data_1KK8
# 
_entry.id   1KK8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KK8         
RCSB  RCSB015040   
WWPDB D_1000015040 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1B7T 
_pdbx_database_related.details        
;1B7T contains the same protein 
complexed with MgADP
;
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KK8 
_pdbx_database_status.recvd_initial_deposition_date   2001-12-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Himmel, M.'        1 
'Gourinath, S.'     2 
'Reshetnikova, L.'  3 
'Shen, Y.'          4 
'Szent-Gyorgyi, G.' 5 
'Cohen, C.'         6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
;
Proc.Natl.Acad.Sci.USA  99 12645 12650 2002 PNASA6 US 0027-8424 0040 ? 12297624 10.1073/pnas.202476799          
1       
;ATOMIC STRUCTURE OF SCALLOP MYOSIN SUBFRAGMENT S1               
COMPLEXED WITH MGADP: A NOVEL CONFORMATION OF THE               
MYOSIN HEAD
;
'Cell(Cambridge,Mass.)' 97 459   470   1999 CELLB5 US 0092-8674 0998 ? ?        '10.1016/S0092-8674(00)80756-4' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Himmel, D.M.'        1  
primary 'Gourinath, S.'       2  
primary 'Reshetnikova, L.'    3  
primary 'Shen, Y.'            4  
primary 'Szent-Gyorgyi, A.G.' 5  
primary 'Cohen, C.'           6  
1       'HOUDUSSE, A.'        7  
1       'KALABOKIS, V.'       8  
1       'HIMMEL, D.'          9  
1       'SZENT-GYORGYI, A.G.' 10 
1       'COHEN, C.'           11 
# 
_cell.entry_id           1KK8 
_cell.length_a           51.604 
_cell.length_b           58.527 
_cell.length_c           133.295 
_cell.angle_alpha        81.08 
_cell.angle_beta         84.94 
_cell.angle_gamma        67.24 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1KK8 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Myosin Heavy Chain, Striated muscle'                     95543.750 1   ? 
'FRAGMENT: PAPAIN DIGESTED, SUBFRAGMENT 1 (S1)' 'MYOSIN HEAVY CHAIN'            ? 
2 polymer     nat 'Myosin Regulatory Light Chain, Striated adductor muscle' 15888.021 1   ? ? 'MYOSIN REGULATORY LIGHT CHAIN' ? 
3 polymer     nat 'Myosin Essential Light Chain,Striated adductor muscle'   17391.365 1   ? ? 'MYOSIN ESSENTIAL LIGHT CHAIN'  ? 
4 non-polymer syn 'MAGNESIUM ION'                                           24.305    2   ? ? ?                               ? 
5 non-polymer syn 'BERYLLIUM TRIFLUORIDE ION'                               66.007    1   ? ? ?                               ? 
6 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"                                427.201   1   ? ? ?                               ? 
7 non-polymer syn GLYCEROL                                                  92.094    1   ? ? ?                               ? 
8 non-polymer syn 'CALCIUM ION'                                             40.078    1   ? ? ?                               ? 
9 water       nat water                                                     18.015    185 ? ? ?                               ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2 R-LC 
3 E-LC 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MNIDFSDPDFQYLAVDRKKLMKEQTAAFDGKKNCWVPDEKEGFASAEIQSSKGDEITVKIVADSSTRTVKKDDIQSMNPP
KFEKLEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFCIAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAY
QNMVTDRENQSCLITGESGAGKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNS
SRFGKFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNDVMLVTPDSGLYSFINQGCLTVD
NIDDVEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGEMKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLK
PKVKVGTEMVTKGQNMNQVVNSVGALAKSLYDRMFNWLVRRVNKTLDTKAKRNYYIGVLDIAGFEIFDFNSFEQLCINYT
NERLQQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFPKADDKSFQDKLYQNHMGKNR
MFTKPGKPTRPNQGPAHFELHHYAGNVPYSITGWLEKNKDPINENVVALLGASKEPLVAELFKAPEEPAGGGKKKKGKSS
AFQTISAVHRESLNKLMKNLYSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKGFPSRLIYSEFKQRY
SILAPNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKK
LQDQRIGLSVIQRNIRKWLVLRNWQWWKLYSKVKPLL
;
;MNIDFSDPDFQYLAVDRKKLMKEQTAAFDGKKNCWVPDEKEGFASAEIQSSKGDEITVKIVADSSTRTVKKDDIQSMNPP
KFEKLEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFCIAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAY
QNMVTDRENQSCLITGESGAGKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNS
SRFGKFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNDVMLVTPDSGLYSFINQGCLTVD
NIDDVEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGEMKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLK
PKVKVGTEMVTKGQNMNQVVNSVGALAKSLYDRMFNWLVRRVNKTLDTKAKRNYYIGVLDIAGFEIFDFNSFEQLCINYT
NERLQQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFPKADDKSFQDKLYQNHMGKNR
MFTKPGKPTRPNQGPAHFELHHYAGNVPYSITGWLEKNKDPINENVVALLGASKEPLVAELFKAPEEPAGGGKKKKGKSS
AFQTISAVHRESLNKLMKNLYSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKGFPSRLIYSEFKQRY
SILAPNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKK
LQDQRIGLSVIQRNIRKWLVLRNWQWWKLYSKVKPLL
;
A ? 
2 'polypeptide(L)' no no 
;PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNA
FAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGS
;
;PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNA
FAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGS
;
B ? 
3 'polypeptide(L)' no no 
;PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQ
GTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
;
;PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQ
GTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
;
C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   ILE n 
1 4   ASP n 
1 5   PHE n 
1 6   SER n 
1 7   ASP n 
1 8   PRO n 
1 9   ASP n 
1 10  PHE n 
1 11  GLN n 
1 12  TYR n 
1 13  LEU n 
1 14  ALA n 
1 15  VAL n 
1 16  ASP n 
1 17  ARG n 
1 18  LYS n 
1 19  LYS n 
1 20  LEU n 
1 21  MET n 
1 22  LYS n 
1 23  GLU n 
1 24  GLN n 
1 25  THR n 
1 26  ALA n 
1 27  ALA n 
1 28  PHE n 
1 29  ASP n 
1 30  GLY n 
1 31  LYS n 
1 32  LYS n 
1 33  ASN n 
1 34  CYS n 
1 35  TRP n 
1 36  VAL n 
1 37  PRO n 
1 38  ASP n 
1 39  GLU n 
1 40  LYS n 
1 41  GLU n 
1 42  GLY n 
1 43  PHE n 
1 44  ALA n 
1 45  SER n 
1 46  ALA n 
1 47  GLU n 
1 48  ILE n 
1 49  GLN n 
1 50  SER n 
1 51  SER n 
1 52  LYS n 
1 53  GLY n 
1 54  ASP n 
1 55  GLU n 
1 56  ILE n 
1 57  THR n 
1 58  VAL n 
1 59  LYS n 
1 60  ILE n 
1 61  VAL n 
1 62  ALA n 
1 63  ASP n 
1 64  SER n 
1 65  SER n 
1 66  THR n 
1 67  ARG n 
1 68  THR n 
1 69  VAL n 
1 70  LYS n 
1 71  LYS n 
1 72  ASP n 
1 73  ASP n 
1 74  ILE n 
1 75  GLN n 
1 76  SER n 
1 77  MET n 
1 78  ASN n 
1 79  PRO n 
1 80  PRO n 
1 81  LYS n 
1 82  PHE n 
1 83  GLU n 
1 84  LYS n 
1 85  LEU n 
1 86  GLU n 
1 87  ASP n 
1 88  MET n 
1 89  ALA n 
1 90  ASN n 
1 91  MET n 
1 92  THR n 
1 93  TYR n 
1 94  LEU n 
1 95  ASN n 
1 96  GLU n 
1 97  ALA n 
1 98  SER n 
1 99  VAL n 
1 100 LEU n 
1 101 TYR n 
1 102 ASN n 
1 103 LEU n 
1 104 ARG n 
1 105 SER n 
1 106 ARG n 
1 107 TYR n 
1 108 THR n 
1 109 SER n 
1 110 GLY n 
1 111 LEU n 
1 112 ILE n 
1 113 TYR n 
1 114 THR n 
1 115 TYR n 
1 116 SER n 
1 117 GLY n 
1 118 LEU n 
1 119 PHE n 
1 120 CYS n 
1 121 ILE n 
1 122 ALA n 
1 123 VAL n 
1 124 ASN n 
1 125 PRO n 
1 126 TYR n 
1 127 ARG n 
1 128 ARG n 
1 129 LEU n 
1 130 PRO n 
1 131 ILE n 
1 132 TYR n 
1 133 THR n 
1 134 ASP n 
1 135 SER n 
1 136 VAL n 
1 137 ILE n 
1 138 ALA n 
1 139 LYS n 
1 140 TYR n 
1 141 ARG n 
1 142 GLY n 
1 143 LYS n 
1 144 ARG n 
1 145 LYS n 
1 146 THR n 
1 147 GLU n 
1 148 ILE n 
1 149 PRO n 
1 150 PRO n 
1 151 HIS n 
1 152 LEU n 
1 153 PHE n 
1 154 SER n 
1 155 VAL n 
1 156 ALA n 
1 157 ASP n 
1 158 ASN n 
1 159 ALA n 
1 160 TYR n 
1 161 GLN n 
1 162 ASN n 
1 163 MET n 
1 164 VAL n 
1 165 THR n 
1 166 ASP n 
1 167 ARG n 
1 168 GLU n 
1 169 ASN n 
1 170 GLN n 
1 171 SER n 
1 172 CYS n 
1 173 LEU n 
1 174 ILE n 
1 175 THR n 
1 176 GLY n 
1 177 GLU n 
1 178 SER n 
1 179 GLY n 
1 180 ALA n 
1 181 GLY n 
1 182 LYS n 
1 183 THR n 
1 184 GLU n 
1 185 ASN n 
1 186 THR n 
1 187 LYS n 
1 188 LYS n 
1 189 VAL n 
1 190 ILE n 
1 191 MET n 
1 192 TYR n 
1 193 LEU n 
1 194 ALA n 
1 195 LYS n 
1 196 VAL n 
1 197 ALA n 
1 198 CYS n 
1 199 ALA n 
1 200 VAL n 
1 201 LYS n 
1 202 LYS n 
1 203 LYS n 
1 204 ASP n 
1 205 GLU n 
1 206 GLU n 
1 207 ALA n 
1 208 SER n 
1 209 ASP n 
1 210 LYS n 
1 211 LYS n 
1 212 GLU n 
1 213 GLY n 
1 214 SER n 
1 215 LEU n 
1 216 GLU n 
1 217 ASP n 
1 218 GLN n 
1 219 ILE n 
1 220 ILE n 
1 221 GLN n 
1 222 ALA n 
1 223 ASN n 
1 224 PRO n 
1 225 VAL n 
1 226 LEU n 
1 227 GLU n 
1 228 ALA n 
1 229 TYR n 
1 230 GLY n 
1 231 ASN n 
1 232 ALA n 
1 233 LYS n 
1 234 THR n 
1 235 THR n 
1 236 ARG n 
1 237 ASN n 
1 238 ASN n 
1 239 ASN n 
1 240 SER n 
1 241 SER n 
1 242 ARG n 
1 243 PHE n 
1 244 GLY n 
1 245 LYS n 
1 246 PHE n 
1 247 ILE n 
1 248 ARG n 
1 249 ILE n 
1 250 HIS n 
1 251 PHE n 
1 252 GLY n 
1 253 PRO n 
1 254 THR n 
1 255 GLY n 
1 256 LYS n 
1 257 ILE n 
1 258 ALA n 
1 259 GLY n 
1 260 ALA n 
1 261 ASP n 
1 262 ILE n 
1 263 GLU n 
1 264 THR n 
1 265 TYR n 
1 266 LEU n 
1 267 LEU n 
1 268 GLU n 
1 269 LYS n 
1 270 SER n 
1 271 ARG n 
1 272 VAL n 
1 273 THR n 
1 274 TYR n 
1 275 GLN n 
1 276 GLN n 
1 277 SER n 
1 278 ALA n 
1 279 GLU n 
1 280 ARG n 
1 281 ASN n 
1 282 TYR n 
1 283 HIS n 
1 284 ILE n 
1 285 PHE n 
1 286 TYR n 
1 287 GLN n 
1 288 ILE n 
1 289 CYS n 
1 290 SER n 
1 291 ASN n 
1 292 ALA n 
1 293 ILE n 
1 294 PRO n 
1 295 GLU n 
1 296 LEU n 
1 297 ASN n 
1 298 ASP n 
1 299 VAL n 
1 300 MET n 
1 301 LEU n 
1 302 VAL n 
1 303 THR n 
1 304 PRO n 
1 305 ASP n 
1 306 SER n 
1 307 GLY n 
1 308 LEU n 
1 309 TYR n 
1 310 SER n 
1 311 PHE n 
1 312 ILE n 
1 313 ASN n 
1 314 GLN n 
1 315 GLY n 
1 316 CYS n 
1 317 LEU n 
1 318 THR n 
1 319 VAL n 
1 320 ASP n 
1 321 ASN n 
1 322 ILE n 
1 323 ASP n 
1 324 ASP n 
1 325 VAL n 
1 326 GLU n 
1 327 GLU n 
1 328 PHE n 
1 329 LYS n 
1 330 LEU n 
1 331 CYS n 
1 332 ASP n 
1 333 GLU n 
1 334 ALA n 
1 335 PHE n 
1 336 ASP n 
1 337 ILE n 
1 338 LEU n 
1 339 GLY n 
1 340 PHE n 
1 341 THR n 
1 342 LYS n 
1 343 GLU n 
1 344 GLU n 
1 345 LYS n 
1 346 GLN n 
1 347 SER n 
1 348 MET n 
1 349 PHE n 
1 350 LYS n 
1 351 CYS n 
1 352 THR n 
1 353 ALA n 
1 354 SER n 
1 355 ILE n 
1 356 LEU n 
1 357 HIS n 
1 358 MET n 
1 359 GLY n 
1 360 GLU n 
1 361 MET n 
1 362 LYS n 
1 363 PHE n 
1 364 LYS n 
1 365 GLN n 
1 366 ARG n 
1 367 PRO n 
1 368 ARG n 
1 369 GLU n 
1 370 GLU n 
1 371 GLN n 
1 372 ALA n 
1 373 GLU n 
1 374 SER n 
1 375 ASP n 
1 376 GLY n 
1 377 THR n 
1 378 ALA n 
1 379 GLU n 
1 380 ALA n 
1 381 GLU n 
1 382 LYS n 
1 383 VAL n 
1 384 ALA n 
1 385 PHE n 
1 386 LEU n 
1 387 CYS n 
1 388 GLY n 
1 389 ILE n 
1 390 ASN n 
1 391 ALA n 
1 392 GLY n 
1 393 ASP n 
1 394 LEU n 
1 395 LEU n 
1 396 LYS n 
1 397 ALA n 
1 398 LEU n 
1 399 LEU n 
1 400 LYS n 
1 401 PRO n 
1 402 LYS n 
1 403 VAL n 
1 404 LYS n 
1 405 VAL n 
1 406 GLY n 
1 407 THR n 
1 408 GLU n 
1 409 MET n 
1 410 VAL n 
1 411 THR n 
1 412 LYS n 
1 413 GLY n 
1 414 GLN n 
1 415 ASN n 
1 416 MET n 
1 417 ASN n 
1 418 GLN n 
1 419 VAL n 
1 420 VAL n 
1 421 ASN n 
1 422 SER n 
1 423 VAL n 
1 424 GLY n 
1 425 ALA n 
1 426 LEU n 
1 427 ALA n 
1 428 LYS n 
1 429 SER n 
1 430 LEU n 
1 431 TYR n 
1 432 ASP n 
1 433 ARG n 
1 434 MET n 
1 435 PHE n 
1 436 ASN n 
1 437 TRP n 
1 438 LEU n 
1 439 VAL n 
1 440 ARG n 
1 441 ARG n 
1 442 VAL n 
1 443 ASN n 
1 444 LYS n 
1 445 THR n 
1 446 LEU n 
1 447 ASP n 
1 448 THR n 
1 449 LYS n 
1 450 ALA n 
1 451 LYS n 
1 452 ARG n 
1 453 ASN n 
1 454 TYR n 
1 455 TYR n 
1 456 ILE n 
1 457 GLY n 
1 458 VAL n 
1 459 LEU n 
1 460 ASP n 
1 461 ILE n 
1 462 ALA n 
1 463 GLY n 
1 464 PHE n 
1 465 GLU n 
1 466 ILE n 
1 467 PHE n 
1 468 ASP n 
1 469 PHE n 
1 470 ASN n 
1 471 SER n 
1 472 PHE n 
1 473 GLU n 
1 474 GLN n 
1 475 LEU n 
1 476 CYS n 
1 477 ILE n 
1 478 ASN n 
1 479 TYR n 
1 480 THR n 
1 481 ASN n 
1 482 GLU n 
1 483 ARG n 
1 484 LEU n 
1 485 GLN n 
1 486 GLN n 
1 487 PHE n 
1 488 PHE n 
1 489 ASN n 
1 490 HIS n 
1 491 HIS n 
1 492 MET n 
1 493 PHE n 
1 494 ILE n 
1 495 LEU n 
1 496 GLU n 
1 497 GLN n 
1 498 GLU n 
1 499 GLU n 
1 500 TYR n 
1 501 LYS n 
1 502 LYS n 
1 503 GLU n 
1 504 GLY n 
1 505 ILE n 
1 506 ALA n 
1 507 TRP n 
1 508 GLU n 
1 509 PHE n 
1 510 ILE n 
1 511 ASP n 
1 512 PHE n 
1 513 GLY n 
1 514 MET n 
1 515 ASP n 
1 516 LEU n 
1 517 GLN n 
1 518 MET n 
1 519 CYS n 
1 520 ILE n 
1 521 ASP n 
1 522 LEU n 
1 523 ILE n 
1 524 GLU n 
1 525 LYS n 
1 526 PRO n 
1 527 MET n 
1 528 GLY n 
1 529 ILE n 
1 530 LEU n 
1 531 SER n 
1 532 ILE n 
1 533 LEU n 
1 534 GLU n 
1 535 GLU n 
1 536 GLU n 
1 537 CYS n 
1 538 MET n 
1 539 PHE n 
1 540 PRO n 
1 541 LYS n 
1 542 ALA n 
1 543 ASP n 
1 544 ASP n 
1 545 LYS n 
1 546 SER n 
1 547 PHE n 
1 548 GLN n 
1 549 ASP n 
1 550 LYS n 
1 551 LEU n 
1 552 TYR n 
1 553 GLN n 
1 554 ASN n 
1 555 HIS n 
1 556 MET n 
1 557 GLY n 
1 558 LYS n 
1 559 ASN n 
1 560 ARG n 
1 561 MET n 
1 562 PHE n 
1 563 THR n 
1 564 LYS n 
1 565 PRO n 
1 566 GLY n 
1 567 LYS n 
1 568 PRO n 
1 569 THR n 
1 570 ARG n 
1 571 PRO n 
1 572 ASN n 
1 573 GLN n 
1 574 GLY n 
1 575 PRO n 
1 576 ALA n 
1 577 HIS n 
1 578 PHE n 
1 579 GLU n 
1 580 LEU n 
1 581 HIS n 
1 582 HIS n 
1 583 TYR n 
1 584 ALA n 
1 585 GLY n 
1 586 ASN n 
1 587 VAL n 
1 588 PRO n 
1 589 TYR n 
1 590 SER n 
1 591 ILE n 
1 592 THR n 
1 593 GLY n 
1 594 TRP n 
1 595 LEU n 
1 596 GLU n 
1 597 LYS n 
1 598 ASN n 
1 599 LYS n 
1 600 ASP n 
1 601 PRO n 
1 602 ILE n 
1 603 ASN n 
1 604 GLU n 
1 605 ASN n 
1 606 VAL n 
1 607 VAL n 
1 608 ALA n 
1 609 LEU n 
1 610 LEU n 
1 611 GLY n 
1 612 ALA n 
1 613 SER n 
1 614 LYS n 
1 615 GLU n 
1 616 PRO n 
1 617 LEU n 
1 618 VAL n 
1 619 ALA n 
1 620 GLU n 
1 621 LEU n 
1 622 PHE n 
1 623 LYS n 
1 624 ALA n 
1 625 PRO n 
1 626 GLU n 
1 627 GLU n 
1 628 PRO n 
1 629 ALA n 
1 630 GLY n 
1 631 GLY n 
1 632 GLY n 
1 633 LYS n 
1 634 LYS n 
1 635 LYS n 
1 636 LYS n 
1 637 GLY n 
1 638 LYS n 
1 639 SER n 
1 640 SER n 
1 641 ALA n 
1 642 PHE n 
1 643 GLN n 
1 644 THR n 
1 645 ILE n 
1 646 SER n 
1 647 ALA n 
1 648 VAL n 
1 649 HIS n 
1 650 ARG n 
1 651 GLU n 
1 652 SER n 
1 653 LEU n 
1 654 ASN n 
1 655 LYS n 
1 656 LEU n 
1 657 MET n 
1 658 LYS n 
1 659 ASN n 
1 660 LEU n 
1 661 TYR n 
1 662 SER n 
1 663 THR n 
1 664 HIS n 
1 665 PRO n 
1 666 HIS n 
1 667 PHE n 
1 668 VAL n 
1 669 ARG n 
1 670 CYS n 
1 671 ILE n 
1 672 ILE n 
1 673 PRO n 
1 674 ASN n 
1 675 GLU n 
1 676 LEU n 
1 677 LYS n 
1 678 GLN n 
1 679 PRO n 
1 680 GLY n 
1 681 LEU n 
1 682 VAL n 
1 683 ASP n 
1 684 ALA n 
1 685 GLU n 
1 686 LEU n 
1 687 VAL n 
1 688 LEU n 
1 689 HIS n 
1 690 GLN n 
1 691 LEU n 
1 692 GLN n 
1 693 CYS n 
1 694 ASN n 
1 695 GLY n 
1 696 VAL n 
1 697 LEU n 
1 698 GLU n 
1 699 GLY n 
1 700 ILE n 
1 701 ARG n 
1 702 ILE n 
1 703 CYS n 
1 704 ARG n 
1 705 LYS n 
1 706 GLY n 
1 707 PHE n 
1 708 PRO n 
1 709 SER n 
1 710 ARG n 
1 711 LEU n 
1 712 ILE n 
1 713 TYR n 
1 714 SER n 
1 715 GLU n 
1 716 PHE n 
1 717 LYS n 
1 718 GLN n 
1 719 ARG n 
1 720 TYR n 
1 721 SER n 
1 722 ILE n 
1 723 LEU n 
1 724 ALA n 
1 725 PRO n 
1 726 ASN n 
1 727 ALA n 
1 728 ILE n 
1 729 PRO n 
1 730 GLN n 
1 731 GLY n 
1 732 PHE n 
1 733 VAL n 
1 734 ASP n 
1 735 GLY n 
1 736 LYS n 
1 737 THR n 
1 738 VAL n 
1 739 SER n 
1 740 GLU n 
1 741 LYS n 
1 742 ILE n 
1 743 LEU n 
1 744 ALA n 
1 745 GLY n 
1 746 LEU n 
1 747 GLN n 
1 748 MET n 
1 749 ASP n 
1 750 PRO n 
1 751 ALA n 
1 752 GLU n 
1 753 TYR n 
1 754 ARG n 
1 755 LEU n 
1 756 GLY n 
1 757 THR n 
1 758 THR n 
1 759 LYS n 
1 760 VAL n 
1 761 PHE n 
1 762 PHE n 
1 763 LYS n 
1 764 ALA n 
1 765 GLY n 
1 766 VAL n 
1 767 LEU n 
1 768 GLY n 
1 769 ASN n 
1 770 LEU n 
1 771 GLU n 
1 772 GLU n 
1 773 MET n 
1 774 ARG n 
1 775 ASP n 
1 776 GLU n 
1 777 ARG n 
1 778 LEU n 
1 779 SER n 
1 780 LYS n 
1 781 ILE n 
1 782 ILE n 
1 783 SER n 
1 784 MET n 
1 785 PHE n 
1 786 GLN n 
1 787 ALA n 
1 788 HIS n 
1 789 ILE n 
1 790 ARG n 
1 791 GLY n 
1 792 TYR n 
1 793 LEU n 
1 794 ILE n 
1 795 ARG n 
1 796 LYS n 
1 797 ALA n 
1 798 TYR n 
1 799 LYS n 
1 800 LYS n 
1 801 LEU n 
1 802 GLN n 
1 803 ASP n 
1 804 GLN n 
1 805 ARG n 
1 806 ILE n 
1 807 GLY n 
1 808 LEU n 
1 809 SER n 
1 810 VAL n 
1 811 ILE n 
1 812 GLN n 
1 813 ARG n 
1 814 ASN n 
1 815 ILE n 
1 816 ARG n 
1 817 LYS n 
1 818 TRP n 
1 819 LEU n 
1 820 VAL n 
1 821 LEU n 
1 822 ARG n 
1 823 ASN n 
1 824 TRP n 
1 825 GLN n 
1 826 TRP n 
1 827 TRP n 
1 828 LYS n 
1 829 LEU n 
1 830 TYR n 
1 831 SER n 
1 832 LYS n 
1 833 VAL n 
1 834 LYS n 
1 835 PRO n 
1 836 LEU n 
1 837 LEU n 
2 1   PRO n 
2 2   GLN n 
2 3   LYS n 
2 4   GLN n 
2 5   ILE n 
2 6   GLN n 
2 7   GLU n 
2 8   MET n 
2 9   LYS n 
2 10  GLU n 
2 11  ALA n 
2 12  PHE n 
2 13  SER n 
2 14  MET n 
2 15  ILE n 
2 16  ASP n 
2 17  VAL n 
2 18  ASP n 
2 19  ARG n 
2 20  ASP n 
2 21  GLY n 
2 22  PHE n 
2 23  VAL n 
2 24  SER n 
2 25  LYS n 
2 26  GLU n 
2 27  ASP n 
2 28  ILE n 
2 29  LYS n 
2 30  ALA n 
2 31  ILE n 
2 32  SER n 
2 33  GLU n 
2 34  GLN n 
2 35  LEU n 
2 36  GLY n 
2 37  ARG n 
2 38  ALA n 
2 39  PRO n 
2 40  ASP n 
2 41  ASP n 
2 42  LYS n 
2 43  GLU n 
2 44  LEU n 
2 45  THR n 
2 46  ALA n 
2 47  MET n 
2 48  LEU n 
2 49  LYS n 
2 50  GLU n 
2 51  ALA n 
2 52  PRO n 
2 53  GLY n 
2 54  PRO n 
2 55  LEU n 
2 56  ASN n 
2 57  PHE n 
2 58  THR n 
2 59  MET n 
2 60  PHE n 
2 61  LEU n 
2 62  SER n 
2 63  ILE n 
2 64  PHE n 
2 65  SER n 
2 66  ASP n 
2 67  LYS n 
2 68  LEU n 
2 69  SER n 
2 70  GLY n 
2 71  THR n 
2 72  ASP n 
2 73  SER n 
2 74  GLU n 
2 75  GLU n 
2 76  THR n 
2 77  ILE n 
2 78  ARG n 
2 79  ASN n 
2 80  ALA n 
2 81  PHE n 
2 82  ALA n 
2 83  MET n 
2 84  PHE n 
2 85  ASP n 
2 86  GLU n 
2 87  GLN n 
2 88  GLU n 
2 89  THR n 
2 90  LYS n 
2 91  LYS n 
2 92  LEU n 
2 93  ASN n 
2 94  ILE n 
2 95  GLU n 
2 96  TYR n 
2 97  ILE n 
2 98  LYS n 
2 99  ASP n 
2 100 LEU n 
2 101 LEU n 
2 102 GLU n 
2 103 ASN n 
2 104 MET n 
2 105 GLY n 
2 106 ASP n 
2 107 ASN n 
2 108 PHE n 
2 109 ASN n 
2 110 LYS n 
2 111 ASP n 
2 112 GLU n 
2 113 MET n 
2 114 ARG n 
2 115 MET n 
2 116 THR n 
2 117 PHE n 
2 118 LYS n 
2 119 GLU n 
2 120 ALA n 
2 121 PRO n 
2 122 VAL n 
2 123 GLU n 
2 124 GLY n 
2 125 GLY n 
2 126 LYS n 
2 127 PHE n 
2 128 ASP n 
2 129 TYR n 
2 130 VAL n 
2 131 LYS n 
2 132 PHE n 
2 133 THR n 
2 134 ALA n 
2 135 MET n 
2 136 ILE n 
2 137 LYS n 
2 138 GLY n 
2 139 SER n 
3 1   PRO n 
3 2   LYS n 
3 3   LEU n 
3 4   SER n 
3 5   GLN n 
3 6   ASP n 
3 7   GLU n 
3 8   ILE n 
3 9   ASP n 
3 10  ASP n 
3 11  LEU n 
3 12  LYS n 
3 13  ASP n 
3 14  VAL n 
3 15  PHE n 
3 16  GLU n 
3 17  LEU n 
3 18  PHE n 
3 19  ASP n 
3 20  PHE n 
3 21  TRP n 
3 22  ASP n 
3 23  GLY n 
3 24  ARG n 
3 25  ASP n 
3 26  GLY n 
3 27  ALA n 
3 28  VAL n 
3 29  ASP n 
3 30  ALA n 
3 31  PHE n 
3 32  LYS n 
3 33  LEU n 
3 34  GLY n 
3 35  ASP n 
3 36  VAL n 
3 37  CYS n 
3 38  ARG n 
3 39  CYS n 
3 40  LEU n 
3 41  GLY n 
3 42  ILE n 
3 43  ASN n 
3 44  PRO n 
3 45  ARG n 
3 46  ASN n 
3 47  GLU n 
3 48  ASP n 
3 49  VAL n 
3 50  PHE n 
3 51  ALA n 
3 52  VAL n 
3 53  GLY n 
3 54  GLY n 
3 55  THR n 
3 56  HIS n 
3 57  LYS n 
3 58  MET n 
3 59  GLY n 
3 60  GLU n 
3 61  LYS n 
3 62  SER n 
3 63  LEU n 
3 64  PRO n 
3 65  PHE n 
3 66  GLU n 
3 67  GLU n 
3 68  PHE n 
3 69  LEU n 
3 70  PRO n 
3 71  ALA n 
3 72  TYR n 
3 73  GLU n 
3 74  GLY n 
3 75  LEU n 
3 76  MET n 
3 77  ASP n 
3 78  CYS n 
3 79  GLU n 
3 80  GLN n 
3 81  GLY n 
3 82  THR n 
3 83  PHE n 
3 84  ALA n 
3 85  ASP n 
3 86  TYR n 
3 87  MET n 
3 88  GLU n 
3 89  ALA n 
3 90  PHE n 
3 91  LYS n 
3 92  THR n 
3 93  PHE n 
3 94  ASP n 
3 95  ARG n 
3 96  GLU n 
3 97  GLY n 
3 98  GLN n 
3 99  GLY n 
3 100 PHE n 
3 101 ILE n 
3 102 SER n 
3 103 GLY n 
3 104 ALA n 
3 105 GLU n 
3 106 LEU n 
3 107 ARG n 
3 108 HIS n 
3 109 VAL n 
3 110 LEU n 
3 111 THR n 
3 112 ALA n 
3 113 LEU n 
3 114 GLY n 
3 115 GLU n 
3 116 ARG n 
3 117 LEU n 
3 118 SER n 
3 119 ASP n 
3 120 GLU n 
3 121 ASP n 
3 122 VAL n 
3 123 ASP n 
3 124 GLU n 
3 125 ILE n 
3 126 ILE n 
3 127 LYS n 
3 128 LEU n 
3 129 THR n 
3 130 ASP n 
3 131 LEU n 
3 132 GLN n 
3 133 GLU n 
3 134 ASP n 
3 135 LEU n 
3 136 GLU n 
3 137 GLY n 
3 138 ASN n 
3 139 VAL n 
3 140 LYS n 
3 141 TYR n 
3 142 GLU n 
3 143 ASP n 
3 144 PHE n 
3 145 VAL n 
3 146 LYS n 
3 147 LYS n 
3 148 VAL n 
3 149 MET n 
3 150 ALA n 
3 151 GLY n 
3 152 PRO n 
3 153 TYR n 
3 154 PRO n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? ? 'Argopecten irradians' 31199 Argopecten ? 'BAY SCALLOP' ? ? ? ? ? ? ? ? ? ? ? ? ? 'PAPAIN DIGESTION OF MYOSIN' 
2 1 sample ? ? ? 'Argopecten irradians' 31199 Argopecten ? 'BAY SCALLOP' ? ? ? ? ? ? ? ? ? ? ? ? ? 'PAPAIN DIGESTION OF MYOSIN' 
3 1 sample ? ? ? 'Argopecten irradians' 31199 Argopecten ? 'BAY SCALLOP' ? ? ? ? ? ? ? ? ? ? ? ? ? 'PAPAIN DIGESTION OF MYOSIN' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP MYS_AEQIR 1 
;MNIDFSDPDFQYLAVDRKKLMKEQTAAFDGKKNCWVPDEKEGFASAEIQSSKGDEITVKIVADSSTRTVKKDDIQSMNPP
KFEKLEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFCIAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAY
QNMVTDRENQSCLITGESGAGKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNS
SRFGKFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNDVMLVTPDSGLYSFINQGCLTVD
NIDDVEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGEMKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLK
PKVKVGTEMVTKGQNMNQVVNSVGALAKSLYDRMFNWLVRRVNKTLDTKAKRNYYIGVLDIAGFEIFDFNSFEQLCINYT
NERLQQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFPKADDKSFQDKLYQNHMGKNR
MFTKPGKPTRPNQGPAHFELHHYAGNVPYSITGWLEKNKDPINENVVALLGASKEPLVAELFKAPEEPAGGGKKKKGKSS
AFQTISAVHRESLNKLMKNLYSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKGFPSRLIYSEFKQRY
SILAPNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKK
LQDQRIGLSVIQRNIRKWLVLRNWQWWKLYSKVKPLL
;
1 P24733 ? 
2 UNP MLR_AEQIR 2 
;ADKAASGVLTKLPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKL
SGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA
;
1 P13543 ? 
3 UNP MLE_AEQIR 3 
;PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQ
GTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPDK
;
1 P07291 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KK8 A 1 ? 837 ? P24733 1  ? 837 ? 1  837 
2 2 1KK8 B 1 ? 139 ? P13543 13 ? 151 ? 13 151 
3 3 1KK8 C 1 ? 154 ? P07291 1  ? 154 ? 1  154 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"  ?                               'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                     ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ?                               'C4 H7 N O4'        133.103 
BEF non-polymer         . 'BERYLLIUM TRIFLUORIDE ION' ?                               'Be F3 -1'          66.007  
CA  non-polymer         . 'CALCIUM ION'               ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                    ?                               'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                    'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                   ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                       ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ?                               'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'             ?                               'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE               ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                    ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1KK8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   56.76 
_exptl_crystal.density_Matthews      2.84 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
;PEG 20000, magnesium chloride, ethylene glycol, Tris HCl, ADP-berillium floride, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2000-08-13 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Rh-coated with Si' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9298 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9298 
# 
_reflns.entry_id                     1KK8 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   49703 
_reflns.number_all                   62330 
_reflns.percent_possible_obs         79.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0970000 
_reflns.pdbx_netI_over_sigmaI        12.0 
_reflns.B_iso_Wilson_estimate        50.4 
_reflns.pdbx_redundancy              4.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.d_res_high             2.3 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   72.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.2470000 
_reflns_shell.meanI_over_sigI_obs    3.5 
_reflns_shell.pdbx_redundancy        2.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4527 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.entry_id                                 1KK8 
_refine.ls_number_reflns_obs                     49196 
_refine.ls_number_reflns_all                     49703 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               145691422.33 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             29.84 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    77.9 
_refine.ls_R_factor_obs                          0.2340000 
_refine.ls_R_factor_all                          0.2340000 
_refine.ls_R_factor_R_work                       0.2300000 
_refine.ls_R_factor_R_free                       0.2690000 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2519 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               55.8 
_refine.aniso_B[1][1]                            -2.93 
_refine.aniso_B[2][2]                            10.55 
_refine.aniso_B[3][3]                            -7.62 
_refine.aniso_B[1][2]                            0.63 
_refine.aniso_B[1][3]                            9.18 
_refine.aniso_B[2][3]                            -10.21 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.335473 
_refine.solvent_model_param_bsol                 47.7641 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1B7T' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             OVERALL 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           145691422.33 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1KK8 
_refine_analyze.Luzzati_coordinate_error_obs    0.33 
_refine_analyze.Luzzati_sigma_a_obs             0.29 
_refine_analyze.Luzzati_d_res_low_obs           40.00 
_refine_analyze.Luzzati_coordinate_error_free   0.41 
_refine_analyze.Luzzati_sigma_a_free            0.40 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8477 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         40 
_refine_hist.number_atoms_solvent             185 
_refine_hist.number_atoms_total               8702 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        29.84 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.0  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.86  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.44 
_refine_ls_shell.number_reflns_R_work             6336 
_refine_ls_shell.R_factor_R_work                  0.3090000 
_refine_ls_shell.percent_reflns_obs               63.1 
_refine_ls_shell.R_factor_R_free                  0.3680000 
_refine_ls_shell.R_factor_R_free_error            0.020 
_refine_ls_shell.percent_reflns_R_free            5.2 
_refine_ls_shell.number_reflns_R_free             346 
_refine_ls_shell.number_reflns_obs                6682 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
3 WATER.PARAM       WATER.TOP   'X-RAY DIFFRACTION' 
4 NEWBEF.PAR        NEWBEF.TOP  'X-RAY DIFFRACTION' 
5 GOL.PAR           GOL.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1KK8 
_struct.title                     'SCALLOP MYOSIN (S1-ADP-BeFx) IN THE ACTIN-DETACHED CONFORMATION' 
_struct.pdbx_descriptor           'LLOP MYOSIN S1-ADP-BeFx IN THE ACTIN-DETACHED CONFORMATION' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KK8 
_struct_keywords.pdbx_keywords   'CONTRACTILE PROTEIN' 
_struct_keywords.text            'actin-detached, Myosin, Mechanics of MOTOR, CONTRACTILE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 4 ? 
I N N 8 ? 
J N N 9 ? 
K N N 9 ? 
L N N 9 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 7   ? GLN A 11  ? ASP A 7   GLN A 11  5 ? 5  
HELX_P HELX_P2  2  ASP A 72  ? ILE A 74  ? ASP A 72  ILE A 74  5 ? 3  
HELX_P HELX_P3  3  PRO A 79  ? GLU A 83  ? PRO A 79  GLU A 83  5 ? 5  
HELX_P HELX_P4  4  ASP A 87  ? MET A 91  ? ASP A 87  MET A 91  5 ? 5  
HELX_P HELX_P5  5  ASN A 95  ? SER A 109 ? ASN A 95  SER A 109 1 ? 15 
HELX_P HELX_P6  6  THR A 133 ? ARG A 141 ? THR A 133 ARG A 141 1 ? 9  
HELX_P HELX_P7  7  ARG A 144 ? ILE A 148 ? ARG A 144 ILE A 148 5 ? 5  
HELX_P HELX_P8  8  HIS A 151 ? ARG A 167 ? HIS A 151 ARG A 167 1 ? 17 
HELX_P HELX_P9  9  GLY A 181 ? ALA A 197 ? GLY A 181 ALA A 197 1 ? 17 
HELX_P HELX_P10 10 SER A 214 ? GLY A 230 ? SER A 214 GLY A 230 1 ? 17 
HELX_P HELX_P11 11 GLU A 268 ? THR A 273 ? GLU A 268 THR A 273 5 ? 6  
HELX_P HELX_P12 12 TYR A 282 ? CYS A 289 ? TYR A 282 CYS A 289 1 ? 8  
HELX_P HELX_P13 13 ILE A 293 ? GLU A 295 ? ILE A 293 GLU A 295 5 ? 3  
HELX_P HELX_P14 14 LEU A 296 ? LEU A 301 ? LEU A 296 LEU A 301 1 ? 6  
HELX_P HELX_P15 15 ASP A 305 ? TYR A 309 ? ASP A 305 TYR A 309 5 ? 5  
HELX_P HELX_P16 16 ASP A 323 ? LEU A 338 ? ASP A 323 LEU A 338 1 ? 16 
HELX_P HELX_P17 17 THR A 341 ? GLY A 359 ? THR A 341 GLY A 359 1 ? 19 
HELX_P HELX_P18 18 THR A 377 ? GLY A 388 ? THR A 377 GLY A 388 1 ? 12 
HELX_P HELX_P19 19 ASN A 390 ? LYS A 400 ? ASN A 390 LYS A 400 1 ? 11 
HELX_P HELX_P20 20 ASN A 415 ? ASP A 447 ? ASN A 415 ASP A 447 1 ? 33 
HELX_P HELX_P21 21 SER A 471 ? GLU A 503 ? SER A 471 GLU A 503 1 ? 33 
HELX_P HELX_P22 22 GLY A 513 ? LYS A 525 ? GLY A 513 LYS A 525 1 ? 13 
HELX_P HELX_P23 23 GLY A 528 ? CYS A 537 ? GLY A 528 CYS A 537 1 ? 10 
HELX_P HELX_P24 24 ASP A 543 ? MET A 556 ? ASP A 543 MET A 556 1 ? 14 
HELX_P HELX_P25 25 GLY A 593 ? LYS A 599 ? GLY A 593 LYS A 599 1 ? 7  
HELX_P HELX_P26 26 ASN A 603 ? ALA A 612 ? ASN A 603 ALA A 612 1 ? 10 
HELX_P HELX_P27 27 GLU A 615 ? PHE A 622 ? GLU A 615 PHE A 622 1 ? 8  
HELX_P HELX_P28 28 THR A 644 ? TYR A 661 ? THR A 644 TYR A 661 1 ? 18 
HELX_P HELX_P29 29 ASP A 683 ? GLN A 692 ? ASP A 683 GLN A 692 1 ? 10 
HELX_P HELX_P30 30 TYR A 713 ? SER A 721 ? TYR A 713 SER A 721 1 ? 9  
HELX_P HELX_P31 31 ILE A 722 ? ILE A 728 ? ILE A 722 ILE A 728 5 ? 7  
HELX_P HELX_P32 32 ASP A 734 ? GLN A 747 ? ASP A 734 GLN A 747 1 ? 14 
HELX_P HELX_P33 33 ASP A 749 ? ALA A 751 ? ASP A 749 ALA A 751 5 ? 3  
HELX_P HELX_P34 34 GLY A 765 ? ASN A 823 ? GLY A 765 ASN A 823 1 ? 59 
HELX_P HELX_P35 35 TRP A 824 ? LYS A 834 ? TRP A 824 LYS A 834 1 ? 11 
HELX_P HELX_P36 36 PRO A 835 ? LEU A 837 ? PRO A 835 LEU A 837 5 ? 3  
HELX_P HELX_P37 37 GLN B 2   ? ASP B 16  ? GLN B 14  ASP B 28  1 ? 15 
HELX_P HELX_P38 38 SER B 24  ? GLY B 36  ? SER B 36  GLY B 48  1 ? 13 
HELX_P HELX_P39 39 ASP B 40  ? GLU B 50  ? ASP B 52  GLU B 62  1 ? 11 
HELX_P HELX_P40 40 ASN B 56  ? ASP B 66  ? ASN B 68  ASP B 78  1 ? 11 
HELX_P HELX_P41 41 SER B 73  ? MET B 83  ? SER B 85  MET B 95  1 ? 11 
HELX_P HELX_P42 42 ILE B 94  ? MET B 104 ? ILE B 106 MET B 116 1 ? 11 
HELX_P HELX_P43 43 ASN B 109 ? LYS B 118 ? ASN B 121 LYS B 130 1 ? 10 
HELX_P HELX_P44 44 ASP B 128 ? LYS B 137 ? ASP B 140 LYS B 149 1 ? 10 
HELX_P HELX_P45 45 SER C 4   ? ASP C 22  ? SER C 4   ASP C 22  1 ? 19 
HELX_P HELX_P46 46 LYS C 32  ? LEU C 40  ? LYS C 32  LEU C 40  1 ? 9  
HELX_P HELX_P47 47 ARG C 45  ? VAL C 52  ? ARG C 45  VAL C 52  1 ? 8  
HELX_P HELX_P48 48 PRO C 64  ? MET C 76  ? PRO C 64  MET C 76  1 ? 13 
HELX_P HELX_P49 49 THR C 82  ? THR C 92  ? THR C 82  THR C 92  1 ? 11 
HELX_P HELX_P50 50 GLY C 103 ? LEU C 113 ? GLY C 103 LEU C 113 1 ? 11 
HELX_P HELX_P51 51 SER C 118 ? ASP C 130 ? SER C 118 ASP C 130 1 ? 13 
HELX_P HELX_P52 52 TYR C 141 ? GLY C 151 ? TYR C 141 GLY C 151 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E BEF . BE ? ? ? 1_555 F ADP .   O3B ? ? A BEF 995 A ADP 996  1_555 ? ? ? ? ? ? ? 1.568 ? 
metalc2  metalc ? ? E BEF . F3 ? ? ? 1_555 D MG  .   MG  ? ? A BEF 995 A MG  997  1_555 ? ? ? ? ? ? ? 1.989 ? 
metalc3  metalc ? ? D MG  . MG ? ? ? 1_555 A SER 241 OG  ? ? A MG  997 A SER 241  1_555 ? ? ? ? ? ? ? 2.052 ? 
metalc4  metalc ? ? D MG  . MG ? ? ? 1_555 J HOH .   O   ? ? A MG  997 A HOH 1041 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc5  metalc ? ? D MG  . MG ? ? ? 1_555 F ADP .   O2B ? ? A MG  997 A ADP 996  1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc6  metalc ? ? D MG  . MG ? ? ? 1_555 J HOH .   O   ? ? A MG  997 A HOH 1042 1_555 ? ? ? ? ? ? ? 1.967 ? 
metalc7  metalc ? ? D MG  . MG ? ? ? 1_555 A THR 183 OG1 ? ? A MG  997 A THR 183  1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc8  metalc ? ? H MG  . MG ? ? ? 1_555 B ASP 20  OD1 ? ? B MG  998 B ASP 32   1_555 ? ? ? ? ? ? ? 2.042 ? 
metalc9  metalc ? ? H MG  . MG ? ? ? 1_555 B PHE 22  O   ? ? B MG  998 B PHE 34   1_555 ? ? ? ? ? ? ? 1.840 ? 
metalc10 metalc ? ? H MG  . MG ? ? ? 1_555 B ASP 27  OD1 ? ? B MG  998 B ASP 39   1_555 ? ? ? ? ? ? ? 3.032 ? 
metalc11 metalc ? ? H MG  . MG ? ? ? 1_555 B ASP 27  OD2 ? ? B MG  998 B ASP 39   1_555 ? ? ? ? ? ? ? 2.414 ? 
metalc12 metalc ? ? H MG  . MG ? ? ? 1_555 B ASP 18  OD2 ? ? B MG  998 B ASP 30   1_555 ? ? ? ? ? ? ? 2.973 ? 
metalc13 metalc ? ? H MG  . MG ? ? ? 1_555 B ASP 18  OD1 ? ? B MG  998 B ASP 30   1_555 ? ? ? ? ? ? ? 2.814 ? 
metalc14 metalc ? ? H MG  . MG ? ? ? 1_555 B ASP 16  OD1 ? ? B MG  998 B ASP 28   1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc15 metalc ? ? I CA  . CA ? ? ? 1_555 L HOH .   O   ? ? C CA  999 C HOH 1001 1_555 ? ? ? ? ? ? ? 2.845 ? 
metalc16 metalc ? ? I CA  . CA ? ? ? 1_555 C ASP 19  O   ? ? C CA  999 C ASP 19   1_555 ? ? ? ? ? ? ? 2.636 ? 
metalc17 metalc ? ? I CA  . CA ? ? ? 1_555 C ASP 22  OD1 ? ? C CA  999 C ASP 22   1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc18 metalc ? ? I CA  . CA ? ? ? 1_555 C ASP 25  OD2 ? ? C CA  999 C ASP 25   1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc19 metalc ? ? I CA  . CA ? ? ? 1_555 C GLY 23  O   ? ? C CA  999 C GLY 23   1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc20 metalc ? ? I CA  . CA ? ? ? 1_555 C ASP 19  OD1 ? ? C CA  999 C ASP 19   1_555 ? ? ? ? ? ? ? 2.145 ? 
metalc21 metalc ? ? I CA  . CA ? ? ? 1_555 C ALA 27  O   ? ? C CA  999 C ALA 27   1_555 ? ? ? ? ? ? ? 2.417 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 7 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 3 ? 
G ? 3 ? 
H ? 3 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 66  ? LYS A 70  ? THR A 66  LYS A 70  
A 2 GLU A 55  ? ILE A 60  ? GLU A 55  ILE A 60  
A 3 GLY A 42  ? LYS A 52  ? GLY A 42  LYS A 52  
A 4 ASN A 33  ? ASP A 38  ? ASN A 33  ASP A 38  
A 5 GLN A 75  ? SER A 76  ? GLN A 75  SER A 76  
B 1 TYR A 113 ? SER A 116 ? TYR A 113 SER A 116 
B 2 PHE A 119 ? VAL A 123 ? PHE A 119 VAL A 123 
B 3 THR A 663 ? ILE A 671 ? THR A 663 ILE A 671 
B 4 ASN A 169 ? THR A 175 ? ASN A 169 THR A 175 
B 5 TYR A 454 ? ASP A 460 ? TYR A 454 ASP A 460 
B 6 GLY A 244 ? PHE A 251 ? GLY A 244 PHE A 251 
B 7 ILE A 257 ? TYR A 265 ? ILE A 257 TYR A 265 
C 1 ASN A 231 ? ALA A 232 ? ASN A 231 ALA A 232 
C 2 SER A 240 ? SER A 241 ? SER A 240 SER A 241 
D 1 PHE A 363 ? LYS A 364 ? PHE A 363 LYS A 364 
D 2 GLU A 373 ? SER A 374 ? GLU A 373 SER A 374 
E 1 LYS A 402 ? VAL A 403 ? LYS A 402 VAL A 403 
E 2 VAL A 410 ? THR A 411 ? VAL A 410 THR A 411 
F 1 PHE A 562 ? THR A 563 ? PHE A 562 THR A 563 
F 2 PHE A 578 ? HIS A 582 ? PHE A 578 HIS A 582 
F 3 GLY A 585 ? TYR A 589 ? GLY A 585 TYR A 589 
G 1 SER A 709 ? ILE A 712 ? SER A 709 ILE A 712 
G 2 LYS A 759 ? PHE A 762 ? LYS A 759 PHE A 762 
G 3 TYR A 753 ? LEU A 755 ? TYR A 753 LEU A 755 
H 1 LEU B 92  ? ASN B 93  ? LEU B 104 ASN B 105 
H 2 LYS B 126 ? PHE B 127 ? LYS B 138 PHE B 139 
H 3 VAL B 122 ? GLU B 123 ? VAL B 134 GLU B 135 
I 1 VAL C 28  ? ASP C 29  ? VAL C 28  ASP C 29  
I 2 SER C 62  ? LEU C 63  ? SER C 62  LEU C 63  
J 1 PHE C 100 ? SER C 102 ? PHE C 100 SER C 102 
J 2 ASN C 138 ? LYS C 140 ? ASN C 138 LYS C 140 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 67  ? O ARG A 67  N VAL A 58  ? N VAL A 58  
A 2 3 O LYS A 59  ? O LYS A 59  N GLU A 47  ? N GLU A 47  
A 3 4 O ALA A 44  ? O ALA A 44  N VAL A 36  ? N VAL A 36  
A 4 5 N TRP A 35  ? N TRP A 35  O GLN A 75  ? O GLN A 75  
B 1 2 N THR A 114 ? N THR A 114 O ILE A 121 ? O ILE A 121 
B 2 3 N CYS A 120 ? N CYS A 120 O ARG A 669 ? O ARG A 669 
B 3 4 O CYS A 670 ? O CYS A 670 N THR A 175 ? N THR A 175 
B 4 5 N GLN A 170 ? N GLN A 170 O GLY A 457 ? O GLY A 457 
B 5 6 O TYR A 454 ? O TYR A 454 N PHE A 251 ? N PHE A 251 
B 6 7 N GLY A 244 ? N GLY A 244 O TYR A 265 ? O TYR A 265 
C 1 2 N ALA A 232 ? N ALA A 232 O SER A 240 ? O SER A 240 
D 1 2 N LYS A 364 ? N LYS A 364 O GLU A 373 ? O GLU A 373 
E 1 2 N VAL A 403 ? N VAL A 403 O VAL A 410 ? O VAL A 410 
F 1 2 N THR A 563 ? N THR A 563 O GLU A 579 ? O GLU A 579 
F 2 3 N PHE A 578 ? N PHE A 578 O TYR A 589 ? O TYR A 589 
G 1 2 N LEU A 711 ? N LEU A 711 O VAL A 760 ? O VAL A 760 
G 2 3 O PHE A 761 ? O PHE A 761 N ARG A 754 ? N ARG A 754 
H 1 2 N LEU B 92  ? N LEU B 104 O PHE B 127 ? O PHE B 139 
H 2 3 O LYS B 126 ? O LYS B 138 N GLU B 123 ? N GLU B 135 
I 1 2 N VAL C 28  ? N VAL C 28  O LEU C 63  ? O LEU C 63  
J 1 2 N ILE C 101 ? N ILE C 101 O VAL C 139 ? O VAL C 139 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 997'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG B 998'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA C 999'  
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE BEF A 995' 
AC5 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE ADP A 996' 
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A 998' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  THR A 183 ? THR A 183  . ? 1_555 ? 
2  AC1 6  SER A 241 ? SER A 241  . ? 1_555 ? 
3  AC1 6  BEF E .   ? BEF A 995  . ? 1_555 ? 
4  AC1 6  ADP F .   ? ADP A 996  . ? 1_555 ? 
5  AC1 6  HOH J .   ? HOH A 1041 . ? 1_555 ? 
6  AC1 6  HOH J .   ? HOH A 1042 . ? 1_555 ? 
7  AC2 5  ASP B 16  ? ASP B 28   . ? 1_555 ? 
8  AC2 5  ASP B 18  ? ASP B 30   . ? 1_555 ? 
9  AC2 5  ASP B 20  ? ASP B 32   . ? 1_555 ? 
10 AC2 5  PHE B 22  ? PHE B 34   . ? 1_555 ? 
11 AC2 5  ASP B 27  ? ASP B 39   . ? 1_555 ? 
12 AC3 6  ASP C 19  ? ASP C 19   . ? 1_555 ? 
13 AC3 6  ASP C 22  ? ASP C 22   . ? 1_555 ? 
14 AC3 6  GLY C 23  ? GLY C 23   . ? 1_555 ? 
15 AC3 6  ASP C 25  ? ASP C 25   . ? 1_555 ? 
16 AC3 6  ALA C 27  ? ALA C 27   . ? 1_555 ? 
17 AC3 6  HOH L .   ? HOH C 1001 . ? 1_555 ? 
18 AC4 9  SER A 178 ? SER A 178  . ? 1_555 ? 
19 AC4 9  GLY A 179 ? GLY A 179  . ? 1_555 ? 
20 AC4 9  LYS A 182 ? LYS A 182  . ? 1_555 ? 
21 AC4 9  ASN A 237 ? ASN A 237  . ? 1_555 ? 
22 AC4 9  SER A 240 ? SER A 240  . ? 1_555 ? 
23 AC4 9  SER A 241 ? SER A 241  . ? 1_555 ? 
24 AC4 9  ADP F .   ? ADP A 996  . ? 1_555 ? 
25 AC4 9  MG  D .   ? MG  A 997  . ? 1_555 ? 
26 AC4 9  HOH J .   ? HOH A 1042 . ? 1_555 ? 
27 AC5 18 ASN A 124 ? ASN A 124  . ? 1_555 ? 
28 AC5 18 ARG A 127 ? ARG A 127  . ? 1_555 ? 
29 AC5 18 TYR A 132 ? TYR A 132  . ? 1_555 ? 
30 AC5 18 GLU A 177 ? GLU A 177  . ? 1_555 ? 
31 AC5 18 SER A 178 ? SER A 178  . ? 1_555 ? 
32 AC5 18 GLY A 179 ? GLY A 179  . ? 1_555 ? 
33 AC5 18 ALA A 180 ? ALA A 180  . ? 1_555 ? 
34 AC5 18 GLY A 181 ? GLY A 181  . ? 1_555 ? 
35 AC5 18 LYS A 182 ? LYS A 182  . ? 1_555 ? 
36 AC5 18 THR A 183 ? THR A 183  . ? 1_555 ? 
37 AC5 18 GLU A 184 ? GLU A 184  . ? 1_555 ? 
38 AC5 18 ASN A 237 ? ASN A 237  . ? 1_555 ? 
39 AC5 18 BEF E .   ? BEF A 995  . ? 1_555 ? 
40 AC5 18 MG  D .   ? MG  A 997  . ? 1_555 ? 
41 AC5 18 HOH J .   ? HOH A 1035 . ? 1_555 ? 
42 AC5 18 HOH J .   ? HOH A 1041 . ? 1_555 ? 
43 AC5 18 HOH J .   ? HOH A 1042 . ? 1_555 ? 
44 AC5 18 HOH J .   ? HOH A 1102 . ? 1_555 ? 
45 AC6 7  SER A 178 ? SER A 178  . ? 1_555 ? 
46 AC6 7  THR A 234 ? THR A 234  . ? 1_555 ? 
47 AC6 7  THR A 235 ? THR A 235  . ? 1_555 ? 
48 AC6 7  ARG A 236 ? ARG A 236  . ? 1_555 ? 
49 AC6 7  SER A 240 ? SER A 240  . ? 1_555 ? 
50 AC6 7  ARG A 242 ? ARG A 242  . ? 1_555 ? 
51 AC6 7  HOH J .   ? HOH A 1019 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1KK8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KK8 
_atom_sites.fract_transf_matrix[1][1]   0.019378 
_atom_sites.fract_transf_matrix[1][2]   -0.008129 
_atom_sites.fract_transf_matrix[1][3]   -0.000650 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018529 
_atom_sites.fract_transf_matrix[2][3]   -0.002462 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007598 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BE 
C  
CA 
F  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? -13.653 11.757  -27.431 1.00   89.40 ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? -12.985 11.804  -26.094 1.00   90.49 ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? -13.540 12.924  -25.231 1.00   90.09 ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? -14.651 12.825  -24.714 1.00   90.43 ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? -11.468 11.981  -26.255 1.00   88.70 ? 1    MET A CB    1 
ATOM   6    N  N     . ASN A 1 2   ? -12.767 13.997  -25.082 1.00   92.78 ? 2    ASN A N     1 
ATOM   7    C  CA    . ASN A 1 2   ? -13.204 15.108  -24.248 1.00   95.36 ? 2    ASN A CA    1 
ATOM   8    C  C     . ASN A 1 2   ? -12.972 16.515  -24.798 1.00   96.44 ? 2    ASN A C     1 
ATOM   9    O  O     . ASN A 1 2   ? -12.220 16.725  -25.751 1.00   98.59 ? 2    ASN A O     1 
ATOM   10   C  CB    . ASN A 1 2   ? -12.564 14.989  -22.861 1.00   97.09 ? 2    ASN A CB    1 
ATOM   11   N  N     . ILE A 1 3   ? -13.642 17.466  -24.150 1.00   97.67 ? 3    ILE A N     1 
ATOM   12   C  CA    . ILE A 1 3   ? -13.587 18.886  -24.480 1.00   97.86 ? 3    ILE A CA    1 
ATOM   13   C  C     . ILE A 1 3   ? -13.157 19.633  -23.208 1.00   97.35 ? 3    ILE A C     1 
ATOM   14   O  O     . ILE A 1 3   ? -13.650 19.337  -22.119 1.00   96.35 ? 3    ILE A O     1 
ATOM   15   C  CB    . ILE A 1 3   ? -14.996 19.422  -24.908 1.00   98.63 ? 3    ILE A CB    1 
ATOM   16   C  CG1   . ILE A 1 3   ? -15.748 18.394  -25.768 1.00   99.20 ? 3    ILE A CG1   1 
ATOM   17   C  CG2   . ILE A 1 3   ? -14.841 20.706  -25.702 1.00   99.39 ? 3    ILE A CG2   1 
ATOM   18   C  CD1   . ILE A 1 3   ? -16.376 17.254  -24.980 1.00   99.07 ? 3    ILE A CD1   1 
ATOM   19   N  N     . ASP A 1 4   ? -12.249 20.593  -23.344 1.00   96.02 ? 4    ASP A N     1 
ATOM   20   C  CA    . ASP A 1 4   ? -11.767 21.385  -22.209 1.00   94.18 ? 4    ASP A CA    1 
ATOM   21   C  C     . ASP A 1 4   ? -10.867 22.471  -22.781 1.00   93.06 ? 4    ASP A C     1 
ATOM   22   O  O     . ASP A 1 4   ? -10.081 22.208  -23.695 1.00   91.73 ? 4    ASP A O     1 
ATOM   23   C  CB    . ASP A 1 4   ? -10.987 20.500  -21.234 1.00   93.13 ? 4    ASP A CB    1 
ATOM   24   N  N     . PHE A 1 5   ? -10.968 23.688  -22.254 1.00   91.65 ? 5    PHE A N     1 
ATOM   25   C  CA    . PHE A 1 5   ? -10.174 24.795  -22.784 1.00   91.10 ? 5    PHE A CA    1 
ATOM   26   C  C     . PHE A 1 5   ? -8.908  25.159  -22.001 1.00   90.62 ? 5    PHE A C     1 
ATOM   27   O  O     . PHE A 1 5   ? -8.141  24.296  -21.575 1.00   90.49 ? 5    PHE A O     1 
ATOM   28   C  CB    . PHE A 1 5   ? -11.062 26.042  -22.934 1.00   91.69 ? 5    PHE A CB    1 
ATOM   29   C  CG    . PHE A 1 5   ? -10.461 27.123  -23.810 1.00   92.82 ? 5    PHE A CG    1 
ATOM   30   C  CD1   . PHE A 1 5   ? -10.374 28.442  -23.357 1.00   93.10 ? 5    PHE A CD1   1 
ATOM   31   C  CD2   . PHE A 1 5   ? -9.964  26.817  -25.078 1.00   92.88 ? 5    PHE A CD2   1 
ATOM   32   C  CE1   . PHE A 1 5   ? -9.793  29.438  -24.148 1.00   93.20 ? 5    PHE A CE1   1 
ATOM   33   C  CE2   . PHE A 1 5   ? -9.381  27.803  -25.880 1.00   93.16 ? 5    PHE A CE2   1 
ATOM   34   C  CZ    . PHE A 1 5   ? -9.296  29.118  -25.416 1.00   93.20 ? 5    PHE A CZ    1 
ATOM   35   N  N     . SER A 1 6   ? -8.709  26.470  -21.840 1.00   88.81 ? 6    SER A N     1 
ATOM   36   C  CA    . SER A 1 6   ? -7.572  27.058  -21.145 1.00   86.27 ? 6    SER A CA    1 
ATOM   37   C  C     . SER A 1 6   ? -7.881  27.140  -19.653 1.00   83.74 ? 6    SER A C     1 
ATOM   38   O  O     . SER A 1 6   ? -7.449  28.063  -18.959 1.00   79.87 ? 6    SER A O     1 
ATOM   39   C  CB    . SER A 1 6   ? -7.310  28.462  -21.718 1.00   88.94 ? 6    SER A CB    1 
ATOM   40   O  OG    . SER A 1 6   ? -6.263  29.135  -21.035 1.00   95.60 ? 6    SER A OG    1 
ATOM   41   N  N     . ASP A 1 7   ? -8.636  26.161  -19.174 1.00   78.36 ? 7    ASP A N     1 
ATOM   42   C  CA    . ASP A 1 7   ? -9.023  26.093  -17.771 1.00   72.19 ? 7    ASP A CA    1 
ATOM   43   C  C     . ASP A 1 7   ? -7.816  25.775  -16.881 1.00   68.51 ? 7    ASP A C     1 
ATOM   44   O  O     . ASP A 1 7   ? -7.141  24.769  -17.082 1.00   63.95 ? 7    ASP A O     1 
ATOM   45   C  CB    . ASP A 1 7   ? -10.088 25.013  -17.594 1.00   72.34 ? 7    ASP A CB    1 
ATOM   46   C  CG    . ASP A 1 7   ? -10.792 25.104  -16.264 1.00   75.25 ? 7    ASP A CG    1 
ATOM   47   O  OD1   . ASP A 1 7   ? -10.124 25.414  -15.256 1.00   77.48 ? 7    ASP A OD1   1 
ATOM   48   O  OD2   . ASP A 1 7   ? -12.015 24.858  -16.224 1.00   78.07 ? 7    ASP A OD2   1 
ATOM   49   N  N     . PRO A 1 8   ? -7.526  26.634  -15.889 1.00   66.41 ? 8    PRO A N     1 
ATOM   50   C  CA    . PRO A 1 8   ? -6.377  26.359  -15.017 1.00   63.52 ? 8    PRO A CA    1 
ATOM   51   C  C     . PRO A 1 8   ? -6.512  24.980  -14.339 1.00   62.25 ? 8    PRO A C     1 
ATOM   52   O  O     . PRO A 1 8   ? -5.525  24.270  -14.154 1.00   61.54 ? 8    PRO A O     1 
ATOM   53   C  CB    . PRO A 1 8   ? -6.411  27.517  -14.018 1.00   63.65 ? 8    PRO A CB    1 
ATOM   54   C  CG    . PRO A 1 8   ? -7.879  27.857  -13.948 1.00   64.01 ? 8    PRO A CG    1 
ATOM   55   C  CD    . PRO A 1 8   ? -8.289  27.800  -15.401 1.00   63.13 ? 8    PRO A CD    1 
ATOM   56   N  N     . ASP A 1 9   ? -7.750  24.631  -13.976 1.00   61.55 ? 9    ASP A N     1 
ATOM   57   C  CA    . ASP A 1 9   ? -8.078  23.348  -13.352 1.00   61.51 ? 9    ASP A CA    1 
ATOM   58   C  C     . ASP A 1 9   ? -7.387  22.162  -14.046 1.00   61.08 ? 9    ASP A C     1 
ATOM   59   O  O     . ASP A 1 9   ? -7.111  21.148  -13.406 1.00   60.45 ? 9    ASP A O     1 
ATOM   60   C  CB    . ASP A 1 9   ? -9.596  23.127  -13.386 1.00   62.80 ? 9    ASP A CB    1 
ATOM   61   C  CG    . ASP A 1 9   ? -10.276 23.478  -12.072 1.00   64.58 ? 9    ASP A CG    1 
ATOM   62   O  OD1   . ASP A 1 9   ? -9.781  24.368  -11.334 1.00   64.44 ? 9    ASP A OD1   1 
ATOM   63   O  OD2   . ASP A 1 9   ? -11.325 22.856  -11.789 1.00   64.82 ? 9    ASP A OD2   1 
ATOM   64   N  N     . PHE A 1 10  ? -7.109  22.290  -15.346 1.00   59.38 ? 10   PHE A N     1 
ATOM   65   C  CA    . PHE A 1 10  ? -6.457  21.210  -16.075 1.00   57.61 ? 10   PHE A CA    1 
ATOM   66   C  C     . PHE A 1 10  ? -4.970  21.429  -16.342 1.00   56.74 ? 10   PHE A C     1 
ATOM   67   O  O     . PHE A 1 10  ? -4.342  20.607  -17.014 1.00   55.01 ? 10   PHE A O     1 
ATOM   68   C  CB    . PHE A 1 10  ? -7.166  20.953  -17.411 1.00   55.92 ? 10   PHE A CB    1 
ATOM   69   C  CG    . PHE A 1 10  ? -8.449  20.183  -17.285 1.00   54.94 ? 10   PHE A CG    1 
ATOM   70   C  CD1   . PHE A 1 10  ? -8.503  19.018  -16.525 1.00   55.03 ? 10   PHE A CD1   1 
ATOM   71   C  CD2   . PHE A 1 10  ? -9.597  20.595  -17.959 1.00   55.55 ? 10   PHE A CD2   1 
ATOM   72   C  CE1   . PHE A 1 10  ? -9.686  18.265  -16.442 1.00   55.87 ? 10   PHE A CE1   1 
ATOM   73   C  CE2   . PHE A 1 10  ? -10.790 19.851  -17.885 1.00   55.57 ? 10   PHE A CE2   1 
ATOM   74   C  CZ    . PHE A 1 10  ? -10.830 18.683  -17.124 1.00   55.61 ? 10   PHE A CZ    1 
ATOM   75   N  N     . GLN A 1 11  ? -4.405  22.509  -15.821 1.00   55.83 ? 11   GLN A N     1 
ATOM   76   C  CA    . GLN A 1 11  ? -2.992  22.786  -16.081 1.00   57.98 ? 11   GLN A CA    1 
ATOM   77   C  C     . GLN A 1 11  ? -2.084  21.577  -15.882 1.00   57.32 ? 11   GLN A C     1 
ATOM   78   O  O     . GLN A 1 11  ? -1.240  21.283  -16.735 1.00   56.82 ? 11   GLN A O     1 
ATOM   79   C  CB    . GLN A 1 11  ? -2.479  23.940  -15.206 1.00   62.49 ? 11   GLN A CB    1 
ATOM   80   C  CG    . GLN A 1 11  ? -1.055  24.352  -15.566 1.00   68.05 ? 11   GLN A CG    1 
ATOM   81   C  CD    . GLN A 1 11  ? -0.386  25.200  -14.498 1.00   71.98 ? 11   GLN A CD    1 
ATOM   82   O  OE1   . GLN A 1 11  ? 0.846   25.351  -14.486 1.00   73.86 ? 11   GLN A OE1   1 
ATOM   83   N  NE2   . GLN A 1 11  ? -1.191  25.761  -13.583 1.00   73.67 ? 11   GLN A NE2   1 
ATOM   84   N  N     . TYR A 1 12  ? -2.255  20.876  -14.757 1.00   54.27 ? 12   TYR A N     1 
ATOM   85   C  CA    . TYR A 1 12  ? -1.453  19.700  -14.447 1.00   50.96 ? 12   TYR A CA    1 
ATOM   86   C  C     . TYR A 1 12  ? -2.122  18.371  -14.754 1.00   49.51 ? 12   TYR A C     1 
ATOM   87   O  O     . TYR A 1 12  ? -1.722  17.340  -14.211 1.00   48.89 ? 12   TYR A O     1 
ATOM   88   C  CB    . TYR A 1 12  ? -1.074  19.701  -12.973 1.00   52.93 ? 12   TYR A CB    1 
ATOM   89   C  CG    . TYR A 1 12  ? -0.034  20.705  -12.595 1.00   55.12 ? 12   TYR A CG    1 
ATOM   90   C  CD1   . TYR A 1 12  ? -0.193  21.483  -11.468 1.00   56.18 ? 12   TYR A CD1   1 
ATOM   91   C  CD2   . TYR A 1 12  ? 1.118   20.868  -13.359 1.00   57.01 ? 12   TYR A CD2   1 
ATOM   92   C  CE1   . TYR A 1 12  ? 0.772   22.416  -11.096 1.00   57.89 ? 12   TYR A CE1   1 
ATOM   93   C  CE2   . TYR A 1 12  ? 2.090   21.795  -13.000 1.00   58.47 ? 12   TYR A CE2   1 
ATOM   94   C  CZ    . TYR A 1 12  ? 1.907   22.567  -11.861 1.00   58.33 ? 12   TYR A CZ    1 
ATOM   95   O  OH    . TYR A 1 12  ? 2.864   23.468  -11.467 1.00   59.27 ? 12   TYR A OH    1 
ATOM   96   N  N     . LEU A 1 13  ? -3.130  18.367  -15.617 1.00   46.06 ? 13   LEU A N     1 
ATOM   97   C  CA    . LEU A 1 13  ? -3.829  17.126  -15.948 1.00   43.33 ? 13   LEU A CA    1 
ATOM   98   C  C     . LEU A 1 13  ? -3.953  16.802  -17.427 1.00   44.11 ? 13   LEU A C     1 
ATOM   99   O  O     . LEU A 1 13  ? -3.780  15.654  -17.842 1.00   44.18 ? 13   LEU A O     1 
ATOM   100  C  CB    . LEU A 1 13  ? -5.230  17.166  -15.337 1.00   42.59 ? 13   LEU A CB    1 
ATOM   101  C  CG    . LEU A 1 13  ? -5.512  16.544  -13.968 1.00   41.57 ? 13   LEU A CG    1 
ATOM   102  C  CD1   . LEU A 1 13  ? -4.215  16.121  -13.306 1.00   40.42 ? 13   LEU A CD1   1 
ATOM   103  C  CD2   . LEU A 1 13  ? -6.313  17.518  -13.126 1.00   38.25 ? 13   LEU A CD2   1 
ATOM   104  N  N     . ALA A 1 14  ? -4.261  17.812  -18.242 1.00   44.53 ? 14   ALA A N     1 
ATOM   105  C  CA    . ALA A 1 14  ? -4.448  17.611  -19.667 1.00   44.55 ? 14   ALA A CA    1 
ATOM   106  C  C     . ALA A 1 14  ? -3.208  17.756  -20.522 1.00   48.34 ? 14   ALA A C     1 
ATOM   107  O  O     . ALA A 1 14  ? -2.289  18.504  -20.194 1.00   45.17 ? 14   ALA A O     1 
ATOM   108  C  CB    . ALA A 1 14  ? -5.510  18.563  -20.177 1.00   43.52 ? 14   ALA A CB    1 
ATOM   109  N  N     . VAL A 1 15  ? -3.194  17.029  -21.642 1.00   53.88 ? 15   VAL A N     1 
ATOM   110  C  CA    . VAL A 1 15  ? -2.111  17.103  -22.635 1.00   57.47 ? 15   VAL A CA    1 
ATOM   111  C  C     . VAL A 1 15  ? -2.738  17.756  -23.925 1.00   61.88 ? 15   VAL A C     1 
ATOM   112  O  O     . VAL A 1 15  ? -3.553  17.120  -24.595 1.00   59.60 ? 15   VAL A O     1 
ATOM   113  C  CB    . VAL A 1 15  ? -1.555  15.670  -23.017 1.00   60.77 ? 15   VAL A CB    1 
ATOM   114  C  CG1   . VAL A 1 15  ? -0.472  15.803  -24.066 1.00   66.00 ? 15   VAL A CG1   1 
ATOM   115  C  CG2   . VAL A 1 15  ? -0.981  14.940  -21.799 1.00   65.38 ? 15   VAL A CG2   1 
ATOM   116  N  N     . ASP A 1 16  ? -2.331  18.988  -24.220 1.00   83.18 ? 16   ASP A N     1 
ATOM   117  C  CA    . ASP A 1 16  ? -2.780  19.756  -25.390 1.00   86.27 ? 16   ASP A CA    1 
ATOM   118  C  C     . ASP A 1 16  ? -1.931  19.380  -26.588 1.00   84.20 ? 16   ASP A C     1 
ATOM   119  O  O     . ASP A 1 16  ? -1.307  20.238  -27.198 1.00   86.58 ? 16   ASP A O     1 
ATOM   120  C  CB    . ASP A 1 16  ? -2.525  21.227  -25.118 1.00   83.03 ? 16   ASP A CB    1 
ATOM   121  C  CG    . ASP A 1 16  ? -1.090  21.472  -24.653 1.00   80.72 ? 16   ASP A CG    1 
ATOM   122  O  OD1   . ASP A 1 16  ? -0.743  21.064  -23.517 1.00   78.91 ? 16   ASP A OD1   1 
ATOM   123  O  OD2   . ASP A 1 16  ? -0.299  22.035  -25.422 1.00   79.11 ? 16   ASP A OD2   1 
ATOM   124  N  N     . ARG A 1 17  ? -1.855  18.071  -26.923 1.00   84.15 ? 17   ARG A N     1 
ATOM   125  C  CA    . ARG A 1 17  ? -1.038  17.615  -28.047 1.00   85.65 ? 17   ARG A CA    1 
ATOM   126  C  C     . ARG A 1 17  ? -1.132  18.387  -29.374 1.00   87.71 ? 17   ARG A C     1 
ATOM   127  O  O     . ARG A 1 17  ? -1.298  17.784  -30.435 1.00   86.89 ? 17   ARG A O     1 
ATOM   128  C  CB    . ARG A 1 17  ? -1.283  16.110  -28.295 1.00   81.96 ? 17   ARG A CB    1 
ATOM   129  C  CG    . ARG A 1 17  ? -2.683  15.595  -27.886 1.00   71.28 ? 17   ARG A CG    1 
ATOM   130  C  CD    . ARG A 1 17  ? -2.742  14.055  -27.577 1.00   59.69 ? 17   ARG A CD    1 
ATOM   131  N  NE    . ARG A 1 17  ? -1.402  13.474  -27.385 1.00   57.97 ? 17   ARG A NE    1 
ATOM   132  C  CZ    . ARG A 1 17  ? -0.698  12.932  -28.376 1.00   50.34 ? 17   ARG A CZ    1 
ATOM   133  N  NH1   . ARG A 1 17  ? -1.231  12.849  -29.621 1.00   49.20 ? 17   ARG A NH1   1 
ATOM   134  N  NH2   . ARG A 1 17  ? 0.591   12.620  -28.191 1.00   43.65 ? 17   ARG A NH2   1 
ATOM   135  N  N     . LYS A 1 18  ? -0.959  19.689  -29.317 0.51   87.40 ? 18   LYS A N     1 
ATOM   136  C  CA    . LYS A 1 18  ? -0.994  20.603  -30.458 1.00   91.17 ? 18   LYS A CA    1 
ATOM   137  C  C     . LYS A 1 18  ? -0.654  22.021  -29.960 1.00   91.49 ? 18   LYS A C     1 
ATOM   138  O  O     . LYS A 1 18  ? -1.272  23.007  -30.348 0.83   93.80 ? 18   LYS A O     1 
ATOM   139  C  CB    . LYS A 1 18  ? -2.376  20.580  -31.112 1.00   90.59 ? 18   LYS A CB    1 
ATOM   140  N  N     . LYS A 1 19  ? 0.300   22.055  -29.108 1.00   92.05 ? 19   LYS A N     1 
ATOM   141  C  CA    . LYS A 1 19  ? 0.896   23.245  -28.498 1.00   90.38 ? 19   LYS A CA    1 
ATOM   142  C  C     . LYS A 1 19  ? 2.090   22.423  -28.037 1.00   93.92 ? 19   LYS A C     1 
ATOM   143  O  O     . LYS A 1 19  ? 2.943   22.862  -27.262 1.00   94.81 ? 19   LYS A O     1 
ATOM   144  C  CB    . LYS A 1 19  ? 0.060   23.722  -27.302 1.00   83.03 ? 19   LYS A CB    1 
ATOM   145  C  CG    . LYS A 1 19  ? 0.542   25.015  -26.623 1.00   67.31 ? 19   LYS A CG    1 
ATOM   146  C  CD    . LYS A 1 19  ? -0.178  26.247  -27.179 1.00   66.49 ? 19   LYS A CD    1 
ATOM   147  C  CE    . LYS A 1 19  ? -0.193  27.370  -26.139 1.00   54.75 ? 19   LYS A CE    1 
ATOM   148  N  NZ    . LYS A 1 19  ? -1.090  28.507  -26.630 1.00   56.31 ? 19   LYS A NZ    1 
ATOM   149  N  N     . LEU A 1 20  ? 2.081   21.242  -28.543 0.27   94.64 ? 20   LEU A N     1 
ATOM   150  C  CA    . LEU A 1 20  ? 3.052   20.171  -28.348 1.00   93.54 ? 20   LEU A CA    1 
ATOM   151  C  C     . LEU A 1 20  ? 2.719   18.939  -29.234 0.76   92.47 ? 20   LEU A C     1 
ATOM   152  O  O     . LEU A 1 20  ? 2.446   17.846  -28.724 0.82   92.30 ? 20   LEU A O     1 
ATOM   153  C  CB    . LEU A 1 20  ? 3.089   19.769  -26.883 0.34   94.07 ? 20   LEU A CB    1 
ATOM   154  N  N     . MET A 1 21  ? 2.716   19.150  -30.547 0.89   90.72 ? 21   MET A N     1 
ATOM   155  C  CA    . MET A 1 21  ? 2.497   18.156  -31.617 1.00   89.63 ? 21   MET A CA    1 
ATOM   156  C  C     . MET A 1 21  ? 3.279   18.949  -32.640 1.00   89.63 ? 21   MET A C     1 
ATOM   157  O  O     . MET A 1 21  ? 3.639   18.498  -33.726 0.68   90.61 ? 21   MET A O     1 
ATOM   158  C  CB    . MET A 1 21  ? 1.041   18.079  -32.026 1.00   88.50 ? 21   MET A CB    1 
ATOM   159  N  N     . LYS A 1 22  ? 3.519   20.173  -32.189 1.00   89.98 ? 22   LYS A N     1 
ATOM   160  C  CA    . LYS A 1 22  ? 4.258   21.217  -32.854 1.00   90.50 ? 22   LYS A CA    1 
ATOM   161  C  C     . LYS A 1 22  ? 5.555   21.312  -32.060 1.00   90.94 ? 22   LYS A C     1 
ATOM   162  O  O     . LYS A 1 22  ? 6.470   20.508  -32.245 1.00   93.15 ? 22   LYS A O     1 
ATOM   163  C  CB    . LYS A 1 22  ? 3.485   22.516  -32.748 1.00   92.78 ? 22   LYS A CB    1 
ATOM   164  N  N     . THR A 1 25  ? 8.658   18.301  -34.694 1.00   68.32 ? 25   THR A N     1 
ATOM   165  C  CA    . THR A 1 25  ? 9.766   18.865  -35.458 1.00   68.56 ? 25   THR A CA    1 
ATOM   166  C  C     . THR A 1 25  ? 11.015  17.975  -35.405 1.00   67.60 ? 25   THR A C     1 
ATOM   167  O  O     . THR A 1 25  ? 12.097  18.417  -35.010 1.00   69.51 ? 25   THR A O     1 
ATOM   168  C  CB    . THR A 1 25  ? 10.091  20.263  -34.951 1.00   68.73 ? 25   THR A CB    1 
ATOM   169  N  N     . ALA A 1 26  ? 10.834  16.712  -35.807 1.00   65.02 ? 26   ALA A N     1 
ATOM   170  C  CA    . ALA A 1 26  ? 11.897  15.697  -35.858 1.00   62.97 ? 26   ALA A CA    1 
ATOM   171  C  C     . ALA A 1 26  ? 11.374  14.450  -36.596 1.00   61.77 ? 26   ALA A C     1 
ATOM   172  O  O     . ALA A 1 26  ? 10.201  14.092  -36.462 1.00   63.06 ? 26   ALA A O     1 
ATOM   173  C  CB    . ALA A 1 26  ? 12.339  15.322  -34.459 1.00   62.68 ? 26   ALA A CB    1 
ATOM   174  N  N     . ALA A 1 27  ? 12.234  13.792  -37.373 1.00   58.28 ? 27   ALA A N     1 
ATOM   175  C  CA    . ALA A 1 27  ? 11.812  12.612  -38.131 1.00   55.94 ? 27   ALA A CA    1 
ATOM   176  C  C     . ALA A 1 27  ? 11.893  11.293  -37.358 1.00   55.51 ? 27   ALA A C     1 
ATOM   177  O  O     . ALA A 1 27  ? 12.677  11.155  -36.415 1.00   53.54 ? 27   ALA A O     1 
ATOM   178  C  CB    . ALA A 1 27  ? 12.624  12.501  -39.413 1.00   55.98 ? 27   ALA A CB    1 
ATOM   179  N  N     . PHE A 1 28  ? 11.074  10.339  -37.782 1.00   52.40 ? 28   PHE A N     1 
ATOM   180  C  CA    . PHE A 1 28  ? 11.022  9.026   -37.176 1.00   50.77 ? 28   PHE A CA    1 
ATOM   181  C  C     . PHE A 1 28  ? 10.855  7.907   -38.221 1.00   50.85 ? 28   PHE A C     1 
ATOM   182  O  O     . PHE A 1 28  ? 10.067  8.022   -39.148 1.00   48.16 ? 28   PHE A O     1 
ATOM   183  C  CB    . PHE A 1 28  ? 9.856   8.955   -36.180 1.00   50.27 ? 28   PHE A CB    1 
ATOM   184  C  CG    . PHE A 1 28  ? 9.592   7.562   -35.658 1.00   49.05 ? 28   PHE A CG    1 
ATOM   185  C  CD1   . PHE A 1 28  ? 10.224  7.099   -34.510 1.00   48.88 ? 28   PHE A CD1   1 
ATOM   186  C  CD2   . PHE A 1 28  ? 8.771   6.691   -36.363 1.00   48.53 ? 28   PHE A CD2   1 
ATOM   187  C  CE1   . PHE A 1 28  ? 10.043  5.798   -34.088 1.00   49.54 ? 28   PHE A CE1   1 
ATOM   188  C  CE2   . PHE A 1 28  ? 8.584   5.383   -35.943 1.00   48.45 ? 28   PHE A CE2   1 
ATOM   189  C  CZ    . PHE A 1 28  ? 9.218   4.932   -34.811 1.00   48.80 ? 28   PHE A CZ    1 
ATOM   190  N  N     . ASP A 1 29  ? 11.602  6.817   -38.035 1.00   52.36 ? 29   ASP A N     1 
ATOM   191  C  CA    . ASP A 1 29  ? 11.534  5.648   -38.916 1.00   52.75 ? 29   ASP A CA    1 
ATOM   192  C  C     . ASP A 1 29  ? 11.599  4.361   -38.072 1.00   52.04 ? 29   ASP A C     1 
ATOM   193  O  O     . ASP A 1 29  ? 12.641  4.045   -37.498 1.00   51.55 ? 29   ASP A O     1 
ATOM   194  C  CB    . ASP A 1 29  ? 12.704  5.661   -39.904 1.00   55.32 ? 29   ASP A CB    1 
ATOM   195  C  CG    . ASP A 1 29  ? 12.535  4.644   -41.026 1.00   58.77 ? 29   ASP A CG    1 
ATOM   196  O  OD1   . ASP A 1 29  ? 12.035  3.519   -40.773 1.00   59.73 ? 29   ASP A OD1   1 
ATOM   197  O  OD2   . ASP A 1 29  ? 12.918  4.977   -42.171 1.00   61.47 ? 29   ASP A OD2   1 
ATOM   198  N  N     . GLY A 1 30  ? 10.487  3.631   -38.014 1.00   51.86 ? 30   GLY A N     1 
ATOM   199  C  CA    . GLY A 1 30  ? 10.431  2.400   -37.238 1.00   51.25 ? 30   GLY A CA    1 
ATOM   200  C  C     . GLY A 1 30  ? 11.550  1.389   -37.462 1.00   52.34 ? 30   GLY A C     1 
ATOM   201  O  O     . GLY A 1 30  ? 11.957  0.699   -36.524 1.00   50.35 ? 30   GLY A O     1 
ATOM   202  N  N     . LYS A 1 31  ? 12.050  1.291   -38.690 1.00   52.32 ? 31   LYS A N     1 
ATOM   203  C  CA    . LYS A 1 31  ? 13.119  0.339   -38.997 1.00   51.57 ? 31   LYS A CA    1 
ATOM   204  C  C     . LYS A 1 31  ? 14.481  0.829   -38.535 1.00   50.43 ? 31   LYS A C     1 
ATOM   205  O  O     . LYS A 1 31  ? 15.438  0.064   -38.491 1.00   47.18 ? 31   LYS A O     1 
ATOM   206  C  CB    . LYS A 1 31  ? 13.202  0.075   -40.507 1.00   54.86 ? 31   LYS A CB    1 
ATOM   207  C  CG    . LYS A 1 31  ? 11.997  -0.617  -41.153 1.00   63.63 ? 31   LYS A CG    1 
ATOM   208  C  CD    . LYS A 1 31  ? 11.609  -1.900  -40.437 1.00   69.38 ? 31   LYS A CD    1 
ATOM   209  C  CE    . LYS A 1 31  ? 10.489  -2.626  -41.192 1.00   72.38 ? 31   LYS A CE    1 
ATOM   210  N  NZ    . LYS A 1 31  ? 9.862   -3.729  -40.386 1.00   73.02 ? 31   LYS A NZ    1 
ATOM   211  N  N     . LYS A 1 32  ? 14.563  2.107   -38.185 1.00   49.29 ? 32   LYS A N     1 
ATOM   212  C  CA    . LYS A 1 32  ? 15.821  2.709   -37.786 1.00   48.02 ? 32   LYS A CA    1 
ATOM   213  C  C     . LYS A 1 32  ? 15.880  3.216   -36.327 1.00   46.69 ? 32   LYS A C     1 
ATOM   214  O  O     . LYS A 1 32  ? 16.902  3.065   -35.652 1.00   45.83 ? 32   LYS A O     1 
ATOM   215  C  CB    . LYS A 1 32  ? 16.151  3.847   -38.770 1.00   50.69 ? 32   LYS A CB    1 
ATOM   216  C  CG    . LYS A 1 32  ? 17.429  4.632   -38.480 1.00   57.54 ? 32   LYS A CG    1 
ATOM   217  C  CD    . LYS A 1 32  ? 17.748  5.694   -39.573 1.00   61.93 ? 32   LYS A CD    1 
ATOM   218  C  CE    . LYS A 1 32  ? 16.662  6.799   -39.697 1.00   63.47 ? 32   LYS A CE    1 
ATOM   219  N  NZ    . LYS A 1 32  ? 16.367  7.532   -38.409 1.00   64.47 ? 32   LYS A NZ    1 
ATOM   220  N  N     . ASN A 1 33  ? 14.790  3.811   -35.860 1.00   45.00 ? 33   ASN A N     1 
ATOM   221  C  CA    . ASN A 1 33  ? 14.714  4.356   -34.510 1.00   43.11 ? 33   ASN A CA    1 
ATOM   222  C  C     . ASN A 1 33  ? 14.303  3.259   -33.523 1.00   42.75 ? 33   ASN A C     1 
ATOM   223  O  O     . ASN A 1 33  ? 13.335  2.533   -33.759 1.00   41.05 ? 33   ASN A O     1 
ATOM   224  C  CB    . ASN A 1 33  ? 13.715  5.519   -34.480 1.00   43.19 ? 33   ASN A CB    1 
ATOM   225  C  CG    . ASN A 1 33  ? 14.211  6.726   -35.268 1.00   44.89 ? 33   ASN A CG    1 
ATOM   226  O  OD1   . ASN A 1 33  ? 15.068  7.474   -34.803 1.00   44.65 ? 33   ASN A OD1   1 
ATOM   227  N  ND2   . ASN A 1 33  ? 13.681  6.906   -36.482 1.00   45.63 ? 33   ASN A ND2   1 
ATOM   228  N  N     . CYS A 1 34  ? 15.052  3.151   -32.425 1.00   40.79 ? 34   CYS A N     1 
ATOM   229  C  CA    . CYS A 1 34  ? 14.785  2.121   -31.430 1.00   39.98 ? 34   CYS A CA    1 
ATOM   230  C  C     . CYS A 1 34  ? 15.423  2.448   -30.077 1.00   37.85 ? 34   CYS A C     1 
ATOM   231  O  O     . CYS A 1 34  ? 16.186  3.402   -29.943 1.00   36.52 ? 34   CYS A O     1 
ATOM   232  C  CB    . CYS A 1 34  ? 15.356  0.796   -31.927 1.00   38.98 ? 34   CYS A CB    1 
ATOM   233  S  SG    . CYS A 1 34  ? 17.174  0.905   -32.127 1.00   43.02 ? 34   CYS A SG    1 
ATOM   234  N  N     . TRP A 1 35  ? 15.097  1.628   -29.090 1.00   37.17 ? 35   TRP A N     1 
ATOM   235  C  CA    . TRP A 1 35  ? 15.643  1.784   -27.740 1.00   35.79 ? 35   TRP A CA    1 
ATOM   236  C  C     . TRP A 1 35  ? 16.760  0.792   -27.514 1.00   35.00 ? 35   TRP A C     1 
ATOM   237  O  O     . TRP A 1 35  ? 16.660  -0.363  -27.920 1.00   35.09 ? 35   TRP A O     1 
ATOM   238  C  CB    . TRP A 1 35  ? 14.579  1.505   -26.691 1.00   33.68 ? 35   TRP A CB    1 
ATOM   239  C  CG    . TRP A 1 35  ? 13.501  2.487   -26.650 1.00   32.86 ? 35   TRP A CG    1 
ATOM   240  C  CD1   . TRP A 1 35  ? 12.183  2.269   -26.949 1.00   31.94 ? 35   TRP A CD1   1 
ATOM   241  C  CD2   . TRP A 1 35  ? 13.605  3.849   -26.227 1.00   31.47 ? 35   TRP A CD2   1 
ATOM   242  N  NE1   . TRP A 1 35  ? 11.458  3.408   -26.727 1.00   32.84 ? 35   TRP A NE1   1 
ATOM   243  C  CE2   . TRP A 1 35  ? 12.312  4.401   -26.284 1.00   31.21 ? 35   TRP A CE2   1 
ATOM   244  C  CE3   . TRP A 1 35  ? 14.667  4.645   -25.802 1.00   30.29 ? 35   TRP A CE3   1 
ATOM   245  C  CZ2   . TRP A 1 35  ? 12.041  5.724   -25.935 1.00   31.37 ? 35   TRP A CZ2   1 
ATOM   246  C  CZ3   . TRP A 1 35  ? 14.405  5.967   -25.437 1.00   32.13 ? 35   TRP A CZ3   1 
ATOM   247  C  CH2   . TRP A 1 35  ? 13.096  6.491   -25.508 1.00   31.88 ? 35   TRP A CH2   1 
ATOM   248  N  N     . VAL A 1 36  ? 17.820  1.237   -26.860 1.00   36.57 ? 36   VAL A N     1 
ATOM   249  C  CA    . VAL A 1 36  ? 18.903  0.313   -26.548 1.00   36.81 ? 36   VAL A CA    1 
ATOM   250  C  C     . VAL A 1 36  ? 19.237  0.504   -25.084 1.00   37.31 ? 36   VAL A C     1 
ATOM   251  O  O     . VAL A 1 36  ? 19.047  1.585   -24.530 1.00   37.67 ? 36   VAL A O     1 
ATOM   252  C  CB    . VAL A 1 36  ? 20.157  0.549   -27.439 1.00   36.33 ? 36   VAL A CB    1 
ATOM   253  C  CG1   . VAL A 1 36  ? 19.771  0.438   -28.895 1.00   34.59 ? 36   VAL A CG1   1 
ATOM   254  C  CG2   . VAL A 1 36  ? 20.804  1.894   -27.128 1.00   32.86 ? 36   VAL A CG2   1 
ATOM   255  N  N     . PRO A 1 37  ? 19.738  -0.551  -24.427 1.00   42.50 ? 37   PRO A N     1 
ATOM   256  C  CA    . PRO A 1 37  ? 20.077  -0.425  -23.007 1.00   44.81 ? 37   PRO A CA    1 
ATOM   257  C  C     . PRO A 1 37  ? 21.016  0.740   -22.782 1.00   46.76 ? 37   PRO A C     1 
ATOM   258  O  O     . PRO A 1 37  ? 21.759  1.139   -23.678 1.00   49.28 ? 37   PRO A O     1 
ATOM   259  C  CB    . PRO A 1 37  ? 20.714  -1.762  -22.686 1.00   44.26 ? 37   PRO A CB    1 
ATOM   260  C  CG    . PRO A 1 37  ? 19.932  -2.685  -23.606 1.00   42.38 ? 37   PRO A CG    1 
ATOM   261  C  CD    . PRO A 1 37  ? 19.975  -1.921  -24.896 1.00   41.40 ? 37   PRO A CD    1 
ATOM   262  N  N     . ASP A 1 38  ? 20.965  1.280   -21.576 1.00   50.86 ? 38   ASP A N     1 
ATOM   263  C  CA    . ASP A 1 38  ? 21.785  2.410   -21.212 1.00   54.59 ? 38   ASP A CA    1 
ATOM   264  C  C     . ASP A 1 38  ? 21.953  2.384   -19.704 1.00   59.04 ? 38   ASP A C     1 
ATOM   265  O  O     . ASP A 1 38  ? 20.997  2.602   -18.957 1.00   58.21 ? 38   ASP A O     1 
ATOM   266  C  CB    . ASP A 1 38  ? 21.097  3.698   -21.662 1.00   52.03 ? 38   ASP A CB    1 
ATOM   267  C  CG    . ASP A 1 38  ? 22.023  4.900   -21.606 1.00   50.11 ? 38   ASP A CG    1 
ATOM   268  O  OD1   . ASP A 1 38  ? 21.906  5.688   -20.637 1.00   48.66 ? 38   ASP A OD1   1 
ATOM   269  O  OD2   . ASP A 1 38  ? 22.877  5.043   -22.523 1.00   47.40 ? 38   ASP A OD2   1 
ATOM   270  N  N     . GLU A 1 39  ? 23.171  2.117   -19.254 1.00   63.98 ? 39   GLU A N     1 
ATOM   271  C  CA    . GLU A 1 39  ? 23.434  2.028   -17.825 1.00   67.45 ? 39   GLU A CA    1 
ATOM   272  C  C     . GLU A 1 39  ? 23.049  3.234   -16.954 1.00   66.81 ? 39   GLU A C     1 
ATOM   273  O  O     . GLU A 1 39  ? 22.869  3.075   -15.747 1.00   64.50 ? 39   GLU A O     1 
ATOM   274  C  CB    . GLU A 1 39  ? 24.905  1.690   -17.579 1.00   73.44 ? 39   GLU A CB    1 
ATOM   275  C  CG    . GLU A 1 39  ? 25.881  2.763   -18.016 1.00   85.95 ? 39   GLU A CG    1 
ATOM   276  C  CD    . GLU A 1 39  ? 27.264  2.544   -17.429 1.00   91.59 ? 39   GLU A CD    1 
ATOM   277  O  OE1   . GLU A 1 39  ? 27.397  2.587   -16.185 1.00   94.23 ? 39   GLU A OE1   1 
ATOM   278  O  OE2   . GLU A 1 39  ? 28.217  2.326   -18.207 1.00   93.99 ? 39   GLU A OE2   1 
ATOM   279  N  N     . LYS A 1 40  ? 22.918  4.424   -17.536 1.00   64.25 ? 40   LYS A N     1 
ATOM   280  C  CA    . LYS A 1 40  ? 22.582  5.592   -16.723 1.00   61.15 ? 40   LYS A CA    1 
ATOM   281  C  C     . LYS A 1 40  ? 21.201  6.234   -16.929 1.00   59.56 ? 40   LYS A C     1 
ATOM   282  O  O     . LYS A 1 40  ? 20.852  7.172   -16.217 1.00   57.15 ? 40   LYS A O     1 
ATOM   283  C  CB    . LYS A 1 40  ? 23.678  6.658   -16.865 1.00   63.36 ? 40   LYS A CB    1 
ATOM   284  C  CG    . LYS A 1 40  ? 25.061  6.254   -16.290 1.00   68.78 ? 40   LYS A CG    1 
ATOM   285  C  CD    . LYS A 1 40  ? 26.134  7.293   -16.623 1.00   72.14 ? 40   LYS A CD    1 
ATOM   286  C  CE    . LYS A 1 40  ? 27.556  6.695   -16.686 1.00   73.67 ? 40   LYS A CE    1 
ATOM   287  N  NZ    . LYS A 1 40  ? 28.399  6.974   -15.465 1.00   74.53 ? 40   LYS A NZ    1 
ATOM   288  N  N     . GLU A 1 41  ? 20.418  5.749   -17.894 1.00   55.13 ? 41   GLU A N     1 
ATOM   289  C  CA    . GLU A 1 41  ? 19.084  6.285   -18.134 1.00   50.16 ? 41   GLU A CA    1 
ATOM   290  C  C     . GLU A 1 41  ? 18.116  5.159   -18.456 1.00   47.59 ? 41   GLU A C     1 
ATOM   291  O  O     . GLU A 1 41  ? 17.006  5.391   -18.935 1.00   44.31 ? 41   GLU A O     1 
ATOM   292  C  CB    . GLU A 1 41  ? 19.089  7.314   -19.265 1.00   52.00 ? 41   GLU A CB    1 
ATOM   293  C  CG    . GLU A 1 41  ? 19.678  8.657   -18.856 1.00   59.41 ? 41   GLU A CG    1 
ATOM   294  C  CD    . GLU A 1 41  ? 18.875  9.329   -17.744 1.00   63.58 ? 41   GLU A CD    1 
ATOM   295  O  OE1   . GLU A 1 41  ? 19.419  10.232  -17.062 1.00   64.18 ? 41   GLU A OE1   1 
ATOM   296  O  OE2   . GLU A 1 41  ? 17.690  8.956   -17.552 1.00   66.37 ? 41   GLU A OE2   1 
ATOM   297  N  N     . GLY A 1 42  ? 18.559  3.933   -18.180 1.00   44.44 ? 42   GLY A N     1 
ATOM   298  C  CA    . GLY A 1 42  ? 17.744  2.766   -18.423 1.00   42.18 ? 42   GLY A CA    1 
ATOM   299  C  C     . GLY A 1 42  ? 17.799  2.363   -19.873 1.00   41.15 ? 42   GLY A C     1 
ATOM   300  O  O     . GLY A 1 42  ? 18.282  1.291   -20.225 1.00   41.69 ? 42   GLY A O     1 
ATOM   301  N  N     . PHE A 1 43  ? 17.291  3.252   -20.726 1.00   41.48 ? 43   PHE A N     1 
ATOM   302  C  CA    . PHE A 1 43  ? 17.267  3.051   -22.171 1.00   42.75 ? 43   PHE A CA    1 
ATOM   303  C  C     . PHE A 1 43  ? 17.584  4.367   -22.858 1.00   43.03 ? 43   PHE A C     1 
ATOM   304  O  O     . PHE A 1 43  ? 17.190  5.438   -22.387 1.00   44.35 ? 43   PHE A O     1 
ATOM   305  C  CB    . PHE A 1 43  ? 15.897  2.549   -22.613 1.00   43.30 ? 43   PHE A CB    1 
ATOM   306  C  CG    . PHE A 1 43  ? 15.651  1.122   -22.266 1.00   43.73 ? 43   PHE A CG    1 
ATOM   307  C  CD1   . PHE A 1 43  ? 16.216  0.104   -23.027 1.00   43.46 ? 43   PHE A CD1   1 
ATOM   308  C  CD2   . PHE A 1 43  ? 14.890  0.781   -21.151 1.00   42.90 ? 43   PHE A CD2   1 
ATOM   309  C  CE1   . PHE A 1 43  ? 16.031  -1.238  -22.671 1.00   42.16 ? 43   PHE A CE1   1 
ATOM   310  C  CE2   . PHE A 1 43  ? 14.704  -0.557  -20.798 1.00   40.81 ? 43   PHE A CE2   1 
ATOM   311  C  CZ    . PHE A 1 43  ? 15.272  -1.562  -21.559 1.00   40.49 ? 43   PHE A CZ    1 
ATOM   312  N  N     . ALA A 1 44  ? 18.302  4.274   -23.972 1.00   41.62 ? 44   ALA A N     1 
ATOM   313  C  CA    . ALA A 1 44  ? 18.707  5.435   -24.746 1.00   40.41 ? 44   ALA A CA    1 
ATOM   314  C  C     . ALA A 1 44  ? 18.142  5.378   -26.164 1.00   40.45 ? 44   ALA A C     1 
ATOM   315  O  O     . ALA A 1 44  ? 18.054  4.308   -26.781 1.00   35.98 ? 44   ALA A O     1 
ATOM   316  C  CB    . ALA A 1 44  ? 20.219  5.500   -24.792 1.00   39.00 ? 44   ALA A CB    1 
ATOM   317  N  N     . SER A 1 45  ? 17.757  6.545   -26.664 1.00   40.21 ? 45   SER A N     1 
ATOM   318  C  CA    . SER A 1 45  ? 17.188  6.674   -28.000 1.00   40.39 ? 45   SER A CA    1 
ATOM   319  C  C     . SER A 1 45  ? 18.266  6.491   -29.059 1.00   40.20 ? 45   SER A C     1 
ATOM   320  O  O     . SER A 1 45  ? 19.286  7.174   -29.036 1.00   37.04 ? 45   SER A O     1 
ATOM   321  C  CB    . SER A 1 45  ? 16.555  8.053   -28.150 1.00   42.24 ? 45   SER A CB    1 
ATOM   322  O  OG    . SER A 1 45  ? 16.121  8.236   -29.481 1.00   47.55 ? 45   SER A OG    1 
ATOM   323  N  N     . ALA A 1 46  ? 18.049  5.562   -29.983 1.00   40.69 ? 46   ALA A N     1 
ATOM   324  C  CA    . ALA A 1 46  ? 19.065  5.315   -30.997 1.00   40.62 ? 46   ALA A CA    1 
ATOM   325  C  C     . ALA A 1 46  ? 18.575  5.056   -32.409 1.00   41.24 ? 46   ALA A C     1 
ATOM   326  O  O     . ALA A 1 46  ? 17.377  4.886   -32.669 1.00   39.60 ? 46   ALA A O     1 
ATOM   327  C  CB    . ALA A 1 46  ? 19.955  4.177   -30.556 1.00   39.50 ? 46   ALA A CB    1 
ATOM   328  N  N     . GLU A 1 47  ? 19.541  5.031   -33.315 1.00   44.26 ? 47   GLU A N     1 
ATOM   329  C  CA    . GLU A 1 47  ? 19.303  4.805   -34.736 1.00   46.93 ? 47   GLU A CA    1 
ATOM   330  C  C     . GLU A 1 47  ? 20.297  3.772   -35.221 1.00   46.60 ? 47   GLU A C     1 
ATOM   331  O  O     . GLU A 1 47  ? 21.510  3.960   -35.103 1.00   47.64 ? 47   GLU A O     1 
ATOM   332  C  CB    . GLU A 1 47  ? 19.482  6.106   -35.506 1.00   50.27 ? 47   GLU A CB    1 
ATOM   333  C  CG    . GLU A 1 47  ? 18.346  7.083   -35.286 1.00   59.33 ? 47   GLU A CG    1 
ATOM   334  C  CD    . GLU A 1 47  ? 18.655  8.501   -35.774 1.00   64.03 ? 47   GLU A CD    1 
ATOM   335  O  OE1   . GLU A 1 47  ? 19.555  9.160   -35.187 1.00   66.17 ? 47   GLU A OE1   1 
ATOM   336  O  OE2   . GLU A 1 47  ? 17.998  8.954   -36.742 1.00   65.68 ? 47   GLU A OE2   1 
ATOM   337  N  N     . ILE A 1 48  ? 19.784  2.676   -35.756 1.00   45.86 ? 48   ILE A N     1 
ATOM   338  C  CA    . ILE A 1 48  ? 20.624  1.601   -36.277 1.00   44.95 ? 48   ILE A CA    1 
ATOM   339  C  C     . ILE A 1 48  ? 21.476  2.044   -37.476 1.00   46.95 ? 48   ILE A C     1 
ATOM   340  O  O     . ILE A 1 48  ? 20.938  2.468   -38.497 1.00   45.79 ? 48   ILE A O     1 
ATOM   341  C  CB    . ILE A 1 48  ? 19.737  0.420   -36.707 1.00   42.47 ? 48   ILE A CB    1 
ATOM   342  C  CG1   . ILE A 1 48  ? 19.145  -0.241  -35.456 1.00   40.42 ? 48   ILE A CG1   1 
ATOM   343  C  CG2   . ILE A 1 48  ? 20.528  -0.535  -37.605 1.00   38.38 ? 48   ILE A CG2   1 
ATOM   344  C  CD1   . ILE A 1 48  ? 17.727  -0.717  -35.601 1.00   38.91 ? 48   ILE A CD1   1 
ATOM   345  N  N     . GLN A 1 49  ? 22.801  1.940   -37.349 1.00   49.53 ? 49   GLN A N     1 
ATOM   346  C  CA    . GLN A 1 49  ? 23.713  2.314   -38.433 1.00   51.76 ? 49   GLN A CA    1 
ATOM   347  C  C     . GLN A 1 49  ? 23.881  1.164   -39.400 1.00   51.64 ? 49   GLN A C     1 
ATOM   348  O  O     . GLN A 1 49  ? 23.660  1.306   -40.600 1.00   51.89 ? 49   GLN A O     1 
ATOM   349  C  CB    . GLN A 1 49  ? 25.101  2.698   -37.892 1.00   55.73 ? 49   GLN A CB    1 
ATOM   350  C  CG    . GLN A 1 49  ? 25.145  4.010   -37.144 1.00   62.49 ? 49   GLN A CG    1 
ATOM   351  C  CD    . GLN A 1 49  ? 24.271  5.061   -37.801 1.00   65.87 ? 49   GLN A CD    1 
ATOM   352  O  OE1   . GLN A 1 49  ? 23.055  5.072   -37.609 1.00   67.23 ? 49   GLN A OE1   1 
ATOM   353  N  NE2   . GLN A 1 49  ? 24.881  5.938   -38.599 1.00   67.05 ? 49   GLN A NE2   1 
ATOM   354  N  N     . SER A 1 50  ? 24.289  0.019   -38.872 1.00   51.25 ? 50   SER A N     1 
ATOM   355  C  CA    . SER A 1 50  ? 24.484  -1.158  -39.691 1.00   50.48 ? 50   SER A CA    1 
ATOM   356  C  C     . SER A 1 50  ? 24.289  -2.408  -38.849 1.00   51.95 ? 50   SER A C     1 
ATOM   357  O  O     . SER A 1 50  ? 24.001  -2.332  -37.663 1.00   48.91 ? 50   SER A O     1 
ATOM   358  C  CB    . SER A 1 50  ? 25.891  -1.163  -40.325 1.00   48.69 ? 50   SER A CB    1 
ATOM   359  O  OG    . SER A 1 50  ? 26.914  -1.252  -39.353 1.00   48.22 ? 50   SER A OG    1 
ATOM   360  N  N     . SER A 1 51  ? 24.457  -3.553  -39.493 1.00   54.37 ? 51   SER A N     1 
ATOM   361  C  CA    . SER A 1 51  ? 24.283  -4.826  -38.850 1.00   56.19 ? 51   SER A CA    1 
ATOM   362  C  C     . SER A 1 51  ? 25.324  -5.842  -39.313 1.00   56.03 ? 51   SER A C     1 
ATOM   363  O  O     . SER A 1 51  ? 25.723  -5.863  -40.475 1.00   52.22 ? 51   SER A O     1 
ATOM   364  C  CB    . SER A 1 51  ? 22.887  -5.364  -39.151 1.00   59.92 ? 51   SER A CB    1 
ATOM   365  O  OG    . SER A 1 51  ? 22.743  -6.681  -38.642 1.00   73.05 ? 51   SER A OG    1 
ATOM   366  N  N     . LYS A 1 52  ? 25.742  -6.681  -38.373 1.00   53.63 ? 52   LYS A N     1 
ATOM   367  C  CA    . LYS A 1 52  ? 26.708  -7.730  -38.609 1.00   50.81 ? 52   LYS A CA    1 
ATOM   368  C  C     . LYS A 1 52  ? 26.231  -8.906  -37.753 1.00   49.84 ? 52   LYS A C     1 
ATOM   369  O  O     . LYS A 1 52  ? 26.799  -9.179  -36.696 1.00   47.01 ? 52   LYS A O     1 
ATOM   370  C  CB    . LYS A 1 52  ? 28.107  -7.274  -38.168 1.00   51.91 ? 52   LYS A CB    1 
ATOM   371  C  CG    . LYS A 1 52  ? 29.245  -8.124  -38.734 1.00   57.57 ? 52   LYS A CG    1 
ATOM   372  C  CD    . LYS A 1 52  ? 30.601  -7.619  -38.259 1.00   61.59 ? 52   LYS A CD    1 
ATOM   373  C  CE    . LYS A 1 52  ? 30.781  -7.842  -36.738 1.00   63.67 ? 52   LYS A CE    1 
ATOM   374  N  NZ    . LYS A 1 52  ? 32.039  -7.206  -36.180 1.00   64.70 ? 52   LYS A NZ    1 
ATOM   375  N  N     . GLY A 1 53  ? 25.176  -9.575  -38.206 1.00   49.55 ? 53   GLY A N     1 
ATOM   376  C  CA    . GLY A 1 53  ? 24.627  -10.694 -37.465 1.00   51.98 ? 53   GLY A CA    1 
ATOM   377  C  C     . GLY A 1 53  ? 23.896  -10.263 -36.199 1.00   54.51 ? 53   GLY A C     1 
ATOM   378  O  O     . GLY A 1 53  ? 23.010  -9.412  -36.242 1.00   54.05 ? 53   GLY A O     1 
ATOM   379  N  N     . ASP A 1 54  ? 24.287  -10.847 -35.074 1.00   58.51 ? 54   ASP A N     1 
ATOM   380  C  CA    . ASP A 1 54  ? 23.690  -10.577 -33.770 1.00   62.80 ? 54   ASP A CA    1 
ATOM   381  C  C     . ASP A 1 54  ? 24.229  -9.277  -33.171 1.00   63.34 ? 54   ASP A C     1 
ATOM   382  O  O     . ASP A 1 54  ? 23.748  -8.820  -32.132 1.00   63.49 ? 54   ASP A O     1 
ATOM   383  C  CB    . ASP A 1 54  ? 23.978  -11.761 -32.830 1.00   68.47 ? 54   ASP A CB    1 
ATOM   384  C  CG    . ASP A 1 54  ? 22.924  -11.929 -31.728 1.00   76.16 ? 54   ASP A CG    1 
ATOM   385  O  OD1   . ASP A 1 54  ? 23.049  -11.241 -30.687 1.00   78.37 ? 54   ASP A OD1   1 
ATOM   386  O  OD2   . ASP A 1 54  ? 21.974  -12.749 -31.906 1.00   79.46 ? 54   ASP A OD2   1 
ATOM   387  N  N     . GLU A 1 55  ? 25.221  -8.687  -33.823 1.00   62.05 ? 55   GLU A N     1 
ATOM   388  C  CA    . GLU A 1 55  ? 25.805  -7.443  -33.341 1.00   59.53 ? 55   GLU A CA    1 
ATOM   389  C  C     . GLU A 1 55  ? 25.335  -6.266  -34.203 1.00   55.95 ? 55   GLU A C     1 
ATOM   390  O  O     . GLU A 1 55  ? 25.574  -6.244  -35.407 1.00   54.26 ? 55   GLU A O     1 
ATOM   391  C  CB    . GLU A 1 55  ? 27.322  -7.559  -33.375 1.00   61.46 ? 55   GLU A CB    1 
ATOM   392  C  CG    . GLU A 1 55  ? 28.036  -6.311  -32.990 1.00   67.00 ? 55   GLU A CG    1 
ATOM   393  C  CD    . GLU A 1 55  ? 29.530  -6.433  -33.189 1.00   70.47 ? 55   GLU A CD    1 
ATOM   394  O  OE1   . GLU A 1 55  ? 30.245  -6.613  -32.174 1.00   71.92 ? 55   GLU A OE1   1 
ATOM   395  O  OE2   . GLU A 1 55  ? 29.979  -6.356  -34.361 1.00   71.45 ? 55   GLU A OE2   1 
ATOM   396  N  N     . ILE A 1 56  ? 24.665  -5.289  -33.594 1.00   50.15 ? 56   ILE A N     1 
ATOM   397  C  CA    . ILE A 1 56  ? 24.158  -4.144  -34.343 1.00   45.86 ? 56   ILE A CA    1 
ATOM   398  C  C     . ILE A 1 56  ? 24.897  -2.893  -33.930 1.00   45.19 ? 56   ILE A C     1 
ATOM   399  O  O     . ILE A 1 56  ? 25.240  -2.716  -32.764 1.00   44.78 ? 56   ILE A O     1 
ATOM   400  C  CB    . ILE A 1 56  ? 22.639  -3.903  -34.082 1.00   43.59 ? 56   ILE A CB    1 
ATOM   401  C  CG1   . ILE A 1 56  ? 21.845  -5.196  -34.289 1.00   41.21 ? 56   ILE A CG1   1 
ATOM   402  C  CG2   . ILE A 1 56  ? 22.105  -2.806  -34.994 1.00   42.40 ? 56   ILE A CG2   1 
ATOM   403  C  CD1   . ILE A 1 56  ? 22.017  -5.854  -35.627 1.00   38.89 ? 56   ILE A CD1   1 
ATOM   404  N  N     . THR A 1 57  ? 25.152  -2.008  -34.891 1.00   43.68 ? 57   THR A N     1 
ATOM   405  C  CA    . THR A 1 57  ? 25.829  -0.767  -34.580 1.00   42.48 ? 57   THR A CA    1 
ATOM   406  C  C     . THR A 1 57  ? 24.812  0.345   -34.589 1.00   43.56 ? 57   THR A C     1 
ATOM   407  O  O     . THR A 1 57  ? 24.070  0.502   -35.560 1.00   41.89 ? 57   THR A O     1 
ATOM   408  C  CB    . THR A 1 57  ? 26.891  -0.434  -35.610 1.00   42.74 ? 57   THR A CB    1 
ATOM   409  O  OG1   . THR A 1 57  ? 27.865  -1.480  -35.623 1.00   43.42 ? 57   THR A OG1   1 
ATOM   410  C  CG2   . THR A 1 57  ? 27.559  0.910   -35.294 1.00   40.61 ? 57   THR A CG2   1 
ATOM   411  N  N     . VAL A 1 58  ? 24.758  1.119   -33.512 1.00   43.18 ? 58   VAL A N     1 
ATOM   412  C  CA    . VAL A 1 58  ? 23.812  2.212   -33.483 1.00   43.81 ? 58   VAL A CA    1 
ATOM   413  C  C     . VAL A 1 58  ? 24.483  3.530   -33.175 1.00   45.44 ? 58   VAL A C     1 
ATOM   414  O  O     . VAL A 1 58  ? 25.618  3.590   -32.717 1.00   43.61 ? 58   VAL A O     1 
ATOM   415  C  CB    . VAL A 1 58  ? 22.677  2.025   -32.434 1.00   45.06 ? 58   VAL A CB    1 
ATOM   416  C  CG1   . VAL A 1 58  ? 21.871  0.783   -32.729 1.00   45.98 ? 58   VAL A CG1   1 
ATOM   417  C  CG2   . VAL A 1 58  ? 23.269  2.014   -31.017 1.00   47.11 ? 58   VAL A CG2   1 
ATOM   418  N  N     . LYS A 1 59  ? 23.734  4.582   -33.447 1.00   47.01 ? 59   LYS A N     1 
ATOM   419  C  CA    . LYS A 1 59  ? 24.159  5.939   -33.209 1.00   47.42 ? 59   LYS A CA    1 
ATOM   420  C  C     . LYS A 1 59  ? 23.271  6.411   -32.055 1.00   46.79 ? 59   LYS A C     1 
ATOM   421  O  O     . LYS A 1 59  ? 22.040  6.394   -32.170 1.00   45.80 ? 59   LYS A O     1 
ATOM   422  C  CB    . LYS A 1 59  ? 23.900  6.767   -34.460 1.00   50.32 ? 59   LYS A CB    1 
ATOM   423  C  CG    . LYS A 1 59  ? 24.149  8.255   -34.311 1.00   58.30 ? 59   LYS A CG    1 
ATOM   424  C  CD    . LYS A 1 59  ? 23.884  8.989   -35.644 1.00   62.94 ? 59   LYS A CD    1 
ATOM   425  C  CE    . LYS A 1 59  ? 24.038  10.498  -35.496 1.00   65.00 ? 59   LYS A CE    1 
ATOM   426  N  NZ    . LYS A 1 59  ? 23.095  11.034  -34.464 1.00   66.32 ? 59   LYS A NZ    1 
ATOM   427  N  N     . ILE A 1 60  ? 23.887  6.810   -30.952 1.00   46.92 ? 60   ILE A N     1 
ATOM   428  C  CA    . ILE A 1 60  ? 23.155  7.299   -29.781 1.00   47.28 ? 60   ILE A CA    1 
ATOM   429  C  C     . ILE A 1 60  ? 22.707  8.710   -30.093 1.00   49.13 ? 60   ILE A C     1 
ATOM   430  O  O     . ILE A 1 60  ? 23.517  9.642   -30.085 1.00   49.82 ? 60   ILE A O     1 
ATOM   431  C  CB    . ILE A 1 60  ? 24.059  7.332   -28.531 1.00   45.41 ? 60   ILE A CB    1 
ATOM   432  C  CG1   . ILE A 1 60  ? 24.510  5.915   -28.174 1.00   44.10 ? 60   ILE A CG1   1 
ATOM   433  C  CG2   . ILE A 1 60  ? 23.319  7.959   -27.377 1.00   43.29 ? 60   ILE A CG2   1 
ATOM   434  C  CD1   . ILE A 1 60  ? 23.405  5.058   -27.615 1.00   42.52 ? 60   ILE A CD1   1 
ATOM   435  N  N     . VAL A 1 61  ? 21.416  8.876   -30.365 1.00   52.58 ? 61   VAL A N     1 
ATOM   436  C  CA    . VAL A 1 61  ? 20.858  10.182  -30.715 1.00   55.80 ? 61   VAL A CA    1 
ATOM   437  C  C     . VAL A 1 61  ? 21.262  11.391  -29.866 1.00   56.39 ? 61   VAL A C     1 
ATOM   438  O  O     . VAL A 1 61  ? 21.418  12.484  -30.403 1.00   58.81 ? 61   VAL A O     1 
ATOM   439  C  CB    . VAL A 1 61  ? 19.298  10.140  -30.773 1.00   57.29 ? 61   VAL A CB    1 
ATOM   440  C  CG1   . VAL A 1 61  ? 18.749  11.560  -30.896 1.00   57.65 ? 61   VAL A CG1   1 
ATOM   441  C  CG2   . VAL A 1 61  ? 18.834  9.304   -31.973 1.00   56.72 ? 61   VAL A CG2   1 
ATOM   442  N  N     . ALA A 1 62  ? 21.445  11.217  -28.561 1.00   58.30 ? 62   ALA A N     1 
ATOM   443  C  CA    . ALA A 1 62  ? 21.809  12.360  -27.718 1.00   60.75 ? 62   ALA A CA    1 
ATOM   444  C  C     . ALA A 1 62  ? 23.138  13.028  -28.104 1.00   62.71 ? 62   ALA A C     1 
ATOM   445  O  O     . ALA A 1 62  ? 23.154  14.209  -28.464 1.00   65.95 ? 62   ALA A O     1 
ATOM   446  C  CB    . ALA A 1 62  ? 21.839  11.955  -26.256 1.00   59.84 ? 62   ALA A CB    1 
ATOM   447  N  N     . ASP A 1 63  ? 24.245  12.285  -28.040 1.00   65.17 ? 63   ASP A N     1 
ATOM   448  C  CA    . ASP A 1 63  ? 25.566  12.838  -28.371 1.00   67.10 ? 63   ASP A CA    1 
ATOM   449  C  C     . ASP A 1 63  ? 26.271  12.334  -29.645 1.00   67.49 ? 63   ASP A C     1 
ATOM   450  O  O     . ASP A 1 63  ? 27.431  12.677  -29.873 1.00   68.08 ? 63   ASP A O     1 
ATOM   451  C  CB    . ASP A 1 63  ? 26.521  12.641  -27.189 1.00   67.44 ? 63   ASP A CB    1 
ATOM   452  C  CG    . ASP A 1 63  ? 26.606  11.190  -26.735 1.00   66.34 ? 63   ASP A CG    1 
ATOM   453  O  OD1   . ASP A 1 63  ? 26.148  10.304  -27.484 1.00   64.95 ? 63   ASP A OD1   1 
ATOM   454  O  OD2   . ASP A 1 63  ? 27.144  10.938  -25.629 1.00   66.21 ? 63   ASP A OD2   1 
ATOM   455  N  N     . SER A 1 64  ? 25.594  11.529  -30.460 1.00   66.00 ? 64   SER A N     1 
ATOM   456  C  CA    . SER A 1 64  ? 26.191  11.007  -31.694 1.00   65.09 ? 64   SER A CA    1 
ATOM   457  C  C     . SER A 1 64  ? 27.236  9.900   -31.497 1.00   64.21 ? 64   SER A C     1 
ATOM   458  O  O     . SER A 1 64  ? 27.856  9.461   -32.465 1.00   62.88 ? 64   SER A O     1 
ATOM   459  C  CB    . SER A 1 64  ? 26.825  12.148  -32.510 1.00   65.49 ? 64   SER A CB    1 
ATOM   460  O  OG    . SER A 1 64  ? 25.847  12.917  -33.192 1.00   66.01 ? 64   SER A OG    1 
ATOM   461  N  N     . SER A 1 65  ? 27.439  9.455   -30.264 1.00   60.84 ? 65   SER A N     1 
ATOM   462  C  CA    . SER A 1 65  ? 28.410  8.400   -30.009 1.00   57.92 ? 65   SER A CA    1 
ATOM   463  C  C     . SER A 1 65  ? 27.972  7.122   -30.695 1.00   56.25 ? 65   SER A C     1 
ATOM   464  O  O     . SER A 1 65  ? 26.816  6.988   -31.098 1.00   54.24 ? 65   SER A O     1 
ATOM   465  C  CB    . SER A 1 65  ? 28.556  8.161   -28.508 1.00   58.60 ? 65   SER A CB    1 
ATOM   466  O  OG    . SER A 1 65  ? 27.293  7.917   -27.913 1.00   62.97 ? 65   SER A OG    1 
ATOM   467  N  N     . THR A 1 66  ? 28.895  6.183   -30.825 1.00   52.21 ? 66   THR A N     1 
ATOM   468  C  CA    . THR A 1 66  ? 28.609  4.917   -31.479 1.00   49.36 ? 66   THR A CA    1 
ATOM   469  C  C     . THR A 1 66  ? 28.830  3.756   -30.531 1.00   48.98 ? 66   THR A C     1 
ATOM   470  O  O     . THR A 1 66  ? 29.770  3.764   -29.738 1.00   47.38 ? 66   THR A O     1 
ATOM   471  C  CB    . THR A 1 66  ? 29.517  4.706   -32.727 1.00   49.93 ? 66   THR A CB    1 
ATOM   472  O  OG1   . THR A 1 66  ? 29.033  5.502   -33.823 1.00   51.16 ? 66   THR A OG1   1 
ATOM   473  C  CG2   . THR A 1 66  ? 29.530  3.236   -33.144 1.00   51.31 ? 66   THR A CG2   1 
ATOM   474  N  N     . ARG A 1 67  ? 27.965  2.761   -30.606 1.00   48.43 ? 67   ARG A N     1 
ATOM   475  C  CA    . ARG A 1 67  ? 28.117  1.612   -29.752 1.00   47.50 ? 67   ARG A CA    1 
ATOM   476  C  C     . ARG A 1 67  ? 27.488  0.399   -30.400 1.00   48.04 ? 67   ARG A C     1 
ATOM   477  O  O     . ARG A 1 67  ? 26.721  0.494   -31.353 1.00   46.16 ? 67   ARG A O     1 
ATOM   478  C  CB    . ARG A 1 67  ? 27.522  1.866   -28.351 1.00   47.19 ? 67   ARG A CB    1 
ATOM   479  C  CG    . ARG A 1 67  ? 26.034  1.706   -28.250 1.00   50.35 ? 67   ARG A CG    1 
ATOM   480  C  CD    . ARG A 1 67  ? 25.537  1.901   -26.825 1.00   51.66 ? 67   ARG A CD    1 
ATOM   481  N  NE    . ARG A 1 67  ? 25.830  3.242   -26.357 1.00   52.64 ? 67   ARG A NE    1 
ATOM   482  C  CZ    . ARG A 1 67  ? 25.225  3.820   -25.327 1.00   52.32 ? 67   ARG A CZ    1 
ATOM   483  N  NH1   . ARG A 1 67  ? 24.284  3.173   -24.644 1.00   51.75 ? 67   ARG A NH1   1 
ATOM   484  N  NH2   . ARG A 1 67  ? 25.547  5.058   -25.002 1.00   52.37 ? 67   ARG A NH2   1 
ATOM   485  N  N     . THR A 1 68  ? 27.843  -0.753  -29.843 1.00   50.27 ? 68   THR A N     1 
ATOM   486  C  CA    . THR A 1 68  ? 27.418  -2.048  -30.317 1.00   52.18 ? 68   THR A CA    1 
ATOM   487  C  C     . THR A 1 68  ? 26.397  -2.637  -29.361 1.00   51.66 ? 68   THR A C     1 
ATOM   488  O  O     . THR A 1 68  ? 26.545  -2.524  -28.149 1.00   53.12 ? 68   THR A O     1 
ATOM   489  C  CB    . THR A 1 68  ? 28.665  -2.960  -30.420 1.00   54.73 ? 68   THR A CB    1 
ATOM   490  O  OG1   . THR A 1 68  ? 28.980  -3.178  -31.803 1.00   58.02 ? 68   THR A OG1   1 
ATOM   491  C  CG2   . THR A 1 68  ? 28.445  -4.284  -29.680 1.00   58.77 ? 68   THR A CG2   1 
ATOM   492  N  N     . VAL A 1 69  ? 25.357  -3.263  -29.902 1.00   51.29 ? 69   VAL A N     1 
ATOM   493  C  CA    . VAL A 1 69  ? 24.316  -3.862  -29.072 1.00   49.69 ? 69   VAL A CA    1 
ATOM   494  C  C     . VAL A 1 69  ? 23.777  -5.171  -29.641 1.00   50.68 ? 69   VAL A C     1 
ATOM   495  O  O     . VAL A 1 69  ? 23.526  -5.278  -30.839 1.00   48.37 ? 69   VAL A O     1 
ATOM   496  C  CB    . VAL A 1 69  ? 23.135  -2.905  -28.899 1.00   48.22 ? 69   VAL A CB    1 
ATOM   497  C  CG1   . VAL A 1 69  ? 23.593  -1.626  -28.233 1.00   48.79 ? 69   VAL A CG1   1 
ATOM   498  C  CG2   . VAL A 1 69  ? 22.537  -2.600  -30.227 1.00   48.75 ? 69   VAL A CG2   1 
ATOM   499  N  N     . LYS A 1 70  ? 23.616  -6.172  -28.772 1.00   51.61 ? 70   LYS A N     1 
ATOM   500  C  CA    . LYS A 1 70  ? 23.076  -7.467  -29.168 1.00   52.76 ? 70   LYS A CA    1 
ATOM   501  C  C     . LYS A 1 70  ? 21.715  -7.152  -29.757 1.00   53.38 ? 70   LYS A C     1 
ATOM   502  O  O     . LYS A 1 70  ? 20.966  -6.345  -29.212 1.00   51.33 ? 70   LYS A O     1 
ATOM   503  C  CB    . LYS A 1 70  ? 22.892  -8.409  -27.963 1.00   55.35 ? 70   LYS A CB    1 
ATOM   504  C  CG    . LYS A 1 70  ? 24.155  -8.770  -27.176 1.00   62.23 ? 70   LYS A CG    1 
ATOM   505  C  CD    . LYS A 1 70  ? 23.818  -9.774  -26.042 1.00   66.87 ? 70   LYS A CD    1 
ATOM   506  C  CE    . LYS A 1 70  ? 24.993  -10.002 -25.072 1.00   69.13 ? 70   LYS A CE    1 
ATOM   507  N  NZ    . LYS A 1 70  ? 24.648  -10.940 -23.936 1.00   69.97 ? 70   LYS A NZ    1 
ATOM   508  N  N     . LYS A 1 71  ? 21.406  -7.785  -30.875 1.00   54.93 ? 71   LYS A N     1 
ATOM   509  C  CA    . LYS A 1 71  ? 20.152  -7.559  -31.567 1.00   56.16 ? 71   LYS A CA    1 
ATOM   510  C  C     . LYS A 1 71  ? 18.940  -7.843  -30.677 1.00   58.35 ? 71   LYS A C     1 
ATOM   511  O  O     . LYS A 1 71  ? 17.882  -7.249  -30.856 1.00   55.30 ? 71   LYS A O     1 
ATOM   512  C  CB    . LYS A 1 71  ? 20.105  -8.444  -32.813 1.00   56.90 ? 71   LYS A CB    1 
ATOM   513  C  CG    . LYS A 1 71  ? 19.113  -8.011  -33.861 1.00   62.51 ? 71   LYS A CG    1 
ATOM   514  C  CD    . LYS A 1 71  ? 18.941  -9.059  -34.944 1.00   65.84 ? 71   LYS A CD    1 
ATOM   515  C  CE    . LYS A 1 71  ? 18.302  -10.319 -34.384 1.00   68.19 ? 71   LYS A CE    1 
ATOM   516  N  NZ    . LYS A 1 71  ? 17.795  -11.247 -35.448 1.00   70.09 ? 71   LYS A NZ    1 
ATOM   517  N  N     . ASP A 1 72  ? 19.097  -8.754  -29.723 1.00   62.30 ? 72   ASP A N     1 
ATOM   518  C  CA    . ASP A 1 72  ? 17.994  -9.109  -28.836 1.00   64.30 ? 72   ASP A CA    1 
ATOM   519  C  C     . ASP A 1 72  ? 17.686  -8.028  -27.802 1.00   62.69 ? 72   ASP A C     1 
ATOM   520  O  O     . ASP A 1 72  ? 16.547  -7.901  -27.367 1.00   61.04 ? 72   ASP A O     1 
ATOM   521  C  CB    . ASP A 1 72  ? 18.294  -10.424 -28.106 1.00   73.33 ? 72   ASP A CB    1 
ATOM   522  C  CG    . ASP A 1 72  ? 18.751  -11.522 -29.047 1.00   85.97 ? 72   ASP A CG    1 
ATOM   523  O  OD1   . ASP A 1 72  ? 19.780  -11.318 -29.744 1.00   92.50 ? 72   ASP A OD1   1 
ATOM   524  O  OD2   . ASP A 1 72  ? 18.078  -12.579 -29.080 1.00   91.87 ? 72   ASP A OD2   1 
ATOM   525  N  N     . ASP A 1 73  ? 18.691  -7.261  -27.402 1.00   59.84 ? 73   ASP A N     1 
ATOM   526  C  CA    . ASP A 1 73  ? 18.472  -6.215  -26.410 1.00   55.59 ? 73   ASP A CA    1 
ATOM   527  C  C     . ASP A 1 73  ? 17.840  -4.944  -26.969 1.00   51.62 ? 73   ASP A C     1 
ATOM   528  O  O     . ASP A 1 73  ? 17.511  -4.035  -26.217 1.00   51.97 ? 73   ASP A O     1 
ATOM   529  C  CB    . ASP A 1 73  ? 19.776  -5.864  -25.691 1.00   56.32 ? 73   ASP A CB    1 
ATOM   530  C  CG    . ASP A 1 73  ? 20.333  -7.038  -24.889 1.00   58.88 ? 73   ASP A CG    1 
ATOM   531  O  OD1   . ASP A 1 73  ? 19.524  -7.877  -24.439 1.00   59.51 ? 73   ASP A OD1   1 
ATOM   532  O  OD2   . ASP A 1 73  ? 21.571  -7.119  -24.697 1.00   60.97 ? 73   ASP A OD2   1 
ATOM   533  N  N     . ILE A 1 74  ? 17.672  -4.876  -28.276 1.00   48.13 ? 74   ILE A N     1 
ATOM   534  C  CA    . ILE A 1 74  ? 17.067  -3.697  -28.876 1.00   45.85 ? 74   ILE A CA    1 
ATOM   535  C  C     . ILE A 1 74  ? 15.569  -3.795  -28.653 1.00   44.50 ? 74   ILE A C     1 
ATOM   536  O  O     . ILE A 1 74  ? 14.966  -4.829  -28.924 1.00   44.49 ? 74   ILE A O     1 
ATOM   537  C  CB    . ILE A 1 74  ? 17.356  -3.628  -30.390 1.00   43.36 ? 74   ILE A CB    1 
ATOM   538  C  CG1   . ILE A 1 74  ? 18.849  -3.382  -30.597 1.00   42.45 ? 74   ILE A CG1   1 
ATOM   539  C  CG2   . ILE A 1 74  ? 16.501  -2.546  -31.069 1.00   39.48 ? 74   ILE A CG2   1 
ATOM   540  C  CD1   . ILE A 1 74  ? 19.273  -3.435  -32.046 1.00   41.94 ? 74   ILE A CD1   1 
ATOM   541  N  N     . GLN A 1 75  ? 14.964  -2.725  -28.150 1.00   43.11 ? 75   GLN A N     1 
ATOM   542  C  CA    . GLN A 1 75  ? 13.526  -2.744  -27.938 1.00   42.24 ? 75   GLN A CA    1 
ATOM   543  C  C     . GLN A 1 75  ? 12.831  -1.726  -28.848 1.00   41.87 ? 75   GLN A C     1 
ATOM   544  O  O     . GLN A 1 75  ? 13.348  -0.622  -29.074 1.00   40.00 ? 75   GLN A O     1 
ATOM   545  C  CB    . GLN A 1 75  ? 13.192  -2.480  -26.453 1.00   43.26 ? 75   GLN A CB    1 
ATOM   546  C  CG    . GLN A 1 75  ? 13.703  -3.559  -25.470 1.00   44.11 ? 75   GLN A CG    1 
ATOM   547  C  CD    . GLN A 1 75  ? 12.980  -3.501  -24.133 1.00   46.66 ? 75   GLN A CD    1 
ATOM   548  O  OE1   . GLN A 1 75  ? 11.760  -3.339  -24.088 1.00   48.95 ? 75   GLN A OE1   1 
ATOM   549  N  NE2   . GLN A 1 75  ? 13.720  -3.635  -23.038 1.00   46.47 ? 75   GLN A NE2   1 
ATOM   550  N  N     . SER A 1 76  ? 11.664  -2.105  -29.364 1.00   40.06 ? 76   SER A N     1 
ATOM   551  C  CA    . SER A 1 76  ? 10.883  -1.260  -30.272 1.00   40.32 ? 76   SER A CA    1 
ATOM   552  C  C     . SER A 1 76  ? 10.446  0.082   -29.697 1.00   39.91 ? 76   SER A C     1 
ATOM   553  O  O     . SER A 1 76  ? 9.930   0.151   -28.585 1.00   39.50 ? 76   SER A O     1 
ATOM   554  C  CB    . SER A 1 76  ? 9.642   -2.007  -30.737 1.00   39.62 ? 76   SER A CB    1 
ATOM   555  O  OG    . SER A 1 76  ? 10.012  -3.136  -31.499 1.00   43.98 ? 76   SER A OG    1 
ATOM   556  N  N     . MET A 1 77  ? 10.640  1.133   -30.476 1.00   39.87 ? 77   MET A N     1 
ATOM   557  C  CA    . MET A 1 77  ? 10.250  2.479   -30.070 1.00   40.15 ? 77   MET A CA    1 
ATOM   558  C  C     . MET A 1 77  ? 8.908   2.872   -30.668 1.00   40.32 ? 77   MET A C     1 
ATOM   559  O  O     . MET A 1 77  ? 8.640   2.576   -31.831 1.00   41.62 ? 77   MET A O     1 
ATOM   560  C  CB    . MET A 1 77  ? 11.309  3.463   -30.525 1.00   40.31 ? 77   MET A CB    1 
ATOM   561  C  CG    . MET A 1 77  ? 10.921  4.930   -30.362 1.00   41.97 ? 77   MET A CG    1 
ATOM   562  S  SD    . MET A 1 77  ? 12.359  5.946   -30.703 1.00   43.06 ? 77   MET A SD    1 
ATOM   563  C  CE    . MET A 1 77  ? 13.392  5.487   -29.305 1.00   42.18 ? 77   MET A CE    1 
ATOM   564  N  N     . ASN A 1 78  ? 8.049   3.530   -29.887 1.00   41.06 ? 78   ASN A N     1 
ATOM   565  C  CA    . ASN A 1 78  ? 6.751   3.968   -30.419 1.00   42.08 ? 78   ASN A CA    1 
ATOM   566  C  C     . ASN A 1 78  ? 6.953   5.244   -31.268 1.00   43.75 ? 78   ASN A C     1 
ATOM   567  O  O     . ASN A 1 78  ? 7.898   5.995   -31.037 1.00   43.95 ? 78   ASN A O     1 
ATOM   568  C  CB    . ASN A 1 78  ? 5.754   4.289   -29.302 1.00   39.49 ? 78   ASN A CB    1 
ATOM   569  C  CG    . ASN A 1 78  ? 5.029   3.062   -28.781 1.00   40.12 ? 78   ASN A CG    1 
ATOM   570  O  OD1   . ASN A 1 78  ? 4.336   2.358   -29.534 1.00   38.69 ? 78   ASN A OD1   1 
ATOM   571  N  ND2   . ASN A 1 78  ? 5.175   2.795   -27.467 1.00   39.65 ? 78   ASN A ND2   1 
ATOM   572  N  N     . PRO A 1 79  ? 6.067   5.496   -32.254 1.00   47.96 ? 79   PRO A N     1 
ATOM   573  C  CA    . PRO A 1 79  ? 6.229   6.711   -33.067 1.00   48.81 ? 79   PRO A CA    1 
ATOM   574  C  C     . PRO A 1 79  ? 5.756   7.966   -32.341 1.00   49.04 ? 79   PRO A C     1 
ATOM   575  O  O     . PRO A 1 79  ? 4.959   7.891   -31.407 1.00   51.42 ? 79   PRO A O     1 
ATOM   576  C  CB    . PRO A 1 79  ? 5.415   6.404   -34.332 1.00   49.42 ? 79   PRO A CB    1 
ATOM   577  C  CG    . PRO A 1 79  ? 4.350   5.467   -33.846 1.00   48.90 ? 79   PRO A CG    1 
ATOM   578  C  CD    . PRO A 1 79  ? 5.119   4.561   -32.886 1.00   47.45 ? 79   PRO A CD    1 
ATOM   579  N  N     . PRO A 1 80  ? 6.240   9.137   -32.769 1.00   52.93 ? 80   PRO A N     1 
ATOM   580  C  CA    . PRO A 1 80  ? 5.905   10.439  -32.183 1.00   53.20 ? 80   PRO A CA    1 
ATOM   581  C  C     . PRO A 1 80  ? 4.436   10.718  -31.870 1.00   52.75 ? 80   PRO A C     1 
ATOM   582  O  O     . PRO A 1 80  ? 4.141   11.548  -31.011 1.00   55.41 ? 80   PRO A O     1 
ATOM   583  C  CB    . PRO A 1 80  ? 6.459   11.423  -33.204 1.00   53.37 ? 80   PRO A CB    1 
ATOM   584  C  CG    . PRO A 1 80  ? 7.634   10.687  -33.764 1.00   53.24 ? 80   PRO A CG    1 
ATOM   585  C  CD    . PRO A 1 80  ? 7.077   9.313   -33.968 1.00   52.58 ? 80   PRO A CD    1 
ATOM   586  N  N     . LYS A 1 81  ? 3.515   10.047  -32.543 1.00   53.28 ? 81   LYS A N     1 
ATOM   587  C  CA    . LYS A 1 81  ? 2.102   10.300  -32.299 1.00   52.65 ? 81   LYS A CA    1 
ATOM   588  C  C     . LYS A 1 81  ? 1.642   9.877   -30.902 1.00   51.88 ? 81   LYS A C     1 
ATOM   589  O  O     . LYS A 1 81  ? 0.737   10.486  -30.331 1.00   53.06 ? 81   LYS A O     1 
ATOM   590  C  CB    . LYS A 1 81  ? 1.256   9.566   -33.319 1.00   51.21 ? 81   LYS A CB    1 
ATOM   591  C  CG    . LYS A 1 81  ? 1.245   8.074   -33.064 1.00   51.18 ? 81   LYS A CG    1 
ATOM   592  C  CD    . LYS A 1 81  ? 0.017   7.378   -33.638 1.00   49.86 ? 81   LYS A CD    1 
ATOM   593  C  CE    . LYS A 1 81  ? 0.118   7.215   -35.119 1.00   50.29 ? 81   LYS A CE    1 
ATOM   594  N  NZ    . LYS A 1 81  ? -1.172  6.634   -35.620 1.00   51.80 ? 81   LYS A NZ    1 
ATOM   595  N  N     . PHE A 1 82  ? 2.256   8.833   -30.350 1.00   49.91 ? 82   PHE A N     1 
ATOM   596  C  CA    . PHE A 1 82  ? 1.860   8.327   -29.034 1.00   49.73 ? 82   PHE A CA    1 
ATOM   597  C  C     . PHE A 1 82  ? 2.537   8.998   -27.847 1.00   50.22 ? 82   PHE A C     1 
ATOM   598  O  O     . PHE A 1 82  ? 2.595   8.433   -26.758 1.00   50.32 ? 82   PHE A O     1 
ATOM   599  C  CB    . PHE A 1 82  ? 2.118   6.831   -28.965 1.00   49.65 ? 82   PHE A CB    1 
ATOM   600  C  CG    . PHE A 1 82  ? 1.367   6.033   -29.986 1.00   46.65 ? 82   PHE A CG    1 
ATOM   601  C  CD1   . PHE A 1 82  ? 2.031   5.426   -31.037 1.00   46.55 ? 82   PHE A CD1   1 
ATOM   602  C  CD2   . PHE A 1 82  ? -0.004  5.872   -29.879 1.00   46.35 ? 82   PHE A CD2   1 
ATOM   603  C  CE1   . PHE A 1 82  ? 1.324   4.664   -31.977 1.00   46.92 ? 82   PHE A CE1   1 
ATOM   604  C  CE2   . PHE A 1 82  ? -0.719  5.115   -30.805 1.00   45.51 ? 82   PHE A CE2   1 
ATOM   605  C  CZ    . PHE A 1 82  ? -0.062  4.513   -31.849 1.00   46.04 ? 82   PHE A CZ    1 
ATOM   606  N  N     . GLU A 1 83  ? 3.045   10.218  -28.065 1.00   48.21 ? 83   GLU A N     1 
ATOM   607  C  CA    . GLU A 1 83  ? 3.719   10.988  -27.046 1.00   45.63 ? 83   GLU A CA    1 
ATOM   608  C  C     . GLU A 1 83  ? 2.833   11.339  -25.857 1.00   44.06 ? 83   GLU A C     1 
ATOM   609  O  O     . GLU A 1 83  ? 1.733   11.857  -26.028 1.00   42.06 ? 83   GLU A O     1 
ATOM   610  C  CB    . GLU A 1 83  ? 4.244   12.267  -27.667 1.00   47.49 ? 83   GLU A CB    1 
ATOM   611  C  CG    . GLU A 1 83  ? 5.642   12.163  -28.146 1.00   52.24 ? 83   GLU A CG    1 
ATOM   612  C  CD    . GLU A 1 83  ? 6.634   12.330  -27.026 1.00   54.72 ? 83   GLU A CD    1 
ATOM   613  O  OE1   . GLU A 1 83  ? 7.816   11.993  -27.249 1.00   56.77 ? 83   GLU A OE1   1 
ATOM   614  O  OE2   . GLU A 1 83  ? 6.244   12.810  -25.935 1.00   54.97 ? 83   GLU A OE2   1 
ATOM   615  N  N     . LYS A 1 84  ? 3.328   11.070  -24.643 1.00   39.92 ? 84   LYS A N     1 
ATOM   616  C  CA    . LYS A 1 84  ? 2.579   11.344  -23.410 1.00   37.43 ? 84   LYS A CA    1 
ATOM   617  C  C     . LYS A 1 84  ? 1.172   10.767  -23.464 1.00   36.19 ? 84   LYS A C     1 
ATOM   618  O  O     . LYS A 1 84  ? 0.249   11.333  -22.892 1.00   34.54 ? 84   LYS A O     1 
ATOM   619  C  CB    . LYS A 1 84  ? 2.456   12.849  -23.149 1.00   37.60 ? 84   LYS A CB    1 
ATOM   620  C  CG    . LYS A 1 84  ? 3.762   13.528  -22.899 1.00   41.41 ? 84   LYS A CG    1 
ATOM   621  C  CD    . LYS A 1 84  ? 3.583   15.031  -22.894 1.00   43.72 ? 84   LYS A CD    1 
ATOM   622  C  CE    . LYS A 1 84  ? 4.898   15.747  -23.232 1.00   45.11 ? 84   LYS A CE    1 
ATOM   623  N  NZ    . LYS A 1 84  ? 5.916   15.757  -22.147 1.00   45.35 ? 84   LYS A NZ    1 
ATOM   624  N  N     . LEU A 1 85  ? 1.003   9.642   -24.147 1.00   36.01 ? 85   LEU A N     1 
ATOM   625  C  CA    . LEU A 1 85  ? -0.329  9.051   -24.240 1.00   35.86 ? 85   LEU A CA    1 
ATOM   626  C  C     . LEU A 1 85  ? -0.947  8.799   -22.854 1.00   36.63 ? 85   LEU A C     1 
ATOM   627  O  O     . LEU A 1 85  ? -0.272  8.369   -21.925 1.00   34.40 ? 85   LEU A O     1 
ATOM   628  C  CB    . LEU A 1 85  ? -0.284  7.753   -25.048 1.00   35.81 ? 85   LEU A CB    1 
ATOM   629  C  CG    . LEU A 1 85  ? -1.565  7.374   -25.813 1.00   38.02 ? 85   LEU A CG    1 
ATOM   630  C  CD1   . LEU A 1 85  ? -2.017  8.527   -26.750 1.00   38.43 ? 85   LEU A CD1   1 
ATOM   631  C  CD2   . LEU A 1 85  ? -1.279  6.141   -26.666 1.00   39.35 ? 85   LEU A CD2   1 
ATOM   632  N  N     . GLU A 1 86  ? -2.243  9.068   -22.756 1.00   38.88 ? 86   GLU A N     1 
ATOM   633  C  CA    . GLU A 1 86  ? -2.991  8.907   -21.524 1.00   41.20 ? 86   GLU A CA    1 
ATOM   634  C  C     . GLU A 1 86  ? -3.299  7.451   -21.159 1.00   42.08 ? 86   GLU A C     1 
ATOM   635  O  O     . GLU A 1 86  ? -3.403  7.137   -19.978 1.00   40.43 ? 86   GLU A O     1 
ATOM   636  C  CB    . GLU A 1 86  ? -4.266  9.755   -21.593 1.00   43.01 ? 86   GLU A CB    1 
ATOM   637  C  CG    . GLU A 1 86  ? -3.923  11.232  -21.804 1.00   48.88 ? 86   GLU A CG    1 
ATOM   638  C  CD    . GLU A 1 86  ? -5.137  12.132  -21.832 1.00   52.01 ? 86   GLU A CD    1 
ATOM   639  O  OE1   . GLU A 1 86  ? -6.113  11.794  -22.531 1.00   53.92 ? 86   GLU A OE1   1 
ATOM   640  O  OE2   . GLU A 1 86  ? -5.113  13.190  -21.164 1.00   54.60 ? 86   GLU A OE2   1 
ATOM   641  N  N     . ASP A 1 87  ? -3.447  6.576   -22.148 1.00   42.55 ? 87   ASP A N     1 
ATOM   642  C  CA    . ASP A 1 87  ? -3.682  5.161   -21.857 1.00   42.36 ? 87   ASP A CA    1 
ATOM   643  C  C     . ASP A 1 87  ? -2.703  4.381   -22.725 1.00   41.50 ? 87   ASP A C     1 
ATOM   644  O  O     . ASP A 1 87  ? -2.806  4.376   -23.949 1.00   40.13 ? 87   ASP A O     1 
ATOM   645  C  CB    . ASP A 1 87  ? -5.119  4.733   -22.162 1.00   43.65 ? 87   ASP A CB    1 
ATOM   646  C  CG    . ASP A 1 87  ? -5.394  3.282   -21.739 1.00   47.20 ? 87   ASP A CG    1 
ATOM   647  O  OD1   . ASP A 1 87  ? -6.577  2.838   -21.735 1.00   49.09 ? 87   ASP A OD1   1 
ATOM   648  O  OD2   . ASP A 1 87  ? -4.412  2.574   -21.411 1.00   47.08 ? 87   ASP A OD2   1 
ATOM   649  N  N     . MET A 1 88  ? -1.747  3.719   -22.080 1.00   41.23 ? 88   MET A N     1 
ATOM   650  C  CA    . MET A 1 88  ? -0.716  2.999   -22.817 1.00   41.57 ? 88   MET A CA    1 
ATOM   651  C  C     . MET A 1 88  ? -1.167  1.734   -23.500 1.00   41.62 ? 88   MET A C     1 
ATOM   652  O  O     . MET A 1 88  ? -0.411  1.151   -24.278 1.00   42.89 ? 88   MET A O     1 
ATOM   653  C  CB    . MET A 1 88  ? 0.494   2.725   -21.917 1.00   41.46 ? 88   MET A CB    1 
ATOM   654  C  CG    . MET A 1 88  ? 1.117   3.988   -21.447 1.00   39.66 ? 88   MET A CG    1 
ATOM   655  S  SD    . MET A 1 88  ? 2.527   3.746   -20.379 1.00   43.31 ? 88   MET A SD    1 
ATOM   656  C  CE    . MET A 1 88  ? 1.819   2.844   -18.965 1.00   38.06 ? 88   MET A CE    1 
ATOM   657  N  N     . ALA A 1 89  ? -2.378  1.307   -23.228 1.00   40.97 ? 89   ALA A N     1 
ATOM   658  C  CA    . ALA A 1 89  ? -2.889  0.127   -23.892 1.00   41.74 ? 89   ALA A CA    1 
ATOM   659  C  C     . ALA A 1 89  ? -3.068  0.477   -25.370 1.00   42.61 ? 89   ALA A C     1 
ATOM   660  O  O     . ALA A 1 89  ? -3.181  -0.414  -26.213 1.00   41.54 ? 89   ALA A O     1 
ATOM   661  C  CB    . ALA A 1 89  ? -4.232  -0.270  -23.314 1.00   39.72 ? 89   ALA A CB    1 
ATOM   662  N  N     . ASN A 1 90  ? -3.103  1.774   -25.681 1.00   43.34 ? 90   ASN A N     1 
ATOM   663  C  CA    . ASN A 1 90  ? -3.318  2.191   -27.062 1.00   45.37 ? 90   ASN A CA    1 
ATOM   664  C  C     . ASN A 1 90  ? -2.067  2.327   -27.878 1.00   46.24 ? 90   ASN A C     1 
ATOM   665  O  O     . ASN A 1 90  ? -2.139  2.459   -29.102 1.00   47.53 ? 90   ASN A O     1 
ATOM   666  C  CB    . ASN A 1 90  ? -4.087  3.517   -27.121 1.00   46.87 ? 90   ASN A CB    1 
ATOM   667  C  CG    . ASN A 1 90  ? -5.455  3.421   -26.495 1.00   49.79 ? 90   ASN A CG    1 
ATOM   668  O  OD1   . ASN A 1 90  ? -6.180  2.456   -26.713 1.00   49.76 ? 90   ASN A OD1   1 
ATOM   669  N  ND2   . ASN A 1 90  ? -5.821  4.430   -25.704 1.00   51.58 ? 90   ASN A ND2   1 
ATOM   670  N  N     . MET A 1 91  ? -0.915  2.315   -27.236 1.00   47.56 ? 91   MET A N     1 
ATOM   671  C  CA    . MET A 1 91  ? 0.313   2.463   -27.998 1.00   47.44 ? 91   MET A CA    1 
ATOM   672  C  C     . MET A 1 91  ? 0.484   1.231   -28.862 1.00   47.88 ? 91   MET A C     1 
ATOM   673  O  O     . MET A 1 91  ? -0.322  0.307   -28.806 1.00   48.32 ? 91   MET A O     1 
ATOM   674  C  CB    . MET A 1 91  ? 1.518   2.638   -27.071 1.00   47.68 ? 91   MET A CB    1 
ATOM   675  C  CG    . MET A 1 91  ? 1.405   3.827   -26.151 1.00   48.55 ? 91   MET A CG    1 
ATOM   676  S  SD    . MET A 1 91  ? 2.938   4.216   -25.301 1.00   51.19 ? 91   MET A SD    1 
ATOM   677  C  CE    . MET A 1 91  ? 3.123   2.845   -24.122 1.00   49.43 ? 91   MET A CE    1 
ATOM   678  N  N     . THR A 1 92  ? 1.528   1.221   -29.668 1.00   49.43 ? 92   THR A N     1 
ATOM   679  C  CA    . THR A 1 92  ? 1.795   0.085   -30.546 1.00   50.73 ? 92   THR A CA    1 
ATOM   680  C  C     . THR A 1 92  ? 2.688   -0.863  -29.770 1.00   49.62 ? 92   THR A C     1 
ATOM   681  O  O     . THR A 1 92  ? 2.442   -2.068  -29.727 1.00   49.45 ? 92   THR A O     1 
ATOM   682  C  CB    . THR A 1 92  ? 2.525   0.522   -31.830 1.00   52.75 ? 92   THR A CB    1 
ATOM   683  O  OG1   . THR A 1 92  ? 1.666   1.376   -32.591 1.00   58.18 ? 92   THR A OG1   1 
ATOM   684  C  CG2   . THR A 1 92  ? 2.909   -0.678  -32.672 1.00   56.38 ? 92   THR A CG2   1 
ATOM   685  N  N     . TYR A 1 93  ? 3.722   -0.310  -29.154 1.00   48.08 ? 93   TYR A N     1 
ATOM   686  C  CA    . TYR A 1 93  ? 4.638   -1.119  -28.391 1.00   46.07 ? 93   TYR A CA    1 
ATOM   687  C  C     . TYR A 1 93  ? 4.501   -0.860  -26.925 1.00   46.22 ? 93   TYR A C     1 
ATOM   688  O  O     . TYR A 1 93  ? 4.600   0.281   -26.453 1.00   45.39 ? 93   TYR A O     1 
ATOM   689  C  CB    . TYR A 1 93  ? 6.070   -0.868  -28.844 1.00   45.70 ? 93   TYR A CB    1 
ATOM   690  C  CG    . TYR A 1 93  ? 6.250   -1.182  -30.313 1.00   46.04 ? 93   TYR A CG    1 
ATOM   691  C  CD1   . TYR A 1 93  ? 6.205   -2.493  -30.777 1.00   45.23 ? 93   TYR A CD1   1 
ATOM   692  C  CD2   . TYR A 1 93  ? 6.373   -0.149  -31.249 1.00   46.56 ? 93   TYR A CD2   1 
ATOM   693  C  CE1   . TYR A 1 93  ? 6.271   -2.775  -32.137 1.00   46.07 ? 93   TYR A CE1   1 
ATOM   694  C  CE2   . TYR A 1 93  ? 6.440   -0.419  -32.606 1.00   47.30 ? 93   TYR A CE2   1 
ATOM   695  C  CZ    . TYR A 1 93  ? 6.387   -1.727  -33.050 1.00   46.84 ? 93   TYR A CZ    1 
ATOM   696  O  OH    . TYR A 1 93  ? 6.430   -1.970  -34.409 1.00   47.40 ? 93   TYR A OH    1 
ATOM   697  N  N     . LEU A 1 94  ? 4.257   -1.945  -26.194 1.00   45.67 ? 94   LEU A N     1 
ATOM   698  C  CA    . LEU A 1 94  ? 4.102   -1.878  -24.751 1.00   46.77 ? 94   LEU A CA    1 
ATOM   699  C  C     . LEU A 1 94  ? 5.206   -2.667  -24.069 1.00   46.18 ? 94   LEU A C     1 
ATOM   700  O  O     . LEU A 1 94  ? 4.943   -3.700  -23.452 1.00   46.85 ? 94   LEU A O     1 
ATOM   701  C  CB    . LEU A 1 94  ? 2.753   -2.460  -24.306 1.00   48.61 ? 94   LEU A CB    1 
ATOM   702  C  CG    . LEU A 1 94  ? 1.692   -1.520  -23.741 1.00   51.77 ? 94   LEU A CG    1 
ATOM   703  C  CD1   . LEU A 1 94  ? 0.791   -2.315  -22.833 1.00   53.57 ? 94   LEU A CD1   1 
ATOM   704  C  CD2   . LEU A 1 94  ? 2.295   -0.397  -22.948 1.00   53.44 ? 94   LEU A CD2   1 
ATOM   705  N  N     . ASN A 1 95  ? 6.430   -2.187  -24.190 1.00   44.90 ? 95   ASN A N     1 
ATOM   706  C  CA    . ASN A 1 95  ? 7.574   -2.826  -23.571 1.00   43.50 ? 95   ASN A CA    1 
ATOM   707  C  C     . ASN A 1 95  ? 8.161   -1.916  -22.485 1.00   43.89 ? 95   ASN A C     1 
ATOM   708  O  O     . ASN A 1 95  ? 7.799   -0.748  -22.388 1.00   41.72 ? 95   ASN A O     1 
ATOM   709  C  CB    . ASN A 1 95  ? 8.636   -3.153  -24.624 1.00   43.40 ? 95   ASN A CB    1 
ATOM   710  C  CG    . ASN A 1 95  ? 9.069   -1.930  -25.446 1.00   44.54 ? 95   ASN A CG    1 
ATOM   711  O  OD1   . ASN A 1 95  ? 9.486   -0.896  -24.910 1.00   44.91 ? 95   ASN A OD1   1 
ATOM   712  N  ND2   . ASN A 1 95  ? 8.985   -2.062  -26.759 1.00   44.69 ? 95   ASN A ND2   1 
ATOM   713  N  N     . GLU A 1 96  ? 9.058   -2.463  -21.665 1.00   43.81 ? 96   GLU A N     1 
ATOM   714  C  CA    . GLU A 1 96  ? 9.681   -1.700  -20.585 1.00   43.61 ? 96   GLU A CA    1 
ATOM   715  C  C     . GLU A 1 96  ? 10.205  -0.366  -21.050 1.00   40.48 ? 96   GLU A C     1 
ATOM   716  O  O     . GLU A 1 96  ? 9.964   0.660   -20.423 1.00   39.28 ? 96   GLU A O     1 
ATOM   717  C  CB    . GLU A 1 96  ? 10.878  -2.434  -19.965 1.00   47.52 ? 96   GLU A CB    1 
ATOM   718  C  CG    . GLU A 1 96  ? 10.581  -3.726  -19.281 1.00   58.41 ? 96   GLU A CG    1 
ATOM   719  C  CD    . GLU A 1 96  ? 11.778  -4.197  -18.469 1.00   63.52 ? 96   GLU A CD    1 
ATOM   720  O  OE1   . GLU A 1 96  ? 12.890  -4.184  -19.043 1.00   65.70 ? 96   GLU A OE1   1 
ATOM   721  O  OE2   . GLU A 1 96  ? 11.605  -4.564  -17.273 1.00   65.73 ? 96   GLU A OE2   1 
ATOM   722  N  N     . ALA A 1 97  ? 10.945  -0.391  -22.131 1.00   37.69 ? 97   ALA A N     1 
ATOM   723  C  CA    . ALA A 1 97  ? 11.551  0.831   -22.631 1.00   36.26 ? 97   ALA A CA    1 
ATOM   724  C  C     . ALA A 1 97  ? 10.523  1.883   -23.017 1.00   35.95 ? 97   ALA A C     1 
ATOM   725  O  O     . ALA A 1 97  ? 10.709  3.052   -22.706 1.00   33.66 ? 97   ALA A O     1 
ATOM   726  C  CB    . ALA A 1 97  ? 12.490  0.532   -23.803 1.00   33.90 ? 97   ALA A CB    1 
ATOM   727  N  N     . SER A 1 98  ? 9.446   1.498   -23.665 1.00   38.42 ? 98   SER A N     1 
ATOM   728  C  CA    . SER A 1 98  ? 8.493   2.545   -24.014 1.00   40.16 ? 98   SER A CA    1 
ATOM   729  C  C     . SER A 1 98  ? 7.487   2.885   -22.908 1.00   38.19 ? 98   SER A C     1 
ATOM   730  O  O     . SER A 1 98  ? 6.864   3.928   -22.965 1.00   36.44 ? 98   SER A O     1 
ATOM   731  C  CB    . SER A 1 98  ? 7.758   2.227   -25.312 1.00   43.98 ? 98   SER A CB    1 
ATOM   732  O  OG    . SER A 1 98  ? 8.598   1.580   -26.247 1.00   56.22 ? 98   SER A OG    1 
ATOM   733  N  N     . VAL A 1 99  ? 7.324   2.010   -21.909 1.00   37.39 ? 99   VAL A N     1 
ATOM   734  C  CA    . VAL A 1 99  ? 6.408   2.326   -20.802 1.00   35.38 ? 99   VAL A CA    1 
ATOM   735  C  C     . VAL A 1 99  ? 7.190   3.295   -19.935 1.00   33.96 ? 99   VAL A C     1 
ATOM   736  O  O     . VAL A 1 99  ? 6.635   4.239   -19.370 1.00   36.23 ? 99   VAL A O     1 
ATOM   737  C  CB    . VAL A 1 99  ? 6.007   1.084   -19.963 1.00   34.72 ? 99   VAL A CB    1 
ATOM   738  C  CG1   . VAL A 1 99  ? 5.602   1.522   -18.581 1.00   34.07 ? 99   VAL A CG1   1 
ATOM   739  C  CG2   . VAL A 1 99  ? 4.820   0.354   -20.616 1.00   31.20 ? 99   VAL A CG2   1 
ATOM   740  N  N     . LEU A 1 100 ? 8.489   3.067   -19.848 1.00   33.53 ? 100  LEU A N     1 
ATOM   741  C  CA    . LEU A 1 100 ? 9.362   3.940   -19.071 1.00   34.33 ? 100  LEU A CA    1 
ATOM   742  C  C     . LEU A 1 100 ? 9.406   5.352   -19.726 1.00   35.51 ? 100  LEU A C     1 
ATOM   743  O  O     . LEU A 1 100 ? 9.399   6.351   -19.027 1.00   34.56 ? 100  LEU A O     1 
ATOM   744  C  CB    . LEU A 1 100 ? 10.779  3.345   -19.002 1.00   28.81 ? 100  LEU A CB    1 
ATOM   745  C  CG    . LEU A 1 100 ? 11.824  4.392   -18.671 1.00   24.97 ? 100  LEU A CG    1 
ATOM   746  C  CD1   . LEU A 1 100 ? 11.587  4.949   -17.247 1.00   21.73 ? 100  LEU A CD1   1 
ATOM   747  C  CD2   . LEU A 1 100 ? 13.209  3.788   -18.859 1.00   22.17 ? 100  LEU A CD2   1 
ATOM   748  N  N     . TYR A 1 101 ? 9.443   5.412   -21.062 1.00   37.30 ? 101  TYR A N     1 
ATOM   749  C  CA    . TYR A 1 101 ? 9.481   6.706   -21.763 1.00   38.67 ? 101  TYR A CA    1 
ATOM   750  C  C     . TYR A 1 101 ? 8.169   7.470   -21.632 1.00   38.37 ? 101  TYR A C     1 
ATOM   751  O  O     . TYR A 1 101 ? 8.168   8.684   -21.448 1.00   37.91 ? 101  TYR A O     1 
ATOM   752  C  CB    . TYR A 1 101 ? 9.771   6.520   -23.261 1.00   39.32 ? 101  TYR A CB    1 
ATOM   753  C  CG    . TYR A 1 101 ? 9.817   7.824   -24.045 1.00   38.90 ? 101  TYR A CG    1 
ATOM   754  C  CD1   . TYR A 1 101 ? 10.825  8.757   -23.815 1.00   39.30 ? 101  TYR A CD1   1 
