CD  1 
ATOM   1557 O  OE1 . GLU C 3 67 ? -1.571  15.348  40.688  1.00 71.91  ? 75  GLU C OE1 1 
ATOM   1558 O  OE2 . GLU C 3 67 ? -2.918  13.979  41.769  1.00 69.22  ? 75  GLU C OE2 1 
ATOM   1559 N  N   . LYS C 3 68 ? 0.249   11.139  36.618  1.00 69.61  ? 76  LYS C N   1 
ATOM   1560 C  CA  . LYS C 3 68 ? 0.874   10.816  35.340  1.00 70.80  ? 76  LYS C CA  1 
ATOM   1561 C  C   . LYS C 3 68 ? 0.347   9.443   34.889  1.00 72.42  ? 76  LYS C C   1 
ATOM   1562 O  O   . LYS C 3 68 ? -0.159  9.292   33.781  1.00 72.25  ? 76  LYS C O   1 
ATOM   1563 C  CB  . LYS C 3 68 ? 2.400   10.789  35.500  1.00 70.36  ? 76  LYS C CB  1 
ATOM   1564 C  CG  . LYS C 3 68 ? 3.189   10.560  34.217  1.00 70.93  ? 76  LYS C CG  1 
ATOM   1565 C  CD  . LYS C 3 68 ? 4.686   10.614  34.474  0.00 71.46  ? 76  LYS C CD  1 
ATOM   1566 C  CE  . LYS C 3 68 ? 5.475   10.414  33.189  0.00 71.83  ? 76  LYS C CE  1 
ATOM   1567 N  NZ  . LYS C 3 68 ? 6.944   10.506  33.417  0.00 72.16  ? 76  LYS C NZ  1 
ATOM   1568 N  N   . ASN C 3 69 ? 0.456   8.442   35.751  1.00 74.17  ? 77  ASN C N   1 
ATOM   1569 C  CA  . ASN C 3 69 ? -0.040  7.119   35.407  1.00 76.45  ? 77  ASN C CA  1 
ATOM   1570 C  C   . ASN C 3 69 ? -1.510  7.206   35.033  1.00 78.31  ? 77  ASN C C   1 
ATOM   1571 O  O   . ASN C 3 69 ? -1.885  6.910   33.908  1.00 78.54  ? 77  ASN C O   1 
ATOM   1572 C  CB  . ASN C 3 69 ? 0.124   6.161   36.582  1.00 75.84  ? 77  ASN C CB  1 
ATOM   1573 C  CG  . ASN C 3 69 ? 1.575   5.828   36.867  1.00 76.92  ? 77  ASN C CG  1 
ATOM   1574 O  OD1 . ASN C 3 69 ? 1.891   5.248   37.906  1.00 76.90  ? 77  ASN C OD1 1 
ATOM   1575 N  ND2 . ASN C 3 69 ? 2.464   6.179   35.942  1.00 77.01  ? 77  ASN C ND2 1 
ATOM   1576 N  N   . LEU C 3 70 ? -2.334  7.628   35.986  1.00 81.98  ? 78  LEU C N   1 
ATOM   1577 C  CA  . LEU C 3 70 ? -3.779  7.751   35.790  1.00 85.18  ? 78  LEU C CA  1 
ATOM   1578 C  C   . LEU C 3 70 ? -4.142  8.338   34.420  1.00 87.60  ? 78  LEU C C   1 
ATOM   1579 O  O   . LEU C 3 70 ? -4.995  7.797   33.720  1.00 88.08  ? 78  LEU C O   1 
ATOM   1580 C  CB  . LEU C 3 70 ? -4.384  8.598   36.917  1.00 84.90  ? 78  LEU C CB  1 
ATOM   1581 C  CG  . LEU C 3 70 ? -5.576  8.032   37.709  1.00 84.79  ? 78  LEU C CG  1 
ATOM   1582 C  CD1 . LEU C 3 70 ? -5.314  6.602   38.150  1.00 84.94  ? 78  LEU C CD1 1 
ATOM   1583 C  CD2 . LEU C 3 70 ? -5.827  8.908   38.928  1.00 84.20  ? 78  LEU C CD2 1 
ATOM   1584 N  N   . LYS C 3 71 ? -3.495  9.435   34.038  1.00 89.87  ? 79  LYS C N   1 
ATOM   1585 C  CA  . LYS C 3 71 ? -3.754  10.048  32.744  1.00 91.71  ? 79  LYS C CA  1 
ATOM   1586 C  C   . LYS C 3 71 ? -3.404  9.092   31.606  1.00 93.20  ? 79  LYS C C   1 
ATOM   1587 O  O   . LYS C 3 71 ? -4.170  8.925   30.659  1.00 94.38  ? 79  LYS C O   1 
ATOM   1588 C  CB  . LYS C 3 71 ? -2.929  11.322  32.570  1.00 92.59  ? 79  LYS C CB  1 
ATOM   1589 C  CG  . LYS C 3 71 ? -3.492  12.566  33.244  1.00 94.40  ? 79  LYS C CG  1 
ATOM   1590 C  CD  . LYS C 3 71 ? -2.869  13.815  32.625  1.00 95.07  ? 79  LYS C CD  1 
ATOM   1591 C  CE  . LYS C 3 71 ? -3.528  15.092  33.116  1.00 96.56  ? 79  LYS C CE  1 
ATOM   1592 N  NZ  . LYS C 3 71 ? -3.182  16.254  32.232  1.00 97.32  ? 79  LYS C NZ  1 
ATOM   1593 N  N   . ASP C 3 72 ? -2.239  8.467   31.701  1.00 94.21  ? 80  ASP C N   1 
ATOM   1594 C  CA  . ASP C 3 72 ? -1.779  7.549   30.673  1.00 95.10  ? 80  ASP C CA  1 
ATOM   1595 C  C   . ASP C 3 72 ? -2.654  6.317   30.505  1.00 95.63  ? 80  ASP C C   1 
ATOM   1596 O  O   . ASP C 3 72 ? -2.174  5.242   30.144  1.00 95.66  ? 80  ASP C O   1 
ATOM   1597 C  CB  . ASP C 3 72 ? -0.340  7.146   30.967  1.00 95.75  ? 80  ASP C CB  1 
ATOM   1598 C  CG  . ASP C 3 72 ? 0.611   8.320   30.875  1.00 97.64  ? 80  ASP C CG  1 
ATOM   1599 O  OD1 . ASP C 3 72 ? 0.201   9.446   31.243  1.00 98.47  ? 80  ASP C OD1 1 
ATOM   1600 O  OD2 . ASP C 3 72 ? 1.769   8.122   30.446  1.00 98.96  ? 80  ASP C OD2 1 
ATOM   1601 N  N   . LEU C 3 73 ? -3.944  6.484   30.773  1.00 96.11  ? 81  LEU C N   1 
ATOM   1602 C  CA  . LEU C 3 73 ? -4.912  5.405   30.624  1.00 97.14  ? 81  LEU C CA  1 
ATOM   1603 C  C   . LEU C 3 73 ? -6.176  5.954   29.955  1.00 97.95  ? 81  LEU C C   1 
ATOM   1604 O  O   . LEU C 3 73 ? -7.285  5.705   30.478  1.00 98.74  ? 81  LEU C O   1 
ATOM   1605 C  CB  . LEU C 3 73 ? -5.260  4.788   31.988  1.00 95.81  ? 81  LEU C CB  1 
ATOM   1606 C  CG  . LEU C 3 73 ? -4.215  3.912   32.685  1.00 94.82  ? 81  LEU C CG  1 
ATOM   1607 C  CD1 . LEU C 3 73 ? -4.777  3.311   33.963  1.00 93.86  ? 81  LEU C CD1 1 
ATOM   1608 C  CD2 . LEU C 3 73 ? -3.805  2.803   31.755  1.00 94.82  ? 81  LEU C CD2 1 
ATOM   1609 N  N   . GLY D 4 1  ? 23.142  42.910  108.648 1.00 80.84  ? 139 GLY D N   1 
ATOM   1610 C  CA  . GLY D 4 1  ? 24.312  42.050  108.333 1.00 81.44  ? 139 GLY D CA  1 
ATOM   1611 C  C   . GLY D 4 1  ? 24.258  40.759  109.129 1.00 81.73  ? 139 GLY D C   1 
ATOM   1612 O  O   . GLY D 4 1  ? 25.265  40.054  109.259 1.00 82.88  ? 139 GLY D O   1 
ATOM   1613 N  N   . SER D 4 2  ? 23.079  40.451  109.665 1.00 80.03  ? 140 SER D N   1 
ATOM   1614 C  CA  . SER D 4 2  ? 22.875  39.246  110.456 1.00 78.71  ? 140 SER D CA  1 
ATOM   1615 C  C   . SER D 4 2  ? 22.926  38.006  109.578 1.00 78.95  ? 140 SER D C   1 
ATOM   1616 O  O   . SER D 4 2  ? 23.008  38.109  108.356 1.00 78.13  ? 140 SER D O   1 
ATOM   1617 C  CB  . SER D 4 2  ? 21.521  39.296  111.146 1.00 78.09  ? 140 SER D CB  1 
ATOM   1618 O  OG  . SER D 4 2  ? 21.323  38.130  111.913 1.00 78.86  ? 140 SER D OG  1 
ATOM   1619 N  N   . ALA D 4 3  ? 22.878  36.831  110.204 1.00 78.79  ? 141 ALA D N   1 
ATOM   1620 C  CA  . ALA D 4 3  ? 22.902  35.580  109.459 1.00 77.26  ? 141 ALA D CA  1 
ATOM   1621 C  C   . ALA D 4 3  ? 21.658  35.557  108.585 1.00 76.64  ? 141 ALA D C   1 
ATOM   1622 O  O   . ALA D 4 3  ? 21.723  35.186  107.410 1.00 76.08  ? 141 ALA D O   1 
ATOM   1623 C  CB  . ALA D 4 3  ? 22.899  34.391  110.410 1.00 79.32  ? 141 ALA D CB  1 
ATOM   1624 N  N   . ARG D 4 4  ? 20.520  35.965  109.151 1.00 74.56  ? 142 ARG D N   1 
ATOM   1625 C  CA  . ARG D 4 4  ? 19.302  35.980  108.368 1.00 72.45  ? 142 ARG D CA  1 
ATOM   1626 C  C   . ARG D 4 4  ? 19.051  37.298  107.636 1.00 71.87  ? 142 ARG D C   1 
ATOM   1627 O  O   . ARG D 4 4  ? 18.300  37.326  106.663 1.00 73.26  ? 142 ARG D O   1 
ATOM   1628 C  CB  . ARG D 4 4  ? 18.091  35.519  109.203 1.00 69.94  ? 142 ARG D CB  1 
ATOM   1629 C  CG  . ARG D 4 4  ? 17.805  36.249  110.470 1.00 68.78  ? 142 ARG D CG  1 
ATOM   1630 C  CD  . ARG D 4 4  ? 17.433  35.257  111.584 1.00 66.02  ? 142 ARG D CD  1 
ATOM   1631 N  NE  . ARG D 4 4  ? 16.466  34.230  111.185 1.00 63.42  ? 142 ARG D NE  1 
ATOM   1632 C  CZ  . ARG D 4 4  ? 15.197  34.462  110.846 1.00 62.20  ? 142 ARG D CZ  1 
ATOM   1633 N  NH1 . ARG D 4 4  ? 14.722  35.696  110.851 1.00 58.38  ? 142 ARG D NH1 1 
ATOM   1634 N  NH2 . ARG D 4 4  ? 14.397  33.456  110.505 1.00 59.86  ? 142 ARG D NH2 1 
ATOM   1635 N  N   . GLU D 4 5  ? 19.684  38.384  108.065 1.00 71.36  ? 143 GLU D N   1 
ATOM   1636 C  CA  . GLU D 4 5  ? 19.533  39.639  107.336 1.00 70.16  ? 143 GLU D CA  1 
ATOM   1637 C  C   . GLU D 4 5  ? 20.282  39.474  106.010 1.00 68.59  ? 143 GLU D C   1 
ATOM   1638 O  O   . GLU D 4 5  ? 19.943  40.100  105.008 1.00 67.21  ? 143 GLU D O   1 
ATOM   1639 C  CB  . GLU D 4 5  ? 20.104  40.820  108.132 1.00 73.32  ? 143 GLU D CB  1 
ATOM   1640 C  CG  . GLU D 4 5  ? 19.187  41.272  109.270 1.00 77.73  ? 143 GLU D CG  1 
ATOM   1641 C  CD  . GLU D 4 5  ? 19.764  42.384  110.152 1.00 79.99  ? 143 GLU D CD  1 
ATOM   1642 O  OE1 . GLU D 4 5  ? 19.056  42.791  111.104 1.00 81.59  ? 143 GLU D OE1 1 
ATOM   1643 O  OE2 . GLU D 4 5  ? 20.904  42.849  109.908 1.00 81.46  ? 143 GLU D OE2 1 
ATOM   1644 N  N   . ASN D 4 6  ? 21.299  38.615  105.996 1.00 67.43  ? 144 ASN D N   1 
ATOM   1645 C  CA  . ASN D 4 6  ? 22.039  38.379  104.756 1.00 67.92  ? 144 ASN D CA  1 
ATOM   1646 C  C   . ASN D 4 6  ? 21.283  37.409  103.857 1.00 66.90  ? 144 ASN D C   1 
ATOM   1647 O  O   . ASN D 4 6  ? 21.379  37.499  102.634 1.00 67.39  ? 144 ASN D O   1 
ATOM   1648 C  CB  . ASN D 4 6  ? 23.443  37.806  105.006 1.00 68.52  ? 144 ASN D CB  1 
ATOM   1649 C  CG  . ASN D 4 6  ? 24.320  38.731  105.814 1.00 69.71  ? 144 ASN D CG  1 
ATOM   1650 O  OD1 . ASN D 4 6  ? 24.240  39.957  105.691 1.00 68.08  ? 144 ASN D OD1 1 
ATOM   1651 N  ND2 . ASN D 4 6  ? 25.178  38.147  106.643 1.00 69.93  ? 144 ASN D ND2 1 
ATOM   1652 N  N   . GLU D 4 7  ? 20.557  36.471  104.462 1.00 65.09  ? 145 GLU D N   1 
ATOM   1653 C  CA  . GLU D 4 7  ? 19.791  35.514  103.689 1.00 63.84  ? 145 GLU D CA  1 
ATOM   1654 C  C   . GLU D 4 7  ? 18.777  36.327  102.885 1.00 64.36  ? 145 GLU D C   1 
ATOM   1655 O  O   . GLU D 4 7  ? 18.567  36.080  101.704 1.00 64.94  ? 145 GLU D O   1 
ATOM   1656 C  CB  . GLU D 4 7  ? 19.065  34.507  104.598 1.00 61.02  ? 145 GLU D CB  1 
ATOM   1657 C  CG  . GLU D 4 7  ? 18.628  33.271  103.834 1.00 58.42  ? 145 GLU D CG  1 
ATOM   1658 C  CD  . GLU D 4 7  ? 17.671  32.360  104.591 1.00 59.29  ? 145 GLU D CD  1 
ATOM   1659 O  OE1 . GLU D 4 7  ? 17.566  32.452  105.831 1.00 58.87  ? 145 GLU D OE1 1 
ATOM   1660 O  OE2 . GLU D 4 7  ? 17.022  31.521  103.934 1.00 58.26  ? 145 GLU D OE2 1 
ATOM   1661 N  N   . MET D 4 8  ? 18.163  37.315  103.523 1.00 65.18  ? 146 MET D N   1 
ATOM   1662 C  CA  . MET D 4 8  ? 17.184  38.155  102.847 1.00 66.17  ? 146 MET D CA  1 
ATOM   1663 C  C   . MET D 4 8  ? 17.808  38.791  101.602 1.00 66.96  ? 146 MET D C   1 
ATOM   1664 O  O   . MET D 4 8  ? 17.217  38.775  100.524 1.00 67.43  ? 146 MET D O   1 
ATOM   1665 C  CB  . MET D 4 8  ? 16.677  39.247  103.795 1.00 66.14  ? 146 MET D CB  1 
ATOM   1666 C  CG  . MET D 4 8  ? 15.657  40.186  103.183 1.00 68.56  ? 146 MET D CG  1 
ATOM   1667 S  SD  . MET D 4 8  ? 13.963  39.937  103.784 1.00 72.69  ? 146 MET D SD  1 
ATOM   1668 C  CE  . MET D 4 8  ? 13.786  41.220  104.984 1.00 70.72  ? 146 MET D CE  1 
ATOM   1669 N  N   . ASP D 4 9  ? 19.010  39.335  101.736 1.00 67.66  ? 147 ASP D N   1 
ATOM   1670 C  CA  . ASP D 4 9  ? 19.647  39.971  100.591 1.00 68.85  ? 147 ASP D CA  1 
ATOM   1671 C  C   . ASP D 4 9  ? 20.034  38.997  99.489  1.00 69.11  ? 147 ASP D C   1 
ATOM   1672 O  O   . ASP D 4 9  ? 19.701  39.213  98.319  1.00 68.99  ? 147 ASP D O   1 
ATOM   1673 C  CB  . ASP D 4 9  ? 20.891  40.750  101.015 1.00 71.84  ? 147 ASP D CB  1 
ATOM   1674 C  CG  . ASP D 4 9  ? 20.590  41.820  102.062 1.00 75.71  ? 147 ASP D CG  1 
ATOM   1675 O  OD1 . ASP D 4 9  ? 19.455  42.365  102.065 1.00 75.27  ? 147 ASP D OD1 1 
ATOM   1676 O  OD2 . ASP D 4 9  ? 21.502  42.121  102.873 1.00 76.71  ? 147 ASP D OD2 1 
ATOM   1677 N  N   . GLU D 4 10 ? 20.746  37.935  99.853  1.00 68.04  ? 148 GLU D N   1 
ATOM   1678 C  CA  . GLU D 4 10 ? 21.191  36.946  98.874  1.00 67.64  ? 148 GLU D CA  1 
ATOM   1679 C  C   . GLU D 4 10 ? 20.038  36.242  98.155  1.00 65.10  ? 148 GLU D C   1 
ATOM   1680 O  O   . GLU D 4 10 ? 20.144  35.935  96.978  1.00 62.56  ? 148 GLU D O   1 
ATOM   1681 C  CB  . GLU D 4 10 ? 22.092  35.910  99.544  1.00 70.51  ? 148 GLU D CB  1 
ATOM   1682 C  CG  . GLU D 4 10 ? 23.355  36.487  100.169 1.00 75.49  ? 148 GLU D CG  1 
ATOM   1683 C  CD  . GLU D 4 10 ? 24.234  35.411  100.804 1.00 78.29  ? 148 GLU D CD  1 
ATOM   1684 O  OE1 . GLU D 4 10 ? 23.703  34.619  101.621 1.00 78.37  ? 148 GLU D OE1 1 
ATOM   1685 O  OE2 . GLU D 4 10 ? 25.451  35.363  100.493 1.00 79.68  ? 148 GLU D OE2 1 
ATOM   1686 N  N   . ASN D 4 11 ? 18.952  35.978  98.876  1.00 63.55  ? 149 ASN D N   1 
ATOM   1687 C  CA  . ASN D 4 11 ? 17.784  35.335  98.296  1.00 62.70  ? 149 ASN D CA  1 
ATOM   1688 C  C   . ASN D 4 11 ? 17.293  36.195  97.145  1.00 62.95  ? 149 ASN D C   1 
ATOM   1689 O  O   . ASN D 4 11 ? 17.110  35.705  96.028  1.00 64.96  ? 149 ASN D O   1 
ATOM   1690 C  CB  . ASN D 4 11 ? 16.671  35.201  99.340  1.00 61.89  ? 149 ASN D CB  1 
ATOM   1691 C  CG  . ASN D 4 11 ? 16.770  33.925  100.131 1.00 60.69  ? 149 ASN D CG  1 
ATOM   1692 O  OD1 . ASN D 4 11 ? 16.094  33.751  101.152 1.00 58.99  ? 149 ASN D OD1 1 
ATOM   1693 N  ND2 . ASN D 4 11 ? 17.610  33.013  99.661  1.00 58.61  ? 149 ASN D ND2 1 
ATOM   1694 N  N   . LEU D 4 12 ? 17.083  37.477  97.426  1.00 63.05  ? 150 LEU D N   1 
ATOM   1695 C  CA  . LEU D 4 12 ? 16.618  38.418  96.426  1.00 63.88  ? 150 LEU D CA  1 
ATOM   1696 C  C   . LEU D 4 12 ? 17.615  38.552  95.286  1.00 64.97  ? 150 LEU D C   1 
ATOM   1697 O  O   . LEU D 4 12 ? 17.234  38.536  94.117  1.00 63.85  ? 150 LEU D O   1 
ATOM   1698 C  CB  . LEU D 4 12 ? 16.346  39.786  97.060  1.00 64.70  ? 150 LEU D CB  1 
ATOM   1699 C  CG  . LEU D 4 12 ? 15.112  39.831  97.973  1.00 67.51  ? 150 LEU D CG  1 
ATOM   1700 C  CD1 . LEU D 4 12 ? 14.747  41.281  98.303  1.00 67.99  ? 150 LEU D CD1 1 
ATOM   1701 C  CD2 . LEU D 4 12 ? 13.933  39.154  97.272  1.00 67.22  ? 150 LEU D CD2 1 
ATOM   1702 N  N   . GLU D 4 13 ? 18.895  38.675  95.607  1.00 66.44  ? 151 GLU D N   1 
ATOM   1703 C  CA  . GLU D 4 13 ? 19.883  38.789  94.552  1.00 67.93  ? 151 GLU D CA  1 
ATOM   1704 C  C   . GLU D 4 13 ? 19.796  37.562  93.637  1.00 67.64  ? 151 GLU D C   1 
ATOM   1705 O  O   . GLU D 4 13 ? 19.870  37.689  92.413  1.00 68.30  ? 151 GLU D O   1 
ATOM   1706 C  CB  . GLU D 4 13 ? 21.291  38.920  95.137  1.00 70.43  ? 151 GLU D CB  1 
ATOM   1707 C  CG  . GLU D 4 13 ? 22.353  39.201  94.076  1.00 76.22  ? 151 GLU D CG  1 
ATOM   1708 C  CD  . GLU D 4 13 ? 23.740  39.443  94.662  1.00 79.77  ? 151 GLU D CD  1 
ATOM   1709 O  OE1 . GLU D 4 13 ? 23.832  40.252  95.617  1.00 80.49  ? 151 GLU D OE1 1 
ATOM   1710 O  OE2 . GLU D 4 13 ? 24.732  38.840  94.165  1.00 79.31  ? 151 GLU D OE2 1 
ATOM   1711 N  N   . GLN D 4 14 ? 19.609  36.377  94.214  1.00 66.38  ? 152 GLN D N   1 
ATOM   1712 C  CA  . GLN D 4 14 ? 19.519  35.181  93.386  1.00 65.92  ? 152 GLN D CA  1 
ATOM   1713 C  C   . GLN D 4 14 ? 18.204  35.136  92.615  1.00 64.79  ? 152 GLN D C   1 
ATOM   1714 O  O   . GLN D 4 14 ? 18.181  34.715  91.457  1.00 63.35  ? 152 GLN D O   1 
ATOM   1715 C  CB  . GLN D 4 14 ? 19.671  33.907  94.215  1.00 67.96  ? 152 GLN D CB  1 
ATOM   1716 C  CG  . GLN D 4 14 ? 19.992  32.692  93.347  1.00 73.70  ? 152 GLN D CG  1 
ATOM   1717 C  CD  . GLN D 4 14 ? 20.196  31.410  94.143  1.00 77.68  ? 152 GLN D CD  1 
ATOM   1718 O  OE1 . GLN D 4 14 ? 20.269  30.316  93.572  1.00 80.74  ? 152 GLN D OE1 1 
ATOM   1719 N  NE2 . GLN D 4 14 ? 20.292  31.537  95.465  1.00 78.53  ? 152 GLN D NE2 1 
ATOM   1720 N  N   . VAL D 4 15 ? 17.108  35.550  93.252  1.00 62.54  ? 153 VAL D N   1 
ATOM   1721 C  CA  . VAL D 4 15 ? 15.816  35.579  92.568  1.00 60.43  ? 153 VAL D CA  1 
ATOM   1722 C  C   . VAL D 4 15 ? 15.945  36.497  91.331  1.00 60.27  ? 153 VAL D C   1 
ATOM   1723 O  O   . VAL D 4 15 ? 15.631  36.097  90.212  1.00 60.31  ? 153 VAL D O   1 
ATOM   1724 C  CB  . VAL D 4 15 ? 14.690  36.096  93.506  1.00 59.44  ? 153 VAL D CB  1 
ATOM   1725 C  CG1 . VAL D 4 15 ? 13.475  36.469  92.700  1.00 59.51  ? 153 VAL D CG1 1 
ATOM   1726 C  CG2 . VAL D 4 15 ? 14.313  35.026  94.523  1.00 56.73  ? 153 VAL D CG2 1 