ATOM   755  C  CD2   . TYR A 1 101 ? 8.857   8.118   -25.020 1.00   39.01 ? 101  TYR A CD2   1 
ATOM   756  C  CE1   . TYR A 1 101 ? 10.887  9.954   -24.524 1.00   39.26 ? 101  TYR A CE1   1 
ATOM   757  C  CE2   . TYR A 1 101 ? 8.908   9.331   -25.745 1.00   38.41 ? 101  TYR A CE2   1 
ATOM   758  C  CZ    . TYR A 1 101 ? 9.926   10.231  -25.486 1.00   39.20 ? 101  TYR A CZ    1 
ATOM   759  O  OH    . TYR A 1 101 ? 10.008  11.424  -26.170 1.00   39.88 ? 101  TYR A OH    1 
ATOM   760  N  N     . ASN A 1 102 ? 7.064   6.746   -21.738 1.00   38.76 ? 102  ASN A N     1 
ATOM   761  C  CA    . ASN A 1 102 ? 5.759   7.371   -21.672 1.00   40.44 ? 102  ASN A CA    1 
ATOM   762  C  C     . ASN A 1 102 ? 5.465   7.940   -20.275 1.00   41.15 ? 102  ASN A C     1 
ATOM   763  O  O     . ASN A 1 102 ? 4.974   9.071   -20.157 1.00   41.25 ? 102  ASN A O     1 
ATOM   764  C  CB    . ASN A 1 102 ? 4.685   6.374   -22.118 1.00   41.90 ? 102  ASN A CB    1 
ATOM   765  C  CG    . ASN A 1 102 ? 3.325   7.018   -22.246 1.00   44.29 ? 102  ASN A CG    1 
ATOM   766  O  OD1   . ASN A 1 102 ? 2.462   6.873   -21.372 1.00   44.95 ? 102  ASN A OD1   1 
ATOM   767  N  ND2   . ASN A 1 102 ? 3.133   7.768   -23.324 1.00   43.54 ? 102  ASN A ND2   1 
ATOM   768  N  N     . LEU A 1 103 ? 5.783   7.189   -19.218 1.00   38.10 ? 103  LEU A N     1 
ATOM   769  C  CA    . LEU A 1 103 ? 5.567   7.688   -17.857 1.00   35.81 ? 103  LEU A CA    1 
ATOM   770  C  C     . LEU A 1 103 ? 6.482   8.872   -17.541 1.00   35.24 ? 103  LEU A C     1 
ATOM   771  O  O     . LEU A 1 103 ? 6.044   9.866   -16.971 1.00   32.02 ? 103  LEU A O     1 
ATOM   772  C  CB    . LEU A 1 103 ? 5.842   6.590   -16.810 1.00   34.76 ? 103  LEU A CB    1 
ATOM   773  C  CG    . LEU A 1 103 ? 5.088   5.257   -16.808 1.00   32.79 ? 103  LEU A CG    1 
ATOM   774  C  CD1   . LEU A 1 103 ? 5.683   4.443   -15.681 1.00   34.83 ? 103  LEU A CD1   1 
ATOM   775  C  CD2   . LEU A 1 103 ? 3.611   5.437   -16.600 1.00   30.00 ? 103  LEU A CD2   1 
ATOM   776  N  N     . ARG A 1 104 ? 7.757   8.742   -17.899 1.00   36.55 ? 104  ARG A N     1 
ATOM   777  C  CA    . ARG A 1 104 ? 8.761   9.783   -17.631 1.00   39.06 ? 104  ARG A CA    1 
ATOM   778  C  C     . ARG A 1 104 ? 8.447   11.112  -18.344 1.00   39.19 ? 104  ARG A C     1 
ATOM   779  O  O     . ARG A 1 104 ? 8.639   12.175  -17.772 1.00   41.03 ? 104  ARG A O     1 
ATOM   780  C  CB    . ARG A 1 104 ? 10.157  9.313   -18.063 1.00   42.13 ? 104  ARG A CB    1 
ATOM   781  C  CG    . ARG A 1 104 ? 11.262  10.165  -17.460 1.00   48.16 ? 104  ARG A CG    1 
ATOM   782  C  CD    . ARG A 1 104 ? 12.559  10.164  -18.274 1.00   51.18 ? 104  ARG A CD    1 
ATOM   783  N  NE    . ARG A 1 104 ? 13.021  8.860   -18.765 1.00   50.69 ? 104  ARG A NE    1 
ATOM   784  C  CZ    . ARG A 1 104 ? 14.179  8.295   -18.413 1.00   51.48 ? 104  ARG A CZ    1 
ATOM   785  N  NH1   . ARG A 1 104 ? 14.989  8.898   -17.551 1.00   51.24 ? 104  ARG A NH1   1 
ATOM   786  N  NH2   . ARG A 1 104 ? 14.569  7.154   -18.972 1.00   52.87 ? 104  ARG A NH2   1 
ATOM   787  N  N     . SER A 1 105 ? 7.981   11.029  -19.595 1.00   38.08 ? 105  SER A N     1 
ATOM   788  C  CA    . SER A 1 105 ? 7.609   12.218  -20.373 1.00   38.46 ? 105  SER A CA    1 
ATOM   789  C  C     . SER A 1 105 ? 6.519   12.979  -19.640 1.00   38.09 ? 105  SER A C     1 
ATOM   790  O  O     . SER A 1 105 ? 6.639   14.180  -19.402 1.00   37.80 ? 105  SER A O     1 
ATOM   791  C  CB    . SER A 1 105 ? 7.048   11.825  -21.748 1.00   37.15 ? 105  SER A CB    1 
ATOM   792  O  OG    . SER A 1 105 ? 8.069   11.343  -22.572 1.00   37.83 ? 105  SER A OG    1 
ATOM   793  N  N     . ARG A 1 106 ? 5.457   12.267  -19.291 1.00   37.26 ? 106  ARG A N     1 
ATOM   794  C  CA    . ARG A 1 106 ? 4.342   12.869  -18.601 1.00   37.95 ? 106  ARG A CA    1 
ATOM   795  C  C     . ARG A 1 106 ? 4.740   13.367  -17.214 1.00   38.89 ? 106  ARG A C     1 
ATOM   796  O  O     . ARG A 1 106 ? 4.287   14.413  -16.773 1.00   39.63 ? 106  ARG A O     1 
ATOM   797  C  CB    . ARG A 1 106 ? 3.191   11.869  -18.500 1.00   36.94 ? 106  ARG A CB    1 
ATOM   798  C  CG    . ARG A 1 106 ? 2.614   11.481  -19.849 1.00   35.42 ? 106  ARG A CG    1 
ATOM   799  C  CD    . ARG A 1 106 ? 1.599   10.367  -19.759 1.00   33.58 ? 106  ARG A CD    1 
ATOM   800  N  NE    . ARG A 1 106 ? 0.574   10.605  -18.745 1.00   35.07 ? 106  ARG A NE    1 
ATOM   801  C  CZ    . ARG A 1 106 ? -0.545  11.299  -18.945 1.00   35.04 ? 106  ARG A CZ    1 
ATOM   802  N  NH1   . ARG A 1 106 ? -0.811  11.835  -20.137 1.00   34.25 ? 106  ARG A NH1   1 
ATOM   803  N  NH2   . ARG A 1 106 ? -1.373  11.489  -17.946 1.00   33.27 ? 106  ARG A NH2   1 
ATOM   804  N  N     . TYR A 1 107 ? 5.600   12.607  -16.529 1.00   41.24 ? 107  TYR A N     1 
ATOM   805  C  CA    . TYR A 1 107 ? 6.039   12.975  -15.191 1.00   42.78 ? 107  TYR A CA    1 
ATOM   806  C  C     . TYR A 1 107 ? 6.842   14.256  -15.203 1.00   44.08 ? 107  TYR A C     1 
ATOM   807  O  O     . TYR A 1 107 ? 6.544   15.174  -14.426 1.00   47.87 ? 107  TYR A O     1 
ATOM   808  C  CB    . TYR A 1 107 ? 6.863   11.850  -14.538 1.00   40.14 ? 107  TYR A CB    1 
ATOM   809  C  CG    . TYR A 1 107 ? 7.243   12.132  -13.101 1.00   35.93 ? 107  TYR A CG    1 
ATOM   810  C  CD1   . TYR A 1 107 ? 6.276   12.269  -12.117 1.00   33.98 ? 107  TYR A CD1   1 
ATOM   811  C  CD2   . TYR A 1 107 ? 8.573   12.276  -12.730 1.00   35.38 ? 107  TYR A CD2   1 
ATOM   812  C  CE1   . TYR A 1 107 ? 6.615   12.550  -10.798 1.00   33.18 ? 107  TYR A CE1   1 
ATOM   813  C  CE2   . TYR A 1 107 ? 8.927   12.553  -11.420 1.00   34.08 ? 107  TYR A CE2   1 
ATOM   814  C  CZ    . TYR A 1 107 ? 7.943   12.696  -10.462 1.00   34.35 ? 107  TYR A CZ    1 
ATOM   815  O  OH    . TYR A 1 107 ? 8.309   13.077  -9.185  1.00   35.20 ? 107  TYR A OH    1 
ATOM   816  N  N     . THR A 1 108 ? 7.858   14.354  -16.039 1.00   46.50 ? 108  THR A N     1 
ATOM   817  C  CA    . THR A 1 108 ? 8.621   15.607  -16.043 1.00   49.90 ? 108  THR A CA    1 
ATOM   818  C  C     . THR A 1 108 ? 7.721   16.777  -16.472 1.00   49.48 ? 108  THR A C     1 
ATOM   819  O  O     . THR A 1 108 ? 8.085   17.937  -16.283 1.00   50.17 ? 108  THR A O     1 
ATOM   820  C  CB    . THR A 1 108 ? 9.880   15.536  -16.934 1.00   49.52 ? 108  THR A CB    1 
ATOM   821  O  OG1   . THR A 1 108 ? 9.529   15.033  -18.225 1.00   49.75 ? 108  THR A OG1   1 
ATOM   822  C  CG2   . THR A 1 108 ? 10.917  14.616  -16.305 1.00   49.66 ? 108  THR A CG2   1 
ATOM   823  N  N     . SER A 1 109 ? 6.560   16.473  -17.039 1.00   48.33 ? 109  SER A N     1 
ATOM   824  C  CA    . SER A 1 109 ? 5.609   17.510  -17.428 1.00   47.51 ? 109  SER A CA    1 
ATOM   825  C  C     . SER A 1 109 ? 4.585   17.772  -16.319 1.00   46.75 ? 109  SER A C     1 
ATOM   826  O  O     . SER A 1 109 ? 3.599   18.480  -16.533 1.00   45.80 ? 109  SER A O     1 
ATOM   827  C  CB    . SER A 1 109 ? 4.851   17.119  -18.687 1.00   48.05 ? 109  SER A CB    1 
ATOM   828  O  OG    . SER A 1 109 ? 5.734   17.038  -19.783 1.00   51.66 ? 109  SER A OG    1 
ATOM   829  N  N     . GLY A 1 110 ? 4.803   17.191  -15.141 1.00   43.74 ? 110  GLY A N     1 
ATOM   830  C  CA    . GLY A 1 110 ? 3.874   17.394  -14.046 1.00   40.10 ? 110  GLY A CA    1 
ATOM   831  C  C     . GLY A 1 110 ? 2.653   16.497  -14.083 1.00   38.48 ? 110  GLY A C     1 
ATOM   832  O  O     . GLY A 1 110 ? 1.721   16.694  -13.297 1.00   39.26 ? 110  GLY A O     1 
ATOM   833  N  N     . LEU A 1 111 ? 2.637   15.514  -14.970 1.00   35.85 ? 111  LEU A N     1 
ATOM   834  C  CA    . LEU A 1 111 ? 1.494   14.605  -15.067 1.00   34.33 ? 111  LEU A CA    1 
ATOM   835  C  C     . LEU A 1 111 ? 1.817   13.276  -14.355 1.00   33.78 ? 111  LEU A C     1 
ATOM   836  O  O     . LEU A 1 111 ? 2.547   12.446  -14.895 1.00   34.65 ? 111  LEU A O     1 
ATOM   837  C  CB    . LEU A 1 111 ? 1.175   14.351  -16.536 1.00   33.22 ? 111  LEU A CB    1 
ATOM   838  C  CG    . LEU A 1 111 ? 0.913   15.627  -17.360 1.00   29.81 ? 111  LEU A CG    1 
ATOM   839  C  CD1   . LEU A 1 111 ? 0.992   15.287  -18.843 1.00   30.29 ? 111  LEU A CD1   1 
ATOM   840  C  CD2   . LEU A 1 111 ? -0.438  16.187  -16.983 1.00   28.02 ? 111  LEU A CD2   1 
ATOM   841  N  N     . ILE A 1 112 ? 1.265   13.075  -13.162 1.00   32.61 ? 112  ILE A N     1 
ATOM   842  C  CA    . ILE A 1 112 ? 1.557   11.856  -12.400 1.00   32.39 ? 112  ILE A CA    1 
ATOM   843  C  C     . ILE A 1 112 ? 0.610   10.695  -12.632 1.00   31.51 ? 112  ILE A C     1 
ATOM   844  O  O     . ILE A 1 112 ? 0.918   9.570   -12.234 1.00   31.42 ? 112  ILE A O     1 
ATOM   845  C  CB    . ILE A 1 112 ? 1.616   12.131  -10.845 1.00   28.76 ? 112  ILE A CB    1 
ATOM   846  C  CG1   . ILE A 1 112 ? 0.280   12.670  -10.349 1.00   26.65 ? 112  ILE A CG1   1 
ATOM   847  C  CG2   . ILE A 1 112 ? 2.756   13.071  -10.502 1.00   25.24 ? 112  ILE A CG2   1 
ATOM   848  C  CD1   . ILE A 1 112 ? 0.205   12.950  -8.827  1.00   28.21 ? 112  ILE A CD1   1 
ATOM   849  N  N     . TYR A 1 113 ? -0.549  10.945  -13.263 1.00   31.48 ? 113  TYR A N     1 
ATOM   850  C  CA    . TYR A 1 113 ? -1.500  9.863   -13.503 1.00   32.24 ? 113  TYR A CA    1 
ATOM   851  C  C     . TYR A 1 113 ? -1.562  9.413   -14.938 1.00   33.49 ? 113  TYR A C     1 
ATOM   852  O  O     . TYR A 1 113 ? -1.713  10.228  -15.851 1.00   35.48 ? 113  TYR A O     1 
ATOM   853  C  CB    . TYR A 1 113 ? -2.905  10.253  -13.057 1.00   31.29 ? 113  TYR A CB    1 
ATOM   854  C  CG    . TYR A 1 113 ? -3.072  10.357  -11.590 1.00   30.69 ? 113  TYR A CG    1 
ATOM   855  C  CD1   . TYR A 1 113 ? -2.773  9.273   -10.751 1.00   30.27 ? 113  TYR A CD1   1 
ATOM   856  C  CD2   . TYR A 1 113 ? -3.462  11.561  -11.008 1.00   30.37 ? 113  TYR A CD2   1 
ATOM   857  C  CE1   . TYR A 1 113 ? -2.847  9.415   -9.369  1.00   29.90 ? 113  TYR A CE1   1 
ATOM   858  C  CE2   . TYR A 1 113 ? -3.541  11.700  -9.658  1.00   29.86 ? 113  TYR A CE2   1 
ATOM   859  C  CZ    . TYR A 1 113 ? -3.230  10.628  -8.834  1.00   30.02 ? 113  TYR A CZ    1 
ATOM   860  O  OH    . TYR A 1 113 ? -3.321  10.781  -7.466  1.00   30.91 ? 113  TYR A OH    1 
ATOM   861  N  N     . THR A 1 114 ? -1.489  8.105   -15.148 1.00   34.68 ? 114  THR A N     1 
ATOM   862  C  CA    . THR A 1 114 ? -1.498  7.531   -16.479 1.00   34.66 ? 114  THR A CA    1 
ATOM   863  C  C     . THR A 1 114 ? -2.152  6.162   -16.419 1.00   36.22 ? 114  THR A C     1 
ATOM   864  O  O     . THR A 1 114 ? -1.943  5.412   -15.459 1.00   38.56 ? 114  THR A O     1 
ATOM   865  C  CB    . THR A 1 114 ? -0.061  7.293   -16.985 1.00   34.52 ? 114  THR A CB    1 
ATOM   866  O  OG1   . THR A 1 114 ? 0.661   8.520   -16.942 1.00   33.95 ? 114  THR A OG1   1 
ATOM   867  C  CG2   . THR A 1 114 ? -0.021  6.766   -18.419 1.00   31.44 ? 114  THR A CG2   1 
ATOM   868  N  N     . TYR A 1 115 ? -2.940  5.842   -17.431 1.00   35.97 ? 115  TYR A N     1 
ATOM   869  C  CA    . TYR A 1 115 ? -3.537  4.534   -17.503 1.00   38.63 ? 115  TYR A CA    1 
ATOM   870  C  C     . TYR A 1 115 ? -2.679  3.644   -18.364 1.00   40.16 ? 115  TYR A C     1 
ATOM   871  O  O     . TYR A 1 115 ? -1.724  4.057   -19.022 1.00   40.84 ? 115  TYR A O     1 
ATOM   872  C  CB    . TYR A 1 115 ? -4.929  4.554   -18.112 1.00   36.76 ? 115  TYR A CB    1 
ATOM   873  C  CG    . TYR A 1 115 ? -5.875  5.388   -17.351 1.00   37.31 ? 115  TYR A CG    1 
ATOM   874  C  CD1   . TYR A 1 115 ? -5.877  5.394   -15.939 1.00   36.15 ? 115  TYR A CD1   1 
ATOM   875  C  CD2   . TYR A 1 115 ? -6.807  6.215   -18.001 1.00   36.42 ? 115  TYR A CD2   1 
ATOM   876  C  CE1   . TYR A 1 115 ? -6.750  6.178   -15.216 1.00   36.68 ? 115  TYR A CE1   1 
ATOM   877  C  CE2   . TYR A 1 115 ? -7.695  7.013   -17.294 1.00   34.91 ? 115  TYR A CE2   1 
ATOM   878  C  CZ    . TYR A 1 115 ? -7.656  6.995   -15.903 1.00   36.60 ? 115  TYR A CZ    1 
ATOM   879  O  OH    . TYR A 1 115 ? -8.530  7.789   -15.192 1.00   35.18 ? 115  TYR A OH    1 
ATOM   880  N  N     . SER A 1 116 ? -3.093  2.385   -18.323 1.00   42.06 ? 116  SER A N     1 
ATOM   881  C  CA    . SER A 1 116 ? -2.493  1.291   -19.049 1.00   42.49 ? 116  SER A CA    1 
ATOM   882  C  C     . SER A 1 116 ? -3.524  0.179   -18.945 1.00   44.12 ? 116  SER A C     1 
ATOM   883  O  O     . SER A 1 116 ? -3.406  -0.734  -18.118 1.00   43.84 ? 116  SER A O     1 
ATOM   884  C  CB    . SER A 1 116 ? -1.177  0.886   -18.400 1.00   40.63 ? 116  SER A CB    1 
ATOM   885  O  OG    . SER A 1 116 ? -0.358  0.204   -19.314 1.00   37.50 ? 116  SER A OG    1 
ATOM   886  N  N     . GLY A 1 117 ? -4.546  0.263   -19.795 1.00   45.04 ? 117  GLY A N     1 
ATOM   887  C  CA    . GLY A 1 117 ? -5.613  -0.713  -19.757 1.00   47.31 ? 117  GLY A CA    1 
ATOM   888  C  C     . GLY A 1 117 ? -6.442  -0.481  -18.505 1.00   50.07 ? 117  GLY A C     1 
ATOM   889  O  O     . GLY A 1 117 ? -6.741  0.664   -18.176 1.00   50.88 ? 117  GLY A O     1 
ATOM   890  N  N     . LEU A 1 118 ? -6.809  -1.537  -17.785 1.00   51.21 ? 118  LEU A N     1 
ATOM   891  C  CA    . LEU A 1 118 ? -7.610  -1.335  -16.580 1.00   50.83 ? 118  LEU A CA    1 
ATOM   892  C  C     . LEU A 1 118 ? -6.816  -0.759  -15.404 1.00   49.54 ? 118  LEU A C     1 
ATOM   893  O  O     . LEU A 1 118 ? -7.405  -0.374  -14.394 1.00   48.62 ? 118  LEU A O     1 
ATOM   894  C  CB    . LEU A 1 118 ? -8.309  -2.639  -16.170 1.00   51.56 ? 118  LEU A CB    1 
ATOM   895  C  CG    . LEU A 1 118 ? -9.438  -3.109  -17.115 1.00   54.71 ? 118  LEU A CG    1 
ATOM   896  C  CD1   . LEU A 1 118 ? -9.718  -4.622  -16.902 1.00   56.24 ? 118  LEU A CD1   1 
ATOM   897  C  CD2   . LEU A 1 118 ? -10.712 -2.274  -16.886 1.00   54.43 ? 118  LEU A CD2   1 
ATOM   898  N  N     . PHE A 1 119 ? -5.492  -0.691  -15.535 1.00   47.92 ? 119  PHE A N     1 
ATOM   899  C  CA    . PHE A 1 119 ? -4.618  -0.170  -14.470 1.00   47.49 ? 119  PHE A CA    1 
ATOM   900  C  C     . PHE A 1 119 ? -4.380  1.337   -14.474 1.00   46.04 ? 119  PHE A C     1 
ATOM   901  O  O     . PHE A 1 119 ? -4.285  1.964   -15.540 1.00   46.69 ? 119  PHE A O     1 
ATOM   902  C  CB    . PHE A 1 119 ? -3.235  -0.831  -14.523 1.00   48.10 ? 119  PHE A CB    1 
ATOM   903  C  CG    . PHE A 1 119 ? -3.272  -2.323  -14.390 1.00   51.95 ? 119  PHE A CG    1 
ATOM   904  C  CD1   . PHE A 1 119 ? -3.373  -3.138  -15.523 1.00   52.23 ? 119  PHE A CD1   1 
ATOM   905  C  CD2   . PHE A 1 119 ? -3.241  -2.925  -13.116 1.00   52.57 ? 119  PHE A CD2   1 
ATOM   906  C  CE1   . PHE A 1 119 ? -3.443  -4.531  -15.386 1.00   53.10 ? 119  PHE A CE1   1 
ATOM   907  C  CE2   . PHE A 1 119 ? -3.312  -4.301  -12.970 1.00   52.27 ? 119  PHE A CE2   1 
ATOM   908  C  CZ    . PHE A 1 119 ? -3.415  -5.111  -14.100 1.00   53.61 ? 119  PHE A CZ    1 
ATOM   909  N  N     . CYS A 1 120 ? -4.268  1.924   -13.283 1.00   43.40 ? 120  CYS A N     1 
ATOM   910  C  CA    . CYS A 1 120 ? -3.965  3.358   -13.161 1.00   39.91 ? 120  CYS A CA    1 
ATOM   911  C  C     . CYS A 1 120 ? -2.612  3.420   -12.461 1.00   38.35 ? 120  CYS A C     1 
ATOM   912  O  O     . CYS A 1 120 ? -2.442  2.877   -11.370 1.00   39.14 ? 120  CYS A O     1 
ATOM   913  C  CB    . CYS A 1 120 ? -5.034  4.093   -12.352 1.00   37.66 ? 120  CYS A CB    1 
ATOM   914  S  SG    . CYS A 1 120 ? -4.597  5.824   -11.967 1.00   37.83 ? 120  CYS A SG    1 
ATOM   915  N  N     . ILE A 1 121 ? -1.641  4.071   -13.101 1.00   36.33 ? 121  ILE A N     1 
ATOM   916  C  CA    . ILE A 1 121 ? -0.294  4.211   -12.575 1.00   34.63 ? 121  ILE A CA    1 
ATOM   917  C  C     . ILE A 1 121 ? -0.192  5.625   -12.002 1.00   35.91 ? 121  ILE A C     1 
ATOM   918  O  O     . ILE A 1 121 ? -0.682  6.588   -12.623 1.00   35.50 ? 121  ILE A O     1 
ATOM   919  C  CB    . ILE A 1 121 ? 0.778   4.094   -13.695 1.00   32.96 ? 121  ILE A CB    1 
ATOM   920  C  CG1   . ILE A 1 121 ? 0.762   2.735   -14.376 1.00   31.80 ? 121  ILE A CG1   1 
ATOM   921  C  CG2   . ILE A 1 121 ? 2.148   4.374   -13.116 1.00   31.15 ? 121  ILE A CG2   1 
ATOM   922  C  CD1   . ILE A 1 121 ? -0.494  2.454   -15.182 1.00   34.48 ? 121  ILE A CD1   1 
ATOM   923  N  N     . ALA A 1 122 ? 0.443   5.761   -10.851 1.00   35.41 ? 122  ALA A N     1 
ATOM   924  C  CA    . ALA A 1 122 ? 0.632   7.052   -10.208 1.00   36.25 ? 122  ALA A CA    1 
ATOM   925  C  C     . ALA A 1 122 ? 2.073   7.227   -9.836  1.00   35.57 ? 122  ALA A C     1 
ATOM   926  O  O     . ALA A 1 122 ? 2.630   6.438   -9.045  1.00   37.25 ? 122  ALA A O     1 
ATOM   927  C  CB    . ALA A 1 122 ? -0.214  7.163   -8.943  1.00   36.95 ? 122  ALA A CB    1 
ATOM   928  N  N     . VAL A 1 123 ? 2.701   8.256   -10.375 1.00   34.58 ? 123  VAL A N     1 
ATOM   929  C  CA    . VAL A 1 123 ? 4.080   8.483   -10.047 1.00   34.22 ? 123  VAL A CA    1 
ATOM   930  C  C     . VAL A 1 123 ? 4.124   9.506   -8.913  1.00   33.73 ? 123  VAL A C     1 
ATOM   931  O  O     . VAL A 1 123 ? 3.563   10.582  -9.030  1.00   33.94 ? 123  VAL A O     1 
ATOM   932  C  CB    . VAL A 1 123 ? 4.820   8.972   -11.260 1.00   30.94 ? 123  VAL A CB    1 
ATOM   933  C  CG1   . VAL A 1 123 ? 6.316   9.080   -10.960 1.00   30.80 ? 123  VAL A CG1   1 
ATOM   934  C  CG2   . VAL A 1 123 ? 4.604   8.001   -12.386 1.00   29.53 ? 123  VAL A CG2   1 
ATOM   935  N  N     . ASN A 1 124 ? 4.789   9.160   -7.808  1.00   32.99 ? 124  ASN A N     1 
ATOM   936  C  CA    . ASN A 1 124 ? 4.873   10.064  -6.674  1.00   34.61 ? 124  ASN A CA    1 
ATOM   937  C  C     . ASN A 1 124 ? 5.536   11.422  -7.020  1.00   36.12 ? 124  ASN A C     1 
ATOM   938  O  O     . ASN A 1 124 ? 6.728   11.478  -7.326  1.00   35.51 ? 124  ASN A O     1 
ATOM   939  C  CB    . ASN A 1 124 ? 5.622   9.400   -5.513  1.00   32.83 ? 124  ASN A CB    1 
ATOM   940  C  CG    . ASN A 1 124 ? 5.696   10.305  -4.297  1.00   34.00 ? 124  ASN A CG    1 
ATOM   941  O  OD1   . ASN A 1 124 ? 5.367   11.479  -4.399  1.00   33.69 ? 124  ASN A OD1   1 
ATOM   942  N  ND2   . ASN A 1 124 ? 6.117   9.773   -3.146  1.00   31.67 ? 124  ASN A ND2   1 
ATOM   943  N  N     . PRO A 1 125 ? 4.772   12.522  -6.961  1.00   34.36 ? 125  PRO A N     1 
ATOM   944  C  CA    . PRO A 1 125 ? 5.208   13.903  -7.261  1.00   34.17 ? 125  PRO A CA    1 
ATOM   945  C  C     . PRO A 1 125 ? 6.386   14.399  -6.417  1.00   34.87 ? 125  PRO A C     1 
ATOM   946  O  O     . PRO A 1 125 ? 7.387   14.905  -6.930  1.00   33.95 ? 125  PRO A O     1 
ATOM   947  C  CB    . PRO A 1 125 ? 3.968   14.750  -6.951  1.00   35.56 ? 125  PRO A CB    1 
ATOM   948  C  CG    . PRO A 1 125 ? 2.822   13.772  -6.955  1.00   37.29 ? 125  PRO A CG    1 
ATOM   949  C  CD    . PRO A 1 125 ? 3.398   12.512  -6.410  1.00   35.26 ? 125  PRO A CD    1 
ATOM   950  N  N     . TYR A 1 126 ? 6.223   14.236  -5.108  1.00   33.46 ? 126  TYR A N     1 
ATOM   951  C  CA    . TYR A 1 126 ? 7.131   14.672  -4.068  1.00   34.77 ? 126  TYR A CA    1 
ATOM   952  C  C     . TYR A 1 126 ? 7.005   16.188  -3.865  1.00   35.75 ? 126  TYR A C     1 
ATOM   953  O  O     . TYR A 1 126 ? 7.931   16.838  -3.385  1.00   33.90 ? 126  TYR A O     1 
ATOM   954  C  CB    . TYR A 1 126 ? 8.584   14.263  -4.335  1.00   33.15 ? 126  TYR A CB    1 
ATOM   955  C  CG    . TYR A 1 126 ? 8.919   12.930  -3.687  1.00   34.06 ? 126  TYR A CG    1 
ATOM   956  C  CD1   . TYR A 1 126 ? 8.733   12.728  -2.329  1.00   32.85 ? 126  TYR A CD1   1 
ATOM   957  C  CD2   . TYR A 1 126 ? 9.394   11.859  -4.455  1.00   33.79 ? 126  TYR A CD2   1 
ATOM   958  C  CE1   . TYR A 1 126 ? 9.008   11.483  -1.742  1.00   33.85 ? 126  TYR A CE1   1 
ATOM   959  C  CE2   . TYR A 1 126 ? 9.679   10.636  -3.896  1.00   33.11 ? 126  TYR A CE2   1 
ATOM   960  C  CZ    . TYR A 1 126 ? 9.482   10.450  -2.537  1.00   34.61 ? 126  TYR A CZ    1 
ATOM   961  O  OH    . TYR A 1 126 ? 9.760   9.231   -1.994  1.00   33.60 ? 126  TYR A OH    1 
ATOM   962  N  N     . ARG A 1 127 ? 5.846   16.714  -4.226  1.00   36.95 ? 127  ARG A N     1 
ATOM   963  C  CA    . ARG A 1 127 ? 5.520   18.133  -4.082  1.00   39.34 ? 127  ARG A CA    1 
ATOM   964  C  C     . ARG A 1 127 ? 3.991   18.196  -4.105  1.00   40.71 ? 127  ARG A C     1 
ATOM   965  O  O     . ARG A 1 127 ? 3.350   17.266  -4.597  1.00   39.69 ? 127  ARG A O     1 
ATOM   966  C  CB    . ARG A 1 127 ? 6.076   18.933  -5.256  1.00   41.06 ? 127  ARG A CB    1 
ATOM   967  C  CG    . ARG A 1 127 ? 5.452   18.540  -6.591  1.00   47.33 ? 127  ARG A CG    1 
ATOM   968  C  CD    . ARG A 1 127 ? 6.094   19.240  -7.780  1.00   51.90 ? 127  ARG A CD    1 
ATOM   969  N  NE    . ARG A 1 127 ? 6.913   18.316  -8.563  1.00   55.67 ? 127  ARG A NE    1 
ATOM   970  C  CZ    . ARG A 1 127 ? 6.437   17.295  -9.281  1.00   56.15 ? 127  ARG A CZ    1 
ATOM   971  N  NH1   . ARG A 1 127 ? 5.136   17.056  -9.333  1.00   57.24 ? 127  ARG A NH1   1 
ATOM   972  N  NH2   . ARG A 1 127 ? 7.265   16.500  -9.945  1.00   57.61 ? 127  ARG A NH2   1 
ATOM   973  N  N     . ARG A 1 128 ? 3.399   19.262  -3.587  1.00   42.92 ? 128  ARG A N     1 
ATOM   974  C  CA    . ARG A 1 128 ? 1.941   19.378  -3.595  1.00   45.78 ? 128  ARG A CA    1 
ATOM   975  C  C     . ARG A 1 128 ? 1.474   19.958  -4.932  1.00   46.88 ? 128  ARG A C     1 
ATOM   976  O  O     . ARG A 1 128 ? 2.034   20.936  -5.429  1.00   48.50 ? 128  ARG A O     1 
ATOM   977  C  CB    . ARG A 1 128 ? 1.461   20.268  -2.451  1.00   48.39 ? 128  ARG A CB    1 
ATOM   978  C  CG    . ARG A 1 128 ? 2.233   20.056  -1.176  1.00   55.52 ? 128  ARG A CG    1 
ATOM   979  C  CD    . ARG A 1 128 ? 1.416   19.448  -0.030  1.00   59.54 ? 128  ARG A CD    1 
ATOM   980  N  NE    . ARG A 1 128 ? 1.128   18.014  -0.125  1.00   61.85 ? 128  ARG A NE    1 
ATOM   981  C  CZ    . ARG A 1 128 ? 1.037   17.224  0.952   1.00   64.28 ? 128  ARG A CZ    1 
ATOM   982  N  NH1   . ARG A 1 128 ? 1.227   17.746  2.165   1.00   64.98 ? 128  ARG A NH1   1 
ATOM   983  N  NH2   . ARG A 1 128 ? 0.712   15.933  0.844   1.00   63.88 ? 128  ARG A NH2   1 
ATOM   984  N  N     . LEU A 1 129 ? 0.445   19.347  -5.500  1.00   48.41 ? 129  LEU A N     1 
ATOM   985  C  CA    . LEU A 1 129 ? -0.113  19.750  -6.777  1.00   47.09 ? 129  LEU A CA    1 
ATOM   986  C  C     . LEU A 1 129 ? -1.525  20.292  -6.566  1.00   46.06 ? 129  LEU A C     1 
ATOM   987  O  O     . LEU A 1 129 ? -2.173  19.996  -5.568  1.00   47.35 ? 129  LEU A O     1 
ATOM   988  C  CB    . LEU A 1 129 ? -0.129  18.548  -7.727  1.00   47.57 ? 129  LEU A CB    1 
ATOM   989  C  CG    . LEU A 1 129 ? 1.244   17.964  -8.070  1.00   47.03 ? 129  LEU A CG    1 
ATOM   990  C  CD1   . LEU A 1 129 ? 1.054   16.761  -8.975  1.00   47.05 ? 129  LEU A CD1   1 
ATOM   991  C  CD2   . LEU A 1 129 ? 2.131   19.017  -8.764  1.00   47.25 ? 129  LEU A CD2   1 
ATOM   992  N  N     . PRO A 1 130 ? -2.013  21.108  -7.517  1.00   48.23 ? 130  PRO A N     1 
ATOM   993  C  CA    . PRO A 1 130 ? -3.344  21.708  -7.450  1.00   47.33 ? 130  PRO A CA    1 
ATOM   994  C  C     . PRO A 1 130 ? -4.456  20.880  -8.083  1.00   46.03 ? 130  PRO A C     1 
ATOM   995  O  O     . PRO A 1 130 ? -5.513  21.416  -8.427  1.00   48.62 ? 130  PRO A O     1 
ATOM   996  C  CB    . PRO A 1 130 ? -3.136  23.012  -8.186  1.00   48.04 ? 130  PRO A CB    1 
ATOM   997  C  CG    . PRO A 1 130 ? -2.268  22.566  -9.305  1.00   47.29 ? 130  PRO A CG    1 
ATOM   998  C  CD    . PRO A 1 130 ? -1.222  21.753  -8.576  1.00   47.55 ? 130  PRO A CD    1 
ATOM   999  N  N     . ILE A 1 131 ? -4.241  19.584  -8.218  1.00   44.09 ? 131  ILE A N     1 
ATOM   1000 C  CA    . ILE A 1 131 ? -5.215  18.718  -8.844  1.00   40.91 ? 131  ILE A CA    1 
ATOM   1001 C  C     . ILE A 1 131 ? -6.272  18.011  -7.982  1.00   40.99 ? 131  ILE A C     1 
ATOM   1002 O  O     . ILE A 1 131 ? -7.026  17.180  -8.505  1.00   39.56 ? 131  ILE A O     1 
ATOM   1003 C  CB    . ILE A 1 131 ? -4.490  17.651  -9.629  1.00   40.41 ? 131  ILE A CB    1 
ATOM   1004 C  CG1   . ILE A 1 131 ? -3.607  16.837  -8.667  1.00   37.78 ? 131  ILE A CG1   1 
ATOM   1005 C  CG2   . ILE A 1 131 ? -3.697  18.296  -10.753 1.00   36.94 ? 131  ILE A CG2   1 
ATOM   1006 C  CD1   . ILE A 1 131 ? -2.986  15.605  -9.295  1.00   37.68 ? 131  ILE A CD1   1 
ATOM   1007 N  N     . TYR A 1 132 ? -6.353  18.315  -6.694  1.00   38.13 ? 132  TYR A N     1 
ATOM   1008 C  CA    . TYR A 1 132 ? -7.327  17.645  -5.827  1.00   37.24 ? 132  TYR A CA    1 
ATOM   1009 C  C     . TYR A 1 132 ? -8.411  18.596  -5.264  1.00   37.67 ? 132  TYR A C     1 
ATOM   1010 O  O     . TYR A 1 132 ? -9.150  18.233  -4.351  1.00   36.30 ? 132  TYR A O     1 
ATOM   1011 C  CB    . TYR A 1 132 ? -6.576  16.936  -4.671  1.00   34.33 ? 132  TYR A CB    1 
ATOM   1012 C  CG    . TYR A 1 132 ? -5.496  15.955  -5.131  1.00   31.32 ? 132  TYR A CG    1 
ATOM   1013 C  CD1   . TYR A 1 132 ? -5.845  14.764  -5.770  1.00   29.48 ? 132  TYR A CD1   1 
ATOM   1014 C  CD2   . TYR A 1 132 ? -4.129  16.240  -4.960  1.00   29.47 ? 132  TYR A CD2   1 
ATOM   1015 C  CE1   . TYR A 1 132 ? -4.891  13.884  -6.223  1.00   28.05 ? 132  TYR A CE1   1 
ATOM   1016 C  CE2   . TYR A 1 132 ? -3.145  15.354  -5.428  1.00   26.98 ? 132  TYR A CE2   1 
ATOM   1017 C  CZ    . TYR A 1 132 ? -3.536  14.178  -6.060  1.00   29.67 ? 132  TYR A CZ    1 
ATOM   1018 O  OH    . TYR A 1 132 ? -2.600  13.283  -6.576  1.00   27.96 ? 132  TYR A OH    1 
ATOM   1019 N  N     . THR A 1 133 ? -8.498  19.797  -5.834  1.00   38.98 ? 133  THR A N     1 
ATOM   1020 C  CA    . THR A 1 133 ? -9.457  20.830  -5.416  1.00   39.59 ? 133  THR A CA    1 
ATOM   1021 C  C     . THR A 1 133 ? -10.886 20.423  -5.721  1.00   40.85 ? 133  THR A C     1 
ATOM   1022 O  O     . THR A 1 133 ? -11.128 19.581  -6.591  1.00   39.97 ? 133  THR A O     1 
ATOM   1023 C  CB    . THR A 1 133 ? -9.187  22.163  -6.148  1.00   40.00 ? 133  THR A CB    1 
ATOM   1024 O  OG1   . THR A 1 133 ? -9.560  22.035  -7.518  1.00   40.41 ? 133  THR A OG1   1 
ATOM   1025 C  CG2   . THR A 1 133 ? -7.720  22.519  -6.089  1.00   40.78 ? 133  THR A CG2   1 
ATOM   1026 N  N     . ASP A 1 134 ? -11.843 21.010  -5.013  1.00   42.58 ? 134  ASP A N     1 
ATOM   1027 C  CA    . ASP A 1 134 ? -13.231 20.675  -5.262  1.00   44.79 ? 134  ASP A CA    1 
ATOM   1028 C  C     . ASP A 1 134 ? -13.653 21.031  -6.663  1.00   46.92 ? 134  ASP A C     1 
ATOM   1029 O  O     . ASP A 1 134 ? -14.560 20.409  -7.236  1.00   48.00 ? 134  ASP A O     1 
ATOM   1030 C  CB    . ASP A 1 134 ? -14.122 21.355  -4.236  1.00   46.92 ? 134  ASP A CB    1 
ATOM   1031 C  CG    . ASP A 1 134 ? -14.463 20.425  -3.075  1.00   51.08 ? 134  ASP A CG    1 
ATOM   1032 O  OD1   . ASP A 1 134 ? -15.302 19.491  -3.291  1.00   53.98 ? 134  ASP A OD1   1 
ATOM   1033 O  OD2   . ASP A 1 134 ? -13.881 20.613  -1.979  1.00   50.26 ? 134  ASP A OD2   1 
ATOM   1034 N  N     . SER A 1 135 ? -12.989 22.028  -7.241  1.00   48.73 ? 135  SER A N     1 
ATOM   1035 C  CA    . SER A 1 135 ? -13.290 22.463  -8.592  1.00   49.67 ? 135  SER A CA    1 
ATOM   1036 C  C     . SER A 1 135 ? -12.931 21.325  -9.549  1.00   48.56 ? 135  SER A C     1 
ATOM   1037 O  O     . SER A 1 135 ? -13.622 21.106  -10.543 1.00   48.58 ? 135  SER A O     1 
ATOM   1038 C  CB    . SER A 1 135 ? -12.485 23.725  -8.903  1.00   52.98 ? 135  SER A CB    1 
ATOM   1039 O  OG    . SER A 1 135 ? -13.022 24.402  -10.019 1.00   61.11 ? 135  SER A OG    1 
ATOM   1040 N  N     . VAL A 1 136 ? -11.853 20.599  -9.261  1.00   45.58 ? 136  VAL A N     1 
ATOM   1041 C  CA    . VAL A 1 136 ? -11.495 19.463  -10.106 1.00   41.97 ? 136  VAL A CA    1 
ATOM   1042 C  C     . VAL A 1 136 ? -12.536 18.362  -9.877  1.00   40.92 ? 136  VAL A C     1 
ATOM   1043 O  O     . VAL A 1 136 ? -13.016 17.746  -10.825 1.00   40.34 ? 136  VAL A O     1 
ATOM   1044 C  CB    . VAL A 1 136 ? -10.083 18.895  -9.765  1.00   41.01 ? 136  VAL A CB    1 
ATOM   1045 C  CG1   . VAL A 1 136 ? -9.833  17.617  -10.549 1.00   38.37 ? 136  VAL A CG1   1 
ATOM   1046 C  CG2   . VAL A 1 136 ? -8.989  19.924  -10.110 1.00   39.15 ? 136  VAL A CG2   1 
ATOM   1047 N  N     . ILE A 1 137 ? -12.888 18.126  -8.619  1.00   40.14 ? 137  ILE A N     1 
ATOM   1048 C  CA    . ILE A 1 137 ? -13.877 17.108  -8.257  1.00   40.91 ? 137  ILE A CA    1 
ATOM   1049 C  C     . ILE A 1 137 ? -15.227 17.420  -8.872  1.00   42.81 ? 137  ILE A C     1 
ATOM   1050 O  O     . ILE A 1 137 ? -16.133 16.587  -8.843  1.00   45.24 ? 137  ILE A O     1 
ATOM   1051 C  CB    . ILE A 1 137 ? -14.121 17.071  -6.728  1.00   36.12 ? 137  ILE A CB    1 
ATOM   1052 C  CG1   . ILE A 1 137 ? -12.870 16.640  -5.988  1.00   35.80 ? 137  ILE A CG1   1 
ATOM   1053 C  CG2   . ILE A 1 137 ? -15.239 16.106  -6.354  1.00   34.74 ? 137  ILE A CG2   1 
ATOM   1054 C  CD1   . ILE A 1 137 ? -13.091 16.484  -4.480  1.00   33.81 ? 137  ILE A CD1   1 
ATOM   1055 N  N     . ALA A 1 138 ? -15.409 18.646  -9.321  1.00   45.05 ? 138  ALA A N     1 
ATOM   1056 C  CA    . ALA A 1 138 ? -16.667 19.057  -9.951  1.00   46.38 ? 138  ALA A CA    1 
ATOM   1057 C  C     . ALA A 1 138 ? -16.560 18.576  -11.412 1.00   46.56 ? 138  ALA A C     1 
ATOM   1058 O  O     . ALA A 1 138 ? -17.551 18.136  -11.991 1.00   46.78 ? 138  ALA A O     1 
ATOM   1059 C  CB    . ALA A 1 138 ? -16.820 20.578  -9.884  1.00   45.22 ? 138  ALA A CB    1 
ATOM   1060 N  N     . LYS A 1 139 ? -15.362 18.632  -11.999 1.00   46.05 ? 139  LYS A N     1 
ATOM   1061 C  CA    . LYS A 1 139 ? -15.163 18.173  -13.376 1.00   45.34 ? 139  LYS A CA    1 
ATOM   1062 C  C     . LYS A 1 139 ? -15.099 16.640  -13.563 1.00   44.97 ? 139  LYS A C     1 
ATOM   1063 O  O     . LYS A 1 139 ? -15.338 16.156  -14.664 1.00   42.85 ? 139  LYS A O     1 
ATOM   1064 C  CB    . LYS A 1 139 ? -13.878 18.743  -13.983 1.00   47.11 ? 139  LYS A CB    1 
ATOM   1065 C  CG    . LYS A 1 139 ? -13.452 20.130  -13.510 1.00   51.03 ? 139  LYS A CG    1 
ATOM   1066 C  CD    . LYS A 1 139 ? -14.309 21.238  -14.097 1.00   53.91 ? 139  LYS A CD    1 
ATOM   1067 C  CE    . LYS A 1 139 ? -13.684 22.612  -13.851 1.00   56.34 ? 139  LYS A CE    1 
ATOM   1068 N  NZ    . LYS A 1 139 ? -12.564 22.905  -14.812 1.00   56.80 ? 139  LYS A NZ    1 
ATOM   1069 N  N     . TYR A 1 140 ? -14.754 15.873  -12.528 1.00   43.68 ? 140  TYR A N     1 
ATOM   1070 C  CA    . TYR A 1 140 ? -14.669 14.420  -12.692 1.00   43.44 ? 140  TYR A CA    1 
ATOM   1071 C  C     . TYR A 1 140 ? -15.936 13.672  -12.335 1.00   45.28 ? 140  TYR A C     1 
ATOM   1072 O  O     . TYR A 1 140 ? -16.073 12.494  -12.664 1.00   46.54 ? 140  TYR A O     1 
ATOM   1073 C  CB    . TYR A 1 140 ? -13.490 13.826  -11.879 1.00   39.63 ? 140  TYR A CB    1 
ATOM   1074 C  CG    . TYR A 1 140 ? -12.158 13.965  -12.575 1.00   36.07 ? 140  TYR A CG    1 
ATOM   1075 C  CD1   . TYR A 1 140 ? -11.470 15.176  -12.546 1.00   34.76 ? 140  TYR A CD1   1 
ATOM   1076 C  CD2   . TYR A 1 140 ? -11.626 12.928  -13.337 1.00   33.64 ? 140  TYR A CD2   1 
ATOM   1077 C  CE1   . TYR A 1 140 ? -10.313 15.354  -13.252 1.00   32.44 ? 140  TYR A CE1   1 
ATOM   1078 C  CE2   . TYR A 1 140 ? -10.454 13.105  -14.064 1.00   31.29 ? 140  TYR A CE2   1 
ATOM   1079 C  CZ    . TYR A 1 140 ? -9.813  14.327  -14.004 1.00   32.05 ? 140  TYR A CZ    1 
ATOM   1080 O  OH    . TYR A 1 140 ? -8.655  14.559  -14.693 1.00   33.65 ? 140  TYR A OH    1 
ATOM   1081 N  N     . ARG A 1 141 ? -16.865 14.328  -11.658 1.00   48.49 ? 141  ARG A N     1 
ATOM   1082 C  CA    . ARG A 1 141 ? -18.108 13.683  -11.262 1.00   51.31 ? 141  ARG A CA    1 
ATOM   1083 C  C     . ARG A 1 141 ? -18.886 13.137  -12.439 1.00   50.58 ? 141  ARG A C     1 
ATOM   1084 O  O     . ARG A 1 141 ? -19.188 13.862  -13.383 1.00   51.03 ? 141  ARG A O     1 
ATOM   1085 C  CB    . ARG A 1 141 ? -19.030 14.626  -10.493 1.00   55.41 ? 141  ARG A CB    1 
ATOM   1086 C  CG    . ARG A 1 141 ? -18.547 15.001  -9.147  1.00   62.26 ? 141  ARG A CG    1 
ATOM   1087 C  CD    . ARG A 1 141 ? -19.718 15.489  -8.358  1.00   66.50 ? 141  ARG A CD    1 
ATOM   1088 N  NE    . ARG A 1 141 ? -20.762 14.476  -8.380  1.00   68.89 ? 141  ARG A NE    1 
ATOM   1089 C  CZ    . ARG A 1 141 ? -21.797 14.459  -7.549  1.00   70.12 ? 141  ARG A CZ    1 
ATOM   1090 N  NH1   . ARG A 1 141 ? -21.918 15.417  -6.634  1.00   70.56 ? 141  ARG A NH1   1 
ATOM   1091 N  NH2   . ARG A 1 141 ? -22.693 13.471  -7.614  1.00   70.38 ? 141  ARG A NH2   1 
ATOM   1092 N  N     . GLY A 1 142 ? -19.199 11.855  -12.370 1.00   49.50 ? 142  GLY A N     1 
ATOM   1093 C  CA    . GLY A 1 142 ? -19.970 11.208  -13.410 1.00   48.05 ? 142  GLY A CA    1 
ATOM   1094 C  C     . GLY A 1 142 ? -19.280 10.862  -14.713 1.00   47.70 ? 142  GLY A C     1 
ATOM   1095 O  O     . GLY A 1 142 ? -19.867 10.181  -15.550 1.00   47.19 ? 142  GLY A O     1 
ATOM   1096 N  N     . LYS A 1 143 ? -18.049 11.302  -14.898 1.00   48.35 ? 143  LYS A N     1 
ATOM   1097 C  CA    . LYS A 1 143 ? -17.331 11.031  -16.134 1.00   51.89 ? 143  LYS A CA    1 
ATOM   1098 C  C     . LYS A 1 143 ? -16.692 9.653   -16.357 1.00   54.78 ? 143  LYS A C     1 
ATOM   1099 O  O     . LYS A 1 143 ? -16.244 8.988   -15.414 1.00   54.33 ? 143  LYS A O     1 
ATOM   1100 C  CB    . LYS A 1 143 ? -16.265 12.103  -16.352 1.00   53.06 ? 143  LYS A CB    1 
ATOM   1101 C  CG    . LYS A 1 143 ? -16.680 13.207  -17.307 1.00   56.58 ? 143  LYS A CG    1 
ATOM   1102 C  CD    . LYS A 1 143 ? -17.900 13.965  -16.825 1.00   58.14 ? 143  LYS A CD    1 
ATOM   1103 C  CE    . LYS A 1 143 ? -18.202 15.098  -17.773 1.00   58.30 ? 143  LYS A CE    1 
ATOM   1104 N  NZ    . LYS A 1 143 ? -17.054 16.039  -17.829 1.00   58.39 ? 143  LYS A NZ    1 
ATOM   1105 N  N     . ARG A 1 144 ? -16.662 9.247   -17.630 1.00   56.93 ? 144  ARG A N     1 
ATOM   1106 C  CA    . ARG A 1 144 ? -16.055 7.994   -18.078 1.00   57.83 ? 144  ARG A CA    1 
ATOM   1107 C  C     . ARG A 1 144 ? -14.570 8.328   -18.125 1.00   56.52 ? 144  ARG A C     1 
ATOM   1108 O  O     . ARG A 1 144 ? -14.218 9.497   -18.248 1.00   55.77 ? 144  ARG A O     1 
ATOM   1109 C  CB    . ARG A 1 144 ? -16.561 7.636   -19.489 1.00   60.77 ? 144  ARG A CB    1 
ATOM   1110 C  CG    . ARG A 1 144 ? -17.712 6.649   -19.516 1.00   67.89 ? 144  ARG A CG    1 
ATOM   1111 C  CD    . ARG A 1 144 ? -18.894 7.165   -20.327 1.00   73.24 ? 144  ARG A CD    1 
ATOM   1112 N  NE    . ARG A 1 144 ? -19.848 7.889   -19.489 1.00   76.58 ? 144  ARG A NE    1 
ATOM   1113 C  CZ    . ARG A 1 144 ? -21.088 8.212   -19.855 1.00   77.94 ? 144  ARG A CZ    1 
ATOM   1114 N  NH1   . ARG A 1 144 ? -21.534 7.879   -21.067 1.00   77.94 ? 144  ARG A NH1   1 
ATOM   1115 N  NH2   . ARG A 1 144 ? -21.893 8.840   -18.992 1.00   77.87 ? 144  ARG A NH2   1 
ATOM   1116 N  N     . LYS A 1 145 ? -13.698 7.336   -18.033 1.00   55.62 ? 145  LYS A N     1 
ATOM   1117 C  CA    . LYS A 1 145 ? -12.262 7.632   -18.043 1.00   54.57 ? 145  LYS A CA    1 
ATOM   1118 C  C     . LYS A 1 145 ? -11.759 8.255   -19.334 1.00   53.48 ? 145  LYS A C     1 
ATOM   1119 O  O     . LYS A 1 145 ? -10.770 8.990   -19.327 1.00   55.20 ? 145  LYS A O     1 
ATOM   1120 C  CB    . LYS A 1 145 ? -11.436 6.384   -17.762 1.00   55.02 ? 145  LYS A CB    1 
ATOM   1121 C  CG    . LYS A 1 145 ? -11.678 5.768   -16.397 1.00   58.62 ? 145  LYS A CG    1 
ATOM   1122 C  CD    . LYS A 1 145 ? -10.567 4.794   -15.995 1.00   60.28 ? 145  LYS A CD    1 
ATOM   1123 C  CE    . LYS A 1 145 ? -10.920 3.985   -14.734 1.00   61.10 ? 145  LYS A CE    1 
ATOM   1124 N  NZ    . LYS A 1 145 ? -9.798  3.063   -14.324 1.00   61.28 ? 145  LYS A NZ    1 
ATOM   1125 N  N     . THR A 1 146 ? -12.432 7.968   -20.439 1.00   52.46 ? 146  THR A N     1 
ATOM   1126 C  CA    . THR A 1 146 ? -12.016 8.479   -21.746 1.00   52.52 ? 146  THR A CA    1 
ATOM   1127 C  C     . THR A 1 146 ? -12.399 9.933   -22.028 1.00   53.07 ? 146  THR A C     1 
ATOM   1128 O  O     . THR A 1 146 ? -11.798 10.580  -22.882 1.00   54.60 ? 146  THR A O     1 
ATOM   1129 C  CB    . THR A 1 146 ? -12.589 7.614   -22.866 1.00   49.62 ? 146  THR A CB    1 
ATOM   1130 O  OG1   . THR A 1 146 ? -13.988 7.422   -22.629 1.00   47.89 ? 146  THR A OG1   1 
ATOM   1131 C  CG2   . THR A 1 146 ? -11.906 6.259   -22.900 1.00   45.49 ? 146  THR A CG2   1 
ATOM   1132 N  N     . GLU A 1 147 ? -13.392 10.446  -21.311 1.00   54.89 ? 147  GLU A N     1 
ATOM   1133 C  CA    . GLU A 1 147 ? -13.836 11.816  -21.509 1.00   56.73 ? 147  GLU A CA    1 
ATOM   1134 C  C     . GLU A 1 147 ? -13.264 12.771  -20.484 1.00   56.22 ? 147  GLU A C     1 
ATOM   1135 O  O     . GLU A 1 147 ? -13.925 13.737  -20.096 1.00   56.10 ? 147  GLU A O     1 
ATOM   1136 C  CB    . GLU A 1 147 ? -15.362 11.896  -21.464 1.00   60.61 ? 147  GLU A CB    1 
ATOM   1137 C  CG    . GLU A 1 147 ? -16.067 10.675  -20.934 1.00   65.76 ? 147  GLU A CG    1 
ATOM   1138 C  CD    . GLU A 1 147 ? -17.556 10.921  -20.756 1.00   68.56 ? 147  GLU A CD    1 
ATOM   1139 O  OE1   . GLU A 1 147 ? -18.282 11.015  -21.775 1.00   70.33 ? 147  GLU A OE1   1 
ATOM   1140 O  OE2   . GLU A 1 147 ? -18.004 11.040  -19.593 1.00   69.27 ? 147  GLU A OE2   1 
ATOM   1141 N  N     . ILE A 1 148 ? -12.041 12.526  -20.055 1.00   53.34 ? 148  ILE A N     1 
ATOM   1142 C  CA    . ILE A 1 148 ? -11.436 13.365  -19.034 1.00   48.80 ? 148  ILE A CA    1 
ATOM   1143 C  C     . ILE A 1 148 ? -10.029 12.810  -18.832 1.00   46.14 ? 148  ILE A C     1 
ATOM   1144 O  O     . ILE A 1 148 ? -9.817  11.603  -18.921 1.00   44.03 ? 148  ILE A O     1 
ATOM   1145 C  CB    . ILE A 1 148 ? -12.312 13.288  -17.738 1.00   50.62 ? 148  ILE A CB    1 
ATOM   1146 C  CG1   . ILE A 1 148 ? -11.873 14.326  -16.715 1.00   51.81 ? 148  ILE A CG1   1 
ATOM   1147 C  CG2   . ILE A 1 148 ? -12.339 11.871  -17.208 1.00   52.03 ? 148  ILE A CG2   1 
ATOM   1148 C  CD1   . ILE A 1 148 ? -12.401 15.705  -17.015 1.00   53.49 ? 148  ILE A CD1   1 
ATOM   1149 N  N     . PRO A 1 149 ? -9.050  13.675  -18.575 1.00   43.59 ? 149  PRO A N     1 
ATOM   1150 C  CA    . PRO A 1 149 ? -7.684  13.182  -18.384 1.00   41.86 ? 149  PRO A CA    1 
ATOM   1151 C  C     . PRO A 1 149 ? -7.582  12.178  -17.238 1.00   41.66 ? 149  PRO A C     1 
ATOM   1152 O  O     . PRO A 1 149 ? -8.448  12.140  -16.361 1.00   41.11 ? 149  PRO A O     1 
ATOM   1153 C  CB    . PRO A 1 149 ? -6.885  14.452  -18.089 1.00   41.25 ? 149  PRO A CB    1 
ATOM   1154 C  CG    . PRO A 1 149 ? -7.698  15.529  -18.759 1.00   41.57 ? 149  PRO A CG    1 
ATOM   1155 C  CD    . PRO A 1 149 ? -9.105  15.140  -18.402 1.00   41.09 ? 149  PRO A CD    1 
ATOM   1156 N  N     . PRO A 1 150 ? -6.521  11.368  -17.227 1.00   41.40 ? 150  PRO A N     1 
ATOM   1157 C  CA    . PRO A 1 150 ? -6.301  10.357  -16.181 1.00   40.14 ? 150  PRO A CA    1 
ATOM   1158 C  C     . PRO A 1 150 ? -6.180  10.989  -14.802 1.00   38.53 ? 150  PRO A C     1 
ATOM   1159 O  O     . PRO A 1 150 ? -5.456  11.962  -14.619 1.00   36.83 ? 150  PRO A O     1 
ATOM   1160 C  CB    . PRO A 1 150 ? -4.996  9.699   -16.615 1.00   42.18 ? 150  PRO A CB    1 
ATOM   1161 C  CG    . PRO A 1 150 ? -5.037  9.830   -18.124 1.00   42.49 ? 150  PRO A CG    1 
ATOM   1162 C  CD    . PRO A 1 150 ? -5.471  11.271  -18.261 1.00   41.49 ? 150  PRO A CD    1 
ATOM   1163 N  N     . HIS A 1 151 ? -6.884  10.435  -13.834 1.00   35.94 ? 151  HIS A N     1 
ATOM   1164 C  CA    . HIS A 1 151 ? -6.812  10.969  -12.477 1.00   35.82 ? 151  HIS A CA    1 
ATOM   1165 C  C     . HIS A 1 151 ? -7.341  9.910   -11.502 1.00   35.45 ? 151  HIS A C     1 
ATOM   1166 O  O     . HIS A 1 151 ? -8.225  9.133   -11.856 1.00   36.53 ? 151  HIS A O     1 
ATOM   1167 C  CB    . HIS A 1 151 ? -7.669  12.230  -12.378 1.00   34.13 ? 151  HIS A CB    1 
ATOM   1168 C  CG    . HIS A 1 151 ? -7.461  13.024  -11.130 1.00   32.00 ? 151  HIS A CG    1 
ATOM   1169 N  ND1   . HIS A 1 151 ? -7.643  12.499  -9.872  1.00   31.55 ? 151  HIS A ND1   1 
ATOM   1170 C  CD2   . HIS A 1 151 ? -7.105  14.318  -10.954 1.00   30.96 ? 151  HIS A CD2   1 
ATOM   1171 C  CE1   . HIS A 1 151 ? -7.403  13.443  -8.968  1.00   32.29 ? 151  HIS A CE1   1 
ATOM   1172 N  NE2   . HIS A 1 151 ? -7.075  14.555  -9.600  1.00   29.72 ? 151  HIS A NE2   1 
ATOM   1173 N  N     . LEU A 1 152 ? -6.807  9.888   -10.294 1.00   35.76 ? 152  LEU A N     1 
ATOM   1174 C  CA    . LEU A 1 152 ? -7.261  8.962   -9.262  1.00   35.25 ? 152  LEU A CA    1 
ATOM   1175 C  C     . LEU A 1 152 ? -8.770  9.098   -9.053  1.00   34.87 ? 152  LEU A C     1 
ATOM   1176 O  O     . LEU A 1 152 ? -9.467  8.101   -8.818  1.00   35.15 ? 152  LEU A O     1 
ATOM   1177 C  CB    . LEU A 1 152 ? -6.549  9.256   -7.941  1.00   36.24 ? 152  LEU A CB    1 
ATOM   1178 C  CG    . LEU A 1 152 ? -6.847  8.247   -6.843  1.00   36.19 ? 152  LEU A CG    1 
ATOM   1179 C  CD1   . LEU A 1 152 ? -5.947  7.028   -7.092  1.00   36.45 ? 152  LEU A CD1   1 
ATOM   1180 C  CD2   . LEU A 1 152 ? -6.602  8.872   -5.491  1.00   32.83 ? 152  LEU A CD2   1 
ATOM   1181 N  N     . PHE A 1 153 ? -9.277  10.311  -9.152  1.00   35.05 ? 153  PHE A N     1 
ATOM   1182 C  CA    . PHE A 1 153 ? -10.711 10.539  -8.975  1.00   36.06 ? 153  PHE A CA    1 
ATOM   1183 C  C     . PHE A 1 153 ? -11.577 9.670   -9.895  1.00   36.97 ? 153  PHE A C     1 
ATOM   1184 O  O     . PHE A 1 153 ? -12.657 9.231   -9.492  1.00   35.05 ? 153  PHE A O     1 
ATOM   1185 C  CB    . PHE A 1 153 ? -11.060 12.026  -9.189  1.00   36.69 ? 153  PHE A CB    1 
ATOM   1186 C  CG    . PHE A 1 153 ? -10.534 12.942  -8.100  1.00   37.54 ? 153  PHE A CG    1 
ATOM   1187 C  CD1   . PHE A 1 153 ? -10.178 12.430  -6.849  1.00   35.55 ? 153  PHE A CD1   1 
ATOM   1188 C  CD2   . PHE A 1 153 ? -10.414 14.306  -8.330  1.00   36.60 ? 153  PHE A CD2   1 
ATOM   1189 C  CE1   . PHE A 1 153 ? -9.709  13.269  -5.850  1.00   36.97 ? 153  PHE A CE1   1 
ATOM   1190 C  CE2   . PHE A 1 153 ? -9.940  15.158  -7.330  1.00   40.22 ? 153  PHE A CE2   1 
ATOM   1191 C  CZ    . PHE A 1 153 ? -9.585  14.638  -6.072  1.00   37.60 ? 153  PHE A CZ    1 
ATOM   1192 N  N     . SER A 1 154 ? -11.109 9.414   -11.119 1.00   37.35 ? 154  SER A N     1 
ATOM   1193 C  CA    . SER A 1 154 ? -11.870 8.594   -12.047 1.00   38.80 ? 154  SER A CA    1 
ATOM   1194 C  C     . SER A 1 154 ? -11.903 7.163   -11.618 1.00   38.15 ? 154  SER A C     1 
ATOM   1195 O  O     . SER A 1 154 ? -12.869 6.459   -11.885 1.00   38.90 ? 154  SER A O     1 
ATOM   1196 C  CB    . SER A 1 154 ? -11.300 8.641   -13.469 1.00   39.14 ? 154  SER A CB    1 
ATOM   1197 O  OG    . SER A 1 154 ? -11.315 9.962   -13.948 1.00   43.53 ? 154  SER A OG    1 
ATOM   1198 N  N     . VAL A 1 155 ? -10.839 6.689   -10.988 1.00   39.59 ? 155  VAL A N     1 
ATOM   1199 C  CA    . VAL A 1 155 ? -10.871 5.294   -10.554 1.00   37.97 ? 155  VAL A CA    1 
ATOM   1200 C  C     . VAL A 1 155 ? -11.976 5.220   -9.552  1.00   36.65 ? 155  VAL A C     1 
ATOM   1201 O  O     . VAL A 1 155 ? -12.868 4.398   -9.684  1.00   36.95 ? 155  VAL A O     1 
ATOM   1202 C  CB    . VAL A 1 155 ? -9.538  4.854   -9.945  1.00   38.31 ? 155  VAL A CB    1 
ATOM   1203 C  CG1   . VAL A 1 155 ? -9.687  3.532   -9.152  1.00   37.15 ? 155  VAL A CG1   1 
ATOM   1204 C  CG2   . VAL A 1 155 ? -8.524  4.702   -11.085 1.00   37.84 ? 155  VAL A CG2   1 
ATOM   1205 N  N     . ALA A 1 156 ? -11.946 6.137   -8.589  1.00   36.39 ? 156  ALA A N     1 
ATOM   1206 C  CA    . ALA A 1 156 ? -12.950 6.193   -7.518  1.00   34.99 ? 156  ALA A CA    1 
ATOM   1207 C  C     . ALA A 1 156 ? -14.379 6.378   -8.021  1.00   35.02 ? 156  ALA A C     1 
ATOM   1208 O  O     . ALA A 1 156 ? -15.290 5.656   -7.598  1.00   31.77 ? 156  ALA A O     1 
ATOM   1209 C  CB    . ALA A 1 156 ? -12.611 7.313   -6.544  1.00   33.59 ? 156  ALA A CB    1 
ATOM   1210 N  N     . ASP A 1 157 ? -14.562 7.340   -8.939  1.00   36.58 ? 157  ASP A N     1 
ATOM   1211 C  CA    . ASP A 1 157 ? -15.880 7.651   -9.471  1.00   36.39 ? 157  ASP A CA    1 
ATOM   1212 C  C     . ASP A 1 157 ? -16.421 6.501   -10.261 1.00   36.72 ? 157  ASP A C     1 
ATOM   1213 O  O     . ASP A 1 157 ? -17.597 6.154   -10.147 1.00   35.78 ? 157  ASP A O     1 
ATOM   1214 C  CB    . ASP A 1 157 ? -15.802 8.931   -10.334 1.00   41.29 ? 157  ASP A CB    1 
ATOM   1215 C  CG    . ASP A 1 157 ? -17.172 9.615   -10.526 1.00   45.47 ? 157  ASP A CG    1 
ATOM   1216 O  OD1   . ASP A 1 157 ? -17.885 9.320   -11.511 1.00   48.30 ? 157  ASP A OD1   1 
ATOM   1217 O  OD2   . ASP A 1 157 ? -17.545 10.442  -9.669  1.00   47.23 ? 157  ASP A OD2   1 
ATOM   1218 N  N     . ASN A 1 158 ? -15.585 5.892   -11.079 1.00   37.02 ? 158  ASN A N     1 
ATOM   1219 C  CA    . ASN A 1 158 ? -16.056 4.775   -11.860 1.00   37.36 ? 158  ASN A CA    1 
ATOM   1220 C  C     . ASN A 1 158 ? -16.336 3.573   -10.969 1.00   38.33 ? 158  ASN A C     1 
ATOM   1221 O  O     . ASN A 1 158 ? -17.265 2.818   -11.230 1.00   37.67 ? 158  ASN A O     1 
ATOM   1222 C  CB    . ASN A 1 158 ? -15.076 4.458   -12.989 1.00   40.44 ? 158  ASN A CB    1 
ATOM   1223 C  CG    . ASN A 1 158 ? -15.188 5.472   -14.150 1.00   48.14 ? 158  ASN A CG    1 
ATOM   1224 O  OD1   . ASN A 1 158 ? -14.392 6.420   -14.264 1.00   50.35 ? 158  ASN A OD1   1 
ATOM   1225 N  ND2   . ASN A 1 158 ? -16.214 5.294   -14.996 1.00   50.33 ? 158  ASN A ND2   1 
ATOM   1226 N  N     . ALA A 1 159 ? -15.539 3.378   -9.903  1.00   39.93 ? 159  ALA A N     1 
ATOM   1227 C  CA    . ALA A 1 159 ? -15.817 2.273   -9.004  1.00   40.54 ? 159  ALA A CA    1 
ATOM   1228 C  C     . ALA A 1 159 ? -17.172 2.572   -8.366  1.00   41.70 ? 159  ALA A C     1 
ATOM   1229 O  O     . ALA A 1 159 ? -17.965 1.661   -8.118  1.00   42.33 ? 159  ALA A O     1 
ATOM   1230 C  CB    . ALA A 1 159 ? -14.733 2.147   -7.937  1.00   40.67 ? 159  ALA A CB    1 
ATOM   1231 N  N     . TYR A 1 160 ? -17.445 3.856   -8.095  1.00   44.00 ? 160  TYR A N     1 
ATOM   1232 C  CA    . TYR A 1 160 ? -18.734 4.259   -7.518  1.00   45.27 ? 160  TYR A CA    1 
ATOM   1233 C  C     . TYR A 1 160 ? -19.860 4.043   -8.540  1.00   46.67 ? 160  TYR A C     1 
ATOM   1234 O  O     . TYR A 1 160 ? -20.897 3.471   -8.201  1.00   46.24 ? 160  TYR A O     1 
ATOM   1235 C  CB    . TYR A 1 160 ? -18.717 5.733   -7.080  1.00   45.39 ? 160  TYR A CB    1 
ATOM   1236 C  CG    . TYR A 1 160 ? -20.063 6.273   -6.597  1.00   45.00 ? 160  TYR A CG    1 
ATOM   1237 C  CD1   . TYR A 1 160 ? -20.428 6.205   -5.248  1.00   44.57 ? 160  TYR A CD1   1 
ATOM   1238 C  CD2   . TYR A 1 160 ? -20.996 6.815   -7.511  1.00   45.01 ? 160  TYR A CD2   1 
ATOM   1239 C  CE1   . TYR A 1 160 ? -21.692 6.656   -4.804  1.00   43.99 ? 160  TYR A CE1   1 
ATOM   1240 C  CE2   . TYR A 1 160 ? -22.267 7.271   -7.078  1.00   45.45 ? 160  TYR A CE2   1 
ATOM   1241 C  CZ    . TYR A 1 160 ? -22.603 7.183   -5.727  1.00   45.80 ? 160  TYR A CZ    1 
ATOM   1242 O  OH    . TYR A 1 160 ? -23.850 7.591   -5.308  1.00   46.57 ? 160  TYR A OH    1 
ATOM   1243 N  N     . GLN A 1 161 ? -19.667 4.496   -9.782  1.00   47.68 ? 161  GLN A N     1 
ATOM   1244 C  CA    . GLN A 1 161 ? -20.697 4.309   -10.808 1.00   49.23 ? 161  GLN A CA    1 
ATOM   1245 C  C     . GLN A 1 161 ? -21.028 2.816   -10.947 1.00   50.24 ? 161  GLN A C     1 
ATOM   1246 O  O     . GLN A 1 161 ? -22.201 2.451   -11.098 1.00   49.42 ? 161  GLN A O     1 
ATOM   1247 C  CB    . GLN A 1 161 ? -20.244 4.856   -12.177 1.00   50.70 ? 161  GLN A CB    1 
ATOM   1248 C  CG    . GLN A 1 161 ? -20.052 6.381   -12.277 1.00   53.33 ? 161  GLN A CG    1 
ATOM   1249 C  CD    . GLN A 1 161 ? -19.523 6.806   -13.655 1.00   56.43 ? 161  GLN A CD    1 
ATOM   1250 O  OE1   . GLN A 1 161 ? -20.194 6.613   -14.691 1.00   58.17 ? 161  GLN A OE1   1 
ATOM   1251 N  NE2   . GLN A 1 161 ? -18.312 7.371   -13.679 1.00   56.59 ? 161  GLN A NE2   1 
ATOM   1252 N  N     . ASN A 1 162 ? -20.008 1.951   -10.907 1.00   49.12 ? 162  ASN A N     1 
ATOM   1253 C  CA    . ASN A 1 162 ? -20.233 0.503   -11.039 1.00   49.27 ? 162  ASN A CA    1 
ATOM   1254 C  C     . ASN A 1 162 ? -21.113 -0.037  -9.928  1.00   49.40 ? 162  ASN A C     1 
ATOM   1255 O  O     . ASN A 1 162 ? -22.056 -0.780  -10.176 1.00   49.10 ? 162  ASN A O     1 
ATOM   1256 C  CB    . ASN A 1 162 ? -18.931 -0.303  -10.975 1.00   48.97 ? 162  ASN A CB    1 
ATOM   1257 C  CG    . ASN A 1 162 ? -18.116 -0.221  -12.239 1.00   50.43 ? 162  ASN A CG    1 
ATOM   1258 O  OD1   . ASN A 1 162 ? -17.040 -0.809  -12.306 1.00   51.52 ? 162  ASN A OD1   1 
ATOM   1259 N  ND2   . ASN A 1 162 ? -18.602 0.506   -13.242 1.00   49.23 ? 162  ASN A ND2   1 
ATOM   1260 N  N     . MET A 1 163 ? -20.781 0.325   -8.696  1.00   49.41 ? 163  MET A N     1 
ATOM   1261 C  CA    . MET A 1 163 ? -21.525 -0.174  -7.549  1.00   49.75 ? 163  MET A CA    1 
ATOM   1262 C  C     . MET A 1 163 ? -23.022 0.046   -7.682  1.00   50.07 ? 163  MET A C     1 
ATOM   1263 O  O     . MET A 1 163 ? -23.819 -0.832  -7.361  1.00   51.38 ? 163  MET A O     1 
ATOM   1264 C  CB    . MET A 1 163 ? -21.026 0.483   -6.265  1.00   48.36 ? 163  MET A CB    1 
ATOM   1265 C  CG    . MET A 1 163 ? -21.791 0.048   -5.031  1.00   47.05 ? 163  MET A CG    1 
ATOM   1266 S  SD    . MET A 1 163 ? -21.383 1.096   -3.657  1.00   46.78 ? 163  MET A SD    1 
ATOM   1267 C  CE    . MET A 1 163 ? -21.737 2.720   -4.411  1.00   47.73 ? 163  MET A CE    1 
ATOM   1268 N  N     . VAL A 1 164 ? -23.395 1.230   -8.147  1.00   51.83 ? 164  VAL A N     1 
ATOM   1269 C  CA    . VAL A 1 164 ? -24.797 1.578   -8.317  1.00   54.38 ? 164  VAL A CA    1 
ATOM   1270 C  C     . VAL A 1 164 ? -25.399 0.945   -9.584  1.00   56.46 ? 164  VAL A C     1 
ATOM   1271 O  O     . VAL A 1 164 ? -26.593 0.658   -9.625  1.00   55.90 ? 164  VAL A O     1 
ATOM   1272 C  CB    . VAL A 1 164 ? -24.991 3.120   -8.364  1.00   54.20 ? 164  VAL A CB    1 
ATOM   1273 C  CG1   . VAL A 1 164 ? -26.470 3.465   -8.344  1.00   54.62 ? 164  VAL A CG1   1 
ATOM   1274 C  CG2   . VAL A 1 164 ? -24.303 3.771   -7.183  1.00   54.15 ? 164  VAL A CG2   1 
ATOM   1275 N  N     . THR A 1 165 ? -24.576 0.722   -10.594 1.00   58.79 ? 165  THR A N     1 
ATOM   1276 C  CA    . THR A 1 165 ? -25.031 0.131   -11.841 1.00   59.25 ? 165  THR A CA    1 
ATOM   1277 C  C     . THR A 1 165 ? -24.992 -1.391  -11.802 1.00   60.01 ? 165  THR A C     1 
ATOM   1278 O  O     . THR A 1 165 ? -25.983 -2.049  -12.119 1.00   59.87 ? 165  THR A O     1 
ATOM   1279 C  CB    . THR A 1 165 ? -24.170 0.629   -13.024 1.00   60.98 ? 165  THR A CB    1 
ATOM   1280 O  OG1   . THR A 1 165 ? -24.389 2.036   -13.217 1.00   63.99 ? 165  THR A OG1   1 
ATOM   1281 C  CG2   . THR A 1 165 ? -24.519 -0.124  -14.292 1.00   63.94 ? 165  THR A CG2   1 
ATOM   1282 N  N     . ASP A 1 166 ? -23.848 -1.957  -11.425 1.00   60.10 ? 166  ASP A N     1 
ATOM   1283 C  CA    . ASP A 1 166 ? -23.707 -3.407  -11.356 1.00   60.36 ? 166  ASP A CA    1 
ATOM   1284 C  C     . ASP A 1 166 ? -24.312 -3.951  -10.062 1.00   62.22 ? 166  ASP A C     1 
ATOM   1285 O  O     . ASP A 1 166 ? -24.496 -5.159  -9.929  1.00   61.99 ? 166  ASP A O     1 
ATOM   1286 C  CB    . ASP A 1 166 ? -22.238 -3.829  -11.435 1.00   60.40 ? 166  ASP A CB    1 
ATOM   1287 C  CG    . ASP A 1 166 ? -21.516 -3.266  -12.661 1.00   61.33 ? 166  ASP A CG    1 
ATOM   1288 O  OD1   . ASP A 1 166 ? -22.135 -3.196  -13.746 1.00   62.45 ? 166  ASP A OD1   1 
ATOM   1289 O  OD2   . ASP A 1 166 ? -20.319 -2.909  -12.549 1.00   60.62 ? 166  ASP A OD2   1 
ATOM   1290 N  N     . ARG A 1 167 ? -24.617 -3.076  -9.112  1.00   63.75 ? 167  ARG A N     1 
ATOM   1291 C  CA    . ARG A 1 167 ? -25.198 -3.529  -7.853  1.00   63.94 ? 167  ARG A CA    1 
ATOM   1292 C  C     . ARG A 1 167 ? -24.217 -4.483  -7.157  1.00   61.95 ? 167  ARG A C     1 
ATOM   1293 O  O     . ARG A 1 167 ? -24.599 -5.590  -6.787  1.00   59.66 ? 167  ARG A O     1 
ATOM   1294 C  CB    . ARG A 1 167 ? -26.505 -4.289  -8.130  1.00   67.82 ? 167  ARG A CB    1 
ATOM   1295 C  CG    . ARG A 1 167 ? -27.691 -3.945  -7.220  1.00   76.22 ? 167  ARG A CG    1 
ATOM   1296 C  CD    . ARG A 1 167 ? -28.547 -2.775  -7.777  1.00   81.29 ? 167  ARG A CD    1 
ATOM   1297 N  NE    . ARG A 1 167 ? -29.982 -3.085  -7.759  1.00   83.22 ? 167  ARG A NE    1 
ATOM   1298 C  CZ    . ARG A 1 167 ? -30.566 -3.960  -8.581  1.00   84.13 ? 167  ARG A CZ    1 
ATOM   1299 N  NH1   . ARG A 1 167 ? -29.833 -4.597  -9.486  1.00   84.36 ? 167  ARG A NH1   1 
ATOM   1300 N  NH2   . ARG A 1 167 ? -31.871 -4.211  -8.498  1.00   83.92 ? 167  ARG A NH2   1 
ATOM   1301 N  N     . GLU A 1 168 ? -22.960 -4.080  -6.992  1.00   57.86 ? 168  GLU A N     1 
ATOM   1302 C  CA    . GLU A 1 168 ? -21.989 -4.959  -6.346  1.00   54.05 ? 168  GLU A CA    1 
ATOM   1303 C  C     . GLU A 1 168 ? -20.870 -4.190  -5.641  1.00   50.62 ? 168  GLU A C     1 
ATOM   1304 O  O     . GLU A 1 168 ? -20.560 -3.060  -6.012  1.00   49.33 ? 168  GLU A O     1 
ATOM   1305 C  CB    . GLU A 1 168 ? -21.402 -5.952  -7.375  1.00   55.40 ? 168  GLU A CB    1 
ATOM   1306 C  CG    . GLU A 1 168 ? -20.279 -5.414  -8.271  1.00   61.27 ? 168  GLU A CG    1 
ATOM   1307 C  CD    . GLU A 1 168 ? -19.811 -6.421  -9.345  1.00   64.63 ? 168  GLU A CD    1 
ATOM   1308 O  OE1   . GLU A 1 168 ? -19.566 -7.601  -9.009  1.00   65.69 ? 168  GLU A OE1   1 
ATOM   1309 O  OE2   . GLU A 1 168 ? -19.674 -6.021  -10.530 1.00   64.42 ? 168  GLU A OE2   1 
ATOM   1310 N  N     . ASN A 1 169 ? -20.270 -4.804  -4.632  1.00   45.80 ? 169  ASN A N     1 
ATOM   1311 C  CA    . ASN A 1 169 ? -19.189 -4.165  -3.890  1.00   41.44 ? 169  ASN A CA    1 
ATOM   1312 C  C     . ASN A 1 169 ? -17.969 -3.935  -4.760  1.00   39.57 ? 169  ASN A C     1 
ATOM   1313 O  O     . ASN A 1 169 ? -17.687 -4.706  -5.683  1.00   37.13 ? 169  ASN A O     1 
ATOM   1314 C  CB    . ASN A 1 169 ? -18.780 -5.008  -2.684  1.00   42.32 ? 169  ASN A CB    1 
ATOM   1315 C  CG    . ASN A 1 169 ? -19.923 -5.236  -1.710  1.00   44.62 ? 169  ASN A CG    1 
ATOM   1316 O  OD1   . ASN A 1 169 ? -20.767 -4.348  -1.480  1.00   45.49 ? 169  ASN A OD1   1 
ATOM   1317 N  ND2   . ASN A 1 169 ? -19.943 -6.424  -1.107  1.00   45.52 ? 169  ASN A ND2   1 
ATOM   1318 N  N     . GLN A 1 170 ? -17.244 -2.870  -4.462  1.00   35.30 ? 170  GLN A N     1 
ATOM   1319 C  CA    . GLN A 1 170 ? -16.052 -2.546  -5.216  1.00   32.23 ? 170  GLN A CA    1 
ATOM   1320 C  C     . GLN A 1 170 ? -14.828 -2.393  -4.281  1.00   32.48 ? 170  GLN A C     1 
ATOM   1321 O  O     . GLN A 1 170 ? -14.973 -2.007  -3.127  1.00   30.42 ? 170  GLN A O     1 
ATOM   1322 C  CB    . GLN A 1 170 ? -16.260 -1.236  -5.955  1.00   32.49 ? 170  GLN A CB    1 
ATOM   1323 C  CG    . GLN A 1 170 ? -17.584 -1.106  -6.725  1.00   31.83 ? 170  GLN A CG    1 
ATOM   1324 C  CD    . GLN A 1 170 ? -17.627 -1.939  -7.970  1.00   32.83 ? 170  GLN A CD    1 
ATOM   1325 O  OE1   . GLN A 1 170 ? -18.583 -2.679  -8.195  1.00   36.70 ? 170  GLN A OE1   1 
ATOM   1326 N  NE2   . GLN A 1 170 ? -16.603 -1.832  -8.798  1.00   33.08 ? 170  GLN A NE2   1 
ATOM   1327 N  N     . SER A 1 171 ? -13.647 -2.703  -4.785  1.00   33.51 ? 171  SER A N     1 
ATOM   1328 C  CA    . SER A 1 171 ? -12.421 -2.529  -4.008  1.00   35.34 ? 171  SER A CA    1 
ATOM   1329 C  C     . SER A 1 171 ? -11.335 -1.829  -4.826  1.00   36.27 ? 171  SER A C     1 
ATOM   1330 O  O     . SER A 1 171 ? -11.173 -2.101  -6.013  1.00   35.74 ? 171  SER A O     1 
ATOM   1331 C  CB    . SER A 1 171 ? -11.877 -3.882  -3.504  1.00   35.70 ? 171  SER A CB    1 
ATOM   1332 O  OG    . SER A 1 171 ? -11.638 -4.807  -4.569  1.00   37.90 ? 171  SER A OG    1 
ATOM   1333 N  N     . CYS A 1 172 ? -10.616 -0.916  -4.179  1.00   39.20 ? 172  CYS A N     1 
ATOM   1334 C  CA    . CYS A 1 172 ? -9.494  -0.214  -4.795  1.00   39.88 ? 172  CYS A CA    1 
ATOM   1335 C  C     . CYS A 1 172 ? -8.279  -0.659  -4.012  1.00   39.13 ? 172  CYS A C     1 
ATOM   1336 O  O     . CYS A 1 172 ? -8.130  -0.315  -2.835  1.00   38.55 ? 172  CYS A O     1 
ATOM   1337 C  CB    . CYS A 1 172 ? -9.608  1.308   -4.671  1.00   41.65 ? 172  CYS A CB    1 
ATOM   1338 S  SG    . CYS A 1 172 ? -11.001 2.018   -5.583  1.00   52.77 ? 172  CYS A SG    1 
ATOM   1339 N  N     . LEU A 1 173 ? -7.427  -1.431  -4.668  1.00   37.67 ? 173  LEU A N     1 
ATOM   1340 C  CA    . LEU A 1 173 ? -6.192  -1.933  -4.084  1.00   36.94 ? 173  LEU A CA    1 
ATOM   1341 C  C     . LEU A 1 173 ? -5.111  -0.982  -4.635  1.00   37.21 ? 173  LEU A C     1 
ATOM   1342 O  O     . LEU A 1 173 ? -4.853  -0.958  -5.841  1.00   36.45 ? 173  LEU A O     1 
ATOM   1343 C  CB    . LEU A 1 173 ? -5.901  -3.353  -4.575  1.00   39.07 ? 173  LEU A CB    1 
ATOM   1344 C  CG    . LEU A 1 173 ? -6.790  -4.639  -4.531  1.00   42.10 ? 173  LEU A CG    1 
ATOM   1345 C  CD1   . LEU A 1 173 ? -6.487  -5.402  -3.279  1.00   42.63 ? 173  LEU A CD1   1 
ATOM   1346 C  CD2   . LEU A 1 173 ? -8.283  -4.337  -4.677  1.00   41.43 ? 173  LEU A CD2   1 
ATOM   1347 N  N     . ILE A 1 174 ? -4.502  -0.201  -3.756  1.00   35.25 ? 174  ILE A N     1 
ATOM   1348 C  CA    . ILE A 1 174 ? -3.481  0.765   -4.119  1.00   33.17 ? 174  ILE A CA    1 
ATOM   1349 C  C     . ILE A 1 174 ? -2.142  0.196   -3.600  1.00   34.30 ? 174  ILE A C     1 
ATOM   1350 O  O     . ILE A 1 174 ? -1.883  0.222   -2.411  1.00   32.67 ? 174  ILE A O     1 
ATOM   1351 C  CB    . ILE A 1 174 ? -3.835  2.091   -3.451  1.00   32.86 ? 174  ILE A CB    1 
ATOM   1352 C  CG1   . ILE A 1 174 ? -5.273  2.459   -3.850  1.00   33.89 ? 174  ILE A CG1   1 
ATOM   1353 C  CG2   . ILE A 1 174 ? -2.831  3.150   -3.792  1.00   32.71 ? 174  ILE A CG2   1 
ATOM   1354 C  CD1   . ILE A 1 174 ? -5.738  3.856   -3.429  1.00   33.44 ? 174  ILE A CD1   1 
ATOM   1355 N  N     . THR A 1 175 ? -1.317  -0.311  -4.517  1.00   35.66 ? 175  THR A N     1 
ATOM   1356 C  CA    . THR A 1 175 ? -0.045  -0.949  -4.212  1.00   36.13 ? 175  THR A CA    1 
ATOM   1357 C  C     . THR A 1 175 ? 1.240   -0.210  -4.602  1.00   36.26 ? 175  THR A C     1 
ATOM   1358 O  O     . THR A 1 175 ? 1.222   0.719   -5.413  1.00   34.13 ? 175  THR A O     1 
ATOM   1359 C  CB    . THR A 1 175 ? 0.016   -2.320  -4.895  1.00   40.87 ? 175  THR A CB    1 
ATOM   1360 O  OG1   . THR A 1 175 ? 0.063   -2.144  -6.326  1.00   45.58 ? 175  THR A OG1   1 
ATOM   1361 C  CG2   . THR A 1 175 ? -1.203  -3.153  -4.517  1.00   44.78 ? 175  THR A CG2   1 
ATOM   1362 N  N     . GLY A 1 176 ? 2.366   -0.647  -4.026  1.00   34.77 ? 176  GLY A N     1 
ATOM   1363 C  CA    . GLY A 1 176 ? 3.648   -0.042  -4.319  1.00   30.51 ? 176  GLY A CA    1 
ATOM   1364 C  C     . GLY A 1 176 ? 4.648   -0.167  -3.202  1.00   31.43 ? 176  GLY A C     1 
ATOM   1365 O  O     . GLY A 1 176 ? 4.348   -0.687  -2.113  1.00   32.00 ? 176  GLY A O     1 
ATOM   1366 N  N     . GLU A 1 177 ? 5.855   0.330   -3.452  1.00   32.06 ? 177  GLU A N     1 
ATOM   1367 C  CA    . GLU A 1 177 ? 6.948   0.287   -2.499  1.00   33.09 ? 177  GLU A CA    1 
ATOM   1368 C  C     . GLU A 1 177 ? 6.713   1.332   -1.437  1.00   34.36 ? 177  GLU A C     1 
ATOM   1369 O  O     . GLU A 1 177 ? 5.832   2.183   -1.583  1.00   36.43 ? 177  GLU A O     1 
ATOM   1370 C  CB    . GLU A 1 177 ? 8.274   0.579   -3.215  1.00   34.24 ? 177  GLU A CB    1 
ATOM   1371 C  CG    . GLU A 1 177 ? 8.729   -0.552  -4.165  1.00   36.79 ? 177  GLU A CG    1 
ATOM   1372 C  CD    . GLU A 1 177 ? 10.113  -0.344  -4.778  1.00   39.27 ? 177  GLU A CD    1 
ATOM   1373 O  OE1   . GLU A 1 177 ? 11.023  0.266   -4.162  1.00   40.83 ? 177  GLU A OE1   1 
ATOM   1374 O  OE2   . GLU A 1 177 ? 10.308  -0.821  -5.909  1.00   43.65 ? 177  GLU A OE2   1 
ATOM   1375 N  N     . SER A 1 178 ? 7.492   1.286   -0.366  1.00   32.94 ? 178  SER A N     1 
ATOM   1376 C  CA    . SER A 1 178 ? 7.347   2.259   0.684   1.00   32.62 ? 178  SER A CA    1 
ATOM   1377 C  C     . SER A 1 178 ? 7.714   3.628   0.132   1.00   32.11 ? 178  SER A C     1 
ATOM   1378 O  O     . SER A 1 178 ? 8.757   3.785   -0.505  1.00   31.71 ? 178  SER A O     1 
ATOM   1379 C  CB    . SER A 1 178 ? 8.263   1.914   1.853   1.00   33.35 ? 178  SER A CB    1 
ATOM   1380 O  OG    . SER A 1 178 ? 8.481   3.067   2.665   1.00   32.66 ? 178  SER A OG    1 
ATOM   1381 N  N     . GLY A 1 179 ? 6.875   4.622   0.395   1.00   29.80 ? 179  GLY A N     1 
ATOM   1382 C  CA    . GLY A 1 179 ? 7.156   5.946   -0.118  1.00   30.84 ? 179  GLY A CA    1 
ATOM   1383 C  C     . GLY A 1 179 ? 6.631   6.178   -1.542  1.00   29.56 ? 179  GLY A C     1 
ATOM   1384 O  O     . GLY A 1 179 ? 6.719   7.295   -2.042  1.00   32.88 ? 179  GLY A O     1 
ATOM   1385 N  N     . ALA A 1 180 ? 6.098   5.159   -2.182  1.00   29.37 ? 180  ALA A N     1 
ATOM   1386 C  CA    . ALA A 1 180 ? 5.574   5.281   -3.532  1.00   29.09 ? 180  ALA A CA    1 
ATOM   1387 C  C     . ALA A 1 180 ? 4.305   6.149   -3.603  1.00   30.44 ? 180  ALA A C     1 
ATOM   1388 O  O     . ALA A 1 180 ? 3.963   6.664   -4.682  1.00   28.54 ? 180  ALA A O     1 
ATOM   1389 C  CB    . ALA A 1 180 ? 5.304   3.916   -4.109  1.00   28.20 ? 180  ALA A CB    1 
ATOM   1390 N  N     . GLY A 1 181 ? 3.627   6.311   -2.463  1.00   30.13 ? 181  GLY A N     1 
ATOM   1391 C  CA    . GLY A 1 181 ? 2.410   7.116   -2.433  1.00   31.40 ? 181  GLY A CA    1 
ATOM   1392 C  C     . GLY A 1 181 ? 1.077   6.405   -2.167  1.00   31.62 ? 181  GLY A C     1 
ATOM   1393 O  O     . GLY A 1 181 ? 0.023   6.975   -2.443  1.00   31.74 ? 181  GLY A O     1 
ATOM   1394 N  N     . LYS A 1 182 ? 1.106   5.182   -1.634  1.00   30.60 ? 182  LYS A N     1 
ATOM   1395 C  CA    . LYS A 1 182 ? -0.127  4.441   -1.362  1.00   30.98 ? 182  LYS A CA    1 
ATOM   1396 C  C     . LYS A 1 182 ? -1.081  5.163   -0.413  1.00   31.19 ? 182  LYS A C     1 
ATOM   1397 O  O     . LYS A 1 182 ? -2.271  5.335   -0.715  1.00   30.25 ? 182  LYS A O     1 
ATOM   1398 C  CB    . LYS A 1 182 ? 0.189   3.064   -0.769  1.00   30.98 ? 182  LYS A CB    1 
ATOM   1399 C  CG    . LYS A 1 182 ? 0.988   2.131   -1.674  1.00   31.93 ? 182  LYS A CG    1 
ATOM   1400 C  CD    . LYS A 1 182 ? 1.175   0.755   -1.033  1.00   33.65 ? 182  LYS A CD    1 
ATOM   1401 C  CE    . LYS A 1 182 ? 1.918   0.827   0.312   1.00   35.21 ? 182  LYS A CE    1 
ATOM   1402 N  NZ    . LYS A 1 182 ? 3.277   1.435   0.183   1.00   33.15 ? 182  LYS A NZ    1 
ATOM   1403 N  N     . THR A 1 183 ? -0.564  5.582   0.738   1.00   30.82 ? 183  THR A N     1 
ATOM   1404 C  CA    . THR A 1 183 ? -1.357  6.254   1.748   1.00   31.16 ? 183  THR A CA    1 
ATOM   1405 C  C     . THR A 1 183 ? -1.953  7.607   1.294   1.00   32.52 ? 183  THR A C     1 
ATOM   1406 O  O     . THR A 1 183 ? -3.132  7.868   1.541   1.00   32.79 ? 183  THR A O     1 
ATOM   1407 C  CB    . THR A 1 183 ? -0.513  6.368   3.059   1.00   32.38 ? 183  THR A CB    1 
ATOM   1408 O  OG1   . THR A 1 183 ? -0.353  5.052   3.616   1.00   31.75 ? 183  THR A OG1   1 
ATOM   1409 C  CG2   . THR A 1 183 ? -1.158  7.295   4.060   1.00   27.72 ? 183  THR A CG2   1 
ATOM   1410 N  N     . GLU A 1 184 ? -1.156  8.460   0.653   1.00   33.99 ? 184  GLU A N     1 
ATOM   1411 C  CA    . GLU A 1 184 ? -1.662  9.723   0.118   1.00   32.71 ? 184  GLU A CA    1 
ATOM   1412 C  C     . GLU A 1 184 ? -2.848  9.426   -0.806  1.00   32.56 ? 184  GLU A C     1 
ATOM   1413 O  O     . GLU A 1 184 ? -3.922  10.008  -0.668  1.00   32.78 ? 184  GLU A O     1 
ATOM   1414 C  CB    . GLU A 1 184 ? -0.596  10.401  -0.707  1.00   34.35 ? 184  GLU A CB    1 
ATOM   1415 C  CG    . GLU A 1 184 ? 0.549   11.057  0.062   1.00   40.33 ? 184  GLU A CG    1 
ATOM   1416 C  CD    . GLU A 1 184 ? 0.066   12.101  1.047   1.00   41.49 ? 184  GLU A CD    1 
ATOM   1417 O  OE1   . GLU A 1 184 ? -0.969  12.740  0.772   1.00   44.06 ? 184  GLU A OE1   1 
ATOM   1418 O  OE2   . GLU A 1 184 ? 0.723   12.286  2.075   1.00   41.13 ? 184  GLU A OE2   1 
ATOM   1419 N  N     . ASN A 1 185 ? -2.653  8.510   -1.748  1.00   32.19 ? 185  ASN A N     1 
ATOM   1420 C  CA    . ASN A 1 185 ? -3.689  8.171   -2.707  1.00   31.56 ? 185  ASN A CA    1 
ATOM   1421 C  C     . ASN A 1 185 ? -4.950  7.547   -2.088  1.00   31.56 ? 185  ASN A C     1 
ATOM   1422 O  O     . ASN A 1 185 ? -6.063  7.816   -2.538  1.00   29.75 ? 185  ASN A O     1 
ATOM   1423 C  CB    . ASN A 1 185 ? -3.082  7.299   -3.820  1.00   32.20 ? 185  ASN A CB    1 
ATOM   1424 C  CG    . ASN A 1 185 ? -2.320  8.135   -4.859  1.00   33.50 ? 185  ASN A CG    1 
ATOM   1425 O  OD1   . ASN A 1 185 ? -2.938  8.700   -5.754  1.00   34.80 ? 185  ASN A OD1   1 
ATOM   1426 N  ND2   . ASN A 1 185 ? -0.995  8.242   -4.727  1.00   31.95 ? 185  ASN A ND2   1 
ATOM   1427 N  N     . THR A 1 186 ? -4.770  6.706   -1.050  1.00   31.25 ? 186  THR A N     1 
ATOM   1428 C  CA    . THR A 1 186 ? -5.890  6.082   -0.340  1.00   30.80 ? 186  THR A CA    1 
ATOM   1429 C  C     . THR A 1 186 ? -6.718  7.203   0.286   1.00   30.50 ? 186  THR A C     1 
ATOM   1430 O  O     . THR A 1 186 ? -7.951  7.129   0.290   1.00   31.05 ? 186  THR A O     1 
ATOM   1431 C  CB    . THR A 1 186 ? -5.379  5.126   0.829   1.00   30.33 ? 186  THR A CB    1 
ATOM   1432 O  OG1   . THR A 1 186 ? -4.931  3.894   0.261   1.00   30.14 ? 186  THR A OG1   1 
ATOM   1433 C  CG2   . THR A 1 186 ? -6.499  4.830   1.866   1.00   28.35 ? 186  THR A CG2   1 
ATOM   1434 N  N     . LYS A 1 187 ? -6.054  8.223   0.825   1.00   30.26 ? 187  LYS A N     1 
ATOM   1435 C  CA    . LYS A 1 187 ? -6.800  9.331   1.444   1.00   31.75 ? 187  LYS A CA    1 
ATOM   1436 C  C     . LYS A 1 187 ? -7.551  10.153  0.365   1.00   32.08 ? 187  LYS A C     1 
ATOM   1437 O  O     . LYS A 1 187 ? -8.689  10.555  0.598   1.00   31.13 ? 187  LYS A O     1 
ATOM   1438 C  CB    . LYS A 1 187 ? -5.882  10.225  2.283   1.00   30.83 ? 187  LYS A CB    1 
ATOM   1439 C  CG    . LYS A 1 187 ? -5.396  9.568   3.597   1.00   32.87 ? 187  LYS A CG    1 
ATOM   1440 C  CD    . LYS A 1 187 ? -4.814  10.551  4.622   1.00   33.04 ? 187  LYS A CD    1 
ATOM   1441 C  CE    . LYS A 1 187 ? -3.342  10.884  4.386   1.00   36.08 ? 187  LYS A CE    1 
ATOM   1442 N  NZ    . LYS A 1 187 ? -2.779  11.773  5.485   1.00   36.29 ? 187  LYS A NZ    1 
ATOM   1443 N  N     . LYS A 1 188 ? -6.931  10.389  -0.804  1.00   31.29 ? 188  LYS A N     1 
ATOM   1444 C  CA    . LYS A 1 188 ? -7.640  11.140  -1.862  1.00   32.61 ? 188  LYS A CA    1 
ATOM   1445 C  C     . LYS A 1 188 ? -8.884  10.400  -2.306  1.00   34.25 ? 188  LYS A C     1 
ATOM   1446 O  O     . LYS A 1 188 ? -9.916  11.013  -2.583  1.00   35.93 ? 188  LYS A O     1 
ATOM   1447 C  CB    . LYS A 1 188 ? -6.766  11.388  -3.111  1.00   31.21 ? 188  LYS A CB    1 
ATOM   1448 C  CG    . LYS A 1 188 ? -5.645  12.384  -2.895  1.00   28.24 ? 188  LYS A CG    1 
ATOM   1449 C  CD    . LYS A 1 188 ? -6.014  13.397  -1.863  1.00   27.80 ? 188  LYS A CD    1 
ATOM   1450 C  CE    . LYS A 1 188 ? -4.952  14.512  -1.795  1.00   31.64 ? 188  LYS A CE    1 
ATOM   1451 N  NZ    . LYS A 1 188 ? -4.887  15.142  -0.430  1.00   29.28 ? 188  LYS A NZ    1 
ATOM   1452 N  N     . VAL A 1 189 ? -8.808  9.064   -2.367  1.00   34.27 ? 189  VAL A N     1 
ATOM   1453 C  CA    . VAL A 1 189 ? -9.963  8.271   -2.777  1.00   34.93 ? 189  VAL A CA    1 
ATOM   1454 C  C     . VAL A 1 189 ? -11.131 8.416   -1.801  1.00   35.80 ? 189  VAL A C     1 
ATOM   1455 O  O     . VAL A 1 189 ? -12.263 8.661   -2.215  1.00   35.20 ? 189  VAL A O     1 
ATOM   1456 C  CB    . VAL A 1 189 ? -9.600  6.770   -2.930  1.00   34.69 ? 189  VAL A CB    1 
ATOM   1457 C  CG1   . VAL A 1 189 ? -10.866 5.905   -2.858  1.00   36.70 ? 189  VAL A CG1   1 
ATOM   1458 C  CG2   . VAL A 1 189 ? -8.934  6.542   -4.252  1.00   34.36 ? 189  VAL A CG2   1 
ATOM   1459 N  N     . ILE A 1 190 ? -10.848 8.263   -0.519  1.00   36.36 ? 190  ILE A N     1 
ATOM   1460 C  CA    . ILE A 1 190 ? -11.859 8.368   0.525   1.00   37.08 ? 190  ILE A CA    1 
ATOM   1461 C  C     . ILE A 1 190 ? -12.436 9.770   0.528   1.00   38.76 ? 190  ILE A C     1 
ATOM   1462 O  O     . ILE A 1 190 ? -13.643 9.958   0.612   1.00   36.68 ? 190  ILE A O     1 
ATOM   1463 C  CB    . ILE A 1 190 ? -11.241 8.118   1.953   1.00   38.97 ? 190  ILE A CB    1 
ATOM   1464 C  CG1   . ILE A 1 190 ? -10.514 6.773   1.981   1.00   39.75 ? 190  ILE A CG1   1 
ATOM   1465 C  CG2   . ILE A 1 190 ? -12.320 8.263   3.042   1.00   37.83 ? 190  ILE A CG2   1 
ATOM   1466 C  CD1   . ILE A 1 190 ? -11.330 5.630   1.500   1.00   40.95 ? 190  ILE A CD1   1 
ATOM   1467 N  N     . MET A 1 191 ? -11.544 10.758  0.450   1.00   40.45 ? 191  MET A N     1 
ATOM   1468 C  CA    . MET A 1 191 ? -11.938 12.151  0.454   1.00   41.85 ? 191  MET A CA    1 
ATOM   1469 C  C     . MET A 1 191 ? -12.901 12.484  -0.692  1.00   41.91 ? 191  MET A C     1 
ATOM   1470 O  O     . MET A 1 191 ? -13.851 13.257  -0.529  1.00   40.49 ? 191  MET A O     1 
ATOM   1471 C  CB    . MET A 1 191 ? -10.702 13.019  0.354   1.00   45.33 ? 191  MET A CB    1 
ATOM   1472 C  CG    . MET A 1 191 ? -10.927 14.406  0.847   1.00   53.07 ? 191  MET A CG    1 
ATOM   1473 S  SD    . MET A 1 191 ? -10.501 15.583  -0.415  1.00   61.00 ? 191  MET A SD    1 
ATOM   1474 C  CE    . MET A 1 191 ? -8.867  16.146  0.209   1.00   59.64 ? 191  MET A CE    1 
ATOM   1475 N  N     . TYR A 1 192 ? -12.639 11.882  -1.851  1.00   40.82 ? 192  TYR A N     1 
ATOM   1476 C  CA    . TYR A 1 192 ? -13.446 12.078  -3.024  1.00   39.84 ? 192  TYR A CA    1 
ATOM   1477 C  C     . TYR A 1 192 ? -14.852 11.533  -2.782  1.00   41.41 ? 192  TYR A C     1 
ATOM   1478 O  O     . TYR A 1 192 ? -15.838 12.236  -3.001  1.00   42.03 ? 192  TYR A O     1 
ATOM   1479 C  CB    . TYR A 1 192 ? -12.777 11.361  -4.198  1.00   39.24 ? 192  TYR A CB    1 
ATOM   1480 C  CG    . TYR A 1 192 ? -13.596 11.411  -5.452  1.00   38.50 ? 192  TYR A CG    1 
ATOM   1481 C  CD1   . TYR A 1 192 ? -14.448 10.385  -5.795  1.00   38.50 ? 192  TYR A CD1   1 
ATOM   1482 C  CD2   . TYR A 1 192 ? -13.546 12.522  -6.270  1.00   39.97 ? 192  TYR A CD2   1 
ATOM   1483 C  CE1   . TYR A 1 192 ? -15.239 10.476  -6.930  1.00   39.50 ? 192  TYR A CE1   1 
ATOM   1484 C  CE2   . TYR A 1 192 ? -14.321 12.619  -7.399  1.00   39.53 ? 192  TYR A CE2   1 
ATOM   1485 C  CZ    . TYR A 1 192 ? -15.158 11.606  -7.726  1.00   39.75 ? 192  TYR A CZ    1 
ATOM   1486 O  OH    . TYR A 1 192 ? -15.898 11.747  -8.878  1.00   41.87 ? 192  TYR A OH    1 
ATOM   1487 N  N     . LEU A 1 193 ? -14.954 10.274  -2.327  1.00   41.44 ? 193  LEU A N     1 
ATOM   1488 C  CA    . LEU A 1 193 ? -16.252 9.682   -2.049  1.00   41.91 ? 193  LEU A CA    1 
ATOM   1489 C  C     . LEU A 1 193 ? -17.004 10.450  -0.959  1.00   42.13 ? 193  LEU A C     1 
ATOM   1490 O  O     . LEU A 1 193 ? -18.228 10.624  -1.045  1.00   41.82 ? 193  LEU A O     1 
ATOM   1491 C  CB    . LEU A 1 193 ? -16.092 8.221   -1.633  1.00   42.87 ? 193  LEU A CB    1 
ATOM   1492 C  CG    . LEU A 1 193 ? -15.508 7.315   -2.727  1.00   44.08 ? 193  LEU A CG    1 
ATOM   1493 C  CD1   . LEU A 1 193 ? -15.208 5.933   -2.144  1.00   44.56 ? 193  LEU A CD1   1 
ATOM   1494 C  CD2   . LEU A 1 193 ? -16.477 7.212   -3.895  1.00   42.52 ? 193  LEU A CD2   1 
ATOM   1495 N  N     . ALA A 1 194 ? -16.283 10.912  0.064   1.00   41.95 ? 194  ALA A N     1 
ATOM   1496 C  CA    . ALA A 1 194 ? -16.908 11.672  1.137   1.00   42.42 ? 194  ALA A CA    1 
ATOM   1497 C  C     . ALA A 1 194 ? -17.464 12.989  0.600   1.00   43.56 ? 194  ALA A C     1 
ATOM   1498 O  O     . ALA A 1 194 ? -18.424 13.525  1.149   1.00   44.89 ? 194  ALA A O     1 
ATOM   1499 C  CB    . ALA A 1 194 ? -15.916 11.959  2.211   1.00   42.09 ? 194  ALA A CB    1 
ATOM   1500 N  N     . LYS A 1 195 ? -16.870 13.508  -0.479  1.00   43.95 ? 195  LYS A N     1 
ATOM   1501 C  CA    . LYS A 1 195 ? -17.331 14.767  -1.043  1.00   44.32 ? 195  LYS A CA    1 
ATOM   1502 C  C     . LYS A 1 195 ? -18.437 14.645  -2.077  1.00   44.87 ? 195  LYS A C     1 
ATOM   1503 O  O     . LYS A 1 195 ? -19.368 15.453  -2.100  1.00   46.45 ? 195  LYS A O     1 
ATOM   1504 C  CB    . LYS A 1 195 ? -16.156 15.530  -1.632  1.00   43.44 ? 195  LYS A CB    1 
ATOM   1505 C  CG    . LYS A 1 195 ? -15.481 16.391  -0.606  1.00   41.35 ? 195  LYS A CG    1 
ATOM   1506 C  CD    . LYS A 1 195 ? -14.246 17.074  -1.131  1.00   40.75 ? 195  LYS A CD    1 
ATOM   1507 C  CE    . LYS A 1 195 ? -13.756 18.053  -0.088  1.00   40.08 ? 195  LYS A CE    1 
ATOM   1508 N  NZ    . LYS A 1 195 ? -12.337 18.373  -0.296  1.00   42.03 ? 195  LYS A NZ    1 
ATOM   1509 N  N     . VAL A 1 196 ? -18.349 13.625  -2.932  1.00   44.13 ? 196  VAL A N     1 
ATOM   1510 C  CA    . VAL A 1 196 ? -19.345 13.409  -3.972  1.00   43.44 ? 196  VAL A CA    1 
ATOM   1511 C  C     . VAL A 1 196 ? -20.557 12.593  -3.519  1.00   45.14 ? 196  VAL A C     1 
ATOM   1512 O  O     . VAL A 1 196 ? -21.604 12.627  -4.175  1.00   43.06 ? 196  VAL A O     1 
ATOM   1513 C  CB    . VAL A 1 196 ? -18.730 12.702  -5.202  1.00   41.99 ? 196  VAL A CB    1 
ATOM   1514 C  CG1   . VAL A 1 196 ? -17.512 13.447  -5.681  1.00   36.85 ? 196  VAL A CG1   1 
ATOM   1515 C  CG2   . VAL A 1 196 ? -18.405 11.251  -4.870  1.00   38.14 ? 196  VAL A CG2   1 
ATOM   1516 N  N     . ALA A 1 197 ? -20.431 11.867  -2.409  1.00   46.37 ? 197  ALA A N     1 
ATOM   1517 C  CA    . ALA A 1 197 ? -21.541 11.040  -1.925  1.00   49.54 ? 197  ALA A CA    1 
ATOM   1518 C  C     . ALA A 1 197 ? -21.974 11.228  -0.460  1.00   51.89 ? 197  ALA A C     1 
ATOM   1519 O  O     . ALA A 1 197 ? -22.692 10.395  0.079   1.00   49.67 ? 197  ALA A O     1 
ATOM   1520 C  CB    . ALA A 1 197 ? -21.227 9.570   -2.181  1.00   48.35 ? 197  ALA A CB    1 
ATOM   1521 N  N     . CYS A 1 198 ? -21.550 12.322  0.172   1.00   55.26 ? 198  CYS A N     1 
ATOM   1522 C  CA    . CYS A 1 198 ? -21.920 12.596  1.561   1.00   58.24 ? 198  CYS A CA    1 
ATOM   1523 C  C     . CYS A 1 198 ? -23.437 12.613  1.720   1.00   59.23 ? 198  CYS A C     1 
ATOM   1524 O  O     . CYS A 1 198 ? -24.162 13.004  0.801   1.00   58.25 ? 198  CYS A O     1 
ATOM   1525 C  CB    . CYS A 1 198 ? -21.339 13.940  2.022   1.00   60.74 ? 198  CYS A CB    1 
ATOM   1526 S  SG    . CYS A 1 198 ? -21.745 15.364  0.935   1.00   68.05 ? 198  CYS A SG    1 
ATOM   1527 N  N     . ALA A 1 199 ? -23.913 12.191  2.892   1.00   59.47 ? 199  ALA A N     1 
ATOM   1528 C  CA    . ALA A 1 199 ? -25.341 12.136  3.167   1.00   60.73 ? 199  ALA A CA    1 
ATOM   1529 C  C     . ALA A 1 199 ? -25.988 13.509  3.289   1.00   63.42 ? 199  ALA A C     1 
ATOM   1530 O  O     . ALA A 1 199 ? -25.317 14.505  3.582   1.00   62.42 ? 199  ALA A O     1 
ATOM   1531 C  CB    . ALA A 1 199 ? -25.593 11.334  4.445   1.00   59.56 ? 199  ALA A CB    1 
ATOM   1532 N  N     . VAL A 1 200 ? -27.296 13.555  3.069   1.00   67.84 ? 200  VAL A N     1 
ATOM   1533 C  CA    . VAL A 1 200 ? -28.053 14.798  3.187   1.00   71.60 ? 200  VAL A CA    1 
ATOM   1534 C  C     . VAL A 1 200 ? -27.931 15.344  4.614   1.00   74.26 ? 200  VAL A C     1 
ATOM   1535 O  O     . VAL A 1 200 ? -27.557 14.617  5.536   1.00   74.73 ? 200  VAL A O     1 
ATOM   1536 C  CB    . VAL A 1 200 ? -29.524 14.541  2.835   1.00   69.04 ? 200  VAL A CB    1 
ATOM   1537 N  N     . LYS A 1 201 ? -28.247 16.623  4.788   1.00   81.83 ? 201  LYS A N     1 
ATOM   1538 C  CA    . LYS A 1 201 ? -28.159 17.268  6.101   1.00   87.63 ? 201  LYS A CA    1 
ATOM   1539 C  C     . LYS A 1 201 ? -29.390 16.962  6.949   1.00   90.05 ? 201  LYS A C     1 
ATOM   1540 O  O     . LYS A 1 201 ? -29.491 17.402  8.092   1.00   92.63 ? 201  LYS A O     1 
ATOM   1541 C  CB    . LYS A 1 201 ? -28.018 18.786  5.929   1.00   92.12 ? 201  LYS A CB    1 
ATOM   1542 C  CG    . LYS A 1 201 ? -27.681 19.222  4.509   1.00   97.24 ? 201  LYS A CG    1 
ATOM   1543 C  CD    . LYS A 1 201 ? -26.361 18.632  4.043   1.00   98.98 ? 201  LYS A CD    1 
ATOM   1544 C  CE    . LYS A 1 201 ? -26.138 18.869  2.562   1.00   99.34 ? 201  LYS A CE    1 
ATOM   1545 N  NZ    . LYS A 1 201 ? -24.865 18.247  2.106   1.00   99.18 ? 201  LYS A NZ    1 
ATOM   1546 N  N     . LYS A 1 210 ? -14.099 21.029  19.938  1.00   94.42 ? 210  LYS A N     1 
ATOM   1547 C  CA    . LYS A 1 210 ? -15.488 21.106  19.504  1.00   93.01 ? 210  LYS A CA    1 
ATOM   1548 C  C     . LYS A 1 210 ? -16.187 19.797  19.827  1.00   93.75 ? 210  LYS A C     1 
ATOM   1549 O  O     . LYS A 1 210 ? -15.769 19.059  20.720  1.00   93.12 ? 210  LYS A O     1 
ATOM   1550 C  CB    . LYS A 1 210 ? -15.557 21.372  18.002  1.00   95.06 ? 210  LYS A CB    1 
ATOM   1551 N  N     . LYS A 1 211 ? -17.256 19.516  19.095  1.00   90.32 ? 211  LYS A N     1 
ATOM   1552 C  CA    . LYS A 1 211 ? -17.991 18.289  19.294  1.00   86.55 ? 211  LYS A CA    1 
ATOM   1553 C  C     . LYS A 1 211 ? -17.881 17.421  18.050  1.00   84.04 ? 211  LYS A C     1 
ATOM   1554 O  O     . LYS A 1 211 ? -17.252 17.803  17.060  1.00   80.74 ? 211  LYS A O     1 
ATOM   1555 C  CB    . LYS A 1 211 ? -19.454 18.590  19.607  1.00   87.43 ? 211  LYS A CB    1 
ATOM   1556 C  CG    . LYS A 1 211 ? -19.689 19.057  21.032  1.00   90.18 ? 211  LYS A CG    1 
ATOM   1557 C  CD    . LYS A 1 211 ? -20.936 18.403  21.569  1.00   92.39 ? 211  LYS A CD    1 
ATOM   1558 C  CE    . LYS A 1 211 ? -20.845 16.895  21.386  1.00   93.65 ? 211  LYS A CE    1 
ATOM   1559 N  NZ    . LYS A 1 211 ? -22.126 16.216  21.718  1.00   94.61 ? 211  LYS A NZ    1 
ATOM   1560 N  N     . GLU A 1 212 ? -18.498 16.248  18.116  1.00   78.14 ? 212  GLU A N     1 
ATOM   1561 C  CA    . GLU A 1 212 ? -18.491 15.289  17.022  1.00   73.86 ? 212  GLU A CA    1 
ATOM   1562 C  C     . GLU A 1 212 ? -19.037 15.864  15.710  1.00   70.37 ? 212  GLU A C     1 
ATOM   1563 O  O     . GLU A 1 212 ? -20.101 16.480  15.686  1.00   68.09 ? 212  GLU A O     1 
ATOM   1564 C  CB    . GLU A 1 212 ? -19.287 14.040  17.445  1.00   75.85 ? 212  GLU A CB    1 
ATOM   1565 C  CG    . GLU A 1 212 ? -19.776 13.135  16.303  1.00   80.32 ? 212  GLU A CG    1 
ATOM   1566 C  CD    . GLU A 1 212 ? -20.197 11.736  16.776  1.00   82.35 ? 212  GLU A CD    1 
ATOM   1567 O  OE1   . GLU A 1 212 ? -20.857 11.009  16.000  1.00   82.75 ? 212  GLU A OE1   1 
ATOM   1568 O  OE2   . GLU A 1 212 ? -19.854 11.353  17.916  1.00   82.84 ? 212  GLU A OE2   1 
ATOM   1569 N  N     . GLY A 1 213 ? -18.285 15.654  14.625  1.00   66.01 ? 213  GLY A N     1 
ATOM   1570 C  CA    . GLY A 1 213 ? -18.703 16.111  13.308  1.00   60.49 ? 213  GLY A CA    1 
ATOM   1571 C  C     . GLY A 1 213 ? -19.563 15.015  12.715  1.00   57.46 ? 213  GLY A C     1 
ATOM   1572 O  O     . GLY A 1 213 ? -19.882 14.054  13.410  1.00   54.95 ? 213  GLY A O     1 
ATOM   1573 N  N     . SER A 1 214 ? -19.947 15.138  11.452  1.00   56.19 ? 214  SER A N     1 
ATOM   1574 C  CA    . SER A 1 214 ? -20.779 14.115  10.828  1.00   55.13 ? 214  SER A CA    1 
ATOM   1575 C  C     . SER A 1 214 ? -19.944 12.897  10.464  1.00   52.71 ? 214  SER A C     1 
ATOM   1576 O  O     . SER A 1 214 ? -18.732 12.884  10.669  1.00   53.86 ? 214  SER A O     1 
ATOM   1577 C  CB    . SER A 1 214 ? -21.442 14.661  9.566   1.00   56.85 ? 214  SER A CB    1 
ATOM   1578 O  OG    . SER A 1 214 ? -20.456 14.979  8.610   1.00   59.82 ? 214  SER A OG    1 
ATOM   1579 N  N     . LEU A 1 215 ? -20.598 11.877  9.922   1.00   50.78 ? 215  LEU A N     1 
ATOM   1580 C  CA    . LEU A 1 215 ? -19.917 10.649  9.515   1.00   48.63 ? 215  LEU A CA    1 
ATOM   1581 C  C     . LEU A 1 215 ? -18.749 10.951  8.578   1.00   48.48 ? 215  LEU A C     1 
ATOM   1582 O  O     . LEU A 1 215 ? -17.607 10.574  8.860   1.00   47.17 ? 215  LEU A O     1 
ATOM   1583 C  CB    . LEU A 1 215 ? -20.898 9.702   8.831   1.00   47.00 ? 215  LEU A CB    1 
ATOM   1584 C  CG    . LEU A 1 215 ? -20.440 8.293   8.443   1.00   45.16 ? 215  LEU A CG    1 
ATOM   1585 C  CD1   . LEU A 1 215 ? -19.935 7.522   9.665   1.00   44.28 ? 215  LEU A CD1   1 
ATOM   1586 C  CD2   . LEU A 1 215 ? -21.599 7.572   7.826   1.00   43.87 ? 215  LEU A CD2   1 
ATOM   1587 N  N     . GLU A 1 216 ? -19.028 11.634  7.472   1.00   47.17 ? 216  GLU A N     1 
ATOM   1588 C  CA    . GLU A 1 216 ? -17.977 11.975  6.516   1.00   46.09 ? 216  GLU A CA    1 
ATOM   1589 C  C     . GLU A 1 216 ? -16.751 12.606  7.203   1.00   45.89 ? 216  GLU A C     1 
ATOM   1590 O  O     . GLU A 1 216 ? -15.617 12.188  6.956   1.00   41.32 ? 216  GLU A O     1 
ATOM   1591 C  CB    . GLU A 1 216 ? -18.523 12.913  5.423   1.00   47.61 ? 216  GLU A CB    1 
ATOM   1592 C  CG    . GLU A 1 216 ? -19.414 12.249  4.360   1.00   51.93 ? 216  GLU A CG    1 
ATOM   1593 C  CD    . GLU A 1 216 ? -20.854 11.997  4.820   1.00   55.92 ? 216  GLU A CD    1 
ATOM   1594 O  OE1   . GLU A 1 216 ? -21.375 12.784  5.648   1.00   57.32 ? 216  GLU A OE1   1 
ATOM   1595 O  OE2   . GLU A 1 216 ? -21.482 11.014  4.339   1.00   57.65 ? 216  GLU A OE2   1 
ATOM   1596 N  N     . ASP A 1 217 ? -16.982 13.602  8.051   1.00   45.58 ? 217  ASP A N     1 
ATOM   1597 C  CA    . ASP A 1 217 ? -15.905 14.262  8.780   1.00   45.09 ? 217  ASP A CA    1 
ATOM   1598 C  C     . ASP A 1 217 ? -15.113 13.254  9.632   1.00   43.41 ? 217  ASP A C     1 
ATOM   1599 O  O     . ASP A 1 217 ? -13.890 13.331  9.717   1.00   41.87 ? 217  ASP A O     1 
ATOM   1600 C  CB    . ASP A 1 217 ? -16.465 15.354  9.715   1.00   50.28 ? 217  ASP A CB    1 
ATOM   1601 C  CG    . ASP A 1 217 ? -16.961 16.606  8.969   1.00   58.10 ? 217  ASP A CG    1 
ATOM   1602 O  OD1   . ASP A 1 217 ? -17.542 17.498  9.635   1.00   62.88 ? 217  ASP A OD1   1 
ATOM   1603 O  OD2   . ASP A 1 217 ? -16.780 16.712  7.737   1.00   62.27 ? 217  ASP A OD2   1 
ATOM   1604 N  N     . GLN A 1 218 ? -15.810 12.314  10.269  1.00   42.20 ? 218  GLN A N     1 
ATOM   1605 C  CA    . GLN A 1 218 ? -15.133 11.324  11.102  1.00   40.62 ? 218  GLN A CA    1 
ATOM   1606 C  C     . GLN A 1 218 ? -14.317 10.351  10.271  1.00   39.70 ? 218  GLN A C     1 
ATOM   1607 O  O     . GLN A 1 218 ? -13.191 10.008  10.642  1.00   40.37 ? 218  GLN A O     1 
ATOM   1608 C  CB    . GLN A 1 218 ? -16.158 10.601  11.959  1.00   39.41 ? 218  GLN A CB    1 
ATOM   1609 C  CG    . GLN A 1 218 ? -16.937 11.621  12.775  1.00   39.49 ? 218  GLN A CG    1 
ATOM   1610 C  CD    . GLN A 1 218 ? -18.028 11.039  13.619  1.00   38.03 ? 218  GLN A CD    1 
ATOM   1611 O  OE1   . GLN A 1 218 ? -18.957 10.380  13.127  1.00   38.60 ? 218  GLN A OE1   1 
ATOM   1612 N  NE2   . GLN A 1 218 ? -17.939 11.298  14.903  1.00   37.40 ? 218  GLN A NE2   1 
ATOM   1613 N  N     . ILE A 1 219 ? -14.875 9.909   9.158   1.00   39.85 ? 219  ILE A N     1 
ATOM   1614 C  CA    . ILE A 1 219 ? -14.151 9.006   8.283   1.00   39.41 ? 219  ILE A CA    1 
ATOM   1615 C  C     . ILE A 1 219 ? -12.763 9.606   7.984   1.00   39.60 ? 219  ILE A C     1 
ATOM   1616 O  O     . ILE A 1 219 ? -11.753 8.918   8.110   1.00   40.55 ? 219  ILE A O     1 
ATOM   1617 C  CB    . ILE A 1 219 ? -14.934 8.785   6.992   1.00   40.95 ? 219  ILE A CB    1 
ATOM   1618 C  CG1   . ILE A 1 219 ? -16.326 8.248   7.345   1.00   43.17 ? 219  ILE A CG1   1 
ATOM   1619 C  CG2   . ILE A 1 219 ? -14.179 7.815   6.085   1.00   41.52 ? 219  ILE A CG2   1 
ATOM   1620 C  CD1   . ILE A 1 219 ? -17.315 8.245   6.185   1.00   43.63 ? 219  ILE A CD1   1 
ATOM   1621 N  N     . ILE A 1 220 ? -12.710 10.891  7.600   1.00   37.47 ? 220  ILE A N     1 
ATOM   1622 C  CA    . ILE A 1 220 ? -11.455 11.577  7.314   1.00   36.61 ? 220  ILE A CA    1 
ATOM   1623 C  C     . ILE A 1 220 ? -10.612 11.805  8.582   1.00   37.46 ? 220  ILE A C     1 
ATOM   1624 O  O     . ILE A 1 220 ? -9.387  11.624  8.549   1.00   36.05 ? 220  ILE A O     1 
ATOM   1625 C  CB    . ILE A 1 220 ? -11.678 12.985  6.630   1.00   33.96 ? 220  ILE A CB    1 
ATOM   1626 C  CG1   . ILE A 1 220 ? -12.067 12.857  5.152   1.00   33.49 ? 220  ILE A CG1   1 
ATOM   1627 C  CG2   . ILE A 1 220 ? -10.345 13.760  6.582   1.00   32.11 ? 220  ILE A CG2   1 
ATOM   1628 C  CD1   . ILE A 1 220 ? -13.138 11.886  4.800   1.00   34.21 ? 220  ILE A CD1   1 
ATOM   1629 N  N     . GLN A 1 221 ? -11.236 12.205  9.686   1.00   37.96 ? 221  GLN A N     1 
ATOM   1630 C  CA    . GLN A 1 221 ? -10.467 12.464  10.905  1.00   39.40 ? 221  GLN A CA    1 
ATOM   1631 C  C     . GLN A 1 221 ? -9.915  11.207  11.619  1.00   40.09 ? 221  GLN A C     1 
ATOM   1632 O  O     . GLN A 1 221 ? -9.266  11.324  12.648  1.00   37.22 ? 221  GLN A O     1 
ATOM   1633 C  CB    . GLN A 1 221 ? -11.276 13.311  11.911  1.00   40.44 ? 221  GLN A CB    1 
ATOM   1634 C  CG    . GLN A 1 221 ? -11.539 14.749  11.476  1.00   43.13 ? 221  GLN A CG    1 
ATOM   1635 C  CD    . GLN A 1 221 ? -10.275 15.512  11.204  1.00   45.60 ? 221  GLN A CD    1 
ATOM   1636 O  OE1   . GLN A 1 221 ? -9.340  15.498  12.007  1.00   46.66 ? 221  GLN A OE1   1 
ATOM   1637 N  NE2   . GLN A 1 221 ? -10.229 16.185  10.061  1.00   46.64 ? 221  GLN A NE2   1 
ATOM   1638 N  N     . ALA A 1 222 ? -10.174 10.024  11.064  1.00   41.49 ? 222  ALA A N     1 
ATOM   1639 C  CA    . ALA A 1 222 ? -9.641  8.801   11.634  1.00   42.26 ? 222  ALA A CA    1 
ATOM   1640 C  C     . ALA A 1 222 ? -8.158  8.705   11.268  1.00   43.09 ? 222  ALA A C     1 
ATOM   1641 O  O     . ALA A 1 222 ? -7.365  8.126   12.004  1.00   42.33 ? 222  ALA A O     1 
ATOM   1642 C  CB    . ALA A 1 222 ? -10.396 7.603   11.090  1.00   43.07 ? 222  ALA A CB    1 
ATOM   1643 N  N     . ASN A 1 223 ? -7.778  9.286   10.127  1.00   44.35 ? 223  ASN A N     1 
ATOM   1644 C  CA    . ASN A 1 223 ? -6.398  9.239   9.694   1.00   44.70 ? 223  ASN A CA    1 
ATOM   1645 C  C     . ASN A 1 223 ? -5.406  9.913   10.625  1.00   43.65 ? 223  ASN A C     1 
ATOM   1646 O  O     . ASN A 1 223 ? -4.387  9.320   10.989  1.00   44.01 ? 223  ASN A O     1 
ATOM   1647 C  CB    . ASN A 1 223 ? -6.264  9.836   8.299   1.00   48.32 ? 223  ASN A CB    1 
ATOM   1648 C  CG    . ASN A 1 223 ? -6.838  8.930   7.247   1.00   51.93 ? 223  ASN A CG    1 
ATOM   1649 O  OD1   . ASN A 1 223 ? -6.446  7.763   7.157   1.00   53.24 ? 223  ASN A OD1   1 
ATOM   1650 N  ND2   . ASN A 1 223 ? -7.773  9.451   6.440   1.00   52.84 ? 223  ASN A ND2   1 
ATOM   1651 N  N     . PRO A 1 224 ? -5.678  11.170  11.021  1.00   40.85 ? 224  PRO A N     1 
ATOM   1652 C  CA    . PRO A 1 224 ? -4.716  11.807  11.921  1.00   39.63 ? 224  PRO A CA    1 
ATOM   1653 C  C     . PRO A 1 224 ? -4.463  11.002  13.192  1.00   37.68 ? 224  PRO A C     1 
ATOM   1654 O  O     . PRO A 1 224 ? -3.346  11.010  13.698  1.00   37.20 ? 224  PRO A O     1 
ATOM   1655 C  CB    . PRO A 1 224 ? -5.339  13.190  12.204  1.00   39.48 ? 224  PRO A CB    1 
ATOM   1656 C  CG    . PRO A 1 224 ? -6.178  13.464  11.002  1.00   38.40 ? 224  PRO A CG    1 
ATOM   1657 C  CD    . PRO A 1 224 ? -6.742  12.098  10.603  1.00   39.96 ? 224  PRO A CD    1 
ATOM   1658 N  N     . VAL A 1 225 ? -5.462  10.311  13.726  1.00   36.81 ? 225  VAL A N     1 
ATOM   1659 C  CA    . VAL A 1 225 ? -5.172  9.562   14.958  1.00   35.06 ? 225  VAL A CA    1 
ATOM   1660 C  C     . VAL A 1 225 ? -4.463  8.236   14.705  1.00   34.32 ? 225  VAL A C     1 
ATOM   1661 O  O     . VAL A 1 225 ? -3.549  7.879   15.457  1.00   34.55 ? 225  VAL A O     1 
ATOM   1662 C  CB    . VAL A 1 225 ? -6.426  9.323   15.853  1.00   35.79 ? 225  VAL A CB    1 
ATOM   1663 C  CG1   . VAL A 1 225 ? -7.030  10.661  16.265  1.00   35.77 ? 225  VAL A CG1   1 
ATOM   1664 C  CG2   . VAL A 1 225 ? -7.437  8.442   15.168  1.00   33.32 ? 225  VAL A CG2   1 
ATOM   1665 N  N     . LEU A 1 226 ? -4.837  7.524   13.662  1.00   33.22 ? 226  LEU A N     1 
ATOM   1666 C  CA    . LEU A 1 226 ? -4.174  6.256   13.352  1.00   33.80 ? 226  LEU A CA    1 
ATOM   1667 C  C     . LEU A 1 226 ? -2.774  6.461   12.805  1.00   34.93 ? 226  LEU A C     1 
ATOM   1668 O  O     . LEU A 1 226 ? -1.903  5.604   12.973  1.00   35.41 ? 226  LEU A O     1 
ATOM   1669 C  CB    . LEU A 1 226 ? -4.963  5.439   12.322  1.00   32.34 ? 226  LEU A CB    1 
ATOM   1670 C  CG    . LEU A 1 226 ? -6.379  4.944   12.711  1.00   31.69 ? 226  LEU A CG    1 
ATOM   1671 C  CD1   . LEU A 1 226 ? -6.896  4.045   11.617  1.00   29.78 ? 226  LEU A CD1   1 
ATOM   1672 C  CD2   . LEU A 1 226 ? -6.393  4.218   14.028  1.00   27.79 ? 226  LEU A CD2   1 
ATOM   1673 N  N     . GLU A 1 227 ? -2.539  7.602   12.133  1.00   34.01 ? 227  GLU A N     1 
ATOM   1674 C  CA    . GLU A 1 227 ? -1.227  7.845   11.553  1.00   32.85 ? 227  GLU A CA    1 
ATOM   1675 C  C     . GLU A 1 227 ? -0.301  8.300   12.643  1.00   30.61 ? 227  GLU A C     1 
ATOM   1676 O  O     . GLU A 1 227 ? 0.921   8.143   12.551  1.00   30.25 ? 227  GLU A O     1 
ATOM   1677 C  CB    . GLU A 1 227 ? -1.293  8.892   10.404  1.00   33.50 ? 227  GLU A CB    1 
ATOM   1678 C  CG    . GLU A 1 227 ? -1.760  8.288   9.056   1.00   33.61 ? 227  GLU A CG    1 
ATOM   1679 C  CD    . GLU A 1 227 ? -1.617  9.231   7.829   1.00   34.12 ? 227  GLU A CD    1 
ATOM   1680 O  OE1   . GLU A 1 227 ? -0.604  9.946   7.704   1.00   35.00 ? 227  GLU A OE1   1 
ATOM   1681 O  OE2   . GLU A 1 227 ? -2.515  9.232   6.956   1.00   36.39 ? 227  GLU A OE2   1 
ATOM   1682 N  N     . ALA A 1 228 ? -0.884  8.877   13.673  1.00   29.36 ? 228  ALA A N     1 
ATOM   1683 C  CA    . ALA A 1 228 ? -0.127  9.362   14.802  1.00   29.65 ? 228  ALA A CA    1 
ATOM   1684 C  C     . ALA A 1 228 ? 0.370   8.115   15.561  1.00   30.37 ? 228  ALA A C     1 
ATOM   1685 O  O     . ALA A 1 228 ? 1.514   8.091   16.016  1.00   31.64 ? 228  ALA A O     1 
ATOM   1686 C  CB    . ALA A 1 228 ? -1.012  10.217  15.709  1.00   28.00 ? 228  ALA A CB    1 
ATOM   1687 N  N     . TYR A 1 229 ? -0.470  7.117   15.684  1.00   29.95 ? 229  TYR A N     1 
ATOM   1688 C  CA    . TYR A 1 229 ? -0.080  5.896   16.386  1.00   32.86 ? 229  TYR A CA    1 
ATOM   1689 C  C     . TYR A 1 229 ? 0.571   4.812   15.479  1.00   33.71 ? 229  TYR A C     1 
ATOM   1690 O  O     . TYR A 1 229 ? 1.267   3.930   15.995  1.00   34.34 ? 229  TYR A O     1 
ATOM   1691 C  CB    . TYR A 1 229 ? -1.277  5.298   17.136  1.00   32.76 ? 229  TYR A CB    1 
ATOM   1692 C  CG    . TYR A 1 229 ? -1.570  6.019   18.450  1.00   35.37 ? 229  TYR A CG    1 
ATOM   1693 C  CD1   . TYR A 1 229 ? -2.298  7.195   18.469  1.00   33.84 ? 229  TYR A CD1   1 
ATOM   1694 C  CD2   . TYR A 1 229 ? -1.027  5.552   19.675  1.00   35.50 ? 229  TYR A CD2   1 
ATOM   1695 C  CE1   . TYR A 1 229 ? -2.476  7.919   19.648  1.00   34.94 ? 229  TYR A CE1   1 
ATOM   1696 C  CE2   . TYR A 1 229 ? -1.193  6.260   20.846  1.00   34.97 ? 229  TYR A CE2   1 
ATOM   1697 C  CZ    . TYR A 1 229 ? -1.921  7.460   20.833  1.00   36.13 ? 229  TYR A CZ    1 
ATOM   1698 O  OH    . TYR A 1 229 ? -2.046  8.237   21.975  1.00   35.08 ? 229  TYR A OH    1 
ATOM   1699 N  N     . GLY A 1 230 ? 0.373   4.870   14.164  1.00   31.19 ? 230  GLY A N     1 
ATOM   1700 C  CA    . GLY A 1 230 ? 0.950   3.832   13.330  1.00   30.43 ? 230  GLY A CA    1 
ATOM   1701 C  C     . GLY A 1 230 ? 1.889   4.201   12.222  1.00   29.96 ? 230  GLY A C     1 
ATOM   1702 O  O     . GLY A 1 230 ? 2.158   3.390   11.352  1.00   28.87 ? 230  GLY A O     1 
ATOM   1703 N  N     . ASN A 1 231 ? 2.397   5.423   12.248  1.00   29.95 ? 231  ASN A N     1 
ATOM   1704 C  CA    . ASN A 1 231 ? 3.307   5.853   11.222  1.00   29.77 ? 231  ASN A CA    1 
ATOM   1705 C  C     . ASN A 1 231 ? 4.547   6.383   11.886  1.00   29.99 ? 231  ASN A C     1 
ATOM   1706 O  O     . ASN A 1 231 ? 4.526   6.832   13.012  1.00   29.02 ? 231  ASN A O     1 
ATOM   1707 C  CB    . ASN A 1 231 ? 2.670   6.934   10.352  1.00   30.70 ? 231  ASN A CB    1 
ATOM   1708 C  CG    . ASN A 1 231 ? 1.608   6.382   9.477   1.00   31.66 ? 231  ASN A CG    1 
ATOM   1709 O  OD1   . ASN A 1 231 ? 0.890   5.483   9.872   1.00   32.92 ? 231  ASN A OD1   1 
ATOM   1710 N  ND2   . ASN A 1 231 ? 1.478   6.932   8.270   1.00   34.47 ? 231  ASN A ND2   1 
ATOM   1711 N  N     . ALA A 1 232 ? 5.649   6.312   11.144  1.00   30.70 ? 232  ALA A N     1 
ATOM   1712 C  CA    . ALA A 1 232 ? 6.910   6.718   11.709  1.00   31.47 ? 232  ALA A CA    1 
ATOM   1713 C  C     . ALA A 1 232 ? 7.881   7.032   10.589  1.00   30.46 ? 232  ALA A C     1 
ATOM   1714 O  O     . ALA A 1 232 ? 7.748   6.510   9.499   1.00   30.48 ? 232  ALA A O     1 
ATOM   1715 C  CB    . ALA A 1 232 ? 7.468   5.569   12.557  1.00   30.65 ? 232  ALA A CB    1 
ATOM   1716 N  N     . LYS A 1 233 ? 8.849   7.866   10.884  1.00   31.58 ? 233  LYS A N     1 
ATOM   1717 C  CA    . LYS A 1 233 ? 9.828   8.151   9.877   1.00   33.84 ? 233  LYS A CA    1 
ATOM   1718 C  C     . LYS A 1 233 ? 10.777  6.975   9.718   1.00   35.99 ? 233  LYS A C     1 
ATOM   1719 O  O     . LYS A 1 233 ? 11.336  6.460   10.682  1.00   34.70 ? 233  LYS A O     1 
ATOM   1720 C  CB    . LYS A 1 233 ? 10.649  9.394   10.202  1.00   32.37 ? 233  LYS A CB    1 
ATOM   1721 C  CG    . LYS A 1 233 ? 11.811  9.551   9.230   1.00   31.80 ? 233  LYS A CG    1 
ATOM   1722 C  CD    . LYS A 1 233 ? 12.893  10.502  9.751   1.00   33.69 ? 233  LYS A CD    1 
ATOM   1723 C  CE    . LYS A 1 233 ? 14.168  10.462  8.862   1.00   34.22 ? 233  LYS A CE    1 
ATOM   1724 N  NZ    . LYS A 1 233 ? 15.232  11.328  9.475   1.00   35.96 ? 233  LYS A NZ    1 
ATOM   1725 N  N     . THR A 1 234 ? 10.945  6.573   8.477   1.00   39.75 ? 234  THR A N     1 
ATOM   1726 C  CA    . THR A 1 234 ? 11.870  5.516   8.125   1.00   42.31 ? 234  THR A CA    1 
ATOM   1727 C  C     . THR A 1 234 ? 12.812  6.139   7.089   1.00   42.75 ? 234  THR A C     1 
ATOM   1728 O  O     . THR A 1 234 ? 12.600  7.284   6.672   1.00   40.12 ? 234  THR A O     1 
ATOM   1729 C  CB    . THR A 1 234 ? 11.138  4.379   7.467   1.00   46.03 ? 234  THR A CB    1 
ATOM   1730 O  OG1   . THR A 1 234 ? 12.076  3.347   7.188   1.00   53.30 ? 234  THR A OG1   1 
ATOM   1731 C  CG2   . THR A 1 234 ? 10.501  4.847   6.142   1.00   49.32 ? 234  THR A CG2   1 
ATOM   1732 N  N     . THR A 1 235 ? 13.837  5.404   6.663   1.00   42.07 ? 235  THR A N     1 
ATOM   1733 C  CA    . THR A 1 235 ? 14.754  5.950   5.661   1.00   40.13 ? 235  THR A CA    1 
ATOM   1734 C  C     . THR A 1 235 ? 14.061  6.248   4.301   1.00   38.54 ? 235  THR A C     1 
ATOM   1735 O  O     . THR A 1 235 ? 14.397  7.215   3.638   1.00   37.32 ? 235  THR A O     1 
ATOM   1736 C  CB    . THR A 1 235 ? 15.931  5.008   5.400   1.00   41.00 ? 235  THR A CB    1 
ATOM   1737 O  OG1   . THR A 1 235 ? 16.687  4.805   6.615   1.00   44.50 ? 235  THR A OG1   1 
ATOM   1738 C  CG2   . THR A 1 235 ? 16.832  5.643   4.379   1.00   45.40 ? 235  THR A CG2   1 
ATOM   1739 N  N     . ARG A 1 236 ? 13.101  5.414   3.933   1.00   37.00 ? 236  ARG A N     1 
ATOM   1740 C  CA    . ARG A 1 236 ? 12.358  5.550   2.694   1.00   38.26 ? 236  ARG A CA    1 
ATOM   1741 C  C     . ARG A 1 236 ? 11.232  6.599   2.682   1.00   37.40 ? 236  ARG A C     1 
ATOM   1742 O  O     . ARG A 1 236 ? 11.037  7.271   1.679   1.00   39.15 ? 236  ARG A O     1 
ATOM   1743 C  CB    . ARG A 1 236 ? 11.712  4.223   2.329   1.00   37.15 ? 236  ARG A CB    1 
ATOM   1744 C  CG    . ARG A 1 236 ? 12.237  3.590   1.051   1.00   38.30 ? 236  ARG A CG    1 
ATOM   1745 C  CD    . ARG A 1 236 ? 12.237  4.535   -0.139  1.00   35.16 ? 236  ARG A CD    1 
ATOM   1746 N  NE    . ARG A 1 236 ? 12.848  3.835   -1.250  1.00   34.17 ? 236  ARG A NE    1 
ATOM   1747 C  CZ    . ARG A 1 236 ? 12.236  2.901   -1.959  1.00   34.95 ? 236  ARG A CZ    1 
ATOM   1748 N  NH1   . ARG A 1 236 ? 10.977  2.579   -1.675  1.00   34.55 ? 236  ARG A NH1   1 
ATOM   1749 N  NH2   . ARG A 1 236 ? 12.893  2.254   -2.926  1.00   34.18 ? 236  ARG A NH2   1 
ATOM   1750 N  N     . ASN A 1 237 ? 10.527  6.732   3.788   1.00   35.54 ? 237  ASN A N     1 
ATOM   1751 C  CA    . ASN A 1 237 ? 9.369   7.610   3.854   1.00   33.92 ? 237  ASN A CA    1 
ATOM   1752 C  C     . ASN A 1 237 ? 9.222   8.298   5.220   1.00   34.29 ? 237  ASN A C     1 
ATOM   1753 O  O     . ASN A 1 237 ? 9.075   7.628   6.255   1.00   31.89 ? 237  ASN A O     1 
ATOM   1754 C  CB    . ASN A 1 237 ? 8.149   6.732   3.525   1.00   32.29 ? 237  ASN A CB    1 
ATOM   1755 C  CG    . ASN A 1 237 ? 6.847   7.473   3.557   1.00   30.14 ? 237  ASN A CG    1 
ATOM   1756 O  OD1   . ASN A 1 237 ? 6.814   8.647   3.868   1.00   29.29 ? 237  ASN A OD1   1 
ATOM   1757 N  ND2   . ASN A 1 237 ? 5.748   6.778   3.239   1.00   27.53 ? 237  ASN A ND2   1 
ATOM   1758 N  N     . ASN A 1 238 ? 9.265   9.629   5.230   1.00   33.29 ? 238  ASN A N     1 
ATOM   1759 C  CA    . ASN A 1 238 ? 9.132   10.370  6.484   1.00   34.51 ? 238  ASN A CA    1 
ATOM   1760 C  C     . ASN A 1 238 ? 7.831   10.078  7.241   1.00   34.41 ? 238  ASN A C     1 
ATOM   1761 O  O     . ASN A 1 238 ? 7.766   10.276  8.456   1.00   35.35 ? 238  ASN A O     1 
ATOM   1762 C  CB    . ASN A 1 238 ? 9.232   11.869  6.229   1.00   34.67 ? 238  ASN A CB    1 
ATOM   1763 C  CG    . ASN A 1 238 ? 10.603  12.289  5.770   1.00   36.11 ? 238  ASN A CG    1 
ATOM   1764 O  OD1   . ASN A 1 238 ? 10.729  13.222  4.993   1.00   38.10 ? 238  ASN A OD1   1 
ATOM   1765 N  ND2   . ASN A 1 238 ? 11.645  11.615  6.253   1.00   37.61 ? 238  ASN A ND2   1 
ATOM   1766 N  N     . ASN A 1 239 ? 6.804   9.611   6.524   1.00   31.85 ? 239  ASN A N     1 
ATOM   1767 C  CA    . ASN A 1 239 ? 5.508   9.276   7.102   1.00   32.18 ? 239  ASN A CA    1 
ATOM   1768 C  C     . ASN A 1 239 ? 5.119   7.817   6.778   1.00   33.06 ? 239  ASN A C     1 
ATOM   1769 O  O     . ASN A 1 239 ? 3.990   7.552   6.349   1.00   33.04 ? 239  ASN A O     1 
ATOM   1770 C  CB    . ASN A 1 239 ? 4.430   10.210  6.547   1.00   32.29 ? 239  ASN A CB    1 
ATOM   1771 C  CG    . ASN A 1 239 ? 3.039   9.886   7.099   1.00   32.92 ? 239  ASN A CG    1 
ATOM   1772 O  OD1   . ASN A 1 239 ? 2.881   9.395   8.226   1.00   30.56 ? 239  ASN A OD1   1 
ATOM   1773 N  ND2   . ASN A 1 239 ? 2.030   10.169  6.311   1.00   31.33 ? 239  ASN A ND2   1 
ATOM   1774 N  N     . SER A 1 240 ? 6.035   6.877   6.970   1.00   34.58 ? 240  SER A N     1 
ATOM   1775 C  CA    . SER A 1 240 ? 5.785   5.468   6.662   1.00   35.96 ? 240  SER A CA    1 
ATOM   1776 C  C     . SER A 1 240 ? 4.711   4.750   7.509   1.00   36.85 ? 240  SER A C     1 
ATOM   1777 O  O     . SER A 1 240 ? 4.751   4.792   8.741   1.00   38.85 ? 240  SER A O     1 
ATOM   1778 C  CB    . SER A 1 240 ? 7.113   4.668   6.747   1.00   35.15 ? 240  SER A CB    1 
ATOM   1779 O  OG    . SER A 1 240 ? 6.922   3.287   6.408   1.00   29.42 ? 240  SER A OG    1 
ATOM   1780 N  N     . SER A 1 241 ? 3.781   4.083   6.835   1.00   38.02 ? 241  SER A N     1 
ATOM   1781 C  CA    . SER A 1 241 ? 2.722   3.308   7.497   1.00   39.40 ? 241  SER A CA    1 
ATOM   1782 C  C     . SER A 1 241 ? 3.334   2.030   8.105   1.00   39.57 ? 241  SER A C     1 
ATOM   1783 O  O     . SER A 1 241 ? 3.878   1.207   7.373   1.00   40.41 ? 241  SER A O     1 
ATOM   1784 C  CB    . SER A 1 241 ? 1.638   2.901   6.487   1.00   38.36 ? 241  SER A CB    1 
ATOM   1785 O  OG    . SER A 1 241 ? 1.048   4.026   5.879   1.00   37.61 ? 241  SER A OG    1 
ATOM   1786 N  N     . ARG A 1 242 ? 3.251   1.858   9.416   1.00   38.23 ? 242  ARG A N     1 
ATOM   1787 C  CA    . ARG A 1 242 ? 3.820   0.665   10.028  1.00   38.51 ? 242  ARG A CA    1 
ATOM   1788 C  C     . ARG A 1 242 ? 2.728   -0.347  10.315  1.00   37.18 ? 242  ARG A C     1 
ATOM   1789 O  O     . ARG A 1 242 ? 2.854   -1.188  11.196  1.00   35.98 ? 242  ARG A O     1 
ATOM   1790 C  CB    . ARG A 1 242 ? 4.565   1.016   11.305  1.00   37.30 ? 242  ARG A CB    1 
ATOM   1791 C  CG    . ARG A 1 242 ? 5.756   1.927   11.084  1.00   37.55 ? 242  ARG A CG    1 
ATOM   1792 C  CD    . ARG A 1 242 ? 6.987   1.151   10.570  1.00   39.79 ? 242  ARG A CD    1 
ATOM   1793 N  NE    . ARG A 1 242 ? 7.146   1.240   9.139   1.00   39.23 ? 242  ARG A NE    1 
ATOM   1794 C  CZ    . ARG A 1 242 ? 7.860   0.399   8.393   1.00   40.98 ? 242  ARG A CZ    1 
ATOM   1795 N  NH1   . ARG A 1 242 ? 8.516   -0.638  8.916   1.00   37.29 ? 242  ARG A NH1   1 
ATOM   1796 N  NH2   . ARG A 1 242 ? 7.925   0.609   7.092   1.00   40.70 ? 242  ARG A NH2   1 
ATOM   1797 N  N     . PHE A 1 243 ? 1.661   -0.250  9.530   1.00   34.30 ? 243  PHE A N     1 
ATOM   1798 C  CA    . PHE A 1 243 ? 0.523   -1.145  9.654   1.00   32.88 ? 243  PHE A CA    1 
ATOM   1799 C  C     . PHE A 1 243 ? -0.275  -1.135  8.354   1.00   33.02 ? 243  PHE A C     1 
ATOM   1800 O  O     . PHE A 1 243 ? -0.251  -0.138  7.617   1.00   31.97 ? 243  PHE A O     1 
ATOM   1801 C  CB    . PHE A 1 243 ? -0.394  -0.726  10.819  1.00   31.70 ? 243  PHE A CB    1 
ATOM   1802 C  CG    . PHE A 1 243 ? -1.230  0.499   10.554  1.00   30.71 ? 243  PHE A CG    1 
ATOM   1803 C  CD1   . PHE A 1 243 ? -0.716  1.783   10.770  1.00   31.28 ? 243  PHE A CD1   1 
ATOM   1804 C  CD2   . PHE A 1 243 ? -2.561  0.375   10.154  1.00   32.17 ? 243  PHE A CD2   1 
ATOM   1805 C  CE1   . PHE A 1 243 ? -1.496  2.917   10.597  1.00   29.57 ? 243  PHE A CE1   1 
ATOM   1806 C  CE2   . PHE A 1 243 ? -3.374  1.516   9.983   1.00   31.72 ? 243  PHE A CE2   1 
ATOM   1807 C  CZ    . PHE A 1 243 ? -2.836  2.793   10.204  1.00   30.59 ? 243  PHE A CZ    1 
ATOM   1808 N  N     . GLY A 1 244 ? -0.963  -2.228  8.075   1.00   29.79 ? 244  GLY A N     1 
ATOM   1809 C  CA    . GLY A 1 244 ? -1.772  -2.297  6.876   1.00   31.60 ? 244  GLY A CA    1 
ATOM   1810 C  C     . GLY A 1 244 ? -3.187  -1.866  7.190   1.00   33.56 ? 244  GLY A C     1 
ATOM   1811 O  O     . GLY A 1 244 ? -3.654  -2.015  8.324   1.00   33.17 ? 244  GLY A O     1 
ATOM   1812 N  N     . LYS A 1 245 ? -3.897  -1.355  6.187   1.00   35.11 ? 245  LYS A N     1 
ATOM   1813 C  CA    . LYS A 1 245 ? -5.251  -0.867  6.404   1.00   35.95 ? 245  LYS A CA    1 
ATOM   1814 C  C     . LYS A 1 245 ? -6.244  -1.268  5.315   1.00   36.04 ? 245  LYS A C     1 
ATOM   1815 O  O     . LYS A 1 245 ? -5.911  -1.318  4.140   1.00   37.20 ? 245  LYS A O     1 
ATOM   1816 C  CB    . LYS A 1 245 ? -5.201  0.647   6.510   1.00   36.87 ? 245  LYS A CB    1 
ATOM   1817 C  CG    . LYS A 1 245 ? -6.417  1.308   7.090   1.00   40.40 ? 245  LYS A CG    1 
ATOM   1818 C  CD    . LYS A 1 245 ? -6.094  2.793   7.394   1.00   43.11 ? 245  LYS A CD    1 
ATOM   1819 C  CE    . LYS A 1 245 ? -7.089  3.760   6.730   1.00   45.56 ? 245  LYS A CE    1 
ATOM   1820 N  NZ    . LYS A 1 245 ? -7.277  3.545   5.246   1.00   42.94 ? 245  LYS A NZ    1 
ATOM   1821 N  N     . PHE A 1 246 ? -7.471  -1.552  5.732   1.00   36.34 ? 246  PHE A N     1 
ATOM   1822 C  CA    . PHE A 1 246 ? -8.531  -1.885  4.798   1.00   38.16 ? 246  PHE A CA    1 
ATOM   1823 C  C     . PHE A 1 246 ? -9.745  -1.097  5.273   1.00   39.17 ? 246  PHE A C     1 
ATOM   1824 O  O     . PHE A 1 246 ? -10.244 -1.341  6.367   1.00   39.93 ? 246  PHE A O     1 
ATOM   1825 C  CB    . PHE A 1 246 ? -8.827  -3.396  4.813   1.00   36.19 ? 246  PHE A CB    1 
ATOM   1826 C  CG    . PHE A 1 246 ? -9.951  -3.799  3.899   1.00   36.20 ? 246  PHE A CG    1 
ATOM   1827 C  CD1   . PHE A 1 246 ? -10.003 -3.327  2.581   1.00   33.72 ? 246  PHE A CD1   1 
ATOM   1828 C  CD2   . PHE A 1 246 ? -10.949 -4.671  4.341   1.00   33.64 ? 246  PHE A CD2   1 
ATOM   1829 C  CE1   . PHE A 1 246 ? -11.033 -3.725  1.720   1.00   35.70 ? 246  PHE A CE1   1 
ATOM   1830 C  CE2   . PHE A 1 246 ? -11.973 -5.071  3.489   1.00   34.44 ? 246  PHE A CE2   1 
ATOM   1831 C  CZ    . PHE A 1 246 ? -12.027 -4.606  2.173   1.00   33.80 ? 246  PHE A CZ    1 
ATOM   1832 N  N     . ILE A 1 247 ? -10.222 -0.145  4.469   1.00   40.73 ? 247  ILE A N     1 
ATOM   1833 C  CA    . ILE A 1 247 ? -11.366 0.660   4.888   1.00   40.37 ? 247  ILE A CA    1 
ATOM   1834 C  C     . ILE A 1 247 ? -12.539 0.411   3.978   1.00   39.69 ? 247  ILE A C     1 
ATOM   1835 O  O     . ILE A 1 247 ? -12.393 0.358   2.767   1.00   40.40 ? 247  ILE A O     1 
ATOM   1836 C  CB    . ILE A 1 247 ? -11.044 2.184   4.903   1.00   40.80 ? 247  ILE A CB    1 
ATOM   1837 C  CG1   . ILE A 1 247 ? -12.209 2.962   5.507   1.00   43.13 ? 247  ILE A CG1   1 
ATOM   1838 C  CG2   . ILE A 1 247 ? -10.941 2.713   3.496   1.00   43.64 ? 247  ILE A CG2   1 
ATOM   1839 C  CD1   . ILE A 1 247 ? -11.864 4.385   5.960   1.00   45.25 ? 247  ILE A CD1   1 
ATOM   1840 N  N     . ARG A 1 248 ? -13.712 0.252   4.567   1.00   39.51 ? 248  ARG A N     1 
ATOM   1841 C  CA    . ARG A 1 248 ? -14.921 0.005   3.773   1.00   38.97 ? 248  ARG A CA    1 
ATOM   1842 C  C     . ARG A 1 248 ? -15.907 1.136   3.998   1.00   39.46 ? 248  ARG A C     1 
ATOM   1843 O  O     . ARG A 1 248 ? -16.251 1.453   5.137   1.00   37.89 ? 248  ARG A O     1 
ATOM   1844 C  CB    . ARG A 1 248 ? -15.591 -1.330  4.131   1.00   37.92 ? 248  ARG A CB    1 
ATOM   1845 C  CG    . ARG A 1 248 ? -14.781 -2.576  3.694   1.00   38.88 ? 248  ARG A CG    1 
ATOM   1846 C  CD    . ARG A 1 248 ? -15.549 -3.908  3.965   1.00   40.09 ? 248  ARG A CD    1 
ATOM   1847 N  NE    . ARG A 1 248 ? -16.074 -3.958  5.341   1.00   40.61 ? 248  ARG A NE    1 
ATOM   1848 C  CZ    . ARG A 1 248 ? -17.017 -4.798  5.774   1.00   39.35 ? 248  ARG A CZ    1 
ATOM   1849 N  NH1   . ARG A 1 248 ? -17.559 -5.700  4.966   1.00   39.81 ? 248  ARG A NH1   1 
ATOM   1850 N  NH2   . ARG A 1 248 ? -17.460 -4.688  7.003   1.00   38.96 ? 248  ARG A NH2   1 
ATOM   1851 N  N     . ILE A 1 249 ? -16.343 1.753   2.907   1.00   38.75 ? 249  ILE A N     1 
ATOM   1852 C  CA    . ILE A 1 249 ? -17.299 2.840   2.977   1.00   38.04 ? 249  ILE A CA    1 
ATOM   1853 C  C     . ILE A 1 249 ? -18.609 2.250   2.496   1.00   37.70 ? 249  ILE A C     1 
ATOM   1854 O  O     . ILE A 1 249 ? -18.754 1.933   1.321   1.00   37.61 ? 249  ILE A O     1 
ATOM   1855 C  CB    . ILE A 1 249 ? -16.913 4.006   2.034   1.00   39.08 ? 249  ILE A CB    1 
ATOM   1856 C  CG1   . ILE A 1 249 ? -15.536 4.562   2.397   1.00   40.18 ? 249  ILE A CG1   1 
ATOM   1857 C  CG2   . ILE A 1 249 ? -17.920 5.103   2.151   1.00   38.77 ? 249  ILE A CG2   1 
ATOM   1858 C  CD1   . ILE A 1 249 ? -15.428 5.001   3.823   1.00   40.58 ? 249  ILE A CD1   1 
ATOM   1859 N  N     . HIS A 1 250 ? -19.571 2.090   3.401   1.00   38.97 ? 250  HIS A N     1 
ATOM   1860 C  CA    . HIS A 1 250 ? -20.864 1.518   3.034   1.00   39.99 ? 250  HIS A CA    1 
ATOM   1861 C  C     . HIS A 1 250 ? -21.823 2.572   2.475   1.00   40.66 ? 250  HIS A C     1 
ATOM   1862 O  O     . HIS A 1 250 ? -21.836 3.716   2.942   1.00   42.25 ? 250  HIS A O     1 
ATOM   1863 C  CB    . HIS A 1 250 ? -21.483 0.844   4.249   1.00   40.90 ? 250  HIS A CB    1 
ATOM   1864 C  CG    . HIS A 1 250 ? -20.629 -0.241  4.820   1.00   41.35 ? 250  HIS A CG    1 
ATOM   1865 N  ND1   . HIS A 1 250 ? -20.580 -1.506  4.283   1.00   41.35 ? 250  HIS A ND1   1 
ATOM   1866 C  CD2   . HIS A 1 250 ? -19.720 -0.220  5.822   1.00   41.56 ? 250  HIS A CD2   1 
ATOM   1867 C  CE1   . HIS A 1 250 ? -19.673 -2.219  4.928   1.00   41.59 ? 250  HIS A CE1   1 
ATOM   1868 N  NE2   . HIS A 1 250 ? -19.134 -1.458  5.866   1.00   40.23 ? 250  HIS A NE2   1 
ATOM   1869 N  N     . PHE A 1 251 ? -22.615 2.197   1.487   1.00   41.72 ? 251  PHE A N     1 
ATOM   1870 C  CA    . PHE A 1 251 ? -23.558 3.134   0.902   1.00   42.98 ? 251  PHE A CA    1 
ATOM   1871 C  C     . PHE A 1 251 ? -25.004 2.674   1.088   1.00   43.58 ? 251  PHE A C     1 
ATOM   1872 O  O     . PHE A 1 251 ? -25.325 1.503   0.893   1.00   44.55 ? 251  PHE A O     1 
ATOM   1873 C  CB    . PHE A 1 251 ? -23.240 3.335   -0.579  1.00   40.78 ? 251  PHE A CB    1 
ATOM   1874 C  CG    . PHE A 1 251 ? -21.887 3.926   -0.832  1.00   39.76 ? 251  PHE A CG    1 
ATOM   1875 C  CD1   . PHE A 1 251 ? -20.736 3.128   -0.760  1.00   38.18 ? 251  PHE A CD1   1 
ATOM   1876 C  CD2   . PHE A 1 251 ? -21.757 5.277   -1.181  1.00   37.18 ? 251  PHE A CD2   1 
ATOM   1877 C  CE1   . PHE A 1 251 ? -19.485 3.666   -1.042  1.00   37.44 ? 251  PHE A CE1   1 
ATOM   1878 C  CE2   . PHE A 1 251 ? -20.518 5.819   -1.460  1.00   36.82 ? 251  PHE A CE2   1 
ATOM   1879 C  CZ    . PHE A 1 251 ? -19.371 5.017   -1.396  1.00   37.15 ? 251  PHE A CZ    1 
ATOM   1880 N  N     . GLY A 1 252 ? -25.868 3.616   1.472   1.00   45.27 ? 252  GLY A N     1 
ATOM   1881 C  CA    . GLY A 1 252 ? -27.269 3.314   1.709   1.00   46.38 ? 252  GLY A CA    1 
ATOM   1882 C  C     . GLY A 1 252 ? -28.142 3.320   0.463   1.00   46.50 ? 252  GLY A C     1 
ATOM   1883 O  O     . GLY A 1 252 ? -27.627 3.424   -0.650  1.00   47.20 ? 252  GLY A O     1 
ATOM   1884 N  N     . PRO A 1 253 ? -29.474 3.217   0.624   1.00   46.30 ? 253  PRO A N     1 
ATOM   1885 C  CA    . PRO A 1 253 ? -30.468 3.195   -0.460  1.00   47.21 ? 253  PRO A CA    1 
ATOM   1886 C  C     . PRO A 1 253 ? -30.340 4.319   -1.500  1.00   48.03 ? 253  PRO A C     1 
ATOM   1887 O  O     . PRO A 1 253 ? -30.364 4.039   -2.700  1.00   48.07 ? 253  PRO A O     1 
ATOM   1888 C  CB    . PRO A 1 253 ? -31.808 3.265   0.289   1.00   47.27 ? 253  PRO A CB    1 
ATOM   1889 C  CG    . PRO A 1 253 ? -31.478 2.706   1.659   1.00   45.98 ? 253  PRO A CG    1 
ATOM   1890 C  CD    . PRO A 1 253 ? -30.135 3.319   1.938   1.00   46.56 ? 253  PRO A CD    1 
ATOM   1891 N  N     . THR A 1 254 ? -30.195 5.570   -1.068  1.00   48.77 ? 254  THR A N     1 
ATOM   1892 C  CA    . THR A 1 254 ? -30.083 6.670   -2.035  1.00   49.47 ? 254  THR A CA    1 
ATOM   1893 C  C     . THR A 1 254 ? -28.692 6.836   -2.665  1.00   50.02 ? 254  THR A C     1 
ATOM   1894 O  O     . THR A 1 254 ? -28.477 7.750   -3.458  1.00   49.57 ? 254  THR A O     1 
ATOM   1895 C  CB    . THR A 1 254 ? -30.501 8.021   -1.423  1.00   50.24 ? 254  THR A CB    1 
ATOM   1896 O  OG1   . THR A 1 254 ? -29.671 8.305   -0.300  1.00   51.96 ? 254  THR A OG1   1 
ATOM   1897 C  CG2   . THR A 1 254 ? -31.949 7.986   -0.948  1.00   51.21 ? 254  THR A CG2   1 
ATOM   1898 N  N     . GLY A 1 255 ? -27.750 5.948   -2.319  1.00   49.39 ? 255  GLY A N     1 
ATOM   1899 C  CA    . GLY A 1 255 ? -26.408 6.025   -2.889  1.00   47.98 ? 255  GLY A CA    1 
ATOM   1900 C  C     . GLY A 1 255 ? -25.475 6.947   -2.124  1.00   47.68 ? 255  GLY A C     1 
ATOM   1901 O  O     . GLY A 1 255 ? -24.413 7.323   -2.616  1.00   47.14 ? 255  GLY A O     1 
ATOM   1902 N  N     . LYS A 1 256 ? -25.894 7.316   -0.916  1.00   46.25 ? 256  LYS A N     1 
ATOM   1903 C  CA    . LYS A 1 256 ? -25.119 8.183   -0.055  1.00   44.53 ? 256  LYS A CA    1 
ATOM   1904 C  C     . LYS A 1 256 ? -24.462 7.307   1.014   1.00   43.31 ? 256  LYS A C     1 
ATOM   1905 O  O     . LYS A 1 256 ? -24.950 6.217   1.326   1.00   41.60 ? 256  LYS A O     1 
ATOM   1906 C  CB    . LYS A 1 256 ? -26.027 9.242   0.598   1.00   45.24 ? 256  LYS A CB    1 
ATOM   1907 C  CG    . LYS A 1 256 ? -26.703 10.192  -0.403  1.00   45.93 ? 256  LYS A CG    1 
ATOM   1908 C  CD    . LYS A 1 256 ? -25.669 10.960  -1.242  1.00   47.57 ? 256  LYS A CD    1 
ATOM   1909 C  CE    . LYS A 1 256 ? -26.324 11.915  -2.250  1.00   47.75 ? 256  LYS A CE    1 
ATOM   1910 N  NZ    . LYS A 1 256 ? -26.908 11.213  -3.425  1.00   49.27 ? 256  LYS A NZ    1 
ATOM   1911 N  N     . ILE A 1 257 ? -23.356 7.795   1.569   1.00   40.80 ? 257  ILE A N     1 
ATOM   1912 C  CA    . ILE A 1 257 ? -22.598 7.077   2.569   1.00   39.10 ? 257  ILE A CA    1 
ATOM   1913 C  C     . ILE A 1 257 ? -23.400 6.709   3.804   1.00   40.20 ? 257  ILE A C     1 
ATOM   1914 O  O     . ILE A 1 257 ? -23.871 7.567   4.546   1.00   41.22 ? 257  ILE A O     1 
ATOM   1915 C  CB    . ILE A 1 257 ? -21.367 7.896   2.954   1.00   37.83 ? 257  ILE A CB    1 
ATOM   1916 C  CG1   . ILE A 1 257 ? -20.417 7.951   1.757   1.00   34.63 ? 257  ILE A CG1   1 
ATOM   1917 C  CG2   . ILE A 1 257 ? -20.661 7.287   4.190   1.00   36.34 ? 257  ILE A CG2   1 
ATOM   1918 C  CD1   . ILE A 1 257 ? -19.347 9.077   1.864   1.00   31.61 ? 257  ILE A CD1   1 
ATOM   1919 N  N     . ALA A 1 258 ? -23.544 5.407   4.027   1.00   41.77 ? 258  ALA A N     1 
ATOM   1920 C  CA    . ALA A 1 258 ? -24.297 4.890   5.170   1.00   41.79 ? 258  ALA A CA    1 
ATOM   1921 C  C     . ALA A 1 258 ? -23.451 4.708   6.439   1.00   42.30 ? 258  ALA A C     1 
ATOM   1922 O  O     . ALA A 1 258 ? -23.951 4.876   7.544   1.00   43.65 ? 258  ALA A O     1 
ATOM   1923 C  CB    . ALA A 1 258 ? -24.957 3.574   4.780   1.00   42.48 ? 258  ALA A CB    1 
ATOM   1924 N  N     . GLY A 1 259 ? -22.176 4.372   6.285   1.00   42.67 ? 259  GLY A N     1 
ATOM   1925 C  CA    . GLY A 1 259 ? -21.302 4.180   7.440   1.00   39.61 ? 259  GLY A CA    1 
ATOM   1926 C  C     . GLY A 1 259 ? -19.951 3.674   6.962   1.00   39.03 ? 259  GLY A C     1 
ATOM   1927 O  O     . GLY A 1 259 ? -19.643 3.777   5.763   1.00   37.06 ? 259  GLY A O     1 
ATOM   1928 N  N     . ALA A 1 260 ? -19.138 3.120   7.866   1.00   36.78 ? 260  ALA A N     1 
ATOM   1929 C  CA    . ALA A 1 260 ? -17.821 2.609   7.485   1.00   37.26 ? 260  ALA A CA    1 
ATOM   1930 C  C     . ALA A 1 260 ? -17.114 1.923   8.648   1.00   37.54 ? 260  ALA A C     1 
ATOM   1931 O  O     . ALA A 1 260 ? -17.432 2.181   9.801   1.00   37.45 ? 260  ALA A O     1 
ATOM   1932 C  CB    . ALA A 1 260 ? -16.944 3.748   6.986   1.00   35.40 ? 260  ALA A CB    1 
ATOM   1933 N  N     . ASP A 1 261 ? -16.154 1.049   8.327   1.00   38.57 ? 261  ASP A N     1 
ATOM   1934 C  CA    . ASP A 1 261 ? -15.334 0.377   9.342   1.00   40.22 ? 261  ASP A CA    1 
ATOM   1935 C  C     . ASP A 1 261 ? -13.905 0.228   8.836   1.00   41.44 ? 261  ASP A C     1 
ATOM   1936 O  O     . ASP A 1 261 ? -13.637 0.368   7.635   1.00   42.44 ? 261  ASP A O     1 
ATOM   1937 C  CB    . ASP A 1 261 ? -15.898 -0.989  9.782   1.00   40.00 ? 261  ASP A CB    1 
ATOM   1938 C  CG    . ASP A 1 261 ? -16.417 -1.820  8.641   1.00   42.67 ? 261  ASP A CG    1 
ATOM   1939 O  OD1   . ASP A 1 261 ? -15.702 -2.062  7.632   1.00   41.08 ? 261  ASP A OD1   1 
ATOM   1940 O  OD2   . ASP A 1 261 ? -17.577 -2.263  8.771   1.00   45.63 ? 261  ASP A OD2   1 
ATOM   1941 N  N     . ILE A 1 262 ? -12.991 -0.064  9.754   1.00   42.09 ? 262  ILE A N     1 
ATOM   1942 C  CA    . ILE A 1 262 ? -11.577 -0.162  9.457   1.00   43.02 ? 262  ILE A CA    1 
ATOM   1943 C  C     . ILE A 1 262 ? -10.877 -1.383  10.090  1.00   44.29 ? 262  ILE A C     1 
ATOM   1944 O  O     . ILE A 1 262 ? -11.066 -1.671  11.273  1.00   45.54 ? 262  ILE A O     1 
ATOM   1945 C  CB    . ILE A 1 262 ? -10.908 1.126   9.971   1.00   43.42 ? 262  ILE A CB    1 
ATOM   1946 C  CG1   . ILE A 1 262 ? -11.468 2.322   9.197   1.00   44.23 ? 262  ILE A CG1   1 
ATOM   1947 C  CG2   . ILE A 1 262 ? -9.398  1.001   9.935   1.00   42.62 ? 262  ILE A CG2   1 
ATOM   1948 C  CD1   . ILE A 1 262 ? -10.877 3.680   9.622   1.00   45.77 ? 262  ILE A CD1   1 
ATOM   1949 N  N     . GLU A 1 263 ? -10.077 -2.088  9.294   1.00   44.29 ? 263  GLU A N     1 
ATOM   1950 C  CA    . GLU A 1 263 ? -9.308  -3.250  9.746   1.00   44.00 ? 263  GLU A CA    1 
ATOM   1951 C  C     . GLU A 1 263 ? -7.862  -2.829  9.562   1.00   43.09 ? 263  GLU A C     1 
ATOM   1952 O  O     . GLU A 1 263 ? -7.504  -2.221  8.550   1.00   43.49 ? 263  GLU A O     1 
ATOM   1953 C  CB    . GLU A 1 263 ? -9.561  -4.486  8.864   1.00   45.88 ? 263  GLU A CB    1 
ATOM   1954 C  CG    . GLU A 1 263 ? -10.953 -5.137  8.943   1.00   50.39 ? 263  GLU A CG    1 
ATOM   1955 C  CD    . GLU A 1 263 ? -11.129 -6.034  10.174  1.00   53.06 ? 263  GLU A CD    1 
ATOM   1956 O  OE1   . GLU A 1 263 ? -10.099 -6.531  10.708  1.00   53.94 ? 263  GLU A OE1   1 
ATOM   1957 O  OE2   . GLU A 1 263 ? -12.296 -6.247  10.597  1.00   53.30 ? 263  GLU A OE2   1 
ATOM   1958 N  N     . THR A 1 264 ? -7.041  -3.145  10.536  1.00   41.32 ? 264  THR A N     1 
ATOM   1959 C  CA    . THR A 1 264 ? -5.636  -2.823  10.502  1.00   39.15 ? 264  THR A CA    1 
ATOM   1960 C  C     . THR A 1 264 ? -4.946  -4.167  10.629  1.00   38.14 ? 264  THR A C     1 
ATOM   1961 O  O     . THR A 1 264 ? -5.501  -5.116  11.171  1.00   37.11 ? 264  THR A O     1 
ATOM   1962 C  CB    . THR A 1 264 ? -5.224  -1.945  11.695  1.00   39.75 ? 264  THR A CB    1 
ATOM   1963 O  OG1   . THR A 1 264 ? -5.414  -2.687  12.913  1.00   40.02 ? 264  THR A OG1   1 
ATOM   1964 C  CG2   . THR A 1 264 ? -6.047  -0.651  11.721  1.00   37.45 ? 264  THR A CG2   1 
ATOM   1965 N  N     . TYR A 1 265 ? -3.721  -4.228  10.109  1.00   36.17 ? 265  TYR A N     1 
ATOM   1966 C  CA    . TYR A 1 265 ? -2.943  -5.445  10.139  1.00   34.62 ? 265  TYR A CA    1 
ATOM   1967 C  C     . TYR A 1 265 ? -1.490  -5.152  10.456  1.00   34.47 ? 265  TYR A C     1 
ATOM   1968 O  O     . TYR A 1 265 ? -0.924  -4.106  10.065  1.00   32.09 ? 265  TYR A O     1 
ATOM   1969 C  CB    . TYR A 1 265 ? -2.996  -6.145  8.786   1.00   33.84 ? 265  TYR A CB    1 
ATOM   1970 C  CG    . TYR A 1 265 ? -4.360  -6.214  8.157   1.00   34.63 ? 265  TYR A CG    1 
ATOM   1971 C  CD1   . TYR A 1 265 ? -5.193  -7.308  8.384   1.00   35.03 ? 265  TYR A CD1   1 
ATOM   1972 C  CD2   . TYR A 1 265 ? -4.834  -5.178  7.346   1.00   34.03 ? 265  TYR A CD2   1 
ATOM   1973 C  CE1   . TYR A 1 265 ? -6.465  -7.374  7.818   1.00   34.75 ? 265  TYR A CE1   1 
ATOM   1974 C  CE2   . TYR A 1 265 ? -6.118  -5.227  6.782   1.00   34.47 ? 265  TYR A CE2   1 
ATOM   1975 C  CZ    . TYR A 1 265 ? -6.923  -6.327  7.017   1.00   35.42 ? 265  TYR A CZ    1 
ATOM   1976 O  OH    . TYR A 1 265 ? -8.174  -6.438  6.446   1.00   35.68 ? 265  TYR A OH    1 
ATOM   1977 N  N     . LEU A 1 266 ? -0.897  -6.090  11.175  1.00   32.04 ? 266  LEU A N     1 
ATOM   1978 C  CA    . LEU A 1 266 ? 0.512   -6.063  11.533  1.00   30.88 ? 266  LEU A CA    1 
ATOM   1979 C  C     . LEU A 1 266 ? 1.189   -4.796  12.007  1.00   31.07 ? 266  LEU A C     1 
ATOM   1980 O  O     . LEU A 1 266 ? 2.135   -4.327  11.381  1.00   32.37 ? 266  LEU A O     1 
ATOM   1981 C  CB    . LEU A 1 266 ? 1.314   -6.643  10.368  1.00   30.30 ? 266  LEU A CB    1 
ATOM   1982 C  CG    . LEU A 1 266 ? 0.707   -7.984  9.914   1.00   30.63 ? 266  LEU A CG    1 
ATOM   1983 C  CD1   . LEU A 1 266 ? 1.419   -8.482  8.684   1.00   28.14 ? 266  LEU A CD1   1 
ATOM   1984 C  CD2   . LEU A 1 266 ? 0.827   -8.990  11.080  1.00   28.74 ? 266  LEU A CD2   1 
ATOM   1985 N  N     . LEU A 1 267 ? 0.761   -4.248  13.134  1.00   32.35 ? 267  LEU A N     1 
ATOM   1986 C  CA    . LEU A 1 267 ? 1.430   -3.071  13.654  1.00   34.57 ? 267  LEU A CA    1 
ATOM   1987 C  C     . LEU A 1 267 ? 2.861   -3.510  14.035  1.00   37.82 ? 267  LEU A C     1 
ATOM   1988 O  O     . LEU A 1 267 ? 3.039   -4.553  14.672  1.00   38.60 ? 267  LEU A O     1 
ATOM   1989 C  CB    . LEU A 1 267 ? 0.675   -2.533  14.864  1.00   34.30 ? 267  LEU A CB    1 
ATOM   1990 C  CG    . LEU A 1 267 ? 1.166   -1.203  15.458  1.00   35.63 ? 267  LEU A CG    1 
ATOM   1991 C  CD1   . LEU A 1 267 ? 1.135   -0.096  14.411  1.00   35.47 ? 267  LEU A CD1   1 
ATOM   1992 C  CD2   . LEU A 1 267 ? 0.311   -0.831  16.634  1.00   36.20 ? 267  LEU A CD2   1 
ATOM   1993 N  N     . GLU A 1 268 ? 3.863   -2.731  13.646  1.00   39.15 ? 268  GLU A N     1 
ATOM   1994 C  CA    . GLU A 1 268 ? 5.261   -3.032  13.929  1.00   40.14 ? 268  GLU A CA    1 
ATOM   1995 C  C     . GLU A 1 268 ? 5.583   -2.750  15.394  1.00   41.81 ? 268  GLU A C     1 
ATOM   1996 O  O     . GLU A 1 268 ? 5.971   -1.635  15.752  1.00   38.94 ? 268  GLU A O     1 
ATOM   1997 C  CB    . GLU A 1 268 ? 6.155   -2.169  13.031  1.00   41.72 ? 268  GLU A CB    1 
ATOM   1998 C  CG    . GLU A 1 268 ? 7.658   -2.464  13.125  1.00   45.96 ? 268  GLU A CG    1 
ATOM   1999 C  CD    . GLU A 1 268 ? 8.505   -1.592  12.187  1.00   47.64 ? 268  GLU A CD    1 
ATOM   2000 O  OE1   . GLU A 1 268 ? 8.614   -0.373  12.412  1.00   48.14 ? 268  GLU A OE1   1 
ATOM   2001 O  OE2   . GLU A 1 268 ? 9.079   -2.134  11.217  1.00   50.70 ? 268  GLU A OE2   1 
ATOM   2002 N  N     . LYS A 1 269 ? 5.442   -3.752  16.247  1.00   43.94 ? 269  LYS A N     1 
ATOM   2003 C  CA    . LYS A 1 269 ? 5.701   -3.575  17.679  1.00   44.57 ? 269  LYS A CA    1 
ATOM   2004 C  C     . LYS A 1 269 ? 7.131   -3.182  18.107  1.00   44.44 ? 269  LYS A C     1 
ATOM   2005 O  O     . LYS A 1 269 ? 7.296   -2.352  18.999  1.00   43.30 ? 269  LYS A O     1 
ATOM   2006 C  CB    . LYS A 1 269 ? 5.269   -4.830  18.403  1.00   46.80 ? 269  LYS A CB    1 
ATOM   2007 C  CG    . LYS A 1 269 ? 4.178   -5.579  17.629  1.00   52.33 ? 269  LYS A CG    1 
ATOM   2008 C  CD    . LYS A 1 269 ? 2.958   -5.890  18.495  1.00   56.23 ? 269  LYS A CD    1 
ATOM   2009 C  CE    . LYS A 1 269 ? 3.328   -6.674  19.759  1.00   57.88 ? 269  LYS A CE    1 
ATOM   2010 N  NZ    . LYS A 1 269 ? 2.229   -6.593  20.794  1.00   60.00 ? 269  LYS A NZ    1 
ATOM   2011 N  N     . SER A 1 270 ? 8.156   -3.749  17.474  1.00   45.04 ? 270  SER A N     1 
ATOM   2012 C  CA    . SER A 1 270 ? 9.529   -3.446  17.890  1.00   45.21 ? 270  SER A CA    1 
ATOM   2013 C  C     . SER A 1 270 ? 9.957   -1.999  17.790  1.00   44.72 ? 270  SER A C     1 
ATOM   2014 O  O     . SER A 1 270 ? 10.886  -1.569  18.487  1.00   44.49 ? 270  SER A O     1 
ATOM   2015 C  CB    . SER A 1 270 ? 10.530  -4.318  17.124  1.00   47.32 ? 270  SER A CB    1 
ATOM   2016 O  OG    . SER A 1 270 ? 10.616  -3.950  15.762  1.00   49.26 ? 270  SER A OG    1 
ATOM   2017 N  N     . ARG A 1 271 ? 9.300   -1.226  16.925  1.00   41.87 ? 271  ARG A N     1 
ATOM   2018 C  CA    . ARG A 1 271 ? 9.667   0.182   16.774  1.00   39.59 ? 271  ARG A CA    1 
ATOM   2019 C  C     . ARG A 1 271 ? 9.440   0.918   18.085  1.00   39.25 ? 271  ARG A C     1 
ATOM   2020 O  O     . ARG A 1 271 ? 10.155  1.860   18.410  1.00   37.92 ? 271  ARG A O     1 
ATOM   2021 C  CB    . ARG A 1 271 ? 8.819   0.827   15.651  1.00   37.14 ? 271  ARG A CB    1 
ATOM   2022 C  CG    . ARG A 1 271 ? 9.218   2.262   15.323  1.00   37.00 ? 271  ARG A CG    1 
ATOM   2023 C  CD    . ARG A 1 271 ? 8.597   2.709   13.983  1.00   35.79 ? 271  ARG A CD    1 
ATOM   2024 N  NE    . ARG A 1 271 ? 9.123   1.919   12.864  1.00   30.73 ? 271  ARG A NE    1 
ATOM   2025 C  CZ    . ARG A 1 271 ? 10.255  2.193   12.226  1.00   29.43 ? 271  ARG A CZ    1 
ATOM   2026 N  NH1   . ARG A 1 271 ? 10.990  3.239   12.563  1.00   26.20 ? 271  ARG A NH1   1 
ATOM   2027 N  NH2   . ARG A 1 271 ? 10.666  1.394   11.257  1.00   32.54 ? 271  ARG A NH2   1 
ATOM   2028 N  N     . VAL A 1 272 ? 8.439   0.478   18.842  1.00   39.81 ? 272  VAL A N     1 
ATOM   2029 C  CA    . VAL A 1 272 ? 8.107   1.092   20.126  1.00   40.02 ? 272  VAL A CA    1 
ATOM   2030 C  C     . VAL A 1 272 ? 9.275   1.244   21.119  1.00   40.90 ? 272  VAL A C     1 
ATOM   2031 O  O     . VAL A 1 272 ? 9.246   2.148   21.952  1.00   41.33 ? 272  VAL A O     1 
ATOM   2032 C  CB    . VAL A 1 272 ? 6.954   0.312   20.799  1.00   42.16 ? 272  VAL A CB    1 
ATOM   2033 C  CG1   . VAL A 1 272 ? 6.775   0.757   22.265  1.00   43.03 ? 272  VAL A CG1   1 
ATOM   2034 C  CG2   . VAL A 1 272 ? 5.659   0.544   19.983  1.00   44.04 ? 272  VAL A CG2   1 
ATOM   2035 N  N     . THR A 1 273 ? 10.289  0.394   21.038  1.00   40.76 ? 273  THR A N     1 
ATOM   2036 C  CA    . THR A 1 273 ? 11.435  0.517   21.950  1.00   42.43 ? 273  THR A CA    1 
ATOM   2037 C  C     . THR A 1 273 ? 12.747  0.553   21.206  1.00   44.69 ? 273  THR A C     1 
ATOM   2038 O  O     . THR A 1 273 ? 13.805  0.755   21.811  1.00   46.45 ? 273  THR A O     1 
ATOM   2039 C  CB    . THR A 1 273 ? 11.533  -0.659  22.956  1.00   40.29 ? 273  THR A CB    1 
ATOM   2040 O  OG1   . THR A 1 273 ? 11.539  -1.904  22.239  1.00   39.21 ? 273  THR A OG1   1 
ATOM   2041 C  CG2   . THR A 1 273 ? 10.375  -0.635  23.931  1.00   38.31 ? 273  THR A CG2   1 
ATOM   2042 N  N     . TYR A 1 274 ? 12.704  0.359   19.888  1.00   48.38 ? 274  TYR A N     1 
ATOM   2043 C  CA    . TYR A 1 274 ? 13.936  0.370   19.100  1.00   51.44 ? 274  TYR A CA    1 
ATOM   2044 C  C     . TYR A 1 274 ? 13.851  1.117   17.777  1.00   51.65 ? 274  TYR A C     1 
ATOM   2045 O  O     . TYR A 1 274 ? 12.909  0.921   17.008  1.00   53.41 ? 274  TYR A O     1 
ATOM   2046 C  CB    . TYR A 1 274 ? 14.401  -1.069  18.821  1.00   54.18 ? 274  TYR A CB    1 
ATOM   2047 C  CG    . TYR A 1 274 ? 15.537  -1.163  17.812  1.00   58.03 ? 274  TYR A CG    1 
ATOM   2048 C  CD1   . TYR A 1 274 ? 16.817  -0.685  18.116  1.00   58.85 ? 274  TYR A CD1   1 
ATOM   2049 C  CD2   . TYR A 1 274 ? 15.311  -1.676  16.529  1.00   59.90 ? 274  TYR A CD2   1 
ATOM   2050 C  CE1   . TYR A 1 274 ? 17.845  -0.710  17.169  1.00   60.24 ? 274  TYR A CE1   1 
ATOM   2051 C  CE2   . TYR A 1 274 ? 16.332  -1.703  15.566  1.00   60.96 ? 274  TYR A CE2   1 
ATOM   2052 C  CZ    . TYR A 1 274 ? 17.598  -1.216  15.889  1.00   61.19 ? 274  TYR A CZ    1 
ATOM   2053 O  OH    . TYR A 1 274 ? 18.588  -1.203  14.917  1.00   60.83 ? 274  TYR A OH    1 
ATOM   2054 N  N     . GLN A 1 275 ? 14.828  1.972   17.519  1.00   52.02 ? 275  GLN A N     1 
ATOM   2055 C  CA    . GLN A 1 275 ? 14.905  2.683   16.257  1.00   52.29 ? 275  GLN A CA    1 
ATOM   2056 C  C     . GLN A 1 275 ? 16.313  2.606   15.696  1.00   53.07 ? 275  GLN A C     1 
ATOM   2057 O  O     . GLN A 1 275 ? 17.297  2.730   16.420  1.00   52.97 ? 275  GLN A O     1 
ATOM   2058 C  CB    . GLN A 1 275 ? 14.529  4.151   16.391  1.00   49.80 ? 275  GLN A CB    1 
ATOM   2059 C  CG    . GLN A 1 275 ? 13.153  4.378   16.923  1.00   47.17 ? 275  GLN A CG    1 
ATOM   2060 C  CD    . GLN A 1 275 ? 13.162  4.427   18.429  1.00   45.60 ? 275  GLN A CD    1 
ATOM   2061 O  OE1   . GLN A 1 275 ? 13.892  5.234   19.018  1.00   42.52 ? 275  GLN A OE1   1 
ATOM   2062 N  NE2   . GLN A 1 275 ? 12.359  3.563   19.066  1.00   43.56 ? 275  GLN A NE2   1 
ATOM   2063 N  N     . GLN A 1 276 ? 16.385  2.401   14.379  1.00   54.67 ? 276  GLN A N     1 
ATOM   2064 C  CA    . GLN A 1 276 ? 17.633  2.322   13.638  1.00   56.48 ? 276  GLN A CA    1 
ATOM   2065 C  C     . GLN A 1 276 ? 18.128  3.755   13.457  1.00   57.19 ? 276  GLN A C     1 
ATOM   2066 O  O     . GLN A 1 276 ? 17.441  4.704   13.832  1.00   56.41 ? 276  GLN A O     1 
ATOM   2067 C  CB    . GLN A 1 276 ? 17.394  1.749   12.235  1.00   59.64 ? 276  GLN A CB    1 
ATOM   2068 C  CG    . GLN A 1 276 ? 16.709  0.394   12.106  1.00   63.44 ? 276  GLN A CG    1 
ATOM   2069 C  CD    . GLN A 1 276 ? 16.298  0.141   10.658  1.00   66.04 ? 276  GLN A CD    1 
ATOM   2070 O  OE1   . GLN A 1 276 ? 16.994  0.569   9.729   1.00   67.03 ? 276  GLN A OE1   1 
ATOM   2071 N  NE2   . GLN A 1 276 ? 15.181  -0.551  10.456  1.00   66.56 ? 276  GLN A NE2   1 
ATOM   2072 N  N     . SER A 1 277 ? 19.310  3.902   12.874  1.00   55.58 ? 277  SER A N     1 
ATOM   2073 C  CA    . SER A 1 277 ? 19.880  5.214   12.601  1.00   53.07 ? 277  SER A CA    1 
ATOM   2074 C  C     . SER A 1 277 ? 19.001  5.934   11.574  1.00   51.26 ? 277  SER A C     1 
ATOM   2075 O  O     . SER A 1 277 ? 18.590  5.333   10.576  1.00   47.80 ? 277  SER A O     1 
ATOM   2076 C  CB    . SER A 1 277 ? 21.300  5.054   12.022  1.00   54.59 ? 277  SER A CB    1 
ATOM   2077 O  OG    . SER A 1 277 ? 21.773  6.247   11.393  1.00   59.34 ? 277  SER A OG    1 
ATOM   2078 N  N     . ALA A 1 278 ? 18.711  7.207   11.821  1.00   47.17 ? 278  ALA A N     1 
ATOM   2079 C  CA    . ALA A 1 278 ? 17.895  8.003   10.900  1.00   44.62 ? 278  ALA A CA    1 
ATOM   2080 C  C     . ALA A 1 278 ? 16.394  7.706   10.904  1.00   43.26 ? 278  ALA A C     1 
ATOM   2081 O  O     . ALA A 1 278 ? 15.682  8.122   9.993   1.00   41.92 ? 278  ALA A O     1 
ATOM   2082 C  CB    . ALA A 1 278 ? 18.439  7.876   9.471   1.00   44.46 ? 278  ALA A CB    1 
ATOM   2083 N  N     . GLU A 1 279 ? 15.916  6.984   11.915  1.00   41.81 ? 279  GLU A N     1 
ATOM   2084 C  CA    . GLU A 1 279 ? 14.491  6.698   12.010  1.00   40.64 ? 279  GLU A CA    1 
ATOM   2085 C  C     . GLU A 1 279 ? 13.952  7.232   13.342  1.00   39.68 ? 279  GLU A C     1 
ATOM   2086 O  O     . GLU A 1 279 ? 14.711  7.703   14.179  1.00   39.45 ? 279  GLU A O     1 
ATOM   2087 C  CB    . GLU A 1 279 ? 14.220  5.202   11.891  1.00   40.25 ? 279  GLU A CB    1 
ATOM   2088 C  CG    . GLU A 1 279 ? 14.854  4.573   10.683  1.00   42.56 ? 279  GLU A CG    1 
ATOM   2089 C  CD    . GLU A 1 279 ? 13.969  3.522   10.051  1.00   44.55 ? 279  GLU A CD    1 
ATOM   2090 O  OE1   . GLU A 1 279 ? 13.299  2.749   10.793  1.00   46.94 ? 279  GLU A OE1   1 
ATOM   2091 O  OE2   . GLU A 1 279 ? 13.949  3.456   8.801   1.00   44.83 ? 279  GLU A OE2   1 
ATOM   2092 N  N     . ARG A 1 280 ? 12.638  7.136   13.513  1.00   39.24 ? 280  ARG A N     1 
ATOM   2093 C  CA    . ARG A 1 280 ? 11.955  7.612   14.693  1.00   37.83 ? 280  ARG A CA    1 
ATOM   2094 C  C     . ARG A 1 280 ? 10.921  6.599   15.146  1.00   37.66 ? 280  ARG A C     1 
ATOM   2095 O  O     . ARG A 1 280 ? 10.575  5.680   14.418  1.00   37.33 ? 280  ARG A O     1 
ATOM   2096 C  CB    . ARG A 1 280 ? 11.184  8.905   14.397  1.00   38.23 ? 280  ARG A CB    1 
ATOM   2097 C  CG    . ARG A 1 280 ? 12.006  10.060  13.938  1.00   38.32 ? 280  ARG A CG    1 
ATOM   2098 C  CD    . ARG A 1 280 ? 11.359  11.323  14.431  1.00   38.79 ? 280  ARG A CD    1 
ATOM   2099 N  NE    . ARG A 1 280 ? 9.933   11.428  14.103  1.00   38.29 ? 280  ARG A NE    1 
ATOM   2100 C  CZ    . ARG A 1 280 ? 9.229   12.539  14.337  1.00   37.69 ? 280  ARG A CZ    1 
ATOM   2101 N  NH1   . ARG A 1 280 ? 9.843   13.576  14.869  1.00   36.61 ? 280  ARG A NH1   1 
ATOM   2102 N  NH2   . ARG A 1 280 ? 7.934   12.618  14.058  1.00   34.95 ? 280  ARG A NH2   1 
ATOM   2103 N  N     . ASN A 1 281 ? 10.422  6.785   16.370  1.00   36.84 ? 281  ASN A N     1 
ATOM   2104 C  CA    . ASN A 1 281 ? 9.374   5.923   16.843  1.00   35.95 ? 281  ASN A CA    1 
ATOM   2105 C  C     . ASN A 1 281 ? 8.113   6.526   16.205  1.00   34.91 ? 281  ASN A C     1 
ATOM   2106 O  O     . ASN A 1 281 ? 8.218   7.438   15.394  1.00   34.14 ? 281  ASN A O     1 
ATOM   2107 C  CB    . ASN A 1 281 ? 9.282   6.010   18.349  1.00   35.04 ? 281  ASN A CB    1 
ATOM   2108 C  CG    . ASN A 1 281 ? 8.770   4.730   18.968  1.00   35.89 ? 281  ASN A CG    1 
ATOM   2109 O  OD1   . ASN A 1 281 ? 7.840   4.090   18.454  1.00   35.74 ? 281  ASN A OD1   1 
ATOM   2110 N  ND2   . ASN A 1 281 ? 9.377   4.341   20.078  1.00   36.91 ? 281  ASN A ND2   1 
ATOM   2111 N  N     . TYR A 1 282 ? 6.946   6.027   16.566  1.00   33.89 ? 282  TYR A N     1 
ATOM   2112 C  CA    . TYR A 1 282 ? 5.697   6.579   16.054  1.00   34.01 ? 282  TYR A CA    1 
ATOM   2113 C  C     . TYR A 1 282 ? 5.597   8.080   16.315  1.00   33.91 ? 282  TYR A C     1 
ATOM   2114 O  O     . TYR A 1 282 ? 6.090   8.577   17.324  1.00   33.82 ? 282  TYR A O     1 
ATOM   2115 C  CB    . TYR A 1 282 ? 4.531   5.835   16.693  1.00   34.57 ? 282  TYR A CB    1 
ATOM   2116 C  CG    . TYR A 1 282 ? 4.540   4.411   16.206  1.00   34.10 ? 282  TYR A CG    1 
ATOM   2117 C  CD1   . TYR A 1 282 ? 4.189   4.130   14.879  1.00   33.17 ? 282  TYR A CD1   1 
ATOM   2118 C  CD2   . TYR A 1 282 ? 5.049   3.372   17.011  1.00   32.65 ? 282  TYR A CD2   1 
ATOM   2119 C  CE1   . TYR A 1 282 ? 4.350   2.858   14.338  1.00   34.86 ? 282  TYR A CE1   1 
ATOM   2120 C  CE2   . TYR A 1 282 ? 5.212   2.073   16.479  1.00   34.64 ? 282  TYR A CE2   1 
ATOM   2121 C  CZ    . TYR A 1 282 ? 4.869   1.836   15.140  1.00   34.12 ? 282  TYR A CZ    1 
ATOM   2122 O  OH    . TYR A 1 282 ? 5.084   0.604   14.559  1.00   33.20 ? 282  TYR A OH    1 
ATOM   2123 N  N     . HIS A 1 283 ? 4.954   8.794   15.389  1.00   34.26 ? 283  HIS A N     1 
ATOM   2124 C  CA    . HIS A 1 283 ? 4.823   10.254  15.458  1.00   35.22 ? 283  HIS A CA    1 
ATOM   2125 C  C     . HIS A 1 283 ? 4.248   10.770  16.773  1.00   35.27 ? 283  HIS A C     1 
ATOM   2126 O  O     . HIS A 1 283 ? 4.611   11.850  17.231  1.00   37.05 ? 283  HIS A O     1 
ATOM   2127 C  CB    . HIS A 1 283 ? 3.929   10.791  14.298  1.00   33.26 ? 283  HIS A CB    1 
ATOM   2128 C  CG    . HIS A 1 283 ? 4.423   10.481  12.917  1.00   32.38 ? 283  HIS A CG    1 
ATOM   2129 N  ND1   . HIS A 1 283 ? 5.752   10.600  12.545  1.00   31.02 ? 283  HIS A ND1   1 
ATOM   2130 C  CD2   . HIS A 1 283 ? 3.752   10.141  11.782  1.00   30.11 ? 283  HIS A CD2   1 
ATOM   2131 C  CE1   . HIS A 1 283 ? 5.878   10.353  11.251  1.00   28.12 ? 283  HIS A CE1   1 
ATOM   2132 N  NE2   . HIS A 1 283 ? 4.680   10.072  10.762  1.00   28.84 ? 283  HIS A NE2   1 
ATOM   2133 N  N     . ILE A 1 284 ? 3.342   10.001  17.370  1.00   37.52 ? 284  ILE A N     1 
ATOM   2134 C  CA    . ILE A 1 284 ? 2.686   10.367  18.624  1.00   37.42 ? 284  ILE A CA    1 
ATOM   2135 C  C     . ILE A 1 284 ? 3.651   10.769  19.733  1.00   36.97 ? 284  ILE A C     1 
ATOM   2136 O  O     . ILE A 1 284 ? 3.444   11.784  20.411  1.00   36.92 ? 284  ILE A O     1 
ATOM   2137 C  CB    . ILE A 1 284 ? 1.760   9.206   19.110  1.00   39.35 ? 284  ILE A CB    1 
ATOM   2138 C  CG1   . ILE A 1 284 ? 0.879   9.686   20.270  1.00   40.65 ? 284  ILE A CG1   1 
ATOM   2139 C  CG2   . ILE A 1 284 ? 2.588   7.997   19.535  1.00   37.19 ? 284  ILE A CG2   1 
ATOM   2140 C  CD1   . ILE A 1 284 ? -0.033  10.868  19.919  1.00   39.88 ? 284  ILE A CD1   1 
ATOM   2141 N  N     . PHE A 1 285 ? 4.706   9.988   19.927  1.00   36.44 ? 285  PHE A N     1 
ATOM   2142 C  CA    . PHE A 1 285 ? 5.691   10.291  20.959  1.00   37.15 ? 285  PHE A CA    1 
ATOM   2143 C  C     . PHE A 1 285 ? 6.307   11.662  20.787  1.00   38.44 ? 285  PHE A C     1 
ATOM   2144 O  O     . PHE A 1 285 ? 6.517   12.373  21.775  1.00   38.94 ? 285  PHE A O     1 
ATOM   2145 C  CB    . PHE A 1 285 ? 6.798   9.246   20.979  1.00   35.53 ? 285  PHE A CB    1 
ATOM   2146 C  CG    . PHE A 1 285 ? 6.320   7.910   21.403  1.00   34.04 ? 285  PHE A CG    1 
ATOM   2147 C  CD1   . PHE A 1 285 ? 5.803   7.722   22.699  1.00   32.52 ? 285  PHE A CD1   1 
ATOM   2148 C  CD2   . PHE A 1 285 ? 6.342   6.833   20.514  1.00   32.79 ? 285  PHE A CD2   1 
ATOM   2149 C  CE1   . PHE A 1 285 ? 5.304   6.482   23.102  1.00   29.51 ? 285  PHE A CE1   1 
ATOM   2150 C  CE2   . PHE A 1 285 ? 5.850   5.594   20.906  1.00   31.92 ? 285  PHE A CE2   1 
ATOM   2151 C  CZ    . PHE A 1 285 ? 5.326   5.423   22.223  1.00   29.72 ? 285  PHE A CZ    1 
ATOM   2152 N  N     . TYR A 1 286 ? 6.601   12.064  19.554  1.00   38.40 ? 286  TYR A N     1 
ATOM   2153 C  CA    . TYR A 1 286 ? 7.185   13.386  19.390  1.00   38.99 ? 286  TYR A CA    1 
ATOM   2154 C  C     . TYR A 1 286 ? 6.120   14.452  19.539  1.00   39.13 ? 286  TYR A C     1 
ATOM   2155 O  O     . TYR A 1 286 ? 6.414   15.594  19.887  1.00   40.07 ? 286  TYR A O     1 
ATOM   2156 C  CB    . TYR A 1 286 ? 7.919   13.476  18.063  1.00   38.12 ? 286  TYR A CB    1 
ATOM   2157 C  CG    . TYR A 1 286 ? 8.858   12.307  17.951  1.00   36.93 ? 286  TYR A CG    1 
ATOM   2158 C  CD1   . TYR A 1 286 ? 8.424   11.102  17.396  1.00   35.13 ? 286  TYR A CD1   1 
ATOM   2159 C  CD2   . TYR A 1 286 ? 10.125  12.354  18.517  1.00   35.23 ? 286  TYR A CD2   1 
ATOM   2160 C  CE1   . TYR A 1 286 ? 9.192   9.980   17.429  1.00   35.58 ? 286  TYR A CE1   1 
ATOM   2161 C  CE2   . TYR A 1 286 ? 10.929  11.218  18.550  1.00   36.90 ? 286  TYR A CE2   1 
ATOM   2162 C  CZ    . TYR A 1 286 ? 10.456  10.034  18.007  1.00   37.13 ? 286  TYR A CZ    1 
ATOM   2163 O  OH    . TYR A 1 286 ? 11.204  8.877   18.080  1.00   37.62 ? 286  TYR A OH    1 
ATOM   2164 N  N     . GLN A 1 287 ? 4.876   14.068  19.299  1.00   39.88 ? 287  GLN A N     1 
ATOM   2165 C  CA    . GLN A 1 287 ? 3.760   14.973  19.493  1.00   41.29 ? 287  GLN A CA    1 
ATOM   2166 C  C     . GLN A 1 287 ? 3.611   15.210  21.004  1.00   41.55 ? 287  GLN A C     1 
ATOM   2167 O  O     . GLN A 1 287 ? 3.521   16.352  21.461  1.00   43.18 ? 287  GLN A O     1 
ATOM   2168 C  CB    . GLN A 1 287 ? 2.486   14.364  18.885  1.00   40.83 ? 287  GLN A CB    1 
ATOM   2169 C  CG    . GLN A 1 287 ? 2.493   14.489  17.328  1.00   41.16 ? 287  GLN A CG    1 
ATOM   2170 C  CD    . GLN A 1 287 ? 1.297   13.864  16.638  1.00   40.64 ? 287  GLN A CD    1 
ATOM   2171 O  OE1   . GLN A 1 287 ? 0.137   14.003  17.065  1.00   41.47 ? 287  GLN A OE1   1 
ATOM   2172 N  NE2   . GLN A 1 287 ? 1.566   13.191  15.562  1.00   39.38 ? 287  GLN A NE2   1 
ATOM   2173 N  N     . ILE A 1 288 ? 3.599   14.119  21.773  1.00   41.13 ? 288  ILE A N     1 
ATOM   2174 C  CA    . ILE A 1 288 ? 3.475   14.186  23.238  1.00   41.38 ? 288  ILE A CA    1 
ATOM   2175 C  C     . ILE A 1 288 ? 4.577   15.028  23.938  1.00   40.48 ? 288  ILE A C     1 
ATOM   2176 O  O     . ILE A 1 288 ? 4.342   15.558  25.025  1.00   40.59 ? 288  ILE A O     1 
ATOM   2177 C  CB    . ILE A 1 288 ? 3.415   12.730  23.830  1.00   40.80 ? 288  ILE A CB    1 
ATOM   2178 C  CG1   . ILE A 1 288 ? 1.964   12.323  24.051  1.00   42.45 ? 288  ILE A CG1   1 
ATOM   2179 C  CG2   . ILE A 1 288 ? 4.186   12.629  25.116  1.00   42.73 ? 288  ILE A CG2   1 
ATOM   2180 C  CD1   . ILE A 1 288 ? 1.275   11.706  22.860  1.00   42.90 ? 288  ILE A CD1   1 
ATOM   2181 N  N     . CYS A 1 289 ? 5.743   15.168  23.324  1.00   38.94 ? 289  CYS A N     1 
ATOM   2182 C  CA    . CYS A 1 289 ? 6.862   15.949  23.855  1.00   38.28 ? 289  CYS A CA    1 
ATOM   2183 C  C     . CYS A 1 289 ? 7.064   17.322  23.190  1.00   37.88 ? 289  CYS A C     1 
ATOM   2184 O  O     . CYS A 1 289 ? 8.079   17.976  23.430  1.00   35.62 ? 289  CYS A O     1 
ATOM   2185 C  CB    . CYS A 1 289 ? 8.181   15.181  23.689  1.00   37.00 ? 289  CYS A CB    1 
ATOM   2186 S  SG    . CYS A 1 289 ? 8.337   13.618  24.639  1.00   42.78 ? 289  CYS A SG    1 
ATOM   2187 N  N     . SER A 1 290 ? 6.128   17.760  22.353  1.00   39.79 ? 290  SER A N     1 
ATOM   2188 C  CA    . SER A 1 290 ? 6.306   19.030  21.629  1.00   41.65 ? 290  SER A CA    1 
ATOM   2189 C  C     . SER A 1 290 ? 5.915   20.304  22.360  1.00   44.13 ? 290  SER A C     1 
ATOM   2190 O  O     . SER A 1 290 ? 6.286   21.398  21.933  1.00   48.13 ? 290  SER A O     1 
ATOM   2191 C  CB    . SER A 1 290 ? 5.530   19.002  20.309  1.00   40.56 ? 290  SER A CB    1 
ATOM   2192 O  OG    . SER A 1 290 ? 4.137   19.115  20.534  1.00   39.35 ? 290  SER A OG    1 
ATOM   2193 N  N     . ASN A 1 291 ? 5.162   20.169  23.448  1.00   47.58 ? 291  ASN A N     1 
ATOM   2194 C  CA    . ASN A 1 291 ? 4.692   21.313  24.216  1.00   50.33 ? 291  ASN A CA    1 
ATOM   2195 C  C     . ASN A 1 291 ? 3.634   22.085  23.412  1.00   51.08 ? 291  ASN A C     1 
ATOM   2196 O  O     . ASN A 1 291 ? 3.513   23.304  23.544  1.00   53.26 ? 291  ASN A O     1 
ATOM   2197 C  CB    . ASN A 1 291 ? 5.853   22.246  24.580  1.00   49.78 ? 291  ASN A CB    1 
ATOM   2198 C  CG    . ASN A 1 291 ? 5.527   23.137  25.767  1.00   49.13 ? 291  ASN A CG    1 
ATOM   2199 O  OD1   . ASN A 1 291 ? 4.893   22.692  26.727  1.00   48.60 ? 291  ASN A OD1   1 
ATOM   2200 N  ND2   . ASN A 1 291 ? 5.966   24.394  25.717  1.00   48.92 ? 291  ASN A ND2   1 
ATOM   2201 N  N     . ALA A 1 292 ? 2.880   21.364  22.591  1.00   50.55 ? 292  ALA A N     1 
ATOM   2202 C  CA    . ALA A 1 292 ? 1.831   21.957  21.750  1.00   50.88 ? 292  ALA A CA    1 
ATOM   2203 C  C     . ALA A 1 292 ? 0.652   22.428  22.589  1.00   50.72 ? 292  ALA A C     1 
ATOM   2204 O  O     . ALA A 1 292 ? 0.000   23.425  22.266  1.00   49.33 ? 292  ALA A O     1 
ATOM   2205 C  CB    . ALA A 1 292 ? 1.351   20.931  20.702  1.00   51.14 ? 292  ALA A CB    1 
ATOM   2206 N  N     . ILE A 1 293 ? 0.384   21.678  23.658  1.00   49.08 ? 293  ILE A N     1 
ATOM   2207 C  CA    . ILE A 1 293 ? -0.691  21.976  24.589  1.00   46.67 ? 293  ILE A CA    1 
ATOM   2208 C  C     . ILE A 1 293 ? -0.066  21.801  25.969  1.00   46.33 ? 293  ILE A C     1 
ATOM   2209 O  O     . ILE A 1 293 ? -0.212  20.754  26.608  1.00   47.56 ? 293  ILE A O     1 
ATOM   2210 C  CB    . ILE A 1 293 ? -1.861  20.988  24.450  1.00   45.78 ? 293  ILE A CB    1 
ATOM   2211 C  CG1   . ILE A 1 293 ? -2.151  20.704  22.969  1.00   42.70 ? 293  ILE A CG1   1 
ATOM   2212 C  CG2   . ILE A 1 293 ? -3.090  21.579  25.109  1.00   42.70 ? 293  ILE A CG2   1 
ATOM   2213 C  CD1   . ILE A 1 293 ? -3.253  19.663  22.743  1.00   41.96 ? 293  ILE A CD1   1 
ATOM   2214 N  N     . PRO A 1 294 ? 0.642   22.832  26.438  1.00   51.62 ? 294  PRO A N     1 
ATOM   2215 C  CA    . PRO A 1 294 ? 1.335   22.875  27.732  1.00   51.82 ? 294  PRO A CA    1 
ATOM   2216 C  C     . PRO A 1 294 ? 0.546   22.321  28.916  1.00   51.89 ? 294  PRO A C     1 
ATOM   2217 O  O     . PRO A 1 294 ? 1.132   21.763  29.844  1.00   56.28 ? 294  PRO A O     1 
ATOM   2218 C  CB    . PRO A 1 294 ? 1.659   24.358  27.902  1.00   51.21 ? 294  PRO A CB    1 
ATOM   2219 C  CG    . PRO A 1 294 ? 1.835   24.818  26.512  1.00   49.13 ? 294  PRO A CG    1 
ATOM   2220 C  CD    . PRO A 1 294 ? 0.676   24.154  25.793  1.00   49.12 ? 294  PRO A CD    1 
ATOM   2221 N  N     . GLU A 1 295 ? -0.771  22.463  28.878  1.00   54.84 ? 295  GLU A N     1 
ATOM   2222 C  CA    . GLU A 1 295 ? -1.612  21.987  29.969  1.00   56.61 ? 295  GLU A CA    1 
ATOM   2223 C  C     . GLU A 1 295 ? -1.643  20.462  30.123  1.00   57.45 ? 295  GLU A C     1 
ATOM   2224 O  O     . GLU A 1 295 ? -1.871  19.955  31.229  1.00   57.72 ? 295  GLU A O     1 
ATOM   2225 C  CB    . GLU A 1 295 ? -3.031  22.528  29.811  1.00   57.64 ? 295  GLU A CB    1 
ATOM   2226 N  N     . LEU A 1 296 ? -1.423  19.722  29.032  1.00   54.69 ? 296  LEU A N     1 
ATOM   2227 C  CA    . LEU A 1 296 ? -1.434  18.259  29.109  1.00   52.50 ? 296  LEU A CA    1 
ATOM   2228 C  C     . LEU A 1 296 ? -0.075  17.714  29.568  1.00   52.69 ? 296  LEU A C     1 
ATOM   2229 O  O     . LEU A 1 296 ? 0.063   16.512  29.797  1.00   49.94 ? 296  LEU A O     1 
ATOM   2230 C  CB    . LEU A 1 296 ? -1.805  17.637  27.752  1.00   50.50 ? 296  LEU A CB    1 
ATOM   2231 C  CG    . LEU A 1 296 ? -3.270  17.638  27.301  1.00   48.93 ? 296  LEU A CG    1 
ATOM   2232 C  CD1   . LEU A 1 296 ? -3.302  17.462  25.803  1.00   49.16 ? 296  LEU A CD1   1 
ATOM   2233 C  CD2   . LEU A 1 296 ? -4.064  16.522  27.981  1.00   47.40 ? 296  LEU A CD2   1 
ATOM   2234 N  N     . ASN A 1 297 ? 0.917   18.591  29.702  1.00   52.57 ? 297  ASN A N     1 
ATOM   2235 C  CA    . ASN A 1 297 ? 2.228   18.155  30.158  1.00   54.05 ? 297  ASN A CA    1 
ATOM   2236 C  C     . ASN A 1 297 ? 2.164   17.570  31.568  1.00   55.13 ? 297  ASN A C     1 
ATOM   2237 O  O     . ASN A 1 297 ? 2.627   16.449  31.798  1.00   55.73 ? 297  ASN A O     1 
ATOM   2238 C  CB    . ASN A 1 297 ? 3.225   19.318  30.098  1.00   54.57 ? 297  ASN A CB    1 
ATOM   2239 C  CG    . ASN A 1 297 ? 3.636   19.649  28.671  1.00   55.56 ? 297  ASN A CG    1 
ATOM   2240 O  OD1   . ASN A 1 297 ? 4.345   20.621  28.413  1.00   55.78 ? 297  ASN A OD1   1 
ATOM   2241 N  ND2   . ASN A 1 297 ? 3.185   18.827  27.731  1.00   56.46 ? 297  ASN A ND2   1 
ATOM   2242 N  N     . ASP A 1 298 ? 1.586   18.313  32.515  1.00   56.37 ? 298  ASP A N     1 
ATOM   2243 C  CA    . ASP A 1 298 ? 1.462   17.809  33.881  1.00   57.88 ? 298  ASP A CA    1 
ATOM   2244 C  C     . ASP A 1 298 ? 0.471   16.657  33.955  1.00   57.35 ? 298  ASP A C     1 
ATOM   2245 O  O     . ASP A 1 298 ? 0.513   15.857  34.892  1.00   58.53 ? 298  ASP A O     1 
ATOM   2246 C  CB    . ASP A 1 298 ? 1.077   18.939  34.846  1.00   61.15 ? 298  ASP A CB    1 
ATOM   2247 C  CG    . ASP A 1 298 ? 2.289   19.792  35.254  1.00   64.08 ? 298  ASP A CG    1 
ATOM   2248 O  OD1   . ASP A 1 298 ? 2.110   20.767  36.017  1.00   64.62 ? 298  ASP A OD1   1 
ATOM   2249 O  OD2   . ASP A 1 298 ? 3.423   19.480  34.811  1.00   64.96 ? 298  ASP A OD2   1 
ATOM   2250 N  N     . VAL A 1 299 ? -0.412  16.563  32.976  1.00   55.39 ? 299  VAL A N     1 
ATOM   2251 C  CA    . VAL A 1 299 ? -1.356  15.456  32.925  1.00   52.18 ? 299  VAL A CA    1 
ATOM   2252 C  C     . VAL A 1 299 ? -0.616  14.182  32.489  1.00   52.15 ? 299  VAL A C     1 
ATOM   2253 O  O     . VAL A 1 299 ? -1.010  13.068  32.848  1.00   50.19 ? 299  VAL A O     1 
ATOM   2254 C  CB    . VAL A 1 299 ? -2.457  15.727  31.911  1.00   50.76 ? 299  VAL A CB    1 
ATOM   2255 C  CG1   . VAL A 1 299 ? -3.406  14.532  31.823  1.00   48.56 ? 299  VAL A CG1   1 
ATOM   2256 C  CG2   . VAL A 1 299 ? -3.175  16.988  32.296  1.00   48.14 ? 299  VAL A CG2   1 
ATOM   2257 N  N     . MET A 1 300 ? 0.459   14.357  31.713  1.00   50.92 ? 300  MET A N     1 
ATOM   2258 C  CA    . MET A 1 300 ? 1.246   13.225  31.221  1.00   52.28 ? 300  MET A CA    1 
ATOM   2259 C  C     . MET A 1 300 ? 2.553   13.067  31.990  1.00   52.59 ? 300  MET A C     1 
ATOM   2260 O  O     . MET A 1 300 ? 3.275   12.095  31.799  1.00   53.47 ? 300  MET A O     1 
ATOM   2261 C  CB    . MET A 1 300 ? 1.554   13.402  29.727  1.00   51.98 ? 300  MET A CB    1 
ATOM   2262 C  CG    . MET A 1 300 ? 0.329   13.457  28.829  1.00   52.81 ? 300  MET A CG    1 
ATOM   2263 S  SD    . MET A 1 300 ? 0.738   13.614  27.059  1.00   52.36 ? 300  MET A SD    1 
ATOM   2264 C  CE    . MET A 1 300 ? 1.108   15.371  26.939  1.00   51.51 ? 300  MET A CE    1 
ATOM   2265 N  N     . LEU A 1 301 ? 2.846   14.036  32.844  1.00   53.67 ? 301  LEU A N     1 
ATOM   2266 C  CA    . LEU A 1 301 ? 4.067   14.026  33.645  1.00   54.40 ? 301  LEU A CA    1 
ATOM   2267 C  C     . LEU A 1 301 ? 5.319   14.068  32.785  1.00   54.23 ? 301  LEU A C     1 
ATOM   2268 O  O     . LEU A 1 301 ? 6.390   13.642  33.214  1.00   55.36 ? 301  LEU A O     1 
ATOM   2269 C  CB    . LEU A 1 301 ? 4.107   12.783  34.534  1.00   54.81 ? 301  LEU A CB    1 
ATOM   2270 C  CG    . LEU A 1 301 ? 2.981   12.655  35.565  1.00   54.81 ? 301  LEU A CG    1 
ATOM   2271 C  CD1   . LEU A 1 301 ? 3.157   11.388  36.380  1.00   54.95 ? 301  LEU A CD1   1 
ATOM   2272 C  CD2   . LEU A 1 301 ? 2.987   13.875  36.459  1.00   54.13 ? 301  LEU A CD2   1 
ATOM   2273 N  N     . VAL A 1 302 ? 5.193   14.600  31.566  1.00   53.62 ? 302  VAL A N     1 
ATOM   2274 C  CA    . VAL A 1 302 ? 6.329   14.689  30.651  1.00   53.62 ? 302  VAL A CA    1 
ATOM   2275 C  C     . VAL A 1 302 ? 7.008   16.048  30.583  1.00   53.91 ? 302  VAL A C     1 
ATOM   2276 O  O     . VAL A 1 302 ? 6.382   17.088  30.776  1.00   54.00 ? 302  VAL A O     1 
ATOM   2277 C  CB    . VAL A 1 302 ? 5.922   14.355  29.185  1.00   53.05 ? 302  VAL A CB    1 
ATOM   2278 C  CG1   . VAL A 1 302 ? 5.083   13.103  29.144  1.00   50.80 ? 302  VAL A CG1   1 
ATOM   2279 C  CG2   . VAL A 1 302 ? 5.175   15.529  28.576  1.00   50.54 ? 302  VAL A CG2   1 
ATOM   2280 N  N     . THR A 1 303 ? 8.304   16.017  30.306  1.00   55.18 ? 303  THR A N     1 
ATOM   2281 C  CA    . THR A 1 303 ? 9.089   17.213  30.120  1.00   57.42 ? 303  THR A CA    1 
ATOM   2282 C  C     . THR A 1 303 ? 9.181   17.277  28.596  1.00   59.94 ? 303  THR A C     1 
ATOM   2283 O  O     . THR A 1 303 ? 9.646   16.334  27.961  1.00   58.10 ? 303  THR A O     1 
ATOM   2284 C  CB    . THR A 1 303 ? 10.499  17.076  30.723  1.00   56.38 ? 303  THR A CB    1 
ATOM   2285 O  OG1   . THR A 1 303 ? 10.419  17.194  32.150  1.00   56.39 ? 303  THR A OG1   1 
ATOM   2286 C  CG2   . THR A 1 303 ? 11.433  18.164  30.168  1.00   56.11 ? 303  THR A CG2   1 
ATOM   2287 N  N     . PRO A 1 304 ? 8.730   18.391  27.995  1.00   60.90 ? 304  PRO A N     1 
ATOM   2288 C  CA    . PRO A 1 304 ? 8.732   18.621  26.543  1.00   60.34 ? 304  PRO A CA    1 
ATOM   2289 C  C     . PRO A 1 304 ? 10.112  18.632  25.881  1.00   60.45 ? 304  PRO A C     1 
ATOM   2290 O  O     . PRO A 1 304 ? 10.545  19.658  25.364  1.00   56.39 ? 304  PRO A O     1 
ATOM   2291 C  CB    . PRO A 1 304 ? 8.027   19.977  26.403  1.00   61.92 ? 304  PRO A CB    1 
ATOM   2292 C  CG    . PRO A 1 304 ? 7.250   20.132  27.681  1.00   64.29 ? 304  PRO A CG    1 
ATOM   2293 C  CD    . PRO A 1 304 ? 8.204   19.570  28.702  1.00   61.58 ? 304  PRO A CD    1 
ATOM   2294 N  N     . ASP A 1 305 ? 10.793  17.495  25.901  1.00   58.94 ? 305  ASP A N     1 
ATOM   2295 C  CA    . ASP A 1 305 ? 12.114  17.371  25.294  1.00   57.79 ? 305  ASP A CA    1 
ATOM   2296 C  C     . ASP A 1 305 ? 12.255  15.915  24.867  1.00   56.01 ? 305  ASP A C     1 
ATOM   2297 O  O     . ASP A 1 305 ? 12.649  15.061  25.663  1.00   53.83 ? 305  ASP A O     1 
ATOM   2298 C  CB    . ASP A 1 305 ? 13.215  17.750  26.304  1.00   62.34 ? 305  ASP A CB    1 
ATOM   2299 C  CG    . ASP A 1 305 ? 14.615  17.751  25.680  1.00   69.49 ? 305  ASP A CG    1 
ATOM   2300 O  OD1   . ASP A 1 305 ? 14.698  17.703  24.426  1.00   73.25 ? 305  ASP A OD1   1 
ATOM   2301 O  OD2   . ASP A 1 305 ? 15.622  17.800  26.434  1.00   72.69 ? 305  ASP A OD2   1 
ATOM   2302 N  N     . SER A 1 306 ? 11.920  15.631  23.611  1.00   53.80 ? 306  SER A N     1 
ATOM   2303 C  CA    . SER A 1 306 ? 11.968  14.263  23.112  1.00   51.17 ? 306  SER A CA    1 
ATOM   2304 C  C     . SER A 1 306 ? 13.319  13.575  23.278  1.00   50.48 ? 306  SER A C     1 
ATOM   2305 O  O     . SER A 1 306 ? 13.370  12.393  23.610  1.00   50.61 ? 306  SER A O     1 
ATOM   2306 C  CB    . SER A 1 306 ? 11.510  14.197  21.645  1.00   49.68 ? 306  SER A CB    1 
ATOM   2307 O  OG    . SER A 1 306 ? 12.437  14.786  20.742  1.00   50.87 ? 306  SER A OG    1 
ATOM   2308 N  N     . GLY A 1 307 ? 14.405  14.303  23.053  1.00   51.41 ? 307  GLY A N     1 
ATOM   2309 C  CA    . GLY A 1 307 ? 15.725  13.709  23.181  1.00   53.45 ? 307  GLY A CA    1 
ATOM   2310 C  C     . GLY A 1 307 ? 16.070  13.301  24.601  1.00   54.57 ? 307  GLY A C     1 
ATOM   2311 O  O     . GLY A 1 307 ? 17.216  12.953  24.904  1.00   56.46 ? 307  GLY A O     1 
ATOM   2312 N  N     . LEU A 1 308 ? 15.068  13.325  25.467  1.00   54.80 ? 308  LEU A N     1 
ATOM   2313 C  CA    . LEU A 1 308 ? 15.244  12.988  26.867  1.00   55.07 ? 308  LEU A CA    1 
ATOM   2314 C  C     . LEU A 1 308 ? 14.831  11.547  27.167  1.00   55.01 ? 308  LEU A C     1 
ATOM   2315 O  O     . LEU A 1 308 ? 15.284  10.965  28.153  1.00   55.06 ? 308  LEU A O     1 
ATOM   2316 C  CB    . LEU A 1 308 ? 14.411  13.945  27.704  1.00   55.24 ? 308  LEU A CB    1 
ATOM   2317 C  CG    . LEU A 1 308 ? 14.977  14.541  28.980  1.00   56.78 ? 308  LEU A CG    1 
ATOM   2318 C  CD1   . LEU A 1 308 ? 16.361  15.165  28.728  1.00   54.50 ? 308  LEU A CD1   1 
ATOM   2319 C  CD2   . LEU A 1 308 ? 13.979  15.583  29.482  1.00   56.10 ? 308  LEU A CD2   1 
ATOM   2320 N  N     . TYR A 1 309 ? 13.971  10.974  26.332  1.00   52.95 ? 309  TYR A N     1 
ATOM   2321 C  CA    . TYR A 1 309 ? 13.523  9.610   26.570  1.00   51.28 ? 309  TYR A CA    1 
ATOM   2322 C  C     . TYR A 1 309 ? 14.259  8.591   25.728  1.00   50.96 ? 309  TYR A C     1 
ATOM   2323 O  O     . TYR A 1 309 ? 14.428  8.762   24.524  1.00   49.35 ? 309  TYR A O     1 
ATOM   2324 C  CB    . TYR A 1 309 ? 12.017  9.512   26.363  1.00   50.89 ? 309  TYR A CB    1 
ATOM   2325 C  CG    . TYR A 1 309 ? 11.288  10.483  27.260  1.00   51.58 ? 309  TYR A CG    1 
ATOM   2326 C  CD1   . TYR A 1 309 ? 10.978  11.766  26.819  1.00   50.78 ? 309  TYR A CD1   1 
ATOM   2327 C  CD2   . TYR A 1 309 ? 11.005  10.154  28.600  1.00   51.64 ? 309  TYR A CD2   1 
ATOM   2328 C  CE1   . TYR A 1 309 ? 10.417  12.701  27.677  1.00   51.90 ? 309  TYR A CE1   1 
ATOM   2329 C  CE2   . TYR A 1 309 ? 10.446  11.082  29.464  1.00   50.74 ? 309  TYR A CE2   1 
ATOM   2330 C  CZ    . TYR A 1 309 ? 10.156  12.357  28.997  1.00   51.60 ? 309  TYR A CZ    1 
ATOM   2331 O  OH    . TYR A 1 309 ? 9.635   13.309  29.843  1.00   51.91 ? 309  TYR A OH    1 
ATOM   2332 N  N     . SER A 1 310 ? 14.673  7.519   26.384  1.00   49.78 ? 310  SER A N     1 
ATOM   2333 C  CA    . SER A 1 310 ? 15.430  6.451   25.751  1.00   48.68 ? 310  SER A CA    1 
ATOM   2334 C  C     . SER A 1 310 ? 14.642  5.664   24.743  1.00   46.74 ? 310  SER A C     1 
ATOM   2335 O  O     . SER A 1 310 ? 15.188  5.173   23.756  1.00   44.97 ? 310  SER A O     1 
ATOM   2336 C  CB    . SER A 1 310 ? 15.968  5.494   26.819  1.00   50.79 ? 310  SER A CB    1 
ATOM   2337 O  OG    . SER A 1 310 ? 17.046  6.101   27.500  1.00   58.55 ? 310  SER A OG    1 
ATOM   2338 N  N     . PHE A 1 311 ? 13.349  5.547   24.995  1.00   44.67 ? 311  PHE A N     1 
ATOM   2339 C  CA    . PHE A 1 311 ? 12.492  4.814   24.099  1.00   42.95 ? 311  PHE A CA    1 
ATOM   2340 C  C     . PHE A 1 311 ? 12.234  5.546   22.768  1.00   41.67 ? 311  PHE A C     1 
ATOM   2341 O  O     . PHE A 1 311 ? 11.701  4.940   21.850  1.00   40.93 ? 311  PHE A O     1 
ATOM   2342 C  CB    . PHE A 1 311 ? 11.248  4.330   24.864  1.00   43.73 ? 311  PHE A CB    1 
ATOM   2343 C  CG    . PHE A 1 311 ? 11.462  3.016   25.588  1.00   45.16 ? 311  PHE A CG    1 
ATOM   2344 C  CD1   . PHE A 1 311 ? 12.750  2.420   25.524  1.00   46.33 ? 311  PHE A CD1   1 
ATOM   2345 C  CD2   . PHE A 1 311 ? 10.470  2.355   26.306  1.00   45.51 ? 311  PHE A CD2   1 
ATOM   2346 C  CE1   . PHE A 1 311 ? 13.015  1.195   26.167  1.00   46.62 ? 311  PHE A CE1   1 
ATOM   2347 C  CE2   . PHE A 1 311 ? 10.730  1.128   26.956  1.00   46.08 ? 311  PHE A CE2   1 
ATOM   2348 C  CZ    . PHE A 1 311 ? 12.002  0.554   26.877  1.00   46.28 ? 311  PHE A CZ    1 
ATOM   2349 N  N     . ILE A 1 312 ? 12.619  6.818   22.609  1.00   41.83 ? 312  ILE A N     1 
ATOM   2350 C  CA    . ILE A 1 312 ? 12.400  7.460   21.314  1.00   42.21 ? 312  ILE A CA    1 
ATOM   2351 C  C     . ILE A 1 312 ? 13.573  8.281   20.766  1.00   42.97 ? 312  ILE A C     1 
ATOM   2352 O  O     . ILE A 1 312 ? 13.529  8.776   19.649  1.00   44.26 ? 312  ILE A O     1 
ATOM   2353 C  CB    . ILE A 1 312 ? 11.168  8.393   21.328  1.00   41.74 ? 312  ILE A CB    1 
ATOM   2354 C  CG1   . ILE A 1 312 ? 11.420  9.579   22.263  1.00   42.26 ? 312  ILE A CG1   1 
ATOM   2355 C  CG2   . ILE A 1 312 ? 9.942   7.675   21.863  1.00   38.10 ? 312  ILE A CG2   1 
ATOM   2356 C  CD1   . ILE A 1 312 ? 10.206  10.518  22.346  1.00   43.03 ? 312  ILE A CD1   1 
ATOM   2357 N  N     . ASN A 1 313 ? 14.621  8.439   21.569  1.00   45.18 ? 313  ASN A N     1 
ATOM   2358 C  CA    . ASN A 1 313 ? 15.765  9.232   21.130  1.00   46.70 ? 313  ASN A CA    1 
ATOM   2359 C  C     . ASN A 1 313 ? 16.949  8.437   20.520  1.00   46.38 ? 313  ASN A C     1 
ATOM   2360 O  O     . ASN A 1 313 ? 18.079  8.933   20.527  1.00   47.70 ? 313  ASN A O     1 
ATOM   2361 C  CB    . ASN A 1 313 ? 16.253  10.119  22.305  1.00   48.31 ? 313  ASN A CB    1 
ATOM   2362 C  CG    . ASN A 1 313 ? 16.788  9.297   23.487  1.00   49.82 ? 313  ASN A CG    1 
ATOM   2363 O  OD1   . ASN A 1 313 ? 17.009  9.835   24.588  1.00   51.24 ? 313  ASN A OD1   1 
ATOM   2364 N  ND2   . ASN A 1 313 ? 16.994  8.012   23.264  1.00   49.23 ? 313  ASN A ND2   1 
ATOM   2365 N  N     . GLN A 1 314 ? 16.705  7.242   19.978  1.00   45.38 ? 314  GLN A N     1 
ATOM   2366 C  CA    . GLN A 1 314 ? 17.768  6.392   19.406  1.00   44.74 ? 314  GLN A CA    1 
ATOM   2367 C  C     . GLN A 1 314 ? 18.166  6.783   17.986  1.00   45.29 ? 314  GLN A C     1 
ATOM   2368 O  O     . GLN A 1 314 ? 19.364  6.931   17.692  1.00   44.77 ? 314  GLN A O     1 
ATOM   2369 C  CB    . GLN A 1 314 ? 17.344  4.919   19.484  1.00   44.41 ? 314  GLN A CB    1 
ATOM   2370 C  CG    . GLN A 1 314 ? 17.107  4.422   20.941  1.00   42.63 ? 314  GLN A CG    1 
ATOM   2371 C  CD    . GLN A 1 314 ? 16.447  3.053   20.975  1.00   42.61 ? 314  GLN A CD    1 
ATOM   2372 O  OE1   . GLN A 1 314 ? 16.823  2.166   20.211  1.00   43.30 ? 314  GLN A OE1   1 
ATOM   2373 N  NE2   . GLN A 1 314 ? 15.453  2.876   21.844  1.00   40.74 ? 314  GLN A NE2   1 
ATOM   2374 N  N     . GLY A 1 315 ? 17.193  6.957   17.103  1.00   44.64 ? 315  GLY A N     1 
ATOM   2375 C  CA    . GLY A 1 315 ? 17.503  7.393   15.760  1.00   44.81 ? 315  GLY A CA    1 
ATOM   2376 C  C     . GLY A 1 315 ? 17.476  8.906   15.828  1.00   46.06 ? 315  GLY A C     1 
ATOM   2377 O  O     . GLY A 1 315 ? 18.101  9.481   16.701  1.00   44.76 ? 315  GLY A O     1 
ATOM   2378 N  N     . CYS A 1 316 ? 16.752  9.572   14.925  1.00   48.65 ? 316  CYS A N     1 
ATOM   2379 C  CA    . CYS A 1 316 ? 16.689  11.029  14.990  1.00   51.43 ? 316  CYS A CA    1 
ATOM   2380 C  C     . CYS A 1 316 ? 15.448  11.526  15.737  1.00   51.75 ? 316  CYS A C     1 
ATOM   2381 O  O     . CYS A 1 316 ? 14.555  10.744  16.072  1.00   52.10 ? 316  CYS A O     1 
ATOM   2382 C  CB    . CYS A 1 316 ? 16.737  11.636  13.588  1.00   54.84 ? 316  CYS A CB    1 
ATOM   2383 S  SG    . CYS A 1 316 ? 15.546  10.966  12.440  1.00   60.10 ? 316  CYS A SG    1 
ATOM   2384 N  N     . LEU A 1 317 ? 15.407  12.831  15.989  1.00   51.87 ? 317  LEU A N     1 
ATOM   2385 C  CA    . LEU A 1 317 ? 14.309  13.448  16.710  1.00   51.02 ? 317  LEU A CA    1 
ATOM   2386 C  C     . LEU A 1 317 ? 13.331  14.208  15.822  1.00   51.73 ? 317  LEU A C     1 
ATOM   2387 O  O     . LEU A 1 317 ? 12.119  14.127  16.028  1.00   50.72 ? 317  LEU A O     1 
ATOM   2388 C  CB    . LEU A 1 317 ? 14.866  14.408  17.768  1.00   49.74 ? 317  LEU A CB    1 
ATOM   2389 C  CG    . LEU A 1 317 ? 15.764  13.811  18.856  1.00   48.55 ? 317  LEU A CG    1 
ATOM   2390 C  CD1   . LEU A 1 317 ? 16.185  14.933  19.844  1.00   46.95 ? 317  LEU A CD1   1 
ATOM   2391 C  CD2   . LEU A 1 317 ? 15.008  12.672  19.587  1.00   46.93 ? 317  LEU A CD2   1 
ATOM   2392 N  N     . THR A 1 318 ? 13.836  14.942  14.845  1.00   51.21 ? 318  THR A N     1 
ATOM   2393 C  CA    . THR A 1 318 ? 12.949  15.714  13.986  1.00   51.39 ? 318  THR A CA    1 
ATOM   2394 C  C     . THR A 1 318 ? 12.856  15.161  12.586  1.00   51.63 ? 318  THR A C     1 
ATOM   2395 O  O     . THR A 1 318 ? 13.603  14.260  12.212  1.00   50.07 ? 318  THR A O     1 
ATOM   2396 C  CB    . THR A 1 318 ? 13.396  17.193  13.922  1.00   53.67 ? 318  THR A CB    1 
ATOM   2397 O  OG1   . THR A 1 318 ? 14.764  17.269  13.498  1.00   56.39 ? 318  THR A OG1   1 
ATOM   2398 C  CG2   . THR A 1 318 ? 13.251  17.849  15.315  1.00   56.67 ? 318  THR A CG2   1 
ATOM   2399 N  N     . VAL A 1 319 ? 11.922  15.691  11.808  1.00   50.17 ? 319  VAL A N     1 
ATOM   2400 C  CA    . VAL A 1 319 ? 11.751  15.249  10.434  1.00   48.81 ? 319  VAL A CA    1 
ATOM   2401 C  C     . VAL A 1 319 ? 11.451  16.454  9.557   1.00   51.74 ? 319  VAL A C     1 
ATOM   2402 O  O     . VAL A 1 319 ? 10.507  17.187  9.839   1.00   47.64 ? 319  VAL A O     1 
ATOM   2403 C  CB    . VAL A 1 319 ? 10.575  14.260  10.309  1.00   48.03 ? 319  VAL A CB    1 
ATOM   2404 C  CG1   . VAL A 1 319 ? 10.501  13.720  8.891   1.00   47.67 ? 319  VAL A CG1   1 
ATOM   2405 C  CG2   . VAL A 1 319 ? 10.735  13.137  11.302  1.00   49.27 ? 319  VAL A CG2   1 
ATOM   2406 N  N     . ASP A 1 320 ? 12.242  16.675  8.507   1.00   56.34 ? 320  ASP A N     1 
ATOM   2407 C  CA    . ASP A 1 320 ? 11.960  17.803  7.614   1.00   59.07 ? 320  ASP A CA    1 
ATOM   2408 C  C     . ASP A 1 320 ? 10.522  17.594  7.185   1.00   58.13 ? 320  ASP A C     1 
ATOM   2409 O  O     . ASP A 1 320 ? 10.050  16.461  7.165   1.00   57.94 ? 320  ASP A O     1 
ATOM   2410 C  CB    . ASP A 1 320 ? 12.797  17.772  6.330   1.00   67.49 ? 320  ASP A CB    1 
ATOM   2411 C  CG    . ASP A 1 320 ? 14.283  17.564  6.573   1.00   79.56 ? 320  ASP A CG    1 
ATOM   2412 O  OD1   . ASP A 1 320 ? 14.776  17.794  7.707   1.00   86.03 ? 320  ASP A OD1   1 
ATOM   2413 O  OD2   . ASP A 1 320 ? 14.956  17.180  5.586   1.00   85.80 ? 320  ASP A OD2   1 
ATOM   2414 N  N     . ASN A 1 321 ? 9.822   18.662  6.848   1.00   56.99 ? 321  ASN A N     1 
ATOM   2415 C  CA    . ASN A 1 321 ? 8.438   18.547  6.380   1.00   55.92 ? 321  ASN A CA    1 
ATOM   2416 C  C     . ASN A 1 321 ? 7.437   17.992  7.416   1.00   54.39 ? 321  ASN A C     1 
ATOM   2417 O  O     . ASN A 1 321 ? 6.313   17.634  7.060   1.00   55.48 ? 321  ASN A O     1 
ATOM   2418 C  CB    . ASN A 1 321 ? 8.384   17.732  5.048   1.00   55.18 ? 321  ASN A CB    1 
ATOM   2419 C  CG    . ASN A 1 321 ? 8.223   16.200  5.256   1.00   55.90 ? 321  ASN A CG    1 
ATOM   2420 O  OD1   . ASN A 1 321 ? 8.052   15.726  6.370   1.00   56.15 ? 321  ASN A OD1   1 
ATOM   2421 N  ND2   . ASN A 1 321 ? 8.261   15.439  4.162   1.00   53.89 ? 321  ASN A ND2   1 
ATOM   2422 N  N     . ILE A 1 322 ? 7.842   17.922  8.683   1.00   52.54 ? 322  ILE A N     1 
ATOM   2423 C  CA    . ILE A 1 322 ? 6.934   17.456  9.724   1.00   50.90 ? 322  ILE A CA    1 
ATOM   2424 C  C     . ILE A 1 322 ? 7.032   18.295  10.984  1.00   50.70 ? 322  ILE A C     1 
ATOM   2425 O  O     . ILE A 1 322 ? 8.054   18.298  11.676  1.00   48.77 ? 322  ILE A O     1 
ATOM   2426 C  CB    . ILE A 1 322 ? 7.156   15.976  10.097  1.00   50.49 ? 322  ILE A CB    1 
ATOM   2427 C  CG1   . ILE A 1 322 ? 6.655   15.072  8.960   1.00   50.15 ? 322  ILE A CG1   1 
ATOM   2428 C  CG2   . ILE A 1 322 ? 6.407   15.665  11.390  1.00   50.02 ? 322  ILE A CG2   1 
ATOM   2429 C  CD1   . ILE A 1 322 ? 6.541   13.583  9.318   1.00   50.80 ? 322  ILE A CD1   1 
ATOM   2430 N  N     . ASP A 1 323 ? 5.949   19.008  11.273  1.00   49.37 ? 323  ASP A N     1 
ATOM   2431 C  CA    . ASP A 1 323 ? 5.866   19.866  12.443  1.00   48.06 ? 323  ASP A CA    1 
ATOM   2432 C  C     . ASP A 1 323 ? 5.046   19.139  13.507  1.00   46.56 ? 323  ASP A C     1 
ATOM   2433 O  O     . ASP A 1 323 ? 3.813   19.131  13.461  1.00   44.59 ? 323  ASP A O     1 
ATOM   2434 C  CB    . ASP A 1 323 ? 5.214   21.187  12.058  1.00   50.87 ? 323  ASP A CB    1 
ATOM   2435 C  CG    . ASP A 1 323 ? 5.068   22.126  13.231  1.00   56.45 ? 323  ASP A CG    1 
ATOM   2436 O  OD1   . ASP A 1 323 ? 5.861   22.015  14.199  1.00   59.39 ? 323  ASP A OD1   1 
ATOM   2437 O  OD2   . ASP A 1 323 ? 4.165   22.989  13.180  1.00   59.41 ? 323  ASP A OD2   1 
ATOM   2438 N  N     . ASP A 1 324 ? 5.746   18.525  14.459  1.00   44.29 ? 324  ASP A N     1 
ATOM   2439 C  CA    . ASP A 1 324 ? 5.093   17.766  15.510  1.00   43.42 ? 324  ASP A CA    1 
ATOM   2440 C  C     . ASP A 1 324 ? 4.182   18.614  16.384  1.00   43.67 ? 324  ASP A C     1 
ATOM   2441 O  O     . ASP A 1 324 ? 3.124   18.147  16.818  1.00   42.43 ? 324  ASP A O     1 
ATOM   2442 C  CB    . ASP A 1 324 ? 6.149   17.046  16.352  1.00   44.25 ? 324  ASP A CB    1 
ATOM   2443 C  CG    . ASP A 1 324 ? 6.944   16.049  15.540  1.00   44.76 ? 324  ASP A CG    1 
ATOM   2444 O  OD1   . ASP A 1 324 ? 6.314   15.264  14.794  1.00   44.77 ? 324  ASP A OD1   1 
ATOM   2445 O  OD2   . ASP A 1 324 ? 8.189   16.044  15.653  1.00   44.91 ? 324  ASP A OD2   1 
ATOM   2446 N  N     . VAL A 1 325 ? 4.599   19.852  16.646  1.00   43.34 ? 325  VAL A N     1 
ATOM   2447 C  CA    . VAL A 1 325 ? 3.798   20.783  17.426  1.00   42.75 ? 325  VAL A CA    1 
ATOM   2448 C  C     . VAL A 1 325 ? 2.437   20.927  16.754  1.00   43.68 ? 325  VAL A C     1 
ATOM   2449 O  O     . VAL A 1 325 ? 1.397   20.728  17.372  1.00   41.80 ? 325  VAL A O     1 
ATOM   2450 C  CB    . VAL A 1 325 ? 4.446   22.190  17.462  1.00   43.38 ? 325  VAL A CB    1 
ATOM   2451 C  CG1   . VAL A 1 325 ? 3.481   23.196  18.072  1.00   43.90 ? 325  VAL A CG1   1 
ATOM   2452 C  CG2   . VAL A 1 325 ? 5.760   22.150  18.253  1.00   44.20 ? 325  VAL A CG2   1 
ATOM   2453 N  N     . GLU A 1 326 ? 2.462   21.268  15.470  1.00   45.48 ? 326  GLU A N     1 
ATOM   2454 C  CA    . GLU A 1 326 ? 1.240   21.446  14.708  1.00   46.67 ? 326  GLU A CA    1 
ATOM   2455 C  C     . GLU A 1 326 ? 0.414   20.166  14.577  1.00   46.84 ? 326  GLU A C     1 
ATOM   2456 O  O     . GLU A 1 326 ? -0.806  20.211  14.699  1.00   46.03 ? 326  GLU A O     1 
ATOM   2457 C  CB    . GLU A 1 326 ? 1.572   22.000  13.325  1.00   49.95 ? 326  GLU A CB    1 
ATOM   2458 C  CG    . GLU A 1 326 ? 0.829   23.269  12.994  1.00   56.14 ? 326  GLU A CG    1 
ATOM   2459 C  CD    . GLU A 1 326 ? -0.662  23.072  13.052  1.00   58.97 ? 326  GLU A CD    1 
ATOM   2460 O  OE1   . GLU A 1 326 ? -1.171  22.318  12.199  1.00   60.98 ? 326  GLU A OE1   1 
ATOM   2461 O  OE2   . GLU A 1 326 ? -1.319  23.653  13.952  1.00   61.10 ? 326  GLU A OE2   1 
ATOM   2462 N  N     . GLU A 1 327 ? 1.055   19.039  14.345  1.00   47.34 ? 327  GLU A N     1 
ATOM   2463 C  CA    . GLU A 1 327 ? 0.290   17.800  14.209  1.00   46.90 ? 327  GLU A CA    1 
ATOM   2464 C  C     . GLU A 1 327 ? -0.327  17.357  15.544  1.00   45.59 ? 327  GLU A C     1 
ATOM   2465 O  O     . GLU A 1 327 ? -1.342  16.664  15.548  1.00   42.61 ? 327  GLU A O     1 
ATOM   2466 C  CB    . GLU A 1 327 ? 1.156   16.674  13.616  1.00   49.52 ? 327  GLU A CB    1 
ATOM   2467 C  CG    . GLU A 1 327 ? 1.856   17.047  12.306  1.00   56.07 ? 327  GLU A CG    1 
ATOM   2468 C  CD    . GLU A 1 327 ? 1.247   16.401  11.062  1.00   60.42 ? 327  GLU A CD    1 
ATOM   2469 O  OE1   . GLU A 1 327 ? 1.760   16.663  9.950   1.00   63.85 ? 327  GLU A OE1   1 
ATOM   2470 O  OE2   . GLU A 1 327 ? 0.269   15.634  11.167  1.00   62.37 ? 327  GLU A OE2   1 
ATOM   2471 N  N     . PHE A 1 328 ? 0.260   17.752  16.678  1.00   44.53 ? 328  PHE A N     1 
ATOM   2472 C  CA    . PHE A 1 328 ? -0.334  17.369  17.959  1.00   43.60 ? 328  PHE A CA    1 
ATOM   2473 C  C     . PHE A 1 328 ? -1.671  18.068  18.094  1.00   42.77 ? 328  PHE A C     1 
ATOM   2474 O  O     . PHE A 1 328 ? -2.669  17.457  18.492  1.00   43.27 ? 328  PHE A O     1 
ATOM   2475 C  CB    . PHE A 1 328 ? 0.549   17.743  19.165  1.00   43.85 ? 328  PHE A CB    1 
ATOM   2476 C  CG    . PHE A 1 328 ? 0.104   17.103  20.472  1.00   44.90 ? 328  PHE A CG    1 
ATOM   2477 C  CD1   . PHE A 1 328 ? -0.593  15.891  20.472  1.00   45.12 ? 328  PHE A CD1   1 
ATOM   2478 C  CD2   . PHE A 1 328 ? 0.412   17.683  21.696  1.00   45.22 ? 328  PHE A CD2   1 
ATOM   2479 C  CE1   . PHE A 1 328 ? -0.972  15.272  21.670  1.00   44.86 ? 328  PHE A CE1   1 
ATOM   2480 C  CE2   . PHE A 1 328 ? 0.034   17.066  22.903  1.00   44.05 ? 328  PHE A CE2   1 
ATOM   2481 C  CZ    . PHE A 1 328 ? -0.657  15.861  22.883  1.00   43.44 ? 328  PHE A CZ    1 
ATOM   2482 N  N     . LYS A 1 329 ? -1.695  19.341  17.757  1.00   43.58 ? 329  LYS A N     1 
ATOM   2483 C  CA    . LYS A 1 329 ? -2.942  20.099  17.831  1.00   44.23 ? 329  LYS A CA    1 
ATOM   2484 C  C     . LYS A 1 329 ? -3.967  19.452  16.926  1.00   43.65 ? 329  LYS A C     1 
ATOM   2485 O  O     . LYS A 1 329 ? -5.157  19.421  17.240  1.00   45.25 ? 329  LYS A O     1 
ATOM   2486 C  CB    . LYS A 1 329 ? -2.701  21.560  17.436  1.00   44.62 ? 329  LYS A CB    1 
ATOM   2487 C  CG    . LYS A 1 329 ? -2.025  22.373  18.533  1.00   45.30 ? 329  LYS A CG    1 
ATOM   2488 C  CD    . LYS A 1 329 ? -1.464  23.686  18.018  1.00   46.24 ? 329  LYS A CD    1 
ATOM   2489 C  CE    . LYS A 1 329 ? -0.608  24.359  19.067  1.00   47.84 ? 329  LYS A CE    1 
ATOM   2490 N  NZ    . LYS A 1 329 ? 0.248   25.482  18.549  1.00   47.41 ? 329  LYS A NZ    1 
ATOM   2491 N  N     . LEU A 1 330 ? -3.507  18.918  15.797  1.00   42.95 ? 330  LEU A N     1 
ATOM   2492 C  CA    . LEU A 1 330 ? -4.408  18.259  14.858  1.00   43.04 ? 330  LEU A CA    1 
ATOM   2493 C  C     . LEU A 1 330 ? -4.878  16.904  15.380  1.00   43.83 ? 330  LEU A C     1 
ATOM   2494 O  O     . LEU A 1 330 ? -6.057  16.571  15.265  1.00   41.93 ? 330  LEU A O     1 
ATOM   2495 C  CB    . LEU A 1 330 ? -3.734  18.124  13.488  1.00   41.71 ? 330  LEU A CB    1 
ATOM   2496 C  CG    . LEU A 1 330 ? -3.547  19.478  12.741  1.00   41.89 ? 330  LEU A CG    1 
ATOM   2497 C  CD1   . LEU A 1 330 ? -2.385  19.386  11.699  1.00   38.86 ? 330  LEU A CD1   1 
ATOM   2498 C  CD2   . LEU A 1 330 ? -4.876  19.894  12.075  1.00   39.21 ? 330  LEU A CD2   1 
ATOM   2499 N  N     . CYS A 1 331 ? -3.972  16.123  15.949  1.00   44.41 ? 331  CYS A N     1 
ATOM   2500 C  CA    . CYS A 1 331 ? -4.347  14.822  16.506  1.00   45.23 ? 331  CYS A CA    1 
ATOM   2501 C  C     . CYS A 1 331 ? -5.355  15.076  17.643  1.00   46.54 ? 331  CYS A C     1 
ATOM   2502 O  O     . CYS A 1 331 ? -6.400  14.421  17.714  1.00   41.50 ? 331  CYS A O     1 
ATOM   2503 C  CB    . CYS A 1 331 ? -3.108  14.092  17.032  1.00   45.87 ? 331  CYS A CB    1 
ATOM   2504 S  SG    . CYS A 1 331 ? -3.414  12.437  17.738  1.00   50.84 ? 331  CYS A SG    1 
ATOM   2505 N  N     . ASP A 1 332 ? -5.029  16.040  18.520  1.00   48.75 ? 332  ASP A N     1 
ATOM   2506 C  CA    . ASP A 1 332 ? -5.902  16.428  19.637  1.00   50.02 ? 332  ASP A CA    1 
ATOM   2507 C  C     . ASP A 1 332 ? -7.312  16.751  19.159  1.00   50.64 ? 332  ASP A C     1 
ATOM   2508 O  O     . ASP A 1 332 ? -8.286  16.209  19.675  1.00   48.24 ? 332  ASP A O     1 
ATOM   2509 C  CB    . ASP A 1 332 ? -5.345  17.667  20.354  1.00   55.97 ? 332  ASP A CB    1 
ATOM   2510 C  CG    . ASP A 1 332 ? -6.347  18.286  21.381  1.00   64.02 ? 332  ASP A CG    1 
ATOM   2511 O  OD1   . ASP A 1 332 ? -6.650  17.643  22.416  1.00   68.49 ? 332  ASP A OD1   1 
ATOM   2512 O  OD2   . ASP A 1 332 ? -6.825  19.425  21.153  1.00   68.49 ? 332  ASP A OD2   1 
ATOM   2513 N  N     . GLU A 1 333 ? -7.429  17.636  18.169  1.00   51.48 ? 333  GLU A N     1 
ATOM   2514 C  CA    . GLU A 1 333 ? -8.752  17.995  17.675  1.00   50.59 ? 333  GLU A CA    1 
ATOM   2515 C  C     . GLU A 1 333 ? -9.425  16.845  16.917  1.00   46.82 ? 333  GLU A C     1 
ATOM   2516 O  O     . GLU A 1 333 ? -10.647 16.786  16.870  1.00   44.82 ? 333  GLU A O     1 
ATOM   2517 C  CB    . GLU A 1 333 ? -8.688  19.254  16.796  1.00   56.34 ? 333  GLU A CB    1 
ATOM   2518 C  CG    . GLU A 1 333 ? -10.060 19.760  16.272  1.00   69.80 ? 333  GLU A CG    1 
ATOM   2519 C  CD    . GLU A 1 333 ? -11.029 20.314  17.358  1.00   76.46 ? 333  GLU A CD    1 
ATOM   2520 O  OE1   . GLU A 1 333 ? -10.636 20.414  18.552  1.00   78.82 ? 333  GLU A OE1   1 
ATOM   2521 O  OE2   . GLU A 1 333 ? -12.195 20.657  16.999  1.00   78.53 ? 333  GLU A OE2   1 
ATOM   2522 N  N     . ALA A 1 334 ? -8.653  15.939  16.333  1.00   41.83 ? 334  ALA A N     1 
ATOM   2523 C  CA    . ALA A 1 334 ? -9.285  14.841  15.614  1.00   39.35 ? 334  ALA A CA    1 
ATOM   2524 C  C     . ALA A 1 334 ? -10.052 13.965  16.598  1.00   38.35 ? 334  ALA A C     1 
ATOM   2525 O  O     . ALA A 1 334 ? -11.137 13.469  16.283  1.00   37.77 ? 334  ALA A O     1 
ATOM   2526 C  CB    . ALA A 1 334 ? -8.245  14.003  14.827  1.00   35.28 ? 334  ALA A CB    1 
ATOM   2527 N  N     . PHE A 1 335 ? -9.500  13.769  17.796  1.00   40.74 ? 335  PHE A N     1 
ATOM   2528 C  CA    . PHE A 1 335 ? -10.193 12.967  18.802  1.00   42.59 ? 335  PHE A CA    1 
ATOM   2529 C  C     . PHE A 1 335 ? -11.508 13.642  19.176  1.00   44.43 ? 335  PHE A C     1 
ATOM   2530 O  O     . PHE A 1 335 ? -12.497 12.966  19.468  1.00   45.30 ? 335  PHE A O     1 
ATOM   2531 C  CB    . PHE A 1 335 ? -9.344  12.815  20.065  1.00   43.14 ? 335  PHE A CB    1 
ATOM   2532 C  CG    . PHE A 1 335 ? -8.351  11.707  19.986  1.00   43.78 ? 335  PHE A CG    1 
ATOM   2533 C  CD1   . PHE A 1 335 ? -8.768  10.402  19.755  1.00   44.19 ? 335  PHE A CD1   1 
ATOM   2534 C  CD2   . PHE A 1 335 ? -7.004  11.964  20.128  1.00   44.20 ? 335  PHE A CD2   1 
ATOM   2535 C  CE1   . PHE A 1 335 ? -7.865  9.376   19.661  1.00   43.30 ? 335  PHE A CE1   1 
ATOM   2536 C  CE2   . PHE A 1 335 ? -6.083  10.935  20.036  1.00   44.98 ? 335  PHE A CE2   1 
ATOM   2537 C  CZ    . PHE A 1 335 ? -6.522  9.635   19.801  1.00   44.67 ? 335  PHE A CZ    1 
ATOM   2538 N  N     . ASP A 1 336 ? -11.530 14.976  19.173  1.00   46.96 ? 336  ASP A N     1 
ATOM   2539 C  CA    . ASP A 1 336 ? -12.757 15.684  19.519  1.00   48.24 ? 336  ASP A CA    1 
ATOM   2540 C  C     . ASP A 1 336 ? -13.865 15.389  18.503  1.00   48.15 ? 336  ASP A C     1 
ATOM   2541 O  O     . ASP A 1 336 ? -14.997 15.097  18.876  1.00   46.80 ? 336  ASP A O     1 
ATOM   2542 C  CB    . ASP A 1 336 ? -12.513 17.187  19.585  1.00   51.15 ? 336  ASP A CB    1 
ATOM   2543 C  CG    . ASP A 1 336 ? -11.665 17.584  20.760  1.00   55.28 ? 336  ASP A CG    1 
ATOM   2544 O  OD1   . ASP A 1 336 ? -11.515 16.752  21.676  1.00   56.10 ? 336  ASP A OD1   1 
ATOM   2545 O  OD2   . ASP A 1 336 ? -11.153 18.735  20.779  1.00   58.38 ? 336  ASP A OD2   1 
ATOM   2546 N  N     . ILE A 1 337 ? -13.524 15.452  17.219  1.00   47.00 ? 337  ILE A N     1 
ATOM   2547 C  CA    . ILE A 1 337 ? -14.484 15.200  16.138  1.00   45.28 ? 337  ILE A CA    1 
ATOM   2548 C  C     . ILE A 1 337 ? -14.924 13.736  16.050  1.00   44.74 ? 337  ILE A C     1 
ATOM   2549 O  O     . ILE A 1 337 ? -16.038 13.437  15.621  1.00   43.48 ? 337  ILE A O     1 
ATOM   2550 C  CB    . ILE A 1 337 ? -13.880 15.687  14.806  1.00   45.77 ? 337  ILE A CB    1 
ATOM   2551 C  CG1   . ILE A 1 337 ? -13.400 17.131  15.013  1.00   47.01 ? 337  ILE A CG1   1 
ATOM   2552 C  CG2   . ILE A 1 337 ? -14.907 15.609  13.678  1.00   46.86 ? 337  ILE A CG2   1 
ATOM   2553 C  CD1   . ILE A 1 337 ? -12.766 17.800  13.803  1.00   49.04 ? 337  ILE A CD1   1 
ATOM   2554 N  N     . LEU A 1 338 ? -14.045 12.815  16.456  1.00   43.91 ? 338  LEU A N     1 
ATOM   2555 C  CA    . LEU A 1 338 ? -14.384 11.394  16.465  1.00   42.61 ? 338  LEU A CA    1 
ATOM   2556 C  C     . LEU A 1 338 ? -15.266 11.130  17.684  1.00   42.33 ? 338  LEU A C     1 
ATOM   2557 O  O     . LEU A 1 338 ? -15.763 10.024  17.880  1.00   41.63 ? 338  LEU A O     1 
ATOM   2558 C  CB    . LEU A 1 338 ? -13.123 10.522  16.539  1.00   43.81 ? 338  LEU A CB    1 
ATOM   2559 C  CG    . LEU A 1 338 ? -12.478 10.016  15.245  1.00   44.61 ? 338  LEU A CG    1 
ATOM   2560 C  CD1   . LEU A 1 338 ? -13.558 9.528   14.286  1.00   46.05 ? 338  LEU A CD1   1 
ATOM   2561 C  CD2   . LEU A 1 338 ? -11.700 11.106  14.604  1.00   45.95 ? 338  LEU A CD2   1 
ATOM   2562 N  N     . GLY A 1 339 ? -15.439 12.166  18.508  1.00   42.13 ? 339  GLY A N     1 
ATOM   2563 C  CA    . GLY A 1 339 ? -16.288 12.067  19.682  1.00   42.69 ? 339  GLY A CA    1 
ATOM   2564 C  C     . GLY A 1 339 ? -15.747 11.325  20.894  1.00   43.81 ? 339  GLY A C     1 
ATOM   2565 O  O     . GLY A 1 339 ? -16.478 10.583  21.545  1.00   43.58 ? 339  GLY A O     1 
ATOM   2566 N  N     . PHE A 1 340 ? -14.467 11.520  21.187  1.00   44.25 ? 340  PHE A N     1 
ATOM   2567 C  CA    . PHE A 1 340 ? -13.829 10.908  22.333  1.00   46.35 ? 340  PHE A CA    1 
ATOM   2568 C  C     . PHE A 1 340 ? -14.052 11.860  23.496  1.00   48.79 ? 340  PHE A C     1 
ATOM   2569 O  O     . PHE A 1 340 ? -13.910 13.076  23.339  1.00   48.22 ? 340  PHE A O     1 
ATOM   2570 C  CB    . PHE A 1 340 ? -12.323 10.754  22.100  1.00   46.52 ? 340  PHE A CB    1 
ATOM   2571 C  CG    . PHE A 1 340 ? -11.927 9.477   21.383  1.00   48.25 ? 340  PHE A CG    1 
ATOM   2572 C  CD1   . PHE A 1 340 ? -12.563 9.089   20.199  1.00   46.72 ? 340  PHE A CD1   1 
ATOM   2573 C  CD2   . PHE A 1 340 ? -10.867 8.696   21.867  1.00   47.33 ? 340  PHE A CD2   1 
ATOM   2574 C  CE1   . PHE A 1 340 ? -12.144 7.949   19.507  1.00   48.00 ? 340  PHE A CE1   1 
ATOM   2575 C  CE2   . PHE A 1 340 ? -10.439 7.561   21.184  1.00   47.28 ? 340  PHE A CE2   1 
ATOM   2576 C  CZ    . PHE A 1 340 ? -11.074 7.181   20.000  1.00   47.36 ? 340  PHE A CZ    1 
ATOM   2577 N  N     . THR A 1 341 ? -14.393 11.325  24.661  1.00   50.07 ? 341  THR A N     1 
ATOM   2578 C  CA    . THR A 1 341 ? -14.608 12.167  25.838  1.00   50.21 ? 341  THR A CA    1 
ATOM   2579 C  C     . THR A 1 341 ? -13.256 12.736  26.229  1.00   51.52 ? 341  THR A C     1 
ATOM   2580 O  O     . THR A 1 341 ? -12.227 12.351  25.666  1.00   48.78 ? 341  THR A O     1 
ATOM   2581 C  CB    . THR A 1 341 ? -15.150 11.355  27.036  1.00   51.77 ? 341  THR A CB    1 
ATOM   2582 O  OG1   . THR A 1 341 ? -16.292 10.595  26.620  1.00   56.38 ? 341  THR A OG1   1 
ATOM   2583 C  CG2   . THR A 1 341 ? -15.596 12.281  28.159  1.00   56.90 ? 341  THR A CG2   1 
ATOM   2584 N  N     . LYS A 1 342 ? -13.255 13.660  27.182  1.00   51.57 ? 342  LYS A N     1 
ATOM   2585 C  CA    . LYS A 1 342 ? -12.022 14.253  27.657  1.00   51.83 ? 342  LYS A CA    1 
ATOM   2586 C  C     . LYS A 1 342 ? -11.247 13.139  28.373  1.00   52.97 ? 342  LYS A C     1 
ATOM   2587 O  O     . LYS A 1 342 ? -10.018 13.100  28.336  1.00   50.89 ? 342  LYS A O     1 
ATOM   2588 C  CB    . LYS A 1 342 ? -12.330 15.404  28.630  1.00   52.94 ? 342  LYS A CB    1 
ATOM   2589 C  CG    . LYS A 1 342 ? -11.127 16.296  28.964  1.00   57.20 ? 342  LYS A CG    1 
ATOM   2590 C  CD    . LYS A 1 342 ? -11.501 17.507  29.839  1.00   60.49 ? 342  LYS A CD    1 
ATOM   2591 C  CE    . LYS A 1 342 ? -10.269 18.373  30.195  1.00   61.59 ? 342  LYS A CE    1 
ATOM   2592 N  NZ    . LYS A 1 342 ? -10.602 19.596  31.000  1.00   61.75 ? 342  LYS A NZ    1 
ATOM   2593 N  N     . GLU A 1 343 ? -11.989 12.230  29.009  1.00   55.00 ? 343  GLU A N     1 
ATOM   2594 C  CA    . GLU A 1 343 ? -11.412 11.098  29.744  1.00   56.50 ? 343  GLU A CA    1 
ATOM   2595 C  C     . GLU A 1 343 ? -10.729 10.101  28.812  1.00   55.50 ? 343  GLU A C     1 
ATOM   2596 O  O     . GLU A 1 343 ? -9.540  9.825   28.953  1.00   54.55 ? 343  GLU A O     1 
ATOM   2597 C  CB    . GLU A 1 343 ? -12.507 10.361  30.520  1.00   60.29 ? 343  GLU A CB    1 
ATOM   2598 C  CG    . GLU A 1 343 ? -13.720 10.016  29.632  1.00   69.54 ? 343  GLU A CG    1 
ATOM   2599 C  CD    . GLU A 1 343 ? -14.299 8.617   29.865  1.00   73.13 ? 343  GLU A CD    1 
ATOM   2600 O  OE1   . GLU A 1 343 ? -15.365 8.321   29.274  1.00   74.74 ? 343  GLU A OE1   1 
ATOM   2601 O  OE2   . GLU A 1 343 ? -13.691 7.817   30.620  1.00   75.17 ? 343  GLU A OE2   1 
ATOM   2602 N  N     . GLU A 1 344 ? -11.498 9.560   27.870  1.00   54.21 ? 344  GLU A N     1 
ATOM   2603 C  CA    . GLU A 1 344 ? -10.974 8.581   26.927  1.00   52.90 ? 344  GLU A CA    1 
ATOM   2604 C  C     . GLU A 1 344 ? -9.727  9.109   26.263  1.00   52.69 ? 344  GLU A C     1 
ATOM   2605 O  O     . GLU A 1 344 ? -8.733  8.401   26.111  1.00   50.98 ? 344  GLU A O     1 
ATOM   2606 C  CB    . GLU A 1 344 ? -12.003 8.279   25.847  1.00   52.89 ? 344  GLU A CB    1 
ATOM   2607 C  CG    . GLU A 1 344 ? -13.240 7.571   26.361  1.00   54.56 ? 344  GLU A CG    1 
ATOM   2608 C  CD    . GLU A 1 344 ? -14.193 7.218   25.248  1.00   55.86 ? 344  GLU A CD    1 
ATOM   2609 O  OE1   . GLU A 1 344 ? -14.612 8.153   24.536  1.00   55.71 ? 344  GLU A OE1   1 
ATOM   2610 O  OE2   . GLU A 1 344 ? -14.523 6.012   25.084  1.00   56.60 ? 344  GLU A OE2   1 
ATOM   2611 N  N     . LYS A 1 345 ? -9.798  10.377  25.878  1.00   51.71 ? 345  LYS A N     1 
ATOM   2612 C  CA    . LYS A 1 345 ? -8.710  11.027  25.196  1.00   50.99 ? 345  LYS A CA    1 
ATOM   2613 C  C     . LYS A 1 345 ? -7.480  11.147  26.067  1.00   50.11 ? 345  LYS A C     1 
ATOM   2614 O  O     . LYS A 1 345 ? -6.368  10.825  25.640  1.00   48.34 ? 345  LYS A O     1 
ATOM   2615 C  CB    . LYS A 1 345 ? -9.158  12.402  24.704  1.00   52.30 ? 345  LYS A CB    1 
ATOM   2616 C  CG    . LYS A 1 345 ? -8.069  13.189  24.007  1.00   55.60 ? 345  LYS A CG    1 
ATOM   2617 C  CD    . LYS A 1 345 ? -8.611  14.469  23.396  1.00   58.05 ? 345  LYS A CD    1 
ATOM   2618 C  CE    . LYS A 1 345 ? -9.041  15.480  24.448  1.00   57.93 ? 345  LYS A CE    1 
ATOM   2619 N  NZ    . LYS A 1 345 ? -9.324  16.783  23.786  1.00   56.86 ? 345  LYS A NZ    1 
ATOM   2620 N  N     . GLN A 1 346 ? -7.672  11.613  27.280  1.00   49.63 ? 346  GLN A N     1 
ATOM   2621 C  CA    . GLN A 1 346 ? -6.546  11.767  28.176  1.00   48.48 ? 346  GLN A CA    1 
ATOM   2622 C  C     . GLN A 1 346 ? -5.987  10.409  28.602  1.00   47.32 ? 346  GLN A C     1 
ATOM   2623 O  O     . GLN A 1 346 ? -4.793  10.288  28.859  1.00   46.96 ? 346  GLN A O     1 
ATOM   2624 C  CB    . GLN A 1 346 ? -6.949  12.606  29.381  1.00   48.28 ? 346  GLN A CB    1 
ATOM   2625 C  CG    . GLN A 1 346 ? -7.443  13.998  29.020  1.00   48.20 ? 346  GLN A CG    1 
ATOM   2626 C  CD    . GLN A 1 346 ? -7.388  14.914  30.210  1.00   49.48 ? 346  GLN A CD    1 
ATOM   2627 O  OE1   . GLN A 1 346 ? -7.448  14.457  31.360  1.00   50.41 ? 346  GLN A OE1   1 
ATOM   2628 N  NE2   . GLN A 1 346 ? -7.263  16.208  29.962  1.00   49.37 ? 346  GLN A NE2   1 
ATOM   2629 N  N     . SER A 1 347 ? -6.837  9.393   28.674  1.00   47.53 ? 347  SER A N     1 
ATOM   2630 C  CA    . SER A 1 347 ? -6.348  8.062   29.021  1.00   49.05 ? 347  SER A CA    1 
ATOM   2631 C  C     . SER A 1 347 ? -5.411  7.619   27.881  1.00   50.31 ? 347  SER A C     1 
ATOM   2632 O  O     . SER A 1 347 ? -4.406  6.956   28.130  1.00   49.30 ? 347  SER A O     1 
ATOM   2633 C  CB    . SER A 1 347 ? -7.502  7.068   29.168  1.00   49.41 ? 347  SER A CB    1 
ATOM   2634 O  OG    . SER A 1 347 ? -8.287  7.395   30.290  1.00   50.48 ? 347  SER A OG    1 
ATOM   2635 N  N     . MET A 1 348 ? -5.745  7.986   26.650  1.00   50.13 ? 348  MET A N     1 
ATOM   2636 C  CA    . MET A 1 348 ? -4.891  7.652   25.505  1.00   49.87 ? 348  MET A CA    1 
ATOM   2637 C  C     . MET A 1 348 ? -3.531  8.312   25.652  1.00   48.08 ? 348  MET A C     1 
ATOM   2638 O  O     . MET A 1 348 ? -2.500  7.646   25.570  1.00   45.25 ? 348  MET A O     1 
ATOM   2639 C  CB    . MET A 1 348 ? -5.514  8.117   24.188  1.00   52.26 ? 348  MET A CB    1 
ATOM   2640 C  CG    . MET A 1 348 ? -6.577  7.178   23.651  1.00   60.10 ? 348  MET A CG    1 
ATOM   2641 S  SD    . MET A 1 348 ? -5.882  5.515   23.407  1.00   64.43 ? 348  MET A SD    1 
ATOM   2642 C  CE    . MET A 1 348 ? -4.490  5.973   22.366  1.00   67.40 ? 348  MET A CE    1 
ATOM   2643 N  N     . PHE A 1 349 ? -3.519  9.620   25.873  1.00   46.34 ? 349  PHE A N     1 
ATOM   2644 C  CA    . PHE A 1 349 ? -2.249  10.311  26.000  1.00   44.30 ? 349  PHE A CA    1 
ATOM   2645 C  C     . PHE A 1 349 ? -1.502  9.897   27.252  1.00   44.16 ? 349  PHE A C     1 
ATOM   2646 O  O     . PHE A 1 349 ? -0.272  9.935   27.288  1.00   44.24 ? 349  PHE A O     1 
ATOM   2647 C  CB    . PHE A 1 349 ? -2.453  11.816  25.981  1.00   45.15 ? 349  PHE A CB    1 
ATOM   2648 C  CG    . PHE A 1 349 ? -3.104  12.320  24.725  1.00   46.48 ? 349  PHE A CG    1 
ATOM   2649 C  CD1   . PHE A 1 349 ? -2.764  11.779  23.482  1.00   46.92 ? 349  PHE A CD1   1 
ATOM   2650 C  CD2   . PHE A 1 349 ? -4.048  13.339  24.776  1.00   47.09 ? 349  PHE A CD2   1 
ATOM   2651 C  CE1   . PHE A 1 349 ? -3.349  12.243  22.317  1.00   46.16 ? 349  PHE A CE1   1 
ATOM   2652 C  CE2   . PHE A 1 349 ? -4.645  13.809  23.604  1.00   47.70 ? 349  PHE A CE2   1 
ATOM   2653 C  CZ    . PHE A 1 349 ? -4.289  13.254  22.376  1.00   46.91 ? 349  PHE A CZ    1 
ATOM   2654 N  N     . LYS A 1 350 ? -2.239  9.497   28.281  1.00   44.67 ? 350  LYS A N     1 
ATOM   2655 C  CA    . LYS A 1 350 ? -1.614  9.079   29.525  1.00   44.17 ? 350  LYS A CA    1 
ATOM   2656 C  C     . LYS A 1 350 ? -0.842  7.779   29.359  1.00   43.47 ? 350  LYS A C     1 
ATOM   2657 O  O     . LYS A 1 350 ? 0.330   7.698   29.728  1.00   43.10 ? 350  LYS A O     1 
ATOM   2658 C  CB    . LYS A 1 350 ? -2.666  8.933   30.620  1.00   44.75 ? 350  LYS A CB    1 
ATOM   2659 C  CG    . LYS A 1 350 ? -2.426  9.887   31.768  1.00   45.88 ? 350  LYS A CG    1 
ATOM   2660 C  CD    . LYS A 1 350 ? -3.488  9.764   32.840  1.00   47.41 ? 350  LYS A CD    1 
ATOM   2661 C  CE    . LYS A 1 350 ? -4.860  10.052  32.283  1.00   47.87 ? 350  LYS A CE    1 
ATOM   2662 N  NZ    . LYS A 1 350 ? -5.924  9.641   33.257  1.00   50.48 ? 350  LYS A NZ    1 
ATOM   2663 N  N     . CYS A 1 351 ? -1.493  6.771   28.791  1.00   43.19 ? 351  CYS A N     1 
ATOM   2664 C  CA    . CYS A 1 351 ? -0.843  5.492   28.563  1.00   44.02 ? 351  CYS A CA    1 
ATOM   2665 C  C     . CYS A 1 351 ? 0.389   5.633   27.662  1.00   44.35 ? 351  CYS A C     1 
ATOM   2666 O  O     . CYS A 1 351 ? 1.425   5.007   27.906  1.00   44.46 ? 351  CYS A O     1 
ATOM   2667 C  CB    . CYS A 1 351 ? -1.840  4.525   27.944  1.00   45.67 ? 351  CYS A CB    1 
ATOM   2668 S  SG    . CYS A 1 351 ? -3.196  4.139   29.083  1.00   50.80 ? 351  CYS A SG    1 
ATOM   2669 N  N     . THR A 1 352 ? 0.283   6.469   26.628  1.00   41.78 ? 352  THR A N     1 
ATOM   2670 C  CA    . THR A 1 352 ? 1.384   6.704   25.703  1.00   37.82 ? 352  THR A CA    1 
ATOM   2671 C  C     . THR A 1 352 ? 2.530   7.319   26.438  1.00   36.94 ? 352  THR A C     1 
ATOM   2672 O  O     . THR A 1 352 ? 3.692   7.036   26.173  1.00   34.27 ? 352  THR A O     1 
ATOM   2673 C  CB    . THR A 1 352 ? 0.964   7.676   24.589  1.00   38.30 ? 352  THR A CB    1 
ATOM   2674 O  OG1   . THR A 1 352 ? -0.231  7.196   23.981  1.00   39.14 ? 352  THR A OG1   1 
ATOM   2675 C  CG2   . THR A 1 352 ? 2.044   7.792   23.545  1.00   37.66 ? 352  THR A CG2   1 
ATOM   2676 N  N     . ALA A 1 353 ? 2.204   8.192   27.380  1.00   36.56 ? 353  ALA A N     1 
ATOM   2677 C  CA    . ALA A 1 353 ? 3.243   8.842   28.164  1.00   36.07 ? 353  ALA A CA    1 
ATOM   2678 C  C     . ALA A 1 353 ? 3.891   7.856   29.173  1.00   35.55 ? 353  ALA A C     1 
ATOM   2679 O  O     . ALA A 1 353 ? 5.064   8.020   29.499  1.00   33.32 ? 353  ALA A O     1 
ATOM   2680 C  CB    . ALA A 1 353 ? 2.679   10.046  28.894  1.00   37.04 ? 353  ALA A CB    1 
ATOM   2681 N  N     . SER A 1 354 ? 3.144   6.861   29.633  1.00   35.62 ? 354  SER A N     1 
ATOM   2682 C  CA    . SER A 1 354 ? 3.719   5.887   30.581  1.00   37.49 ? 354  SER A CA    1 
ATOM   2683 C  C     . SER A 1 354 ? 4.880   5.162   29.906  1.00   37.62 ? 354  SER A C     1 
ATOM   2684 O  O     . SER A 1 354 ? 5.954   4.995   30.493  1.00   36.99 ? 354  SER A O     1 
ATOM   2685 C  CB    . SER A 1 354 ? 2.665   4.873   31.065  1.00   36.42 ? 354  SER A CB    1 
ATOM   2686 O  OG    . SER A 1 354 ? 2.321   3.960   30.040  1.00   37.72 ? 354  SER A OG    1 
ATOM   2687 N  N     . ILE A 1 355 ? 4.671   4.755   28.648  1.00   40.45 ? 355  ILE A N     1 
ATOM   2688 C  CA    . ILE A 1 355 ? 5.719   4.075   27.881  1.00   41.84 ? 355  ILE A CA    1 
ATOM   2689 C  C     . ILE A 1 355 ? 7.014   4.894   27.867  1.00   43.73 ? 355  ILE A C     1 
ATOM   2690 O  O     . ILE A 1 355 ? 8.111   4.344   28.002  1.00   43.89 ? 355  ILE A O     1 
ATOM   2691 C  CB    . ILE A 1 355 ? 5.248   3.808   26.428  1.00   39.54 ? 355  ILE A CB    1 
ATOM   2692 C  CG1   . ILE A 1 355 ? 4.116   2.782   26.454  1.00   38.87 ? 355  ILE A CG1   1 
ATOM   2693 C  CG2   . ILE A 1 355 ? 6.397   3.331   25.565  1.00   37.18 ? 355  ILE A CG2   1 
ATOM   2694 C  CD1   . ILE A 1 355 ? 3.736   2.262   25.096  1.00   37.84 ? 355  ILE A CD1   1 
ATOM   2695 N  N     . LEU A 1 356 ? 6.879   6.205   27.701  1.00   47.20 ? 356  LEU A N     1 
ATOM   2696 C  CA    . LEU A 1 356 ? 8.018   7.101   27.672  1.00   49.99 ? 356  LEU A CA    1 
ATOM   2697 C  C     . LEU A 1 356 ? 8.757   7.048   29.028  1.00   51.74 ? 356  LEU A C     1 
ATOM   2698 O  O     . LEU A 1 356 ? 9.979   7.187   29.078  1.00   53.18 ? 356  LEU A O     1 
ATOM   2699 C  CB    . LEU A 1 356 ? 7.507   8.513   27.394  1.00   51.17 ? 356  LEU A CB    1 
ATOM   2700 C  CG    . LEU A 1 356 ? 8.137   9.566   26.468  1.00   51.66 ? 356  LEU A CG    1 
ATOM   2701 C  CD1   . LEU A 1 356 ? 8.407   9.032   25.053  1.00   50.54 ? 356  LEU A CD1   1 
ATOM   2702 C  CD2   . LEU A 1 356 ? 7.157   10.730  26.420  1.00   51.76 ? 356  LEU A CD2   1 
ATOM   2703 N  N     . HIS A 1 357 ? 8.020   6.846   30.133  1.00   52.49 ? 357  HIS A N     1 
ATOM   2704 C  CA    . HIS A 1 357 ? 8.645   6.780   31.462  1.00   53.59 ? 357  HIS A CA    1 
ATOM   2705 C  C     . HIS A 1 357 ? 9.206   5.407   31.773  1.00   53.48 ? 357  HIS A C     1 
ATOM   2706 O  O     . HIS A 1 357 ? 10.243  5.291   32.426  1.00   55.75 ? 357  HIS A O     1 
ATOM   2707 C  CB    . HIS A 1 357 ? 7.655   7.213   32.552  1.00   51.57 ? 357  HIS A CB    1 
ATOM   2708 C  CG    . HIS A 1 357 ? 7.273   8.656   32.454  1.00   48.16 ? 357  HIS A CG    1 
ATOM   2709 N  ND1   . HIS A 1 357 ? 8.208   9.668   32.497  1.00   46.65 ? 357  HIS A ND1   1 
ATOM   2710 C  CD2   . HIS A 1 357 ? 6.077   9.253   32.231  1.00   46.14 ? 357  HIS A CD2   1 
ATOM   2711 C  CE1   . HIS A 1 357 ? 7.606   10.830  32.298  1.00   46.31 ? 357  HIS A CE1   1 
ATOM   2712 N  NE2   . HIS A 1 357 ? 6.313   10.605  32.132  1.00   47.03 ? 357  HIS A NE2   1 
ATOM   2713 N  N     . MET A 1 358 ? 8.524   4.366   31.300  1.00   52.74 ? 358  MET A N     1 
ATOM   2714 C  CA    . MET A 1 358 ? 9.007   3.007   31.506  1.00   53.33 ? 358  MET A CA    1 
ATOM   2715 C  C     . MET A 1 358 ? 10.449  2.883   31.039  1.00   53.27 ? 358  MET A C     1 
ATOM   2716 O  O     . MET A 1 358 ? 11.267  2.223   31.689  1.00   53.32 ? 358  MET A O     1 
ATOM   2717 C  CB    . MET A 1 358 ? 8.176   2.006   30.717  1.00   53.32 ? 358  MET A CB    1 
ATOM   2718 C  CG    . MET A 1 358 ? 6.780   1.818   31.236  1.00   52.87 ? 358  MET A CG    1 
ATOM   2719 S  SD    . MET A 1 358 ? 5.808   0.779   30.124  1.00   53.06 ? 358  MET A SD    1 
ATOM   2720 C  CE    . MET A 1 358 ? 4.161   0.921   30.865  1.00   52.98 ? 358  MET A CE    1 
ATOM   2721 N  N     . GLY A 1 359 ? 10.765  3.518   29.922  1.00   50.79 ? 359  GLY A N     1 
ATOM   2722 C  CA    . GLY A 1 359 ? 12.108  3.416   29.384  1.00   48.99 ? 359  GLY A CA    1 
ATOM   2723 C  C     . GLY A 1 359 ? 13.149  4.159   30.183  1.00   50.10 ? 359  GLY A C     1 
ATOM   2724 O  O     . GLY A 1 359 ? 14.333  4.157   29.821  1.00   46.49 ? 359  GLY A O     1 
ATOM   2725 N  N     . GLU A 1 360 ? 12.726  4.798   31.270  1.00   50.72 ? 360  GLU A N     1 
ATOM   2726 C  CA    . GLU A 1 360 ? 13.656  5.561   32.095  1.00   52.75 ? 360  GLU A CA    1 
ATOM   2727 C  C     . GLU A 1 360 ? 14.026  4.870   33.407  1.00   54.24 ? 360  GLU A C     1 
ATOM   2728 O  O     . GLU A 1 360 ? 14.997  5.250   34.065  1.00   54.06 ? 360  GLU A O     1 
ATOM   2729 C  CB    . GLU A 1 360 ? 13.064  6.934   32.396  1.00   54.30 ? 360  GLU A CB    1 
ATOM   2730 C  CG    . GLU A 1 360 ? 12.959  7.835   31.206  1.00   59.67 ? 360  GLU A CG    1 
ATOM   2731 C  CD    . GLU A 1 360 ? 14.324  8.252   30.708  1.00   63.53 ? 360  GLU A CD    1 
ATOM   2732 O  OE1   . GLU A 1 360 ? 14.621  8.027   29.504  1.00   64.15 ? 360  GLU A OE1   1 
ATOM   2733 O  OE2   . GLU A 1 360 ? 15.097  8.807   31.530  1.00   64.62 ? 360  GLU A OE2   1 
ATOM   2734 N  N     . MET A 1 361 ? 13.252  3.861   33.781  1.00   57.95 ? 361  MET A N     1 
ATOM   2735 C  CA    . MET A 1 361 ? 13.481  3.116   35.016  1.00   61.08 ? 361  MET A CA    1 
ATOM   2736 C  C     . MET A 1 361 ? 14.865  2.463   35.065  1.00   63.04 ? 361  MET A C     1 
ATOM   2737 O  O     . MET A 1 361 ? 15.089  1.424   34.435  1.00   66.58 ? 361  MET A O     1 
ATOM   2738 C  CB    . MET A 1 361 ? 12.396  2.049   35.164  1.00   61.01 ? 361  MET A CB    1 
ATOM   2739 C  CG    . MET A 1 361 ? 10.991  2.610   35.175  1.00   61.29 ? 361  MET A CG    1 
ATOM   2740 S  SD    . MET A 1 361 ? 9.751   1.334   34.913  1.00   63.78 ? 361  MET A SD    1 
ATOM   2741 C  CE    . MET A 1 361 ? 9.511   0.760   36.564  1.00   64.16 ? 361  MET A CE    1 
ATOM   2742 N  N     . LYS A 1 362 ? 15.793  3.064   35.806  1.00   66.62 ? 362  LYS A N     1 
ATOM   2743 C  CA    . LYS A 1 362 ? 17.149  2.517   35.928  1.00   69.42 ? 362  LYS A CA    1 
ATOM   2744 C  C     . LYS A 1 362 ? 17.214  1.277   36.819  1.00   69.91 ? 362  LYS A C     1 
ATOM   2745 O  O     . LYS A 1 362 ? 16.301  1.014   37.607  1.00   71.67 ? 362  LYS A O     1 
ATOM   2746 C  CB    . LYS A 1 362 ? 18.115  3.567   36.489  1.00   70.91 ? 362  LYS A CB    1 
ATOM   2747 C  CG    . LYS A 1 362 ? 18.624  4.606   35.495  1.00   71.20 ? 362  LYS A CG    1 
ATOM   2748 C  CD    . LYS A 1 362 ? 17.587  5.657   35.174  1.00   71.52 ? 362  LYS A CD    1 
ATOM   2749 C  CE    . LYS A 1 362 ? 18.152  6.727   34.232  1.00   72.50 ? 362  LYS A CE    1 
ATOM   2750 N  NZ    . LYS A 1 362 ? 17.183  7.850   33.966  1.00   73.25 ? 362  LYS A NZ    1 
ATOM   2751 N  N     . PHE A 1 363 ? 18.301  0.516   36.691  1.00   70.52 ? 363  PHE A N     1 
ATOM   2752 C  CA    . PHE A 1 363 ? 18.502  -0.684  37.497  1.00   69.44 ? 363  PHE A CA    1 
ATOM   2753 C  C     . PHE A 1 363 ? 19.966  -0.932  37.832  1.00   70.12 ? 363  PHE A C     1 
ATOM   2754 O  O     . PHE A 1 363 ? 20.864  -0.545  37.089  1.00   71.02 ? 363  PHE A O     1 
ATOM   2755 C  CB    . PHE A 1 363 ? 17.910  -1.899  36.803  1.00   65.46 ? 363  PHE A CB    1 
ATOM   2756 C  CG    . PHE A 1 363 ? 16.428  -1.831  36.659  1.00   59.93 ? 363  PHE A CG    1 
ATOM   2757 C  CD1   . PHE A 1 363 ? 15.846  -1.367  35.480  1.00   58.43 ? 363  PHE A CD1   1 
ATOM   2758 C  CD2   . PHE A 1 363 ? 15.602  -2.201  37.714  1.00   57.94 ? 363  PHE A CD2   1 
ATOM   2759 C  CE1   . PHE A 1 363 ? 14.456  -1.268  35.352  1.00   56.94 ? 363  PHE A CE1   1 
ATOM   2760 C  CE2   . PHE A 1 363 ? 14.211  -2.108  37.610  1.00   57.37 ? 363  PHE A CE2   1 
ATOM   2761 C  CZ    . PHE A 1 363 ? 13.634  -1.639  36.420  1.00   57.91 ? 363  PHE A CZ    1 
ATOM   2762 N  N     . LYS A 1 364 ? 20.190  -1.579  38.975  1.00   73.09 ? 364  LYS A N     1 
ATOM   2763 C  CA    . LYS A 1 364 ? 21.534  -1.876  39.455  1.00   77.04 ? 364  LYS A CA    1 
ATOM   2764 C  C     . LYS A 1 364 ? 21.843  -3.374  39.471  1.00   79.95 ? 364  LYS A C     1 
ATOM   2765 O  O     . LYS A 1 364 ? 20.945  -4.214  39.580  1.00   84.38 ? 364  LYS A O     1 
ATOM   2766 C  CB    . LYS A 1 364 ? 21.719  -1.292  40.854  1.00   75.21 ? 364  LYS A CB    1 
ATOM   2767 N  N     . GLN A 1 365 ? 23.138  -3.674  39.356  1.00   86.24 ? 365  GLN A N     1 
ATOM   2768 C  CA    . GLN A 1 365 ? 23.699  -5.029  39.360  1.00   90.93 ? 365  GLN A CA    1 
ATOM   2769 C  C     . GLN A 1 365 ? 22.758  -6.088  39.921  1.00   93.99 ? 365  GLN A C     1 
ATOM   2770 O  O     . GLN A 1 365 ? 22.636  -7.180  39.362  1.00   97.69 ? 365  GLN A O     1 
ATOM   2771 C  CB    . GLN A 1 365 ? 25.015  -5.009  40.157  1.00   93.33 ? 365  GLN A CB    1 
ATOM   2772 C  CG    . GLN A 1 365 ? 25.580  -6.365  40.567  1.00   90.35 ? 365  GLN A CG    1 
ATOM   2773 C  CD    . GLN A 1 365 ? 26.904  -6.237  41.315  1.00   88.95 ? 365  GLN A CD    1 
ATOM   2774 O  OE1   . GLN A 1 365 ? 27.055  -5.385  42.194  1.00   88.34 ? 365  GLN A OE1   1 
ATOM   2775 N  NE2   . GLN A 1 365 ? 27.865  -7.090  40.975  1.00   87.74 ? 365  GLN A NE2   1 
ATOM   2776 N  N     . GLU A 1 370 ? 23.692  -11.347 40.673  1.00   85.36 ? 370  GLU A N     1 
ATOM   2777 C  CA    . GLU A 1 370 ? 22.645  -12.346 40.482  1.00   83.67 ? 370  GLU A CA    1 
ATOM   2778 C  C     . GLU A 1 370 ? 21.292  -11.682 40.208  1.00   84.20 ? 370  GLU A C     1 
ATOM   2779 O  O     . GLU A 1 370 ? 20.884  -11.529 39.057  1.00   82.08 ? 370  GLU A O     1 
ATOM   2780 C  CB    . GLU A 1 370 ? 22.554  -13.241 41.718  1.00   86.16 ? 370  GLU A CB    1 
ATOM   2781 N  N     . GLN A 1 371 ? 20.608  -11.293 41.284  1.00   81.14 ? 371  GLN A N     1 
ATOM   2782 C  CA    . GLN A 1 371 ? 19.299  -10.637 41.225  1.00   77.52 ? 371  GLN A CA    1 
ATOM   2783 C  C     . GLN A 1 371 ? 19.459  -9.130  40.985  1.00   77.83 ? 371  GLN A C     1 
ATOM   2784 O  O     . GLN A 1 371 ? 20.510  -8.556  41.281  1.00   72.61 ? 371  GLN A O     1 
ATOM   2785 C  CB    . GLN A 1 371 ? 18.552  -10.875 42.542  1.00   75.96 ? 371  GLN A CB    1 
ATOM   2786 C  CG    . GLN A 1 371 ? 17.225  -10.154 42.696  1.00   78.27 ? 371  GLN A CG    1 
ATOM   2787 C  CD    . GLN A 1 371 ? 16.065  -10.895 42.049  1.00   80.24 ? 371  GLN A CD    1 
ATOM   2788 O  OE1   . GLN A 1 371 ? 15.809  -12.060 42.349  1.00   80.59 ? 371  GLN A OE1   1 
ATOM   2789 N  NE2   . GLN A 1 371 ? 15.349  -10.212 41.161  1.00   81.41 ? 371  GLN A NE2   1 
ATOM   2790 N  N     . ALA A 1 372 ? 18.416  -8.492  40.451  1.00   78.50 ? 372  ALA A N     1 
ATOM   2791 C  CA    . ALA A 1 372 ? 18.464  -7.063  40.162  1.00   79.24 ? 372  ALA A CA    1 
ATOM   2792 C  C     . ALA A 1 372 ? 17.688  -6.209  41.157  1.00   80.08 ? 372  ALA A C     1 
ATOM   2793 O  O     . ALA A 1 372 ? 16.871  -6.713  41.931  1.00   78.65 ? 372  ALA A O     1 
ATOM   2794 C  CB    . ALA A 1 372 ? 17.955  -6.810  38.751  1.00   80.37 ? 372  ALA A CB    1 
ATOM   2795 N  N     . GLU A 1 373 ? 17.955  -4.905  41.119  1.00   81.68 ? 373  GLU A N     1 
ATOM   2796 C  CA    . GLU A 1 373 ? 17.313  -3.941  42.013  1.00   81.99 ? 373  GLU A CA    1 
ATOM   2797 C  C     . GLU A 1 373 ? 17.116  -2.579  41.329  1.00   80.35 ? 373  GLU A C     1 
ATOM   2798 O  O     . GLU A 1 373 ? 17.811  -2.256  40.364  1.00   78.68 ? 373  GLU A O     1 
ATOM   2799 C  CB    . GLU A 1 373 ? 18.180  -3.754  43.267  1.00   86.00 ? 373  GLU A CB    1 
ATOM   2800 C  CG    . GLU A 1 373 ? 18.513  -5.056  43.997  1.00   94.77 ? 373  GLU A CG    1 
ATOM   2801 C  CD    . GLU A 1 373 ? 19.484  -4.867  45.156  1.00   98.15 ? 373  GLU A CD    1 
ATOM   2802 O  OE1   . GLU A 1 373 ? 20.623  -4.401  44.919  1.00   98.98 ? 373  GLU A OE1   1 
ATOM   2803 O  OE2   . GLU A 1 373 ? 19.104  -5.191  46.304  1.00   99.39 ? 373  GLU A OE2   1 
ATOM   2804 N  N     . SER A 1 374 ? 16.170  -1.793  41.839  1.00   78.51 ? 374  SER A N     1 
ATOM   2805 C  CA    . SER A 1 374 ? 15.887  -0.459  41.310  1.00   75.65 ? 374  SER A CA    1 
ATOM   2806 C  C     . SER A 1 374 ? 16.994  0.514   41.699  1.00   75.42 ? 374  SER A C     1 
ATOM   2807 O  O     . SER A 1 374 ? 17.445  0.513   42.847  1.00   75.22 ? 374  SER A O     1 
ATOM   2808 C  CB    . SER A 1 374 ? 14.561  0.069   41.872  1.00   72.68 ? 374  SER A CB    1 
ATOM   2809 O  OG    . SER A 1 374 ? 13.488  -0.805  41.578  1.00   71.85 ? 374  SER A OG    1 
ATOM   2810 N  N     . ASP A 1 375 ? 17.435  1.345   40.759  1.00   77.18 ? 375  ASP A N     1 
ATOM   2811 C  CA    . ASP A 1 375 ? 18.479  2.323   41.063  1.00   80.04 ? 375  ASP A CA    1 
ATOM   2812 C  C     . ASP A 1 375 ? 17.823  3.619   41.511  1.00   80.57 ? 375  ASP A C     1 
ATOM   2813 O  O     . ASP A 1 375 ? 18.483  4.645   41.689  1.00   83.59 ? 375  ASP A O     1 
ATOM   2814 C  CB    . ASP A 1 375 ? 19.352  2.610   39.844  1.00   82.03 ? 375  ASP A CB    1 
ATOM   2815 C  CG    . ASP A 1 375 ? 20.637  3.333   40.216  1.00   83.94 ? 375  ASP A CG    1 
ATOM   2816 O  OD1   . ASP A 1 375 ? 21.577  2.660   40.690  1.00   84.23 ? 375  ASP A OD1   1 
ATOM   2817 O  OD2   . ASP A 1 375 ? 20.707  4.573   40.057  1.00   84.78 ? 375  ASP A OD2   1 
ATOM   2818 N  N     . GLY A 1 376 ? 16.512  3.554   41.691  1.00   80.66 ? 376  GLY A N     1 
ATOM   2819 C  CA    . GLY A 1 376 ? 15.737  4.704   42.111  1.00   78.84 ? 376  GLY A CA    1 
ATOM   2820 C  C     . GLY A 1 376 ? 14.287  4.319   41.931  1.00   77.97 ? 376  GLY A C     1 
ATOM   2821 O  O     . GLY A 1 376 ? 13.993  3.158   41.641  1.00   77.59 ? 376  GLY A O     1 
ATOM   2822 N  N     . THR A 1 377 ? 13.377  5.262   42.097  1.00   76.00 ? 377  THR A N     1 
ATOM   2823 C  CA    . THR A 1 377 ? 11.968  4.939   41.926  1.00   71.62 ? 377  THR A CA    1 
ATOM   2824 C  C     . THR A 1 377 ? 11.146  6.067   41.318  1.00   69.36 ? 377  THR A C     1 
ATOM   2825 O  O     . THR A 1 377 ? 9.980   5.870   40.970  1.00   66.82 ? 377  THR A O     1 
ATOM   2826 C  CB    . THR A 1 377 ? 11.333  4.503   43.265  1.00   72.67 ? 377  THR A CB    1 
ATOM   2827 O  OG1   . THR A 1 377 ? 11.897  5.269   44.338  1.00   74.97 ? 377  THR A OG1   1 
ATOM   2828 C  CG2   . THR A 1 377 ? 11.565  3.023   43.502  1.00   75.05 ? 377  THR A CG2   1 
ATOM   2829 N  N     . ALA A 1 378 ? 11.749  7.244   41.192  1.00   64.59 ? 378  ALA A N     1 
ATOM   2830 C  CA    . ALA A 1 378 ? 11.074  8.400   40.607  1.00   62.12 ? 378  ALA A CA    1 
ATOM   2831 C  C     . ALA A 1 378 ? 10.299  8.002   39.339  1.00   63.19 ? 378  ALA A C     1 
ATOM   2832 O  O     . ALA A 1 378 ? 9.115   8.313   39.202  1.00   60.28 ? 378  ALA A O     1 
ATOM   2833 C  CB    . ALA A 1 378 ? 12.097  9.475   40.274  1.00   61.49 ? 378  ALA A CB    1 
ATOM   2834 N  N     . GLU A 1 379 ? 10.983  7.311   38.425  1.00   63.67 ? 379  GLU A N     1 
ATOM   2835 C  CA    . GLU A 1 379 ? 10.399  6.850   37.169  1.00   63.08 ? 379  GLU A CA    1 
ATOM   2836 C  C     . GLU A 1 379 ? 9.196   5.942   37.352  1.00   61.37 ? 379  GLU A C     1 
ATOM   2837 O  O     . GLU A 1 379 ? 8.107   6.225   36.844  1.00   57.36 ? 379  GLU A O     1 
ATOM   2838 C  CB    . GLU A 1 379 ? 11.457  6.099   36.359  1.00   68.18 ? 379  GLU A CB    1 
ATOM   2839 C  CG    . GLU A 1 379 ? 12.318  6.972   35.480  1.00   81.36 ? 379  GLU A CG    1 
ATOM   2840 C  CD    . GLU A 1 379 ? 12.530  8.358   36.042  1.00   87.45 ? 379  GLU A CD    1 
ATOM   2841 O  OE1   . GLU A 1 379 ? 13.012  8.477   37.198  1.00   90.34 ? 379  GLU A OE1   1 
ATOM   2842 O  OE2   . GLU A 1 379 ? 12.210  9.326   35.314  1.00   89.78 ? 379  GLU A OE2   1 
ATOM   2843 N  N     . ALA A 1 380 ? 9.396   4.840   38.079  1.00   58.78 ? 380  ALA A N     1 
ATOM   2844 C  CA    . ALA A 1 380 ? 8.333   3.877   38.305  1.00   55.58 ? 380  ALA A CA    1 
ATOM   2845 C  C     . ALA A 1 380 ? 7.107   4.513   38.946  1.00   55.14 ? 380  ALA A C     1 
ATOM   2846 O  O     . ALA A 1 380 ? 5.981   4.073   38.704  1.00   53.26 ? 380  ALA A O     1 
ATOM   2847 C  CB    . ALA A 1 380 ? 8.838   2.733   39.162  1.00   55.16 ? 380  ALA A CB    1 
ATOM   2848 N  N     . GLU A 1 381 ? 7.311   5.543   39.757  1.00   56.41 ? 381  GLU A N     1 
ATOM   2849 C  CA    . GLU A 1 381 ? 6.168   6.205   40.376  1.00   57.05 ? 381  GLU A CA    1 
ATOM   2850 C  C     . GLU A 1 381 ? 5.364   6.897   39.275  1.00   55.35 ? 381  GLU A C     1 
ATOM   2851 O  O     . GLU A 1 381 ? 4.136   6.932   39.328  1.00   56.67 ? 381  GLU A O     1 
ATOM   2852 C  CB    . GLU A 1 381 ? 6.631   7.207   41.440  1.00   59.38 ? 381  GLU A CB    1 
ATOM   2853 C  CG    . GLU A 1 381 ? 7.184   6.535   42.699  1.00   65.09 ? 381  GLU A CG    1 
ATOM   2854 C  CD    . GLU A 1 381 ? 7.927   7.501   43.619  1.00   68.72 ? 381  GLU A CD    1 
ATOM   2855 O  OE1   . GLU A 1 381 ? 7.292   8.411   44.211  1.00   70.51 ? 381  GLU A OE1   1 
ATOM   2856 O  OE2   . GLU A 1 381 ? 9.163   7.349   43.749  1.00   70.64 ? 381  GLU A OE2   1 
ATOM   2857 N  N     . LYS A 1 382 ? 6.060   7.439   38.268  1.00   54.32 ? 382  LYS A N     1 
ATOM   2858 C  CA    . LYS A 1 382 ? 5.373   8.081   37.141  1.00   53.17 ? 382  LYS A CA    1 
ATOM   2859 C  C     . LYS A 1 382 ? 4.552   7.029   36.392  1.00   50.99 ? 382  LYS A C     1 
ATOM   2860 O  O     . LYS A 1 382 ? 3.358   7.218   36.155  1.00   53.57 ? 382  LYS A O     1 
ATOM   2861 C  CB    . LYS A 1 382 ? 6.386   8.734   36.212  1.00   51.76 ? 382  LYS A CB    1 
ATOM   2862 C  CG    . LYS A 1 382 ? 7.120   9.866   36.910  1.00   49.30 ? 382  LYS A CG    1 
ATOM   2863 C  CD    . LYS A 1 382 ? 8.315   10.393  36.129  1.00   47.65 ? 382  LYS A CD    1 
ATOM   2864 C  CE    . LYS A 1 382 ? 9.186   11.283  37.015  1.00   46.24 ? 382  LYS A CE    1 
ATOM   2865 N  NZ    . LYS A 1 382 ? 10.452  11.707  36.340  1.00   46.58 ? 382  LYS A NZ    1 
ATOM   2866 N  N     . VAL A 1 383 ? 5.191   5.925   36.039  1.00   48.60 ? 383  VAL A N     1 
ATOM   2867 C  CA    . VAL A 1 383 ? 4.500   4.844   35.341  1.00   47.16 ? 383  VAL A CA    1 
ATOM   2868 C  C     . VAL A 1 383 ? 3.282   4.412   36.111  1.00   46.05 ? 383  VAL A C     1 
ATOM   2869 O  O     . VAL A 1 383 ? 2.166   4.445   35.602  1.00   46.26 ? 383  VAL A O     1 
ATOM   2870 C  CB    . VAL A 1 383 ? 5.406   3.608   35.150  1.00   44.13 ? 383  VAL A CB    1 
ATOM   2871 C  CG1   . VAL A 1 383 ? 4.583   2.452   34.631  1.00   41.05 ? 383  VAL A CG1   1 
ATOM   2872 C  CG2   . VAL A 1 383 ? 6.535   3.942   34.186  1.00   40.50 ? 383  VAL A CG2   1 
ATOM   2873 N  N     . ALA A 1 384 ? 3.498   4.001   37.349  1.00   45.79 ? 384  ALA A N     1 
ATOM   2874 C  CA    . ALA A 1 384 ? 2.409   3.554   38.199  1.00   45.67 ? 384  ALA A CA    1 
ATOM   2875 C  C     . ALA A 1 384 ? 1.315   4.607   38.391  1.00   45.49 ? 384  ALA A C     1 
ATOM   2876 O  O     . ALA A 1 384 ? 0.127   4.270   38.379  1.00   43.69 ? 384  ALA A O     1 
ATOM   2877 C  CB    . ALA A 1 384 ? 2.958   3.112   39.557  1.00   45.94 ? 384  ALA A CB    1 
ATOM   2878 N  N     . PHE A 1 385 ? 1.701   5.861   38.573  1.00   45.82 ? 385  PHE A N     1 
ATOM   2879 C  CA    . PHE A 1 385 ? 0.707   6.918   38.740  1.00   48.26 ? 385  PHE A CA    1 
ATOM   2880 C  C     . PHE A 1 385 ? -0.174  7.044   37.493  1.00   49.62 ? 385  PHE A C     1 
ATOM   2881 O  O     . PHE A 1 385 ? -1.394  7.104   37.599  1.00   50.26 ? 385  PHE A O     1 
ATOM   2882 C  CB    . PHE A 1 385 ? 1.363   8.272   39.012  1.00   50.52 ? 385  PHE A CB    1 
ATOM   2883 C  CG    . PHE A 1 385 ? 0.365   9.392   39.165  1.00   55.50 ? 385  PHE A CG    1 
ATOM   2884 C  CD1   . PHE A 1 385 ? -0.599  9.352   40.179  1.00   57.41 ? 385  PHE A CD1   1 
ATOM   2885 C  CD2   . PHE A 1 385 ? 0.381   10.482  38.299  1.00   57.34 ? 385  PHE A CD2   1 
ATOM   2886 C  CE1   . PHE A 1 385 ? -1.531  10.378  40.330  1.00   57.95 ? 385  PHE A CE1   1 
ATOM   2887 C  CE2   . PHE A 1 385 ? -0.547  11.515  38.437  1.00   58.03 ? 385  PHE A CE2   1 
ATOM   2888 C  CZ    . PHE A 1 385 ? -1.503  11.465  39.457  1.00   58.51 ? 385  PHE A CZ    1 
ATOM   2889 N  N     . LEU A 1 386 ? 0.453   7.082   36.309  1.00   49.47 ? 386  LEU A N     1 
ATOM   2890 C  CA    . LEU A 1 386 ? -0.286  7.183   35.051  1.00   49.23 ? 386  LEU A CA    1 
ATOM   2891 C  C     . LEU A 1 386 ? -1.100  5.931   34.767  1.00   49.34 ? 386  LEU A C     1 
ATOM   2892 O  O     . LEU A 1 386 ? -2.162  6.007   34.152  1.00   47.27 ? 386  LEU A O     1 
ATOM   2893 C  CB    . LEU A 1 386 ? 0.681   7.451   33.884  1.00   50.03 ? 386  LEU A CB    1 
ATOM   2894 C  CG    . LEU A 1 386 ? 1.271   8.866   33.894  1.00   51.10 ? 386  LEU A CG    1 
ATOM   2895 C  CD1   . LEU A 1 386 ? 2.403   9.044   32.900  1.00   51.17 ? 386  LEU A CD1   1 
ATOM   2896 C  CD2   . LEU A 1 386 ? 0.144   9.809   33.582  1.00   52.73 ? 386  LEU A CD2   1 
ATOM   2897 N  N     . CYS A 1 387 ? -0.619  4.771   35.220  1.00   50.43 ? 387  CYS A N     1 
ATOM   2898 C  CA    . CYS A 1 387 ? -1.361  3.530   34.977  1.00   50.90 ? 387  CYS A CA    1 
ATOM   2899 C  C     . CYS A 1 387 ? -2.374  3.163   36.044  1.00   51.09 ? 387  CYS A C     1 
ATOM   2900 O  O     . CYS A 1 387 ? -3.060  2.153   35.933  1.00   49.92 ? 387  CYS A O     1 
ATOM   2901 C  CB    . CYS A 1 387 ? -0.410  2.358   34.772  1.00   51.71 ? 387  CYS A CB    1 
ATOM   2902 S  SG    . CYS A 1 387 ? 0.504   2.443   33.197  1.00   54.17 ? 387  CYS A SG    1 
ATOM   2903 N  N     . GLY A 1 388 ? -2.474  3.991   37.092  1.00   51.55 ? 388  GLY A N     1 
ATOM   2904 C  CA    . GLY A 1 388 ? -3.428  3.706   38.144  1.00   51.98 ? 388  GLY A CA    1 
ATOM   2905 C  C     . GLY A 1 388 ? -3.141  2.472   38.995  1.00   52.44 ? 388  GLY A C     1 
ATOM   2906 O  O     . GLY A 1 388 ? -4.039  1.668   39.237  1.00   53.30 ? 388  GLY A O     1 
ATOM   2907 N  N     . ILE A 1 389 ? -1.895  2.316   39.440  1.00   52.42 ? 389  ILE A N     1 
ATOM   2908 C  CA    . ILE A 1 389 ? -1.514  1.182   40.287  1.00   53.00 ? 389  ILE A CA    1 
ATOM   2909 C  C     . ILE A 1 389 ? -0.384  1.637   41.207  1.00   55.30 ? 389  ILE A C     1 
ATOM   2910 O  O     . ILE A 1 389 ? 0.275   2.646   40.933  1.00   52.28 ? 389  ILE A O     1 
ATOM   2911 C  CB    . ILE A 1 389 ? -1.022  -0.044  39.466  1.00   51.30 ? 389  ILE A CB    1 
ATOM   2912 C  CG1   . ILE A 1 389 ? 0.275   0.294   38.736  1.00   51.25 ? 389  ILE A CG1   1 
ATOM   2913 C  CG2   . ILE A 1 389 ? -2.076  -0.490  38.490  1.00   49.28 ? 389  ILE A CG2   1 
ATOM   2914 C  CD1   . ILE A 1 389 ? 0.893   -0.917  38.052  1.00   51.20 ? 389  ILE A CD1   1 
ATOM   2915 N  N     . ASN A 1 390 ? -0.157  0.904   42.304  1.00   57.66 ? 390  ASN A N     1 
ATOM   2916 C  CA    . ASN A 1 390 ? 0.903   1.270   43.249  1.00   58.19 ? 390  ASN A CA    1 
ATOM   2917 C  C     . ASN A 1 390 ? 2.287   0.952   42.686  1.00   56.12 ? 390  ASN A C     1 
ATOM   2918 O  O     . ASN A 1 390 ? 2.517   -0.139  42.173  1.00   53.71 ? 390  ASN A O     1 
ATOM   2919 C  CB    . ASN A 1 390 ? 0.728   0.533   44.595  1.00   64.12 ? 390  ASN A CB    1 
ATOM   2920 C  CG    . ASN A 1 390 ? 1.971   0.656   45.494  1.00   71.79 ? 390  ASN A CG    1 
ATOM   2921 O  OD1   . ASN A 1 390 ? 2.101   1.595   46.278  1.00   75.92 ? 390  ASN A OD1   1 
ATOM   2922 N  ND2   . ASN A 1 390 ? 2.902   -0.282  45.344  1.00   76.11 ? 390  ASN A ND2   1 
ATOM   2923 N  N     . ALA A 1 391 ? 3.200   1.907   42.799  1.00   53.96 ? 391  ALA A N     1 
ATOM   2924 C  CA    . ALA A 1 391 ? 4.560   1.731   42.306  1.00   54.02 ? 391  ALA A CA    1 
ATOM   2925 C  C     . ALA A 1 391 ? 5.282   0.535   42.944  1.00   55.72 ? 391  ALA A C     1 
ATOM   2926 O  O     . ALA A 1 391 ? 5.886   -0.277  42.240  1.00   56.99 ? 391  ALA A O     1 
ATOM   2927 C  CB    . ALA A 1 391 ? 5.364   3.007   42.531  1.00   53.64 ? 391  ALA A CB    1 
ATOM   2928 N  N     . GLY A 1 392 ? 5.225   0.432   44.274  1.00   57.43 ? 392  GLY A N     1 
ATOM   2929 C  CA    . GLY A 1 392 ? 5.880   -0.665  44.961  1.00   58.95 ? 392  GLY A CA    1 
ATOM   2930 C  C     . GLY A 1 392 ? 5.383   -2.006  44.473  1.00   61.25 ? 392  GLY A C     1 
ATOM   2931 O  O     . GLY A 1 392 ? 6.161   -2.953  44.350  1.00   59.88 ? 392  GLY A O     1 
ATOM   2932 N  N     . ASP A 1 393 ? 4.084   -2.102  44.201  1.00   63.77 ? 393  ASP A N     1 
ATOM   2933 C  CA    . ASP A 1 393 ? 3.510   -3.350  43.702  1.00   66.27 ? 393  ASP A CA    1 
ATOM   2934 C  C     . ASP A 1 393 ? 4.201   -3.657  42.378  1.00   65.89 ? 393  ASP A C     1 
ATOM   2935 O  O     . ASP A 1 393 ? 4.669   -4.770  42.138  1.00   64.94 ? 393  ASP A O     1 
ATOM   2936 C  CB    . ASP A 1 393 ? 2.010   -3.198  43.430  1.00   72.00 ? 393  ASP A CB    1 
ATOM   2937 C  CG    . ASP A 1 393 ? 1.192   -3.041  44.687  1.00   79.38 ? 393  ASP A CG    1 
ATOM   2938 O  OD1   . ASP A 1 393 ? 1.563   -2.209  45.532  1.00   83.73 ? 393  ASP A OD1   1 
ATOM   2939 O  OD2   . ASP A 1 393 ? 0.163   -3.739  44.822  1.00   83.25 ? 393  ASP A OD2   1 
ATOM   2940 N  N     . LEU A 1 394 ? 4.247   -2.635  41.527  1.00   64.23 ? 394  LEU A N     1 
ATOM   2941 C  CA    . LEU A 1 394 ? 4.843   -2.725  40.206  1.00   61.56 ? 394  LEU A CA    1 
ATOM   2942 C  C     . LEU A 1 394 ? 6.285   -3.139  40.296  1.00   61.07 ? 394  LEU A C     1 
ATOM   2943 O  O     . LEU A 1 394 ? 6.685   -4.163  39.736  1.00   59.71 ? 394  LEU A O     1 
ATOM   2944 C  CB    . LEU A 1 394 ? 4.765   -1.369  39.491  1.00   60.64 ? 394  LEU A CB    1 
ATOM   2945 C  CG    . LEU A 1 394 ? 5.437   -1.303  38.116  1.00   59.92 ? 394  LEU A CG    1 
ATOM   2946 C  CD1   . LEU A 1 394 ? 4.590   -2.041  37.084  1.00   59.99 ? 394  LEU A CD1   1 
ATOM   2947 C  CD2   . LEU A 1 394 ? 5.617   0.137   37.717  1.00   60.91 ? 394  LEU A CD2   1 
ATOM   2948 N  N     . LEU A 1 395 ? 7.072   -2.331  40.990  1.00   61.21 ? 395  LEU A N     1 
ATOM   2949 C  CA    . LEU A 1 395 ? 8.488   -2.618  41.140  1.00   63.19 ? 395  LEU A CA    1 
ATOM   2950 C  C     . LEU A 1 395 ? 8.726   -4.054  41.582  1.00   65.83 ? 395  LEU A C     1 
ATOM   2951 O  O     . LEU A 1 395 ? 9.683   -4.694  41.139  1.00   64.12 ? 395  LEU A O     1 
ATOM   2952 C  CB    . LEU A 1 395 ? 9.109   -1.662  42.139  1.00   63.57 ? 395  LEU A CB    1 
ATOM   2953 C  CG    . LEU A 1 395 ? 9.394   -0.272  41.577  1.00   65.14 ? 395  LEU A CG    1 
ATOM   2954 C  CD1   . LEU A 1 395 ? 9.230   0.772   42.673  1.00   66.36 ? 395  LEU A CD1   1 
ATOM   2955 C  CD2   . LEU A 1 395 ? 10.791  -0.242  40.992  1.00   65.52 ? 395  LEU A CD2   1 
ATOM   2956 N  N     . LYS A 1 396 ? 7.855   -4.560  42.445  1.00   69.46 ? 396  LYS A N     1 
ATOM   2957 C  CA    . LYS A 1 396 ? 7.990   -5.925  42.939  1.00   71.20 ? 396  LYS A CA    1 
ATOM   2958 C  C     . LYS A 1 396 ? 7.707   -6.949  41.850  1.00   70.19 ? 396  LYS A C     1 
ATOM   2959 O  O     . LYS A 1 396 ? 8.545   -7.796  41.543  1.00   70.38 ? 396  LYS A O     1 
ATOM   2960 C  CB    . LYS A 1 396 ? 7.046   -6.153  44.127  1.00   72.41 ? 396  LYS A CB    1 
ATOM   2961 N  N     . ALA A 1 397 ? 6.515   -6.866  41.271  1.00   70.13 ? 397  ALA A N     1 
ATOM   2962 C  CA    . ALA A 1 397 ? 6.092   -7.776  40.209  1.00   69.91 ? 397  ALA A CA    1 
ATOM   2963 C  C     . ALA A 1 397 ? 7.003   -7.730  38.983  1.00   69.95 ? 397  ALA A C     1 
ATOM   2964 O  O     . ALA A 1 397 ? 6.812   -8.481  38.031  1.00   72.97 ? 397  ALA A O     1 
ATOM   2965 C  CB    . ALA A 1 397 ? 4.666   -7.451  39.801  1.00   70.46 ? 397  ALA A CB    1 
ATOM   2966 N  N     . LEU A 1 398 ? 7.991   -6.850  39.019  1.00   70.51 ? 398  LEU A N     1 
ATOM   2967 C  CA    . LEU A 1 398 ? 8.923   -6.681  37.914  1.00   70.31 ? 398  LEU A CA    1 
ATOM   2968 C  C     . LEU A 1 398 ? 10.260  -7.363  38.216  1.00   69.83 ? 398  LEU A C     1 
ATOM   2969 O  O     . LEU A 1 398 ? 10.798  -8.087  37.381  1.00   69.81 ? 398  LEU A O     1 
ATOM   2970 C  CB    . LEU A 1 398 ? 9.131   -5.183  37.671  1.00   69.58 ? 398  LEU A CB    1 
ATOM   2971 C  CG    . LEU A 1 398 ? 9.421   -4.633  36.276  1.00   67.88 ? 398  LEU A CG    1 
ATOM   2972 C  CD1   . LEU A 1 398 ? 8.447   -5.207  35.235  1.00   66.09 ? 398  LEU A CD1   1 
ATOM   2973 C  CD2   . LEU A 1 398 ? 9.312   -3.115  36.348  1.00   66.52 ? 398  LEU A CD2   1 
ATOM   2974 N  N     . LEU A 1 399 ? 10.796  -7.122  39.415  1.00   67.24 ? 399  LEU A N     1 
ATOM   2975 C  CA    . LEU A 1 399 ? 12.062  -7.717  39.828  1.00   66.49 ? 399  LEU A CA    1 
ATOM   2976 C  C     . LEU A 1 399 ? 11.923  -9.159  40.339  1.00   68.66 ? 399  LEU A C     1 
ATOM   2977 O  O     . LEU A 1 399 ? 12.876  -9.933  40.280  1.00   65.96 ? 399  LEU A O     1 
ATOM   2978 C  CB    . LEU A 1 399 ? 12.710  -6.847  40.900  1.00   64.25 ? 399  LEU A CB    1 
ATOM   2979 C  CG    . LEU A 1 399 ? 13.201  -5.479  40.427  1.00   61.70 ? 399  LEU A CG    1 
ATOM   2980 C  CD1   . LEU A 1 399 ? 13.628  -4.627  41.619  1.00   61.71 ? 399  LEU A CD1   1 
ATOM   2981 C  CD2   . LEU A 1 399 ? 14.353  -5.659  39.482  1.00   60.39 ? 399  LEU A CD2   1 
ATOM   2982 N  N     . LYS A 1 400 ? 10.744  -9.515  40.829  1.00   71.41 ? 400  LYS A N     1 
ATOM   2983 C  CA    . LYS A 1 400 ? 10.494  -10.861 41.332  1.00   71.98 ? 400  LYS A CA    1 
ATOM   2984 C  C     . LYS A 1 400 ? 9.010   -11.198 41.128  1.00   70.10 ? 400  LYS A C     1 
ATOM   2985 O  O     . LYS A 1 400 ? 8.191   -10.977 42.017  1.00   70.04 ? 400  LYS A O     1 
ATOM   2986 C  CB    . LYS A 1 400 ? 10.837  -10.939 42.826  1.00   74.98 ? 400  LYS A CB    1 
ATOM   2987 C  CG    . LYS A 1 400 ? 12.266  -10.524 43.204  1.00   82.03 ? 400  LYS A CG    1 
ATOM   2988 C  CD    . LYS A 1 400 ? 12.484  -10.629 44.722  1.00   86.21 ? 400  LYS A CD    1 
ATOM   2989 C  CE    . LYS A 1 400 ? 13.842  -10.071 45.158  1.00   88.00 ? 400  LYS A CE    1 
ATOM   2990 N  NZ    . LYS A 1 400 ? 14.072  -10.147 46.641  1.00   87.79 ? 400  LYS A NZ    1 
ATOM   2991 N  N     . PRO A 1 401 ? 8.653   -11.735 39.949  1.00   74.49 ? 401  PRO A N     1 
ATOM   2992 C  CA    . PRO A 1 401 ? 7.266   -12.098 39.623  1.00   72.75 ? 401  PRO A CA    1 
ATOM   2993 C  C     . PRO A 1 401 ? 6.685   -13.186 40.520  1.00   72.65 ? 401  PRO A C     1 
ATOM   2994 O  O     . PRO A 1 401 ? 7.407   -14.058 41.002  1.00   75.92 ? 401  PRO A O     1 
ATOM   2995 C  CB    . PRO A 1 401 ? 7.352   -12.562 38.163  1.00   72.91 ? 401  PRO A CB    1 
ATOM   2996 C  CG    . PRO A 1 401 ? 8.561   -11.856 37.638  1.00   72.31 ? 401  PRO A CG    1 
ATOM   2997 C  CD    . PRO A 1 401 ? 9.534   -11.949 38.787  1.00   71.86 ? 401  PRO A CD    1 
ATOM   2998 N  N     . LYS A 1 402 ? 5.375   -13.128 40.737  1.00   76.37 ? 402  LYS A N     1 
ATOM   2999 C  CA    . LYS A 1 402 ? 4.678   -14.114 41.560  1.00   78.91 ? 402  LYS A CA    1 
ATOM   3000 C  C     . LYS A 1 402 ? 3.598   -14.712 40.674  1.00   80.56 ? 402  LYS A C     1 
ATOM   3001 O  O     . LYS A 1 402 ? 2.495   -14.176 40.565  1.00   82.45 ? 402  LYS A O     1 
ATOM   3002 C  CB    . LYS A 1 402 ? 4.056   -13.452 42.791  1.00   74.75 ? 402  LYS A CB    1 
ATOM   3003 N  N     . VAL A 1 403 ? 3.926   -15.834 40.047  1.00   85.96 ? 403  VAL A N     1 
ATOM   3004 C  CA    . VAL A 1 403 ? 3.023   -16.499 39.118  1.00   92.71 ? 403  VAL A CA    1 
ATOM   3005 C  C     . VAL A 1 403 ? 2.018   -17.488 39.722  1.00   93.60 ? 403  VAL A C     1 
ATOM   3006 O  O     . VAL A 1 403 ? 1.647   -17.391 40.894  1.00   96.45 ? 403  VAL A O     1 
ATOM   3007 C  CB    . VAL A 1 403 ? 3.850   -17.209 38.008  1.00   95.82 ? 403  VAL A CB    1 
ATOM   3008 C  CG1   . VAL A 1 403 ? 4.331   -18.581 38.489  1.00   98.75 ? 403  VAL A CG1   1 
ATOM   3009 C  CG2   . VAL A 1 403 ? 3.041   -17.303 36.727  1.00   98.92 ? 403  VAL A CG2   1 
ATOM   3010 N  N     . LYS A 1 404 ? 1.580   -18.428 38.890  1.00   94.97 ? 404  LYS A N     1 
ATOM   3011 C  CA    . LYS A 1 404 ? 0.620   -19.454 39.275  1.00   94.10 ? 404  LYS A CA    1 
ATOM   3012 C  C     . LYS A 1 404 ? 0.675   -20.602 38.273  1.00   93.73 ? 404  LYS A C     1 
ATOM   3013 O  O     . LYS A 1 404 ? 1.512   -20.604 37.366  1.00   93.29 ? 404  LYS A O     1 
ATOM   3014 C  CB    . LYS A 1 404 ? -0.795  -18.860 39.321  1.00   92.64 ? 404  LYS A CB    1 
ATOM   3015 C  CG    . LYS A 1 404 ? -1.266  -18.201 38.022  1.00   89.92 ? 404  LYS A CG    1 
ATOM   3016 C  CD    . LYS A 1 404 ? -1.807  -19.217 37.025  1.00   88.60 ? 404  LYS A CD    1 
ATOM   3017 C  CE    . LYS A 1 404 ? -2.249  -18.550 35.729  1.00   87.83 ? 404  LYS A CE    1 
ATOM   3018 N  NZ    . LYS A 1 404 ? -2.946  -19.508 34.823  1.00   87.14 ? 404  LYS A NZ    1 
ATOM   3019 N  N     . MET A 1 409 ? 1.421   -18.399 45.349  1.00   99.20 ? 409  MET A N     1 
ATOM   3020 C  CA    . MET A 1 409 ? 2.041   -18.138 44.057  1.00   98.78 ? 409  MET A CA    1 
ATOM   3021 C  C     . MET A 1 409 ? 3.415   -18.800 43.939  1.00   96.63 ? 409  MET A C     1 
ATOM   3022 O  O     . MET A 1 409 ? 3.810   -19.587 44.798  1.00   98.84 ? 409  MET A O     1 
ATOM   3023 C  CB    . MET A 1 409 ? 2.159   -16.623 43.822  1.00   99.21 ? 409  MET A CB    1 
ATOM   3024 C  CG    . MET A 1 409 ? 2.759   -15.831 44.981  1.00   99.28 ? 409  MET A CG    1 
ATOM   3025 S  SD    . MET A 1 409 ? 1.591   -15.406 46.309  1.00   99.46 ? 409  MET A SD    1 
ATOM   3026 C  CE    . MET A 1 409 ? 1.750   -13.604 46.345  1.00   99.02 ? 409  MET A CE    1 
ATOM   3027 N  N     . VAL A 1 410 ? 4.136   -18.478 42.868  1.00   93.23 ? 410  VAL A N     1 
ATOM   3028 C  CA    . VAL A 1 410 ? 5.460   -19.043 42.620  1.00   92.13 ? 410  VAL A CA    1 
ATOM   3029 C  C     . VAL A 1 410 ? 6.440   -17.910 42.273  1.00   89.01 ? 410  VAL A C     1 
ATOM   3030 O  O     . VAL A 1 410 ? 6.549   -17.511 41.113  1.00   91.68 ? 410  VAL A O     1 
ATOM   3031 C  CB    . VAL A 1 410 ? 5.399   -20.052 41.447  1.00   90.62 ? 410  VAL A CB    1 
ATOM   3032 C  CG1   . VAL A 1 410 ? 6.658   -20.901 41.423  1.00   85.96 ? 410  VAL A CG1   1 
ATOM   3033 C  CG2   . VAL A 1 410 ? 4.144   -20.927 41.566  1.00   85.81 ? 410  VAL A CG2   1 
ATOM   3034 N  N     . THR A 1 411 ? 7.147   -17.401 43.281  1.00   84.81 ? 411  THR A N     1 
ATOM   3035 C  CA    . THR A 1 411 ? 8.098   -16.300 43.101  1.00   82.34 ? 411  THR A CA    1 
ATOM   3036 C  C     . THR A 1 411 ? 9.354   -16.625 42.284  1.00   81.53 ? 411  THR A C     1 
ATOM   3037 O  O     . THR A 1 411 ? 10.112  -17.531 42.625  1.00   81.46 ? 411  THR A O     1 
ATOM   3038 C  CB    . THR A 1 411 ? 8.534   -15.728 44.474  1.00   79.07 ? 411  THR A CB    1 
ATOM   3039 O  OG1   . THR A 1 411 ? 7.421   -15.049 45.074  1.00   73.01 ? 411  THR A OG1   1 
ATOM   3040 C  CG2   . THR A 1 411 ? 9.703   -14.755 44.324  1.00   72.39 ? 411  THR A CG2   1 
ATOM   3041 N  N     . LYS A 1 412 ? 9.562   -15.867 41.206  1.00   80.02 ? 412  LYS A N     1 
ATOM   3042 C  CA    . LYS A 1 412 ? 10.719  -16.053 40.339  1.00   80.77 ? 412  LYS A CA    1 
ATOM   3043 C  C     . LYS A 1 412 ? 11.763  -14.967 40.596  1.00   81.04 ? 412  LYS A C     1 
ATOM   3044 O  O     . LYS A 1 412 ? 11.458  -13.922 41.169  1.00   82.25 ? 412  LYS A O     1 
ATOM   3045 C  CB    . LYS A 1 412 ? 10.284  -16.036 38.880  1.00   79.51 ? 412  LYS A CB    1 
ATOM   3046 N  N     . GLY A 1 413 ? 12.994  -15.223 40.169  1.00   80.60 ? 413  GLY A N     1 
ATOM   3047 C  CA    . GLY A 1 413 ? 14.063  -14.262 40.369  1.00   80.89 ? 413  GLY A CA    1 
ATOM   3048 C  C     . GLY A 1 413 ? 14.641  -13.788 39.056  1.00   81.26 ? 413  GLY A C     1 
ATOM   3049 O  O     . GLY A 1 413 ? 15.358  -14.524 38.376  1.00   81.81 ? 413  GLY A O     1 
ATOM   3050 N  N     . GLN A 1 414 ? 14.332  -12.550 38.696  1.00   79.25 ? 414  GLN A N     1 
ATOM   3051 C  CA    . GLN A 1 414 ? 14.812  -11.981 37.452  1.00   75.77 ? 414  GLN A CA    1 
ATOM   3052 C  C     . GLN A 1 414 ? 16.135  -11.274 37.668  1.00   74.54 ? 414  GLN A C     1 
ATOM   3053 O  O     . GLN A 1 414 ? 16.385  -10.716 38.731  1.00   69.78 ? 414  GLN A O     1 
ATOM   3054 C  CB    . GLN A 1 414 ? 13.788  -10.993 36.908  1.00   75.85 ? 414  GLN A CB    1 
ATOM   3055 C  CG    . GLN A 1 414 ? 12.370  -11.527 36.901  1.00   78.69 ? 414  GLN A CG    1 
ATOM   3056 C  CD    . GLN A 1 414 ? 12.230  -12.808 36.112  1.00   80.16 ? 414  GLN A CD    1 
ATOM   3057 O  OE1   . GLN A 1 414 ? 12.580  -12.868 34.935  1.00   80.89 ? 414  GLN A OE1   1 
ATOM   3058 N  NE2   . GLN A 1 414 ? 11.706  -13.844 36.758  1.00   81.40 ? 414  GLN A NE2   1 
ATOM   3059 N  N     . ASN A 1 415 ? 16.979  -11.303 36.646  1.00   72.37 ? 415  ASN A N     1 
ATOM   3060 C  CA    . ASN A 1 415 ? 18.270  -10.652 36.712  1.00   71.13 ? 415  ASN A CA    1 
ATOM   3061 C  C     . ASN A 1 415 ? 18.166  -9.343  35.930  1.00   72.07 ? 415  ASN A C     1 
ATOM   3062 O  O     . ASN A 1 415 ? 17.114  -9.028  35.374  1.00   68.71 ? 415  ASN A O     1 
ATOM   3063 C  CB    . ASN A 1 415 ? 19.321  -11.553 36.081  1.00   72.59 ? 415  ASN A CB    1 
ATOM   3064 C  CG    . ASN A 1 415 ? 19.033  -11.835 34.628  1.00   76.81 ? 415  ASN A CG    1 
ATOM   3065 O  OD1   . ASN A 1 415 ? 19.204  -10.967 33.773  1.00   79.11 ? 415  ASN A OD1   1 
ATOM   3066 N  ND2   . ASN A 1 415 ? 18.575  -13.048 34.338  1.00   79.45 ? 415  ASN A ND2   1 
ATOM   3067 N  N     . MET A 1 416 ? 19.258  -8.588  35.894  1.00   73.59 ? 416  MET A N     1 
ATOM   3068 C  CA    . MET A 1 416 ? 19.311  -7.311  35.199  1.00   74.42 ? 416  MET A CA    1 
ATOM   3069 C  C     . MET A 1 416 ? 18.578  -7.299  33.844  1.00   73.38 ? 416  MET A C     1 
ATOM   3070 O  O     . MET A 1 416 ? 17.574  -6.606  33.676  1.00   73.19 ? 416  MET A O     1 
ATOM   3071 C  CB    . MET A 1 416 ? 20.769  -6.931  34.983  1.00   78.10 ? 416  MET A CB    1 
ATOM   3072 C  CG    . MET A 1 416 ? 20.964  -5.579  34.368  1.00   86.20 ? 416  MET A CG    1 
ATOM   3073 S  SD    . MET A 1 416 ? 20.796  -4.333  35.620  1.00   90.30 ? 416  MET A SD    1 
ATOM   3074 C  CE    . MET A 1 416 ? 22.501  -3.856  35.833  1.00   91.60 ? 416  MET A CE    1 
ATOM   3075 N  N     . ASN A 1 417 ? 19.095  -8.066  32.887  1.00   72.27 ? 417  ASN A N     1 
ATOM   3076 C  CA    . ASN A 1 417 ? 18.528  -8.152  31.547  1.00   71.07 ? 417  ASN A CA    1 
ATOM   3077 C  C     . ASN A 1 417 ? 17.081  -8.594  31.522  1.00   72.54 ? 417  ASN A C     1 
ATOM   3078 O  O     . ASN A 1 417 ? 16.235  -7.923  30.928  1.00   70.60 ? 417  ASN A O     1 
ATOM   3079 C  CB    . ASN A 1 417 ? 19.351  -9.117  30.702  1.00   70.47 ? 417  ASN A CB    1 
ATOM   3080 C  CG    . ASN A 1 417 ? 20.784  -8.688  30.582  1.00   70.75 ? 417  ASN A CG    1 
ATOM   3081 O  OD1   . ASN A 1 417 ? 21.659  -9.492  30.293  1.00   71.12 ? 417  ASN A OD1   1 
ATOM   3082 N  ND2   . ASN A 1 417 ? 21.034  -7.404  30.800  1.00   70.99 ? 417  ASN A ND2   1 
ATOM   3083 N  N     . GLN A 1 418 ? 16.793  -9.724  32.152  1.00   74.25 ? 418  GLN A N     1 
ATOM   3084 C  CA    . GLN A 1 418 ? 15.433  -10.234 32.162  1.00   74.25 ? 418  GLN A CA    1 
ATOM   3085 C  C     . GLN A 1 418 ? 14.446  -9.140  32.533  1.00   72.43 ? 418  GLN A C     1 
ATOM   3086 O  O     . GLN A 1 418 ? 13.304  -9.132  32.064  1.00   70.17 ? 418  GLN A O     1 
ATOM   3087 C  CB    . GLN A 1 418 ? 15.298  -11.393 33.147  1.00   78.07 ? 418  GLN A CB    1 
ATOM   3088 C  CG    . GLN A 1 418 ? 16.055  -12.645 32.753  1.00   88.67 ? 418  GLN A CG    1 
ATOM   3089 C  CD    . GLN A 1 418 ? 15.828  -13.770 33.745  1.00   93.50 ? 418  GLN A CD    1 
ATOM   3090 O  OE1   . GLN A 1 418 ? 16.097  -13.615 34.938  1.00   95.90 ? 418  GLN A OE1   1 
ATOM   3091 N  NE2   . GLN A 1 418 ? 15.323  -14.905 33.260  1.00   95.32 ? 418  GLN A NE2   1 
ATOM   3092 N  N     . VAL A 1 419 ? 14.899  -8.212  33.371  1.00   69.79 ? 419  VAL A N     1 
ATOM   3093 C  CA    . VAL A 1 419 ? 14.069  -7.098  33.816  1.00   68.58 ? 419  VAL A CA    1 
ATOM   3094 C  C     . VAL A 1 419 ? 13.962  -5.999  32.763  1.00   69.61 ? 419  VAL A C     1 
ATOM   3095 O  O     . VAL A 1 419 ? 12.861  -5.547  32.446  1.00   68.01 ? 419  VAL A O     1 
ATOM   3096 C  CB    . VAL A 1 419 ? 14.596  -6.507  35.155  1.00   67.44 ? 419  VAL A CB    1 
ATOM   3097 C  CG1   . VAL A 1 419 ? 13.923  -5.182  35.452  1.00   67.86 ? 419  VAL A CG1   1 
ATOM   3098 C  CG2   . VAL A 1 419 ? 14.323  -7.473  36.293  1.00   68.29 ? 419  VAL A CG2   1 
ATOM   3099 N  N     . VAL A 1 420 ? 15.100  -5.569  32.222  1.00   71.45 ? 420  VAL A N     1 
ATOM   3100 C  CA    . VAL A 1 420 ? 15.098  -4.523  31.205  1.00   70.91 ? 420  VAL A CA    1 
ATOM   3101 C  C     . VAL A 1 420 ? 14.445  -5.002  29.904  1.00   69.20 ? 420  VAL A C     1 
ATOM   3102 O  O     . VAL A 1 420 ? 14.164  -4.203  29.011  1.00   66.38 ? 420  VAL A O     1 
ATOM   3103 C  CB    . VAL A 1 420 ? 16.528  -4.025  30.901  1.00   75.95 ? 420  VAL A CB    1 
ATOM   3104 C  CG1   . VAL A 1 420 ? 17.160  -3.439  32.161  1.00   84.62 ? 420  VAL A CG1   1 
ATOM   3105 C  CG2   . VAL A 1 420 ? 17.372  -5.157  30.362  1.00   84.94 ? 420  VAL A CG2   1 