ATOM   1727 N  N   . SER D 4 16 ? 16.416  37.724  91.519  1.00 60.03  ? 154 SER D N   1 
ATOM   1728 C  CA  . SER D 4 16 ? 16.600  38.625  90.380  1.00 60.25  ? 154 SER D CA  1 
ATOM   1729 C  C   . SER D 4 16 ? 17.478  37.971  89.288  1.00 60.08  ? 154 SER D C   1 
ATOM   1730 O  O   . SER D 4 16 ? 17.243  38.168  88.083  1.00 60.23  ? 154 SER D O   1 
ATOM   1731 C  CB  . SER D 4 16 ? 17.234  39.946  90.838  1.00 60.59  ? 154 SER D CB  1 
ATOM   1732 O  OG  . SER D 4 16 ? 18.082  40.491  89.830  1.00 61.15  ? 154 SER D OG  1 
ATOM   1733 N  N   . GLY D 4 17 ? 18.479  37.193  89.702  1.00 57.25  ? 155 GLY D N   1 
ATOM   1734 C  CA  . GLY D 4 17 ? 19.340  36.549  88.724  1.00 55.95  ? 155 GLY D CA  1 
ATOM   1735 C  C   . GLY D 4 17 ? 18.588  35.509  87.917  1.00 57.13  ? 155 GLY D C   1 
ATOM   1736 O  O   . GLY D 4 17 ? 18.694  35.443  86.682  1.00 57.64  ? 155 GLY D O   1 
ATOM   1737 N  N   . ILE D 4 18 ? 17.821  34.676  88.614  1.00 56.25  ? 156 ILE D N   1 
ATOM   1738 C  CA  . ILE D 4 18 ? 17.048  33.645  87.947  1.00 55.27  ? 156 ILE D CA  1 
ATOM   1739 C  C   . ILE D 4 18 ? 15.988  34.279  87.053  1.00 53.55  ? 156 ILE D C   1 
ATOM   1740 O  O   . ILE D 4 18 ? 15.766  33.805  85.951  1.00 53.90  ? 156 ILE D O   1 
ATOM   1741 C  CB  . ILE D 4 18 ? 16.425  32.671  88.970  1.00 55.86  ? 156 ILE D CB  1 
ATOM   1742 C  CG1 . ILE D 4 18 ? 17.556  31.944  89.702  1.00 56.02  ? 156 ILE D CG1 1 
ATOM   1743 C  CG2 . ILE D 4 18 ? 15.570  31.623  88.257  1.00 56.70  ? 156 ILE D CG2 1 
ATOM   1744 C  CD1 . ILE D 4 18 ? 17.105  31.174  90.878  1.00 58.12  ? 156 ILE D CD1 1 
ATOM   1745 N  N   . ILE D 4 19 ? 15.366  35.366  87.495  1.00 53.17  ? 157 ILE D N   1 
ATOM   1746 C  CA  . ILE D 4 19 ? 14.370  36.033  86.660  1.00 54.61  ? 157 ILE D CA  1 
ATOM   1747 C  C   . ILE D 4 19 ? 14.990  36.439  85.318  1.00 56.53  ? 157 ILE D C   1 
ATOM   1748 O  O   . ILE D 4 19 ? 14.302  36.525  84.303  1.00 57.09  ? 157 ILE D O   1 
ATOM   1749 C  CB  . ILE D 4 19 ? 13.789  37.287  87.359  1.00 54.20  ? 157 ILE D CB  1 
ATOM   1750 C  CG1 . ILE D 4 19 ? 13.120  36.885  88.675  1.00 53.71  ? 157 ILE D CG1 1 
ATOM   1751 C  CG2 . ILE D 4 19 ? 12.759  37.974  86.472  1.00 51.55  ? 157 ILE D CG2 1 
ATOM   1752 C  CD1 . ILE D 4 19 ? 11.971  35.927  88.507  1.00 54.39  ? 157 ILE D CD1 1 
ATOM   1753 N  N   . GLY D 4 20 ? 16.296  36.684  85.310  1.00 58.85  ? 158 GLY D N   1 
ATOM   1754 C  CA  . GLY D 4 20 ? 16.962  37.050  84.072  1.00 59.33  ? 158 GLY D CA  1 
ATOM   1755 C  C   . GLY D 4 20 ? 16.995  35.862  83.132  1.00 60.96  ? 158 GLY D C   1 
ATOM   1756 O  O   . GLY D 4 20 ? 16.864  36.003  81.913  1.00 61.82  ? 158 GLY D O   1 
ATOM   1757 N  N   . ASN D 4 21 ? 17.180  34.672  83.695  1.00 62.08  ? 159 ASN D N   1 
ATOM   1758 C  CA  . ASN D 4 21 ? 17.210  33.466  82.887  1.00 61.97  ? 159 ASN D CA  1 
ATOM   1759 C  C   . ASN D 4 21 ? 15.805  33.241  82.355  1.00 62.00  ? 159 ASN D C   1 
ATOM   1760 O  O   . ASN D 4 21 ? 15.629  33.015  81.160  1.00 62.96  ? 159 ASN D O   1 
ATOM   1761 C  CB  . ASN D 4 21 ? 17.656  32.269  83.720  1.00 64.40  ? 159 ASN D CB  1 
ATOM   1762 C  CG  . ASN D 4 21 ? 19.048  32.451  84.303  1.00 68.32  ? 159 ASN D CG  1 
ATOM   1763 O  OD1 . ASN D 4 21 ? 19.355  31.929  85.386  1.00 72.06  ? 159 ASN D OD1 1 
ATOM   1764 N  ND2 . ASN D 4 21 ? 19.904  33.184  83.588  1.00 67.57  ? 159 ASN D ND2 1 
ATOM   1765 N  N   . LEU D 4 22 ? 14.805  33.313  83.233  1.00 59.69  ? 160 LEU D N   1 
ATOM   1766 C  CA  . LEU D 4 22 ? 13.420  33.130  82.813  1.00 59.36  ? 160 LEU D CA  1 
ATOM   1767 C  C   . LEU D 4 22 ? 13.048  34.045  81.640  1.00 60.80  ? 160 LEU D C   1 
ATOM   1768 O  O   . LEU D 4 22 ? 12.371  33.616  80.714  1.00 62.82  ? 160 LEU D O   1 
ATOM   1769 C  CB  . LEU D 4 22 ? 12.462  33.389  83.982  1.00 56.95  ? 160 LEU D CB  1 
ATOM   1770 C  CG  . LEU D 4 22 ? 12.529  32.398  85.139  1.00 54.45  ? 160 LEU D CG  1 
ATOM   1771 C  CD1 . LEU D 4 22 ? 11.544  32.802  86.238  1.00 51.48  ? 160 LEU D CD1 1 
ATOM   1772 C  CD2 . LEU D 4 22 ? 12.243  30.995  84.600  1.00 52.63  ? 160 LEU D CD2 1 
ATOM   1773 N  N   . ARG D 4 23 ? 13.483  35.304  81.683  1.00 61.76  ? 161 ARG D N   1 
ATOM   1774 C  CA  . ARG D 4 23 ? 13.191  36.270  80.617  1.00 62.64  ? 161 ARG D CA  1 
ATOM   1775 C  C   . ARG D 4 23 ? 13.745  35.759  79.294  1.00 62.46  ? 161 ARG D C   1 
ATOM   1776 O  O   . ARG D 4 23 ? 13.076  35.782  78.254  1.00 61.06  ? 161 ARG D O   1 
ATOM   1777 C  CB  . ARG D 4 23 ? 13.831  37.619  80.944  1.00 62.68  ? 161 ARG D CB  1 
ATOM   1778 C  CG  . ARG D 4 23 ? 13.655  38.688  79.886  1.00 64.16  ? 161 ARG D CG  1 
ATOM   1779 C  CD  . ARG D 4 23 ? 14.412  39.967  80.291  1.00 66.80  ? 161 ARG D CD  1 
ATOM   1780 N  NE  . ARG D 4 23 ? 14.065  41.098  79.437  1.00 68.88  ? 161 ARG D NE  1 
ATOM   1781 C  CZ  . ARG D 4 23 ? 14.574  41.313  78.230  1.00 70.37  ? 161 ARG D CZ  1 
ATOM   1782 N  NH1 . ARG D 4 23 ? 15.476  40.473  77.726  1.00 70.65  ? 161 ARG D NH1 1 
ATOM   1783 N  NH2 . ARG D 4 23 ? 14.161  42.354  77.516  1.00 69.74  ? 161 ARG D NH2 1 
ATOM   1784 N  N   . HIS D 4 24 ? 14.982  35.295  79.352  1.00 62.72  ? 162 HIS D N   1 
ATOM   1785 C  CA  . HIS D 4 24 ? 15.664  34.747  78.190  1.00 63.90  ? 162 HIS D CA  1 
ATOM   1786 C  C   . HIS D 4 24 ? 14.921  33.510  77.623  1.00 64.34  ? 162 HIS D C   1 
ATOM   1787 O  O   . HIS D 4 24 ? 14.899  33.285  76.412  1.00 65.02  ? 162 HIS D O   1 
ATOM   1788 C  CB  . HIS D 4 24 ? 17.085  34.370  78.599  1.00 64.93  ? 162 HIS D CB  1 
ATOM   1789 C  CG  . HIS D 4 24 ? 17.929  33.880  77.472  1.00 69.06  ? 162 HIS D CG  1 
ATOM   1790 N  ND1 . HIS D 4 24 ? 18.655  34.729  76.663  1.00 71.84  ? 162 HIS D ND1 1 
ATOM   1791 C  CD2 . HIS D 4 24 ? 18.149  32.631  77.001  1.00 71.16  ? 162 HIS D CD2 1 
ATOM   1792 C  CE1 . HIS D 4 24 ? 19.286  34.022  75.742  1.00 72.29  ? 162 HIS D CE1 1 
ATOM   1793 N  NE2 . HIS D 4 24 ? 18.995  32.746  75.925  1.00 72.71  ? 162 HIS D NE2 1 
ATOM   1794 N  N   . MET D 4 25 ? 14.324  32.699  78.494  1.00 64.10  ? 163 MET D N   1 
ATOM   1795 C  CA  . MET D 4 25 ? 13.600  31.507  78.043  1.00 63.21  ? 163 MET D CA  1 
ATOM   1796 C  C   . MET D 4 25 ? 12.226  31.905  77.482  1.00 62.67  ? 163 MET D C   1 
ATOM   1797 O  O   . MET D 4 25 ? 11.707  31.262  76.565  1.00 61.71  ? 163 MET D O   1 
ATOM   1798 C  CB  . MET D 4 25 ? 13.426  30.506  79.196  1.00 62.73  ? 163 MET D CB  1 
ATOM   1799 C  CG  . MET D 4 25 ? 14.689  29.716  79.576  1.00 65.45  ? 163 MET D CG  1 
ATOM   1800 S  SD  . MET D 4 25 ? 14.392  28.453  80.897  1.00 70.56  ? 163 MET D SD  1 
ATOM   1801 C  CE  . MET D 4 25 ? 14.443  29.463  82.342  1.00 68.42  ? 163 MET D CE  1 
ATOM   1802 N  N   . ALA D 4 26 ? 11.643  32.962  78.042  1.00 61.10  ? 164 ALA D N   1 
ATOM   1803 C  CA  . ALA D 4 26 ? 10.351  33.442  77.579  1.00 61.63  ? 164 ALA D CA  1 
ATOM   1804 C  C   . ALA D 4 26 ? 10.506  33.978  76.149  1.00 61.98  ? 164 ALA D C   1 
ATOM   1805 O  O   . ALA D 4 26 ? 9.592   33.877  75.325  1.00 61.01  ? 164 ALA D O   1 
ATOM   1806 C  CB  . ALA D 4 26 ? 9.845   34.537  78.502  1.00 61.51  ? 164 ALA D CB  1 
ATOM   1807 N  N   . LEU D 4 27 ? 11.676  34.548  75.857  1.00 61.99  ? 165 LEU D N   1 
ATOM   1808 C  CA  . LEU D 4 27 ? 11.937  35.080  74.534  1.00 60.61  ? 165 LEU D CA  1 
ATOM   1809 C  C   . LEU D 4 27 ? 12.219  33.957  73.552  1.00 61.02  ? 165 LEU D C   1 
ATOM   1810 O  O   . LEU D 4 27 ? 11.788  34.046  72.407  1.00 61.22  ? 165 LEU D O   1 
ATOM   1811 C  CB  . LEU D 4 27 ? 13.101  36.075  74.556  1.00 59.31  ? 165 LEU D CB  1 
ATOM   1812 C  CG  . LEU D 4 27 ? 12.830  37.377  75.329  1.00 59.56  ? 165 LEU D CG  1 
ATOM   1813 C  CD1 . LEU D 4 27 ? 14.094  38.245  75.311  1.00 57.05  ? 165 LEU D CD1 1 
ATOM   1814 C  CD2 . LEU D 4 27 ? 11.642  38.123  74.730  1.00 55.89  ? 165 LEU D CD2 1 
ATOM   1815 N  N   . ASP D 4 28 ? 12.932  32.905  73.969  1.00 61.47  ? 166 ASP D N   1 
ATOM   1816 C  CA  . ASP D 4 28 ? 13.183  31.791  73.040  1.00 62.13  ? 166 ASP D CA  1 
ATOM   1817 C  C   . ASP D 4 28 ? 11.852  31.119  72.750  1.00 61.48  ? 166 ASP D C   1 
ATOM   1818 O  O   . ASP D 4 28 ? 11.507  30.841  71.598  1.00 61.07  ? 166 ASP D O   1 
ATOM   1819 C  CB  . ASP D 4 28 ? 14.108  30.724  73.631  1.00 64.39  ? 166 ASP D CB  1 
ATOM   1820 C  CG  . ASP D 4 28 ? 15.552  31.165  73.703  1.00 67.77  ? 166 ASP D CG  1 
ATOM   1821 O  OD1 . ASP D 4 28 ? 16.039  31.801  72.736  1.00 68.22  ? 166 ASP D OD1 1 
ATOM   1822 O  OD2 . ASP D 4 28 ? 16.203  30.853  74.727  1.00 69.18  ? 166 ASP D OD2 1 
ATOM   1823 N  N   . MET D 4 29 ? 11.113  30.865  73.823  1.00 60.41  ? 167 MET D N   1 
ATOM   1824 C  CA  . MET D 4 29 ? 9.816   30.217  73.738  1.00 60.73  ? 167 MET D CA  1 
ATOM   1825 C  C   . MET D 4 29 ? 8.941   30.788  72.643  1.00 60.28  ? 167 MET D C   1 
ATOM   1826 O  O   . MET D 4 29 ? 8.560   30.076  71.705  1.00 59.92  ? 167 MET D O   1 
ATOM   1827 C  CB  . MET D 4 29 ? 9.089   30.353  75.061  1.00 60.83  ? 167 MET D CB  1 
ATOM   1828 C  CG  . MET D 4 29 ? 9.260   29.181  75.956  1.00 60.61  ? 167 MET D CG  1 
ATOM   1829 S  SD  . MET D 4 29 ? 8.191   29.421  77.345  1.00 62.36  ? 167 MET D SD  1 
ATOM   1830 C  CE  . MET D 4 29 ? 6.637   29.816  76.546  1.00 60.42  ? 167 MET D CE  1 
ATOM   1831 N  N   . GLY D 4 30 ? 8.626   32.073  72.785  1.00 59.65  ? 168 GLY D N   1 
ATOM   1832 C  CA  . GLY D 4 30 ? 7.792   32.766  71.818  1.00 59.74  ? 168 GLY D CA  1 
ATOM   1833 C  C   . GLY D 4 30 ? 8.356   32.764  70.407  1.00 59.78  ? 168 GLY D C   1 
ATOM   1834 O  O   . GLY D 4 30 ? 7.601   32.633  69.448  1.00 59.97  ? 168 GLY D O   1 
ATOM   1835 N  N   . ASN D 4 31 ? 9.666   32.911  70.253  1.00 59.49  ? 169 ASN D N   1 
ATOM   1836 C  CA  . ASN D 4 31 ? 10.219  32.908  68.904  1.00 61.34  ? 169 ASN D CA  1 
ATOM   1837 C  C   . ASN D 4 31 ? 10.049  31.521  68.301  1.00 61.00  ? 169 ASN D C   1 
ATOM   1838 O  O   . ASN D 4 31 ? 9.814   31.370  67.087  1.00 58.88  ? 169 ASN D O   1 
ATOM   1839 C  CB  . ASN D 4 31 ? 11.707  33.296  68.905  1.00 64.38  ? 169 ASN D CB  1 
ATOM   1840 C  CG  . ASN D 4 31 ? 11.926  34.802  69.067  1.00 68.02  ? 169 ASN D CG  1 
ATOM   1841 O  OD1 . ASN D 4 31 ? 11.502  35.606  68.226  1.00 69.80  ? 169 ASN D OD1 1 
ATOM   1842 N  ND2 . ASN D 4 31 ? 12.595  35.186  70.147  1.00 69.37  ? 169 ASN D ND2 1 
ATOM   1843 N  N   . GLU D 4 32 ? 10.165  30.503  69.154  1.00 59.67  ? 170 GLU D N   1 
ATOM   1844 C  CA  . GLU D 4 32 ? 10.031  29.139  68.682  1.00 57.69  ? 170 GLU D CA  1 
ATOM   1845 C  C   . GLU D 4 32 ? 8.574   28.874  68.381  1.00 56.54  ? 170 GLU D C   1 
ATOM   1846 O  O   . GLU D 4 32 ? 8.254   28.270  67.361  1.00 56.66  ? 170 GLU D O   1 
ATOM   1847 C  CB  . GLU D 4 32 ? 10.555  28.155  69.723  1.00 58.16  ? 170 GLU D CB  1 
ATOM   1848 C  CG  . GLU D 4 32 ? 10.666  26.730  69.219  1.00 59.69  ? 170 GLU D CG  1 
ATOM   1849 C  CD  . GLU D 4 32 ? 11.353  26.614  67.856  1.00 62.60  ? 170 GLU D CD  1 
ATOM   1850 O  OE1 . GLU D 4 32 ? 12.072  27.547  67.438  1.00 65.12  ? 170 GLU D OE1 1 
ATOM   1851 O  OE2 . GLU D 4 32 ? 11.183  25.577  67.193  1.00 62.45  ? 170 GLU D OE2 1 
ATOM   1852 N  N   . ILE D 4 33 ? 7.685   29.329  69.258  1.00 54.81  ? 171 ILE D N   1 
ATOM   1853 C  CA  . ILE D 4 33 ? 6.274   29.120  69.014  1.00 54.52  ? 171 ILE D CA  1 
ATOM   1854 C  C   . ILE D 4 33 ? 5.893   29.748  67.670  1.00 55.62  ? 171 ILE D C   1 
ATOM   1855 O  O   . ILE D 4 33 ? 5.218   29.103  66.868  1.00 57.64  ? 171 ILE D O   1 
ATOM   1856 C  CB  . ILE D 4 33 ? 5.400   29.701  70.158  1.00 54.98  ? 171 ILE D CB  1 
ATOM   1857 C  CG1 . ILE D 4 33 ? 5.830   29.089  71.491  1.00 54.39  ? 171 ILE D CG1 1 
ATOM   1858 C  CG2 . ILE D 4 33 ? 3.909   29.365  69.938  1.00 52.92  ? 171 ILE D CG2 1 
ATOM   1859 C  CD1 . ILE D 4 33 ? 5.987   27.603  71.434  1.00 52.33  ? 171 ILE D CD1 1 
ATOM   1860 N  N   . ASP D 4 34 ? 6.336   30.983  67.411  1.00 55.44  ? 172 ASP D N   1 
ATOM   1861 C  CA  . ASP D 4 34 ? 6.033   31.681  66.148  1.00 54.44  ? 172 ASP D CA  1 
ATOM   1862 C  C   . ASP D 4 34 ? 6.549   30.921  64.930  1.00 54.18  ? 172 ASP D C   1 
ATOM   1863 O  O   . ASP D 4 34 ? 5.809   30.663  63.990  1.00 55.28  ? 172 ASP D O   1 
ATOM   1864 C  CB  . ASP D 4 34 ? 6.645   33.092  66.124  1.00 55.54  ? 172 ASP D CB  1 
ATOM   1865 C  CG  . ASP D 4 34 ? 5.973   34.044  67.092  1.00 59.21  ? 172 ASP D CG  1 
ATOM   1866 O  OD1 . ASP D 4 34 ? 4.734   33.984  67.225  1.00 60.21  ? 172 ASP D OD1 1 
ATOM   1867 O  OD2 . ASP D 4 34 ? 6.676   34.875  67.715  1.00 63.10  ? 172 ASP D OD2 1 
ATOM   1868 N  N   . THR D 4 35 ? 7.825   30.567  64.926  1.00 53.09  ? 173 THR D N   1 
ATOM   1869 C  CA  . THR D 4 35 ? 8.353   29.838  63.790  1.00 53.18  ? 173 THR D CA  1 
ATOM   1870 C  C   . THR D 4 35 ? 7.461   28.623  63.529  1.00 53.25  ? 173 THR D C   1 
ATOM   1871 O  O   . THR D 4 35 ? 6.970   28.424  62.420  1.00 54.14  ? 173 THR D O   1 
ATOM   1872 C  CB  . THR D 4 35 ? 9.799   29.352  64.050  1.00 54.34  ? 173 THR D CB  1 
ATOM   1873 O  OG1 . THR D 4 35 ? 10.605  30.463  64.449  1.00 55.32  ? 173 THR D OG1 1 
ATOM   1874 C  CG2 . THR D 4 35 ? 10.395  28.750  62.791  1.00 52.71  ? 173 THR D CG2 1 
ATOM   1875 N  N   . GLN D 4 36 ? 7.252   27.813  64.562  1.00 52.53  ? 174 GLN D N   1 
ATOM   1876 C  CA  . GLN D 4 36 ? 6.433   26.618  64.426  1.00 51.69  ? 174 GLN D CA  1 
ATOM   1877 C  C   . GLN D 4 36 ? 4.997   26.901  63.980  1.00 51.72  ? 174 GLN D C   1 
ATOM   1878 O  O   . GLN D 4 36 ? 4.428   26.144  63.168  1.00 49.12  ? 174 GLN D O   1 
ATOM   1879 C  CB  . GLN D 4 36 ? 6.460   25.804  65.728  1.00 50.87  ? 174 GLN D CB  1 
ATOM   1880 C  CG  . GLN D 4 36 ? 7.792   25.084  65.962  1.00 48.37  ? 174 GLN D CG  1 
ATOM   1881 C  CD  . GLN D 4 36 ? 7.755   24.100  67.125  1.00 49.25  ? 174 GLN D CD  1 
ATOM   1882 O  OE1 . GLN D 4 36 ? 6.696   23.602  67.506  1.00 47.84  ? 174 GLN D OE1 1 
ATOM   1883 N  NE2 . GLN D 4 36 ? 8.925   23.800  67.683  1.00 47.76  ? 174 GLN D NE2 1 
ATOM   1884 N  N   . ASN D 4 37 ? 4.403   27.983  64.477  1.00 50.54  ? 175 ASN D N   1 
ATOM   1885 C  CA  . ASN D 4 37 ? 3.045   28.297  64.046  1.00 51.85  ? 175 ASN D CA  1 
ATOM   1886 C  C   . ASN D 4 37 ? 2.982   28.501  62.530  1.00 52.43  ? 175 ASN D C   1 
ATOM   1887 O  O   . ASN D 4 37 ? 1.994   28.124  61.877  1.00 54.39  ? 175 ASN D O   1 
ATOM   1888 C  CB  . ASN D 4 37 ? 2.504   29.538  64.752  1.00 50.30  ? 175 ASN D CB  1 
ATOM   1889 C  CG  . ASN D 4 37 ? 1.837   29.210  66.089  1.00 52.45  ? 175 ASN D CG  1 
ATOM   1890 O  OD1 . ASN D 4 37 ? 1.482   28.050  66.373  1.00 49.40  ? 175 ASN D OD1 1 
ATOM   1891 N  ND2 . ASN D 4 37 ? 1.649   30.233  66.908  1.00 51.35  ? 175 ASN D ND2 1 
ATOM   1892 N  N   . ARG D 4 38 ? 4.031   29.079  61.959  1.00 51.94  ? 176 ARG D N   1 
ATOM   1893 C  CA  . ARG D 4 38 ? 4.050   29.296  60.521  1.00 52.20  ? 176 ARG D CA  1 
ATOM   1894 C  C   . ARG D 4 38 ? 4.249   27.965  59.823  1.00 51.59  ? 176 ARG D C   1 
ATOM   1895 O  O   . ARG D 4 38 ? 3.618   27.682  58.810  1.00 50.06  ? 176 ARG D O   1 