ATOM   3106 N  N     . ASN A 1 421 ? 14.211  -6.314  29.807  1.00   64.14 ? 421  ASN A N     1 
ATOM   3107 C  CA    . ASN A 1 421 ? 13.567  -6.922  28.647  1.00   57.87 ? 421  ASN A CA    1 
ATOM   3108 C  C     . ASN A 1 421 ? 12.112  -7.041  29.014  1.00   55.65 ? 421  ASN A C     1 
ATOM   3109 O  O     . ASN A 1 421 ? 11.236  -7.130  28.152  1.00   53.42 ? 421  ASN A O     1 
ATOM   3110 C  CB    . ASN A 1 421 ? 14.091  -8.334  28.389  1.00   58.41 ? 421  ASN A CB    1 
ATOM   3111 C  CG    . ASN A 1 421 ? 15.171  -8.373  27.347  1.00   60.37 ? 421  ASN A CG    1 
ATOM   3112 O  OD1   . ASN A 1 421 ? 16.188  -7.703  27.467  1.00   62.13 ? 421  ASN A OD1   1 
ATOM   3113 N  ND2   . ASN A 1 421 ? 14.959  -9.175  26.311  1.00   62.17 ? 421  ASN A ND2   1 
ATOM   3114 N  N     . SER A 1 422 ? 11.853  -7.044  30.310  1.00   52.75 ? 422  SER A N     1 
ATOM   3115 C  CA    . SER A 1 422 ? 10.493  -7.171  30.795  1.00   49.99 ? 422  SER A CA    1 
ATOM   3116 C  C     . SER A 1 422 ? 9.816   -5.809  30.709  1.00   48.66 ? 422  SER A C     1 
ATOM   3117 O  O     . SER A 1 422 ? 8.603   -5.728  30.536  1.00   46.71 ? 422  SER A O     1 
ATOM   3118 C  CB    . SER A 1 422 ? 10.493  -7.686  32.240  1.00   50.00 ? 422  SER A CB    1 
ATOM   3119 O  OG    . SER A 1 422 ? 9.181   -8.004  32.660  1.00   50.93 ? 422  SER A OG    1 
ATOM   3120 N  N     . VAL A 1 423 ? 10.598  -4.750  30.837  1.00   48.86 ? 423  VAL A N     1 
ATOM   3121 C  CA    . VAL A 1 423 ? 10.037  -3.409  30.752  1.00   49.42 ? 423  VAL A CA    1 
ATOM   3122 C  C     . VAL A 1 423 ? 9.732   -3.117  29.288  1.00   49.34 ? 423  VAL A C     1 
ATOM   3123 O  O     . VAL A 1 423 ? 8.698   -2.535  28.960  1.00   49.64 ? 423  VAL A O     1 
ATOM   3124 C  CB    . VAL A 1 423 ? 11.005  -2.347  31.314  1.00   50.07 ? 423  VAL A CB    1 
ATOM   3125 C  CG1   . VAL A 1 423 ? 10.626  -0.958  30.799  1.00   51.02 ? 423  VAL A CG1   1 
ATOM   3126 C  CG2   . VAL A 1 423 ? 10.935  -2.361  32.861  1.00   51.27 ? 423  VAL A CG2   1 
ATOM   3127 N  N     . GLY A 1 424 ? 10.639  -3.551  28.420  1.00   49.93 ? 424  GLY A N     1 
ATOM   3128 C  CA    . GLY A 1 424 ? 10.469  -3.364  26.986  1.00   49.78 ? 424  GLY A CA    1 
ATOM   3129 C  C     . GLY A 1 424 ? 9.227   -4.075  26.484  1.00   49.43 ? 424  GLY A C     1 
ATOM   3130 O  O     . GLY A 1 424 ? 8.503   -3.550  25.636  1.00   51.00 ? 424  GLY A O     1 
ATOM   3131 N  N     . ALA A 1 425 ? 8.968   -5.266  27.018  1.00   47.75 ? 425  ALA A N     1 
ATOM   3132 C  CA    . ALA A 1 425 ? 7.814   -6.056  26.615  1.00   46.66 ? 425  ALA A CA    1 
ATOM   3133 C  C     . ALA A 1 425 ? 6.495   -5.501  27.136  1.00   46.53 ? 425  ALA A C     1 
ATOM   3134 O  O     . ALA A 1 425 ? 5.444   -5.717  26.527  1.00   47.73 ? 425  ALA A O     1 
ATOM   3135 C  CB    . ALA A 1 425 ? 7.983   -7.506  27.076  1.00   44.98 ? 425  ALA A CB    1 
ATOM   3136 N  N     . LEU A 1 426 ? 6.540   -4.805  28.255  1.00   45.26 ? 426  LEU A N     1 
ATOM   3137 C  CA    . LEU A 1 426 ? 5.332   -4.231  28.826  1.00   45.27 ? 426  LEU A CA    1 
ATOM   3138 C  C     . LEU A 1 426 ? 4.965   -3.042  27.941  1.00   44.09 ? 426  LEU A C     1 
ATOM   3139 O  O     . LEU A 1 426 ? 3.801   -2.860  27.575  1.00   44.90 ? 426  LEU A O     1 
ATOM   3140 C  CB    . LEU A 1 426 ? 5.601   -3.765  30.266  1.00   45.73 ? 426  LEU A CB    1 
ATOM   3141 C  CG    . LEU A 1 426 ? 4.568   -2.913  30.985  1.00   44.70 ? 426  LEU A CG    1 
ATOM   3142 C  CD1   . LEU A 1 426 ? 3.491   -3.783  31.621  1.00   44.51 ? 426  LEU A CD1   1 
ATOM   3143 C  CD2   . LEU A 1 426 ? 5.303   -2.070  32.027  1.00   43.76 ? 426  LEU A CD2   1 
ATOM   3144 N  N     . ALA A 1 427 ? 5.967   -2.239  27.609  1.00   41.55 ? 427  ALA A N     1 
ATOM   3145 C  CA    . ALA A 1 427 ? 5.762   -1.094  26.736  1.00   41.31 ? 427  ALA A CA    1 
ATOM   3146 C  C     . ALA A 1 427 ? 5.093   -1.546  25.409  1.00   40.76 ? 427  ALA A C     1 
ATOM   3147 O  O     . ALA A 1 427 ? 4.066   -0.988  25.018  1.00   42.02 ? 427  ALA A O     1 
ATOM   3148 C  CB    . ALA A 1 427 ? 7.083   -0.429  26.457  1.00   39.40 ? 427  ALA A CB    1 
ATOM   3149 N  N     . LYS A 1 428 ? 5.649   -2.557  24.760  1.00   39.34 ? 428  LYS A N     1 
ATOM   3150 C  CA    . LYS A 1 428 ? 5.108   -3.043  23.512  1.00   39.89 ? 428  LYS A CA    1 
ATOM   3151 C  C     . LYS A 1 428 ? 3.746   -3.665  23.606  1.00   40.96 ? 428  LYS A C     1 
ATOM   3152 O  O     . LYS A 1 428 ? 2.911   -3.510  22.693  1.00   41.75 ? 428  LYS A O     1 
ATOM   3153 C  CB    . LYS A 1 428 ? 6.053   -4.049  22.877  1.00   39.35 ? 428  LYS A CB    1 
ATOM   3154 C  CG    . LYS A 1 428 ? 7.415   -3.484  22.552  1.00   38.04 ? 428  LYS A CG    1 
ATOM   3155 C  CD    . LYS A 1 428 ? 8.247   -4.546  21.869  1.00   38.57 ? 428  LYS A CD    1 
ATOM   3156 C  CE    . LYS A 1 428 ? 9.702   -4.310  22.066  1.00   40.39 ? 428  LYS A CE    1 
ATOM   3157 N  NZ    . LYS A 1 428 ? 10.479  -5.124  21.091  1.00   42.78 ? 428  LYS A NZ    1 
ATOM   3158 N  N     . SER A 1 429 ? 3.490   -4.381  24.678  1.00   40.77 ? 429  SER A N     1 
ATOM   3159 C  CA    . SER A 1 429 ? 2.202   -5.036  24.835  1.00   39.92 ? 429  SER A CA    1 
ATOM   3160 C  C     . SER A 1 429 ? 1.160   -3.953  25.109  1.00   39.44 ? 429  SER A C     1 
ATOM   3161 O  O     . SER A 1 429 ? 0.001   -4.094  24.730  1.00   37.85 ? 429  SER A O     1 
ATOM   3162 C  CB    . SER A 1 429 ? 2.242   -6.044  26.005  1.00   40.73 ? 429  SER A CB    1 
ATOM   3163 O  OG    . SER A 1 429 ? 0.973   -6.669  26.187  1.00   39.41 ? 429  SER A OG    1 
ATOM   3164 N  N     . LEU A 1 430 ? 1.581   -2.890  25.778  1.00   39.24 ? 430  LEU A N     1 
ATOM   3165 C  CA    . LEU A 1 430 ? 0.661   -1.804  26.112  1.00   40.49 ? 430  LEU A CA    1 
ATOM   3166 C  C     . LEU A 1 430 ? 0.285   -1.062  24.824  1.00   40.30 ? 430  LEU A C     1 
ATOM   3167 O  O     . LEU A 1 430 ? -0.890  -0.917  24.490  1.00   39.27 ? 430  LEU A O     1 
ATOM   3168 C  CB    . LEU A 1 430 ? 1.301   -0.819  27.098  1.00   38.32 ? 430  LEU A CB    1 
ATOM   3169 C  CG    . LEU A 1 430 ? 0.466   0.443   27.322  1.00   38.25 ? 430  LEU A CG    1 
ATOM   3170 C  CD1   . LEU A 1 430 ? -0.870  0.005   27.930  1.00   38.57 ? 430  LEU A CD1   1 
ATOM   3171 C  CD2   . LEU A 1 430 ? 1.179   1.465   28.191  1.00   35.44 ? 430  LEU A CD2   1 
ATOM   3172 N  N     . TYR A 1 431 ? 1.307   -0.608  24.125  1.00   41.78 ? 431  TYR A N     1 
ATOM   3173 C  CA    . TYR A 1 431 ? 1.116   0.110   22.879  1.00   43.38 ? 431  TYR A CA    1 
ATOM   3174 C  C     . TYR A 1 431 ? 0.218   -0.682  21.930  1.00   44.83 ? 431  TYR A C     1 
ATOM   3175 O  O     . TYR A 1 431 ? -0.733  -0.148  21.356  1.00   43.49 ? 431  TYR A O     1 
ATOM   3176 C  CB    . TYR A 1 431 ? 2.459   0.356   22.227  1.00   41.62 ? 431  TYR A CB    1 
ATOM   3177 C  CG    . TYR A 1 431 ? 2.391   1.447   21.195  1.00   42.00 ? 431  TYR A CG    1 
ATOM   3178 C  CD1   . TYR A 1 431 ? 2.136   1.153   19.858  1.00   38.85 ? 431  TYR A CD1   1 
ATOM   3179 C  CD2   . TYR A 1 431 ? 2.566   2.781   21.565  1.00   40.24 ? 431  TYR A CD2   1 
ATOM   3180 C  CE1   . TYR A 1 431 ? 2.062   2.143   18.925  1.00   39.98 ? 431  TYR A CE1   1 
ATOM   3181 C  CE2   . TYR A 1 431 ? 2.493   3.777   20.637  1.00   41.95 ? 431  TYR A CE2   1 
ATOM   3182 C  CZ    . TYR A 1 431 ? 2.246   3.457   19.310  1.00   40.36 ? 431  TYR A CZ    1 
ATOM   3183 O  OH    . TYR A 1 431 ? 2.229   4.448   18.376  1.00   40.29 ? 431  TYR A OH    1 
ATOM   3184 N  N     . ASP A 1 432 ? 0.521   -1.966  21.790  1.00   46.33 ? 432  ASP A N     1 
ATOM   3185 C  CA    . ASP A 1 432 ? -0.233  -2.812  20.900  1.00   47.54 ? 432  ASP A CA    1 
ATOM   3186 C  C     . ASP A 1 432 ? -1.688  -2.968  21.323  1.00   48.33 ? 432  ASP A C     1 
ATOM   3187 O  O     . ASP A 1 432 ? -2.586  -2.870  20.489  1.00   48.16 ? 432  ASP A O     1 
ATOM   3188 C  CB    . ASP A 1 432 ? 0.467   -4.160  20.794  1.00   49.32 ? 432  ASP A CB    1 
ATOM   3189 C  CG    . ASP A 1 432 ? -0.187  -5.069  19.807  1.00   51.64 ? 432  ASP A CG    1 
ATOM   3190 O  OD1   . ASP A 1 432 ? -0.165  -4.753  18.599  1.00   53.39 ? 432  ASP A OD1   1 
ATOM   3191 O  OD2   . ASP A 1 432 ? -0.738  -6.100  20.242  1.00   53.67 ? 432  ASP A OD2   1 
ATOM   3192 N  N     . ARG A 1 433 ? -1.948  -3.213  22.599  1.00   47.46 ? 433  ARG A N     1 
ATOM   3193 C  CA    . ARG A 1 433 ? -3.326  -3.351  23.048  1.00   46.34 ? 433  ARG A CA    1 
ATOM   3194 C  C     . ARG A 1 433 ? -4.059  -2.018  22.836  1.00   44.69 ? 433  ARG A C     1 
ATOM   3195 O  O     . ARG A 1 433 ? -5.252  -1.997  22.557  1.00   42.33 ? 433  ARG A O     1 
ATOM   3196 C  CB    . ARG A 1 433 ? -3.377  -3.736  24.532  1.00   48.31 ? 433  ARG A CB    1 
ATOM   3197 C  CG    . ARG A 1 433 ? -2.757  -5.092  24.843  1.00   52.66 ? 433  ARG A CG    1 
ATOM   3198 C  CD    . ARG A 1 433 ? -2.479  -5.271  26.331  1.00   54.16 ? 433  ARG A CD    1 
ATOM   3199 N  NE    . ARG A 1 433 ? -1.739  -6.503  26.565  1.00   55.89 ? 433  ARG A NE    1 
ATOM   3200 C  CZ    . ARG A 1 433 ? -2.288  -7.649  26.967  1.00   57.20 ? 433  ARG A CZ    1 
ATOM   3201 N  NH1   . ARG A 1 433 ? -3.598  -7.723  27.195  1.00   56.74 ? 433  ARG A NH1   1 
ATOM   3202 N  NH2   . ARG A 1 433 ? -1.529  -8.733  27.113  1.00   57.38 ? 433  ARG A NH2   1 
ATOM   3203 N  N     . MET A 1 434 ? -3.337  -0.923  22.988  1.00   42.15 ? 434  MET A N     1 
ATOM   3204 C  CA    . MET A 1 434 ? -3.898  0.402   22.826  1.00   41.23 ? 434  MET A CA    1 
ATOM   3205 C  C     . MET A 1 434 ? -4.310  0.738   21.385  1.00   41.59 ? 434  MET A C     1 
ATOM   3206 O  O     . MET A 1 434 ? -5.400  1.265   21.149  1.00   40.27 ? 434  MET A O     1 
ATOM   3207 C  CB    . MET A 1 434 ? -2.907  1.434   23.349  1.00   42.86 ? 434  MET A CB    1 
ATOM   3208 C  CG    . MET A 1 434 ? -3.215  2.866   22.987  1.00   45.98 ? 434  MET A CG    1 
ATOM   3209 S  SD    . MET A 1 434 ? -2.587  3.992   24.239  1.00   51.54 ? 434  MET A SD    1 
ATOM   3210 C  CE    . MET A 1 434 ? -0.897  3.355   24.515  1.00   48.96 ? 434  MET A CE    1 
ATOM   3211 N  N     . PHE A 1 435 ? -3.443  0.423   20.423  1.00   40.24 ? 435  PHE A N     1 
ATOM   3212 C  CA    . PHE A 1 435 ? -3.728  0.675   19.021  1.00   39.88 ? 435  PHE A CA    1 
ATOM   3213 C  C     . PHE A 1 435 ? -4.993  -0.107  18.625  1.00   41.01 ? 435  PHE A C     1 
ATOM   3214 O  O     . PHE A 1 435 ? -5.879  0.435   17.955  1.00   38.35 ? 435  PHE A O     1 
ATOM   3215 C  CB    . PHE A 1 435 ? -2.520  0.252   18.177  1.00   40.39 ? 435  PHE A CB    1 
ATOM   3216 C  CG    . PHE A 1 435 ? -2.597  0.663   16.730  1.00   41.86 ? 435  PHE A CG    1 
ATOM   3217 C  CD1   . PHE A 1 435 ? -3.135  -0.195  15.770  1.00   41.96 ? 435  PHE A CD1   1 
ATOM   3218 C  CD2   . PHE A 1 435 ? -2.113  1.906   16.316  1.00   41.32 ? 435  PHE A CD2   1 
ATOM   3219 C  CE1   . PHE A 1 435 ? -3.192  0.189   14.424  1.00   41.60 ? 435  PHE A CE1   1 
ATOM   3220 C  CE2   . PHE A 1 435 ? -2.172  2.293   14.959  1.00   41.29 ? 435  PHE A CE2   1 
ATOM   3221 C  CZ    . PHE A 1 435 ? -2.706  1.436   14.031  1.00   40.76 ? 435  PHE A CZ    1 
ATOM   3222 N  N     . ASN A 1 436 ? -5.087  -1.380  19.040  1.00   42.39 ? 436  ASN A N     1 
ATOM   3223 C  CA    . ASN A 1 436 ? -6.268  -2.165  18.719  1.00   44.17 ? 436  ASN A CA    1 
ATOM   3224 C  C     . ASN A 1 436 ? -7.505  -1.582  19.403  1.00   44.34 ? 436  ASN A C     1 
ATOM   3225 O  O     . ASN A 1 436 ? -8.609  -1.615  18.840  1.00   42.78 ? 436  ASN A O     1 
ATOM   3226 C  CB    . ASN A 1 436 ? -6.095  -3.634  19.112  1.00   47.80 ? 436  ASN A CB    1 
ATOM   3227 C  CG    . ASN A 1 436 ? -5.183  -4.377  18.152  1.00   51.79 ? 436  ASN A CG    1 
ATOM   3228 O  OD1   . ASN A 1 436 ? -5.279  -4.216  16.936  1.00   53.69 ? 436  ASN A OD1   1 
ATOM   3229 N  ND2   . ASN A 1 436 ? -4.297  -5.194  18.696  1.00   54.88 ? 436  ASN A ND2   1 
ATOM   3230 N  N     . TRP A 1 437 ? -7.321  -1.040  20.599  1.00   44.14 ? 437  TRP A N     1 
ATOM   3231 C  CA    . TRP A 1 437 ? -8.444  -0.426  21.283  1.00   43.85 ? 437  TRP A CA    1 
ATOM   3232 C  C     . TRP A 1 437 ? -8.855  0.801   20.459  1.00   42.33 ? 437  TRP A C     1 
ATOM   3233 O  O     . TRP A 1 437 ? -10.038 1.007   20.194  1.00   41.25 ? 437  TRP A O     1 
ATOM   3234 C  CB    . TRP A 1 437 ? -8.063  0.015   22.700  1.00   45.42 ? 437  TRP A CB    1 
ATOM   3235 C  CG    . TRP A 1 437 ? -9.207  0.649   23.417  1.00   48.54 ? 437  TRP A CG    1 
ATOM   3236 C  CD1   . TRP A 1 437 ? -10.171 0.018   24.157  1.00   49.53 ? 437  TRP A CD1   1 
ATOM   3237 C  CD2   . TRP A 1 437 ? -9.579  2.040   23.383  1.00   50.10 ? 437  TRP A CD2   1 
ATOM   3238 N  NE1   . TRP A 1 437 ? -11.118 0.926   24.581  1.00   50.56 ? 437  TRP A NE1   1 
ATOM   3239 C  CE2   . TRP A 1 437 ? -10.777 2.173   24.119  1.00   50.75 ? 437  TRP A CE2   1 
ATOM   3240 C  CE3   . TRP A 1 437 ? -9.006  3.182   22.799  1.00   49.89 ? 437  TRP A CE3   1 
ATOM   3241 C  CZ2   . TRP A 1 437 ? -11.423 3.407   24.282  1.00   50.28 ? 437  TRP A CZ2   1 
ATOM   3242 C  CZ3   . TRP A 1 437 ? -9.651  4.407   22.964  1.00   50.75 ? 437  TRP A CZ3   1 
ATOM   3243 C  CH2   . TRP A 1 437 ? -10.844 4.508   23.702  1.00   51.04 ? 437  TRP A CH2   1 
ATOM   3244 N  N     . LEU A 1 438 ? -7.869  1.603   20.065  1.00   41.50 ? 438  LEU A N     1 
ATOM   3245 C  CA    . LEU A 1 438 ? -8.130  2.817   19.271  1.00   39.89 ? 438  LEU A CA    1 
ATOM   3246 C  C     . LEU A 1 438 ? -8.956  2.506   18.023  1.00   37.37 ? 438  LEU A C     1 
ATOM   3247 O  O     . LEU A 1 438 ? -9.967  3.152   17.772  1.00   37.44 ? 438  LEU A O     1 
ATOM   3248 C  CB    . LEU A 1 438 ? -6.798  3.461   18.879  1.00   42.20 ? 438  LEU A CB    1 
ATOM   3249 C  CG    . LEU A 1 438 ? -6.732  4.863   18.279  1.00   45.12 ? 438  LEU A CG    1 
ATOM   3250 C  CD1   . LEU A 1 438 ? -5.291  5.160   17.868  1.00   46.29 ? 438  LEU A CD1   1 
ATOM   3251 C  CD2   . LEU A 1 438 ? -7.621  4.953   17.061  1.00   48.12 ? 438  LEU A CD2   1 
ATOM   3252 N  N     . VAL A 1 439 ? -8.530  1.506   17.262  1.00   34.52 ? 439  VAL A N     1 
ATOM   3253 C  CA    . VAL A 1 439 ? -9.211  1.085   16.041  1.00   33.09 ? 439  VAL A CA    1 
ATOM   3254 C  C     . VAL A 1 439 ? -10.663 0.664   16.261  1.00   35.02 ? 439  VAL A C     1 
ATOM   3255 O  O     . VAL A 1 439 ? -11.548 0.988   15.452  1.00   32.49 ? 439  VAL A O     1 
ATOM   3256 C  CB    . VAL A 1 439 ? -8.403  -0.057  15.332  1.00   31.22 ? 439  VAL A CB    1 
ATOM   3257 C  CG1   . VAL A 1 439 ? -9.216  -0.714  14.234  1.00   28.83 ? 439  VAL A CG1   1 
ATOM   3258 C  CG2   . VAL A 1 439 ? -7.116  0.517   14.755  1.00   27.97 ? 439  VAL A CG2   1 
ATOM   3259 N  N     . ARG A 1 440 ? -10.925 -0.063  17.365  1.00   36.91 ? 440  ARG A N     1 
ATOM   3260 C  CA    . ARG A 1 440 ? -12.276 -0.504  17.718  1.00   37.29 ? 440  ARG A CA    1 
ATOM   3261 C  C     . ARG A 1 440 ? -13.080 0.702   18.196  1.00   36.26 ? 440  ARG A C     1 
ATOM   3262 O  O     . ARG A 1 440 ? -14.281 0.772   17.978  1.00   36.48 ? 440  ARG A O     1 
ATOM   3263 C  CB    . ARG A 1 440 ? -12.249 -1.543  18.869  1.00   41.40 ? 440  ARG A CB    1 
ATOM   3264 C  CG    . ARG A 1 440 ? -11.843 -2.981  18.502  1.00   45.47 ? 440  ARG A CG    1 
ATOM   3265 C  CD    . ARG A 1 440 ? -12.236 -3.965  19.620  1.00   48.58 ? 440  ARG A CD    1 
ATOM   3266 N  NE    . ARG A 1 440 ? -11.518 -3.703  20.863  1.00   49.72 ? 440  ARG A NE    1 
ATOM   3267 C  CZ    . ARG A 1 440 ? -10.230 -3.973  21.043  1.00   50.68 ? 440  ARG A CZ    1 
ATOM   3268 N  NH1   . ARG A 1 440 ? -9.522  -4.523  20.074  1.00   53.58 ? 440  ARG A NH1   1 
ATOM   3269 N  NH2   . ARG A 1 440 ? -9.628  -3.651  22.170  1.00   51.43 ? 440  ARG A NH2   1 
ATOM   3270 N  N     . ARG A 1 441 ? -12.431 1.636   18.856  1.00   36.49 ? 441  ARG A N     1 
ATOM   3271 C  CA    . ARG A 1 441 ? -13.143 2.815   19.355  1.00   38.13 ? 441  ARG A CA    1 
ATOM   3272 C  C     . ARG A 1 441 ? -13.568 3.679   18.153  1.00   39.28 ? 441  ARG A C     1 
ATOM   3273 O  O     . ARG A 1 441 ? -14.703 4.160   18.104  1.00   38.01 ? 441  ARG A O     1 
ATOM   3274 C  CB    . ARG A 1 441 ? -12.269 3.625   20.325  1.00   37.83 ? 441  ARG A CB    1 
ATOM   3275 C  CG    . ARG A 1 441 ? -12.947 4.838   20.961  1.00   39.26 ? 441  ARG A CG    1 
ATOM   3276 C  CD    . ARG A 1 441 ? -14.322 4.482   21.600  1.00   41.81 ? 441  ARG A CD    1 
ATOM   3277 N  NE    . ARG A 1 441 ? -14.987 5.671   22.170  1.00   43.57 ? 441  ARG A NE    1 
ATOM   3278 C  CZ    . ARG A 1 441 ? -15.769 6.503   21.474  1.00   43.46 ? 441  ARG A CZ    1 
ATOM   3279 N  NH1   . ARG A 1 441 ? -16.003 6.285   20.187  1.00   43.69 ? 441  ARG A NH1   1 
ATOM   3280 N  NH2   . ARG A 1 441 ? -16.288 7.581   22.053  1.00   43.62 ? 441  ARG A NH2   1 
ATOM   3281 N  N     . VAL A 1 442 ? -12.655 3.864   17.210  1.00   38.65 ? 442  VAL A N     1 
ATOM   3282 C  CA    . VAL A 1 442 ? -12.956 4.617   16.009  1.00   39.21 ? 442  VAL A CA    1 
ATOM   3283 C  C     . VAL A 1 442 ? -14.056 3.897   15.232  1.00   39.87 ? 442  VAL A C     1 
ATOM   3284 O  O     . VAL A 1 442 ? -14.898 4.547   14.611  1.00   38.75 ? 442  VAL A O     1 
ATOM   3285 C  CB    . VAL A 1 442 ? -11.705 4.767   15.137  1.00   40.08 ? 442  VAL A CB    1 
ATOM   3286 C  CG1   . VAL A 1 442 ? -12.097 5.051   13.678  1.00   42.45 ? 442  VAL A CG1   1 
ATOM   3287 C  CG2   . VAL A 1 442 ? -10.844 5.892   15.701  1.00   41.04 ? 442  VAL A CG2   1 
ATOM   3288 N  N     . ASN A 1 443 ? -14.069 2.566   15.254  1.00   39.97 ? 443  ASN A N     1 
ATOM   3289 C  CA    . ASN A 1 443 ? -15.120 1.856   14.530  1.00   40.69 ? 443  ASN A CA    1 
ATOM   3290 C  C     . ASN A 1 443 ? -16.475 2.038   15.220  1.00   43.14 ? 443  ASN A C     1 
ATOM   3291 O  O     . ASN A 1 443 ? -17.511 2.086   14.549  1.00   41.51 ? 443  ASN A O     1 
ATOM   3292 C  CB    . ASN A 1 443 ? -14.807 0.362   14.359  1.00   40.82 ? 443  ASN A CB    1 
ATOM   3293 C  CG    . ASN A 1 443 ? -13.878 0.077   13.174  1.00   42.48 ? 443  ASN A CG    1 
ATOM   3294 O  OD1   . ASN A 1 443 ? -14.181 0.392   12.039  1.00   44.77 ? 443  ASN A OD1   1 
ATOM   3295 N  ND2   . ASN A 1 443 ? -12.749 -0.522  13.447  1.00   44.44 ? 443  ASN A ND2   1 
ATOM   3296 N  N     . LYS A 1 444 ? -16.490 2.145   16.543  1.00   44.99 ? 444  LYS A N     1 
ATOM   3297 C  CA    . LYS A 1 444 ? -17.756 2.356   17.234  1.00   46.34 ? 444  LYS A CA    1 
ATOM   3298 C  C     . LYS A 1 444 ? -18.390 3.648   16.714  1.00   45.83 ? 444  LYS A C     1 
ATOM   3299 O  O     . LYS A 1 444 ? -19.582 3.699   16.442  1.00   43.97 ? 444  LYS A O     1 
ATOM   3300 C  CB    . LYS A 1 444 ? -17.546 2.452   18.740  1.00   49.16 ? 444  LYS A CB    1 
ATOM   3301 C  CG    . LYS A 1 444 ? -17.841 1.148   19.484  1.00   57.25 ? 444  LYS A CG    1 
ATOM   3302 C  CD    . LYS A 1 444 ? -17.195 -0.072  18.808  1.00   61.97 ? 444  LYS A CD    1 
ATOM   3303 C  CE    . LYS A 1 444 ? -17.705 -1.399  19.426  1.00   64.61 ? 444  LYS A CE    1 
ATOM   3304 N  NZ    . LYS A 1 444 ? -19.177 -1.663  19.192  1.00   65.03 ? 444  LYS A NZ    1 
ATOM   3305 N  N     . THR A 1 445 ? -17.574 4.688   16.584  1.00   45.67 ? 445  THR A N     1 
ATOM   3306 C  CA    . THR A 1 445 ? -18.032 5.985   16.088  1.00   46.09 ? 445  THR A CA    1 
ATOM   3307 C  C     . THR A 1 445 ? -18.576 5.905   14.655  1.00   46.75 ? 445  THR A C     1 
ATOM   3308 O  O     . THR A 1 445 ? -19.611 6.494   14.350  1.00   45.84 ? 445  THR A O     1 
ATOM   3309 C  CB    . THR A 1 445 ? -16.888 7.002   16.070  1.00   46.38 ? 445  THR A CB    1 
ATOM   3310 O  OG1   . THR A 1 445 ? -16.383 7.181   17.399  1.00   48.27 ? 445  THR A OG1   1 
ATOM   3311 C  CG2   . THR A 1 445 ? -17.376 8.320   15.535  1.00   47.08 ? 445  THR A CG2   1 
ATOM   3312 N  N     . LEU A 1 446 ? -17.862 5.180   13.789  1.00   48.75 ? 446  LEU A N     1 
ATOM   3313 C  CA    . LEU A 1 446 ? -18.238 5.057   12.380  1.00   51.95 ? 446  LEU A CA    1 
ATOM   3314 C  C     . LEU A 1 446 ? -19.359 4.073   12.079  1.00   56.65 ? 446  LEU A C     1 
ATOM   3315 O  O     . LEU A 1 446 ? -19.912 4.085   10.981  1.00   57.18 ? 446  LEU A O     1 
ATOM   3316 C  CB    . LEU A 1 446 ? -17.008 4.678   11.535  1.00   46.32 ? 446  LEU A CB    1 
ATOM   3317 C  CG    . LEU A 1 446 ? -15.809 5.611   11.703  1.00   42.79 ? 446  LEU A CG    1 
ATOM   3318 C  CD1   . LEU A 1 446 ? -14.678 5.212   10.786  1.00   40.00 ? 446  LEU A CD1   1 
ATOM   3319 C  CD2   . LEU A 1 446 ? -16.254 7.027   11.409  1.00   41.89 ? 446  LEU A CD2   1 
ATOM   3320 N  N     . ASP A 1 447 ? -19.697 3.219   13.044  1.00   66.10 ? 447  ASP A N     1 
ATOM   3321 C  CA    . ASP A 1 447 ? -20.765 2.242   12.840  1.00   74.02 ? 447  ASP A CA    1 
ATOM   3322 C  C     . ASP A 1 447 ? -22.150 2.792   13.127  1.00   73.20 ? 447  ASP A C     1 
ATOM   3323 O  O     . ASP A 1 447 ? -22.825 2.333   14.051  1.00   78.73 ? 447  ASP A O     1 
ATOM   3324 C  CB    . ASP A 1 447 ? -20.560 0.989   13.706  1.00   82.25 ? 447  ASP A CB    1 
ATOM   3325 C  CG    . ASP A 1 447 ? -21.717 -0.012  13.577  1.00   90.47 ? 447  ASP A CG    1 
ATOM   3326 O  OD1   . ASP A 1 447 ? -22.301 -0.105  12.476  1.00   94.24 ? 447  ASP A OD1   1 
ATOM   3327 O  OD2   . ASP A 1 447 ? -22.043 -0.711  14.562  1.00   94.09 ? 447  ASP A OD2   1 
ATOM   3328 N  N     . THR A 1 448 ? -22.579 3.788   12.366  1.00   70.78 ? 448  THR A N     1 
ATOM   3329 C  CA    . THR A 1 448 ? -23.919 4.309   12.568  1.00   69.91 ? 448  THR A CA    1 
ATOM   3330 C  C     . THR A 1 448 ? -24.734 3.096   12.158  1.00   69.92 ? 448  THR A C     1 
ATOM   3331 O  O     . THR A 1 448 ? -24.319 2.365   11.252  1.00   68.82 ? 448  THR A O     1 
ATOM   3332 C  CB    . THR A 1 448 ? -24.217 5.471   11.623  1.00   66.40 ? 448  THR A CB    1 
ATOM   3333 O  OG1   . THR A 1 448 ? -24.202 5.000   10.273  1.00   60.71 ? 448  THR A OG1   1 
ATOM   3334 C  CG2   . THR A 1 448 ? -23.175 6.559   11.789  1.00   60.88 ? 448  THR A CG2   1 
ATOM   3335 N  N     . LYS A 1 449 ? -25.864 2.852   12.790  1.00   68.80 ? 449  LYS A N     1 
ATOM   3336 C  CA    . LYS A 1 449 ? -26.633 1.667   12.425  1.00   67.10 ? 449  LYS A CA    1 
ATOM   3337 C  C     . LYS A 1 449 ? -27.552 1.927   11.235  1.00   64.62 ? 449  LYS A C     1 
ATOM   3338 O  O     . LYS A 1 449 ? -28.670 1.422   11.186  1.00   59.55 ? 449  LYS A O     1 
ATOM   3339 C  CB    . LYS A 1 449 ? -27.452 1.184   13.621  1.00   69.64 ? 449  LYS A CB    1 
ATOM   3340 C  CG    . LYS A 1 449 ? -26.953 -0.117  14.266  1.00   77.25 ? 449  LYS A CG    1 
ATOM   3341 C  CD    . LYS A 1 449 ? -25.677 0.071   15.084  1.00   81.43 ? 449  LYS A CD    1 
ATOM   3342 C  CE    . LYS A 1 449 ? -25.301 -1.228  15.819  1.00   83.19 ? 449  LYS A CE    1 
ATOM   3343 N  NZ    . LYS A 1 449 ? -24.061 -1.118  16.639  1.00   83.13 ? 449  LYS A NZ    1 
ATOM   3344 N  N     . ALA A 1 450 ? -27.070 2.709   10.276  1.00   59.68 ? 450  ALA A N     1 
ATOM   3345 C  CA    . ALA A 1 450 ? -27.859 3.060   9.106   1.00   57.25 ? 450  ALA A CA    1 
ATOM   3346 C  C     . ALA A 1 450 ? -28.010 1.908   8.126   1.00   57.37 ? 450  ALA A C     1 
ATOM   3347 O  O     . ALA A 1 450 ? -27.159 1.023   8.062   1.00   57.76 ? 450  ALA A O     1 
ATOM   3348 C  CB    . ALA A 1 450 ? -27.236 4.259   8.406   1.00   57.31 ? 450  ALA A CB    1 
ATOM   3349 N  N     . LYS A 1 451 ? -29.100 1.917   7.366   1.00   56.83 ? 451  LYS A N     1 
ATOM   3350 C  CA    . LYS A 1 451 ? -29.315 0.870   6.394   1.00   56.59 ? 451  LYS A CA    1 
ATOM   3351 C  C     . LYS A 1 451 ? -28.269 1.035   5.288   1.00   56.42 ? 451  LYS A C     1 
ATOM   3352 O  O     . LYS A 1 451 ? -27.950 2.153   4.888   1.00   54.64 ? 451  LYS A O     1 
ATOM   3353 C  CB    . LYS A 1 451 ? -30.721 0.939   5.807   1.00   57.88 ? 451  LYS A CB    1 
ATOM   3354 C  CG    . LYS A 1 451 ? -30.954 -0.137  4.755   1.00   62.54 ? 451  LYS A CG    1 
ATOM   3355 C  CD    . LYS A 1 451 ? -30.820 -1.556  5.347   1.00   64.52 ? 451  LYS A CD    1 
ATOM   3356 C  CE    . LYS A 1 451 ? -30.364 -2.581  4.297   1.00   64.73 ? 451  LYS A CE    1 
ATOM   3357 N  NZ    . LYS A 1 451 ? -30.958 -2.343  2.936   1.00   64.98 ? 451  LYS A NZ    1 
ATOM   3358 N  N     . ARG A 1 452 ? -27.749 -0.086  4.809   1.00   54.91 ? 452  ARG A N     1 
ATOM   3359 C  CA    . ARG A 1 452 ? -26.718 -0.088  3.791   1.00   53.68 ? 452  ARG A CA    1 
ATOM   3360 C  C     . ARG A 1 452 ? -26.973 -1.142  2.736   1.00   54.73 ? 452  ARG A C     1 
ATOM   3361 O  O     . ARG A 1 452 ? -27.761 -2.069  2.935   1.00   52.13 ? 452  ARG A O     1 
ATOM   3362 C  CB    . ARG A 1 452 ? -25.369 -0.343  4.453   1.00   53.95 ? 452  ARG A CB    1 
ATOM   3363 C  CG    . ARG A 1 452 ? -25.387 -1.559  5.345   1.00   55.33 ? 452  ARG A CG    1 
ATOM   3364 C  CD    . ARG A 1 452 ? -24.087 -1.751  6.122   1.00   56.71 ? 452  ARG A CD    1 
ATOM   3365 N  NE    . ARG A 1 452 ? -23.759 -0.659  7.041   1.00   55.58 ? 452  ARG A NE    1 
ATOM   3366 C  CZ    . ARG A 1 452 ? -22.783 -0.749  7.932   1.00   55.85 ? 452  ARG A CZ    1 
ATOM   3367 N  NH1   . ARG A 1 452 ? -22.085 -1.870  8.009   1.00   56.45 ? 452  ARG A NH1   1 
ATOM   3368 N  NH2   . ARG A 1 452 ? -22.478 0.270   8.720   1.00   56.57 ? 452  ARG A NH2   1 
ATOM   3369 N  N     . ASN A 1 453 ? -26.299 -0.994  1.599   1.00   56.58 ? 453  ASN A N     1 
ATOM   3370 C  CA    . ASN A 1 453 ? -26.454 -1.927  0.498   1.00   56.79 ? 453  ASN A CA    1 
ATOM   3371 C  C     . ASN A 1 453 ? -25.168 -2.574  0.020   1.00   55.42 ? 453  ASN A C     1 
ATOM   3372 O  O     . ASN A 1 453 ? -25.046 -3.792  0.004   1.00   53.73 ? 453  ASN A O     1 
ATOM   3373 C  CB    . ASN A 1 453 ? -27.117 -1.233  -0.689  1.00   63.21 ? 453  ASN A CB    1 
ATOM   3374 C  CG    . ASN A 1 453 ? -28.605 -1.045  -0.497  1.00   72.42 ? 453  ASN A CG    1 
ATOM   3375 O  OD1   . ASN A 1 453 ? -29.337 -2.009  -0.231  1.00   77.53 ? 453  ASN A OD1   1 
ATOM   3376 N  ND2   . ASN A 1 453 ? -29.069 0.196   -0.638  1.00   77.21 ? 453  ASN A ND2   1 
ATOM   3377 N  N     . TYR A 1 454 ? -24.212 -1.748  -0.389  1.00   54.25 ? 454  TYR A N     1 
ATOM   3378 C  CA    . TYR A 1 454 ? -22.945 -2.230  -0.920  1.00   50.33 ? 454  TYR A CA    1 
ATOM   3379 C  C     . TYR A 1 454 ? -21.855 -1.326  -0.406  1.00   47.09 ? 454  TYR A C     1 
ATOM   3380 O  O     . TYR A 1 454 ? -22.139 -0.295  0.195   1.00   45.45 ? 454  TYR A O     1 
ATOM   3381 C  CB    . TYR A 1 454 ? -22.993 -2.198  -2.443  1.00   53.81 ? 454  TYR A CB    1 
ATOM   3382 C  CG    . TYR A 1 454 ? -23.831 -3.298  -3.053  1.00   60.10 ? 454  TYR A CG    1 
ATOM   3383 C  CD1   . TYR A 1 454 ? -23.412 -4.637  -2.992  1.00   62.94 ? 454  TYR A CD1   1 
ATOM   3384 C  CD2   . TYR A 1 454 ? -25.054 -3.016  -3.661  1.00   62.29 ? 454  TYR A CD2   1 
ATOM   3385 C  CE1   . TYR A 1 454 ? -24.193 -5.668  -3.522  1.00   63.61 ? 454  TYR A CE1   1 
ATOM   3386 C  CE2   . TYR A 1 454 ? -25.847 -4.044  -4.188  1.00   63.97 ? 454  TYR A CE2   1 
ATOM   3387 C  CZ    . TYR A 1 454 ? -25.413 -5.369  -4.108  1.00   64.08 ? 454  TYR A CZ    1 
ATOM   3388 O  OH    . TYR A 1 454 ? -26.229 -6.392  -4.549  1.00   64.52 ? 454  TYR A OH    1 
ATOM   3389 N  N     . TYR A 1 455 ? -20.603 -1.703  -0.639  1.00   43.70 ? 455  TYR A N     1 
ATOM   3390 C  CA    . TYR A 1 455 ? -19.508 -0.896  -0.136  1.00   39.95 ? 455  TYR A CA    1 
ATOM   3391 C  C     . TYR A 1 455 ? -18.378 -0.812  -1.126  1.00   38.73 ? 455  TYR A C     1 
ATOM   3392 O  O     . TYR A 1 455 ? -18.347 -1.517  -2.140  1.00   37.38 ? 455  TYR A O     1 
ATOM   3393 C  CB    . TYR A 1 455 ? -18.978 -1.473  1.185   1.00   40.33 ? 455  TYR A CB    1 
ATOM   3394 C  CG    . TYR A 1 455 ? -18.234 -2.802  1.038   1.00   42.29 ? 455  TYR A CG    1 
ATOM   3395 C  CD1   . TYR A 1 455 ? -16.974 -2.856  0.439   1.00   41.95 ? 455  TYR A CD1   1 
ATOM   3396 C  CD2   . TYR A 1 455 ? -18.797 -4.007  1.503   1.00   42.80 ? 455  TYR A CD2   1 
ATOM   3397 C  CE1   . TYR A 1 455 ? -16.281 -4.060  0.295   1.00   43.30 ? 455  TYR A CE1   1 
ATOM   3398 C  CE2   . TYR A 1 455 ? -18.107 -5.233  1.364   1.00   43.77 ? 455  TYR A CE2   1 
ATOM   3399 C  CZ    . TYR A 1 455 ? -16.845 -5.250  0.753   1.00   44.28 ? 455  TYR A CZ    1 
ATOM   3400 O  OH    . TYR A 1 455 ? -16.153 -6.441  0.584   1.00   43.70 ? 455  TYR A OH    1 
ATOM   3401 N  N     . ILE A 1 456 ? -17.441 0.064   -0.809  1.00   35.91 ? 456  ILE A N     1 
ATOM   3402 C  CA    . ILE A 1 456 ? -16.260 0.274   -1.620  1.00   34.97 ? 456  ILE A CA    1 
ATOM   3403 C  C     . ILE A 1 456 ? -15.174 0.169   -0.581  1.00   33.85 ? 456  ILE A C     1 
ATOM   3404 O  O     . ILE A 1 456 ? -15.170 0.928   0.393   1.00   33.97 ? 456  ILE A O     1 
ATOM   3405 C  CB    . ILE A 1 456 ? -16.224 1.719   -2.257  1.00   35.82 ? 456  ILE A CB    1 
ATOM   3406 C  CG1   . ILE A 1 456 ? -17.511 1.952   -3.080  1.00   37.76 ? 456  ILE A CG1   1 
ATOM   3407 C  CG2   . ILE A 1 456 ? -14.979 1.887   -3.126  1.00   34.86 ? 456  ILE A CG2   1 
ATOM   3408 C  CD1   . ILE A 1 456 ? -17.519 3.228   -3.949  1.00   38.48 ? 456  ILE A CD1   1 
ATOM   3409 N  N     . GLY A 1 457 ? -14.270 -0.765  -0.774  1.00   32.63 ? 457  GLY A N     1 
ATOM   3410 C  CA    . GLY A 1 457 ? -13.195 -0.959  0.175   1.00   30.98 ? 457  GLY A CA    1 
ATOM   3411 C  C     . GLY A 1 457 ? -11.889 -0.549  -0.448  1.00   31.84 ? 457  GLY A C     1 
ATOM   3412 O  O     . GLY A 1 457 ? -11.591 -0.911  -1.585  1.00   32.94 ? 457  GLY A O     1 
ATOM   3413 N  N     . VAL A 1 458 ? -11.102 0.229   0.281   1.00   32.02 ? 458  VAL A N     1 
ATOM   3414 C  CA    . VAL A 1 458 ? -9.829  0.685   -0.220  1.00   32.44 ? 458  VAL A CA    1 
ATOM   3415 C  C     . VAL A 1 458 ? -8.789  0.015   0.652   1.00   33.38 ? 458  VAL A C     1 
ATOM   3416 O  O     . VAL A 1 458 ? -8.817  0.137   1.877   1.00   33.54 ? 458  VAL A O     1 
ATOM   3417 C  CB    . VAL A 1 458 ? -9.702  2.244   -0.149  1.00   31.98 ? 458  VAL A CB    1 
ATOM   3418 C  CG1   . VAL A 1 458 ? -8.363  2.687   -0.753  1.00   29.80 ? 458  VAL A CG1   1 
ATOM   3419 C  CG2   . VAL A 1 458 ? -10.840 2.895   -0.956  1.00   30.85 ? 458  VAL A CG2   1 
ATOM   3420 N  N     . LEU A 1 459 ? -7.867  -0.683  0.009   1.00   32.97 ? 459  LEU A N     1 
ATOM   3421 C  CA    . LEU A 1 459 ? -6.840  -1.421  0.714   1.00   34.18 ? 459  LEU A CA    1 
ATOM   3422 C  C     . LEU A 1 459 ? -5.436  -0.855  0.512   1.00   35.78 ? 459  LEU A C     1 
ATOM   3423 O  O     . LEU A 1 459 ? -5.018  -0.607  -0.610  1.00   33.22 ? 459  LEU A O     1 
ATOM   3424 C  CB    . LEU A 1 459 ? -6.907  -2.894  0.253   1.00   33.43 ? 459  LEU A CB    1 
ATOM   3425 C  CG    . LEU A 1 459 ? -5.841  -3.845  0.804   1.00   34.93 ? 459  LEU A CG    1 
ATOM   3426 C  CD1   . LEU A 1 459 ? -6.031  -3.990  2.272   1.00   32.84 ? 459  LEU A CD1   1 
ATOM   3427 C  CD2   . LEU A 1 459 ? -5.921  -5.196  0.102   1.00   36.59 ? 459  LEU A CD2   1 
ATOM   3428 N  N     . ASP A 1 460 ? -4.716  -0.667  1.599   1.00   37.90 ? 460  ASP A N     1 
ATOM   3429 C  CA    . ASP A 1 460 ? -3.360  -0.140  1.550   1.00   39.03 ? 460  ASP A CA    1 
ATOM   3430 C  C     . ASP A 1 460 ? -2.450  -0.907  2.503   1.00   38.64 ? 460  ASP A C     1 
ATOM   3431 O  O     . ASP A 1 460 ? -2.391  -0.598  3.677   1.00   36.83 ? 460  ASP A O     1 
ATOM   3432 C  CB    . ASP A 1 460 ? -3.384  1.352   1.918   1.00   45.79 ? 460  ASP A CB    1 
ATOM   3433 C  CG    . ASP A 1 460 ? -1.975  1.985   1.988   1.00   54.39 ? 460  ASP A CG    1 
ATOM   3434 O  OD1   . ASP A 1 460 ? -1.121  1.649   1.138   1.00   59.91 ? 460  ASP A OD1   1 
ATOM   3435 O  OD2   . ASP A 1 460 ? -1.727  2.835   2.874   1.00   57.62 ? 460  ASP A OD2   1 
ATOM   3436 N  N     . ILE A 1 461 ? -1.751  -1.922  1.997   1.00   39.79 ? 461  ILE A N     1 
ATOM   3437 C  CA    . ILE A 1 461 ? -0.822  -2.694  2.823   1.00   40.46 ? 461  ILE A CA    1 
ATOM   3438 C  C     . ILE A 1 461 ? 0.553   -2.657  2.176   1.00   40.18 ? 461  ILE A C     1 
ATOM   3439 O  O     . ILE A 1 461 ? 0.678   -2.285  1.016   1.00   41.06 ? 461  ILE A O     1 
ATOM   3440 C  CB    . ILE A 1 461 ? -1.271  -4.180  3.001   1.00   40.97 ? 461  ILE A CB    1 
ATOM   3441 C  CG1   . ILE A 1 461 ? -1.726  -4.765  1.681   1.00   40.44 ? 461  ILE A CG1   1 
ATOM   3442 C  CG2   . ILE A 1 461 ? -2.377  -4.272  4.046   1.00   43.17 ? 461  ILE A CG2   1 
ATOM   3443 C  CD1   . ILE A 1 461 ? -0.612  -5.041  0.706   1.00   45.10 ? 461  ILE A CD1   1 
ATOM   3444 N  N     . ALA A 1 462 ? 1.589   -3.046  2.919   1.00   40.93 ? 462  ALA A N     1 
ATOM   3445 C  CA    . ALA A 1 462 ? 2.935   -3.020  2.367   1.00   41.74 ? 462  ALA A CA    1 
ATOM   3446 C  C     . ALA A 1 462 ? 3.089   -4.135  1.362   1.00   43.44 ? 462  ALA A C     1 
ATOM   3447 O  O     . ALA A 1 462 ? 2.477   -5.204  1.503   1.00   44.28 ? 462  ALA A O     1 
ATOM   3448 C  CB    . ALA A 1 462 ? 3.972   -3.180  3.483   1.00   40.17 ? 462  ALA A CB    1 
ATOM   3449 N  N     . GLY A 1 463 ? 3.901   -3.909  0.346   1.00   44.91 ? 463  GLY A N     1 
ATOM   3450 C  CA    . GLY A 1 463 ? 4.094   -4.953  -0.638  1.00   47.44 ? 463  GLY A CA    1 
ATOM   3451 C  C     . GLY A 1 463 ? 5.194   -5.913  -0.237  1.00   49.30 ? 463  GLY A C     1 
ATOM   3452 O  O     . GLY A 1 463 ? 5.782   -5.798  0.841   1.00   49.17 ? 463  GLY A O     1 
ATOM   3453 N  N     . PHE A 1 464 ? 5.461   -6.857  -1.118  1.00   50.81 ? 464  PHE A N     1 
ATOM   3454 C  CA    . PHE A 1 464 ? 6.489   -7.854  -0.911  1.00   53.69 ? 464  PHE A CA    1 
ATOM   3455 C  C     . PHE A 1 464 ? 7.821   -7.146  -0.670  1.00   57.29 ? 464  PHE A C     1 
ATOM   3456 O  O     . PHE A 1 464 ? 8.045   -6.052  -1.190  1.00   54.47 ? 464  PHE A O     1 
ATOM   3457 C  CB    . PHE A 1 464 ? 6.585   -8.729  -2.157  1.00   53.61 ? 464  PHE A CB    1 
ATOM   3458 C  CG    . PHE A 1 464 ? 7.589   -9.824  -2.047  1.00   55.23 ? 464  PHE A CG    1 
ATOM   3459 C  CD1   . PHE A 1 464 ? 7.250   -11.034 -1.447  1.00   55.86 ? 464  PHE A CD1   1 
ATOM   3460 C  CD2   . PHE A 1 464 ? 8.868   -9.659  -2.567  1.00   55.98 ? 464  PHE A CD2   1 
ATOM   3461 C  CE1   . PHE A 1 464 ? 8.174   -12.066 -1.364  1.00   56.49 ? 464  PHE A CE1   1 
ATOM   3462 C  CE2   . PHE A 1 464 ? 9.807   -10.684 -2.493  1.00   57.37 ? 464  PHE A CE2   1 
ATOM   3463 C  CZ    . PHE A 1 464 ? 9.456   -11.898 -1.889  1.00   57.17 ? 464  PHE A CZ    1 
ATOM   3464 N  N     . GLU A 1 465 ? 8.706   -7.764  0.100   1.00   61.72 ? 465  GLU A N     1 
ATOM   3465 C  CA    . GLU A 1 465 ? 9.997   -7.149  0.365   1.00   63.40 ? 465  GLU A CA    1 
ATOM   3466 C  C     . GLU A 1 465 ? 11.097  -8.143  0.780   1.00   61.64 ? 465  GLU A C     1 
ATOM   3467 O  O     . GLU A 1 465 ? 10.857  -9.067  1.552   1.00   60.13 ? 465  GLU A O     1 
ATOM   3468 C  CB    . GLU A 1 465 ? 9.833   -6.064  1.432   1.00   66.38 ? 465  GLU A CB    1 
ATOM   3469 N  N     . ILE A 1 466 ? 12.297  -7.920  0.254   1.00   59.19 ? 466  ILE A N     1 
ATOM   3470 C  CA    . ILE A 1 466 ? 13.453  -8.759  0.536   1.00   58.75 ? 466  ILE A CA    1 
ATOM   3471 C  C     . ILE A 1 466 ? 14.578  -7.883  1.063   1.00   58.32 ? 466  ILE A C     1 
ATOM   3472 O  O     . ILE A 1 466 ? 15.185  -7.119  0.301   1.00   59.45 ? 466  ILE A O     1 
ATOM   3473 C  CB    . ILE A 1 466 ? 13.927  -9.467  -0.740  1.00   56.32 ? 466  ILE A CB    1 
ATOM   3474 C  CG1   . ILE A 1 466 ? 12.804  -10.363 -1.280  1.00   55.98 ? 466  ILE A CG1   1 
ATOM   3475 C  CG2   . ILE A 1 466 ? 15.178  -10.282 -0.457  1.00   55.32 ? 466  ILE A CG2   1 
ATOM   3476 C  CD1   . ILE A 1 466 ? 13.180  -11.113 -2.564  1.00   54.98 ? 466  ILE A CD1   1 
ATOM   3477 N  N     . PHE A 1 467 ? 14.858  -7.977  2.354   1.00   58.72 ? 467  PHE A N     1 
ATOM   3478 C  CA    . PHE A 1 467 ? 15.917  -7.179  2.958   1.00   59.87 ? 467  PHE A CA    1 
ATOM   3479 C  C     . PHE A 1 467 ? 17.143  -8.043  3.218   1.00   62.17 ? 467  PHE A C     1 
ATOM   3480 O  O     . PHE A 1 467 ? 17.104  -9.261  3.027   1.00   60.59 ? 467  PHE A O     1 
ATOM   3481 C  CB    . PHE A 1 467 ? 15.441  -6.586  4.279   1.00   59.58 ? 467  PHE A CB    1 
ATOM   3482 C  CG    . PHE A 1 467 ? 14.225  -5.709  4.153   1.00   60.72 ? 467  PHE A CG    1 
ATOM   3483 C  CD1   . PHE A 1 467 ? 14.322  -4.434  3.601   1.00   60.92 ? 467  PHE A CD1   1 
ATOM   3484 C  CD2   . PHE A 1 467 ? 12.971  -6.173  4.554   1.00   61.16 ? 467  PHE A CD2   1 
ATOM   3485 C  CE1   . PHE A 1 467 ? 13.188  -3.635  3.448   1.00   61.65 ? 467  PHE A CE1   1 
ATOM   3486 C  CE2   . PHE A 1 467 ? 11.829  -5.380  4.407   1.00   61.36 ? 467  PHE A CE2   1 
ATOM   3487 C  CZ    . PHE A 1 467 ? 11.937  -4.115  3.852   1.00   61.44 ? 467  PHE A CZ    1 
ATOM   3488 N  N     . ASP A 1 468 ? 18.239  -7.418  3.641   1.00   64.21 ? 468  ASP A N     1 
ATOM   3489 C  CA    . ASP A 1 468 ? 19.457  -8.153  3.957   1.00   64.64 ? 468  ASP A CA    1 
ATOM   3490 C  C     . ASP A 1 468 ? 19.128  -9.116  5.095   1.00   62.39 ? 468  ASP A C     1 
ATOM   3491 O  O     . ASP A 1 468 ? 19.636  -10.238 5.141   1.00   61.21 ? 468  ASP A O     1 
ATOM   3492 C  CB    . ASP A 1 468 ? 20.561  -7.185  4.382   1.00   71.90 ? 468  ASP A CB    1 
ATOM   3493 C  CG    . ASP A 1 468 ? 21.513  -6.855  3.251   1.00   81.94 ? 468  ASP A CG    1 
ATOM   3494 O  OD1   . ASP A 1 468 ? 22.309  -5.900  3.387   1.00   87.36 ? 468  ASP A OD1   1 
ATOM   3495 O  OD2   . ASP A 1 468 ? 21.475  -7.565  2.225   1.00   87.62 ? 468  ASP A OD2   1 
ATOM   3496 N  N     . PHE A 1 469 ? 18.277  -8.668  6.017   1.00   58.82 ? 469  PHE A N     1 
ATOM   3497 C  CA    . PHE A 1 469 ? 17.846  -9.502  7.139   1.00   55.20 ? 469  PHE A CA    1 
ATOM   3498 C  C     . PHE A 1 469 ? 16.314  -9.602  7.169   1.00   53.24 ? 469  PHE A C     1 
ATOM   3499 O  O     . PHE A 1 469 ? 15.622  -8.589  7.283   1.00   52.00 ? 469  PHE A O     1 
ATOM   3500 C  CB    . PHE A 1 469 ? 18.323  -8.925  8.463   1.00   54.61 ? 469  PHE A CB    1 
ATOM   3501 C  CG    . PHE A 1 469 ? 18.018  -9.798  9.639   1.00   54.02 ? 469  PHE A CG    1 
ATOM   3502 C  CD1   . PHE A 1 469 ? 18.712  -10.987 9.833   1.00   53.90 ? 469  PHE A CD1   1 
ATOM   3503 C  CD2   . PHE A 1 469 ? 17.038  -9.439  10.548  1.00   53.67 ? 469  PHE A CD2   1 
ATOM   3504 C  CE1   . PHE A 1 469 ? 18.437  -11.803 10.925  1.00   54.36 ? 469  PHE A CE1   1 
ATOM   3505 C  CE2   . PHE A 1 469 ? 16.754  -10.244 11.641  1.00   53.93 ? 469  PHE A CE2   1 
ATOM   3506 C  CZ    . PHE A 1 469 ? 17.455  -11.434 11.833  1.00   53.98 ? 469  PHE A CZ    1 
ATOM   3507 N  N     . ASN A 1 470 ? 15.796  -10.826 7.063   1.00   50.58 ? 470  ASN A N     1 
ATOM   3508 C  CA    . ASN A 1 470 ? 14.353  -11.068 7.064   1.00   48.64 ? 470  ASN A CA    1 
ATOM   3509 C  C     . ASN A 1 470 ? 13.975  -11.922 8.267   1.00   48.30 ? 470  ASN A C     1 
ATOM   3510 O  O     . ASN A 1 470 ? 14.632  -12.916 8.565   1.00   47.97 ? 470  ASN A O     1 
ATOM   3511 C  CB    . ASN A 1 470 ? 13.960  -11.753 5.762   1.00   46.66 ? 470  ASN A CB    1 
ATOM   3512 C  CG    . ASN A 1 470 ? 14.362  -10.939 4.538   1.00   45.33 ? 470  ASN A CG    1 
ATOM   3513 O  OD1   . ASN A 1 470 ? 13.684  -9.984  4.170   1.00   44.46 ? 470  ASN A OD1   1 
ATOM   3514 N  ND2   . ASN A 1 470 ? 15.473  -11.313 3.909   1.00   43.27 ? 470  ASN A ND2   1 
ATOM   3515 N  N     . SER A 1 471 ? 12.910  -11.525 8.952   1.00   48.23 ? 471  SER A N     1 
ATOM   3516 C  CA    . SER A 1 471 ? 12.458  -12.202 10.154  1.00   48.20 ? 471  SER A CA    1 
ATOM   3517 C  C     . SER A 1 471 ? 10.950  -12.424 10.145  1.00   46.93 ? 471  SER A C     1 
ATOM   3518 O  O     . SER A 1 471 ? 10.326  -12.415 9.090   1.00   47.56 ? 471  SER A O     1 
ATOM   3519 C  CB    . SER A 1 471 ? 12.875  -11.365 11.382  1.00   50.34 ? 471  SER A CB    1 
ATOM   3520 O  OG    . SER A 1 471 ? 12.311  -11.831 12.596  1.00   52.99 ? 471  SER A OG    1 
ATOM   3521 N  N     . PHE A 1 472 ? 10.366  -12.602 11.328  1.00   44.45 ? 472  PHE A N     1 
ATOM   3522 C  CA    . PHE A 1 472 ? 8.941   -12.860 11.436  1.00   43.71 ? 472  PHE A CA    1 
ATOM   3523 C  C     . PHE A 1 472 ? 8.057   -11.857 10.712  1.00   46.24 ? 472  PHE A C     1 
ATOM   3524 O  O     . PHE A 1 472 ? 7.186   -12.231 9.924   1.00   44.97 ? 472  PHE A O     1 
ATOM   3525 C  CB    . PHE A 1 472 ? 8.521   -12.914 12.903  1.00   39.37 ? 472  PHE A CB    1 
ATOM   3526 C  CG    . PHE A 1 472 ? 7.096   -13.347 13.095  1.00   36.03 ? 472  PHE A CG    1 
ATOM   3527 C  CD1   . PHE A 1 472 ? 6.639   -14.550 12.534  1.00   35.91 ? 472  PHE A CD1   1 
ATOM   3528 C  CD2   . PHE A 1 472 ? 6.228   -12.606 13.867  1.00   34.57 ? 472  PHE A CD2   1 
ATOM   3529 C  CE1   . PHE A 1 472 ? 5.327   -15.004 12.758  1.00   33.97 ? 472  PHE A CE1   1 
ATOM   3530 C  CE2   . PHE A 1 472 ? 4.917   -13.057 14.095  1.00   33.95 ? 472  PHE A CE2   1 
ATOM   3531 C  CZ    . PHE A 1 472 ? 4.474   -14.259 13.539  1.00   32.63 ? 472  PHE A CZ    1 
ATOM   3532 N  N     . GLU A 1 473 ? 8.278   -10.576 11.004  1.00   48.40 ? 473  GLU A N     1 
ATOM   3533 C  CA    . GLU A 1 473 ? 7.522   -9.490  10.422  1.00   49.59 ? 473  GLU A CA    1 
ATOM   3534 C  C     . GLU A 1 473 ? 7.492   -9.576  8.900   1.00   48.76 ? 473  GLU A C     1 
ATOM   3535 O  O     . GLU A 1 473 ? 6.450   -9.352  8.278   1.00   46.71 ? 473  GLU A O     1 
ATOM   3536 C  CB    . GLU A 1 473 ? 8.128   -8.157  10.868  1.00   54.08 ? 473  GLU A CB    1 
ATOM   3537 C  CG    . GLU A 1 473 ? 8.065   -7.905  12.383  1.00   65.00 ? 473  GLU A CG    1 
ATOM   3538 C  CD    . GLU A 1 473 ? 9.080   -8.734  13.199  1.00   70.58 ? 473  GLU A CD    1 
ATOM   3539 O  OE1   . GLU A 1 473 ? 10.228  -8.912  12.720  1.00   72.91 ? 473  GLU A OE1   1 
ATOM   3540 O  OE2   . GLU A 1 473 ? 8.738   -9.188  14.328  1.00   73.35 ? 473  GLU A OE2   1 
ATOM   3541 N  N     . GLN A 1 474 ? 8.633   -9.901  8.292   1.00   47.18 ? 474  GLN A N     1 
ATOM   3542 C  CA    . GLN A 1 474 ? 8.679   -10.015 6.840   1.00   45.99 ? 474  GLN A CA    1 
ATOM   3543 C  C     . GLN A 1 474 ? 7.872   -11.217 6.359   1.00   44.61 ? 474  GLN A C     1 
ATOM   3544 O  O     . GLN A 1 474 ? 7.211   -11.147 5.318   1.00   46.02 ? 474  GLN A O     1 
ATOM   3545 C  CB    . GLN A 1 474 ? 10.117  -10.137 6.351   1.00   46.51 ? 474  GLN A CB    1 
ATOM   3546 C  CG    . GLN A 1 474 ? 10.893  -8.827  6.331   1.00   47.98 ? 474  GLN A CG    1 
ATOM   3547 C  CD    . GLN A 1 474 ? 11.116  -8.243  7.711   1.00   49.51 ? 474  GLN A CD    1 
ATOM   3548 O  OE1   . GLN A 1 474 ? 11.541  -8.943  8.637   1.00   49.22 ? 474  GLN A OE1   1 
ATOM   3549 N  NE2   . GLN A 1 474 ? 10.847  -6.944  7.855   1.00   49.77 ? 474  GLN A NE2   1 
ATOM   3550 N  N     . LEU A 1 475 ? 7.913   -12.317 7.105   1.00   43.03 ? 475  LEU A N     1 
ATOM   3551 C  CA    . LEU A 1 475 ? 7.177   -13.521 6.704   1.00   41.18 ? 475  LEU A CA    1 
ATOM   3552 C  C     . LEU A 1 475 ? 5.678   -13.250 6.686   1.00   41.87 ? 475  LEU A C     1 
ATOM   3553 O  O     . LEU A 1 475 ? 4.962   -13.716 5.800   1.00   42.14 ? 475  LEU A O     1 
ATOM   3554 C  CB    . LEU A 1 475 ? 7.491   -14.674 7.658   1.00   38.48 ? 475  LEU A CB    1 
ATOM   3555 C  CG    . LEU A 1 475 ? 7.094   -16.133 7.320   1.00   36.46 ? 475  LEU A CG    1 
ATOM   3556 C  CD1   . LEU A 1 475 ? 5.835   -16.517 8.019   1.00   35.10 ? 475  LEU A CD1   1 
ATOM   3557 C  CD2   . LEU A 1 475 ? 6.962   -16.314 5.840   1.00   32.65 ? 475  LEU A CD2   1 
ATOM   3558 N  N     . CYS A 1 476 ? 5.207   -12.480 7.671   1.00   42.53 ? 476  CYS A N     1 
ATOM   3559 C  CA    . CYS A 1 476 ? 3.794   -12.123 7.789   1.00   42.49 ? 476  CYS A CA    1 
ATOM   3560 C  C     . CYS A 1 476 ? 3.361   -11.186 6.643   1.00   43.83 ? 476  CYS A C     1 
ATOM   3561 O  O     . CYS A 1 476 ? 2.311   -11.389 6.048   1.00   40.40 ? 476  CYS A O     1 
ATOM   3562 C  CB    . CYS A 1 476 ? 3.533   -11.453 9.145   1.00   44.30 ? 476  CYS A CB    1 
ATOM   3563 S  SG    . CYS A 1 476 ? 3.755   -12.526 10.610  1.00   49.27 ? 476  CYS A SG    1 
ATOM   3564 N  N     . ILE A 1 477 ? 4.173   -10.173 6.350   1.00   44.04 ? 477  ILE A N     1 
ATOM   3565 C  CA    . ILE A 1 477 ? 3.885   -9.241  5.262   1.00   42.84 ? 477  ILE A CA    1 
ATOM   3566 C  C     . ILE A 1 477 ? 3.847   -10.020 3.951   1.00   41.59 ? 477  ILE A C     1 
ATOM   3567 O  O     . ILE A 1 477 ? 2.876   -9.935  3.201   1.00   39.40 ? 477  ILE A O     1 
ATOM   3568 C  CB    . ILE A 1 477 ? 5.012   -8.161  5.074   1.00   48.28 ? 477  ILE A CB    1 
ATOM   3569 C  CG1   . ILE A 1 477 ? 5.243   -7.366  6.352   1.00   54.75 ? 477  ILE A CG1   1 
ATOM   3570 C  CG2   . ILE A 1 477 ? 4.672   -7.237  3.926   1.00   52.80 ? 477  ILE A CG2   1 
ATOM   3571 C  CD1   . ILE A 1 477 ? 4.104   -6.432  6.774   1.00   59.45 ? 477  ILE A CD1   1 
ATOM   3572 N  N     . ASN A 1 478 ? 4.905   -10.773 3.671   1.00   39.21 ? 478  ASN A N     1 
ATOM   3573 C  CA    . ASN A 1 478 ? 4.985   -11.512 2.412   1.00   37.56 ? 478  ASN A CA    1 
ATOM   3574 C  C     . ASN A 1 478 ? 3.874   -12.502 2.233   1.00   37.56 ? 478  ASN A C     1 
ATOM   3575 O  O     . ASN A 1 478 ? 3.300   -12.635 1.143   1.00   38.62 ? 478  ASN A O     1 
ATOM   3576 C  CB    . ASN A 1 478 ? 6.330   -12.205 2.262   1.00   36.88 ? 478  ASN A CB    1 
ATOM   3577 C  CG    . ASN A 1 478 ? 7.469   -11.202 2.104   1.00   39.34 ? 478  ASN A CG    1 
ATOM   3578 O  OD1   . ASN A 1 478 ? 7.259   -10.104 1.589   1.00   38.84 ? 478  ASN A OD1   1 
ATOM   3579 N  ND2   . ASN A 1 478 ? 8.673   -11.577 2.534   1.00   38.57 ? 478  ASN A ND2   1 
ATOM   3580 N  N     . TYR A 1 479 ? 3.545   -13.205 3.310   1.00   37.54 ? 479  TYR A N     1 
ATOM   3581 C  CA    . TYR A 1 479 ? 2.450   -14.162 3.263   1.00   37.01 ? 479  TYR A CA    1 
ATOM   3582 C  C     . TYR A 1 479 ? 1.141   -13.444 2.883   1.00   37.51 ? 479  TYR A C     1 
ATOM   3583 O  O     . TYR A 1 479 ? 0.356   -13.973 2.108   1.00   38.60 ? 479  TYR A O     1 
ATOM   3584 C  CB    . TYR A 1 479 ? 2.344   -14.871 4.632   1.00   34.86 ? 479  TYR A CB    1 
ATOM   3585 C  CG    . TYR A 1 479 ? 1.009   -15.485 4.896   1.00   30.77 ? 479  TYR A CG    1 
ATOM   3586 C  CD1   . TYR A 1 479 ? 0.459   -16.400 4.024   1.00   29.86 ? 479  TYR A CD1   1 
ATOM   3587 C  CD2   . TYR A 1 479 ? 0.284   -15.124 6.029   1.00   31.03 ? 479  TYR A CD2   1 
ATOM   3588 C  CE1   . TYR A 1 479 ? -0.807  -16.950 4.264   1.00   30.09 ? 479  TYR A CE1   1 
ATOM   3589 C  CE2   . TYR A 1 479 ? -0.973  -15.665 6.282   1.00   30.27 ? 479  TYR A CE2   1 
ATOM   3590 C  CZ    . TYR A 1 479 ? -1.505  -16.575 5.391   1.00   30.01 ? 479  TYR A CZ    1 
ATOM   3591 O  OH    . TYR A 1 479 ? -2.756  -17.091 5.635   1.00   32.09 ? 479  TYR A OH    1 
ATOM   3592 N  N     . THR A 1 480 ? 0.899   -12.249 3.432   1.00   38.48 ? 480  THR A N     1 
ATOM   3593 C  CA    . THR A 1 480 ? -0.301  -11.485 3.082   1.00   39.08 ? 480  THR A CA    1 
ATOM   3594 C  C     . THR A 1 480 ? -0.294  -11.166 1.574   1.00   41.15 ? 480  THR A C     1 
ATOM   3595 O  O     . THR A 1 480 ? -1.327  -11.240 0.921   1.00   39.86 ? 480  THR A O     1 
ATOM   3596 C  CB    . THR A 1 480 ? -0.396  -10.132 3.835   1.00   39.81 ? 480  THR A CB    1 
ATOM   3597 O  OG1   . THR A 1 480 ? -0.245  -10.335 5.252   1.00   39.22 ? 480  THR A OG1   1 
ATOM   3598 C  CG2   . THR A 1 480 ? -1.764  -9.498  3.575   1.00   39.81 ? 480  THR A CG2   1 
ATOM   3599 N  N     . ASN A 1 481 ? 0.881   -10.812 1.031   1.00   42.27 ? 481  ASN A N     1 
ATOM   3600 C  CA    . ASN A 1 481 ? 1.009   -10.491 -0.386  1.00   43.11 ? 481  ASN A CA    1 
ATOM   3601 C  C     . ASN A 1 481 ? 0.832   -11.720 -1.282  1.00   44.14 ? 481  ASN A C     1 
ATOM   3602 O  O     . ASN A 1 481 ? 0.304   -11.613 -2.388  1.00   43.99 ? 481  ASN A O     1 
ATOM   3603 C  CB    . ASN A 1 481 ? 2.358   -9.824  -0.656  1.00   44.59 ? 481  ASN A CB    1 
ATOM   3604 C  CG    . ASN A 1 481 ? 2.322   -8.310  -0.420  1.00   47.34 ? 481  ASN A CG    1 
ATOM   3605 O  OD1   . ASN A 1 481 ? 1.739   -7.555  -1.203  1.00   46.93 ? 481  ASN A OD1   1 
ATOM   3606 N  ND2   . ASN A 1 481 ? 2.935   -7.870  0.673   1.00   49.04 ? 481  ASN A ND2   1 
ATOM   3607 N  N     . GLU A 1 482 ? 1.257   -12.886 -0.804  1.00   45.67 ? 482  GLU A N     1 
ATOM   3608 C  CA    . GLU A 1 482 ? 1.112   -14.118 -1.583  1.00   46.41 ? 482  GLU A CA    1 
ATOM   3609 C  C     . GLU A 1 482 ? -0.401  -14.428 -1.764  1.00   45.55 ? 482  GLU A C     1 
ATOM   3610 O  O     . GLU A 1 482 ? -0.808  -14.836 -2.843  1.00   45.64 ? 482  GLU A O     1 
ATOM   3611 C  CB    . GLU A 1 482 ? 1.856   -15.266 -0.893  1.00   47.55 ? 482  GLU A CB    1 
ATOM   3612 C  CG    . GLU A 1 482 ? 2.556   -16.250 -1.855  1.00   53.44 ? 482  GLU A CG    1 
ATOM   3613 C  CD    . GLU A 1 482 ? 4.066   -15.978 -2.109  1.00   55.31 ? 482  GLU A CD    1 
ATOM   3614 O  OE1   . GLU A 1 482 ? 4.764   -15.386 -1.252  1.00   56.32 ? 482  GLU A OE1   1 
ATOM   3615 O  OE2   . GLU A 1 482 ? 4.572   -16.406 -3.170  1.00   56.96 ? 482  GLU A OE2   1 
ATOM   3616 N  N     . ARG A 1 483 ? -1.216  -14.229 -0.730  1.00   45.08 ? 483  ARG A N     1 
ATOM   3617 C  CA    . ARG A 1 483 ? -2.669  -14.436 -0.866  1.00   44.27 ? 483  ARG A CA    1 
ATOM   3618 C  C     . ARG A 1 483 ? -3.224  -13.316 -1.786  1.00   43.20 ? 483  ARG A C     1 
ATOM   3619 O  O     . ARG A 1 483 ? -4.136  -13.563 -2.563  1.00   42.76 ? 483  ARG A O     1 
ATOM   3620 C  CB    . ARG A 1 483 ? -3.425  -14.353 0.485   1.00   44.06 ? 483  ARG A CB    1 
ATOM   3621 C  CG    . ARG A 1 483 ? -3.126  -15.398 1.582   1.00   46.30 ? 483  ARG A CG    1 
ATOM   3622 C  CD    . ARG A 1 483 ? -3.851  -16.727 1.424   1.00   46.46 ? 483  ARG A CD    1 
ATOM   3623 N  NE    . ARG A 1 483 ? -5.314  -16.641 1.366   1.00   47.41 ? 483  ARG A NE    1 
ATOM   3624 C  CZ    . ARG A 1 483 ? -6.128  -16.686 2.417   1.00   46.90 ? 483  ARG A CZ    1 
ATOM   3625 N  NH1   . ARG A 1 483 ? -5.652  -16.811 3.643   1.00   46.82 ? 483  ARG A NH1   1 
ATOM   3626 N  NH2   . ARG A 1 483 ? -7.432  -16.610 2.235   1.00   46.71 ? 483  ARG A NH2   1 
ATOM   3627 N  N     . LEU A 1 484 ? -2.681  -12.099 -1.681  1.00   41.66 ? 484  LEU A N     1 
ATOM   3628 C  CA    . LEU A 1 484 ? -3.141  -10.972 -2.518  1.00   41.88 ? 484  LEU A CA    1 
ATOM   3629 C  C     . LEU A 1 484 ? -2.819  -11.211 -3.987  1.00   42.41 ? 484  LEU A C     1 
ATOM   3630 O  O     . LEU A 1 484 ? -3.694  -11.080 -4.838  1.00   41.31 ? 484  LEU A O     1 
ATOM   3631 C  CB    . LEU A 1 484 ? -2.530  -9.620  -2.050  1.00   40.22 ? 484  LEU A CB    1 
ATOM   3632 C  CG    . LEU A 1 484 ? -3.267  -9.028  -0.833  1.00   40.51 ? 484  LEU A CG    1 
ATOM   3633 C  CD1   . LEU A 1 484 ? -2.547  -7.797  -0.274  1.00   39.79 ? 484  LEU A CD1   1 
ATOM   3634 C  CD2   . LEU A 1 484 ? -4.690  -8.692  -1.255  1.00   38.47 ? 484  LEU A CD2   1 
ATOM   3635 N  N     . GLN A 1 485 ? -1.571  -11.570 -4.285  1.00   44.37 ? 485  GLN A N     1 
ATOM   3636 C  CA    . GLN A 1 485 ? -1.173  -11.872 -5.666  1.00   44.97 ? 485  GLN A CA    1 
ATOM   3637 C  C     . GLN A 1 485 ? -2.133  -12.886 -6.277  1.00   43.82 ? 485  GLN A C     1 
ATOM   3638 O  O     . GLN A 1 485 ? -2.549  -12.749 -7.418  1.00   42.96 ? 485  GLN A O     1 
ATOM   3639 C  CB    . GLN A 1 485 ? 0.234   -12.464 -5.715  1.00   47.37 ? 485  GLN A CB    1 
ATOM   3640 C  CG    . GLN A 1 485 ? 1.288   -11.536 -6.302  1.00   54.51 ? 485  GLN A CG    1 
ATOM   3641 C  CD    . GLN A 1 485 ? 1.115   -11.312 -7.779  1.00   57.01 ? 485  GLN A CD    1 
ATOM   3642 O  OE1   . GLN A 1 485 ? 1.862   -10.567 -8.377  1.00   59.83 ? 485  GLN A OE1   1 
ATOM   3643 N  NE2   . GLN A 1 485 ? 0.135   -11.967 -8.373  1.00   59.42 ? 485  GLN A NE2   1 
ATOM   3644 N  N     . GLN A 1 486 ? -2.481  -13.901 -5.501  1.00   44.28 ? 486  GLN A N     1 
ATOM   3645 C  CA    . GLN A 1 486 ? -3.397  -14.924 -5.980  1.00   45.41 ? 486  GLN A CA    1 
ATOM   3646 C  C     . GLN A 1 486 ? -4.739  -14.298 -6.374  1.00   45.20 ? 486  GLN A C     1 
ATOM   3647 O  O     . GLN A 1 486 ? -5.347  -14.696 -7.367  1.00   45.68 ? 486  GLN A O     1 
ATOM   3648 C  CB    . GLN A 1 486 ? -3.607  -15.963 -4.892  1.00   46.24 ? 486  GLN A CB    1 
ATOM   3649 C  CG    . GLN A 1 486 ? -4.483  -17.111 -5.277  1.00   47.46 ? 486  GLN A CG    1 
ATOM   3650 C  CD    . GLN A 1 486 ? -4.506  -18.137 -4.173  1.00   48.41 ? 486  GLN A CD    1 
ATOM   3651 O  OE1   . GLN A 1 486 ? -5.034  -17.880 -3.080  1.00   48.33 ? 486  GLN A OE1   1 
ATOM   3652 N  NE2   . GLN A 1 486 ? -3.908  -19.295 -4.431  1.00   47.29 ? 486  GLN A NE2   1 
ATOM   3653 N  N     . PHE A 1 487 ? -5.193  -13.327 -5.582  1.00   44.29 ? 487  PHE A N     1 
ATOM   3654 C  CA    . PHE A 1 487 ? -6.446  -12.639 -5.856  1.00   43.60 ? 487  PHE A CA    1 
ATOM   3655 C  C     . PHE A 1 487 ? -6.273  -11.925 -7.213  1.00   44.25 ? 487  PHE A C     1 
ATOM   3656 O  O     . PHE A 1 487 ? -7.096  -12.086 -8.117  1.00   41.12 ? 487  PHE A O     1 
ATOM   3657 C  CB    . PHE A 1 487 ? -6.734  -11.623 -4.741  1.00   42.81 ? 487  PHE A CB    1 
ATOM   3658 C  CG    . PHE A 1 487 ? -7.875  -10.671 -5.049  1.00   41.72 ? 487  PHE A CG    1 
ATOM   3659 C  CD1   . PHE A 1 487 ? -9.189  -11.144 -5.154  1.00   39.43 ? 487  PHE A CD1   1 
ATOM   3660 C  CD2   . PHE A 1 487 ? -7.623  -9.298  -5.235  1.00   39.65 ? 487  PHE A CD2   1 
ATOM   3661 C  CE1   . PHE A 1 487 ? -10.244 -10.274 -5.448  1.00   39.54 ? 487  PHE A CE1   1 
ATOM   3662 C  CE2   . PHE A 1 487 ? -8.664  -8.417  -5.528  1.00   40.51 ? 487  PHE A CE2   1 
ATOM   3663 C  CZ    . PHE A 1 487 ? -9.991  -8.901  -5.638  1.00   39.70 ? 487  PHE A CZ    1 
ATOM   3664 N  N     . PHE A 1 488 ? -5.194  -11.145 -7.338  1.00   43.99 ? 488  PHE A N     1 
ATOM   3665 C  CA    . PHE A 1 488 ? -4.908  -10.427 -8.565  1.00   44.88 ? 488  PHE A CA    1 
ATOM   3666 C  C     . PHE A 1 488 ? -4.785  -11.388 -9.752  1.00   47.50 ? 488  PHE A C     1 
ATOM   3667 O  O     . PHE A 1 488 ? -5.183  -11.052 -10.867 1.00   46.94 ? 488  PHE A O     1 
ATOM   3668 C  CB    . PHE A 1 488 ? -3.619  -9.616  -8.398  1.00   44.30 ? 488  PHE A CB    1 
ATOM   3669 C  CG    . PHE A 1 488 ? -3.079  -9.060  -9.696  1.00   44.75 ? 488  PHE A CG    1 
ATOM   3670 C  CD1   . PHE A 1 488 ? -2.105  -9.744  -10.403 1.00   44.27 ? 488  PHE A CD1   1 
ATOM   3671 C  CD2   . PHE A 1 488 ? -3.556  -7.859  -10.209 1.00   44.34 ? 488  PHE A CD2   1 
ATOM   3672 C  CE1   . PHE A 1 488 ? -1.604  -9.241  -11.607 1.00   45.78 ? 488  PHE A CE1   1 
ATOM   3673 C  CE2   . PHE A 1 488 ? -3.063  -7.350  -11.410 1.00   45.40 ? 488  PHE A CE2   1 
ATOM   3674 C  CZ    . PHE A 1 488 ? -2.086  -8.037  -12.112 1.00   44.85 ? 488  PHE A CZ    1 
ATOM   3675 N  N     . ASN A 1 489 ? -4.241  -12.586 -9.520  1.00   50.20 ? 489  ASN A N     1 
ATOM   3676 C  CA    . ASN A 1 489 ? -4.099  -13.575 -10.590 1.00   51.77 ? 489  ASN A CA    1 
ATOM   3677 C  C     . ASN A 1 489 ? -5.441  -14.171 -10.986 1.00   51.95 ? 489  ASN A C     1 
ATOM   3678 O  O     . ASN A 1 489 ? -5.650  -14.546 -12.136 1.00   51.31 ? 489  ASN A O     1 
ATOM   3679 C  CB    . ASN A 1 489 ? -3.127  -14.683 -10.185 1.00   53.98 ? 489  ASN A CB    1 
ATOM   3680 C  CG    . ASN A 1 489 ? -1.695  -14.295 -10.445 1.00   58.24 ? 489  ASN A CG    1 
ATOM   3681 O  OD1   . ASN A 1 489 ? -1.029  -14.890 -11.285 1.00   61.86 ? 489  ASN A OD1   1 
ATOM   3682 N  ND2   . ASN A 1 489 ? -1.222  -13.264 -9.759  1.00   59.17 ? 489  ASN A ND2   1 
ATOM   3683 N  N     . HIS A 1 490 ? -6.347  -14.254 -10.020 1.00   52.32 ? 490  HIS A N     1 
ATOM   3684 C  CA    . HIS A 1 490 ? -7.675  -14.770 -10.283 1.00   52.31 ? 490  HIS A CA    1 
ATOM   3685 C  C     . HIS A 1 490 ? -8.376  -13.810 -11.244 1.00   51.77 ? 490  HIS A C     1 
ATOM   3686 O  O     . HIS A 1 490 ? -8.958  -14.238 -12.235 1.00   52.83 ? 490  HIS A O     1 
ATOM   3687 C  CB    . HIS A 1 490 ? -8.464  -14.889 -8.983  1.00   52.46 ? 490  HIS A CB    1 
ATOM   3688 C  CG    . HIS A 1 490 ? -9.926  -15.120 -9.191  1.00   54.18 ? 490  HIS A CG    1 
ATOM   3689 N  ND1   . HIS A 1 490 ? -10.831 -14.087 -9.325  1.00   54.39 ? 490  HIS A ND1   1 
ATOM   3690 C  CD2   . HIS A 1 490 ? -10.634 -16.263 -9.363  1.00   54.48 ? 490  HIS A CD2   1 
ATOM   3691 C  CE1   . HIS A 1 490 ? -12.031 -14.583 -9.575  1.00   54.64 ? 490  HIS A CE1   1 
ATOM   3692 N  NE2   . HIS A 1 490 ? -11.937 -15.901 -9.607  1.00   54.41 ? 490  HIS A NE2   1 
ATOM   3693 N  N     . HIS A 1 491 ? -8.317  -12.513 -10.956 1.00   51.23 ? 491  HIS A N     1 
ATOM   3694 C  CA    . HIS A 1 491 ? -8.951  -11.529 -11.820 1.00   51.30 ? 491  HIS A CA    1 
ATOM   3695 C  C     . HIS A 1 491 ? -8.252  -11.350 -13.171 1.00   51.81 ? 491  HIS A C     1 
ATOM   3696 O  O     . HIS A 1 491 ? -8.858  -10.845 -14.114 1.00   50.74 ? 491  HIS A O     1 
ATOM   3697 C  CB    . HIS A 1 491 ? -9.117  -10.192 -11.090 1.00   48.65 ? 491  HIS A CB    1 
ATOM   3698 C  CG    . HIS A 1 491 ? -10.314 -10.161 -10.187 1.00   48.06 ? 491  HIS A CG    1 
ATOM   3699 N  ND1   . HIS A 1 491 ? -11.597 -9.973  -10.658 1.00   46.90 ? 491  HIS A ND1   1 
ATOM   3700 C  CD2   . HIS A 1 491 ? -10.439 -10.373 -8.852  1.00   45.86 ? 491  HIS A CD2   1 
ATOM   3701 C  CE1   . HIS A 1 491 ? -12.456 -10.073 -9.659  1.00   45.20 ? 491  HIS A CE1   1 
ATOM   3702 N  NE2   . HIS A 1 491 ? -11.782 -10.314 -8.557  1.00   45.67 ? 491  HIS A NE2   1 
ATOM   3703 N  N     . MET A 1 492 ? -6.995  -11.766 -13.264 1.00   52.81 ? 492  MET A N     1 
ATOM   3704 C  CA    . MET A 1 492 ? -6.268  -11.677 -14.530 1.00   54.71 ? 492  MET A CA    1 
ATOM   3705 C  C     . MET A 1 492 ? -6.707  -12.834 -15.438 1.00   56.45 ? 492  MET A C     1 
ATOM   3706 O  O     . MET A 1 492 ? -6.756  -12.689 -16.656 1.00   54.36 ? 492  MET A O     1 
ATOM   3707 C  CB    . MET A 1 492 ? -4.755  -11.739 -14.297 1.00   54.89 ? 492  MET A CB    1 
ATOM   3708 C  CG    . MET A 1 492 ? -4.187  -10.485 -13.652 1.00   57.32 ? 492  MET A CG    1 
ATOM   3709 S  SD    . MET A 1 492 ? -4.619  -8.988  -14.590 1.00   57.79 ? 492  MET A SD    1 
ATOM   3710 C  CE    . MET A 1 492 ? -3.114  -8.741  -15.530 1.00   59.14 ? 492  MET A CE    1 
ATOM   3711 N  N     . PHE A 1 493 ? -7.023  -13.969 -14.832 1.00   58.27 ? 493  PHE A N     1 
ATOM   3712 C  CA    . PHE A 1 493 ? -7.480  -15.128 -15.575 1.00   60.16 ? 493  PHE A CA    1 
ATOM   3713 C  C     . PHE A 1 493 ? -8.833  -14.802 -16.216 1.00   60.01 ? 493  PHE A C     1 
ATOM   3714 O  O     . PHE A 1 493 ? -9.133  -15.276 -17.311 1.00   60.49 ? 493  PHE A O     1 
ATOM   3715 C  CB    . PHE A 1 493 ? -7.620  -16.344 -14.652 1.00   63.54 ? 493  PHE A CB    1 
ATOM   3716 C  CG    . PHE A 1 493 ? -8.049  -17.598 -15.369 1.00   69.98 ? 493  PHE A CG    1 
ATOM   3717 C  CD1   . PHE A 1 493 ? -8.927  -18.492 -14.766 1.00   72.34 ? 493  PHE A CD1   1 
ATOM   3718 C  CD2   . PHE A 1 493 ? -7.585  -17.877 -16.658 1.00   72.71 ? 493  PHE A CD2   1 
ATOM   3719 C  CE1   . PHE A 1 493 ? -9.347  -19.648 -15.435 1.00   73.94 ? 493  PHE A CE1   1 
ATOM   3720 C  CE2   . PHE A 1 493 ? -7.996  -19.025 -17.335 1.00   74.24 ? 493  PHE A CE2   1 
ATOM   3721 C  CZ    . PHE A 1 493 ? -8.882  -19.914 -16.720 1.00   74.36 ? 493  PHE A CZ    1 
ATOM   3722 N  N     . ILE A 1 494 ? -9.648  -13.998 -15.534 1.00   60.01 ? 494  ILE A N     1 
ATOM   3723 C  CA    . ILE A 1 494 ? -10.947 -13.595 -16.071 1.00   59.99 ? 494  ILE A CA    1 
ATOM   3724 C  C     . ILE A 1 494 ? -10.732 -12.657 -17.261 1.00   60.40 ? 494  ILE A C     1 
ATOM   3725 O  O     . ILE A 1 494 ? -11.500 -12.679 -18.218 1.00   62.61 ? 494  ILE A O     1 
ATOM   3726 C  CB    . ILE A 1 494 ? -11.809 -12.863 -15.001 1.00   58.10 ? 494  ILE A CB    1 
ATOM   3727 C  CG1   . ILE A 1 494 ? -12.367 -13.869 -13.998 1.00   55.58 ? 494  ILE A CG1   1 
ATOM   3728 C  CG2   . ILE A 1 494 ? -12.958 -12.093 -15.663 1.00   55.90 ? 494  ILE A CG2   1 
ATOM   3729 C  CD1   . ILE A 1 494 ? -13.006 -13.202 -12.800 1.00   54.18 ? 494  ILE A CD1   1 
ATOM   3730 N  N     . LEU A 1 495 ? -9.690  -11.831 -17.205 1.00   61.93 ? 495  LEU A N     1 
ATOM   3731 C  CA    . LEU A 1 495 ? -9.410  -10.920 -18.309 1.00   64.56 ? 495  LEU A CA    1 
ATOM   3732 C  C     . LEU A 1 495 ? -8.870  -11.754 -19.456 1.00   66.78 ? 495  LEU A C     1 
ATOM   3733 O  O     . LEU A 1 495 ? -8.965  -11.383 -20.627 1.00   66.86 ? 495  LEU A O     1 
ATOM   3734 C  CB    . LEU A 1 495 ? -8.379  -9.874  -17.897 1.00   62.94 ? 495  LEU A CB    1 
ATOM   3735 C  CG    . LEU A 1 495 ? -8.813  -9.000  -16.721 1.00   61.18 ? 495  LEU A CG    1 
ATOM   3736 C  CD1   . LEU A 1 495 ? -7.809  -7.863  -16.514 1.00   58.99 ? 495  LEU A CD1   1 
ATOM   3737 C  CD2   . LEU A 1 495 ? -10.203 -8.441  -16.997 1.00   59.67 ? 495  LEU A CD2   1 
ATOM   3738 N  N     . GLU A 1 496 ? -8.306  -12.895 -19.084 1.00   69.08 ? 496  GLU A N     1 
ATOM   3739 C  CA    . GLU A 1 496 ? -7.730  -13.851 -20.011 1.00   70.42 ? 496  GLU A CA    1 
ATOM   3740 C  C     . GLU A 1 496 ? -8.862  -14.562 -20.753 1.00   70.53 ? 496  GLU A C     1 
ATOM   3741 O  O     . GLU A 1 496 ? -8.885  -14.603 -21.981 1.00   70.03 ? 496  GLU A O     1 
ATOM   3742 C  CB    . GLU A 1 496 ? -6.896  -14.858 -19.215 1.00   71.49 ? 496  GLU A CB    1 
ATOM   3743 C  CG    . GLU A 1 496 ? -5.984  -15.778 -20.021 1.00   75.80 ? 496  GLU A CG    1 
ATOM   3744 C  CD    . GLU A 1 496 ? -4.965  -15.038 -20.876 1.00   77.85 ? 496  GLU A CD    1 
ATOM   3745 O  OE1   . GLU A 1 496 ? -4.500  -13.948 -20.459 1.00   77.90 ? 496  GLU A OE1   1 
ATOM   3746 O  OE2   . GLU A 1 496 ? -4.619  -15.567 -21.965 1.00   78.72 ? 496  GLU A OE2   1 
ATOM   3747 N  N     . GLN A 1 497 ? -9.801  -15.110 -19.997 1.00   70.66 ? 497  GLN A N     1 
ATOM   3748 C  CA    . GLN A 1 497 ? -10.929 -15.824 -20.562 1.00   71.19 ? 497  GLN A CA    1 
ATOM   3749 C  C     . GLN A 1 497 ? -11.861 -14.984 -21.427 1.00   72.06 ? 497  GLN A C     1 
ATOM   3750 O  O     . GLN A 1 497 ? -12.586 -15.532 -22.249 1.00   72.48 ? 497  GLN A O     1 
ATOM   3751 C  CB    . GLN A 1 497 ? -11.704 -16.519 -19.449 1.00   70.48 ? 497  GLN A CB    1 
ATOM   3752 C  CG    . GLN A 1 497 ? -10.905 -17.655 -18.854 1.00   70.96 ? 497  GLN A CG    1 
ATOM   3753 C  CD    . GLN A 1 497 ? -11.569 -18.302 -17.660 1.00   71.80 ? 497  GLN A CD    1 
ATOM   3754 O  OE1   . GLN A 1 497 ? -11.838 -17.644 -16.649 1.00   72.18 ? 497  GLN A OE1   1 
ATOM   3755 N  NE2   . GLN A 1 497 ? -11.833 -19.606 -17.762 1.00   72.03 ? 497  GLN A NE2   1 
ATOM   3756 N  N     . GLU A 1 498 ? -11.852 -13.670 -21.259 1.00   72.86 ? 498  GLU A N     1 
ATOM   3757 C  CA    . GLU A 1 498 ? -12.710 -12.839 -22.088 1.00   74.06 ? 498  GLU A CA    1 
ATOM   3758 C  C     . GLU A 1 498 ? -11.983 -12.403 -23.356 1.00   75.21 ? 498  GLU A C     1 
ATOM   3759 O  O     . GLU A 1 498 ? -12.616 -11.958 -24.313 1.00   73.20 ? 498  GLU A O     1 
ATOM   3760 C  CB    . GLU A 1 498 ? -13.227 -11.622 -21.309 1.00   75.54 ? 498  GLU A CB    1 
ATOM   3761 C  CG    . GLU A 1 498 ? -14.533 -11.866 -20.511 1.00   78.84 ? 498  GLU A CG    1 
ATOM   3762 C  CD    . GLU A 1 498 ? -15.683 -12.466 -21.357 1.00   80.51 ? 498  GLU A CD    1 
ATOM   3763 O  OE1   . GLU A 1 498 ? -15.867 -12.051 -22.527 1.00   80.99 ? 498  GLU A OE1   1 
ATOM   3764 O  OE2   . GLU A 1 498 ? -16.418 -13.346 -20.847 1.00   80.06 ? 498  GLU A OE2   1 
ATOM   3765 N  N     . GLU A 1 499 ? -10.661 -12.519 -23.371 1.00   74.48 ? 499  GLU A N     1 
ATOM   3766 C  CA    . GLU A 1 499 ? -9.895  -12.159 -24.558 1.00   72.84 ? 499  GLU A CA    1 
ATOM   3767 C  C     . GLU A 1 499 ? -10.048 -13.345 -25.505 1.00   71.21 ? 499  GLU A C     1 
ATOM   3768 O  O     . GLU A 1 499 ? -10.105 -13.182 -26.726 1.00   66.72 ? 499  GLU A O     1 
ATOM   3769 C  CB    . GLU A 1 499 ? -8.414  -11.956 -24.228 1.00   76.42 ? 499  GLU A CB    1 
ATOM   3770 C  CG    . GLU A 1 499 ? -7.503  -11.748 -25.449 1.00   86.45 ? 499  GLU A CG    1 
ATOM   3771 C  CD    . GLU A 1 499 ? -7.224  -10.276 -25.763 1.00   91.47 ? 499  GLU A CD    1 
ATOM   3772 O  OE1   . GLU A 1 499 ? -8.190  -9.508  -25.985 1.00   93.34 ? 499  GLU A OE1   1 
ATOM   3773 O  OE2   . GLU A 1 499 ? -6.031  -9.888  -25.789 1.00   93.41 ? 499  GLU A OE2   1 
ATOM   3774 N  N     . TYR A 1 500 ? -10.115 -14.538 -24.926 1.00   67.69 ? 500  TYR A N     1 
ATOM   3775 C  CA    . TYR A 1 500 ? -10.276 -15.745 -25.705 1.00   65.85 ? 500  TYR A CA    1 
ATOM   3776 C  C     . TYR A 1 500 ? -11.529 -15.631 -26.568 1.00   68.55 ? 500  TYR A C     1 
ATOM   3777 O  O     . TYR A 1 500 ? -11.452 -15.663 -27.799 1.00   68.00 ? 500  TYR A O     1 
ATOM   3778 C  CB    . TYR A 1 500 ? -10.399 -16.968 -24.787 1.00   62.64 ? 500  TYR A CB    1 
ATOM   3779 C  CG    . TYR A 1 500 ? -9.162  -17.283 -23.958 1.00   60.43 ? 500  TYR A CG    1 
ATOM   3780 C  CD1   . TYR A 1 500 ? -7.946  -16.636 -24.205 1.00   59.88 ? 500  TYR A CD1   1 
ATOM   3781 C  CD2   . TYR A 1 500 ? -9.199  -18.256 -22.955 1.00   59.71 ? 500  TYR A CD2   1 
ATOM   3782 C  CE1   . TYR A 1 500 ? -6.804  -16.946 -23.482 1.00   59.32 ? 500  TYR A CE1   1 
ATOM   3783 C  CE2   . TYR A 1 500 ? -8.056  -18.575 -22.221 1.00   59.30 ? 500  TYR A CE2   1 
ATOM   3784 C  CZ    . TYR A 1 500 ? -6.866  -17.915 -22.495 1.00   59.47 ? 500  TYR A CZ    1 
ATOM   3785 O  OH    . TYR A 1 500 ? -5.728  -18.215 -21.793 1.00   59.96 ? 500  TYR A OH    1 
ATOM   3786 N  N     . LYS A 1 501 ? -12.681 -15.496 -25.924 1.00   73.16 ? 501  LYS A N     1 
ATOM   3787 C  CA    . LYS A 1 501 ? -13.952 -15.385 -26.625 1.00   77.64 ? 501  LYS A CA    1 
ATOM   3788 C  C     . LYS A 1 501 ? -13.964 -14.277 -27.678 1.00   80.01 ? 501  LYS A C     1 
ATOM   3789 O  O     . LYS A 1 501 ? -14.578 -14.426 -28.735 1.00   78.98 ? 501  LYS A O     1 
ATOM   3790 C  CB    . LYS A 1 501 ? -15.082 -15.177 -25.613 1.00   81.56 ? 501  LYS A CB    1 
ATOM   3791 C  CG    . LYS A 1 501 ? -15.336 -16.403 -24.726 1.00   89.91 ? 501  LYS A CG    1 
ATOM   3792 C  CD    . LYS A 1 501 ? -14.082 -16.786 -23.932 1.00   93.77 ? 501  LYS A CD    1 
ATOM   3793 C  CE    . LYS A 1 501 ? -14.252 -18.059 -23.117 1.00   94.75 ? 501  LYS A CE    1 
ATOM   3794 N  NZ    . LYS A 1 501 ? -14.364 -19.255 -23.998 1.00   94.60 ? 501  LYS A NZ    1 
ATOM   3795 N  N     . LYS A 1 502 ? -13.284 -13.175 -27.393 1.00   83.42 ? 502  LYS A N     1 
ATOM   3796 C  CA    . LYS A 1 502 ? -13.207 -12.055 -28.323 1.00   84.20 ? 502  LYS A CA    1 
ATOM   3797 C  C     . LYS A 1 502 ? -12.383 -12.475 -29.552 1.00   84.43 ? 502  LYS A C     1 
ATOM   3798 O  O     . LYS A 1 502 ? -12.450 -11.837 -30.604 1.00   82.87 ? 502  LYS A O     1 
ATOM   3799 C  CB    . LYS A 1 502 ? -12.569 -10.851 -27.621 1.00   85.69 ? 502  LYS A CB    1 
ATOM   3800 C  CG    . LYS A 1 502 ? -12.897 -9.483  -28.209 1.00   92.31 ? 502  LYS A CG    1 
ATOM   3801 C  CD    . LYS A 1 502 ? -12.610 -8.386  -27.177 1.00   96.28 ? 502  LYS A CD    1 
ATOM   3802 C  CE    . LYS A 1 502 ? -13.039 -7.001  -27.656 1.00   97.77 ? 502  LYS A CE    1 
ATOM   3803 N  NZ    . LYS A 1 502 ? -12.327 -6.573  -28.893 1.00   98.39 ? 502  LYS A NZ    1 
ATOM   3804 N  N     . GLU A 1 503 ? -11.607 -13.545 -29.405 1.00   84.52 ? 503  GLU A N     1 
ATOM   3805 C  CA    . GLU A 1 503 ? -10.796 -14.074 -30.503 1.00   84.70 ? 503  GLU A CA    1 
ATOM   3806 C  C     . GLU A 1 503 ? -11.440 -15.378 -30.967 1.00   82.90 ? 503  GLU A C     1 
ATOM   3807 O  O     . GLU A 1 503 ? -10.934 -16.056 -31.859 1.00   82.35 ? 503  GLU A O     1 
ATOM   3808 C  CB    . GLU A 1 503 ? -9.357  -14.342 -30.047 1.00   88.51 ? 503  GLU A CB    1 
ATOM   3809 C  CG    . GLU A 1 503 ? -8.541  -13.098 -29.728 1.00   95.61 ? 503  GLU A CG    1 
ATOM   3810 C  CD    . GLU A 1 503 ? -8.278  -12.222 -30.943 1.00   98.53 ? 503  GLU A CD    1 
ATOM   3811 O  OE1   . GLU A 1 503 ? -7.614  -12.689 -31.902 1.00   99.33 ? 503  GLU A OE1   1 
ATOM   3812 O  OE2   . GLU A 1 503 ? -8.739  -11.058 -30.928 1.00   99.32 ? 503  GLU A OE2   1 
ATOM   3813 N  N     . GLY A 1 504 ? -12.563 -15.717 -30.333 1.00   80.67 ? 504  GLY A N     1 
ATOM   3814 C  CA    . GLY A 1 504 ? -13.311 -16.912 -30.676 1.00   75.78 ? 504  GLY A CA    1 
ATOM   3815 C  C     . GLY A 1 504 ? -12.678 -18.265 -30.406 1.00   72.75 ? 504  GLY A C     1 
ATOM   3816 O  O     . GLY A 1 504 ? -12.879 -19.203 -31.176 1.00   71.24 ? 504  GLY A O     1 
ATOM   3817 N  N     . ILE A 1 505 ? -11.926 -18.384 -29.314 1.00   69.82 ? 505  ILE A N     1 
ATOM   3818 C  CA    . ILE A 1 505 ? -11.288 -19.649 -28.976 1.00   69.26 ? 505  ILE A CA    1 
ATOM   3819 C  C     . ILE A 1 505 ? -11.689 -20.116 -27.587 1.00   69.07 ? 505  ILE A C     1 
ATOM   3820 O  O     . ILE A 1 505 ? -12.433 -19.432 -26.884 1.00   70.30 ? 505  ILE A O     1 
ATOM   3821 C  CB    . ILE A 1 505 ? -9.763  -19.520 -29.017 1.00   68.61 ? 505  ILE A CB    1 
ATOM   3822 C  CG1   . ILE A 1 505 ? -9.273  -18.768 -27.771 1.00   67.28 ? 505  ILE A CG1   1 
ATOM   3823 C  CG2   . ILE A 1 505 ? -9.353  -18.785 -30.285 1.00   66.87 ? 505  ILE A CG2   1 
ATOM   3824 C  CD1   . ILE A 1 505 ? -7.764  -18.671 -27.640 1.00   67.04 ? 505  ILE A CD1   1 
ATOM   3825 N  N     . ALA A 1 506 ? -11.189 -21.276 -27.186 1.00   69.46 ? 506  ALA A N     1 
ATOM   3826 C  CA    . ALA A 1 506 ? -11.512 -21.800 -25.873 1.00   70.44 ? 506  ALA A CA    1 
ATOM   3827 C  C     . ALA A 1 506 ? -10.431 -22.723 -25.332 1.00   72.14 ? 506  ALA A C     1 
ATOM   3828 O  O     . ALA A 1 506 ? -10.069 -23.712 -25.969 1.00   72.10 ? 506  ALA A O     1 
ATOM   3829 C  CB    . ALA A 1 506 ? -12.828 -22.531 -25.923 1.00   68.07 ? 506  ALA A CB    1 
ATOM   3830 N  N     . TRP A 1 507 ? -9.918  -22.398 -24.152 1.00   76.50 ? 507  TRP A N     1 
ATOM   3831 C  CA    . TRP A 1 507 ? -8.898  -23.226 -23.533 1.00   80.25 ? 507  TRP A CA    1 
ATOM   3832 C  C     . TRP A 1 507 ? -9.521  -24.091 -22.452 1.00   83.01 ? 507  TRP A C     1 
ATOM   3833 O  O     . TRP A 1 507 ? -9.444  -23.785 -21.263 1.00   85.95 ? 507  TRP A O     1 
ATOM   3834 C  CB    . TRP A 1 507 ? -7.786  -22.359 -22.948 1.00   79.27 ? 507  TRP A CB    1 
ATOM   3835 C  CG    . TRP A 1 507 ? -6.827  -21.874 -23.983 1.00   77.59 ? 507  TRP A CG    1 
ATOM   3836 C  CD1   . TRP A 1 507 ? -6.839  -20.667 -24.621 1.00   76.89 ? 507  TRP A CD1   1 
ATOM   3837 C  CD2   . TRP A 1 507 ? -5.718  -22.599 -24.523 1.00   76.83 ? 507  TRP A CD2   1 
ATOM   3838 N  NE1   . TRP A 1 507 ? -5.803  -20.595 -25.523 1.00   76.34 ? 507  TRP A NE1   1 
ATOM   3839 C  CE2   . TRP A 1 507 ? -5.103  -21.771 -25.485 1.00   76.58 ? 507  TRP A CE2   1 
ATOM   3840 C  CE3   . TRP A 1 507 ? -5.191  -23.877 -24.288 1.00   76.68 ? 507  TRP A CE3   1 
ATOM   3841 C  CZ2   . TRP A 1 507 ? -3.980  -22.174 -26.210 1.00   76.40 ? 507  TRP A CZ2   1 
ATOM   3842 C  CZ3   . TRP A 1 507 ? -4.076  -24.279 -25.012 1.00   76.50 ? 507  TRP A CZ3   1 
ATOM   3843 C  CH2   . TRP A 1 507 ? -3.482  -23.431 -25.962 1.00   76.48 ? 507  TRP A CH2   1 
ATOM   3844 N  N     . GLU A 1 508 ? -10.141 -25.183 -22.892 1.00   88.79 ? 508  GLU A N     1 
ATOM   3845 C  CA    . GLU A 1 508 ? -10.812 -26.128 -22.004 1.00   92.96 ? 508  GLU A CA    1 
ATOM   3846 C  C     . GLU A 1 508 ? -10.076 -26.446 -20.703 1.00   93.89 ? 508  GLU A C     1 
ATOM   3847 O  O     . GLU A 1 508 ? -10.622 -26.253 -19.616 1.00   98.05 ? 508  GLU A O     1 
ATOM   3848 C  CB    . GLU A 1 508 ? -11.101 -27.422 -22.757 1.00   96.02 ? 508  GLU A CB    1 
ATOM   3849 N  N     . PHE A 1 509 ? -8.844  -26.934 -20.810 1.00   94.86 ? 509  PHE A N     1 
ATOM   3850 C  CA    . PHE A 1 509 ? -8.074  -27.289 -19.622 1.00   94.90 ? 509  PHE A CA    1 
ATOM   3851 C  C     . PHE A 1 509 ? -6.769  -26.503 -19.514 1.00   93.80 ? 509  PHE A C     1 
ATOM   3852 O  O     . PHE A 1 509 ? -5.961  -26.493 -20.445 1.00   97.22 ? 509  PHE A O     1 
ATOM   3853 C  CB    . PHE A 1 509 ? -7.788  -28.788 -19.628 1.00   93.68 ? 509  PHE A CB    1 
ATOM   3854 N  N     . ILE A 1 510 ? -6.570  -25.851 -18.372 1.00   91.94 ? 510  ILE A N     1 
ATOM   3855 C  CA    . ILE A 1 510 ? -5.362  -25.063 -18.132 1.00   92.92 ? 510  ILE A CA    1 
ATOM   3856 C  C     . ILE A 1 510 ? -4.611  -25.534 -16.886 1.00   92.95 ? 510  ILE A C     1 
ATOM   3857 O  O     . ILE A 1 510 ? -4.920  -26.587 -16.320 1.00   93.32 ? 510  ILE A O     1 
ATOM   3858 C  CB    . ILE A 1 510 ? -5.703  -23.564 -17.971 1.00   91.04 ? 510  ILE A CB    1 
ATOM   3859 C  CG1   . ILE A 1 510 ? -7.167  -23.411 -17.547 1.00   87.85 ? 510  ILE A CG1   1 
ATOM   3860 C  CG2   . ILE A 1 510 ? -5.418  -22.812 -19.265 1.00   87.93 ? 510  ILE A CG2   1 
ATOM   3861 C  CD1   . ILE A 1 510 ? -7.460  -23.885 -16.137 1.00   85.38 ? 510  ILE A CD1   1 
ATOM   3862 N  N     . ASP A 1 511 ? -3.624  -24.747 -16.464 1.00   92.47 ? 511  ASP A N     1 
ATOM   3863 C  CA    . ASP A 1 511 ? -2.816  -25.053 -15.285 1.00   91.93 ? 511  ASP A CA    1 
ATOM   3864 C  C     . ASP A 1 511 ? -2.005  -23.802 -14.972 1.00   90.49 ? 511  ASP A C     1 
ATOM   3865 O  O     . ASP A 1 511 ? -0.908  -23.619 -15.502 1.00   90.08 ? 511  ASP A O     1 
ATOM   3866 C  CB    . ASP A 1 511 ? -1.887  -26.231 -15.580 1.00   88.81 ? 511  ASP A CB    1 
ATOM   3867 N  N     . PHE A 1 512 ? -2.533  -22.940 -14.103 1.00   88.88 ? 512  PHE A N     1 
ATOM   3868 C  CA    . PHE A 1 512 ? -1.834  -21.693 -13.800 1.00   89.89 ? 512  PHE A CA    1 
ATOM   3869 C  C     . PHE A 1 512 ? -1.394  -21.376 -12.361 1.00   88.10 ? 512  PHE A C     1 
ATOM   3870 O  O     . PHE A 1 512 ? -0.364  -20.722 -12.176 1.00   88.75 ? 512  PHE A O     1 
ATOM   3871 C  CB    . PHE A 1 512 ? -2.655  -20.511 -14.348 1.00   94.08 ? 512  PHE A CB    1 
ATOM   3872 C  CG    . PHE A 1 512 ? -3.980  -20.310 -13.663 1.00   97.44 ? 512  PHE A CG    1 
ATOM   3873 C  CD1   . PHE A 1 512 ? -4.068  -19.559 -12.489 1.00   98.22 ? 512  PHE A CD1   1 
ATOM   3874 C  CD2   . PHE A 1 512 ? -5.132  -20.922 -14.155 1.00   98.49 ? 512  PHE A CD2   1 
ATOM   3875 C  CE1   . PHE A 1 512 ? -5.287  -19.404 -11.824 1.00   98.14 ? 512  PHE A CE1   1 
ATOM   3876 C  CE2   . PHE A 1 512 ? -6.365  -20.775 -13.495 1.00   98.57 ? 512  PHE A CE2   1 
ATOM   3877 C  CZ    . PHE A 1 512 ? -6.438  -20.023 -12.322 1.00   98.41 ? 512  PHE A CZ    1 
ATOM   3878 N  N     . GLY A 1 513 ? -2.141  -21.821 -11.350 1.00   85.02 ? 513  GLY A N     1 
ATOM   3879 C  CA    . GLY A 1 513 ? -1.759  -21.475 -9.992  1.00   78.15 ? 513  GLY A CA    1 
ATOM   3880 C  C     . GLY A 1 513 ? -1.529  -22.526 -8.915  1.00   76.11 ? 513  GLY A C     1 
ATOM   3881 O  O     . GLY A 1 513 ? -2.092  -22.415 -7.827  1.00   69.73 ? 513  GLY A O     1 
ATOM   3882 N  N     . MET A 1 514 ? -0.697  -23.528 -9.187  1.00   74.48 ? 514  MET A N     1 
ATOM   3883 C  CA    . MET A 1 514 ? -0.408  -24.562 -8.186  1.00   73.42 ? 514  MET A CA    1 
ATOM   3884 C  C     . MET A 1 514 ? 0.748   -24.169 -7.247  1.00   70.95 ? 514  MET A C     1 
ATOM   3885 O  O     . MET A 1 514 ? 0.696   -24.439 -6.052  1.00   67.13 ? 514  MET A O     1 
ATOM   3886 C  CB    . MET A 1 514 ? -0.096  -25.897 -8.878  1.00   78.57 ? 514  MET A CB    1 
ATOM   3887 C  CG    . MET A 1 514 ? -1.316  -26.547 -9.527  1.00   90.89 ? 514  MET A CG    1 
ATOM   3888 S  SD    . MET A 1 514 ? -0.951  -27.946 -10.648 1.00   97.34 ? 514  MET A SD    1 
ATOM   3889 C  CE    . MET A 1 514 ? -0.905  -27.104 -12.265 1.00   98.93 ? 514  MET A CE    1 
ATOM   3890 N  N     . ASP A 1 515 ? 1.782   -23.531 -7.802  1.00   67.79 ? 515  ASP A N     1 
ATOM   3891 C  CA    . ASP A 1 515 ? 2.938   -23.095 -7.022  1.00   63.78 ? 515  ASP A CA    1 
ATOM   3892 C  C     . ASP A 1 515 ? 2.573   -21.994 -6.039  1.00   61.66 ? 515  ASP A C     1 
ATOM   3893 O  O     . ASP A 1 515 ? 3.074   -21.964 -4.916  1.00   60.11 ? 515  ASP A O     1 
ATOM   3894 C  CB    . ASP A 1 515 ? 4.030   -22.587 -7.952  1.00   65.29 ? 515  ASP A CB    1 
ATOM   3895 C  CG    . ASP A 1 515 ? 4.558   -23.668 -8.854  1.00   68.43 ? 515  ASP A CG    1 
ATOM   3896 O  OD1   . ASP A 1 515 ? 3.744   -24.526 -9.246  1.00   70.33 ? 515  ASP A OD1   1 
ATOM   3897 O  OD2   . ASP A 1 515 ? 5.770   -23.654 -9.178  1.00   70.33 ? 515  ASP A OD2   1 
ATOM   3898 N  N     . LEU A 1 516 ? 1.705   -21.091 -6.463  1.00   59.73 ? 516  LEU A N     1 
ATOM   3899 C  CA    . LEU A 1 516 ? 1.287   -20.004 -5.599  1.00   57.45 ? 516  LEU A CA    1 
ATOM   3900 C  C     . LEU A 1 516 ? 0.538   -20.584 -4.407  1.00   55.86 ? 516  LEU A C     1 
ATOM   3901 O  O     . LEU A 1 516 ? 0.823   -20.240 -3.257  1.00   54.17 ? 516  LEU A O     1 
ATOM   3902 C  CB    . LEU A 1 516 ? 0.396   -19.049 -6.372  1.00   58.91 ? 516  LEU A CB    1 
ATOM   3903 C  CG    . LEU A 1 516 ? -0.142  -17.772 -5.729  1.00   62.51 ? 516  LEU A CG    1 
ATOM   3904 C  CD1   . LEU A 1 516 ? 0.838   -17.178 -4.716  1.00   63.60 ? 516  LEU A CD1   1 
ATOM   3905 C  CD2   . LEU A 1 516 ? -0.420  -16.786 -6.859  1.00   63.38 ? 516  LEU A CD2   1 
ATOM   3906 N  N     . GLN A 1 517 ? -0.408  -21.467 -4.686  1.00   54.39 ? 517  GLN A N     1 
ATOM   3907 C  CA    . GLN A 1 517 ? -1.189  -22.093 -3.623  1.00   52.95 ? 517  GLN A CA    1 
ATOM   3908 C  C     . GLN A 1 517 ? -0.287  -22.961 -2.762  1.00   52.89 ? 517  GLN A C     1 
ATOM   3909 O  O     . GLN A 1 517 ? -0.480  -23.066 -1.548  1.00   52.96 ? 517  GLN A O     1 
ATOM   3910 C  CB    . GLN A 1 517 ? -2.322  -22.945 -4.208  1.00   52.39 ? 517  GLN A CB    1 
ATOM   3911 C  CG    . GLN A 1 517 ? -3.729  -22.592 -3.675  1.00   52.92 ? 517  GLN A CG    1 
ATOM   3912 C  CD    . GLN A 1 517 ? -3.868  -22.776 -2.174  1.00   51.84 ? 517  GLN A CD    1 
ATOM   3913 O  OE1   . GLN A 1 517 ? -3.140  -22.195 -1.392  1.00   52.50 ? 517  GLN A OE1   1 
ATOM   3914 N  NE2   . GLN A 1 517 ? -4.813  -23.584 -1.773  1.00   53.83 ? 517  GLN A NE2   1 
ATOM   3915 N  N     . MET A 1 518 ? 0.703   -23.572 -3.397  1.00   53.49 ? 518  MET A N     1 
ATOM   3916 C  CA    . MET A 1 518 ? 1.654   -24.437 -2.722  1.00   53.96 ? 518  MET A CA    1 
ATOM   3917 C  C     . MET A 1 518 ? 2.487   -23.658 -1.694  1.00   53.74 ? 518  MET A C     1 
ATOM   3918 O  O     . MET A 1 518 ? 2.724   -24.147 -0.586  1.00   52.30 ? 518  MET A O     1 
ATOM   3919 C  CB    . MET A 1 518 ? 2.565   -25.092 -3.754  1.00   57.75 ? 518  MET A CB    1 
ATOM   3920 C  CG    . MET A 1 518 ? 3.391   -26.249 -3.229  1.00   65.75 ? 518  MET A CG    1 
ATOM   3921 S  SD    . MET A 1 518 ? 4.263   -27.139 -4.561  1.00   70.74 ? 518  MET A SD    1 
ATOM   3922 C  CE    . MET A 1 518 ? 5.992   -26.774 -4.068  1.00   71.56 ? 518  MET A CE    1 
ATOM   3923 N  N     . CYS A 1 519 ? 2.932   -22.466 -2.053  1.00   51.25 ? 519  CYS A N     1 
ATOM   3924 C  CA    . CYS A 1 519 ? 3.708   -21.639 -1.139  1.00   47.38 ? 519  CYS A CA    1 
ATOM   3925 C  C     . CYS A 1 519 ? 2.796   -21.175 0.015   1.00   44.07 ? 519  CYS A C     1 
ATOM   3926 O  O     . CYS A 1 519 ? 3.219   -21.115 1.166   1.00   41.93 ? 519  CYS A O     1 
ATOM   3927 C  CB    . CYS A 1 519 ? 4.296   -20.443 -1.910  1.00   46.97 ? 519  CYS A CB    1 
ATOM   3928 S  SG    . CYS A 1 519 ? 4.610   -18.989 -0.915  1.00   52.52 ? 519  CYS A SG    1 
ATOM   3929 N  N     . ILE A 1 520 ? 1.546   -20.859 -0.309  1.00   42.35 ? 520  ILE A N     1 
ATOM   3930 C  CA    . ILE A 1 520 ? 0.562   -20.426 0.691   1.00   42.49 ? 520  ILE A CA    1 
ATOM   3931 C  C     . ILE A 1 520 ? 0.246   -21.541 1.690   1.00   44.00 ? 520  ILE A C     1 
ATOM   3932 O  O     . ILE A 1 520 ? 0.104   -21.288 2.886   1.00   44.95 ? 520  ILE A O     1 
ATOM   3933 C  CB    . ILE A 1 520 ? -0.769  -20.019 0.016   1.00   39.52 ? 520  ILE A CB    1 
ATOM   3934 C  CG1   . ILE A 1 520 ? -0.611  -18.666 -0.693  1.00   38.73 ? 520  ILE A CG1   1 
ATOM   3935 C  CG2   . ILE A 1 520 ? -1.873  -19.977 1.036   1.00   37.84 ? 520  ILE A CG2   1 
ATOM   3936 C  CD1   . ILE A 1 520 ? -1.736  -18.398 -1.699  1.00   35.26 ? 520  ILE A CD1   1 
ATOM   3937 N  N     . ASP A 1 521 ? 0.127   -22.766 1.191   1.00   47.63 ? 521  ASP A N     1 
ATOM   3938 C  CA    . ASP A 1 521 ? -0.201  -23.911 2.025   1.00   50.22 ? 521  ASP A CA    1 
ATOM   3939 C  C     . ASP A 1 521 ? 0.947   -24.238 2.977   1.00   49.97 ? 521  ASP A C     1 
ATOM   3940 O  O     . ASP A 1 521 ? 0.727   -24.601 4.132   1.00   49.87 ? 521  ASP A O     1 
ATOM   3941 C  CB    . ASP A 1 521 ? -0.543  -25.111 1.132   1.00   54.16 ? 521  ASP A CB    1 
ATOM   3942 C  CG    . ASP A 1 521 ? -1.874  -24.932 0.380   1.00   59.33 ? 521  ASP A CG    1 
ATOM   3943 O  OD1   . ASP A 1 521 ? -2.071  -25.536 -0.703  1.00   62.84 ? 521  ASP A OD1   1 
ATOM   3944 O  OD2   . ASP A 1 521 ? -2.745  -24.195 0.883   1.00   62.54 ? 521  ASP A OD2   1 
ATOM   3945 N  N     . LEU A 1 522 ? 2.167   -24.093 2.487   1.00   49.47 ? 522  LEU A N     1 
ATOM   3946 C  CA    . LEU A 1 522 ? 3.366   -24.348 3.266   1.00   48.87 ? 522  LEU A CA    1 
ATOM   3947 C  C     . LEU A 1 522 ? 3.363   -23.434 4.486   1.00   49.45 ? 522  LEU A C     1 
ATOM   3948 O  O     . LEU A 1 522 ? 3.904   -23.773 5.543   1.00   51.11 ? 522  LEU A O     1 
ATOM   3949 C  CB    . LEU A 1 522 ? 4.583   -24.032 2.416   1.00   47.59 ? 522  LEU A CB    1 
ATOM   3950 C  CG    . LEU A 1 522 ? 5.933   -24.706 2.646   1.00   48.41 ? 522  LEU A CG    1 
ATOM   3951 C  CD1   . LEU A 1 522 ? 7.004   -23.713 2.168   1.00   47.06 ? 522  LEU A CD1   1 
ATOM   3952 C  CD2   . LEU A 1 522 ? 6.142   -25.107 4.110   1.00   46.11 ? 522  LEU A CD2   1 
ATOM   3953 N  N     . ILE A 1 523 ? 2.752   -22.270 4.334   1.00   49.11 ? 523  ILE A N     1 
ATOM   3954 C  CA    . ILE A 1 523 ? 2.703   -21.282 5.398   1.00   50.50 ? 523  ILE A CA    1 
ATOM   3955 C  C     . ILE A 1 523 ? 1.489   -21.367 6.312   1.00   51.02 ? 523  ILE A C     1 
ATOM   3956 O  O     . ILE A 1 523 ? 1.637   -21.303 7.522   1.00   49.87 ? 523  ILE A O     1 
ATOM   3957 C  CB    . ILE A 1 523 ? 2.737   -19.833 4.820   1.00   49.07 ? 523  ILE A CB    1 
ATOM   3958 C  CG1   . ILE A 1 523 ? 3.988   -19.620 3.962   1.00   49.00 ? 523  ILE A CG1   1 
ATOM   3959 C  CG2   . ILE A 1 523 ? 2.650   -18.812 5.962   1.00   47.09 ? 523  ILE A CG2   1 
ATOM   3960 C  CD1   . ILE A 1 523 ? 5.294   -19.651 4.728   1.00   48.62 ? 523  ILE A CD1   1 
ATOM   3961 N  N     . GLU A 1 524 ? 0.294   -21.491 5.743   1.00   52.47 ? 524  GLU A N     1 
ATOM   3962 C  CA    . GLU A 1 524 ? -0.916  -21.499 6.566   1.00   53.47 ? 524  GLU A CA    1 
ATOM   3963 C  C     . GLU A 1 524 ? -1.631  -22.810 6.920   1.00   55.07 ? 524  GLU A C     1 
ATOM   3964 O  O     . GLU A 1 524 ? -2.488  -22.810 7.802   1.00   53.79 ? 524  GLU A O     1 
ATOM   3965 C  CB    . GLU A 1 524 ? -1.947  -20.522 5.974   1.00   53.13 ? 524  GLU A CB    1 
ATOM   3966 C  CG    . GLU A 1 524 ? -2.425  -20.872 4.569   1.00   56.84 ? 524  GLU A CG    1 
ATOM   3967 C  CD    . GLU A 1 524 ? -3.578  -19.980 4.055   1.00   58.92 ? 524  GLU A CD    1 
ATOM   3968 O  OE1   . GLU A 1 524 ? -3.513  -18.739 4.219   1.00   58.65 ? 524  GLU A OE1   1 
ATOM   3969 O  OE2   . GLU A 1 524 ? -4.543  -20.529 3.462   1.00   60.09 ? 524  GLU A OE2   1 
ATOM   3970 N  N     . LYS A 1 525 ? -1.308  -23.914 6.250   1.00   59.49 ? 525  LYS A N     1 
ATOM   3971 C  CA    . LYS A 1 525 ? -1.950  -25.198 6.547   1.00   64.03 ? 525  LYS A CA    1 
ATOM   3972 C  C     . LYS A 1 525 ? -1.610  -25.669 7.984   1.00   66.09 ? 525  LYS A C     1 
ATOM   3973 O  O     . LYS A 1 525 ? -0.689  -25.141 8.609   1.00   68.17 ? 525  LYS A O     1 
ATOM   3974 C  CB    . LYS A 1 525 ? -1.579  -26.221 5.487   1.00   65.14 ? 525  LYS A CB    1 
ATOM   3975 C  CG    . LYS A 1 525 ? -2.168  -25.910 4.110   1.00   68.08 ? 525  LYS A CG    1 
ATOM   3976 C  CD    . LYS A 1 525 ? -3.688  -26.103 4.053   1.00   70.54 ? 525  LYS A CD    1 
ATOM   3977 C  CE    . LYS A 1 525 ? -4.462  -24.797 4.230   1.00   72.04 ? 525  LYS A CE    1 
ATOM   3978 N  NZ    . LYS A 1 525 ? -4.569  -24.018 2.975   1.00   73.20 ? 525  LYS A NZ    1 
ATOM   3979 N  N     . PRO A 1 526 ? -2.377  -26.703 8.471   1.00   76.14 ? 526  PRO A N     1 
ATOM   3980 C  CA    . PRO A 1 526 ? -2.172  -27.294 9.842   1.00   75.67 ? 526  PRO A CA    1 
ATOM   3981 C  C     . PRO A 1 526 ? -0.846  -28.001 10.152  1.00   75.93 ? 526  PRO A C     1 
ATOM   3982 O  O     . PRO A 1 526 ? -0.732  -28.668 11.185  1.00   79.97 ? 526  PRO A O     1 
ATOM   3983 C  CB    . PRO A 1 526 ? -3.401  -28.215 9.957   1.00   76.34 ? 526  PRO A CB    1 
ATOM   3984 C  CG    . PRO A 1 526 ? -4.348  -27.727 8.904   1.00   76.48 ? 526  PRO A CG    1 
ATOM   3985 C  CD    . PRO A 1 526 ? -3.440  -27.341 7.779   1.00   74.85 ? 526  PRO A CD    1 
ATOM   3986 N  N     . MET A 1 527 ? 0.148   -27.914 9.268   1.00   75.49 ? 527  MET A N     1 
ATOM   3987 C  CA    . MET A 1 527 ? 1.474   -28.492 9.502   1.00   74.09 ? 527  MET A CA    1 
ATOM   3988 C  C     . MET A 1 527 ? 2.409   -27.437 8.872   1.00   69.62 ? 527  MET A C     1 
ATOM   3989 O  O     . MET A 1 527 ? 3.613   -27.634 8.720   1.00   68.39 ? 527  MET A O     1 
ATOM   3990 C  CB    . MET A 1 527 ? 1.625   -29.863 8.809   1.00   80.40 ? 527  MET A CB    1 
ATOM   3991 C  CG    . MET A 1 527 ? 1.819   -29.760 7.308   1.00   87.63 ? 527  MET A CG    1 
ATOM   3992 S  SD    . MET A 1 527 ? 3.087   -30.864 6.674   1.00   93.64 ? 527  MET A SD    1 
ATOM   3993 C  CE    . MET A 1 527 ? 4.664   -30.368 7.357   1.00   96.25 ? 527  MET A CE    1 
ATOM   3994 N  N     . GLY A 1 528 ? 1.803   -26.297 8.532   1.00   65.27 ? 528  GLY A N     1 
ATOM   3995 C  CA    . GLY A 1 528 ? 2.526   -25.193 7.918   1.00   59.95 ? 528  GLY A CA    1 
ATOM   3996 C  C     . GLY A 1 528 ? 3.520   -24.495 8.828   1.00   56.36 ? 528  GLY A C     1 
ATOM   3997 O  O     . GLY A 1 528 ? 3.652   -24.845 9.996   1.00   55.76 ? 528  GLY A O     1 
ATOM   3998 N  N     . ILE A 1 529 ? 4.217   -23.507 8.289   1.00   53.32 ? 529  ILE A N     1 
ATOM   3999 C  CA    . ILE A 1 529 ? 5.202   -22.771 9.056   1.00   51.11 ? 529  ILE A CA    1 
ATOM   4000 C  C     . ILE A 1 529 ? 4.608   -22.007 10.238  1.00   51.14 ? 529  ILE A C     1 
ATOM   4001 O  O     . ILE A 1 529 ? 5.223   -21.942 11.308  1.00   50.04 ? 529  ILE A O     1 
ATOM   4002 C  CB    . ILE A 1 529 ? 5.969   -21.790 8.170   1.00   50.45 ? 529  ILE A CB    1 
ATOM   4003 C  CG1   . ILE A 1 529 ? 6.884   -22.578 7.229   1.00   49.63 ? 529  ILE A CG1   1 
ATOM   4004 C  CG2   . ILE A 1 529 ? 6.754   -20.804 9.031   1.00   48.84 ? 529  ILE A CG2   1 
ATOM   4005 C  CD1   . ILE A 1 529 ? 7.668   -21.713 6.231   1.00   49.49 ? 529  ILE A CD1   1 
ATOM   4006 N  N     . LEU A 1 530 ? 3.419   -21.435 10.054  1.00   50.53 ? 530  LEU A N     1 
ATOM   4007 C  CA    . LEU A 1 530 ? 2.792   -20.673 11.129  1.00   51.52 ? 530  LEU A CA    1 
ATOM   4008 C  C     . LEU A 1 530 ? 2.227   -21.552 12.225  1.00   53.65 ? 530  LEU A C     1 
ATOM   4009 O  O     . LEU A 1 530 ? 2.317   -21.209 13.405  1.00   53.08 ? 530  LEU A O     1 
ATOM   4010 C  CB    . LEU A 1 530 ? 1.682   -19.760 10.590  1.00   49.15 ? 530  LEU A CB    1 
ATOM   4011 C  CG    . LEU A 1 530 ? 2.111   -18.572 9.702   1.00   48.27 ? 530  LEU A CG    1 
ATOM   4012 C  CD1   . LEU A 1 530 ? 0.862   -17.815 9.243   1.00   47.04 ? 530  LEU A CD1   1 
ATOM   4013 C  CD2   . LEU A 1 530 ? 3.052   -17.641 10.439  1.00   45.22 ? 530  LEU A CD2   1 
ATOM   4014 N  N     . SER A 1 531 ? 1.648   -22.684 11.846  1.00   57.35 ? 531  SER A N     1 
ATOM   4015 C  CA    . SER A 1 531 ? 1.064   -23.588 12.829  1.00   59.69 ? 531  SER A CA    1 
ATOM   4016 C  C     . SER A 1 531 ? 2.133   -24.265 13.673  1.00   59.14 ? 531  SER A C     1 
ATOM   4017 O  O     . SER A 1 531 ? 1.925   -24.505 14.859  1.00   58.86 ? 531  SER A O     1 
ATOM   4018 C  CB    . SER A 1 531 ? 0.189   -24.634 12.144  1.00   62.96 ? 531  SER A CB    1 
ATOM   4019 O  OG    . SER A 1 531 ? 0.886   -25.260 11.085  1.00   73.25 ? 531  SER A OG    1 
ATOM   4020 N  N     . ILE A 1 532 ? 3.276   -24.568 13.071  1.00   58.18 ? 532  ILE A N     1 
ATOM   4021 C  CA    . ILE A 1 532 ? 4.361   -25.198 13.818  1.00   56.14 ? 532  ILE A CA    1 
ATOM   4022 C  C     . ILE A 1 532 ? 4.805   -24.194 14.863  1.00   54.70 ? 532  ILE A C     1 
ATOM   4023 O  O     . ILE A 1 532 ? 5.174   -24.559 15.974  1.00   56.60 ? 532  ILE A O     1 
ATOM   4024 C  CB    . ILE A 1 532 ? 5.570   -25.571 12.903  1.00   54.85 ? 532  ILE A CB    1 
ATOM   4025 C  CG1   . ILE A 1 532 ? 5.302   -26.902 12.202  1.00   53.98 ? 532  ILE A CG1   1 
ATOM   4026 C  CG2   . ILE A 1 532 ? 6.854   -25.655 13.719  1.00   53.24 ? 532  ILE A CG2   1 
ATOM   4027 C  CD1   . ILE A 1 532 ? 6.414   -27.342 11.249  1.00   52.62 ? 532  ILE A CD1   1 
ATOM   4028 N  N     . LEU A 1 533 ? 4.759   -22.917 14.500  1.00   53.66 ? 533  LEU A N     1 
ATOM   4029 C  CA    . LEU A 1 533 ? 5.145   -21.852 15.419  1.00   55.39 ? 533  LEU A CA    1 
ATOM   4030 C  C     . LEU A 1 533 ? 4.083   -21.658 16.523  1.00   57.92 ? 533  LEU A C     1 
ATOM   4031 O  O     . LEU A 1 533 ? 4.428   -21.455 17.683  1.00   57.32 ? 533  LEU A O     1 
ATOM   4032 C  CB    . LEU A 1 533 ? 5.349   -20.539 14.657  1.00   51.58 ? 533  LEU A CB    1 
ATOM   4033 C  CG    . LEU A 1 533 ? 5.773   -19.288 15.433  1.00   47.84 ? 533  LEU A CG    1 
ATOM   4034 C  CD1   . LEU A 1 533 ? 7.160   -19.486 16.011  1.00   45.70 ? 533  LEU A CD1   1 
ATOM   4035 C  CD2   . LEU A 1 533 ? 5.778   -18.084 14.500  1.00   44.42 ? 533  LEU A CD2   1 
ATOM   4036 N  N     . GLU A 1 534 ? 2.805   -21.714 16.154  1.00   60.67 ? 534  GLU A N     1 
ATOM   4037 C  CA    . GLU A 1 534 ? 1.729   -21.528 17.121  1.00   62.32 ? 534  GLU A CA    1 
ATOM   4038 C  C     . GLU A 1 534 ? 1.692   -22.639 18.173  1.00   62.62 ? 534  GLU A C     1 
ATOM   4039 O  O     . GLU A 1 534 ? 1.361   -22.386 19.323  1.00   60.99 ? 534  GLU A O     1 
ATOM   4040 C  CB    . GLU A 1 534 ? 0.374   -21.457 16.411  1.00   63.58 ? 534  GLU A CB    1 
ATOM   4041 C  CG    . GLU A 1 534 ? -0.014  -20.075 15.922  1.00   68.95 ? 534  GLU A CG    1 
ATOM   4042 C  CD    . GLU A 1 534 ? -1.112  -20.116 14.871  1.00   71.93 ? 534  GLU A CD    1 
ATOM   4043 O  OE1   . GLU A 1 534 ? -2.070  -20.903 15.024  1.00   73.96 ? 534  GLU A OE1   1 
ATOM   4044 O  OE2   . GLU A 1 534 ? -1.025  -19.355 13.887  1.00   72.93 ? 534  GLU A OE2   1 
ATOM   4045 N  N     . GLU A 1 535 ? 2.026   -23.862 17.774  1.00   62.52 ? 535  GLU A N     1 
ATOM   4046 C  CA    . GLU A 1 535 ? 2.011   -24.978 18.709  1.00   64.29 ? 535  GLU A CA    1 
ATOM   4047 C  C     . GLU A 1 535 ? 3.208   -24.852 19.632  1.00   67.22 ? 535  GLU A C     1 
ATOM   4048 O  O     . GLU A 1 535 ? 3.106   -25.080 20.832  1.00   67.77 ? 535  GLU A O     1 
ATOM   4049 C  CB    . GLU A 1 535 ? 2.058   -26.302 17.962  1.00   63.16 ? 535  GLU A CB    1 
ATOM   4050 N  N     . GLU A 1 536 ? 4.336   -24.463 19.062  1.00   71.78 ? 536  GLU A N     1 
ATOM   4051 C  CA    . GLU A 1 536 ? 5.561   -24.310 19.818  1.00   74.90 ? 536  GLU A CA    1 
ATOM   4052 C  C     . GLU A 1 536 ? 5.523   -23.155 20.826  1.00   75.93 ? 536  GLU A C     1 
ATOM   4053 O  O     . GLU A 1 536 ? 6.157   -23.229 21.880  1.00   75.77 ? 536  GLU A O     1 
ATOM   4054 C  CB    . GLU A 1 536 ? 6.727   -24.105 18.855  1.00   77.05 ? 536  GLU A CB    1 
ATOM   4055 C  CG    . GLU A 1 536 ? 8.072   -24.359 19.477  1.00   82.08 ? 536  GLU A CG    1 
ATOM   4056 C  CD    . GLU A 1 536 ? 8.365   -25.835 19.605  1.00   84.08 ? 536  GLU A CD    1 
ATOM   4057 O  OE1   . GLU A 1 536 ? 7.425   -26.612 19.890  1.00   85.01 ? 536  GLU A OE1   1 
ATOM   4058 O  OE2   . GLU A 1 536 ? 9.541   -26.212 19.427  1.00   84.82 ? 536  GLU A OE2   1 
ATOM   4059 N  N     . CYS A 1 537 ? 4.794   -22.092 20.508  1.00   76.93 ? 537  CYS A N     1 
ATOM   4060 C  CA    . CYS A 1 537 ? 4.711   -20.928 21.401  1.00   78.08 ? 537  CYS A CA    1 
ATOM   4061 C  C     . CYS A 1 537 ? 3.945   -21.189 22.701  1.00   78.72 ? 537  CYS A C     1 
ATOM   4062 O  O     . CYS A 1 537 ? 4.003   -20.384 23.629  1.00   78.29 ? 537  CYS A O     1 
ATOM   4063 C  CB    . CYS A 1 537 ? 4.082   -19.730 20.663  1.00   77.79 ? 537  CYS A CB    1 
ATOM   4064 S  SG    . CYS A 1 537 ? 5.273   -18.810 19.593  1.00   78.90 ? 537  CYS A SG    1 
ATOM   4065 N  N     . MET A 1 538 ? 3.236   -22.315 22.756  1.00   80.00 ? 538  MET A N     1 
ATOM   4066 C  CA    . MET A 1 538 ? 2.449   -22.680 23.932  1.00   81.96 ? 538  MET A CA    1 
ATOM   4067 C  C     . MET A 1 538 ? 3.144   -23.748 24.780  1.00   80.97 ? 538  MET A C     1 
ATOM   4068 O  O     . MET A 1 538 ? 2.488   -24.557 25.435  1.00   79.61 ? 538  MET A O     1 
ATOM   4069 C  CB    . MET A 1 538 ? 1.061   -23.177 23.498  1.00   86.24 ? 538  MET A CB    1 
ATOM   4070 C  CG    . MET A 1 538 ? 0.243   -22.147 22.737  1.00   92.34 ? 538  MET A CG    1 
ATOM   4071 S  SD    . MET A 1 538 ? -1.467  -22.666 22.490  1.00   97.66 ? 538  MET A SD    1 
ATOM   4072 C  CE    . MET A 1 538 ? -1.252  -23.987 21.297  1.00   98.34 ? 538  MET A CE    1 
ATOM   4073 N  N     . PHE A 1 539 ? 4.473   -23.737 24.765  1.00   78.68 ? 539  PHE A N     1 
ATOM   4074 C  CA    . PHE A 1 539 ? 5.286   -24.680 25.527  1.00   74.11 ? 539  PHE A CA    1 
ATOM   4075 C  C     . PHE A 1 539 ? 6.398   -23.877 26.185  1.00   70.84 ? 539  PHE A C     1 
ATOM   4076 O  O     . PHE A 1 539 ? 7.334   -23.434 25.522  1.00   72.54 ? 539  PHE A O     1 
ATOM   4077 C  CB    . PHE A 1 539 ? 5.894   -25.734 24.597  1.00   73.94 ? 539  PHE A CB    1 
ATOM   4078 C  CG    . PHE A 1 539 ? 4.894   -26.718 24.040  1.00   72.64 ? 539  PHE A CG    1 
ATOM   4079 C  CD1   . PHE A 1 539 ? 4.263   -27.639 24.868  1.00   72.38 ? 539  PHE A CD1   1 
ATOM   4080 C  CD2   . PHE A 1 539 ? 4.593   -26.731 22.687  1.00   72.58 ? 539  PHE A CD2   1 
ATOM   4081 C  CE1   . PHE A 1 539 ? 3.350   -28.563 24.350  1.00   72.66 ? 539  PHE A CE1   1 
ATOM   4082 C  CE2   . PHE A 1 539 ? 3.677   -27.655 22.159  1.00   72.63 ? 539  PHE A CE2   1 
ATOM   4083 C  CZ    . PHE A 1 539 ? 3.057   -28.568 22.992  1.00   72.46 ? 539  PHE A CZ    1 
ATOM   4084 N  N     . PRO A 1 540 ? 6.314   -23.680 27.510  1.00   74.34 ? 540  PRO A N     1 
ATOM   4085 C  CA    . PRO A 1 540 ? 7.300   -22.918 28.288  1.00   74.03 ? 540  PRO A CA    1 
ATOM   4086 C  C     . PRO A 1 540 ? 8.779   -23.289 28.134  1.00   75.13 ? 540  PRO A C     1 
ATOM   4087 O  O     . PRO A 1 540 ? 9.652   -22.449 28.351  1.00   80.15 ? 540  PRO A O     1 
ATOM   4088 C  CB    . PRO A 1 540 ? 6.816   -23.101 29.728  1.00   72.91 ? 540  PRO A CB    1 
ATOM   4089 C  CG    . PRO A 1 540 ? 5.338   -23.240 29.566  1.00   70.08 ? 540  PRO A CG    1 
ATOM   4090 C  CD    . PRO A 1 540 ? 5.244   -24.186 28.387  1.00   71.20 ? 540  PRO A CD    1 
ATOM   4091 N  N     . LYS A 1 541 ? 9.069   -24.531 27.760  1.00   79.28 ? 541  LYS A N     1 
ATOM   4092 C  CA    . LYS A 1 541 ? 10.462  -24.968 27.622  1.00   80.76 ? 541  LYS A CA    1 
ATOM   4093 C  C     . LYS A 1 541 ? 11.120  -24.771 26.248  1.00   79.94 ? 541  LYS A C     1 
ATOM   4094 O  O     . LYS A 1 541 ? 12.347  -24.750 26.146  1.00   78.13 ? 541  LYS A O     1 
ATOM   4095 C  CB    . LYS A 1 541 ? 10.573  -26.442 28.044  1.00   84.16 ? 541  LYS A CB    1 
ATOM   4096 N  N     . ALA A 1 542 ? 10.309  -24.629 25.197  1.00   75.47 ? 542  ALA A N     1 
ATOM   4097 C  CA    . ALA A 1 542 ? 10.806  -24.469 23.826  1.00   70.91 ? 542  ALA A CA    1 
ATOM   4098 C  C     . ALA A 1 542 ? 11.664  -23.230 23.570  1.00   69.18 ? 542  ALA A C     1 
ATOM   4099 O  O     . ALA A 1 542 ? 11.575  -22.241 24.300  1.00   64.93 ? 542  ALA A O     1 
ATOM   4100 C  CB    . ALA A 1 542 ? 9.628   -24.486 22.862  1.00   68.94 ? 542  ALA A CB    1 
ATOM   4101 N  N     . ASP A 1 543 ? 12.494  -23.288 22.530  1.00   66.93 ? 543  ASP A N     1 
ATOM   4102 C  CA    . ASP A 1 543 ? 13.353  -22.159 22.169  1.00   65.91 ? 543  ASP A CA    1 
ATOM   4103 C  C     . ASP A 1 543 ? 13.630  -22.115 20.657  1.00   66.48 ? 543  ASP A C     1 
ATOM   4104 O  O     . ASP A 1 543 ? 13.020  -22.869 19.896  1.00   64.53 ? 543  ASP A O     1 
ATOM   4105 C  CB    . ASP A 1 543 ? 14.677  -22.248 22.914  1.00   67.58 ? 543  ASP A CB    1 
ATOM   4106 C  CG    . ASP A 1 543 ? 15.686  -23.069 22.180  1.00   71.10 ? 543  ASP A CG    1 
ATOM   4107 O  OD1   . ASP A 1 543 ? 15.335  -24.201 21.783  1.00   74.10 ? 543  ASP A OD1   1 
ATOM   4108 O  OD2   . ASP A 1 543 ? 16.817  -22.584 21.986  1.00   72.92 ? 543  ASP A OD2   1 
ATOM   4109 N  N     . ASP A 1 544 ? 14.536  -21.244 20.225  1.00   68.87 ? 544  ASP A N     1 
ATOM   4110 C  CA    . ASP A 1 544 ? 14.844  -21.137 18.801  1.00   71.15 ? 544  ASP A CA    1 
ATOM   4111 C  C     . ASP A 1 544 ? 15.128  -22.484 18.144  1.00   72.57 ? 544  ASP A C     1 
ATOM   4112 O  O     . ASP A 1 544 ? 14.414  -22.897 17.229  1.00   75.71 ? 544  ASP A O     1 
ATOM   4113 C  CB    . ASP A 1 544 ? 16.038  -20.210 18.557  1.00   70.49 ? 544  ASP A CB    1 
ATOM   4114 C  CG    . ASP A 1 544 ? 15.743  -18.769 18.916  1.00   71.09 ? 544  ASP A CG    1 
ATOM   4115 O  OD1   . ASP A 1 544 ? 14.553  -18.382 18.896  1.00   71.67 ? 544  ASP A OD1   1 
ATOM   4116 O  OD2   . ASP A 1 544 ? 16.704  -18.018 19.204  1.00   71.68 ? 544  ASP A OD2   1 
ATOM   4117 N  N     . LYS A 1 545 ? 16.170  -23.167 18.609  1.00   75.75 ? 545  LYS A N     1 
ATOM   4118 C  CA    . LYS A 1 545 ? 16.550  -24.461 18.049  1.00   78.92 ? 545  LYS A CA    1 
ATOM   4119 C  C     . LYS A 1 545 ? 15.411  -25.470 18.076  1.00   78.16 ? 545  LYS A C     1 
ATOM   4120 O  O     . LYS A 1 545 ? 15.229  -26.237 17.129  1.00   79.20 ? 545  LYS A O     1 
ATOM   4121 C  CB    . LYS A 1 545 ? 17.761  -25.049 18.790  1.00   84.68 ? 545  LYS A CB    1 
ATOM   4122 C  CG    . LYS A 1 545 ? 18.131  -26.439 18.289  1.00   90.03 ? 545  LYS A CG    1 
ATOM   4123 C  CD    . LYS A 1 545 ? 19.340  -27.027 18.984  1.00   92.09 ? 545  LYS A CD    1 
ATOM   4124 C  CE    . LYS A 1 545 ? 19.654  -28.411 18.409  1.00   92.69 ? 545  LYS A CE    1 
ATOM   4125 N  NZ    . LYS A 1 545 ? 20.831  -29.051 19.061  1.00   92.77 ? 545  LYS A NZ    1 
ATOM   4126 N  N     . SER A 1 546 ? 14.655  -25.475 19.159  1.00   76.09 ? 546  SER A N     1 
ATOM   4127 C  CA    . SER A 1 546 ? 13.537  -26.384 19.307  1.00   70.24 ? 546  SER A CA    1 
ATOM   4128 C  C     . SER A 1 546 ? 12.577  -26.187 18.142  1.00   66.65 ? 546  SER A C     1 
ATOM   4129 O  O     . SER A 1 546 ? 12.039  -27.141 17.620  1.00   67.26 ? 546  SER A O     1 
ATOM   4130 C  CB    . SER A 1 546 ? 12.833  -26.098 20.628  1.00   65.46 ? 546  SER A CB    1 
ATOM   4131 O  OG    . SER A 1 546 ? 11.636  -26.835 20.774  1.00   60.72 ? 546  SER A OG    1 
ATOM   4132 N  N     . PHE A 1 547 ? 12.386  -24.924 17.757  1.00   63.48 ? 547  PHE A N     1 
ATOM   4133 C  CA    . PHE A 1 547 ? 11.490  -24.524 16.669  1.00   65.58 ? 547  PHE A CA    1 
ATOM   4134 C  C     . PHE A 1 547 ? 12.129  -24.840 15.327  1.00   67.21 ? 547  PHE A C     1 
ATOM   4135 O  O     . PHE A 1 547 ? 11.445  -25.214 14.377  1.00   70.36 ? 547  PHE A O     1 
ATOM   4136 C  CB    . PHE A 1 547 ? 11.205  -23.022 16.800  1.00   62.87 ? 547  PHE A CB    1 
ATOM   4137 C  CG    . PHE A 1 547 ? 10.496  -22.425 15.629  1.00   55.27 ? 547  PHE A CG    1 
ATOM   4138 C  CD1   . PHE A 1 547 ? 9.290   -22.942 15.190  1.00   51.97 ? 547  PHE A CD1   1 
ATOM   4139 C  CD2   . PHE A 1 547 ? 11.010  -21.314 14.981  1.00   51.84 ? 547  PHE A CD2   1 
ATOM   4140 C  CE1   . PHE A 1 547 ? 8.612   -22.356 14.116  1.00   49.76 ? 547  PHE A CE1   1 
ATOM   4141 C  CE2   . PHE A 1 547 ? 10.359  -20.722 13.913  1.00   49.28 ? 547  PHE A CE2   1 
ATOM   4142 C  CZ    . PHE A 1 547 ? 9.149   -21.246 13.481  1.00   48.88 ? 547  PHE A CZ    1 
ATOM   4143 N  N     . GLN A 1 548 ? 13.441  -24.691 15.265  1.00   68.12 ? 548  GLN A N     1 
ATOM   4144 C  CA    . GLN A 1 548 ? 14.165  -24.964 14.048  1.00   66.92 ? 548  GLN A CA    1 
ATOM   4145 C  C     . GLN A 1 548 ? 14.077  -26.437 13.659  1.00   66.87 ? 548  GLN A C     1 
ATOM   4146 O  O     . GLN A 1 548 ? 14.108  -26.780 12.474  1.00   61.69 ? 548  GLN A O     1 
ATOM   4147 C  CB    . GLN A 1 548 ? 15.625  -24.577 14.213  1.00   65.96 ? 548  GLN A CB    1 
ATOM   4148 C  CG    . GLN A 1 548 ? 16.317  -24.370 12.895  1.00   68.47 ? 548  GLN A CG    1 
ATOM   4149 C  CD    . GLN A 1 548 ? 17.806  -24.258 13.036  1.00   70.42 ? 548  GLN A CD    1 
ATOM   4150 O  OE1   . GLN A 1 548 ? 18.308  -23.420 13.776  1.00   72.19 ? 548  GLN A OE1   1 
ATOM   4151 N  NE2   . GLN A 1 548 ? 18.529  -25.107 12.319  1.00   72.59 ? 548  GLN A NE2   1 
ATOM   4152 N  N     . ASP A 1 549 ? 13.957  -27.310 14.653  1.00   64.69 ? 549  ASP A N     1 
ATOM   4153 C  CA    . ASP A 1 549 ? 13.897  -28.739 14.406  1.00   63.23 ? 549  ASP A CA    1 
ATOM   4154 C  C     . ASP A 1 549 ? 12.557  -29.223 13.903  1.00   61.68 ? 549  ASP A C     1 
ATOM   4155 O  O     . ASP A 1 549 ? 12.494  -30.138 13.075  1.00   60.70 ? 549  ASP A O     1 
ATOM   4156 C  CB    . ASP A 1 549 ? 14.302  -29.494 15.669  1.00   68.87 ? 549  ASP A CB    1 
ATOM   4157 C  CG    . ASP A 1 549 ? 15.707  -29.151 16.096  1.00   77.30 ? 549  ASP A CG    1 
ATOM   4158 O  OD1   . ASP A 1 549 ? 16.464  -28.670 15.220  1.00   81.73 ? 549  ASP A OD1   1 
ATOM   4159 O  OD2   . ASP A 1 549 ? 16.065  -29.359 17.280  1.00   81.71 ? 549  ASP A OD2   1 
ATOM   4160 N  N     . LYS A 1 550 ? 11.483  -28.633 14.381  1.00   59.02 ? 550  LYS A N     1 
ATOM   4161 C  CA    . LYS A 1 550 ? 10.169  -29.041 13.919  1.00   56.45 ? 550  LYS A CA    1 
ATOM   4162 C  C     . LYS A 1 550 ? 9.978   -28.542 12.485  1.00   55.14 ? 550  LYS A C     1 
ATOM   4163 O  O     . LYS A 1 550 ? 9.460   -29.270 11.638  1.00   54.45 ? 550  LYS A O     1 
ATOM   4164 C  CB    . LYS A 1 550 ? 9.065   -28.506 14.830  1.00   55.15 ? 550  LYS A CB    1 
ATOM   4165 C  CG    . LYS A 1 550 ? 8.858   -29.342 16.083  1.00   56.21 ? 550  LYS A CG    1 
ATOM   4166 C  CD    . LYS A 1 550 ? 8.253   -30.689 15.743  0.0000 56.66 ? 550  LYS A CD    1 
ATOM   4167 C  CE    . LYS A 1 550 ? 6.881   -30.530 15.103  0.0000 57.01 ? 550  LYS A CE    1 
ATOM   4168 N  NZ    . LYS A 1 550 ? 6.274   -31.842 14.747  0.0000 57.16 ? 550  LYS A NZ    1 
ATOM   4169 N  N     . LEU A 1 551 ? 10.398  -27.308 12.219  1.00   53.92 ? 551  LEU A N     1 
ATOM   4170 C  CA    . LEU A 1 551 ? 10.279  -26.765 10.875  1.00   54.55 ? 551  LEU A CA    1 
ATOM   4171 C  C     . LEU A 1 551 ? 11.059  -27.638 9.911   1.00   55.89 ? 551  LEU A C     1 
ATOM   4172 O  O     . LEU A 1 551 ? 10.577  -27.961 8.823   1.00   54.75 ? 551  LEU A O     1 
ATOM   4173 C  CB    . LEU A 1 551 ? 10.825  -25.339 10.802  1.00   53.94 ? 551  LEU A CB    1 
ATOM   4174 C  CG    . LEU A 1 551 ? 9.888   -24.195 11.179  1.00   53.73 ? 551  LEU A CG    1 
ATOM   4175 C  CD1   . LEU A 1 551 ? 10.624  -22.905 10.935  1.00   52.78 ? 551  LEU A CD1   1 
ATOM   4176 C  CD2   . LEU A 1 551 ? 8.615   -24.234 10.347  1.00   52.25 ? 551  LEU A CD2   1 
ATOM   4177 N  N     . TYR A 1 552 ? 12.265  -28.025 10.310  1.00   57.03 ? 552  TYR A N     1 
ATOM   4178 C  CA    . TYR A 1 552 ? 13.084  -28.867 9.459   1.00   57.42 ? 552  TYR A CA    1 
ATOM   4179 C  C     . TYR A 1 552 ? 12.504  -30.257 9.226   1.00   58.93 ? 552  TYR A C     1 
ATOM   4180 O  O     . TYR A 1 552 ? 12.412  -30.709 8.086   1.00   54.38 ? 552  TYR A O     1 
ATOM   4181 C  CB    . TYR A 1 552 ? 14.484  -28.973 10.037  1.00   59.56 ? 552  TYR A CB    1 
ATOM   4182 C  CG    . TYR A 1 552 ? 15.397  -27.876 9.564   1.00   65.25 ? 552  TYR A CG    1 
ATOM   4183 C  CD1   . TYR A 1 552 ? 14.975  -26.545 9.546   1.00   68.02 ? 552  TYR A CD1   1 
ATOM   4184 C  CD2   . TYR A 1 552 ? 16.700  -28.156 9.154   1.00   68.16 ? 552  TYR A CD2   1 
ATOM   4185 C  CE1   . TYR A 1 552 ? 15.832  -25.515 9.130   1.00   69.14 ? 552  TYR A CE1   1 
ATOM   4186 C  CE2   . TYR A 1 552 ? 17.560  -27.134 8.739   1.00   69.84 ? 552  TYR A CE2   1 
ATOM   4187 C  CZ    . TYR A 1 552 ? 17.112  -25.821 8.730   1.00   69.67 ? 552  TYR A CZ    1 
ATOM   4188 O  OH    . TYR A 1 552 ? 17.949  -24.824 8.306   1.00   71.04 ? 552  TYR A OH    1 
ATOM   4189 N  N     . GLN A 1 553 ? 12.113  -30.932 10.303  1.00   61.38 ? 553  GLN A N     1 
ATOM   4190 C  CA    . GLN A 1 553 ? 11.550  -32.272 10.183  1.00   62.50 ? 553  GLN A CA    1 
ATOM   4191 C  C     . GLN A 1 553 ? 10.279  -32.338 9.342   1.00   61.06 ? 553  GLN A C     1 
ATOM   4192 O  O     . GLN A 1 553 ? 9.994   -33.353 8.716   1.00   59.95 ? 553  GLN A O     1 
ATOM   4193 C  CB    . GLN A 1 553 ? 11.288  -32.836 11.578  1.00   67.77 ? 553  GLN A CB    1 
ATOM   4194 C  CG    . GLN A 1 553 ? 12.569  -33.173 12.334  1.00   80.41 ? 553  GLN A CG    1 
ATOM   4195 C  CD    . GLN A 1 553 ? 12.330  -33.463 13.795  1.00   85.76 ? 553  GLN A CD    1 
ATOM   4196 O  OE1   . GLN A 1 553 ? 11.451  -34.255 14.155  1.00   87.74 ? 553  GLN A OE1   1 
ATOM   4197 N  NE2   . GLN A 1 553 ? 13.120  -32.825 14.655  1.00   87.87 ? 553  GLN A NE2   1 
ATOM   4198 N  N     . ASN A 1 554 ? 9.524   -31.250 9.329   1.00   59.84 ? 554  ASN A N     1 
ATOM   4199 C  CA    . ASN A 1 554 ? 8.283   -31.177 8.563   1.00   57.52 ? 554  ASN A CA    1 
ATOM   4200 C  C     . ASN A 1 554 ? 8.437   -30.667 7.134   1.00   56.14 ? 554  ASN A C     1 
ATOM   4201 O  O     . ASN A 1 554 ? 7.574   -30.921 6.298   1.00   54.87 ? 554  ASN A O     1 
ATOM   4202 C  CB    . ASN A 1 554 ? 7.276   -30.272 9.271   1.00   58.77 ? 554  ASN A CB    1 
ATOM   4203 C  CG    . ASN A 1 554 ? 6.360   -31.031 10.226  1.00   62.01 ? 554  ASN A CG    1 
ATOM   4204 O  OD1   . ASN A 1 554 ? 5.469   -31.768 9.794   1.00   62.87 ? 554  ASN A OD1   1 
ATOM   4205 N  ND2   . ASN A 1 554 ? 6.578   -30.854 11.531  1.00   62.89 ? 554  ASN A ND2   1 
ATOM   4206 N  N     . HIS A 1 555 ? 9.512   -29.950 6.835   1.00   54.67 ? 555  HIS A N     1 
ATOM   4207 C  CA    . HIS A 1 555 ? 9.611   -29.402 5.492   1.00   53.65 ? 555  HIS A CA    1 
ATOM   4208 C  C     . HIS A 1 555 ? 10.930  -29.479 4.743   1.00   53.59 ? 555  HIS A C     1 
ATOM   4209 O  O     . HIS A 1 555 ? 10.932  -29.440 3.512   1.00   52.23 ? 555  HIS A O     1 
ATOM   4210 C  CB    . HIS A 1 555 ? 9.149   -27.939 5.515   1.00   53.17 ? 555  HIS A CB    1 
ATOM   4211 C  CG    . HIS A 1 555 ? 7.784   -27.747 6.106   1.00   52.65 ? 555  HIS A CG    1 
ATOM   4212 N  ND1   . HIS A 1 555 ? 7.564   -26.964 7.218   1.00   52.75 ? 555  HIS A ND1   1 
ATOM   4213 C  CD2   . HIS A 1 555 ? 6.577   -28.242 5.746   1.00   52.48 ? 555  HIS A CD2   1 
ATOM   4214 C  CE1   . HIS A 1 555 ? 6.276   -26.988 7.520   1.00   52.30 ? 555  HIS A CE1   1 
ATOM   4215 N  NE2   . HIS A 1 555 ? 5.659   -27.755 6.645   1.00   52.46 ? 555  HIS A NE2   1 
ATOM   4216 N  N     . MET A 1 556 ? 12.048  -29.571 5.451   1.00   53.61 ? 556  MET A N     1 
ATOM   4217 C  CA    . MET A 1 556 ? 13.323  -29.622 4.748   1.00   54.53 ? 556  MET A CA    1 
ATOM   4218 C  C     . MET A 1 556 ? 13.411  -30.934 3.971   1.00   53.69 ? 556  MET A C     1 
ATOM   4219 O  O     . MET A 1 556 ? 13.205  -32.011 4.535   1.00   53.66 ? 556  MET A O     1 
ATOM   4220 C  CB    . MET A 1 556 ? 14.485  -29.498 5.736   1.00   56.91 ? 556  MET A CB    1 
ATOM   4221 C  CG    . MET A 1 556 ? 15.834  -29.237 5.075   1.00   61.06 ? 556  MET A CG    1 
ATOM   4222 S  SD    . MET A 1 556 ? 15.836  -27.756 4.002   1.00   63.80 ? 556  MET A SD    1 
ATOM   4223 C  CE    . MET A 1 556 ? 15.911  -26.444 5.218   1.00   65.66 ? 556  MET A CE    1 
ATOM   4224 N  N     . GLY A 1 557 ? 13.702  -30.839 2.678   1.00   52.67 ? 557  GLY A N     1 
ATOM   4225 C  CA    . GLY A 1 557 ? 13.790  -32.031 1.845   1.00   51.51 ? 557  GLY A CA    1 
ATOM   4226 C  C     . GLY A 1 557 ? 12.450  -32.693 1.525   1.00   51.13 ? 557  GLY A C     1 
ATOM   4227 O  O     . GLY A 1 557 ? 12.415  -33.732 0.869   1.00   51.03 ? 557  GLY A O     1 
ATOM   4228 N  N     . LYS A 1 558 ? 11.353  -32.091 1.984   1.00   50.93 ? 558  LYS A N     1 
ATOM   4229 C  CA    . LYS A 1 558 ? 10.017  -32.621 1.750   1.00   51.02 ? 558  LYS A CA    1 
ATOM   4230 C  C     . LYS A 1 558 ? 9.166   -31.642 0.938   1.00   50.89 ? 558  LYS A C     1 
ATOM   4231 O  O     . LYS A 1 558 ? 7.993   -31.911 0.666   1.00   49.90 ? 558  LYS A O     1 
ATOM   4232 C  CB    . LYS A 1 558 ? 9.332   -32.905 3.095   1.00   53.49 ? 558  LYS A CB    1 
ATOM   4233 C  CG    . LYS A 1 558 ? 10.056  -33.936 3.945   1.00   56.89 ? 558  LYS A CG    1 
ATOM   4234 C  CD    . LYS A 1 558 ? 9.224   -34.343 5.147   1.00   59.66 ? 558  LYS A CD    1 
ATOM   4235 C  CE    . LYS A 1 558 ? 9.955   -35.369 6.001   1.00   61.97 ? 558  LYS A CE    1 
ATOM   4236 N  NZ    . LYS A 1 558 ? 9.144   -35.785 7.185   1.00   62.91 ? 558  LYS A NZ    1 
ATOM   4237 N  N     . ASN A 1 559 ? 9.753   -30.511 0.538   1.00   49.90 ? 559  ASN A N     1 
ATOM   4238 C  CA    . ASN A 1 559 ? 9.007   -29.508 -0.225  1.00   50.65 ? 559  ASN A CA    1 
ATOM   4239 C  C     . ASN A 1 559 ? 9.970   -28.616 -0.999  1.00   53.82 ? 559  ASN A C     1 
ATOM   4240 O  O     . ASN A 1 559 ? 10.976  -28.162 -0.445  1.00   51.14 ? 559  ASN A O     1 
ATOM   4241 C  CB    . ASN A 1 559 ? 8.158   -28.662 0.741   1.00   49.82 ? 559  ASN A CB    1 
ATOM   4242 C  CG    . ASN A 1 559 ? 7.164   -27.767 0.027   1.00   50.01 ? 559  ASN A CG    1 
ATOM   4243 O  OD1   . ASN A 1 559 ? 7.523   -27.045 -0.909  1.00   50.32 ? 559  ASN A OD1   1 
ATOM   4244 N  ND2   . ASN A 1 559 ? 5.912   -27.793 0.478   1.00   48.14 ? 559  ASN A ND2   1 
ATOM   4245 N  N     . ARG A 1 560 ? 9.672   -28.353 -2.264  1.00   56.37 ? 560  ARG A N     1 
ATOM   4246 C  CA    . ARG A 1 560 ? 10.581  -27.525 -3.036  1.00   58.42 ? 560  ARG A CA    1 
ATOM   4247 C  C     . ARG A 1 560 ? 10.495  -26.027 -2.776  1.00   58.28 ? 560  ARG A C     1 
ATOM   4248 O  O     . ARG A 1 560 ? 11.377  -25.278 -3.195  1.00   55.70 ? 560  ARG A O     1 
ATOM   4249 C  CB    . ARG A 1 560 ? 10.440  -27.812 -4.539  1.00   62.81 ? 560  ARG A CB    1 
ATOM   4250 C  CG    . ARG A 1 560 ? 9.147   -27.393 -5.184  1.00   72.99 ? 560  ARG A CG    1 
ATOM   4251 C  CD    . ARG A 1 560 ? 9.242   -27.621 -6.692  1.00   79.21 ? 560  ARG A CD    1 
ATOM   4252 N  NE    . ARG A 1 560 ? 8.069   -27.112 -7.394  1.00   82.37 ? 560  ARG A NE    1 
ATOM   4253 C  CZ    . ARG A 1 560 ? 6.830   -27.506 -7.126  1.00   83.45 ? 560  ARG A CZ    1 
ATOM   4254 N  NH1   . ARG A 1 560 ? 6.616   -28.411 -6.177  1.00   83.86 ? 560  ARG A NH1   1 
ATOM   4255 N  NH2   . ARG A 1 560 ? 5.809   -26.990 -7.796  1.00   84.04 ? 560  ARG A NH2   1 
ATOM   4256 N  N     . MET A 1 561 ? 9.449   -25.584 -2.085  1.00   58.47 ? 561  MET A N     1 
ATOM   4257 C  CA    . MET A 1 561 ? 9.321   -24.165 -1.772  1.00   57.67 ? 561  MET A CA    1 
ATOM   4258 C  C     . MET A 1 561 ? 10.141  -23.854 -0.514  1.00   56.75 ? 561  MET A C     1 
ATOM   4259 O  O     . MET A 1 561 ? 10.578  -22.723 -0.316  1.00   57.10 ? 561  MET A O     1 
ATOM   4260 C  CB    . MET A 1 561 ? 7.859   -23.779 -1.541  1.00   59.81 ? 561  MET A CB    1 
ATOM   4261 C  CG    . MET A 1 561 ? 6.944   -23.986 -2.738  1.00   65.01 ? 561  MET A CG    1 
ATOM   4262 S  SD    . MET A 1 561 ? 7.565   -23.314 -4.312  1.00   66.55 ? 561  MET A SD    1 
ATOM   4263 C  CE    . MET A 1 561 ? 6.021   -23.239 -5.256  1.00   67.67 ? 561  MET A CE    1 
ATOM   4264 N  N     . PHE A 1 562 ? 10.349  -24.866 0.326   1.00   55.80 ? 562  PHE A N     1 
ATOM   4265 C  CA    . PHE A 1 562 ? 11.126  -24.709 1.551   1.00   54.70 ? 562  PHE A CA    1 
ATOM   4266 C  C     . PHE A 1 562 ? 12.566  -25.155 1.264   1.00   55.35 ? 562  PHE A C     1 
ATOM   4267 O  O     . PHE A 1 562 ? 12.824  -26.339 1.071   1.00   54.52 ? 562  PHE A O     1 
ATOM   4268 C  CB    . PHE A 1 562 ? 10.520  -25.564 2.656   1.00   52.61 ? 562  PHE A CB    1 
ATOM   4269 C  CG    . PHE A 1 562 ? 10.990  -25.202 4.040   1.00   51.23 ? 562  PHE A CG    1 
ATOM   4270 C  CD1   . PHE A 1 562 ? 10.335  -24.225 4.775   1.00   50.25 ? 562  PHE A CD1   1 
ATOM   4271 C  CD2   . PHE A 1 562 ? 12.082  -25.850 4.611   1.00   50.47 ? 562  PHE A CD2   1 
ATOM   4272 C  CE1   . PHE A 1 562 ? 10.752  -23.899 6.069   1.00   50.53 ? 562  PHE A CE1   1 
ATOM   4273 C  CE2   . PHE A 1 562 ? 12.510  -25.538 5.891   1.00   50.82 ? 562  PHE A CE2   1 
ATOM   4274 C  CZ    . PHE A 1 562 ? 11.842  -24.552 6.629   1.00   50.59 ? 562  PHE A CZ    1 
ATOM   4275 N  N     . THR A 1 563 ? 13.496  -24.205 1.258   1.00   57.18 ? 563  THR A N     1 
ATOM   4276 C  CA    . THR A 1 563 ? 14.902  -24.479 0.940   1.00   58.87 ? 563  THR A CA    1 
ATOM   4277 C  C     . THR A 1 563 ? 15.940  -24.150 2.022   1.00   59.86 ? 563  THR A C     1 
ATOM   4278 O  O     . THR A 1 563 ? 15.635  -23.489 3.011   1.00   61.73 ? 563  THR A O     1 
ATOM   4279 C  CB    . THR A 1 563 ? 15.277  -23.706 -0.354  1.00   58.26 ? 563  THR A CB    1 
ATOM   4280 O  OG1   . THR A 1 563 ? 14.579  -24.288 -1.454  1.00   60.73 ? 563  THR A OG1   1 
ATOM   4281 C  CG2   . THR A 1 563 ? 16.749  -23.738 -0.641  1.00   59.00 ? 563  THR A CG2   1 
ATOM   4282 N  N     . LYS A 1 564 ? 17.168  -24.623 1.818   1.00   61.92 ? 564  LYS A N     1 
ATOM   4283 C  CA    . LYS A 1 564 ? 18.277  -24.345 2.731   1.00   65.08 ? 564  LYS A CA    1 
ATOM   4284 C  C     . LYS A 1 564 ? 18.957  -23.110 2.132   1.00   68.42 ? 564  LYS A C     1 
ATOM   4285 O  O     . LYS A 1 564 ? 19.142  -23.032 0.920   1.00   69.54 ? 564  LYS A O     1 
ATOM   4286 C  CB    . LYS A 1 564 ? 19.254  -25.527 2.777   1.00   64.99 ? 564  LYS A CB    1 
ATOM   4287 N  N     . PRO A 1 565 ? 19.337  -22.134 2.968   1.00   72.57 ? 565  PRO A N     1 
ATOM   4288 C  CA    . PRO A 1 565 ? 19.986  -20.915 2.471   1.00   75.84 ? 565  PRO A CA    1 
ATOM   4289 C  C     . PRO A 1 565 ? 21.205  -21.131 1.567   1.00   79.59 ? 565  PRO A C     1 
ATOM   4290 O  O     . PRO A 1 565 ? 22.136  -21.854 1.921   1.00   80.32 ? 565  PRO A O     1 
ATOM   4291 C  CB    . PRO A 1 565 ? 20.336  -20.160 3.756   1.00   74.94 ? 565  PRO A CB    1 
ATOM   4292 C  CG    . PRO A 1 565 ? 20.524  -21.265 4.771   1.00   72.68 ? 565  PRO A CG    1 
ATOM   4293 C  CD    . PRO A 1 565 ? 19.391  -22.199 4.444   1.00   72.42 ? 565  PRO A CD    1 
ATOM   4294 N  N     . GLY A 1 566 ? 21.185  -20.491 0.394   1.00   83.12 ? 566  GLY A N     1 
ATOM   4295 C  CA    . GLY A 1 566 ? 22.282  -20.608 -0.555  1.00   88.36 ? 566  GLY A CA    1 
ATOM   4296 C  C     . GLY A 1 566 ? 23.393  -19.596 -0.319  1.00   90.40 ? 566  GLY A C     1 
ATOM   4297 O  O     . GLY A 1 566 ? 23.713  -19.277 0.826   1.00   94.07 ? 566  GLY A O     1 
ATOM   4298 N  N     . LYS A 1 567 ? 23.984  -19.092 -1.401  1.00   90.78 ? 567  LYS A N     1 
ATOM   4299 C  CA    . LYS A 1 567 ? 25.066  -18.111 -1.306  1.00   89.87 ? 567  LYS A CA    1 
ATOM   4300 C  C     . LYS A 1 567 ? 24.469  -16.703 -1.239  1.00   89.99 ? 567  LYS A C     1 
ATOM   4301 O  O     . LYS A 1 567 ? 23.447  -16.432 -1.870  1.00   90.06 ? 567  LYS A O     1 
ATOM   4302 C  CB    . LYS A 1 567 ? 25.999  -18.235 -2.518  1.00   90.51 ? 567  LYS A CB    1 
ATOM   4303 N  N     . PRO A 1 568 ? 25.094  -15.794 -0.472  1.00   86.88 ? 568  PRO A N     1 
ATOM   4304 C  CA    . PRO A 1 568 ? 24.559  -14.433 -0.368  1.00   87.75 ? 568  PRO A CA    1 
ATOM   4305 C  C     . PRO A 1 568 ? 24.262  -13.800 -1.722  1.00   87.92 ? 568  PRO A C     1 
ATOM   4306 O  O     . PRO A 1 568 ? 25.084  -13.830 -2.635  1.00   89.38 ? 568  PRO A O     1 
ATOM   4307 C  CB    . PRO A 1 568 ? 25.646  -13.691 0.403   1.00   86.56 ? 568  PRO A CB    1 
ATOM   4308 C  CG    . PRO A 1 568 ? 26.884  -14.430 0.024   1.00   85.32 ? 568  PRO A CG    1 
ATOM   4309 C  CD    . PRO A 1 568 ? 26.434  -15.861 0.127   1.00   87.08 ? 568  PRO A CD    1 
ATOM   4310 N  N     . THR A 1 569 ? 23.064  -13.234 -1.832  1.00   88.56 ? 569  THR A N     1 
ATOM   4311 C  CA    . THR A 1 569 ? 22.614  -12.581 -3.051  1.00   90.33 ? 569  THR A CA    1 
ATOM   4312 C  C     . THR A 1 569 ? 23.040  -11.119 -2.995  1.00   91.19 ? 569  THR A C     1 
ATOM   4313 O  O     . THR A 1 569 ? 22.933  -10.386 -3.980  1.00   94.80 ? 569  THR A O     1 
ATOM   4314 C  CB    . THR A 1 569 ? 21.087  -12.692 -3.168  1.00   91.03 ? 569  THR A CB    1 
ATOM   4315 N  N     . ARG A 1 570 ? 23.520  -10.708 -1.827  1.00   92.08 ? 570  ARG A N     1 
ATOM   4316 C  CA    . ARG A 1 570 ? 23.977  -9.342  -1.603  1.00   90.88 ? 570  ARG A CA    1 
ATOM   4317 C  C     . ARG A 1 570 ? 24.889  -9.312  -0.378  1.00   87.72 ? 570  ARG A C     1 
ATOM   4318 O  O     . ARG A 1 570 ? 24.724  -10.108 0.545   1.00   93.39 ? 570  ARG A O     1 
ATOM   4319 C  CB    . ARG A 1 570 ? 22.778  -8.416  -1.395  1.00   92.81 ? 570  ARG A CB    1 
ATOM   4320 N  N     . PRO A 1 571 ? 25.868  -8.401  -0.359  1.00   86.13 ? 571  PRO A N     1 
ATOM   4321 C  CA    . PRO A 1 571 ? 26.787  -8.293  0.776   1.00   85.85 ? 571  PRO A CA    1 
ATOM   4322 C  C     . PRO A 1 571 ? 26.015  -7.700  1.940   1.00   83.06 ? 571  PRO A C     1 
ATOM   4323 O  O     . PRO A 1 571 ? 24.966  -7.082  1.741   1.00   87.70 ? 571  PRO A O     1 
ATOM   4324 C  CB    . PRO A 1 571 ? 27.862  -7.356  0.252   1.00   86.63 ? 571  PRO A CB    1 
ATOM   4325 C  CG    . PRO A 1 571 ? 27.067  -6.428  -0.559  1.00   84.85 ? 571  PRO A CG    1 
ATOM   4326 C  CD    . PRO A 1 571 ? 26.137  -7.341  -1.339  1.00   87.91 ? 571  PRO A CD    1 
ATOM   4327 N  N     . ASN A 1 572 ? 26.521  -7.884  3.152   1.00   78.92 ? 572  ASN A N     1 
ATOM   4328 C  CA    . ASN A 1 572 ? 25.842  -7.382  4.336   1.00   74.94 ? 572  ASN A CA    1 
ATOM   4329 C  C     . ASN A 1 572 ? 24.532  -8.156  4.495   1.00   74.17 ? 572  ASN A C     1 
ATOM   4330 O  O     . ASN A 1 572 ? 23.623  -7.718  5.204   1.00   68.79 ? 572  ASN A O     1 
ATOM   4331 C  CB    . ASN A 1 572 ? 25.573  -5.868  4.210   1.00   72.25 ? 572  ASN A CB    1 
ATOM   4332 N  N     . GLN A 1 573 ? 24.440  -9.307  3.833   1.00   71.11 ? 573  GLN A N     1 
ATOM   4333 C  CA    . GLN A 1 573 ? 23.249  -10.143 3.934   1.00   68.96 ? 573  GLN A CA    1 
ATOM   4334 C  C     . GLN A 1 573 ? 23.334  -10.912 5.249   1.00   67.34 ? 573  GLN A C     1 
ATOM   4335 O  O     . GLN A 1 573 ? 24.209  -11.759 5.434   1.00   64.06 ? 573  GLN A O     1 
ATOM   4336 C  CB    . GLN A 1 573 ? 23.156  -11.115 2.756   1.00   71.22 ? 573  GLN A CB    1 
ATOM   4337 C  CG    . GLN A 1 573 ? 21.916  -12.001 2.809   1.00   80.53 ? 573  GLN A CG    1 
ATOM   4338 C  CD    . GLN A 1 573 ? 21.838  -12.984 1.656   1.00   84.87 ? 573  GLN A CD    1 
ATOM   4339 O  OE1   . GLN A 1 573 ? 21.581  -12.606 0.512   1.00   87.04 ? 573  GLN A OE1   1 
ATOM   4340 N  NE2   . GLN A 1 573 ? 22.067  -14.258 1.953   1.00   87.13 ? 573  GLN A NE2   1 
ATOM   4341 N  N     . GLY A 1 574 ? 22.413  -10.603 6.162   1.00   65.80 ? 574  GLY A N     1 
ATOM   4342 C  CA    . GLY A 1 574 ? 22.394  -11.230 7.473   1.00   65.04 ? 574  GLY A CA    1 
ATOM   4343 C  C     . GLY A 1 574 ? 22.201  -12.729 7.459   1.00   65.46 ? 574  GLY A C     1 
ATOM   4344 O  O     . GLY A 1 574 ? 22.009  -13.320 6.397   1.00   66.55 ? 574  GLY A O     1 
ATOM   4345 N  N     . PRO A 1 575 ? 22.260  -13.383 8.632   1.00   67.98 ? 575  PRO A N     1 
ATOM   4346 C  CA    . PRO A 1 575 ? 22.079  -14.834 8.736   1.00   67.51 ? 575  PRO A CA    1 
ATOM   4347 C  C     . PRO A 1 575 ? 20.659  -15.284 8.404   1.00   65.95 ? 575  PRO A C     1 
ATOM   4348 O  O     . PRO A 1 575 ? 19.707  -14.519 8.541   1.00   66.73 ? 575  PRO A O     1 
ATOM   4349 C  CB    . PRO A 1 575 ? 22.449  -15.129 10.189  1.00   69.04 ? 575  PRO A CB    1 
ATOM   4350 C  CG    . PRO A 1 575 ? 22.069  -13.866 10.888  1.00   70.42 ? 575  PRO A CG    1 
ATOM   4351 C  CD    . PRO A 1 575 ? 22.605  -12.810 9.942   1.00   68.75 ? 575  PRO A CD    1 
ATOM   4352 N  N     . ALA A 1 576 ? 20.535  -16.530 7.959   1.00   64.47 ? 576  ALA A N     1 
ATOM   4353 C  CA    . ALA A 1 576 ? 19.246  -17.102 7.604   1.00   62.69 ? 576  ALA A CA    1 
ATOM   4354 C  C     . ALA A 1 576 ? 19.278  -18.583 7.956   1.00   60.81 ? 576  ALA A C     1 
ATOM   4355 O  O     . ALA A 1 576 ? 20.344  -19.181 8.050   1.00   63.68 ? 576  ALA A O     1 
ATOM   4356 C  CB    . ALA A 1 576 ? 18.979  -16.914 6.126   1.00   58.93 ? 576  ALA A CB    1 
ATOM   4357 N  N     . HIS A 1 577 ? 18.104  -19.172 8.149   1.00   60.78 ? 577  HIS A N     1 
ATOM   4358 C  CA    . HIS A 1 577 ? 18.011  -20.579 8.517   1.00   63.09 ? 577  HIS A CA    1 
ATOM   4359 C  C     . HIS A 1 577 ? 17.326  -21.423 7.443   1.00   63.54 ? 577  HIS A C     1 
ATOM   4360 O  O     . HIS A 1 577 ? 17.524  -22.633 7.385   1.00   66.17 ? 577  HIS A O     1 
ATOM   4361 C  CB    . HIS A 1 577 ? 17.298  -20.692 9.867   1.00   63.56 ? 577  HIS A CB    1 
ATOM   4362 C  CG    . HIS A 1 577 ? 17.959  -19.897 10.958  1.00   60.24 ? 577  HIS A CG    1 
ATOM   4363 N  ND1   . HIS A 1 577 ? 17.276  -19.415 12.049  1.00   59.19 ? 577  HIS A ND1   1 
ATOM   4364 C  CD2   . HIS A 1 577 ? 19.239  -19.492 11.107  1.00   58.72 ? 577  HIS A CD2   1 
ATOM   4365 C  CE1   . HIS A 1 577 ? 18.101  -18.739 12.826  1.00   57.70 ? 577  HIS A CE1   1 
ATOM   4366 N  NE2   . HIS A 1 577 ? 19.303  -18.769 12.277  1.00   57.63 ? 577  HIS A NE2   1 
ATOM   4367 N  N     . PHE A 1 578 ? 16.532  -20.783 6.591   1.00   61.66 ? 578  PHE A N     1 
ATOM   4368 C  CA    . PHE A 1 578 ? 15.853  -21.475 5.500   1.00   59.06 ? 578  PHE A CA    1 
ATOM   4369 C  C     . PHE A 1 578 ? 15.356  -20.440 4.505   1.00   59.76 ? 578  PHE A C     1 
ATOM   4370 O  O     . PHE A 1 578 ? 15.140  -19.282 4.866   1.00   56.38 ? 578  PHE A O     1 
ATOM   4371 C  CB    . PHE A 1 578 ? 14.655  -22.282 6.004   1.00   55.67 ? 578  PHE A CB    1 
ATOM   4372 C  CG    . PHE A 1 578 ? 13.483  -21.431 6.438   1.00   53.45 ? 578  PHE A CG    1 
ATOM   4373 C  CD1   . PHE A 1 578 ? 13.401  -20.937 7.740   1.00   52.60 ? 578  PHE A CD1   1 
ATOM   4374 C  CD2   . PHE A 1 578 ? 12.460  -21.122 5.543   1.00   52.48 ? 578  PHE A CD2   1 
ATOM   4375 C  CE1   . PHE A 1 578 ? 12.316  -20.153 8.146   1.00   52.27 ? 578  PHE A CE1   1 
ATOM   4376 C  CE2   . PHE A 1 578 ? 11.375  -20.338 5.940   1.00   52.57 ? 578  PHE A CE2   1 
ATOM   4377 C  CZ    . PHE A 1 578 ? 11.300  -19.855 7.243   1.00   51.65 ? 578  PHE A CZ    1 
ATOM   4378 N  N     . GLU A 1 579 ? 15.181  -20.847 3.250   1.00   59.57 ? 579  GLU A N     1 
ATOM   4379 C  CA    . GLU A 1 579 ? 14.676  -19.939 2.232   1.00   59.90 ? 579  GLU A CA    1 
ATOM   4380 C  C     . GLU A 1 579 ? 13.315  -20.373 1.748   1.00   58.84 ? 579  GLU A C     1 
ATOM   4381 O  O     . GLU A 1 579 ? 13.057  -21.556 1.539   1.00   57.79 ? 579  GLU A O     1 
ATOM   4382 C  CB    . GLU A 1 579 ? 15.627  -19.837 1.044   1.00   63.59 ? 579  GLU A CB    1 
ATOM   4383 C  CG    . GLU A 1 579 ? 16.448  -18.556 1.064   1.00   72.70 ? 579  GLU A CG    1 
ATOM   4384 C  CD    . GLU A 1 579 ? 17.265  -18.333 -0.204  1.00   76.65 ? 579  GLU A CD    1 
ATOM   4385 O  OE1   . GLU A 1 579 ? 16.652  -18.236 -1.292  1.00   78.29 ? 579  GLU A OE1   1 
ATOM   4386 O  OE2   . GLU A 1 579 ? 18.516  -18.248 -0.110  1.00   78.30 ? 579  GLU A OE2   1 
ATOM   4387 N  N     . LEU A 1 580 ? 12.441  -19.393 1.569   1.00   58.25 ? 580  LEU A N     1 
ATOM   4388 C  CA    . LEU A 1 580 ? 11.091  -19.644 1.110   1.00   57.07 ? 580  LEU A CA    1 
ATOM   4389 C  C     . LEU A 1 580 ? 10.927  -19.046 -0.279  1.00   58.01 ? 580  LEU A C     1 
ATOM   4390 O  O     . LEU A 1 580 ? 11.165  -17.852 -0.488  1.00   58.89 ? 580  LEU A O     1 
ATOM   4391 C  CB    . LEU A 1 580 ? 10.123  -19.001 2.086   1.00   55.02 ? 580  LEU A CB    1 
ATOM   4392 C  CG    . LEU A 1 580 ? 8.782   -19.660 2.341   1.00   53.22 ? 580  LEU A CG    1 
ATOM   4393 C  CD1   . LEU A 1 580 ? 8.966   -21.138 2.540   1.00   52.78 ? 580  LEU A CD1   1 
ATOM   4394 C  CD2   . LEU A 1 580 ? 8.179   -19.019 3.583   1.00   52.54 ? 580  LEU A CD2   1 
ATOM   4395 N  N     . HIS A 1 581 ? 10.524  -19.879 -1.237  1.00   60.18 ? 581  HIS A N     1 
ATOM   4396 C  CA    . HIS A 1 581 ? 10.350  -19.444 -2.620  1.00   62.02 ? 581  HIS A CA    1 
ATOM   4397 C  C     . HIS A 1 581 ? 9.016   -18.728 -2.831  1.00   60.56 ? 581  HIS A C     1 
ATOM   4398 O  O     . HIS A 1 581 ? 8.005   -19.361 -3.133  1.00   61.52 ? 581  HIS A O     1 
ATOM   4399 C  CB    . HIS A 1 581 ? 10.433  -20.657 -3.546  1.00   66.37 ? 581  HIS A CB    1 
ATOM   4400 C  CG    . HIS A 1 581 ? 11.754  -21.356 -3.510  1.00   70.90 ? 581  HIS A CG    1 
ATOM   4401 N  ND1   . HIS A 1 581 ? 12.671  -21.167 -2.497  1.00   72.54 ? 581  HIS A ND1   1 
ATOM   4402 C  CD2   . HIS A 1 581 ? 12.323  -22.239 -4.367  1.00   72.20 ? 581  HIS A CD2   1 
ATOM   4403 C  CE1   . HIS A 1 581 ? 13.745  -21.895 -2.734  1.00   73.16 ? 581  HIS A CE1   1 
ATOM   4404 N  NE2   . HIS A 1 581 ? 13.559  -22.555 -3.863  1.00   72.79 ? 581  HIS A NE2   1 
ATOM   4405 N  N     . HIS A 1 582 ? 9.015   -17.409 -2.670  1.00   57.69 ? 582  HIS A N     1 
ATOM   4406 C  CA    . HIS A 1 582 ? 7.800   -16.621 -2.851  1.00   54.69 ? 582  HIS A CA    1 
ATOM   4407 C  C     . HIS A 1 582 ? 7.622   -16.311 -4.336  1.00   55.84 ? 582  HIS A C     1 
ATOM   4408 O  O     . HIS A 1 582 ? 8.516   -16.560 -5.143  1.00   52.77 ? 582  HIS A O     1 
ATOM   4409 C  CB    . HIS A 1 582 ? 7.893   -15.317 -2.045  1.00   50.64 ? 582  HIS A CB    1 
ATOM   4410 C  CG    . HIS A 1 582 ? 7.967   -15.524 -0.561  1.00   46.09 ? 582  HIS A CG    1 
ATOM   4411 N  ND1   . HIS A 1 582 ? 6.890   -15.949 0.186   1.00   44.64 ? 582  HIS A ND1   1 
ATOM   4412 C  CD2   . HIS A 1 582 ? 9.005   -15.428 0.300   1.00   44.31 ? 582  HIS A CD2   1 
ATOM   4413 C  CE1   . HIS A 1 582 ? 7.264   -16.112 1.443   1.00   42.94 ? 582  HIS A CE1   1 
ATOM   4414 N  NE2   . HIS A 1 582 ? 8.548   -15.800 1.537   1.00   42.08 ? 582  HIS A NE2   1 
ATOM   4415 N  N     . TYR A 1 583 ? 6.463   -15.765 -4.684  1.00   57.58 ? 583  TYR A N     1 
ATOM   4416 C  CA    . TYR A 1 583 ? 6.143   -15.399 -6.058  1.00   58.96 ? 583  TYR A CA    1 
ATOM   4417 C  C     . TYR A 1 583 ? 7.173   -14.418 -6.617  1.00   57.52 ? 583  TYR A C     1 
ATOM   4418 O  O     . TYR A 1 583 ? 7.594   -14.534 -7.762  1.00   55.69 ? 583  TYR A O     1 
ATOM   4419 C  CB    . TYR A 1 583 ? 4.771   -14.729 -6.118  1.00   65.81 ? 583  TYR A CB    1 
ATOM   4420 C  CG    . TYR A 1 583 ? 4.066   -14.886 -7.445  1.00   77.76 ? 583  TYR A CG    1 
ATOM   4421 C  CD1   . TYR A 1 583 ? 3.420   -16.082 -7.769  1.00   82.59 ? 583  TYR A CD1   1 
ATOM   4422 C  CD2   . TYR A 1 583 ? 4.031   -13.846 -8.379  1.00   82.76 ? 583  TYR A CD2   1 
ATOM   4423 C  CE1   . TYR A 1 583 ? 2.755   -16.245 -8.980  1.00   85.35 ? 583  TYR A CE1   1 
ATOM   4424 C  CE2   . TYR A 1 583 ? 3.361   -14.003 -9.612  1.00   85.39 ? 583  TYR A CE2   1 
ATOM   4425 C  CZ    . TYR A 1 583 ? 2.726   -15.209 -9.896  1.00   85.94 ? 583  TYR A CZ    1 
ATOM   4426 O  OH    . TYR A 1 583 ? 2.054   -15.400 -11.083 1.00   86.89 ? 583  TYR A OH    1 
ATOM   4427 N  N     . ALA A 1 584 ? 7.570   -13.456 -5.791  1.00   55.06 ? 584  ALA A N     1 
ATOM   4428 C  CA    . ALA A 1 584 ? 8.507   -12.423 -6.189  1.00   52.20 ? 584  ALA A CA    1 
ATOM   4429 C  C     . ALA A 1 584 ? 9.979   -12.661 -5.891  1.00   51.53 ? 584  ALA A C     1 
ATOM   4430 O  O     . ALA A 1 584 ? 10.785  -11.729 -5.979  1.00   50.69 ? 584  ALA A O     1 
ATOM   4431 C  CB    . ALA A 1 584 ? 8.085   -11.114 -5.579  1.00   52.14 ? 584  ALA A CB    1 
ATOM   4432 N  N     . GLY A 1 585 ? 10.360  -13.886 -5.545  1.00   51.02 ? 585  GLY A N     1 
ATOM   4433 C  CA    . GLY A 1 585 ? 11.766  -14.109 -5.268  1.00   50.06 ? 585  GLY A CA    1 
ATOM   4434 C  C     . GLY A 1 585 ? 12.033  -14.938 -4.041  1.00   49.70 ? 585  GLY A C     1 
ATOM   4435 O  O     . GLY A 1 585 ? 11.186  -15.064 -3.156  1.00   50.08 ? 585  GLY A O     1 
ATOM   4436 N  N     . ASN A 1 586 ? 13.229  -15.507 -3.985  1.00   50.09 ? 586  ASN A N     1 
ATOM   4437 C  CA    . ASN A 1 586 ? 13.640  -16.345 -2.869  1.00   50.59 ? 586  ASN A CA    1 
ATOM   4438 C  C     . ASN A 1 586 ? 13.993  -15.462 -1.678  1.00   49.64 ? 586  ASN A C     1 
ATOM   4439 O  O     . ASN A 1 586 ? 14.793  -14.535 -1.807  1.00   51.40 ? 586  ASN A O     1 
ATOM   4440 C  CB    . ASN A 1 586 ? 14.830  -17.215 -3.284  1.00   52.16 ? 586  ASN A CB    1 
ATOM   4441 C  CG    . ASN A 1 586 ? 14.483  -18.192 -4.417  1.00   55.85 ? 586  ASN A CG    1 
ATOM   4442 O  OD1   . ASN A 1 586 ? 13.572  -19.018 -4.300  1.00   56.60 ? 586  ASN A OD1   1 
ATOM   4443 N  ND2   . ASN A 1 586 ? 15.211  -18.095 -5.524  1.00   57.92 ? 586  ASN A ND2   1 
ATOM   4444 N  N     . VAL A 1 587 ? 13.402  -15.732 -0.530  1.00   47.98 ? 587  VAL A N     1 
ATOM   4445 C  CA    . VAL A 1 587 ? 13.676  -14.924 0.650   1.00   46.18 ? 587  VAL A CA    1 
ATOM   4446 C  C     . VAL A 1 587 ? 14.319  -15.716 1.792   1.00   46.15 ? 587  VAL A C     1 
ATOM   4447 O  O     . VAL A 1 587 ? 13.712  -16.632 2.344   1.00   44.77 ? 587  VAL A O     1 
ATOM   4448 C  CB    . VAL A 1 587 ? 12.389  -14.257 1.160   1.00   43.62 ? 587  VAL A CB    1 
ATOM   4449 C  CG1   . VAL A 1 587 ? 12.657  -13.505 2.422   1.00   41.14 ? 587  VAL A CG1   1 
ATOM   4450 C  CG2   . VAL A 1 587 ? 11.857  -13.318 0.111   1.00   42.35 ? 587  VAL A CG2   1 
ATOM   4451 N  N     . PRO A 1 588 ? 15.574  -15.375 2.149   1.00   49.25 ? 588  PRO A N     1 
ATOM   4452 C  CA    . PRO A 1 588 ? 16.222  -16.097 3.253   1.00   48.49 ? 588  PRO A CA    1 
ATOM   4453 C  C     . PRO A 1 588 ? 15.727  -15.558 4.578   1.00   49.06 ? 588  PRO A C     1 
ATOM   4454 O  O     . PRO A 1 588 ? 15.888  -14.381 4.883   1.00   50.49 ? 588  PRO A O     1 
ATOM   4455 C  CB    . PRO A 1 588 ? 17.717  -15.844 3.028   1.00   48.94 ? 588  PRO A CB    1 
ATOM   4456 C  CG    . PRO A 1 588 ? 17.767  -14.563 2.235   1.00   49.57 ? 588  PRO A CG    1 
ATOM   4457 C  CD    . PRO A 1 588 ? 16.552  -14.622 1.329   1.00   47.89 ? 588  PRO A CD    1 
ATOM   4458 N  N     . TYR A 1 589 ? 15.113  -16.430 5.377   1.00   49.94 ? 589  TYR A N     1 
ATOM   4459 C  CA    . TYR A 1 589 ? 14.568  -16.049 6.668   1.00   50.42 ? 589  TYR A CA    1 
ATOM   4460 C  C     . TYR A 1 589 ? 15.391  -16.549 7.856   1.00   53.15 ? 589  TYR A C     1 
ATOM   4461 O  O     . TYR A 1 589 ? 15.970  -17.629 7.811   1.00   51.84 ? 589  TYR A O     1 
ATOM   4462 C  CB    . TYR A 1 589 ? 13.145  -16.597 6.808   1.00   48.66 ? 589  TYR A CB    1 
ATOM   4463 C  CG    . TYR A 1 589 ? 12.104  -15.921 5.944   1.00   47.35 ? 589  TYR A CG    1 
ATOM   4464 C  CD1   . TYR A 1 589 ? 11.729  -14.594 6.176   1.00   46.38 ? 589  TYR A CD1   1 
ATOM   4465 C  CD2   . TYR A 1 589 ? 11.477  -16.608 4.916   1.00   46.25 ? 589  TYR A CD2   1 
ATOM   4466 C  CE1   . TYR A 1 589 ? 10.743  -13.963 5.397   1.00   46.40 ? 589  TYR A CE1   1 
ATOM   4467 C  CE2   . TYR A 1 589 ? 10.484  -15.989 4.122   1.00   47.01 ? 589  TYR A CE2   1 
ATOM   4468 C  CZ    . TYR A 1 589 ? 10.124  -14.668 4.379   1.00   46.71 ? 589  TYR A CZ    1 
ATOM   4469 O  OH    . TYR A 1 589 ? 9.129   -14.084 3.641   1.00   46.40 ? 589  TYR A OH    1 
ATOM   4470 N  N     . SER A 1 590 ? 15.423  -15.749 8.920   1.00   57.02 ? 590  SER A N     1 
ATOM   4471 C  CA    . SER A 1 590 ? 16.094  -16.096 10.175  1.00   59.44 ? 590  SER A CA    1 
ATOM   4472 C  C     . SER A 1 590 ? 14.978  -16.333 11.205  1.00   59.88 ? 590  SER A C     1 
ATOM   4473 O  O     . SER A 1 590 ? 14.021  -15.562 11.263  1.00   60.99 ? 590  SER A O     1 
ATOM   4474 C  CB    . SER A 1 590 ? 16.987  -14.941 10.653  1.00   58.83 ? 590  SER A CB    1 
ATOM   4475 O  OG    . SER A 1 590 ? 17.234  -15.028 12.055  1.00   60.17 ? 590  SER A OG    1 
ATOM   4476 N  N     . ILE A 1 591 ? 15.093  -17.391 12.010  1.00   62.47 ? 591  ILE A N     1 
ATOM   4477 C  CA    . ILE A 1 591 ? 14.062  -17.690 13.015  1.00   67.30 ? 591  ILE A CA    1 
ATOM   4478 C  C     . ILE A 1 591 ? 14.501  -17.434 14.447  1.00   67.13 ? 591  ILE A C     1 
ATOM   4479 O  O     . ILE A 1 591 ? 14.154  -18.187 15.357  1.00   70.87 ? 591  ILE A O     1 
ATOM   4480 C  CB    . ILE A 1 591 ? 13.540  -19.163 12.916  1.00   67.53 ? 591  ILE A CB    1 
ATOM   4481 C  CG1   . ILE A 1 591 ? 14.695  -20.162 12.823  1.00   67.47 ? 591  ILE A CG1   1 
ATOM   4482 C  CG2   . ILE A 1 591 ? 12.639  -19.318 11.714  1.00   68.96 ? 591  ILE A CG2   1 
ATOM   4483 C  CD1   . ILE A 1 591 ? 15.359  -20.497 14.133  1.00   65.52 ? 591  ILE A CD1   1 
ATOM   4484 N  N     . THR A 1 592 ? 15.264  -16.364 14.651  1.00   66.54 ? 592  THR A N     1 
ATOM   4485 C  CA    . THR A 1 592 ? 15.740  -16.003 15.982  1.00   64.25 ? 592  THR A CA    1 
ATOM   4486 C  C     . THR A 1 592 ? 14.698  -15.081 16.598  1.00   62.97 ? 592  THR A C     1 
ATOM   4487 O  O     . THR A 1 592 ? 14.236  -14.139 15.951  1.00   60.83 ? 592  THR A O     1 
ATOM   4488 C  CB    . THR A 1 592 ? 17.096  -15.237 15.922  1.00   63.84 ? 592  THR A CB    1 
ATOM   4489 O  OG1   . THR A 1 592 ? 18.137  -16.122 15.503  1.00   62.32 ? 592  THR A OG1   1 
ATOM   4490 C  CG2   . THR A 1 592 ? 17.456  -14.659 17.280  1.00   62.74 ? 592  THR A CG2   1 
ATOM   4491 N  N     . GLY A 1 593 ? 14.320  -15.349 17.846  1.00   59.18 ? 593  GLY A N     1 
ATOM   4492 C  CA    . GLY A 1 593 ? 13.332  -14.518 18.511  1.00   56.43 ? 593  GLY A CA    1 
ATOM   4493 C  C     . GLY A 1 593 ? 11.891  -14.703 18.057  1.00   55.90 ? 593  GLY A C     1 
ATOM   4494 O  O     . GLY A 1 593 ? 10.988  -14.044 18.582  1.00   55.09 ? 593  GLY A O     1 
ATOM   4495 N  N     . TRP A 1 594 ? 11.663  -15.596 17.101  1.00   54.87 ? 594  TRP A N     1 
ATOM   4496 C  CA    . TRP A 1 594 ? 10.318  -15.850 16.587  1.00   55.18 ? 594  TRP A CA    1 
ATOM   4497 C  C     . TRP A 1 594 ? 9.275   -16.275 17.611  1.00   56.58 ? 594  TRP A C     1 
ATOM   4498 O  O     . TRP A 1 594 ? 8.090   -15.962 17.462  1.00   54.54 ? 594  TRP A O     1 
ATOM   4499 C  CB    . TRP A 1 594 ? 10.379  -16.891 15.461  1.00   55.84 ? 594  TRP A CB    1 
ATOM   4500 C  CG    . TRP A 1 594 ? 10.670  -16.283 14.124  1.00   58.22 ? 594  TRP A CG    1 
ATOM   4501 C  CD1   . TRP A 1 594 ? 11.511  -15.245 13.866  1.00   59.05 ? 594  TRP A CD1   1 
ATOM   4502 C  CD2   . TRP A 1 594 ? 10.152  -16.705 12.863  1.00   59.12 ? 594  TRP A CD2   1 
ATOM   4503 N  NE1   . TRP A 1 594 ? 11.554  -14.994 12.528  1.00   59.68 ? 594  TRP A NE1   1 
ATOM   4504 C  CE2   . TRP A 1 594 ? 10.729  -15.874 11.883  1.00   59.90 ? 594  TRP A CE2   1 
ATOM   4505 C  CE3   . TRP A 1 594 ? 9.259   -17.708 12.459  1.00   60.00 ? 594  TRP A CE3   1 
ATOM   4506 C  CZ2   . TRP A 1 594 ? 10.441  -16.014 10.521  1.00   60.14 ? 594  TRP A CZ2   1 
ATOM   4507 C  CZ3   . TRP A 1 594 ? 8.974   -17.851 11.117  1.00   59.16 ? 594  TRP A CZ3   1 
ATOM   4508 C  CH2   . TRP A 1 594 ? 9.563   -17.008 10.159  1.00   59.96 ? 594  TRP A CH2   1 
ATOM   4509 N  N     . LEU A 1 595 ? 9.702   -16.994 18.648  1.00   58.40 ? 595  LEU A N     1 
ATOM   4510 C  CA    . LEU A 1 595 ? 8.784   -17.458 19.671  1.00   59.54 ? 595  LEU A CA    1 
ATOM   4511 C  C     . LEU A 1 595 ? 8.257   -16.283 20.491  1.00   61.43 ? 595  LEU A C     1 
ATOM   4512 O  O     . LEU A 1 595 ? 7.058   -16.189 20.754  1.00   58.73 ? 595  LEU A O     1 
ATOM   4513 C  CB    . LEU A 1 595 ? 9.488   -18.488 20.551  1.00   61.08 ? 595  LEU A CB    1 
ATOM   4514 C  CG    . LEU A 1 595 ? 9.794   -19.821 19.850  1.00   64.87 ? 595  LEU A CG    1 
ATOM   4515 C  CD1   . LEU A 1 595 ? 10.599  -20.703 20.783  1.00   67.92 ? 595  LEU A CD1   1 
ATOM   4516 C  CD2   . LEU A 1 595 ? 8.508   -20.530 19.454  1.00   66.80 ? 595  LEU A CD2   1 
ATOM   4517 N  N     . GLU A 1 596 ? 9.157   -15.385 20.886  1.00   64.44 ? 596  GLU A N     1 
ATOM   4518 C  CA    . GLU A 1 596 ? 8.764   -14.196 21.629  1.00   66.16 ? 596  GLU A CA    1 
ATOM   4519 C  C     . GLU A 1 596 ? 7.946   -13.257 20.733  1.00   64.20 ? 596  GLU A C     1 
ATOM   4520 O  O     . GLU A 1 596 ? 7.067   -12.550 21.217  1.00   63.50 ? 596  GLU A O     1 
ATOM   4521 C  CB    . GLU A 1 596 ? 9.988   -13.421 22.098  1.00   72.10 ? 596  GLU A CB    1 
ATOM   4522 C  CG    . GLU A 1 596 ? 10.914  -14.140 23.029  1.00   84.54 ? 596  GLU A CG    1 
ATOM   4523 C  CD    . GLU A 1 596 ? 12.071  -13.246 23.427  1.00   90.18 ? 596  GLU A CD    1 
ATOM   4524 O  OE1   . GLU A 1 596 ? 12.778  -12.768 22.507  1.00   92.01 ? 596  GLU A OE1   1 
ATOM   4525 O  OE2   . GLU A 1 596 ? 12.264  -13.014 24.647  1.00   92.86 ? 596  GLU A OE2   1 
ATOM   4526 N  N     . LYS A 1 597 ? 8.239   -13.247 19.433  1.00   60.72 ? 597  LYS A N     1 
ATOM   4527 C  CA    . LYS A 1 597 ? 7.526   -12.357 18.525  1.00   57.40 ? 597  LYS A CA    1 
ATOM   4528 C  C     . LYS A 1 597 ? 6.073   -12.714 18.331  1.00   57.37 ? 597  LYS A C     1 
ATOM   4529 O  O     . LYS A 1 597 ? 5.203   -11.837 18.349  1.00   56.30 ? 597  LYS A O     1 
ATOM   4530 C  CB    . LYS A 1 597 ? 8.244   -12.296 17.177  1.00   55.20 ? 597  LYS A CB    1 
ATOM   4531 C  CG    . LYS A 1 597 ? 9.581   -11.538 17.253  1.00   52.77 ? 597  LYS A CG    1 
ATOM   4532 C  CD    . LYS A 1 597 ? 10.442  -11.782 16.038  1.00   52.20 ? 597  LYS A CD    1 
ATOM   4533 C  CE    . LYS A 1 597 ? 11.881  -11.392 16.291  1.00   51.93 ? 597  LYS A CE    1 
ATOM   4534 N  NZ    . LYS A 1 597 ? 12.018  -9.963  16.696  1.00   52.67 ? 597  LYS A NZ    1 
ATOM   4535 N  N     . ASN A 1 598 ? 5.793   -13.998 18.163  1.00   57.46 ? 598  ASN A N     1 
ATOM   4536 C  CA    . ASN A 1 598 ? 4.430   -14.444 17.958  1.00   57.81 ? 598  ASN A CA    1 
ATOM   4537 C  C     . ASN A 1 598 ? 3.577   -14.425 19.232  1.00   58.69 ? 598  ASN A C     1 
ATOM   4538 O  O     . ASN A 1 598 ? 2.380   -14.147 19.177  1.00   59.38 ? 598  ASN A O     1 
ATOM   4539 C  CB    . ASN A 1 598 ? 4.442   -15.853 17.359  1.00   55.88 ? 598  ASN A CB    1 
ATOM   4540 C  CG    . ASN A 1 598 ? 3.058   -16.333 16.958  1.00   53.98 ? 598  ASN A CG    1 
ATOM   4541 O  OD1   . ASN A 1 598 ? 2.297   -15.589 16.346  1.00   53.59 ? 598  ASN A OD1   1 
ATOM   4542 N  ND2   . ASN A 1 598 ? 2.732   -17.582 17.289  1.00   52.62 ? 598  ASN A ND2   1 
ATOM   4543 N  N     . LYS A 1 599 ? 4.191   -14.728 20.369  1.00   61.31 ? 599  LYS A N     1 
ATOM   4544 C  CA    . LYS A 1 599 ? 3.470   -14.766 21.640  1.00   65.49 ? 599  LYS A CA    1 
ATOM   4545 C  C     . LYS A 1 599 ? 3.949   -13.636 22.553  1.00   67.12 ? 599  LYS A C     1 
ATOM   4546 O  O     . LYS A 1 599 ? 5.151   -13.466 22.758  1.00   69.08 ? 599  LYS A O     1 
ATOM   4547 C  CB    . LYS A 1 599 ? 3.704   -16.108 22.328  1.00   68.01 ? 599  LYS A CB    1 
ATOM   4548 C  CG    . LYS A 1 599 ? 2.645   -16.495 23.351  1.00   70.37 ? 599  LYS A CG    1 
ATOM   4549 C  CD    . LYS A 1 599 ? 1.583   -17.385 22.702  1.00   70.43 ? 599  LYS A CD    1 
ATOM   4550 C  CE    . LYS A 1 599 ? 0.665   -18.079 23.718  1.00   70.02 ? 599  LYS A CE    1 
ATOM   4551 N  NZ    . LYS A 1 599 ? 0.007   -19.273 23.097  1.00   69.22 ? 599  LYS A NZ    1 
ATOM   4552 N  N     . ASP A 1 600 ? 3.012   -12.863 23.105  1.00   66.70 ? 600  ASP A N     1 
ATOM   4553 C  CA    . ASP A 1 600 ? 3.371   -11.742 23.983  1.00   63.90 ? 600  ASP A CA    1 
ATOM   4554 C  C     . ASP A 1 600 ? 4.054   -12.244 25.271  1.00   61.87 ? 600  ASP A C     1 
ATOM   4555 O  O     . ASP A 1 600 ? 3.450   -12.974 26.056  1.00   58.18 ? 600  ASP A O     1 
ATOM   4556 C  CB    . ASP A 1 600 ? 2.118   -10.917 24.307  1.00   64.40 ? 600  ASP A CB    1 
ATOM   4557 C  CG    . ASP A 1 600 ? 2.447   -9.562  24.908  1.00   66.96 ? 600  ASP A CG    1 
ATOM   4558 O  OD1   . ASP A 1 600 ? 3.510   -8.989  24.553  1.00   68.86 ? 600  ASP A OD1   1 
ATOM   4559 O  OD2   . ASP A 1 600 ? 1.634   -9.061  25.716  1.00   67.18 ? 600  ASP A OD2   1 
ATOM   4560 N  N     . PRO A 1 601 ? 5.323   -11.856 25.483  1.00   57.44 ? 601  PRO A N     1 
ATOM   4561 C  CA    . PRO A 1 601 ? 6.142   -12.233 26.641  1.00   57.00 ? 601  PRO A CA    1 
ATOM   4562 C  C     . PRO A 1 601 ? 6.030   -11.341 27.871  1.00   58.01 ? 601  PRO A C     1 
ATOM   4563 O  O     . PRO A 1 601 ? 7.021   -11.149 28.580  1.00   57.47 ? 601  PRO A O     1 
ATOM   4564 C  CB    . PRO A 1 601 ? 7.553   -12.200 26.072  1.00   55.57 ? 601  PRO A CB    1 
ATOM   4565 C  CG    . PRO A 1 601 ? 7.489   -10.956 25.225  1.00   54.24 ? 601  PRO A CG    1 
ATOM   4566 C  CD    . PRO A 1 601 ? 6.141   -11.121 24.500  1.00   55.83 ? 601  PRO A CD    1 
ATOM   4567 N  N     . ILE A 1 602 ? 4.855   -10.782 28.142  1.00   60.97 ? 602  ILE A N     1 
ATOM   4568 C  CA    . ILE A 1 602 ? 4.762   -9.939  29.323  1.00   64.14 ? 602  ILE A CA    1 
ATOM   4569 C  C     . ILE A 1 602 ? 4.490   -10.674 30.605  1.00   65.51 ? 602  ILE A C     1 
ATOM   4570 O  O     . ILE A 1 602 ? 3.711   -11.626 30.669  1.00   67.59 ? 602  ILE A O     1 
ATOM   4571 C  CB    . ILE A 1 602 ? 3.688   -8.824  29.222  1.00   64.49 ? 602  ILE A CB    1 
ATOM   4572 C  CG1   . ILE A 1 602 ? 2.490   -9.298  28.405  1.00   64.88 ? 602  ILE A CG1   1 
ATOM   4573 C  CG2   . ILE A 1 602 ? 4.325   -7.553  28.698  1.00   65.42 ? 602  ILE A CG2   1 
ATOM   4574 C  CD1   . ILE A 1 602 ? 1.714   -10.414 29.014  1.00   64.05 ? 602  ILE A CD1   1 
ATOM   4575 N  N     . ASN A 1 603 ? 5.171   -10.197 31.632  1.00   68.33 ? 603  ASN A N     1 
ATOM   4576 C  CA    . ASN A 1 603 ? 5.046   -10.683 32.994  1.00   69.76 ? 603  ASN A CA    1 
ATOM   4577 C  C     . ASN A 1 603 ? 3.578   -10.788 33.389  1.00   69.69 ? 603  ASN A C     1 
ATOM   4578 O  O     . ASN A 1 603 ? 2.917   -9.768  33.579  1.00   70.33 ? 603  ASN A O     1 
ATOM   4579 C  CB    . ASN A 1 603 ? 5.739   -9.681  33.887  1.00   70.83 ? 603  ASN A CB    1 
ATOM   4580 C  CG    . ASN A 1 603 ? 7.022   -10.193 34.427  1.00   71.91 ? 603  ASN A CG    1 
ATOM   4581 O  OD1   . ASN A 1 603 ? 7.698   -11.003 33.785  1.00   71.78 ? 603  ASN A OD1   1 
ATOM   4582 N  ND2   . ASN A 1 603 ? 7.383   -9.729  35.616  1.00   71.15 ? 603  ASN A ND2   1 
ATOM   4583 N  N     . GLU A 1 604 ? 3.068   -12.013 33.527  1.00   69.07 ? 604  GLU A N     1 
ATOM   4584 C  CA    . GLU A 1 604 ? 1.658   -12.210 33.886  1.00   67.99 ? 604  GLU A CA    1 
ATOM   4585 C  C     . GLU A 1 604 ? 1.318   -11.671 35.265  1.00   68.01 ? 604  GLU A C     1 
ATOM   4586 O  O     . GLU A 1 604 ? 0.150   -11.611 35.651  1.00   66.19 ? 604  GLU A O     1 
ATOM   4587 C  CB    . GLU A 1 604 ? 1.292   -13.679 33.806  1.00   67.40 ? 604  GLU A CB    1 
ATOM   4588 N  N     . ASN A 1 605 ? 2.350   -11.278 36.002  1.00   67.19 ? 605  ASN A N     1 
ATOM   4589 C  CA    . ASN A 1 605 ? 2.185   -10.733 37.340  1.00   66.57 ? 605  ASN A CA    1 
ATOM   4590 C  C     . ASN A 1 605 ? 1.914   -9.241  37.204  1.00   64.60 ? 605  ASN A C     1 
ATOM   4591 O  O     . ASN A 1 605 ? 0.991   -8.707  37.821  1.00   64.21 ? 605  ASN A O     1 
ATOM   4592 C  CB    . ASN A 1 605 ? 3.453   -11.006 38.153  1.00   68.57 ? 605  ASN A CB    1 
ATOM   4593 C  CG    . ASN A 1 605 ? 3.435   -10.352 39.506  1.00   71.61 ? 605  ASN A CG    1 
ATOM   4594 O  OD1   . ASN A 1 605 ? 2.380   -9.992  40.026  1.00   72.95 ? 605  ASN A OD1   1 
ATOM   4595 N  ND2   . ASN A 1 605 ? 4.611   -10.211 40.100  1.00   73.55 ? 605  ASN A ND2   1 
ATOM   4596 N  N     . VAL A 1 606 ? 2.732   -8.572  36.389  1.00   61.95 ? 606  VAL A N     1 
ATOM   4597 C  CA    . VAL A 1 606 ? 2.539   -7.151  36.115  1.00   60.38 ? 606  VAL A CA    1 
ATOM   4598 C  C     . VAL A 1 606 ? 1.172   -7.032  35.412  1.00   60.19 ? 606  VAL A C     1 
ATOM   4599 O  O     . VAL A 1 606 ? 0.481   -6.026  35.560  1.00   59.36 ? 606  VAL A O     1 
ATOM   4600 C  CB    . VAL A 1 606 ? 3.649   -6.602  35.196  1.00   58.72 ? 606  VAL A CB    1 
ATOM   4601 C  CG1   . VAL A 1 606 ? 3.308   -5.215  34.746  1.00   57.65 ? 606  VAL A CG1   1 
ATOM   4602 C  CG2   . VAL A 1 606 ? 4.975   -6.585  35.937  1.00   56.56 ? 606  VAL A CG2   1 
ATOM   4603 N  N     . VAL A 1 607 ? 0.793   -8.068  34.665  1.00   60.59 ? 607  VAL A N     1 
ATOM   4604 C  CA    . VAL A 1 607 ? -0.494  -8.075  33.986  1.00   60.44 ? 607  VAL A CA    1 
ATOM   4605 C  C     . VAL A 1 607 ? -1.599  -7.981  35.038  1.00   60.66 ? 607  VAL A C     1 
ATOM   4606 O  O     . VAL A 1 607 ? -2.429  -7.067  35.016  1.00   61.03 ? 607  VAL A O     1 
ATOM   4607 C  CB    . VAL A 1 607 ? -0.712  -9.369  33.193  1.00   60.69 ? 607  VAL A CB    1 
ATOM   4608 C  CG1   . VAL A 1 607 ? -2.037  -9.313  32.487  1.00   61.17 ? 607  VAL A CG1   1 
ATOM   4609 C  CG2   . VAL A 1 607 ? 0.405   -9.571  32.201  1.00   61.63 ? 607  VAL A CG2   1 
ATOM   4610 N  N     . ALA A 1 608 ? -1.597  -8.950  35.962  1.00   60.66 ? 608  ALA A N     1 
ATOM   4611 C  CA    . ALA A 1 608 ? -2.565  -9.029  37.054  1.00   60.00 ? 608  ALA A CA    1 
ATOM   4612 C  C     . ALA A 1 608 ? -2.806  -7.667  37.714  1.00   59.20 ? 608  ALA A C     1 
ATOM   4613 O  O     . ALA A 1 608 ? -3.957  -7.265  37.900  1.00   61.55 ? 608  ALA A O     1 
ATOM   4614 C  CB    . ALA A 1 608 ? -2.077  -10.044 38.101  1.00   61.75 ? 608  ALA A CB    1 
ATOM   4615 N  N     . LEU A 1 609 ? -1.737  -6.962  38.063  1.00   57.96 ? 609  LEU A N     1 
ATOM   4616 C  CA    . LEU A 1 609 ? -1.882  -5.642  38.684  1.00   57.15 ? 609  LEU A CA    1 
ATOM   4617 C  C     . LEU A 1 609 ? -2.684  -4.681  37.805  1.00   56.66 ? 609  LEU A C     1 
ATOM   4618 O  O     . LEU A 1 609 ? -3.621  -4.026  38.271  1.00   57.38 ? 609  LEU A O     1 
ATOM   4619 C  CB    . LEU A 1 609 ? -0.515  -5.011  38.964  1.00   54.12 ? 609  LEU A CB    1 
ATOM   4620 C  CG    . LEU A 1 609 ? 0.419   -5.714  39.953  1.00   51.34 ? 609  LEU A CG    1 
ATOM   4621 C  CD1   . LEU A 1 609 ? 1.599   -4.814  40.244  1.00   48.29 ? 609  LEU A CD1   1 
ATOM   4622 C  CD2   . LEU A 1 609 ? -0.331  -6.038  41.254  1.00   49.27 ? 609  LEU A CD2   1 
ATOM   4623 N  N     . LEU A 1 610 ? -2.303  -4.604  36.525  1.00   54.95 ? 610  LEU A N     1 
ATOM   4624 C  CA    . LEU A 1 610 ? -2.939  -3.712  35.560  1.00   53.84 ? 610  LEU A CA    1 
ATOM   4625 C  C     . LEU A 1 610 ? -4.385  -4.094  35.341  1.00   54.12 ? 610  LEU A C     1 
ATOM   4626 O  O     . LEU A 1 610 ? -5.233  -3.237  35.083  1.00   54.65 ? 610  LEU A O     1 
ATOM   4627 C  CB    . LEU A 1 610 ? -2.172  -3.757  34.229  1.00   51.43 ? 610  LEU A CB    1 
ATOM   4628 C  CG    . LEU A 1 610 ? -0.741  -3.195  34.252  1.00   48.56 ? 610  LEU A CG    1 
ATOM   4629 C  CD1   . LEU A 1 610 ? -0.010  -3.556  32.980  1.00   47.80 ? 610  LEU A CD1   1 
ATOM   4630 C  CD2   . LEU A 1 610 ? -0.775  -1.694  34.416  1.00   47.27 ? 610  LEU A CD2   1 
ATOM   4631 N  N     . GLY A 1 611 ? -4.678  -5.383  35.442  1.00   54.09 ? 611  GLY A N     1 
ATOM   4632 C  CA    . GLY A 1 611 ? -6.042  -5.828  35.250  1.00   54.35 ? 611  GLY A CA    1 
ATOM   4633 C  C     . GLY A 1 611 ? -6.913  -5.247  36.339  1.00   54.86 ? 611  GLY A C     1 
ATOM   4634 O  O     . GLY A 1 611 ? -8.134  -5.192  36.219  1.00   54.16 ? 611  GLY A O     1 
ATOM   4635 N  N     . ALA A 1 612 ? -6.269  -4.801  37.402  1.00   55.41 ? 612  ALA A N     1 
ATOM   4636 C  CA    . ALA A 1 612 ? -6.978  -4.227  38.521  1.00   55.72 ? 612  ALA A CA    1 
ATOM   4637 C  C     . ALA A 1 612 ? -6.629  -2.757  38.719  1.00   56.25 ? 612  ALA A C     1 
ATOM   4638 O  O     . ALA A 1 612 ? -6.669  -2.244  39.841  1.00   54.46 ? 612  ALA A O     1 
ATOM   4639 C  CB    . ALA A 1 612 ? -6.668  -5.039  39.786  1.00   55.90 ? 612  ALA A CB    1 
ATOM   4640 N  N     . SER A 1 613 ? -6.295  -2.076  37.630  1.00   57.64 ? 613  SER A N     1 
ATOM   4641 C  CA    . SER A 1 613 ? -5.947  -0.663  37.681  1.00   58.62 ? 613  SER A CA    1 
ATOM   4642 C  C     . SER A 1 613 ? -7.131  0.232   38.028  1.00   61.29 ? 613  SER A C     1 
ATOM   4643 O  O     . SER A 1 613 ? -8.290  -0.159  37.899  1.00   59.56 ? 613  SER A O     1 
ATOM   4644 C  CB    . SER A 1 613 ? -5.385  -0.195  36.336  1.00   57.38 ? 613  SER A CB    1 
ATOM   4645 O  OG    . SER A 1 613 ? -5.155  1.209   36.357  1.00   58.21 ? 613  SER A OG    1 
ATOM   4646 N  N     . LYS A 1 614 ? -6.806  1.447   38.457  1.00   65.57 ? 614  LYS A N     1 
ATOM   4647 C  CA    . LYS A 1 614 ? -7.801  2.449   38.802  1.00   69.19 ? 614  LYS A CA    1 
ATOM   4648 C  C     . LYS A 1 614 ? -8.264  3.147   37.516  1.00   68.37 ? 614  LYS A C     1 
ATOM   4649 O  O     . LYS A 1 614 ? -9.422  3.551   37.393  1.00   67.06 ? 614  LYS A O     1 
ATOM   4650 C  CB    . LYS A 1 614 ? -7.180  3.465   39.762  1.00   75.94 ? 614  LYS A CB    1 
ATOM   4651 C  CG    . LYS A 1 614 ? -7.949  3.640   41.055  1.00   88.35 ? 614  LYS A CG    1 
ATOM   4652 C  CD    . LYS A 1 614 ? -8.177  2.319   41.768  1.00   94.14 ? 614  LYS A CD    1 
ATOM   4653 C  CE    . LYS A 1 614 ? -9.045  2.520   43.011  1.00   96.33 ? 614  LYS A CE    1 
ATOM   4654 N  NZ    . LYS A 1 614 ? -10.408 3.044   42.679  1.00   96.90 ? 614  LYS A NZ    1 
ATOM   4655 N  N     . GLU A 1 615 ? -7.338  3.281   36.568  1.00   65.42 ? 615  GLU A N     1 
ATOM   4656 C  CA    . GLU A 1 615 ? -7.592  3.905   35.269  1.00   62.16 ? 615  GLU A CA    1 
ATOM   4657 C  C     . GLU A 1 615 ? -8.466  2.967   34.437  1.00   61.44 ? 615  GLU A C     1 
ATOM   4658 O  O     . GLU A 1 615 ? -8.069  1.841   34.143  1.00   56.96 ? 615  GLU A O     1 
ATOM   4659 C  CB    . GLU A 1 615 ? -6.247  4.162   34.569  1.00   60.28 ? 615  GLU A CB    1 
ATOM   4660 C  CG    . GLU A 1 615 ? -6.317  4.241   33.039  1.00   64.58 ? 615  GLU A CG    1 
ATOM   4661 C  CD    . GLU A 1 615 ? -7.110  5.435   32.531  1.00   65.80 ? 615  GLU A CD    1 
ATOM   4662 O  OE1   . GLU A 1 615 ? -6.622  6.583   32.683  1.00   65.81 ? 615  GLU A OE1   1 
ATOM   4663 O  OE2   . GLU A 1 615 ? -8.218  5.213   31.986  1.00   66.51 ? 615  GLU A OE2   1 
ATOM   4664 N  N     . PRO A 1 616 ? -9.675  3.416   34.041  1.00   58.13 ? 616  PRO A N     1 
ATOM   4665 C  CA    . PRO A 1 616 ? -10.578 2.567   33.244  1.00   55.49 ? 616  PRO A CA    1 
ATOM   4666 C  C     . PRO A 1 616 ? -10.016 2.003   31.941  1.00   52.97 ? 616  PRO A C     1 
ATOM   4667 O  O     . PRO A 1 616 ? -10.352 0.887   31.557  1.00   49.03 ? 616  PRO A O     1 
ATOM   4668 C  CB    . PRO A 1 616 ? -11.796 3.466   33.003  1.00   56.72 ? 616  PRO A CB    1 
ATOM   4669 C  CG    . PRO A 1 616 ? -11.213 4.845   33.016  1.00   60.70 ? 616  PRO A CG    1 
ATOM   4670 C  CD    . PRO A 1 616 ? -10.245 4.764   34.203  1.00   58.25 ? 616  PRO A CD    1 
ATOM   4671 N  N     . LEU A 1 617 ? -9.161  2.772   31.265  1.00   48.34 ? 617  LEU A N     1 
ATOM   4672 C  CA    . LEU A 1 617 ? -8.604  2.301   30.002  1.00   45.54 ? 617  LEU A CA    1 
ATOM   4673 C  C     . LEU A 1 617 ? -7.610  1.187   30.228  1.00   44.35 ? 617  LEU A C     1 
ATOM   4674 O  O     . LEU A 1 617 ? -7.688  0.145   29.581  1.00   45.77 ? 617  LEU A O     1 
ATOM   4675 C  CB    . LEU A 1 617 ? -7.933  3.447   29.214  1.00   43.09 ? 617  LEU A CB    1 
ATOM   4676 C  CG    . LEU A 1 617 ? -7.383  3.009   27.858  1.00   39.08 ? 617  LEU A CG    1 
ATOM   4677 C  CD1   . LEU A 1 617 ? -8.450  2.304   27.055  1.00   36.99 ? 617  LEU A CD1   1 
ATOM   4678 C  CD2   . LEU A 1 617 ? -6.867  4.203   27.112  1.00   39.05 ? 617  LEU A CD2   1 
ATOM   4679 N  N     . VAL A 1 618 ? -6.678  1.399   31.130  1.00   46.61 ? 618  VAL A N     1 
ATOM   4680 C  CA    . VAL A 1 618 ? -5.707  0.372   31.437  1.00   47.45 ? 618  VAL A CA    1 
ATOM   4681 C  C     . VAL A 1 618 ? -6.455  -0.882  31.885  1.00   48.72 ? 618  VAL A C     1 
ATOM   4682 O  O     . VAL A 1 618 ? -6.160  -1.992  31.430  1.00   50.79 ? 618  VAL A O     1 
ATOM   4683 C  CB    . VAL A 1 618 ? -4.756  0.844   32.533  1.00   46.50 ? 618  VAL A CB    1 
ATOM   4684 C  CG1   . VAL A 1 618 ? -3.908  -0.312  33.036  1.00   43.92 ? 618  VAL A CG1   1 
ATOM   4685 C  CG2   . VAL A 1 618 ? -3.865  1.979   31.982  1.00   42.93 ? 618  VAL A CG2   1 
ATOM   4686 N  N     . ALA A 1 619 ? -7.435  -0.705  32.766  1.00   50.27 ? 619  ALA A N     1 
ATOM   4687 C  CA    . ALA A 1 619 ? -8.213  -1.846  33.250  1.00   52.21 ? 619  ALA A CA    1 
ATOM   4688 C  C     . ALA A 1 619 ? -8.682  -2.647  32.053  1.00   54.40 ? 619  ALA A C     1 
ATOM   4689 O  O     . ALA A 1 619 ? -8.347  -3.826  31.906  1.00   55.21 ? 619  ALA A O     1 
ATOM   4690 C  CB    . ALA A 1 619 ? -9.420  -1.362  34.081  1.00   54.09 ? 619  ALA A CB    1 
ATOM   4691 N  N     . GLU A 1 620 ? -9.463  -2.004  31.190  1.00   55.01 ? 620  GLU A N     1 
ATOM   4692 C  CA    . GLU A 1 620 ? -9.992  -2.650  29.999  1.00   53.00 ? 620  GLU A CA    1 
ATOM   4693 C  C     . GLU A 1 620 ? -8.884  -3.227  29.112  1.00   50.75 ? 620  GLU A C     1 
ATOM   4694 O  O     . GLU A 1 620 ? -9.015  -4.337  28.609  1.00   49.52 ? 620  GLU A O     1 
ATOM   4695 C  CB    . GLU A 1 620 ? -10.817 -1.648  29.204  1.00   53.73 ? 620  GLU A CB    1 
ATOM   4696 C  CG    . GLU A 1 620 ? -11.543 -2.210  28.002  1.00   58.17 ? 620  GLU A CG    1 
ATOM   4697 C  CD    . GLU A 1 620 ? -12.201 -1.102  27.191  1.00   61.41 ? 620  GLU A CD    1 
ATOM   4698 O  OE1   . GLU A 1 620 ? -12.054 0.073   27.591  1.00   63.46 ? 620  GLU A OE1   1 
ATOM   4699 O  OE2   . GLU A 1 620 ? -12.853 -1.389  26.164  1.00   62.86 ? 620  GLU A OE2   1 
ATOM   4700 N  N     . LEU A 1 621 ? -7.799  -2.476  28.915  1.00   48.15 ? 621  LEU A N     1 
ATOM   4701 C  CA    . LEU A 1 621 ? -6.708  -2.966  28.071  1.00   49.01 ? 621  LEU A CA    1 
ATOM   4702 C  C     . LEU A 1 621 ? -6.149  -4.302  28.544  1.00   50.33 ? 621  LEU A C     1 
ATOM   4703 O  O     . LEU A 1 621 ? -5.633  -5.080  27.744  1.00   53.19 ? 621  LEU A O     1 
ATOM   4704 C  CB    . LEU A 1 621 ? -5.573  -1.935  27.961  1.00   43.47 ? 621  LEU A CB    1 
ATOM   4705 C  CG    . LEU A 1 621 ? -5.870  -0.733  27.036  1.00   39.91 ? 621  LEU A CG    1 
ATOM   4706 C  CD1   . LEU A 1 621 ? -4.602  0.062   26.766  1.00   34.62 ? 621  LEU A CD1   1 
ATOM   4707 C  CD2   . LEU A 1 621 ? -6.483  -1.224  25.732  1.00   33.49 ? 621  LEU A CD2   1 
ATOM   4708 N  N     . PHE A 1 622 ? -6.247  -4.572  29.845  1.00   54.42 ? 622  PHE A N     1 
ATOM   4709 C  CA    . PHE A 1 622 ? -5.756  -5.834  30.383  1.00   56.95 ? 622  PHE A CA    1 
ATOM   4710 C  C     . PHE A 1 622 ? -6.865  -6.615  31.073  1.00   59.30 ? 622  PHE A C     1 
ATOM   4711 O  O     . PHE A 1 622 ? -6.770  -6.929  32.256  1.00   61.50 ? 622  PHE A O     1 
ATOM   4712 C  CB    . PHE A 1 622 ? -4.608  -5.586  31.352  1.00   53.83 ? 622  PHE A CB    1 
ATOM   4713 C  CG    . PHE A 1 622 ? -3.340  -5.112  30.686  1.00   50.69 ? 622  PHE A CG    1 
ATOM   4714 C  CD1   . PHE A 1 622 ? -3.115  -3.752  30.465  1.00   48.46 ? 622  PHE A CD1   1 
ATOM   4715 C  CD2   . PHE A 1 622 ? -2.359  -6.024  30.299  1.00   48.69 ? 622  PHE A CD2   1 
ATOM   4716 C  CE1   . PHE A 1 622 ? -1.936  -3.310  29.877  1.00   47.35 ? 622  PHE A CE1   1 
ATOM   4717 C  CE2   . PHE A 1 622 ? -1.173  -5.592  29.708  1.00   47.80 ? 622  PHE A CE2   1 
ATOM   4718 C  CZ    . PHE A 1 622 ? -0.960  -4.231  29.497  1.00   47.18 ? 622  PHE A CZ    1 
ATOM   4719 N  N     . LYS A 1 623 ? -7.916  -6.932  30.332  1.00   63.89 ? 623  LYS A N     1 
ATOM   4720 C  CA    . LYS A 1 623 ? -9.046  -7.674  30.878  1.00   68.78 ? 623  LYS A CA    1 
ATOM   4721 C  C     . LYS A 1 623 ? -9.018  -9.136  30.434  1.00   70.28 ? 623  LYS A C     1 
ATOM   4722 O  O     . LYS A 1 623 ? -8.943  -9.431  29.238  1.00   73.53 ? 623  LYS A O     1 
ATOM   4723 C  CB    . LYS A 1 623 ? -10.364 -7.023  30.444  1.00   70.73 ? 623  LYS A CB    1 
ATOM   4724 C  CG    . LYS A 1 623 ? -11.619 -7.677  31.006  1.00   71.29 ? 623  LYS A CG    1 
ATOM   4725 C  CD    . LYS A 1 623 ? -12.882 -6.997  30.481  1.00   71.50 ? 623  LYS A CD    1 
ATOM   4726 C  CE    . LYS A 1 623 ? -13.006 -7.145  28.971  1.00   71.67 ? 623  LYS A CE    1 
ATOM   4727 N  NZ    . LYS A 1 623 ? -14.266 -6.550  28.448  1.00   71.84 ? 623  LYS A NZ    1 
ATOM   4728 N  N     . ALA A 1 624 ? -9.076  -10.040 31.407  1.00   71.87 ? 624  ALA A N     1 
ATOM   4729 C  CA    . ALA A 1 624 ? -9.059  -11.476 31.158  1.00   72.40 ? 624  ALA A CA    1 
ATOM   4730 C  C     . ALA A 1 624 ? -9.880  -11.857 29.932  1.00   72.91 ? 624  ALA A C     1 
ATOM   4731 O  O     . ALA A 1 624 ? -9.353  -12.447 28.985  1.00   74.50 ? 624  ALA A O     1 
ATOM   4732 C  CB    . ALA A 1 624 ? -9.578  -12.219 32.384  1.00   72.43 ? 624  ALA A CB    1 
ATOM   4733 N  N     . GLN A 1 643 ? -4.494  -17.220 20.351  1.00   70.13 ? 643  GLN A N     1 
ATOM   4734 C  CA    . GLN A 1 643 ? -4.651  -15.770 20.380  1.00   69.23 ? 643  GLN A CA    1 
ATOM   4735 C  C     . GLN A 1 643 ? -3.291  -15.062 20.328  1.00   66.22 ? 643  GLN A C     1 
ATOM   4736 O  O     . GLN A 1 643 ? -2.987  -14.176 21.126  1.00   65.71 ? 643  GLN A O     1 
ATOM   4737 C  CB    . GLN A 1 643 ? -5.448  -15.368 21.625  1.00   72.33 ? 643  GLN A CB    1 
ATOM   4738 C  CG    . GLN A 1 643 ? -6.915  -15.826 21.549  1.00   77.58 ? 643  GLN A CG    1 
ATOM   4739 C  CD    . GLN A 1 643 ? -7.653  -15.728 22.875  1.00   79.46 ? 643  GLN A CD    1 
ATOM   4740 O  OE1   . GLN A 1 643 ? -8.871  -15.892 22.930  1.00   79.28 ? 643  GLN A OE1   1 
ATOM   4741 N  NE2   . GLN A 1 643 ? -6.913  -15.473 23.950  1.00   80.67 ? 643  GLN A NE2   1 
ATOM   4742 N  N     . THR A 1 644 ? -2.490  -15.493 19.350  1.00   60.90 ? 644  THR A N     1 
ATOM   4743 C  CA    . THR A 1 644 ? -1.143  -14.989 19.069  1.00   55.89 ? 644  THR A CA    1 
ATOM   4744 C  C     . THR A 1 644 ? -1.185  -14.118 17.793  1.00   53.78 ? 644  THR A C     1 
ATOM   4745 O  O     . THR A 1 644 ? -2.217  -14.050 17.123  1.00   51.87 ? 644  THR A O     1 
ATOM   4746 C  CB    . THR A 1 644 ? -0.171  -16.169 18.814  1.00   53.72 ? 644  THR A CB    1 
ATOM   4747 O  OG1   . THR A 1 644 ? -0.641  -16.952 17.702  1.00   49.31 ? 644  THR A OG1   1 
ATOM   4748 C  CG2   . THR A 1 644 ? -0.108  -17.067 20.038  1.00   50.05 ? 644  THR A CG2   1 
ATOM   4749 N  N     . ILE A 1 645 ? -0.070  -13.478 17.470  1.00   51.95 ? 645  ILE A N     1 
ATOM   4750 C  CA    . ILE A 1 645 ? 0.008   -12.615 16.295  1.00   51.54 ? 645  ILE A CA    1 
ATOM   4751 C  C     . ILE A 1 645 ? -0.297  -13.373 15.022  1.00   51.59 ? 645  ILE A C     1 
ATOM   4752 O  O     . ILE A 1 645 ? -1.086  -12.922 14.194  1.00   51.64 ? 645  ILE A O     1 
ATOM   4753 C  CB    . ILE A 1 645 ? 1.387   -11.961 16.189  1.00   50.79 ? 645  ILE A CB    1 
ATOM   4754 C  CG1   . ILE A 1 645 ? 1.489   -10.834 17.210  1.00   49.15 ? 645  ILE A CG1   1 
ATOM   4755 C  CG2   . ILE A 1 645 ? 1.608   -11.423 14.794  1.00   51.62 ? 645  ILE A CG2   1 
ATOM   4756 C  CD1   . ILE A 1 645 ? 2.864   -10.250 17.302  1.00   50.41 ? 645  ILE A CD1   1 
ATOM   4757 N  N     . SER A 1 646 ? 0.316   -14.540 14.873  1.00   51.33 ? 646  SER A N     1 
ATOM   4758 C  CA    . SER A 1 646 ? 0.072   -15.340 13.697  1.00   51.47 ? 646  SER A CA    1 
ATOM   4759 C  C     . SER A 1 646 ? -1.375  -15.798 13.706  1.00   51.62 ? 646  SER A C     1 
ATOM   4760 O  O     . SER A 1 646 ? -2.048  -15.767 12.666  1.00   51.36 ? 646  SER A O     1 
ATOM   4761 C  CB    . SER A 1 646 ? 0.997   -16.547 13.660  1.00   52.94 ? 646  SER A CB    1 
ATOM   4762 O  OG    . SER A 1 646 ? 0.570   -17.514 14.590  1.00   56.08 ? 646  SER A OG    1 
ATOM   4763 N  N     . ALA A 1 647 ? -1.871  -16.221 14.866  1.00   49.44 ? 647  ALA A N     1 
ATOM   4764 C  CA    . ALA A 1 647 ? -3.253  -16.676 14.929  1.00   48.03 ? 647  ALA A CA    1 
ATOM   4765 C  C     . ALA A 1 647 ? -4.201  -15.545 14.558  1.00   46.90 ? 647  ALA A C     1 
ATOM   4766 O  O     . ALA A 1 647 ? -5.070  -15.709 13.709  1.00   44.63 ? 647  ALA A O     1 
ATOM   4767 C  CB    . ALA A 1 647 ? -3.588  -17.211 16.324  1.00   46.80 ? 647  ALA A CB    1 
ATOM   4768 N  N     . VAL A 1 648 ? -4.028  -14.404 15.211  1.00   46.78 ? 648  VAL A N     1 
ATOM   4769 C  CA    . VAL A 1 648 ? -4.846  -13.232 14.943  1.00   46.48 ? 648  VAL A CA    1 
ATOM   4770 C  C     . VAL A 1 648 ? -4.781  -12.818 13.456  1.00   45.85 ? 648  VAL A C     1 
ATOM   4771 O  O     . VAL A 1 648 ? -5.805  -12.543 12.847  1.00   46.60 ? 648  VAL A O     1 
ATOM   4772 C  CB    . VAL A 1 648 ? -4.386  -12.047 15.825  1.00   47.83 ? 648  VAL A CB    1 
ATOM   4773 C  CG1   . VAL A 1 648 ? -5.051  -10.752 15.350  1.00   48.67 ? 648  VAL A CG1   1 
ATOM   4774 C  CG2   . VAL A 1 648 ? -4.713  -12.346 17.298  1.00   48.52 ? 648  VAL A CG2   1 
ATOM   4775 N  N     . HIS A 1 649 ? -3.577  -12.795 12.889  1.00   46.85 ? 649  HIS A N     1 
ATOM   4776 C  CA    . HIS A 1 649 ? -3.393  -12.414 11.486  1.00   48.18 ? 649  HIS A CA    1 
ATOM   4777 C  C     . HIS A 1 649 ? -4.070  -13.343 10.510  1.00   49.58 ? 649  HIS A C     1 
ATOM   4778 O  O     . HIS A 1 649 ? -4.558  -12.900 9.463   1.00   50.97 ? 649  HIS A O     1 
ATOM   4779 C  CB    . HIS A 1 649 ? -1.911  -12.312 11.110  1.00   47.67 ? 649  HIS A CB    1 
ATOM   4780 C  CG    . HIS A 1 649 ? -1.693  -11.698 9.763   1.00   47.14 ? 649  HIS A CG    1 
ATOM   4781 N  ND1   . HIS A 1 649 ? -2.284  -10.515 9.384   1.00   45.52 ? 649  HIS A ND1   1 
ATOM   4782 C  CD2   . HIS A 1 649 ? -0.999  -12.134 8.684   1.00   46.52 ? 649  HIS A CD2   1 
ATOM   4783 C  CE1   . HIS A 1 649 ? -1.974  -10.247 8.131   1.00   45.43 ? 649  HIS A CE1   1 
ATOM   4784 N  NE2   . HIS A 1 649 ? -1.193  -11.214 7.678   1.00   45.43 ? 649  HIS A NE2   1 
ATOM   4785 N  N     . ARG A 1 650 ? -4.114  -14.626 10.826  1.00   49.86 ? 650  ARG A N     1 
ATOM   4786 C  CA    . ARG A 1 650 ? -4.776  -15.561 9.940   1.00   49.94 ? 650  ARG A CA    1 
ATOM   4787 C  C     . ARG A 1 650 ? -6.245  -15.202 9.856   1.00   50.17 ? 650  ARG A C     1 
ATOM   4788 O  O     . ARG A 1 650 ? -6.810  -15.165 8.757   1.00   47.22 ? 650  ARG A O     1 
ATOM   4789 C  CB    . ARG A 1 650 ? -4.644  -17.007 10.431  1.00   52.66 ? 650  ARG A CB    1 
ATOM   4790 C  CG    . ARG A 1 650 ? -3.728  -17.849 9.601   1.00   57.43 ? 650  ARG A CG    1 
ATOM   4791 C  CD    . ARG A 1 650 ? -2.366  -17.974 10.237  1.00   61.62 ? 650  ARG A CD    1 
ATOM   4792 N  NE    . ARG A 1 650 ? -2.412  -18.830 11.421  1.00   64.18 ? 650  ARG A NE    1 
ATOM   4793 C  CZ    . ARG A 1 650 ? -2.759  -20.115 11.408  1.00   65.14 ? 650  ARG A CZ    1 
ATOM   4794 N  NH1   . ARG A 1 650 ? -3.092  -20.715 10.265  1.00   64.99 ? 650  ARG A NH1   1 
ATOM   4795 N  NH2   . ARG A 1 650 ? -2.780  -20.801 12.546  1.00   66.17 ? 650  ARG A NH2   1 
ATOM   4796 N  N     . GLU A 1 651 ? -6.886  -14.945 10.996  1.00   47.61 ? 651  GLU A N     1 
ATOM   4797 C  CA    . GLU A 1 651 ? -8.305  -14.607 10.943  1.00   45.70 ? 651  GLU A CA    1 
ATOM   4798 C  C     . GLU A 1 651 ? -8.545  -13.306 10.180  1.00   43.24 ? 651  GLU A C     1 
ATOM   4799 O  O     . GLU A 1 651 ? -9.436  -13.239 9.345   1.00   40.78 ? 651  GLU A O     1 
ATOM   4800 C  CB    . GLU A 1 651 ? -8.921  -14.476 12.333  1.00   49.02 ? 651  GLU A CB    1 
ATOM   4801 C  CG    . GLU A 1 651 ? -10.021 -15.478 12.655  1.00   58.79 ? 651  GLU A CG    1 
ATOM   4802 C  CD    . GLU A 1 651 ? -11.114 -15.661 11.593  1.00   64.19 ? 651  GLU A CD    1 
ATOM   4803 O  OE1   . GLU A 1 651 ? -12.276 -15.868 12.010  1.00   67.37 ? 651  GLU A OE1   1 
ATOM   4804 O  OE2   . GLU A 1 651 ? -10.850 -15.647 10.367  1.00   66.93 ? 651  GLU A OE2   1 
ATOM   4805 N  N     . SER A 1 652 ? -7.751  -12.275 10.480  1.00   41.24 ? 652  SER A N     1 
ATOM   4806 C  CA    . SER A 1 652 ? -7.886  -11.007 9.784   1.00   39.73 ? 652  SER A CA    1 
ATOM   4807 C  C     . SER A 1 652 ? -7.737  -11.254 8.301   1.00   39.82 ? 652  SER A C     1 
ATOM   4808 O  O     . SER A 1 652 ? -8.576  -10.836 7.503   1.00   40.92 ? 652  SER A O     1 
ATOM   4809 C  CB    . SER A 1 652 ? -6.811  -10.024 10.226  1.00   38.90 ? 652  SER A CB    1 
ATOM   4810 O  OG    . SER A 1 652 ? -7.177  -9.368  11.431  1.00   41.23 ? 652  SER A OG    1 
ATOM   4811 N  N     . LEU A 1 653 ? -6.668  -11.940 7.928   1.00   41.12 ? 653  LEU A N     1 
ATOM   4812 C  CA    . LEU A 1 653 ? -6.435  -12.216 6.528   1.00   42.63 ? 653  LEU A CA    1 
ATOM   4813 C  C     . LEU A 1 653 ? -7.567  -12.991 5.854   1.00   43.58 ? 653  LEU A C     1 
ATOM   4814 O  O     . LEU A 1 653 ? -7.972  -12.637 4.739   1.00   43.78 ? 653  LEU A O     1 
ATOM   4815 C  CB    . LEU A 1 653 ? -5.107  -12.945 6.335   1.00   44.04 ? 653  LEU A CB    1 
ATOM   4816 C  CG    . LEU A 1 653 ? -4.672  -12.962 4.873   1.00   45.59 ? 653  LEU A CG    1 
ATOM   4817 C  CD1   . LEU A 1 653 ? -4.678  -11.521 4.324   1.00   46.38 ? 653  LEU A CD1   1 
ATOM   4818 C  CD2   . LEU A 1 653 ? -3.297  -13.570 4.772   1.00   46.31 ? 653  LEU A CD2   1 
ATOM   4819 N  N     . ASN A 1 654 ? -8.087  -14.034 6.496   1.00   43.81 ? 654  ASN A N     1 
ATOM   4820 C  CA    . ASN A 1 654 ? -9.191  -14.793 5.907   1.00   44.14 ? 654  ASN A CA    1 
ATOM   4821 C  C     . ASN A 1 654 ? -10.410 -13.908 5.654   1.00   43.94 ? 654  ASN A C     1 
ATOM   4822 O  O     . ASN A 1 654 ? -11.104 -14.063 4.646   1.00   43.08 ? 654  ASN A O     1 
ATOM   4823 C  CB    . ASN A 1 654 ? -9.618  -15.967 6.810   1.00   45.86 ? 654  ASN A CB    1 
ATOM   4824 C  CG    . ASN A 1 654 ? -8.710  -17.187 6.668   1.00   47.79 ? 654  ASN A CG    1 
ATOM   4825 O  OD1   . ASN A 1 654 ? -8.122  -17.438 5.604   1.00   48.94 ? 654  ASN A OD1   1 
ATOM   4826 N  ND2   . ASN A 1 654 ? -8.616  -17.965 7.740   1.00   48.44 ? 654  ASN A ND2   1 
ATOM   4827 N  N     . LYS A 1 655 ? -10.655 -12.986 6.570   1.00   43.55 ? 655  LYS A N     1 
ATOM   4828 C  CA    . LYS A 1 655 ? -11.771 -12.058 6.476   1.00   43.73 ? 655  LYS A CA    1 
ATOM   4829 C  C     . LYS A 1 655 ? -11.532 -11.084 5.319   1.00   42.48 ? 655  LYS A C     1 
ATOM   4830 O  O     . LYS A 1 655 ? -12.442 -10.812 4.536   1.00   43.84 ? 655  LYS A O     1 
ATOM   4831 C  CB    . LYS A 1 655 ? -11.905 -11.286 7.795   1.00   46.61 ? 655  LYS A CB    1 
ATOM   4832 C  CG    . LYS A 1 655 ? -13.227 -10.588 7.970   1.00   51.42 ? 655  LYS A CG    1 
ATOM   4833 C  CD    . LYS A 1 655 ? -13.202 -9.670  9.168   1.00   54.06 ? 655  LYS A CD    1 
ATOM   4834 C  CE    . LYS A 1 655 ? -14.577 -9.013  9.396   1.00   56.00 ? 655  LYS A CE    1 
ATOM   4835 N  NZ    . LYS A 1 655 ? -14.489 -7.810  10.287  1.00   56.81 ? 655  LYS A NZ    1 
ATOM   4836 N  N     . LEU A 1 656 ? -10.323 -10.571 5.191   1.00   39.69 ? 656  LEU A N     1 
ATOM   4837 C  CA    . LEU A 1 656 ? -10.037 -9.645  4.104   1.00   38.44 ? 656  LEU A CA    1 
ATOM   4838 C  C     . LEU A 1 656 ? -10.270 -10.319 2.764   1.00   39.04 ? 656  LEU A C     1 
ATOM   4839 O  O     . LEU A 1 656 ? -11.018 -9.805  1.922   1.00   40.26 ? 656  LEU A O     1 
ATOM   4840 C  CB    . LEU A 1 656 ? -8.605  -9.114  4.204   1.00   34.38 ? 656  LEU A CB    1 
ATOM   4841 C  CG    . LEU A 1 656 ? -8.103  -8.307  3.000   1.00   33.50 ? 656  LEU A CG    1 
ATOM   4842 C  CD1   . LEU A 1 656 ? -9.034  -7.107  2.769   1.00   31.55 ? 656  LEU A CD1   1 
ATOM   4843 C  CD2   . LEU A 1 656 ? -6.634  -7.841  3.240   1.00   31.10 ? 656  LEU A CD2   1 
ATOM   4844 N  N     . MET A 1 657 ? -9.663  -11.487 2.557   1.00   42.38 ? 657  MET A N     1 
ATOM   4845 C  CA    . MET A 1 657 ? -9.819  -12.185 1.275   1.00   42.39 ? 657  MET A CA    1 
ATOM   4846 C  C     . MET A 1 657 ? -11.276 -12.452 0.960   1.00   42.00 ? 657  MET A C     1 
ATOM   4847 O  O     . MET A 1 657 ? -11.734 -12.294 -0.170  1.00   41.47 ? 657  MET A O     1 
ATOM   4848 C  CB    . MET A 1 657 ? -9.021  -13.493 1.256   1.00   41.37 ? 657  MET A CB    1 
ATOM   4849 C  CG    . MET A 1 657 ? -7.517  -13.278 1.411   1.00   42.72 ? 657  MET A CG    1 
ATOM   4850 S  SD    . MET A 1 657 ? -6.859  -11.738 0.605   1.00   42.66 ? 657  MET A SD    1 
ATOM   4851 C  CE    . MET A 1 657 ? -6.991  -12.180 -1.093  1.00   41.11 ? 657  MET A CE    1 
ATOM   4852 N  N     . LYS A 1 658 ? -12.019 -12.839 1.980   1.00   43.02 ? 658  LYS A N     1 
ATOM   4853 C  CA    . LYS A 1 658 ? -13.431 -13.098 1.789   1.00   44.21 ? 658  LYS A CA    1 
ATOM   4854 C  C     . LYS A 1 658 ? -14.183 -11.858 1.307   1.00   44.13 ? 658  LYS A C     1 
ATOM   4855 O  O     . LYS A 1 658 ? -15.061 -11.942 0.460   1.00   43.66 ? 658  LYS A O     1 
ATOM   4856 C  CB    . LYS A 1 658 ? -14.024 -13.592 3.073   1.00   45.04 ? 658  LYS A CB    1 
ATOM   4857 N  N     . ASN A 1 659 ? -13.865 -10.701 1.867   1.00   44.87 ? 659  ASN A N     1 
ATOM   4858 C  CA    . ASN A 1 659 ? -14.527 -9.490  1.421   1.00   45.26 ? 659  ASN A CA    1 
ATOM   4859 C  C     . ASN A 1 659 ? -14.140 -9.115  -0.029  1.00   45.64 ? 659  ASN A C     1 
ATOM   4860 O  O     . ASN A 1 659 ? -15.002 -8.750  -0.850  1.00   44.53 ? 659  ASN A O     1 
ATOM   4861 C  CB    . ASN A 1 659 ? -14.210 -8.360  2.405   1.00   46.75 ? 659  ASN A CB    1 
ATOM   4862 C  CG    . ASN A 1 659 ? -15.192 -8.323  3.549   1.00   48.33 ? 659  ASN A CG    1 
ATOM   4863 O  OD1   . ASN A 1 659 ? -14.942 -7.738  4.608   1.00   49.95 ? 659  ASN A OD1   1 
ATOM   4864 N  ND2   . ASN A 1 659 ? -16.344 -8.956  3.336   1.00   51.07 ? 659  ASN A ND2   1 
ATOM   4865 N  N     . LEU A 1 660 ? -12.853 -9.273  -0.351  1.00   43.60 ? 660  LEU A N     1 
ATOM   4866 C  CA    . LEU A 1 660 ? -12.319 -8.921  -1.682  1.00   42.30 ? 660  LEU A CA    1 
ATOM   4867 C  C     . LEU A 1 660 ? -12.876 -9.840  -2.773  1.00   42.22 ? 660  LEU A C     1 
ATOM   4868 O  O     . LEU A 1 660 ? -13.162 -9.367  -3.875  1.00   41.21 ? 660  LEU A O     1 
ATOM   4869 C  CB    . LEU A 1 660 ? -10.795 -8.996  -1.674  1.00   42.53 ? 660  LEU A CB    1 
ATOM   4870 C  CG    . LEU A 1 660 ? -10.153 -7.785  -0.990  1.00   42.77 ? 660  LEU A CG    1 
ATOM   4871 C  CD1   . LEU A 1 660 ? -8.625  -7.847  -0.984  1.00   42.41 ? 660  LEU A CD1   1 
ATOM   4872 C  CD2   . LEU A 1 660 ? -10.521 -6.456  -1.657  1.00   41.26 ? 660  LEU A CD2   1 
ATOM   4873 N  N     . TYR A 1 661 ? -13.040 -11.139 -2.491  1.00   42.62 ? 661  TYR A N     1 
ATOM   4874 C  CA    . TYR A 1 661 ? -13.582 -12.057 -3.506  1.00   42.74 ? 661  TYR A CA    1 
ATOM   4875 C  C     . TYR A 1 661 ? -15.060 -11.796 -3.724  1.00   43.74 ? 661  TYR A C     1 
ATOM   4876 O  O     . TYR A 1 661 ? -15.714 -12.475 -4.499  1.00   45.24 ? 661  TYR A O     1 
ATOM   4877 C  CB    . TYR A 1 661 ? -13.372 -13.536 -3.127  1.00   39.62 ? 661  TYR A CB    1 
ATOM   4878 C  CG    . TYR A 1 661 ? -11.997 -14.046 -3.467  1.00   35.16 ? 661  TYR A CG    1 
ATOM   4879 C  CD1   . TYR A 1 661 ? -11.617 -14.283 -4.785  1.00   34.72 ? 661  TYR A CD1   1 
ATOM   4880 C  CD2   . TYR A 1 661 ? -11.053 -14.236 -2.472  1.00   33.64 ? 661  TYR A CD2   1 
ATOM   4881 C  CE1   . TYR A 1 661 ? -10.305 -14.702 -5.094  1.00   33.63 ? 661  TYR A CE1   1 
ATOM   4882 C  CE2   . TYR A 1 661 ? -9.758  -14.635 -2.762  1.00   32.02 ? 661  TYR A CE2   1 
ATOM   4883 C  CZ    . TYR A 1 661 ? -9.391  -14.868 -4.056  1.00   33.83 ? 661  TYR A CZ    1 
ATOM   4884 O  OH    . TYR A 1 661 ? -8.087  -15.225 -4.301  1.00   35.24 ? 661  TYR A OH    1 
ATOM   4885 N  N     . SER A 1 662 ? -15.590 -10.811 -3.019  1.00   46.84 ? 662  SER A N     1 
ATOM   4886 C  CA    . SER A 1 662 ? -16.991 -10.465 -3.191  1.00   50.16 ? 662  SER A CA    1 
ATOM   4887 C  C     . SER A 1 662 ? -17.092 -9.100  -3.908  1.00   49.46 ? 662  SER A C     1 
ATOM   4888 O  O     . SER A 1 662 ? -18.186 -8.564  -4.064  1.00   52.69 ? 662  SER A O     1 
ATOM   4889 C  CB    . SER A 1 662 ? -17.685 -10.384 -1.827  1.00   51.52 ? 662  SER A CB    1 
ATOM   4890 O  OG    . SER A 1 662 ? -17.420 -9.136  -1.206  1.00   53.14 ? 662  SER A OG    1 
ATOM   4891 N  N     . THR A 1 663 ? -15.950 -8.549  -4.341  1.00   47.72 ? 663  THR A N     1 
ATOM   4892 C  CA    . THR A 1 663 ? -15.924 -7.248  -5.003  1.00   46.34 ? 663  THR A CA    1 
ATOM   4893 C  C     . THR A 1 663 ? -15.378 -7.265  -6.417  1.00   47.05 ? 663  THR A C     1 
ATOM   4894 O  O     . THR A 1 663 ? -14.807 -8.252  -6.884  1.00   46.13 ? 663  THR A O     1 
ATOM   4895 C  CB    . THR A 1 663 ? -15.043 -6.237  -4.255  1.00   44.18 ? 663  THR A CB    1 
ATOM   4896 O  OG1   . THR A 1 663 ? -13.659 -6.528  -4.504  1.00   40.26 ? 663  THR A OG1   1 
ATOM   4897 C  CG2   . THR A 1 663 ? -15.294 -6.290  -2.781  1.00   40.85 ? 663  THR A CG2   1 
ATOM   4898 N  N     . HIS A 1 664 ? -15.567 -6.141  -7.111  1.00   45.79 ? 664  HIS A N     1 
ATOM   4899 C  CA    . HIS A 1 664 ? -15.043 -5.939  -8.459  1.00   42.94 ? 664  HIS A CA    1 
ATOM   4900 C  C     . HIS A 1 664 ? -13.823 -5.088  -8.091  1.00   40.40 ? 664  HIS A C     1 
ATOM   4901 O  O     . HIS A 1 664 ? -13.973 -4.018  -7.517  1.00   40.43 ? 664  HIS A O     1 
ATOM   4902 C  CB    . HIS A 1 664 ? -16.045 -5.129  -9.254  1.00   46.53 ? 664  HIS A CB    1 
ATOM   4903 C  CG    . HIS A 1 664 ? -15.580 -4.751  -10.624 1.00   51.20 ? 664  HIS A CG    1 
ATOM   4904 N  ND1   . HIS A 1 664 ? -14.319 -4.260  -10.881 1.00   52.55 ? 664  HIS A ND1   1 
ATOM   4905 C  CD2   . HIS A 1 664 ? -16.236 -4.747  -11.808 1.00   52.90 ? 664  HIS A CD2   1 
ATOM   4906 C  CE1   . HIS A 1 664 ? -14.214 -3.973  -12.164 1.00   53.81 ? 664  HIS A CE1   1 
ATOM   4907 N  NE2   . HIS A 1 664 ? -15.361 -4.259  -12.748 1.00   54.66 ? 664  HIS A NE2   1 
ATOM   4908 N  N     . PRO A 1 665 ? -12.601 -5.544  -8.415  1.00   40.21 ? 665  PRO A N     1 
ATOM   4909 C  CA    . PRO A 1 665 ? -11.428 -4.756  -8.061  1.00   38.06 ? 665  PRO A CA    1 
ATOM   4910 C  C     . PRO A 1 665 ? -10.928 -3.709  -9.065  1.00   38.26 ? 665  PRO A C     1 
ATOM   4911 O  O     . PRO A 1 665 ? -11.045 -3.879  -10.278 1.00   41.07 ? 665  PRO A O     1 
ATOM   4912 C  CB    . PRO A 1 665 ? -10.388 -5.828  -7.822  1.00   35.68 ? 665  PRO A CB    1 
ATOM   4913 C  CG    . PRO A 1 665 ? -10.665 -6.765  -8.972  1.00   34.09 ? 665  PRO A CG    1 
ATOM   4914 C  CD    . PRO A 1 665 ? -12.202 -6.805  -9.064  1.00   36.57 ? 665  PRO A CD    1 
ATOM   4915 N  N     . HIS A 1 666 ? -10.358 -2.628  -8.521  1.00   40.02 ? 666  HIS A N     1 
ATOM   4916 C  CA    . HIS A 1 666 ? -9.770  -1.534  -9.299  1.00   42.69 ? 666  HIS A CA    1 
ATOM   4917 C  C     . HIS A 1 666 ? -8.333  -1.358  -8.748  1.00   42.88 ? 666  HIS A C     1 
ATOM   4918 O  O     . HIS A 1 666 ? -8.160  -0.944  -7.603  1.00   43.85 ? 666  HIS A O     1 
ATOM   4919 C  CB    . HIS A 1 666 ? -10.592 -0.245  -9.079  1.00   43.16 ? 666  HIS A CB    1 
ATOM   4920 C  CG    . HIS A 1 666 ? -12.024 -0.370  -9.507  1.00   43.04 ? 666  HIS A CG    1 
ATOM   4921 N  ND1   . HIS A 1 666 ? -12.466 0.032   -10.750 1.00   42.06 ? 666  HIS A ND1   1 
ATOM   4922 C  CD2   . HIS A 1 666 ? -13.098 -0.909  -8.883  1.00   43.32 ? 666  HIS A CD2   1 
ATOM   4923 C  CE1   . HIS A 1 666 ? -13.754 -0.257  -10.870 1.00   41.36 ? 666  HIS A CE1   1 
ATOM   4924 N  NE2   . HIS A 1 666 ? -14.159 -0.826  -9.751  1.00   41.75 ? 666  HIS A NE2   1 
ATOM   4925 N  N     . PHE A 1 667 ? -7.325  -1.671  -9.552  1.00   41.14 ? 667  PHE A N     1 
ATOM   4926 C  CA    . PHE A 1 667 ? -5.933  -1.588  -9.133  1.00   37.96 ? 667  PHE A CA    1 
ATOM   4927 C  C     . PHE A 1 667 ? -5.214  -0.281  -9.482  1.00   37.08 ? 667  PHE A C     1 
ATOM   4928 O  O     . PHE A 1 667 ? -5.329  0.239   -10.579 1.00   34.83 ? 667  PHE A O     1 
ATOM   4929 C  CB    . PHE A 1 667 ? -5.151  -2.755  -9.742  1.00   37.44 ? 667  PHE A CB    1 
ATOM   4930 C  CG    . PHE A 1 667 ? -5.802  -4.099  -9.552  1.00   35.74 ? 667  PHE A CG    1 
ATOM   4931 C  CD1   . PHE A 1 667 ? -6.792  -4.526  -10.410 1.00   36.08 ? 667  PHE A CD1   1 
ATOM   4932 C  CD2   . PHE A 1 667 ? -5.420  -4.935  -8.501  1.00   35.63 ? 667  PHE A CD2   1 
ATOM   4933 C  CE1   . PHE A 1 667 ? -7.410  -5.793  -10.233 1.00   37.39 ? 667  PHE A CE1   1 
ATOM   4934 C  CE2   . PHE A 1 667 ? -6.022  -6.193  -8.305  1.00   37.18 ? 667  PHE A CE2   1 
ATOM   4935 C  CZ    . PHE A 1 667 ? -7.018  -6.630  -9.165  1.00   37.22 ? 667  PHE A CZ    1 
ATOM   4936 N  N     . VAL A 1 668 ? -4.464  0.239   -8.509  1.00   37.15 ? 668  VAL A N     1 
ATOM   4937 C  CA    . VAL A 1 668 ? -3.679  1.462   -8.652  1.00   36.61 ? 668  VAL A CA    1 
ATOM   4938 C  C     . VAL A 1 668 ? -2.250  1.096   -8.294  1.00   36.38 ? 668  VAL A C     1 
ATOM   4939 O  O     . VAL A 1 668 ? -1.981  0.661   -7.160  1.00   37.19 ? 668  VAL A O     1 
ATOM   4940 C  CB    . VAL A 1 668 ? -4.138  2.553   -7.657  1.00   37.96 ? 668  VAL A CB    1 
ATOM   4941 C  CG1   . VAL A 1 668 ? -3.220  3.761   -7.746  1.00   38.21 ? 668  VAL A CG1   1 
ATOM   4942 C  CG2   . VAL A 1 668 ? -5.568  2.939   -7.927  1.00   39.03 ? 668  VAL A CG2   1 
ATOM   4943 N  N     . ARG A 1 669 ? -1.330  1.259   -9.229  1.00   34.68 ? 669  ARG A N     1 
ATOM   4944 C  CA    . ARG A 1 669 ? 0.062   0.946   -8.953  1.00   32.46 ? 669  ARG A CA    1 
ATOM   4945 C  C     . ARG A 1 669 ? 0.795   2.233   -8.684  1.00   33.00 ? 669  ARG A C     1 
ATOM   4946 O  O     . ARG A 1 669 ? 0.953   3.066   -9.580  1.00   31.30 ? 669  ARG A O     1 
ATOM   4947 C  CB    . ARG A 1 669 ? 0.729   0.263   -10.147 1.00   32.51 ? 669  ARG A CB    1 
ATOM   4948 C  CG    . ARG A 1 669 ? 0.076   -1.030  -10.623 1.00   31.67 ? 669  ARG A CG    1 
ATOM   4949 C  CD    . ARG A 1 669 ? -0.232  -1.916  -9.482  1.00   30.37 ? 669  ARG A CD    1 
ATOM   4950 N  NE    . ARG A 1 669 ? -0.715  -3.215  -9.931  1.00   32.19 ? 669  ARG A NE    1 
ATOM   4951 C  CZ    . ARG A 1 669 ? -1.070  -4.208  -9.107  1.00   32.71 ? 669  ARG A CZ    1 
ATOM   4952 N  NH1   . ARG A 1 669 ? -0.998  -4.038  -7.799  1.00   30.96 ? 669  ARG A NH1   1 
ATOM   4953 N  NH2   . ARG A 1 669 ? -1.496  -5.370  -9.592  1.00   32.98 ? 669  ARG A NH2   1 
ATOM   4954 N  N     . CYS A 1 670 ? 1.256   2.413   -7.450  1.00   31.32 ? 670  CYS A N     1 
ATOM   4955 C  CA    . CYS A 1 670 ? 2.006   3.605   -7.104  1.00   32.12 ? 670  CYS A CA    1 
ATOM   4956 C  C     . CYS A 1 670 ? 3.461   3.283   -7.339  1.00   32.69 ? 670  CYS A C     1 
ATOM   4957 O  O     . CYS A 1 670 ? 3.872   2.137   -7.167  1.00   30.63 ? 670  CYS A O     1 
ATOM   4958 C  CB    . CYS A 1 670 ? 1.819   3.984   -5.642  1.00   32.27 ? 670  CYS A CB    1 
ATOM   4959 S  SG    . CYS A 1 670 ? 0.204   4.564   -5.224  1.00   37.36 ? 670  CYS A SG    1 
ATOM   4960 N  N     . ILE A 1 671 ? 4.252   4.285   -7.751  1.00   33.64 ? 671  ILE A N     1 
ATOM   4961 C  CA    . ILE A 1 671 ? 5.653   4.031   -7.981  1.00   33.85 ? 671  ILE A CA    1 
ATOM   4962 C  C     . ILE A 1 671 ? 6.481   5.233   -7.574  1.00   33.97 ? 671  ILE A C     1 
ATOM   4963 O  O     . ILE A 1 671 ? 6.175   6.379   -7.912  1.00   32.39 ? 671  ILE A O     1 
ATOM   4964 C  CB    . ILE A 1 671 ? 5.977   3.610   -9.479  1.00   37.74 ? 671  ILE A CB    1 
ATOM   4965 C  CG1   . ILE A 1 671 ? 6.179   4.826   -10.350 1.00   39.95 ? 671  ILE A CG1   1 
ATOM   4966 C  CG2   . ILE A 1 671 ? 4.876   2.732   -10.085 1.00   38.15 ? 671  ILE A CG2   1 
ATOM   4967 C  CD1   . ILE A 1 671 ? 7.601   5.261   -10.406 1.00   42.12 ? 671  ILE A CD1   1 
ATOM   4968 N  N     . ILE A 1 672 ? 7.542   4.953   -6.808  1.00   33.13 ? 672  ILE A N     1 
ATOM   4969 C  CA    . ILE A 1 672 ? 8.440   5.975   -6.312  1.00   34.35 ? 672  ILE A CA    1 
ATOM   4970 C  C     . ILE A 1 672 ? 9.486   6.227   -7.416  1.00   34.74 ? 672  ILE A C     1 
ATOM   4971 O  O     . ILE A 1 672 ? 10.164  5.304   -7.861  1.00   34.76 ? 672  ILE A O     1 
ATOM   4972 C  CB    . ILE A 1 672 ? 9.106   5.507   -4.968  1.00   33.01 ? 672  ILE A CB    1 
ATOM   4973 C  CG1   . ILE A 1 672 ? 9.915   6.634   -4.346  1.00   31.85 ? 672  ILE A CG1   1 
ATOM   4974 C  CG2   . ILE A 1 672 ? 9.973   4.273   -5.202  1.00   32.26 ? 672  ILE A CG2   1 
ATOM   4975 C  CD1   . ILE A 1 672 ? 10.587  6.245   -3.018  1.00   30.08 ? 672  ILE A CD1   1 
ATOM   4976 N  N     . PRO A 1 673 ? 9.611   7.487   -7.870  1.00   35.86 ? 673  PRO A N     1 
ATOM   4977 C  CA    . PRO A 1 673 ? 10.556  7.858   -8.930  1.00   36.62 ? 673  PRO A CA    1 
ATOM   4978 C  C     . PRO A 1 673 ? 12.041  7.926   -8.600  1.00   36.23 ? 673  PRO A C     1 
ATOM   4979 O  O     . PRO A 1 673 ? 12.872  7.801   -9.490  1.00   37.27 ? 673  PRO A O     1 
ATOM   4980 C  CB    . PRO A 1 673 ? 10.004  9.190   -9.416  1.00   35.16 ? 673  PRO A CB    1 
ATOM   4981 C  CG    . PRO A 1 673 ? 9.516   9.816   -8.145  1.00   34.77 ? 673  PRO A CG    1 
ATOM   4982 C  CD    . PRO A 1 673 ? 8.854   8.662   -7.397  1.00   35.94 ? 673  PRO A CD    1 
ATOM   4983 N  N     . ASN A 1 674 ? 12.385  8.139   -7.331  1.00   37.48 ? 674  ASN A N     1 
ATOM   4984 C  CA    . ASN A 1 674 ? 13.786  8.210   -6.940  1.00   38.12 ? 674  ASN A CA    1 
ATOM   4985 C  C     . ASN A 1 674 ? 13.915  8.023   -5.444  1.00   39.16 ? 674  ASN A C     1 
ATOM   4986 O  O     . ASN A 1 674 ? 12.912  7.967   -4.731  1.00   39.31 ? 674  ASN A O     1 
ATOM   4987 C  CB    . ASN A 1 674 ? 14.407  9.560   -7.380  1.00   37.91 ? 674  ASN A CB    1 
ATOM   4988 C  CG    . ASN A 1 674 ? 13.812  10.749  -6.665  1.00   36.70 ? 674  ASN A CG    1 
ATOM   4989 O  OD1   . ASN A 1 674 ? 14.169  11.038  -5.532  1.00   37.10 ? 674  ASN A OD1   1 
ATOM   4990 N  ND2   . ASN A 1 674 ? 12.902  11.447  -7.324  1.00   34.52 ? 674  ASN A ND2   1 
ATOM   4991 N  N     . GLU A 1 675 ? 15.148  7.927   -4.962  1.00   39.37 ? 675  GLU A N     1 
ATOM   4992 C  CA    . GLU A 1 675 ? 15.440  7.709   -3.546  1.00   40.68 ? 675  GLU A CA    1 
ATOM   4993 C  C     . GLU A 1 675 ? 15.717  8.999   -2.790  1.00   41.51 ? 675  GLU A C     1 
ATOM   4994 O  O     . GLU A 1 675 ? 16.078  8.957   -1.610  1.00   40.32 ? 675  GLU A O     1 
ATOM   4995 C  CB    . GLU A 1 675 ? 16.689  6.829   -3.401  1.00   42.64 ? 675  GLU A CB    1 
ATOM   4996 C  CG    . GLU A 1 675 ? 16.619  5.460   -4.021  1.00   47.95 ? 675  GLU A CG    1 
ATOM   4997 C  CD    . GLU A 1 675 ? 15.778  4.496   -3.191  1.00   52.28 ? 675  GLU A CD    1 
ATOM   4998 O  OE1   . GLU A 1 675 ? 15.874  3.266   -3.401  1.00   54.81 ? 675  GLU A OE1   1 
ATOM   4999 O  OE2   . GLU A 1 675 ? 15.013  4.960   -2.321  1.00   53.67 ? 675  GLU A OE2   1 
ATOM   5000 N  N     . LEU A 1 676 ? 15.574  10.140  -3.446  1.00   40.59 ? 676  LEU A N     1 
ATOM   5001 C  CA    . LEU A 1 676 ? 15.892  11.411  -2.807  1.00   39.28 ? 676  LEU A CA    1 
ATOM   5002 C  C     . LEU A 1 676 ? 14.691  12.270  -2.459  1.00   37.86 ? 676  LEU A C     1 
ATOM   5003 O  O     . LEU A 1 676 ? 14.849  13.376  -1.966  1.00   37.36 ? 676  LEU A O     1 
ATOM   5004 C  CB    . LEU A 1 676 ? 16.849  12.213  -3.720  1.00   42.23 ? 676  LEU A CB    1 
ATOM   5005 C  CG    . LEU A 1 676 ? 18.113  11.521  -4.268  1.00   46.08 ? 676  LEU A CG    1 
ATOM   5006 C  CD1   . LEU A 1 676 ? 18.889  12.450  -5.221  1.00   47.62 ? 676  LEU A CD1   1 
ATOM   5007 C  CD2   . LEU A 1 676 ? 19.010  11.121  -3.085  1.00   48.60 ? 676  LEU A CD2   1 
ATOM   5008 N  N     . LYS A 1 677 ? 13.482  11.761  -2.721  1.00   36.88 ? 677  LYS A N     1 
ATOM   5009 C  CA    . LYS A 1 677 ? 12.253  12.493  -2.415  1.00   36.20 ? 677  LYS A CA    1 
ATOM   5010 C  C     . LYS A 1 677 ? 12.292  13.805  -3.184  1.00   37.64 ? 677  LYS A C     1 
ATOM   5011 O  O     . LYS A 1 677 ? 11.703  14.805  -2.766  1.00   37.67 ? 677  LYS A O     1 
ATOM   5012 C  CB    . LYS A 1 677 ? 12.149  12.793  -0.909  1.00   35.51 ? 677  LYS A CB    1 
ATOM   5013 C  CG    . LYS A 1 677 ? 12.281  11.587  0.046   1.00   33.15 ? 677  LYS A CG    1 
ATOM   5014 C  CD    . LYS A 1 677 ? 12.169  12.060  1.513   1.00   34.68 ? 677  LYS A CD    1 
ATOM   5015 C  CE    . LYS A 1 677 ? 12.185  10.909  2.559   1.00   33.11 ? 677  LYS A CE    1 
ATOM   5016 N  NZ    . LYS A 1 677 ? 13.417  10.048  2.496   1.00   32.18 ? 677  LYS A NZ    1 
ATOM   5017 N  N     . GLN A 1 678 ? 12.990  13.790  -4.294  1.00   38.83 ? 678  GLN A N     1 
ATOM   5018 C  CA    . GLN A 1 678 ? 13.140  14.969  -5.104  1.00   41.85 ? 678  GLN A CA    1 
ATOM   5019 C  C     . GLN A 1 678 ? 12.093  14.991  -6.214  1.00   42.61 ? 678  GLN A C     1 
ATOM   5020 O  O     . GLN A 1 678 ? 12.020  14.076  -7.031  1.00   43.30 ? 678  GLN A O     1 
ATOM   5021 C  CB    . GLN A 1 678 ? 14.536  14.985  -5.689  1.00   42.91 ? 678  GLN A CB    1 
ATOM   5022 C  CG    . GLN A 1 678 ? 14.897  16.251  -6.409  1.00   47.29 ? 678  GLN A CG    1 
ATOM   5023 C  CD    . GLN A 1 678 ? 16.373  16.267  -6.763  1.00   49.30 ? 678  GLN A CD    1 
ATOM   5024 O  OE1   . GLN A 1 678 ? 17.242  16.371  -5.874  1.00   49.92 ? 678  GLN A OE1   1 
ATOM   5025 N  NE2   . GLN A 1 678 ? 16.672  16.132  -8.056  1.00   48.57 ? 678  GLN A NE2   1 
ATOM   5026 N  N     . PRO A 1 679 ? 11.273  16.037  -6.246  1.00   43.64 ? 679  PRO A N     1 
ATOM   5027 C  CA    . PRO A 1 679 ? 10.229  16.160  -7.271  1.00   44.63 ? 679  PRO A CA    1 
ATOM   5028 C  C     . PRO A 1 679 ? 10.800  16.261  -8.697  1.00   45.05 ? 679  PRO A C     1 
ATOM   5029 O  O     . PRO A 1 679 ? 11.814  16.913  -8.910  1.00   44.91 ? 679  PRO A O     1 
ATOM   5030 C  CB    . PRO A 1 679 ? 9.473   17.421  -6.853  1.00   44.36 ? 679  PRO A CB    1 
ATOM   5031 C  CG    . PRO A 1 679 ? 10.544  18.238  -6.164  1.00   44.50 ? 679  PRO A CG    1 
ATOM   5032 C  CD    . PRO A 1 679 ? 11.289  17.214  -5.354  1.00   42.89 ? 679  PRO A CD    1 
ATOM   5033 N  N     . GLY A 1 680 ? 10.150  15.606  -9.647  1.00   45.79 ? 680  GLY A N     1 
ATOM   5034 C  CA    . GLY A 1 680 ? 10.600  15.665  -11.033 1.00   47.09 ? 680  GLY A CA    1 
ATOM   5035 C  C     . GLY A 1 680 ? 11.793  14.811  -11.459 1.00   47.52 ? 680  GLY A C     1 
ATOM   5036 O  O     . GLY A 1 680 ? 12.018  14.630  -12.651 1.00   47.93 ? 680  GLY A O     1 
ATOM   5037 N  N     . LEU A 1 681 ? 12.557  14.292  -10.494 1.00   47.34 ? 681  LEU A N     1 
ATOM   5038 C  CA    . LEU A 1 681 ? 13.725  13.466  -10.792 1.00   46.37 ? 681  LEU A CA    1 
ATOM   5039 C  C     . LEU A 1 681 ? 13.320  12.023  -11.092 1.00   46.33 ? 681  LEU A C     1 
ATOM   5040 O  O     . LEU A 1 681 ? 12.464  11.459  -10.401 1.00   45.37 ? 681  LEU A O     1 
ATOM   5041 C  CB    . LEU A 1 681 ? 14.666  13.452  -9.588  1.00   46.18 ? 681  LEU A CB    1 
ATOM   5042 C  CG    . LEU A 1 681 ? 15.867  12.513  -9.707  1.00   45.19 ? 681  LEU A CG    1 
ATOM   5043 C  CD1   . LEU A 1 681 ? 16.836  13.153  -10.695 1.00   44.43 ? 681  LEU A CD1   1 
ATOM   5044 C  CD2   . LEU A 1 681 ? 16.553  12.284  -8.352  1.00   43.58 ? 681  LEU A CD2   1 
ATOM   5045 N  N     . VAL A 1 682 ? 13.925  11.425  -12.118 1.00   45.21 ? 682  VAL A N     1 
ATOM   5046 C  CA    . VAL A 1 682 ? 13.638  10.030  -12.445 1.00   45.30 ? 682  VAL A CA    1 
ATOM   5047 C  C     . VAL A 1 682 ? 14.904  9.161   -12.378 1.00   45.66 ? 682  VAL A C     1 
ATOM   5048 O  O     . VAL A 1 682 ? 15.944  9.514   -12.925 1.00   45.02 ? 682  VAL A O     1 
ATOM   5049 C  CB    . VAL A 1 682 ? 12.988  9.886   -13.831 1.00   44.73 ? 682  VAL A CB    1 
ATOM   5050 C  CG1   . VAL A 1 682 ? 12.615  8.428   -14.073 1.00   44.20 ? 682  VAL A CG1   1 
ATOM   5051 C  CG2   . VAL A 1 682 ? 11.729  10.746  -13.908 1.00   44.50 ? 682  VAL A CG2   1 
ATOM   5052 N  N     . ASP A 1 683 ? 14.791  8.023   -11.679 1.00   45.33 ? 683  ASP A N     1 
ATOM   5053 C  CA    . ASP A 1 683 ? 15.875  7.046   -11.469 1.00   44.70 ? 683  ASP A CA    1 
ATOM   5054 C  C     . ASP A 1 683 ? 15.431  5.795   -12.228 1.00   44.46 ? 683  ASP A C     1 
ATOM   5055 O  O     . ASP A 1 683 ? 14.680  4.964   -11.713 1.00   43.45 ? 683  ASP A O     1 
ATOM   5056 C  CB    . ASP A 1 683 ? 15.997  6.773   -9.959  1.00   47.14 ? 683  ASP A CB    1 
ATOM   5057 C  CG    . ASP A 1 683 ? 16.984  5.645   -9.604  1.00   50.00 ? 683  ASP A CG    1 
ATOM   5058 O  OD1   . ASP A 1 683 ? 17.298  4.787   -10.461 1.00   50.35 ? 683  ASP A OD1   1 
ATOM   5059 O  OD2   . ASP A 1 683 ? 17.421  5.612   -8.418  1.00   51.74 ? 683  ASP A OD2   1 
ATOM   5060 N  N     . ALA A 1 684 ? 15.906  5.689   -13.457 1.00   43.41 ? 684  ALA A N     1 
ATOM   5061 C  CA    . ALA A 1 684 ? 15.574  4.617   -14.382 1.00   43.04 ? 684  ALA A CA    1 
ATOM   5062 C  C     . ALA A 1 684 ? 15.561  3.199   -13.774 1.00   46.25 ? 684  ALA A C     1 
ATOM   5063 O  O     . ALA A 1 684 ? 14.507  2.555   -13.677 1.00   43.02 ? 684  ALA A O     1 
ATOM   5064 C  CB    . ALA A 1 684 ? 16.527  4.680   -15.574 1.00   41.38 ? 684  ALA A CB    1 
ATOM   5065 N  N     . GLU A 1 685 ? 16.716  2.698   -13.391 1.00   50.50 ? 685  GLU A N     1 
ATOM   5066 C  CA    . GLU A 1 685 ? 16.825  1.322   -12.856 1.00   51.45 ? 685  GLU A CA    1 
ATOM   5067 C  C     . GLU A 1 685 ? 15.780  1.077   -11.732 1.00   48.15 ? 685  GLU A C     1 
ATOM   5068 O  O     . GLU A 1 685 ? 15.321  -0.056  -11.520 1.00   44.07 ? 685  GLU A O     1 
ATOM   5069 C  CB    . GLU A 1 685 ? 18.256  1.072   -12.353 1.00   61.77 ? 685  GLU A CB    1 
ATOM   5070 C  CG    . GLU A 1 685 ? 19.314  1.352   -13.436 1.00   84.41 ? 685  GLU A CG    1 
ATOM   5071 C  CD    . GLU A 1 685 ? 20.652  0.627   -13.219 1.00   94.55 ? 685  GLU A CD    1 
ATOM   5072 O  OE1   . GLU A 1 685 ? 20.762  -0.632  -13.482 1.00   98.30 ? 685  GLU A OE1   1 
ATOM   5073 O  OE2   . GLU A 1 685 ? 21.677  1.281   -12.782 1.00   98.39 ? 685  GLU A OE2   1 
ATOM   5074 N  N     . LEU A 1 686 ? 15.409  2.154   -11.033 1.00   42.71 ? 686  LEU A N     1 
ATOM   5075 C  CA    . LEU A 1 686 ? 14.422  2.100   -9.911  1.00   36.39 ? 686  LEU A CA    1 
ATOM   5076 C  C     . LEU A 1 686 ? 12.988  1.952   -10.453 1.00   33.75 ? 686  LEU A C     1 
ATOM   5077 O  O     . LEU A 1 686 ? 12.248  1.043   -10.049 1.00   30.81 ? 686  LEU A O     1 
ATOM   5078 C  CB    . LEU A 1 686 ? 14.494  3.375   -9.072  1.00   35.15 ? 686  LEU A CB    1 
ATOM   5079 C  CG    . LEU A 1 686 ? 13.579  3.328   -7.845  1.00   35.87 ? 686  LEU A CG    1 
ATOM   5080 C  CD1   . LEU A 1 686 ? 13.818  2.098   -6.966  1.00   35.92 ? 686  LEU A CD1   1 
ATOM   5081 C  CD2   . LEU A 1 686 ? 13.752  4.536   -6.923  1.00   35.30 ? 686  LEU A CD2   1 
ATOM   5082 N  N     . VAL A 1 687 ? 12.602  2.841   -11.383 1.00   32.45 ? 687  VAL A N     1 
ATOM   5083 C  CA    . VAL A 1 687 ? 11.280  2.763   -11.991 1.00   30.86 ? 687  VAL A CA    1 
ATOM   5084 C  C     . VAL A 1 687 ? 11.107  1.478   -12.790 1.00   32.41 ? 687  VAL A C     1 
ATOM   5085 O  O     . VAL A 1 687 ? 10.037  0.861   -12.732 1.00   32.76 ? 687  VAL A O     1 
ATOM   5086 C  CB    . VAL A 1 687 ? 11.005  3.980   -12.955 1.00   30.70 ? 687  VAL A CB    1 
ATOM   5087 C  CG1   . VAL A 1 687 ? 9.668   3.769   -13.651 1.00   27.70 ? 687  VAL A CG1   1 
ATOM   5088 C  CG2   . VAL A 1 687 ? 10.983  5.291   -12.171 1.00   28.51 ? 687  VAL A CG2   1 
ATOM   5089 N  N     . LEU A 1 688 ? 12.126  1.056   -13.548 1.00   32.65 ? 688  LEU A N     1 
ATOM   5090 C  CA    . LEU A 1 688 ? 11.974  -0.174  -14.333 1.00   34.70 ? 688  LEU A CA    1 
ATOM   5091 C  C     . LEU A 1 688 ? 11.663  -1.345  -13.427 1.00   36.41 ? 688  LEU A C     1 
ATOM   5092 O  O     . LEU A 1 688 ? 10.746  -2.122  -13.675 1.00   34.80 ? 688  LEU A O     1 
ATOM   5093 C  CB    . LEU A 1 688 ? 13.256  -0.484  -15.112 1.00   37.70 ? 688  LEU A CB    1 
ATOM   5094 C  CG    . LEU A 1 688 ? 13.542  0.328   -16.380 1.00   41.32 ? 688  LEU A CG    1 
ATOM   5095 C  CD1   . LEU A 1 688 ? 14.980  0.104   -16.779 1.00   42.42 ? 688  LEU A CD1   1 
ATOM   5096 C  CD2   . LEU A 1 688 ? 12.552  -0.053  -17.498 1.00   42.75 ? 688  LEU A CD2   1 
ATOM   5097 N  N     . HIS A 1 689 ? 12.454  -1.456  -12.355 1.00   38.92 ? 689  HIS A N     1 
ATOM   5098 C  CA    . HIS A 1 689 ? 12.306  -2.514  -11.381 1.00   39.58 ? 689  HIS A CA    1 
ATOM   5099 C  C     . HIS A 1 689 ? 10.875  -2.591  -10.851 1.00   40.16 ? 689  HIS A C     1 
ATOM   5100 O  O     . HIS A 1 689 ? 10.330  -3.674  -10.697 1.00   39.82 ? 689  HIS A O     1 
ATOM   5101 C  CB    . HIS A 1 689 ? 13.303  -2.297  -10.240 1.00   42.78 ? 689  HIS A CB    1 
ATOM   5102 C  CG    . HIS A 1 689 ? 13.025  -3.143  -9.043  1.00   48.19 ? 689  HIS A CG    1 
ATOM   5103 N  ND1   . HIS A 1 689 ? 12.697  -4.478  -9.141  1.00   50.07 ? 689  HIS A ND1   1 
ATOM   5104 C  CD2   . HIS A 1 689 ? 12.891  -2.821  -7.734  1.00   50.46 ? 689  HIS A CD2   1 
ATOM   5105 C  CE1   . HIS A 1 689 ? 12.362  -4.939  -7.951  1.00   51.86 ? 689  HIS A CE1   1 
ATOM   5106 N  NE2   . HIS A 1 689 ? 12.471  -3.951  -7.080  1.00   51.60 ? 689  HIS A NE2   1 
ATOM   5107 N  N     . GLN A 1 690 ? 10.266  -1.445  -10.589 1.00   41.97 ? 690  GLN A N     1 
ATOM   5108 C  CA    . GLN A 1 690 ? 8.899   -1.445  -10.109 1.00   43.82 ? 690  GLN A CA    1 
ATOM   5109 C  C     . GLN A 1 690 ? 7.922   -1.809  -11.223 1.00   46.35 ? 690  GLN A C     1 
ATOM   5110 O  O     . GLN A 1 690 ? 6.742   -2.031  -10.945 1.00   47.59 ? 690  GLN A O     1 
ATOM   5111 C  CB    . GLN A 1 690 ? 8.529   -0.081  -9.504  1.00   43.25 ? 690  GLN A CB    1 
ATOM   5112 C  CG    . GLN A 1 690 ? 9.421   0.338   -8.343  1.00   40.43 ? 690  GLN A CG    1 
ATOM   5113 C  CD    . GLN A 1 690 ? 9.253   1.799   -7.973  1.00   40.43 ? 690  GLN A CD    1 
ATOM   5114 O  OE1   . GLN A 1 690 ? 8.266   2.194   -7.325  1.00   37.34 ? 690  GLN A OE1   1 
ATOM   5115 N  NE2   . GLN A 1 690 ? 10.214  2.618   -8.388  1.00   37.70 ? 690  GLN A NE2   1 
ATOM   5116 N  N     . LEU A 1 691 ? 8.366   -1.875  -12.469 1.00   48.47 ? 691  LEU A N     1 
ATOM   5117 C  CA    . LEU A 1 691 ? 7.417   -2.246  -13.522 1.00   52.43 ? 691  LEU A CA    1 
ATOM   5118 C  C     . LEU A 1 691 ? 7.453   -3.760  -13.792 1.00   57.26 ? 691  LEU A C     1 
ATOM   5119 O  O     . LEU A 1 691 ? 6.592   -4.290  -14.488 1.00   54.25 ? 691  LEU A O     1 
ATOM   5120 C  CB    . LEU A 1 691 ? 7.679   -1.474  -14.834 1.00   49.31 ? 691  LEU A CB    1 
ATOM   5121 C  CG    . LEU A 1 691 ? 7.588   0.060   -14.762 1.00   46.93 ? 691  LEU A CG    1 
ATOM   5122 C  CD1   . LEU A 1 691 ? 8.007   0.663   -16.079 1.00   46.18 ? 691  LEU A CD1   1 
ATOM   5123 C  CD2   . LEU A 1 691 ? 6.186   0.486   -14.405 1.00   46.07 ? 691  LEU A CD2   1 
ATOM   5124 N  N     . GLN A 1 692 ? 8.450   -4.435  -13.220 1.00   65.41 ? 692  GLN A N     1 
ATOM   5125 C  CA    . GLN A 1 692 ? 8.651   -5.878  -13.387 1.00   72.57 ? 692  GLN A CA    1 
ATOM   5126 C  C     . GLN A 1 692 ? 7.543   -6.884  -13.056 1.00   75.79 ? 692  GLN A C     1 
ATOM   5127 O  O     . GLN A 1 692 ? 7.464   -7.927  -13.704 1.00   76.41 ? 692  GLN A O     1 
ATOM   5128 C  CB    . GLN A 1 692 ? 9.901   -6.314  -12.627 1.00   75.71 ? 692  GLN A CB    1 
ATOM   5129 C  CG    . GLN A 1 692 ? 11.186  -6.229  -13.415 1.00   85.01 ? 692  GLN A CG    1 
ATOM   5130 C  CD    . GLN A 1 692 ? 12.290  -7.014  -12.739 1.00   89.28 ? 692  GLN A CD    1 
ATOM   5131 O  OE1   . GLN A 1 692 ? 12.700  -6.696  -11.621 1.00   91.04 ? 692  GLN A OE1   1 
ATOM   5132 N  NE2   . GLN A 1 692 ? 12.766  -8.059  -13.407 1.00   91.69 ? 692  GLN A NE2   1 
ATOM   5133 N  N     . CYS A 1 693 ? 6.675   -6.617  -12.083 1.00   94.27 ? 693  CYS A N     1 
ATOM   5134 C  CA    . CYS A 1 693 ? 5.632   -7.610  -11.769 1.00   94.74 ? 693  CYS A CA    1 
ATOM   5135 C  C     . CYS A 1 693 ? 4.335   -7.013  -11.183 1.00   94.09 ? 693  CYS A C     1 
ATOM   5136 O  O     . CYS A 1 693 ? 4.013   -7.240  -10.009 1.00   93.82 ? 693  CYS A O     1 
ATOM   5137 C  CB    . CYS A 1 693 ? 6.218   -8.659  -10.798 1.00   95.37 ? 693  CYS A CB    1 
ATOM   5138 S  SG    . CYS A 1 693 ? 5.524   -10.356 -10.879 1.00   97.10 ? 693  CYS A SG    1 
ATOM   5139 N  N     . ASN A 1 694 ? 3.573   -6.291  -12.004 1.00   93.38 ? 694  ASN A N     1 
ATOM   5140 C  CA    . ASN A 1 694 ? 2.352   -5.663  -11.511 1.00   92.69 ? 694  ASN A CA    1 
ATOM   5141 C  C     . ASN A 1 694 ? 1.204   -5.468  -12.495 1.00   92.45 ? 694  ASN A C     1 
ATOM   5142 O  O     . ASN A 1 694 ? 0.297   -4.674  -12.244 1.00   92.15 ? 694  ASN A O     1 
ATOM   5143 C  CB    . ASN A 1 694 ? 2.705   -4.308  -10.900 1.00   92.34 ? 694  ASN A CB    1 
ATOM   5144 C  CG    . ASN A 1 694 ? 3.444   -3.407  -11.868 1.00   91.73 ? 694  ASN A CG    1 
ATOM   5145 O  OD1   . ASN A 1 694 ? 3.912   -2.337  -11.490 1.00   91.40 ? 694  ASN A OD1   1 
ATOM   5146 N  ND2   . ASN A 1 694 ? 3.548   -3.831  -13.122 1.00   91.20 ? 694  ASN A ND2   1 
ATOM   5147 N  N     . GLY A 1 695 ? 1.217   -6.182  -13.605 1.00   74.19 ? 695  GLY A N     1 
ATOM   5148 C  CA    . GLY A 1 695 ? 0.129   -6.006  -14.543 1.00   74.16 ? 695  GLY A CA    1 
ATOM   5149 C  C     . GLY A 1 695 ? 0.390   -4.998  -15.642 1.00   73.53 ? 695  GLY A C     1 
ATOM   5150 O  O     . GLY A 1 695 ? -0.107  -5.175  -16.756 1.00   74.24 ? 695  GLY A O     1 
ATOM   5151 N  N     . VAL A 1 696 ? 1.131   -3.934  -15.347 1.00   73.49 ? 696  VAL A N     1 
ATOM   5152 C  CA    . VAL A 1 696 ? 1.431   -2.956  -16.389 1.00   77.97 ? 696  VAL A CA    1 
ATOM   5153 C  C     . VAL A 1 696 ? 2.093   -3.900  -17.391 1.00   80.83 ? 696  VAL A C     1 
ATOM   5154 O  O     . VAL A 1 696 ? 3.062   -4.581  -17.049 1.00   84.38 ? 696  VAL A O     1 
ATOM   5155 C  CB    . VAL A 1 696 ? 2.395   -1.897  -15.865 1.00   81.95 ? 696  VAL A CB    1 
ATOM   5156 N  N     . LEU A 1 697 ? 1.555   -3.981  -18.602 1.00   81.08 ? 697  LEU A N     1 
ATOM   5157 C  CA    . LEU A 1 697 ? 2.059   -4.935  -19.594 1.00   78.60 ? 697  LEU A CA    1 
ATOM   5158 C  C     . LEU A 1 697 ? 3.534   -4.748  -19.874 1.00   75.68 ? 697  LEU A C     1 
ATOM   5159 O  O     . LEU A 1 697 ? 4.056   -5.231  -20.881 1.00   73.62 ? 697  LEU A O     1 
ATOM   5160 C  CB    . LEU A 1 697 ? 1.267   -4.825  -20.893 1.00   78.40 ? 697  LEU A CB    1 
ATOM   5161 N  N     . GLU A 1 698 ? 4.205   -4.019  -18.990 1.00   69.51 ? 698  GLU A N     1 
ATOM   5162 C  CA    . GLU A 1 698 ? 5.627   -3.732  -19.130 1.00   65.58 ? 698  GLU A CA    1 
ATOM   5163 C  C     . GLU A 1 698 ? 6.440   -4.584  -18.163 1.00   63.97 ? 698  GLU A C     1 
ATOM   5164 O  O     . GLU A 1 698 ? 7.460   -4.140  -17.636 1.00   64.60 ? 698  GLU A O     1 
ATOM   5165 C  CB    . GLU A 1 698 ? 5.884   -2.257  -18.872 1.00   63.24 ? 698  GLU A CB    1 
ATOM   5166 N  N     . ARG A 1 704 ? 5.766   -13.409 -13.001 1.00   88.67 ? 704  ARG A N     1 
ATOM   5167 C  CA    . ARG A 1 704 ? 5.612   -14.171 -14.227 1.00   88.84 ? 704  ARG A CA    1 
ATOM   5168 C  C     . ARG A 1 704 ? 4.353   -15.034 -14.180 1.00   90.06 ? 704  ARG A C     1 
ATOM   5169 O  O     . ARG A 1 704 ? 3.991   -15.561 -13.127 1.00   91.41 ? 704  ARG A O     1 
ATOM   5170 C  CB    . ARG A 1 704 ? 6.839   -15.045 -14.456 1.00   89.19 ? 704  ARG A CB    1 
ATOM   5171 N  N     . LYS A 1 705 ? 3.687   -15.178 -15.328 1.00   88.25 ? 705  LYS A N     1 
ATOM   5172 C  CA    . LYS A 1 705 ? 2.463   -15.984 -15.416 1.00   86.80 ? 705  LYS A CA    1 
ATOM   5173 C  C     . LYS A 1 705 ? 2.555   -17.203 -16.354 1.00   83.76 ? 705  LYS A C     1 
ATOM   5174 O  O     . LYS A 1 705 ? 3.243   -17.163 -17.376 1.00   81.69 ? 705  LYS A O     1 
ATOM   5175 C  CB    . LYS A 1 705 ? 1.264   -15.121 -15.839 1.00   89.80 ? 705  LYS A CB    1 
ATOM   5176 C  CG    . LYS A 1 705 ? 0.767   -14.132 -14.795 1.00   93.42 ? 705  LYS A CG    1 
ATOM   5177 C  CD    . LYS A 1 705 ? 1.182   -12.713 -15.159 1.00   95.48 ? 705  LYS A CD    1 
ATOM   5178 C  CE    . LYS A 1 705 ? 0.621   -11.697 -14.171 1.00   96.46 ? 705  LYS A CE    1 
ATOM   5179 N  NZ    . LYS A 1 705 ? 1.050   -10.299 -14.495 1.00   96.60 ? 705  LYS A NZ    1 
ATOM   5180 N  N     . GLY A 1 706 ? 1.847   -18.278 -15.989 1.00   77.36 ? 706  GLY A N     1 
ATOM   5181 C  CA    . GLY A 1 706 ? 1.841   -19.503 -16.776 1.00   68.97 ? 706  GLY A CA    1 
ATOM   5182 C  C     . GLY A 1 706 ? 0.706   -19.564 -17.787 1.00   65.59 ? 706  GLY A C     1 
ATOM   5183 O  O     . GLY A 1 706 ? 0.224   -20.642 -18.130 1.00   60.99 ? 706  GLY A O     1 
ATOM   5184 N  N     . PHE A 1 707 ? 0.278   -18.391 -18.256 1.00   62.67 ? 707  PHE A N     1 
ATOM   5185 C  CA    . PHE A 1 707 ? -0.797  -18.287 -19.239 1.00   58.93 ? 707  PHE A CA    1 
ATOM   5186 C  C     . PHE A 1 707 ? -0.260  -18.508 -20.644 1.00   55.44 ? 707  PHE A C     1 
ATOM   5187 O  O     . PHE A 1 707 ? 0.937   -18.352 -20.897 1.00   53.78 ? 707  PHE A O     1 
ATOM   5188 C  CB    . PHE A 1 707 ? -1.450  -16.894 -19.213 1.00   60.91 ? 707  PHE A CB    1 
ATOM   5189 C  CG    . PHE A 1 707 ? -2.163  -16.565 -17.930 1.00   65.90 ? 707  PHE A CG    1 
ATOM   5190 C  CD1   . PHE A 1 707 ? -2.679  -17.570 -17.118 1.00   67.90 ? 707  PHE A CD1   1 
ATOM   5191 C  CD2   . PHE A 1 707 ? -2.349  -15.234 -17.554 1.00   67.71 ? 707  PHE A CD2   1 
ATOM   5192 C  CE1   . PHE A 1 707 ? -3.374  -17.252 -15.954 1.00   69.12 ? 707  PHE A CE1   1 
ATOM   5193 C  CE2   . PHE A 1 707 ? -3.042  -14.908 -16.392 1.00   68.93 ? 707  PHE A CE2   1 
ATOM   5194 C  CZ    . PHE A 1 707 ? -3.553  -15.919 -15.590 1.00   69.42 ? 707  PHE A CZ    1 
ATOM   5195 N  N     . PRO A 1 708 ? -1.141  -18.877 -21.575 1.00   56.64 ? 708  PRO A N     1 
ATOM   5196 C  CA    . PRO A 1 708 ? -0.701  -19.104 -22.954 1.00   55.07 ? 708  PRO A CA    1 
ATOM   5197 C  C     . PRO A 1 708 ? -0.190  -17.823 -23.593 1.00   56.68 ? 708  PRO A C     1 
ATOM   5198 O  O     . PRO A 1 708 ? -0.721  -16.738 -23.350 1.00   56.70 ? 708  PRO A O     1 
ATOM   5199 C  CB    . PRO A 1 708 ? -1.958  -19.634 -23.641 1.00   53.94 ? 708  PRO A CB    1 
ATOM   5200 C  CG    . PRO A 1 708 ? -3.073  -19.055 -22.826 1.00   53.70 ? 708  PRO A CG    1 
ATOM   5201 C  CD    . PRO A 1 708 ? -2.565  -19.222 -21.423 1.00   53.67 ? 708  PRO A CD    1 
ATOM   5202 N  N     . SER A 1 709 ? 0.850   -17.956 -24.409 1.00   60.52 ? 709  SER A N     1 
ATOM   5203 C  CA    . SER A 1 709 ? 1.423   -16.811 -25.102 1.00   61.82 ? 709  SER A CA    1 
ATOM   5204 C  C     . SER A 1 709 ? 0.607   -16.559 -26.364 1.00   61.81 ? 709  SER A C     1 
ATOM   5205 O  O     . SER A 1 709 ? -0.111  -17.443 -26.833 1.00   57.85 ? 709  SER A O     1 
ATOM   5206 C  CB    . SER A 1 709 ? 2.883   -17.086 -25.473 1.00   63.26 ? 709  SER A CB    1 
ATOM   5207 O  OG    . SER A 1 709 ? 2.974   -18.216 -26.321 1.00   72.17 ? 709  SER A OG    1 
ATOM   5208 N  N     . ARG A 1 710 ? 0.721   -15.355 -26.907 1.00   62.51 ? 710  ARG A N     1 
ATOM   5209 C  CA    . ARG A 1 710 ? -0.031  -14.990 -28.108 1.00   62.04 ? 710  ARG A CA    1 
ATOM   5210 C  C     . ARG A 1 710 ? 0.731   -14.071 -29.052 1.00   60.36 ? 710  ARG A C     1 
ATOM   5211 O  O     . ARG A 1 710 ? 1.472   -13.188 -28.616 1.00   60.70 ? 710  ARG A O     1 
ATOM   5212 C  CB    . ARG A 1 710 ? -1.332  -14.308 -27.692 1.00   63.81 ? 710  ARG A CB    1 
ATOM   5213 C  CG    . ARG A 1 710 ? -1.113  -13.093 -26.829 1.00   67.79 ? 710  ARG A CG    1 
ATOM   5214 C  CD    . ARG A 1 710 ? -2.291  -12.901 -25.924 1.00   71.31 ? 710  ARG A CD    1 
ATOM   5215 N  NE    . ARG A 1 710 ? -2.116  -11.763 -25.033 1.00   72.91 ? 710  ARG A NE    1 
ATOM   5216 C  CZ    . ARG A 1 710 ? -2.905  -11.514 -23.993 1.00   73.69 ? 710  ARG A CZ    1 
ATOM   5217 N  NH1   . ARG A 1 710 ? -3.923  -12.329 -23.726 1.00   73.51 ? 710  ARG A NH1   1 
ATOM   5218 N  NH2   . ARG A 1 710 ? -2.666  -10.467 -23.214 1.00   73.90 ? 710  ARG A NH2   1 
ATOM   5219 N  N     . LEU A 1 711 ? 0.544   -14.283 -30.344 1.00   60.29 ? 711  LEU A N     1 
ATOM   5220 C  CA    . LEU A 1 711 ? 1.211   -13.450 -31.351 1.00   60.61 ? 711  LEU A CA    1 
ATOM   5221 C  C     . LEU A 1 711 ? 0.271   -13.042 -32.468 1.00   61.23 ? 711  LEU A C     1 
ATOM   5222 O  O     . LEU A 1 711 ? -0.555  -13.837 -32.915 1.00   61.28 ? 711  LEU A O     1 
ATOM   5223 C  CB    . LEU A 1 711 ? 2.383   -14.183 -31.992 1.00   58.78 ? 711  LEU A CB    1 
ATOM   5224 C  CG    . LEU A 1 711 ? 3.650   -14.450 -31.194 1.00   57.03 ? 711  LEU A CG    1 
ATOM   5225 C  CD1   . LEU A 1 711 ? 4.613   -15.213 -32.087 1.00   56.53 ? 711  LEU A CD1   1 
ATOM   5226 C  CD2   . LEU A 1 711 ? 4.289   -13.154 -30.743 1.00   55.58 ? 711  LEU A CD2   1 
ATOM   5227 N  N     . ILE A 1 712 ? 0.414   -11.806 -32.922 1.00   63.18 ? 712  ILE A N     1 
ATOM   5228 C  CA    . ILE A 1 712 ? -0.389  -11.331 -34.037 1.00   63.41 ? 712  ILE A CA    1 
ATOM   5229 C  C     . ILE A 1 712 ? 0.200   -12.054 -35.245 1.00   63.88 ? 712  ILE A C     1 
ATOM   5230 O  O     . ILE A 1 712 ? 1.393   -11.927 -35.529 1.00   63.71 ? 712  ILE A O     1 
ATOM   5231 C  CB    . ILE A 1 712 ? -0.243  -9.799  -34.232 1.00   64.12 ? 712  ILE A CB    1 
ATOM   5232 C  CG1   . ILE A 1 712 ? 1.221   -9.424  -34.497 1.00   64.39 ? 712  ILE A CG1   1 
ATOM   5233 C  CG2   . ILE A 1 712 ? -0.711  -9.076  -32.973 1.00   65.34 ? 712  ILE A CG2   1 
ATOM   5234 C  CD1   . ILE A 1 712 ? 1.459   -7.938  -34.695 1.00   64.92 ? 712  ILE A CD1   1 
ATOM   5235 N  N     . TYR A 1 713 ? -0.623  -12.834 -35.932 1.00   64.92 ? 713  TYR A N     1 
ATOM   5236 C  CA    . TYR A 1 713 ? -0.189  -13.577 -37.109 1.00   66.46 ? 713  TYR A CA    1 
ATOM   5237 C  C     . TYR A 1 713 ? 0.981   -12.941 -37.876 1.00   67.50 ? 713  TYR A C     1 
ATOM   5238 O  O     . TYR A 1 713 ? 1.918   -13.634 -38.266 1.00   69.99 ? 713  TYR A O     1 
ATOM   5239 C  CB    . TYR A 1 713 ? -1.383  -13.782 -38.024 1.00   64.99 ? 713  TYR A CB    1 
ATOM   5240 C  CG    . TYR A 1 713 ? -2.386  -14.763 -37.461 1.00   62.93 ? 713  TYR A CG    1 
ATOM   5241 C  CD1   . TYR A 1 713 ? -2.033  -16.093 -37.237 1.00   62.03 ? 713  TYR A CD1   1 
ATOM   5242 C  CD2   . TYR A 1 713 ? -3.695  -14.376 -37.183 1.00   62.01 ? 713  TYR A CD2   1 
ATOM   5243 C  CE1   . TYR A 1 713 ? -2.956  -17.019 -36.760 1.00   61.63 ? 713  TYR A CE1   1 
ATOM   5244 C  CE2   . TYR A 1 713 ? -4.626  -15.295 -36.708 1.00   61.34 ? 713  TYR A CE2   1 
ATOM   5245 C  CZ    . TYR A 1 713 ? -4.250  -16.616 -36.504 1.00   61.77 ? 713  TYR A CZ    1 
ATOM   5246 O  OH    . TYR A 1 713 ? -5.179  -17.549 -36.098 1.00   62.26 ? 713  TYR A OH    1 
ATOM   5247 N  N     . SER A 1 714 ? 0.922   -11.625 -38.085 1.00   69.17 ? 714  SER A N     1 
ATOM   5248 C  CA    . SER A 1 714 ? 1.983   -10.908 -38.780 1.00   70.25 ? 714  SER A CA    1 
ATOM   5249 C  C     . SER A 1 714 ? 3.356   -11.183 -38.167 1.00   70.15 ? 714  SER A C     1 
ATOM   5250 O  O     . SER A 1 714 ? 4.241   -11.702 -38.846 1.00   69.46 ? 714  SER A O     1 
ATOM   5251 C  CB    . SER A 1 714 ? 1.713   -9.406  -38.749 1.00   72.73 ? 714  SER A CB    1 
ATOM   5252 O  OG    . SER A 1 714 ? 2.877   -8.685  -39.115 1.00   74.96 ? 714  SER A OG    1 
ATOM   5253 N  N     . GLU A 1 715 ? 3.538   -10.848 -36.889 1.00   67.47 ? 715  GLU A N     1 
ATOM   5254 C  CA    . GLU A 1 715 ? 4.831   -11.066 -36.242 1.00   64.13 ? 715  GLU A CA    1 
ATOM   5255 C  C     . GLU A 1 715 ? 5.208   -12.546 -36.275 1.00   61.50 ? 715  GLU A C     1 
ATOM   5256 O  O     . GLU A 1 715 ? 6.384   -12.889 -36.321 1.00   57.97 ? 715  GLU A O     1 
ATOM   5257 C  CB    . GLU A 1 715 ? 4.816   -10.551 -34.800 1.00   62.16 ? 715  GLU A CB    1 
ATOM   5258 N  N     . PHE A 1 716 ? 4.195   -13.416 -36.253 1.00   59.21 ? 716  PHE A N     1 
ATOM   5259 C  CA    . PHE A 1 716 ? 4.434   -14.859 -36.308 1.00   59.15 ? 716  PHE A CA    1 
ATOM   5260 C  C     . PHE A 1 716 ? 5.106   -15.177 -37.633 1.00   60.09 ? 716  PHE A C     1 
ATOM   5261 O  O     . PHE A 1 716 ? 6.262   -15.610 -37.674 1.00   59.44 ? 716  PHE A O     1 
ATOM   5262 C  CB    . PHE A 1 716 ? 3.113   -15.643 -36.228 1.00   59.32 ? 716  PHE A CB    1 
ATOM   5263 C  CG    . PHE A 1 716 ? 3.302   -17.142 -36.145 1.00   59.89 ? 716  PHE A CG    1 
ATOM   5264 C  CD1   . PHE A 1 716 ? 3.876   -17.725 -35.017 1.00   60.46 ? 716  PHE A CD1   1 
ATOM   5265 C  CD2   . PHE A 1 716 ? 2.932   -17.962 -37.196 1.00   60.27 ? 716  PHE A CD2   1 
ATOM   5266 C  CE1   . PHE A 1 716 ? 4.076   -19.100 -34.941 1.00   59.86 ? 716  PHE A CE1   1 
ATOM   5267 C  CE2   . PHE A 1 716 ? 3.128   -19.342 -37.129 1.00   60.50 ? 716  PHE A CE2   1 
ATOM   5268 C  CZ    . PHE A 1 716 ? 3.703   -19.911 -35.998 1.00   60.10 ? 716  PHE A CZ    1 
ATOM   5269 N  N     . LYS A 1 717 ? 4.365   -14.947 -38.721 1.00   61.45 ? 717  LYS A N     1 
ATOM   5270 C  CA    . LYS A 1 717 ? 4.843   -15.196 -40.078 1.00   62.27 ? 717  LYS A CA    1 
ATOM   5271 C  C     . LYS A 1 717 ? 6.222   -14.609 -40.340 1.00   63.71 ? 717  LYS A C     1 
ATOM   5272 O  O     . LYS A 1 717 ? 7.032   -15.212 -41.044 1.00   60.62 ? 717  LYS A O     1 
ATOM   5273 C  CB    . LYS A 1 717 ? 3.841   -14.641 -41.101 1.00   60.69 ? 717  LYS A CB    1 
ATOM   5274 N  N     . GLN A 1 718 ? 6.487   -13.439 -39.779 1.00   65.89 ? 718  GLN A N     1 
ATOM   5275 C  CA    . GLN A 1 718 ? 7.786   -12.817 -39.962 1.00   67.59 ? 718  GLN A CA    1 
ATOM   5276 C  C     . GLN A 1 718 ? 8.843   -13.382 -39.032 1.00   65.20 ? 718  GLN A C     1 
ATOM   5277 O  O     . GLN A 1 718 ? 10.026  -13.066 -39.171 1.00   64.39 ? 718  GLN A O     1 
ATOM   5278 C  CB    . GLN A 1 718 ? 7.701   -11.283 -39.817 1.00   74.90 ? 718  GLN A CB    1 
ATOM   5279 C  CG    . GLN A 1 718 ? 6.804   -10.737 -38.716 1.00   90.22 ? 718  GLN A CG    1 
ATOM   5280 C  CD    . GLN A 1 718 ? 6.165   -9.387  -39.093 1.00   96.88 ? 718  GLN A CD    1 
ATOM   5281 O  OE1   . GLN A 1 718 ? 5.561   -8.706  -38.245 1.00   99.02 ? 718  GLN A OE1   1 
ATOM   5282 N  NE2   . GLN A 1 718 ? 6.287   -9.006  -40.374 1.00   98.76 ? 718  GLN A NE2   1 
ATOM   5283 N  N     . ARG A 1 719 ? 8.442   -14.229 -38.097 1.00   59.31 ? 719  ARG A N     1 
ATOM   5284 C  CA    . ARG A 1 719 ? 9.421   -14.808 -37.194 1.00   53.29 ? 719  ARG A CA    1 
ATOM   5285 C  C     . ARG A 1 719 ? 9.621   -16.305 -37.436 1.00   51.91 ? 719  ARG A C     1 
ATOM   5286 O  O     . ARG A 1 719 ? 10.735  -16.810 -37.278 1.00   47.88 ? 719  ARG A O     1 
ATOM   5287 C  CB    . ARG A 1 719 ? 8.998   -14.578 -35.746 1.00   52.00 ? 719  ARG A CB    1 
ATOM   5288 C  CG    . ARG A 1 719 ? 9.990   -15.042 -34.714 1.00   52.09 ? 719  ARG A CG    1 
ATOM   5289 C  CD    . ARG A 1 719 ? 11.213  -14.159 -34.658 1.00   52.39 ? 719  ARG A CD    1 
ATOM   5290 N  NE    . ARG A 1 719 ? 12.158  -14.624 -33.645 1.00   53.12 ? 719  ARG A NE    1 
ATOM   5291 C  CZ    . ARG A 1 719 ? 13.327  -14.036 -33.393 1.00   53.80 ? 719  ARG A CZ    1 
ATOM   5292 N  NH1   . ARG A 1 719 ? 13.688  -12.957 -34.089 1.00   54.58 ? 719  ARG A NH1   1 
ATOM   5293 N  NH2   . ARG A 1 719 ? 14.142  -14.526 -32.460 1.00   52.53 ? 719  ARG A NH2   1 
ATOM   5294 N  N     . TYR A 1 720 ? 8.560   -17.011 -37.831 1.00   50.27 ? 720  TYR A N     1 
ATOM   5295 C  CA    . TYR A 1 720 ? 8.656   -18.452 -38.040 1.00   49.40 ? 720  TYR A CA    1 
ATOM   5296 C  C     . TYR A 1 720 ? 8.355   -19.013 -39.426 1.00   50.02 ? 720  TYR A C     1 
ATOM   5297 O  O     . TYR A 1 720 ? 8.267   -20.232 -39.585 1.00   50.12 ? 720  TYR A O     1 
ATOM   5298 C  CB    . TYR A 1 720 ? 7.783   -19.207 -37.010 1.00   48.69 ? 720  TYR A CB    1 
ATOM   5299 C  CG    . TYR A 1 720 ? 8.151   -18.915 -35.574 1.00   48.04 ? 720  TYR A CG    1 
ATOM   5300 C  CD1   . TYR A 1 720 ? 9.400   -19.251 -35.077 1.00   49.69 ? 720  TYR A CD1   1 
ATOM   5301 C  CD2   . TYR A 1 720 ? 7.275   -18.232 -34.734 1.00   48.61 ? 720  TYR A CD2   1 
ATOM   5302 C  CE1   . TYR A 1 720 ? 9.779   -18.898 -33.786 1.00   49.99 ? 720  TYR A CE1   1 
ATOM   5303 C  CE2   . TYR A 1 720 ? 7.643   -17.874 -33.451 1.00   48.48 ? 720  TYR A CE2   1 
ATOM   5304 C  CZ    . TYR A 1 720 ? 8.893   -18.206 -32.986 1.00   49.66 ? 720  TYR A CZ    1 
ATOM   5305 O  OH    . TYR A 1 720 ? 9.308   -17.775 -31.743 1.00   51.60 ? 720  TYR A OH    1 
ATOM   5306 N  N     . SER A 1 721 ? 8.190   -18.164 -40.437 1.00   53.21 ? 721  SER A N     1 
ATOM   5307 C  CA    . SER A 1 721 ? 7.949   -18.702 -41.775 1.00   57.63 ? 721  SER A CA    1 
ATOM   5308 C  C     . SER A 1 721 ? 9.147   -19.607 -42.140 1.00   59.43 ? 721  SER A C     1 
ATOM   5309 O  O     . SER A 1 721 ? 9.020   -20.495 -42.980 1.00   62.26 ? 721  SER A O     1 
ATOM   5310 C  CB    . SER A 1 721 ? 7.794   -17.578 -42.799 1.00   60.37 ? 721  SER A CB    1 
ATOM   5311 O  OG    . SER A 1 721 ? 9.016   -16.889 -42.970 1.00   63.39 ? 721  SER A OG    1 
ATOM   5312 N  N     . ILE A 1 722 ? 10.288  -19.391 -41.490 1.00   61.42 ? 722  ILE A N     1 
ATOM   5313 C  CA    . ILE A 1 722 ? 11.491  -20.186 -41.723 1.00   60.21 ? 722  ILE A CA    1 
ATOM   5314 C  C     . ILE A 1 722 ? 11.380  -21.643 -41.244 1.00   60.19 ? 722  ILE A C     1 
ATOM   5315 O  O     . ILE A 1 722 ? 12.176  -22.493 -41.644 1.00   60.23 ? 722  ILE A O     1 
ATOM   5316 C  CB    . ILE A 1 722 ? 12.703  -19.559 -41.017 1.00   60.20 ? 722  ILE A CB    1 
ATOM   5317 C  CG1   . ILE A 1 722 ? 13.999  -20.169 -41.540 1.00   58.91 ? 722  ILE A CG1   1 
ATOM   5318 C  CG2   . ILE A 1 722 ? 12.616  -19.810 -39.516 1.00   59.75 ? 722  ILE A CG2   1 
ATOM   5319 C  CD1   . ILE A 1 722 ? 15.233  -19.598 -40.903 1.00   58.17 ? 722  ILE A CD1   1 
ATOM   5320 N  N     . LEU A 1 723 ? 10.403  -21.937 -40.396 1.00   58.68 ? 723  LEU A N     1 
ATOM   5321 C  CA    . LEU A 1 723 ? 10.239  -23.298 -39.887 1.00   58.72 ? 723  LEU A CA    1 
ATOM   5322 C  C     . LEU A 1 723 ? 9.578   -24.195 -40.916 1.00   59.51 ? 723  LEU A C     1 
ATOM   5323 O  O     . LEU A 1 723 ? 9.535   -25.419 -40.748 1.00   62.98 ? 723  LEU A O     1 
ATOM   5324 C  CB    . LEU A 1 723 ? 9.433   -23.283 -38.584 1.00   56.63 ? 723  LEU A CB    1 
ATOM   5325 C  CG    . LEU A 1 723 ? 10.105  -23.711 -37.262 1.00   54.29 ? 723  LEU A CG    1 
ATOM   5326 C  CD1   . LEU A 1 723 ? 11.603  -23.411 -37.235 1.00   50.20 ? 723  LEU A CD1   1 
ATOM   5327 C  CD2   . LEU A 1 723 ? 9.395   -22.994 -36.108 1.00   51.26 ? 723  LEU A CD2   1 
ATOM   5328 N  N     . ALA A 1 724 ? 9.065   -23.596 -41.994 1.00   59.19 ? 724  ALA A N     1 
ATOM   5329 C  CA    . ALA A 1 724 ? 8.432   -24.359 -43.078 1.00   59.66 ? 724  ALA A CA    1 
ATOM   5330 C  C     . ALA A 1 724 ? 8.386   -23.513 -44.369 1.00   60.15 ? 724  ALA A C     1 
ATOM   5331 O  O     . ALA A 1 724 ? 7.312   -23.193 -44.875 1.00   59.32 ? 724  ALA A O     1 
ATOM   5332 C  CB    . ALA A 1 724 ? 7.013   -24.791 -42.669 1.00   58.50 ? 724  ALA A CB    1 
ATOM   5333 N  N     . PRO A 1 725 ? 9.567   -23.147 -44.911 1.00   59.02 ? 725  PRO A N     1 
ATOM   5334 C  CA    . PRO A 1 725 ? 9.716   -22.323 -46.116 1.00   59.78 ? 725  PRO A CA    1 
ATOM   5335 C  C     . PRO A 1 725 ? 9.130   -22.899 -47.403 1.00   60.07 ? 725  PRO A C     1 
ATOM   5336 O  O     . PRO A 1 725 ? 8.673   -22.152 -48.271 1.00   60.96 ? 725  PRO A O     1 
ATOM   5337 C  CB    . PRO A 1 725 ? 11.236  -22.142 -46.236 1.00   59.71 ? 725  PRO A CB    1 
ATOM   5338 C  CG    . PRO A 1 725 ? 11.752  -22.412 -44.858 1.00   59.17 ? 725  PRO A CG    1 
ATOM   5339 C  CD    . PRO A 1 725 ? 10.892  -23.551 -44.407 1.00   59.58 ? 725  PRO A CD    1 
ATOM   5340 N  N     . ASN A 1 726 ? 9.147   -24.218 -47.525 1.00   60.74 ? 726  ASN A N     1 
ATOM   5341 C  CA    . ASN A 1 726 ? 8.659   -24.873 -48.731 1.00   63.17 ? 726  ASN A CA    1 
ATOM   5342 C  C     . ASN A 1 726 ? 7.163   -25.135 -48.755 1.00   66.41 ? 726  ASN A C     1 
ATOM   5343 O  O     . ASN A 1 726 ? 6.676   -25.912 -49.577 1.00   69.09 ? 726  ASN A O     1 
ATOM   5344 C  CB    . ASN A 1 726 ? 9.415   -26.184 -48.949 1.00   58.93 ? 726  ASN A CB    1 
ATOM   5345 C  CG    . ASN A 1 726 ? 10.910  -25.974 -49.079 1.00   54.18 ? 726  ASN A CG    1 
ATOM   5346 O  OD1   . ASN A 1 726 ? 11.366  -25.226 -49.939 1.00   51.83 ? 726  ASN A OD1   1 
ATOM   5347 N  ND2   . ASN A 1 726 ? 11.682  -26.630 -48.220 1.00   51.55 ? 726  ASN A ND2   1 
ATOM   5348 N  N     . ALA A 1 727 ? 6.428   -24.489 -47.854 1.00   71.24 ? 727  ALA A N     1 
ATOM   5349 C  CA    . ALA A 1 727 ? 4.983   -24.655 -47.802 1.00   74.61 ? 727  ALA A CA    1 
ATOM   5350 C  C     . ALA A 1 727 ? 4.338   -23.281 -47.710 1.00   75.89 ? 727  ALA A C     1 
ATOM   5351 O  O     . ALA A 1 727 ? 3.218   -23.137 -47.221 1.00   77.44 ? 727  ALA A O     1 
ATOM   5352 C  CB    . ALA A 1 727 ? 4.593   -25.519 -46.606 1.00   76.43 ? 727  ALA A CB    1 
ATOM   5353 N  N     . ILE A 1 728 ? 5.061   -22.274 -48.176 1.00   78.21 ? 728  ILE A N     1 
ATOM   5354 C  CA    . ILE A 1 728 ? 4.573   -20.897 -48.178 1.00   80.16 ? 728  ILE A CA    1 
ATOM   5355 C  C     . ILE A 1 728 ? 4.392   -20.474 -49.642 1.00   82.41 ? 728  ILE A C     1 
ATOM   5356 O  O     . ILE A 1 728 ? 5.345   -20.475 -50.417 1.00   83.53 ? 728  ILE A O     1 
ATOM   5357 C  CB    . ILE A 1 728 ? 5.576   -19.955 -47.471 1.00   76.63 ? 728  ILE A CB    1 
ATOM   5358 C  CG1   . ILE A 1 728 ? 5.720   -20.374 -46.005 1.00   73.46 ? 728  ILE A CG1   1 
ATOM   5359 C  CG2   . ILE A 1 728 ? 5.102   -18.506 -47.559 1.00   73.79 ? 728  ILE A CG2   1 
ATOM   5360 C  CD1   . ILE A 1 728 ? 6.739   -19.592 -45.235 1.00   70.84 ? 728  ILE A CD1   1 
ATOM   5361 N  N     . PRO A 1 729 ? 3.157   -20.115 -50.035 1.00   87.77 ? 729  PRO A N     1 
ATOM   5362 C  CA    . PRO A 1 729 ? 2.860   -19.696 -51.413 1.00   88.86 ? 729  PRO A CA    1 
ATOM   5363 C  C     . PRO A 1 729 ? 3.310   -18.286 -51.799 1.00   89.29 ? 729  PRO A C     1 
ATOM   5364 O  O     . PRO A 1 729 ? 3.506   -17.428 -50.938 1.00   88.29 ? 729  PRO A O     1 
ATOM   5365 C  CB    . PRO A 1 729 ? 1.343   -19.874 -51.502 1.00   90.95 ? 729  PRO A CB    1 
ATOM   5366 C  CG    . PRO A 1 729 ? 0.890   -19.530 -50.107 1.00   92.77 ? 729  PRO A CG    1 
ATOM   5367 C  CD    . PRO A 1 729 ? 1.915   -20.241 -49.242 1.00   90.11 ? 729  PRO A CD    1 
ATOM   5368 N  N     . GLN A 1 730 ? 3.455   -18.077 -53.109 1.00   88.29 ? 730  GLN A N     1 
ATOM   5369 C  CA    . GLN A 1 730 ? 3.873   -16.815 -53.729 1.00   86.63 ? 730  GLN A CA    1 
ATOM   5370 C  C     . GLN A 1 730 ? 4.808   -17.091 -54.903 1.00   84.38 ? 730  GLN A C     1 
ATOM   5371 O  O     . GLN A 1 730 ? 6.025   -17.161 -54.739 1.00   80.04 ? 730  GLN A O     1 
ATOM   5372 C  CB    . GLN A 1 730 ? 4.587   -15.896 -52.730 1.00   86.02 ? 730  GLN A CB    1 
ATOM   5373 C  CG    . GLN A 1 730 ? 5.157   -14.626 -53.353 1.00   89.92 ? 730  GLN A CG    1 
ATOM   5374 C  CD    . GLN A 1 730 ? 5.420   -13.543 -52.325 1.00   92.25 ? 730  GLN A CD    1 
ATOM   5375 O  OE1   . GLN A 1 730 ? 4.520   -13.159 -51.575 1.00   92.93 ? 730  GLN A OE1   1 
ATOM   5376 N  NE2   . GLN A 1 730 ? 6.650   -13.039 -52.288 1.00   92.85 ? 730  GLN A NE2   1 
ATOM   5377 N  N     . ASP A 1 734 ? -1.362  -12.883 -46.760 1.00   89.77 ? 734  ASP A N     1 
ATOM   5378 C  CA    . ASP A 1 734 ? -2.307  -13.237 -45.708 1.00   88.18 ? 734  ASP A CA    1 
ATOM   5379 C  C     . ASP A 1 734 ? -1.577  -13.845 -44.513 1.00   86.13 ? 734  ASP A C     1 
ATOM   5380 O  O     . ASP A 1 734 ? -1.481  -15.069 -44.390 1.00   84.04 ? 734  ASP A O     1 
ATOM   5381 C  CB    . ASP A 1 734 ? -3.347  -14.224 -46.249 1.00   91.67 ? 734  ASP A CB    1 
ATOM   5382 C  CG    . ASP A 1 734 ? -4.360  -14.645 -45.198 1.00   96.79 ? 734  ASP A CG    1 
ATOM   5383 O  OD1   . ASP A 1 734 ? -5.317  -15.369 -45.551 1.00   98.89 ? 734  ASP A OD1   1 
ATOM   5384 O  OD2   . ASP A 1 734 ? -4.204  -14.261 -44.019 1.00   98.81 ? 734  ASP A OD2   1 
ATOM   5385 N  N     . GLY A 1 735 ? -1.062  -12.982 -43.639 1.00   83.14 ? 735  GLY A N     1 
ATOM   5386 C  CA    . GLY A 1 735 ? -0.348  -13.446 -42.463 1.00   78.35 ? 735  GLY A CA    1 
ATOM   5387 C  C     . GLY A 1 735 ? -1.059  -14.557 -41.704 1.00   75.84 ? 735  GLY A C     1 
ATOM   5388 O  O     . GLY A 1 735 ? -0.414  -15.407 -41.088 1.00   73.30 ? 735  GLY A O     1 
ATOM   5389 N  N     . LYS A 1 736 ? -2.385  -14.555 -41.757 1.00   74.48 ? 736  LYS A N     1 
ATOM   5390 C  CA    . LYS A 1 736 ? -3.200  -15.553 -41.069 1.00   76.44 ? 736  LYS A CA    1 
ATOM   5391 C  C     . LYS A 1 736 ? -3.040  -16.969 -41.644 1.00   79.08 ? 736  LYS A C     1 
ATOM   5392 O  O     . LYS A 1 736 ? -2.925  -17.935 -40.889 1.00   78.15 ? 736  LYS A O     1 
ATOM   5393 C  CB    . LYS A 1 736 ? -4.672  -15.125 -41.115 1.00   76.61 ? 736  LYS A CB    1 
ATOM   5394 C  CG    . LYS A 1 736 ? -5.547  -15.658 -39.994 1.00   76.33 ? 736  LYS A CG    1 
ATOM   5395 C  CD    . LYS A 1 736 ? -5.946  -17.104 -40.212 1.00   76.31 ? 736  LYS A CD    1 
ATOM   5396 C  CE    . LYS A 1 736 ? -7.068  -17.505 -39.253 1.00   75.66 ? 736  LYS A CE    1 
ATOM   5397 N  NZ    . LYS A 1 736 ? -7.627  -18.846 -39.576 1.00   75.14 ? 736  LYS A NZ    1 
ATOM   5398 N  N     . THR A 1 737 ? -3.031  -17.094 -42.969 1.00   82.53 ? 737  THR A N     1 
ATOM   5399 C  CA    . THR A 1 737 ? -2.884  -18.409 -43.586 1.00   82.66 ? 737  THR A CA    1 
ATOM   5400 C  C     . THR A 1 737 ? -1.426  -18.853 -43.633 1.00   80.20 ? 737  THR A C     1 
ATOM   5401 O  O     . THR A 1 737 ? -1.130  -20.048 -43.596 1.00   80.31 ? 737  THR A O     1 
ATOM   5402 C  CB    . THR A 1 737 ? -3.481  -18.426 -45.002 1.00   86.17 ? 737  THR A CB    1 
ATOM   5403 O  OG1   . THR A 1 737 ? -3.256  -17.155 -45.621 1.00   91.77 ? 737  THR A OG1   1 
ATOM   5404 C  CG2   . THR A 1 737 ? -4.981  -18.728 -44.946 1.00   91.32 ? 737  THR A CG2   1 
ATOM   5405 N  N     . VAL A 1 738 ? -0.525  -17.886 -43.714 1.00   76.39 ? 738  VAL A N     1 
ATOM   5406 C  CA    . VAL A 1 738 ? 0.903   -18.179 -43.728 1.00   74.57 ? 738  VAL A CA    1 
ATOM   5407 C  C     . VAL A 1 738 ? 1.264   -18.770 -42.370 1.00   73.15 ? 738  VAL A C     1 
ATOM   5408 O  O     . VAL A 1 738 ? 2.208   -19.550 -42.250 1.00   74.91 ? 738  VAL A O     1 
ATOM   5409 C  CB    . VAL A 1 738 ? 1.744   -16.897 -43.945 1.00   72.29 ? 738  VAL A CB    1 
ATOM   5410 C  CG1   . VAL A 1 738 ? 3.227   -17.207 -43.781 1.00   67.81 ? 738  VAL A CG1   1 
ATOM   5411 C  CG2   . VAL A 1 738 ? 1.471   -16.324 -45.325 1.00   67.96 ? 738  VAL A CG2   1 
ATOM   5412 N  N     . SER A 1 739 ? 0.499   -18.391 -41.349 1.00   73.41 ? 739  SER A N     1 
ATOM   5413 C  CA    . SER A 1 739 ? 0.738   -18.879 -39.993 1.00   74.27 ? 739  SER A CA    1 
ATOM   5414 C  C     . SER A 1 739 ? 0.180   -20.279 -39.801 1.00   76.16 ? 739  SER A C     1 
ATOM   5415 O  O     . SER A 1 739 ? 0.720   -21.073 -39.030 1.00   75.60 ? 739  SER A O     1 
ATOM   5416 C  CB    . SER A 1 739 ? 0.108   -17.934 -38.959 1.00   71.79 ? 739  SER A CB    1 
ATOM   5417 O  OG    . SER A 1 739 ? 0.755   -16.667 -38.941 1.00   66.43 ? 739  SER A OG    1 
ATOM   5418 N  N     . GLU A 1 740 ? -0.904  -20.582 -40.511 1.00   78.84 ? 740  GLU A N     1 
ATOM   5419 C  CA    . GLU A 1 740 ? -1.546  -21.887 -40.407 1.00   81.23 ? 740  GLU A CA    1 
ATOM   5420 C  C     . GLU A 1 740 ? -0.821  -22.966 -41.213 1.00   79.89 ? 740  GLU A C     1 
ATOM   5421 O  O     . GLU A 1 740 ? -0.868  -24.144 -40.862 1.00   79.55 ? 740  GLU A O     1 
ATOM   5422 C  CB    . GLU A 1 740 ? -3.010  -21.776 -40.848 1.00   86.16 ? 740  GLU A CB    1 
ATOM   5423 C  CG    . GLU A 1 740 ? -3.782  -23.091 -40.867 1.00   94.71 ? 740  GLU A CG    1 
ATOM   5424 C  CD    . GLU A 1 740 ? -5.282  -22.898 -40.654 1.00   98.22 ? 740  GLU A CD    1 
ATOM   5425 O  OE1   . GLU A 1 740 ? -5.822  -21.855 -41.102 1.00   99.01 ? 740  GLU A OE1   1 
ATOM   5426 O  OE2   . GLU A 1 740 ? -5.913  -23.800 -40.047 1.00   98.98 ? 740  GLU A OE2   1 
ATOM   5427 N  N     . LYS A 1 741 ? -0.152  -22.563 -42.288 1.00   75.91 ? 741  LYS A N     1 
ATOM   5428 C  CA    . LYS A 1 741 ? 0.573   -23.516 -43.116 1.00   71.60 ? 741  LYS A CA    1 
ATOM   5429 C  C     . LYS A 1 741 ? 1.881   -23.913 -42.439 1.00   69.49 ? 741  LYS A C     1 
ATOM   5430 O  O     . LYS A 1 741 ? 2.373   -25.026 -42.624 1.00   67.02 ? 741  LYS A O     1 
ATOM   5431 C  CB    . LYS A 1 741 ? 0.848   -22.920 -44.493 1.00   71.09 ? 741  LYS A CB    1 
ATOM   5432 N  N     . ILE A 1 742 ? 2.443   -22.996 -41.667 1.00   65.92 ? 742  ILE A N     1 
ATOM   5433 C  CA    . ILE A 1 742 ? 3.680   -23.264 -40.966 1.00   62.89 ? 742  ILE A CA    1 
ATOM   5434 C  C     . ILE A 1 742 ? 3.389   -24.259 -39.850 1.00   63.13 ? 742  ILE A C     1 
ATOM   5435 O  O     . ILE A 1 742 ? 4.125   -25.226 -39.654 1.00   61.75 ? 742  ILE A O     1 
ATOM   5436 C  CB    . ILE A 1 742 ? 4.261   -21.975 -40.355 1.00   61.34 ? 742  ILE A CB    1 
ATOM   5437 C  CG1   . ILE A 1 742 ? 4.653   -21.005 -41.477 1.00   60.00 ? 742  ILE A CG1   1 
ATOM   5438 C  CG2   . ILE A 1 742 ? 5.452   -22.314 -39.463 1.00   59.76 ? 742  ILE A CG2   1 
ATOM   5439 C  CD1   . ILE A 1 742 ? 5.075   -19.634 -41.004 1.00   58.72 ? 742  ILE A CD1   1 
ATOM   5440 N  N     . LEU A 1 743 ? 2.302   -24.011 -39.123 1.00   63.91 ? 743  LEU A N     1 
ATOM   5441 C  CA    . LEU A 1 743 ? 1.913   -24.872 -38.025 1.00   65.55 ? 743  LEU A CA    1 
ATOM   5442 C  C     . LEU A 1 743 ? 1.455   -26.196 -38.603 1.00   67.03 ? 743  LEU A C     1 
ATOM   5443 O  O     . LEU A 1 743 ? 1.728   -27.259 -38.041 1.00   68.18 ? 743  LEU A O     1 
ATOM   5444 C  CB    . LEU A 1 743 ? 0.803   -24.211 -37.193 1.00   65.06 ? 743  LEU A CB    1 
ATOM   5445 C  CG    . LEU A 1 743 ? 1.180   -22.923 -36.444 1.00   64.14 ? 743  LEU A CG    1 
ATOM   5446 C  CD1   . LEU A 1 743 ? 0.003   -22.496 -35.600 1.00   63.66 ? 743  LEU A CD1   1 
ATOM   5447 C  CD2   . LEU A 1 743 ? 2.394   -23.132 -35.559 1.00   62.57 ? 743  LEU A CD2   1 
ATOM   5448 N  N     . ALA A 1 744 ? 0.755   -26.126 -39.725 1.00   69.94 ? 744  ALA A N     1 
ATOM   5449 C  CA    . ALA A 1 744 ? 0.312   -27.335 -40.397 1.00   72.33 ? 744  ALA A CA    1 
ATOM   5450 C  C     . ALA A 1 744 ? 1.600   -28.064 -40.795 1.00   72.97 ? 744  ALA A C     1 
ATOM   5451 O  O     . ALA A 1 744 ? 1.699   -29.284 -40.683 1.00   73.65 ? 744  ALA A O     1 
ATOM   5452 C  CB    . ALA A 1 744 ? -0.497  -26.983 -41.629 1.00   72.73 ? 744  ALA A CB    1 
ATOM   5453 N  N     . GLY A 1 745 ? 2.580   -27.289 -41.250 1.00   72.98 ? 745  GLY A N     1 
ATOM   5454 C  CA    . GLY A 1 745 ? 3.867   -27.838 -41.640 1.00   73.57 ? 745  GLY A CA    1 
ATOM   5455 C  C     . GLY A 1 745 ? 4.532   -28.611 -40.512 1.00   75.00 ? 745  GLY A C     1 