ATOM   1896 C  CB  . ARG D 4 38 ? 5.155   30.269  60.129  1.00 54.07  ? 176 ARG D CB  1 
ATOM   1897 C  CG  . ARG D 4 38 ? 4.857   31.715  60.509  1.00 58.00  ? 176 ARG D CG  1 
ATOM   1898 C  CD  . ARG D 4 38 ? 5.911   32.664  59.928  1.00 64.43  ? 176 ARG D CD  1 
ATOM   1899 N  NE  . ARG D 4 38 ? 7.254   32.440  60.475  1.00 68.19  ? 176 ARG D NE  1 
ATOM   1900 C  CZ  . ARG D 4 38 ? 7.743   33.046  61.559  1.00 69.55  ? 176 ARG D CZ  1 
ATOM   1901 N  NH1 . ARG D 4 38 ? 7.005   33.929  62.226  1.00 70.76  ? 176 ARG D NH1 1 
ATOM   1902 N  NH2 . ARG D 4 38 ? 8.971   32.759  61.989  1.00 70.06  ? 176 ARG D NH2 1 
ATOM   1903 N  N   . GLN D 4 39 ? 5.122   27.135  60.374  1.00 50.62  ? 177 GLN D N   1 
ATOM   1904 C  CA  . GLN D 4 39 ? 5.347   25.832  59.777  1.00 49.53  ? 177 GLN D CA  1 
ATOM   1905 C  C   . GLN D 4 39 ? 4.078   24.984  59.833  1.00 47.96  ? 177 GLN D C   1 
ATOM   1906 O  O   . GLN D 4 39 ? 3.792   24.233  58.897  1.00 48.58  ? 177 GLN D O   1 
ATOM   1907 C  CB  . GLN D 4 39 ? 6.497   25.104  60.466  1.00 47.51  ? 177 GLN D CB  1 
ATOM   1908 C  CG  . GLN D 4 39 ? 6.717   23.690  59.937  1.00 51.02  ? 177 GLN D CG  1 
ATOM   1909 C  CD  . GLN D 4 39 ? 7.870   22.992  60.634  1.00 53.99  ? 177 GLN D CD  1 
ATOM   1910 O  OE1 . GLN D 4 39 ? 8.121   23.230  61.820  1.00 55.85  ? 177 GLN D OE1 1 
ATOM   1911 N  NE2 . GLN D 4 39 ? 8.571   22.120  59.913  1.00 51.55  ? 177 GLN D NE2 1 
ATOM   1912 N  N   . ILE D 4 40 ? 3.312   25.094  60.912  1.00 47.04  ? 178 ILE D N   1 
ATOM   1913 C  CA  . ILE D 4 40 ? 2.083   24.297  61.014  1.00 46.86  ? 178 ILE D CA  1 
ATOM   1914 C  C   . ILE D 4 40 ? 1.097   24.800  59.982  1.00 47.27  ? 178 ILE D C   1 
ATOM   1915 O  O   . ILE D 4 40 ? 0.333   24.021  59.415  1.00 47.16  ? 178 ILE D O   1 
ATOM   1916 C  CB  . ILE D 4 40 ? 1.480   24.327  62.458  1.00 45.79  ? 178 ILE D CB  1 
ATOM   1917 C  CG1 . ILE D 4 40 ? 2.506   23.723  63.442  1.00 44.00  ? 178 ILE D CG1 1 
ATOM   1918 C  CG2 . ILE D 4 40 ? 0.209   23.468  62.531  1.00 43.66  ? 178 ILE D CG2 1 
ATOM   1919 C  CD1 . ILE D 4 40 ? 2.283   24.062  64.902  1.00 41.36  ? 178 ILE D CD1 1 
ATOM   1920 N  N   . ASP D 4 41 ? 1.136   26.097  59.692  1.00 48.37  ? 179 ASP D N   1 
ATOM   1921 C  CA  . ASP D 4 41 ? 0.243   26.626  58.669  1.00 49.38  ? 179 ASP D CA  1 
ATOM   1922 C  C   . ASP D 4 41 ? 0.654   26.112  57.288  1.00 48.60  ? 179 ASP D C   1 
ATOM   1923 O  O   . ASP D 4 41 ? -0.184  25.666  56.483  1.00 50.22  ? 179 ASP D O   1 
ATOM   1924 C  CB  . ASP D 4 41 ? 0.248   28.153  58.673  1.00 51.60  ? 179 ASP D CB  1 
ATOM   1925 C  CG  . ASP D 4 41 ? -0.575  28.725  59.802  1.00 57.39  ? 179 ASP D CG  1 
ATOM   1926 O  OD1 . ASP D 4 41 ? -1.619  28.101  60.145  1.00 58.80  ? 179 ASP D OD1 1 
ATOM   1927 O  OD2 . ASP D 4 41 ? -0.187  29.797  60.331  1.00 60.31  ? 179 ASP D OD2 1 
ATOM   1928 N  N   . ARG D 4 42 ? 1.943   26.175  57.003  1.00 45.95  ? 180 ARG D N   1 
ATOM   1929 C  CA  . ARG D 4 42 ? 2.416   25.700  55.723  1.00 45.38  ? 180 ARG D CA  1 
ATOM   1930 C  C   . ARG D 4 42 ? 2.050   24.215  55.605  1.00 45.22  ? 180 ARG D C   1 
ATOM   1931 O  O   . ARG D 4 42 ? 1.542   23.777  54.557  1.00 45.48  ? 180 ARG D O   1 
ATOM   1932 C  CB  . ARG D 4 42 ? 3.931   25.923  55.617  1.00 43.87  ? 180 ARG D CB  1 
ATOM   1933 C  CG  . ARG D 4 42 ? 4.515   25.567  54.283  1.00 44.55  ? 180 ARG D CG  1 
ATOM   1934 C  CD  . ARG D 4 42 ? 6.010   25.899  54.209  1.00 46.19  ? 180 ARG D CD  1 
ATOM   1935 N  NE  . ARG D 4 42 ? 6.792   25.210  55.228  1.00 44.80  ? 180 ARG D NE  1 
ATOM   1936 C  CZ  . ARG D 4 42 ? 7.380   25.817  56.258  1.00 45.74  ? 180 ARG D CZ  1 
ATOM   1937 N  NH1 . ARG D 4 42 ? 7.289   27.127  56.403  1.00 43.61  ? 180 ARG D NH1 1 
ATOM   1938 N  NH2 . ARG D 4 42 ? 8.055   25.109  57.159  1.00 43.11  ? 180 ARG D NH2 1 
ATOM   1939 N  N   . ILE D 4 43 ? 2.261   23.444  56.681  1.00 44.58  ? 181 ILE D N   1 
ATOM   1940 C  CA  . ILE D 4 43 ? 1.955   22.012  56.642  1.00 45.33  ? 181 ILE D CA  1 
ATOM   1941 C  C   . ILE D 4 43 ? 0.449   21.730  56.378  1.00 45.46  ? 181 ILE D C   1 
ATOM   1942 O  O   . ILE D 4 43 ? 0.101   20.724  55.780  1.00 45.64  ? 181 ILE D O   1 
ATOM   1943 C  CB  . ILE D 4 43 ? 2.419   21.275  57.959  1.00 45.17  ? 181 ILE D CB  1 
ATOM   1944 C  CG1 . ILE D 4 43 ? 3.940   21.356  58.125  1.00 44.73  ? 181 ILE D CG1 1 
ATOM   1945 C  CG2 . ILE D 4 43 ? 2.032   19.813  57.911  1.00 41.48  ? 181 ILE D CG2 1 
ATOM   1946 C  CD1 . ILE D 4 43 ? 4.446   20.792  59.474  1.00 42.70  ? 181 ILE D CD1 1 
ATOM   1947 N  N   . MET D 4 44 ? -0.445  22.597  56.816  1.00 48.20  ? 182 MET D N   1 
ATOM   1948 C  CA  . MET D 4 44 ? -1.857  22.343  56.562  1.00 52.84  ? 182 MET D CA  1 
ATOM   1949 C  C   . MET D 4 44 ? -2.275  22.653  55.144  1.00 51.04  ? 182 MET D C   1 
ATOM   1950 O  O   . MET D 4 44 ? -3.165  22.006  54.598  1.00 52.28  ? 182 MET D O   1 
ATOM   1951 C  CB  . MET D 4 44 ? -2.738  23.093  57.551  1.00 56.13  ? 182 MET D CB  1 
ATOM   1952 C  CG  . MET D 4 44 ? -2.772  22.334  58.845  1.00 61.28  ? 182 MET D CG  1 
ATOM   1953 S  SD  . MET D 4 44 ? -4.140  22.730  59.831  1.00 62.29  ? 182 MET D SD  1 
ATOM   1954 C  CE  . MET D 4 44 ? -3.401  24.144  60.824  1.00 57.76  ? 182 MET D CE  1 
ATOM   1955 N  N   . GLU D 4 45 ? -1.636  23.644  54.552  1.00 50.42  ? 183 GLU D N   1 
ATOM   1956 C  CA  . GLU D 4 45 ? -1.934  23.975  53.176  1.00 50.43  ? 183 GLU D CA  1 
ATOM   1957 C  C   . GLU D 4 45 ? -1.405  22.810  52.325  1.00 49.11  ? 183 GLU D C   1 
ATOM   1958 O  O   . GLU D 4 45 ? -2.010  22.445  51.321  1.00 49.69  ? 183 GLU D O   1 
ATOM   1959 C  CB  . GLU D 4 45 ? -1.247  25.280  52.799  1.00 52.34  ? 183 GLU D CB  1 
ATOM   1960 C  CG  . GLU D 4 45 ? -1.441  26.364  53.831  1.00 57.86  ? 183 GLU D CG  1 
ATOM   1961 C  CD  . GLU D 4 45 ? -0.921  27.704  53.373  1.00 60.85  ? 183 GLU D CD  1 
ATOM   1962 O  OE1 . GLU D 4 45 ? -0.549  28.539  54.230  1.00 66.61  ? 183 GLU D OE1 1 
ATOM   1963 O  OE2 . GLU D 4 45 ? -0.891  27.934  52.154  1.00 63.34  ? 183 GLU D OE2 1 
ATOM   1964 N  N   . LYS D 4 46 ? -0.277  22.234  52.722  1.00 46.18  ? 184 LYS D N   1 
ATOM   1965 C  CA  . LYS D 4 46 ? 0.283   21.095  51.998  1.00 46.76  ? 184 LYS D CA  1 
ATOM   1966 C  C   . LYS D 4 46 ? -0.637  19.895  52.126  1.00 45.74  ? 184 LYS D C   1 
ATOM   1967 O  O   . LYS D 4 46 ? -0.908  19.204  51.150  1.00 46.65  ? 184 LYS D O   1 
ATOM   1968 C  CB  . LYS D 4 46 ? 1.675   20.712  52.536  1.00 45.63  ? 184 LYS D CB  1 
ATOM   1969 C  CG  . LYS D 4 46 ? 2.749   21.748  52.220  1.00 48.88  ? 184 LYS D CG  1 
ATOM   1970 C  CD  . LYS D 4 46 ? 4.124   21.277  52.615  1.00 46.81  ? 184 LYS D CD  1 
ATOM   1971 C  CE  . LYS D 4 46 ? 5.171   22.254  52.103  1.00 47.66  ? 184 LYS D CE  1 
ATOM   1972 N  NZ  . LYS D 4 46 ? 6.526   21.644  52.129  1.00 39.79  ? 184 LYS D NZ  1 
ATOM   1973 N  N   . ALA D 4 47 ? -1.113  19.651  53.334  1.00 46.67  ? 185 ALA D N   1 
ATOM   1974 C  CA  . ALA D 4 47 ? -1.989  18.512  53.578  1.00 48.85  ? 185 ALA D CA  1 
ATOM   1975 C  C   . ALA D 4 47 ? -3.289  18.717  52.825  1.00 49.54  ? 185 ALA D C   1 
ATOM   1976 O  O   . ALA D 4 47 ? -3.889  17.764  52.321  1.00 51.44  ? 185 ALA D O   1 
ATOM   1977 C  CB  . ALA D 4 47 ? -2.251  18.358  55.047  1.00 46.12  ? 185 ALA D CB  1 
ATOM   1978 N  N   . ASP D 4 48 ? -3.694  19.973  52.705  1.00 50.87  ? 186 ASP D N   1 
ATOM   1979 C  CA  . ASP D 4 48 ? -4.913  20.295  51.997  1.00 52.59  ? 186 ASP D CA  1 
ATOM   1980 C  C   . ASP D 4 48 ? -4.732  20.013  50.507  1.00 52.55  ? 186 ASP D C   1 
ATOM   1981 O  O   . ASP D 4 48 ? -5.632  19.510  49.834  1.00 52.95  ? 186 ASP D O   1 
ATOM   1982 C  CB  . ASP D 4 48 ? -5.258  21.756  52.230  1.00 57.25  ? 186 ASP D CB  1 
ATOM   1983 C  CG  . ASP D 4 48 ? -6.694  22.056  51.907  1.00 62.60  ? 186 ASP D CG  1 
ATOM   1984 O  OD1 . ASP D 4 48 ? -7.016  22.217  50.713  1.00 61.90  ? 186 ASP D OD1 1 
ATOM   1985 O  OD2 . ASP D 4 48 ? -7.505  22.104  52.859  1.00 68.11  ? 186 ASP D OD2 1 
ATOM   1986 N  N   . SER D 4 49 ? -3.549  20.311  49.988  1.00 50.61  ? 187 SER D N   1 
ATOM   1987 C  CA  . SER D 4 49 ? -3.286  20.067  48.581  1.00 48.78  ? 187 SER D CA  1 
ATOM   1988 C  C   . SER D 4 49 ? -3.263  18.549  48.330  1.00 50.02  ? 187 SER D C   1 
ATOM   1989 O  O   . SER D 4 49 ? -3.875  18.068  47.368  1.00 50.67  ? 187 SER D O   1 
ATOM   1990 C  CB  . SER D 4 49 ? -1.957  20.721  48.187  1.00 47.04  ? 187 SER D CB  1 
ATOM   1991 O  OG  . SER D 4 49 ? -1.551  20.361  46.882  1.00 46.63  ? 187 SER D OG  1 
ATOM   1992 N  N   . ASN D 4 50 ? -2.592  17.808  49.216  1.00 48.21  ? 188 ASN D N   1 
ATOM   1993 C  CA  . ASN D 4 50 ? -2.488  16.365  49.093  1.00 47.99  ? 188 ASN D CA  1 
ATOM   1994 C  C   . ASN D 4 50 ? -3.839  15.680  49.223  1.00 48.86  ? 188 ASN D C   1 
ATOM   1995 O  O   . ASN D 4 50 ? -4.145  14.749  48.479  1.00 45.49  ? 188 ASN D O   1 
ATOM   1996 C  CB  . ASN D 4 50 ? -1.533  15.798  50.156  1.00 46.83  ? 188 ASN D CB  1 
ATOM   1997 C  CG  . ASN D 4 50 ? -0.063  16.112  49.870  1.00 45.50  ? 188 ASN D CG  1 
ATOM   1998 O  OD1 . ASN D 4 50 ? 0.345   16.338  48.728  1.00 46.05  ? 188 ASN D OD1 1 
ATOM   1999 N  ND2 . ASN D 4 50 ? 0.738   16.097  50.912  1.00 43.18  ? 188 ASN D ND2 1 
ATOM   2000 N  N   . LYS D 4 51 ? -4.634  16.123  50.191  1.00 51.60  ? 189 LYS D N   1 
ATOM   2001 C  CA  . LYS D 4 51 ? -5.961  15.559  50.403  1.00 54.48  ? 189 LYS D CA  1 
ATOM   2002 C  C   . LYS D 4 51 ? -6.762  15.632  49.098  1.00 52.81  ? 189 LYS D C   1 
ATOM   2003 O  O   . LYS D 4 51 ? -7.361  14.663  48.681  1.00 54.08  ? 189 LYS D O   1 
ATOM   2004 C  CB  . LYS D 4 51 ? -6.687  16.342  51.491  1.00 59.23  ? 189 LYS D CB  1 
ATOM   2005 C  CG  . LYS D 4 51 ? -8.142  15.889  51.715  1.00 65.67  ? 189 LYS D CG  1 
ATOM   2006 C  CD  . LYS D 4 51 ? -8.901  16.942  52.546  1.00 70.16  ? 189 LYS D CD  1 
ATOM   2007 C  CE  . LYS D 4 51 ? -10.373 16.602  52.759  1.00 72.17  ? 189 LYS D CE  1 
ATOM   2008 N  NZ  . LYS D 4 51 ? -10.913 17.460  53.870  1.00 75.18  ? 189 LYS D NZ  1 
ATOM   2009 N  N   . THR D 4 52 ? -6.737  16.789  48.454  1.00 52.66  ? 190 THR D N   1 
ATOM   2010 C  CA  . THR D 4 52 ? -7.429  17.016  47.194  1.00 52.33  ? 190 THR D CA  1 
ATOM   2011 C  C   . THR D 4 52 ? -7.003  16.075  46.071  1.00 54.40  ? 190 THR D C   1 
ATOM   2012 O  O   . THR D 4 52 ? -7.848  15.470  45.385  1.00 54.38  ? 190 THR D O   1 
ATOM   2013 C  CB  . THR D 4 52 ? -7.170  18.422  46.704  1.00 51.13  ? 190 THR D CB  1 
ATOM   2014 O  OG1 . THR D 4 52 ? -7.700  19.342  47.654  1.00 51.39  ? 190 THR D OG1 1 
ATOM   2015 C  CG2 . THR D 4 52 ? -7.800  18.647  45.333  1.00 52.06  ? 190 THR D CG2 1 
ATOM   2016 N  N   . ARG D 4 53 ? -5.691  15.995  45.851  1.00 53.04  ? 191 ARG D N   1 
ATOM   2017 C  CA  . ARG D 4 53 ? -5.172  15.131  44.816  1.00 52.30  ? 191 ARG D CA  1 
ATOM   2018 C  C   . ARG D 4 53 ? -5.551  13.694  45.115  1.00 52.52  ? 191 ARG D C   1 
ATOM   2019 O  O   . ARG D 4 53 ? -5.851  12.935  44.200  1.00 53.10  ? 191 ARG D O   1 
ATOM   2020 C  CB  . ARG D 4 53 ? -3.662  15.284  44.713  1.00 51.87  ? 191 ARG D CB  1 
ATOM   2021 C  CG  . ARG D 4 53 ? -3.252  16.689  44.357  1.00 54.63  ? 191 ARG D CG  1 
ATOM   2022 C  CD  . ARG D 4 53 ? -1.763  16.861  44.406  1.00 57.69  ? 191 ARG D CD  1 
ATOM   2023 N  NE  . ARG D 4 53 ? -1.119  16.461  43.160  1.00 64.91  ? 191 ARG D NE  1 
ATOM   2024 C  CZ  . ARG D 4 53 ? 0.198   16.290  43.022  1.00 68.12  ? 191 ARG D CZ  1 
ATOM   2025 N  NH1 . ARG D 4 53 ? 1.013   16.477  44.059  1.00 67.63  ? 191 ARG D NH1 1 
ATOM   2026 N  NH2 . ARG D 4 53 ? 0.705   15.928  41.846  1.00 68.88  ? 191 ARG D NH2 1 
ATOM   2027 N  N   . ILE D 4 54 ? -5.554  13.317  46.393  1.00 53.28  ? 192 ILE D N   1 
ATOM   2028 C  CA  . ILE D 4 54 ? -5.916  11.953  46.766  1.00 53.20  ? 192 ILE D CA  1 
ATOM   2029 C  C   . ILE D 4 54 ? -7.414  11.718  46.578  1.00 55.55  ? 192 ILE D C   1 
ATOM   2030 O  O   . ILE D 4 54 ? -7.825  10.665  46.072  1.00 56.02  ? 192 ILE D O   1 
ATOM   2031 C  CB  . ILE D 4 54 ? -5.505  11.609  48.236  1.00 50.37  ? 192 ILE D CB  1 
ATOM   2032 C  CG1 . ILE D 4 54 ? -3.979  11.452  48.326  1.00 48.98  ? 192 ILE D CG1 1 
ATOM   2033 C  CG2 . ILE D 4 54 ? -6.134  10.296  48.682  1.00 46.70  ? 192 ILE D CG2 1 
ATOM   2034 C  CD1 . ILE D 4 54 ? -3.462  11.417  49.743  1.00 45.35  ? 192 ILE D CD1 1 
ATOM   2035 N  N   . ASP D 4 55 ? -8.238  12.678  46.981  1.00 56.97  ? 193 ASP D N   1 
ATOM   2036 C  CA  . ASP D 4 55 ? -9.678  12.509  46.798  1.00 58.78  ? 193 ASP D CA  1 
ATOM   2037 C  C   . ASP D 4 55 ? -9.968  12.426  45.301  1.00 58.46  ? 193 ASP D C   1 
ATOM   2038 O  O   . ASP D 4 55 ? -10.864 11.723  44.854  1.00 58.17  ? 193 ASP D O   1 
ATOM   2039 C  CB  . ASP D 4 55 ? -10.459 13.683  47.412  1.00 60.31  ? 193 ASP D CB  1 
ATOM   2040 C  CG  . ASP D 4 55 ? -10.357 13.736  48.942  1.00 62.45  ? 193 ASP D CG  1 
ATOM   2041 O  OD1 . ASP D 4 55 ? -10.299 12.664  49.602  1.00 62.48  ? 193 ASP D OD1 1 
ATOM   2042 O  OD2 . ASP D 4 55 ? -10.360 14.865  49.486  1.00 65.43  ? 193 ASP D OD2 1 
ATOM   2043 N  N   . GLU D 4 56 ? -9.187  13.142  44.514  1.00 59.77  ? 194 GLU D N   1 
ATOM   2044 C  CA  . GLU D 4 56 ? -9.401  13.119  43.088  1.00 63.48  ? 194 GLU D CA  1 
ATOM   2045 C  C   . GLU D 4 56 ? -8.806  11.898  42.389  1.00 64.92  ? 194 GLU D C   1 
ATOM   2046 O  O   . GLU D 4 56 ? -9.459  11.293  41.551  1.00 67.05  ? 194 GLU D O   1 
ATOM   2047 C  CB  . GLU D 4 56 ? -8.863  14.399  42.460  1.00 64.77  ? 194 GLU D CB  1 
ATOM   2048 C  CG  . GLU D 4 56 ? -9.556  15.651  42.951  1.00 68.65  ? 194 GLU D CG  1 
ATOM   2049 C  CD  . GLU D 4 56 ? -9.122  16.890  42.179  1.00 72.82  ? 194 GLU D CD  1 
ATOM   2050 O  OE1 . GLU D 4 56 ? -9.597  18.009  42.517  1.00 74.31  ? 194 GLU D OE1 1 
ATOM   2051 O  OE2 . GLU D 4 56 ? -8.309  16.743  41.230  1.00 73.34  ? 194 GLU D OE2 1 
ATOM   2052 N  N   . ALA D 4 57 ? -7.574  11.525  42.711  1.00 65.24  ? 195 ALA D N   1 
ATOM   2053 C  CA  . ALA D 4 57 ? -7.000  10.369  42.043  1.00 65.07  ? 195 ALA D CA  1 
ATOM   2054 C  C   . ALA D 4 57 ? -7.882  9.159   42.350  1.00 65.36  ? 195 ALA D C   1 
ATOM   2055 O  O   . ALA D 4 57 ? -7.976  8.221   41.555  1.00 64.53  ? 195 ALA D O   1 
ATOM   2056 C  CB  . ALA D 4 57 ? -5.570  10.133  42.519  1.00 63.46  ? 195 ALA D CB  1 
ATOM   2057 N  N   . ASN D 4 58 ? -8.548  9.201   43.496  1.00 65.96  ? 196 ASN D N   1 
ATOM   2058 C  CA  . ASN D 4 58 ? -9.408  8.105   43.892  1.00 69.53  ? 196 ASN D CA  1 
ATOM   2059 C  C   . ASN D 4 58 ? -10.669 8.009   43.027  1.00 72.12  ? 196 ASN D C   1 
ATOM   2060 O  O   . ASN D 4 58 ? -11.121 6.906   42.688  1.00 71.66  ? 196 ASN D O   1 
ATOM   2061 C  CB  . ASN D 4 58 ? -9.806  8.245   45.353  1.00 69.51  ? 196 ASN D CB  1 
ATOM   2062 C  CG  . ASN D 4 58 ? -10.073 6.916   45.995  1.00 69.40  ? 196 ASN D CG  1 
ATOM   2063 O  OD1 . ASN D 4 58 ? -10.663 6.843   47.063  1.00 72.95  ? 196 ASN D OD1 1 
ATOM   2064 N  ND2 . ASN D 4 58 ? -9.631  5.846   45.347  1.00 70.08  ? 196 ASN D ND2 1 
ATOM   2065 N  N   . GLN D 4 59 ? -11.246 9.158   42.682  1.00 74.17  ? 197 GLN D N   1 
ATOM   2066 C  CA  . GLN D 4 59 ? -12.428 9.163   41.834  1.00 75.68  ? 197 GLN D CA  1 
ATOM   2067 C  C   . GLN D 4 59 ? -12.050 8.523   40.511  1.00 75.10  ? 197 GLN D C   1 
ATOM   2068 O  O   . GLN D 4 59 ? -12.568 7.464   40.164  1.00 75.23  ? 197 GLN D O   1 
ATOM   2069 C  CB  . GLN D 4 59 ? -12.910 10.589  41.602  1.00 78.47  ? 197 GLN D CB  1 
ATOM   2070 C  CG  . GLN D 4 59 ? -13.127 11.351  42.880  1.00 83.61  ? 197 GLN D CG  1 
ATOM   2071 C  CD  . GLN D 4 59 ? -14.065 10.628  43.832  1.00 87.04  ? 197 GLN D CD  1 
ATOM   2072 O  OE1 . GLN D 4 59 ? -15.134 11.145  44.175  1.00 89.53  ? 197 GLN D OE1 1 
ATOM   2073 N  NE2 . GLN D 4 59 ? -13.670 9.428   44.270  1.00 87.68  ? 197 GLN D NE2 1 
ATOM   2074 N  N   . ARG D 4 60 ? -11.130 9.158   39.788  1.00 75.22  ? 198 ARG D N   1 
ATOM   2075 C  CA  . ARG D 4 60 ? -10.674 8.639   38.499  1.00 76.91  ? 198 ARG D CA  1 
ATOM   2076 C  C   . ARG D 4 60 ? -10.402 7.153   38.622  1.00 76.80  ? 198 ARG D C   1 
ATOM   2077 O  O   . ARG D 4 60 ? -10.871 6.357   37.807  1.00 76.21  ? 198 ARG D O   1 
ATOM   2078 C  CB  . ARG D 4 60 ? -9.384  9.332   38.035  1.00 77.35  ? 198 ARG D CB  1 
ATOM   2079 C  CG  . ARG D 4 60 ? -9.541  10.772  37.569  1.00 80.81  ? 198 ARG D CG  1 
ATOM   2080 C  CD  . ARG D 4 60 ? -8.186  11.376  37.216  1.00 84.00  ? 198 ARG D CD  1 
ATOM   2081 N  NE  . ARG D 4 60 ? -8.050  12.741  37.724  1.00 88.68  ? 198 ARG D NE  1 
ATOM   2082 C  CZ  . ARG D 4 60 ? -6.901  13.277  38.142  1.00 90.86  ? 198 ARG D CZ  1 
ATOM   2083 N  NH1 . ARG D 4 60 ? -5.776  12.569  38.113  1.00 91.12  ? 198 ARG D NH1 1 
ATOM   2084 N  NH2 . ARG D 4 60 ? -6.876  14.520  38.614  1.00 92.11  ? 198 ARG D NH2 1 
ATOM   2085 N  N   . ALA D 4 61 ? -9.639  6.789   39.651  1.00 76.91  ? 199 ALA D N   1 
ATOM   2086 C  CA  . ALA D 4 61 ? -9.288  5.401   39.890  1.00 77.01  ? 199 ALA D CA  1 
ATOM   2087 C  C   . ALA D 4 61 ? -10.536 4.533   39.895  1.00 77.14  ? 199 ALA D C   1 
ATOM   2088 O  O   . ALA D 4 61 ? -10.622 3.553   39.163  1.00 76.20  ? 199 ALA D O   1 
ATOM   2089 C  CB  . ALA D 4 61 ? -8.551  5.270   41.212  1.00 76.66  ? 199 ALA D CB  1 
ATOM   2090 N  N   . THR D 4 62 ? -11.509 4.921   40.710  1.00 78.65  ? 200 THR D N   1 
ATOM   2091 C  CA  . THR D 4 62 ? -12.753 4.183   40.850  1.00 80.12  ? 200 THR D CA  1 
ATOM   2092 C  C   . THR D 4 62 ? -13.623 4.144   39.594  1.00 82.36  ? 200 THR D C   1 
ATOM   2093 O  O   . THR D 4 62 ? -14.311 3.147   39.334  1.00 81.55  ? 200 THR D O   1 
ATOM   2094 C  CB  . THR D 4 62 ? -13.559 4.755   42.005  1.00 79.81  ? 200 THR D CB  1 
ATOM   2095 O  OG1 . THR D 4 62 ? -12.771 4.680   43.191  1.00 78.82  ? 200 THR D OG1 1 
ATOM   2096 C  CG2 . THR D 4 62 ? -14.844 3.975   42.216  1.00 80.56  ? 200 THR D CG2 1 
ATOM   2097 N  N   . LYS D 4 63 ? -13.602 5.216   38.811  1.00 84.26  ? 201 LYS D N   1 
ATOM   2098 C  CA  . LYS D 4 63 ? -14.405 5.234   37.595  1.00 86.54  ? 201 LYS D CA  1 
ATOM   2099 C  C   . LYS D 4 63 ? -13.899 4.189   36.603  1.00 87.51  ? 201 LYS D C   1 
ATOM   2100 O  O   . LYS D 4 63 ? -14.684 3.600   35.862  1.00 87.96  ? 201 LYS D O   1 
ATOM   2101 C  CB  . LYS D 4 63 ? -14.385 6.623   36.947  1.00 87.11  ? 201 LYS D CB  1 
ATOM   2102 C  CG  . LYS D 4 63 ? -15.035 7.707   37.795  1.00 88.17  ? 201 LYS D CG  1 
ATOM   2103 C  CD  . LYS D 4 63 ? -15.068 9.041   37.067  1.00 89.59  ? 201 LYS D CD  1 
ATOM   2104 C  CE  . LYS D 4 63 ? -15.274 10.221  38.027  1.00 90.28  ? 201 LYS D CE  1 
ATOM   2105 N  NZ  . LYS D 4 63 ? -16.535 10.144  38.817  1.00 89.83  ? 201 LYS D NZ  1 
ATOM   2106 N  N   . MET D 4 64 ? -12.589 3.956   36.599  1.00 88.82  ? 202 MET D N   1 
ATOM   2107 C  CA  . MET D 4 64 ? -11.988 2.986   35.694  1.00 90.13  ? 202 MET D CA  1 
ATOM   2108 C  C   . MET D 4 64 ? -12.188 1.547   36.135  1.00 91.73  ? 202 MET D C   1 
ATOM   2109 O  O   . MET D 4 64 ? -11.849 0.628   35.402  1.00 91.82  ? 202 MET D O   1 
ATOM   2110 C  CB  . MET D 4 64 ? -10.500 3.251   35.556  1.00 89.92  ? 202 MET D CB  1 
ATOM   2111 C  CG  . MET D 4 64 ? -10.176 4.611   35.003  1.00 91.15  ? 202 MET D CG  1 
ATOM   2112 S  SD  . MET D 4 64 ? -8.408  4.901   35.096  1.00 92.61  ? 202 MET D SD  1 
ATOM   2113 C  CE  . MET D 4 64 ? -7.859  3.953   33.685  1.00 92.25  ? 202 MET D CE  1 
ATOM   2114 N  N   . LEU D 4 65 ? -12.720 1.342   37.334  1.00 93.88  ? 203 LEU D N   1 
ATOM   2115 C  CA  . LEU D 4 65 ? -12.950 -0.014  37.805  1.00 96.26  ? 203 LEU D CA  1 
ATOM   2116 C  C   . LEU D 4 65 ? -14.340 -0.478  37.398  1.00 98.67  ? 203 LEU D C   1 
ATOM   2117 O  O   . LEU D 4 65 ? -14.894 -1.418  37.976  1.00 99.13  ? 203 LEU D O   1 
ATOM   2118 C  CB  . LEU D 4 65 ? -12.774 -0.105  39.322  1.00 94.87  ? 203 LEU D CB  1 
ATOM   2119 C  CG  . LEU D 4 65 ? -11.309 -0.114  39.760  1.00 94.89  ? 203 LEU D CG  1 
ATOM   2120 C  CD1 . LEU D 4 65 ? -11.210 -0.003  41.272  1.00 94.26  ? 203 LEU D CD1 1 
ATOM   2121 C  CD2 . LEU D 4 65 ? -10.646 -1.386  39.259  1.00 94.25  ? 203 LEU D CD2 1 
ATOM   2122 N  N   . TRP D 4 66 ? -14.896 0.196   36.394  1.00 100.75 ? 204 TRP D N   1 
ATOM   2123 C  CA  . TRP D 4 66 ? -16.216 -0.139  35.863  1.00 102.79 ? 204 TRP D CA  1 
ATOM   2124 C  C   . TRP D 4 66 ? -16.100 -0.396  34.360  1.00 103.42 ? 204 TRP D C   1 
ATOM   2125 O  O   . TRP D 4 66 ? -16.642 0.418   33.579  1.00 103.80 ? 204 TRP D O   1 
ATOM   2126 C  CB  . TRP D 4 66 ? -17.223 0.997   36.113  1.00 103.48 ? 204 TRP D CB  1 
ATOM   2127 C  CG  . TRP D 4 66 ? -17.606 1.198   37.558  1.00 104.70 ? 204 TRP D CG  1 
ATOM   2128 C  CD1 . TRP D 4 66 ? -17.870 0.224   38.485  1.00 105.40 ? 204 TRP D CD1 1 
ATOM   2129 C  CD2 . TRP D 4 66 ? -17.815 2.452   38.227  1.00 105.57 ? 204 TRP D CD2 1 
ATOM   2130 N  NE1 . TRP D 4 66 ? -18.227 0.794   39.686  1.00 105.32 ? 204 TRP D NE1 1 
ATOM   2131 C  CE2 . TRP D 4 66 ? -18.201 2.159   39.557  1.00 105.58 ? 204 TRP D CE2 1 
ATOM   2132 C  CE3 . TRP D 4 66 ? -17.711 3.796   37.833  1.00 106.12 ? 204 TRP D CE3 1 
ATOM   2133 C  CZ2 . TRP D 4 66 ? -18.488 3.162   40.494  1.00 105.69 ? 204 TRP D CZ2 1 
ATOM   2134 C  CZ3 . TRP D 4 66 ? -17.998 4.796   38.769  1.00 106.03 ? 204 TRP D CZ3 1 
ATOM   2135 C  CH2 . TRP D 4 66 ? -18.380 4.469   40.082  1.00 105.76 ? 204 TRP D CH2 1 
ATOM   2136 O  OXT . TRP D 4 66 ? -15.455 -1.403  33.982  1.00 103.96 ? 204 TRP D OXT 1 
ATOM   2137 N  N   . LYS E 5 9  ? -24.796 0.396   41.537  1.00 126.78 ? 32  LYS E N   1 
ATOM   2138 C  CA  . LYS E 5 9  ? -25.868 -0.422  42.173  1.00 126.88 ? 32  LYS E CA  1 
ATOM   2139 C  C   . LYS E 5 9  ? -25.529 -0.658  43.643  1.00 126.94 ? 32  LYS E C   1 
ATOM   2140 O  O   . LYS E 5 9  ? -25.778 0.204   44.487  1.00 127.31 ? 32  LYS E O   1 
ATOM   2141 C  CB  . LYS E 5 9  ? -26.010 -1.751  41.429  0.00 126.91 ? 32  LYS E CB  1 
ATOM   2142 C  CG  . LYS E 5 9  ? -26.329 -1.576  39.950  0.00 126.94 ? 32  LYS E CG  1 
ATOM   2143 C  CD  . LYS E 5 9  ? -26.404 -2.906  39.222  0.00 126.95 ? 32  LYS E CD  1 
ATOM   2144 C  CE  . LYS E 5 9  ? -26.715 -2.699  37.747  0.00 126.96 ? 32  LYS E CE  1 
ATOM   2145 N  NZ  . LYS E 5 9  ? -26.781 -3.986  37.002  0.00 126.95 ? 32  LYS E NZ  1 
ATOM   2146 N  N   . LYS E 5 10 ? -24.960 -1.819  43.954  1.00 126.62 ? 33  LYS E N   1 
ATOM   2147 C  CA  . LYS E 5 10 ? -24.582 -2.128  45.329  1.00 126.19 ? 33  LYS E CA  1 
ATOM   2148 C  C   . LYS E 5 10 ? -23.366 -1.275  45.702  1.00 126.04 ? 33  LYS E C   1 
ATOM   2149 O  O   . LYS E 5 10 ? -22.899 -1.296  46.846  1.00 126.08 ? 33  LYS E O   1 
ATOM   2150 C  CB  . LYS E 5 10 ? -24.230 -3.613  45.465  1.00 126.33 ? 33  LYS E CB  1 
ATOM   2151 C  CG  . LYS E 5 10 ? -23.973 -4.058  46.899  1.00 126.64 ? 33  LYS E CG  1 
ATOM   2152 C  CD  . LYS E 5 10 ? -23.483 -5.492  46.978  0.00 126.65 ? 33  LYS E CD  1 
ATOM   2153 C  CE  . LYS E 5 10 ? -22.079 -5.625  46.412  0.00 126.71 ? 33  LYS E CE  1 
ATOM   2154 N  NZ  . LYS E 5 10 ? -21.546 -7.004  46.582  0.00 126.75 ? 33  LYS E NZ  1 
ATOM   2155 N  N   . GLU E 5 11 ? -22.860 -0.529  44.722  1.00 125.30 ? 34  GLU E N   1 
ATOM   2156 C  CA  . GLU E 5 11 ? -21.700 0.336   44.910  1.00 124.53 ? 34  GLU E CA  1 
ATOM   2157 C  C   . GLU E 5 11 ? -22.116 1.639   45.582  1.00 123.83 ? 34  GLU E C   1 
ATOM   2158 O  O   . GLU E 5 11 ? -21.396 2.166   46.431  1.00 123.99 ? 34  GLU E O   1 
ATOM   2159 C  CB  . GLU E 5 11 ? -21.040 0.631   43.556  1.00 124.91 ? 34  GLU E CB  1 
ATOM   2160 C  CG  . GLU E 5 11 ? -19.568 1.073   43.616  1.00 125.08 ? 34  GLU E CG  1 
ATOM   2161 C  CD  . GLU E 5 11 ? -19.373 2.516   44.059  1.00 125.20 ? 34  GLU E CD  1 
ATOM   2162 O  OE1 . GLU E 5 11 ? -19.948 3.421   43.419  1.00 125.39 ? 34  GLU E OE1 1 
ATOM   2163 O  OE2 . GLU E 5 11 ? -18.633 2.747   45.040  1.00 125.27 ? 34  GLU E OE2 1 
ATOM   2164 N  N   . GLU E 5 12 ? -23.274 2.167   45.207  1.00 122.72 ? 35  GLU E N   1 
ATOM   2165 C  CA  . GLU E 5 12 ? -23.729 3.399   45.824  1.00 122.10 ? 35  GLU E CA  1 
ATOM   2166 C  C   . GLU E 5 12 ? -23.997 3.162   47.300  1.00 121.23 ? 35  GLU E C   1 
ATOM   2167 O  O   . GLU E 5 12 ? -23.884 4.076   48.115  1.00 120.73 ? 35  GLU E O   1 
ATOM   2168 C  CB  . GLU E 5 12 ? -24.986 3.923   45.134  1.00 122.89 ? 35  GLU E CB  1 
ATOM   2169 C  CG  . GLU E 5 12 ? -24.705 5.078   44.184  1.00 123.83 ? 35  GLU E CG  1 
ATOM   2170 C  CD  . GLU E 5 12 ? -24.001 6.247   44.869  1.00 123.88 ? 35  GLU E CD  1 
ATOM   2171 O  OE1 . GLU E 5 12 ? -24.600 6.868   45.776  1.00 123.62 ? 35  GLU E OE1 1 
ATOM   2172 O  OE2 . GLU E 5 12 ? -22.844 6.542   44.501  1.00 123.67 ? 35  GLU E OE2 1 
ATOM   2173 N  N   . GLU E 5 13 ? -24.346 1.926   47.641  1.00 120.56 ? 36  GLU E N   1 
ATOM   2174 C  CA  . GLU E 5 13 ? -24.611 1.574   49.028  1.00 119.96 ? 36  GLU E CA  1 
ATOM   2175 C  C   . GLU E 5 13 ? -23.330 1.775   49.845  1.00 119.56 ? 36  GLU E C   1 
ATOM   2176 O  O   . GLU E 5 13 ? -23.381 2.054   51.050  1.00 119.46 ? 36  GLU E O   1 
ATOM   2177 C  CB  . GLU E 5 13 ? -25.083 0.118   49.119  1.00 120.25 ? 36  GLU E CB  1 
ATOM   2178 C  CG  . GLU E 5 13 ? -26.317 -0.183  48.283  0.00 120.94 ? 36  GLU E CG  1 
ATOM   2179 C  CD  . GLU E 5 13 ? -26.838 -1.591  48.496  0.00 121.25 ? 36  GLU E CD  1 
ATOM   2180 O  OE1 . GLU E 5 13 ? -26.064 -2.550  48.297  0.00 121.45 ? 36  GLU E OE1 1 
ATOM   2181 O  OE2 . GLU E 5 13 ? -28.023 -1.738  48.861  0.00 121.45 ? 36  GLU E OE2 1 
ATOM   2182 N  N   . ARG E 5 14 ? -22.183 1.642   49.175  1.00 118.65 ? 37  ARG E N   1 
ATOM   2183 C  CA  . ARG E 5 14 ? -20.873 1.809   49.809  1.00 117.52 ? 37  ARG E CA  1 
ATOM   2184 C  C   . ARG E 5 14 ? -20.514 3.272   49.998  1.00 116.05 ? 37  ARG E C   1 
ATOM   2185 O  O   . ARG E 5 14 ? -20.133 3.685   51.092  1.00 115.98 ? 37  ARG E O   1 
ATOM   2186 C  CB  . ARG E 5 14 ? -19.778 1.140   48.979  1.00 118.13 ? 37  ARG E CB  1 
ATOM   2187 C  CG  . ARG E 5 14 ? -19.607 -0.345  49.233  1.00 118.69 ? 37  ARG E CG  1 
ATOM   2188 C  CD  . ARG E 5 14 ? -18.408 -0.900  48.474  1.00 118.94 ? 37  ARG E CD  1 
ATOM   2189 N  NE  . ARG E 5 14 ? -17.149 -0.244  48.837  1.00 119.39 ? 37  ARG E NE  1 
ATOM   2190 C  CZ  . ARG E 5 14 ? -16.719 0.919   48.345  1.00 119.63 ? 37  ARG E CZ  1 
ATOM   2191 N  NH1 . ARG E 5 14 ? -17.440 1.584   47.452  1.00 119.22 ? 37  ARG E NH1 1 
ATOM   2192 N  NH2 . ARG E 5 14 ? -15.554 1.419   48.746  1.00 119.37 ? 37  ARG E NH2 1 
ATOM   2193 N  N   . GLN E 5 15 ? -20.616 4.047   48.923  1.00 114.33 ? 38  GLN E N   1 
ATOM   2194 C  CA  . GLN E 5 15 ? -20.323 5.471   48.990  1.00 112.73 ? 38  GLN E CA  1 
ATOM   2195 C  C   . GLN E 5 15 ? -21.095 6.056   50.166  1.00 111.50 ? 38  GLN E C   1 
ATOM   2196 O  O   . GLN E 5 15 ? -20.690 7.063   50.741  1.00 110.75 ? 38  GLN E O   1 
ATOM   2197 C  CB  . GLN E 5 15 ? -20.741 6.164   47.696  1.00 112.91 ? 38  GLN E CB  1 
ATOM   2198 C  CG  . GLN E 5 15 ? -19.971 5.713   46.472  1.00 112.93 ? 38  GLN E CG  1 
ATOM   2199 C  CD  . GLN E 5 15 ? -18.503 6.072   46.543  0.00 113.56 ? 38  GLN E CD  1 
ATOM   2200 O  OE1 . GLN E 5 15 ? -17.779 5.604   47.421  0.00 113.73 ? 38  GLN E OE1 1 
ATOM   2201 N  NE2 . GLN E 5 15 ? -18.054 6.910   45.616  0.00 113.73 ? 38  GLN E NE2 1 
ATOM   2202 N  N   . GLU E 5 16 ? -22.216 5.418   50.505  1.00 110.63 ? 39  GLU E N   1 
ATOM   2203 C  CA  . GLU E 5 16 ? -23.032 5.843   51.635  1.00 109.47 ? 39  GLU E CA  1 
ATOM   2204 C  C   . GLU E 5 16 ? -22.241 5.471   52.882  1.00 107.81 ? 39  GLU E C   1 
ATOM   2205 O  O   . GLU E 5 16 ? -22.035 6.294   53.776  1.00 108.31 ? 39  GLU E O   1 
ATOM   2206 C  CB  . GLU E 5 16 ? -24.378 5.111   51.657  0.00 110.21 ? 39  GLU E CB  1 
ATOM   2207 C  CG  . GLU E 5 16 ? -25.332 5.481   50.536  0.00 111.13 ? 39  GLU E CG  1 
ATOM   2208 C  CD  . GLU E 5 16 ? -26.711 4.877   50.732  0.00 111.62 ? 39  GLU E CD  1 
ATOM   2209 O  OE1 . GLU E 5 16 ? -26.811 3.636   50.821  0.00 111.92 ? 39  GLU E OE1 1 
ATOM   2210 O  OE2 . GLU E 5 16 ? -27.695 5.645   50.800  0.00 111.92 ? 39  GLU E OE2 1 
ATOM   2211 N  N   . ALA E 5 17 ? -21.795 4.221   52.934  1.00 105.19 ? 40  ALA E N   1 
ATOM   2212 C  CA  . ALA E 5 17 ? -21.014 3.747   54.063  1.00 103.31 ? 40  ALA E CA  1 
ATOM   2213 C  C   . ALA E 5 17 ? -19.873 4.725   54.319  1.00 102.02 ? 40  ALA E C   1 
ATOM   2214 O  O   . ALA E 5 17 ? -19.673 5.187   55.440  1.00 101.73 ? 40  ALA E O   1 
ATOM   2215 C  CB  . ALA E 5 17 ? -20.460 2.363   53.767  1.00 103.39 ? 40  ALA E CB  1 
ATOM   2216 N  N   . LEU E 5 18 ? -19.140 5.043   53.259  1.00 100.29 ? 41  LEU E N   1 
ATOM   2217 C  CA  . LEU E 5 18 ? -18.012 5.961   53.339  1.00 98.83  ? 41  LEU E CA  1 
ATOM   2218 C  C   . LEU E 5 18 ? -18.401 7.358   53.807  1.00 98.01  ? 41  LEU E C   1 
ATOM   2219 O  O   . LEU E 5 18 ? -17.810 7.883   54.745  1.00 97.58  ? 41  LEU E O   1 
ATOM   2220 C  CB  . LEU E 5 18 ? -17.331 6.057   51.977  1.00 97.92  ? 41  LEU E CB  1 
ATOM   2221 C  CG  . LEU E 5 18 ? -16.929 4.697   51.413  1.00 97.75  ? 41  LEU E CG  1 
ATOM   2222 C  CD1 . LEU E 5 18 ? -16.285 4.866   50.048  1.00 96.76  ? 41  LEU E CD1 1 
ATOM   2223 C  CD2 . LEU E 5 18 ? -15.985 4.016   52.386  1.00 97.64  ? 41  LEU E CD2 1 
ATOM   2224 N  N   . ARG E 5 19 ? -19.385 7.959   53.144  1.00 97.65  ? 42  ARG E N   1 
ATOM   2225 C  CA  . ARG E 5 19 ? -19.843 9.303   53.492  1.00 96.97  ? 42  ARG E CA  1 
ATOM   2226 C  C   . ARG E 5 19 ? -20.308 9.389   54.940  1.00 96.14  ? 42  ARG E C   1 
ATOM   2227 O  O   . ARG E 5 19 ? -20.049 10.378  55.632  1.00 96.41  ? 42  ARG E O   1 
ATOM   2228 C  CB  . ARG E 5 19 ? -20.988 9.742   52.566  1.00 97.37  ? 42  ARG E CB  1 
ATOM   2229 C  CG  . ARG E 5 19 ? -20.571 9.996   51.125  1.00 98.17  ? 42  ARG E CG  1 
ATOM   2230 C  CD  . ARG E 5 19 ? -21.761 10.343  50.244  0.00 99.26  ? 42  ARG E CD  1 
ATOM   2231 N  NE  . ARG E 5 19 ? -22.723 9.248   50.163  0.00 100.05 ? 42  ARG E NE  1 
ATOM   2232 C  CZ  . ARG E 5 19 ? -23.818 9.270   49.410  0.00 100.47 ? 42  ARG E CZ  1 
ATOM   2233 N  NH1 . ARG E 5 19 ? -24.095 10.333  48.668  0.00 100.71 ? 42  ARG E NH1 1 
ATOM   2234 N  NH2 . ARG E 5 19 ? -24.639 8.228   49.398  0.00 100.71 ? 42  ARG E NH2 1 
ATOM   2235 N  N   . GLN E 5 20 ? -20.988 8.353   55.406  1.00 94.34  ? 43  GLN E N   1 