ATOM   5456 O  O     . GLY A 1 745 ? 4.767   -29.812 -40.642 1.00   74.03 ? 745  GLY A O     1 
ATOM   5457 N  N     . LEU A 1 746 ? 4.843   -27.934 -39.407 1.00   76.17 ? 746  LEU A N     1 
ATOM   5458 C  CA    . LEU A 1 746 ? 5.471   -28.601 -38.270 1.00   75.45 ? 746  LEU A CA    1 
ATOM   5459 C  C     . LEU A 1 746 ? 4.532   -29.693 -37.776 1.00   76.73 ? 746  LEU A C     1 
ATOM   5460 O  O     . LEU A 1 746 ? 4.915   -30.523 -36.954 1.00   73.07 ? 746  LEU A O     1 
ATOM   5461 C  CB    . LEU A 1 746 ? 5.730   -27.614 -37.129 1.00   75.81 ? 746  LEU A CB    1 
ATOM   5462 C  CG    . LEU A 1 746 ? 6.460   -26.302 -37.431 1.00   79.13 ? 746  LEU A CG    1 
ATOM   5463 C  CD1   . LEU A 1 746 ? 6.469   -25.423 -36.179 1.00   80.69 ? 746  LEU A CD1   1 
ATOM   5464 C  CD2   . LEU A 1 746 ? 7.881   -26.590 -37.908 1.00   81.53 ? 746  LEU A CD2   1 
ATOM   5465 N  N     . GLN A 1 747 ? 3.303   -29.685 -38.275 1.00   79.48 ? 747  GLN A N     1 
ATOM   5466 C  CA    . GLN A 1 747 ? 2.315   -30.678 -37.868 1.00   82.12 ? 747  GLN A CA    1 
ATOM   5467 C  C     . GLN A 1 747 ? 2.168   -30.693 -36.353 1.00   82.23 ? 747  GLN A C     1 
ATOM   5468 O  O     . GLN A 1 747 ? 1.989   -31.747 -35.744 1.00   82.69 ? 747  GLN A O     1 
ATOM   5469 C  CB    . GLN A 1 747 ? 2.733   -32.068 -38.344 1.00   85.85 ? 747  GLN A CB    1 
ATOM   5470 C  CG    . GLN A 1 747 ? 2.596   -32.293 -39.839 1.00   94.32 ? 747  GLN A CG    1 
ATOM   5471 C  CD    . GLN A 1 747 ? 3.002   -33.695 -40.237 1.00   98.03 ? 747  GLN A CD    1 
ATOM   5472 O  OE1   . GLN A 1 747 ? 2.752   -34.130 -41.366 1.00   99.17 ? 747  GLN A OE1   1 
ATOM   5473 N  NE2   . GLN A 1 747 ? 3.640   -34.415 -39.308 1.00   99.02 ? 747  GLN A NE2   1 
ATOM   5474 N  N     . MET A 1 748 ? 2.247   -29.512 -35.752 1.00   82.72 ? 748  MET A N     1 
ATOM   5475 C  CA    . MET A 1 748 ? 2.132   -29.375 -34.310 1.00   82.50 ? 748  MET A CA    1 
ATOM   5476 C  C     . MET A 1 748 ? 0.801   -29.924 -33.811 1.00   82.18 ? 748  MET A C     1 
ATOM   5477 O  O     . MET A 1 748 ? -0.226  -29.812 -34.487 1.00   81.71 ? 748  MET A O     1 
ATOM   5478 C  CB    . MET A 1 748 ? 2.256   -27.903 -33.927 1.00   83.84 ? 748  MET A CB    1 
ATOM   5479 C  CG    . MET A 1 748 ? 2.145   -27.614 -32.442 1.00   85.91 ? 748  MET A CG    1 
ATOM   5480 S  SD    . MET A 1 748 ? 2.170   -25.830 -32.144 1.00   86.59 ? 748  MET A SD    1 
ATOM   5481 C  CE    . MET A 1 748 ? 3.910   -25.470 -32.338 1.00   86.85 ? 748  MET A CE    1 
ATOM   5482 N  N     . ASP A 1 749 ? 0.834   -30.520 -32.625 1.00   81.08 ? 749  ASP A N     1 
ATOM   5483 C  CA    . ASP A 1 749 ? -0.354  -31.077 -31.988 1.00   78.98 ? 749  ASP A CA    1 
ATOM   5484 C  C     . ASP A 1 749 ? -1.393  -29.963 -31.843 1.00   77.26 ? 749  ASP A C     1 
ATOM   5485 O  O     . ASP A 1 749 ? -1.123  -28.932 -31.223 1.00   75.86 ? 749  ASP A O     1 
ATOM   5486 C  CB    . ASP A 1 749 ? 0.037   -31.645 -30.613 1.00   79.95 ? 749  ASP A CB    1 
ATOM   5487 C  CG    . ASP A 1 749 ? -1.162  -31.915 -29.713 1.00   82.19 ? 749  ASP A CG    1 
ATOM   5488 O  OD1   . ASP A 1 749 ? -2.156  -32.513 -30.187 1.00   83.02 ? 749  ASP A OD1   1 
ATOM   5489 O  OD2   . ASP A 1 749 ? -1.095  -31.534 -28.519 1.00   83.57 ? 749  ASP A OD2   1 
ATOM   5490 N  N     . PRO A 1 750 ? -2.598  -30.153 -32.414 1.00   74.97 ? 750  PRO A N     1 
ATOM   5491 C  CA    . PRO A 1 750 ? -3.670  -29.153 -32.341 1.00   73.12 ? 750  PRO A CA    1 
ATOM   5492 C  C     . PRO A 1 750 ? -4.082  -28.820 -30.909 1.00   71.73 ? 750  PRO A C     1 
ATOM   5493 O  O     . PRO A 1 750 ? -4.769  -27.828 -30.663 1.00   72.15 ? 750  PRO A O     1 
ATOM   5494 C  CB    . PRO A 1 750 ? -4.797  -29.808 -33.128 1.00   73.25 ? 750  PRO A CB    1 
ATOM   5495 C  CG    . PRO A 1 750 ? -4.587  -31.266 -32.818 1.00   73.60 ? 750  PRO A CG    1 
ATOM   5496 C  CD    . PRO A 1 750 ? -3.096  -31.401 -33.016 1.00   73.95 ? 750  PRO A CD    1 
ATOM   5497 N  N     . ALA A 1 751 ? -3.649  -29.655 -29.966 1.00   69.33 ? 751  ALA A N     1 
ATOM   5498 C  CA    . ALA A 1 751 ? -3.961  -29.461 -28.557 1.00   67.68 ? 751  ALA A CA    1 
ATOM   5499 C  C     . ALA A 1 751 ? -2.908  -28.609 -27.854 1.00   67.81 ? 751  ALA A C     1 
ATOM   5500 O  O     . ALA A 1 751 ? -2.776  -28.667 -26.625 1.00   67.09 ? 751  ALA A O     1 
ATOM   5501 C  CB    . ALA A 1 751 ? -4.078  -30.814 -27.870 1.00   67.93 ? 751  ALA A CB    1 
ATOM   5502 N  N     . GLU A 1 752 ? -2.159  -27.816 -28.621 1.00   66.32 ? 752  GLU A N     1 
ATOM   5503 C  CA    . GLU A 1 752 ? -1.119  -26.974 -28.047 1.00   65.09 ? 752  GLU A CA    1 
ATOM   5504 C  C     . GLU A 1 752 ? -1.234  -25.512 -28.463 1.00   65.15 ? 752  GLU A C     1 
ATOM   5505 O  O     . GLU A 1 752 ? -0.453  -24.667 -28.008 1.00   62.86 ? 752  GLU A O     1 
ATOM   5506 C  CB    . GLU A 1 752 ? 0.258   -27.521 -28.413 1.00   63.83 ? 752  GLU A CB    1 
ATOM   5507 N  N     . TYR A 1 753 ? -2.200  -25.208 -29.319 1.00   64.78 ? 753  TYR A N     1 
ATOM   5508 C  CA    . TYR A 1 753 ? -2.399  -23.832 -29.754 1.00   65.47 ? 753  TYR A CA    1 
ATOM   5509 C  C     . TYR A 1 753 ? -3.857  -23.530 -30.068 1.00   66.29 ? 753  TYR A C     1 
ATOM   5510 O  O     . TYR A 1 753 ? -4.704  -24.425 -30.053 1.00   63.22 ? 753  TYR A O     1 
ATOM   5511 C  CB    . TYR A 1 753 ? -1.531  -23.512 -30.974 1.00   69.12 ? 753  TYR A CB    1 
ATOM   5512 C  CG    . TYR A 1 753 ? -1.832  -24.348 -32.187 1.00   75.52 ? 753  TYR A CG    1 
ATOM   5513 C  CD1   . TYR A 1 753 ? -1.537  -25.709 -32.209 1.00   78.03 ? 753  TYR A CD1   1 
ATOM   5514 C  CD2   . TYR A 1 753 ? -2.426  -23.783 -33.309 1.00   77.89 ? 753  TYR A CD2   1 
ATOM   5515 C  CE1   . TYR A 1 753 ? -1.827  -26.487 -33.315 1.00   79.22 ? 753  TYR A CE1   1 
ATOM   5516 C  CE2   . TYR A 1 753 ? -2.719  -24.549 -34.421 1.00   79.52 ? 753  TYR A CE2   1 
ATOM   5517 C  CZ    . TYR A 1 753 ? -2.419  -25.902 -34.417 1.00   79.79 ? 753  TYR A CZ    1 
ATOM   5518 O  OH    . TYR A 1 753 ? -2.726  -26.669 -35.512 1.00   80.45 ? 753  TYR A OH    1 
ATOM   5519 N  N     . ARG A 1 754 ? -4.137  -22.260 -30.348 1.00   68.20 ? 754  ARG A N     1 
ATOM   5520 C  CA    . ARG A 1 754 ? -5.487  -21.832 -30.654 1.00   67.97 ? 754  ARG A CA    1 
ATOM   5521 C  C     . ARG A 1 754 ? -5.518  -20.672 -31.627 1.00   69.72 ? 754  ARG A C     1 
ATOM   5522 O  O     . ARG A 1 754 ? -4.815  -19.671 -31.489 1.00   69.12 ? 754  ARG A O     1 
ATOM   5523 C  CB    . ARG A 1 754 ? -6.238  -21.467 -29.371 1.00   65.91 ? 754  ARG A CB    1 
ATOM   5524 C  CG    . ARG A 1 754 ? -6.560  -22.669 -28.489 1.00   67.18 ? 754  ARG A CG    1 
ATOM   5525 C  CD    . ARG A 1 754 ? -7.601  -23.548 -29.147 1.00   68.40 ? 754  ARG A CD    1 
ATOM   5526 N  NE    . ARG A 1 754 ? -7.379  -24.970 -28.895 1.00   69.72 ? 754  ARG A NE    1 
ATOM   5527 C  CZ    . ARG A 1 754 ? -7.460  -25.559 -27.707 1.00   69.91 ? 754  ARG A CZ    1 
ATOM   5528 N  NH1   . ARG A 1 754 ? -7.758  -24.855 -26.629 1.00   71.05 ? 754  ARG A NH1   1 
ATOM   5529 N  NH2   . ARG A 1 754 ? -7.243  -26.860 -27.598 1.00   70.54 ? 754  ARG A NH2   1 
ATOM   5530 N  N     . LEU A 1 755 ? -6.371  -20.860 -32.625 1.00   74.58 ? 755  LEU A N     1 
ATOM   5531 C  CA    . LEU A 1 755 ? -6.627  -19.950 -33.727 1.00   80.27 ? 755  LEU A CA    1 
ATOM   5532 C  C     . LEU A 1 755 ? -7.298  -18.653 -33.294 1.00   80.84 ? 755  LEU A C     1 
ATOM   5533 O  O     . LEU A 1 755 ? -8.488  -18.650 -32.982 1.00   83.41 ? 755  LEU A O     1 
ATOM   5534 C  CB    . LEU A 1 755 ? -7.542  -20.674 -34.716 1.00   87.70 ? 755  LEU A CB    1 
ATOM   5535 C  CG    . LEU A 1 755 ? -8.885  -21.158 -34.110 1.00   95.90 ? 755  LEU A CG    1 
ATOM   5536 C  CD1   . LEU A 1 755 ? -9.679  -21.903 -35.184 1.00   98.67 ? 755  LEU A CD1   1 
ATOM   5537 C  CD2   . LEU A 1 755 ? -8.669  -22.070 -32.893 1.00   98.39 ? 755  LEU A CD2   1 
ATOM   5538 N  N     . GLY A 1 756 ? -6.566  -17.551 -33.274 1.00   82.33 ? 756  GLY A N     1 
ATOM   5539 C  CA    . GLY A 1 756 ? -7.195  -16.303 -32.885 1.00   79.25 ? 756  GLY A CA    1 
ATOM   5540 C  C     . GLY A 1 756 ? -7.591  -15.506 -34.108 1.00   78.62 ? 756  GLY A C     1 
ATOM   5541 O  O     . GLY A 1 756 ? -6.826  -15.433 -35.065 1.00   75.45 ? 756  GLY A O     1 
ATOM   5542 N  N     . THR A 1 757 ? -8.778  -14.917 -34.096 1.00   78.94 ? 757  THR A N     1 
ATOM   5543 C  CA    . THR A 1 757 ? -9.223  -14.126 -35.238 1.00   81.26 ? 757  THR A CA    1 
ATOM   5544 C  C     . THR A 1 757 ? -8.110  -13.164 -35.629 1.00   82.04 ? 757  THR A C     1 
ATOM   5545 O  O     . THR A 1 757 ? -7.935  -12.844 -36.804 1.00   81.44 ? 757  THR A O     1 
ATOM   5546 C  CB    . THR A 1 757 ? -10.437 -13.270 -34.896 1.00   84.06 ? 757  THR A CB    1 
ATOM   5547 O  OG1   . THR A 1 757 ? -10.003 -12.122 -34.156 1.00   88.52 ? 757  THR A OG1   1 
ATOM   5548 C  CG2   . THR A 1 757 ? -11.434 -14.067 -34.062 1.00   88.41 ? 757  THR A CG2   1 
ATOM   5549 N  N     . THR A 1 758 ? -7.359  -12.706 -34.631 1.00   81.91 ? 758  THR A N     1 
ATOM   5550 C  CA    . THR A 1 758 ? -6.282  -11.760 -34.871 1.00   80.19 ? 758  THR A CA    1 
ATOM   5551 C  C     . THR A 1 758 ? -4.912  -12.246 -34.417 1.00   79.49 ? 758  THR A C     1 
ATOM   5552 O  O     . THR A 1 758 ? -3.888  -11.665 -34.788 1.00   75.63 ? 758  THR A O     1 
ATOM   5553 C  CB    . THR A 1 758 ? -6.621  -10.399 -34.214 1.00   82.47 ? 758  THR A CB    1 
ATOM   5554 O  OG1   . THR A 1 758 ? -7.610  -9.741  -35.015 1.00   87.15 ? 758  THR A OG1   1 
ATOM   5555 C  CG2   . THR A 1 758 ? -5.399  -9.503  -34.097 1.00   86.91 ? 758  THR A CG2   1 
ATOM   5556 N  N     . LYS A 1 759 ? -4.876  -13.317 -33.637 1.00   76.71 ? 759  LYS A N     1 
ATOM   5557 C  CA    . LYS A 1 759 ? -3.589  -13.829 -33.177 1.00   72.08 ? 759  LYS A CA    1 
ATOM   5558 C  C     . LYS A 1 759 ? -3.621  -15.291 -32.774 1.00   67.11 ? 759  LYS A C     1 
ATOM   5559 O  O     . LYS A 1 759 ? -4.668  -15.823 -32.427 1.00   66.01 ? 759  LYS A O     1 
ATOM   5560 C  CB    . LYS A 1 759 ? -3.085  -12.987 -32.009 1.00   74.99 ? 759  LYS A CB    1 
ATOM   5561 C  CG    . LYS A 1 759 ? -4.091  -12.810 -30.890 1.00   82.98 ? 759  LYS A CG    1 
ATOM   5562 C  CD    . LYS A 1 759 ? -3.615  -11.777 -29.869 1.00   87.27 ? 759  LYS A CD    1 
ATOM   5563 C  CE    . LYS A 1 759 ? -3.594  -10.371 -30.463 1.00   89.27 ? 759  LYS A CE    1 
ATOM   5564 N  NZ    . LYS A 1 759 ? -3.082  -9.324  -29.519 1.00   89.45 ? 759  LYS A NZ    1 
ATOM   5565 N  N     . VAL A 1 760 ? -2.467  -15.947 -32.816 1.00   61.33 ? 760  VAL A N     1 
ATOM   5566 C  CA    . VAL A 1 760 ? -2.403  -17.354 -32.435 1.00   57.47 ? 760  VAL A CA    1 
ATOM   5567 C  C     . VAL A 1 760 ? -1.933  -17.462 -30.981 1.00   55.39 ? 760  VAL A C     1 
ATOM   5568 O  O     . VAL A 1 760 ? -1.111  -16.662 -30.524 1.00   56.91 ? 760  VAL A O     1 
ATOM   5569 C  CB    . VAL A 1 760 ? -1.450  -18.156 -33.368 1.00   53.46 ? 760  VAL A CB    1 
ATOM   5570 C  CG1   . VAL A 1 760 ? -0.028  -17.599 -33.287 1.00   47.54 ? 760  VAL A CG1   1 
ATOM   5571 C  CG2   . VAL A 1 760 ? -1.490  -19.639 -32.985 1.00   48.78 ? 760  VAL A CG2   1 
ATOM   5572 N  N     . PHE A 1 761 ? -2.466  -18.453 -30.268 1.00   55.31 ? 761  PHE A N     1 
ATOM   5573 C  CA    . PHE A 1 761 ? -2.146  -18.686 -28.864 1.00   55.84 ? 761  PHE A CA    1 
ATOM   5574 C  C     . PHE A 1 761 ? -1.480  -20.056 -28.695 1.00   55.69 ? 761  PHE A C     1 
ATOM   5575 O  O     . PHE A 1 761 ? -1.878  -21.022 -29.335 1.00   55.89 ? 761  PHE A O     1 
ATOM   5576 C  CB    . PHE A 1 761 ? -3.429  -18.668 -28.007 1.00   55.47 ? 761  PHE A CB    1 
ATOM   5577 C  CG    . PHE A 1 761 ? -4.112  -17.326 -27.915 1.00   54.46 ? 761  PHE A CG    1 
ATOM   5578 C  CD1   . PHE A 1 761 ? -4.726  -16.754 -29.034 1.00   54.81 ? 761  PHE A CD1   1 
ATOM   5579 C  CD2   . PHE A 1 761 ? -4.215  -16.672 -26.693 1.00   53.34 ? 761  PHE A CD2   1 
ATOM   5580 C  CE1   . PHE A 1 761 ? -5.436  -15.552 -28.934 1.00   53.55 ? 761  PHE A CE1   1 
ATOM   5581 C  CE2   . PHE A 1 761 ? -4.918  -15.472 -26.572 1.00   52.88 ? 761  PHE A CE2   1 
ATOM   5582 C  CZ    . PHE A 1 761 ? -5.537  -14.910 -27.696 1.00   54.19 ? 761  PHE A CZ    1 
ATOM   5583 N  N     . PHE A 1 762 ? -0.472  -20.134 -27.818 1.00   54.33 ? 762  PHE A N     1 
ATOM   5584 C  CA    . PHE A 1 762 ? 0.246   -21.383 -27.546 1.00   52.62 ? 762  PHE A CA    1 
ATOM   5585 C  C     . PHE A 1 762 ? 0.246   -21.664 -26.052 1.00   52.63 ? 762  PHE A C     1 
ATOM   5586 O  O     . PHE A 1 762 ? 0.219   -20.740 -25.246 1.00   51.33 ? 762  PHE A O     1 
ATOM   5587 C  CB    . PHE A 1 762 ? 1.706   -21.269 -27.978 1.00   52.34 ? 762  PHE A CB    1 
ATOM   5588 C  CG    . PHE A 1 762 ? 1.891   -20.936 -29.418 1.00   52.34 ? 762  PHE A CG    1 
ATOM   5589 C  CD1   . PHE A 1 762 ? 1.811   -21.925 -30.389 1.00   52.44 ? 762  PHE A CD1   1 
ATOM   5590 C  CD2   . PHE A 1 762 ? 2.130   -19.623 -29.809 1.00   52.65 ? 762  PHE A CD2   1 
ATOM   5591 C  CE1   . PHE A 1 762 ? 1.964   -21.604 -31.729 1.00   52.85 ? 762  PHE A CE1   1 
ATOM   5592 C  CE2   . PHE A 1 762 ? 2.284   -19.289 -31.146 1.00   52.41 ? 762  PHE A CE2   1 
ATOM   5593 C  CZ    . PHE A 1 762 ? 2.201   -20.279 -32.107 1.00   52.77 ? 762  PHE A CZ    1 
ATOM   5594 N  N     . LYS A 1 763 ? 0.292   -22.939 -25.682 1.00   53.23 ? 763  LYS A N     1 
ATOM   5595 C  CA    . LYS A 1 763 ? 0.354   -23.304 -24.269 1.00   52.78 ? 763  LYS A CA    1 
ATOM   5596 C  C     . LYS A 1 763 ? 1.725   -22.901 -23.777 1.00   52.16 ? 763  LYS A C     1 
ATOM   5597 O  O     . LYS A 1 763 ? 2.706   -22.979 -24.519 1.00   52.31 ? 763  LYS A O     1 
ATOM   5598 C  CB    . LYS A 1 763 ? 0.193   -24.818 -24.067 1.00   54.50 ? 763  LYS A CB    1 
ATOM   5599 C  CG    . LYS A 1 763 ? -1.239  -25.317 -23.887 1.00   58.79 ? 763  LYS A CG    1 
ATOM   5600 C  CD    . LYS A 1 763 ? -1.253  -26.805 -23.500 1.00   61.18 ? 763  LYS A CD    1 
ATOM   5601 C  CE    . LYS A 1 763 ? -2.562  -27.237 -22.816 1.00   62.36 ? 763  LYS A CE    1 
ATOM   5602 N  NZ    . LYS A 1 763 ? -3.733  -27.413 -23.728 1.00   63.19 ? 763  LYS A NZ    1 
ATOM   5603 N  N     . ALA A 1 764 ? 1.804   -22.462 -22.525 1.00   52.39 ? 764  ALA A N     1 
ATOM   5604 C  CA    . ALA A 1 764 ? 3.068   -22.068 -21.924 1.00   51.76 ? 764  ALA A CA    1 
ATOM   5605 C  C     . ALA A 1 764 ? 4.184   -23.033 -22.339 1.00   51.83 ? 764  ALA A C     1 
ATOM   5606 O  O     . ALA A 1 764 ? 3.994   -24.249 -22.329 1.00   53.06 ? 764  ALA A O     1 
ATOM   5607 C  CB    . ALA A 1 764 ? 2.927   -22.054 -20.414 1.00   51.61 ? 764  ALA A CB    1 
ATOM   5608 N  N     . GLY A 1 765 ? 5.345   -22.495 -22.698 1.00   52.31 ? 765  GLY A N     1 
ATOM   5609 C  CA    . GLY A 1 765 ? 6.457   -23.345 -23.098 1.00   52.52 ? 765  GLY A CA    1 
ATOM   5610 C  C     . GLY A 1 765 ? 6.608   -23.606 -24.593 1.00   52.08 ? 765  GLY A C     1 
ATOM   5611 O  O     . GLY A 1 765 ? 7.728   -23.735 -25.088 1.00   52.33 ? 765  GLY A O     1 
ATOM   5612 N  N     . VAL A 1 766 ? 5.495   -23.686 -25.308 1.00   50.77 ? 766  VAL A N     1 
ATOM   5613 C  CA    . VAL A 1 766 ? 5.523   -23.946 -26.739 1.00   50.34 ? 766  VAL A CA    1 
ATOM   5614 C  C     . VAL A 1 766 ? 6.348   -22.935 -27.523 1.00   50.57 ? 766  VAL A C     1 
ATOM   5615 O  O     . VAL A 1 766 ? 7.254   -23.308 -28.274 1.00   49.06 ? 766  VAL A O     1 
ATOM   5616 C  CB    . VAL A 1 766 ? 4.110   -23.959 -27.325 1.00   49.68 ? 766  VAL A CB    1 
ATOM   5617 C  CG1   . VAL A 1 766 ? 4.164   -24.265 -28.792 1.00   49.60 ? 766  VAL A CG1   1 
ATOM   5618 C  CG2   . VAL A 1 766 ? 3.274   -24.993 -26.606 1.00   51.35 ? 766  VAL A CG2   1 
ATOM   5619 N  N     . LEU A 1 767 ? 6.030   -21.655 -27.351 1.00   49.74 ? 767  LEU A N     1 
ATOM   5620 C  CA    . LEU A 1 767 ? 6.734   -20.603 -28.053 1.00   48.80 ? 767  LEU A CA    1 
ATOM   5621 C  C     . LEU A 1 767 ? 8.241   -20.707 -27.788 1.00   48.81 ? 767  LEU A C     1 
ATOM   5622 O  O     . LEU A 1 767 ? 9.050   -20.371 -28.648 1.00   48.00 ? 767  LEU A O     1 
ATOM   5623 C  CB    . LEU A 1 767 ? 6.187   -19.243 -27.626 1.00   48.92 ? 767  LEU A CB    1 
ATOM   5624 C  CG    . LEU A 1 767 ? 6.533   -18.050 -28.528 1.00   51.28 ? 767  LEU A CG    1 
ATOM   5625 C  CD1   . LEU A 1 767 ? 5.782   -18.180 -29.865 1.00   51.62 ? 767  LEU A CD1   1 
ATOM   5626 C  CD2   . LEU A 1 767 ? 6.175   -16.742 -27.827 1.00   52.36 ? 767  LEU A CD2   1 
ATOM   5627 N  N     . GLY A 1 768 ? 8.621   -21.176 -26.602 1.00   49.03 ? 768  GLY A N     1 
ATOM   5628 C  CA    . GLY A 1 768 ? 10.032  -21.328 -26.288 1.00   49.17 ? 768  GLY A CA    1 
ATOM   5629 C  C     . GLY A 1 768 ? 10.641  -22.403 -27.174 1.00   50.82 ? 768  GLY A C     1 
ATOM   5630 O  O     . GLY A 1 768 ? 11.746  -22.242 -27.693 1.00   51.16 ? 768  GLY A O     1 
ATOM   5631 N  N     . ASN A 1 769 ? 9.913   -23.499 -27.346 1.00   51.54 ? 769  ASN A N     1 
ATOM   5632 C  CA    . ASN A 1 769 ? 10.366  -24.597 -28.181 1.00   52.13 ? 769  ASN A CA    1 
ATOM   5633 C  C     . ASN A 1 769 ? 10.502  -24.188 -29.656 1.00   51.88 ? 769  ASN A C     1 
ATOM   5634 O  O     . ASN A 1 769 ? 11.436  -24.621 -30.330 1.00   50.41 ? 769  ASN A O     1 
ATOM   5635 C  CB    . ASN A 1 769 ? 9.402   -25.786 -28.045 1.00   54.36 ? 769  ASN A CB    1 
ATOM   5636 C  CG    . ASN A 1 769 ? 9.416   -26.401 -26.637 1.00   57.89 ? 769  ASN A CG    1 
ATOM   5637 O  OD1   . ASN A 1 769 ? 8.510   -27.150 -26.266 1.00   60.28 ? 769  ASN A OD1   1 
ATOM   5638 N  ND2   . ASN A 1 769 ? 10.454  -26.098 -25.860 1.00   59.17 ? 769  ASN A ND2   1 
ATOM   5639 N  N     . LEU A 1 770 ? 9.571   -23.369 -30.161 1.00   50.67 ? 770  LEU A N     1 
ATOM   5640 C  CA    . LEU A 1 770 ? 9.643   -22.928 -31.541 1.00   49.89 ? 770  LEU A CA    1 
ATOM   5641 C  C     . LEU A 1 770 ? 10.895  -22.073 -31.709 1.00   51.06 ? 770  LEU A C     1 
ATOM   5642 O  O     . LEU A 1 770 ? 11.605  -22.207 -32.708 1.00   51.85 ? 770  LEU A O     1 
ATOM   5643 C  CB    . LEU A 1 770 ? 8.408   -22.128 -31.930 1.00   48.19 ? 770  LEU A CB    1 
ATOM   5644 C  CG    . LEU A 1 770 ? 7.079   -22.885 -31.997 1.00   47.91 ? 770  LEU A CG    1 
ATOM   5645 C  CD1   . LEU A 1 770 ? 5.985   -21.947 -32.508 1.00   47.16 ? 770  LEU A CD1   1 
ATOM   5646 C  CD2   . LEU A 1 770 ? 7.194   -24.087 -32.906 1.00   45.80 ? 770  LEU A CD2   1 
ATOM   5647 N  N     . GLU A 1 771 ? 11.179  -21.210 -30.743 1.00   53.09 ? 771  GLU A N     1 
ATOM   5648 C  CA    . GLU A 1 771 ? 12.386  -20.385 -30.799 1.00   56.99 ? 771  GLU A CA    1 
ATOM   5649 C  C     . GLU A 1 771 ? 13.659  -21.237 -30.907 1.00   60.84 ? 771  GLU A C     1 
ATOM   5650 O  O     . GLU A 1 771 ? 14.653  -20.810 -31.497 1.00   59.15 ? 771  GLU A O     1 
ATOM   5651 C  CB    . GLU A 1 771 ? 12.501  -19.479 -29.567 1.00   56.16 ? 771  GLU A CB    1 
ATOM   5652 C  CG    . GLU A 1 771 ? 11.847  -18.120 -29.754 1.00   57.00 ? 771  GLU A CG    1 
ATOM   5653 C  CD    . GLU A 1 771 ? 12.434  -17.338 -30.932 1.00   56.61 ? 771  GLU A CD    1 
ATOM   5654 O  OE1   . GLU A 1 771 ? 13.639  -16.995 -30.867 1.00   56.24 ? 771  GLU A OE1   1 
ATOM   5655 O  OE2   . GLU A 1 771 ? 11.692  -17.069 -31.911 1.00   55.12 ? 771  GLU A OE2   1 
ATOM   5656 N  N     . GLU A 1 772 ? 13.620  -22.434 -30.331 1.00   65.60 ? 772  GLU A N     1 
ATOM   5657 C  CA    . GLU A 1 772 ? 14.756  -23.339 -30.366 1.00   68.57 ? 772  GLU A CA    1 
ATOM   5658 C  C     . GLU A 1 772 ? 14.888  -23.995 -31.729 1.00   68.11 ? 772  GLU A C     1 
ATOM   5659 O  O     . GLU A 1 772 ? 15.983  -24.068 -32.282 1.00   64.59 ? 772  GLU A O     1 
ATOM   5660 C  CB    . GLU A 1 772 ? 14.601  -24.405 -29.291 1.00   74.49 ? 772  GLU A CB    1 
ATOM   5661 C  CG    . GLU A 1 772 ? 14.921  -23.889 -27.924 1.00   88.92 ? 772  GLU A CG    1 
ATOM   5662 C  CD    . GLU A 1 772 ? 16.380  -23.502 -27.792 1.00   95.30 ? 772  GLU A CD    1 
ATOM   5663 O  OE1   . GLU A 1 772 ? 16.867  -22.708 -28.632 1.00   98.51 ? 772  GLU A OE1   1 
ATOM   5664 O  OE2   . GLU A 1 772 ? 17.038  -23.992 -26.848 1.00   98.29 ? 772  GLU A OE2   1 
ATOM   5665 N  N     . MET A 1 773 ? 13.774  -24.478 -32.258 1.00   66.14 ? 773  MET A N     1 
ATOM   5666 C  CA    . MET A 1 773 ? 13.782  -25.103 -33.566 1.00   63.54 ? 773  MET A CA    1 
ATOM   5667 C  C     . MET A 1 773 ? 14.253  -24.057 -34.561 1.00   60.74 ? 773  MET A C     1 
ATOM   5668 O  O     . MET A 1 773 ? 14.951  -24.369 -35.528 1.00   58.25 ? 773  MET A O     1 
ATOM   5669 C  CB    . MET A 1 773 ? 12.382  -25.566 -33.964 1.00   67.11 ? 773  MET A CB    1 
ATOM   5670 C  CG    . MET A 1 773 ? 11.816  -26.710 -33.138 1.00   75.66 ? 773  MET A CG    1 
ATOM   5671 S  SD    . MET A 1 773 ? 10.195  -27.255 -33.760 1.00   80.25 ? 773  MET A SD    1 
ATOM   5672 C  CE    . MET A 1 773 ? 9.100   -26.770 -32.425 1.00   82.39 ? 773  MET A CE    1 
ATOM   5673 N  N     . ARG A 1 774 ? 13.867  -22.809 -34.314 1.00   55.83 ? 774  ARG A N     1 
ATOM   5674 C  CA    . ARG A 1 774 ? 14.232  -21.719 -35.199 1.00   51.41 ? 774  ARG A CA    1 
ATOM   5675 C  C     . ARG A 1 774 ? 15.744  -21.587 -35.294 1.00   51.38 ? 774  ARG A C     1 
ATOM   5676 O  O     . ARG A 1 774 ? 16.292  -21.444 -36.383 1.00   48.96 ? 774  ARG A O     1 
ATOM   5677 C  CB    . ARG A 1 774 ? 13.608  -20.416 -34.706 1.00   49.61 ? 774  ARG A CB    1 
ATOM   5678 C  CG    . ARG A 1 774 ? 13.747  -19.264 -35.686 1.00   48.52 ? 774  ARG A CG    1 
ATOM   5679 C  CD    . ARG A 1 774 ? 13.070  -18.026 -35.169 1.00   47.04 ? 774  ARG A CD    1 
ATOM   5680 N  NE    . ARG A 1 774 ? 13.270  -16.876 -36.042 1.00   47.32 ? 774  ARG A NE    1 
ATOM   5681 C  CZ    . ARG A 1 774 ? 14.338  -16.084 -35.996 1.00   48.20 ? 774  ARG A CZ    1 
ATOM   5682 N  NH1   . ARG A 1 774 ? 15.301  -16.329 -35.117 1.00   47.45 ? 774  ARG A NH1   1 
ATOM   5683 N  NH2   . ARG A 1 774 ? 14.434  -15.027 -36.808 1.00   48.19 ? 774  ARG A NH2   1 
ATOM   5684 N  N     . ASP A 1 775 ? 16.417  -21.643 -34.152 1.00   51.60 ? 775  ASP A N     1 
ATOM   5685 C  CA    . ASP A 1 775 ? 17.870  -21.551 -34.108 1.00   52.20 ? 775  ASP A CA    1 
ATOM   5686 C  C     . ASP A 1 775 ? 18.535  -22.667 -34.916 1.00   54.21 ? 775  ASP A C     1 
ATOM   5687 O  O     . ASP A 1 775 ? 19.450  -22.423 -35.701 1.00   49.74 ? 775  ASP A O     1 
ATOM   5688 C  CB    . ASP A 1 775 ? 18.368  -21.611 -32.665 1.00   55.28 ? 775  ASP A CB    1 
ATOM   5689 C  CG    . ASP A 1 775 ? 18.340  -20.249 -31.986 1.00   62.29 ? 775  ASP A CG    1 
ATOM   5690 O  OD1   . ASP A 1 775 ? 18.506  -19.244 -32.722 1.00   65.33 ? 775  ASP A OD1   1 
ATOM   5691 O  OD2   . ASP A 1 775 ? 18.171  -20.185 -30.735 1.00   65.62 ? 775  ASP A OD2   1 
ATOM   5692 N  N     . GLU A 1 776 ? 18.053  -23.888 -34.699 1.00   55.92 ? 776  GLU A N     1 
ATOM   5693 C  CA    . GLU A 1 776 ? 18.561  -25.070 -35.368 1.00   56.28 ? 776  GLU A CA    1 
ATOM   5694 C  C     . GLU A 1 776 ? 18.343  -24.989 -36.872 1.00   54.32 ? 776  GLU A C     1 
ATOM   5695 O  O     . GLU A 1 776 ? 19.236  -25.300 -37.656 1.00   50.98 ? 776  GLU A O     1 
ATOM   5696 C  CB    . GLU A 1 776 ? 17.844  -26.319 -34.840 1.00   62.33 ? 776  GLU A CB    1 
ATOM   5697 C  CG    . GLU A 1 776 ? 18.165  -26.692 -33.403 1.00   78.40 ? 776  GLU A CG    1 
ATOM   5698 C  CD    . GLU A 1 776 ? 17.174  -27.716 -32.815 1.00   85.45 ? 776  GLU A CD    1 
ATOM   5699 O  OE1   . GLU A 1 776 ? 16.792  -28.668 -33.543 1.00   88.00 ? 776  GLU A OE1   1 
ATOM   5700 O  OE2   . GLU A 1 776 ? 16.793  -27.567 -31.623 1.00   88.08 ? 776  GLU A OE2   1 
ATOM   5701 N  N     . ARG A 1 777 ? 17.147  -24.566 -37.248 1.00   52.10 ? 777  ARG A N     1 
ATOM   5702 C  CA    . ARG A 1 777 ? 16.736  -24.458 -38.649 1.00   48.60 ? 777  ARG A CA    1 
ATOM   5703 C  C     . ARG A 1 777 ? 17.556  -23.421 -39.401 1.00   45.94 ? 777  ARG A C     1 
ATOM   5704 O  O     . ARG A 1 777 ? 18.120  -23.716 -40.453 1.00   45.12 ? 777  ARG A O     1 
ATOM   5705 C  CB    . ARG A 1 777 ? 15.249  -24.110 -38.706 1.00   50.94 ? 777  ARG A CB    1 
ATOM   5706 C  CG    . ARG A 1 777 ? 14.532  -24.586 -39.929 1.00   58.04 ? 777  ARG A CG    1 
ATOM   5707 C  CD    . ARG A 1 777 ? 14.656  -26.094 -40.079 1.00   62.37 ? 777  ARG A CD    1 
ATOM   5708 N  NE    . ARG A 1 777 ? 14.814  -26.462 -41.485 1.00   65.00 ? 777  ARG A NE    1 
ATOM   5709 C  CZ    . ARG A 1 777 ? 15.521  -27.509 -41.898 1.00   66.27 ? 777  ARG A CZ    1 
ATOM   5710 N  NH1   . ARG A 1 777 ? 16.127  -28.289 -41.008 1.00   66.68 ? 777  ARG A NH1   1 
ATOM   5711 N  NH2   . ARG A 1 777 ? 15.643  -27.755 -43.194 1.00   66.66 ? 777  ARG A NH2   1 
ATOM   5712 N  N     . LEU A 1 778 ? 17.627  -22.217 -38.856 1.00   44.64 ? 778  LEU A N     1 
ATOM   5713 C  CA    . LEU A 1 778 ? 18.397  -21.149 -39.468 1.00   45.08 ? 778  LEU A CA    1 
ATOM   5714 C  C     . LEU A 1 778 ? 19.860  -21.549 -39.606 1.00   45.60 ? 778  LEU A C     1 
ATOM   5715 O  O     . LEU A 1 778 ? 20.490  -21.288 -40.633 1.00   47.57 ? 778  LEU A O     1 
ATOM   5716 C  CB    . LEU A 1 778 ? 18.333  -19.870 -38.638 1.00   43.45 ? 778  LEU A CB    1 
ATOM   5717 C  CG    . LEU A 1 778 ? 19.222  -18.712 -39.100 1.00   42.56 ? 778  LEU A CG    1 
ATOM   5718 C  CD1   . LEU A 1 778 ? 18.811  -18.255 -40.518 1.00   42.09 ? 778  LEU A CD1   1 
ATOM   5719 C  CD2   . LEU A 1 778 ? 19.081  -17.556 -38.097 1.00   41.66 ? 778  LEU A CD2   1 
ATOM   5720 N  N     . SER A 1 779 ? 20.396  -22.184 -38.569 1.00   46.68 ? 779  SER A N     1 
ATOM   5721 C  CA    . SER A 1 779 ? 21.793  -22.601 -38.597 1.00   47.44 ? 779  SER A CA    1 
ATOM   5722 C  C     . SER A 1 779 ? 22.059  -23.662 -39.651 1.00   47.74 ? 779  SER A C     1 
ATOM   5723 O  O     . SER A 1 779 ? 23.065  -23.593 -40.354 1.00   47.73 ? 779  SER A O     1 
ATOM   5724 C  CB    . SER A 1 779 ? 22.216  -23.126 -37.230 1.00   48.30 ? 779  SER A CB    1 
ATOM   5725 O  OG    . SER A 1 779 ? 23.605  -23.343 -37.223 1.00   48.75 ? 779  SER A OG    1 
ATOM   5726 N  N     . LYS A 1 780 ? 21.163  -24.635 -39.766 1.00   47.74 ? 780  LYS A N     1 
ATOM   5727 C  CA    . LYS A 1 780 ? 21.343  -25.696 -40.747 1.00   46.86 ? 780  LYS A CA    1 
ATOM   5728 C  C     . LYS A 1 780 ? 21.211  -25.201 -42.194 1.00   45.82 ? 780  LYS A C     1 
ATOM   5729 O  O     . LYS A 1 780 ? 21.960  -25.624 -43.068 1.00   42.76 ? 780  LYS A O     1 
ATOM   5730 C  CB    . LYS A 1 780 ? 20.345  -26.836 -40.519 1.00   47.78 ? 780  LYS A CB    1 
ATOM   5731 C  CG    . LYS A 1 780 ? 20.585  -27.998 -41.497 1.00   52.75 ? 780  LYS A CG    1 
ATOM   5732 C  CD    . LYS A 1 780 ? 19.714  -29.204 -41.212 1.00   56.05 ? 780  LYS A CD    1 
ATOM   5733 C  CE    . LYS A 1 780 ? 20.015  -30.320 -42.208 1.00   58.53 ? 780  LYS A CE    1 
ATOM   5734 N  NZ    . LYS A 1 780 ? 19.145  -31.543 -42.054 1.00   60.24 ? 780  LYS A NZ    1 
ATOM   5735 N  N     . ILE A 1 781 ? 20.243  -24.312 -42.433 1.00   44.66 ? 781  ILE A N     1 
ATOM   5736 C  CA    . ILE A 1 781 ? 20.029  -23.756 -43.763 1.00   43.81 ? 781  ILE A CA    1 
ATOM   5737 C  C     . ILE A 1 781 ? 21.261  -22.988 -44.196 1.00   42.73 ? 781  ILE A C     1 
ATOM   5738 O  O     . ILE A 1 781 ? 21.697  -23.109 -45.338 1.00   43.60 ? 781  ILE A O     1 
ATOM   5739 C  CB    . ILE A 1 781 ? 18.814  -22.817 -43.789 1.00   44.89 ? 781  ILE A CB    1 
ATOM   5740 C  CG1   . ILE A 1 781 ? 17.525  -23.630 -43.546 1.00   47.81 ? 781  ILE A CG1   1 
ATOM   5741 C  CG2   . ILE A 1 781 ? 18.755  -22.099 -45.122 1.00   46.37 ? 781  ILE A CG2   1 
ATOM   5742 C  CD1   . ILE A 1 781 ? 16.245  -22.800 -43.419 1.00   47.97 ? 781  ILE A CD1   1 
ATOM   5743 N  N     . ILE A 1 782 ? 21.828  -22.202 -43.294 1.00   41.41 ? 782  ILE A N     1 
ATOM   5744 C  CA    . ILE A 1 782 ? 23.024  -21.451 -43.632 1.00   41.07 ? 782  ILE A CA    1 
ATOM   5745 C  C     . ILE A 1 782 ? 24.127  -22.438 -44.045 1.00   43.28 ? 782  ILE A C     1 
ATOM   5746 O  O     . ILE A 1 782 ? 24.875  -22.186 -44.987 1.00   40.43 ? 782  ILE A O     1 
ATOM   5747 C  CB    . ILE A 1 782 ? 23.499  -20.614 -42.447 1.00   39.50 ? 782  ILE A CB    1 
ATOM   5748 C  CG1   . ILE A 1 782 ? 22.470  -19.531 -42.145 1.00   39.96 ? 782  ILE A CG1   1 
ATOM   5749 C  CG2   . ILE A 1 782 ? 24.871  -20.014 -42.721 1.00   37.40 ? 782  ILE A CG2   1 
ATOM   5750 C  CD1   . ILE A 1 782 ? 22.738  -18.754 -40.829 1.00   39.95 ? 782  ILE A CD1   1 
ATOM   5751 N  N     . SER A 1 783 ? 24.211  -23.558 -43.327 1.00   44.98 ? 783  SER A N     1 
ATOM   5752 C  CA    . SER A 1 783 ? 25.196  -24.582 -43.607 1.00   46.47 ? 783  SER A CA    1 
ATOM   5753 C  C     . SER A 1 783 ? 24.965  -25.244 -44.956 1.00   45.94 ? 783  SER A C     1 
ATOM   5754 O  O     . SER A 1 783 ? 25.914  -25.513 -45.681 1.00   44.69 ? 783  SER A O     1 
ATOM   5755 C  CB    . SER A 1 783 ? 25.169  -25.647 -42.519 1.00   49.68 ? 783  SER A CB    1 
ATOM   5756 O  OG    . SER A 1 783 ? 25.894  -25.186 -41.404 1.00   61.11 ? 783  SER A OG    1 
ATOM   5757 N  N     . MET A 1 784 ? 23.708  -25.503 -45.295 1.00   44.65 ? 784  MET A N     1 
ATOM   5758 C  CA    . MET A 1 784 ? 23.416  -26.121 -46.572 1.00   42.48 ? 784  MET A CA    1 
ATOM   5759 C  C     . MET A 1 784 ? 23.828  -25.140 -47.664 1.00   42.58 ? 784  MET A C     1 
ATOM   5760 O  O     . MET A 1 784 ? 24.291  -25.557 -48.730 1.00   42.66 ? 784  MET A O     1 
ATOM   5761 C  CB    . MET A 1 784 ? 21.924  -26.483 -46.709 1.00   41.91 ? 784  MET A CB    1 
ATOM   5762 C  CG    . MET A 1 784 ? 21.454  -27.555 -45.741 1.00   40.22 ? 784  MET A CG    1 
ATOM   5763 S  SD    . MET A 1 784 ? 19.853  -28.297 -46.097 1.00   44.74 ? 784  MET A SD    1 
ATOM   5764 C  CE    . MET A 1 784 ? 18.673  -27.179 -45.331 1.00   41.61 ? 784  MET A CE    1 
ATOM   5765 N  N     . PHE A 1 785 ? 23.671  -23.844 -47.413 1.00   42.92 ? 785  PHE A N     1 
ATOM   5766 C  CA    . PHE A 1 785 ? 24.049  -22.857 -48.424 1.00   44.06 ? 785  PHE A CA    1 
ATOM   5767 C  C     . PHE A 1 785 ? 25.570  -22.846 -48.557 1.00   44.02 ? 785  PHE A C     1 
ATOM   5768 O  O     . PHE A 1 785 ? 26.104  -22.764 -49.662 1.00   44.34 ? 785  PHE A O     1 
ATOM   5769 C  CB    . PHE A 1 785 ? 23.547  -21.462 -48.059 1.00   43.43 ? 785  PHE A CB    1 
ATOM   5770 C  CG    . PHE A 1 785 ? 23.735  -20.438 -49.153 1.00   44.01 ? 785  PHE A CG    1 
ATOM   5771 C  CD1   . PHE A 1 785 ? 23.068  -20.564 -50.370 1.00   43.47 ? 785  PHE A CD1   1 
ATOM   5772 C  CD2   . PHE A 1 785 ? 24.566  -19.331 -48.960 1.00   44.00 ? 785  PHE A CD2   1 
ATOM   5773 C  CE1   . PHE A 1 785 ? 23.222  -19.607 -51.387 1.00   42.58 ? 785  PHE A CE1   1 
ATOM   5774 C  CE2   . PHE A 1 785 ? 24.725  -18.372 -49.972 1.00   43.74 ? 785  PHE A CE2   1 
ATOM   5775 C  CZ    . PHE A 1 785 ? 24.043  -18.519 -51.188 1.00   42.86 ? 785  PHE A CZ    1 
ATOM   5776 N  N     . GLN A 1 786 ? 26.263  -22.925 -47.424 1.00   44.57 ? 786  GLN A N     1 
ATOM   5777 C  CA    . GLN A 1 786 ? 27.710  -22.951 -47.445 1.00   44.26 ? 786  GLN A CA    1 
ATOM   5778 C  C     . GLN A 1 786 ? 28.141  -24.236 -48.182 1.00   44.19 ? 786  GLN A C     1 
ATOM   5779 O  O     . GLN A 1 786 ? 29.122  -24.224 -48.930 1.00   43.69 ? 786  GLN A O     1 
ATOM   5780 C  CB    . GLN A 1 786 ? 28.271  -22.926 -46.024 1.00   43.66 ? 786  GLN A CB    1 
ATOM   5781 C  CG    . GLN A 1 786 ? 28.034  -21.607 -45.293 1.00   43.43 ? 786  GLN A CG    1 
ATOM   5782 C  CD    . GLN A 1 786 ? 28.205  -21.699 -43.776 1.00   41.69 ? 786  GLN A CD    1 
ATOM   5783 O  OE1   . GLN A 1 786 ? 27.791  -22.676 -43.153 1.00   43.06 ? 786  GLN A OE1   1 
ATOM   5784 N  NE2   . GLN A 1 786 ? 28.786  -20.674 -43.181 1.00   40.23 ? 786  GLN A NE2   1 
ATOM   5785 N  N     . ALA A 1 787 ? 27.398  -25.319 -47.970 1.00   42.79 ? 787  ALA A N     1 
ATOM   5786 C  CA    . ALA A 1 787 ? 27.684  -26.593 -48.606 1.00   43.33 ? 787  ALA A CA    1 
ATOM   5787 C  C     . ALA A 1 787 ? 27.490  -26.442 -50.109 1.00   44.69 ? 787  ALA A C     1 
ATOM   5788 O  O     . ALA A 1 787 ? 28.228  -27.025 -50.907 1.00   44.07 ? 787  ALA A O     1 
ATOM   5789 C  CB    . ALA A 1 787 ? 26.752  -27.674 -48.071 1.00   42.32 ? 787  ALA A CB    1 
ATOM   5790 N  N     . HIS A 1 788 ? 26.488  -25.657 -50.484 1.00   45.59 ? 788  HIS A N     1 
ATOM   5791 C  CA    . HIS A 1 788 ? 26.190  -25.407 -51.879 1.00   45.39 ? 788  HIS A CA    1 
ATOM   5792 C  C     . HIS A 1 788 ? 27.325  -24.616 -52.511 1.00   44.88 ? 788  HIS A C     1 
ATOM   5793 O  O     . HIS A 1 788 ? 27.667  -24.827 -53.676 1.00   44.20 ? 788  HIS A O     1 
ATOM   5794 C  CB    . HIS A 1 788 ? 24.891  -24.628 -52.005 1.00   47.34 ? 788  HIS A CB    1 
ATOM   5795 C  CG    . HIS A 1 788 ? 24.139  -24.929 -53.260 1.00   50.10 ? 788  HIS A CG    1 
ATOM   5796 N  ND1   . HIS A 1 788 ? 22.797  -25.251 -53.264 1.00   51.00 ? 788  HIS A ND1   1 
ATOM   5797 C  CD2   . HIS A 1 788 ? 24.550  -25.002 -54.545 1.00   50.64 ? 788  HIS A CD2   1 
ATOM   5798 C  CE1   . HIS A 1 788 ? 22.419  -25.514 -54.498 1.00   51.74 ? 788  HIS A CE1   1 
ATOM   5799 N  NE2   . HIS A 1 788 ? 23.464  -25.370 -55.296 1.00   51.46 ? 788  HIS A NE2   1 
ATOM   5800 N  N     . ILE A 1 789 ? 27.907  -23.703 -51.739 1.00   45.10 ? 789  ILE A N     1 
ATOM   5801 C  CA    . ILE A 1 789 ? 29.001  -22.888 -52.231 1.00   46.30 ? 789  ILE A CA    1 
ATOM   5802 C  C     . ILE A 1 789 ? 30.252  -23.744 -52.411 1.00   48.03 ? 789  ILE A C     1 
ATOM   5803 O  O     . ILE A 1 789 ? 30.991  -23.577 -53.391 1.00   48.74 ? 789  ILE A O     1 
ATOM   5804 C  CB    . ILE A 1 789 ? 29.309  -21.697 -51.281 1.00   45.10 ? 789  ILE A CB    1 
ATOM   5805 C  CG1   . ILE A 1 789 ? 28.176  -20.668 -51.366 1.00   43.78 ? 789  ILE A CG1   1 
ATOM   5806 C  CG2   . ILE A 1 789 ? 30.657  -21.050 -51.660 1.00   42.69 ? 789  ILE A CG2   1 
ATOM   5807 C  CD1   . ILE A 1 789 ? 28.389  -19.429 -50.541 1.00   40.74 ? 789  ILE A CD1   1 
ATOM   5808 N  N     . ARG A 1 790 ? 30.494  -24.664 -51.474 1.00   48.81 ? 790  ARG A N     1 
ATOM   5809 C  CA    . ARG A 1 790 ? 31.646  -25.546 -51.595 1.00   49.54 ? 790  ARG A CA    1 
ATOM   5810 C  C     . ARG A 1 790 ? 31.447  -26.441 -52.818 1.00   48.38 ? 790  ARG A C     1 
ATOM   5811 O  O     . ARG A 1 790 ? 32.410  -26.806 -53.485 1.00   47.94 ? 790  ARG A O     1 
ATOM   5812 C  CB    . ARG A 1 790 ? 31.821  -26.393 -50.328 1.00   52.77 ? 790  ARG A CB    1 
ATOM   5813 C  CG    . ARG A 1 790 ? 32.197  -25.577 -49.070 1.00   57.19 ? 790  ARG A CG    1 
ATOM   5814 C  CD    . ARG A 1 790 ? 32.550  -26.489 -47.899 1.00   60.23 ? 790  ARG A CD    1 
ATOM   5815 N  NE    . ARG A 1 790 ? 31.703  -26.288 -46.721 1.00   62.50 ? 790  ARG A NE    1 
ATOM   5816 C  CZ    . ARG A 1 790 ? 31.994  -25.486 -45.696 1.00   63.09 ? 790  ARG A CZ    1 
ATOM   5817 N  NH1   . ARG A 1 790 ? 33.124  -24.790 -45.672 1.00   62.81 ? 790  ARG A NH1   1 
ATOM   5818 N  NH2   . ARG A 1 790 ? 31.147  -25.386 -44.681 1.00   63.64 ? 790  ARG A NH2   1 
ATOM   5819 N  N     . GLY A 1 791 ? 30.199  -26.784 -53.114 1.00   45.55 ? 791  GLY A N     1 
ATOM   5820 C  CA    . GLY A 1 791 ? 29.916  -27.615 -54.267 1.00   43.15 ? 791  GLY A CA    1 
ATOM   5821 C  C     . GLY A 1 791 ? 30.156  -26.910 -55.602 1.00   42.15 ? 791  GLY A C     1 
ATOM   5822 O  O     . GLY A 1 791 ? 30.489  -27.552 -56.602 1.00   39.50 ? 791  GLY A O     1 
ATOM   5823 N  N     . TYR A 1 792 ? 29.985  -25.594 -55.609 1.00   42.03 ? 792  TYR A N     1 
ATOM   5824 C  CA    . TYR A 1 792 ? 30.189  -24.765 -56.799 1.00   43.16 ? 792  TYR A CA    1 
ATOM   5825 C  C     . TYR A 1 792 ? 31.683  -24.654 -57.081 1.00   43.67 ? 792  TYR A C     1 
ATOM   5826 O  O     . TYR A 1 792 ? 32.128  -24.890 -58.200 1.00   45.51 ? 792  TYR A O     1 
ATOM   5827 C  CB    . TYR A 1 792 ? 29.585  -23.379 -56.552 1.00   42.58 ? 792  TYR A CB    1 
ATOM   5828 C  CG    . TYR A 1 792 ? 29.730  -22.366 -57.672 1.00   42.36 ? 792  TYR A CG    1 
ATOM   5829 C  CD1   . TYR A 1 792 ? 30.971  -21.828 -57.996 1.00   42.43 ? 792  TYR A CD1   1 
ATOM   5830 C  CD2   . TYR A 1 792 ? 28.608  -21.865 -58.323 1.00   41.22 ? 792  TYR A CD2   1 
ATOM   5831 C  CE1   . TYR A 1 792 ? 31.087  -20.810 -58.914 1.00   42.39 ? 792  TYR A CE1   1 
ATOM   5832 C  CE2   . TYR A 1 792 ? 28.712  -20.852 -59.241 1.00   41.50 ? 792  TYR A CE2   1 
ATOM   5833 C  CZ    . TYR A 1 792 ? 29.956  -20.328 -59.526 1.00   42.75 ? 792  TYR A CZ    1 
ATOM   5834 O  OH    . TYR A 1 792 ? 30.069  -19.261 -60.374 1.00   44.05 ? 792  TYR A OH    1 
ATOM   5835 N  N     . LEU A 1 793 ? 32.454  -24.304 -56.058 1.00   45.87 ? 793  LEU A N     1 
ATOM   5836 C  CA    . LEU A 1 793 ? 33.902  -24.175 -56.206 1.00   47.90 ? 793  LEU A CA    1 
ATOM   5837 C  C     . LEU A 1 793 ? 34.563  -25.466 -56.711 1.00   49.87 ? 793  LEU A C     1 
ATOM   5838 O  O     . LEU A 1 793 ? 35.401  -25.407 -57.602 1.00   50.99 ? 793  LEU A O     1 
ATOM   5839 C  CB    . LEU A 1 793 ? 34.539  -23.733 -54.882 1.00   47.49 ? 793  LEU A CB    1 
ATOM   5840 C  CG    . LEU A 1 793 ? 34.064  -22.371 -54.349 1.00   46.85 ? 793  LEU A CG    1 
ATOM   5841 C  CD1   . LEU A 1 793 ? 34.730  -22.062 -53.021 1.00   44.85 ? 793  LEU A CD1   1 
ATOM   5842 C  CD2   . LEU A 1 793 ? 34.365  -21.282 -55.361 1.00   45.32 ? 793  LEU A CD2   1 
ATOM   5843 N  N     . ILE A 1 794 ? 34.188  -26.626 -56.161 1.00   51.35 ? 794  ILE A N     1 
ATOM   5844 C  CA    . ILE A 1 794 ? 34.779  -27.883 -56.611 1.00   50.62 ? 794  ILE A CA    1 
ATOM   5845 C  C     . ILE A 1 794 ? 34.329  -28.282 -58.020 1.00   50.65 ? 794  ILE A C     1 
ATOM   5846 O  O     . ILE A 1 794 ? 35.086  -28.897 -58.764 1.00   50.15 ? 794  ILE A O     1 
ATOM   5847 C  CB    . ILE A 1 794 ? 34.462  -29.050 -55.642 1.00   51.38 ? 794  ILE A CB    1 
ATOM   5848 C  CG1   . ILE A 1 794 ? 35.072  -28.771 -54.264 1.00   50.24 ? 794  ILE A CG1   1 
ATOM   5849 C  CG2   . ILE A 1 794 ? 35.035  -30.367 -56.210 1.00   51.01 ? 794  ILE A CG2   1 
ATOM   5850 C  CD1   . ILE A 1 794 ? 36.589  -28.712 -54.258 1.00   50.02 ? 794  ILE A CD1   1 
ATOM   5851 N  N     . ARG A 1 795 ? 33.102  -27.934 -58.388 1.00   51.12 ? 795  ARG A N     1 
ATOM   5852 C  CA    . ARG A 1 795 ? 32.600  -28.260 -59.719 1.00   51.62 ? 795  ARG A CA    1 
ATOM   5853 C  C     . ARG A 1 795 ? 33.169  -27.307 -60.768 1.00   52.12 ? 795  ARG A C     1 
ATOM   5854 O  O     . ARG A 1 795 ? 33.087  -27.571 -61.970 1.00   54.90 ? 795  ARG A O     1 
ATOM   5855 C  CB    . ARG A 1 795 ? 31.060  -28.262 -59.748 1.00   49.99 ? 795  ARG A CB    1 
ATOM   5856 C  CG    . ARG A 1 795 ? 30.456  -29.533 -59.118 1.00   47.27 ? 795  ARG A CG    1 
ATOM   5857 C  CD    . ARG A 1 795 ? 28.957  -29.680 -59.346 1.00   45.60 ? 795  ARG A CD    1 
ATOM   5858 N  NE    . ARG A 1 795 ? 28.180  -28.677 -58.607 1.00   46.15 ? 795  ARG A NE    1 
ATOM   5859 C  CZ    . ARG A 1 795 ? 27.823  -28.766 -57.327 1.00   45.23 ? 795  ARG A CZ    1 
ATOM   5860 N  NH1   . ARG A 1 795 ? 28.151  -29.820 -56.591 1.00   44.94 ? 795  ARG A NH1   1 
ATOM   5861 N  NH2   . ARG A 1 795 ? 27.145  -27.776 -56.771 1.00   44.56 ? 795  ARG A NH2   1 
ATOM   5862 N  N     . LYS A 1 796 ? 33.745  -26.216 -60.309 1.00   53.40 ? 796  LYS A N     1 
ATOM   5863 C  CA    . LYS A 1 796 ? 34.359  -25.218 -61.185 1.00   54.74 ? 796  LYS A CA    1 
ATOM   5864 C  C     . LYS A 1 796 ? 35.759  -25.715 -61.571 1.00   54.98 ? 796  LYS A C     1 
ATOM   5865 O  O     . LYS A 1 796 ? 36.215  -25.511 -62.695 1.00   55.45 ? 796  LYS A O     1 
ATOM   5866 C  CB    . LYS A 1 796 ? 34.477  -23.875 -60.445 1.00   54.35 ? 796  LYS A CB    1 
ATOM   5867 C  CG    . LYS A 1 796 ? 35.266  -22.769 -61.153 1.00   52.35 ? 796  LYS A CG    1 
ATOM   5868 C  CD    . LYS A 1 796 ? 34.592  -22.354 -62.447 1.00   53.63 ? 796  LYS A CD    1 
ATOM   5869 C  CE    . LYS A 1 796 ? 35.416  -21.301 -63.191 1.00   53.99 ? 796  LYS A CE    1 
ATOM   5870 N  NZ    . LYS A 1 796 ? 34.746  -20.893 -64.451 1.00   53.99 ? 796  LYS A NZ    1 
ATOM   5871 N  N     . ALA A 1 797 ? 36.423  -26.363 -60.623 1.00   53.74 ? 797  ALA A N     1 
ATOM   5872 C  CA    . ALA A 1 797 ? 37.774  -26.884 -60.810 1.00   53.73 ? 797  ALA A CA    1 
ATOM   5873 C  C     . ALA A 1 797 ? 37.820  -28.242 -61.501 1.00   54.20 ? 797  ALA A C     1 
ATOM   5874 O  O     . ALA A 1 797 ? 38.881  -28.685 -61.940 1.00   51.99 ? 797  ALA A O     1 
ATOM   5875 C  CB    . ALA A 1 797 ? 38.465  -26.978 -59.456 1.00   53.17 ? 797  ALA A CB    1 
ATOM   5876 N  N     . TYR A 1 798 ? 36.665  -28.895 -61.601 1.00   54.75 ? 798  TYR A N     1 
ATOM   5877 C  CA    . TYR A 1 798 ? 36.579  -30.221 -62.211 1.00   55.41 ? 798  TYR A CA    1 
ATOM   5878 C  C     . TYR A 1 798 ? 37.212  -30.349 -63.597 1.00   57.46 ? 798  TYR A C     1 
ATOM   5879 O  O     . TYR A 1 798 ? 38.059  -31.206 -63.804 1.00   54.84 ? 798  TYR A O     1 
ATOM   5880 C  CB    . TYR A 1 798 ? 35.119  -30.669 -62.261 1.00   55.51 ? 798  TYR A CB    1 
ATOM   5881 C  CG    . TYR A 1 798 ? 34.916  -32.092 -62.737 1.00   58.27 ? 798  TYR A CG    1 
ATOM   5882 C  CD1   . TYR A 1 798 ? 35.498  -33.174 -62.063 1.00   58.75 ? 798  TYR A CD1   1 
ATOM   5883 C  CD2   . TYR A 1 798 ? 34.119  -32.359 -63.855 1.00   59.20 ? 798  TYR A CD2   1 
ATOM   5884 C  CE1   . TYR A 1 798 ? 35.288  -34.492 -62.499 1.00   59.59 ? 798  TYR A CE1   1 
ATOM   5885 C  CE2   . TYR A 1 798 ? 33.901  -33.663 -64.298 1.00   60.10 ? 798  TYR A CE2   1 
ATOM   5886 C  CZ    . TYR A 1 798 ? 34.484  -34.726 -63.621 1.00   60.57 ? 798  TYR A CZ    1 
ATOM   5887 O  OH    . TYR A 1 798 ? 34.250  -36.011 -64.081 1.00   60.88 ? 798  TYR A OH    1 
ATOM   5888 N  N     . LYS A 1 799 ? 36.808  -29.500 -64.541 1.00   60.79 ? 799  LYS A N     1 
ATOM   5889 C  CA    . LYS A 1 799 ? 37.346  -29.548 -65.898 1.00   62.75 ? 799  LYS A CA    1 
ATOM   5890 C  C     . LYS A 1 799 ? 38.889  -29.434 -65.936 1.00   61.69 ? 799  LYS A C     1 
ATOM   5891 O  O     . LYS A 1 799 ? 39.554  -30.242 -66.588 1.00   59.52 ? 799  LYS A O     1 
ATOM   5892 C  CB    . LYS A 1 799 ? 36.706  -28.448 -66.761 1.00   69.36 ? 799  LYS A CB    1 
ATOM   5893 C  CG    . LYS A 1 799 ? 37.607  -27.230 -66.989 1.00   82.66 ? 799  LYS A CG    1 
ATOM   5894 C  CD    . LYS A 1 799 ? 36.852  -25.959 -67.351 1.00   89.41 ? 799  LYS A CD    1 
ATOM   5895 C  CE    . LYS A 1 799 ? 37.835  -24.789 -67.487 1.00   92.31 ? 799  LYS A CE    1 
ATOM   5896 N  NZ    . LYS A 1 799 ? 37.250  -23.617 -68.220 1.00   93.95 ? 799  LYS A NZ    1 
ATOM   5897 N  N     . LYS A 1 800 ? 39.444  -28.447 -65.240 1.00   58.98 ? 800  LYS A N     1 
ATOM   5898 C  CA    . LYS A 1 800 ? 40.891  -28.232 -65.200 1.00   55.51 ? 800  LYS A CA    1 
ATOM   5899 C  C     . LYS A 1 800 ? 41.584  -29.466 -64.614 1.00   53.45 ? 800  LYS A C     1 
ATOM   5900 O  O     . LYS A 1 800 ? 42.685  -29.833 -65.030 1.00   50.93 ? 800  LYS A O     1 
ATOM   5901 C  CB    . LYS A 1 800 ? 41.222  -26.983 -64.358 1.00   55.67 ? 800  LYS A CB    1 
ATOM   5902 C  CG    . LYS A 1 800 ? 42.697  -26.602 -64.305 1.00   60.10 ? 800  LYS A CG    1 
ATOM   5903 C  CD    . LYS A 1 800 ? 42.954  -25.305 -63.520 1.00   61.71 ? 800  LYS A CD    1 
ATOM   5904 C  CE    . LYS A 1 800 ? 42.426  -25.377 -62.092 1.00   63.34 ? 800  LYS A CE    1 
ATOM   5905 N  NZ    . LYS A 1 800 ? 42.644  -24.113 -61.298 1.00   63.53 ? 800  LYS A NZ    1 
ATOM   5906 N  N     . LEU A 1 801 ? 40.923  -30.094 -63.643 1.00   51.06 ? 801  LEU A N     1 
ATOM   5907 C  CA    . LEU A 1 801 ? 41.438  -31.294 -62.984 1.00   49.47 ? 801  LEU A CA    1 
ATOM   5908 C  C     . LEU A 1 801 ? 41.525  -32.442 -64.000 1.00   50.14 ? 801  LEU A C     1 
ATOM   5909 O  O     . LEU A 1 801 ? 42.427  -33.272 -63.930 1.00   48.51 ? 801  LEU A O     1 
ATOM   5910 C  CB    . LEU A 1 801 ? 40.513  -31.677 -61.819 1.00   48.30 ? 801  LEU A CB    1 
ATOM   5911 C  CG    . LEU A 1 801 ? 41.181  -32.273 -60.581 1.00   48.84 ? 801  LEU A CG    1 
ATOM   5912 C  CD1   . LEU A 1 801 ? 41.864  -31.165 -59.816 1.00   47.60 ? 801  LEU A CD1   1 
ATOM   5913 C  CD2   . LEU A 1 801 ? 40.136  -32.967 -59.677 1.00   49.55 ? 801  LEU A CD2   1 
ATOM   5914 N  N     . GLN A 1 802 ? 40.580  -32.484 -64.948 1.00   52.57 ? 802  GLN A N     1 
ATOM   5915 C  CA    . GLN A 1 802 ? 40.586  -33.510 -65.986 1.00   53.47 ? 802  GLN A CA    1 
ATOM   5916 C  C     . GLN A 1 802 ? 41.607  -33.167 -67.067 1.00   52.35 ? 802  GLN A C     1 
ATOM   5917 O  O     . GLN A 1 802 ? 42.301  -34.052 -67.565 1.00   52.56 ? 802  GLN A O     1 
ATOM   5918 C  CB    . GLN A 1 802 ? 39.205  -33.673 -66.621 1.00   56.24 ? 802  GLN A CB    1 
ATOM   5919 C  CG    . GLN A 1 802 ? 38.211  -34.406 -65.753 1.00   61.90 ? 802  GLN A CG    1 
ATOM   5920 C  CD    . GLN A 1 802 ? 37.016  -34.850 -66.547 1.00   65.27 ? 802  GLN A CD    1 
ATOM   5921 O  OE1   . GLN A 1 802 ? 36.417  -34.052 -67.273 1.00   67.59 ? 802  GLN A OE1   1 
ATOM   5922 N  NE2   . GLN A 1 802 ? 36.655  -36.126 -66.426 1.00   66.52 ? 802  GLN A NE2   1 
ATOM   5923 N  N     . ASP A 1 803 ? 41.711  -31.896 -67.430 1.00   52.06 ? 803  ASP A N     1 
ATOM   5924 C  CA    . ASP A 1 803 ? 42.703  -31.506 -68.432 1.00   51.28 ? 803  ASP A CA    1 
ATOM   5925 C  C     . ASP A 1 803 ? 44.086  -31.834 -67.879 1.00   49.89 ? 803  ASP A C     1 
ATOM   5926 O  O     . ASP A 1 803 ? 44.882  -32.498 -68.539 1.00   50.61 ? 803  ASP A O     1 
ATOM   5927 C  CB    . ASP A 1 803 ? 42.638  -30.008 -68.754 1.00   51.47 ? 803  ASP A CB    1 
ATOM   5928 C  CG    . ASP A 1 803 ? 41.295  -29.587 -69.354 1.00   53.31 ? 803  ASP A CG    1 
ATOM   5929 O  OD1   . ASP A 1 803 ? 40.566  -30.464 -69.888 1.00   52.97 ? 803  ASP A OD1   1 
ATOM   5930 O  OD2   . ASP A 1 803 ? 40.970  -28.374 -69.303 1.00   52.93 ? 803  ASP A OD2   1 
ATOM   5931 N  N     . GLN A 1 804 ? 44.363  -31.373 -66.657 1.00   48.14 ? 804  GLN A N     1 
ATOM   5932 C  CA    . GLN A 1 804 ? 45.663  -31.624 -66.050 1.00   46.61 ? 804  GLN A CA    1 
ATOM   5933 C  C     . GLN A 1 804 ? 45.986  -33.104 -65.857 1.00   46.60 ? 804  GLN A C     1 
ATOM   5934 O  O     . GLN A 1 804 ? 47.165  -33.463 -65.869 1.00   46.71 ? 804  GLN A O     1 
ATOM   5935 C  CB    . GLN A 1 804 ? 45.792  -30.900 -64.711 1.00   44.77 ? 804  GLN A CB    1 
ATOM   5936 C  CG    . GLN A 1 804 ? 45.707  -29.391 -64.830 1.00   41.74 ? 804  GLN A CG    1 
ATOM   5937 C  CD    . GLN A 1 804 ? 45.825  -28.687 -63.490 1.00   40.27 ? 804  GLN A CD    1 
ATOM   5938 O  OE1   . GLN A 1 804 ? 45.175  -29.070 -62.527 1.00   37.58 ? 804  GLN A OE1   1 
ATOM   5939 N  NE2   . GLN A 1 804 ? 46.646  -27.646 -63.430 1.00   38.10 ? 804  GLN A NE2   1 
ATOM   5940 N  N     . ARG A 1 805 ? 44.993  -33.971 -65.685 1.00   45.64 ? 805  ARG A N     1 
ATOM   5941 C  CA    . ARG A 1 805 ? 45.350  -35.379 -65.513 1.00   46.37 ? 805  ARG A CA    1 
ATOM   5942 C  C     . ARG A 1 805 ? 46.048  -35.823 -66.794 1.00   45.91 ? 805  ARG A C     1 
ATOM   5943 O  O     . ARG A 1 805 ? 47.002  -36.597 -66.757 1.00   45.60 ? 805  ARG A O     1 
ATOM   5944 C  CB    . ARG A 1 805 ? 44.144  -36.300 -65.266 1.00   45.39 ? 805  ARG A CB    1 
ATOM   5945 C  CG    . ARG A 1 805 ? 44.518  -37.765 -65.492 1.00   45.03 ? 805  ARG A CG    1 
ATOM   5946 C  CD    . ARG A 1 805 ? 43.446  -38.743 -65.073 1.00   44.80 ? 805  ARG A CD    1 
ATOM   5947 N  NE    . ARG A 1 805 ? 42.200  -38.506 -65.774 1.00   43.68 ? 805  ARG A NE    1 
ATOM   5948 C  CZ    . ARG A 1 805 ? 41.117  -39.251 -65.624 1.00   43.99 ? 805  ARG A CZ    1 
ATOM   5949 N  NH1   . ARG A 1 805 ? 41.140  -40.283 -64.805 1.00   43.00 ? 805  ARG A NH1   1 
ATOM   5950 N  NH2   . ARG A 1 805 ? 40.011  -38.958 -66.299 1.00   44.32 ? 805  ARG A NH2   1 
ATOM   5951 N  N     . ILE A 1 806 ? 45.557  -35.324 -67.917 1.00   45.57 ? 806  ILE A N     1 
ATOM   5952 C  CA    . ILE A 1 806 ? 46.162  -35.655 -69.187 1.00   47.04 ? 806  ILE A CA    1 
ATOM   5953 C  C     . ILE A 1 806 ? 47.548  -35.022 -69.253 1.00   47.09 ? 806  ILE A C     1 
ATOM   5954 O  O     . ILE A 1 806 ? 48.496  -35.662 -69.707 1.00   47.68 ? 806  ILE A O     1 
ATOM   5955 C  CB    . ILE A 1 806 ? 45.323  -35.153 -70.345 1.00   46.47 ? 806  ILE A CB    1 
ATOM   5956 C  CG1   . ILE A 1 806 ? 43.997  -35.907 -70.344 1.00   47.56 ? 806  ILE A CG1   1 
ATOM   5957 C  CG2   . ILE A 1 806 ? 46.089  -35.341 -71.658 1.00   45.72 ? 806  ILE A CG2   1 
ATOM   5958 C  CD1   . ILE A 1 806 ? 43.030  -35.470 -71.409 1.00   48.43 ? 806  ILE A CD1   1 
ATOM   5959 N  N     . GLY A 1 807 ? 47.664  -33.778 -68.806 1.00   46.79 ? 807  GLY A N     1 
ATOM   5960 C  CA    . GLY A 1 807 ? 48.963  -33.143 -68.829 1.00   46.67 ? 807  GLY A CA    1 
ATOM   5961 C  C     . GLY A 1 807 ? 49.997  -33.972 -68.070 1.00   45.94 ? 807  GLY A C     1 
ATOM   5962 O  O     . GLY A 1 807 ? 50.999  -34.389 -68.641 1.00   45.90 ? 807  GLY A O     1 
ATOM   5963 N  N     . LEU A 1 808 ? 49.741  -34.216 -66.779 1.00   44.87 ? 808  LEU A N     1 
ATOM   5964 C  CA    . LEU A 1 808 ? 50.662  -34.987 -65.943 1.00   43.57 ? 808  LEU A CA    1 
ATOM   5965 C  C     . LEU A 1 808 ? 50.984  -36.364 -66.506 1.00   42.86 ? 808  LEU A C     1 
ATOM   5966 O  O     . LEU A 1 808 ? 52.116  -36.819 -66.379 1.00   42.78 ? 808  LEU A O     1 
ATOM   5967 C  CB    . LEU A 1 808 ? 50.120  -35.137 -64.505 1.00   41.30 ? 808  LEU A CB    1 
ATOM   5968 C  CG    . LEU A 1 808 ? 51.145  -35.707 -63.504 1.00   39.11 ? 808  LEU A CG    1 
ATOM   5969 C  CD1   . LEU A 1 808 ? 52.328  -34.746 -63.380 1.00   36.58 ? 808  LEU A CD1   1 
ATOM   5970 C  CD2   . LEU A 1 808 ? 50.500  -35.934 -62.140 1.00   38.08 ? 808  LEU A CD2   1 
ATOM   5971 N  N     . SER A 1 809 ? 50.018  -37.032 -67.113 1.00   43.51 ? 809  SER A N     1 
ATOM   5972 C  CA    . SER A 1 809 ? 50.285  -38.355 -67.698 1.00   44.18 ? 809  SER A CA    1 
ATOM   5973 C  C     . SER A 1 809 ? 51.313  -38.249 -68.847 1.00   43.26 ? 809  SER A C     1 
ATOM   5974 O  O     . SER A 1 809 ? 52.161  -39.119 -69.002 1.00   42.39 ? 809  SER A O     1 
ATOM   5975 C  CB    . SER A 1 809 ? 49.000  -39.008 -68.216 1.00   44.79 ? 809  SER A CB    1 
ATOM   5976 O  OG    . SER A 1 809 ? 48.276  -39.606 -67.150 1.00   48.11 ? 809  SER A OG    1 
ATOM   5977 N  N     . VAL A 1 810 ? 51.229  -37.185 -69.640 1.00   41.81 ? 810  VAL A N     1 
ATOM   5978 C  CA    . VAL A 1 810 ? 52.158  -36.974 -70.746 1.00   41.77 ? 810  VAL A CA    1 
ATOM   5979 C  C     . VAL A 1 810 ? 53.569  -36.707 -70.222 1.00   42.06 ? 810  VAL A C     1 
ATOM   5980 O  O     . VAL A 1 810 ? 54.549  -37.198 -70.782 1.00   43.02 ? 810  VAL A O     1 
ATOM   5981 C  CB    . VAL A 1 810 ? 51.744  -35.761 -71.604 1.00   40.08 ? 810  VAL A CB    1 
ATOM   5982 C  CG1   . VAL A 1 810 ? 52.934  -35.225 -72.399 1.00   38.38 ? 810  VAL A CG1   1 
ATOM   5983 C  CG2   . VAL A 1 810 ? 50.623  -36.151 -72.524 1.00   38.88 ? 810  VAL A CG2   1 
ATOM   5984 N  N     . ILE A 1 811 ? 53.667  -35.933 -69.157 1.00   42.02 ? 811  ILE A N     1 
ATOM   5985 C  CA    . ILE A 1 811 ? 54.954  -35.577 -68.612 1.00   42.80 ? 811  ILE A CA    1 
ATOM   5986 C  C     . ILE A 1 811 ? 55.648  -36.766 -67.964 1.00   44.47 ? 811  ILE A C     1 
ATOM   5987 O  O     . ILE A 1 811 ? 56.825  -37.028 -68.242 1.00   44.99 ? 811  ILE A O     1 
ATOM   5988 C  CB    . ILE A 1 811 ? 54.778  -34.401 -67.642 1.00   43.21 ? 811  ILE A CB    1 
ATOM   5989 C  CG1   . ILE A 1 811 ? 54.427  -33.135 -68.448 1.00   43.96 ? 811  ILE A CG1   1 
ATOM   5990 C  CG2   . ILE A 1 811 ? 56.026  -34.214 -66.769 1.00   43.52 ? 811  ILE A CG2   1 
ATOM   5991 C  CD1   . ILE A 1 811 ? 53.606  -32.075 -67.654 1.00   44.36 ? 811  ILE A CD1   1 
ATOM   5992 N  N     . GLN A 1 812 ? 54.945  -37.494 -67.104 1.00   45.36 ? 812  GLN A N     1 
ATOM   5993 C  CA    . GLN A 1 812 ? 55.528  -38.659 -66.442 1.00   45.94 ? 812  GLN A CA    1 
ATOM   5994 C  C     . GLN A 1 812 ? 55.925  -39.690 -67.490 1.00   45.79 ? 812  GLN A C     1 
ATOM   5995 O  O     . GLN A 1 812 ? 57.010  -40.260 -67.433 1.00   45.35 ? 812  GLN A O     1 
ATOM   5996 C  CB    . GLN A 1 812 ? 54.536  -39.284 -65.447 1.00   45.87 ? 812  GLN A CB    1 
ATOM   5997 C  CG    . GLN A 1 812 ? 54.096  -38.320 -64.345 1.00   46.95 ? 812  GLN A CG    1 
ATOM   5998 C  CD    . GLN A 1 812 ? 53.243  -38.965 -63.259 1.00   47.22 ? 812  GLN A CD    1 
ATOM   5999 O  OE1   . GLN A 1 812 ? 52.227  -39.610 -63.527 1.00   47.89 ? 812  GLN A OE1   1 
ATOM   6000 N  NE2   . GLN A 1 812 ? 53.657  -38.780 -62.021 1.00   48.28 ? 812  GLN A NE2   1 
ATOM   6001 N  N     . ARG A 1 813 ? 55.043  -39.915 -68.458 1.00   47.72 ? 813  ARG A N     1 
ATOM   6002 C  CA    . ARG A 1 813 ? 55.303  -40.878 -69.528 1.00   48.82 ? 813  ARG A CA    1 
ATOM   6003 C  C     . ARG A 1 813 ? 56.556  -40.537 -70.345 1.00   48.93 ? 813  ARG A C     1 
ATOM   6004 O  O     . ARG A 1 813 ? 57.459  -41.372 -70.476 1.00   49.66 ? 813  ARG A O     1 
ATOM   6005 C  CB    . ARG A 1 813 ? 54.112  -40.975 -70.476 1.00   50.11 ? 813  ARG A CB    1 
ATOM   6006 C  CG    . ARG A 1 813 ? 54.286  -42.064 -71.524 1.00   53.22 ? 813  ARG A CG    1 
ATOM   6007 C  CD    . ARG A 1 813 ? 53.032  -42.281 -72.371 1.00   54.68 ? 813  ARG A CD    1 
ATOM   6008 N  NE    . ARG A 1 813 ? 52.621  -41.075 -73.090 1.00   56.09 ? 813  ARG A NE    1 
ATOM   6009 C  CZ    . ARG A 1 813 ? 51.477  -40.421 -72.877 1.00   56.54 ? 813  ARG A CZ    1 
ATOM   6010 N  NH1   . ARG A 1 813 ? 50.610  -40.844 -71.956 1.00   56.79 ? 813  ARG A NH1   1 
ATOM   6011 N  NH2   . ARG A 1 813 ? 51.185  -39.353 -73.607 1.00   56.97 ? 813  ARG A NH2   1 
ATOM   6012 N  N     . ASN A 1 814 ? 56.618  -39.319 -70.877 1.00   48.08 ? 814  ASN A N     1 
ATOM   6013 C  CA    . ASN A 1 814 ? 57.757  -38.910 -71.689 1.00   48.19 ? 814  ASN A CA    1 
ATOM   6014 C  C     . ASN A 1 814 ? 59.050  -38.672 -70.926 1.00   48.39 ? 814  ASN A C     1 
ATOM   6015 O  O     . ASN A 1 814 ? 60.105  -38.562 -71.539 1.00   49.70 ? 814  ASN A O     1 
ATOM   6016 C  CB    . ASN A 1 814 ? 57.399  -37.678 -72.537 1.00   43.81 ? 814  ASN A CB    1 
ATOM   6017 C  CG    . ASN A 1 814 ? 56.339  -37.995 -73.595 1.00   42.01 ? 814  ASN A CG    1 
ATOM   6018 O  OD1   . ASN A 1 814 ? 55.134  -37.863 -73.351 1.00   39.52 ? 814  ASN A OD1   1 
ATOM   6019 N  ND2   . ASN A 1 814 ? 56.784  -38.447 -74.776 1.00   39.85 ? 814  ASN A ND2   1 
ATOM   6020 N  N     . ILE A 1 815 ? 58.998  -38.576 -69.603 1.00   49.55 ? 815  ILE A N     1 
ATOM   6021 C  CA    . ILE A 1 815 ? 60.258  -38.389 -68.891 1.00   51.70 ? 815  ILE A CA    1 
ATOM   6022 C  C     . ILE A 1 815 ? 60.806  -39.791 -68.672 1.00   51.15 ? 815  ILE A C     1 
ATOM   6023 O  O     . ILE A 1 815 ? 62.004  -40.011 -68.755 1.00   52.77 ? 815  ILE A O     1 
ATOM   6024 C  CB    . ILE A 1 815 ? 60.105  -37.655 -67.521 1.00   51.08 ? 815  ILE A CB    1 
ATOM   6025 C  CG1   . ILE A 1 815 ? 59.816  -36.163 -67.742 1.00   50.48 ? 815  ILE A CG1   1 
ATOM   6026 C  CG2   . ILE A 1 815 ? 61.416  -37.748 -66.739 1.00   50.75 ? 815  ILE A CG2   1 
ATOM   6027 C  CD1   . ILE A 1 815 ? 59.802  -35.305 -66.455 1.00   48.86 ? 815  ILE A CD1   1 
ATOM   6028 N  N     . ARG A 1 816 ? 59.913  -40.734 -68.404 1.00   50.43 ? 816  ARG A N     1 
ATOM   6029 C  CA    . ARG A 1 816 ? 60.323  -42.112 -68.215 1.00   50.34 ? 816  ARG A CA    1 
ATOM   6030 C  C     . ARG A 1 816 ? 60.968  -42.649 -69.514 1.00   50.06 ? 816  ARG A C     1 
ATOM   6031 O  O     . ARG A 1 816 ? 61.966  -43.362 -69.446 1.00   47.80 ? 816  ARG A O     1 
ATOM   6032 C  CB    . ARG A 1 816 ? 59.126  -42.996 -67.804 1.00   49.92 ? 816  ARG A CB    1 
ATOM   6033 C  CG    . ARG A 1 816 ? 58.574  -42.684 -66.422 1.00   49.95 ? 816  ARG A CG    1 
ATOM   6034 C  CD    . ARG A 1 816 ? 57.763  -43.842 -65.877 1.00   50.56 ? 816  ARG A CD    1 
ATOM   6035 N  NE    . ARG A 1 816 ? 57.789  -43.897 -64.415 1.00   50.05 ? 816  ARG A NE    1 
ATOM   6036 C  CZ    . ARG A 1 816 ? 56.778  -43.530 -63.626 1.00   50.63 ? 816  ARG A CZ    1 
ATOM   6037 N  NH1   . ARG A 1 816 ? 55.646  -43.075 -64.156 1.00   49.80 ? 816  ARG A NH1   1 
ATOM   6038 N  NH2   . ARG A 1 816 ? 56.900  -43.621 -62.303 1.00   50.22 ? 816  ARG A NH2   1 
ATOM   6039 N  N     . LYS A 1 817 ? 60.406  -42.316 -70.674 1.00   48.74 ? 817  LYS A N     1 
ATOM   6040 C  CA    . LYS A 1 817 ? 60.983  -42.771 -71.945 1.00   48.43 ? 817  LYS A CA    1 
ATOM   6041 C  C     . LYS A 1 817 ? 62.386  -42.178 -72.121 1.00   48.06 ? 817  LYS A C     1 
ATOM   6042 O  O     . LYS A 1 817 ? 63.339  -42.888 -72.437 1.00   46.64 ? 817  LYS A O     1 
ATOM   6043 C  CB    . LYS A 1 817 ? 60.111  -42.357 -73.132 1.00   48.35 ? 817  LYS A CB    1 
ATOM   6044 C  CG    . LYS A 1 817 ? 58.845  -43.164 -73.285 1.00   49.63 ? 817  LYS A CG    1 
ATOM   6045 C  CD    . LYS A 1 817 ? 59.131  -44.587 -73.689 1.00   51.06 ? 817  LYS A CD    1 
ATOM   6046 C  CE    . LYS A 1 817 ? 59.745  -44.658 -75.095 1.00   53.46 ? 817  LYS A CE    1 
ATOM   6047 N  NZ    . LYS A 1 817 ? 59.817  -46.061 -75.605 1.00   53.27 ? 817  LYS A NZ    1 
ATOM   6048 N  N     . TRP A 1 818 ? 62.490  -40.867 -71.909 1.00   48.72 ? 818  TRP A N     1 
ATOM   6049 C  CA    . TRP A 1 818 ? 63.756  -40.155 -72.020 1.00   49.67 ? 818  TRP A CA    1 
ATOM   6050 C  C     . TRP A 1 818 ? 64.746  -40.764 -71.044 1.00   50.11 ? 818  TRP A C     1 
ATOM   6051 O  O     . TRP A 1 818 ? 65.944  -40.795 -71.310 1.00   52.57 ? 818  TRP A O     1 
ATOM   6052 C  CB    . TRP A 1 818 ? 63.543  -38.673 -71.706 1.00   49.24 ? 818  TRP A CB    1 
ATOM   6053 C  CG    . TRP A 1 818 ? 64.797  -37.848 -71.616 1.00   49.34 ? 818  TRP A CG    1 
ATOM   6054 C  CD1   . TRP A 1 818 ? 65.648  -37.521 -72.634 1.00   48.62 ? 818  TRP A CD1   1 
ATOM   6055 C  CD2   . TRP A 1 818 ? 65.310  -37.201 -70.447 1.00   48.57 ? 818  TRP A CD2   1 
ATOM   6056 N  NE1   . TRP A 1 818 ? 66.659  -36.707 -72.169 1.00   47.23 ? 818  TRP A NE1   1 
ATOM   6057 C  CE2   . TRP A 1 818 ? 66.472  -36.497 -70.830 1.00   48.53 ? 818  TRP A CE2   1 
ATOM   6058 C  CE3   . TRP A 1 818 ? 64.901  -37.145 -69.113 1.00   49.07 ? 818  TRP A CE3   1 
ATOM   6059 C  CZ2   . TRP A 1 818 ? 67.232  -35.749 -69.926 1.00   49.82 ? 818  TRP A CZ2   1 
ATOM   6060 C  CZ3   . TRP A 1 818 ? 65.657  -36.401 -68.211 1.00   50.45 ? 818  TRP A CZ3   1 
ATOM   6061 C  CH2   . TRP A 1 818 ? 66.808  -35.710 -68.622 1.00   49.71 ? 818  TRP A CH2   1 
ATOM   6062 N  N     . LEU A 1 819 ? 64.251  -41.248 -69.916 1.00   51.52 ? 819  LEU A N     1 
ATOM   6063 C  CA    . LEU A 1 819 ? 65.125  -41.863 -68.926 1.00   52.19 ? 819  LEU A CA    1 
ATOM   6064 C  C     . LEU A 1 819 ? 65.568  -43.271 -69.314 1.00   52.07 ? 819  LEU A C     1 
ATOM   6065 O  O     . LEU A 1 819 ? 66.749  -43.601 -69.187 1.00   53.76 ? 819  LEU A O     1 
ATOM   6066 C  CB    . LEU A 1 819 ? 64.462  -41.905 -67.542 1.00   51.22 ? 819  LEU A CB    1 
ATOM   6067 C  CG    . LEU A 1 819 ? 64.780  -40.724 -66.618 1.00   50.34 ? 819  LEU A CG    1 
ATOM   6068 C  CD1   . LEU A 1 819 ? 64.085  -40.893 -65.260 1.00   48.92 ? 819  LEU A CD1   1 
ATOM   6069 C  CD2   . LEU A 1 819 ? 66.273  -40.633 -66.451 1.00   49.07 ? 819  LEU A CD2   1 
ATOM   6070 N  N     . VAL A 1 820 ? 64.638  -44.101 -69.773 1.00   51.40 ? 820  VAL A N     1 
ATOM   6071 C  CA    . VAL A 1 820 ? 64.973  -45.472 -70.166 1.00   52.76 ? 820  VAL A CA    1 
ATOM   6072 C  C     . VAL A 1 820 ? 65.873  -45.499 -71.407 1.00   52.68 ? 820  VAL A C     1 
ATOM   6073 O  O     . VAL A 1 820 ? 66.714  -46.387 -71.547 1.00   52.78 ? 820  VAL A O     1 
ATOM   6074 C  CB    . VAL A 1 820 ? 63.712  -46.314 -70.449 1.00   52.75 ? 820  VAL A CB    1 
ATOM   6075 C  CG1   . VAL A 1 820 ? 62.799  -45.563 -71.378 1.00   53.11 ? 820  VAL A CG1   1 
ATOM   6076 C  CG2   . VAL A 1 820 ? 64.101  -47.655 -71.075 1.00   52.31 ? 820  VAL A CG2   1 
ATOM   6077 N  N     . LEU A 1 821 ? 65.696  -44.524 -72.286 1.00   51.09 ? 821  LEU A N     1 
ATOM   6078 C  CA    . LEU A 1 821 ? 66.497  -44.419 -73.500 1.00   50.78 ? 821  LEU A CA    1 
ATOM   6079 C  C     . LEU A 1 821 ? 67.931  -44.055 -73.154 1.00   52.18 ? 821  LEU A C     1 
ATOM   6080 O  O     . LEU A 1 821 ? 68.879  -44.507 -73.804 1.00   48.78 ? 821  LEU A O     1 
ATOM   6081 C  CB    . LEU A 1 821 ? 65.927  -43.339 -74.436 1.00   49.45 ? 821  LEU A CB    1 
ATOM   6082 C  CG    . LEU A 1 821 ? 66.939  -42.862 -75.474 1.00   50.34 ? 821  LEU A CG    1 
ATOM   6083 C  CD1   . LEU A 1 821 ? 67.194  -44.024 -76.406 1.00   51.30 ? 821  LEU A CD1   1 
ATOM   6084 C  CD2   . LEU A 1 821 ? 66.451  -41.633 -76.258 1.00   50.70 ? 821  LEU A CD2   1 
ATOM   6085 N  N     . ARG A 1 822 ? 68.084  -43.222 -72.127 1.00   53.55 ? 822  ARG A N     1 
ATOM   6086 C  CA    . ARG A 1 822 ? 69.395  -42.764 -71.688 1.00   54.46 ? 822  ARG A CA    1 
ATOM   6087 C  C     . ARG A 1 822 ? 70.192  -43.895 -71.078 1.00   56.44 ? 822  ARG A C     1 
ATOM   6088 O  O     . ARG A 1 822 ? 71.412  -43.805 -70.951 1.00   52.42 ? 822  ARG A O     1 
ATOM   6089 C  CB    . ARG A 1 822 ? 69.254  -41.639 -70.677 1.00   57.81 ? 822  ARG A CB    1 
ATOM   6090 C  CG    . ARG A 1 822 ? 69.243  -40.236 -71.268 1.00   67.40 ? 822  ARG A CG    1 
ATOM   6091 C  CD    . ARG A 1 822 ? 69.399  -39.228 -70.134 1.00   73.92 ? 822  ARG A CD    1 
ATOM   6092 N  NE    . ARG A 1 822 ? 69.945  -39.884 -68.942 1.00   78.22 ? 822  ARG A NE    1 
ATOM   6093 C  CZ    . ARG A 1 822 ? 70.009  -39.341 -67.725 1.00   80.52 ? 822  ARG A CZ    1 
ATOM   6094 N  NH1   . ARG A 1 822 ? 69.561  -38.110 -67.517 1.00   81.45 ? 822  ARG A NH1   1 
ATOM   6095 N  NH2   . ARG A 1 822 ? 70.501  -40.040 -66.702 1.00   81.51 ? 822  ARG A NH2   1 
ATOM   6096 N  N     . ASN A 1 823 ? 69.509  -44.966 -70.707 1.00   59.37 ? 823  ASN A N     1 
ATOM   6097 C  CA    . ASN A 1 823 ? 70.204  -46.111 -70.134 1.00   59.86 ? 823  ASN A CA    1 
ATOM   6098 C  C     . ASN A 1 823 ? 70.350  -47.243 -71.154 1.00   57.01 ? 823  ASN A C     1 
ATOM   6099 O  O     . ASN A 1 823 ? 70.798  -48.336 -70.820 1.00   55.11 ? 823  ASN A O     1 
ATOM   6100 C  CB    . ASN A 1 823 ? 69.464  -46.634 -68.900 1.00   67.91 ? 823  ASN A CB    1 
ATOM   6101 C  CG    . ASN A 1 823 ? 70.350  -47.506 -68.024 1.00   79.81 ? 823  ASN A CG    1 
ATOM   6102 O  OD1   . ASN A 1 823 ? 71.410  -47.062 -67.553 1.00   86.38 ? 823  ASN A OD1   1 
ATOM   6103 N  ND2   . ASN A 1 823 ? 69.931  -48.755 -67.807 1.00   86.19 ? 823  ASN A ND2   1 
ATOM   6104 N  N     . TRP A 1 824 ? 69.956  -46.972 -72.400 1.00   53.94 ? 824  TRP A N     1 
ATOM   6105 C  CA    . TRP A 1 824 ? 70.031  -47.963 -73.485 1.00   51.68 ? 824  TRP A CA    1 
ATOM   6106 C  C     . TRP A 1 824 ? 71.450  -47.984 -74.063 1.00   50.98 ? 824  TRP A C     1 
ATOM   6107 O  O     . TRP A 1 824 ? 71.920  -46.964 -74.574 1.00   50.43 ? 824  TRP A O     1 
ATOM   6108 C  CB    . TRP A 1 824 ? 69.018  -47.587 -74.564 1.00   50.74 ? 824  TRP A CB    1 
ATOM   6109 C  CG    . TRP A 1 824 ? 68.856  -48.538 -75.707 1.00   50.43 ? 824  TRP A CG    1 
ATOM   6110 C  CD1   . TRP A 1 824 ? 68.752  -49.897 -75.638 1.00   50.56 ? 824  TRP A CD1   1 
ATOM   6111 C  CD2   . TRP A 1 824 ? 68.609  -48.184 -77.075 1.00   49.72 ? 824  TRP A CD2   1 
ATOM   6112 N  NE1   . TRP A 1 824 ? 68.447  -50.411 -76.877 1.00   50.22 ? 824  TRP A NE1   1 
ATOM   6113 C  CE2   . TRP A 1 824 ? 68.353  -49.384 -77.777 1.00   49.84 ? 824  TRP A CE2   1 
ATOM   6114 C  CE3   . TRP A 1 824 ? 68.581  -46.967 -77.776 1.00   49.13 ? 824  TRP A CE3   1 
ATOM   6115 C  CZ2   . TRP A 1 824 ? 68.056  -49.405 -79.150 1.00   50.20 ? 824  TRP A CZ2   1 
ATOM   6116 C  CZ3   . TRP A 1 824 ? 68.291  -46.981 -79.140 1.00   49.42 ? 824  TRP A CZ3   1 
ATOM   6117 C  CH2   . TRP A 1 824 ? 68.032  -48.197 -79.814 1.00   50.08 ? 824  TRP A CH2   1 
ATOM   6118 N  N     . GLN A 1 825 ? 72.127  -49.120 -73.962 1.00   50.20 ? 825  GLN A N     1 
ATOM   6119 C  CA    . GLN A 1 825 ? 73.498  -49.251 -74.468 1.00   49.67 ? 825  GLN A CA    1 
ATOM   6120 C  C     . GLN A 1 825 ? 73.723  -48.546 -75.809 1.00   48.07 ? 825  GLN A C     1 
ATOM   6121 O  O     . GLN A 1 825 ? 74.680  -47.787 -75.964 1.00   45.83 ? 825  GLN A O     1 
ATOM   6122 C  CB    . GLN A 1 825 ? 73.900  -50.731 -74.606 1.00   51.99 ? 825  GLN A CB    1 
ATOM   6123 C  CG    . GLN A 1 825 ? 74.322  -51.410 -73.301 1.00   59.13 ? 825  GLN A CG    1 
ATOM   6124 C  CD    . GLN A 1 825 ? 75.385  -50.618 -72.542 1.00   63.01 ? 825  GLN A CD    1 
ATOM   6125 O  OE1   . GLN A 1 825 ? 76.211  -49.915 -73.133 1.00   64.43 ? 825  GLN A OE1   1 
ATOM   6126 N  NE2   . GLN A 1 825 ? 75.368  -50.739 -71.225 1.00   64.95 ? 825  GLN A NE2   1 
ATOM   6127 N  N     . TRP A 1 826 ? 72.831  -48.793 -76.760 1.00   45.51 ? 826  TRP A N     1 
ATOM   6128 C  CA    . TRP A 1 826 ? 72.930  -48.183 -78.079 1.00   44.11 ? 826  TRP A CA    1 
ATOM   6129 C  C     . TRP A 1 826 ? 72.878  -46.680 -78.052 1.00   44.55 ? 826  TRP A C     1 
ATOM   6130 O  O     . TRP A 1 826 ? 73.640  -46.018 -78.759 1.00   45.14 ? 826  TRP A O     1 
ATOM   6131 C  CB    . TRP A 1 826 ? 71.827  -48.705 -79.010 1.00   43.43 ? 826  TRP A CB    1 
ATOM   6132 C  CG    . TRP A 1 826 ? 72.088  -50.064 -79.565 1.00   42.94 ? 826  TRP A CG    1 
ATOM   6133 C  CD1   . TRP A 1 826 ? 71.463  -51.218 -79.216 1.00   43.11 ? 826  TRP A CD1   1 
ATOM   6134 C  CD2   . TRP A 1 826 ? 73.080  -50.417 -80.536 1.00   42.14 ? 826  TRP A CD2   1 
ATOM   6135 N  NE1   . TRP A 1 826 ? 72.006  -52.276 -79.902 1.00   42.69 ? 826  TRP A NE1   1 
ATOM   6136 C  CE2   . TRP A 1 826 ? 73.002  -51.808 -80.720 1.00   43.34 ? 826  TRP A CE2   1 
ATOM   6137 C  CE3   . TRP A 1 826 ? 74.032  -49.690 -81.261 1.00   42.69 ? 826  TRP A CE3   1 
ATOM   6138 C  CZ2   . TRP A 1 826 ? 73.841  -52.495 -81.607 1.00   42.72 ? 826  TRP A CZ2   1 
ATOM   6139 C  CZ3   . TRP A 1 826 ? 74.873  -50.370 -82.151 1.00   41.47 ? 826  TRP A CZ3   1 
ATOM   6140 C  CH2   . TRP A 1 826 ? 74.770  -51.753 -82.309 1.00   42.56 ? 826  TRP A CH2   1 
ATOM   6141 N  N     . TRP A 1 827 ? 71.990  -46.115 -77.251 1.00   46.34 ? 827  TRP A N     1 
ATOM   6142 C  CA    . TRP A 1 827 ? 71.901  -44.663 -77.208 1.00   48.13 ? 827  TRP A CA    1 
ATOM   6143 C  C     . TRP A 1 827 ? 73.150  -44.074 -76.565 1.00   50.64 ? 827  TRP A C     1 
ATOM   6144 O  O     . TRP A 1 827 ? 73.539  -42.940 -76.867 1.00   49.40 ? 827  TRP A O     1 
ATOM   6145 C  CB    . TRP A 1 827 ? 70.636  -44.208 -76.469 1.00   48.21 ? 827  TRP A CB    1 
ATOM   6146 C  CG    . TRP A 1 827 ? 70.480  -42.733 -76.495 1.00   49.01 ? 827  TRP A CG    1 
ATOM   6147 C  CD1   . TRP A 1 827 ? 70.884  -41.854 -75.534 1.00   50.38 ? 827  TRP A CD1   1 
ATOM   6148 C  CD2   . TRP A 1 827 ? 70.021  -41.940 -77.595 1.00   50.10 ? 827  TRP A CD2   1 
ATOM   6149 N  NE1   . TRP A 1 827 ? 70.719  -40.563 -75.972 1.00   50.87 ? 827  TRP A NE1   1 
ATOM   6150 C  CE2   . TRP A 1 827 ? 70.193  -40.585 -77.237 1.00   50.21 ? 827  TRP A CE2   1 
ATOM   6151 C  CE3   . TRP A 1 827 ? 69.491  -42.242 -78.859 1.00   49.79 ? 827  TRP A CE3   1 
ATOM   6152 C  CZ2   . TRP A 1 827 ? 69.851  -39.528 -78.091 1.00   50.93 ? 827  TRP A CZ2   1 
ATOM   6153 C  CZ3   . TRP A 1 827 ? 69.152  -41.190 -79.712 1.00   49.79 ? 827  TRP A CZ3   1 
ATOM   6154 C  CH2   . TRP A 1 827 ? 69.334  -39.850 -79.326 1.00   49.82 ? 827  TRP A CH2   1 
ATOM   6155 N  N     . LYS A 1 828 ? 73.784  -44.843 -75.679 1.00   52.96 ? 828  LYS A N     1 
ATOM   6156 C  CA    . LYS A 1 828 ? 74.995  -44.379 -75.014 1.00   55.41 ? 828  LYS A CA    1 
ATOM   6157 C  C     . LYS A 1 828 ? 76.170  -44.356 -75.968 1.00   56.14 ? 828  LYS A C     1 
ATOM   6158 O  O     . LYS A 1 828 ? 76.920  -43.381 -76.014 1.00   55.87 ? 828  LYS A O     1 
ATOM   6159 C  CB    . LYS A 1 828 ? 75.314  -45.269 -73.814 1.00   58.10 ? 828  LYS A CB    1 
ATOM   6160 C  CG    . LYS A 1 828 ? 74.814  -44.692 -72.512 1.00   63.79 ? 828  LYS A CG    1 
ATOM   6161 C  CD    . LYS A 1 828 ? 74.157  -45.751 -71.641 1.00   68.06 ? 828  LYS A CD    1 
ATOM   6162 C  CE    . LYS A 1 828 ? 75.159  -46.716 -71.028 1.00   69.12 ? 828  LYS A CE    1 
ATOM   6163 N  NZ    . LYS A 1 828 ? 74.504  -47.517 -69.967 1.00   69.83 ? 828  LYS A NZ    1 
ATOM   6164 N  N     . LEU A 1 829 ? 76.345  -45.428 -76.725 1.00   56.88 ? 829  LEU A N     1 
ATOM   6165 C  CA    . LEU A 1 829 ? 77.438  -45.475 -77.688 1.00   57.39 ? 829  LEU A CA    1 
ATOM   6166 C  C     . LEU A 1 829 ? 77.191  -44.332 -78.659 1.00   59.92 ? 829  LEU A C     1 
ATOM   6167 O  O     . LEU A 1 829 ? 78.105  -43.591 -79.015 1.00   57.92 ? 829  LEU A O     1 
ATOM   6168 C  CB    . LEU A 1 829 ? 77.445  -46.807 -78.445 1.00   56.92 ? 829  LEU A CB    1 
ATOM   6169 C  CG    . LEU A 1 829 ? 78.460  -46.991 -79.584 1.00   58.02 ? 829  LEU A CG    1 
ATOM   6170 C  CD1   . LEU A 1 829 ? 79.891  -46.931 -79.058 1.00   58.19 ? 829  LEU A CD1   1 
ATOM   6171 C  CD2   . LEU A 1 829 ? 78.193  -48.321 -80.267 1.00   57.94 ? 829  LEU A CD2   1 
ATOM   6172 N  N     . TYR A 1 830 ? 75.942  -44.193 -79.078 1.00   65.44 ? 830  TYR A N     1 
ATOM   6173 C  CA    . TYR A 1 830 ? 75.568  -43.139 -79.997 1.00   69.18 ? 830  TYR A CA    1 
ATOM   6174 C  C     . TYR A 1 830 ? 75.921  -41.755 -79.448 1.00   70.80 ? 830  TYR A C     1 
ATOM   6175 O  O     . TYR A 1 830 ? 76.503  -40.936 -80.153 1.00   73.32 ? 830  TYR A O     1 
ATOM   6176 C  CB    . TYR A 1 830 ? 74.077  -43.225 -80.305 1.00   70.31 ? 830  TYR A CB    1 
ATOM   6177 C  CG    . TYR A 1 830 ? 73.618  -42.195 -81.295 1.00   73.75 ? 830  TYR A CG    1 
ATOM   6178 C  CD1   . TYR A 1 830 ? 73.132  -40.959 -80.871 1.00   75.79 ? 830  TYR A CD1   1 
ATOM   6179 C  CD2   . TYR A 1 830 ? 73.698  -42.438 -82.661 1.00   75.62 ? 830  TYR A CD2   1 
ATOM   6180 C  CE1   . TYR A 1 830 ? 72.731  -39.992 -81.783 1.00   76.90 ? 830  TYR A CE1   1 
ATOM   6181 C  CE2   . TYR A 1 830 ? 73.306  -41.480 -83.581 1.00   76.94 ? 830  TYR A CE2   1 
ATOM   6182 C  CZ    . TYR A 1 830 ? 72.822  -40.262 -83.135 1.00   77.51 ? 830  TYR A CZ    1 
ATOM   6183 O  OH    . TYR A 1 830 ? 72.406  -39.322 -84.045 1.00   78.53 ? 830  TYR A OH    1 
ATOM   6184 N  N     . SER A 1 831 ? 75.570  -41.494 -78.194 1.00   75.93 ? 831  SER A N     1 
ATOM   6185 C  CA    . SER A 1 831 ? 75.870  -40.203 -77.582 1.00   81.51 ? 831  SER A CA    1 
ATOM   6186 C  C     . SER A 1 831 ? 77.364  -39.901 -77.587 1.00   82.67 ? 831  SER A C     1 
ATOM   6187 O  O     . SER A 1 831 ? 77.768  -38.742 -77.689 1.00   88.13 ? 831  SER A O     1 
ATOM   6188 C  CB    . SER A 1 831 ? 75.342  -40.157 -76.149 1.00   84.53 ? 831  SER A CB    1 
ATOM   6189 O  OG    . SER A 1 831 ? 73.930  -40.052 -76.147 1.00   83.55 ? 831  SER A OG    1 
ATOM   6190 N  N     . LYS A 1 832 ? 78.181  -40.940 -77.478 1.00   82.54 ? 832  LYS A N     1 
ATOM   6191 C  CA    . LYS A 1 832 ? 79.627  -40.773 -77.472 1.00   80.99 ? 832  LYS A CA    1 
ATOM   6192 C  C     . LYS A 1 832 ? 80.197  -40.446 -78.859 1.00   79.90 ? 832  LYS A C     1 
ATOM   6193 O  O     . LYS A 1 832 ? 81.263  -39.845 -78.967 1.00   77.51 ? 832  LYS A O     1 
ATOM   6194 C  CB    . LYS A 1 832 ? 80.294  -42.041 -76.932 1.00   80.92 ? 832  LYS A CB    1 
ATOM   6195 C  CG    . LYS A 1 832 ? 80.061  -42.301 -75.462 1.00   78.30 ? 832  LYS A CG    1 
ATOM   6196 C  CD    . LYS A 1 832 ? 80.865  -43.502 -74.956 1.00   77.58 ? 832  LYS A CD    1 
ATOM   6197 C  CE    . LYS A 1 832 ? 80.253  -44.839 -75.371 1.00   77.62 ? 832  LYS A CE    1 
ATOM   6198 N  NZ    . LYS A 1 832 ? 80.955  -45.997 -74.732 1.00   77.35 ? 832  LYS A NZ    1 
ATOM   6199 N  N     . VAL A 1 833 ? 79.489  -40.842 -79.910 1.00   76.33 ? 833  VAL A N     1 
ATOM   6200 C  CA    . VAL A 1 833 ? 79.946  -40.617 -81.282 1.00   72.14 ? 833  VAL A CA    1 
ATOM   6201 C  C     . VAL A 1 833 ? 79.465  -39.319 -81.946 1.00   72.65 ? 833  VAL A C     1 
ATOM   6202 O  O     . VAL A 1 833 ? 80.158  -38.767 -82.802 1.00   71.67 ? 833  VAL A O     1 
ATOM   6203 C  CB    . VAL A 1 833 ? 79.546  -41.812 -82.196 1.00   69.57 ? 833  VAL A CB    1 
ATOM   6204 C  CG1   . VAL A 1 833 ? 79.868  -41.502 -83.645 1.00   65.94 ? 833  VAL A CG1   1 
ATOM   6205 C  CG2   . VAL A 1 833 ? 80.272  -43.073 -81.763 1.00   65.29 ? 833  VAL A CG2   1 
ATOM   6206 N  N     . LYS A 1 834 ? 78.289  -38.830 -81.553 1.00   73.29 ? 834  LYS A N     1 
ATOM   6207 C  CA    . LYS A 1 834 ? 77.737  -37.604 -82.143 1.00   77.25 ? 834  LYS A CA    1 
ATOM   6208 C  C     . LYS A 1 834 ? 78.679  -36.402 -82.088 1.00   80.82 ? 834  LYS A C     1 
ATOM   6209 O  O     . LYS A 1 834 ? 78.721  -35.594 -83.019 1.00   83.30 ? 834  LYS A O     1 
ATOM   6210 C  CB    . LYS A 1 834 ? 76.421  -37.247 -81.471 1.00   78.90 ? 834  LYS A CB    1 
ATOM   6211 N  N     . PRO A 1 835 ? 79.455  -36.259 -81.005 1.00   82.32 ? 835  PRO A N     1 
ATOM   6212 C  CA    . PRO A 1 835 ? 80.397  -35.155 -80.861 1.00   85.34 ? 835  PRO A CA    1 
ATOM   6213 C  C     . PRO A 1 835 ? 81.548  -35.209 -81.857 1.00   86.20 ? 835  PRO A C     1 
ATOM   6214 O  O     . PRO A 1 835 ? 82.324  -34.256 -81.945 1.00   85.42 ? 835  PRO A O     1 
ATOM   6215 C  CB    . PRO A 1 835 ? 80.991  -35.367 -79.472 1.00   85.19 ? 835  PRO A CB    1 
ATOM   6216 C  CG    . PRO A 1 835 ? 80.990  -36.837 -79.303 1.00   85.27 ? 835  PRO A CG    1 
ATOM   6217 C  CD    . PRO A 1 835 ? 79.791  -37.353 -80.057 1.00   84.83 ? 835  PRO A CD    1 
ATOM   6218 N  N     . LEU A 1 836 ? 81.681  -36.304 -82.600 1.00   86.39 ? 836  LEU A N     1 
ATOM   6219 C  CA    . LEU A 1 836 ? 82.867  -36.472 -83.443 1.00   87.32 ? 836  LEU A CA    1 
ATOM   6220 C  C     . LEU A 1 836 ? 82.626  -36.300 -84.928 1.00   88.65 ? 836  LEU A C     1 
ATOM   6221 O  O     . LEU A 1 836 ? 83.529  -36.524 -85.735 1.00   88.85 ? 836  LEU A O     1 
ATOM   6222 C  CB    . LEU A 1 836 ? 83.482  -37.869 -83.187 1.00   85.98 ? 836  LEU A CB    1 
ATOM   6223 C  CG    . LEU A 1 836 ? 83.903  -38.196 -81.748 1.00   85.39 ? 836  LEU A CG    1 
ATOM   6224 C  CD1   . LEU A 1 836 ? 84.470  -39.603 -81.674 1.00   85.04 ? 836  LEU A CD1   1 
ATOM   6225 C  CD2   . LEU A 1 836 ? 84.920  -37.182 -81.252 1.00   85.01 ? 836  LEU A CD2   1 
ATOM   6226 N  N     . LEU A 1 837 ? 81.418  -35.897 -85.304 1.00   90.19 ? 837  LEU A N     1 
ATOM   6227 C  CA    . LEU A 1 837 ? 81.095  -35.712 -86.717 1.00   91.66 ? 837  LEU A CA    1 
ATOM   6228 C  C     . LEU A 1 837 ? 80.478  -34.340 -86.950 1.00   92.42 ? 837  LEU A C     1 
ATOM   6229 O  O     . LEU A 1 837 ? 79.545  -33.978 -86.198 1.00   92.88 ? 837  LEU A O     1 
ATOM   6230 C  CB    . LEU A 1 837 ? 80.135  -36.807 -87.175 1.00   91.88 ? 837  LEU A CB    1 
ATOM   6231 O  OXT   . LEU A 1 837 ? 80.931  -33.639 -87.880 1.00   92.96 ? 837  LEU A OXT   1 
ATOM   6232 N  N     . PRO B 2 1   ? 61.383  -39.136 -88.824 1.00   86.54 ? 13   PRO B N     1 
ATOM   6233 C  CA    . PRO B 2 1   ? 62.865  -39.033 -88.801 1.00   88.53 ? 13   PRO B CA    1 
ATOM   6234 C  C     . PRO B 2 1   ? 63.409  -38.700 -90.186 1.00   89.95 ? 13   PRO B C     1 
ATOM   6235 O  O     . PRO B 2 1   ? 63.390  -39.543 -91.083 1.00   90.08 ? 13   PRO B O     1 
ATOM   6236 C  CB    . PRO B 2 1   ? 63.390  -40.380 -88.315 1.00   88.67 ? 13   PRO B CB    1 
ATOM   6237 C  CG    . PRO B 2 1   ? 62.243  -41.314 -88.716 1.00   87.51 ? 13   PRO B CG    1 
ATOM   6238 C  CD    . PRO B 2 1   ? 60.965  -40.503 -88.467 1.00   87.98 ? 13   PRO B CD    1 
ATOM   6239 N  N     . GLN B 2 2   ? 63.891  -37.473 -90.363 1.00   91.94 ? 14   GLN B N     1 
ATOM   6240 C  CA    . GLN B 2 2   ? 64.418  -37.055 -91.659 1.00   92.69 ? 14   GLN B CA    1 
ATOM   6241 C  C     . GLN B 2 2   ? 65.833  -36.473 -91.564 1.00   93.11 ? 14   GLN B C     1 
ATOM   6242 O  O     . GLN B 2 2   ? 66.756  -36.966 -92.214 1.00   91.18 ? 14   GLN B O     1 
ATOM   6243 C  CB    . GLN B 2 2   ? 63.475  -36.031 -92.302 1.00   93.38 ? 14   GLN B CB    1 
ATOM   6244 C  CG    . GLN B 2 2   ? 63.674  -35.842 -93.799 1.00   97.07 ? 14   GLN B CG    1 
ATOM   6245 C  CD    . GLN B 2 2   ? 65.127  -35.628 -94.180 1.00   98.60 ? 14   GLN B CD    1 
ATOM   6246 O  OE1   . GLN B 2 2   ? 65.771  -34.680 -93.731 1.00   99.36 ? 14   GLN B OE1   1 
ATOM   6247 N  NE2   . GLN B 2 2   ? 65.653  -36.521 -95.012 1.00   99.41 ? 14   GLN B NE2   1 
ATOM   6248 N  N     . LYS B 2 3   ? 66.001  -35.428 -90.763 1.00   94.13 ? 15   LYS B N     1 
ATOM   6249 C  CA    . LYS B 2 3   ? 67.309  -34.796 -90.602 1.00   94.30 ? 15   LYS B CA    1 
ATOM   6250 C  C     . LYS B 2 3   ? 68.194  -35.672 -89.726 1.00   93.13 ? 15   LYS B C     1 
ATOM   6251 O  O     . LYS B 2 3   ? 69.418  -35.667 -89.858 1.00   94.93 ? 15   LYS B O     1 
ATOM   6252 C  CB    . LYS B 2 3   ? 67.144  -33.396 -89.982 1.00   95.59 ? 15   LYS B CB    1 
ATOM   6253 C  CG    . LYS B 2 3   ? 67.992  -33.114 -88.736 1.00   98.20 ? 15   LYS B CG    1 
ATOM   6254 C  CD    . LYS B 2 3   ? 69.469  -32.902 -89.053 1.00   98.87 ? 15   LYS B CD    1 
ATOM   6255 C  CE    . LYS B 2 3   ? 70.246  -32.616 -87.774 1.00   99.41 ? 15   LYS B CE    1 
ATOM   6256 N  NZ    . LYS B 2 3   ? 71.708  -32.476 -88.012 1.00   99.43 ? 15   LYS B NZ    1 
ATOM   6257 N  N     . GLN B 2 4   ? 67.564  -36.432 -88.840 1.00   92.24 ? 16   GLN B N     1 
ATOM   6258 C  CA    . GLN B 2 4   ? 68.288  -37.322 -87.949 1.00   92.51 ? 16   GLN B CA    1 
ATOM   6259 C  C     . GLN B 2 4   ? 69.014  -38.419 -88.732 1.00   94.00 ? 16   GLN B C     1 
ATOM   6260 O  O     . GLN B 2 4   ? 70.210  -38.643 -88.534 1.00   94.60 ? 16   GLN B O     1 
ATOM   6261 C  CB    . GLN B 2 4   ? 67.326  -37.944 -86.939 1.00   93.47 ? 16   GLN B CB    1 
ATOM   6262 N  N     . ILE B 2 5   ? 68.289  -39.097 -89.615 1.00   95.24 ? 17   ILE B N     1 
ATOM   6263 C  CA    . ILE B 2 5   ? 68.847  -40.180 -90.424 1.00   93.46 ? 17   ILE B CA    1 
ATOM   6264 C  C     . ILE B 2 5   ? 70.268  -39.964 -90.937 1.00   92.39 ? 17   ILE B C     1 
ATOM   6265 O  O     . ILE B 2 5   ? 71.151  -40.775 -90.658 1.00   92.71 ? 17   ILE B O     1 
ATOM   6266 C  CB    . ILE B 2 5   ? 67.934  -40.492 -91.621 1.00   94.29 ? 17   ILE B CB    1 
ATOM   6267 C  CG1   . ILE B 2 5   ? 66.600  -41.030 -91.107 1.00   94.64 ? 17   ILE B CG1   1 
ATOM   6268 C  CG2   . ILE B 2 5   ? 68.588  -41.504 -92.545 1.00   94.09 ? 17   ILE B CG2   1 
ATOM   6269 C  CD1   . ILE B 2 5   ? 66.734  -42.239 -90.195 1.00   95.85 ? 17   ILE B CD1   1 
ATOM   6270 N  N     . GLN B 2 6   ? 70.494  -38.893 -91.686 1.00   89.84 ? 18   GLN B N     1 
ATOM   6271 C  CA    . GLN B 2 6   ? 71.833  -38.642 -92.206 1.00   90.20 ? 18   GLN B CA    1 
ATOM   6272 C  C     . GLN B 2 6   ? 72.827  -38.682 -91.054 1.00   89.50 ? 18   GLN B C     1 
ATOM   6273 O  O     . GLN B 2 6   ? 73.893  -39.289 -91.165 1.00   92.35 ? 18   GLN B O     1 
ATOM   6274 C  CB    . GLN B 2 6   ? 71.902  -37.286 -92.915 1.00   90.90 ? 18   GLN B CB    1 
ATOM   6275 C  CG    . GLN B 2 6   ? 73.299  -36.897 -93.413 1.00   87.41 ? 18   GLN B CG    1 
ATOM   6276 C  CD    . GLN B 2 6   ? 73.907  -37.943 -94.317 1.00   85.52 ? 18   GLN B CD    1 
ATOM   6277 O  OE1   . GLN B 2 6   ? 73.200  -38.786 -94.871 1.00   84.85 ? 18   GLN B OE1   1 
ATOM   6278 N  NE2   . GLN B 2 6   ? 75.222  -37.888 -94.487 1.00   84.39 ? 18   GLN B NE2   1 
ATOM   6279 N  N     . GLU B 2 7   ? 72.475  -38.035 -89.947 1.00   86.96 ? 19   GLU B N     1 
ATOM   6280 C  CA    . GLU B 2 7   ? 73.349  -38.017 -88.777 1.00   84.36 ? 19   GLU B CA    1 
ATOM   6281 C  C     . GLU B 2 7   ? 73.559  -39.441 -88.298 1.00   83.34 ? 19   GLU B C     1 
ATOM   6282 O  O     . GLU B 2 7   ? 74.643  -39.797 -87.837 1.00   79.92 ? 19   GLU B O     1 
ATOM   6283 C  CB    . GLU B 2 7   ? 72.734  -37.179 -87.656 1.00   83.16 ? 19   GLU B CB    1 
ATOM   6284 N  N     . MET B 2 8   ? 72.518  -40.256 -88.410 1.00   80.67 ? 20   MET B N     1 
ATOM   6285 C  CA    . MET B 2 8   ? 72.612  -41.636 -87.972 1.00   77.96 ? 20   MET B CA    1 
ATOM   6286 C  C     . MET B 2 8   ? 73.409  -42.473 -88.958 1.00   75.30 ? 20   MET B C     1 
ATOM   6287 O  O     . MET B 2 8   ? 73.764  -43.615 -88.669 1.00   74.64 ? 20   MET B O     1 
ATOM   6288 C  CB    . MET B 2 8   ? 71.219  -42.227 -87.772 1.00   79.19 ? 20   MET B CB    1 
ATOM   6289 C  CG    . MET B 2 8   ? 70.438  -41.562 -86.658 1.00   83.11 ? 20   MET B CG    1 
ATOM   6290 S  SD    . MET B 2 8   ? 69.367  -42.720 -85.763 1.00   86.35 ? 20   MET B SD    1 
ATOM   6291 C  CE    . MET B 2 8   ? 67.779  -42.490 -86.626 1.00   86.71 ? 20   MET B CE    1 
ATOM   6292 N  N     . LYS B 2 9   ? 73.696  -41.899 -90.121 1.00   71.92 ? 21   LYS B N     1 
ATOM   6293 C  CA    . LYS B 2 9   ? 74.472  -42.604 -91.141 1.00   70.36 ? 21   LYS B CA    1 
ATOM   6294 C  C     . LYS B 2 9   ? 75.967  -42.349 -90.948 1.00   69.96 ? 21   LYS B C     1 
ATOM   6295 O  O     . LYS B 2 9   ? 76.789  -43.232 -91.186 1.00   71.19 ? 21   LYS B O     1 
ATOM   6296 C  CB    . LYS B 2 9   ? 74.036  -42.170 -92.546 1.00   70.85 ? 21   LYS B CB    1 
ATOM   6297 N  N     . GLU B 2 10  ? 76.313  -41.139 -90.517 1.00   69.49 ? 22   GLU B N     1 
ATOM   6298 C  CA    . GLU B 2 10  ? 77.706  -40.785 -90.281 1.00   67.59 ? 22   GLU B CA    1 
ATOM   6299 C  C     . GLU B 2 10  ? 78.154  -41.570 -89.053 1.00   65.23 ? 22   GLU B C     1 
ATOM   6300 O  O     . GLU B 2 10  ? 79.254  -42.114 -89.011 1.00   65.36 ? 22   GLU B O     1 
ATOM   6301 C  CB    . GLU B 2 10  ? 77.833  -39.293 -90.025 1.00   67.20 ? 22   GLU B CB    1 
ATOM   6302 N  N     . ALA B 2 11  ? 77.282  -41.610 -88.061 1.00   62.41 ? 23   ALA B N     1 
ATOM   6303 C  CA    . ALA B 2 11  ? 77.544  -42.329 -86.831 1.00   61.58 ? 23   ALA B CA    1 
ATOM   6304 C  C     . ALA B 2 11  ? 77.721  -43.804 -87.172 1.00   61.10 ? 23   ALA B C     1 
ATOM   6305 O  O     . ALA B 2 11  ? 78.687  -44.434 -86.741 1.00   63.31 ? 23   ALA B O     1 
ATOM   6306 C  CB    . ALA B 2 11  ? 76.384  -42.148 -85.863 1.00   59.95 ? 23   ALA B CB    1 
ATOM   6307 N  N     . PHE B 2 12  ? 76.787  -44.346 -87.945 1.00   61.47 ? 24   PHE B N     1 
ATOM   6308 C  CA    . PHE B 2 12  ? 76.869  -45.753 -88.301 1.00   63.53 ? 24   PHE B CA    1 
ATOM   6309 C  C     . PHE B 2 12  ? 78.206  -46.138 -88.923 1.00   66.68 ? 24   PHE B C     1 
ATOM   6310 O  O     . PHE B 2 12  ? 78.721  -47.227 -88.673 1.00   67.38 ? 24   PHE B O     1 
ATOM   6311 C  CB    . PHE B 2 12  ? 75.748  -46.144 -89.263 1.00   59.61 ? 24   PHE B CB    1 
ATOM   6312 C  CG    . PHE B 2 12  ? 75.898  -47.533 -89.802 1.00   53.44 ? 24   PHE B CG    1 
ATOM   6313 C  CD1   . PHE B 2 12  ? 76.727  -47.787 -90.889 1.00   50.51 ? 24   PHE B CD1   1 
ATOM   6314 C  CD2   . PHE B 2 12  ? 75.244  -48.602 -89.189 1.00   51.11 ? 24   PHE B CD2   1 
ATOM   6315 C  CE1   . PHE B 2 12  ? 76.902  -49.084 -91.352 1.00   49.17 ? 24   PHE B CE1   1 
ATOM   6316 C  CE2   . PHE B 2 12  ? 75.413  -49.908 -89.647 1.00   49.49 ? 24   PHE B CE2   1 
ATOM   6317 C  CZ    . PHE B 2 12  ? 76.239  -50.151 -90.725 1.00   49.04 ? 24   PHE B CZ    1 
ATOM   6318 N  N     . SER B 2 13  ? 78.759  -45.241 -89.730 1.00   69.55 ? 25   SER B N     1 
ATOM   6319 C  CA    . SER B 2 13  ? 80.027  -45.497 -90.399 1.00   71.96 ? 25   SER B CA    1 
ATOM   6320 C  C     . SER B 2 13  ? 81.200  -45.268 -89.464 1.00   72.34 ? 25   SER B C     1 
ATOM   6321 O  O     . SER B 2 13  ? 82.341  -45.562 -89.814 1.00   71.36 ? 25   SER B O     1 
ATOM   6322 C  CB    . SER B 2 13  ? 80.194  -44.559 -91.590 1.00   74.11 ? 25   SER B CB    1 
ATOM   6323 O  OG    . SER B 2 13  ? 80.885  -43.391 -91.177 1.00   79.21 ? 25   SER B OG    1 
ATOM   6324 N  N     . MET B 2 14  ? 80.928  -44.731 -88.283 1.00   71.73 ? 26   MET B N     1 
ATOM   6325 C  CA    . MET B 2 14  ? 82.000  -44.467 -87.333 1.00   70.43 ? 26   MET B CA    1 
ATOM   6326 C  C     . MET B 2 14  ? 82.080  -45.614 -86.338 1.00   68.70 ? 26   MET B C     1 
ATOM   6327 O  O     . MET B 2 14  ? 83.131  -45.871 -85.748 1.00   68.84 ? 26   MET B O     1 
ATOM   6328 C  CB    . MET B 2 14  ? 81.755  -43.139 -86.609 1.00   71.58 ? 26   MET B CB    1 
ATOM   6329 C  CG    . MET B 2 14  ? 82.978  -42.591 -85.895 1.00   75.07 ? 26   MET B CG    1 
ATOM   6330 S  SD    . MET B 2 14  ? 82.781  -40.881 -85.303 1.00   77.36 ? 26   MET B SD    1 
ATOM   6331 C  CE    . MET B 2 14  ? 83.327  -39.990 -86.740 1.00   78.48 ? 26   MET B CE    1 
ATOM   6332 N  N     . ILE B 2 15  ? 80.961  -46.300 -86.156 1.00   67.12 ? 27   ILE B N     1 
ATOM   6333 C  CA    . ILE B 2 15  ? 80.890  -47.439 -85.253 1.00   66.52 ? 27   ILE B CA    1 
ATOM   6334 C  C     . ILE B 2 15  ? 81.432  -48.664 -85.987 1.00   67.28 ? 27   ILE B C     1 
ATOM   6335 O  O     . ILE B 2 15  ? 82.091  -49.524 -85.399 1.00   68.44 ? 27   ILE B O     1 
ATOM   6336 C  CB    . ILE B 2 15  ? 79.441  -47.670 -84.809 1.00   63.96 ? 27   ILE B CB    1 
ATOM   6337 C  CG1   . ILE B 2 15  ? 78.967  -46.425 -84.046 1.00   60.49 ? 27   ILE B CG1   1 
ATOM   6338 C  CG2   . ILE B 2 15  ? 79.335  -48.937 -83.971 1.00   60.23 ? 27   ILE B CG2   1 
ATOM   6339 C  CD1   . ILE B 2 15  ? 77.488  -46.355 -83.830 1.00   58.65 ? 27   ILE B CD1   1 
ATOM   6340 N  N     . ASP B 2 16  ? 81.145  -48.723 -87.288 1.00   69.49 ? 28   ASP B N     1 
ATOM   6341 C  CA    . ASP B 2 16  ? 81.606  -49.796 -88.168 1.00   71.55 ? 28   ASP B CA    1 
ATOM   6342 C  C     . ASP B 2 16  ? 83.070  -49.473 -88.464 1.00   73.01 ? 28   ASP B C     1 
ATOM   6343 O  O     . ASP B 2 16  ? 83.384  -48.797 -89.443 1.00   72.66 ? 28   ASP B O     1 
ATOM   6344 C  CB    . ASP B 2 16  ? 80.766  -49.787 -89.451 1.00   72.01 ? 28   ASP B CB    1 
ATOM   6345 C  CG    . ASP B 2 16  ? 81.252  -50.779 -90.492 1.00   71.87 ? 28   ASP B CG    1 
ATOM   6346 O  OD1   . ASP B 2 16  ? 81.639  -51.912 -90.115 1.00   71.09 ? 28   ASP B OD1   1 
ATOM   6347 O  OD2   . ASP B 2 16  ? 81.222  -50.415 -91.693 1.00   71.10 ? 28   ASP B OD2   1 
ATOM   6348 N  N     . VAL B 2 17  ? 83.954  -49.962 -87.599 1.00   74.46 ? 29   VAL B N     1 
ATOM   6349 C  CA    . VAL B 2 17  ? 85.382  -49.699 -87.712 1.00   74.75 ? 29   VAL B CA    1 
ATOM   6350 C  C     . VAL B 2 17  ? 86.066  -50.345 -88.915 1.00   75.32 ? 29   VAL B C     1 
ATOM   6351 O  O     . VAL B 2 17  ? 86.736  -49.661 -89.689 1.00   74.01 ? 29   VAL B O     1 
ATOM   6352 C  CB    . VAL B 2 17  ? 86.113  -50.124 -86.419 1.00   75.50 ? 29   VAL B CB    1 
ATOM   6353 C  CG1   . VAL B 2 17  ? 87.572  -49.690 -86.476 1.00   77.29 ? 29   VAL B CG1   1 
ATOM   6354 C  CG2   . VAL B 2 17  ? 85.421  -49.508 -85.208 1.00   76.98 ? 29   VAL B CG2   1 
ATOM   6355 N  N     . ASP B 2 18  ? 85.901  -51.654 -89.077 1.00   75.84 ? 30   ASP B N     1 
ATOM   6356 C  CA    . ASP B 2 18  ? 86.520  -52.349 -90.201 1.00   75.39 ? 30   ASP B CA    1 
ATOM   6357 C  C     . ASP B 2 18  ? 85.950  -51.880 -91.539 1.00   73.98 ? 30   ASP B C     1 
ATOM   6358 O  O     . ASP B 2 18  ? 86.344  -52.374 -92.594 1.00   75.44 ? 30   ASP B O     1 
ATOM   6359 C  CB    . ASP B 2 18  ? 86.347  -53.872 -90.058 1.00   76.55 ? 30   ASP B CB    1 
ATOM   6360 C  CG    . ASP B 2 18  ? 84.891  -54.316 -90.116 1.00   77.42 ? 30   ASP B CG    1 
ATOM   6361 O  OD1   . ASP B 2 18  ? 84.163  -53.881 -91.035 1.00   78.38 ? 30   ASP B OD1   1 
ATOM   6362 O  OD2   . ASP B 2 18  ? 84.486  -55.117 -89.248 1.00   77.59 ? 30   ASP B OD2   1 
ATOM   6363 N  N     . ARG B 2 19  ? 85.029  -50.924 -91.484 1.00   72.64 ? 31   ARG B N     1 
ATOM   6364 C  CA    . ARG B 2 19  ? 84.399  -50.371 -92.684 1.00   72.90 ? 31   ARG B CA    1 
ATOM   6365 C  C     . ARG B 2 19  ? 84.007  -51.477 -93.650 1.00   73.90 ? 31   ARG B C     1 
ATOM   6366 O  O     . ARG B 2 19  ? 84.768  -51.816 -94.556 1.00   75.31 ? 31   ARG B O     1 
ATOM   6367 C  CB    . ARG B 2 19  ? 85.350  -49.375 -93.372 1.00   72.94 ? 31   ARG B CB    1 
ATOM   6368 N  N     . ASP B 2 20  ? 82.820  -52.037 -93.465 1.00   74.13 ? 32   ASP B N     1 
ATOM   6369 C  CA    . ASP B 2 20  ? 82.358  -53.112 -94.329 1.00   73.10 ? 32   ASP B CA    1 
ATOM   6370 C  C     . ASP B 2 20  ? 80.840  -53.078 -94.487 1.00   71.79 ? 32   ASP B C     1 
ATOM   6371 O  O     . ASP B 2 20  ? 80.261  -53.901 -95.201 1.00   69.38 ? 32   ASP B O     1 
ATOM   6372 C  CB    . ASP B 2 20  ? 82.803  -54.464 -93.757 1.00   75.20 ? 32   ASP B CB    1 
ATOM   6373 C  CG    . ASP B 2 20  ? 81.939  -54.924 -92.602 1.00   77.98 ? 32   ASP B CG    1 
ATOM   6374 O  OD1   . ASP B 2 20  ? 81.757  -54.147 -91.640 1.00   79.66 ? 32   ASP B OD1   1 
ATOM   6375 O  OD2   . ASP B 2 20  ? 81.439  -56.070 -92.658 1.00   80.12 ? 32   ASP B OD2   1 
ATOM   6376 N  N     . GLY B 2 21  ? 80.201  -52.122 -93.817 1.00   69.07 ? 33   GLY B N     1 
ATOM   6377 C  CA    . GLY B 2 21  ? 78.759  -51.997 -93.902 1.00   66.51 ? 33   GLY B CA    1 
ATOM   6378 C  C     . GLY B 2 21  ? 77.988  -52.798 -92.868 1.00   64.31 ? 33   GLY B C     1 
ATOM   6379 O  O     . GLY B 2 21  ? 76.763  -52.870 -92.930 1.00   64.63 ? 33   GLY B O     1 
ATOM   6380 N  N     . PHE B 2 22  ? 78.695  -53.408 -91.924 1.00   62.40 ? 34   PHE B N     1 
ATOM   6381 C  CA    . PHE B 2 22  ? 78.037  -54.191 -90.888 1.00   61.99 ? 34   PHE B CA    1 
ATOM   6382 C  C     . PHE B 2 22  ? 78.707  -53.998 -89.552 1.00   62.68 ? 34   PHE B C     1 
ATOM   6383 O  O     . PHE B 2 22  ? 79.920  -54.168 -89.416 1.00   64.64 ? 34   PHE B O     1 
ATOM   6384 C  CB    . PHE B 2 22  ? 78.041  -55.674 -91.235 1.00   59.57 ? 34   PHE B CB    1 
ATOM   6385 C  CG    . PHE B 2 22  ? 77.187  -56.023 -92.413 1.00   56.23 ? 34   PHE B CG    1 
ATOM   6386 C  CD1   . PHE B 2 22  ? 77.629  -55.774 -93.712 1.00   54.31 ? 34   PHE B CD1   1 
ATOM   6387 C  CD2   . PHE B 2 22  ? 75.926  -56.587 -92.227 1.00   54.32 ? 34   PHE B CD2   1 
ATOM   6388 C  CE1   . PHE B 2 22  ? 76.826  -56.078 -94.808 1.00   53.15 ? 34   PHE B CE1   1 
ATOM   6389 C  CE2   . PHE B 2 22  ? 75.115  -56.893 -93.310 1.00   52.80 ? 34   PHE B CE2   1 
ATOM   6390 C  CZ    . PHE B 2 22  ? 75.570  -56.636 -94.609 1.00   53.17 ? 34   PHE B CZ    1 
ATOM   6391 N  N     . VAL B 2 23  ? 77.908  -53.641 -88.550 1.00   63.47 ? 35   VAL B N     1 
ATOM   6392 C  CA    . VAL B 2 23  ? 78.424  -53.438 -87.203 1.00   63.15 ? 35   VAL B CA    1 
ATOM   6393 C  C     . VAL B 2 23  ? 78.465  -54.783 -86.484 1.00   63.19 ? 35   VAL B C     1 
ATOM   6394 O  O     . VAL B 2 23  ? 77.430  -55.411 -86.267 1.00   63.10 ? 35   VAL B O     1 
ATOM   6395 C  CB    . VAL B 2 23  ? 77.520  -52.473 -86.397 1.00   62.05 ? 35   VAL B CB    1 
ATOM   6396 C  CG1   . VAL B 2 23  ? 78.003  -52.388 -84.957 1.00   59.52 ? 35   VAL B CG1   1 
ATOM   6397 C  CG2   . VAL B 2 23  ? 77.518  -51.093 -87.038 1.00   59.49 ? 35   VAL B CG2   1 
ATOM   6398 N  N     . SER B 2 24  ? 79.666  -55.219 -86.125 1.00   63.35 ? 36   SER B N     1 
ATOM   6399 C  CA    . SER B 2 24  ? 79.840  -56.491 -85.424 1.00   65.53 ? 36   SER B CA    1 
ATOM   6400 C  C     . SER B 2 24  ? 80.282  -56.264 -83.980 1.00   67.95 ? 36   SER B C     1 
ATOM   6401 O  O     . SER B 2 24  ? 80.525  -55.134 -83.564 1.00   66.09 ? 36   SER B O     1 
ATOM   6402 C  CB    . SER B 2 24  ? 80.879  -57.364 -86.142 1.00   65.39 ? 36   SER B CB    1 
ATOM   6403 O  OG    . SER B 2 24  ? 82.171  -56.771 -86.113 1.00   63.78 ? 36   SER B OG    1 
ATOM   6404 N  N     . LYS B 2 25  ? 80.380  -57.354 -83.229 1.00   71.25 ? 37   LYS B N     1 
ATOM   6405 C  CA    . LYS B 2 25  ? 80.794  -57.309 -81.832 1.00   72.44 ? 37   LYS B CA    1 
ATOM   6406 C  C     . LYS B 2 25  ? 82.130  -56.571 -81.726 1.00   73.56 ? 37   LYS B C     1 
ATOM   6407 O  O     . LYS B 2 25  ? 82.298  -55.677 -80.898 1.00   69.10 ? 37   LYS B O     1 
ATOM   6408 C  CB    . LYS B 2 25  ? 80.922  -58.739 -81.300 1.00   74.41 ? 37   LYS B CB    1 
ATOM   6409 C  CG    . LYS B 2 25  ? 80.936  -58.869 -79.782 1.00   84.23 ? 37   LYS B CG    1 
ATOM   6410 C  CD    . LYS B 2 25  ? 80.851  -60.338 -79.335 1.00   89.23 ? 37   LYS B CD    1 
ATOM   6411 C  CE    . LYS B 2 25  ? 79.539  -60.981 -79.771 1.00   91.52 ? 37   LYS B CE    1 
ATOM   6412 N  NZ    . LYS B 2 25  ? 79.458  -62.450 -79.493 1.00   92.24 ? 37   LYS B NZ    1 
ATOM   6413 N  N     . GLU B 2 26  ? 83.069  -56.950 -82.583 1.00   75.17 ? 38   GLU B N     1 
ATOM   6414 C  CA    . GLU B 2 26  ? 84.390  -56.338 -82.616 1.00   76.28 ? 38   GLU B CA    1 
ATOM   6415 C  C     . GLU B 2 26  ? 84.318  -54.880 -83.037 1.00   76.63 ? 38   GLU B C     1 
ATOM   6416 O  O     . GLU B 2 26  ? 85.122  -54.062 -82.594 1.00   74.89 ? 38   GLU B O     1 
ATOM   6417 C  CB    . GLU B 2 26  ? 85.294  -57.115 -83.574 1.00   80.65 ? 38   GLU B CB    1 
ATOM   6418 C  CG    . GLU B 2 26  ? 85.570  -58.535 -83.098 1.00   92.37 ? 38   GLU B CG    1 
ATOM   6419 C  CD    . GLU B 2 26  ? 84.293  -59.286 -82.741 1.00   97.36 ? 38   GLU B CD    1 
ATOM   6420 O  OE1   . GLU B 2 26  ? 83.454  -59.503 -83.647 1.00   98.89 ? 38   GLU B OE1   1 
ATOM   6421 O  OE2   . GLU B 2 26  ? 84.127  -59.644 -81.550 1.00   99.07 ? 38   GLU B OE2   1 
ATOM   6422 N  N     . ASP B 2 27  ? 83.358  -54.551 -83.896 1.00   77.15 ? 39   ASP B N     1 
ATOM   6423 C  CA    . ASP B 2 27  ? 83.192  -53.172 -84.347 1.00   75.07 ? 39   ASP B CA    1 
ATOM   6424 C  C     . ASP B 2 27  ? 82.849  -52.279 -83.161 1.00   72.17 ? 39   ASP B C     1 
ATOM   6425 O  O     . ASP B 2 27  ? 83.358  -51.165 -83.032 1.00   71.51 ? 39   ASP B O     1 
ATOM   6426 C  CB    . ASP B 2 27  ? 82.066  -53.077 -85.375 1.00   78.73 ? 39   ASP B CB    1 
ATOM   6427 C  CG    . ASP B 2 27  ? 82.483  -53.557 -86.742 1.00   84.67 ? 39   ASP B CG    1 
ATOM   6428 O  OD1   . ASP B 2 27  ? 83.420  -52.957 -87.309 1.00   88.03 ? 39   ASP B OD1   1 
ATOM   6429 O  OD2   . ASP B 2 27  ? 81.873  -54.525 -87.245 1.00   87.86 ? 39   ASP B OD2   1 
ATOM   6430 N  N     . ILE B 2 28  ? 81.973  -52.790 -82.297 1.00   69.76 ? 40   ILE B N     1 
ATOM   6431 C  CA    . ILE B 2 28  ? 81.525  -52.073 -81.110 1.00   68.97 ? 40   ILE B CA    1 
ATOM   6432 C  C     . ILE B 2 28  ? 82.604  -52.060 -80.028 1.00   70.52 ? 40   ILE B C     1 
ATOM   6433 O  O     . ILE B 2 28  ? 82.915  -51.014 -79.460 1.00   72.09 ? 40   ILE B O     1 
ATOM   6434 C  CB    . ILE B 2 28  ? 80.264  -52.731 -80.521 1.00   63.26 ? 40   ILE B CB    1 
ATOM   6435 C  CG1   . ILE B 2 28  ? 79.134  -52.705 -81.543 1.00   56.97 ? 40   ILE B CG1   1 
ATOM   6436 C  CG2   . ILE B 2 28  ? 79.839  -51.996 -79.258 1.00   59.49 ? 40   ILE B CG2   1 
ATOM   6437 C  CD1   . ILE B 2 28  ? 77.955  -53.527 -81.140 1.00   53.29 ? 40   ILE B CD1   1 
ATOM   6438 N  N     . LYS B 2 29  ? 83.168  -53.232 -79.754 1.00   74.58 ? 41   LYS B N     1 
ATOM   6439 C  CA    . LYS B 2 29  ? 84.204  -53.367 -78.736 1.00   78.76 ? 41   LYS B CA    1 
ATOM   6440 C  C     . LYS B 2 29  ? 85.403  -52.476 -79.012 1.00   78.88 ? 41   LYS B C     1 
ATOM   6441 O  O     . LYS B 2 29  ? 86.101  -52.061 -78.089 1.00   79.07 ? 41   LYS B O     1 
ATOM   6442 C  CB    . LYS B 2 29  ? 84.665  -54.824 -78.649 1.00   83.20 ? 41   LYS B CB    1 
ATOM   6443 C  CG    . LYS B 2 29  ? 85.539  -55.119 -77.440 1.00   89.04 ? 41   LYS B CG    1 
ATOM   6444 C  CD    . LYS B 2 29  ? 85.695  -56.620 -77.219 1.00   91.61 ? 41   LYS B CD    1 
ATOM   6445 C  CE    . LYS B 2 29  ? 86.306  -56.915 -75.854 1.00   92.28 ? 41   LYS B CE    1 
ATOM   6446 N  NZ    . LYS B 2 29  ? 87.607  -56.205 -75.646 1.00   92.31 ? 41   LYS B NZ    1 
ATOM   6447 N  N     . ALA B 2 30  ? 85.640  -52.180 -80.284 1.00   77.02 ? 42   ALA B N     1 
ATOM   6448 C  CA    . ALA B 2 30  ? 86.766  -51.346 -80.672 1.00   73.60 ? 42   ALA B CA    1 
ATOM   6449 C  C     . ALA B 2 30  ? 86.457  -49.859 -80.593 1.00   71.23 ? 42   ALA B C     1 
ATOM   6450 O  O     . ALA B 2 30  ? 87.267  -49.081 -80.090 1.00   69.68 ? 42   ALA B O     1 
ATOM   6451 C  CB    . ALA B 2 30  ? 87.220  -51.708 -82.079 1.00   72.48 ? 42   ALA B CB    1 
ATOM   6452 N  N     . ILE B 2 31  ? 85.292  -49.458 -81.088 1.00   68.93 ? 43   ILE B N     1 
ATOM   6453 C  CA    . ILE B 2 31  ? 84.913  -48.048 -81.056 1.00   68.70 ? 43   ILE B CA    1 
ATOM   6454 C  C     . ILE B 2 31  ? 84.600  -47.623 -79.632 1.00   70.93 ? 43   ILE B C     1 
ATOM   6455 O  O     . ILE B 2 31  ? 84.853  -46.481 -79.244 1.00   71.73 ? 43   ILE B O     1 
ATOM   6456 C  CB    . ILE B 2 31  ? 83.673  -47.770 -81.935 1.00   65.22 ? 43   ILE B CB    1 
ATOM   6457 C  CG1   . ILE B 2 31  ? 83.314  -46.284 -81.896 1.00   61.82 ? 43   ILE B CG1   1 
ATOM   6458 C  CG2   . ILE B 2 31  ? 82.501  -48.600 -81.448 1.00   62.73 ? 43   ILE B CG2   1 
ATOM   6459 C  CD1   . ILE B 2 31  ? 84.374  -45.369 -82.476 1.00   59.94 ? 43   ILE B CD1   1 
ATOM   6460 N  N     . SER B 2 32  ? 84.049  -48.543 -78.858 1.00   74.76 ? 44   SER B N     1 
ATOM   6461 C  CA    . SER B 2 32  ? 83.705  -48.246 -77.479 1.00   78.09 ? 44   SER B CA    1 
ATOM   6462 C  C     . SER B 2 32  ? 84.993  -47.963 -76.709 1.00   77.29 ? 44   SER B C     1 
ATOM   6463 O  O     . SER B 2 32  ? 85.172  -46.867 -76.182 1.00   78.45 ? 44   SER B O     1 
ATOM   6464 C  CB    . SER B 2 32  ? 82.948  -49.422 -76.860 1.00   81.78 ? 44   SER B CB    1 
ATOM   6465 O  OG    . SER B 2 32  ? 82.436  -49.078 -75.588 1.00   88.44 ? 44   SER B OG    1 
ATOM   6466 N  N     . GLU B 2 33  ? 85.891  -48.944 -76.651 1.00   74.77 ? 45   GLU B N     1 
ATOM   6467 C  CA    . GLU B 2 33  ? 87.165  -48.765 -75.961 1.00   72.81 ? 45   GLU B CA    1 
ATOM   6468 C  C     . GLU B 2 33  ? 87.915  -47.549 -76.518 1.00   73.27 ? 45   GLU B C     1 
ATOM   6469 O  O     . GLU B 2 33  ? 88.727  -46.939 -75.821 1.00   72.83 ? 45   GLU B O     1 
ATOM   6470 C  CB    . GLU B 2 33  ? 88.020  -50.015 -76.104 1.00   69.59 ? 45   GLU B CB    1 
ATOM   6471 N  N     . GLN B 2 34  ? 87.632  -47.198 -77.768 1.00   74.09 ? 46   GLN B N     1 
ATOM   6472 C  CA    . GLN B 2 34  ? 88.279  -46.061 -78.420 1.00   76.97 ? 46   GLN B CA    1 
ATOM   6473 C  C     . GLN B 2 34  ? 87.811  -44.727 -77.842 1.00   80.65 ? 46   GLN B C     1 
ATOM   6474 O  O     . GLN B 2 34  ? 88.616  -43.833 -77.585 1.00   78.07 ? 46   GLN B O     1 
ATOM   6475 C  CB    . GLN B 2 34  ? 88.008  -46.093 -79.930 1.00   77.50 ? 46   GLN B CB    1 
ATOM   6476 C  CG    . GLN B 2 34  ? 89.036  -45.341 -80.762 1.00   78.12 ? 46   GLN B CG    1 
ATOM   6477 C  CD    . GLN B 2 34  ? 88.583  -43.967 -81.156 1.00   78.95 ? 46   GLN B CD    1 
ATOM   6478 O  OE1   . GLN B 2 34  ? 88.110  -43.737 -82.281 1.00   78.83 ? 46   GLN B OE1   1 
ATOM   6479 N  NE2   . GLN B 2 34  ? 88.693  -42.973 -80.260 1.00   79.16 ? 46   GLN B NE2   1 
ATOM   6480 N  N     . LEU B 2 35  ? 86.500  -44.600 -77.638 1.00   84.11 ? 47   LEU B N     1 
ATOM   6481 C  CA    . LEU B 2 35  ? 85.920  -43.370 -77.099 1.00   85.22 ? 47   LEU B CA    1 
ATOM   6482 C  C     . LEU B 2 35  ? 85.802  -43.505 -75.612 1.00   85.51 ? 47   LEU B C     1 
ATOM   6483 O  O     . LEU B 2 35  ? 85.501  -42.573 -74.867 1.00   84.13 ? 47   LEU B O     1 
ATOM   6484 C  CB    . LEU B 2 35  ? 84.558  -43.115 -77.725 1.00   88.47 ? 47   LEU B CB    1 
ATOM   6485 C  CG    . LEU B 2 35  ? 84.718  -42.687 -79.204 1.00   94.16 ? 47   LEU B CG    1 
ATOM   6486 C  CD1   . LEU B 2 35  ? 83.385  -42.659 -79.921 1.00   97.71 ? 47   LEU B CD1   1 
ATOM   6487 C  CD2   . LEU B 2 35  ? 85.332  -41.300 -79.317 1.00   97.35 ? 47   LEU B CD2   1 
ATOM   6488 N  N     . GLY B 2 36  ? 86.064  -44.746 -75.230 1.00   84.46 ? 48   GLY B N     1 
ATOM   6489 C  CA    . GLY B 2 36  ? 86.093  -45.136 -73.865 1.00   85.53 ? 48   GLY B CA    1 
ATOM   6490 C  C     . GLY B 2 36  ? 84.863  -45.827 -73.390 1.00   87.00 ? 48   GLY B C     1 
ATOM   6491 O  O     . GLY B 2 36  ? 83.749  -45.716 -73.905 1.00   88.74 ? 48   GLY B O     1 
ATOM   6492 N  N     . ARG B 2 37  ? 85.154  -46.700 -72.424 1.00   88.38 ? 49   ARG B N     1 
ATOM   6493 C  CA    . ARG B 2 37  ? 84.216  -47.372 -71.540 1.00   86.17 ? 49   ARG B CA    1 
ATOM   6494 C  C     . ARG B 2 37  ? 83.517  -48.524 -72.248 1.00   83.26 ? 49   ARG B C     1 
ATOM   6495 O  O     . ARG B 2 37  ? 82.257  -48.567 -72.082 1.00   81.95 ? 49   ARG B O     1 
ATOM   6496 C  CB    . ARG B 2 37  ? 83.195  -46.384 -71.001 1.00   84.59 ? 49   ARG B CB    1 
ATOM   6497 N  N     . ALA B 2 38  ? 84.117  -49.550 -72.791 1.00   79.37 ? 50   ALA B N     1 
ATOM   6498 C  CA    . ALA B 2 38  ? 83.349  -50.609 -73.463 1.00   77.94 ? 50   ALA B CA    1 
ATOM   6499 C  C     . ALA B 2 38  ? 82.470  -51.537 -72.648 1.00   78.50 ? 50   ALA B C     1 
ATOM   6500 O  O     . ALA B 2 38  ? 82.725  -51.771 -71.467 1.00   79.00 ? 50   ALA B O     1 
ATOM   6501 C  CB    . ALA B 2 38  ? 84.290  -51.476 -74.277 1.00   79.28 ? 50   ALA B CB    1 
ATOM   6502 N  N     . PRO B 2 39  ? 81.434  -52.108 -73.282 1.00   75.99 ? 51   PRO B N     1 
ATOM   6503 C  CA    . PRO B 2 39  ? 80.527  -53.045 -72.611 1.00   76.58 ? 51   PRO B CA    1 
ATOM   6504 C  C     . PRO B 2 39  ? 81.207  -54.387 -72.296 1.00   76.54 ? 51   PRO B C     1 
ATOM   6505 O  O     . PRO B 2 39  ? 82.258  -54.718 -72.845 1.00   76.98 ? 51   PRO B O     1 
ATOM   6506 C  CB    . PRO B 2 39  ? 79.395  -53.224 -73.621 1.00   75.68 ? 51   PRO B CB    1 
ATOM   6507 C  CG    . PRO B 2 39  ? 79.370  -51.913 -74.332 1.00   73.85 ? 51   PRO B CG    1 
ATOM   6508 C  CD    . PRO B 2 39  ? 80.834  -51.648 -74.556 1.00   75.80 ? 51   PRO B CD    1 
ATOM   6509 N  N     . ASP B 2 40  ? 80.579  -55.143 -71.402 1.00   77.41 ? 52   ASP B N     1 
ATOM   6510 C  CA    . ASP B 2 40  ? 81.071  -56.454 -71.002 1.00   80.63 ? 52   ASP B CA    1 
ATOM   6511 C  C     . ASP B 2 40  ? 80.848  -57.372 -72.193 1.00   83.42 ? 52   ASP B C     1 
ATOM   6512 O  O     . ASP B 2 40  ? 79.890  -57.191 -72.946 1.00   87.39 ? 52   ASP B O     1 
ATOM   6513 C  CB    . ASP B 2 40  ? 80.287  -56.956 -69.788 1.00   80.44 ? 52   ASP B CB    1 
ATOM   6514 N  N     . ASP B 2 41  ? 81.726  -58.349 -72.378 1.00   87.15 ? 53   ASP B N     1 
ATOM   6515 C  CA    . ASP B 2 41  ? 81.596  -59.267 -73.504 1.00   88.61 ? 53   ASP B CA    1 
ATOM   6516 C  C     . ASP B 2 41  ? 80.188  -59.845 -73.645 1.00   87.65 ? 53   ASP B C     1 
ATOM   6517 O  O     . ASP B 2 41  ? 79.825  -60.338 -74.713 1.00   89.14 ? 53   ASP B O     1 
ATOM   6518 C  CB    . ASP B 2 41  ? 82.612  -60.391 -73.376 1.00   92.16 ? 53   ASP B CB    1 
ATOM   6519 N  N     . LYS B 2 42  ? 79.395  -59.792 -72.579 1.00   83.58 ? 54   LYS B N     1 
ATOM   6520 C  CA    . LYS B 2 42  ? 78.034  -60.321 -72.634 1.00   80.96 ? 54   LYS B CA    1 
ATOM   6521 C  C     . LYS B 2 42  ? 77.049  -59.221 -73.015 1.00   80.72 ? 54   LYS B C     1 
ATOM   6522 O  O     . LYS B 2 42  ? 75.983  -59.488 -73.573 1.00   79.23 ? 54   LYS B O     1 
ATOM   6523 C  CB    . LYS B 2 42  ? 77.642  -60.937 -71.288 1.00   77.96 ? 54   LYS B CB    1 
ATOM   6524 N  N     . GLU B 2 43  ? 77.416  -57.984 -72.702 1.00   79.18 ? 55   GLU B N     1 
ATOM   6525 C  CA    . GLU B 2 43  ? 76.587  -56.822 -73.001 1.00   78.25 ? 55   GLU B CA    1 
ATOM   6526 C  C     . GLU B 2 43  ? 76.616  -56.487 -74.494 1.00   75.91 ? 55   GLU B C     1 
ATOM   6527 O  O     . GLU B 2 43  ? 75.661  -55.932 -75.033 1.00   71.35 ? 55   GLU B O     1 
ATOM   6528 C  CB    . GLU B 2 43  ? 77.061  -55.625 -72.172 1.00   83.48 ? 55   GLU B CB    1 
ATOM   6529 C  CG    . GLU B 2 43  ? 76.770  -55.776 -70.676 1.00   93.83 ? 55   GLU B CG    1 
ATOM   6530 C  CD    . GLU B 2 43  ? 77.453  -54.723 -69.800 1.00   97.92 ? 55   GLU B CD    1 
ATOM   6531 O  OE1   . GLU B 2 43  ? 76.992  -54.525 -68.655 1.00   99.21 ? 55   GLU B OE1   1 
ATOM   6532 O  OE2   . GLU B 2 43  ? 78.448  -54.104 -70.242 1.00   99.25 ? 55   GLU B OE2   1 
ATOM   6533 N  N     . LEU B 2 44  ? 77.721  -56.832 -75.150 1.00   70.59 ? 56   LEU B N     1 
ATOM   6534 C  CA    . LEU B 2 44  ? 77.885  -56.584 -76.573 1.00   64.26 ? 56   LEU B CA    1 
ATOM   6535 C  C     . LEU B 2 44  ? 76.953  -57.509 -77.341 1.00   64.01 ? 56   LEU B C     1 
ATOM   6536 O  O     . LEU B 2 44  ? 76.359  -57.126 -78.347 1.00   59.52 ? 56   LEU B O     1 
ATOM   6537 C  CB    . LEU B 2 44  ? 79.323  -56.852 -76.987 1.00   60.27 ? 56   LEU B CB    1 
ATOM   6538 C  CG    . LEU B 2 44  ? 80.381  -55.933 -76.382 1.00   58.93 ? 56   LEU B CG    1 
ATOM   6539 C  CD1   . LEU B 2 44  ? 81.762  -56.439 -76.771 1.00   59.45 ? 56   LEU B CD1   1 
ATOM   6540 C  CD2   . LEU B 2 44  ? 80.169  -54.507 -76.863 1.00   58.93 ? 56   LEU B CD2   1 
ATOM   6541 N  N     . THR B 2 45  ? 76.832  -58.735 -76.845 1.00   65.97 ? 57   THR B N     1 
ATOM   6542 C  CA    . THR B 2 45  ? 75.974  -59.734 -77.459 1.00   69.08 ? 57   THR B CA    1 
ATOM   6543 C  C     . THR B 2 45  ? 74.523  -59.283 -77.434 1.00   68.13 ? 57   THR B C     1 
ATOM   6544 O  O     . THR B 2 45  ? 73.779  -59.504 -78.388 1.00   70.26 ? 57   THR B O     1 
ATOM   6545 C  CB    . THR B 2 45  ? 76.119  -61.084 -76.730 1.00   73.46 ? 57   THR B CB    1 
ATOM   6546 O  OG1   . THR B 2 45  ? 77.434  -61.600 -76.972 1.00   80.20 ? 57   THR B OG1   1 
ATOM   6547 C  CG2   . THR B 2 45  ? 75.079  -62.094 -77.215 1.00   79.55 ? 57   THR B CG2   1 
ATOM   6548 N  N     . ALA B 2 46  ? 74.122  -58.645 -76.342 1.00   66.76 ? 58   ALA B N     1 
ATOM   6549 C  CA    . ALA B 2 46  ? 72.751  -58.169 -76.214 1.00   63.69 ? 58   ALA B CA    1 
ATOM   6550 C  C     . ALA B 2 46  ? 72.462  -57.079 -77.237 1.00   62.27 ? 58   ALA B C     1 
ATOM   6551 O  O     . ALA B 2 46  ? 71.437  -57.118 -77.921 1.00   60.68 ? 58   ALA B O     1 
ATOM   6552 C  CB    . ALA B 2 46  ? 72.508  -57.645 -74.810 1.00   63.11 ? 58   ALA B CB    1 
ATOM   6553 N  N     . MET B 2 47  ? 73.366  -56.110 -77.342 1.00   59.81 ? 59   MET B N     1 
ATOM   6554 C  CA    . MET B 2 47  ? 73.187  -55.020 -78.290 1.00   58.24 ? 59   MET B CA    1 
ATOM   6555 C  C     . MET B 2 47  ? 72.971  -55.527 -79.715 1.00   58.41 ? 59   MET B C     1 
ATOM   6556 O  O     . MET B 2 47  ? 72.202  -54.937 -80.473 1.00   57.81 ? 59   MET B O     1 
ATOM   6557 C  CB    . MET B 2 47  ? 74.400  -54.102 -78.277 1.00   56.67 ? 59   MET B CB    1 
ATOM   6558 C  CG    . MET B 2 47  ? 74.569  -53.312 -77.024 1.00   55.05 ? 59   MET B CG    1 
ATOM   6559 S  SD    . MET B 2 47  ? 76.142  -52.493 -77.044 1.00   55.31 ? 59   MET B SD    1 
ATOM   6560 C  CE    . MET B 2 47  ? 75.892  -51.281 -78.317 1.00   54.57 ? 59   MET B CE    1 
ATOM   6561 N  N     . LEU B 2 48  ? 73.648  -56.616 -80.076 1.00   58.61 ? 60   LEU B N     1 
ATOM   6562 C  CA    . LEU B 2 48  ? 73.521  -57.182 -81.420 1.00   60.91 ? 60   LEU B CA    1 
ATOM   6563 C  C     . LEU B 2 48  ? 72.307  -58.092 -81.534 1.00   64.66 ? 60   LEU B C     1 
ATOM   6564 O  O     . LEU B 2 48  ? 71.632  -58.109 -82.565 1.00   63.48 ? 60   LEU B O     1 
ATOM   6565 C  CB    . LEU B 2 48  ? 74.787  -57.959 -81.799 1.00   58.98 ? 60   LEU B CB    1 
ATOM   6566 C  CG    . LEU B 2 48  ? 76.069  -57.123 -81.895 1.00   57.74 ? 60   LEU B CG    1 
ATOM   6567 C  CD1   . LEU B 2 48  ? 77.276  -58.041 -81.857 1.00   56.50 ? 60   LEU B CD1   1 
ATOM   6568 C  CD2   . LEU B 2 48  ? 76.047  -56.281 -83.160 1.00   55.80 ? 60   LEU B CD2   1 
ATOM   6569 N  N     . LYS B 2 49  ? 72.029  -58.843 -80.476 1.00   69.65 ? 61   LYS B N     1 
ATOM   6570 C  CA    . LYS B 2 49  ? 70.878  -59.741 -80.467 1.00   72.87 ? 61   LYS B CA    1 
ATOM   6571 C  C     . LYS B 2 49  ? 69.580  -58.952 -80.664 1.00   73.54 ? 61   LYS B C     1 
ATOM   6572 O  O     . LYS B 2 49  ? 68.562  -59.508 -81.068 1.00   69.99 ? 61   LYS B O     1 
ATOM   6573 C  CB    . LYS B 2 49  ? 70.822  -60.519 -79.147 1.00   77.58 ? 61   LYS B CB    1 
ATOM   6574 C  CG    . LYS B 2 49  ? 69.615  -61.441 -79.022 1.00   89.69 ? 61   LYS B CG    1 
ATOM   6575 C  CD    . LYS B 2 49  ? 69.536  -62.087 -77.640 1.00   95.88 ? 61   LYS B CD    1 
ATOM   6576 C  CE    . LYS B 2 49  ? 68.336  -63.019 -77.516 1.00   98.10 ? 61   LYS B CE    1 
ATOM   6577 N  NZ    . LYS B 2 49  ? 68.197  -63.542 -76.121 1.00   99.12 ? 61   LYS B NZ    1 
ATOM   6578 N  N     . GLU B 2 50  ? 69.629  -57.654 -80.379 1.00   75.54 ? 62   GLU B N     1 
ATOM   6579 C  CA    . GLU B 2 50  ? 68.470  -56.781 -80.529 1.00   74.95 ? 62   GLU B CA    1 
ATOM   6580 C  C     . GLU B 2 50  ? 68.162  -56.568 -82.006 1.00   74.70 ? 62   GLU B C     1 
ATOM   6581 O  O     . GLU B 2 50  ? 67.159  -55.956 -82.367 1.00   76.11 ? 62   GLU B O     1 
ATOM   6582 C  CB    . GLU B 2 50  ? 68.740  -55.431 -79.861 1.00   74.90 ? 62   GLU B CB    1 
ATOM   6583 C  CG    . GLU B 2 50  ? 68.674  -55.444 -78.331 1.00   77.07 ? 62   GLU B CG    1 
ATOM   6584 C  CD    . GLU B 2 50  ? 69.126  -54.123 -77.720 1.00   78.10 ? 62   GLU B CD    1 
ATOM   6585 O  OE1   . GLU B 2 50  ? 68.770  -53.054 -78.264 1.00   78.68 ? 62   GLU B OE1   1 
ATOM   6586 O  OE2   . GLU B 2 50  ? 69.831  -54.154 -76.691 1.00   79.12 ? 62   GLU B OE2   1 
ATOM   6587 N  N     . ALA B 2 51  ? 69.045  -57.085 -82.853 1.00   78.03 ? 63   ALA B N     1 
ATOM   6588 C  CA    . ALA B 2 51  ? 68.899  -56.969 -84.297 1.00   82.43 ? 63   ALA B CA    1 
ATOM   6589 C  C     . ALA B 2 51  ? 69.029  -58.344 -84.955 1.00   86.63 ? 63   ALA B C     1 
ATOM   6590 O  O     . ALA B 2 51  ? 70.101  -58.710 -85.437 1.00   89.31 ? 63   ALA B O     1 
ATOM   6591 C  CB    . ALA B 2 51  ? 69.958  -56.025 -84.844 1.00   83.88 ? 63   ALA B CB    1 
ATOM   6592 N  N     . PRO B 2 52  ? 67.938  -59.126 -84.970 1.00   88.23 ? 64   PRO B N     1 
ATOM   6593 C  CA    . PRO B 2 52  ? 67.908  -60.466 -85.568 1.00   89.39 ? 64   PRO B CA    1 
ATOM   6594 C  C     . PRO B 2 52  ? 68.229  -60.446 -87.063 1.00   87.97 ? 64   PRO B C     1 
ATOM   6595 O  O     . PRO B 2 52  ? 67.338  -60.547 -87.906 1.00   85.77 ? 64   PRO B O     1 
ATOM   6596 C  CB    . PRO B 2 52  ? 66.484  -60.934 -85.285 1.00   91.06 ? 64   PRO B CB    1 
ATOM   6597 C  CG    . PRO B 2 52  ? 66.180  -60.271 -83.978 1.00   93.21 ? 64   PRO B CG    1 
ATOM   6598 C  CD    . PRO B 2 52  ? 66.704  -58.873 -84.205 1.00   91.91 ? 64   PRO B CD    1 
ATOM   6599 N  N     . GLY B 2 53  ? 69.514  -60.317 -87.373 1.00   83.38 ? 65   GLY B N     1 
ATOM   6600 C  CA    . GLY B 2 53  ? 69.971  -60.273 -88.746 1.00   78.26 ? 65   GLY B CA    1 
ATOM   6601 C  C     . GLY B 2 53  ? 71.213  -59.410 -88.803 1.00   75.47 ? 65   GLY B C     1 
ATOM   6602 O  O     . GLY B 2 53  ? 71.322  -58.452 -88.037 1.00   74.53 ? 65   GLY B O     1 
ATOM   6603 N  N     . PRO B 2 54  ? 72.177  -59.726 -89.684 1.00   70.49 ? 66   PRO B N     1 
ATOM   6604 C  CA    . PRO B 2 54  ? 73.403  -58.925 -89.790 1.00   68.76 ? 66   PRO B CA    1 
ATOM   6605 C  C     . PRO B 2 54  ? 73.049  -57.458 -89.659 1.00   66.79 ? 66   PRO B C     1 
ATOM   6606 O  O     . PRO B 2 54  ? 72.070  -56.988 -90.247 1.00   64.73 ? 66   PRO B O     1 
ATOM   6607 C  CB    . PRO B 2 54  ? 73.926  -59.290 -91.168 1.00   68.89 ? 66   PRO B CB    1 
ATOM   6608 C  CG    . PRO B 2 54  ? 73.566  -60.744 -91.257 1.00   70.56 ? 66   PRO B CG    1 
ATOM   6609 C  CD    . PRO B 2 54  ? 72.150  -60.790 -90.704 1.00   71.56 ? 66   PRO B CD    1 
ATOM   6610 N  N     . LEU B 2 55  ? 73.844  -56.731 -88.893 1.00   62.95 ? 67   LEU B N     1 
ATOM   6611 C  CA    . LEU B 2 55  ? 73.562  -55.329 -88.650 1.00   58.97 ? 67   LEU B CA    1 
ATOM   6612 C  C     . LEU B 2 55  ? 74.093  -54.303 -89.644 1.00   56.97 ? 67   LEU B C     1 
ATOM   6613 O  O     . LEU B 2 55  ? 75.220  -53.812 -89.510 1.00   53.51 ? 67   LEU B O     1 
ATOM   6614 C  CB    . LEU B 2 55  ? 74.011  -54.957 -87.232 1.00   60.47 ? 67   LEU B CB    1 
ATOM   6615 C  CG    . LEU B 2 55  ? 73.891  -53.476 -86.862 1.00   62.92 ? 67   LEU B CG    1 
ATOM   6616 C  CD1   . LEU B 2 55  ? 72.450  -53.031 -86.998 1.00   64.56 ? 67   LEU B CD1   1 
ATOM   6617 C  CD2   . LEU B 2 55  ? 74.389  -53.261 -85.459 1.00   64.77 ? 67   LEU B CD2   1 
ATOM   6618 N  N     . ASN B 2 56  ? 73.265  -53.984 -90.634 1.00   54.15 ? 68   ASN B N     1 
ATOM   6619 C  CA    . ASN B 2 56  ? 73.599  -52.964 -91.633 1.00   53.43 ? 68   ASN B CA    1 
ATOM   6620 C  C     . ASN B 2 56  ? 72.845  -51.695 -91.259 1.00   55.69 ? 68   ASN B C     1 
ATOM   6621 O  O     . ASN B 2 56  ? 72.038  -51.705 -90.323 1.00   54.64 ? 68   ASN B O     1 
ATOM   6622 C  CB    . ASN B 2 56  ? 73.200  -53.408 -93.052 1.00   49.78 ? 68   ASN B CB    1 
ATOM   6623 C  CG    . ASN B 2 56  ? 71.770  -53.957 -93.143 1.00   47.06 ? 68   ASN B CG    1 
ATOM   6624 O  OD1   . ASN B 2 56  ? 71.418  -54.589 -94.131 1.00   45.75 ? 68   ASN B OD1   1 
ATOM   6625 N  ND2   . ASN B 2 56  ? 70.954  -53.725 -92.119 1.00   45.86 ? 68   ASN B ND2   1 
ATOM   6626 N  N     . PHE B 2 57  ? 73.087  -50.607 -91.982 1.00   60.86 ? 69   PHE B N     1 
ATOM   6627 C  CA    . PHE B 2 57  ? 72.407  -49.355 -91.672 1.00   65.57 ? 69   PHE B CA    1 
ATOM   6628 C  C     . PHE B 2 57  ? 70.892  -49.488 -91.583 1.00   64.73 ? 69   PHE B C     1 
ATOM   6629 O  O     . PHE B 2 57  ? 70.253  -48.754 -90.832 1.00   67.01 ? 69   PHE B O     1 
ATOM   6630 C  CB    . PHE B 2 57  ? 72.745  -48.272 -92.692 1.00   71.89 ? 69   PHE B CB    1 