ATOM   2236 C  CA  . GLN E 5 20 ? -21.481 8.374   56.765  1.00 93.16  ? 43  GLN E CA  1 
ATOM   2237 C  C   . GLN E 5 20 ? -20.363 8.115   57.752  1.00 90.89  ? 43  GLN E C   1 
ATOM   2238 O  O   . GLN E 5 20 ? -20.423 8.565   58.897  1.00 91.04  ? 43  GLN E O   1 
ATOM   2239 C  CB  . GLN E 5 20 ? -22.592 7.342   56.949  1.00 95.06  ? 43  GLN E CB  1 
ATOM   2240 C  CG  . GLN E 5 20 ? -23.332 7.489   58.265  1.00 98.07  ? 43  GLN E CG  1 
ATOM   2241 C  CD  . GLN E 5 20 ? -24.517 6.551   58.371  1.00 100.59 ? 43  GLN E CD  1 
ATOM   2242 O  OE1 . GLN E 5 20 ? -24.357 5.327   58.341  1.00 102.29 ? 43  GLN E OE1 1 
ATOM   2243 N  NE2 . GLN E 5 20 ? -25.717 7.118   58.492  1.00 100.63 ? 43  GLN E NE2 1 
ATOM   2244 N  N   . ALA E 5 21 ? -19.341 7.388   57.309  1.00 87.91  ? 44  ALA E N   1 
ATOM   2245 C  CA  . ALA E 5 21 ? -18.208 7.073   58.171  1.00 84.91  ? 44  ALA E CA  1 
ATOM   2246 C  C   . ALA E 5 21 ? -17.358 8.320   58.390  1.00 84.13  ? 44  ALA E C   1 
ATOM   2247 O  O   . ALA E 5 21 ? -16.741 8.489   59.445  1.00 83.58  ? 44  ALA E O   1 
ATOM   2248 C  CB  . ALA E 5 21 ? -17.378 5.980   57.551  1.00 83.07  ? 44  ALA E CB  1 
ATOM   2249 N  N   . GLU E 5 22 ? -17.332 9.186   57.379  1.00 83.16  ? 45  GLU E N   1 
ATOM   2250 C  CA  . GLU E 5 22 ? -16.580 10.431  57.433  1.00 82.09  ? 45  GLU E CA  1 
ATOM   2251 C  C   . GLU E 5 22 ? -17.350 11.447  58.277  1.00 82.70  ? 45  GLU E C   1 
ATOM   2252 O  O   . GLU E 5 22 ? -16.745 12.243  58.994  1.00 82.50  ? 45  GLU E O   1 
ATOM   2253 C  CB  . GLU E 5 22 ? -16.341 10.962  56.017  1.00 80.19  ? 45  GLU E CB  1 
ATOM   2254 C  CG  . GLU E 5 22 ? -15.610 12.293  55.935  1.00 79.50  ? 45  GLU E CG  1 
ATOM   2255 C  CD  . GLU E 5 22 ? -14.242 12.285  56.615  1.00 79.69  ? 45  GLU E CD  1 
ATOM   2256 O  OE1 . GLU E 5 22 ? -13.633 11.200  56.761  1.00 78.91  ? 45  GLU E OE1 1 
ATOM   2257 O  OE2 . GLU E 5 22 ? -13.766 13.379  56.986  1.00 77.77  ? 45  GLU E OE2 1 
ATOM   2258 N  N   . GLU E 5 23 ? -18.680 11.418  58.200  1.00 82.65  ? 46  GLU E N   1 
ATOM   2259 C  CA  . GLU E 5 23 ? -19.487 12.329  59.004  1.00 82.86  ? 46  GLU E CA  1 
ATOM   2260 C  C   . GLU E 5 23 ? -19.230 11.999  60.467  1.00 81.17  ? 46  GLU E C   1 
ATOM   2261 O  O   . GLU E 5 23 ? -19.347 12.857  61.331  1.00 80.31  ? 46  GLU E O   1 
ATOM   2262 C  CB  . GLU E 5 23 ? -20.984 12.161  58.721  1.00 85.95  ? 46  GLU E CB  1 
ATOM   2263 C  CG  . GLU E 5 23 ? -21.439 12.610  57.345  1.00 89.93  ? 46  GLU E CG  1 
ATOM   2264 C  CD  . GLU E 5 23 ? -22.959 12.608  57.214  1.00 93.21  ? 46  GLU E CD  1 
ATOM   2265 O  OE1 . GLU E 5 23 ? -23.588 11.604  57.618  1.00 95.53  ? 46  GLU E OE1 1 
ATOM   2266 O  OE2 . GLU E 5 23 ? -23.529 13.601  56.699  1.00 94.73  ? 46  GLU E OE2 1 
ATOM   2267 N  N   . GLU E 5 24 ? -18.882 10.742  60.731  1.00 80.24  ? 47  GLU E N   1 
ATOM   2268 C  CA  . GLU E 5 24 ? -18.604 10.279  62.085  1.00 80.25  ? 47  GLU E CA  1 
ATOM   2269 C  C   . GLU E 5 24 ? -17.159 10.528  62.486  1.00 79.61  ? 47  GLU E C   1 
ATOM   2270 O  O   . GLU E 5 24 ? -16.884 10.807  63.645  1.00 78.40  ? 47  GLU E O   1 
ATOM   2271 C  CB  . GLU E 5 24 ? -18.908 8.794   62.206  1.00 80.86  ? 47  GLU E CB  1 
ATOM   2272 C  CG  . GLU E 5 24 ? -20.282 8.443   61.716  1.00 84.72  ? 47  GLU E CG  1 
ATOM   2273 C  CD  . GLU E 5 24 ? -20.662 7.025   62.051  1.00 87.60  ? 47  GLU E CD  1 
ATOM   2274 O  OE1 . GLU E 5 24 ? -19.818 6.125   61.827  1.00 88.91  ? 47  GLU E OE1 1 
ATOM   2275 O  OE2 . GLU E 5 24 ? -21.803 6.811   62.528  1.00 88.24  ? 47  GLU E OE2 1 
ATOM   2276 N  N   . ARG E 5 25 ? -16.240 10.405  61.531  1.00 79.69  ? 48  ARG E N   1 
ATOM   2277 C  CA  . ARG E 5 25 ? -14.830 10.645  61.793  1.00 79.86  ? 48  ARG E CA  1 
ATOM   2278 C  C   . ARG E 5 25 ? -14.764 12.121  62.122  1.00 83.28  ? 48  ARG E C   1 
ATOM   2279 O  O   . ARG E 5 25 ? -14.037 12.551  63.028  1.00 82.55  ? 48  ARG E O   1 
ATOM   2280 C  CB  . ARG E 5 25 ? -14.003 10.381  60.541  1.00 76.17  ? 48  ARG E CB  1 
ATOM   2281 C  CG  . ARG E 5 25 ? -12.503 10.501  60.739  1.00 70.56  ? 48  ARG E CG  1 
ATOM   2282 C  CD  . ARG E 5 25 ? -11.803 10.748  59.421  1.00 67.90  ? 48  ARG E CD  1 
ATOM   2283 N  NE  . ARG E 5 25 ? -11.970 12.121  58.937  1.00 66.02  ? 48  ARG E NE  1 
ATOM   2284 C  CZ  . ARG E 5 25 ? -11.416 13.193  59.505  1.00 63.79  ? 48  ARG E CZ  1 
ATOM   2285 N  NH1 . ARG E 5 25 ? -10.662 13.061  60.581  1.00 62.19  ? 48  ARG E NH1 1 
ATOM   2286 N  NH2 . ARG E 5 25 ? -11.587 14.397  58.981  1.00 63.81  ? 48  ARG E NH2 1 
ATOM   2287 N  N   A LYS E 5 26 ? -15.556 12.882  61.372  0.49 85.23  ? 49  LYS E N   1 
ATOM   2288 N  N   B LYS E 5 26 ? -15.516 12.922  61.372  0.51 85.56  ? 49  LYS E N   1 
ATOM   2289 C  CA  A LYS E 5 26 ? -15.662 14.334  61.511  0.49 87.18  ? 49  LYS E CA  1 
ATOM   2290 C  CA  B LYS E 5 26 ? -15.523 14.360  61.628  0.51 87.85  ? 49  LYS E CA  1 
ATOM   2291 C  C   A LYS E 5 26 ? -16.342 14.716  62.836  0.49 87.22  ? 49  LYS E C   1 
ATOM   2292 C  C   B LYS E 5 26 ? -16.281 14.697  62.919  0.51 87.62  ? 49  LYS E C   1 
ATOM   2293 O  O   A LYS E 5 26 ? -16.061 15.768  63.419  0.49 89.88  ? 49  LYS E O   1 
ATOM   2294 O  O   B LYS E 5 26 ? -15.995 15.708  63.567  0.51 90.19  ? 49  LYS E O   1 
ATOM   2295 C  CB  A LYS E 5 26 ? -16.475 14.886  60.335  0.49 88.35  ? 49  LYS E CB  1 
ATOM   2296 C  CB  B LYS E 5 26 ? -16.108 15.133  60.437  0.51 89.52  ? 49  LYS E CB  1 
ATOM   2297 C  CG  A LYS E 5 26 ? -16.262 16.359  60.006  0.49 88.23  ? 49  LYS E CG  1 
ATOM   2298 C  CG  B LYS E 5 26 ? -15.236 15.101  59.177  0.51 91.29  ? 49  LYS E CG  1 
ATOM   2299 C  CD  A LYS E 5 26 ? -17.275 16.806  58.953  0.49 88.90  ? 49  LYS E CD  1 
ATOM   2300 C  CD  B LYS E 5 26 ? -15.611 16.218  58.210  0.51 92.03  ? 49  LYS E CD  1 
ATOM   2301 C  CE  A LYS E 5 26 ? -17.193 15.956  57.681  0.49 90.15  ? 49  LYS E CE  1 
ATOM   2302 C  CE  B LYS E 5 26 ? -14.858 16.132  56.882  0.51 91.32  ? 49  LYS E CE  1 
ATOM   2303 N  NZ  A LYS E 5 26 ? -18.290 16.266  56.719  0.49 89.85  ? 49  LYS E NZ  1 
ATOM   2304 N  NZ  B LYS E 5 26 ? -15.462 15.144  55.943  0.51 90.20  ? 49  LYS E NZ  1 
ATOM   2305 N  N   . ALA E 5 27 ? -17.234 13.855  63.306  1.00 85.51  ? 50  ALA E N   1 
ATOM   2306 C  CA  . ALA E 5 27 ? -17.961 14.097  64.543  1.00 81.47  ? 50  ALA E CA  1 
ATOM   2307 C  C   . ALA E 5 27 ? -17.021 13.898  65.737  1.00 78.18  ? 50  ALA E C   1 
ATOM   2308 O  O   . ALA E 5 27 ? -17.013 14.701  66.665  1.00 77.03  ? 50  ALA E O   1 
ATOM   2309 C  CB  . ALA E 5 27 ? -19.145 13.155  64.636  1.00 81.30  ? 50  ALA E CB  1 
ATOM   2310 N  N   . LYS E 5 28 ? -16.219 12.837  65.694  1.00 75.11  ? 51  LYS E N   1 
ATOM   2311 C  CA  . LYS E 5 28 ? -15.277 12.524  66.771  1.00 72.39  ? 51  LYS E CA  1 
ATOM   2312 C  C   . LYS E 5 28 ? -14.188 13.598  66.910  1.00 70.07  ? 51  LYS E C   1 
ATOM   2313 O  O   . LYS E 5 28 ? -13.612 13.769  67.982  1.00 70.00  ? 51  LYS E O   1 
ATOM   2314 C  CB  . LYS E 5 28 ? -14.588 11.171  66.526  1.00 72.91  ? 51  LYS E CB  1 
ATOM   2315 C  CG  . LYS E 5 28 ? -15.512 9.980   66.239  1.00 73.45  ? 51  LYS E CG  1 
ATOM   2316 C  CD  . LYS E 5 28 ? -14.689 8.771   65.776  1.00 74.96  ? 51  LYS E CD  1 
ATOM   2317 C  CE  . LYS E 5 28 ? -15.538 7.611   65.291  1.00 73.79  ? 51  LYS E CE  1 
ATOM   2318 N  NZ  . LYS E 5 28 ? -16.148 6.901   66.431  1.00 74.37  ? 51  LYS E NZ  1 
ATOM   2319 N  N   . TYR E 5 29 ? -13.889 14.310  65.833  1.00 66.64  ? 52  TYR E N   1 
ATOM   2320 C  CA  . TYR E 5 29 ? -12.867 15.332  65.912  1.00 64.79  ? 52  TYR E CA  1 
ATOM   2321 C  C   . TYR E 5 29 ? -13.473 16.676  66.303  1.00 65.65  ? 52  TYR E C   1 
ATOM   2322 O  O   . TYR E 5 29 ? -12.780 17.572  66.791  1.00 66.28  ? 52  TYR E O   1 
ATOM   2323 C  CB  . TYR E 5 29 ? -12.103 15.415  64.583  1.00 62.76  ? 52  TYR E CB  1 
ATOM   2324 C  CG  . TYR E 5 29 ? -10.787 14.649  64.607  1.00 59.89  ? 52  TYR E CG  1 
ATOM   2325 C  CD1 . TYR E 5 29 ? -9.678  15.161  65.270  1.00 58.36  ? 52  TYR E CD1 1 
ATOM   2326 C  CD2 . TYR E 5 29 ? -10.678 13.380  64.040  1.00 58.80  ? 52  TYR E CD2 1 
ATOM   2327 C  CE1 . TYR E 5 29 ? -8.498  14.435  65.376  1.00 57.71  ? 52  TYR E CE1 1 
ATOM   2328 C  CE2 . TYR E 5 29 ? -9.499  12.640  64.140  1.00 56.89  ? 52  TYR E CE2 1 
ATOM   2329 C  CZ  . TYR E 5 29 ? -8.413  13.170  64.812  1.00 58.30  ? 52  TYR E CZ  1 
ATOM   2330 O  OH  . TYR E 5 29 ? -7.254  12.430  64.961  1.00 57.48  ? 52  TYR E OH  1 
ATOM   2331 N  N   . ALA E 5 30 ? -14.776 16.820  66.111  1.00 65.43  ? 53  ALA E N   1 
ATOM   2332 C  CA  . ALA E 5 30 ? -15.425 18.067  66.479  1.00 64.46  ? 53  ALA E CA  1 
ATOM   2333 C  C   . ALA E 5 30 ? -15.627 18.075  67.996  1.00 63.59  ? 53  ALA E C   1 
ATOM   2334 O  O   . ALA E 5 30 ? -15.515 19.122  68.641  1.00 62.60  ? 53  ALA E O   1 
ATOM   2335 C  CB  . ALA E 5 30 ? -16.748 18.204  65.756  1.00 65.40  ? 53  ALA E CB  1 
ATOM   2336 N  N   . LYS E 5 31 ? -15.914 16.906  68.568  1.00 62.75  ? 54  LYS E N   1 
ATOM   2337 C  CA  . LYS E 5 31 ? -16.090 16.794  70.017  1.00 64.25  ? 54  LYS E CA  1 
ATOM   2338 C  C   . LYS E 5 31 ? -14.736 17.027  70.712  1.00 63.33  ? 54  LYS E C   1 
ATOM   2339 O  O   . LYS E 5 31 ? -14.673 17.612  71.790  1.00 63.51  ? 54  LYS E O   1 
ATOM   2340 C  CB  . LYS E 5 31 ? -16.629 15.405  70.386  1.00 65.84  ? 54  LYS E CB  1 
ATOM   2341 C  CG  . LYS E 5 31 ? -16.653 15.114  71.876  1.00 69.15  ? 54  LYS E CG  1 
ATOM   2342 C  CD  . LYS E 5 31 ? -17.092 13.671  72.185  1.00 72.69  ? 54  LYS E CD  1 
ATOM   2343 C  CE  . LYS E 5 31 ? -18.539 13.396  71.743  1.00 74.71  ? 54  LYS E CE  1 
ATOM   2344 N  NZ  . LYS E 5 31 ? -19.058 12.036  72.120  1.00 75.75  ? 54  LYS E NZ  1 
ATOM   2345 N  N   . MET E 5 32 ? -13.657 16.563  70.087  1.00 62.89  ? 55  MET E N   1 
ATOM   2346 C  CA  . MET E 5 32 ? -12.328 16.738  70.643  1.00 61.56  ? 55  MET E CA  1 
ATOM   2347 C  C   . MET E 5 32 ? -11.993 18.230  70.668  1.00 60.02  ? 55  MET E C   1 
ATOM   2348 O  O   . MET E 5 32 ? -11.503 18.763  71.673  1.00 57.51  ? 55  MET E O   1 
ATOM   2349 C  CB  . MET E 5 32 ? -11.290 15.975  69.807  1.00 64.19  ? 55  MET E CB  1 
ATOM   2350 C  CG  . MET E 5 32 ? -11.343 14.442  69.938  1.00 66.22  ? 55  MET E CG  1 
ATOM   2351 S  SD  . MET E 5 32 ? -10.050 13.527  68.958  1.00 69.81  ? 55  MET E SD  1 
ATOM   2352 C  CE  . MET E 5 32 ? -11.012 12.364  68.012  1.00 66.44  ? 55  MET E CE  1 
ATOM   2353 N  N   . GLU E 5 33 ? -12.289 18.910  69.568  1.00 58.95  ? 56  GLU E N   1 
ATOM   2354 C  CA  . GLU E 5 33 ? -11.994 20.333  69.470  1.00 60.06  ? 56  GLU E CA  1 
ATOM   2355 C  C   . GLU E 5 33 ? -12.708 21.153  70.558  1.00 61.20  ? 56  GLU E C   1 
ATOM   2356 O  O   . GLU E 5 33 ? -12.080 21.984  71.230  1.00 60.80  ? 56  GLU E O   1 
ATOM   2357 C  CB  . GLU E 5 33 ? -12.348 20.846  68.063  1.00 59.27  ? 56  GLU E CB  1 
ATOM   2358 C  CG  . GLU E 5 33 ? -12.250 22.373  67.877  1.00 58.48  ? 56  GLU E CG  1 
ATOM   2359 C  CD  . GLU E 5 33 ? -10.905 22.943  68.313  1.00 58.95  ? 56  GLU E CD  1 
ATOM   2360 O  OE1 . GLU E 5 33 ? -9.981  22.150  68.551  1.00 58.35  ? 56  GLU E OE1 1 
ATOM   2361 O  OE2 . GLU E 5 33 ? -10.767 24.180  68.421  1.00 59.25  ? 56  GLU E OE2 1 
ATOM   2362 N  N   . ALA E 5 34 ? -14.007 20.906  70.747  1.00 61.69  ? 57  ALA E N   1 
ATOM   2363 C  CA  . ALA E 5 34 ? -14.788 21.628  71.762  1.00 60.33  ? 57  ALA E CA  1 
ATOM   2364 C  C   . ALA E 5 34 ? -14.160 21.417  73.133  1.00 60.73  ? 57  ALA E C   1 
ATOM   2365 O  O   . ALA E 5 34 ? -14.005 22.354  73.923  1.00 59.66  ? 57  ALA E O   1 
ATOM   2366 C  CB  . ALA E 5 34 ? -16.230 21.143  71.772  1.00 56.94  ? 57  ALA E CB  1 
ATOM   2367 N  N   . GLU E 5 35 ? -13.783 20.180  73.415  1.00 61.92  ? 58  GLU E N   1 
ATOM   2368 C  CA  . GLU E 5 35 ? -13.172 19.899  74.694  1.00 64.31  ? 58  GLU E CA  1 
ATOM   2369 C  C   . GLU E 5 35 ? -11.845 20.664  74.827  1.00 63.80  ? 58  GLU E C   1 
ATOM   2370 O  O   . GLU E 5 35 ? -11.493 21.103  75.910  1.00 64.61  ? 58  GLU E O   1 
ATOM   2371 C  CB  . GLU E 5 35 ? -12.950 18.393  74.861  1.00 66.29  ? 58  GLU E CB  1 
ATOM   2372 C  CG  . GLU E 5 35 ? -12.670 17.994  76.295  1.00 70.83  ? 58  GLU E CG  1 
ATOM   2373 C  CD  . GLU E 5 35 ? -11.757 16.781  76.408  1.00 73.22  ? 58  GLU E CD  1 
ATOM   2374 O  OE1 . GLU E 5 35 ? -11.773 15.933  75.481  1.00 73.73  ? 58  GLU E OE1 1 
ATOM   2375 O  OE2 . GLU E 5 35 ? -11.038 16.675  77.433  1.00 73.20  ? 58  GLU E OE2 1 
ATOM   2376 N  N   . ARG E 5 36 ? -11.113 20.852  73.735  1.00 63.57  ? 59  ARG E N   1 
ATOM   2377 C  CA  . ARG E 5 36 ? -9.843  21.583  73.840  1.00 62.97  ? 59  ARG E CA  1 
ATOM   2378 C  C   . ARG E 5 36 ? -10.113 23.051  74.100  1.00 61.00  ? 59  ARG E C   1 
ATOM   2379 O  O   . ARG E 5 36 ? -9.452  23.670  74.924  1.00 61.10  ? 59  ARG E O   1 
ATOM   2380 C  CB  . ARG E 5 36 ? -9.017  21.481  72.555  1.00 61.84  ? 59  ARG E CB  1 
ATOM   2381 C  CG  . ARG E 5 36 ? -8.898  20.099  71.954  1.00 61.00  ? 59  ARG E CG  1 
ATOM   2382 C  CD  . ARG E 5 36 ? -7.642  19.401  72.417  1.00 62.37  ? 59  ARG E CD  1 
ATOM   2383 N  NE  . ARG E 5 36 ? -6.481  20.289  72.562  1.00 59.96  ? 59  ARG E NE  1 
ATOM   2384 C  CZ  . ARG E 5 36 ? -5.332  19.895  73.100  1.00 57.50  ? 59  ARG E CZ  1 
ATOM   2385 N  NH1 . ARG E 5 36 ? -5.200  18.639  73.519  1.00 54.65  ? 59  ARG E NH1 1 
ATOM   2386 N  NH2 . ARG E 5 36 ? -4.342  20.754  73.269  1.00 57.08  ? 59  ARG E NH2 1 
ATOM   2387 N  N   . GLU E 5 37 ? -11.079 23.606  73.377  1.00 61.06  ? 60  GLU E N   1 
ATOM   2388 C  CA  . GLU E 5 37 ? -11.439 25.017  73.509  1.00 61.82  ? 60  GLU E CA  1 
ATOM   2389 C  C   . GLU E 5 37 ? -11.882 25.386  74.933  1.00 61.32  ? 60  GLU E C   1 
ATOM   2390 O  O   . GLU E 5 37 ? -11.644 26.503  75.398  1.00 62.06  ? 60  GLU E O   1 
ATOM   2391 C  CB  . GLU E 5 37 ? -12.528 25.365  72.481  1.00 61.07  ? 60  GLU E CB  1 
ATOM   2392 C  CG  . GLU E 5 37 ? -12.983 26.838  72.433  1.00 62.62  ? 60  GLU E CG  1 
ATOM   2393 C  CD  . GLU E 5 37 ? -11.855 27.885  72.351  1.00 63.85  ? 60  GLU E CD  1 
ATOM   2394 O  OE1 . GLU E 5 37 ? -10.877 27.715  71.566  1.00 58.49  ? 60  GLU E OE1 1 
ATOM   2395 O  OE2 . GLU E 5 37 ? -11.981 28.911  73.075  1.00 64.06  ? 60  GLU E OE2 1 
ATOM   2396 N  N   . VAL E 5 38 ? -12.509 24.448  75.631  1.00 60.92  ? 61  VAL E N   1 
ATOM   2397 C  CA  . VAL E 5 38 ? -12.935 24.711  76.991  1.00 60.80  ? 61  VAL E CA  1 
ATOM   2398 C  C   . VAL E 5 38 ? -11.711 24.962  77.849  1.00 61.14  ? 61  VAL E C   1 
ATOM   2399 O  O   . VAL E 5 38 ? -11.683 25.914  78.643  1.00 64.03  ? 61  VAL E O   1 
ATOM   2400 C  CB  . VAL E 5 38 ? -13.719 23.527  77.593  1.00 61.79  ? 61  VAL E CB  1 
ATOM   2401 C  CG1 . VAL E 5 38 ? -13.878 23.728  79.083  1.00 61.26  ? 61  VAL E CG1 1 
ATOM   2402 C  CG2 . VAL E 5 38 ? -15.093 23.413  76.936  1.00 62.07  ? 61  VAL E CG2 1 
ATOM   2403 N  N   . MET E 5 39 ? -10.710 24.097  77.712  1.00 59.30  ? 62  MET E N   1 
ATOM   2404 C  CA  . MET E 5 39 ? -9.476  24.243  78.469  1.00 57.76  ? 62  MET E CA  1 
ATOM   2405 C  C   . MET E 5 39 ? -8.744  25.517  78.039  1.00 57.11  ? 62  MET E C   1 
ATOM   2406 O  O   . MET E 5 39 ? -8.127  26.176  78.872  1.00 57.02  ? 62  MET E O   1 
ATOM   2407 C  CB  . MET E 5 39 ? -8.582  23.002  78.293  1.00 58.65  ? 62  MET E CB  1 
ATOM   2408 C  CG  . MET E 5 39 ? -7.091  23.222  78.588  1.00 57.70  ? 62  MET E CG  1 
ATOM   2409 S  SD  . MET E 5 39 ? -6.185  23.760  77.132  1.00 63.05  ? 62  MET E SD  1 
ATOM   2410 C  CE  . MET E 5 39 ? -5.624  25.318  77.609  1.00 61.17  ? 62  MET E CE  1 
ATOM   2411 N  N   . ARG E 5 40 ? -8.838  25.874  76.757  1.00 55.35  ? 63  ARG E N   1 
ATOM   2412 C  CA  . ARG E 5 40 ? -8.197  27.081  76.248  1.00 56.03  ? 63  ARG E CA  1 
ATOM   2413 C  C   . ARG E 5 40 ? -8.819  28.312  76.878  1.00 59.61  ? 63  ARG E C   1 
ATOM   2414 O  O   . ARG E 5 40 ? -8.128  29.268  77.231  1.00 59.25  ? 63  ARG E O   1 
ATOM   2415 C  CB  . ARG E 5 40 ? -8.362  27.198  74.735  1.00 52.78  ? 63  ARG E CB  1 
ATOM   2416 C  CG  . ARG E 5 40 ? -7.677  26.124  73.951  1.00 50.25  ? 63  ARG E CG  1 
ATOM   2417 C  CD  . ARG E 5 40 ? -7.803  26.383  72.459  1.00 48.93  ? 63  ARG E CD  1 
ATOM   2418 N  NE  . ARG E 5 40 ? -7.360  25.210  71.727  1.00 50.90  ? 63  ARG E NE  1 
ATOM   2419 C  CZ  . ARG E 5 40 ? -8.046  24.622  70.754  1.00 52.32  ? 63  ARG E CZ  1 
ATOM   2420 N  NH1 . ARG E 5 40 ? -9.222  25.107  70.377  1.00 51.15  ? 63  ARG E NH1 1 
ATOM   2421 N  NH2 . ARG E 5 40 ? -7.562  23.523  70.185  1.00 51.78  ? 63  ARG E NH2 1 
ATOM   2422 N  N   . GLN E 5 41 ? -10.143 28.291  76.991  1.00 63.14  ? 64  GLN E N   1 
ATOM   2423 C  CA  . GLN E 5 41 ? -10.854 29.410  77.572  1.00 64.58  ? 64  GLN E CA  1 
ATOM   2424 C  C   . GLN E 5 41 ? -10.526 29.486  79.045  1.00 64.96  ? 64  GLN E C   1 
ATOM   2425 O  O   . GLN E 5 41 ? -10.328 30.567  79.578  1.00 65.40  ? 64  GLN E O   1 
ATOM   2426 C  CB  . GLN E 5 41 ? -12.351 29.242  77.401  1.00 65.33  ? 64  GLN E CB  1 
ATOM   2427 C  CG  . GLN E 5 41 ? -13.101 30.496  77.788  1.00 66.64  ? 64  GLN E CG  1 
ATOM   2428 C  CD  . GLN E 5 41 ? -12.624 31.694  76.996  1.00 67.18  ? 64  GLN E CD  1 
ATOM   2429 O  OE1 . GLN E 5 41 ? -12.639 31.679  75.769  1.00 67.62  ? 64  GLN E OE1 1 
ATOM   2430 N  NE2 . GLN E 5 41 ? -12.198 32.739  77.693  1.00 68.65  ? 64  GLN E NE2 1 
ATOM   2431 N  N   . GLY E 5 42 ? -10.475 28.333  79.700  1.00 64.71  ? 65  GLY E N   1 
ATOM   2432 C  CA  . GLY E 5 42 ? -10.154 28.312  81.113  1.00 66.17  ? 65  GLY E CA  1 
ATOM   2433 C  C   . GLY E 5 42 ? -8.841  29.029  81.352  1.00 67.80  ? 65  GLY E C   1 
ATOM   2434 O  O   . GLY E 5 42 ? -8.732  29.850  82.262  1.00 69.20  ? 65  GLY E O   1 
ATOM   2435 N  N   . ILE E 5 43 ? -7.846  28.717  80.528  1.00 67.20  ? 66  ILE E N   1 
ATOM   2436 C  CA  . ILE E 5 43 ? -6.538  29.333  80.621  1.00 67.87  ? 66  ILE E CA  1 
ATOM   2437 C  C   . ILE E 5 43 ? -6.668  30.818  80.263  1.00 70.54  ? 66  ILE E C   1 
ATOM   2438 O  O   . ILE E 5 43 ? -5.972  31.668  80.827  1.00 71.14  ? 66  ILE E O   1 
ATOM   2439 C  CB  . ILE E 5 43 ? -5.523  28.644  79.633  1.00 67.04  ? 66  ILE E CB  1 
ATOM   2440 C  CG1 . ILE E 5 43 ? -5.035  27.312  80.202  1.00 63.67  ? 66  ILE E CG1 1 
ATOM   2441 C  CG2 . ILE E 5 43 ? -4.322  29.553  79.370  1.00 65.97  ? 66  ILE E CG2 1 
ATOM   2442 C  CD1 . ILE E 5 43 ? -4.184  27.454  81.443  1.00 64.59  ? 66  ILE E CD1 1 
ATOM   2443 N  N   . ARG E 5 44 ? -7.552  31.132  79.322  1.00 72.09  ? 67  ARG E N   1 
ATOM   2444 C  CA  . ARG E 5 44 ? -7.735  32.518  78.903  1.00 74.91  ? 67  ARG E CA  1 
ATOM   2445 C  C   . ARG E 5 44 ? -8.198  33.393  80.064  1.00 76.33  ? 67  ARG E C   1 
ATOM   2446 O  O   . ARG E 5 44 ? -7.566  34.404  80.375  1.00 75.58  ? 67  ARG E O   1 
ATOM   2447 C  CB  . ARG E 5 44 ? -8.740  32.602  77.747  1.00 76.31  ? 67  ARG E CB  1 
ATOM   2448 C  CG  . ARG E 5 44 ? -8.108  32.873  76.385  1.00 76.74  ? 67  ARG E CG  1 
ATOM   2449 C  CD  . ARG E 5 44 ? -9.182  33.120  75.349  1.00 77.01  ? 67  ARG E CD  1 
ATOM   2450 N  NE  . ARG E 5 44 ? -9.705  31.891  74.763  1.00 80.65  ? 67  ARG E NE  1 
ATOM   2451 C  CZ  . ARG E 5 44 ? -9.164  31.270  73.712  1.00 82.10  ? 67  ARG E CZ  1 
ATOM   2452 N  NH1 . ARG E 5 44 ? -8.074  31.770  73.129  1.00 82.10  ? 67  ARG E NH1 1 
ATOM   2453 N  NH2 . ARG E 5 44 ? -9.717  30.156  73.231  1.00 81.21  ? 67  ARG E NH2 1 
ATOM   2454 N  N   . ASP E 5 45 ? -9.294  32.993  80.707  1.00 77.26  ? 68  ASP E N   1 
ATOM   2455 C  CA  . ASP E 5 45 ? -9.812  33.741  81.840  1.00 78.07  ? 68  ASP E CA  1 
ATOM   2456 C  C   . ASP E 5 45 ? -8.702  33.888  82.848  1.00 78.08  ? 68  ASP E C   1 
ATOM   2457 O  O   . ASP E 5 45 ? -8.338  34.999  83.239  1.00 79.71  ? 68  ASP E O   1 
ATOM   2458 C  CB  . ASP E 5 45 ? -10.972 33.013  82.513  1.00 78.30  ? 68  ASP E CB  1 
ATOM   2459 C  CG  . ASP E 5 45 ? -12.148 32.823  81.593  1.00 79.49  ? 68  ASP E CG  1 
ATOM   2460 O  OD1 . ASP E 5 45 ? -12.297 33.629  80.643  1.00 78.66  ? 68  ASP E OD1 1 
ATOM   2461 O  OD2 . ASP E 5 45 ? -12.927 31.872  81.831  1.00 80.79  ? 68  ASP E OD2 1 
ATOM   2462 N  N   . LYS E 5 46 ? -8.159  32.751  83.258  1.00 75.70  ? 69  LYS E N   1 
ATOM   2463 C  CA  . LYS E 5 46 ? -7.096  32.740  84.240  1.00 73.92  ? 69  LYS E CA  1 
ATOM   2464 C  C   . LYS E 5 46 ? -6.062  33.844  84.047  1.00 73.37  ? 69  LYS E C   1 
ATOM   2465 O  O   . LYS E 5 46 ? -5.531  34.362  85.018  1.00 72.33  ? 69  LYS E O   1 
ATOM   2466 C  CB  . LYS E 5 46 ? -6.411  31.377  84.237  1.00 72.85  ? 69  LYS E CB  1 
ATOM   2467 C  CG  . LYS E 5 46 ? -5.384  31.182  85.335  1.00 72.69  ? 69  LYS E CG  1 
ATOM   2468 C  CD  . LYS E 5 46 ? -4.801  29.779  85.294  1.00 72.47  ? 69  LYS E CD  1 
ATOM   2469 C  CE  . LYS E 5 46 ? -3.727  29.586  86.344  1.00 74.00  ? 69  LYS E CE  1 
ATOM   2470 N  NZ  . LYS E 5 46 ? -3.100  28.241  86.230  1.00 75.59  ? 69  LYS E NZ  1 
ATOM   2471 N  N   . TYR E 5 47 ? -5.788  34.234  82.808  1.00 73.76  ? 70  TYR E N   1 
ATOM   2472 C  CA  . TYR E 5 47 ? -4.771  35.263  82.594  1.00 74.48  ? 70  TYR E CA  1 
ATOM   2473 C  C   . TYR E 5 47 ? -5.211  36.532  81.887  1.00 76.78  ? 70  TYR E C   1 
ATOM   2474 O  O   . TYR E 5 47 ? -4.387  37.399  81.586  1.00 77.30  ? 70  TYR E O   1 
ATOM   2475 C  CB  . TYR E 5 47 ? -3.579  34.661  81.846  1.00 71.60  ? 70  TYR E CB  1 
ATOM   2476 C  CG  . TYR E 5 47 ? -2.882  33.551  82.611  1.00 69.51  ? 70  TYR E CG  1 
ATOM   2477 C  CD1 . TYR E 5 47 ? -2.292  33.788  83.848  1.00 67.97  ? 70  TYR E CD1 1 
ATOM   2478 C  CD2 . TYR E 5 47 ? -2.816  32.266  82.090  1.00 67.89  ? 70  TYR E CD2 1 
ATOM   2479 C  CE1 . TYR E 5 47 ? -1.647  32.774  84.545  1.00 67.77  ? 70  TYR E CE1 1 
ATOM   2480 C  CE2 . TYR E 5 47 ? -2.181  31.249  82.771  1.00 67.16  ? 70  TYR E CE2 1 
ATOM   2481 C  CZ  . TYR E 5 47 ? -1.596  31.500  83.999  1.00 68.43  ? 70  TYR E CZ  1 
ATOM   2482 O  OH  . TYR E 5 47 ? -0.958  30.469  84.656  1.00 65.81  ? 70  TYR E OH  1 
ATOM   2483 N  N   . GLY E 5 48 ? -6.503  36.667  81.628  1.00 78.47  ? 71  GLY E N   1 
ATOM   2484 C  CA  . GLY E 5 48 ? -6.961  37.855  80.937  1.00 80.35  ? 71  GLY E CA  1 
ATOM   2485 C  C   . GLY E 5 48 ? -6.472  37.871  79.498  1.00 82.37  ? 71  GLY E C   1 
ATOM   2486 O  O   . GLY E 5 48 ? -5.409  38.421  79.178  1.00 83.06  ? 71  GLY E O   1 
ATOM   2487 N  N   . ILE E 5 49 ? -7.267  37.260  78.622  1.00 82.41  ? 72  ILE E N   1 
ATOM   2488 C  CA  . ILE E 5 49 ? -6.971  37.179  77.201  1.00 81.86  ? 72  ILE E CA  1 
ATOM   2489 C  C   . ILE E 5 49 ? -8.324  37.033  76.521  1.00 82.96  ? 72  ILE E C   1 
ATOM   2490 O  O   . ILE E 5 49 ? -8.539  37.681  75.465  1.00 83.33  ? 72  ILE E O   1 
ATOM   2491 C  CB  . ILE E 5 49 ? -6.066  35.969  76.900  1.00 82.14  ? 72  ILE E CB  1 
ATOM   2492 C  CG1 . ILE E 5 49 ? -4.680  36.207  77.517  1.00 82.03  ? 72  ILE E CG1 1 
ATOM   2493 C  CG2 . ILE E 5 49 ? -5.935  35.749  75.400  1.00 82.19  ? 72  ILE E CG2 1 
ATOM   2494 C  CD1 . ILE E 5 49 ? -3.785  34.995  77.520  1.00 83.25  ? 72  ILE E CD1 1 
ATOM   2495 O  OXT . ILE E 5 49 ? -9.157  36.276  77.074  1.00 84.18  ? 72  ILE E OXT 1 
HETATM 2496 MG MG  . MG  F 6 .  ? -7.757  7.277   62.012  1.00 71.56  ? 301 MG  A MG  1 
HETATM 2497 MG MG  . MG  G 6 .  ? 12.548  23.531  64.129  1.00 67.33  ? 302 MG  C MG  1 
HETATM 2498 O  O   . HOH H 7 .  ? -9.716  7.470   61.772  1.00 59.12  ? 302 HOH A O   1 
HETATM 2499 O  O   . HOH H 7 .  ? -7.906  7.110   64.267  1.00 75.90  ? 303 HOH A O   1 
HETATM 2500 O  O   . HOH H 7 .  ? -7.156  7.214   59.853  1.00 48.45  ? 304 HOH A O   1 
HETATM 2501 O  O   . HOH H 7 .  ? -8.165  -9.659  31.744  1.00 55.30  ? 305 HOH A O   1 
HETATM 2502 O  O   . HOH H 7 .  ? -9.348  -6.800  33.093  1.00 60.44  ? 306 HOH A O   1 
HETATM 2503 O  O   . HOH H 7 .  ? -3.470  13.145  63.213  1.00 42.93  ? 307 HOH A O   1 
HETATM 2504 O  O   . HOH H 7 .  ? -1.988  -0.477  45.762  1.00 46.88  ? 308 HOH A O   1 
HETATM 2505 O  O   . HOH H 7 .  ? 3.205   42.586  84.659  1.00 61.61  ? 309 HOH A O   1 
HETATM 2506 O  O   . HOH H 7 .  ? 7.081   36.513  72.657  1.00 61.95  ? 310 HOH A O   1 
HETATM 2507 O  O   . HOH H 7 .  ? -2.129  32.438  63.038  1.00 63.55  ? 311 HOH A O   1 
HETATM 2508 O  O   . HOH H 7 .  ? -8.072  17.202  69.158  1.00 71.50  ? 312 HOH A O   1 
HETATM 2509 O  O   . HOH H 7 .  ? -5.293  24.547  55.121  1.00 54.44  ? 313 HOH A O   1 
HETATM 2510 O  O   . HOH H 7 .  ? -10.536 8.918   65.444  1.00 61.96  ? 314 HOH A O   1 
HETATM 2511 O  O   . HOH H 7 .  ? -11.799 2.469   48.625  1.00 57.48  ? 315 HOH A O   1 
HETATM 2512 O  O   . HOH H 7 .  ? -12.873 -2.593  48.779  1.00 65.00  ? 316 HOH A O   1 
HETATM 2513 O  O   . HOH H 7 .  ? -10.253 -5.366  40.005  1.00 64.60  ? 317 HOH A O   1 
HETATM 2514 O  O   . HOH H 7 .  ? -11.623 -4.891  31.166  1.00 61.06  ? 318 HOH A O   1 
HETATM 2515 O  O   . HOH H 7 .  ? 3.711   -5.912  30.247  1.00 56.48  ? 319 HOH A O   1 
HETATM 2516 O  O   . HOH H 7 .  ? 17.188  49.429  102.706 1.00 89.42  ? 320 HOH A O   1 
HETATM 2517 O  O   . HOH H 7 .  ? -8.656  4.472   58.556  1.00 75.11  ? 321 HOH A O   1 
HETATM 2518 O  O   . HOH H 7 .  ? -0.127  -3.807  37.280  1.00 57.42  ? 322 HOH A O   1 
HETATM 2519 O  O   . HOH H 7 .  ? -13.595 17.914  59.531  1.00 67.93  ? 323 HOH A O   1 
HETATM 2520 O  O   . HOH H 7 .  ? -3.304  2.283   27.195  1.00 63.65  ? 324 HOH A O   1 
HETATM 2521 O  O   . HOH I 7 .  ? -5.922  7.005   62.786  1.00 65.66  ? 2   HOH B O   1 
HETATM 2522 O  O   . HOH I 7 .  ? -7.587  4.825   61.797  1.00 53.49  ? 4   HOH B O   1 
HETATM 2523 O  O   . HOH I 7 .  ? -4.880  6.246   65.229  1.00 62.36  ? 19  HOH B O   1 
HETATM 2524 O  O   . HOH I 7 .  ? 6.992   11.785  71.608  1.00 63.60  ? 23  HOH B O   1 
HETATM 2525 O  O   . HOH I 7 .  ? 12.013  52.179  111.986 1.00 86.00  ? 26  HOH B O   1 
HETATM 2526 O  O   . HOH I 7 .  ? 2.028   35.302  98.761  1.00 60.80  ? 29  HOH B O   1 
HETATM 2527 O  O   . HOH I 7 .  ? 1.992   14.319  82.615  1.00 84.80  ? 36  HOH B O   1 
HETATM 2528 O  O   . HOH I 7 .  ? -0.866  35.609  92.590  1.00 74.94  ? 37  HOH B O   1 
HETATM 2529 O  O   . HOH I 7 .  ? 6.988   27.023  80.602  1.00 45.09  ? 38  HOH B O   1 
HETATM 2530 O  O   . HOH I 7 .  ? -0.400  18.168  80.249  1.00 47.20  ? 45  HOH B O   1 
HETATM 2531 O  O   . HOH I 7 .  ? -8.183  12.006  73.357  1.00 64.68  ? 47  HOH B O   1 
HETATM 2532 O  O   . HOH I 7 .  ? -5.930  13.470  73.355  1.00 75.55  ? 48  HOH B O   1 
HETATM 2533 O  O   . HOH I 7 .  ? 0.509   1.917   56.178  1.00 55.51  ? 49  HOH B O   1 
HETATM 2534 O  O   . HOH I 7 .  ? -1.153  26.537  88.141  1.00 69.83  ? 50  HOH B O   1 
HETATM 2535 O  O   . HOH I 7 .  ? -3.459  9.558   70.694  1.00 52.83  ? 51  HOH B O   1 
HETATM 2536 O  O   . HOH I 7 .  ? 7.193   53.364  114.010 1.00 79.60  ? 64  HOH B O   1 
HETATM 2537 O  O   . HOH I 7 .  ? -1.386  38.312  99.674  1.00 67.41  ? 66  HOH B O   1 
HETATM 2538 O  O   . HOH I 7 .  ? 0.148   39.743  91.141  1.00 75.57  ? 67  HOH B O   1 
HETATM 2539 O  O   . HOH I 7 .  ? -2.253  38.175  93.931  1.00 71.29  ? 68  HOH B O   1 
HETATM 2540 O  O   . HOH I 7 .  ? -0.274  15.400  78.293  1.00 68.96  ? 69  HOH B O   1 
HETATM 2541 O  O   . HOH I 7 .  ? -0.984  10.370  71.002  1.00 52.76  ? 70  HOH B O   1 
HETATM 2542 O  O   . HOH I 7 .  ? 0.499   7.521   68.689  1.00 65.54  ? 72  HOH B O   1 
HETATM 2543 O  O   . HOH I 7 .  ? -1.840  4.737   40.368  1.00 58.20  ? 73  HOH B O   1 
HETATM 2544 O  O   . HOH I 7 .  ? 4.150   -3.187  43.509  1.00 72.03  ? 94  HOH B O   1 
HETATM 2545 O  O   . HOH I 7 .  ? 5.761   -5.025  44.190  1.00 79.86  ? 95  HOH B O   1 
HETATM 2546 O  O   . HOH I 7 .  ? 4.124   13.241  73.607  1.00 51.66  ? 108 HOH B O   1 
HETATM 2547 O  O   . HOH J 7 .  ? 12.844  21.397  65.717  1.00 63.33  ? 303 HOH C O   1 
HETATM 2548 O  O   . HOH J 7 .  ? 10.478  22.309  63.548  1.00 56.64  ? 304 HOH C O   1 
HETATM 2549 O  O   . HOH J 7 .  ? 11.886  23.367  62.238  1.00 89.79  ? 305 HOH C O   1 
HETATM 2550 O  O   . HOH J 7 .  ? 12.842  20.941  63.993  1.00 63.57  ? 306 HOH C O   1 
HETATM 2551 O  O   . HOH J 7 .  ? 4.200   19.242  81.743  1.00 78.48  ? 307 HOH C O   1 
HETATM 2552 O  O   . HOH J 7 .  ? 11.214  14.330  68.200  1.00 54.05  ? 308 HOH C O   1 
HETATM 2553 O  O   . HOH J 7 .  ? 7.270   17.980  46.689  1.00 53.37  ? 309 HOH C O   1 
HETATM 2554 O  O   . HOH J 7 .  ? 10.784  7.695   48.864  1.00 73.16  ? 310 HOH C O   1 
HETATM 2555 O  O   . HOH J 7 .  ? 4.997   14.806  70.861  1.00 57.20  ? 311 HOH C O   1 
HETATM 2556 O  O   . HOH J 7 .  ? 14.991  41.186  115.156 1.00 52.55  ? 312 HOH C O   1 
HETATM 2557 O  O   . HOH J 7 .  ? 4.899   5.782   37.412  1.00 80.03  ? 313 HOH C O   1 
HETATM 2558 O  O   . HOH J 7 .  ? 14.647  18.256  61.688  1.00 55.02  ? 314 HOH C O   1 
HETATM 2559 O  O   . HOH J 7 .  ? 11.575  33.538  109.015 1.00 60.87  ? 315 HOH C O   1 
HETATM 2560 O  O   . HOH J 7 .  ? 4.151   33.797  113.928 1.00 77.83  ? 316 HOH C O   1 
HETATM 2561 O  O   . HOH J 7 .  ? 2.032   35.718  115.141 1.00 88.52  ? 317 HOH C O   1 
HETATM 2562 O  O   . HOH J 7 .  ? 5.935   23.129  97.324  1.00 82.11  ? 318 HOH C O   1 
HETATM 2563 O  O   . HOH J 7 .  ? 13.686  15.830  61.554  1.00 70.40  ? 319 HOH C O   1 
HETATM 2564 O  O   . HOH J 7 .  ? 15.325  17.471  58.975  1.00 66.97  ? 320 HOH C O   1 
HETATM 2565 O  O   . HOH J 7 .  ? 11.628  16.742  51.340  1.00 64.21  ? 321 HOH C O   1 
HETATM 2566 O  O   . HOH J 7 .  ? -7.722  10.254  32.995  1.00 59.91  ? 322 HOH C O   1 
HETATM 2567 O  O   . HOH J 7 .  ? 0.314   17.803  46.285  1.00 57.37  ? 323 HOH C O   1 
HETATM 2568 O  O   . HOH J 7 .  ? 8.194   16.662  43.030  1.00 61.12  ? 324 HOH C O   1 
HETATM 2569 O  O   . HOH J 7 .  ? -6.423  9.239   29.614  1.00 87.09  ? 325 HOH C O   1 
HETATM 2570 O  O   . HOH J 7 .  ? 10.763  17.839  78.701  1.00 59.48  ? 326 HOH C O   1 
HETATM 2571 O  O   . HOH J 7 .  ? 9.329   12.220  69.492  1.00 53.97  ? 327 HOH C O   1 
HETATM 2572 O  O   . HOH K 7 .  ? 11.579  25.056  63.516  1.00 61.59  ? 6   HOH D O   1 
HETATM 2573 O  O   . HOH K 7 .  ? 11.479  23.841  65.694  1.00 66.74  ? 8   HOH D O   1 
HETATM 2574 O  O   . HOH K 7 .  ? 13.855  25.026  64.058  1.00 53.66  ? 10  HOH D O   1 