ATOM   6631 C  CG    . PHE B 2 57  ? 72.215  -46.915 -92.320 1.00   80.30 ? 69   PHE B CG    1 
ATOM   6632 C  CD1   . PHE B 2 57  ? 72.611  -46.303 -91.131 1.00   83.53 ? 69   PHE B CD1   1 
ATOM   6633 C  CD2   . PHE B 2 57  ? 71.312  -46.251 -93.141 1.00   83.40 ? 69   PHE B CD2   1 
ATOM   6634 C  CE1   . PHE B 2 57  ? 72.120  -45.044 -90.766 1.00   84.71 ? 69   PHE B CE1   1 
ATOM   6635 C  CE2   . PHE B 2 57  ? 70.813  -44.992 -92.787 1.00   84.85 ? 69   PHE B CE2   1 
ATOM   6636 C  CZ    . PHE B 2 57  ? 71.219  -44.390 -91.593 1.00   85.30 ? 69   PHE B CZ    1 
ATOM   6637 N  N     . THR B 2 58  ? 70.315  -50.416 -92.330 1.00   62.64 ? 70   THR B N     1 
ATOM   6638 C  CA    . THR B 2 58  ? 68.872  -50.571 -92.280 1.00   61.37 ? 70   THR B CA    1 
ATOM   6639 C  C     . THR B 2 58  ? 68.415  -51.117 -90.942 1.00   61.95 ? 70   THR B C     1 
ATOM   6640 O  O     . THR B 2 58  ? 67.447  -50.619 -90.363 1.00   59.01 ? 70   THR B O     1 
ATOM   6641 C  CB    . THR B 2 58  ? 68.356  -51.472 -93.415 1.00   59.43 ? 70   THR B CB    1 
ATOM   6642 O  OG1   . THR B 2 58  ? 68.481  -50.766 -94.653 1.00   58.57 ? 70   THR B OG1   1 
ATOM   6643 C  CG2   . THR B 2 58  ? 66.890  -51.831 -93.201 1.00   56.88 ? 70   THR B CG2   1 
ATOM   6644 N  N     . MET B 2 59  ? 69.097  -52.143 -90.448 1.00   62.06 ? 71   MET B N     1 
ATOM   6645 C  CA    . MET B 2 59  ? 68.737  -52.709 -89.163 1.00   60.86 ? 71   MET B CA    1 
ATOM   6646 C  C     . MET B 2 59  ? 69.048  -51.664 -88.073 1.00   58.55 ? 71   MET B C     1 
ATOM   6647 O  O     . MET B 2 59  ? 68.341  -51.572 -87.073 1.00   55.88 ? 71   MET B O     1 
ATOM   6648 C  CB    . MET B 2 59  ? 69.520  -53.998 -88.922 1.00   64.85 ? 71   MET B CB    1 
ATOM   6649 C  CG    . MET B 2 59  ? 69.147  -54.724 -87.639 1.00   75.23 ? 71   MET B CG    1 
ATOM   6650 S  SD    . MET B 2 59  ? 67.410  -55.228 -87.546 1.00   81.09 ? 71   MET B SD    1 
ATOM   6651 C  CE    . MET B 2 59  ? 67.538  -57.055 -87.547 1.00   82.80 ? 71   MET B CE    1 
ATOM   6652 N  N     . PHE B 2 60  ? 70.096  -50.881 -88.295 1.00   55.80 ? 72   PHE B N     1 
ATOM   6653 C  CA    . PHE B 2 60  ? 70.519  -49.832 -87.378 1.00   54.58 ? 72   PHE B CA    1 
ATOM   6654 C  C     . PHE B 2 60  ? 69.367  -48.847 -87.125 1.00   55.60 ? 72   PHE B C     1 
ATOM   6655 O  O     . PHE B 2 60  ? 68.942  -48.666 -85.989 1.00   56.03 ? 72   PHE B O     1 
ATOM   6656 C  CB    . PHE B 2 60  ? 71.716  -49.080 -87.969 1.00   52.48 ? 72   PHE B CB    1 
ATOM   6657 C  CG    . PHE B 2 60  ? 72.426  -48.188 -86.985 1.00   50.55 ? 72   PHE B CG    1 
ATOM   6658 C  CD1   . PHE B 2 60  ? 73.202  -48.731 -85.960 1.00   49.87 ? 72   PHE B CD1   1 
ATOM   6659 C  CD2   . PHE B 2 60  ? 72.320  -46.803 -87.083 1.00   50.02 ? 72   PHE B CD2   1 
ATOM   6660 C  CE1   . PHE B 2 60  ? 73.873  -47.912 -85.044 1.00   49.13 ? 72   PHE B CE1   1 
ATOM   6661 C  CE2   . PHE B 2 60  ? 72.980  -45.966 -86.179 1.00   50.69 ? 72   PHE B CE2   1 
ATOM   6662 C  CZ    . PHE B 2 60  ? 73.765  -46.523 -85.144 1.00   49.70 ? 72   PHE B CZ    1 
ATOM   6663 N  N     . LEU B 2 61  ? 68.875  -48.207 -88.191 1.00   58.24 ? 73   LEU B N     1 
ATOM   6664 C  CA    . LEU B 2 61  ? 67.771  -47.256 -88.075 1.00   59.90 ? 73   LEU B CA    1 
ATOM   6665 C  C     . LEU B 2 61  ? 66.567  -47.949 -87.476 1.00   59.80 ? 73   LEU B C     1 
ATOM   6666 O  O     . LEU B 2 61  ? 65.848  -47.379 -86.659 1.00   60.68 ? 73   LEU B O     1 
ATOM   6667 C  CB    . LEU B 2 61  ? 67.380  -46.704 -89.446 1.00   61.52 ? 73   LEU B CB    1 
ATOM   6668 C  CG    . LEU B 2 61  ? 68.412  -45.863 -90.187 1.00   63.98 ? 73   LEU B CG    1 
ATOM   6669 C  CD1   . LEU B 2 61  ? 67.832  -45.432 -91.534 1.00   64.91 ? 73   LEU B CD1   1 
ATOM   6670 C  CD2   . LEU B 2 61  ? 68.790  -44.654 -89.356 1.00   64.43 ? 73   LEU B CD2   1 
ATOM   6671 N  N     . SER B 2 62  ? 66.355  -49.185 -87.887 1.00   59.59 ? 74   SER B N     1 
ATOM   6672 C  CA    . SER B 2 62  ? 65.234  -49.964 -87.393 1.00   59.29 ? 74   SER B CA    1 
ATOM   6673 C  C     . SER B 2 62  ? 65.180  -50.023 -85.869 1.00   59.70 ? 74   SER B C     1 
ATOM   6674 O  O     . SER B 2 62  ? 64.132  -49.762 -85.279 1.00   58.73 ? 74   SER B O     1 
ATOM   6675 C  CB    . SER B 2 62  ? 65.296  -51.376 -87.955 1.00   58.57 ? 74   SER B CB    1 
ATOM   6676 O  OG    . SER B 2 62  ? 64.397  -52.222 -87.276 1.00   58.77 ? 74   SER B OG    1 
ATOM   6677 N  N     . ILE B 2 63  ? 66.289  -50.367 -85.224 1.00   59.90 ? 75   ILE B N     1 
ATOM   6678 C  CA    . ILE B 2 63  ? 66.281  -50.448 -83.770 1.00   59.94 ? 75   ILE B CA    1 
ATOM   6679 C  C     . ILE B 2 63  ? 66.091  -49.064 -83.148 1.00   60.02 ? 75   ILE B C     1 
ATOM   6680 O  O     . ILE B 2 63  ? 65.362  -48.922 -82.161 1.00   58.84 ? 75   ILE B O     1 
ATOM   6681 C  CB    . ILE B 2 63  ? 67.571  -51.103 -83.219 1.00   61.61 ? 75   ILE B CB    1 
ATOM   6682 C  CG1   . ILE B 2 63  ? 68.802  -50.371 -83.757 1.00   63.68 ? 75   ILE B CG1   1 
ATOM   6683 C  CG2   . ILE B 2 63  ? 67.599  -52.590 -83.599 1.00   62.22 ? 75   ILE B CG2   1 
ATOM   6684 C  CD1   . ILE B 2 63  ? 70.078  -50.658 -82.989 1.00   65.02 ? 75   ILE B CD1   1 
ATOM   6685 N  N     . PHE B 2 64  ? 66.731  -48.050 -83.724 1.00   59.55 ? 76   PHE B N     1 
ATOM   6686 C  CA    . PHE B 2 64  ? 66.584  -46.689 -83.222 1.00   59.85 ? 76   PHE B CA    1 
ATOM   6687 C  C     . PHE B 2 64  ? 65.190  -46.145 -83.491 1.00   61.81 ? 76   PHE B C     1 
ATOM   6688 O  O     . PHE B 2 64  ? 64.543  -45.599 -82.595 1.00   59.88 ? 76   PHE B O     1 
ATOM   6689 C  CB    . PHE B 2 64  ? 67.607  -45.760 -83.861 1.00   60.59 ? 76   PHE B CB    1 
ATOM   6690 C  CG    . PHE B 2 64  ? 68.902  -45.680 -83.104 1.00   64.09 ? 76   PHE B CG    1 
ATOM   6691 C  CD1   . PHE B 2 64  ? 69.743  -46.792 -83.011 1.00   64.75 ? 76   PHE B CD1   1 
ATOM   6692 C  CD2   . PHE B 2 64  ? 69.280  -44.494 -82.471 1.00   64.46 ? 76   PHE B CD2   1 
ATOM   6693 C  CE1   . PHE B 2 64  ? 70.944  -46.725 -82.296 1.00   65.66 ? 76   PHE B CE1   1 
ATOM   6694 C  CE2   . PHE B 2 64  ? 70.477  -44.417 -81.756 1.00   65.49 ? 76   PHE B CE2   1 
ATOM   6695 C  CZ    . PHE B 2 64  ? 71.312  -45.535 -81.668 1.00   65.63 ? 76   PHE B CZ    1 
ATOM   6696 N  N     . SER B 2 65  ? 64.733  -46.293 -84.727 1.00   62.55 ? 77   SER B N     1 
ATOM   6697 C  CA    . SER B 2 65  ? 63.417  -45.823 -85.127 1.00   62.72 ? 77   SER B CA    1 
ATOM   6698 C  C     . SER B 2 65  ? 62.333  -46.338 -84.191 1.00   62.77 ? 77   SER B C     1 
ATOM   6699 O  O     . SER B 2 65  ? 61.464  -45.582 -83.752 1.00   59.35 ? 77   SER B O     1 
ATOM   6700 C  CB    . SER B 2 65  ? 63.122  -46.278 -86.560 1.00   64.70 ? 77   SER B CB    1 
ATOM   6701 O  OG    . SER B 2 65  ? 61.747  -46.148 -86.899 1.00   73.89 ? 77   SER B OG    1 
ATOM   6702 N  N     . ASP B 2 66  ? 62.395  -47.625 -83.890 1.00   62.03 ? 78   ASP B N     1 
ATOM   6703 C  CA    . ASP B 2 66  ? 61.424  -48.265 -83.030 1.00   60.79 ? 78   ASP B CA    1 
ATOM   6704 C  C     . ASP B 2 66  ? 61.608  -47.975 -81.560 1.00   60.00 ? 78   ASP B C     1 
ATOM   6705 O  O     . ASP B 2 66  ? 60.749  -48.313 -80.753 1.00   59.15 ? 78   ASP B O     1 
ATOM   6706 C  CB    . ASP B 2 66  ? 61.443  -49.766 -83.257 1.00   63.30 ? 78   ASP B CB    1 
ATOM   6707 C  CG    . ASP B 2 66  ? 60.641  -50.186 -84.491 1.00   69.49 ? 78   ASP B CG    1 
ATOM   6708 O  OD1   . ASP B 2 66  ? 60.750  -49.527 -85.559 1.00   71.14 ? 78   ASP B OD1   1 
ATOM   6709 O  OD2   . ASP B 2 66  ? 59.896  -51.190 -84.389 1.00   73.02 ? 78   ASP B OD2   1 
ATOM   6710 N  N     . LYS B 2 67  ? 62.735  -47.384 -81.195 1.00   59.67 ? 79   LYS B N     1 
ATOM   6711 C  CA    . LYS B 2 67  ? 62.979  -47.060 -79.797 1.00   58.85 ? 79   LYS B CA    1 
ATOM   6712 C  C     . LYS B 2 67  ? 62.381  -45.693 -79.493 1.00   58.61 ? 79   LYS B C     1 
ATOM   6713 O  O     . LYS B 2 67  ? 61.735  -45.501 -78.459 1.00   60.30 ? 79   LYS B O     1 
ATOM   6714 C  CB    . LYS B 2 67  ? 64.475  -47.022 -79.511 1.00   58.60 ? 79   LYS B CB    1 
ATOM   6715 C  CG    . LYS B 2 67  ? 64.824  -46.780 -78.053 1.00   57.43 ? 79   LYS B CG    1 
ATOM   6716 C  CD    . LYS B 2 67  ? 64.485  -47.994 -77.203 1.00   56.08 ? 79   LYS B CD    1 
ATOM   6717 C  CE    . LYS B 2 67  ? 65.127  -47.875 -75.837 1.00   56.49 ? 79   LYS B CE    1 
ATOM   6718 N  NZ    . LYS B 2 67  ? 64.963  -49.109 -75.033 1.00   56.56 ? 79   LYS B NZ    1 
ATOM   6719 N  N     . LEU B 2 68  ? 62.599  -44.753 -80.404 1.00   59.89 ? 80   LEU B N     1 
ATOM   6720 C  CA    . LEU B 2 68  ? 62.106  -43.388 -80.262 1.00   61.80 ? 80   LEU B CA    1 
ATOM   6721 C  C     . LEU B 2 68  ? 60.691  -43.258 -80.809 1.00   63.53 ? 80   LEU B C     1 
ATOM   6722 O  O     . LEU B 2 68  ? 60.258  -42.176 -81.211 1.00   66.93 ? 80   LEU B O     1 
ATOM   6723 C  CB    . LEU B 2 68  ? 63.035  -42.435 -81.006 1.00   58.57 ? 80   LEU B CB    1 
ATOM   6724 C  CG    . LEU B 2 68  ? 64.499  -42.707 -80.660 1.00   54.55 ? 80   LEU B CG    1 
ATOM   6725 C  CD1   . LEU B 2 68  ? 65.416  -41.869 -81.520 1.00   51.21 ? 80   LEU B CD1   1 
ATOM   6726 C  CD2   . LEU B 2 68  ? 64.720  -42.431 -79.198 1.00   50.85 ? 80   LEU B CD2   1 
ATOM   6727 N  N     . SER B 2 69  ? 59.974  -44.377 -80.823 1.00   66.83 ? 81   SER B N     1 
ATOM   6728 C  CA    . SER B 2 69  ? 58.604  -44.419 -81.314 1.00   70.00 ? 81   SER B CA    1 
ATOM   6729 C  C     . SER B 2 69  ? 57.613  -44.375 -80.152 1.00   70.97 ? 81   SER B C     1 
ATOM   6730 O  O     . SER B 2 69  ? 57.829  -45.016 -79.125 1.00   72.59 ? 81   SER B O     1 
ATOM   6731 C  CB    . SER B 2 69  ? 58.384  -45.706 -82.107 1.00   70.40 ? 81   SER B CB    1 
ATOM   6732 O  OG    . SER B 2 69  ? 57.023  -45.841 -82.479 1.00   67.53 ? 81   SER B OG    1 
ATOM   6733 N  N     . GLY B 2 70  ? 56.529  -43.623 -80.318 1.00   71.77 ? 82   GLY B N     1 
ATOM   6734 C  CA    . GLY B 2 70  ? 55.530  -43.553 -79.262 1.00   71.64 ? 82   GLY B CA    1 
ATOM   6735 C  C     . GLY B 2 70  ? 55.442  -42.215 -78.551 1.00   69.83 ? 82   GLY B C     1 
ATOM   6736 O  O     . GLY B 2 70  ? 54.351  -41.708 -78.301 1.00   71.12 ? 82   GLY B O     1 
ATOM   6737 N  N     . THR B 2 71  ? 56.597  -41.644 -78.234 1.00   65.85 ? 83   THR B N     1 
ATOM   6738 C  CA    . THR B 2 71  ? 56.677  -40.374 -77.541 1.00   63.19 ? 83   THR B CA    1 
ATOM   6739 C  C     . THR B 2 71  ? 55.870  -39.255 -78.200 1.00   63.79 ? 83   THR B C     1 
ATOM   6740 O  O     . THR B 2 71  ? 55.540  -39.323 -79.382 1.00   59.69 ? 83   THR B O     1 
ATOM   6741 C  CB    . THR B 2 71  ? 58.128  -39.914 -77.440 1.00   61.31 ? 83   THR B CB    1 
ATOM   6742 O  OG1   . THR B 2 71  ? 58.563  -39.433 -78.715 1.00   59.48 ? 83   THR B OG1   1 
ATOM   6743 C  CG2   . THR B 2 71  ? 58.997  -41.062 -77.010 1.00   58.92 ? 83   THR B CG2   1 
ATOM   6744 N  N     . ASP B 2 72  ? 55.566  -38.224 -77.407 1.00   62.37 ? 84   ASP B N     1 
ATOM   6745 C  CA    . ASP B 2 72  ? 54.807  -37.065 -77.868 1.00   60.58 ? 84   ASP B CA    1 
ATOM   6746 C  C     . ASP B 2 72  ? 55.770  -36.003 -78.389 1.00   59.16 ? 84   ASP B C     1 
ATOM   6747 O  O     . ASP B 2 72  ? 56.956  -36.017 -78.067 1.00   55.36 ? 84   ASP B O     1 
ATOM   6748 C  CB    . ASP B 2 72  ? 53.976  -36.479 -76.711 1.00   64.39 ? 84   ASP B CB    1 
ATOM   6749 C  CG    . ASP B 2 72  ? 52.895  -37.440 -76.200 1.00   71.09 ? 84   ASP B CG    1 
ATOM   6750 O  OD1   . ASP B 2 72  ? 51.829  -37.552 -76.849 1.00   75.14 ? 84   ASP B OD1   1 
ATOM   6751 O  OD2   . ASP B 2 72  ? 53.115  -38.083 -75.144 1.00   74.99 ? 84   ASP B OD2   1 
ATOM   6752 N  N     . SER B 2 73  ? 55.253  -35.083 -79.189 1.00   57.51 ? 85   SER B N     1 
ATOM   6753 C  CA    . SER B 2 73  ? 56.067  -34.013 -79.758 1.00   57.15 ? 85   SER B CA    1 
ATOM   6754 C  C     . SER B 2 73  ? 56.549  -33.053 -78.692 1.00   57.55 ? 85   SER B C     1 
ATOM   6755 O  O     . SER B 2 73  ? 56.167  -33.165 -77.527 1.00   56.95 ? 85   SER B O     1 
ATOM   6756 C  CB    . SER B 2 73  ? 55.255  -33.250 -80.800 1.00   58.39 ? 85   SER B CB    1 
ATOM   6757 O  OG    . SER B 2 73  ? 53.894  -33.163 -80.399 1.00   63.34 ? 85   SER B OG    1 
ATOM   6758 N  N     . GLU B 2 74  ? 57.378  -32.099 -79.088 1.00   58.32 ? 86   GLU B N     1 
ATOM   6759 C  CA    . GLU B 2 74  ? 57.885  -31.124 -78.147 1.00   58.18 ? 86   GLU B CA    1 
ATOM   6760 C  C     . GLU B 2 74  ? 56.783  -30.148 -77.742 1.00   59.32 ? 86   GLU B C     1 
ATOM   6761 O  O     . GLU B 2 74  ? 56.670  -29.786 -76.569 1.00   57.22 ? 86   GLU B O     1 
ATOM   6762 C  CB    . GLU B 2 74  ? 59.075  -30.361 -78.731 1.00   57.88 ? 86   GLU B CB    1 
ATOM   6763 C  CG    . GLU B 2 74  ? 59.838  -29.577 -77.677 1.00   62.73 ? 86   GLU B CG    1 
ATOM   6764 C  CD    . GLU B 2 74  ? 61.165  -29.005 -78.149 1.00   65.79 ? 86   GLU B CD    1 
ATOM   6765 O  OE1   . GLU B 2 74  ? 62.006  -29.774 -78.682 1.00   67.35 ? 86   GLU B OE1   1 
ATOM   6766 O  OE2   . GLU B 2 74  ? 61.376  -27.780 -77.966 1.00   67.31 ? 86   GLU B OE2   1 
ATOM   6767 N  N     . GLU B 2 75  ? 55.972  -29.722 -78.703 1.00   61.27 ? 87   GLU B N     1 
ATOM   6768 C  CA    . GLU B 2 75  ? 54.893  -28.791 -78.410 1.00   62.40 ? 87   GLU B CA    1 
ATOM   6769 C  C     . GLU B 2 75  ? 53.896  -29.405 -77.421 1.00   60.89 ? 87   GLU B C     1 
ATOM   6770 O  O     . GLU B 2 75  ? 53.476  -28.744 -76.469 1.00   59.10 ? 87   GLU B O     1 
ATOM   6771 C  CB    . GLU B 2 75  ? 54.165  -28.368 -79.694 1.00   67.55 ? 87   GLU B CB    1 
ATOM   6772 C  CG    . GLU B 2 75  ? 52.858  -27.599 -79.423 1.00   78.93 ? 87   GLU B CG    1 
ATOM   6773 C  CD    . GLU B 2 75  ? 52.278  -26.885 -80.650 1.00   83.86 ? 87   GLU B CD    1 
ATOM   6774 O  OE1   . GLU B 2 75  ? 52.047  -27.544 -81.688 1.00   85.75 ? 87   GLU B OE1   1 
ATOM   6775 O  OE2   . GLU B 2 75  ? 52.043  -25.656 -80.568 1.00   86.26 ? 87   GLU B OE2   1 
ATOM   6776 N  N     . THR B 2 76  ? 53.520  -30.660 -77.651 1.00   58.32 ? 88   THR B N     1 
ATOM   6777 C  CA    . THR B 2 76  ? 52.577  -31.348 -76.776 1.00   54.67 ? 88   THR B CA    1 
ATOM   6778 C  C     . THR B 2 76  ? 53.099  -31.383 -75.338 1.00   52.93 ? 88   THR B C     1 
ATOM   6779 O  O     . THR B 2 76  ? 52.384  -31.021 -74.403 1.00   52.41 ? 88   THR B O     1 
ATOM   6780 C  CB    . THR B 2 76  ? 52.343  -32.795 -77.231 1.00   55.08 ? 88   THR B CB    1 
ATOM   6781 O  OG1   . THR B 2 76  ? 51.803  -32.801 -78.559 1.00   57.34 ? 88   THR B OG1   1 
ATOM   6782 C  CG2   . THR B 2 76  ? 51.359  -33.498 -76.296 1.00   56.27 ? 88   THR B CG2   1 
ATOM   6783 N  N     . ILE B 2 77  ? 54.342  -31.812 -75.172 1.00   50.54 ? 89   ILE B N     1 
ATOM   6784 C  CA    . ILE B 2 77  ? 54.954  -31.896 -73.856 1.00   48.37 ? 89   ILE B CA    1 
ATOM   6785 C  C     . ILE B 2 77  ? 55.107  -30.511 -73.252 1.00   48.67 ? 89   ILE B C     1 
ATOM   6786 O  O     . ILE B 2 77  ? 54.902  -30.330 -72.050 1.00   48.44 ? 89   ILE B O     1 
ATOM   6787 C  CB    . ILE B 2 77  ? 56.311  -32.628 -73.939 1.00   46.67 ? 89   ILE B CB    1 
ATOM   6788 C  CG1   . ILE B 2 77  ? 56.056  -34.112 -74.300 1.00   44.02 ? 89   ILE B CG1   1 
ATOM   6789 C  CG2   . ILE B 2 77  ? 57.091  -32.446 -72.642 1.00   43.42 ? 89   ILE B CG2   1 
ATOM   6790 C  CD1   . ILE B 2 77  ? 57.316  -34.910 -74.608 1.00   41.92 ? 89   ILE B CD1   1 
ATOM   6791 N  N     . ARG B 2 78  ? 55.453  -29.530 -74.082 1.00   49.63 ? 90   ARG B N     1 
ATOM   6792 C  CA    . ARG B 2 78  ? 55.583  -28.161 -73.596 1.00   50.85 ? 90   ARG B CA    1 
ATOM   6793 C  C     . ARG B 2 78  ? 54.213  -27.682 -73.116 1.00   51.68 ? 90   ARG B C     1 
ATOM   6794 O  O     . ARG B 2 78  ? 54.109  -26.982 -72.106 1.00   51.85 ? 90   ARG B O     1 
ATOM   6795 C  CB    . ARG B 2 78  ? 56.067  -27.222 -74.701 1.00   51.94 ? 90   ARG B CB    1 
ATOM   6796 C  CG    . ARG B 2 78  ? 56.150  -25.781 -74.237 1.00   53.72 ? 90   ARG B CG    1 
ATOM   6797 C  CD    . ARG B 2 78  ? 56.649  -24.828 -75.308 1.00   55.18 ? 90   ARG B CD    1 
ATOM   6798 N  NE    . ARG B 2 78  ? 57.830  -25.347 -75.996 1.00   56.61 ? 90   ARG B NE    1 
ATOM   6799 C  CZ    . ARG B 2 78  ? 57.802  -25.879 -77.215 1.00   56.92 ? 90   ARG B CZ    1 
ATOM   6800 N  NH1   . ARG B 2 78  ? 56.659  -25.952 -77.890 1.00   56.94 ? 90   ARG B NH1   1 
ATOM   6801 N  NH2   . ARG B 2 78  ? 58.908  -26.365 -77.752 1.00   57.61 ? 90   ARG B NH2   1 
ATOM   6802 N  N     . ASN B 2 79  ? 53.166  -28.063 -73.845 1.00   51.77 ? 91   ASN B N     1 
ATOM   6803 C  CA    . ASN B 2 79  ? 51.805  -27.679 -73.495 1.00   50.91 ? 91   ASN B CA    1 
ATOM   6804 C  C     . ASN B 2 79  ? 51.258  -28.467 -72.287 1.00   49.71 ? 91   ASN B C     1 
ATOM   6805 O  O     . ASN B 2 79  ? 50.284  -28.038 -71.665 1.00   49.44 ? 91   ASN B O     1 
ATOM   6806 C  CB    . ASN B 2 79  ? 50.878  -27.858 -74.710 1.00   53.31 ? 91   ASN B CB    1 
ATOM   6807 C  CG    . ASN B 2 79  ? 51.050  -26.744 -75.774 1.00   55.80 ? 91   ASN B CG    1 
ATOM   6808 O  OD1   . ASN B 2 79  ? 50.498  -26.844 -76.865 1.00   58.40 ? 91   ASN B OD1   1 
ATOM   6809 N  ND2   . ASN B 2 79  ? 51.798  -25.693 -75.446 1.00   56.57 ? 91   ASN B ND2   1 
ATOM   6810 N  N     . ALA B 2 80  ? 51.872  -29.607 -71.960 1.00   47.16 ? 92   ALA B N     1 
ATOM   6811 C  CA    . ALA B 2 80  ? 51.432  -30.397 -70.805 1.00   46.15 ? 92   ALA B CA    1 
ATOM   6812 C  C     . ALA B 2 80  ? 51.903  -29.658 -69.548 1.00   45.59 ? 92   ALA B C     1 
ATOM   6813 O  O     . ALA B 2 80  ? 51.178  -29.587 -68.558 1.00   46.40 ? 92   ALA B O     1 
ATOM   6814 C  CB    . ALA B 2 80  ? 52.018  -31.789 -70.850 1.00   44.28 ? 92   ALA B CB    1 
ATOM   6815 N  N     . PHE B 2 81  ? 53.105  -29.098 -69.604 1.00   46.03 ? 93   PHE B N     1 
ATOM   6816 C  CA    . PHE B 2 81  ? 53.642  -28.341 -68.481 1.00   46.70 ? 93   PHE B CA    1 
ATOM   6817 C  C     . PHE B 2 81  ? 52.870  -27.042 -68.297 1.00   47.49 ? 93   PHE B C     1 
ATOM   6818 O  O     . PHE B 2 81  ? 52.634  -26.599 -67.172 1.00   47.54 ? 93   PHE B O     1 
ATOM   6819 C  CB    . PHE B 2 81  ? 55.116  -28.004 -68.706 1.00   45.87 ? 93   PHE B CB    1 
ATOM   6820 C  CG    . PHE B 2 81  ? 56.059  -29.106 -68.330 1.00   46.82 ? 93   PHE B CG    1 
ATOM   6821 C  CD1   . PHE B 2 81  ? 56.287  -29.414 -66.990 1.00   46.28 ? 93   PHE B CD1   1 
ATOM   6822 C  CD2   . PHE B 2 81  ? 56.706  -29.861 -69.319 1.00   45.38 ? 93   PHE B CD2   1 
ATOM   6823 C  CE1   . PHE B 2 81  ? 57.142  -30.467 -66.630 1.00   46.83 ? 93   PHE B CE1   1 
ATOM   6824 C  CE2   . PHE B 2 81  ? 57.550  -30.906 -68.986 1.00   45.69 ? 93   PHE B CE2   1 
ATOM   6825 C  CZ    . PHE B 2 81  ? 57.777  -31.218 -67.637 1.00   47.21 ? 93   PHE B CZ    1 
ATOM   6826 N  N     . ALA B 2 82  ? 52.479  -26.424 -69.416 1.00   47.86 ? 94   ALA B N     1 
ATOM   6827 C  CA    . ALA B 2 82  ? 51.764  -25.151 -69.380 1.00   47.61 ? 94   ALA B CA    1 
ATOM   6828 C  C     . ALA B 2 82  ? 50.447  -25.248 -68.624 1.00   47.19 ? 94   ALA B C     1 
ATOM   6829 O  O     . ALA B 2 82  ? 49.923  -24.243 -68.154 1.00   46.66 ? 94   ALA B O     1 
ATOM   6830 C  CB    . ALA B 2 82  ? 51.520  -24.628 -70.819 1.00   47.71 ? 94   ALA B CB    1 
ATOM   6831 N  N     . MET B 2 83  ? 49.920  -26.458 -68.509 1.00   47.12 ? 95   MET B N     1 
ATOM   6832 C  CA    . MET B 2 83  ? 48.672  -26.658 -67.791 1.00   46.86 ? 95   MET B CA    1 
ATOM   6833 C  C     . MET B 2 83  ? 48.851  -26.514 -66.272 1.00   45.68 ? 95   MET B C     1 
ATOM   6834 O  O     . MET B 2 83  ? 47.877  -26.555 -65.526 1.00   44.30 ? 95   MET B O     1 
ATOM   6835 C  CB    . MET B 2 83  ? 48.083  -28.033 -68.118 1.00   50.49 ? 95   MET B CB    1 
ATOM   6836 C  CG    . MET B 2 83  ? 47.682  -28.234 -69.571 1.00   55.38 ? 95   MET B CG    1 
ATOM   6837 S  SD    . MET B 2 83  ? 46.555  -29.633 -69.739 1.00   61.14 ? 95   MET B SD    1 
ATOM   6838 C  CE    . MET B 2 83  ? 46.959  -30.274 -71.385 1.00   61.38 ? 95   MET B CE    1 
ATOM   6839 N  N     . PHE B 2 84  ? 50.082  -26.354 -65.804 1.00   43.40 ? 96   PHE B N     1 
ATOM   6840 C  CA    . PHE B 2 84  ? 50.291  -26.171 -64.369 1.00   43.43 ? 96   PHE B CA    1 
ATOM   6841 C  C     . PHE B 2 84  ? 50.904  -24.814 -64.089 1.00   45.61 ? 96   PHE B C     1 
ATOM   6842 O  O     . PHE B 2 84  ? 51.299  -24.512 -62.963 1.00   45.50 ? 96   PHE B O     1 
ATOM   6843 C  CB    . PHE B 2 84  ? 51.187  -27.273 -63.798 1.00   39.47 ? 96   PHE B CB    1 
ATOM   6844 C  CG    . PHE B 2 84  ? 50.637  -28.654 -64.008 1.00   36.81 ? 96   PHE B CG    1 
ATOM   6845 C  CD1   . PHE B 2 84  ? 51.056  -29.422 -65.073 1.00   35.20 ? 96   PHE B CD1   1 
ATOM   6846 C  CD2   . PHE B 2 84  ? 49.643  -29.144 -63.179 1.00   36.60 ? 96   PHE B CD2   1 
ATOM   6847 C  CE1   . PHE B 2 84  ? 50.496  -30.658 -65.327 1.00   35.22 ? 96   PHE B CE1   1 
ATOM   6848 C  CE2   . PHE B 2 84  ? 49.069  -30.387 -63.426 1.00   36.99 ? 96   PHE B CE2   1 
ATOM   6849 C  CZ    . PHE B 2 84  ? 49.502  -31.147 -64.508 1.00   35.97 ? 96   PHE B CZ    1 
ATOM   6850 N  N     . ASP B 2 85  ? 50.985  -23.997 -65.132 1.00   49.71 ? 97   ASP B N     1 
ATOM   6851 C  CA    . ASP B 2 85  ? 51.544  -22.655 -65.048 1.00   55.17 ? 97   ASP B CA    1 
ATOM   6852 C  C     . ASP B 2 85  ? 50.482  -21.724 -65.591 1.00   62.54 ? 97   ASP B C     1 
ATOM   6853 O  O     . ASP B 2 85  ? 50.488  -21.362 -66.768 1.00   63.69 ? 97   ASP B O     1 
ATOM   6854 C  CB    . ASP B 2 85  ? 52.814  -22.608 -65.885 1.00   50.95 ? 97   ASP B CB    1 
ATOM   6855 C  CG    . ASP B 2 85  ? 53.280  -21.173 -66.201 1.00   48.53 ? 97   ASP B CG    1 
ATOM   6856 O  OD1   . ASP B 2 85  ? 53.211  -20.294 -65.303 1.00   47.09 ? 97   ASP B OD1   1 
ATOM   6857 O  OD2   . ASP B 2 85  ? 53.739  -20.937 -67.351 1.00   47.21 ? 97   ASP B OD2   1 
ATOM   6858 N  N     . GLU B 2 86  ? 49.566  -21.343 -64.717 1.00   71.63 ? 98   GLU B N     1 
ATOM   6859 C  CA    . GLU B 2 86  ? 48.446  -20.482 -65.071 1.00   79.08 ? 98   GLU B CA    1 
ATOM   6860 C  C     . GLU B 2 86  ? 48.872  -19.064 -65.429 1.00   81.60 ? 98   GLU B C     1 
ATOM   6861 O  O     . GLU B 2 86  ? 48.286  -18.432 -66.306 1.00   81.11 ? 98   GLU B O     1 
ATOM   6862 C  CB    . GLU B 2 86  ? 47.455  -20.432 -63.906 1.00   83.40 ? 98   GLU B CB    1 
ATOM   6863 C  CG    . GLU B 2 86  ? 48.065  -20.881 -62.576 1.00   93.55 ? 98   GLU B CG    1 
ATOM   6864 C  CD    . GLU B 2 86  ? 48.303  -22.417 -62.497 1.00   97.81 ? 98   GLU B CD    1 
ATOM   6865 O  OE1   . GLU B 2 86  ? 47.311  -23.193 -62.583 1.00   99.31 ? 98   GLU B OE1   1 
ATOM   6866 O  OE2   . GLU B 2 86  ? 49.481  -22.847 -62.340 1.00   99.26 ? 98   GLU B OE2   1 
ATOM   6867 N  N     . GLN B 2 87  ? 49.896  -18.560 -64.740 1.00   82.40 ? 99   GLN B N     1 
ATOM   6868 C  CA    . GLN B 2 87  ? 50.408  -17.210 -64.965 1.00   83.33 ? 99   GLN B CA    1 
ATOM   6869 C  C     . GLN B 2 87  ? 51.127  -17.155 -66.294 1.00   83.67 ? 99   GLN B C     1 
ATOM   6870 O  O     . GLN B 2 87  ? 51.520  -16.085 -66.758 1.00   81.16 ? 99   GLN B O     1 
ATOM   6871 C  CB    . GLN B 2 87  ? 51.408  -16.821 -63.870 1.00   87.56 ? 99   GLN B CB    1 
ATOM   6872 C  CG    . GLN B 2 87  ? 50.799  -16.660 -62.489 1.00   94.78 ? 99   GLN B CG    1 
ATOM   6873 C  CD    . GLN B 2 87  ? 49.731  -15.542 -62.435 1.00   98.10 ? 99   GLN B CD    1 
ATOM   6874 O  OE1   . GLN B 2 87  ? 48.565  -15.827 -62.544 1.00   98.88 ? 99   GLN B OE1   1 
ATOM   6875 N  NE2   . GLN B 2 87  ? 50.180  -14.303 -62.278 1.00   99.15 ? 99   GLN B NE2   1 
ATOM   6876 N  N     . GLU B 2 88  ? 51.305  -18.314 -66.909 1.00   81.36 ? 100  GLU B N     1 
ATOM   6877 C  CA    . GLU B 2 88  ? 52.035  -18.379 -68.168 1.00   77.73 ? 100  GLU B CA    1 
ATOM   6878 C  C     . GLU B 2 88  ? 53.363  -17.634 -67.993 1.00   75.21 ? 100  GLU B C     1 
ATOM   6879 O  O     . GLU B 2 88  ? 53.714  -16.771 -68.794 1.00   69.95 ? 100  GLU B O     1 
ATOM   6880 C  CB    . GLU B 2 88  ? 51.221  -17.744 -69.302 1.00   81.60 ? 100  GLU B CB    1 
ATOM   6881 C  CG    . GLU B 2 88  ? 49.914  -18.467 -69.639 1.00   92.06 ? 100  GLU B CG    1 
ATOM   6882 C  CD    . GLU B 2 88  ? 49.240  -17.921 -70.905 1.00   97.25 ? 100  GLU B CD    1 
ATOM   6883 O  OE1   . GLU B 2 88  ? 49.041  -16.686 -70.999 1.00   98.86 ? 100  GLU B OE1   1 
ATOM   6884 O  OE2   . GLU B 2 88  ? 48.904  -18.731 -71.805 1.00   99.18 ? 100  GLU B OE2   1 
ATOM   6885 N  N     . THR B 2 89  ? 54.089  -17.972 -66.928 1.00   70.96 ? 101  THR B N     1 
ATOM   6886 C  CA    . THR B 2 89  ? 55.380  -17.347 -66.632 1.00   65.35 ? 101  THR B CA    1 
ATOM   6887 C  C     . THR B 2 89  ? 56.490  -18.156 -67.274 1.00   64.41 ? 101  THR B C     1 
ATOM   6888 O  O     . THR B 2 89  ? 57.656  -17.772 -67.242 1.00   63.69 ? 101  THR B O     1 
ATOM   6889 C  CB    . THR B 2 89  ? 55.656  -17.292 -65.116 1.00   64.32 ? 101  THR B CB    1 
ATOM   6890 O  OG1   . THR B 2 89  ? 55.519  -18.608 -64.560 1.00   64.29 ? 101  THR B OG1   1 
ATOM   6891 C  CG2   . THR B 2 89  ? 54.684  -16.347 -64.423 1.00   64.37 ? 101  THR B CG2   1 
ATOM   6892 N  N     . LYS B 2 90  ? 56.107  -19.286 -67.849 1.00   64.43 ? 102  LYS B N     1 
ATOM   6893 C  CA    . LYS B 2 90  ? 57.044  -20.186 -68.506 1.00   66.34 ? 102  LYS B CA    1 
ATOM   6894 C  C     . LYS B 2 90  ? 57.959  -20.912 -67.519 1.00   65.55 ? 102  LYS B C     1 
ATOM   6895 O  O     . LYS B 2 90  ? 59.025  -21.397 -67.893 1.00   67.53 ? 102  LYS B O     1 
ATOM   6896 C  CB    . LYS B 2 90  ? 57.863  -19.424 -69.558 1.00   69.26 ? 102  LYS B CB    1 
ATOM   6897 C  CG    . LYS B 2 90  ? 57.000  -18.910 -70.716 1.00   72.39 ? 102  LYS B CG    1 
ATOM   6898 C  CD    . LYS B 2 90  ? 56.108  -20.042 -71.224 1.00   73.75 ? 102  LYS B CD    1 
ATOM   6899 C  CE    . LYS B 2 90  ? 55.116  -19.606 -72.286 1.00   73.85 ? 102  LYS B CE    1 
ATOM   6900 N  NZ    . LYS B 2 90  ? 54.075  -20.666 -72.462 1.00   74.39 ? 102  LYS B NZ    1 
ATOM   6901 N  N     . LYS B 2 91  ? 57.530  -20.982 -66.264 1.00   63.37 ? 103  LYS B N     1 
ATOM   6902 C  CA    . LYS B 2 91  ? 58.280  -21.672 -65.219 1.00   59.26 ? 103  LYS B CA    1 
ATOM   6903 C  C     . LYS B 2 91  ? 57.307  -22.322 -64.245 1.00   55.58 ? 103  LYS B C     1 
ATOM   6904 O  O     . LYS B 2 91  ? 56.129  -21.982 -64.205 1.00   53.45 ? 103  LYS B O     1 
ATOM   6905 C  CB    . LYS B 2 91  ? 59.169  -20.712 -64.441 1.00   59.85 ? 103  LYS B CB    1 
ATOM   6906 C  CG    . LYS B 2 91  ? 60.554  -20.441 -65.026 1.00   62.61 ? 103  LYS B CG    1 
ATOM   6907 C  CD    . LYS B 2 91  ? 60.512  -19.539 -66.249 1.00   65.50 ? 103  LYS B CD    1 
ATOM   6908 C  CE    . LYS B 2 91  ? 61.893  -18.939 -66.543 1.00   66.87 ? 103  LYS B CE    1 
ATOM   6909 N  NZ    . LYS B 2 91  ? 62.313  -18.004 -65.448 1.00   67.33 ? 103  LYS B NZ    1 
ATOM   6910 N  N     . LEU B 2 92  ? 57.816  -23.268 -63.476 1.00   49.83 ? 104  LEU B N     1 
ATOM   6911 C  CA    . LEU B 2 92  ? 57.031  -23.964 -62.470 1.00   46.42 ? 104  LEU B CA    1 
ATOM   6912 C  C     . LEU B 2 92  ? 57.831  -23.915 -61.181 1.00   45.77 ? 104  LEU B C     1 
ATOM   6913 O  O     . LEU B 2 92  ? 59.059  -24.031 -61.206 1.00   42.92 ? 104  LEU B O     1 
ATOM   6914 C  CB    . LEU B 2 92  ? 56.785  -25.414 -62.874 1.00   45.31 ? 104  LEU B CB    1 
ATOM   6915 C  CG    . LEU B 2 92  ? 55.729  -25.616 -63.965 1.00   44.85 ? 104  LEU B CG    1 
ATOM   6916 C  CD1   . LEU B 2 92  ? 55.409  -27.097 -64.078 1.00   45.01 ? 104  LEU B CD1   1 
ATOM   6917 C  CD2   . LEU B 2 92  ? 54.445  -24.833 -63.624 1.00   44.59 ? 104  LEU B CD2   1 
ATOM   6918 N  N     . ASN B 2 93  ? 57.149  -23.722 -60.056 1.00   43.59 ? 105  ASN B N     1 
ATOM   6919 C  CA    . ASN B 2 93  ? 57.852  -23.671 -58.776 1.00   42.33 ? 105  ASN B CA    1 
ATOM   6920 C  C     . ASN B 2 93  ? 58.466  -25.032 -58.545 1.00   40.68 ? 105  ASN B C     1 
ATOM   6921 O  O     . ASN B 2 93  ? 57.785  -26.042 -58.661 1.00   38.41 ? 105  ASN B O     1 
ATOM   6922 C  CB    . ASN B 2 93  ? 56.894  -23.317 -57.627 1.00   43.81 ? 105  ASN B CB    1 
ATOM   6923 C  CG    . ASN B 2 93  ? 56.588  -21.826 -57.564 1.00   47.54 ? 105  ASN B CG    1 
ATOM   6924 O  OD1   . ASN B 2 93  ? 57.369  -20.998 -58.057 1.00   47.79 ? 105  ASN B OD1   1 
ATOM   6925 N  ND2   . ASN B 2 93  ? 55.457  -21.471 -56.931 1.00   50.36 ? 105  ASN B ND2   1 
ATOM   6926 N  N     . ILE B 2 94  ? 59.754  -25.058 -58.234 1.00   40.72 ? 106  ILE B N     1 
ATOM   6927 C  CA    . ILE B 2 94  ? 60.427  -26.340 -58.018 1.00   41.49 ? 106  ILE B CA    1 
ATOM   6928 C  C     . ILE B 2 94  ? 59.685  -27.294 -57.107 1.00   43.92 ? 106  ILE B C     1 
ATOM   6929 O  O     . ILE B 2 94  ? 59.545  -28.481 -57.425 1.00   42.29 ? 106  ILE B O     1 
ATOM   6930 C  CB    . ILE B 2 94  ? 61.854  -26.162 -57.473 1.00   41.56 ? 106  ILE B CB    1 
ATOM   6931 C  CG1   . ILE B 2 94  ? 62.598  -27.492 -57.561 1.00   43.62 ? 106  ILE B CG1   1 
ATOM   6932 C  CG2   . ILE B 2 94  ? 61.811  -25.675 -56.054 1.00   43.37 ? 106  ILE B CG2   1 
ATOM   6933 C  CD1   . ILE B 2 94  ? 62.685  -28.078 -58.979 1.00   42.67 ? 106  ILE B CD1   1 
ATOM   6934 N  N     . GLU B 2 95  ? 59.180  -26.791 -55.986 1.00   47.00 ? 107  GLU B N     1 
ATOM   6935 C  CA    . GLU B 2 95  ? 58.466  -27.639 -55.046 1.00   48.35 ? 107  GLU B CA    1 
ATOM   6936 C  C     . GLU B 2 95  ? 57.220  -28.196 -55.681 1.00   46.61 ? 107  GLU B C     1 
ATOM   6937 O  O     . GLU B 2 95  ? 56.859  -29.360 -55.470 1.00   44.67 ? 107  GLU B O     1 
ATOM   6938 C  CB    . GLU B 2 95  ? 58.070  -26.862 -53.776 1.00   55.55 ? 107  GLU B CB    1 
ATOM   6939 C  CG    . GLU B 2 95  ? 59.073  -25.789 -53.338 1.00   71.01 ? 107  GLU B CG    1 
ATOM   6940 C  CD    . GLU B 2 95  ? 59.046  -24.523 -54.229 1.00   78.46 ? 107  GLU B CD    1 
ATOM   6941 O  OE1   . GLU B 2 95  ? 58.465  -24.581 -55.349 1.00   80.32 ? 107  GLU B OE1   1 
ATOM   6942 O  OE2   . GLU B 2 95  ? 59.617  -23.480 -53.798 1.00   81.19 ? 107  GLU B OE2   1 
ATOM   6943 N  N     . TYR B 2 96  ? 56.542  -27.361 -56.461 1.00   43.41 ? 108  TYR B N     1 
ATOM   6944 C  CA    . TYR B 2 96  ? 55.315  -27.769 -57.120 1.00   39.63 ? 108  TYR B CA    1 
ATOM   6945 C  C     . TYR B 2 96  ? 55.523  -28.904 -58.139 1.00   38.86 ? 108  TYR B C     1 
ATOM   6946 O  O     . TYR B 2 96  ? 54.843  -29.934 -58.063 1.00   37.97 ? 108  TYR B O     1 
ATOM   6947 C  CB    . TYR B 2 96  ? 54.662  -26.537 -57.769 1.00   38.80 ? 108  TYR B CB    1 
ATOM   6948 C  CG    . TYR B 2 96  ? 53.289  -26.777 -58.377 1.00   39.12 ? 108  TYR B CG    1 
ATOM   6949 C  CD1   . TYR B 2 96  ? 52.399  -27.685 -57.808 1.00   39.12 ? 108  TYR B CD1   1 
ATOM   6950 C  CD2   . TYR B 2 96  ? 52.877  -26.081 -59.519 1.00   39.82 ? 108  TYR B CD2   1 
ATOM   6951 C  CE1   . TYR B 2 96  ? 51.139  -27.898 -58.355 1.00   39.40 ? 108  TYR B CE1   1 
ATOM   6952 C  CE2   . TYR B 2 96  ? 51.614  -26.280 -60.070 1.00   38.49 ? 108  TYR B CE2   1 
ATOM   6953 C  CZ    . TYR B 2 96  ? 50.755  -27.192 -59.483 1.00   39.20 ? 108  TYR B CZ    1 
ATOM   6954 O  OH    . TYR B 2 96  ? 49.496  -27.401 -60.018 1.00   40.42 ? 108  TYR B OH    1 
ATOM   6955 N  N     . ILE B 2 97  ? 56.451  -28.740 -59.087 1.00   38.92 ? 109  ILE B N     1 
ATOM   6956 C  CA    . ILE B 2 97  ? 56.672  -29.800 -60.091 1.00   38.73 ? 109  ILE B CA    1 
ATOM   6957 C  C     . ILE B 2 97  ? 57.127  -31.126 -59.471 1.00   39.08 ? 109  ILE B C     1 
ATOM   6958 O  O     . ILE B 2 97  ? 56.707  -32.198 -59.914 1.00   38.45 ? 109  ILE B O     1 
ATOM   6959 C  CB    . ILE B 2 97  ? 57.654  -29.343 -61.194 1.00   39.02 ? 109  ILE B CB    1 
ATOM   6960 C  CG1   . ILE B 2 97  ? 58.039  -30.526 -62.089 1.00   40.41 ? 109  ILE B CG1   1 
ATOM   6961 C  CG2   . ILE B 2 97  ? 58.874  -28.689 -60.583 1.00   39.60 ? 109  ILE B CG2   1 
ATOM   6962 C  CD1   . ILE B 2 97  ? 56.833  -31.295 -62.665 1.00   42.36 ? 109  ILE B CD1   1 
ATOM   6963 N  N     . LYS B 2 98  ? 57.973  -31.061 -58.443 1.00   42.72 ? 110  LYS B N     1 
ATOM   6964 C  CA    . LYS B 2 98  ? 58.444  -32.267 -57.758 1.00   43.44 ? 110  LYS B CA    1 
ATOM   6965 C  C     . LYS B 2 98  ? 57.261  -32.921 -57.072 1.00   43.72 ? 110  LYS B C     1 
ATOM   6966 O  O     . LYS B 2 98  ? 57.122  -34.141 -57.093 1.00   43.88 ? 110  LYS B O     1 
ATOM   6967 C  CB    . LYS B 2 98  ? 59.507  -31.932 -56.708 1.00   44.91 ? 110  LYS B CB    1 
ATOM   6968 C  CG    . LYS B 2 98  ? 60.864  -31.574 -57.284 1.00   45.96 ? 110  LYS B CG    1 
ATOM   6969 C  CD    . LYS B 2 98  ? 61.929  -31.358 -56.199 1.00   46.77 ? 110  LYS B CD    1 
ATOM   6970 C  CE    . LYS B 2 98  ? 63.271  -31.032 -56.876 1.00   49.04 ? 110  LYS B CE    1 
ATOM   6971 N  NZ    . LYS B 2 98  ? 64.423  -30.950 -55.928 1.00   51.40 ? 110  LYS B NZ    1 
ATOM   6972 N  N     . ASP B 2 99  ? 56.411  -32.084 -56.476 1.00   43.66 ? 111  ASP B N     1 
ATOM   6973 C  CA    . ASP B 2 99  ? 55.209  -32.533 -55.797 1.00   44.93 ? 111  ASP B CA    1 
ATOM   6974 C  C     . ASP B 2 99  ? 54.353  -33.306 -56.779 1.00   43.74 ? 111  ASP B C     1 
ATOM   6975 O  O     . ASP B 2 99  ? 53.905  -34.417 -56.488 1.00   43.73 ? 111  ASP B O     1 
ATOM   6976 C  CB    . ASP B 2 99  ? 54.439  -31.322 -55.244 1.00   47.99 ? 111  ASP B CB    1 
ATOM   6977 C  CG    . ASP B 2 99  ? 53.297  -31.715 -54.293 1.00   50.86 ? 111  ASP B CG    1 
ATOM   6978 O  OD1   . ASP B 2 99  ? 52.388  -30.876 -54.085 1.00   54.05 ? 111  ASP B OD1   1 
ATOM   6979 O  OD2   . ASP B 2 99  ? 53.303  -32.837 -53.743 1.00   50.36 ? 111  ASP B OD2   1 
ATOM   6980 N  N     . LEU B 2 100 ? 54.132  -32.715 -57.953 1.00   43.23 ? 112  LEU B N     1 
ATOM   6981 C  CA    . LEU B 2 100 ? 53.336  -33.365 -58.993 1.00   42.27 ? 112  LEU B CA    1 
ATOM   6982 C  C     . LEU B 2 100 ? 53.901  -34.695 -59.477 1.00   41.90 ? 112  LEU B C     1 
ATOM   6983 O  O     . LEU B 2 100 ? 53.148  -35.650 -59.637 1.00   42.19 ? 112  LEU B O     1 
ATOM   6984 C  CB    . LEU B 2 100 ? 53.196  -32.445 -60.213 1.00   41.99 ? 112  LEU B CB    1 
ATOM   6985 C  CG    . LEU B 2 100 ? 52.296  -31.223 -60.037 1.00   41.85 ? 112  LEU B CG    1 
ATOM   6986 C  CD1   . LEU B 2 100 ? 52.630  -30.193 -61.086 1.00   40.41 ? 112  LEU B CD1   1 
ATOM   6987 C  CD2   . LEU B 2 100 ? 50.840  -31.644 -60.073 1.00   40.00 ? 112  LEU B CD2   1 
ATOM   6988 N  N     . LEU B 2 101 ? 55.213  -34.760 -59.724 1.00   43.35 ? 113  LEU B N     1 
ATOM   6989 C  CA    . LEU B 2 101 ? 55.826  -35.979 -60.267 1.00   44.99 ? 113  LEU B CA    1 
ATOM   6990 C  C     . LEU B 2 101 ? 55.963  -37.144 -59.313 1.00   46.42 ? 113  LEU B C     1 
ATOM   6991 O  O     . LEU B 2 101 ? 55.847  -38.303 -59.704 1.00   46.22 ? 113  LEU B O     1 
ATOM   6992 C  CB    . LEU B 2 101 ? 57.219  -35.677 -60.830 1.00   43.37 ? 113  LEU B CB    1 
ATOM   6993 C  CG    . LEU B 2 101 ? 57.323  -34.665 -61.984 1.00   43.62 ? 113  LEU B CG    1 
ATOM   6994 C  CD1   . LEU B 2 101 ? 58.799  -34.464 -62.330 1.00   42.19 ? 113  LEU B CD1   1 
ATOM   6995 C  CD2   . LEU B 2 101 ? 56.536  -35.136 -63.195 1.00   41.19 ? 113  LEU B CD2   1 
ATOM   6996 N  N     . GLU B 2 102 ? 56.205  -36.827 -58.056 1.00   48.91 ? 114  GLU B N     1 
ATOM   6997 C  CA    . GLU B 2 102 ? 56.420  -37.854 -57.066 1.00   51.48 ? 114  GLU B CA    1 
ATOM   6998 C  C     . GLU B 2 102 ? 55.221  -38.323 -56.254 1.00   51.58 ? 114  GLU B C     1 
ATOM   6999 O  O     . GLU B 2 102 ? 55.119  -39.502 -55.921 1.00   51.44 ? 114  GLU B O     1 
ATOM   7000 C  CB    . GLU B 2 102 ? 57.506  -37.373 -56.126 1.00   54.44 ? 114  GLU B CB    1 
ATOM   7001 C  CG    . GLU B 2 102 ? 57.772  -38.276 -54.958 1.00   58.86 ? 114  GLU B CG    1 
ATOM   7002 C  CD    . GLU B 2 102 ? 59.135  -38.003 -54.382 1.00   61.16 ? 114  GLU B CD    1 
ATOM   7003 O  OE1   . GLU B 2 102 ? 59.394  -36.848 -53.993 1.00   62.19 ? 114  GLU B OE1   1 
ATOM   7004 O  OE2   . GLU B 2 102 ? 59.956  -38.940 -54.331 1.00   63.59 ? 114  GLU B OE2   1 
ATOM   7005 N  N     . ASN B 2 103 ? 54.266  -37.415 -55.962 1.00   50.47 ? 115  ASN B N     1 
ATOM   7006 C  CA    . ASN B 2 103 ? 53.163  -37.751 -55.089 1.00   49.60 ? 115  ASN B CA    1 
ATOM   7007 C  C     . ASN B 2 103 ? 51.880  -37.903 -55.881 1.00   49.54 ? 115  ASN B C     1 
ATOM   7008 O  O     . ASN B 2 103 ? 50.815  -38.188 -55.233 1.00   48.77 ? 115  ASN B O     1 
ATOM   7009 C  CB    . ASN B 2 103 ? 53.062  -36.734 -53.959 1.00   47.95 ? 115  ASN B CB    1 
ATOM   7010 C  CG    . ASN B 2 103 ? 54.368  -36.627 -53.195 1.00   47.67 ? 115  ASN B CG    1 
ATOM   7011 O  OD1   . ASN B 2 103 ? 54.935  -37.637 -52.771 1.00   48.02 ? 115  ASN B OD1   1 
ATOM   7012 N  ND2   . ASN B 2 103 ? 54.855  -35.405 -53.017 1.00   46.09 ? 115  ASN B ND2   1 
ATOM   7013 N  N     . MET B 2 104 ? 51.842  -37.758 -57.173 1.00   49.73 ? 116  MET B N     1 
ATOM   7014 C  CA    . MET B 2 104 ? 50.597  -37.907 -57.911 1.00   49.69 ? 116  MET B CA    1 
ATOM   7015 C  C     . MET B 2 104 ? 50.715  -38.704 -59.211 1.00   49.69 ? 116  MET B C     1 
ATOM   7016 O  O     . MET B 2 104 ? 51.809  -39.120 -59.597 1.00   49.42 ? 116  MET B O     1 
ATOM   7017 C  CB    . MET B 2 104 ? 50.022  -36.526 -58.170 1.00   50.86 ? 116  MET B CB    1 
ATOM   7018 C  CG    . MET B 2 104 ? 49.860  -35.731 -56.888 1.00   51.83 ? 116  MET B CG    1 
ATOM   7019 S  SD    . MET B 2 104 ? 49.566  -33.996 -57.195 1.00   52.59 ? 116  MET B SD    1 
ATOM   7020 C  CE    . MET B 2 104 ? 51.056  -33.251 -56.561 1.00   52.34 ? 116  MET B CE    1 
ATOM   7021 N  N     . GLY B 2 105 ? 49.578  -38.904 -59.876 1.00   48.88 ? 117  GLY B N     1 
ATOM   7022 C  CA    . GLY B 2 105 ? 49.560  -39.662 -61.114 1.00   49.48 ? 117  GLY B CA    1 
ATOM   7023 C  C     . GLY B 2 105 ? 50.237  -40.988 -60.862 1.00   51.08 ? 117  GLY B C     1 
ATOM   7024 O  O     . GLY B 2 105 ? 49.924  -41.683 -59.893 1.00   50.04 ? 117  GLY B O     1 
ATOM   7025 N  N     . ASP B 2 106 ? 51.168  -41.345 -61.738 1.00   52.63 ? 118  ASP B N     1 
ATOM   7026 C  CA    . ASP B 2 106 ? 51.928  -42.572 -61.578 1.00   52.88 ? 118  ASP B CA    1 
ATOM   7027 C  C     . ASP B 2 106 ? 53.194  -42.105 -60.885 1.00   51.68 ? 118  ASP B C     1 
ATOM   7028 O  O     . ASP B 2 106 ? 54.157  -41.688 -61.529 1.00   49.66 ? 118  ASP B O     1 
ATOM   7029 C  CB    . ASP B 2 106 ? 52.229  -43.185 -62.942 1.00   57.95 ? 118  ASP B CB    1 
ATOM   7030 C  CG    . ASP B 2 106 ? 50.972  -43.617 -63.663 1.00   64.32 ? 118  ASP B CG    1 
ATOM   7031 O  OD1   . ASP B 2 106 ? 50.226  -44.457 -63.101 1.00   68.27 ? 118  ASP B OD1   1 
ATOM   7032 O  OD2   . ASP B 2 106 ? 50.722  -43.113 -64.779 1.00   67.86 ? 118  ASP B OD2   1 
ATOM   7033 N  N     . ASN B 2 107 ? 53.166  -42.166 -59.552 1.00   50.17 ? 119  ASN B N     1 
ATOM   7034 C  CA    . ASN B 2 107 ? 54.264  -41.693 -58.715 1.00   48.91 ? 119  ASN B CA    1 
ATOM   7035 C  C     . ASN B 2 107 ? 55.648  -42.178 -59.146 1.00   47.72 ? 119  ASN B C     1 
ATOM   7036 O  O     . ASN B 2 107 ? 55.856  -43.368 -59.342 1.00   48.74 ? 119  ASN B O     1 
ATOM   7037 C  CB    . ASN B 2 107 ? 54.054  -42.105 -57.235 1.00   48.65 ? 119  ASN B CB    1 
ATOM   7038 C  CG    . ASN B 2 107 ? 52.640  -41.896 -56.735 1.00   48.27 ? 119  ASN B CG    1 
ATOM   7039 O  OD1   . ASN B 2 107 ? 51.704  -42.532 -57.211 1.00   50.00 ? 119  ASN B OD1   1 
ATOM   7040 N  ND2   . ASN B 2 107 ? 52.478  -41.018 -55.750 1.00   47.73 ? 119  ASN B ND2   1 
ATOM   7041 N  N     . PHE B 2 108 ? 56.580  -41.250 -59.276 1.00   48.23 ? 120  PHE B N     1 
ATOM   7042 C  CA    . PHE B 2 108 ? 57.970  -41.571 -59.612 1.00   48.49 ? 120  PHE B CA    1 
ATOM   7043 C  C     . PHE B 2 108 ? 58.608  -42.096 -58.315 1.00   49.29 ? 120  PHE B C     1 
ATOM   7044 O  O     . PHE B 2 108 ? 58.356  -41.535 -57.250 1.00   49.20 ? 120  PHE B O     1 
ATOM   7045 C  CB    . PHE B 2 108 ? 58.752  -40.307 -59.986 1.00   47.77 ? 120  PHE B CB    1 
ATOM   7046 C  CG    . PHE B 2 108 ? 58.588  -39.856 -61.394 1.00   48.20 ? 120  PHE B CG    1 
ATOM   7047 C  CD1   . PHE B 2 108 ? 57.605  -40.400 -62.224 1.00   48.98 ? 120  PHE B CD1   1 
ATOM   7048 C  CD2   . PHE B 2 108 ? 59.439  -38.869 -61.913 1.00   49.06 ? 120  PHE B CD2   1 
ATOM   7049 C  CE1   . PHE B 2 108 ? 57.469  -39.983 -63.544 1.00   47.25 ? 120  PHE B CE1   1 
ATOM   7050 C  CE2   . PHE B 2 108 ? 59.312  -38.435 -63.247 1.00   47.91 ? 120  PHE B CE2   1 
ATOM   7051 C  CZ    . PHE B 2 108 ? 58.322  -39.001 -64.052 1.00   48.16 ? 120  PHE B CZ    1 
ATOM   7052 N  N     . ASN B 2 109 ? 59.421  -43.140 -58.380 1.00   50.83 ? 121  ASN B N     1 
ATOM   7053 C  CA    . ASN B 2 109 ? 60.095  -43.606 -57.168 1.00   51.44 ? 121  ASN B CA    1 
ATOM   7054 C  C     . ASN B 2 109 ? 61.225  -42.608 -56.959 1.00   51.56 ? 121  ASN B C     1 
ATOM   7055 O  O     . ASN B 2 109 ? 61.465  -41.753 -57.811 1.00   52.33 ? 121  ASN B O     1 
ATOM   7056 C  CB    . ASN B 2 109 ? 60.639  -45.037 -57.328 1.00   52.01 ? 121  ASN B CB    1 
ATOM   7057 C  CG    . ASN B 2 109 ? 61.627  -45.167 -58.468 1.00   53.50 ? 121  ASN B CG    1 
ATOM   7058 O  OD1   . ASN B 2 109 ? 61.398  -45.908 -59.429 1.00   54.38 ? 121  ASN B OD1   1 
ATOM   7059 N  ND2   . ASN B 2 109 ? 62.739  -44.451 -58.369 1.00   55.37 ? 121  ASN B ND2   1 
ATOM   7060 N  N     . LYS B 2 110 ? 61.926  -42.702 -55.835 1.00   52.46 ? 122  LYS B N     1 
ATOM   7061 C  CA    . LYS B 2 110 ? 63.003  -41.768 -55.519 1.00   52.87 ? 122  LYS B CA    1 
ATOM   7062 C  C     . LYS B 2 110 ? 64.186  -41.705 -56.496 1.00   54.98 ? 122  LYS B C     1 
ATOM   7063 O  O     . LYS B 2 110 ? 64.908  -40.706 -56.505 1.00   53.72 ? 122  LYS B O     1 
ATOM   7064 C  CB    . LYS B 2 110 ? 63.519  -42.030 -54.079 1.00   55.22 ? 122  LYS B CB    1 
ATOM   7065 N  N     . ASP B 2 111 ? 64.405  -42.737 -57.304 1.00   55.55 ? 123  ASP B N     1 
ATOM   7066 C  CA    . ASP B 2 111 ? 65.527  -42.696 -58.237 1.00   54.95 ? 123  ASP B CA    1 
ATOM   7067 C  C     . ASP B 2 111 ? 65.125  -41.943 -59.497 1.00   53.90 ? 123  ASP B C     1 
ATOM   7068 O  O     . ASP B 2 111 ? 65.930  -41.206 -60.070 1.00   50.77 ? 123  ASP B O     1 
ATOM   7069 C  CB    . ASP B 2 111 ? 66.002  -44.100 -58.639 1.00   58.77 ? 123  ASP B CB    1 
ATOM   7070 C  CG    . ASP B 2 111 ? 66.581  -44.889 -57.471 1.00   65.18 ? 123  ASP B CG    1 
ATOM   7071 O  OD1   . ASP B 2 111 ? 67.557  -44.417 -56.820 1.00   67.38 ? 123  ASP B OD1   1 
ATOM   7072 O  OD2   . ASP B 2 111 ? 66.042  -45.995 -57.222 1.00   69.07 ? 123  ASP B OD2   1 
ATOM   7073 N  N     . GLU B 2 112 ? 63.885  -42.135 -59.929 1.00   51.19 ? 124  GLU B N     1 
ATOM   7074 C  CA    . GLU B 2 112 ? 63.403  -41.447 -61.114 1.00   50.16 ? 124  GLU B CA    1 
ATOM   7075 C  C     . GLU B 2 112 ? 63.479  -39.947 -60.833 1.00   50.41 ? 124  GLU B C     1 
ATOM   7076 O  O     . GLU B 2 112 ? 63.807  -39.154 -61.718 1.00   49.07 ? 124  GLU B O     1 
ATOM   7077 C  CB    . GLU B 2 112 ? 61.975  -41.891 -61.415 1.00   50.82 ? 124  GLU B CB    1 
ATOM   7078 C  CG    . GLU B 2 112 ? 61.833  -43.413 -61.397 1.00   54.12 ? 124  GLU B CG    1 
ATOM   7079 C  CD    . GLU B 2 112 ? 60.429  -43.915 -61.729 1.00   55.56 ? 124  GLU B CD    1 
ATOM   7080 O  OE1   . GLU B 2 112 ? 60.217  -44.385 -62.871 1.00   56.27 ? 124  GLU B OE1   1 
ATOM   7081 O  OE2   . GLU B 2 112 ? 59.537  -43.846 -60.852 1.00   55.41 ? 124  GLU B OE2   1 
ATOM   7082 N  N     . MET B 2 113 ? 63.185  -39.568 -59.590 1.00   50.44 ? 125  MET B N     1 
ATOM   7083 C  CA    . MET B 2 113 ? 63.236  -38.176 -59.165 1.00   50.33 ? 125  MET B CA    1 
ATOM   7084 C  C     . MET B 2 113 ? 64.667  -37.655 -59.224 1.00   51.34 ? 125  MET B C     1 
ATOM   7085 O  O     . MET B 2 113 ? 64.917  -36.556 -59.722 1.00   48.73 ? 125  MET B O     1 
ATOM   7086 C  CB    . MET B 2 113 ? 62.729  -38.031 -57.728 1.00   50.66 ? 125  MET B CB    1 
ATOM   7087 C  CG    . MET B 2 113 ? 61.240  -38.269 -57.535 1.00   53.50 ? 125  MET B CG    1 
ATOM   7088 S  SD    . MET B 2 113 ? 60.198  -37.056 -58.406 1.00   56.16 ? 125  MET B SD    1 
ATOM   7089 C  CE    . MET B 2 113 ? 60.726  -35.516 -57.631 1.00   55.14 ? 125  MET B CE    1 
ATOM   7090 N  N     . ARG B 2 114 ? 65.604  -38.445 -58.711 1.00   52.56 ? 126  ARG B N     1 
ATOM   7091 C  CA    . ARG B 2 114 ? 67.001  -38.041 -58.702 1.00   53.97 ? 126  ARG B CA    1 
ATOM   7092 C  C     . ARG B 2 114 ? 67.546  -37.890 -60.115 1.00   55.74 ? 126  ARG B C     1 
ATOM   7093 O  O     . ARG B 2 114 ? 68.261  -36.931 -60.418 1.00   54.70 ? 126  ARG B O     1 
ATOM   7094 C  CB    . ARG B 2 114 ? 67.839  -39.063 -57.938 1.00   55.91 ? 126  ARG B CB    1 
ATOM   7095 C  CG    . ARG B 2 114 ? 69.295  -38.631 -57.730 1.00   60.87 ? 126  ARG B CG    1 
ATOM   7096 C  CD    . ARG B 2 114 ? 70.128  -39.716 -57.013 1.00   63.39 ? 126  ARG B CD    1 
ATOM   7097 N  NE    . ARG B 2 114 ? 70.434  -40.846 -57.890 1.00   63.69 ? 126  ARG B NE    1 
ATOM   7098 C  CZ    . ARG B 2 114 ? 69.982  -42.082 -57.717 1.00   64.15 ? 126  ARG B CZ    1 
ATOM   7099 N  NH1   . ARG B 2 114 ? 69.198  -42.367 -56.688 1.00   64.49 ? 126  ARG B NH1   1 
ATOM   7100 N  NH2   . ARG B 2 114 ? 70.302  -43.032 -58.586 1.00   64.34 ? 126  ARG B NH2   1 
ATOM   7101 N  N     . MET B 2 115 ? 67.210  -38.837 -60.986 1.00   57.45 ? 127  MET B N     1 
ATOM   7102 C  CA    . MET B 2 115 ? 67.687  -38.793 -62.356 1.00   58.05 ? 127  MET B CA    1 
ATOM   7103 C  C     . MET B 2 115 ? 67.024  -37.669 -63.153 1.00   55.22 ? 127  MET B C     1 
ATOM   7104 O  O     . MET B 2 115 ? 67.602  -37.157 -64.103 1.00   54.47 ? 127  MET B O     1 
ATOM   7105 C  CB    . MET B 2 115 ? 67.431  -40.133 -63.053 1.00   64.22 ? 127  MET B CB    1 
ATOM   7106 C  CG    . MET B 2 115 ? 68.047  -41.338 -62.356 1.00   74.65 ? 127  MET B CG    1 
ATOM   7107 S  SD    . MET B 2 115 ? 69.815  -41.159 -62.002 1.00   81.14 ? 127  MET B SD    1 
ATOM   7108 C  CE    . MET B 2 115 ? 70.523  -41.291 -63.665 1.00   85.59 ? 127  MET B CE    1 
ATOM   7109 N  N     . THR B 2 116 ? 65.813  -37.291 -62.761 1.00   53.25 ? 128  THR B N     1 
ATOM   7110 C  CA    . THR B 2 116 ? 65.079  -36.246 -63.462 1.00   50.71 ? 128  THR B CA    1 
ATOM   7111 C  C     . THR B 2 116 ? 65.581  -34.848 -63.122 1.00   51.21 ? 128  THR B C     1 
ATOM   7112 O  O     . THR B 2 116 ? 65.753  -34.013 -64.008 1.00   51.84 ? 128  THR B O     1 
ATOM   7113 C  CB    . THR B 2 116 ? 63.581  -36.304 -63.134 1.00   48.04 ? 128  THR B CB    1 
ATOM   7114 O  OG1   . THR B 2 116 ? 63.040  -37.572 -63.535 1.00   44.85 ? 128  THR B OG1   1 
ATOM   7115 C  CG2   . THR B 2 116 ? 62.846  -35.198 -63.830 1.00   43.15 ? 128  THR B CG2   1 
ATOM   7116 N  N     . PHE B 2 117 ? 65.827  -34.590 -61.842 1.00   55.40 ? 129  PHE B N     1 
ATOM   7117 C  CA    . PHE B 2 117 ? 66.269  -33.264 -61.460 1.00   59.58 ? 129  PHE B CA    1 
ATOM   7118 C  C     . PHE B 2 117 ? 67.767  -33.074 -61.390 1.00   62.76 ? 129  PHE B C     1 
ATOM   7119 O  O     . PHE B 2 117 ? 68.253  -31.971 -61.131 1.00   66.36 ? 129  PHE B O     1 
ATOM   7120 C  CB    . PHE B 2 117 ? 65.587  -32.880 -60.161 1.00   56.08 ? 129  PHE B CB    1 
ATOM   7121 C  CG    . PHE B 2 117 ? 64.101  -32.740 -60.300 1.00   51.23 ? 129  PHE B CG    1 
ATOM   7122 C  CD1   . PHE B 2 117 ? 63.550  -31.589 -60.861 1.00   49.13 ? 129  PHE B CD1   1 
ATOM   7123 C  CD2   . PHE B 2 117 ? 63.260  -33.796 -59.984 1.00   48.38 ? 129  PHE B CD2   1 
ATOM   7124 C  CE1   . PHE B 2 117 ? 62.187  -31.503 -61.108 1.00   47.57 ? 129  PHE B CE1   1 
ATOM   7125 C  CE2   . PHE B 2 117 ? 61.900  -33.719 -60.224 1.00   47.54 ? 129  PHE B CE2   1 
ATOM   7126 C  CZ    . PHE B 2 117 ? 61.360  -32.571 -60.794 1.00   47.69 ? 129  PHE B CZ    1 
ATOM   7127 N  N     . LYS B 2 118 ? 68.505  -34.148 -61.645 1.00   69.22 ? 130  LYS B N     1 
ATOM   7128 C  CA    . LYS B 2 118 ? 69.963  -34.087 -61.632 1.00   75.48 ? 130  LYS B CA    1 
ATOM   7129 C  C     . LYS B 2 118 ? 70.516  -33.040 -62.615 1.00   77.84 ? 130  LYS B C     1 
ATOM   7130 O  O     . LYS B 2 118 ? 71.420  -32.284 -62.261 1.00   78.58 ? 130  LYS B O     1 
ATOM   7131 C  CB    . LYS B 2 118 ? 70.554  -35.463 -61.943 1.00   77.88 ? 130  LYS B CB    1 
ATOM   7132 C  CG    . LYS B 2 118 ? 71.922  -35.679 -61.335 1.00   80.50 ? 130  LYS B CG    1 
ATOM   7133 C  CD    . LYS B 2 118 ? 72.506  -37.029 -61.714 1.00   82.13 ? 130  LYS B CD    1 
ATOM   7134 C  CE    . LYS B 2 118 ? 73.938  -37.148 -61.193 1.00   83.21 ? 130  LYS B CE    1 
ATOM   7135 N  NZ    . LYS B 2 118 ? 74.639  -38.385 -61.647 1.00   84.34 ? 130  LYS B NZ    1 
ATOM   7136 N  N     . GLU B 2 119 ? 69.990  -32.992 -63.832 1.00   79.79 ? 131  GLU B N     1 
ATOM   7137 C  CA    . GLU B 2 119 ? 70.461  -32.007 -64.806 1.00   78.34 ? 131  GLU B CA    1 
ATOM   7138 C  C     . GLU B 2 119 ? 69.345  -31.032 -65.213 1.00   74.78 ? 131  GLU B C     1 
ATOM   7139 O  O     . GLU B 2 119 ? 69.496  -30.262 -66.160 1.00   72.96 ? 131  GLU B O     1 
ATOM   7140 C  CB    . GLU B 2 119 ? 71.029  -32.715 -66.047 1.00   80.39 ? 131  GLU B CB    1 
ATOM   7141 N  N     . ALA B 2 120 ? 68.226  -31.078 -64.488 1.00   67.80 ? 132  ALA B N     1 
ATOM   7142 C  CA    . ALA B 2 120 ? 67.088  -30.204 -64.744 1.00   61.90 ? 132  ALA B CA    1 
ATOM   7143 C  C     . ALA B 2 120 ? 67.507  -28.749 -64.538 1.00   59.97 ? 132  ALA B C     1 
ATOM   7144 O  O     . ALA B 2 120 ? 68.181  -28.421 -63.559 1.00   60.06 ? 132  ALA B O     1 
ATOM   7145 C  CB    . ALA B 2 120 ? 65.961  -30.566 -63.811 1.00   61.92 ? 132  ALA B CB    1 
ATOM   7146 N  N     . PRO B 2 121 ? 67.117  -27.855 -65.460 1.00   53.67 ? 133  PRO B N     1 
ATOM   7147 C  CA    . PRO B 2 121 ? 67.452  -26.429 -65.394 1.00   53.47 ? 133  PRO B CA    1 
ATOM   7148 C  C     . PRO B 2 121 ? 66.620  -25.747 -64.308 1.00   52.77 ? 133  PRO B C     1 
ATOM   7149 O  O     . PRO B 2 121 ? 65.410  -25.557 -64.465 1.00   51.47 ? 133  PRO B O     1 
ATOM   7150 C  CB    . PRO B 2 121 ? 67.094  -25.933 -66.791 1.00   52.64 ? 133  PRO B CB    1 
ATOM   7151 C  CG    . PRO B 2 121 ? 65.844  -26.703 -67.083 1.00   51.93 ? 133  PRO B CG    1 
ATOM   7152 C  CD    . PRO B 2 121 ? 66.137  -28.112 -66.538 1.00   55.23 ? 133  PRO B CD    1 
ATOM   7153 N  N     . VAL B 2 122 ? 67.268  -25.378 -63.214 1.00   51.04 ? 134  VAL B N     1 
ATOM   7154 C  CA    . VAL B 2 122 ? 66.582  -24.748 -62.101 1.00   50.81 ? 134  VAL B CA    1 
ATOM   7155 C  C     . VAL B 2 122 ? 67.353  -23.538 -61.585 1.00   52.72 ? 134  VAL B C     1 
ATOM   7156 O  O     . VAL B 2 122 ? 68.562  -23.608 -61.380 1.00   51.26 ? 134  VAL B O     1 
ATOM   7157 C  CB    . VAL B 2 122 ? 66.406  -25.750 -60.941 1.00   49.82 ? 134  VAL B CB    1 
ATOM   7158 C  CG1   . VAL B 2 122 ? 65.626  -25.107 -59.813 1.00   50.55 ? 134  VAL B CG1   1 
ATOM   7159 C  CG2   . VAL B 2 122 ? 65.691  -27.012 -61.431 1.00   48.86 ? 134  VAL B CG2   1 
ATOM   7160 N  N     . GLU B 2 123 ? 66.653  -22.429 -61.384 1.00   54.48 ? 135  GLU B N     1 
ATOM   7161 C  CA    . GLU B 2 123 ? 67.278  -21.227 -60.857 1.00   55.62 ? 135  GLU B CA    1 
ATOM   7162 C  C     . GLU B 2 123 ? 66.233  -20.435 -60.088 1.00   53.67 ? 135  GLU B C     1 
ATOM   7163 O  O     . GLU B 2 123 ? 65.086  -20.320 -60.518 1.00   51.92 ? 135  GLU B O     1 
ATOM   7164 C  CB    . GLU B 2 123 ? 67.899  -20.381 -61.975 1.00   61.25 ? 135  GLU B CB    1 
ATOM   7165 C  CG    . GLU B 2 123 ? 66.921  -19.673 -62.908 1.00   74.41 ? 135  GLU B CG    1 
ATOM   7166 C  CD    . GLU B 2 123 ? 66.223  -18.472 -62.266 1.00   80.53 ? 135  GLU B CD    1 
ATOM   7167 O  OE1   . GLU B 2 123 ? 66.917  -17.577 -61.721 1.00   82.75 ? 135  GLU B OE1   1 
ATOM   7168 O  OE2   . GLU B 2 123 ? 64.971  -18.426 -62.322 1.00   83.20 ? 135  GLU B OE2   1 
ATOM   7169 N  N     . GLY B 2 124 ? 66.633  -19.907 -58.936 1.00   50.72 ? 136  GLY B N     1 
ATOM   7170 C  CA    . GLY B 2 124 ? 65.717  -19.150 -58.103 1.00   47.38 ? 136  GLY B CA    1 
ATOM   7171 C  C     . GLY B 2 124 ? 64.467  -19.939 -57.748 1.00   46.33 ? 136  GLY B C     1 
ATOM   7172 O  O     . GLY B 2 124 ? 63.383  -19.370 -57.624 1.00   45.24 ? 136  GLY B O     1 
ATOM   7173 N  N     . GLY B 2 125 ? 64.618  -21.253 -57.600 1.00   46.64 ? 137  GLY B N     1 
ATOM   7174 C  CA    . GLY B 2 125 ? 63.499  -22.115 -57.256 1.00   47.51 ? 137  GLY B CA    1 
ATOM   7175 C  C     . GLY B 2 125 ? 62.474  -22.311 -58.360 1.00   47.98 ? 137  GLY B C     1 
ATOM   7176 O  O     . GLY B 2 125 ? 61.404  -22.873 -58.126 1.00   47.87 ? 137  GLY B O     1 
ATOM   7177 N  N     . LYS B 2 126 ? 62.802  -21.856 -59.563 1.00   48.86 ? 138  LYS B N     1 
ATOM   7178 C  CA    . LYS B 2 126 ? 61.885  -21.990 -60.694 1.00   50.61 ? 138  LYS B CA    1 
ATOM   7179 C  C     . LYS B 2 126 ? 62.420  -23.038 -61.665 1.00   49.87 ? 138  LYS B C     1 
ATOM   7180 O  O     . LYS B 2 126 ? 63.606  -23.060 -61.982 1.00   50.55 ? 138  LYS B O     1 
ATOM   7181 C  CB    . LYS B 2 126 ? 61.728  -20.656 -61.432 1.00   52.19 ? 138  LYS B CB    1 
ATOM   7182 C  CG    . LYS B 2 126 ? 61.492  -19.446 -60.557 1.00   54.13 ? 138  LYS B CG    1 
ATOM   7183 C  CD    . LYS B 2 126 ? 62.211  -18.258 -61.189 1.00   55.88 ? 138  LYS B CD    1 
ATOM   7184 C  CE    . LYS B 2 126 ? 62.753  -17.254 -60.159 1.00   56.83 ? 138  LYS B CE    1 
ATOM   7185 N  NZ    . LYS B 2 126 ? 64.035  -16.608 -60.628 1.00   56.26 ? 138  LYS B NZ    1 
ATOM   7186 N  N     . PHE B 2 127 ? 61.531  -23.894 -62.122 1.00   48.15 ? 139  PHE B N     1 
ATOM   7187 C  CA    . PHE B 2 127 ? 61.861  -24.956 -63.054 1.00   46.76 ? 139  PHE B CA    1 
ATOM   7188 C  C     . PHE B 2 127 ? 61.504  -24.457 -64.452 1.00   47.62 ? 139  PHE B C     1 
ATOM   7189 O  O     . PHE B 2 127 ? 60.346  -24.145 -64.726 1.00   43.77 ? 139  PHE B O     1 
ATOM   7190 C  CB    . PHE B 2 127 ? 61.025  -26.175 -62.717 1.00   46.36 ? 139  PHE B CB    1 
ATOM   7191 C  CG    . PHE B 2 127 ? 61.236  -27.344 -63.616 1.00   47.42 ? 139  PHE B CG    1 
ATOM   7192 C  CD1   . PHE B 2 127 ? 62.260  -28.244 -63.375 1.00   48.74 ? 139  PHE B CD1   1 
ATOM   7193 C  CD2   . PHE B 2 127 ? 60.342  -27.611 -64.647 1.00   47.74 ? 139  PHE B CD2   1 
ATOM   7194 C  CE1   . PHE B 2 127 ? 62.382  -29.410 -64.159 1.00   49.58 ? 139  PHE B CE1   1 
ATOM   7195 C  CE2   . PHE B 2 127 ? 60.457  -28.767 -65.428 1.00   47.46 ? 139  PHE B CE2   1 
ATOM   7196 C  CZ    . PHE B 2 127 ? 61.473  -29.666 -65.183 1.00   47.65 ? 139  PHE B CZ    1 
ATOM   7197 N  N     . ASP B 2 128 ? 62.505  -24.370 -65.321 1.00   46.67 ? 140  ASP B N     1 
ATOM   7198 C  CA    . ASP B 2 128 ? 62.293  -23.950 -66.684 1.00   47.03 ? 140  ASP B CA    1 
ATOM   7199 C  C     . ASP B 2 128 ? 61.837  -25.109 -67.549 1.00   47.49 ? 140  ASP B C     1 
ATOM   7200 O  O     . ASP B 2 128 ? 62.659  -25.802 -68.157 1.00   45.27 ? 140  ASP B O     1 
ATOM   7201 C  CB    . ASP B 2 128 ? 63.562  -23.335 -67.267 1.00   49.81 ? 140  ASP B CB    1 
ATOM   7202 C  CG    . ASP B 2 128 ? 63.314  -22.683 -68.613 1.00   55.38 ? 140  ASP B CG    1 
ATOM   7203 O  OD1   . ASP B 2 128 ? 62.299  -23.023 -69.257 1.00   58.00 ? 140  ASP B OD1   1 
ATOM   7204 O  OD2   . ASP B 2 128 ? 64.131  -21.834 -69.022 1.00   58.56 ? 140  ASP B OD2   1 
ATOM   7205 N  N     . TYR B 2 129 ? 60.530  -25.364 -67.585 1.00   48.56 ? 141  TYR B N     1 
ATOM   7206 C  CA    . TYR B 2 129 ? 59.987  -26.468 -68.371 1.00   49.59 ? 141  TYR B CA    1 
ATOM   7207 C  C     . TYR B 2 129 ? 60.137  -26.357 -69.891 1.00   51.09 ? 141  TYR B C     1 
ATOM   7208 O  O     . TYR B 2 129 ? 60.172  -27.381 -70.573 1.00   49.74 ? 141  TYR B O     1 
ATOM   7209 C  CB    . TYR B 2 129 ? 58.511  -26.717 -68.027 1.00   50.62 ? 141  TYR B CB    1 
ATOM   7210 C  CG    . TYR B 2 129 ? 57.552  -25.593 -68.346 1.00   53.64 ? 141  TYR B CG    1 
ATOM   7211 C  CD1   . TYR B 2 129 ? 57.089  -24.749 -67.331 1.00   53.90 ? 141  TYR B CD1   1 
ATOM   7212 C  CD2   . TYR B 2 129 ? 57.057  -25.408 -69.649 1.00   54.07 ? 141  TYR B CD2   1 
ATOM   7213 C  CE1   . TYR B 2 129 ? 56.153  -23.758 -67.585 1.00   54.78 ? 141  TYR B CE1   1 
ATOM   7214 C  CE2   . TYR B 2 129 ? 56.106  -24.409 -69.927 1.00   54.82 ? 141  TYR B CE2   1 
ATOM   7215 C  CZ    . TYR B 2 129 ? 55.656  -23.592 -68.881 1.00   56.14 ? 141  TYR B CZ    1 
ATOM   7216 O  OH    . TYR B 2 129 ? 54.678  -22.651 -69.088 1.00   55.68 ? 141  TYR B OH    1 
ATOM   7217 N  N     . VAL B 2 130 ? 60.224  -25.151 -70.432 1.00   54.32 ? 142  VAL B N     1 
ATOM   7218 C  CA    . VAL B 2 130 ? 60.376  -24.994 -71.874 1.00   55.79 ? 142  VAL B CA    1 
ATOM   7219 C  C     . VAL B 2 130 ? 61.789  -25.428 -72.268 1.00   55.37 ? 142  VAL B C     1 
ATOM   7220 O  O     . VAL B 2 130 ? 61.998  -26.026 -73.320 1.00   54.73 ? 142  VAL B O     1 
ATOM   7221 C  CB    . VAL B 2 130 ? 60.159  -23.523 -72.332 1.00   58.99 ? 142  VAL B CB    1 
ATOM   7222 C  CG1   . VAL B 2 130 ? 58.732  -23.089 -72.052 1.00   64.14 ? 142  VAL B CG1   1 
ATOM   7223 C  CG2   . VAL B 2 130 ? 61.129  -22.612 -71.611 1.00   64.77 ? 142  VAL B CG2   1 
ATOM   7224 N  N     . LYS B 2 131 ? 62.747  -25.116 -71.411 1.00   53.78 ? 143  LYS B N     1 
ATOM   7225 C  CA    . LYS B 2 131 ? 64.132  -25.471 -71.647 1.00   52.32 ? 143  LYS B CA    1 
ATOM   7226 C  C     . LYS B 2 131 ? 64.270  -26.978 -71.430 1.00   52.10 ? 143  LYS B C     1 
ATOM   7227 O  O     . LYS B 2 131 ? 64.908  -27.677 -72.227 1.00   51.75 ? 143  LYS B O     1 
ATOM   7228 C  CB    . LYS B 2 131 ? 65.017  -24.698 -70.677 1.00   52.56 ? 143  LYS B CB    1 
ATOM   7229 C  CG    . LYS B 2 131 ? 66.424  -24.438 -71.142 1.00   52.70 ? 143  LYS B CG    1 
ATOM   7230 C  CD    . LYS B 2 131 ? 67.020  -23.327 -70.298 1.00   53.05 ? 143  LYS B CD    1 
ATOM   7231 C  CE    . LYS B 2 131 ? 68.405  -22.916 -70.751 1.00   54.15 ? 143  LYS B CE    1 
ATOM   7232 N  NZ    . LYS B 2 131 ? 68.892  -21.700 -69.994 1.00   54.23 ? 143  LYS B NZ    1 
ATOM   7233 N  N     . PHE B 2 132 ? 63.666  -27.478 -70.342 1.00   50.76 ? 144  PHE B N     1 
ATOM   7234 C  CA    . PHE B 2 132 ? 63.696  -28.902 -70.019 1.00   49.69 ? 144  PHE B CA    1 
ATOM   7235 C  C     . PHE B 2 132 ? 63.004  -29.716 -71.107 1.00   50.07 ? 144  PHE B C     1 
ATOM   7236 O  O     . PHE B 2 132 ? 63.331  -30.885 -71.323 1.00   50.66 ? 144  PHE B O     1 
ATOM   7237 C  CB    . PHE B 2 132 ? 63.012  -29.159 -68.680 1.00   46.81 ? 144  PHE B CB    1 
ATOM   7238 C  CG    . PHE B 2 132 ? 62.898  -30.619 -68.317 1.00   42.89 ? 144  PHE B CG    1 
ATOM   7239 C  CD1   . PHE B 2 132 ? 61.776  -31.356 -68.681 1.00   42.67 ? 144  PHE B CD1   1 
ATOM   7240 C  CD2   . PHE B 2 132 ? 63.911  -31.253 -67.612 1.00   41.49 ? 144  PHE B CD2   1 
ATOM   7241 C  CE1   . PHE B 2 132 ? 61.663  -32.709 -68.349 1.00   41.97 ? 144  PHE B CE1   1 
ATOM   7242 C  CE2   . PHE B 2 132 ? 63.815  -32.596 -67.270 1.00   42.34 ? 144  PHE B CE2   1 
ATOM   7243 C  CZ    . PHE B 2 132 ? 62.692  -33.330 -67.638 1.00   42.60 ? 144  PHE B CZ    1 
ATOM   7244 N  N     . THR B 2 133 ? 62.049  -29.098 -71.799 1.00   51.37 ? 145  THR B N     1 
ATOM   7245 C  CA    . THR B 2 133 ? 61.336  -29.784 -72.878 1.00   53.71 ? 145  THR B CA    1 
ATOM   7246 C  C     . THR B 2 133 ? 62.242  -29.872 -74.109 1.00   55.15 ? 145  THR B C     1 
ATOM   7247 O  O     . THR B 2 133 ? 62.297  -30.899 -74.771 1.00   56.78 ? 145  THR B O     1 
ATOM   7248 C  CB    . THR B 2 133 ? 60.045  -29.042 -73.252 1.00   52.36 ? 145  THR B CB    1 
ATOM   7249 O  OG1   . THR B 2 133 ? 59.190  -28.984 -72.106 1.00   49.51 ? 145  THR B OG1   1 
ATOM   7250 C  CG2   . THR B 2 133 ? 59.311  -29.760 -74.386 1.00   48.82 ? 145  THR B CG2   1 
ATOM   7251 N  N     . ALA B 2 134 ? 62.943  -28.779 -74.405 1.00   58.57 ? 146  ALA B N     1 
ATOM   7252 C  CA    . ALA B 2 134 ? 63.857  -28.740 -75.546 1.00   62.09 ? 146  ALA B CA    1 
ATOM   7253 C  C     . ALA B 2 134 ? 64.935  -29.781 -75.315 1.00   63.62 ? 146  ALA B C     1 
ATOM   7254 O  O     . ALA B 2 134 ? 65.390  -30.443 -76.240 1.00   64.64 ? 146  ALA B O     1 
ATOM   7255 C  CB    . ALA B 2 134 ? 64.504  -27.346 -75.673 1.00   60.81 ? 146  ALA B CB    1 
ATOM   7256 N  N     . MET B 2 135 ? 65.320  -29.917 -74.051 1.00   66.25 ? 147  MET B N     1 
ATOM   7257 C  CA    . MET B 2 135 ? 66.353  -30.848 -73.637 1.00   68.81 ? 147  MET B CA    1 
ATOM   7258 C  C     . MET B 2 135 ? 65.936  -32.312 -73.681 1.00   70.02 ? 147  MET B C     1 
ATOM   7259 O  O     . MET B 2 135 ? 66.749  -33.179 -74.001 1.00   71.58 ? 147  MET B O     1 
ATOM   7260 C  CB    . MET B 2 135 ? 66.819  -30.499 -72.225 1.00   71.27 ? 147  MET B CB    1 
ATOM   7261 C  CG    . MET B 2 135 ? 67.844  -31.456 -71.654 1.00   72.61 ? 147  MET B CG    1 
ATOM   7262 S  SD    . MET B 2 135 ? 68.210  -31.157 -69.917 1.00   76.39 ? 147  MET B SD    1 
ATOM   7263 C  CE    . MET B 2 135 ? 68.008  -29.354 -69.797 1.00   75.02 ? 147  MET B CE    1 
ATOM   7264 N  N     . ILE B 2 136 ? 64.690  -32.595 -73.357 1.00   69.15 ? 148  ILE B N     1 
ATOM   7265 C  CA    . ILE B 2 136 ? 64.234  -33.971 -73.370 1.00   67.80 ? 148  ILE B CA    1 
ATOM   7266 C  C     . ILE B 2 136 ? 64.092  -34.455 -74.817 1.00   69.00 ? 148  ILE B C     1 
ATOM   7267 O  O     . ILE B 2 136 ? 64.427  -35.589 -75.140 1.00   66.26 ? 148  ILE B O     1 
ATOM   7268 C  CB    . ILE B 2 136 ? 62.874  -34.108 -72.656 1.00   69.17 ? 148  ILE B CB    1 
ATOM   7269 C  CG1   . ILE B 2 136 ? 62.377  -35.548 -72.759 1.00   68.79 ? 148  ILE B CG1   1 
ATOM   7270 C  CG2   . ILE B 2 136 ? 61.853  -33.159 -73.289 1.00   68.05 ? 148  ILE B CG2   1 
ATOM   7271 C  CD1   . ILE B 2 136 ? 60.958  -35.724 -72.281 1.00   69.87 ? 148  ILE B CD1   1 
ATOM   7272 N  N     . LYS B 2 137 ? 63.600  -33.568 -75.672 1.00   69.84 ? 149  LYS B N     1 
ATOM   7273 C  CA    . LYS B 2 137 ? 63.381  -33.866 -77.075 1.00   70.40 ? 149  LYS B CA    1 
ATOM   7274 C  C     . LYS B 2 137 ? 64.641  -33.744 -77.915 1.00   71.33 ? 149  LYS B C     1 
ATOM   7275 O  O     . LYS B 2 137 ? 64.571  -33.437 -79.111 1.00   71.57 ? 149  LYS B O     1 
ATOM   7276 C  CB    . LYS B 2 137 ? 62.311  -32.936 -77.643 1.00   70.08 ? 149  LYS B CB    1 
ATOM   7277 C  CG    . LYS B 2 137 ? 60.908  -33.409 -77.383 1.00   70.11 ? 149  LYS B CG    1 
ATOM   7278 C  CD    . LYS B 2 137 ? 60.710  -34.765 -78.020 1.00   70.17 ? 149  LYS B CD    1 
ATOM   7279 C  CE    . LYS B 2 137 ? 59.328  -35.278 -77.783 1.00   70.61 ? 149  LYS B CE    1 
ATOM   7280 N  NZ    . LYS B 2 137 ? 59.173  -36.658 -78.320 1.00   70.84 ? 149  LYS B NZ    1 
ATOM   7281 N  N     . GLY B 2 138 ? 65.794  -33.986 -77.298 1.00   78.11 ? 150  GLY B N     1 
ATOM   7282 C  CA    . GLY B 2 138 ? 67.040  -33.888 -78.045 1.00   81.11 ? 150  GLY B CA    1 
ATOM   7283 C  C     . GLY B 2 138 ? 67.733  -32.541 -78.152 1.00   82.95 ? 150  GLY B C     1 
ATOM   7284 O  O     . GLY B 2 138 ? 68.964  -32.502 -78.222 1.00   84.36 ? 150  GLY B O     1 
ATOM   7285 N  N     . SER B 2 139 ? 66.986  -31.440 -78.137 1.00   83.66 ? 151  SER B N     1 
ATOM   7286 C  CA    . SER B 2 139 ? 67.611  -30.126 -78.285 1.00   84.28 ? 151  SER B CA    1 
ATOM   7287 C  C     . SER B 2 139 ? 68.324  -29.665 -77.013 1.00   84.46 ? 151  SER B C     1 
ATOM   7288 O  O     . SER B 2 139 ? 68.374  -28.434 -76.798 1.00   84.94 ? 151  SER B O     1 
ATOM   7289 C  CB    . SER B 2 139 ? 66.558  -29.086 -78.693 1.00   84.75 ? 151  SER B CB    1 
ATOM   7290 O  OG    . SER B 2 139 ? 66.558  -28.868 -80.086 1.00   84.69 ? 151  SER B OG    1 
ATOM   7291 N  N     . PRO C 3 1   ? 19.889  -45.078 -52.002 1.00   88.45 ? 1    PRO C N     1 
ATOM   7292 C  CA    . PRO C 3 1   ? 19.167  -44.773 -53.267 1.00   86.87 ? 1    PRO C CA    1 
ATOM   7293 C  C     . PRO C 3 1   ? 19.278  -45.952 -54.224 1.00   87.95 ? 1    PRO C C     1 
ATOM   7294 O  O     . PRO C 3 1   ? 20.099  -46.849 -54.027 1.00   86.48 ? 1    PRO C O     1 
ATOM   7295 C  CB    . PRO C 3 1   ? 19.758  -43.520 -53.916 1.00   89.41 ? 1    PRO C CB    1 
ATOM   7296 N  N     . LYS C 3 2   ? 18.442  -45.949 -55.258 1.00   84.47 ? 2    LYS C N     1 
ATOM   7297 C  CA    . LYS C 3 2   ? 18.457  -47.003 -56.269 1.00   79.68 ? 2    LYS C CA    1 
ATOM   7298 C  C     . LYS C 3 2   ? 19.240  -46.493 -57.473 1.00   76.75 ? 2    LYS C C     1 
ATOM   7299 O  O     . LYS C 3 2   ? 18.677  -46.255 -58.542 1.00   72.11 ? 2    LYS C O     1 
ATOM   7300 C  CB    . LYS C 3 2   ? 17.032  -47.356 -56.706 1.00   80.40 ? 2    LYS C CB    1 
ATOM   7301 C  CG    . LYS C 3 2   ? 16.279  -48.302 -55.783 1.00   84.02 ? 2    LYS C CG    1 
ATOM   7302 C  CD    . LYS C 3 2   ? 16.413  -49.747 -56.240 1.00   86.49 ? 2    LYS C CD    1 
ATOM   7303 C  CE    . LYS C 3 2   ? 15.505  -50.671 -55.438 1.00   87.43 ? 2    LYS C CE    1 
ATOM   7304 N  NZ    . LYS C 3 2   ? 15.608  -52.091 -55.881 1.00   87.34 ? 2    LYS C NZ    1 
ATOM   7305 N  N     . LEU C 3 3   ? 20.543  -46.318 -57.281 1.00   73.32 ? 3    LEU C N     1 
ATOM   7306 C  CA    . LEU C 3 3   ? 21.413  -45.836 -58.340 1.00   71.43 ? 3    LEU C CA    1 
ATOM   7307 C  C     . LEU C 3 3   ? 21.334  -46.739 -59.555 1.00   71.53 ? 3    LEU C C     1 
ATOM   7308 O  O     . LEU C 3 3   ? 21.323  -47.962 -59.437 1.00   73.97 ? 3    LEU C O     1 
ATOM   7309 C  CB    . LEU C 3 3   ? 22.857  -45.781 -57.855 1.00   67.98 ? 3    LEU C CB    1 
ATOM   7310 C  CG    . LEU C 3 3   ? 23.124  -44.867 -56.671 1.00   63.76 ? 3    LEU C CG    1 
ATOM   7311 C  CD1   . LEU C 3 3   ? 24.583  -44.964 -56.303 1.00   61.72 ? 3    LEU C CD1   1 
ATOM   7312 C  CD2   . LEU C 3 3   ? 22.742  -43.443 -57.029 1.00   61.79 ? 3    LEU C CD2   1 
ATOM   7313 N  N     . SER C 3 4   ? 21.280  -46.117 -60.724 1.00   74.40 ? 4    SER C N     1 
ATOM   7314 C  CA    . SER C 3 4   ? 21.212  -46.840 -61.980 1.00   78.57 ? 4    SER C CA    1 
ATOM   7315 C  C     . SER C 3 4   ? 22.611  -47.266 -62.391 1.00   81.23 ? 4    SER C C     1 
ATOM   7316 O  O     . SER C 3 4   ? 23.547  -47.209 -61.593 1.00   82.18 ? 4    SER C O     1 
ATOM   7317 C  CB    . SER C 3 4   ? 20.616  -45.945 -63.065 1.00   80.46 ? 4    SER C CB    1 
ATOM   7318 O  OG    . SER C 3 4   ? 21.383  -44.766 -63.234 1.00   79.71 ? 4    SER C OG    1 
ATOM   7319 N  N     . GLN C 3 5   ? 22.754  -47.692 -63.637 1.00   82.95 ? 5    GLN C N     1 
ATOM   7320 C  CA    . GLN C 3 5   ? 24.054  -48.110 -64.119 1.00   81.54 ? 5    GLN C CA    1 
ATOM   7321 C  C     . GLN C 3 5   ? 24.839  -46.856 -64.466 1.00   78.98 ? 5    GLN C C     1 
ATOM   7322 O  O     . GLN C 3 5   ? 25.965  -46.664 -64.010 1.00   74.67 ? 5    GLN C O     1 
ATOM   7323 C  CB    . GLN C 3 5   ? 23.907  -48.998 -65.356 1.00   85.05 ? 5    GLN C CB    1 
ATOM   7324 C  CG    . GLN C 3 5   ? 25.226  -49.631 -65.808 1.00   93.70 ? 5    GLN C CG    1 
ATOM   7325 C  CD    . GLN C 3 5   ? 25.973  -50.291 -64.650 1.00   97.70 ? 5    GLN C CD    1 
ATOM   7326 O  OE1   . GLN C 3 5   ? 25.530  -51.304 -64.105 1.00   99.28 ? 5    GLN C OE1   1 
ATOM   7327 N  NE2   . GLN C 3 5   ? 27.105  -49.707 -64.262 1.00   99.07 ? 5    GLN C NE2   1 
ATOM   7328 N  N     . ASP C 3 6   ? 24.223  -46.007 -65.277 1.00   74.22 ? 6    ASP C N     1 
ATOM   7329 C  CA    . ASP C 3 6   ? 24.832  -44.759 -65.715 1.00   70.26 ? 6    ASP C CA    1 
ATOM   7330 C  C     . ASP C 3 6   ? 25.424  -43.949 -64.559 1.00   69.29 ? 6    ASP C C     1 
ATOM   7331 O  O     . ASP C 3 6   ? 26.505  -43.371 -64.687 1.00   66.33 ? 6    ASP C O     1 
ATOM   7332 C  CB    . ASP C 3 6   ? 23.802  -43.926 -66.458 1.00   68.80 ? 6    ASP C CB    1 
ATOM   7333 N  N     . GLU C 3 7   ? 24.711  -43.910 -63.432 1.00   68.67 ? 7    GLU C N     1 
ATOM   7334 C  CA    . GLU C 3 7   ? 25.166  -43.167 -62.260 1.00   67.63 ? 7    GLU C CA    1 
ATOM   7335 C  C     . GLU C 3 7   ? 26.332  -43.832 -61.528 1.00   66.10 ? 7    GLU C C     1 
ATOM   7336 O  O     . GLU C 3 7   ? 27.199  -43.144 -61.000 1.00   64.37 ? 7    GLU C O     1 
ATOM   7337 C  CB    . GLU C 3 7   ? 24.002  -42.948 -61.293 1.00   70.33 ? 7    GLU C CB    1 
ATOM   7338 C  CG    . GLU C 3 7   ? 22.918  -42.036 -61.841 1.00   76.78 ? 7    GLU C CG    1 
ATOM   7339 C  CD    . GLU C 3 7   ? 21.767  -41.858 -60.866 1.00   80.03 ? 7    GLU C CD    1 
ATOM   7340 O  OE1   . GLU C 3 7   ? 21.173  -42.885 -60.453 1.00   81.06 ? 7    GLU C OE1   1 
ATOM   7341 O  OE2   . GLU C 3 7   ? 21.460  -40.694 -60.515 1.00   80.96 ? 7    GLU C OE2   1 
ATOM   7342 N  N     . ILE C 3 8   ? 26.365  -45.162 -61.490 1.00   64.59 ? 8    ILE C N     1 
ATOM   7343 C  CA    . ILE C 3 8   ? 27.479  -45.827 -60.832 1.00   62.57 ? 8    ILE C CA    1 
ATOM   7344 C  C     . ILE C 3 8   ? 28.688  -45.688 -61.752 1.00   63.42 ? 8    ILE C C     1 
ATOM   7345 O  O     . ILE C 3 8   ? 29.836  -45.745 -61.309 1.00   61.36 ? 8    ILE C O     1 
ATOM   7346 C  CB    . ILE C 3 8   ? 27.175  -47.304 -60.557 1.00   62.13 ? 8    ILE C CB    1 
ATOM   7347 C  CG1   . ILE C 3 8   ? 26.022  -47.403 -59.552 1.00   62.59 ? 8    ILE C CG1   1 
ATOM   7348 C  CG2   . ILE C 3 8   ? 28.408  -48.000 -59.981 1.00   62.39 ? 8    ILE C CG2   1 
ATOM   7349 C  CD1   . ILE C 3 8   ? 25.589  -48.826 -59.221 1.00   63.29 ? 8    ILE C CD1   1 
ATOM   7350 N  N     . ASP C 3 9   ? 28.416  -45.490 -63.040 1.00   65.03 ? 9    ASP C N     1 
ATOM   7351 C  CA    . ASP C 3 9   ? 29.471  -45.297 -64.026 1.00   65.74 ? 9    ASP C CA    1 
ATOM   7352 C  C     . ASP C 3 9   ? 30.063  -43.912 -63.796 1.00   65.96 ? 9    ASP C C     1 
ATOM   7353 O  O     . ASP C 3 9   ? 31.277  -43.725 -63.838 1.00   63.67 ? 9    ASP C O     1 
ATOM   7354 C  CB    . ASP C 3 9   ? 28.917  -45.391 -65.455 1.00   68.84 ? 9    ASP C CB    1 
ATOM   7355 C  CG    . ASP C 3 9   ? 28.490  -46.811 -65.842 1.00   74.85 ? 9    ASP C CG    1 
ATOM   7356 O  OD1   . ASP C 3 9   ? 28.947  -47.779 -65.183 1.00   78.00 ? 9    ASP C OD1   1 
ATOM   7357 O  OD2   . ASP C 3 9   ? 27.705  -46.961 -66.816 1.00   77.79 ? 9    ASP C OD2   1 
ATOM   7358 N  N     . ASP C 3 10  ? 29.195  -42.931 -63.573 1.00   66.41 ? 10   ASP C N     1 
ATOM   7359 C  CA    . ASP C 3 10  ? 29.650  -41.566 -63.315 1.00   65.84 ? 10   ASP C CA    1 
ATOM   7360 C  C     . ASP C 3 10  ? 30.479  -41.545 -62.030 1.00   63.47 ? 10   ASP C C     1 
ATOM   7361 O  O     . ASP C 3 10  ? 31.483  -40.841 -61.944 1.00   60.89 ? 10   ASP C O     1 
ATOM   7362 C  CB    . ASP C 3 10  ? 28.459  -40.608 -63.176 1.00   72.51 ? 10   ASP C CB    1 
ATOM   7363 C  CG    . ASP C 3 10  ? 27.630  -40.507 -64.458 1.00   81.91 ? 10   ASP C CG    1 
ATOM   7364 O  OD1   . ASP C 3 10  ? 28.225  -40.415 -65.557 1.00   86.62 ? 10   ASP C OD1   1 
ATOM   7365 O  OD2   . ASP C 3 10  ? 26.383  -40.508 -64.366 1.00   86.83 ? 10   ASP C OD2   1 
ATOM   7366 N  N     . LEU C 3 11  ? 30.053  -42.320 -61.042 1.00   59.66 ? 11   LEU C N     1 
ATOM   7367 C  CA    . LEU C 3 11  ? 30.763  -42.396 -59.775 1.00   55.43 ? 11   LEU C CA    1 
ATOM   7368 C  C     . LEU C 3 11  ? 32.139  -43.016 -59.983 1.00   54.89 ? 11   LEU C C     1 
ATOM   7369 O  O     . LEU C 3 11  ? 33.133  -42.524 -59.453 1.00   51.89 ? 11   LEU C O     1 
ATOM   7370 C  CB    . LEU C 3 11  ? 29.963  -43.225 -58.759 1.00   52.80 ? 11   LEU C CB    1 
ATOM   7371 C  CG    . LEU C 3 11  ? 30.604  -43.535 -57.401 1.00   53.02 ? 11   LEU C CG    1 
ATOM   7372 C  CD1   . LEU C 3 11  ? 30.888  -42.243 -56.618 1.00   53.05 ? 11   LEU C CD1   1 
ATOM   7373 C  CD2   . LEU C 3 11  ? 29.677  -44.443 -56.612 1.00   52.88 ? 11   LEU C CD2   1 
ATOM   7374 N  N     . LYS C 3 12  ? 32.200  -44.099 -60.755 1.00   56.81 ? 12   LYS C N     1 
ATOM   7375 C  CA    . LYS C 3 12  ? 33.476  -44.752 -61.007 1.00   57.89 ? 12   LYS C CA    1 
ATOM   7376 C  C     . LYS C 3 12  ? 34.428  -43.799 -61.737 1.00   56.63 ? 12   LYS C C     1 
ATOM   7377 O  O     . LYS C 3 12  ? 35.614  -43.734 -61.404 1.00   56.42 ? 12   LYS C O     1 
ATOM   7378 C  CB    . LYS C 3 12  ? 33.282  -46.055 -61.796 1.00   63.25 ? 12   LYS C CB    1 
ATOM   7379 C  CG    . LYS C 3 12  ? 32.608  -45.908 -63.156 1.00   73.43 ? 12   LYS C CG    1 
ATOM   7380 C  CD    . LYS C 3 12  ? 33.374  -46.632 -64.305 1.00   78.37 ? 12   LYS C CD    1 
ATOM   7381 C  CE    . LYS C 3 12  ? 32.837  -46.213 -65.690 1.00   79.94 ? 12   LYS C CE    1 
ATOM   7382 N  NZ    . LYS C 3 12  ? 33.615  -46.746 -66.837 1.00   80.55 ? 12   LYS C NZ    1 
ATOM   7383 N  N     . ASP C 3 13  ? 33.919  -43.050 -62.713 1.00   54.30 ? 13   ASP C N     1 
ATOM   7384 C  CA    . ASP C 3 13  ? 34.743  -42.091 -63.445 1.00   51.63 ? 13   ASP C CA    1 
ATOM   7385 C  C     . ASP C 3 13  ? 35.357  -41.031 -62.537 1.00   50.81 ? 13   ASP C C     1 
ATOM   7386 O  O     . ASP C 3 13  ? 36.533  -40.683 -62.683 1.00   48.67 ? 13   ASP C O     1 
ATOM   7387 C  CB    . ASP C 3 13  ? 33.920  -41.394 -64.542 1.00   51.38 ? 13   ASP C CB    1 
ATOM   7388 N  N     . VAL C 3 14  ? 34.561  -40.516 -61.596 1.00   48.61 ? 14   VAL C N     1 
ATOM   7389 C  CA    . VAL C 3 14  ? 35.033  -39.472 -60.706 1.00   46.09 ? 14   VAL C CA    1 
ATOM   7390 C  C     . VAL C 3 14  ? 36.032  -40.040 -59.732 1.00   45.59 ? 14   VAL C C     1 
ATOM   7391 O  O     . VAL C 3 14  ? 37.058  -39.423 -59.452 1.00   44.01 ? 14   VAL C O     1 
ATOM   7392 C  CB    . VAL C 3 14  ? 33.843  -38.807 -59.943 1.00   47.63 ? 14   VAL C CB    1 
ATOM   7393 C  CG1   . VAL C 3 14  ? 34.380  -37.832 -58.895 1.00   47.88 ? 14   VAL C CG1   1 
ATOM   7394 C  CG2   . VAL C 3 14  ? 32.915  -38.050 -60.945 1.00   47.56 ? 14   VAL C CG2   1 
ATOM   7395 N  N     . PHE C 3 15  ? 35.729  -41.218 -59.212 1.00   44.18 ? 15   PHE C N     1 
ATOM   7396 C  CA    . PHE C 3 15  ? 36.623  -41.887 -58.279 1.00   43.23 ? 15   PHE C CA    1 
ATOM   7397 C  C     . PHE C 3 15  ? 38.002  -42.074 -58.939 1.00   43.58 ? 15   PHE C C     1 
ATOM   7398 O  O     . PHE C 3 15  ? 39.035  -41.747 -58.340 1.00   43.53 ? 15   PHE C O     1 
ATOM   7399 C  CB    . PHE C 3 15  ? 36.016  -43.239 -57.890 1.00   44.41 ? 15   PHE C CB    1 
ATOM   7400 C  CG    . PHE C 3 15  ? 36.914  -44.104 -57.053 1.00   45.91 ? 15   PHE C CG    1 
ATOM   7401 C  CD1   . PHE C 3 15  ? 37.951  -44.828 -57.636 1.00   46.44 ? 15   PHE C CD1   1 
ATOM   7402 C  CD2   . PHE C 3 15  ? 36.730  -44.188 -55.686 1.00   46.39 ? 15   PHE C CD2   1 
ATOM   7403 C  CE1   . PHE C 3 15  ? 38.798  -45.626 -56.861 1.00   46.75 ? 15   PHE C CE1   1 
ATOM   7404 C  CE2   . PHE C 3 15  ? 37.575  -44.988 -54.900 1.00   47.51 ? 15   PHE C CE2   1 
ATOM   7405 C  CZ    . PHE C 3 15  ? 38.610  -45.705 -55.497 1.00   46.31 ? 15   PHE C CZ    1 
ATOM   7406 N  N     . GLU C 3 16  ? 38.007  -42.595 -60.171 1.00   43.74 ? 16   GLU C N     1 
ATOM   7407 C  CA    . GLU C 3 16  ? 39.228  -42.834 -60.932 1.00   44.14 ? 16   GLU C CA    1 
ATOM   7408 C  C     . GLU C 3 16  ? 40.051  -41.559 -61.048 1.00   44.02 ? 16   GLU C C     1 
ATOM   7409 O  O     . GLU C 3 16  ? 41.238  -41.551 -60.691 1.00   46.17 ? 16   GLU C O     1 
ATOM   7410 C  CB    . GLU C 3 16  ? 38.884  -43.395 -62.341 1.00   44.24 ? 16   GLU C CB    1 
ATOM   7411 N  N     . LEU C 3 17  ? 39.446  -40.480 -61.529 1.00   44.20 ? 17   LEU C N     1 
ATOM   7412 C  CA    . LEU C 3 17  ? 40.160  -39.207 -61.616 1.00   44.68 ? 17   LEU C CA    1 
ATOM   7413 C  C     . LEU C 3 17  ? 40.759  -38.893 -60.244 1.00   45.39 ? 17   LEU C C     1 
ATOM   7414 O  O     . LEU C 3 17  ? 41.967  -38.654 -60.128 1.00   46.38 ? 17   LEU C O     1 
ATOM   7415 C  CB    . LEU C 3 17  ? 39.227  -38.058 -62.040 1.00   43.53 ? 17   LEU C CB    1 
ATOM   7416 C  CG    . LEU C 3 17  ? 39.899  -36.668 -62.037 1.00   43.56 ? 17   LEU C CG    1 
ATOM   7417 C  CD1   . LEU C 3 17  ? 41.107  -36.732 -62.959 1.00   41.32 ? 17   LEU C CD1   1 
ATOM   7418 C  CD2   . LEU C 3 17  ? 38.924  -35.551 -62.474 1.00   41.50 ? 17   LEU C CD2   1 
ATOM   7419 N  N     . PHE C 3 18  ? 39.939  -38.888 -59.198 1.00   45.39 ? 18   PHE C N     1 
ATOM   7420 C  CA    . PHE C 3 18  ? 40.465  -38.601 -57.868 1.00   44.40 ? 18   PHE C CA    1 
ATOM   7421 C  C     . PHE C 3 18  ? 41.511  -39.608 -57.377 1.00   43.74 ? 18   PHE C C     1 
ATOM   7422 O  O     . PHE C 3 18  ? 42.387  -39.243 -56.600 1.00   41.55 ? 18   PHE C O     1 
ATOM   7423 C  CB    . PHE C 3 18  ? 39.329  -38.460 -56.855 1.00   44.74 ? 18   PHE C CB    1 
ATOM   7424 C  CG    . PHE C 3 18  ? 38.756  -37.057 -56.787 1.00   45.53 ? 18   PHE C CG    1 
ATOM   7425 C  CD1   . PHE C 3 18  ? 38.007  -36.537 -57.841 1.00   45.02 ? 18   PHE C CD1   1 
ATOM   7426 C  CD2   . PHE C 3 18  ? 39.008  -36.238 -55.692 1.00   46.02 ? 18   PHE C CD2   1 
ATOM   7427 C  CE1   . PHE C 3 18  ? 37.523  -35.231 -57.809 1.00   44.38 ? 18   PHE C CE1   1 
ATOM   7428 C  CE2   . PHE C 3 18  ? 38.525  -34.924 -55.660 1.00   45.94 ? 18   PHE C CE2   1 
ATOM   7429 C  CZ    . PHE C 3 18  ? 37.783  -34.426 -56.722 1.00   44.76 ? 18   PHE C CZ    1 
ATOM   7430 N  N     . ASP C 3 19  ? 41.431  -40.862 -57.817 1.00   43.19 ? 19   ASP C N     1 
ATOM   7431 C  CA    . ASP C 3 19  ? 42.425  -41.830 -57.376 1.00   43.01 ? 19   ASP C CA    1 
ATOM   7432 C  C     . ASP C 3 19  ? 43.746  -41.509 -58.050 1.00   43.07 ? 19   ASP C C     1 
ATOM   7433 O  O     . ASP C 3 19  ? 44.821  -41.794 -57.529 1.00   42.76 ? 19   ASP C O     1 
ATOM   7434 C  CB    . ASP C 3 19  ? 42.003  -43.253 -57.727 1.00   43.74 ? 19   ASP C CB    1 
ATOM   7435 C  CG    . ASP C 3 19  ? 43.130  -44.241 -57.558 1.00   44.58 ? 19   ASP C CG    1 
ATOM   7436 O  OD1   . ASP C 3 19  ? 43.950  -44.058 -56.624 1.00   43.64 ? 19   ASP C OD1   1 
ATOM   7437 O  OD2   . ASP C 3 19  ? 43.191  -45.199 -58.362 1.00   46.33 ? 19   ASP C OD2   1 
ATOM   7438 N  N     . PHE C 3 20  ? 43.650  -40.900 -59.225 1.00   44.26 ? 20   PHE C N     1 
ATOM   7439 C  CA    . PHE C 3 20  ? 44.832  -40.511 -59.973 1.00   44.15 ? 20   PHE C CA    1 
ATOM   7440 C  C     . PHE C 3 20  ? 45.544  -39.363 -59.269 1.00   43.85 ? 20   PHE C C     1 
ATOM   7441 O  O     . PHE C 3 20  ? 46.767  -39.393 -59.113 1.00   43.38 ? 20   PHE C O     1 
ATOM   7442 C  CB    . PHE C 3 20  ? 44.431  -40.099 -61.389 1.00   44.46 ? 20   PHE C CB    1 
ATOM   7443 C  CG    . PHE C 3 20  ? 45.567  -39.604 -62.237 1.00   44.99 ? 20   PHE C CG    1 
ATOM   7444 C  CD1   . PHE C 3 20  ? 46.029  -38.298 -62.116 1.00   44.61 ? 20   PHE C CD1   1 
ATOM   7445 C  CD2   . PHE C 3 20  ? 46.147  -40.435 -63.201 1.00   45.49 ? 20   PHE C CD2   1 
ATOM   7446 C  CE1   . PHE C 3 20  ? 47.056  -37.819 -62.958 1.00   45.62 ? 20   PHE C CE1   1 
ATOM   7447 C  CE2   . PHE C 3 20  ? 47.163  -39.964 -64.035 1.00   45.61 ? 20   PHE C CE2   1 
ATOM   7448 C  CZ    . PHE C 3 20  ? 47.617  -38.651 -63.913 1.00   44.12 ? 20   PHE C CZ    1 
ATOM   7449 N  N     . TRP C 3 21  ? 44.788  -38.355 -58.832 1.00   44.13 ? 21   TRP C N     1 
ATOM   7450 C  CA    . TRP C 3 21  ? 45.424  -37.213 -58.193 1.00   45.48 ? 21   TRP C CA    1 
ATOM   7451 C  C     . TRP C 3 21  ? 46.161  -37.378 -56.870 1.00   47.05 ? 21   TRP C C     1 
ATOM   7452 O  O     . TRP C 3 21  ? 47.082  -36.602 -56.600 1.00   47.46 ? 21   TRP C O     1 
ATOM   7453 C  CB    . TRP C 3 21  ? 44.458  -36.035 -58.139 1.00   42.42 ? 21   TRP C CB    1 
ATOM   7454 C  CG    . TRP C 3 21  ? 44.401  -35.416 -59.497 1.00   40.78 ? 21   TRP C CG    1 
ATOM   7455 C  CD1   . TRP C 3 21  ? 43.359  -35.464 -60.385 1.00   38.75 ? 21   TRP C CD1   1 
ATOM   7456 C  CD2   . TRP C 3 21  ? 45.457  -34.702 -60.156 1.00   39.30 ? 21   TRP C CD2   1 
ATOM   7457 N  NE1   . TRP C 3 21  ? 43.701  -34.821 -61.553 1.00   39.43 ? 21   TRP C NE1   1 
ATOM   7458 C  CE2   . TRP C 3 21  ? 44.982  -34.338 -61.443 1.00   38.58 ? 21   TRP C CE2   1 
ATOM   7459 C  CE3   . TRP C 3 21  ? 46.752  -34.331 -59.787 1.00   38.07 ? 21   TRP C CE3   1 
ATOM   7460 C  CZ2   . TRP C 3 21  ? 45.752  -33.625 -62.359 1.00   36.95 ? 21   TRP C CZ2   1 
ATOM   7461 C  CZ3   . TRP C 3 21  ? 47.532  -33.614 -60.714 1.00   39.39 ? 21   TRP C CZ3   1 
ATOM   7462 C  CH2   . TRP C 3 21  ? 47.021  -33.273 -61.983 1.00   37.12 ? 21   TRP C CH2   1 
ATOM   7463 N  N     . ASP C 3 22  ? 45.796  -38.340 -56.033 1.00   48.91 ? 22   ASP C N     1 
ATOM   7464 C  CA    . ASP C 3 22  ? 46.597  -38.507 -54.818 1.00   51.74 ? 22   ASP C CA    1 
ATOM   7465 C  C     . ASP C 3 22  ? 47.475  -39.730 -55.056 1.00   53.32 ? 22   ASP C C     1 
ATOM   7466 O  O     . ASP C 3 22  ? 47.949  -40.378 -54.115 1.00   53.10 ? 22   ASP C O     1 
ATOM   7467 C  CB    . ASP C 3 22  ? 45.738  -38.691 -53.559 1.00   51.74 ? 22   ASP C CB    1 
ATOM   7468 C  CG    . ASP C 3 22  ? 44.676  -39.739 -53.730 1.00   52.42 ? 22   ASP C CG    1 
ATOM   7469 O  OD1   . ASP C 3 22  ? 44.973  -40.807 -54.319 1.00   51.91 ? 22   ASP C OD1   1 
ATOM   7470 O  OD2   . ASP C 3 22  ? 43.542  -39.488 -53.259 1.00   52.68 ? 22   ASP C OD2   1 
ATOM   7471 N  N     . GLY C 3 23  ? 47.684  -40.036 -56.344 1.00   55.17 ? 23   GLY C N     1 
ATOM   7472 C  CA    . GLY C 3 23  ? 48.507  -41.160 -56.734 1.00   57.42 ? 23   GLY C CA    1 
ATOM   7473 C  C     . GLY C 3 23  ? 47.675  -42.375 -57.023 1.00   59.89 ? 23   GLY C C     1 
ATOM   7474 O  O     . GLY C 3 23  ? 47.034  -42.967 -56.153 1.00   60.42 ? 23   GLY C O     1 
ATOM   7475 N  N     . ARG C 3 24  ? 47.730  -42.743 -58.291 1.00   61.88 ? 24   ARG C N     1 
ATOM   7476 C  CA    . ARG C 3 24  ? 46.985  -43.856 -58.809 1.00   64.35 ? 24   ARG C CA    1 
ATOM   7477 C  C     . ARG C 3 24  ? 47.307  -45.164 -58.121 1.00   63.28 ? 24   ARG C C     1 
ATOM   7478 O  O     . ARG C 3 24  ? 48.420  -45.678 -58.228 1.00   64.23 ? 24   ARG C O     1 
ATOM   7479 C  CB    . ARG C 3 24  ? 47.261  -44.005 -60.295 1.00   67.94 ? 24   ARG C CB    1 
ATOM   7480 C  CG    . ARG C 3 24  ? 47.108  -45.437 -60.765 1.00   73.75 ? 24   ARG C CG    1 
ATOM   7481 C  CD    . ARG C 3 24  ? 47.532  -45.597 -62.215 1.00   78.51 ? 24   ARG C CD    1 
ATOM   7482 N  NE    . ARG C 3 24  ? 46.609  -44.898 -63.111 1.00   81.92 ? 24   ARG C NE    1 
ATOM   7483 C  CZ    . ARG C 3 24  ? 46.957  -44.261 -64.254 1.00   83.87 ? 24   ARG C CZ    1 
ATOM   7484 N  NH1   . ARG C 3 24  ? 48.208  -44.204 -64.661 1.00   85.09 ? 24   ARG C NH1   1 
ATOM   7485 N  NH2   . ARG C 3 24  ? 46.032  -43.671 -64.999 1.00   84.87 ? 24   ARG C NH2   1 
ATOM   7486 N  N     . ASP C 3 25  ? 46.323  -45.720 -57.414 1.00   61.04 ? 25   ASP C N     1 
ATOM   7487 C  CA    . ASP C 3 25  ? 46.505  -47.000 -56.728 1.00   58.16 ? 25   ASP C CA    1 
ATOM   7488 C  C     . ASP C 3 25  ? 45.173  -47.711 -56.356 1.00   57.42 ? 25   ASP C C     1 
ATOM   7489 O  O     . ASP C 3 25  ? 45.155  -48.516 -55.420 1.00   57.50 ? 25   ASP C O     1 
ATOM   7490 C  CB    . ASP C 3 25  ? 47.326  -46.773 -55.460 1.00   56.68 ? 25   ASP C CB    1 
ATOM   7491 C  CG    . ASP C 3 25  ? 46.746  -45.627 -54.595 1.00   53.99 ? 25   ASP C CG    1 
ATOM   7492 O  OD1   . ASP C 3 25  ? 47.486  -45.076 -53.745 1.00   53.90 ? 25   ASP C OD1   1 
ATOM   7493 O  OD2   . ASP C 3 25  ? 45.548  -45.283 -54.772 1.00   51.62 ? 25   ASP C OD2   1 
ATOM   7494 N  N     . GLY C 3 26  ? 44.050  -47.432 -57.058 1.00   55.98 ? 26   GLY C N     1 
ATOM   7495 C  CA    . GLY C 3 26  ? 42.754  -48.029 -56.777 1.00   55.15 ? 26   GLY C CA    1 
ATOM   7496 C  C     . GLY C 3 26  ? 42.135  -47.514 -55.469 1.00   55.50 ? 26   GLY C C     1 
ATOM   7497 O  O     . GLY C 3 26  ? 41.137  -48.053 -54.986 1.00   55.08 ? 26   GLY C O     1 
ATOM   7498 N  N     . ALA C 3 27  ? 42.738  -46.477 -54.884 1.00   54.39 ? 27   ALA C N     1 
ATOM   7499 C  CA    . ALA C 3 27  ? 42.219  -45.906 -53.640 1.00   54.11 ? 27   ALA C CA    1 
ATOM   7500 C  C     . ALA C 3 27  ? 42.110  -44.385 -53.694 1.00   52.99 ? 27   ALA C C     1 
ATOM   7501 O  O     . ALA C 3 27  ? 42.833  -43.723 -54.446 1.00   54.06 ? 27   ALA C O     1 
ATOM   7502 C  CB    . ALA C 3 27  ? 43.096  -46.312 -52.455 1.00   56.03 ? 27   ALA C CB    1 
ATOM   7503 N  N     . VAL C 3 28  ? 41.205  -43.835 -52.898 1.00   49.53 ? 28   VAL C N     1 
ATOM   7504 C  CA    . VAL C 3 28  ? 40.995  -42.396 -52.837 1.00   46.82 ? 28   VAL C CA    1 
ATOM   7505 C  C     . VAL C 3 28  ? 41.089  -41.962 -51.391 1.00   47.21 ? 28   VAL C C     1 
ATOM   7506 O  O     . VAL C 3 28  ? 40.474  -42.572 -50.515 1.00   46.48 ? 28   VAL C O     1 
ATOM   7507 C  CB    . VAL C 3 28  ? 39.605  -42.006 -53.415 1.00   44.53 ? 28   VAL C CB    1 
ATOM   7508 C  CG1   . VAL C 3 28  ? 39.359  -40.533 -53.210 1.00   42.79 ? 28   VAL C CG1   1 
ATOM   7509 C  CG2   . VAL C 3 28  ? 39.547  -42.329 -54.917 1.00   40.83 ? 28   VAL C CG2   1 
ATOM   7510 N  N     . ASP C 3 29  ? 41.857  -40.922 -51.124 1.00   48.98 ? 29   ASP C N     1 
ATOM   7511 C  CA    . ASP C 3 29  ? 42.003  -40.462 -49.758 1.00   50.43 ? 29   ASP C CA    1 
ATOM   7512 C  C     . ASP C 3 29  ? 40.646  -40.048 -49.194 1.00   50.29 ? 29   ASP C C     1 
ATOM   7513 O  O     . ASP C 3 29  ? 39.877  -39.346 -49.852 1.00   52.30 ? 29   ASP C O     1 
ATOM   7514 C  CB    . ASP C 3 29  ? 42.997  -39.306 -49.702 1.00   51.77 ? 29   ASP C CB    1 
ATOM   7515 C  CG    . ASP C 3 29  ? 43.432  -38.995 -48.293 1.00   53.54 ? 29   ASP C CG    1 
ATOM   7516 O  OD1   . ASP C 3 29  ? 42.560  -38.594 -47.499 1.00   55.79 ? 29   ASP C OD1   1 
ATOM   7517 O  OD2   . ASP C 3 29  ? 44.631  -39.157 -47.973 1.00   53.87 ? 29   ASP C OD2   1 
ATOM   7518 N  N     . ALA C 3 30  ? 40.350  -40.491 -47.972 1.00   51.39 ? 30   ALA C N     1 
ATOM   7519 C  CA    . ALA C 3 30  ? 39.079  -40.198 -47.311 1.00   51.93 ? 30   ALA C CA    1 
ATOM   7520 C  C     . ALA C 3 30  ? 38.840  -38.697 -47.096 1.00   52.86 ? 30   ALA C C     1 
ATOM   7521 O  O     . ALA C 3 30  ? 37.687  -38.258 -47.027 1.00   54.72 ? 30   ALA C O     1 
ATOM   7522 C  CB    . ALA C 3 30  ? 38.992  -40.950 -45.973 1.00   54.70 ? 30   ALA C CB    1 
ATOM   7523 N  N     . PHE C 3 31  ? 39.909  -37.919 -46.996 1.00   50.56 ? 31   PHE C N     1 
ATOM   7524 C  CA    . PHE C 3 31  ? 39.787  -36.466 -46.832 1.00   47.93 ? 31   PHE C CA    1 
ATOM   7525 C  C     . PHE C 3 31  ? 39.193  -35.871 -48.116 1.00   47.14 ? 31   PHE C C     1 
ATOM   7526 O  O     . PHE C 3 31  ? 38.764  -34.723 -48.130 1.00   43.27 ? 31   PHE C O     1 
ATOM   7527 C  CB    . PHE C 3 31  ? 41.165  -35.849 -46.565 1.00   47.59 ? 31   PHE C CB    1 
ATOM   7528 C  CG    . PHE C 3 31  ? 41.176  -34.345 -46.538 1.00   48.99 ? 31   PHE C CG    1 
ATOM   7529 C  CD1   . PHE C 3 31  ? 40.622  -33.642 -45.465 1.00   49.53 ? 31   PHE C CD1   1 
ATOM   7530 C  CD2   . PHE C 3 31  ? 41.781  -33.616 -47.580 1.00   49.76 ? 31   PHE C CD2   1 
ATOM   7531 C  CE1   . PHE C 3 31  ? 40.676  -32.229 -45.422 1.00   49.79 ? 31   PHE C CE1   1 
ATOM   7532 C  CE2   . PHE C 3 31  ? 41.842  -32.216 -47.551 1.00   48.98 ? 31   PHE C CE2   1 
ATOM   7533 C  CZ    . PHE C 3 31  ? 41.288  -31.518 -46.470 1.00   49.21 ? 31   PHE C CZ    1 
ATOM   7534 N  N     . LYS C 3 32  ? 39.163  -36.670 -49.191 1.00   44.62 ? 32   LYS C N     1 
ATOM   7535 C  CA    . LYS C 3 32  ? 38.634  -36.209 -50.472 1.00   43.94 ? 32   LYS C CA    1 
ATOM   7536 C  C     . LYS C 3 32  ? 37.264  -36.784 -50.776 1.00   43.43 ? 32   LYS C C     1 
ATOM   7537 O  O     . LYS C 3 32  ? 36.694  -36.529 -51.840 1.00   43.43 ? 32   LYS C O     1 
ATOM   7538 C  CB    . LYS C 3 32  ? 39.601  -36.548 -51.626 1.00   43.78 ? 32   LYS C CB    1 
ATOM   7539 C  CG    . LYS C 3 32  ? 40.832  -35.630 -51.716 1.00   46.04 ? 32   LYS C CG    1 
ATOM   7540 C  CD    . LYS C 3 32  ? 40.417  -34.149 -51.724 1.00   46.99 ? 32   LYS C CD    1 
ATOM   7541 C  CE    . LYS C 3 32  ? 41.602  -33.217 -52.011 1.00   48.57 ? 32   LYS C CE    1 
ATOM   7542 N  NZ    . LYS C 3 32  ? 41.260  -31.784 -52.149 1.00   49.01 ? 32   LYS C NZ    1 
ATOM   7543 N  N     . LEU C 3 33  ? 36.725  -37.567 -49.840 1.00   44.10 ? 33   LEU C N     1 
ATOM   7544 C  CA    . LEU C 3 33  ? 35.407  -38.174 -50.046 1.00   45.34 ? 33   LEU C CA    1 
ATOM   7545 C  C     . LEU C 3 33  ? 34.306  -37.140 -50.317 1.00   45.65 ? 33   LEU C C     1 
ATOM   7546 O  O     . LEU C 3 33  ? 33.398  -37.393 -51.111 1.00   46.85 ? 33   LEU C O     1 
ATOM   7547 C  CB    . LEU C 3 33  ? 35.041  -39.040 -48.840 1.00   43.79 ? 33   LEU C CB    1 
ATOM   7548 C  CG    . LEU C 3 33  ? 33.641  -39.649 -48.682 1.00   41.87 ? 33   LEU C CG    1 
ATOM   7549 C  CD1   . LEU C 3 33  ? 33.202  -40.379 -49.931 1.00   39.56 ? 33   LEU C CD1   1 
ATOM   7550 C  CD2   . LEU C 3 33  ? 33.672  -40.623 -47.482 1.00   40.96 ? 33   LEU C CD2   1 
ATOM   7551 N  N     . GLY C 3 34  ? 34.392  -35.988 -49.656 1.00   46.80 ? 34   GLY C N     1 
ATOM   7552 C  CA    . GLY C 3 34  ? 33.400  -34.945 -49.850 1.00   48.00 ? 34   GLY C CA    1 
ATOM   7553 C  C     . GLY C 3 34  ? 33.445  -34.321 -51.242 1.00   49.57 ? 34   GLY C C     1 
ATOM   7554 O  O     . GLY C 3 34  ? 32.411  -34.216 -51.901 1.00   47.57 ? 34   GLY C O     1 
ATOM   7555 N  N     . ASP C 3 35  ? 34.634  -33.910 -51.679 1.00   50.72 ? 35   ASP C N     1 
ATOM   7556 C  CA    . ASP C 3 35  ? 34.812  -33.303 -52.998 1.00   52.53 ? 35   ASP C CA    1 
ATOM   7557 C  C     . ASP C 3 35  ? 34.406  -34.240 -54.118 1.00   52.47 ? 35   ASP C C     1 
ATOM   7558 O  O     . ASP C 3 35  ? 33.942  -33.788 -55.170 1.00   51.99 ? 35   ASP C O     1 
ATOM   7559 C  CB    . ASP C 3 35  ? 36.264  -32.860 -53.214 1.00   57.34 ? 35   ASP C CB    1 
ATOM   7560 C  CG    . ASP C 3 35  ? 36.661  -31.680 -52.327 1.00   63.80 ? 35   ASP C CG    1 
ATOM   7561 O  OD1   . ASP C 3 35  ? 35.747  -30.971 -51.838 1.00   67.28 ? 35   ASP C OD1   1 
ATOM   7562 O  OD2   . ASP C 3 35  ? 37.879  -31.453 -52.133 1.00   67.00 ? 35   ASP C OD2   1 
ATOM   7563 N  N     . VAL C 3 36  ? 34.570  -35.550 -53.915 1.00   51.09 ? 36   VAL C N     1 
ATOM   7564 C  CA    . VAL C 3 36  ? 34.175  -36.512 -54.945 1.00   49.97 ? 36   VAL C CA    1 
ATOM   7565 C  C     . VAL C 3 36  ? 32.688  -36.340 -55.222 1.00   50.40 ? 36   VAL C C     1 
ATOM   7566 O  O     . VAL C 3 36  ? 32.262  -36.207 -56.371 1.00   49.45 ? 36   VAL C O     1 
ATOM   7567 C  CB    . VAL C 3 36  ? 34.393  -37.973 -54.503 1.00   49.29 ? 36   VAL C CB    1 
ATOM   7568 C  CG1   . VAL C 3 36  ? 33.570  -38.900 -55.366 1.00   48.05 ? 36   VAL C CG1   1 
ATOM   7569 C  CG2   . VAL C 3 36  ? 35.861  -38.345 -54.612 1.00   49.76 ? 36   VAL C CG2   1 
ATOM   7570 N  N     . CYS C 3 37  ? 31.906  -36.344 -54.147 1.00   51.01 ? 37   CYS C N     1 
ATOM   7571 C  CA    . CYS C 3 37  ? 30.456  -36.196 -54.212 1.00   50.98 ? 37   CYS C CA    1 
ATOM   7572 C  C     . CYS C 3 37  ? 29.997  -34.853 -54.783 1.00   50.61 ? 37   CYS C C     1 
ATOM   7573 O  O     . CYS C 3 37  ? 28.944  -34.780 -55.419 1.00   49.13 ? 37   CYS C O     1 
ATOM   7574 C  CB    . CYS C 3 37  ? 29.867  -36.406 -52.813 1.00   53.15 ? 37   CYS C CB    1 
ATOM   7575 S  SG    . CYS C 3 37  ? 30.322  -38.012 -52.082 1.00   56.20 ? 37   CYS C SG    1 
ATOM   7576 N  N     . ARG C 3 38  ? 30.770  -33.797 -54.563 1.00   49.36 ? 38   ARG C N     1 
ATOM   7577 C  CA    . ARG C 3 38  ? 30.404  -32.492 -55.107 1.00   49.28 ? 38   ARG C CA    1 
ATOM   7578 C  C     . ARG C 3 38  ? 30.506  -32.527 -56.634 1.00   49.51 ? 38   ARG C C     1 
ATOM   7579 O  O     . ARG C 3 38  ? 29.655  -31.981 -57.337 1.00   48.50 ? 38   ARG C O     1 
ATOM   7580 C  CB    . ARG C 3 38  ? 31.289  -31.391 -54.497 1.00   48.30 ? 38   ARG C CB    1 
ATOM   7581 C  CG    . ARG C 3 38  ? 30.952  -31.132 -53.032 1.00   48.83 ? 38   ARG C CG    1 
ATOM   7582 C  CD    . ARG C 3 38  ? 32.105  -30.503 -52.247 1.00   50.50 ? 38   ARG C CD    1 
ATOM   7583 N  NE    . ARG C 3 38  ? 31.765  -30.492 -50.827 1.00   51.51 ? 38   ARG C NE    1 
ATOM   7584 C  CZ    . ARG C 3 38  ? 32.600  -30.764 -49.823 1.00   50.30 ? 38   ARG C CZ    1 
ATOM   7585 N  NH1   . ARG C 3 38  ? 33.869  -31.071 -50.039 1.00   49.44 ? 38   ARG C NH1   1 
ATOM   7586 N  NH2   . ARG C 3 38  ? 32.131  -30.758 -48.585 1.00   50.82 ? 38   ARG C NH2   1 
ATOM   7587 N  N     . CYS C 3 39  ? 31.552  -33.193 -57.142 1.00   51.22 ? 39   CYS C N     1 
ATOM   7588 C  CA    . CYS C 3 39  ? 31.753  -33.366 -58.593 1.00   51.89 ? 39   CYS C CA    1 
ATOM   7589 C  C     . CYS C 3 39  ? 30.550  -34.060 -59.227 1.00   51.64 ? 39   CYS C C     1 
ATOM   7590 O  O     . CYS C 3 39  ? 30.262  -33.866 -60.403 1.00   51.65 ? 39   CYS C O     1 
ATOM   7591 C  CB    . CYS C 3 39  ? 33.000  -34.218 -58.870 1.00   52.44 ? 39   CYS C CB    1 
ATOM   7592 S  SG    . CYS C 3 39  ? 34.565  -33.389 -58.578 1.00   56.25 ? 39   CYS C SG    1 
ATOM   7593 N  N     . LEU C 3 40  ? 29.852  -34.871 -58.438 1.00   52.27 ? 40   LEU C N     1 
ATOM   7594 C  CA    . LEU C 3 40  ? 28.684  -35.586 -58.935 1.00   51.91 ? 40   LEU C CA    1 
ATOM   7595 C  C     . LEU C 3 40  ? 27.373  -34.833 -58.749 1.00   51.62 ? 40   LEU C C     1 
ATOM   7596 O  O     . LEU C 3 40  ? 26.301  -35.416 -58.841 1.00   52.32 ? 40   LEU C O     1 
ATOM   7597 C  CB    . LEU C 3 40  ? 28.607  -36.961 -58.278 1.00   52.09 ? 40   LEU C CB    1 
ATOM   7598 C  CG    . LEU C 3 40  ? 29.724  -37.935 -58.672 1.00   53.30 ? 40   LEU C CG    1 
ATOM   7599 C  CD1   . LEU C 3 40  ? 29.726  -39.119 -57.700 1.00   53.85 ? 40   LEU C CD1   1 
ATOM   7600 C  CD2   . LEU C 3 40  ? 29.521  -38.412 -60.111 1.00   52.03 ? 40   LEU C CD2   1 
ATOM   7601 N  N     . GLY C 3 41  ? 27.463  -33.530 -58.480 1.00   51.04 ? 41   GLY C N     1 
ATOM   7602 C  CA    . GLY C 3 41  ? 26.270  -32.714 -58.332 1.00   51.02 ? 41   GLY C CA    1 
ATOM   7603 C  C     . GLY C 3 41  ? 25.505  -32.739 -57.017 1.00   53.21 ? 41   GLY C C     1 
ATOM   7604 O  O     . GLY C 3 41  ? 24.329  -32.382 -56.972 1.00   50.20 ? 41   GLY C O     1 
ATOM   7605 N  N     . ILE C 3 42  ? 26.174  -33.151 -55.950 1.00   54.54 ? 42   ILE C N     1 
ATOM   7606 C  CA    . ILE C 3 42  ? 25.577  -33.207 -54.634 1.00   52.28 ? 42   ILE C CA    1 
ATOM   7607 C  C     . ILE C 3 42  ? 26.235  -32.098 -53.833 1.00   51.55 ? 42   ILE C C     1 
ATOM   7608 O  O     . ILE C 3 42  ? 27.396  -31.766 -54.061 1.00   47.84 ? 42   ILE C O     1 
ATOM   7609 C  CB    . ILE C 3 42  ? 25.859  -34.573 -53.992 1.00   57.64 ? 42   ILE C CB    1 
ATOM   7610 C  CG1   . ILE C 3 42  ? 25.208  -35.648 -54.847 1.00   64.45 ? 42   ILE C CG1   1 
ATOM   7611 C  CG2   . ILE C 3 42  ? 25.348  -34.642 -52.548 1.00   63.24 ? 42   ILE C CG2   1 
ATOM   7612 C  CD1   . ILE C 3 42  ? 23.750  -35.350 -55.171 1.00   69.53 ? 42   ILE C CD1   1 
ATOM   7613 N  N     . ASN C 3 43  ? 25.484  -31.518 -52.898 1.00   49.08 ? 43   ASN C N     1 
ATOM   7614 C  CA    . ASN C 3 43  ? 25.980  -30.438 -52.050 1.00   48.04 ? 43   ASN C CA    1 
ATOM   7615 C  C     . ASN C 3 43  ? 25.944  -30.854 -50.571 1.00   48.56 ? 43   ASN C C     1 
ATOM   7616 O  O     . ASN C 3 43  ? 25.141  -30.338 -49.802 1.00   50.12 ? 43   ASN C O     1 
ATOM   7617 C  CB    . ASN C 3 43  ? 25.099  -29.203 -52.246 1.00   46.66 ? 43   ASN C CB    1 
ATOM   7618 C  CG    . ASN C 3 43  ? 25.022  -28.772 -53.708 1.00   46.08 ? 43   ASN C CG    1 
ATOM   7619 O  OD1   . ASN C 3 43  ? 25.954  -28.153 -54.233 1.00   45.54 ? 43   ASN C OD1   1 
ATOM   7620 N  ND2   . ASN C 3 43  ? 23.930  -29.127 -54.374 1.00   44.20 ? 43   ASN C ND2   1 
ATOM   7621 N  N     . PRO C 3 44  ? 26.810  -31.795 -50.157 1.00   50.99 ? 44   PRO C N     1 
ATOM   7622 C  CA    . PRO C 3 44  ? 26.807  -32.237 -48.754 1.00   51.43 ? 44   PRO C CA    1 
ATOM   7623 C  C     . PRO C 3 44  ? 27.502  -31.342 -47.736 1.00   51.91 ? 44   PRO C C     1 
ATOM   7624 O  O     . PRO C 3 44  ? 28.496  -30.673 -48.030 1.00   51.33 ? 44   PRO C O     1 
ATOM   7625 C  CB    . PRO C 3 44  ? 27.443  -33.624 -48.829 1.00   51.56 ? 44   PRO C CB    1 
ATOM   7626 C  CG    . PRO C 3 44  ? 28.480  -33.431 -49.889 1.00   52.54 ? 44   PRO C CG    1 
ATOM   7627 C  CD    . PRO C 3 44  ? 27.687  -32.668 -50.968 1.00   52.28 ? 44   PRO C CD    1 
ATOM   7628 N  N     . ARG C 3 45  ? 26.960  -31.348 -46.525 1.00   52.01 ? 45   ARG C N     1 
ATOM   7629 C  CA    . ARG C 3 45  ? 27.493  -30.568 -45.413 1.00   51.25 ? 45   ARG C CA    1 
ATOM   7630 C  C     . ARG C 3 45  ? 28.675  -31.349 -44.825 1.00   51.22 ? 45   ARG C C     1 
ATOM   7631 O  O     . ARG C 3 45  ? 28.750  -32.563 -44.997 1.00   48.34 ? 45   ARG C O     1 
ATOM   7632 C  CB    . ARG C 3 45  ? 26.397  -30.384 -44.360 1.00   51.93 ? 45   ARG C CB    1 
ATOM   7633 C  CG    . ARG C 3 45  ? 25.228  -29.551 -44.839 1.00   54.35 ? 45   ARG C CG    1 
ATOM   7634 C  CD    . ARG C 3 45  ? 24.008  -29.843 -44.024 1.00   55.62 ? 45   ARG C CD    1 
ATOM   7635 N  NE    . ARG C 3 45  ? 24.258  -29.593 -42.624 1.00   56.45 ? 45   ARG C NE    1 
ATOM   7636 C  CZ    . ARG C 3 45  ? 23.736  -30.304 -41.630 1.00   57.25 ? 45   ARG C CZ    1 
ATOM   7637 N  NH1   . ARG C 3 45  ? 22.936  -31.328 -41.891 1.00   56.64 ? 45   ARG C NH1   1 
ATOM   7638 N  NH2   . ARG C 3 45  ? 24.011  -29.975 -40.370 1.00   57.60 ? 45   ARG C NH2   1 
ATOM   7639 N  N     . ASN C 3 46  ? 29.593  -30.666 -44.145 1.00   51.20 ? 46   ASN C N     1 
ATOM   7640 C  CA    . ASN C 3 46  ? 30.753  -31.360 -43.590 1.00   52.51 ? 46   ASN C CA    1 
ATOM   7641 C  C     . ASN C 3 46  ? 30.325  -32.433 -42.617 1.00   54.09 ? 46   ASN C C     1 
ATOM   7642 O  O     . ASN C 3 46  ? 30.850  -33.540 -42.635 1.00   53.04 ? 46   ASN C O     1 
ATOM   7643 C  CB    . ASN C 3 46  ? 31.699  -30.394 -42.885 1.00   53.45 ? 46   ASN C CB    1 
ATOM   7644 C  CG    . ASN C 3 46  ? 32.203  -29.322 -43.792 1.00   55.28 ? 46   ASN C CG    1 
ATOM   7645 O  OD1   . ASN C 3 46  ? 32.287  -29.513 -45.001 1.00   57.35 ? 46   ASN C OD1   1 
ATOM   7646 N  ND2   . ASN C 3 46  ? 32.554  -28.180 -43.219 1.00   57.70 ? 46   ASN C ND2   1 
ATOM   7647 N  N     . GLU C 3 47  ? 29.370  -32.096 -41.761 1.00   56.38 ? 47   GLU C N     1 
ATOM   7648 C  CA    . GLU C 3 47  ? 28.858  -33.050 -40.789 1.00   57.71 ? 47   GLU C CA    1 
ATOM   7649 C  C     . GLU C 3 47  ? 28.375  -34.320 -41.504 1.00   58.99 ? 47   GLU C C     1 
ATOM   7650 O  O     . GLU C 3 47  ? 28.581  -35.428 -41.015 1.00   55.69 ? 47   GLU C O     1 
ATOM   7651 C  CB    . GLU C 3 47  ? 27.708  -32.422 -39.999 1.00   60.19 ? 47   GLU C CB    1 
ATOM   7652 C  CG    . GLU C 3 47  ? 27.192  -33.282 -38.850 1.00   68.29 ? 47   GLU C CG    1 
ATOM   7653 C  CD    . GLU C 3 47  ? 25.976  -32.677 -38.140 1.00   72.05 ? 47   GLU C CD    1 
ATOM   7654 O  OE1   . GLU C 3 47  ? 26.135  -31.636 -37.459 1.00   73.60 ? 47   GLU C OE1   1 
ATOM   7655 O  OE2   . GLU C 3 47  ? 24.864  -33.244 -38.268 1.00   73.56 ? 47   GLU C OE2   1 
ATOM   7656 N  N     . ASP C 3 48  ? 27.733  -34.150 -42.657 1.00   60.19 ? 48   ASP C N     1 
ATOM   7657 C  CA    . ASP C 3 48  ? 27.223  -35.275 -43.438 1.00   60.27 ? 48   ASP C CA    1 
ATOM   7658 C  C     . ASP C 3 48  ? 28.355  -36.187 -43.918 1.00   58.89 ? 48   ASP C C     1 
ATOM   7659 O  O     . ASP C 3 48  ? 28.209  -37.411 -43.917 1.00   56.86 ? 48   ASP C O     1 
ATOM   7660 C  CB    . ASP C 3 48  ? 26.462  -34.789 -44.681 1.00   66.62 ? 48   ASP C CB    1 
ATOM   7661 C  CG    . ASP C 3 48  ? 25.093  -34.187 -44.360 1.00   76.48 ? 48   ASP C CG    1 
ATOM   7662 O  OD1   . ASP C 3 48  ? 24.452  -33.669 -45.311 1.00   82.23 ? 48   ASP C OD1   1 
ATOM   7663 O  OD2   . ASP C 3 48  ? 24.654  -34.232 -43.185 1.00   80.86 ? 48   ASP C OD2   1 
ATOM   7664 N  N     . VAL C 3 49  ? 29.473  -35.598 -44.325 1.00   55.99 ? 49   VAL C N     1 
ATOM   7665 C  CA    . VAL C 3 49  ? 30.574  -36.398 -44.831 1.00   53.64 ? 49   VAL C CA    1 
ATOM   7666 C  C     . VAL C 3 49  ? 31.364  -37.121 -43.743 1.00   53.24 ? 49   VAL C C     1 
ATOM   7667 O  O     . VAL C 3 49  ? 31.713  -38.288 -43.915 1.00   52.05 ? 49   VAL C O     1 
ATOM   7668 C  CB    . VAL C 3 49  ? 31.537  -35.561 -45.728 1.00   53.13 ? 49   VAL C CB    1 
ATOM   7669 C  CG1   . VAL C 3 49  ? 30.739  -34.797 -46.772 1.00   54.34 ? 49   VAL C CG1   1 
ATOM   7670 C  CG2   . VAL C 3 49  ? 32.355  -34.615 -44.888 1.00   55.86 ? 49   VAL C CG2   1 
ATOM   7671 N  N     . PHE C 3 50  ? 31.652  -36.441 -42.640 1.00   53.54 ? 50   PHE C N     1 
ATOM   7672 C  CA    . PHE C 3 50  ? 32.392  -37.066 -41.548 1.00   53.93 ? 50   PHE C CA    1 
ATOM   7673 C  C     . PHE C 3 50  ? 31.600  -38.291 -41.087 1.00   53.24 ? 50   PHE C C     1 
ATOM   7674 O  O     . PHE C 3 50  ? 32.173  -39.300 -40.675 1.00   54.62 ? 50   PHE C O     1 
ATOM   7675 C  CB    . PHE C 3 50  ? 32.552  -36.093 -40.371 1.00   55.20 ? 50   PHE C CB    1 
ATOM   7676 C  CG    . PHE C 3 50  ? 33.383  -34.863 -40.682 1.00   56.36 ? 50   PHE C CG    1 
ATOM   7677 C  CD1   . PHE C 3 50  ? 33.068  -33.636 -40.106 1.00   57.18 ? 50   PHE C CD1   1 
ATOM   7678 C  CD2   . PHE C 3 50  ? 34.490  -34.936 -41.507 1.00   56.86 ? 50   PHE C CD2   1 
ATOM   7679 C  CE1   . PHE C 3 50  ? 33.850  -32.497 -40.350 1.00   57.42 ? 50   PHE C CE1   1 
ATOM   7680 C  CE2   . PHE C 3 50  ? 35.277  -33.801 -41.755 1.00   57.75 ? 50   PHE C CE2   1 
ATOM   7681 C  CZ    . PHE C 3 50  ? 34.956  -32.585 -41.176 1.00   57.28 ? 50   PHE C CZ    1 
ATOM   7682 N  N     . ALA C 3 51  ? 30.275  -38.188 -41.174 1.00   53.59 ? 51   ALA C N     1 
ATOM   7683 C  CA    . ALA C 3 51  ? 29.379  -39.259 -40.765 1.00   53.96 ? 51   ALA C CA    1 
ATOM   7684 C  C     . ALA C 3 51  ? 29.406  -40.456 -41.711 1.00   54.86 ? 51   ALA C C     1 
ATOM   7685 O  O     . ALA C 3 51  ? 29.105  -41.579 -41.293 1.00   58.22 ? 51   ALA C O     1 
ATOM   7686 C  CB    . ALA C 3 51  ? 27.950  -38.720 -40.631 1.00   54.46 ? 51   ALA C CB    1 
ATOM   7687 N  N     . VAL C 3 52  ? 29.753  -40.243 -42.979 1.00   54.15 ? 52   VAL C N     1 
ATOM   7688 C  CA    . VAL C 3 52  ? 29.817  -41.367 -43.914 1.00   53.61 ? 52   VAL C CA    1 
ATOM   7689 C  C     . VAL C 3 52  ? 31.266  -41.854 -44.017 1.00   52.90 ? 52   VAL C C     1 
ATOM   7690 O  O     . VAL C 3 52  ? 31.587  -42.689 -44.859 1.00   52.19 ? 52   VAL C O     1 
ATOM   7691 C  CB    . VAL C 3 52  ? 29.285  -41.003 -45.336 1.00   53.57 ? 52   VAL C CB    1 
ATOM   7692 C  CG1   . VAL C 3 52  ? 27.772  -40.865 -45.317 1.00   52.09 ? 52   VAL C CG1   1 
ATOM   7693 C  CG2   . VAL C 3 52  ? 29.925  -39.712 -45.829 1.00   52.27 ? 52   VAL C CG2   1 
ATOM   7694 N  N     . GLY C 3 53  ? 32.139  -41.316 -43.165 1.00   51.10 ? 53   GLY C N     1 
ATOM   7695 C  CA    . GLY C 3 53  ? 33.528  -41.744 -43.160 1.00   49.33 ? 53   GLY C CA    1 
ATOM   7696 C  C     . GLY C 3 53  ? 34.601  -40.758 -43.577 1.00   49.17 ? 53   GLY C C     1 
ATOM   7697 O  O     . GLY C 3 53  ? 35.786  -41.078 -43.501 1.00   47.98 ? 53   GLY C O     1 
ATOM   7698 N  N     . GLY C 3 54  ? 34.218  -39.569 -44.032 1.00   48.99 ? 54   GLY C N     1 
ATOM   7699 C  CA    . GLY C 3 54  ? 35.214  -38.600 -44.439 1.00   50.09 ? 54   GLY C CA    1 
ATOM   7700 C  C     . GLY C 3 54  ? 36.149  -38.273 -43.290 1.00   51.88 ? 54   GLY C C     1 
ATOM   7701 O  O     . GLY C 3 54  ? 35.734  -38.283 -42.126 1.00   53.44 ? 54   GLY C O     1 
ATOM   7702 N  N     . THR C 3 55  ? 37.414  -37.979 -43.606 1.00   52.04 ? 55   THR C N     1 
ATOM   7703 C  CA    . THR C 3 55  ? 38.408  -37.647 -42.591 1.00   53.32 ? 55   THR C CA    1 
ATOM   7704 C  C     . THR C 3 55  ? 38.699  -36.152 -42.562 1.00   55.48 ? 55   THR C C     1 
ATOM   7705 O  O     . THR C 3 55  ? 38.119  -35.387 -43.333 1.00   55.26 ? 55   THR C O     1 
ATOM   7706 C  CB    . THR C 3 55  ? 39.741  -38.420 -42.801 1.00   51.93 ? 55   THR C CB    1 
ATOM   7707 O  OG1   . THR C 3 55  ? 40.176  -38.296 -44.169 1.00   49.92 ? 55   THR C OG1   1 
ATOM   7708 C  CG2   . THR C 3 55  ? 39.559  -39.890 -42.437 1.00   49.77 ? 55   THR C CG2   1 
ATOM   7709 N  N     . HIS C 3 56  ? 39.604  -35.739 -41.678 1.00   57.58 ? 56   HIS C N     1 
ATOM   7710 C  CA    . HIS C 3 56  ? 39.925  -34.329 -41.515 1.00   59.88 ? 56   HIS C CA    1 
ATOM   7711 C  C     . HIS C 3 56  ? 41.222  -33.866 -42.152 1.00   61.27 ? 56   HIS C C     1 
ATOM   7712 O  O     . HIS C 3 56  ? 41.451  -32.664 -42.290 1.00   60.61 ? 56   HIS C O     1 
ATOM   7713 C  CB    . HIS C 3 56  ? 39.938  -33.981 -40.023 1.00   61.02 ? 56   HIS C CB    1 
ATOM   7714 C  CG    . HIS C 3 56  ? 38.604  -34.123 -39.354 1.00   64.27 ? 56   HIS C CG    1 
ATOM   7715 N  ND1   . HIS C 3 56  ? 37.869  -35.290 -39.391 1.00   65.85 ? 56   HIS C ND1   1 
ATOM   7716 C  CD2   . HIS C 3 56  ? 37.860  -33.238 -38.644 1.00   65.39 ? 56   HIS C CD2   1 
ATOM   7717 C  CE1   . HIS C 3 56  ? 36.733  -35.117 -38.738 1.00   65.41 ? 56   HIS C CE1   1 
ATOM   7718 N  NE2   . HIS C 3 56  ? 36.704  -33.883 -38.279 1.00   65.41 ? 56   HIS C NE2   1 
ATOM   7719 N  N     . LYS C 3 57  ? 42.071  -34.807 -42.538 1.00   63.42 ? 57   LYS C N     1 
ATOM   7720 C  CA    . LYS C 3 57  ? 43.352  -34.470 -43.157 1.00   65.16 ? 57   LYS C CA    1 
ATOM   7721 C  C     . LYS C 3 57  ? 43.804  -35.518 -44.155 1.00   64.66 ? 57   LYS C C     1 
ATOM   7722 O  O     . LYS C 3 57  ? 43.484  -36.699 -44.024 1.00   64.87 ? 57   LYS C O     1 
ATOM   7723 C  CB    . LYS C 3 57  ? 44.461  -34.353 -42.106 1.00   67.83 ? 57   LYS C CB    1 
ATOM   7724 C  CG    . LYS C 3 57  ? 44.310  -33.259 -41.086 1.00   73.31 ? 57   LYS C CG    1 
ATOM   7725 C  CD    . LYS C 3 57  ? 45.547  -33.224 -40.176 1.00   77.01 ? 57   LYS C CD    1 
ATOM   7726 C  CE    . LYS C 3 57  ? 45.714  -34.534 -39.380 1.00   78.35 ? 57   LYS C CE    1 
ATOM   7727 N  NZ    . LYS C 3 57  ? 47.012  -34.627 -38.636 1.00   78.80 ? 57   LYS C NZ    1 
ATOM   7728 N  N     . MET C 3 58  ? 44.556  -35.073 -45.155 1.00   64.27 ? 58   MET C N     1 
ATOM   7729 C  CA    . MET C 3 58  ? 45.120  -35.977 -46.148 1.00   63.36 ? 58   MET C CA    1 
ATOM   7730 C  C     . MET C 3 58  ? 46.065  -36.884 -45.364 1.00   62.25 ? 58   MET C C     1 
ATOM   7731 O  O     . MET C 3 58  ? 46.547  -36.506 -44.298 1.00   62.29 ? 58   MET C O     1 
ATOM   7732 C  CB    . MET C 3 58  ? 45.928  -35.202 -47.201 1.00   62.82 ? 58   MET C CB    1 
ATOM   7733 C  CG    . MET C 3 58  ? 45.106  -34.639 -48.355 1.00   62.76 ? 58   MET C CG    1 
ATOM   7734 S  SD    . MET C 3 58  ? 44.272  -35.917 -49.362 1.00   61.85 ? 58   MET C SD    1 
ATOM   7735 C  CE    . MET C 3 58  ? 45.509  -36.212 -50.602 1.00   60.74 ? 58   MET C CE    1 
ATOM   7736 N  N     . GLY C 3 59  ? 46.320  -38.069 -45.889 1.00   61.38 ? 59   GLY C N     1 
ATOM   7737 C  CA    . GLY C 3 59  ? 47.210  -38.995 -45.213 1.00   60.60 ? 59   GLY C CA    1 
ATOM   7738 C  C     . GLY C 3 59  ? 46.718  -39.414 -43.846 1.00   60.60 ? 59   GLY C C     1 
ATOM   7739 O  O     . GLY C 3 59  ? 47.264  -38.999 -42.819 1.00   60.58 ? 59   GLY C O     1 
ATOM   7740 N  N     . GLU C 3 60  ? 45.675  -40.230 -43.839 1.00   60.56 ? 60   GLU C N     1 
ATOM   7741 C  CA    . GLU C 3 60  ? 45.054  -40.759 -42.619 1.00   59.76 ? 60   GLU C CA    1 
ATOM   7742 C  C     . GLU C 3 60  ? 44.304  -42.030 -43.000 1.00   58.83 ? 60   GLU C C     1 
ATOM   7743 O  O     . GLU C 3 60  ? 44.561  -43.093 -42.445 1.00   58.99 ? 60   GLU C O     1 
ATOM   7744 C  CB    . GLU C 3 60  ? 44.069  -39.751 -41.997 1.00   60.56 ? 60   GLU C CB    1 
ATOM   7745 C  CG    . GLU C 3 60  ? 44.689  -38.736 -41.041 1.00   63.86 ? 60   GLU C CG    1 
ATOM   7746 C  CD    . GLU C 3 60  ? 43.647  -37.888 -40.302 1.00   66.01 ? 60   GLU C CD    1 
ATOM   7747 O  OE1   . GLU C 3 60  ? 44.037  -37.070 -39.426 1.00   66.71 ? 60   GLU C OE1   1 
ATOM   7748 O  OE2   . GLU C 3 60  ? 42.439  -38.035 -40.596 1.00   67.07 ? 60   GLU C OE2   1 
ATOM   7749 N  N     . LYS C 3 61  ? 43.376  -41.921 -43.945 1.00   57.17 ? 61   LYS C N     1 
ATOM   7750 C  CA    . LYS C 3 61  ? 42.625  -43.085 -44.383 1.00   57.34 ? 61   LYS C CA    1 
ATOM   7751 C  C     . LYS C 3 61  ? 42.325  -42.984 -45.886 1.00   57.56 ? 61   LYS C C     1 
ATOM   7752 O  O     . LYS C 3 61  ? 42.024  -41.905 -46.388 1.00   58.12 ? 61   LYS C O     1 
ATOM   7753 C  CB    . LYS C 3 61  ? 41.321  -43.221 -43.593 1.00   56.45 ? 61   LYS C CB    1 
ATOM   7754 C  CG    . LYS C 3 61  ? 40.676  -44.592 -43.740 1.00   55.63 ? 61   LYS C CG    1 
ATOM   7755 C  CD    . LYS C 3 61  ? 39.506  -44.833 -42.791 1.00   55.71 ? 61   LYS C CD    1 
ATOM   7756 C  CE    . LYS C 3 61  ? 39.063  -46.303 -42.873 1.00   56.35 ? 61   LYS C CE    1 
ATOM   7757 N  NZ    . LYS C 3 61  ? 37.815  -46.658 -42.094 1.00   56.66 ? 61   LYS C NZ    1 
ATOM   7758 N  N     . SER C 3 62  ? 42.419  -44.112 -46.583 1.00   58.03 ? 62   SER C N     1 
ATOM   7759 C  CA    . SER C 3 62  ? 42.175  -44.171 -48.018 1.00   58.75 ? 62   SER C CA    1 
ATOM   7760 C  C     . SER C 3 62  ? 40.966  -45.037 -48.286 1.00   58.73 ? 62   SER C C     1 
ATOM   7761 O  O     . SER C 3 62  ? 40.576  -45.843 -47.447 1.00   59.39 ? 62   SER C O     1 
ATOM   7762 C  CB    . SER C 3 62  ? 43.386  -44.761 -48.744 1.00   57.69 ? 62   SER C CB    1 
ATOM   7763 O  OG    . SER C 3 62  ? 44.529  -43.949 -48.552 1.00   59.87 ? 62   SER C OG    1 
ATOM   7764 N  N     . LEU C 3 63  ? 40.375  -44.881 -49.464 1.00   58.67 ? 63   LEU C N     1 
ATOM   7765 C  CA    . LEU C 3 63  ? 39.194  -45.655 -49.791 1.00   58.99 ? 63   LEU C CA    1 
ATOM   7766 C  C     . LEU C 3 63  ? 39.137  -46.263 -51.173 1.00   59.14 ? 63   LEU C C     1 
ATOM   7767 O  O     . LEU C 3 63  ? 39.395  -45.598 -52.179 1.00   60.23 ? 63   LEU C O     1 
ATOM   7768 C  CB    . LEU C 3 63  ? 37.934  -44.815 -49.623 1.00   59.74 ? 63   LEU C CB    1 
ATOM   7769 C  CG    . LEU C 3 63  ? 37.597  -44.271 -48.248 1.00   60.85 ? 63   LEU C CG    1 
ATOM   7770 C  CD1   . LEU C 3 63  ? 36.211  -43.631 -48.317 1.00   60.33 ? 63   LEU C CD1   1 
ATOM   7771 C  CD2   . LEU C 3 63  ? 37.634  -45.407 -47.215 1.00   61.33 ? 63   LEU C CD2   1 
ATOM   7772 N  N     . PRO C 3 64  ? 38.787  -47.553 -51.239 1.00   57.18 ? 64   PRO C N     1 
ATOM   7773 C  CA    . PRO C 3 64  ? 38.659  -48.283 -52.496 1.00   57.38 ? 64   PRO C CA    1 
ATOM   7774 C  C     . PRO C 3 64  ? 37.257  -47.932 -52.983 1.00   56.87 ? 64   PRO C C     1 
ATOM   7775 O  O     . PRO C 3 64  ? 36.458  -47.397 -52.225 1.00   56.03 ? 64   PRO C O     1 
ATOM   7776 C  CB    . PRO C 3 64  ? 38.774  -49.738 -52.052 1.00   56.62 ? 64   PRO C CB    1 
ATOM   7777 C  CG    . PRO C 3 64  ? 38.086  -49.713 -50.745 1.00   56.99 ? 64   PRO C CG    1 
ATOM   7778 C  CD    . PRO C 3 64  ? 38.680  -48.472 -50.096 1.00   57.81 ? 64   PRO C CD    1 
ATOM   7779 N  N     . PHE C 3 65  ? 36.961  -48.226 -54.231 1.00   57.90 ? 65   PHE C N     1 
ATOM   7780 C  CA    . PHE C 3 65  ? 35.662  -47.906 -54.774 1.00   58.53 ? 65   PHE C CA    1 
ATOM   7781 C  C     . PHE C 3 65  ? 34.480  -48.572 -54.056 1.00   59.62 ? 65   PHE C C     1 
ATOM   7782 O  O     . PHE C 3 65  ? 33.442  -47.941 -53.848 1.00   60.71 ? 65   PHE C O     1 
ATOM   7783 C  CB    . PHE C 3 65  ? 35.634  -48.246 -56.258 1.00   56.99 ? 65   PHE C CB    1 
ATOM   7784 C  CG    . PHE C 3 65  ? 34.362  -47.872 -56.918 1.00   55.60 ? 65   PHE C CG    1 
ATOM   7785 C  CD1   . PHE C 3 65  ? 33.348  -48.808 -57.074 1.00   55.37 ? 65   PHE C CD1   1 
ATOM   7786 C  CD2   . PHE C 3 65  ? 34.135  -46.560 -57.296 1.00   54.45 ? 65   PHE C CD2   1 
ATOM   7787 C  CE1   . PHE C 3 65  ? 32.118  -48.434 -57.593 1.00   56.15 ? 65   PHE C CE1   1 
ATOM   7788 C  CE2   . PHE C 3 65  ? 32.913  -46.172 -57.813 1.00   55.10 ? 65   PHE C CE2   1 
ATOM   7789 C  CZ    . PHE C 3 65  ? 31.899  -47.105 -57.963 1.00   55.87 ? 65   PHE C CZ    1 
ATOM   7790 N  N     . GLU C 3 66  ? 34.635  -49.841 -53.677 1.00   61.83 ? 66   GLU C N     1 
ATOM   7791 C  CA    . GLU C 3 66  ? 33.566  -50.576 -53.000 1.00   63.97 ? 66   GLU C CA    1 
ATOM   7792 C  C     . GLU C 3 66  ? 33.043  -49.872 -51.753 1.00   65.87 ? 66   GLU C C     1 
ATOM   7793 O  O     . GLU C 3 66  ? 31.841  -49.914 -51.473 1.00   67.34 ? 66   GLU C O     1 
ATOM   7794 C  CB    . GLU C 3 66  ? 34.041  -51.984 -52.645 1.00   65.58 ? 66   GLU C CB    1 
ATOM   7795 N  N     . GLU C 3 67  ? 33.927  -49.230 -51.006 1.00   66.75 ? 67   GLU C N     1 
ATOM   7796 C  CA    . GLU C 3 67  ? 33.516  -48.525 -49.796 1.00   67.03 ? 67   GLU C CA    1 
ATOM   7797 C  C     . GLU C 3 67  ? 32.928  -47.148 -50.083 1.00   66.45 ? 67   GLU C C     1 
ATOM   7798 O  O     . GLU C 3 67  ? 32.178  -46.605 -49.278 1.00   64.01 ? 67   GLU C O     1 
ATOM   7799 C  CB    . GLU C 3 67  ? 34.694  -48.421 -48.824 1.00   68.53 ? 67   GLU C CB    1 
ATOM   7800 C  CG    . GLU C 3 67  ? 34.862  -49.683 -47.983 1.00   72.97 ? 67   GLU C CG    1 
ATOM   7801 C  CD    . GLU C 3 67  ? 36.269  -49.884 -47.463 1.00   75.47 ? 67   GLU C CD    1 
ATOM   7802 O  OE1   . GLU C 3 67  ? 36.870  -48.914 -46.958 1.00   77.54 ? 67   GLU C OE1   1 
ATOM   7803 O  OE2   . GLU C 3 67  ? 36.779  -51.021 -47.547 1.00   76.73 ? 67   GLU C OE2   1 
ATOM   7804 N  N     . PHE C 3 68  ? 33.263  -46.600 -51.243 1.00   64.05 ? 68   PHE C N     1 
ATOM   7805 C  CA    . PHE C 3 68  ? 32.767  -45.304 -51.664 1.00   61.71 ? 68   PHE C CA    1 