HETATM 2575 O  O   . HOH K 7 .  ? 9.044   22.964  50.806  1.00 58.80  ? 15  HOH D O   1 
HETATM 2576 O  O   . HOH K 7 .  ? 9.167   25.935  62.200  1.00 61.84  ? 16  HOH D O   1 
HETATM 2577 O  O   . HOH K 7 .  ? -14.847 -3.274  32.117  1.00 78.40  ? 17  HOH D O   1 
HETATM 2578 O  O   . HOH K 7 .  ? 1.995   33.110  66.533  1.00 56.07  ? 24  HOH D O   1 
HETATM 2579 O  O   . HOH K 7 .  ? 26.567  37.733  95.715  1.00 76.75  ? 31  HOH D O   1 
HETATM 2580 O  O   . HOH K 7 .  ? 18.581  43.283  104.692 1.00 69.94  ? 33  HOH D O   1 
HETATM 2581 O  O   . HOH K 7 .  ? 19.419  30.627  73.287  1.00 70.99  ? 34  HOH D O   1 
HETATM 2582 O  O   . HOH K 7 .  ? -5.802  15.852  41.519  1.00 94.86  ? 39  HOH D O   1 
HETATM 2583 O  O   . HOH K 7 .  ? 2.117   29.272  54.710  1.00 75.56  ? 52  HOH D O   1 
HETATM 2584 O  O   . HOH K 7 .  ? -4.018  30.374  59.534  1.00 65.08  ? 55  HOH D O   1 
HETATM 2585 O  O   . HOH K 7 .  ? 18.712  30.273  100.563 1.00 63.39  ? 71  HOH D O   1 
HETATM 2586 O  O   . HOH K 7 .  ? 15.199  39.179  109.376 1.00 65.60  ? 76  HOH D O   1 
HETATM 2587 O  O   . HOH K 7 .  ? 9.800   25.727  53.143  1.00 63.22  ? 80  HOH D O   1 
HETATM 2588 O  O   . HOH K 7 .  ? 20.422  35.215  112.140 1.00 67.35  ? 83  HOH D O   1 
HETATM 2589 O  O   . HOH K 7 .  ? 18.478  42.124  94.061  1.00 54.12  ? 84  HOH D O   1 
HETATM 2590 O  O   . HOH K 7 .  ? 9.820   26.572  59.886  1.00 66.06  ? 85  HOH D O   1 
HETATM 2591 O  O   . HOH K 7 .  ? 19.947  30.432  76.641  1.00 83.64  ? 99  HOH D O   1 
HETATM 2592 O  O   . HOH K 7 .  ? 15.118  33.342  70.340  1.00 73.97  ? 100 HOH D O   1 
HETATM 2593 O  O   . HOH K 7 .  ? 20.368  36.313  84.974  1.00 59.18  ? 111 HOH D O   1 
HETATM 2594 O  O   . HOH K 7 .  ? -14.962 6.980   45.388  1.00 64.30  ? 112 HOH D O   1 
HETATM 2595 O  O   . HOH L 7 .  ? -14.679 23.916  68.985  1.00 68.01  ? 73  HOH E O   1 
HETATM 2596 O  O   . HOH L 7 .  ? -15.966 21.517  68.107  1.00 64.11  ? 74  HOH E O   1 
HETATM 2597 O  O   . HOH L 7 .  ? -12.193 14.894  55.247  1.00 75.98  ? 75  HOH E O   1 
HETATM 2598 O  O   . HOH L 7 .  ? -22.782 13.124  53.503  1.00 77.36  ? 76  HOH E O   1 
HETATM 2599 O  O   . HOH L 7 .  ? -10.768 17.253  57.535  1.00 77.46  ? 77  HOH E O   1 
HETATM 2600 O  O   . HOH L 7 .  ? -13.388 13.560  73.041  1.00 75.22  ? 78  HOH E O   1 
HETATM 2601 O  O   . HOH L 7 .  ? -7.881  18.423  77.006  1.00 52.12  ? 79  HOH E O   1 
HETATM 2602 O  O   . HOH L 7 .  ? -11.258 35.966  78.571  1.00 88.19  ? 80  HOH E O   1 
HETATM 2603 O  O   . HOH L 7 .  ? -6.555  28.974  87.984  1.00 70.55  ? 81  HOH E O   1 
HETATM 2604 O  O   . HOH L 7 .  ? -7.516  36.941  72.922  1.00 89.26  ? 82  HOH E O   1 
HETATM 2605 O  O   . HOH L 7 .  ? -11.357 11.060  54.597  1.00 65.29  ? 83  HOH E O   1 
HETATM 2606 O  O   . HOH L 7 .  ? -15.173 15.830  75.099  1.00 84.04  ? 84  HOH E O   1 
HETATM 2607 O  O   . HOH L 7 .  ? -16.836 18.005  74.054  1.00 59.99  ? 85  HOH E O   1 
HETATM 2608 O  O   . HOH L 7 .  ? -13.047 29.287  83.343  1.00 71.16  ? 86  HOH E O   1 
HETATM 2609 O  O   . HOH L 7 .  ? -14.088 27.064  81.472  1.00 68.87  ? 87  HOH E O   1 
HETATM 2610 O  O   . HOH L 7 .  ? -7.651  25.046  81.936  1.00 66.43  ? 88  HOH E O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  27  ?   ?   ?   A . n 
A 1 2  SER 2  28  28  SER SER A . n 
A 1 3  ASN 3  29  29  ASN ASN A . n 
A 1 4  ARG 4  30  30  ARG ARG A . n 
A 1 5  ARG 5  31  31  ARG ARG A . n 
A 1 6  LEU 6  32  32  LEU LEU A . n 
A 1 7  GLN 7  33  33  GLN GLN A . n 
A 1 8  GLN 8  34  34  GLN GLN A . n 
A 1 9  THR 9  35  35  THR THR A . n 
A 1 10 GLN 10 36  36  GLN GLN A . n 
A 1 11 ALA 11 37  37  ALA ALA A . n 
A 1 12 GLN 12 38  38  GLN GLN A . n 
A 1 13 VAL 13 39  39  VAL VAL A . n 
A 1 14 ASP 14 40  40  ASP ASP A . n 
A 1 15 GLU 15 41  41  GLU GLU A . n 
A 1 16 VAL 16 42  42  VAL VAL A . n 
A 1 17 VAL 17 43  43  VAL VAL A . n 
A 1 18 ASP 18 44  44  ASP ASP A . n 
A 1 19 ILE 19 45  45  ILE ILE A . n 
A 1 20 MET 20 46  46  MET MET A . n 
A 1 21 ARG 21 47  47  ARG ARG A . n 
A 1 22 VAL 22 48  48  VAL VAL A . n 
A 1 23 ASN 23 49  49  ASN ASN A . n 
A 1 24 VAL 24 50  50  VAL VAL A . n 
A 1 25 ASP 25 51  51  ASP ASP A . n 
A 1 26 LYS 26 52  52  LYS LYS A . n 
A 1 27 VAL 27 53  53  VAL VAL A . n 
A 1 28 LEU 28 54  54  LEU LEU A . n 
A 1 29 GLU 29 55  55  GLU GLU A . n 
A 1 30 ARG 30 56  56  ARG ARG A . n 
A 1 31 ASP 31 57  57  ASP ASP A . n 
A 1 32 GLN 32 58  58  GLN GLN A . n 
A 1 33 LYS 33 59  59  LYS LYS A . n 
A 1 34 LEU 34 60  60  LEU LEU A . n 
A 1 35 SER 35 61  61  SER SER A . n 
A 1 36 GLU 36 62  62  GLU GLU A . n 
A 1 37 LEU 37 63  63  LEU LEU A . n 
A 1 38 ASP 38 64  64  ASP ASP A . n 
A 1 39 ASP 39 65  65  ASP ASP A . n 
A 1 40 ARG 40 66  66  ARG ARG A . n 
A 1 41 ALA 41 67  67  ALA ALA A . n 
A 1 42 ASP 42 68  68  ASP ASP A . n 
A 1 43 ALA 43 69  69  ALA ALA A . n 
A 1 44 LEU 44 70  70  LEU LEU A . n 
A 1 45 GLN 45 71  71  GLN GLN A . n 
A 1 46 ALA 46 72  72  ALA ALA A . n 
A 1 47 GLY 47 73  73  GLY GLY A . n 
A 1 48 ALA 48 74  74  ALA ALA A . n 
A 1 49 SER 49 75  75  SER SER A . n 
A 1 50 GLN 50 76  76  GLN GLN A . n 
A 1 51 PHE 51 77  77  PHE PHE A . n 
A 1 52 GLU 52 78  78  GLU GLU A . n 
A 1 53 THR 53 79  79  THR THR A . n 
A 1 54 SER 54 80  80  SER SER A . n 
A 1 55 ALA 55 81  81  ALA ALA A . n 
A 1 56 ALA 56 82  82  ALA ALA A . n 
A 1 57 LYS 57 83  83  LYS LYS A . n 
A 1 58 LEU 58 84  84  LEU LEU A . n 
A 1 59 LYS 59 85  85  LYS LYS A . n 
A 1 60 ARG 60 86  86  ARG ARG A . n 
A 1 61 LYS 61 87  87  LYS LYS A . n 
A 1 62 TYR 62 88  88  TYR TYR A . n 
A 1 63 TRP 63 89  89  TRP TRP A . n 
A 1 64 TRP 64 90  90  TRP TRP A . n 
A 1 65 LYS 65 91  91  LYS LYS A . n 
A 1 66 ASN 66 92  92  ASN ASN A . n 
B 2 1  GLY 1  189 ?   ?   ?   B . n 
B 2 2  SER 2  190 ?   ?   ?   B . n 
B 2 3  ALA 3  191 ?   ?   ?   B . n 
B 2 4  LEU 4  192 192 LEU LEU B . n 
B 2 5  SER 5  193 193 SER SER B . n 
B 2 6  GLU 6  194 194 GLU GLU B . n 
B 2 7  ILE 7  195 195 ILE ILE B . n 
B 2 8  GLU 8  196 196 GLU GLU B . n 
B 2 9  THR 9  197 197 THR THR B . n 
B 2 10 ARG 10 198 198 ARG ARG B . n 
B 2 11 HIS 11 199 199 HIS HIS B . n 
B 2 12 SER 12 200 200 SER SER B . n 
B 2 13 GLU 13 201 201 GLU GLU B . n 
B 2 14 ILE 14 202 202 ILE ILE B . n 
B 2 15 ILE 15 203 203 ILE ILE B . n 
B 2 16 LYS 16 204 204 LYS LYS B . n 
B 2 17 LEU 17 205 205 LEU LEU B . n 
B 2 18 GLU 18 206 206 GLU GLU B . n 
B 2 19 ASN 19 207 207 ASN ASN B . n 
B 2 20 SER 20 208 208 SER SER B . n 
B 2 21 ILE 21 209 209 ILE ILE B . n 
B 2 22 ARG 22 210 210 ARG ARG B . n 
B 2 23 GLU 23 211 211 GLU GLU B . n 
B 2 24 LEU 24 212 212 LEU LEU B . n 
B 2 25 HIS 25 213 213 HIS HIS B . n 
B 2 26 ASP 26 214 214 ASP ASP B . n 
B 2 27 MET 27 215 215 MET MET B . n 
B 2 28 PHE 28 216 216 PHE PHE B . n 
B 2 29 MET 29 217 217 MET MET B . n 
B 2 30 ASP 30 218 218 ASP ASP B . n 
B 2 31 MET 31 219 219 MET MET B . n 
B 2 32 ALA 32 220 220 ALA ALA B . n 
B 2 33 MET 33 221 221 MET MET B . n 
B 2 34 LEU 34 222 222 LEU LEU B . n 
B 2 35 VAL 35 223 223 VAL VAL B . n 
B 2 36 GLU 36 224 224 GLU GLU B . n 
B 2 37 SER 37 225 225 SER SER B . n 
B 2 38 GLN 38 226 226 GLN GLN B . n 
B 2 39 GLY 39 227 227 GLY GLY B . n 
B 2 40 GLU 40 228 228 GLU GLU B . n 
B 2 41 MET 41 229 229 MET MET B . n 
B 2 42 ILE 42 230 230 ILE ILE B . n 
B 2 43 ASP 43 231 231 ASP ASP B . n 
B 2 44 ARG 44 232 232 ARG ARG B . n 
B 2 45 ILE 45 233 233 ILE ILE B . n 
B 2 46 GLU 46 234 234 GLU GLU B . n 
B 2 47 TYR 47 235 235 TYR TYR B . n 
B 2 48 ASN 48 236 236 ASN ASN B . n 
B 2 49 VAL 49 237 237 VAL VAL B . n 
B 2 50 GLU 50 238 238 GLU GLU B . n 
B 2 51 HIS 51 239 239 HIS HIS B . n 
B 2 52 ALA 52 240 240 ALA ALA B . n 
B 2 53 VAL 53 241 241 VAL VAL B . n 
B 2 54 ASP 54 242 242 ASP ASP B . n 
B 2 55 TYR 55 243 243 TYR TYR B . n 
B 2 56 VAL 56 244 244 VAL VAL B . n 
B 2 57 GLU 57 245 245 GLU GLU B . n 
B 2 58 ARG 58 246 246 ARG ARG B . n 
B 2 59 ALA 59 247 247 ALA ALA B . n 
B 2 60 VAL 60 248 248 VAL VAL B . n 
B 2 61 SER 61 249 249 SER SER B . n 
B 2 62 ASP 62 250 250 ASP ASP B . n 
C 3 1  GLY 1  9   ?   ?   ?   C . n 
C 3 2  SER 2  10  10  SER SER C . n 
C 3 3  LEU 3  11  11  LEU LEU C . n 
C 3 4  GLU 4  12  12  GLU GLU C . n 
C 3 5  GLU 5  13  13  GLU GLU C . n 
C 3 6  MET 6  14  14  MET MET C . n 
C 3 7  GLN 7  15  15  GLN GLN C . n 
C 3 8  ARG 8  16  16  ARG ARG C . n 
C 3 9  ARG 9  17  17  ARG ARG C . n 
C 3 10 ALA 10 18  18  ALA ALA C . n 
C 3 11 ASP 11 19  19  ASP ASP C . n 
C 3 12 GLN 12 20  20  GLN GLN C . n 
C 3 13 LEU 13 21  21  LEU LEU C . n 
C 3 14 ALA 14 22  22  ALA ALA C . n 
C 3 15 ASP 15 23  23  ASP ASP C . n 
C 3 16 GLU 16 24  24  GLU GLU C . n 
C 3 17 SER 17 25  25  SER SER C . n 
C 3 18 LEU 18 26  26  LEU LEU C . n 
C 3 19 GLU 19 27  27  GLU GLU C . n 
C 3 20 SER 20 28  28  SER SER C . n 
C 3 21 THR 21 29  29  THR THR C . n 
C 3 22 ARG 22 30  30  ARG ARG C . n 
C 3 23 ARG 23 31  31  ARG ARG C . n 
C 3 24 MET 24 32  32  MET MET C . n 
C 3 25 LEU 25 33  33  LEU LEU C . n 
C 3 26 GLN 26 34  34  GLN GLN C . n 
C 3 27 LEU 27 35  35  LEU LEU C . n 
C 3 28 VAL 28 36  36  VAL VAL C . n 
C 3 29 GLU 29 37  37  GLU GLU C . n 
C 3 30 GLU 30 38  38  GLU GLU C . n 
C 3 31 SER 31 39  39  SER SER C . n 
C 3 32 LYS 32 40  40  LYS LYS C . n 
C 3 33 ASP 33 41  41  ASP ASP C . n 
C 3 34 ALA 34 42  42  ALA ALA C . n 
C 3 35 GLY 35 43  43  GLY GLY C . n 
C 3 36 ILE 36 44  44  ILE ILE C . n 
C 3 37 ARG 37 45  45  ARG ARG C . n 
C 3 38 THR 38 46  46  THR THR C . n 
C 3 39 LEU 39 47  47  LEU LEU C . n 
C 3 40 VAL 40 48  48  VAL VAL C . n 
C 3 41 MET 41 49  49  MET MET C . n 
C 3 42 LEU 42 50  50  LEU LEU C . n 
C 3 43 ASP 43 51  51  ASP ASP C . n 
C 3 44 GLU 44 52  52  GLU GLU C . n 
C 3 45 GLN 45 53  53  GLN GLN C . n 
C 3 46 GLY 46 54  54  GLY GLY C . n 
C 3 47 GLU 47 55  55  GLU GLU C . n 
C 3 48 GLN 48 56  56  GLN GLN C . n 
C 3 49 LEU 49 57  57  LEU LEU C . n 
C 3 50 ASP 50 58  58  ASP ASP C . n 
C 3 51 ARG 51 59  59  ARG ARG C . n 
C 3 52 VAL 52 60  60  VAL VAL C . n 
C 3 53 GLU 53 61  61  GLU GLU C . n 
C 3 54 GLU 54 62  62  GLU GLU C . n 
C 3 55 GLY 55 63  63  GLY GLY C . n 
C 3 56 MET 56 64  64  MET MET C . n 
C 3 57 ASN 57 65  65  ASN ASN C . n 
C 3 58 HIS 58 66  66  HIS HIS C . n 
C 3 59 ILE 59 67  67  ILE ILE C . n 
C 3 60 ASN 60 68  68  ASN ASN C . n 
C 3 61 GLN 61 69  69  GLN GLN C . n 
C 3 62 ASP 62 70  70  ASP ASP C . n 
C 3 63 MET 63 71  71  MET MET C . n 
C 3 64 LYS 64 72  72  LYS LYS C . n 
C 3 65 GLU 65 73  73  GLU GLU C . n 
C 3 66 ALA 66 74  74  ALA ALA C . n 
C 3 67 GLU 67 75  75  GLU GLU C . n 
C 3 68 LYS 68 76  76  LYS LYS C . n 
C 3 69 ASN 69 77  77  ASN ASN C . n 
C 3 70 LEU 70 78  78  LEU LEU C . n 
C 3 71 LYS 71 79  79  LYS LYS C . n 
C 3 72 ASP 72 80  80  ASP ASP C . n 
C 3 73 LEU 73 81  81  LEU LEU C . n 
C 3 74 TRP 74 82  ?   ?   ?   C . n 
D 4 1  GLY 1  139 139 GLY GLY D . n 
D 4 2  SER 2  140 140 SER SER D . n 
D 4 3  ALA 3  141 141 ALA ALA D . n 
D 4 4  ARG 4  142 142 ARG ARG D . n 
D 4 5  GLU 5  143 143 GLU GLU D . n 
D 4 6  ASN 6  144 144 ASN ASN D . n 
D 4 7  GLU 7  145 145 GLU GLU D . n 
D 4 8  MET 8  146 146 MET MET D . n 
D 4 9  ASP 9  147 147 ASP ASP D . n 
D 4 10 GLU 10 148 148 GLU GLU D . n 
D 4 11 ASN 11 149 149 ASN ASN D . n 
D 4 12 LEU 12 150 150 LEU LEU D . n 
D 4 13 GLU 13 151 151 GLU GLU D . n 
D 4 14 GLN 14 152 152 GLN GLN D . n 
D 4 15 VAL 15 153 153 VAL VAL D . n 
D 4 16 SER 16 154 154 SER SER D . n 
D 4 17 GLY 17 155 155 GLY GLY D . n 
D 4 18 ILE 18 156 156 ILE ILE D . n 
D 4 19 ILE 19 157 157 ILE ILE D . n 
D 4 20 GLY 20 158 158 GLY GLY D . n 
D 4 21 ASN 21 159 159 ASN ASN D . n 
D 4 22 LEU 22 160 160 LEU LEU D . n 
D 4 23 ARG 23 161 161 ARG ARG D . n 
D 4 24 HIS 24 162 162 HIS HIS D . n 
D 4 25 MET 25 163 163 MET MET D . n 
D 4 26 ALA 26 164 164 ALA ALA D . n 
D 4 27 LEU 27 165 165 LEU LEU D . n 
D 4 28 ASP 28 166 166 ASP ASP D . n 
D 4 29 MET 29 167 167 MET MET D . n 
D 4 30 GLY 30 168 168 GLY GLY D . n 
D 4 31 ASN 31 169 169 ASN ASN D . n 
D 4 32 GLU 32 170 170 GLU GLU D . n 
D 4 33 ILE 33 171 171 ILE ILE D . n 
D 4 34 ASP 34 172 172 ASP ASP D . n 
D 4 35 THR 35 173 173 THR THR D . n 
D 4 36 GLN 36 174 174 GLN GLN D . n 
D 4 37 ASN 37 175 175 ASN ASN D . n 
D 4 38 ARG 38 176 176 ARG ARG D . n 
D 4 39 GLN 39 177 177 GLN GLN D . n 
D 4 40 ILE 40 178 178 ILE ILE D . n 
D 4 41 ASP 41 179 179 ASP ASP D . n 
D 4 42 ARG 42 180 180 ARG ARG D . n 
D 4 43 ILE 43 181 181 ILE ILE D . n 
D 4 44 MET 44 182 182 MET MET D . n 
D 4 45 GLU 45 183 183 GLU GLU D . n 
D 4 46 LYS 46 184 184 LYS LYS D . n 
D 4 47 ALA 47 185 185 ALA ALA D . n 
D 4 48 ASP 48 186 186 ASP ASP D . n 
D 4 49 SER 49 187 187 SER SER D . n 
D 4 50 ASN 50 188 188 ASN ASN D . n 
D 4 51 LYS 51 189 189 LYS LYS D . n 
D 4 52 THR 52 190 190 THR THR D . n 
D 4 53 ARG 53 191 191 ARG ARG D . n 
D 4 54 ILE 54 192 192 ILE ILE D . n 
D 4 55 ASP 55 193 193 ASP ASP D . n 
D 4 56 GLU 56 194 194 GLU GLU D . n 
D 4 57 ALA 57 195 195 ALA ALA D . n 
D 4 58 ASN 58 196 196 ASN ASN D . n 
D 4 59 GLN 59 197 197 GLN GLN D . n 
D 4 60 ARG 60 198 198 ARG ARG D . n 
D 4 61 ALA 61 199 199 ALA ALA D . n 
D 4 62 THR 62 200 200 THR THR D . n 
D 4 63 LYS 63 201 201 LYS LYS D . n 
D 4 64 MET 64 202 202 MET MET D . n 
D 4 65 LEU 65 203 203 LEU LEU D . n 
D 4 66 TRP 66 204 204 TRP TRP D . n 
E 5 1  GLY 1  24  ?   ?   ?   E . n 
E 5 2  SER 2  25  ?   ?   ?   E . n 
E 5 3  LYS 3  26  ?   ?   ?   E . n 
E 5 4  ASP 4  27  ?   ?   ?   E . n 
E 5 5  PRO 5  28  ?   ?   ?   E . n 
E 5 6  ASP 6  29  ?   ?   ?   E . n 
E 5 7  ALA 7  30  ?   ?   ?   E . n 
E 5 8  ALA 8  31  ?   ?   ?   E . n 
E 5 9  LYS 9  32  32  LYS LYS E . n 
E 5 10 LYS 10 33  33  LYS LYS E . n 
E 5 11 GLU 11 34  34  GLU GLU E . n 
E 5 12 GLU 12 35  35  GLU GLU E . n 
E 5 13 GLU 13 36  36  GLU GLU E . n 
E 5 14 ARG 14 37  37  ARG ARG E . n 
E 5 15 GLN 15 38  38  GLN GLN E . n 
E 5 16 GLU 16 39  39  GLU GLU E . n 
E 5 17 ALA 17 40  40  ALA ALA E . n 
E 5 18 LEU 18 41  41  LEU LEU E . n 
E 5 19 ARG 19 42  42  ARG ARG E . n 
E 5 20 GLN 20 43  43  GLN GLN E . n 
E 5 21 ALA 21 44  44  ALA ALA E . n 
E 5 22 GLU 22 45  45  GLU GLU E . n 
E 5 23 GLU 23 46  46  GLU GLU E . n 
E 5 24 GLU 24 47  47  GLU GLU E . n 
E 5 25 ARG 25 48  48  ARG ARG E . n 
E 5 26 LYS 26 49  49  LYS LYS E . n 
E 5 27 ALA 27 50  50  ALA ALA E . n 
E 5 28 LYS 28 51  51  LYS LYS E . n 
E 5 29 TYR 29 52  52  TYR TYR E . n 
E 5 30 ALA 30 53  53  ALA ALA E . n 
E 5 31 LYS 31 54  54  LYS LYS E . n 
E 5 32 MET 32 55  55  MET MET E . n 
E 5 33 GLU 33 56  56  GLU GLU E . n 
E 5 34 ALA 34 57  57  ALA ALA E . n 
E 5 35 GLU 35 58  58  GLU GLU E . n 
E 5 36 ARG 36 59  59  ARG ARG E . n 
E 5 37 GLU 37 60  60  GLU GLU E . n 
E 5 38 VAL 38 61  61  VAL VAL E . n 
E 5 39 MET 39 62  62  MET MET E . n 
E 5 40 ARG 40 63  63  ARG ARG E . n 
E 5 41 GLN 41 64  64  GLN GLN E . n 
E 5 42 GLY 42 65  65  GLY GLY E . n 
E 5 43 ILE 43 66  66  ILE ILE E . n 
E 5 44 ARG 44 67  67  ARG ARG E . n 
E 5 45 ASP 45 68  68  ASP ASP E . n 
E 5 46 LYS 46 69  69  LYS LYS E . n 
E 5 47 TYR 47 70  70  TYR TYR E . n 
E 5 48 GLY 48 71  71  GLY GLY E . n 
E 5 49 ILE 49 72  72  ILE ILE E . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   pentameric 
_pdbx_struct_assembly.oligomeric_count     5 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 13790 ? 
1 MORE         -113  ? 
1 'SSA (A^2)'  16520 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 42 ? A ASP 68  ? 1_555 MG ? F MG . ? A MG 301 ? 1_555 O ? H HOH . ? A HOH 302 ? 1_555 96.9  ? 
2  OD1 ? A ASP 42 ? A ASP 68  ? 1_555 MG ? F MG . ? A MG 301 ? 1_555 O ? H HOH . ? A HOH 304 ? 1_555 96.9  ? 
3  O   ? H HOH .  ? A HOH 302 ? 1_555 MG ? F MG . ? A MG 301 ? 1_555 O ? H HOH . ? A HOH 304 ? 1_555 98.7  ? 
4  OD1 ? A ASP 42 ? A ASP 68  ? 1_555 MG ? F MG . ? A MG 301 ? 1_555 O ? I HOH . ? B HOH 4   ? 1_555 164.1 ? 
5  O   ? H HOH .  ? A HOH 302 ? 1_555 MG ? F MG . ? A MG 301 ? 1_555 O ? I HOH . ? B HOH 4   ? 1_555 98.9  ? 
6  O   ? H HOH .  ? A HOH 304 ? 1_555 MG ? F MG . ? A MG 301 ? 1_555 O ? I HOH . ? B HOH 4   ? 1_555 82.5  ? 
7  OD1 ? A ASP 42 ? A ASP 68  ? 1_555 MG ? F MG . ? A MG 301 ? 1_555 O ? H HOH . ? A HOH 303 ? 1_555 86.2  ? 
8  O   ? H HOH .  ? A HOH 302 ? 1_555 MG ? F MG . ? A MG 301 ? 1_555 O ? H HOH . ? A HOH 303 ? 1_555 93.6  ? 
9  O   ? H HOH .  ? A HOH 304 ? 1_555 MG ? F MG . ? A MG 301 ? 1_555 O ? H HOH . ? A HOH 303 ? 1_555 166.9 ? 
10 O   ? I HOH .  ? B HOH 4   ? 1_555 MG ? F MG . ? A MG 301 ? 1_555 O ? H HOH . ? A HOH 303 ? 1_555 91.0  ? 
11 OD1 ? A ASP 42 ? A ASP 68  ? 1_555 MG ? F MG . ? A MG 301 ? 1_555 O ? I HOH . ? B HOH 2   ? 1_555 83.7  ? 
12 O   ? H HOH .  ? A HOH 302 ? 1_555 MG ? F MG . ? A MG 301 ? 1_555 O ? I HOH . ? B HOH 2   ? 1_555 164.1 ? 
13 O   ? H HOH .  ? A HOH 304 ? 1_555 MG ? F MG . ? A MG 301 ? 1_555 O ? I HOH . ? B HOH 2   ? 1_555 97.0  ? 
14 O   ? I HOH .  ? B HOH 4   ? 1_555 MG ? F MG . ? A MG 301 ? 1_555 O ? I HOH . ? B HOH 2   ? 1_555 80.6  ? 
15 O   ? H HOH .  ? A HOH 303 ? 1_555 MG ? F MG . ? A MG 301 ? 1_555 O ? I HOH . ? B HOH 2   ? 1_555 70.5  ? 
16 O   ? J HOH .  ? C HOH 303 ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? J HOH . ? C HOH 306 ? 1_555 39.4  ? 
17 O   ? J HOH .  ? C HOH 303 ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? J HOH . ? C HOH 305 ? 1_555 122.0 ? 
18 O   ? J HOH .  ? C HOH 306 ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? J HOH . ? C HOH 305 ? 1_555 84.7  ? 
19 O   ? J HOH .  ? C HOH 303 ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? K HOH . ? D HOH 6   ? 1_555 152.1 ? 
20 O   ? J HOH .  ? C HOH 306 ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? K HOH . ? D HOH 6   ? 1_555 146.5 ? 
21 O   ? J HOH .  ? C HOH 305 ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? K HOH . ? D HOH 6   ? 1_555 66.2  ? 
22 O   ? J HOH .  ? C HOH 303 ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? K HOH . ? D HOH 8   ? 1_555 72.9  ? 
23 O   ? J HOH .  ? C HOH 306 ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? K HOH . ? D HOH 8   ? 1_555 105.4 ? 
24 O   ? J HOH .  ? C HOH 305 ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? K HOH . ? D HOH 8   ? 1_555 126.6 ? 
25 O   ? K HOH .  ? D HOH 6   ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? K HOH . ? D HOH 8   ? 1_555 81.4  ? 
26 O   ? J HOH .  ? C HOH 303 ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? K HOH . ? D HOH 10  ? 1_555 123.3 ? 
27 O   ? J HOH .  ? C HOH 306 ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? K HOH . ? D HOH 10  ? 1_555 132.1 ? 
28 O   ? J HOH .  ? C HOH 305 ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? K HOH . ? D HOH 10  ? 1_555 104.1 ? 
29 O   ? K HOH .  ? D HOH 6   ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? K HOH . ? D HOH 10  ? 1_555 73.8  ? 
30 O   ? K HOH .  ? D HOH 8   ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? K HOH . ? D HOH 10  ? 1_555 105.9 ? 
31 O   ? J HOH .  ? C HOH 303 ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? J HOH . ? C HOH 304 ? 1_555 80.7  ? 
32 O   ? J HOH .  ? C HOH 306 ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? J HOH . ? C HOH 304 ? 1_555 65.9  ? 
33 O   ? J HOH .  ? C HOH 305 ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? J HOH . ? C HOH 304 ? 1_555 57.5  ? 
34 O   ? K HOH .  ? D HOH 6   ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? J HOH . ? C HOH 304 ? 1_555 83.9  ? 
35 O   ? K HOH .  ? D HOH 8   ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? J HOH . ? C HOH 304 ? 1_555 78.8  ? 
36 O   ? K HOH .  ? D HOH 10  ? 1_555 MG ? G MG . ? C MG 302 ? 1_555 O ? J HOH . ? C HOH 304 ? 1_555 156.1 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-03-13 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .   ? 1 
HKL-2000 'data reduction'  .   ? 2 
AMoRE    phasing           .   ? 3 
CNS      refinement        1.1 ? 4 
HKL-2000 'data scaling'    .   ? 5 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
; SEQUENCE
RESIDUE 10 CHAIN C, THE WILD-TYPE SEQUENCE STARTS WITH LEU11.
SER10 IN THE COORDINATES IS PART OF THE VECTOR GLY9
WHICH IS DISORDERED.
RESIDUE 140 CHAIN D, THE WILD-TYPE SEQUENCE STARTS WITH ALA141.
BOTH RESIDUES FROM THE VECTOR GLY139 AND SER140 ARE ORDERED.
RESIDUE 204 CHAIN D IS AN ENGINEERED TRP(FLUORESCENCE STUDIES)
IT IS NOT PART OF THE NATIVE SEQUENCES, THREFORE NOT A MUTATION.
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O C HOH 303 ? ? O C HOH 306 ? ? 1.78 
2 1 O C HOH 305 ? ? O D HOH 6   ? ? 2.14 
3 1 O C HOH 304 ? ? O C HOH 305 ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 88 ? ? -103.92 62.75 
2 1 ASP C 80 ? ? -63.55  30.68 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A SER 28  ? CB  ? A SER 2  CB  
2  1 Y 1 A SER 28  ? OG  ? A SER 2  OG  
3  1 Y 0 A ARG 30  ? CG  ? A ARG 4  CG  
4  1 Y 0 A ARG 30  ? CD  ? A ARG 4  CD  
5  1 Y 0 A ARG 30  ? NE  ? A ARG 4  NE  
6  1 Y 0 A ARG 30  ? CZ  ? A ARG 4  CZ  
7  1 Y 0 A ARG 30  ? NH1 ? A ARG 4  NH1 
8  1 Y 0 A ARG 30  ? NH2 ? A ARG 4  NH2 
9  1 Y 0 A ARG 31  ? CG  ? A ARG 5  CG  
10 1 Y 0 A ARG 31  ? CD  ? A ARG 5  CD  
11 1 Y 0 A ARG 31  ? NE  ? A ARG 5  NE  
12 1 Y 0 A ARG 31  ? CZ  ? A ARG 5  CZ  
13 1 Y 0 A ARG 31  ? NH1 ? A ARG 5  NH1 
14 1 Y 0 A ARG 31  ? NH2 ? A ARG 5  NH2 
15 1 Y 0 B GLU 194 ? CD  ? B GLU 6  CD  
16 1 Y 0 B GLU 194 ? OE1 ? B GLU 6  OE1 
17 1 Y 0 B GLU 194 ? OE2 ? B GLU 6  OE2 
18 1 Y 0 B LYS 204 ? CE  ? B LYS 16 CE  
19 1 Y 0 B LYS 204 ? NZ  ? B LYS 16 NZ  
20 1 Y 0 C GLU 12  ? CB  ? C GLU 4  CB  
21 1 Y 0 C GLU 12  ? CG  ? C GLU 4  CG  
22 1 Y 0 C GLU 12  ? CD  ? C GLU 4  CD  
23 1 Y 0 C GLU 12  ? OE1 ? C GLU 4  OE1 
24 1 Y 0 C GLU 12  ? OE2 ? C GLU 4  OE2 
25 1 Y 0 C GLU 13  ? CB  ? C GLU 5  CB  
26 1 Y 0 C GLU 13  ? CG  ? C GLU 5  CG  
27 1 Y 0 C GLU 13  ? CD  ? C GLU 5  CD  
28 1 Y 0 C GLU 13  ? OE1 ? C GLU 5  OE1 
29 1 Y 0 C GLU 13  ? OE2 ? C GLU 5  OE2 
30 1 Y 0 C LYS 76  ? CD  ? C LYS 68 CD  
31 1 Y 0 C LYS 76  ? CE  ? C LYS 68 CE  
32 1 Y 0 C LYS 76  ? NZ  ? C LYS 68 NZ  
33 1 Y 0 E LYS 32  ? CB  ? E LYS 9  CB  
34 1 Y 0 E LYS 32  ? CG  ? E LYS 9  CG  
35 1 Y 0 E LYS 32  ? CD  ? E LYS 9  CD  
36 1 Y 0 E LYS 32  ? CE  ? E LYS 9  CE  
37 1 Y 0 E LYS 32  ? NZ  ? E LYS 9  NZ  
38 1 Y 0 E LYS 33  ? CD  ? E LYS 10 CD  
39 1 Y 0 E LYS 33  ? CE  ? E LYS 10 CE  
40 1 Y 0 E LYS 33  ? NZ  ? E LYS 10 NZ  
41 1 Y 0 E GLU 36  ? CG  ? E GLU 13 CG  
42 1 Y 0 E GLU 36  ? CD  ? E GLU 13 CD  
43 1 Y 0 E GLU 36  ? OE1 ? E GLU 13 OE1 
44 1 Y 0 E GLU 36  ? OE2 ? E GLU 13 OE2 
45 1 Y 0 E GLN 38  ? CD  ? E GLN 15 CD  
46 1 Y 0 E GLN 38  ? OE1 ? E GLN 15 OE1 
47 1 Y 0 E GLN 38  ? NE2 ? E GLN 15 NE2 
48 1 Y 0 E GLU 39  ? CB  ? E GLU 16 CB  
49 1 Y 0 E GLU 39  ? CG  ? E GLU 16 CG  
50 1 Y 0 E GLU 39  ? CD  ? E GLU 16 CD  
51 1 Y 0 E GLU 39  ? OE1 ? E GLU 16 OE1 
52 1 Y 0 E GLU 39  ? OE2 ? E GLU 16 OE2 
53 1 Y 0 E ARG 42  ? CD  ? E ARG 19 CD  
54 1 Y 0 E ARG 42  ? NE  ? E ARG 19 NE  
55 1 Y 0 E ARG 42  ? CZ  ? E ARG 19 CZ  
56 1 Y 0 E ARG 42  ? NH1 ? E ARG 19 NH1 
57 1 Y 0 E ARG 42  ? NH2 ? E ARG 19 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 27  ? A GLY 1  
2  1 Y 1 B GLY 189 ? B GLY 1  
3  1 Y 1 B SER 190 ? B SER 2  
4  1 Y 1 B ALA 191 ? B ALA 3  
5  1 Y 1 C GLY 9   ? C GLY 1  
6  1 Y 1 C TRP 82  ? C TRP 74 
7  1 Y 1 E GLY 24  ? E GLY 1  
8  1 Y 1 E SER 25  ? E SER 2  
9  1 Y 1 E LYS 26  ? E LYS 3  
10 1 Y 1 E ASP 27  ? E ASP 4  
11 1 Y 1 E PRO 28  ? E PRO 5  
12 1 Y 1 E ASP 29  ? E ASP 6  
13 1 Y 1 E ALA 30  ? E ALA 7  
14 1 Y 1 E ALA 31  ? E ALA 8  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
6 'MAGNESIUM ION' MG  
7 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 6 MG  1  301 301 MG  MG  A . 
G 6 MG  1  302 302 MG  MG  C . 
H 7 HOH 1  302 1   HOH HOH A . 
H 7 HOH 2  303 3   HOH HOH A . 
H 7 HOH 3  304 5   HOH HOH A . 
H 7 HOH 4  305 13  HOH HOH A . 
H 7 HOH 5  306 18  HOH HOH A . 
H 7 HOH 6  307 20  HOH HOH A . 
H 7 HOH 7  308 21  HOH HOH A . 
H 7 HOH 8  309 28  HOH HOH A . 
H 7 HOH 9  310 53  HOH HOH A . 
H 7 HOH 10 311 54  HOH HOH A . 
H 7 HOH 11 312 56  HOH HOH A . 
H 7 HOH 12 313 57  HOH HOH A . 
H 7 HOH 13 314 58  HOH HOH A . 
H 7 HOH 14 315 59  HOH HOH A . 
H 7 HOH 15 316 60  HOH HOH A . 
H 7 HOH 16 317 61  HOH HOH A . 
H 7 HOH 17 318 62  HOH HOH A . 
H 7 HOH 18 319 63  HOH HOH A . 
H 7 HOH 19 320 65  HOH HOH A . 
H 7 HOH 20 321 92  HOH HOH A . 
H 7 HOH 21 322 93  HOH HOH A . 
H 7 HOH 22 323 106 HOH HOH A . 
H 7 HOH 23 324 107 HOH HOH A . 
I 7 HOH 1  2   2   HOH HOH B . 
I 7 HOH 2  4   4   HOH HOH B . 
I 7 HOH 3  19  19  HOH HOH B . 
I 7 HOH 4  23  23  HOH HOH B . 
I 7 HOH 5  26  26  HOH HOH B . 
I 7 HOH 6  29  29  HOH HOH B . 
I 7 HOH 7  36  36  HOH HOH B . 
I 7 HOH 8  37  37  HOH HOH B . 
I 7 HOH 9  38  38  HOH HOH B . 
I 7 HOH 10 45  45  HOH HOH B . 
I 7 HOH 11 47  47  HOH HOH B . 
I 7 HOH 12 48  48  HOH HOH B . 
I 7 HOH 13 49  49  HOH HOH B . 
I 7 HOH 14 50  50  HOH HOH B . 
I 7 HOH 15 51  51  HOH HOH B . 
I 7 HOH 16 64  64  HOH HOH B . 
I 7 HOH 17 66  66  HOH HOH B . 
I 7 HOH 18 67  67  HOH HOH B . 
I 7 HOH 19 68  68  HOH HOH B . 
I 7 HOH 20 69  69  HOH HOH B . 
I 7 HOH 21 70  70  HOH HOH B . 
I 7 HOH 22 72  72  HOH HOH B . 
I 7 HOH 23 73  73  HOH HOH B . 
I 7 HOH 24 94  94  HOH HOH B . 
I 7 HOH 25 95  95  HOH HOH B . 
I 7 HOH 26 108 108 HOH HOH B . 
J 7 HOH 1  303 7   HOH HOH C . 
J 7 HOH 2  304 9   HOH HOH C . 
J 7 HOH 3  305 11  HOH HOH C . 
J 7 HOH 4  306 12  HOH HOH C . 
J 7 HOH 5  307 14  HOH HOH C . 
J 7 HOH 6  308 22  HOH HOH C . 
J 7 HOH 7  309 25  HOH HOH C . 
J 7 HOH 8  310 27  HOH HOH C . 
J 7 HOH 9  311 30  HOH HOH C . 
J 7 HOH 10 312 40  HOH HOH C . 
J 7 HOH 11 313 43  HOH HOH C . 
J 7 HOH 12 314 44  HOH HOH C . 
J 7 HOH 13 315 46  HOH HOH C . 
J 7 HOH 14 316 74  HOH HOH C . 
J 7 HOH 15 317 75  HOH HOH C . 
J 7 HOH 16 318 77  HOH HOH C . 
J 7 HOH 17 319 78  HOH HOH C . 
J 7 HOH 18 320 79  HOH HOH C . 
J 7 HOH 19 321 81  HOH HOH C . 
J 7 HOH 20 322 82  HOH HOH C . 
J 7 HOH 21 323 96  HOH HOH C . 
J 7 HOH 22 324 97  HOH HOH C . 
J 7 HOH 23 325 98  HOH HOH C . 
J 7 HOH 24 326 109 HOH HOH C . 
J 7 HOH 25 327 110 HOH HOH C . 
K 7 HOH 1  6   6   HOH HOH D . 
K 7 HOH 2  8   8   HOH HOH D . 
K 7 HOH 3  10  10  HOH HOH D . 
K 7 HOH 4  15  15  HOH HOH D . 
K 7 HOH 5  16  16  HOH HOH D . 
K 7 HOH 6  17  17  HOH HOH D . 
K 7 HOH 7  24  24  HOH HOH D . 
K 7 HOH 8  31  31  HOH HOH D . 
K 7 HOH 9  33  33  HOH HOH D . 
K 7 HOH 10 34  34  HOH HOH D . 
K 7 HOH 11 39  39  HOH HOH D . 
K 7 HOH 12 52  52  HOH HOH D . 
K 7 HOH 13 55  55  HOH HOH D . 
K 7 HOH 14 71  71  HOH HOH D . 
K 7 HOH 15 76  76  HOH HOH D . 
K 7 HOH 16 80  80  HOH HOH D . 
K 7 HOH 17 83  83  HOH HOH D . 
K 7 HOH 18 84  84  HOH HOH D . 
K 7 HOH 19 85  85  HOH HOH D . 
K 7 HOH 20 99  99  HOH HOH D . 
K 7 HOH 21 100 100 HOH HOH D . 
K 7 HOH 22 111 111 HOH HOH D . 
K 7 HOH 23 112 112 HOH HOH D . 
L 7 HOH 1  73  32  HOH HOH E . 
L 7 HOH 2  74  35  HOH HOH E . 
L 7 HOH 3  75  41  HOH HOH E . 
L 7 HOH 4  76  42  HOH HOH E . 
L 7 HOH 5  77  86  HOH HOH E . 
L 7 HOH 6  78  87  HOH HOH E . 
L 7 HOH 7  79  88  HOH HOH E . 
L 7 HOH 8  80  89  HOH HOH E . 
L 7 HOH 9  81  90  HOH HOH E . 
L 7 HOH 10 82  91  HOH HOH E . 
L 7 HOH 11 83  101 HOH HOH E . 
L 7 HOH 12 84  102 HOH HOH E . 
L 7 HOH 13 85  103 HOH HOH E . 
L 7 HOH 14 86  104 HOH HOH E . 
L 7 HOH 15 87  105 HOH HOH E . 
L 7 HOH 16 88  113 HOH HOH E . 
#