ATOM   7806 C  C     . PHE C 3 68  ? 31.271  -45.333 -51.965 1.00   60.83 ? 68   PHE C C     1 
ATOM   7807 O  O     . PHE C 3 68  ? 30.499  -44.540 -51.420 1.00   60.16 ? 68   PHE C O     1 
ATOM   7808 C  CB    . PHE C 3 68  ? 33.491  -44.874 -52.921 1.00   62.56 ? 68   PHE C CB    1 
ATOM   7809 C  CG    . PHE C 3 68  ? 34.110  -43.536 -52.818 1.00   65.68 ? 68   PHE C CG    1 
ATOM   7810 C  CD1   . PHE C 3 68  ? 35.314  -43.370 -52.145 1.00   66.83 ? 68   PHE C CD1   1 
ATOM   7811 C  CD2   . PHE C 3 68  ? 33.497  -42.438 -53.396 1.00   66.57 ? 68   PHE C CD2   1 
ATOM   7812 C  CE1   . PHE C 3 68  ? 35.907  -42.131 -52.047 1.00   68.16 ? 68   PHE C CE1   1 
ATOM   7813 C  CE2   . PHE C 3 68  ? 34.078  -41.194 -53.304 1.00   68.65 ? 68   PHE C CE2   1 
ATOM   7814 C  CZ    . PHE C 3 68  ? 35.293  -41.033 -52.626 1.00   68.75 ? 68   PHE C CZ    1 
ATOM   7815 N  N     . LEU C 3 69  ? 30.876  -46.244 -52.846 1.00   60.01 ? 69   LEU C N     1 
ATOM   7816 C  CA    . LEU C 3 69  ? 29.489  -46.399 -53.269 1.00   60.40 ? 69   LEU C CA    1 
ATOM   7817 C  C     . LEU C 3 69  ? 28.500  -46.214 -52.119 1.00   62.61 ? 69   LEU C C     1 
ATOM   7818 O  O     . LEU C 3 69  ? 27.550  -45.440 -52.231 1.00   60.92 ? 69   LEU C O     1 
ATOM   7819 C  CB    . LEU C 3 69  ? 29.304  -47.772 -53.903 1.00   58.77 ? 69   LEU C CB    1 
ATOM   7820 C  CG    . LEU C 3 69  ? 28.628  -47.803 -55.266 1.00   59.47 ? 69   LEU C CG    1 
ATOM   7821 C  CD1   . LEU C 3 69  ? 28.524  -49.242 -55.718 1.00   59.25 ? 69   LEU C CD1   1 
ATOM   7822 C  CD2   . LEU C 3 69  ? 27.254  -47.148 -55.197 1.00   58.84 ? 69   LEU C CD2   1 
ATOM   7823 N  N     . PRO C 3 70  ? 28.708  -46.922 -50.996 1.00   63.23 ? 70   PRO C N     1 
ATOM   7824 C  CA    . PRO C 3 70  ? 27.821  -46.805 -49.830 1.00   63.02 ? 70   PRO C CA    1 
ATOM   7825 C  C     . PRO C 3 70  ? 27.846  -45.382 -49.267 1.00   61.52 ? 70   PRO C C     1 
ATOM   7826 O  O     . PRO C 3 70  ? 26.800  -44.777 -49.041 1.00   59.74 ? 70   PRO C O     1 
ATOM   7827 C  CB    . PRO C 3 70  ? 28.408  -47.815 -48.837 1.00   64.30 ? 70   PRO C CB    1 
ATOM   7828 C  CG    . PRO C 3 70  ? 29.004  -48.848 -49.735 1.00   66.76 ? 70   PRO C CG    1 
ATOM   7829 C  CD    . PRO C 3 70  ? 29.676  -48.015 -50.804 1.00   64.19 ? 70   PRO C CD    1 
ATOM   7830 N  N     . ALA C 3 71  ? 29.053  -44.864 -49.043 1.00   57.80 ? 71   ALA C N     1 
ATOM   7831 C  CA    . ALA C 3 71  ? 29.214  -43.512 -48.525 1.00   57.23 ? 71   ALA C CA    1 
ATOM   7832 C  C     . ALA C 3 71  ? 28.464  -42.571 -49.454 1.00   58.08 ? 71   ALA C C     1 
ATOM   7833 O  O     . ALA C 3 71  ? 27.815  -41.629 -49.004 1.00   59.44 ? 71   ALA C O     1 
ATOM   7834 C  CB    . ALA C 3 71  ? 30.687  -43.128 -48.477 1.00   55.36 ? 71   ALA C CB    1 
ATOM   7835 N  N     . TYR C 3 72  ? 28.549  -42.831 -50.752 1.00   59.86 ? 72   TYR C N     1 
ATOM   7836 C  CA    . TYR C 3 72  ? 27.854  -41.982 -51.699 1.00   61.95 ? 72   TYR C CA    1 
ATOM   7837 C  C     . TYR C 3 72  ? 26.341  -42.087 -51.533 1.00   63.09 ? 72   TYR C C     1 
ATOM   7838 O  O     . TYR C 3 72  ? 25.669  -41.079 -51.317 1.00   63.04 ? 72   TYR C O     1 
ATOM   7839 C  CB    . TYR C 3 72  ? 28.236  -42.336 -53.128 1.00   61.12 ? 72   TYR C CB    1 
ATOM   7840 C  CG    . TYR C 3 72  ? 27.585  -41.423 -54.125 1.00   60.49 ? 72   TYR C CG    1 
ATOM   7841 C  CD1   . TYR C 3 72  ? 28.043  -40.120 -54.309 1.00   60.42 ? 72   TYR C CD1   1 
ATOM   7842 C  CD2   . TYR C 3 72  ? 26.500  -41.854 -54.880 1.00   60.87 ? 72   TYR C CD2   1 
ATOM   7843 C  CE1   . TYR C 3 72  ? 27.433  -39.265 -55.226 1.00   60.53 ? 72   TYR C CE1   1 
ATOM   7844 C  CE2   . TYR C 3 72  ? 25.885  -41.011 -55.802 1.00   60.90 ? 72   TYR C CE2   1 
ATOM   7845 C  CZ    . TYR C 3 72  ? 26.357  -39.722 -55.969 1.00   60.69 ? 72   TYR C CZ    1 
ATOM   7846 O  OH    . TYR C 3 72  ? 25.763  -38.903 -56.895 1.00   61.53 ? 72   TYR C OH    1 
ATOM   7847 N  N     . GLU C 3 73  ? 25.805  -43.300 -51.638 1.00   64.80 ? 73   GLU C N     1 
ATOM   7848 C  CA    . GLU C 3 73  ? 24.363  -43.514 -51.494 1.00   66.59 ? 73   GLU C CA    1 
ATOM   7849 C  C     . GLU C 3 73  ? 23.875  -42.893 -50.180 1.00   65.67 ? 73   GLU C C     1 
ATOM   7850 O  O     . GLU C 3 73  ? 22.728  -42.458 -50.079 1.00   65.52 ? 73   GLU C O     1 
ATOM   7851 C  CB    . GLU C 3 73  ? 24.031  -45.011 -51.524 1.00   69.71 ? 73   GLU C CB    1 
ATOM   7852 C  CG    . GLU C 3 73  ? 24.538  -45.749 -52.768 1.00   74.09 ? 73   GLU C CG    1 
ATOM   7853 C  CD    . GLU C 3 73  ? 24.141  -47.218 -52.771 1.00   76.73 ? 73   GLU C CD    1 
ATOM   7854 O  OE1   . GLU C 3 73  ? 24.194  -47.841 -51.684 1.00   78.13 ? 73   GLU C OE1   1 
ATOM   7855 O  OE2   . GLU C 3 73  ? 23.786  -47.756 -53.849 1.00   77.25 ? 73   GLU C OE2   1 
ATOM   7856 N  N     . GLY C 3 74  ? 24.755  -42.857 -49.193 1.00   63.72 ? 74   GLY C N     1 
ATOM   7857 C  CA    . GLY C 3 74  ? 24.414  -42.254 -47.922 1.00   61.57 ? 74   GLY C CA    1 
ATOM   7858 C  C     . GLY C 3 74  ? 24.268  -40.741 -48.041 1.00   60.16 ? 74   GLY C C     1 
ATOM   7859 O  O     . GLY C 3 74  ? 23.275  -40.182 -47.571 1.00   59.81 ? 74   GLY C O     1 
ATOM   7860 N  N     . LEU C 3 75  ? 25.239  -40.079 -48.663 1.00   58.68 ? 75   LEU C N     1 
ATOM   7861 C  CA    . LEU C 3 75  ? 25.183  -38.631 -48.826 1.00   58.14 ? 75   LEU C CA    1 
ATOM   7862 C  C     . LEU C 3 75  ? 24.050  -38.201 -49.758 1.00   60.32 ? 75   LEU C C     1 
ATOM   7863 O  O     . LEU C 3 75  ? 23.681  -37.031 -49.790 1.00   59.52 ? 75   LEU C O     1 
ATOM   7864 C  CB    . LEU C 3 75  ? 26.524  -38.099 -49.351 1.00   54.36 ? 75   LEU C CB    1 
ATOM   7865 C  CG    . LEU C 3 75  ? 27.679  -38.187 -48.347 1.00   52.13 ? 75   LEU C CG    1 
ATOM   7866 C  CD1   . LEU C 3 75  ? 28.996  -37.895 -49.013 1.00   50.64 ? 75   LEU C CD1   1 
ATOM   7867 C  CD2   . LEU C 3 75  ? 27.447  -37.214 -47.212 1.00   50.24 ? 75   LEU C CD2   1 
ATOM   7868 N  N     . MET C 3 76  ? 23.502  -39.144 -50.514 1.00   65.02 ? 76   MET C N     1 
ATOM   7869 C  CA    . MET C 3 76  ? 22.413  -38.830 -51.423 1.00   69.28 ? 76   MET C CA    1 
ATOM   7870 C  C     . MET C 3 76  ? 21.115  -38.657 -50.644 1.00   70.26 ? 76   MET C C     1 
ATOM   7871 O  O     . MET C 3 76  ? 20.177  -38.013 -51.113 1.00   71.87 ? 76   MET C O     1 
ATOM   7872 C  CB    . MET C 3 76  ? 22.233  -39.942 -52.456 1.00   72.56 ? 76   MET C CB    1 
ATOM   7873 C  CG    . MET C 3 76  ? 23.436  -40.194 -53.335 1.00   78.62 ? 76   MET C CG    1 
ATOM   7874 S  SD    . MET C 3 76  ? 22.971  -41.042 -54.879 1.00   82.28 ? 76   MET C SD    1 
ATOM   7875 C  CE    . MET C 3 76  ? 22.760  -39.614 -55.996 1.00   83.23 ? 76   MET C CE    1 
ATOM   7876 N  N     . ASP C 3 77  ? 21.073  -39.236 -49.449 1.00   71.35 ? 77   ASP C N     1 
ATOM   7877 C  CA    . ASP C 3 77  ? 19.897  -39.168 -48.596 1.00   71.76 ? 77   ASP C CA    1 
ATOM   7878 C  C     . ASP C 3 77  ? 19.766  -37.828 -47.865 1.00   73.01 ? 77   ASP C C     1 
ATOM   7879 O  O     . ASP C 3 77  ? 18.660  -37.303 -47.726 1.00   71.72 ? 77   ASP C O     1 
ATOM   7880 C  CB    . ASP C 3 77  ? 19.927  -40.317 -47.585 1.00   73.84 ? 77   ASP C CB    1 
ATOM   7881 N  N     . CYS C 3 78  ? 20.885  -37.276 -47.400 1.00   71.80 ? 78   CYS C N     1 
ATOM   7882 C  CA    . CYS C 3 78  ? 20.862  -36.011 -46.670 1.00   69.11 ? 78   CYS C CA    1 
ATOM   7883 C  C     . CYS C 3 78  ? 20.114  -34.886 -47.393 1.00   67.53 ? 78   CYS C C     1 
ATOM   7884 O  O     . CYS C 3 78  ? 20.057  -34.838 -48.622 1.00   62.28 ? 78   CYS C O     1 
ATOM   7885 C  CB    . CYS C 3 78  ? 22.285  -35.563 -46.345 1.00   69.46 ? 78   CYS C CB    1 
ATOM   7886 S  SG    . CYS C 3 78  ? 23.194  -34.975 -47.763 1.00   78.58 ? 78   CYS C SG    1 
ATOM   7887 N  N     . GLU C 3 79  ? 19.544  -33.985 -46.598 1.00   65.57 ? 79   GLU C N     1 
ATOM   7888 C  CA    . GLU C 3 79  ? 18.764  -32.852 -47.077 1.00   62.73 ? 79   GLU C CA    1 
ATOM   7889 C  C     . GLU C 3 79  ? 19.526  -31.817 -47.905 1.00   61.01 ? 79   GLU C C     1 
ATOM   7890 O  O     . GLU C 3 79  ? 20.623  -31.386 -47.545 1.00   60.15 ? 79   GLU C O     1 
ATOM   7891 C  CB    . GLU C 3 79  ? 18.086  -32.188 -45.873 1.00   63.94 ? 79   GLU C CB    1 
ATOM   7892 C  CG    . GLU C 3 79  ? 17.488  -30.817 -46.117 1.00   68.83 ? 79   GLU C CG    1 
ATOM   7893 C  CD    . GLU C 3 79  ? 16.675  -30.310 -44.928 1.00   70.97 ? 79   GLU C CD    1 
ATOM   7894 O  OE1   . GLU C 3 79  ? 17.126  -30.441 -43.765 1.00   69.99 ? 79   GLU C OE1   1 
ATOM   7895 O  OE2   . GLU C 3 79  ? 15.578  -29.768 -45.175 1.00   72.72 ? 79   GLU C OE2   1 
ATOM   7896 N  N     . GLN C 3 80  ? 18.916  -31.429 -49.022 1.00   61.00 ? 80   GLN C N     1 
ATOM   7897 C  CA    . GLN C 3 80  ? 19.493  -30.450 -49.935 1.00   60.66 ? 80   GLN C CA    1 
ATOM   7898 C  C     . GLN C 3 80  ? 18.707  -29.148 -49.814 1.00   59.70 ? 80   GLN C C     1 
ATOM   7899 O  O     . GLN C 3 80  ? 17.477  -29.159 -49.873 1.00   61.72 ? 80   GLN C O     1 
ATOM   7900 C  CB    . GLN C 3 80  ? 19.426  -30.983 -51.360 1.00   62.93 ? 80   GLN C CB    1 
ATOM   7901 N  N     . GLY C 3 81  ? 19.401  -28.033 -49.646 1.00   58.37 ? 81   GLY C N     1 
ATOM   7902 C  CA    . GLY C 3 81  ? 18.692  -26.770 -49.510 1.00   55.08 ? 81   GLY C CA    1 
ATOM   7903 C  C     . GLY C 3 81  ? 17.965  -26.303 -50.760 1.00   51.87 ? 81   GLY C C     1 
ATOM   7904 O  O     . GLY C 3 81  ? 18.464  -26.484 -51.874 1.00   52.12 ? 81   GLY C O     1 
ATOM   7905 N  N     . THR C 3 82  ? 16.782  -25.701 -50.588 1.00   47.64 ? 82   THR C N     1 
ATOM   7906 C  CA    . THR C 3 82  ? 15.992  -25.167 -51.710 1.00   43.59 ? 82   THR C CA    1 
ATOM   7907 C  C     . THR C 3 82  ? 16.180  -23.653 -51.791 1.00   42.79 ? 82   THR C C     1 
ATOM   7908 O  O     . THR C 3 82  ? 16.841  -23.052 -50.934 1.00   41.01 ? 82   THR C O     1 
ATOM   7909 C  CB    . THR C 3 82  ? 14.480  -25.381 -51.525 1.00   43.90 ? 82   THR C CB    1 
ATOM   7910 O  OG1   . THR C 3 82  ? 14.024  -24.606 -50.397 1.00   41.11 ? 82   THR C OG1   1 
ATOM   7911 C  CG2   . THR C 3 82  ? 14.165  -26.860 -51.319 1.00   42.45 ? 82   THR C CG2   1 
ATOM   7912 N  N     . PHE C 3 83  ? 15.582  -23.043 -52.811 1.00   39.92 ? 83   PHE C N     1 
ATOM   7913 C  CA    . PHE C 3 83  ? 15.650  -21.603 -53.026 1.00   37.97 ? 83   PHE C CA    1 
ATOM   7914 C  C     . PHE C 3 83  ? 14.925  -20.865 -51.915 1.00   38.22 ? 83   PHE C C     1 
ATOM   7915 O  O     . PHE C 3 83  ? 15.436  -19.895 -51.351 1.00   39.61 ? 83   PHE C O     1 
ATOM   7916 C  CB    . PHE C 3 83  ? 14.986  -21.257 -54.364 1.00   37.26 ? 83   PHE C CB    1 
ATOM   7917 C  CG    . PHE C 3 83  ? 14.893  -19.804 -54.637 1.00   35.16 ? 83   PHE C CG    1 
ATOM   7918 C  CD1   . PHE C 3 83  ? 16.030  -19.055 -54.891 1.00   34.73 ? 83   PHE C CD1   1 
ATOM   7919 C  CD2   . PHE C 3 83  ? 13.654  -19.170 -54.638 1.00   35.83 ? 83   PHE C CD2   1 
ATOM   7920 C  CE1   . PHE C 3 83  ? 15.944  -17.690 -55.139 1.00   34.07 ? 83   PHE C CE1   1 
ATOM   7921 C  CE2   . PHE C 3 83  ? 13.549  -17.802 -54.888 1.00   35.06 ? 83   PHE C CE2   1 
ATOM   7922 C  CZ    . PHE C 3 83  ? 14.694  -17.064 -55.137 1.00   35.00 ? 83   PHE C CZ    1 
ATOM   7923 N  N     . ALA C 3 84  ? 13.722  -21.325 -51.609 1.00   39.58 ? 84   ALA C N     1 
ATOM   7924 C  CA    . ALA C 3 84  ? 12.914  -20.723 -50.572 1.00   41.69 ? 84   ALA C CA    1 
ATOM   7925 C  C     . ALA C 3 84  ? 13.577  -20.883 -49.177 1.00   44.09 ? 84   ALA C C     1 
ATOM   7926 O  O     . ALA C 3 84  ? 13.379  -20.024 -48.315 1.00   45.14 ? 84   ALA C O     1 
ATOM   7927 C  CB    . ALA C 3 84  ? 11.484  -21.320 -50.590 1.00   40.57 ? 84   ALA C CB    1 
ATOM   7928 N  N     . ASP C 3 85  ? 14.348  -21.950 -48.945 1.00   46.82 ? 85   ASP C N     1 
ATOM   7929 C  CA    . ASP C 3 85  ? 15.008  -22.101 -47.627 1.00   48.26 ? 85   ASP C CA    1 
ATOM   7930 C  C     . ASP C 3 85  ? 16.039  -20.983 -47.480 1.00   47.80 ? 85   ASP C C     1 
ATOM   7931 O  O     . ASP C 3 85  ? 16.151  -20.370 -46.425 1.00   46.16 ? 85   ASP C O     1 
ATOM   7932 C  CB    . ASP C 3 85  ? 15.749  -23.452 -47.482 1.00   51.36 ? 85   ASP C CB    1 
ATOM   7933 C  CG    . ASP C 3 85  ? 14.811  -24.647 -47.381 1.00   55.19 ? 85   ASP C CG    1 
ATOM   7934 O  OD1   . ASP C 3 85  ? 15.132  -25.721 -47.953 1.00   57.48 ? 85   ASP C OD1   1 
ATOM   7935 O  OD2   . ASP C 3 85  ? 13.755  -24.524 -46.719 1.00   58.85 ? 85   ASP C OD2   1 
ATOM   7936 N  N     . TYR C 3 86  ? 16.790  -20.720 -48.558 1.00   46.18 ? 86   TYR C N     1 
ATOM   7937 C  CA    . TYR C 3 86  ? 17.829  -19.688 -48.526 1.00   45.12 ? 86   TYR C CA    1 
ATOM   7938 C  C     . TYR C 3 86  ? 17.300  -18.267 -48.387 1.00   44.75 ? 86   TYR C C     1 
ATOM   7939 O  O     . TYR C 3 86  ? 17.875  -17.463 -47.655 1.00   43.89 ? 86   TYR C O     1 
ATOM   7940 C  CB    . TYR C 3 86  ? 18.735  -19.780 -49.773 1.00   44.45 ? 86   TYR C CB    1 
ATOM   7941 C  CG    . TYR C 3 86  ? 19.387  -21.147 -49.960 1.00   45.03 ? 86   TYR C CG    1 
ATOM   7942 C  CD1   . TYR C 3 86  ? 19.922  -21.857 -48.867 1.00   44.42 ? 86   TYR C CD1   1 
ATOM   7943 C  CD2   . TYR C 3 86  ? 19.474  -21.732 -51.229 1.00   44.39 ? 86   TYR C CD2   1 
ATOM   7944 C  CE1   . TYR C 3 86  ? 20.516  -23.108 -49.043 1.00   43.27 ? 86   TYR C CE1   1 
ATOM   7945 C  CE2   . TYR C 3 86  ? 20.066  -22.969 -51.406 1.00   43.69 ? 86   TYR C CE2   1 
ATOM   7946 C  CZ    . TYR C 3 86  ? 20.583  -23.646 -50.310 1.00   43.85 ? 86   TYR C CZ    1 
ATOM   7947 O  OH    . TYR C 3 86  ? 21.189  -24.848 -50.512 1.00   43.65 ? 86   TYR C OH    1 
ATOM   7948 N  N     . MET C 3 87  ? 16.204  -17.961 -49.077 1.00   44.71 ? 87   MET C N     1 
ATOM   7949 C  CA    . MET C 3 87  ? 15.617  -16.635 -49.003 1.00   45.61 ? 87   MET C CA    1 
ATOM   7950 C  C     . MET C 3 87  ? 15.121  -16.334 -47.591 1.00   46.20 ? 87   MET C C     1 
ATOM   7951 O  O     . MET C 3 87  ? 15.423  -15.276 -47.043 1.00   45.93 ? 87   MET C O     1 
ATOM   7952 C  CB    . MET C 3 87  ? 14.461  -16.509 -49.999 1.00   46.92 ? 87   MET C CB    1 
ATOM   7953 C  CG    . MET C 3 87  ? 14.896  -16.557 -51.459 1.00   49.86 ? 87   MET C CG    1 
ATOM   7954 S  SD    . MET C 3 87  ? 16.046  -15.233 -51.907 1.00   51.08 ? 87   MET C SD    1 
ATOM   7955 C  CE    . MET C 3 87  ? 14.875  -13.940 -52.412 1.00   53.14 ? 87   MET C CE    1 
ATOM   7956 N  N     . GLU C 3 88  ? 14.360  -17.251 -47.001 1.00   46.30 ? 88   GLU C N     1 
ATOM   7957 C  CA    . GLU C 3 88  ? 13.869  -17.045 -45.649 1.00   46.31 ? 88   GLU C CA    1 
ATOM   7958 C  C     . GLU C 3 88  ? 15.063  -16.808 -44.711 1.00   45.29 ? 88   GLU C C     1 
ATOM   7959 O  O     . GLU C 3 88  ? 15.057  -15.859 -43.927 1.00   44.12 ? 88   GLU C O     1 
ATOM   7960 C  CB    . GLU C 3 88  ? 13.090  -18.260 -45.164 1.00   49.17 ? 88   GLU C CB    1 
ATOM   7961 C  CG    . GLU C 3 88  ? 11.839  -18.545 -45.936 1.00   54.50 ? 88   GLU C CG    1 
ATOM   7962 C  CD    . GLU C 3 88  ? 10.840  -17.406 -45.875 1.00   58.60 ? 88   GLU C CD    1 
ATOM   7963 O  OE1   . GLU C 3 88  ? 10.831  -16.672 -44.857 1.00   59.14 ? 88   GLU C OE1   1 
ATOM   7964 O  OE2   . GLU C 3 88  ? 10.042  -17.259 -46.842 1.00   60.51 ? 88   GLU C OE2   1 
ATOM   7965 N  N     . ALA C 3 89  ? 16.088  -17.660 -44.792 1.00   43.21 ? 89   ALA C N     1 
ATOM   7966 C  CA    . ALA C 3 89  ? 17.261  -17.481 -43.933 1.00   40.77 ? 89   ALA C CA    1 
ATOM   7967 C  C     . ALA C 3 89  ? 17.862  -16.100 -44.111 1.00   39.84 ? 89   ALA C C     1 
ATOM   7968 O  O     . ALA C 3 89  ? 18.144  -15.415 -43.132 1.00   39.01 ? 89   ALA C O     1 
ATOM   7969 C  CB    . ALA C 3 89  ? 18.310  -18.540 -44.218 1.00   40.78 ? 89   ALA C CB    1 
ATOM   7970 N  N     . PHE C 3 90  ? 18.068  -15.675 -45.357 1.00   39.19 ? 90   PHE C N     1 
ATOM   7971 C  CA    . PHE C 3 90  ? 18.648  -14.352 -45.570 1.00   39.27 ? 90   PHE C CA    1 
ATOM   7972 C  C     . PHE C 3 90  ? 17.681  -13.272 -45.115 1.00   41.16 ? 90   PHE C C     1 
ATOM   7973 O  O     . PHE C 3 90  ? 18.098  -12.229 -44.634 1.00   39.22 ? 90   PHE C O     1 
ATOM   7974 C  CB    . PHE C 3 90  ? 19.023  -14.136 -47.042 1.00   39.80 ? 90   PHE C CB    1 
ATOM   7975 C  CG    . PHE C 3 90  ? 20.431  -14.562 -47.380 1.00   39.68 ? 90   PHE C CG    1 
ATOM   7976 C  CD1   . PHE C 3 90  ? 21.519  -13.916 -46.824 1.00   38.61 ? 90   PHE C CD1   1 
ATOM   7977 C  CD2   . PHE C 3 90  ? 20.661  -15.596 -48.279 1.00   39.78 ? 90   PHE C CD2   1 
ATOM   7978 C  CE1   . PHE C 3 90  ? 22.811  -14.282 -47.155 1.00   38.98 ? 90   PHE C CE1   1 
ATOM   7979 C  CE2   . PHE C 3 90  ? 21.959  -15.968 -48.615 1.00   39.89 ? 90   PHE C CE2   1 
ATOM   7980 C  CZ    . PHE C 3 90  ? 23.036  -15.306 -48.053 1.00   38.31 ? 90   PHE C CZ    1 
ATOM   7981 N  N     . LYS C 3 91  ? 16.396  -13.535 -45.265 1.00   42.88 ? 91   LYS C N     1 
ATOM   7982 C  CA    . LYS C 3 91  ? 15.386  -12.593 -44.839 1.00   43.78 ? 91   LYS C CA    1 
ATOM   7983 C  C     . LYS C 3 91  ? 15.548  -12.265 -43.370 1.00   43.05 ? 91   LYS C C     1 
ATOM   7984 O  O     . LYS C 3 91  ? 15.253  -11.148 -42.939 1.00   41.50 ? 91   LYS C O     1 
ATOM   7985 C  CB    . LYS C 3 91  ? 13.984  -13.155 -45.089 1.00   47.44 ? 91   LYS C CB    1 
ATOM   7986 C  CG    . LYS C 3 91  ? 13.230  -12.509 -46.249 1.00   55.34 ? 91   LYS C CG    1 
ATOM   7987 C  CD    . LYS C 3 91  ? 11.845  -13.163 -46.430 1.00   60.19 ? 91   LYS C CD    1 
ATOM   7988 C  CE    . LYS C 3 91  ? 11.118  -13.268 -45.091 1.00   63.10 ? 91   LYS C CE    1 
ATOM   7989 N  NZ    . LYS C 3 91  ? 9.990   -14.285 -45.057 1.00   63.87 ? 91   LYS C NZ    1 
ATOM   7990 N  N     . THR C 3 92  ? 16.013  -13.237 -42.573 1.00   43.92 ? 92   THR C N     1 
ATOM   7991 C  CA    . THR C 3 92  ? 16.197  -12.968 -41.145 1.00   43.75 ? 92   THR C CA    1 
ATOM   7992 C  C     . THR C 3 92  ? 17.225  -11.878 -40.881 1.00   43.93 ? 92   THR C C     1 
ATOM   7993 O  O     . THR C 3 92  ? 17.175  -11.223 -39.843 1.00   45.53 ? 92   THR C O     1 
ATOM   7994 C  CB    . THR C 3 92  ? 16.642  -14.208 -40.343 1.00   42.33 ? 92   THR C CB    1 
ATOM   7995 O  OG1   . THR C 3 92  ? 17.900  -14.669 -40.833 1.00   41.78 ? 92   THR C OG1   1 
ATOM   7996 C  CG2   . THR C 3 92  ? 15.616  -15.304 -40.425 1.00   41.41 ? 92   THR C CG2   1 
ATOM   7997 N  N     . PHE C 3 93  ? 18.163  -11.667 -41.805 1.00   46.15 ? 93   PHE C N     1 
ATOM   7998 C  CA    . PHE C 3 93  ? 19.193  -10.624 -41.593 1.00   48.42 ? 93   PHE C CA    1 
ATOM   7999 C  C     . PHE C 3 93  ? 18.861  -9.312  -42.286 1.00   49.55 ? 93   PHE C C     1 
ATOM   8000 O  O     . PHE C 3 93  ? 19.596  -8.333  -42.171 1.00   48.80 ? 93   PHE C O     1 
ATOM   8001 C  CB    . PHE C 3 93  ? 20.561  -11.068 -42.113 1.00   46.92 ? 93   PHE C CB    1 
ATOM   8002 C  CG    . PHE C 3 93  ? 21.045  -12.347 -41.530 1.00   46.76 ? 93   PHE C CG    1 
ATOM   8003 C  CD1   . PHE C 3 93  ? 20.594  -13.559 -42.024 1.00   45.48 ? 93   PHE C CD1   1 
ATOM   8004 C  CD2   . PHE C 3 93  ? 21.953  -12.339 -40.467 1.00   45.69 ? 93   PHE C CD2   1 
ATOM   8005 C  CE1   . PHE C 3 93  ? 21.034  -14.744 -41.479 1.00   45.82 ? 93   PHE C CE1   1 
ATOM   8006 C  CE2   . PHE C 3 93  ? 22.400  -13.517 -39.914 1.00   45.41 ? 93   PHE C CE2   1 
ATOM   8007 C  CZ    . PHE C 3 93  ? 21.938  -14.734 -40.421 1.00   45.56 ? 93   PHE C CZ    1 
ATOM   8008 N  N     . ASP C 3 94  ? 17.748  -9.306  -43.003 1.00   51.18 ? 94   ASP C N     1 
ATOM   8009 C  CA    . ASP C 3 94  ? 17.296  -8.147  -43.767 1.00   52.44 ? 94   ASP C CA    1 
ATOM   8010 C  C     . ASP C 3 94  ? 16.314  -7.291  -42.966 1.00   54.30 ? 94   ASP C C     1 
ATOM   8011 O  O     . ASP C 3 94  ? 15.120  -7.579  -42.935 1.00   52.85 ? 94   ASP C O     1 
ATOM   8012 C  CB    . ASP C 3 94  ? 16.629  -8.656  -45.053 1.00   52.46 ? 94   ASP C CB    1 
ATOM   8013 C  CG    . ASP C 3 94  ? 16.327  -7.539  -46.059 1.00   54.41 ? 94   ASP C CG    1 
ATOM   8014 O  OD1   . ASP C 3 94  ? 16.785  -6.392  -45.826 1.00   54.52 ? 94   ASP C OD1   1 
ATOM   8015 O  OD2   . ASP C 3 94  ? 15.637  -7.825  -47.079 1.00   53.35 ? 94   ASP C OD2   1 
ATOM   8016 N  N     . ARG C 3 95  ? 16.818  -6.245  -42.321 1.00   57.84 ? 95   ARG C N     1 
ATOM   8017 C  CA    . ARG C 3 95  ? 15.991  -5.335  -41.529 1.00   61.65 ? 95   ARG C CA    1 
ATOM   8018 C  C     . ARG C 3 95  ? 14.994  -4.550  -42.397 1.00   65.53 ? 95   ARG C C     1 
ATOM   8019 O  O     . ARG C 3 95  ? 13.794  -4.554  -42.115 1.00   63.45 ? 95   ARG C O     1 
ATOM   8020 C  CB    . ARG C 3 95  ? 16.875  -4.350  -40.743 1.00   64.05 ? 95   ARG C CB    1 
ATOM   8021 C  CG    . ARG C 3 95  ? 17.679  -5.001  -39.614 1.00   70.33 ? 95   ARG C CG    1 
ATOM   8022 C  CD    . ARG C 3 95  ? 18.632  -4.048  -38.865 1.00   73.12 ? 95   ARG C CD    1 
ATOM   8023 N  NE    . ARG C 3 95  ? 20.000  -4.013  -39.400 1.00   74.97 ? 95   ARG C NE    1 
ATOM   8024 C  CZ    . ARG C 3 95  ? 20.440  -3.141  -40.313 1.00   75.68 ? 95   ARG C CZ    1 
ATOM   8025 N  NH1   . ARG C 3 95  ? 19.624  -2.220  -40.809 1.00   76.37 ? 95   ARG C NH1   1 
ATOM   8026 N  NH2   . ARG C 3 95  ? 21.703  -3.170  -40.725 1.00   75.27 ? 95   ARG C NH2   1 
ATOM   8027 N  N     . GLU C 3 96  ? 15.475  -3.883  -43.444 1.00   69.71 ? 96   GLU C N     1 
ATOM   8028 C  CA    . GLU C 3 96  ? 14.581  -3.113  -44.309 1.00   71.02 ? 96   GLU C CA    1 
ATOM   8029 C  C     . GLU C 3 96  ? 13.677  -3.984  -45.181 1.00   69.26 ? 96   GLU C C     1 
ATOM   8030 O  O     . GLU C 3 96  ? 12.698  -3.501  -45.746 1.00   66.85 ? 96   GLU C O     1 
ATOM   8031 C  CB    . GLU C 3 96  ? 15.378  -2.155  -45.202 1.00   76.45 ? 96   GLU C CB    1 
ATOM   8032 C  CG    . GLU C 3 96  ? 14.519  -1.329  -46.192 1.00   90.77 ? 96   GLU C CG    1 
ATOM   8033 C  CD    . GLU C 3 96  ? 13.462  -0.432  -45.522 1.00   96.88 ? 96   GLU C CD    1 
ATOM   8034 O  OE1   . GLU C 3 96  ? 12.475  -0.967  -44.960 1.00   98.85 ? 96   GLU C OE1   1 
ATOM   8035 O  OE2   . GLU C 3 96  ? 13.621  0.812   -45.562 1.00   98.96 ? 96   GLU C OE2   1 
ATOM   8036 N  N     . GLY C 3 97  ? 14.001  -5.269  -45.279 1.00   66.16 ? 97   GLY C N     1 
ATOM   8037 C  CA    . GLY C 3 97  ? 13.196  -6.172  -46.079 1.00   63.34 ? 97   GLY C CA    1 
ATOM   8038 C  C     . GLY C 3 97  ? 13.079  -5.759  -47.538 1.00   62.64 ? 97   GLY C C     1 
ATOM   8039 O  O     . GLY C 3 97  ? 12.004  -5.855  -48.135 1.00   62.33 ? 97   GLY C O     1 
ATOM   8040 N  N     . GLN C 3 98  ? 14.183  -5.305  -48.109 1.00   62.09 ? 98   GLN C N     1 
ATOM   8041 C  CA    . GLN C 3 98  ? 14.211  -4.872  -49.493 1.00   61.39 ? 98   GLN C CA    1 
ATOM   8042 C  C     . GLN C 3 98  ? 14.920  -5.852  -50.421 1.00   59.91 ? 98   GLN C C     1 
ATOM   8043 O  O     . GLN C 3 98  ? 14.781  -5.775  -51.647 1.00   59.30 ? 98   GLN C O     1 
ATOM   8044 C  CB    . GLN C 3 98  ? 14.887  -3.505  -49.594 1.00   62.60 ? 98   GLN C CB    1 
ATOM   8045 C  CG    . GLN C 3 98  ? 14.008  -2.376  -49.121 1.00   66.64 ? 98   GLN C CG    1 
ATOM   8046 C  CD    . GLN C 3 98  ? 12.780  -2.224  -49.995 1.00   69.02 ? 98   GLN C CD    1 
ATOM   8047 O  OE1   . GLN C 3 98  ? 11.640  -2.355  -49.527 1.00   69.57 ? 98   GLN C OE1   1 
ATOM   8048 N  NE2   . GLN C 3 98  ? 13.008  -1.955  -51.284 1.00   69.69 ? 98   GLN C NE2   1 
ATOM   8049 N  N     . GLY C 3 99  ? 15.676  -6.770  -49.839 1.00   56.63 ? 99   GLY C N     1 
ATOM   8050 C  CA    . GLY C 3 99  ? 16.410  -7.738  -50.633 1.00   53.67 ? 99   GLY C CA    1 
ATOM   8051 C  C     . GLY C 3 99  ? 17.886  -7.393  -50.575 1.00   53.69 ? 99   GLY C C     1 
ATOM   8052 O  O     . GLY C 3 99  ? 18.690  -7.941  -51.329 1.00   52.68 ? 99   GLY C O     1 
ATOM   8053 N  N     . PHE C 3 100 ? 18.246  -6.492  -49.670 1.00   52.83 ? 100  PHE C N     1 
ATOM   8054 C  CA    . PHE C 3 100 ? 19.626  -6.068  -49.529 1.00   51.25 ? 100  PHE C CA    1 
ATOM   8055 C  C     . PHE C 3 100 ? 20.291  -6.436  -48.199 1.00   50.73 ? 100  PHE C C     1 
ATOM   8056 O  O     . PHE C 3 100 ? 19.659  -6.471  -47.157 1.00   47.24 ? 100  PHE C O     1 
ATOM   8057 C  CB    . PHE C 3 100 ? 19.724  -4.550  -49.737 1.00   52.71 ? 100  PHE C CB    1 
ATOM   8058 C  CG    . PHE C 3 100 ? 19.493  -4.119  -51.161 1.00   56.99 ? 100  PHE C CG    1 
ATOM   8059 C  CD1   . PHE C 3 100 ? 20.541  -4.107  -52.077 1.00   59.17 ? 100  PHE C CD1   1 
ATOM   8060 C  CD2   . PHE C 3 100 ? 18.224  -3.764  -51.597 1.00   59.21 ? 100  PHE C CD2   1 
ATOM   8061 C  CE1   . PHE C 3 100 ? 20.327  -3.756  -53.415 1.00   60.67 ? 100  PHE C CE1   1 
ATOM   8062 C  CE2   . PHE C 3 100 ? 17.996  -3.407  -52.940 1.00   61.54 ? 100  PHE C CE2   1 
ATOM   8063 C  CZ    . PHE C 3 100 ? 19.055  -3.403  -53.850 1.00   61.09 ? 100  PHE C CZ    1 
ATOM   8064 N  N     . ILE C 3 101 ? 21.586  -6.704  -48.279 1.00   51.13 ? 101  ILE C N     1 
ATOM   8065 C  CA    . ILE C 3 101 ? 22.409  -7.032  -47.133 1.00   50.94 ? 101  ILE C CA    1 
ATOM   8066 C  C     . ILE C 3 101 ? 23.783  -6.481  -47.512 1.00   50.63 ? 101  ILE C C     1 
ATOM   8067 O  O     . ILE C 3 101 ? 24.212  -6.622  -48.657 1.00   50.72 ? 101  ILE C O     1 
ATOM   8068 C  CB    . ILE C 3 101 ? 22.502  -8.551  -46.934 1.00   54.56 ? 101  ILE C CB    1 
ATOM   8069 C  CG1   . ILE C 3 101 ? 23.254  -8.868  -45.646 1.00   58.22 ? 101  ILE C CG1   1 
ATOM   8070 C  CG2   . ILE C 3 101 ? 23.200  -9.191  -48.126 1.00   56.48 ? 101  ILE C CG2   1 
ATOM   8071 C  CD1   . ILE C 3 101 ? 23.504  -10.355 -45.464 1.00   61.06 ? 101  ILE C CD1   1 
ATOM   8072 N  N     . SER C 3 102 ? 24.464  -5.843  -46.570 1.00   50.67 ? 102  SER C N     1 
ATOM   8073 C  CA    . SER C 3 102 ? 25.775  -5.277  -46.862 1.00   49.82 ? 102  SER C CA    1 
ATOM   8074 C  C     . SER C 3 102 ? 26.799  -6.364  -47.139 1.00   49.19 ? 102  SER C C     1 
ATOM   8075 O  O     . SER C 3 102 ? 26.702  -7.475  -46.613 1.00   49.30 ? 102  SER C O     1 
ATOM   8076 C  CB    . SER C 3 102 ? 26.264  -4.423  -45.698 1.00   49.29 ? 102  SER C CB    1 
ATOM   8077 O  OG    . SER C 3 102 ? 26.838  -5.246  -44.687 1.00   50.60 ? 102  SER C OG    1 
ATOM   8078 N  N     . GLY C 3 103 ? 27.778  -6.040  -47.968 1.00   49.10 ? 103  GLY C N     1 
ATOM   8079 C  CA    . GLY C 3 103 ? 28.818  -6.998  -48.287 1.00   48.29 ? 103  GLY C CA    1 
ATOM   8080 C  C     . GLY C 3 103 ? 29.439  -7.562  -47.032 1.00   48.07 ? 103  GLY C C     1 
ATOM   8081 O  O     . GLY C 3 103 ? 29.705  -8.764  -46.948 1.00   48.51 ? 103  GLY C O     1 
ATOM   8082 N  N     . ALA C 3 104 ? 29.666  -6.702  -46.044 1.00   47.25 ? 104  ALA C N     1 
ATOM   8083 C  CA    . ALA C 3 104 ? 30.261  -7.120  -44.784 1.00   46.82 ? 104  ALA C CA    1 
ATOM   8084 C  C     . ALA C 3 104 ? 29.373  -8.130  -44.064 1.00   48.24 ? 104  ALA C C     1 
ATOM   8085 O  O     . ALA C 3 104 ? 29.865  -9.131  -43.531 1.00   46.72 ? 104  ALA C O     1 
ATOM   8086 C  CB    . ALA C 3 104 ? 30.498  -5.913  -43.883 1.00   45.89 ? 104  ALA C CB    1 
ATOM   8087 N  N     . GLU C 3 105 ? 28.075  -7.872  -44.034 1.00   48.55 ? 105  GLU C N     1 
ATOM   8088 C  CA    . GLU C 3 105 ? 27.199  -8.790  -43.363 1.00   49.08 ? 105  GLU C CA    1 
ATOM   8089 C  C     . GLU C 3 105 ? 27.208  -10.129 -44.104 1.00   48.11 ? 105  GLU C C     1 
ATOM   8090 O  O     . GLU C 3 105 ? 27.287  -11.183 -43.474 1.00   46.65 ? 105  GLU C O     1 
ATOM   8091 C  CB    . GLU C 3 105 ? 25.797  -8.215  -43.264 1.00   51.29 ? 105  GLU C CB    1 
ATOM   8092 C  CG    . GLU C 3 105 ? 24.822  -9.187  -42.621 1.00   57.36 ? 105  GLU C CG    1 
ATOM   8093 C  CD    . GLU C 3 105 ? 24.002  -8.571  -41.524 1.00   60.31 ? 105  GLU C CD    1 
ATOM   8094 O  OE1   . GLU C 3 105 ? 24.415  -8.665  -40.348 1.00   62.24 ? 105  GLU C OE1   1 
ATOM   8095 O  OE2   . GLU C 3 105 ? 22.943  -7.986  -41.838 1.00   62.06 ? 105  GLU C OE2   1 
ATOM   8096 N  N     . LEU C 3 106 ? 27.122  -10.092 -45.427 1.00   47.16 ? 106  LEU C N     1 
ATOM   8097 C  CA    . LEU C 3 106 ? 27.157  -11.326 -46.195 1.00   45.78 ? 106  LEU C CA    1 
ATOM   8098 C  C     . LEU C 3 106 ? 28.428  -12.102 -45.844 1.00   45.81 ? 106  LEU C C     1 
ATOM   8099 O  O     . LEU C 3 106 ? 28.362  -13.303 -45.577 1.00   45.03 ? 106  LEU C O     1 
ATOM   8100 C  CB    . LEU C 3 106 ? 27.136  -11.035 -47.690 1.00   45.73 ? 106  LEU C CB    1 
ATOM   8101 C  CG    . LEU C 3 106 ? 27.405  -12.251 -48.584 1.00   46.76 ? 106  LEU C CG    1 
ATOM   8102 C  CD1   . LEU C 3 106 ? 26.404  -13.361 -48.276 1.00   45.89 ? 106  LEU C CD1   1 
ATOM   8103 C  CD2   . LEU C 3 106 ? 27.332  -11.832 -50.056 1.00   46.57 ? 106  LEU C CD2   1 
ATOM   8104 N  N     . ARG C 3 107 ? 29.579  -11.427 -45.839 1.00   46.46 ? 107  ARG C N     1 
ATOM   8105 C  CA    . ARG C 3 107 ? 30.825  -12.099 -45.501 1.00   47.81 ? 107  ARG C CA    1 
ATOM   8106 C  C     . ARG C 3 107 ? 30.788  -12.639 -44.060 1.00   48.10 ? 107  ARG C C     1 
ATOM   8107 O  O     . ARG C 3 107 ? 31.292  -13.726 -43.789 1.00   48.53 ? 107  ARG C O     1 
ATOM   8108 C  CB    . ARG C 3 107 ? 32.025  -11.164 -45.664 1.00   48.47 ? 107  ARG C CB    1 
ATOM   8109 C  CG    . ARG C 3 107 ? 33.352  -11.820 -45.276 1.00   50.05 ? 107  ARG C CG    1 
ATOM   8110 C  CD    . ARG C 3 107 ? 34.542  -10.897 -45.531 1.00   52.65 ? 107  ARG C CD    1 
ATOM   8111 N  NE    . ARG C 3 107 ? 34.761  -10.689 -46.961 1.00   56.62 ? 107  ARG C NE    1 
ATOM   8112 C  CZ    . ARG C 3 107 ? 35.476  -11.495 -47.751 1.00   57.57 ? 107  ARG C CZ    1 
ATOM   8113 N  NH1   . ARG C 3 107 ? 36.065  -12.582 -47.257 1.00   57.76 ? 107  ARG C NH1   1 
ATOM   8114 N  NH2   . ARG C 3 107 ? 35.572  -11.227 -49.053 1.00   57.85 ? 107  ARG C NH2   1 
ATOM   8115 N  N     . HIS C 3 108 ? 30.188  -11.880 -43.142 1.00   49.09 ? 108  HIS C N     1 
ATOM   8116 C  CA    . HIS C 3 108 ? 30.084  -12.310 -41.762 1.00   49.90 ? 108  HIS C CA    1 
ATOM   8117 C  C     . HIS C 3 108 ? 29.308  -13.633 -41.642 1.00   50.27 ? 108  HIS C C     1 
ATOM   8118 O  O     . HIS C 3 108 ? 29.757  -14.563 -40.962 1.00   51.35 ? 108  HIS C O     1 
ATOM   8119 C  CB    . HIS C 3 108 ? 29.383  -11.245 -40.920 1.00   51.47 ? 108  HIS C CB    1 
ATOM   8120 C  CG    . HIS C 3 108 ? 29.092  -11.693 -39.522 1.00   52.03 ? 108  HIS C CG    1 
ATOM   8121 N  ND1   . HIS C 3 108 ? 30.060  -11.732 -38.542 1.00   51.89 ? 108  HIS C ND1   1 
ATOM   8122 C  CD2   . HIS C 3 108 ? 27.984  -12.255 -38.985 1.00   51.17 ? 108  HIS C CD2   1 
ATOM   8123 C  CE1   . HIS C 3 108 ? 29.562  -12.309 -37.460 1.00   51.79 ? 108  HIS C CE1   1 
ATOM   8124 N  NE2   . HIS C 3 108 ? 28.307  -12.638 -37.706 1.00   51.82 ? 108  HIS C NE2   1 
ATOM   8125 N  N     . VAL C 3 109 ? 28.152  -13.707 -42.296 1.00   48.87 ? 109  VAL C N     1 
ATOM   8126 C  CA    . VAL C 3 109 ? 27.298  -14.891 -42.277 1.00   47.85 ? 109  VAL C CA    1 
ATOM   8127 C  C     . VAL C 3 109 ? 28.004  -16.139 -42.833 1.00   47.76 ? 109  VAL C C     1 
ATOM   8128 O  O     . VAL C 3 109 ? 27.908  -17.222 -42.253 1.00   45.88 ? 109  VAL C O     1 
ATOM   8129 C  CB    . VAL C 3 109 ? 25.992  -14.662 -43.123 1.00   47.25 ? 109  VAL C CB    1 
ATOM   8130 C  CG1   . VAL C 3 109 ? 25.147  -15.926 -43.140 1.00   45.29 ? 109  VAL C CG1   1 
ATOM   8131 C  CG2   . VAL C 3 109 ? 25.192  -13.505 -42.566 1.00   45.34 ? 109  VAL C CG2   1 
ATOM   8132 N  N     . LEU C 3 110 ? 28.699  -15.976 -43.952 1.00   46.84 ? 110  LEU C N     1 
ATOM   8133 C  CA    . LEU C 3 110 ? 29.390  -17.095 -44.592 1.00   47.60 ? 110  LEU C CA    1 
ATOM   8134 C  C     . LEU C 3 110 ? 30.645  -17.555 -43.848 1.00   47.74 ? 110  LEU C C     1 
ATOM   8135 O  O     . LEU C 3 110 ? 30.969  -18.741 -43.853 1.00   47.99 ? 110  LEU C O     1 
ATOM   8136 C  CB    . LEU C 3 110 ? 29.766  -16.721 -46.034 1.00   48.24 ? 110  LEU C CB    1 
ATOM   8137 C  CG    . LEU C 3 110 ? 28.605  -16.415 -46.990 1.00   49.48 ? 110  LEU C CG    1 
ATOM   8138 C  CD1   . LEU C 3 110 ? 29.153  -15.937 -48.316 1.00   50.29 ? 110  LEU C CD1   1 
ATOM   8139 C  CD2   . LEU C 3 110 ? 27.745  -17.643 -47.193 1.00   48.51 ? 110  LEU C CD2   1 
ATOM   8140 N  N     . THR C 3 111 ? 31.341  -16.619 -43.210 1.00   48.06 ? 111  THR C N     1 
ATOM   8141 C  CA    . THR C 3 111 ? 32.566  -16.936 -42.484 1.00   48.37 ? 111  THR C CA    1 
ATOM   8142 C  C     . THR C 3 111 ? 32.433  -17.165 -40.979 1.00   47.87 ? 111  THR C C     1 
ATOM   8143 O  O     . THR C 3 111 ? 33.333  -17.737 -40.364 1.00   50.33 ? 111  THR C O     1 
ATOM   8144 C  CB    . THR C 3 111 ? 33.647  -15.831 -42.684 1.00   47.85 ? 111  THR C CB    1 
ATOM   8145 O  OG1   . THR C 3 111 ? 33.178  -14.583 -42.146 1.00   46.40 ? 111  THR C OG1   1 
ATOM   8146 C  CG2   . THR C 3 111 ? 33.971  -15.675 -44.147 1.00   45.52 ? 111  THR C CG2   1 
ATOM   8147 N  N     . ALA C 3 112 ? 31.327  -16.731 -40.377 1.00   48.13 ? 112  ALA C N     1 
ATOM   8148 C  CA    . ALA C 3 112 ? 31.166  -16.897 -38.932 1.00   48.95 ? 112  ALA C CA    1 
ATOM   8149 C  C     . ALA C 3 112 ? 29.982  -17.741 -38.450 1.00   50.79 ? 112  ALA C C     1 
ATOM   8150 O  O     . ALA C 3 112 ? 29.958  -18.152 -37.283 1.00   52.70 ? 112  ALA C O     1 
ATOM   8151 C  CB    . ALA C 3 112 ? 31.139  -15.524 -38.269 1.00   48.30 ? 112  ALA C CB    1 
ATOM   8152 N  N     . LEU C 3 113 ? 28.996  -18.001 -39.311 1.00   51.17 ? 113  LEU C N     1 
ATOM   8153 C  CA    . LEU C 3 113 ? 27.835  -18.804 -38.905 1.00   51.51 ? 113  LEU C CA    1 
ATOM   8154 C  C     . LEU C 3 113 ? 27.861  -20.206 -39.533 1.00   51.55 ? 113  LEU C C     1 
ATOM   8155 O  O     . LEU C 3 113 ? 28.715  -20.491 -40.371 1.00   50.50 ? 113  LEU C O     1 
ATOM   8156 C  CB    . LEU C 3 113 ? 26.528  -18.085 -39.269 1.00   51.99 ? 113  LEU C CB    1 
ATOM   8157 C  CG    . LEU C 3 113 ? 26.249  -16.739 -38.575 1.00   52.86 ? 113  LEU C CG    1 
ATOM   8158 C  CD1   . LEU C 3 113 ? 24.845  -16.217 -38.956 1.00   50.79 ? 113  LEU C CD1   1 
ATOM   8159 C  CD2   . LEU C 3 113 ? 26.372  -16.933 -37.047 1.00   51.12 ? 113  LEU C CD2   1 
ATOM   8160 N  N     . GLY C 3 114 ? 26.933  -21.064 -39.123 1.00   50.51 ? 114  GLY C N     1 
ATOM   8161 C  CA    . GLY C 3 114 ? 26.876  -22.429 -39.629 1.00   50.84 ? 114  GLY C CA    1 
ATOM   8162 C  C     . GLY C 3 114 ? 28.244  -23.086 -39.686 1.00   52.23 ? 114  GLY C C     1 
ATOM   8163 O  O     . GLY C 3 114 ? 29.061  -22.912 -38.775 1.00   51.33 ? 114  GLY C O     1 
ATOM   8164 N  N     . GLU C 3 115 ? 28.498  -23.853 -40.740 1.00   53.35 ? 115  GLU C N     1 
ATOM   8165 C  CA    . GLU C 3 115 ? 29.801  -24.493 -40.915 1.00   54.98 ? 115  GLU C CA    1 
ATOM   8166 C  C     . GLU C 3 115 ? 30.599  -23.433 -41.668 1.00   56.23 ? 115  GLU C C     1 
ATOM   8167 O  O     . GLU C 3 115 ? 30.521  -23.343 -42.897 1.00   56.60 ? 115  GLU C O     1 
ATOM   8168 C  CB    . GLU C 3 115 ? 29.681  -25.764 -41.772 1.00   55.34 ? 115  GLU C CB    1 
ATOM   8169 C  CG    . GLU C 3 115 ? 28.619  -26.749 -41.319 1.00   57.16 ? 115  GLU C CG    1 
ATOM   8170 C  CD    . GLU C 3 115 ? 28.790  -28.157 -41.912 1.00   58.51 ? 115  GLU C CD    1 
ATOM   8171 O  OE1   . GLU C 3 115 ? 28.823  -28.293 -43.158 1.00   56.85 ? 115  GLU C OE1   1 
ATOM   8172 O  OE2   . GLU C 3 115 ? 28.888  -29.128 -41.116 1.00   58.64 ? 115  GLU C OE2   1 
ATOM   8173 N  N     . ARG C 3 116 ? 31.357  -22.628 -40.936 1.00   57.29 ? 116  ARG C N     1 
ATOM   8174 C  CA    . ARG C 3 116 ? 32.137  -21.539 -41.522 1.00   57.38 ? 116  ARG C CA    1 
ATOM   8175 C  C     . ARG C 3 116 ? 32.885  -21.841 -42.819 1.00   56.20 ? 116  ARG C C     1 
ATOM   8176 O  O     . ARG C 3 116 ? 33.304  -22.969 -43.063 1.00   56.49 ? 116  ARG C O     1 
ATOM   8177 C  CB    . ARG C 3 116 ? 33.146  -21.021 -40.500 1.00   59.83 ? 116  ARG C CB    1 
ATOM   8178 C  CG    . ARG C 3 116 ? 32.546  -20.482 -39.191 1.00   62.80 ? 116  ARG C CG    1 
ATOM   8179 C  CD    . ARG C 3 116 ? 33.656  -20.053 -38.245 1.00   64.67 ? 116  ARG C CD    1 
ATOM   8180 N  NE    . ARG C 3 116 ? 33.133  -19.557 -36.976 1.00   67.64 ? 116  ARG C NE    1 
ATOM   8181 C  CZ    . ARG C 3 116 ? 33.889  -19.140 -35.961 1.00   68.27 ? 116  ARG C CZ    1 
ATOM   8182 N  NH1   . ARG C 3 116 ? 35.213  -19.164 -36.064 1.00   69.00 ? 116  ARG C NH1   1 
ATOM   8183 N  NH2   . ARG C 3 116 ? 33.321  -18.679 -34.854 1.00   67.85 ? 116  ARG C NH2   1 
ATOM   8184 N  N     . LEU C 3 117 ? 33.035  -20.816 -43.646 1.00   53.79 ? 117  LEU C N     1 
ATOM   8185 C  CA    . LEU C 3 117 ? 33.797  -20.909 -44.882 1.00   52.94 ? 117  LEU C CA    1 
ATOM   8186 C  C     . LEU C 3 117 ? 35.000  -20.029 -44.577 1.00   54.05 ? 117  LEU C C     1 
ATOM   8187 O  O     . LEU C 3 117 ? 34.966  -19.259 -43.616 1.00   53.48 ? 117  LEU C O     1 
ATOM   8188 C  CB    . LEU C 3 117 ? 33.031  -20.324 -46.075 1.00   49.77 ? 117  LEU C CB    1 
ATOM   8189 C  CG    . LEU C 3 117 ? 31.917  -21.140 -46.751 1.00   46.18 ? 117  LEU C CG    1 
ATOM   8190 C  CD1   . LEU C 3 117 ? 31.338  -20.319 -47.867 1.00   44.30 ? 117  LEU C CD1   1 
ATOM   8191 C  CD2   . LEU C 3 117 ? 32.444  -22.440 -47.292 1.00   43.48 ? 117  LEU C CD2   1 
ATOM   8192 N  N     . SER C 3 118 ? 36.060  -20.126 -45.365 1.00   56.21 ? 118  SER C N     1 
ATOM   8193 C  CA    . SER C 3 118 ? 37.239  -19.300 -45.109 1.00   57.89 ? 118  SER C CA    1 
ATOM   8194 C  C     . SER C 3 118 ? 37.151  -18.049 -45.956 1.00   59.83 ? 118  SER C C     1 
ATOM   8195 O  O     . SER C 3 118 ? 36.352  -17.974 -46.890 1.00   58.62 ? 118  SER C O     1 
ATOM   8196 C  CB    . SER C 3 118 ? 38.517  -20.059 -45.453 1.00   57.05 ? 118  SER C CB    1 
ATOM   8197 O  OG    . SER C 3 118 ? 38.591  -20.266 -46.851 1.00   59.22 ? 118  SER C OG    1 
ATOM   8198 N  N     . ASP C 3 119 ? 37.975  -17.060 -45.630 1.00   63.67 ? 119  ASP C N     1 
ATOM   8199 C  CA    . ASP C 3 119 ? 37.972  -15.813 -46.380 1.00   66.60 ? 119  ASP C CA    1 
ATOM   8200 C  C     . ASP C 3 119 ? 38.426  -15.969 -47.822 1.00   65.55 ? 119  ASP C C     1 
ATOM   8201 O  O     . ASP C 3 119 ? 38.101  -15.134 -48.665 1.00   67.25 ? 119  ASP C O     1 
ATOM   8202 C  CB    . ASP C 3 119 ? 38.826  -14.749 -45.677 1.00   72.07 ? 119  ASP C CB    1 
ATOM   8203 C  CG    . ASP C 3 119 ? 38.012  -13.910 -44.698 1.00   78.28 ? 119  ASP C CG    1 
ATOM   8204 O  OD1   . ASP C 3 119 ? 36.980  -13.347 -45.127 1.00   80.97 ? 119  ASP C OD1   1 
ATOM   8205 O  OD2   . ASP C 3 119 ? 38.394  -13.814 -43.510 1.00   80.76 ? 119  ASP C OD2   1 
ATOM   8206 N  N     . GLU C 3 120 ? 39.174  -17.027 -48.119 1.00   63.18 ? 120  GLU C N     1 
ATOM   8207 C  CA    . GLU C 3 120 ? 39.623  -17.239 -49.494 1.00   61.05 ? 120  GLU C CA    1 
ATOM   8208 C  C     . GLU C 3 120 ? 38.452  -17.809 -50.294 1.00   62.20 ? 120  GLU C C     1 
ATOM   8209 O  O     . GLU C 3 120 ? 38.221  -17.409 -51.435 1.00   59.19 ? 120  GLU C O     1 
ATOM   8210 C  CB    . GLU C 3 120 ? 40.820  -18.194 -49.537 1.00   59.81 ? 120  GLU C CB    1 
ATOM   8211 N  N     . ASP C 3 121 ? 37.712  -18.744 -49.694 1.00   62.15 ? 121  ASP C N     1 
ATOM   8212 C  CA    . ASP C 3 121 ? 36.563  -19.341 -50.366 1.00   61.02 ? 121  ASP C CA    1 
ATOM   8213 C  C     . ASP C 3 121 ? 35.481  -18.307 -50.656 1.00   59.40 ? 121  ASP C C     1 
ATOM   8214 O  O     . ASP C 3 121 ? 34.802  -18.384 -51.669 1.00   54.93 ? 121  ASP C O     1 
ATOM   8215 C  CB    . ASP C 3 121 ? 35.974  -20.480 -49.525 1.00   66.81 ? 121  ASP C CB    1 
ATOM   8216 C  CG    . ASP C 3 121 ? 36.504  -21.853 -49.941 1.00   75.95 ? 121  ASP C CG    1 
ATOM   8217 O  OD1   . ASP C 3 121 ? 35.868  -22.867 -49.584 1.00   81.76 ? 121  ASP C OD1   1 
ATOM   8218 O  OD2   . ASP C 3 121 ? 37.553  -21.930 -50.620 1.00   81.12 ? 121  ASP C OD2   1 
ATOM   8219 N  N     . VAL C 3 122 ? 35.325  -17.337 -49.762 1.00   57.06 ? 122  VAL C N     1 
ATOM   8220 C  CA    . VAL C 3 122 ? 34.329  -16.293 -49.957 1.00   54.00 ? 122  VAL C CA    1 
ATOM   8221 C  C     . VAL C 3 122 ? 34.779  -15.348 -51.069 1.00   53.42 ? 122  VAL C C     1 
ATOM   8222 O  O     . VAL C 3 122 ? 33.976  -14.940 -51.908 1.00   51.36 ? 122  VAL C O     1 
ATOM   8223 C  CB    . VAL C 3 122 ? 34.082  -15.502 -48.646 1.00   55.51 ? 122  VAL C CB    1 
ATOM   8224 C  CG1   . VAL C 3 122 ? 33.068  -14.382 -48.890 1.00   58.63 ? 122  VAL C CG1   1 
ATOM   8225 C  CG2   . VAL C 3 122 ? 33.566  -16.452 -47.560 1.00   58.87 ? 122  VAL C CG2   1 
ATOM   8226 N  N     . ASP C 3 123 ? 36.063  -15.006 -51.078 1.00   53.29 ? 123  ASP C N     1 
ATOM   8227 C  CA    . ASP C 3 123 ? 36.622  -14.141 -52.124 1.00   52.76 ? 123  ASP C CA    1 
ATOM   8228 C  C     . ASP C 3 123 ? 36.429  -14.847 -53.470 1.00   52.00 ? 123  ASP C C     1 
ATOM   8229 O  O     . ASP C 3 123 ? 35.957  -14.252 -54.439 1.00   50.18 ? 123  ASP C O     1 
ATOM   8230 C  CB    . ASP C 3 123 ? 38.124  -13.911 -51.901 1.00   56.02 ? 123  ASP C CB    1 
ATOM   8231 C  CG    . ASP C 3 123 ? 38.421  -13.001 -50.714 1.00   61.65 ? 123  ASP C CG    1 
ATOM   8232 O  OD1   . ASP C 3 123 ? 39.622  -12.790 -50.410 1.00   64.59 ? 123  ASP C OD1   1 
ATOM   8233 O  OD2   . ASP C 3 123 ? 37.466  -12.492 -50.084 1.00   64.71 ? 123  ASP C OD2   1 
ATOM   8234 N  N     . GLU C 3 124 ? 36.792  -16.129 -53.505 1.00   51.09 ? 124  GLU C N     1 
ATOM   8235 C  CA    . GLU C 3 124 ? 36.674  -16.946 -54.711 1.00   49.12 ? 124  GLU C CA    1 
ATOM   8236 C  C     . GLU C 3 124 ? 35.261  -17.025 -55.248 1.00   47.67 ? 124  GLU C C     1 
ATOM   8237 O  O     . GLU C 3 124 ? 35.041  -16.825 -56.439 1.00   47.97 ? 124  GLU C O     1 
ATOM   8238 C  CB    . GLU C 3 124 ? 37.193  -18.357 -54.428 1.00   50.02 ? 124  GLU C CB    1 
ATOM   8239 C  CG    . GLU C 3 124 ? 37.497  -19.194 -55.669 1.00   52.63 ? 124  GLU C CG    1 
ATOM   8240 C  CD    . GLU C 3 124 ? 38.163  -20.513 -55.333 0.0000 54.21 ? 124  GLU C CD    1 
ATOM   8241 O  OE1   . GLU C 3 124 ? 37.573  -21.297 -54.561 0.0000 54.78 ? 124  GLU C OE1   1 
ATOM   8242 O  OE2   . GLU C 3 124 ? 39.276  -20.765 -55.841 0.0000 54.78 ? 124  GLU C OE2   1 
ATOM   8243 N  N     . ILE C 3 125 ? 34.290  -17.314 -54.382 1.00   47.62 ? 125  ILE C N     1 
ATOM   8244 C  CA    . ILE C 3 125 ? 32.908  -17.420 -54.850 1.00   47.48 ? 125  ILE C CA    1 
ATOM   8245 C  C     . ILE C 3 125 ? 32.341  -16.068 -55.270 1.00   47.55 ? 125  ILE C C     1 
ATOM   8246 O  O     . ILE C 3 125 ? 31.543  -15.994 -56.200 1.00   49.86 ? 125  ILE C O     1 
ATOM   8247 C  CB    . ILE C 3 125 ? 31.967  -18.090 -53.786 1.00   45.18 ? 125  ILE C CB    1 
ATOM   8248 C  CG1   . ILE C 3 125 ? 30.623  -18.429 -54.419 1.00   41.46 ? 125  ILE C CG1   1 
ATOM   8249 C  CG2   . ILE C 3 125 ? 31.719  -17.166 -52.603 1.00   42.79 ? 125  ILE C CG2   1 
ATOM   8250 C  CD1   . ILE C 3 125 ? 30.653  -19.632 -55.326 1.00   40.47 ? 125  ILE C CD1   1 
ATOM   8251 N  N     . ILE C 3 126 ? 32.753  -15.000 -54.591 1.00   50.62 ? 126  ILE C N     1 
ATOM   8252 C  CA    . ILE C 3 126 ? 32.283  -13.658 -54.941 1.00   54.40 ? 126  ILE C CA    1 
ATOM   8253 C  C     . ILE C 3 126 ? 32.787  -13.299 -56.340 1.00   55.72 ? 126  ILE C C     1 
ATOM   8254 O  O     . ILE C 3 126 ? 32.033  -12.776 -57.158 1.00   57.44 ? 126  ILE C O     1 
ATOM   8255 C  CB    . ILE C 3 126 ? 32.781  -12.587 -53.925 1.00   53.11 ? 126  ILE C CB    1 
ATOM   8256 C  CG1   . ILE C 3 126 ? 32.108  -12.812 -52.568 1.00   52.35 ? 126  ILE C CG1   1 
ATOM   8257 C  CG2   . ILE C 3 126 ? 32.461  -11.177 -54.421 1.00   51.32 ? 126  ILE C CG2   1 
ATOM   8258 C  CD1   . ILE C 3 126 ? 32.603  -11.888 -51.487 1.00   50.93 ? 126  ILE C CD1   1 
ATOM   8259 N  N     . LYS C 3 127 ? 34.054  -13.584 -56.609 1.00   57.50 ? 127  LYS C N     1 
ATOM   8260 C  CA    . LYS C 3 127 ? 34.631  -13.292 -57.921 1.00   58.78 ? 127  LYS C CA    1 
ATOM   8261 C  C     . LYS C 3 127 ? 33.998  -14.143 -59.027 1.00   59.77 ? 127  LYS C C     1 
ATOM   8262 O  O     . LYS C 3 127 ? 33.664  -13.634 -60.095 1.00   56.94 ? 127  LYS C O     1 
ATOM   8263 C  CB    . LYS C 3 127 ? 36.141  -13.519 -57.889 1.00   59.60 ? 127  LYS C CB    1 
ATOM   8264 N  N     . LEU C 3 128 ? 33.830  -15.443 -58.764 1.00   58.75 ? 128  LEU C N     1 
ATOM   8265 C  CA    . LEU C 3 128 ? 33.262  -16.370 -59.734 1.00   57.06 ? 128  LEU C CA    1 
ATOM   8266 C  C     . LEU C 3 128 ? 31.825  -16.074 -60.104 1.00   56.44 ? 128  LEU C C     1 
ATOM   8267 O  O     . LEU C 3 128 ? 31.396  -16.337 -61.230 1.00   53.57 ? 128  LEU C O     1 
ATOM   8268 C  CB    . LEU C 3 128 ? 33.349  -17.808 -59.212 1.00   59.92 ? 128  LEU C CB    1 
ATOM   8269 C  CG    . LEU C 3 128 ? 34.306  -18.712 -59.983 1.00   65.10 ? 128  LEU C CG    1 
ATOM   8270 C  CD1   . LEU C 3 128 ? 33.982  -18.602 -61.484 1.00   68.27 ? 128  LEU C CD1   1 
ATOM   8271 C  CD2   . LEU C 3 128 ? 35.750  -18.302 -59.728 1.00   67.73 ? 128  LEU C CD2   1 
ATOM   8272 N  N     . THR C 3 129 ? 31.070  -15.541 -59.155 1.00   55.62 ? 129  THR C N     1 
ATOM   8273 C  CA    . THR C 3 129 ? 29.677  -15.224 -59.411 1.00   54.67 ? 129  THR C CA    1 
ATOM   8274 C  C     . THR C 3 129 ? 29.610  -13.771 -59.852 1.00   55.56 ? 129  THR C C     1 
ATOM   8275 O  O     . THR C 3 129 ? 28.558  -13.278 -60.250 1.00   55.56 ? 129  THR C O     1 
ATOM   8276 C  CB    . THR C 3 129 ? 28.809  -15.442 -58.148 1.00   54.22 ? 129  THR C CB    1 
ATOM   8277 O  OG1   . THR C 3 129 ? 29.452  -14.846 -57.014 1.00   53.88 ? 129  THR C OG1   1 
ATOM   8278 C  CG2   . THR C 3 129 ? 28.602  -16.927 -57.882 1.00   54.75 ? 129  THR C CG2   1 
ATOM   8279 N  N     . ASP C 3 130 ? 30.750  -13.096 -59.781 1.00   57.23 ? 130  ASP C N     1 
ATOM   8280 C  CA    . ASP C 3 130 ? 30.830  -11.707 -60.188 1.00   59.60 ? 130  ASP C CA    1 
ATOM   8281 C  C     . ASP C 3 130 ? 29.861  -10.854 -59.379 1.00   61.66 ? 130  ASP C C     1 
ATOM   8282 O  O     . ASP C 3 130 ? 29.231  -9.941  -59.918 1.00   60.52 ? 130  ASP C O     1 
ATOM   8283 C  CB    . ASP C 3 130 ? 30.512  -11.591 -61.686 1.00   61.53 ? 130  ASP C CB    1 
ATOM   8284 N  N     . LEU C 3 131 ? 29.739  -11.151 -58.092 1.00   62.74 ? 131  LEU C N     1 
ATOM   8285 C  CA    . LEU C 3 131 ? 28.840  -10.389 -57.244 1.00   63.58 ? 131  LEU C CA    1 
ATOM   8286 C  C     . LEU C 3 131 ? 29.469  -9.060  -56.892 1.00   66.55 ? 131  LEU C C     1 
ATOM   8287 O  O     . LEU C 3 131 ? 30.580  -9.009  -56.365 1.00   63.16 ? 131  LEU C O     1 
ATOM   8288 C  CB    . LEU C 3 131 ? 28.535  -11.138 -55.953 1.00   62.86 ? 131  LEU C CB    1 
ATOM   8289 C  CG    . LEU C 3 131 ? 27.509  -10.434 -55.066 1.00   63.06 ? 131  LEU C CG    1 
ATOM   8290 C  CD1   . LEU C 3 131 ? 26.113  -10.661 -55.629 1.00   64.03 ? 131  LEU C CD1   1 
ATOM   8291 C  CD2   . LEU C 3 131 ? 27.610  -10.960 -53.658 1.00   63.67 ? 131  LEU C CD2   1 
ATOM   8292 N  N     . GLN C 3 132 ? 28.755  -7.984  -57.179 1.00   71.32 ? 132  GLN C N     1 
ATOM   8293 C  CA    . GLN C 3 132 ? 29.260  -6.660  -56.862 1.00   75.77 ? 132  GLN C CA    1 
ATOM   8294 C  C     . GLN C 3 132 ? 28.240  -5.843  -56.091 1.00   76.78 ? 132  GLN C C     1 
ATOM   8295 O  O     . GLN C 3 132 ? 27.031  -5.955  -56.314 1.00   76.65 ? 132  GLN C O     1 
ATOM   8296 C  CB    . GLN C 3 132 ? 29.656  -5.930  -58.137 1.00   80.75 ? 132  GLN C CB    1 
ATOM   8297 C  CG    . GLN C 3 132 ? 28.613  -5.992  -59.229 1.00   92.47 ? 132  GLN C CG    1 
ATOM   8298 C  CD    . GLN C 3 132 ? 29.118  -5.382  -60.519 1.00   97.33 ? 132  GLN C CD    1 
ATOM   8299 O  OE1   . GLN C 3 132 ? 29.660  -4.274  -60.516 1.00   99.03 ? 132  GLN C OE1   1 
ATOM   8300 N  NE2   . GLN C 3 132 ? 28.944  -6.096  -61.631 1.00   98.98 ? 132  GLN C NE2   1 
ATOM   8301 N  N     . GLU C 3 133 ? 28.739  -5.021  -55.181 1.00   77.52 ? 133  GLU C N     1 
ATOM   8302 C  CA    . GLU C 3 133 ? 27.885  -4.184  -54.360 1.00   77.60 ? 133  GLU C CA    1 
ATOM   8303 C  C     . GLU C 3 133 ? 27.709  -2.765  -54.910 1.00   77.53 ? 133  GLU C C     1 
ATOM   8304 O  O     . GLU C 3 133 ? 28.599  -2.231  -55.571 1.00   76.07 ? 133  GLU C O     1 
ATOM   8305 C  CB    . GLU C 3 133 ? 28.446  -4.145  -52.943 1.00   79.06 ? 133  GLU C CB    1 
ATOM   8306 C  CG    . GLU C 3 133 ? 29.955  -4.238  -52.881 1.00   83.54 ? 133  GLU C CG    1 
ATOM   8307 C  CD    . GLU C 3 133 ? 30.458  -4.505  -51.471 1.00   85.82 ? 133  GLU C CD    1 
ATOM   8308 O  OE1   . GLU C 3 133 ? 30.106  -3.734  -50.553 1.00   86.96 ? 133  GLU C OE1   1 
ATOM   8309 O  OE2   . GLU C 3 133 ? 31.206  -5.485  -51.269 1.00   86.82 ? 133  GLU C OE2   1 
ATOM   8310 N  N     . ASP C 3 134 ? 26.545  -2.169  -54.629 1.00   76.56 ? 134  ASP C N     1 
ATOM   8311 C  CA    . ASP C 3 134 ? 26.224  -0.814  -55.074 1.00   74.83 ? 134  ASP C CA    1 
ATOM   8312 C  C     . ASP C 3 134 ? 27.119  0.207   -54.393 1.00   75.28 ? 134  ASP C C     1 
ATOM   8313 O  O     . ASP C 3 134 ? 28.113  -0.162  -53.767 1.00   70.24 ? 134  ASP C O     1 
ATOM   8314 C  CB    . ASP C 3 134 ? 24.749  -0.477  -54.796 1.00   77.23 ? 134  ASP C CB    1 
ATOM   8315 C  CG    . ASP C 3 134 ? 24.310  -0.805  -53.367 1.00   82.17 ? 134  ASP C CG    1 
ATOM   8316 O  OD1   . ASP C 3 134 ? 25.046  -0.503  -52.401 1.00   84.32 ? 134  ASP C OD1   1 
ATOM   8317 O  OD2   . ASP C 3 134 ? 23.198  -1.356  -53.214 1.00   85.21 ? 134  ASP C OD2   1 
ATOM   8318 N  N     . LEU C 3 135 ? 26.783  1.485   -54.504 1.00   74.95 ? 135  LEU C N     1 
ATOM   8319 C  CA    . LEU C 3 135 ? 27.624  2.505   -53.886 1.00   74.13 ? 135  LEU C CA    1 
ATOM   8320 C  C     . LEU C 3 135 ? 27.614  2.457   -52.361 1.00   74.18 ? 135  LEU C C     1 
ATOM   8321 O  O     . LEU C 3 135 ? 28.594  2.835   -51.717 1.00   70.21 ? 135  LEU C O     1 
ATOM   8322 C  CB    . LEU C 3 135 ? 27.227  3.902   -54.369 1.00   78.60 ? 135  LEU C CB    1 
ATOM   8323 C  CG    . LEU C 3 135 ? 27.446  4.154   -55.868 1.00   87.74 ? 135  LEU C CG    1 
ATOM   8324 C  CD1   . LEU C 3 135 ? 26.247  3.634   -56.661 1.00   92.85 ? 135  LEU C CD1   1 
ATOM   8325 C  CD2   . LEU C 3 135 ? 27.633  5.643   -56.115 1.00   92.90 ? 135  LEU C CD2   1 
ATOM   8326 N  N     . GLU C 3 136 ? 26.509  1.991   -51.787 1.00   74.15 ? 136  GLU C N     1 
ATOM   8327 C  CA    . GLU C 3 136 ? 26.379  1.894   -50.333 1.00   72.46 ? 136  GLU C CA    1 
ATOM   8328 C  C     . GLU C 3 136 ? 27.190  0.705   -49.846 1.00   69.08 ? 136  GLU C C     1 
ATOM   8329 O  O     . GLU C 3 136 ? 27.519  0.605   -48.664 1.00   67.69 ? 136  GLU C O     1 
ATOM   8330 C  CB    . GLU C 3 136 ? 24.913  1.686   -49.920 1.00   78.11 ? 136  GLU C CB    1 
ATOM   8331 C  CG    . GLU C 3 136 ? 23.878  1.920   -51.027 1.00   91.30 ? 136  GLU C CG    1 
ATOM   8332 C  CD    . GLU C 3 136 ? 23.772  3.386   -51.437 1.00   97.17 ? 136  GLU C CD    1 
ATOM   8333 O  OE1   . GLU C 3 136 ? 23.386  4.213   -50.574 1.00   98.91 ? 136  GLU C OE1   1 
ATOM   8334 O  OE2   . GLU C 3 136 ? 24.079  3.703   -52.615 1.00   98.92 ? 136  GLU C OE2   1 
ATOM   8335 N  N     . GLY C 3 137 ? 27.507  -0.193  -50.767 1.00   65.23 ? 137  GLY C N     1 
ATOM   8336 C  CA    . GLY C 3 137 ? 28.258  -1.373  -50.398 1.00   60.01 ? 137  GLY C CA    1 
ATOM   8337 C  C     . GLY C 3 137 ? 27.331  -2.516  -50.019 1.00   57.53 ? 137  GLY C C     1 
ATOM   8338 O  O     . GLY C 3 137 ? 27.702  -3.385  -49.228 1.00   56.33 ? 137  GLY C O     1 
ATOM   8339 N  N     . ASN C 3 138 ? 26.123  -2.505  -50.576 1.00   55.49 ? 138  ASN C N     1 
ATOM   8340 C  CA    . ASN C 3 138 ? 25.141  -3.554  -50.305 1.00   54.63 ? 138  ASN C CA    1 
ATOM   8341 C  C     . ASN C 3 138 ? 24.955  -4.441  -51.541 1.00   53.55 ? 138  ASN C C     1 
ATOM   8342 O  O     . ASN C 3 138 ? 25.296  -4.047  -52.657 1.00   52.93 ? 138  ASN C O     1 
ATOM   8343 C  CB    . ASN C 3 138 ? 23.785  -2.950  -49.904 1.00   56.20 ? 138  ASN C CB    1 
ATOM   8344 C  CG    . ASN C 3 138 ? 23.890  -2.010  -48.715 1.00   57.84 ? 138  ASN C CG    1 
ATOM   8345 O  OD1   . ASN C 3 138 ? 23.855  -0.798  -48.879 1.00   59.44 ? 138  ASN C OD1   1 
ATOM   8346 N  ND2   . ASN C 3 138 ? 24.022  -2.562  -47.518 1.00   58.13 ? 138  ASN C ND2   1 
ATOM   8347 N  N     . VAL C 3 139 ? 24.412  -5.632  -51.330 1.00   52.11 ? 139  VAL C N     1 
ATOM   8348 C  CA    . VAL C 3 139 ? 24.199  -6.580  -52.407 1.00   50.34 ? 139  VAL C CA    1 
ATOM   8349 C  C     . VAL C 3 139 ? 22.781  -7.096  -52.413 1.00   50.69 ? 139  VAL C C     1 
ATOM   8350 O  O     . VAL C 3 139 ? 22.044  -6.948  -51.436 1.00   51.41 ? 139  VAL C O     1 
ATOM   8351 C  CB    . VAL C 3 139 ? 25.159  -7.789  -52.285 1.00   49.08 ? 139  VAL C CB    1 
ATOM   8352 C  CG1   . VAL C 3 139 ? 26.592  -7.316  -52.283 1.00   48.43 ? 139  VAL C CG1   1 
ATOM   8353 C  CG2   . VAL C 3 139 ? 24.887  -8.541  -51.012 1.00   48.88 ? 139  VAL C CG2   1 
ATOM   8354 N  N     . LYS C 3 140 ? 22.398  -7.697  -53.524 1.00   52.09 ? 140  LYS C N     1 
ATOM   8355 C  CA    . LYS C 3 140 ? 21.078  -8.261  -53.672 1.00   53.57 ? 140  LYS C CA    1 
ATOM   8356 C  C     . LYS C 3 140 ? 21.264  -9.749  -53.417 1.00   53.03 ? 140  LYS C C     1 
ATOM   8357 O  O     . LYS C 3 140 ? 21.640  -10.492 -54.320 1.00   54.67 ? 140  LYS C O     1 
ATOM   8358 C  CB    . LYS C 3 140 ? 20.552  -8.019  -55.084 1.00   56.22 ? 140  LYS C CB    1 
ATOM   8359 C  CG    . LYS C 3 140 ? 19.388  -7.059  -55.148 1.00   61.43 ? 140  LYS C CG    1 
ATOM   8360 C  CD    . LYS C 3 140 ? 18.260  -7.514  -54.228 1.00   64.82 ? 140  LYS C CD    1 
ATOM   8361 C  CE    . LYS C 3 140 ? 17.037  -6.596  -54.281 1.00   66.11 ? 140  LYS C CE    1 
ATOM   8362 N  NZ    . LYS C 3 140 ? 16.300  -6.712  -55.584 1.00   66.98 ? 140  LYS C NZ    1 
ATOM   8363 N  N     . TYR C 3 141 ? 21.003  -10.189 -52.199 1.00   51.28 ? 141  TYR C N     1 
ATOM   8364 C  CA    . TYR C 3 141 ? 21.211  -11.593 -51.875 1.00   49.96 ? 141  TYR C CA    1 
ATOM   8365 C  C     . TYR C 3 141 ? 20.432  -12.606 -52.726 1.00   50.99 ? 141  TYR C C     1 
ATOM   8366 O  O     . TYR C 3 141 ? 20.858  -13.753 -52.864 1.00   48.94 ? 141  TYR C O     1 
ATOM   8367 C  CB    . TYR C 3 141 ? 20.967  -11.842 -50.377 1.00   47.12 ? 141  TYR C CB    1 
ATOM   8368 C  CG    . TYR C 3 141 ? 19.601  -11.410 -49.872 1.00   44.72 ? 141  TYR C CG    1 
ATOM   8369 C  CD1   . TYR C 3 141 ? 19.461  -10.295 -49.048 1.00   43.72 ? 141  TYR C CD1   1 
ATOM   8370 C  CD2   . TYR C 3 141 ? 18.462  -12.136 -50.203 1.00   43.60 ? 141  TYR C CD2   1 
ATOM   8371 C  CE1   . TYR C 3 141 ? 18.205  -9.918  -48.559 1.00   43.61 ? 141  TYR C CE1   1 
ATOM   8372 C  CE2   . TYR C 3 141 ? 17.220  -11.783 -49.731 1.00   44.39 ? 141  TYR C CE2   1 
ATOM   8373 C  CZ    . TYR C 3 141 ? 17.092  -10.667 -48.910 1.00   44.37 ? 141  TYR C CZ    1 
ATOM   8374 O  OH    . TYR C 3 141 ? 15.838  -10.312 -48.484 1.00   44.72 ? 141  TYR C OH    1 
ATOM   8375 N  N     . GLU C 3 142 ? 19.312  -12.193 -53.292 1.00   52.61 ? 142  GLU C N     1 
ATOM   8376 C  CA    . GLU C 3 142 ? 18.509  -13.086 -54.115 1.00   53.08 ? 142  GLU C CA    1 
ATOM   8377 C  C     . GLU C 3 142 ? 19.236  -13.453 -55.410 1.00   52.06 ? 142  GLU C C     1 
ATOM   8378 O  O     . GLU C 3 142 ? 19.102  -14.563 -55.902 1.00   49.53 ? 142  GLU C O     1 
ATOM   8379 C  CB    . GLU C 3 142 ? 17.171  -12.440 -54.436 1.00   56.10 ? 142  GLU C CB    1 
ATOM   8380 C  CG    . GLU C 3 142 ? 16.246  -13.298 -55.266 1.00   64.28 ? 142  GLU C CG    1 
ATOM   8381 C  CD    . GLU C 3 142 ? 14.962  -12.565 -55.598 1.00   68.69 ? 142  GLU C CD    1 
ATOM   8382 O  OE1   . GLU C 3 142 ? 15.066  -11.412 -56.069 1.00   71.07 ? 142  GLU C OE1   1 
ATOM   8383 O  OE2   . GLU C 3 142 ? 13.857  -13.126 -55.393 1.00   71.09 ? 142  GLU C OE2   1 
ATOM   8384 N  N     . ASP C 3 143 ? 20.003  -12.512 -55.946 1.00   52.12 ? 143  ASP C N     1 
ATOM   8385 C  CA    . ASP C 3 143 ? 20.755  -12.758 -57.171 1.00   52.18 ? 143  ASP C CA    1 
ATOM   8386 C  C     . ASP C 3 143 ? 21.903  -13.688 -56.830 1.00   51.40 ? 143  ASP C C     1 
ATOM   8387 O  O     . ASP C 3 143 ? 22.224  -14.607 -57.588 1.00   52.11 ? 143  ASP C O     1 
ATOM   8388 C  CB    . ASP C 3 143 ? 21.351  -11.462 -57.755 1.00   54.59 ? 143  ASP C CB    1 
ATOM   8389 C  CG    . ASP C 3 143 ? 20.298  -10.394 -58.046 1.00   57.53 ? 143  ASP C CG    1 
ATOM   8390 O  OD1   . ASP C 3 143 ? 19.174  -10.729 -58.493 1.00   58.57 ? 143  ASP C OD1   1 
ATOM   8391 O  OD2   . ASP C 3 143 ? 20.613  -9.206  -57.837 1.00   58.84 ? 143  ASP C OD2   1 
ATOM   8392 N  N     . PHE C 3 144 ? 22.524  -13.441 -55.689 1.00   50.08 ? 144  PHE C N     1 
ATOM   8393 C  CA    . PHE C 3 144 ? 23.637  -14.256 -55.256 1.00   47.85 ? 144  PHE C CA    1 
ATOM   8394 C  C     . PHE C 3 144 ? 23.192  -15.695 -55.032 1.00   45.30 ? 144  PHE C C     1 
ATOM   8395 O  O     . PHE C 3 144 ? 23.864  -16.629 -55.451 1.00   45.86 ? 144  PHE C O     1 
ATOM   8396 C  CB    . PHE C 3 144 ? 24.231  -13.690 -53.972 1.00   48.03 ? 144  PHE C CB    1 
ATOM   8397 C  CG    . PHE C 3 144 ? 25.419  -14.435 -53.491 1.00   48.08 ? 144  PHE C CG    1 
ATOM   8398 C  CD1   . PHE C 3 144 ? 26.490  -14.682 -54.344 1.00   48.39 ? 144  PHE C CD1   1 
ATOM   8399 C  CD2   . PHE C 3 144 ? 25.475  -14.905 -52.186 1.00   48.34 ? 144  PHE C CD2   1 
ATOM   8400 C  CE1   . PHE C 3 144 ? 27.595  -15.397 -53.897 1.00   48.60 ? 144  PHE C CE1   1 
ATOM   8401 C  CE2   . PHE C 3 144 ? 26.565  -15.615 -51.735 1.00   47.99 ? 144  PHE C CE2   1 
ATOM   8402 C  CZ    . PHE C 3 144 ? 27.629  -15.863 -52.586 1.00   48.10 ? 144  PHE C CZ    1 
ATOM   8403 N  N     . VAL C 3 145 ? 22.051  -15.877 -54.368 1.00   41.89 ? 145  VAL C N     1 
ATOM   8404 C  CA    . VAL C 3 145 ? 21.577  -17.222 -54.120 1.00   39.91 ? 145  VAL C CA    1 
ATOM   8405 C  C     . VAL C 3 145 ? 21.329  -17.919 -55.454 1.00   39.78 ? 145  VAL C C     1 
ATOM   8406 O  O     . VAL C 3 145 ? 21.550  -19.118 -55.583 1.00   38.73 ? 145  VAL C O     1 
ATOM   8407 C  CB    . VAL C 3 145 ? 20.309  -17.214 -53.269 1.00   34.97 ? 145  VAL C CB    1 
ATOM   8408 C  CG1   . VAL C 3 145 ? 19.623  -18.590 -53.312 1.00   30.85 ? 145  VAL C CG1   1 
ATOM   8409 C  CG2   . VAL C 3 145 ? 20.674  -16.854 -51.850 1.00   33.58 ? 145  VAL C CG2   1 
ATOM   8410 N  N     . LYS C 3 146 ? 20.863  -17.148 -56.434 1.00   41.13 ? 146  LYS C N     1 
ATOM   8411 C  CA    . LYS C 3 146 ? 20.594  -17.663 -57.772 1.00   43.88 ? 146  LYS C CA    1 
ATOM   8412 C  C     . LYS C 3 146 ? 21.864  -18.087 -58.509 1.00   43.99 ? 146  LYS C C     1 
ATOM   8413 O  O     . LYS C 3 146 ? 21.880  -19.109 -59.181 1.00   43.50 ? 146  LYS C O     1 
ATOM   8414 C  CB    . LYS C 3 146 ? 19.871  -16.610 -58.623 1.00   45.41 ? 146  LYS C CB    1 
ATOM   8415 C  CG    . LYS C 3 146 ? 18.399  -16.530 -58.329 1.00   49.88 ? 146  LYS C CG    1 
ATOM   8416 C  CD    . LYS C 3 146 ? 17.762  -15.371 -59.047 1.00   52.86 ? 146  LYS C CD    1 
ATOM   8417 C  CE    . LYS C 3 146 ? 16.281  -15.389 -58.799 1.00   55.43 ? 146  LYS C CE    1 
ATOM   8418 N  NZ    . LYS C 3 146 ? 15.721  -16.668 -59.318 1.00   57.84 ? 146  LYS C NZ    1 
ATOM   8419 N  N     . LYS C 3 147 ? 22.908  -17.287 -58.384 1.00   44.07 ? 147  LYS C N     1 
ATOM   8420 C  CA    . LYS C 3 147 ? 24.162  -17.579 -59.047 1.00   44.41 ? 147  LYS C CA    1 
ATOM   8421 C  C     . LYS C 3 147 ? 24.776  -18.853 -58.479 1.00   44.83 ? 147  LYS C C     1 
ATOM   8422 O  O     . LYS C 3 147 ? 25.290  -19.683 -59.223 1.00   44.99 ? 147  LYS C O     1 
ATOM   8423 C  CB    . LYS C 3 147 ? 25.148  -16.422 -58.864 1.00   46.32 ? 147  LYS C CB    1 
ATOM   8424 C  CG    . LYS C 3 147 ? 24.769  -15.113 -59.556 1.00   50.96 ? 147  LYS C CG    1 
ATOM   8425 C  CD    . LYS C 3 147 ? 24.655  -15.302 -61.049 1.00   54.46 ? 147  LYS C CD    1 
ATOM   8426 C  CE    . LYS C 3 147 ? 24.744  -13.975 -61.786 1.00   56.57 ? 147  LYS C CE    1 
ATOM   8427 N  NZ    . LYS C 3 147 ? 26.010  -13.258 -61.432 1.00   58.02 ? 147  LYS C NZ    1 
ATOM   8428 N  N     . VAL C 3 148 ? 24.723  -19.007 -57.161 1.00   44.75 ? 148  VAL C N     1 
ATOM   8429 C  CA    . VAL C 3 148 ? 25.303  -20.169 -56.517 1.00   43.49 ? 148  VAL C CA    1 
ATOM   8430 C  C     . VAL C 3 148 ? 24.546  -21.430 -56.902 1.00   44.19 ? 148  VAL C C     1 
ATOM   8431 O  O     . VAL C 3 148 ? 25.149  -22.437 -57.283 1.00   44.77 ? 148  VAL C O     1 
ATOM   8432 C  CB    . VAL C 3 148 ? 25.311  -19.975 -55.006 1.00   42.68 ? 148  VAL C CB    1 
ATOM   8433 C  CG1   . VAL C 3 148 ? 25.775  -21.232 -54.294 1.00   42.64 ? 148  VAL C CG1   1 
ATOM   8434 C  CG2   . VAL C 3 148 ? 26.235  -18.821 -54.661 1.00   41.17 ? 148  VAL C CG2   1 
ATOM   8435 N  N     . MET C 3 149 ? 23.219  -21.378 -56.818 1.00   45.38 ? 149  MET C N     1 
ATOM   8436 C  CA    . MET C 3 149 ? 22.400  -22.530 -57.168 1.00   46.81 ? 149  MET C CA    1 
ATOM   8437 C  C     . MET C 3 149 ? 22.470  -22.897 -58.667 1.00   49.03 ? 149  MET C C     1 
ATOM   8438 O  O     . MET C 3 149 ? 22.188  -24.044 -59.029 1.00   51.30 ? 149  MET C O     1 
ATOM   8439 C  CB    . MET C 3 149 ? 20.932  -22.283 -56.784 1.00   45.93 ? 149  MET C CB    1 
ATOM   8440 C  CG    . MET C 3 149 ? 20.628  -22.166 -55.288 1.00   41.26 ? 149  MET C CG    1 
ATOM   8441 S  SD    . MET C 3 149 ? 18.848  -22.246 -54.982 1.00   39.74 ? 149  MET C SD    1 
ATOM   8442 C  CE    . MET C 3 149 ? 18.476  -23.922 -55.325 1.00   37.10 ? 149  MET C CE    1 
ATOM   8443 N  N     . ALA C 3 150 ? 22.828  -21.945 -59.532 1.00   48.93 ? 150  ALA C N     1 
ATOM   8444 C  CA    . ALA C 3 150 ? 22.886  -22.207 -60.972 1.00   49.56 ? 150  ALA C CA    1 
ATOM   8445 C  C     . ALA C 3 150 ? 24.176  -22.917 -61.401 1.00   49.71 ? 150  ALA C C     1 
ATOM   8446 O  O     . ALA C 3 150 ? 24.208  -23.561 -62.450 1.00   48.21 ? 150  ALA C O     1 
ATOM   8447 C  CB    . ALA C 3 150 ? 22.708  -20.882 -61.779 1.00   48.68 ? 150  ALA C CB    1 
ATOM   8448 N  N     . GLY C 3 151 ? 25.229  -22.796 -60.600 1.00   49.13 ? 151  GLY C N     1 
ATOM   8449 C  CA    . GLY C 3 151 ? 26.475  -23.461 -60.921 1.00   49.84 ? 151  GLY C CA    1 
ATOM   8450 C  C     . GLY C 3 151 ? 27.465  -22.671 -61.752 1.00   51.73 ? 151  GLY C C     1 
ATOM   8451 O  O     . GLY C 3 151 ? 27.113  -21.653 -62.354 1.00   50.51 ? 151  GLY C O     1 
ATOM   8452 N  N     . PRO C 3 152 ? 28.726  -23.135 -61.813 1.00   53.47 ? 152  PRO C N     1 
ATOM   8453 C  CA    . PRO C 3 152 ? 29.804  -22.479 -62.563 1.00   54.46 ? 152  PRO C CA    1 
ATOM   8454 C  C     . PRO C 3 152 ? 29.470  -22.273 -64.053 1.00   55.73 ? 152  PRO C C     1 
ATOM   8455 O  O     . PRO C 3 152 ? 29.924  -21.306 -64.661 1.00   55.07 ? 152  PRO C O     1 
ATOM   8456 C  CB    . PRO C 3 152 ? 30.995  -23.435 -62.376 1.00   54.53 ? 152  PRO C CB    1 
ATOM   8457 C  CG    . PRO C 3 152 ? 30.612  -24.301 -61.235 1.00   53.94 ? 152  PRO C CG    1 
ATOM   8458 C  CD    . PRO C 3 152 ? 29.140  -24.479 -61.391 1.00   52.60 ? 152  PRO C CD    1 
ATOM   8459 N  N     . TYR C 3 153 ? 28.678  -23.186 -64.624 1.00   59.12 ? 153  TYR C N     1 
ATOM   8460 C  CA    . TYR C 3 153 ? 28.293  -23.102 -66.038 1.00   60.62 ? 153  TYR C CA    1 
ATOM   8461 C  C     . TYR C 3 153 ? 26.791  -22.901 -66.187 1.00   59.89 ? 153  TYR C C     1 
ATOM   8462 O  O     . TYR C 3 153 ? 26.034  -23.853 -66.399 1.00   65.40 ? 153  TYR C O     1 
ATOM   8463 C  CB    . TYR C 3 153 ? 28.752  -24.371 -66.770 1.00   60.61 ? 153  TYR C CB    1 
ATOM   8464 C  CG    . TYR C 3 153 ? 30.202  -24.664 -66.453 1.00   59.34 ? 153  TYR C CG    1 
ATOM   8465 C  CD1   . TYR C 3 153 ? 31.216  -23.789 -66.873 1.00   57.60 ? 153  TYR C CD1   1 
ATOM   8466 C  CD2   . TYR C 3 153 ? 30.556  -25.731 -65.607 1.00   57.52 ? 153  TYR C CD2   1 
ATOM   8467 C  CE1   . TYR C 3 153 ? 32.541  -23.957 -66.449 1.00   57.66 ? 153  TYR C CE1   1 
ATOM   8468 C  CE2   . TYR C 3 153 ? 31.876  -25.907 -65.181 1.00   56.95 ? 153  TYR C CE2   1 
ATOM   8469 C  CZ    . TYR C 3 153 ? 32.862  -25.014 -65.601 1.00   57.49 ? 153  TYR C CZ    1 
ATOM   8470 O  OH    . TYR C 3 153 ? 34.158  -25.151 -65.152 1.00   57.42 ? 153  TYR C OH    1 
ATOM   8471 N  N     . PRO C 3 154 ? 26.342  -21.643 -66.077 1.00   65.86 ? 154  PRO C N     1 
ATOM   8472 C  CA    . PRO C 3 154 ? 24.916  -21.312 -66.193 1.00   66.88 ? 154  PRO C CA    1 
ATOM   8473 C  C     . PRO C 3 154 ? 24.339  -21.398 -67.615 1.00   66.15 ? 154  PRO C C     1 
ATOM   8474 O  O     . PRO C 3 154 ? 25.125  -21.658 -68.550 1.00   71.15 ? 154  PRO C O     1 
ATOM   8475 C  CB    . PRO C 3 154 ? 24.850  -19.905 -65.607 1.00   67.84 ? 154  PRO C CB    1 
ATOM   8476 C  CG    . PRO C 3 154 ? 26.206  -19.330 -65.947 1.00   64.62 ? 154  PRO C CG    1 
ATOM   8477 C  CD    . PRO C 3 154 ? 27.138  -20.460 -65.687 1.00   65.34 ? 154  PRO C CD    1 
HETATM 8478 MG MG    . MG  D 4 .   ? 1.877   4.429   4.046   1.00   29.35 ? 997  MG  A MG    1 
HETATM 8479 BE BE    . BEF E 5 .   ? 4.769   3.211   3.004   1.00   35.67 ? 995  BEF A BE    1 
HETATM 8480 F  F1    . BEF E 5 .   ? 4.849   1.744   2.439   1.00   33.88 ? 995  BEF A F1    1 
HETATM 8481 F  F2    . BEF E 5 .   ? 6.025   3.567   3.791   1.00   36.12 ? 995  BEF A F2    1 
HETATM 8482 F  F3    . BEF E 5 .   ? 3.514   3.310   3.885   1.00   39.13 ? 995  BEF A F3    1 
HETATM 8483 P  PB    . ADP F 6 .   ? 3.407   4.898   1.094   1.00   39.91 ? 996  ADP A PB    1 
HETATM 8484 O  O1B   . ADP F 6 .   ? 3.262   4.340   -0.235  1.00   34.96 ? 996  ADP A O1B   1 
HETATM 8485 O  O2B   . ADP F 6 .   ? 2.234   4.819   1.949   1.00   34.01 ? 996  ADP A O2B   1 
HETATM 8486 O  O3B   . ADP F 6 .   ? 4.608   4.199   1.797   1.00   37.62 ? 996  ADP A O3B   1 
HETATM 8487 P  PA    . ADP F 6 .   ? 3.064   7.726   1.062   1.00   32.43 ? 996  ADP A PA    1 
HETATM 8488 O  O1A   . ADP F 6 .   ? 1.721   7.877   0.527   1.00   32.47 ? 996  ADP A O1A   1 
HETATM 8489 O  O2A   . ADP F 6 .   ? 3.093   7.927   2.502   1.00   34.66 ? 996  ADP A O2A   1 
HETATM 8490 O  O3A   . ADP F 6 .   ? 3.693   6.356   0.641   1.00   35.60 ? 996  ADP A O3A   1 
HETATM 8491 O  "O5'" . ADP F 6 .   ? 3.929   8.705   0.456   1.00   33.35 ? 996  ADP A "O5'" 1 
HETATM 8492 C  "C5'" . ADP F 6 .   ? 5.303   9.091   0.820   1.00   34.60 ? 996  ADP A "C5'" 1 
HETATM 8493 C  "C4'" . ADP F 6 .   ? 5.436   10.535  0.786   1.00   34.78 ? 996  ADP A "C4'" 1 
HETATM 8494 O  "O4'" . ADP F 6 .   ? 5.502   10.965  -0.607  1.00   35.22 ? 996  ADP A "O4'" 1 
HETATM 8495 C  "C3'" . ADP F 6 .   ? 4.300   11.367  1.354   1.00   34.75 ? 996  ADP A "C3'" 1 
HETATM 8496 O  "O3'" . ADP F 6 .   ? 4.542   11.524  2.742   1.00   34.88 ? 996  ADP A "O3'" 1 
HETATM 8497 C  "C2'" . ADP F 6 .   ? 4.424   12.645  0.560   1.00   34.57 ? 996  ADP A "C2'" 1 
HETATM 8498 O  "O2'" . ADP F 6 .   ? 5.424   13.550  1.039   1.00   34.04 ? 996  ADP A "O2'" 1 
HETATM 8499 C  "C1'" . ADP F 6 .   ? 4.787   12.206  -0.830  1.00   33.73 ? 996  ADP A "C1'" 1 
HETATM 8500 N  N9    . ADP F 6 .   ? 3.579   11.965  -1.692  1.00   34.43 ? 996  ADP A N9    1 
HETATM 8501 C  C8    . ADP F 6 .   ? 3.100   10.773  -2.242  1.00   34.60 ? 996  ADP A C8    1 
HETATM 8502 N  N7    . ADP F 6 .   ? 2.117   10.916  -3.068  1.00   33.24 ? 996  ADP A N7    1 
HETATM 8503 C  C5    . ADP F 6 .   ? 1.895   12.290  -3.026  1.00   35.38 ? 996  ADP A C5    1 
HETATM 8504 C  C6    . ADP F 6 .   ? 0.940   13.123  -3.690  1.00   35.58 ? 996  ADP A C6    1 
HETATM 8505 N  N6    . ADP F 6 .   ? 0.045   12.611  -4.517  1.00   32.73 ? 996  ADP A N6    1 
HETATM 8506 N  N1    . ADP F 6 .   ? 0.972   14.475  -3.450  1.00   36.17 ? 996  ADP A N1    1 
HETATM 8507 C  C2    . ADP F 6 .   ? 1.893   14.964  -2.613  1.00   35.86 ? 996  ADP A C2    1 
HETATM 8508 N  N3    . ADP F 6 .   ? 2.843   14.309  -1.932  1.00   36.24 ? 996  ADP A N3    1 
HETATM 8509 C  C4    . ADP F 6 .   ? 2.779   12.926  -2.191  1.00   35.37 ? 996  ADP A C4    1 
HETATM 8510 C  C1    . GOL G 7 .   ? 10.130  0.164   5.229   1.00   58.03 ? 998  GOL A C1    1 
HETATM 8511 O  O1    . GOL G 7 .   ? 10.304  -0.517  4.046   1.00   59.77 ? 998  GOL A O1    1 
HETATM 8512 C  C2    . GOL G 7 .   ? 11.082  1.364   5.468   1.00   57.26 ? 998  GOL A C2    1 
HETATM 8513 O  O2    . GOL G 7 .   ? 10.230  2.450   5.230   1.00   55.40 ? 998  GOL A O2    1 
HETATM 8514 C  C3    . GOL G 7 .   ? 12.202  1.539   4.318   1.00   56.69 ? 998  GOL A C3    1 
HETATM 8515 O  O3    . GOL G 7 .   ? 13.038  2.688   4.672   1.00   55.42 ? 998  GOL A O3    1 
HETATM 8516 MG MG    . MG  H 4 .   ? 81.745  -54.021 -89.602 1.00   61.28 ? 998  MG  B MG    1 
HETATM 8517 CA CA    . CA  I 8 .   ? 44.998  -42.909 -55.147 1.00   44.34 ? 999  CA  C CA    1 
HETATM 8518 O  O     . HOH J 9 .   ? 13.090  -2.198  -33.833 1.00   60.87 ? 999  HOH A O     1 
HETATM 8519 O  O     . HOH J 9 .   ? 27.702  5.633   -26.501 1.00   57.91 ? 1000 HOH A O     1 
HETATM 8520 O  O     . HOH J 9 .   ? -2.364  11.351  -27.448 1.00   50.32 ? 1001 HOH A O     1 
HETATM 8521 O  O     . HOH J 9 .   ? 8.588   4.499   -27.162 1.00   40.92 ? 1002 HOH A O     1 
HETATM 8522 O  O     . HOH J 9 .   ? 6.387   5.417   -25.684 1.00   34.78 ? 1003 HOH A O     1 
HETATM 8523 O  O     . HOH J 9 .   ? 3.984   9.927   -14.879 1.00   25.74 ? 1004 HOH A O     1 
HETATM 8524 O  O     . HOH J 9 .   ? -1.544  13.459  -14.000 1.00   30.58 ? 1005 HOH A O     1 
HETATM 8525 O  O     . HOH J 9 .   ? -12.445 -2.757  7.290   1.00   34.86 ? 1006 HOH A O     1 
HETATM 8526 O  O     . HOH J 9 .   ? -7.935  2.158   -16.228 1.00   55.69 ? 1007 HOH A O     1 
HETATM 8527 O  O     . HOH J 9 .   ? -8.337  23.977  -8.960  1.00   50.36 ? 1008 HOH A O     1 
HETATM 8528 O  O     . HOH J 9 .   ? -11.109 19.293  -2.528  1.00   40.03 ? 1009 HOH A O     1 
HETATM 8529 O  O     . HOH J 9 .   ? -14.962 4.396   -17.559 1.00   43.95 ? 1010 HOH A O     1 
HETATM 8530 O  O     . HOH J 9 .   ? -1.861  -2.057  -0.915  1.00   28.84 ? 1011 HOH A O     1 
HETATM 8531 O  O     . HOH J 9 .   ? -2.523  3.956   4.449   1.00   35.56 ? 1012 HOH A O     1 
HETATM 8532 O  O     . HOH J 9 .   ? 21.278  -8.627  -38.145 1.00   51.40 ? 1013 HOH A O     1 
HETATM 8533 O  O     . HOH J 9 .   ? -3.683  6.460   7.254   1.00   45.15 ? 1014 HOH A O     1 
HETATM 8534 O  O     . HOH J 9 .   ? 14.120  -26.049 -44.499 1.00   59.84 ? 1015 HOH A O     1 
HETATM 8535 O  O     . HOH J 9 .   ? 9.280   8.773   0.604   1.00   22.88 ? 1016 HOH A O     1 
HETATM 8536 O  O     . HOH J 9 .   ? 12.789  9.019   -2.359  1.00   25.65 ? 1017 HOH A O     1 
HETATM 8537 O  O     . HOH J 9 .   ? -27.929 6.506   0.617   1.00   43.55 ? 1018 HOH A O     1 
HETATM 8538 O  O     . HOH J 9 .   ? 10.245  -2.559  6.542   1.00   63.47 ? 1019 HOH A O     1 
HETATM 8539 O  O     . HOH J 9 .   ? 16.976  14.963  15.299  1.00   61.29 ? 1020 HOH A O     1 
HETATM 8540 O  O     . HOH J 9 .   ? 11.130  16.122  18.372  1.00   46.91 ? 1021 HOH A O     1 
HETATM 8541 O  O     . HOH J 9 .   ? -12.130 14.983  23.778  1.00   53.48 ? 1022 HOH A O     1 
HETATM 8542 O  O     . HOH J 9 .   ? -22.536 -2.813  2.674   1.00   49.31 ? 1023 HOH A O     1 
HETATM 8543 O  O     . HOH J 9 .   ? -23.243 9.324   12.200  1.00   57.38 ? 1024 HOH A O     1 
HETATM 8544 O  O     . HOH J 9 .   ? 7.853   -13.311 -49.702 1.00   63.78 ? 1025 HOH A O     1 
HETATM 8545 O  O     . HOH J 9 .   ? 2.401   -13.679 -51.107 1.00   62.09 ? 1026 HOH A O     1 
HETATM 8546 O  O     . HOH J 9 .   ? -12.328 2.391   -11.707 1.00   42.86 ? 1027 HOH A O     1 
HETATM 8547 O  O     . HOH J 9 .   ? 3.300   -0.395  -8.006  1.00   45.92 ? 1028 HOH A O     1 
HETATM 8548 O  O     . HOH J 9 .   ? 17.745  2.141   -5.310  1.00   56.31 ? 1029 HOH A O     1 
HETATM 8549 O  O     . HOH J 9 .   ? 8.735   10.727  2.719   1.00   33.14 ? 1030 HOH A O     1 
HETATM 8550 O  O     . HOH J 9 .   ? -3.097  14.025  -19.883 1.00   24.85 ? 1031 HOH A O     1 
HETATM 8551 O  O     . HOH J 9 .   ? 6.793   17.545  -32.862 1.00   67.62 ? 1032 HOH A O     1 
HETATM 8552 O  O     . HOH J 9 .   ? 17.368  8.919   -24.945 1.00   40.66 ? 1033 HOH A O     1 
HETATM 8553 O  O     . HOH J 9 .   ? 12.930  4.239   -22.918 1.00   34.66 ? 1034 HOH A O     1 
HETATM 8554 O  O     . HOH J 9 .   ? 2.344   10.017  3.659   1.00   26.23 ? 1035 HOH A O     1 
HETATM 8555 O  O     . HOH J 9 .   ? -10.830 23.262  -3.030  1.00   46.37 ? 1036 HOH A O     1 
HETATM 8556 O  O     . HOH J 9 .   ? -4.021  13.410  -15.968 1.00   39.59 ? 1037 HOH A O     1 
HETATM 8557 O  O     . HOH J 9 .   ? -1.714  -6.850  -7.173  1.00   57.74 ? 1038 HOH A O     1 
HETATM 8558 O  O     . HOH J 9 .   ? 0.183   -8.280  -5.113  1.00   50.44 ? 1039 HOH A O     1 
HETATM 8559 O  O     . HOH J 9 .   ? -0.872  5.330   7.189   1.00   38.79 ? 1040 HOH A O     1 
HETATM 8560 O  O     . HOH J 9 .   ? 2.408   6.480   4.474   1.00   27.48 ? 1041 HOH A O     1 
HETATM 8561 O  O     . HOH J 9 .   ? 1.054   2.794   3.326   1.00   24.37 ? 1042 HOH A O     1 
HETATM 8562 O  O     . HOH J 9 .   ? 12.502  0.600   14.470  1.00   46.73 ? 1043 HOH A O     1 
HETATM 8563 O  O     . HOH J 9 .   ? 22.972  -8.479  37.512  1.00   64.19 ? 1044 HOH A O     1 
HETATM 8564 O  O     . HOH J 9 .   ? -8.386  -5.020  17.563  1.00   65.15 ? 1045 HOH A O     1 
HETATM 8565 O  O     . HOH J 9 .   ? 2.577   -19.616 -9.591  1.00   45.24 ? 1046 HOH A O     1 
HETATM 8566 O  O     . HOH J 9 .   ? 9.333   -34.695 12.817  1.00   70.77 ? 1047 HOH A O     1 
HETATM 8567 O  O     . HOH J 9 .   ? 14.976  -13.138 13.703  1.00   55.67 ? 1048 HOH A O     1 
HETATM 8568 O  O     . HOH J 9 .   ? 41.079  -36.645 -67.804 1.00   50.24 ? 1049 HOH A O     1 
HETATM 8569 O  O     . HOH J 9 .   ? 38.610  -40.633 -64.947 1.00   52.66 ? 1050 HOH A O     1 
HETATM 8570 O  O     . HOH J 9 .   ? 11.168  -25.759 -52.372 1.00   68.36 ? 1051 HOH A O     1 
HETATM 8571 O  O     . HOH J 9 .   ? 25.951  -13.453 -35.425 1.00   50.05 ? 1052 HOH A O     1 
HETATM 8572 O  O     . HOH J 9 .   ? 27.041  -11.234 -36.129 1.00   72.90 ? 1053 HOH A O     1 
HETATM 8573 O  O     . HOH J 9 .   ? 29.195  -9.910  -34.907 1.00   55.50 ? 1054 HOH A O     1 
HETATM 8574 O  O     . HOH J 9 .   ? -22.873 17.892  -5.626  1.00   63.05 ? 1055 HOH A O     1 
HETATM 8575 O  O     . HOH J 9 .   ? -17.437 8.511   19.625  1.00   58.91 ? 1056 HOH A O     1 
HETATM 8576 O  O     . HOH J 9 .   ? -2.519  -8.226  11.659  1.00   46.15 ? 1057 HOH A O     1 
HETATM 8577 O  O     . HOH J 9 .   ? -0.734  15.598  -12.436 1.00   45.36 ? 1058 HOH A O     1 
HETATM 8578 O  O     . HOH J 9 .   ? -2.361  12.581  -24.938 1.00   70.49 ? 1059 HOH A O     1 
HETATM 8579 O  O     . HOH J 9 .   ? 11.785  0.674   -33.154 1.00   35.43 ? 1060 HOH A O     1 
HETATM 8580 O  O     . HOH J 9 .   ? 23.908  8.617   -13.250 1.00   47.77 ? 1061 HOH A O     1 
HETATM 8581 O  O     . HOH J 9 .   ? -5.041  7.105   -24.904 1.00   40.42 ? 1062 HOH A O     1 
HETATM 8582 O  O     . HOH J 9 .   ? 2.073   8.019   -14.515 1.00   32.11 ? 1063 HOH A O     1 
HETATM 8583 O  O     . HOH J 9 .   ? -3.286  12.402  0.419   1.00   31.84 ? 1064 HOH A O     1 
HETATM 8584 O  O     . HOH J 9 .   ? 5.768   -2.931  6.555   1.00   57.56 ? 1065 HOH A O     1 
HETATM 8585 O  O     . HOH J 9 .   ? 13.590  0.007   7.845   1.00   60.52 ? 1066 HOH A O     1 
HETATM 8586 O  O     . HOH J 9 .   ? 14.052  2.346   13.202  1.00   52.38 ? 1067 HOH A O     1 
HETATM 8587 O  O     . HOH J 9 .   ? 8.033   9.450   13.602  1.00   35.52 ? 1068 HOH A O     1 
HETATM 8588 O  O     . HOH J 9 .   ? -1.150  1.040   5.115   1.00   34.16 ? 1069 HOH A O     1 
HETATM 8589 O  O     . HOH J 9 .   ? -19.779 -2.300  10.008  1.00   50.96 ? 1070 HOH A O     1 
HETATM 8590 O  O     . HOH J 9 .   ? 2.340   -7.121  14.067  1.00   56.18 ? 1071 HOH A O     1 
HETATM 8591 O  O     . HOH J 9 .   ? -11.433 -13.577 28.411  1.00   62.96 ? 1072 HOH A O     1 
HETATM 8592 O  O     . HOH J 9 .   ? 4.631   -0.406  5.324   1.00   48.75 ? 1073 HOH A O     1 
HETATM 8593 O  O     . HOH J 9 .   ? -6.944  -15.243 -5.875  1.00   70.94 ? 1074 HOH A O     1 
HETATM 8594 O  O     . HOH J 9 .   ? -6.111  18.081  25.065  1.00   53.83 ? 1075 HOH A O     1 
HETATM 8595 O  O     . HOH J 9 .   ? -6.134  -15.325 -2.528  1.00   59.76 ? 1076 HOH A O     1 
HETATM 8596 O  O     . HOH J 9 .   ? 15.454  -0.091  -5.808  1.00   62.68 ? 1077 HOH A O     1 
HETATM 8597 O  O     . HOH J 9 .   ? 15.006  10.299  -24.602 1.00   62.29 ? 1078 HOH A O     1 
HETATM 8598 O  O     . HOH J 9 .   ? 1.141   -7.091  -7.988  1.00   44.52 ? 1079 HOH A O     1 
HETATM 8599 O  O     . HOH J 9 .   ? 29.543  -4.359  41.325  1.00   73.93 ? 1080 HOH A O     1 
HETATM 8600 O  O     . HOH J 9 .   ? 43.091  -42.269 -64.447 1.00   54.71 ? 1081 HOH A O     1 
HETATM 8601 O  O     . HOH J 9 .   ? 46.478  -41.760 -67.235 1.00   47.85 ? 1082 HOH A O     1 
HETATM 8602 O  O     . HOH J 9 .   ? 2.490   0.149   3.723   1.00   49.15 ? 1083 HOH A O     1 
HETATM 8603 O  O     . HOH J 9 .   ? 63.519  -45.199 -74.485 1.00   49.83 ? 1084 HOH A O     1 
HETATM 8604 O  O     . HOH J 9 .   ? -7.893  17.226  13.006  1.00   44.11 ? 1085 HOH A O     1 
HETATM 8605 O  O     . HOH J 9 .   ? -1.851  -9.734  14.049  1.00   45.22 ? 1086 HOH A O     1 
HETATM 8606 O  O     . HOH J 9 .   ? -3.531  -8.142  -5.500  1.00   53.83 ? 1087 HOH A O     1 
HETATM 8607 O  O     . HOH J 9 .   ? -10.025 10.002  -16.432 1.00   36.95 ? 1088 HOH A O     1 
HETATM 8608 O  O     . HOH J 9 .   ? 13.067  8.271   0.330   1.00   54.58 ? 1089 HOH A O     1 
HETATM 8609 O  O     . HOH J 9 .   ? -9.953  -8.012  7.959   1.00   44.31 ? 1090 HOH A O     1 
HETATM 8610 O  O     . HOH J 9 .   ? 8.187   -13.304 -11.995 1.00   69.53 ? 1091 HOH A O     1 
HETATM 8611 O  O     . HOH J 9 .   ? -8.793  -4.746  12.718  1.00   50.49 ? 1092 HOH A O     1 
HETATM 8612 O  O     . HOH J 9 .   ? 9.630   0.136   -35.075 1.00   60.04 ? 1093 HOH A O     1 
HETATM 8613 O  O     . HOH J 9 .   ? 3.835   22.878  -5.794  1.00   64.64 ? 1094 HOH A O     1 
HETATM 8614 O  O     . HOH J 9 .   ? -21.561 10.742  13.675  1.00   61.21 ? 1095 HOH A O     1 
HETATM 8615 O  O     . HOH J 9 .   ? 8.564   21.993  20.342  1.00   63.32 ? 1096 HOH A O     1 
HETATM 8616 O  O     . HOH J 9 .   ? 15.368  -15.425 -6.241  1.00   55.75 ? 1097 HOH A O     1 
HETATM 8617 O  O     . HOH J 9 .   ? -15.534 -14.032 -6.332  1.00   58.17 ? 1098 HOH A O     1 
HETATM 8618 O  O     . HOH J 9 .   ? 70.762  -51.135 -73.374 1.00   67.65 ? 1099 HOH A O     1 
HETATM 8619 O  O     . HOH J 9 .   ? -14.190 -1.784  6.037   1.00   62.26 ? 1100 HOH A O     1 
HETATM 8620 O  O     . HOH J 9 .   ? -4.908  19.721  -4.924  1.00   51.08 ? 1101 HOH A O     1 
HETATM 8621 O  O     . HOH J 9 .   ? 0.910   9.992   -5.487  1.00   51.55 ? 1102 HOH A O     1 
HETATM 8622 O  O     . HOH J 9 .   ? 2.096   7.357   -6.132  1.00   44.18 ? 1103 HOH A O     1 
HETATM 8623 O  O     . HOH J 9 .   ? -16.047 16.131  -10.748 1.00   52.85 ? 1104 HOH A O     1 
HETATM 8624 O  O     . HOH J 9 .   ? -12.113 -6.723  6.227   1.00   55.96 ? 1105 HOH A O     1 
HETATM 8625 O  O     . HOH J 9 .   ? -15.252 -14.970 1.484   1.00   47.66 ? 1106 HOH A O     1 
HETATM 8626 O  O     . HOH J 9 .   ? -5.967  -3.843  -14.680 1.00   57.56 ? 1107 HOH A O     1 
HETATM 8627 O  O     . HOH J 9 .   ? 3.042   -17.920 -11.740 1.00   73.76 ? 1108 HOH A O     1 
HETATM 8628 O  O     . HOH J 9 .   ? 0.792   -21.374 -9.019  1.00   61.16 ? 1109 HOH A O     1 
HETATM 8629 O  O     . HOH J 9 .   ? 38.435  -26.368 -64.195 1.00   56.64 ? 1110 HOH A O     1 
HETATM 8630 O  O     . HOH J 9 .   ? 0.677   -22.985 9.138   1.00   53.46 ? 1111 HOH A O     1 
HETATM 8631 O  O     . HOH J 9 .   ? 0.398   -8.721  -9.831  1.00   63.52 ? 1112 HOH A O     1 
HETATM 8632 O  O     . HOH J 9 .   ? -4.941  3.627   4.907   1.00   58.55 ? 1113 HOH A O     1 
HETATM 8633 O  O     . HOH J 9 .   ? -13.644 -10.389 -6.191  1.00   71.74 ? 1114 HOH A O     1 
HETATM 8634 O  O     . HOH J 9 .   ? 28.004  -26.337 -44.690 1.00   67.64 ? 1115 HOH A O     1 
HETATM 8635 O  O     . HOH J 9 .   ? -0.188  -17.582 42.342  1.00   68.19 ? 1116 HOH A O     1 
HETATM 8636 O  O     . HOH J 9 .   ? 5.026   -10.168 36.196  1.00   59.47 ? 1117 HOH A O     1 
HETATM 8637 O  O     . HOH J 9 .   ? 10.693  -27.307 16.251  1.00   78.57 ? 1118 HOH A O     1 
HETATM 8638 O  O     . HOH J 9 .   ? 10.390  -10.504 -38.774 1.00   57.09 ? 1119 HOH A O     1 
HETATM 8639 O  O     . HOH J 9 .   ? -15.246 -18.962 -32.427 1.00   51.21 ? 1120 HOH A O     1 
HETATM 8640 O  O     . HOH J 9 .   ? 13.866  -0.542  12.545  1.00   62.63 ? 1121 HOH A O     1 
HETATM 8641 O  O     . HOH J 9 .   ? 2.239   -21.987 -11.250 1.00   62.53 ? 1122 HOH A O     1 
HETATM 8642 O  O     . HOH J 9 .   ? -9.997  2.683   -17.861 1.00   61.99 ? 1123 HOH A O     1 
HETATM 8643 O  O     . HOH J 9 .   ? 9.304   -1.092  -0.120  1.00   58.04 ? 1124 HOH A O     1 
HETATM 8644 O  O     . HOH J 9 .   ? 7.100   -0.477  4.256   1.00   72.09 ? 1125 HOH A O     1 
HETATM 8645 O  O     . HOH J 9 .   ? 16.290  10.290  0.584   1.00   48.29 ? 1126 HOH A O     1 
HETATM 8646 O  O     . HOH J 9 .   ? 6.615   0.244   -24.558 1.00   61.98 ? 1127 HOH A O     1 
HETATM 8647 O  O     . HOH J 9 .   ? 1.737   -1.733  5.749   1.00   52.61 ? 1128 HOH A O     1 
HETATM 8648 O  O     . HOH J 9 .   ? 11.806  -1.577  10.718  1.00   70.44 ? 1129 HOH A O     1 
HETATM 8649 O  O     . HOH J 9 .   ? 9.752   -9.509  35.465  1.00   62.15 ? 1130 HOH A O     1 
HETATM 8650 O  O     . HOH J 9 .   ? -6.947  -4.368  22.527  1.00   46.99 ? 1131 HOH A O     1 
HETATM 8651 O  O     . HOH J 9 .   ? 6.267   -33.249 6.556   1.00   57.88 ? 1132 HOH A O     1 
HETATM 8652 O  O     . HOH J 9 .   ? 15.135  -30.386 19.193  1.00   57.81 ? 1133 HOH A O     1 
HETATM 8653 O  O     . HOH J 9 .   ? 20.698  0.294   15.292  1.00   60.38 ? 1134 HOH A O     1 
HETATM 8654 O  O     . HOH J 9 .   ? 12.111  -3.859  20.082  1.00   48.83 ? 1135 HOH A O     1 
HETATM 8655 O  O     . HOH J 9 .   ? 5.984   0.853   -6.388  1.00   46.47 ? 1136 HOH A O     1 
HETATM 8656 O  O     . HOH J 9 .   ? 12.106  6.621   27.461  1.00   50.93 ? 1137 HOH A O     1 
HETATM 8657 O  O     . HOH J 9 .   ? 13.385  -21.102 15.667  1.00   65.95 ? 1138 HOH A O     1 
HETATM 8658 O  O     . HOH J 9 .   ? 61.628  -47.317 -74.140 1.00   58.29 ? 1139 HOH A O     1 
HETATM 8659 O  O     . HOH J 9 .   ? -14.131 10.000  -14.152 1.00   65.79 ? 1140 HOH A O     1 
HETATM 8660 O  O     . HOH J 9 .   ? -1.340  23.973  -12.274 1.00   67.49 ? 1141 HOH A O     1 
HETATM 8661 O  O     . HOH J 9 .   ? -8.144  2.623   -19.828 1.00   58.19 ? 1142 HOH A O     1 
HETATM 8662 O  O     . HOH J 9 .   ? -4.963  7.486   -13.953 1.00   52.01 ? 1143 HOH A O     1 
HETATM 8663 O  O     . HOH K 9 .   ? 55.068  -21.401 -54.533 1.00   68.52 ? 999  HOH B O     1 
HETATM 8664 O  O     . HOH K 9 .   ? 61.246  -23.778 -52.465 1.00   69.84 ? 1000 HOH B O     1 
HETATM 8665 O  O     . HOH K 9 .   ? 61.838  -21.599 -54.021 1.00   26.23 ? 1001 HOH B O     1 
HETATM 8666 O  O     . HOH K 9 .   ? 59.576  -21.797 -56.147 1.00   61.92 ? 1002 HOH B O     1 
HETATM 8667 O  O     . HOH K 9 .   ? 63.217  -16.942 -57.562 1.00   59.89 ? 1003 HOH B O     1 
HETATM 8668 O  O     . HOH K 9 .   ? 59.180  -47.566 -78.897 1.00   64.40 ? 1004 HOH B O     1 
HETATM 8669 O  O     . HOH K 9 .   ? 50.603  -40.605 -65.266 1.00   38.20 ? 1005 HOH B O     1 
HETATM 8670 O  O     . HOH K 9 .   ? 57.275  -34.029 -51.361 1.00   64.81 ? 1006 HOH B O     1 
HETATM 8671 O  O     . HOH K 9 .   ? 50.640  -40.175 -53.333 1.00   57.03 ? 1007 HOH B O     1 
HETATM 8672 O  O     . HOH K 9 .   ? 61.316  -20.448 -69.483 1.00   48.12 ? 1008 HOH B O     1 
HETATM 8673 O  O     . HOH K 9 .   ? 60.784  -26.622 -75.584 1.00   50.54 ? 1009 HOH B O     1 
HETATM 8674 O  O     . HOH K 9 .   ? 69.492  -58.726 -76.958 1.00   73.96 ? 1010 HOH B O     1 
HETATM 8675 O  O     . HOH K 9 .   ? 60.022  -23.416 -68.849 1.00   74.89 ? 1011 HOH B O     1 
HETATM 8676 O  O     . HOH K 9 .   ? 56.320  -33.123 -53.605 1.00   65.19 ? 1012 HOH B O     1 
HETATM 8677 O  O     . HOH K 9 .   ? 66.978  -22.681 -57.383 1.00   45.58 ? 1013 HOH B O     1 
HETATM 8678 O  O     . HOH K 9 .   ? 81.982  -44.788 -69.276 1.00   63.34 ? 1014 HOH B O     1 
HETATM 8679 O  O     . HOH K 9 .   ? 59.522  -34.028 -53.221 1.00   64.33 ? 1015 HOH B O     1 
HETATM 8680 O  O     . HOH K 9 .   ? 45.635  -26.096 -66.389 1.00   66.60 ? 1016 HOH B O     1 
HETATM 8681 O  O     . HOH K 9 .   ? 62.375  -19.323 -55.210 1.00   71.01 ? 1017 HOH B O     1 
HETATM 8682 O  O     . HOH K 9 .   ? 63.958  -20.621 -71.189 1.00   58.83 ? 1018 HOH B O     1 
HETATM 8683 O  O     . HOH L 9 .   ? 41.707  -42.875 -68.298 1.00   62.10 ? 1000 HOH C O     1 
HETATM 8684 O  O     . HOH L 9 .   ? 46.436  -43.193 -52.709 1.00   55.41 ? 1001 HOH C O     1 
HETATM 8685 O  O     . HOH L 9 .   ? 49.874  -44.311 -53.626 1.00   61.13 ? 1002 HOH C O     1 
HETATM 8686 O  O     . HOH L 9 .   ? 21.414  -28.902 -52.493 1.00   60.69 ? 1003 HOH C O     1 
HETATM 8687 O  O     . HOH L 9 .   ? 45.073  -32.655 -45.205 1.00   51.99 ? 1004 HOH C O     1 
HETATM 8688 O  O     . HOH L 9 .   ? 30.052  -44.616 -45.321 1.00   52.80 ? 1005 HOH C O     1 
HETATM 8689 O  O     . HOH L 9 .   ? 17.977  -10.010 -52.810 1.00   53.33 ? 1006 HOH C O     1 
HETATM 8690 O  O     . HOH L 9 .   ? 25.354  -19.069 -61.919 1.00   42.27 ? 1007 HOH C O     1 
HETATM 8691 O  O     . HOH L 9 .   ? 12.481  -23.451 -53.534 1.00   44.43 ? 1008 HOH C O     1 
HETATM 8692 O  O     . HOH L 9 .   ? 14.432  -24.852 -55.315 1.00   33.53 ? 1009 HOH C O     1 
HETATM 8693 O  O     . HOH L 9 .   ? 22.188  -27.184 -49.940 1.00   51.83 ? 1010 HOH C O     1 
HETATM 8694 O  O     . HOH L 9 .   ? 42.704  -39.240 -44.732 1.00   41.67 ? 1011 HOH C O     1 
HETATM 8695 O  O     . HOH L 9 .   ? 12.316  -15.563 -43.153 1.00   51.53 ? 1012 HOH C O     1 
HETATM 8696 O  O     . HOH L 9 .   ? 24.220  -36.238 -58.347 1.00   63.94 ? 1013 HOH C O     1 
HETATM 8697 O  O     . HOH L 9 .   ? 34.927  -27.581 -64.310 1.00   58.86 ? 1014 HOH C O     1 
HETATM 8698 O  O     . HOH L 9 .   ? 16.768  -5.059  -47.901 1.00   55.72 ? 1015 HOH C O     1 
HETATM 8699 O  O     . HOH L 9 .   ? 28.812  -29.985 -50.594 1.00   59.31 ? 1016 HOH C O     1 
HETATM 8700 O  O     . HOH L 9 .   ? 11.056  -8.192  -47.536 1.00   69.11 ? 1017 HOH C O     1 
HETATM 8701 O  O     . HOH L 9 .   ? 44.000  -42.389 -66.983 1.00   59.18 ? 1018 HOH C O     1 
HETATM 8702 O  O     . HOH L 9 .   ? 40.091  -32.006 -54.175 1.00   48.65 ? 1019 HOH C O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   ILE 3   3   3   ILE ILE A . n 
A 1 4   ASP 4   4   4   ASP ASP A . n 
A 1 5   PHE 5   5   5   PHE PHE A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  PHE 10  10  10  PHE PHE A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  TYR 12  12  12  TYR TYR A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  ASP 16  16  16  ASP ASP A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  GLU 23  23  ?   ?   ?   A . n 
A 1 24  GLN 24  24  ?   ?   ?   A . n 
A 1 25  THR 25  25  25  THR THR A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  ASP 29  29  29  ASP ASP A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  CYS 34  34  34  CYS CYS A . n 
A 1 35  TRP 35  35  35  TRP TRP A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  GLY 53  53  53  GLY GLY A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  ASP 63  63  63  ASP ASP A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  LYS 71  71  71  LYS LYS A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  ASP 73  73  73  ASP ASP A . n 
A 1 74  ILE 74  74  74  ILE ILE A . n 
A 1 75  GLN 75  75  75  GLN GLN A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  MET 77  77  77  MET MET A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  PHE 82  82  82  PHE PHE A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  MET 88  88  88  MET MET A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  MET 91  91  91  MET MET A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  TYR 93  93  93  TYR TYR A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 TYR 101 101 101 TYR TYR A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 TYR 107 107 107 TYR TYR A . n 
A 1 108 THR 108 108 108 THR THR A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 ILE 112 112 112 ILE ILE A . n 
A 1 113 TYR 113 113 113 TYR TYR A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 SER 116 116 116 SER SER A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 CYS 120 120 120 CYS CYS A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 ASN 124 124 124 ASN ASN A . n 
A 1 125 PRO 125 125 125 PRO PRO A . n 
A 1 126 TYR 126 126 126 TYR TYR A . n 
A 1 127 ARG 127 127 127 ARG ARG A . n 
A 1 128 ARG 128 128 128 ARG ARG A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 TYR 132 132 132 TYR TYR A . n 
A 1 133 THR 133 133 133 THR THR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 SER 135 135 135 SER SER A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 ILE 137 137 137 ILE ILE A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 LYS 139 139 139 LYS LYS A . n 
A 1 140 TYR 140 140 140 TYR TYR A . n 
A 1 141 ARG 141 141 141 ARG ARG A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 LYS 145 145 145 LYS LYS A . n 
A 1 146 THR 146 146 146 THR THR A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 ILE 148 148 148 ILE ILE A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 HIS 151 151 151 HIS HIS A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 ASP 157 157 157 ASP ASP A . n 
A 1 158 ASN 158 158 158 ASN ASN A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 TYR 160 160 160 TYR TYR A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 ASN 162 162 162 ASN ASN A . n 
A 1 163 MET 163 163 163 MET MET A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 GLU 168 168 168 GLU GLU A . n 
A 1 169 ASN 169 169 169 ASN ASN A . n 
A 1 170 GLN 170 170 170 GLN GLN A . n 
A 1 171 SER 171 171 171 SER SER A . n 
A 1 172 CYS 172 172 172 CYS CYS A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 GLY 176 176 176 GLY GLY A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 ALA 180 180 180 ALA ALA A . n 
A 1 181 GLY 181 181 181 GLY GLY A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 THR 183 183 183 THR THR A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 ASN 185 185 185 ASN ASN A . n 
A 1 186 THR 186 186 186 THR THR A . n 
A 1 187 LYS 187 187 187 LYS LYS A . n 
A 1 188 LYS 188 188 188 LYS LYS A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 ILE 190 190 190 ILE ILE A . n 
A 1 191 MET 191 191 191 MET MET A . n 
A 1 192 TYR 192 192 192 TYR TYR A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 ALA 194 194 194 ALA ALA A . n 
A 1 195 LYS 195 195 195 LYS LYS A . n 
A 1 196 VAL 196 196 196 VAL VAL A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 CYS 198 198 198 CYS CYS A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 VAL 200 200 200 VAL VAL A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 LYS 202 202 ?   ?   ?   A . n 
A 1 203 LYS 203 203 ?   ?   ?   A . n 
A 1 204 ASP 204 204 ?   ?   ?   A . n 
A 1 205 GLU 205 205 ?   ?   ?   A . n 
A 1 206 GLU 206 206 ?   ?   ?   A . n 
A 1 207 ALA 207 207 ?   ?   ?   A . n 
A 1 208 SER 208 208 ?   ?   ?   A . n 
A 1 209 ASP 209 209 ?   ?   ?   A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 LYS 211 211 211 LYS LYS A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 SER 214 214 214 SER SER A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 GLU 216 216 216 GLU GLU A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 GLN 218 218 218 GLN GLN A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 ILE 220 220 220 ILE ILE A . n 
A 1 221 GLN 221 221 221 GLN GLN A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ASN 223 223 223 ASN ASN A . n 
A 1 224 PRO 224 224 224 PRO PRO A . n 
A 1 225 VAL 225 225 225 VAL VAL A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 GLU 227 227 227 GLU GLU A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 TYR 229 229 229 TYR TYR A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 ASN 231 231 231 ASN ASN A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 THR 235 235 235 THR THR A . n 
A 1 236 ARG 236 236 236 ARG ARG A . n 
A 1 237 ASN 237 237 237 ASN ASN A . n 
A 1 238 ASN 238 238 238 ASN ASN A . n 
A 1 239 ASN 239 239 239 ASN ASN A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 PHE 243 243 243 PHE PHE A . n 
A 1 244 GLY 244 244 244 GLY GLY A . n 
A 1 245 LYS 245 245 245 LYS LYS A . n 
A 1 246 PHE 246 246 246 PHE PHE A . n 
A 1 247 ILE 247 247 247 ILE ILE A . n 
A 1 248 ARG 248 248 248 ARG ARG A . n 
A 1 249 ILE 249 249 249 ILE ILE A . n 
A 1 250 HIS 250 250 250 HIS HIS A . n 
A 1 251 PHE 251 251 251 PHE PHE A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 PRO 253 253 253 PRO PRO A . n 
A 1 254 THR 254 254 254 THR THR A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 LYS 256 256 256 LYS LYS A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 ALA 258 258 258 ALA ALA A . n 
A 1 259 GLY 259 259 259 GLY GLY A . n 
A 1 260 ALA 260 260 260 ALA ALA A . n 
A 1 261 ASP 261 261 261 ASP ASP A . n 
A 1 262 ILE 262 262 262 ILE ILE A . n 
A 1 263 GLU 263 263 263 GLU GLU A . n 
A 1 264 THR 264 264 264 THR THR A . n 
A 1 265 TYR 265 265 265 TYR TYR A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 LEU 267 267 267 LEU LEU A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 SER 270 270 270 SER SER A . n 
A 1 271 ARG 271 271 271 ARG ARG A . n 
A 1 272 VAL 272 272 272 VAL VAL A . n 
A 1 273 THR 273 273 273 THR THR A . n 
A 1 274 TYR 274 274 274 TYR TYR A . n 
A 1 275 GLN 275 275 275 GLN GLN A . n 
A 1 276 GLN 276 276 276 GLN GLN A . n 
A 1 277 SER 277 277 277 SER SER A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLU 279 279 279 GLU GLU A . n 
A 1 280 ARG 280 280 280 ARG ARG A . n 
A 1 281 ASN 281 281 281 ASN ASN A . n 
A 1 282 TYR 282 282 282 TYR TYR A . n 
A 1 283 HIS 283 283 283 HIS HIS A . n 
A 1 284 ILE 284 284 284 ILE ILE A . n 
A 1 285 PHE 285 285 285 PHE PHE A . n 
A 1 286 TYR 286 286 286 TYR TYR A . n 
A 1 287 GLN 287 287 287 GLN GLN A . n 
A 1 288 ILE 288 288 288 ILE ILE A . n 
A 1 289 CYS 289 289 289 CYS CYS A . n 
A 1 290 SER 290 290 290 SER SER A . n 
A 1 291 ASN 291 291 291 ASN ASN A . n 
A 1 292 ALA 292 292 292 ALA ALA A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 GLU 295 295 295 GLU GLU A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 ASN 297 297 297 ASN ASN A . n 
A 1 298 ASP 298 298 298 ASP ASP A . n 
A 1 299 VAL 299 299 299 VAL VAL A . n 
A 1 300 MET 300 300 300 MET MET A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 PRO 304 304 304 PRO PRO A . n 
A 1 305 ASP 305 305 305 ASP ASP A . n 
A 1 306 SER 306 306 306 SER SER A . n 
A 1 307 GLY 307 307 307 GLY GLY A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 TYR 309 309 309 TYR TYR A . n 
A 1 310 SER 310 310 310 SER SER A . n 
A 1 311 PHE 311 311 311 PHE PHE A . n 
A 1 312 ILE 312 312 312 ILE ILE A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 GLN 314 314 314 GLN GLN A . n 
A 1 315 GLY 315 315 315 GLY GLY A . n 
A 1 316 CYS 316 316 316 CYS CYS A . n 
A 1 317 LEU 317 317 317 LEU LEU A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 VAL 319 319 319 VAL VAL A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 ASN 321 321 321 ASN ASN A . n 
A 1 322 ILE 322 322 322 ILE ILE A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 VAL 325 325 325 VAL VAL A . n 
A 1 326 GLU 326 326 326 GLU GLU A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 PHE 328 328 328 PHE PHE A . n 
A 1 329 LYS 329 329 329 LYS LYS A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 CYS 331 331 331 CYS CYS A . n 
A 1 332 ASP 332 332 332 ASP ASP A . n 
A 1 333 GLU 333 333 333 GLU GLU A . n 
A 1 334 ALA 334 334 334 ALA ALA A . n 
A 1 335 PHE 335 335 335 PHE PHE A . n 
A 1 336 ASP 336 336 336 ASP ASP A . n 
A 1 337 ILE 337 337 337 ILE ILE A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 GLY 339 339 339 GLY GLY A . n 
A 1 340 PHE 340 340 340 PHE PHE A . n 
A 1 341 THR 341 341 341 THR THR A . n 
A 1 342 LYS 342 342 342 LYS LYS A . n 
A 1 343 GLU 343 343 343 GLU GLU A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 LYS 345 345 345 LYS LYS A . n 
A 1 346 GLN 346 346 346 GLN GLN A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 MET 348 348 348 MET MET A . n 
A 1 349 PHE 349 349 349 PHE PHE A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 CYS 351 351 351 CYS CYS A . n 
A 1 352 THR 352 352 352 THR THR A . n 
A 1 353 ALA 353 353 353 ALA ALA A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 ILE 355 355 355 ILE ILE A . n 
A 1 356 LEU 356 356 356 LEU LEU A . n 
A 1 357 HIS 357 357 357 HIS HIS A . n 
A 1 358 MET 358 358 358 MET MET A . n 
A 1 359 GLY 359 359 359 GLY GLY A . n 
A 1 360 GLU 360 360 360 GLU GLU A . n 
A 1 361 MET 361 361 361 MET MET A . n 
A 1 362 LYS 362 362 362 LYS LYS A . n 
A 1 363 PHE 363 363 363 PHE PHE A . n 
A 1 364 LYS 364 364 364 LYS LYS A . n 
A 1 365 GLN 365 365 365 GLN GLN A . n 
A 1 366 ARG 366 366 ?   ?   ?   A . n 
A 1 367 PRO 367 367 ?   ?   ?   A . n 
A 1 368 ARG 368 368 ?   ?   ?   A . n 
A 1 369 GLU 369 369 ?   ?   ?   A . n 
A 1 370 GLU 370 370 370 GLU GLU A . n 
A 1 371 GLN 371 371 371 GLN GLN A . n 
A 1 372 ALA 372 372 372 ALA ALA A . n 
A 1 373 GLU 373 373 373 GLU GLU A . n 
A 1 374 SER 374 374 374 SER SER A . n 
A 1 375 ASP 375 375 375 ASP ASP A . n 
A 1 376 GLY 376 376 376 GLY GLY A . n 
A 1 377 THR 377 377 377 THR THR A . n 
A 1 378 ALA 378 378 378 ALA ALA A . n 
A 1 379 GLU 379 379 379 GLU GLU A . n 
A 1 380 ALA 380 380 380 ALA ALA A . n 
A 1 381 GLU 381 381 381 GLU GLU A . n 
A 1 382 LYS 382 382 382 LYS LYS A . n 
A 1 383 VAL 383 383 383 VAL VAL A . n 
A 1 384 ALA 384 384 384 ALA ALA A . n 
A 1 385 PHE 385 385 385 PHE PHE A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 CYS 387 387 387 CYS CYS A . n 
A 1 388 GLY 388 388 388 GLY GLY A . n 
A 1 389 ILE 389 389 389 ILE ILE A . n 
A 1 390 ASN 390 390 390 ASN ASN A . n 
A 1 391 ALA 391 391 391 ALA ALA A . n 
A 1 392 GLY 392 392 392 GLY GLY A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 LEU 395 395 395 LEU LEU A . n 
A 1 396 LYS 396 396 396 LYS LYS A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 LEU 398 398 398 LEU LEU A . n 
A 1 399 LEU 399 399 399 LEU LEU A . n 
A 1 400 LYS 400 400 400 LYS LYS A . n 
A 1 401 PRO 401 401 401 PRO PRO A . n 
A 1 402 LYS 402 402 402 LYS LYS A . n 
A 1 403 VAL 403 403 403 VAL VAL A . n 
A 1 404 LYS 404 404 404 LYS LYS A . n 
A 1 405 VAL 405 405 ?   ?   ?   A . n 
A 1 406 GLY 406 406 ?   ?   ?   A . n 
A 1 407 THR 407 407 ?   ?   ?   A . n 
A 1 408 GLU 408 408 ?   ?   ?   A . n 
A 1 409 MET 409 409 409 MET MET A . n 
A 1 410 VAL 410 410 410 VAL VAL A . n 
A 1 411 THR 411 411 411 THR THR A . n 
A 1 412 LYS 412 412 412 LYS LYS A . n 
A 1 413 GLY 413 413 413 GLY GLY A . n 
A 1 414 GLN 414 414 414 GLN GLN A . n 
A 1 415 ASN 415 415 415 ASN ASN A . n 
A 1 416 MET 416 416 416 MET MET A . n 
A 1 417 ASN 417 417 417 ASN ASN A . n 
A 1 418 GLN 418 418 418 GLN GLN A . n 
A 1 419 VAL 419 419 419 VAL VAL A . n 
A 1 420 VAL 420 420 420 VAL VAL A . n 
A 1 421 ASN 421 421 421 ASN ASN A . n 
A 1 422 SER 422 422 422 SER SER A . n 
A 1 423 VAL 423 423 423 VAL VAL A . n 
A 1 424 GLY 424 424 424 GLY GLY A . n 
A 1 425 ALA 425 425 425 ALA ALA A . n 
A 1 426 LEU 426 426 426 LEU LEU A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 LYS 428 428 428 LYS LYS A . n 
A 1 429 SER 429 429 429 SER SER A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 TYR 431 431 431 TYR TYR A . n 
A 1 432 ASP 432 432 432 ASP ASP A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 MET 434 434 434 MET MET A . n 
A 1 435 PHE 435 435 435 PHE PHE A . n 
A 1 436 ASN 436 436 436 ASN ASN A . n 
A 1 437 TRP 437 437 437 TRP TRP A . n 
A 1 438 LEU 438 438 438 LEU LEU A . n 
A 1 439 VAL 439 439 439 VAL VAL A . n 
A 1 440 ARG 440 440 440 ARG ARG A . n 
A 1 441 ARG 441 441 441 ARG ARG A . n 
A 1 442 VAL 442 442 442 VAL VAL A . n 
A 1 443 ASN 443 443 443 ASN ASN A . n 
A 1 444 LYS 444 444 444 LYS LYS A . n 
A 1 445 THR 445 445 445 THR THR A . n 
A 1 446 LEU 446 446 446 LEU LEU A . n 
A 1 447 ASP 447 447 447 ASP ASP A . n 
A 1 448 THR 448 448 448 THR THR A . n 
A 1 449 LYS 449 449 449 LYS LYS A . n 
A 1 450 ALA 450 450 450 ALA ALA A . n 
A 1 451 LYS 451 451 451 LYS LYS A . n 
A 1 452 ARG 452 452 452 ARG ARG A . n 
A 1 453 ASN 453 453 453 ASN ASN A . n 
A 1 454 TYR 454 454 454 TYR TYR A . n 
A 1 455 TYR 455 455 455 TYR TYR A . n 
A 1 456 ILE 456 456 456 ILE ILE A . n 
A 1 457 GLY 457 457 457 GLY GLY A . n 
A 1 458 VAL 458 458 458 VAL VAL A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 ILE 461 461 461 ILE ILE A . n 
A 1 462 ALA 462 462 462 ALA ALA A . n 
A 1 463 GLY 463 463 463 GLY GLY A . n 
A 1 464 PHE 464 464 464 PHE PHE A . n 
A 1 465 GLU 465 465 465 GLU GLU A . n 
A 1 466 ILE 466 466 466 ILE ILE A . n 
A 1 467 PHE 467 467 467 PHE PHE A . n 
A 1 468 ASP 468 468 468 ASP ASP A . n 
A 1 469 PHE 469 469 469 PHE PHE A . n 
A 1 470 ASN 470 470 470 ASN ASN A . n 
A 1 471 SER 471 471 471 SER SER A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 GLU 473 473 473 GLU GLU A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 LEU 475 475 475 LEU LEU A . n 
A 1 476 CYS 476 476 476 CYS CYS A . n 
A 1 477 ILE 477 477 477 ILE ILE A . n 
A 1 478 ASN 478 478 478 ASN ASN A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 THR 480 480 480 THR THR A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 GLU 482 482 482 GLU GLU A . n 
A 1 483 ARG 483 483 483 ARG ARG A . n 
A 1 484 LEU 484 484 484 LEU LEU A . n 
A 1 485 GLN 485 485 485 GLN GLN A . n 
A 1 486 GLN 486 486 486 GLN GLN A . n 
A 1 487 PHE 487 487 487 PHE PHE A . n 
A 1 488 PHE 488 488 488 PHE PHE A . n 
A 1 489 ASN 489 489 489 ASN ASN A . n 
A 1 490 HIS 490 490 490 HIS HIS A . n 
A 1 491 HIS 491 491 491 HIS HIS A . n 
A 1 492 MET 492 492 492 MET MET A . n 
A 1 493 PHE 493 493 493 PHE PHE A . n 
A 1 494 ILE 494 494 494 ILE ILE A . n 
A 1 495 LEU 495 495 495 LEU LEU A . n 
A 1 496 GLU 496 496 496 GLU GLU A . n 
A 1 497 GLN 497 497 497 GLN GLN A . n 
A 1 498 GLU 498 498 498 GLU GLU A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 TYR 500 500 500 TYR TYR A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 LYS 502 502 502 LYS LYS A . n 
A 1 503 GLU 503 503 503 GLU GLU A . n 
A 1 504 GLY 504 504 504 GLY GLY A . n 
A 1 505 ILE 505 505 505 ILE ILE A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 TRP 507 507 507 TRP TRP A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PHE 509 509 509 PHE PHE A . n 
A 1 510 ILE 510 510 510 ILE ILE A . n 
A 1 511 ASP 511 511 511 ASP ASP A . n 
A 1 512 PHE 512 512 512 PHE PHE A . n 
A 1 513 GLY 513 513 513 GLY GLY A . n 
A 1 514 MET 514 514 514 MET MET A . n 
A 1 515 ASP 515 515 515 ASP ASP A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 GLN 517 517 517 GLN GLN A . n 
A 1 518 MET 518 518 518 MET MET A . n 
A 1 519 CYS 519 519 519 CYS CYS A . n 
A 1 520 ILE 520 520 520 ILE ILE A . n 
A 1 521 ASP 521 521 521 ASP ASP A . n 
A 1 522 LEU 522 522 522 LEU LEU A . n 
A 1 523 ILE 523 523 523 ILE ILE A . n 
A 1 524 GLU 524 524 524 GLU GLU A . n 
A 1 525 LYS 525 525 525 LYS LYS A . n 
A 1 526 PRO 526 526 526 PRO PRO A . n 
A 1 527 MET 527 527 527 MET MET A . n 
A 1 528 GLY 528 528 528 GLY GLY A . n 
A 1 529 ILE 529 529 529 ILE ILE A . n 
A 1 530 LEU 530 530 530 LEU LEU A . n 
A 1 531 SER 531 531 531 SER SER A . n 
A 1 532 ILE 532 532 532 ILE ILE A . n 
A 1 533 LEU 533 533 533 LEU LEU A . n 
A 1 534 GLU 534 534 534 GLU GLU A . n 
A 1 535 GLU 535 535 535 GLU GLU A . n 
A 1 536 GLU 536 536 536 GLU GLU A . n 
A 1 537 CYS 537 537 537 CYS CYS A . n 
A 1 538 MET 538 538 538 MET MET A . n 
A 1 539 PHE 539 539 539 PHE PHE A . n 
A 1 540 PRO 540 540 540 PRO PRO A . n 
A 1 541 LYS 541 541 541 LYS LYS A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 ASP 543 543 543 ASP ASP A . n 
A 1 544 ASP 544 544 544 ASP ASP A . n 
A 1 545 LYS 545 545 545 LYS LYS A . n 
A 1 546 SER 546 546 546 SER SER A . n 
A 1 547 PHE 547 547 547 PHE PHE A . n 
A 1 548 GLN 548 548 548 GLN GLN A . n 
A 1 549 ASP 549 549 549 ASP ASP A . n 
A 1 550 LYS 550 550 550 LYS LYS A . n 
A 1 551 LEU 551 551 551 LEU LEU A . n 
A 1 552 TYR 552 552 552 TYR TYR A . n 
A 1 553 GLN 553 553 553 GLN GLN A . n 
A 1 554 ASN 554 554 554 ASN ASN A . n 
A 1 555 HIS 555 555 555 HIS HIS A . n 
A 1 556 MET 556 556 556 MET MET A . n 
A 1 557 GLY 557 557 557 GLY GLY A . n 
A 1 558 LYS 558 558 558 LYS LYS A . n 
A 1 559 ASN 559 559 559 ASN ASN A . n 
A 1 560 ARG 560 560 560 ARG ARG A . n 
A 1 561 MET 561 561 561 MET MET A . n 
A 1 562 PHE 562 562 562 PHE PHE A . n 
A 1 563 THR 563 563 563 THR THR A . n 
A 1 564 LYS 564 564 564 LYS LYS A . n 
A 1 565 PRO 565 565 565 PRO PRO A . n 
A 1 566 GLY 566 566 566 GLY GLY A . n 
A 1 567 LYS 567 567 567 LYS LYS A . n 
A 1 568 PRO 568 568 568 PRO PRO A . n 
A 1 569 THR 569 569 569 THR THR A . n 
A 1 570 ARG 570 570 570 ARG ARG A . n 
A 1 571 PRO 571 571 571 PRO PRO A . n 
A 1 572 ASN 572 572 572 ASN ASN A . n 
A 1 573 GLN 573 573 573 GLN GLN A . n 
A 1 574 GLY 574 574 574 GLY GLY A . n 
A 1 575 PRO 575 575 575 PRO PRO A . n 
A 1 576 ALA 576 576 576 ALA ALA A . n 
A 1 577 HIS 577 577 577 HIS HIS A . n 
A 1 578 PHE 578 578 578 PHE PHE A . n 
A 1 579 GLU 579 579 579 GLU GLU A . n 
A 1 580 LEU 580 580 580 LEU LEU A . n 
A 1 581 HIS 581 581 581 HIS HIS A . n 
A 1 582 HIS 582 582 582 HIS HIS A . n 
A 1 583 TYR 583 583 583 TYR TYR A . n 
A 1 584 ALA 584 584 584 ALA ALA A . n 
A 1 585 GLY 585 585 585 GLY GLY A . n 
A 1 586 ASN 586 586 586 ASN ASN A . n 
A 1 587 VAL 587 587 587 VAL VAL A . n 
A 1 588 PRO 588 588 588 PRO PRO A . n 
A 1 589 TYR 589 589 589 TYR TYR A . n 
A 1 590 SER 590 590 590 SER SER A . n 
A 1 591 ILE 591 591 591 ILE ILE A . n 
A 1 592 THR 592 592 592 THR THR A . n 
A 1 593 GLY 593 593 593 GLY GLY A . n 
A 1 594 TRP 594 594 594 TRP TRP A . n 
A 1 595 LEU 595 595 595 LEU LEU A . n 
A 1 596 GLU 596 596 596 GLU GLU A . n 
A 1 597 LYS 597 597 597 LYS LYS A . n 
A 1 598 ASN 598 598 598 ASN ASN A . n 
A 1 599 LYS 599 599 599 LYS LYS A . n 
A 1 600 ASP 600 600 600 ASP ASP A . n 
A 1 601 PRO 601 601 601 PRO PRO A . n 
A 1 602 ILE 602 602 602 ILE ILE A . n 
A 1 603 ASN 603 603 603 ASN ASN A . n 
A 1 604 GLU 604 604 604 GLU GLU A . n 
A 1 605 ASN 605 605 605 ASN ASN A . n 
A 1 606 VAL 606 606 606 VAL VAL A . n 
A 1 607 VAL 607 607 607 VAL VAL A . n 
A 1 608 ALA 608 608 608 ALA ALA A . n 
A 1 609 LEU 609 609 609 LEU LEU A . n 
A 1 610 LEU 610 610 610 LEU LEU A . n 
A 1 611 GLY 611 611 611 GLY GLY A . n 
A 1 612 ALA 612 612 612 ALA ALA A . n 
A 1 613 SER 613 613 613 SER SER A . n 
A 1 614 LYS 614 614 614 LYS LYS A . n 
A 1 615 GLU 615 615 615 GLU GLU A . n 
A 1 616 PRO 616 616 616 PRO PRO A . n 
A 1 617 LEU 617 617 617 LEU LEU A . n 
A 1 618 VAL 618 618 618 VAL VAL A . n 
A 1 619 ALA 619 619 619 ALA ALA A . n 
A 1 620 GLU 620 620 620 GLU GLU A . n 
A 1 621 LEU 621 621 621 LEU LEU A . n 
A 1 622 PHE 622 622 622 PHE PHE A . n 
A 1 623 LYS 623 623 623 LYS LYS A . n 
A 1 624 ALA 624 624 624 ALA ALA A . n 
A 1 625 PRO 625 625 ?   ?   ?   A . n 
A 1 626 GLU 626 626 ?   ?   ?   A . n 
A 1 627 GLU 627 627 ?   ?   ?   A . n 
A 1 628 PRO 628 628 ?   ?   ?   A . n 
A 1 629 ALA 629 629 ?   ?   ?   A . n 
A 1 630 GLY 630 630 ?   ?   ?   A . n 
A 1 631 GLY 631 631 ?   ?   ?   A . n 
A 1 632 GLY 632 632 ?   ?   ?   A . n 
A 1 633 LYS 633 633 ?   ?   ?   A . n 
A 1 634 LYS 634 634 ?   ?   ?   A . n 
A 1 635 LYS 635 635 ?   ?   ?   A . n 
A 1 636 LYS 636 636 ?   ?   ?   A . n 
A 1 637 GLY 637 637 ?   ?   ?   A . n 
A 1 638 LYS 638 638 ?   ?   ?   A . n 
A 1 639 SER 639 639 ?   ?   ?   A . n 
A 1 640 SER 640 640 ?   ?   ?   A . n 
A 1 641 ALA 641 641 ?   ?   ?   A . n 
A 1 642 PHE 642 642 ?   ?   ?   A . n 
A 1 643 GLN 643 643 643 GLN GLN A . n 
A 1 644 THR 644 644 644 THR THR A . n 
A 1 645 ILE 645 645 645 ILE ILE A . n 
A 1 646 SER 646 646 646 SER SER A . n 
A 1 647 ALA 647 647 647 ALA ALA A . n 
A 1 648 VAL 648 648 648 VAL VAL A . n 
A 1 649 HIS 649 649 649 HIS HIS A . n 
A 1 650 ARG 650 650 650 ARG ARG A . n 
A 1 651 GLU 651 651 651 GLU GLU A . n 
A 1 652 SER 652 652 652 SER SER A . n 
A 1 653 LEU 653 653 653 LEU LEU A . n 
A 1 654 ASN 654 654 654 ASN ASN A . n 
A 1 655 LYS 655 655 655 LYS LYS A . n 
A 1 656 LEU 656 656 656 LEU LEU A . n 
A 1 657 MET 657 657 657 MET MET A . n 
A 1 658 LYS 658 658 658 LYS LYS A . n 
A 1 659 ASN 659 659 659 ASN ASN A . n 
A 1 660 LEU 660 660 660 LEU LEU A . n 
A 1 661 TYR 661 661 661 TYR TYR A . n 
A 1 662 SER 662 662 662 SER SER A . n 
A 1 663 THR 663 663 663 THR THR A . n 
A 1 664 HIS 664 664 664 HIS HIS A . n 
A 1 665 PRO 665 665 665 PRO PRO A . n 
A 1 666 HIS 666 666 666 HIS HIS A . n 
A 1 667 PHE 667 667 667 PHE PHE A . n 
A 1 668 VAL 668 668 668 VAL VAL A . n 
A 1 669 ARG 669 669 669 ARG ARG A . n 
A 1 670 CYS 670 670 670 CYS CYS A . n 
A 1 671 ILE 671 671 671 ILE ILE A . n 
A 1 672 ILE 672 672 672 ILE ILE A . n 
A 1 673 PRO 673 673 673 PRO PRO A . n 
A 1 674 ASN 674 674 674 ASN ASN A . n 
A 1 675 GLU 675 675 675 GLU GLU A . n 
A 1 676 LEU 676 676 676 LEU LEU A . n 
A 1 677 LYS 677 677 677 LYS LYS A . n 
A 1 678 GLN 678 678 678 GLN GLN A . n 
A 1 679 PRO 679 679 679 PRO PRO A . n 
A 1 680 GLY 680 680 680 GLY GLY A . n 
A 1 681 LEU 681 681 681 LEU LEU A . n 
A 1 682 VAL 682 682 682 VAL VAL A . n 
A 1 683 ASP 683 683 683 ASP ASP A . n 
A 1 684 ALA 684 684 684 ALA ALA A . n 
A 1 685 GLU 685 685 685 GLU GLU A . n 
A 1 686 LEU 686 686 686 LEU LEU A . n 
A 1 687 VAL 687 687 687 VAL VAL A . n 
A 1 688 LEU 688 688 688 LEU LEU A . n 
A 1 689 HIS 689 689 689 HIS HIS A . n 
A 1 690 GLN 690 690 690 GLN GLN A . n 
A 1 691 LEU 691 691 691 LEU LEU A . n 
A 1 692 GLN 692 692 692 GLN GLN A . n 
A 1 693 CYS 693 693 693 CYS CYS A . n 
A 1 694 ASN 694 694 694 ASN ASN A . n 
A 1 695 GLY 695 695 695 GLY GLY A . n 
A 1 696 VAL 696 696 696 VAL VAL A . n 
A 1 697 LEU 697 697 697 LEU LEU A . n 
A 1 698 GLU 698 698 698 GLU GLU A . n 
A 1 699 GLY 699 699 ?   ?   ?   A . n 
A 1 700 ILE 700 700 ?   ?   ?   A . n 
A 1 701 ARG 701 701 ?   ?   ?   A . n 
A 1 702 ILE 702 702 ?   ?   ?   A . n 
A 1 703 CYS 703 703 ?   ?   ?   A . n 
A 1 704 ARG 704 704 704 ARG ARG A . n 
A 1 705 LYS 705 705 705 LYS LYS A . n 
A 1 706 GLY 706 706 706 GLY GLY A . n 
A 1 707 PHE 707 707 707 PHE PHE A . n 
A 1 708 PRO 708 708 708 PRO PRO A . n 
A 1 709 SER 709 709 709 SER SER A . n 
A 1 710 ARG 710 710 710 ARG ARG A . n 
A 1 711 LEU 711 711 711 LEU LEU A . n 
A 1 712 ILE 712 712 712 ILE ILE A . n 
A 1 713 TYR 713 713 713 TYR TYR A . n 
A 1 714 SER 714 714 714 SER SER A . n 
A 1 715 GLU 715 715 715 GLU GLU A . n 
A 1 716 PHE 716 716 716 PHE PHE A . n 
A 1 717 LYS 717 717 717 LYS LYS A . n 
A 1 718 GLN 718 718 718 GLN GLN A . n 
A 1 719 ARG 719 719 719 ARG ARG A . n 
A 1 720 TYR 720 720 720 TYR TYR A . n 
A 1 721 SER 721 721 721 SER SER A . n 
A 1 722 ILE 722 722 722 ILE ILE A . n 
A 1 723 LEU 723 723 723 LEU LEU A . n 
A 1 724 ALA 724 724 724 ALA ALA A . n 
A 1 725 PRO 725 725 725 PRO PRO A . n 
A 1 726 ASN 726 726 726 ASN ASN A . n 
A 1 727 ALA 727 727 727 ALA ALA A . n 
A 1 728 ILE 728 728 728 ILE ILE A . n 
A 1 729 PRO 729 729 729 PRO PRO A . n 
A 1 730 GLN 730 730 730 GLN GLN A . n 
A 1 731 GLY 731 731 ?   ?   ?   A . n 
A 1 732 PHE 732 732 ?   ?   ?   A . n 
A 1 733 VAL 733 733 ?   ?   ?   A . n 
A 1 734 ASP 734 734 734 ASP ASP A . n 
A 1 735 GLY 735 735 735 GLY GLY A . n 
A 1 736 LYS 736 736 736 LYS LYS A . n 
A 1 737 THR 737 737 737 THR THR A . n 
A 1 738 VAL 738 738 738 VAL VAL A . n 
A 1 739 SER 739 739 739 SER SER A . n 
A 1 740 GLU 740 740 740 GLU GLU A . n 
A 1 741 LYS 741 741 741 LYS LYS A . n 
A 1 742 ILE 742 742 742 ILE ILE A . n 
A 1 743 LEU 743 743 743 LEU LEU A . n 
A 1 744 ALA 744 744 744 ALA ALA A . n 
A 1 745 GLY 745 745 745 GLY GLY A . n 
A 1 746 LEU 746 746 746 LEU LEU A . n 
A 1 747 GLN 747 747 747 GLN GLN A . n 
A 1 748 MET 748 748 748 MET MET A . n 
A 1 749 ASP 749 749 749 ASP ASP A . n 
A 1 750 PRO 750 750 750 PRO PRO A . n 
A 1 751 ALA 751 751 751 ALA ALA A . n 
A 1 752 GLU 752 752 752 GLU GLU A . n 
A 1 753 TYR 753 753 753 TYR TYR A . n 
A 1 754 ARG 754 754 754 ARG ARG A . n 
A 1 755 LEU 755 755 755 LEU LEU A . n 
A 1 756 GLY 756 756 756 GLY GLY A . n 
A 1 757 THR 757 757 757 THR THR A . n 
A 1 758 THR 758 758 758 THR THR A . n 
A 1 759 LYS 759 759 759 LYS LYS A . n 
A 1 760 VAL 760 760 760 VAL VAL A . n 
A 1 761 PHE 761 761 761 PHE PHE A . n 
A 1 762 PHE 762 762 762 PHE PHE A . n 
A 1 763 LYS 763 763 763 LYS LYS A . n 
A 1 764 ALA 764 764 764 ALA ALA A . n 
A 1 765 GLY 765 765 765 GLY GLY A . n 
A 1 766 VAL 766 766 766 VAL VAL A . n 
A 1 767 LEU 767 767 767 LEU LEU A . n 
A 1 768 GLY 768 768 768 GLY GLY A . n 
A 1 769 ASN 769 769 769 ASN ASN A . n 
A 1 770 LEU 770 770 770 LEU LEU A . n 
A 1 771 GLU 771 771 771 GLU GLU A . n 
A 1 772 GLU 772 772 772 GLU GLU A . n 
A 1 773 MET 773 773 773 MET MET A . n 
A 1 774 ARG 774 774 774 ARG ARG A . n 
A 1 775 ASP 775 775 775 ASP ASP A . n 
A 1 776 GLU 776 776 776 GLU GLU A . n 
A 1 777 ARG 777 777 777 ARG ARG A . n 
A 1 778 LEU 778 778 778 LEU LEU A . n 
A 1 779 SER 779 779 779 SER SER A . n 
A 1 780 LYS 780 780 780 LYS LYS A . n 
A 1 781 ILE 781 781 781 ILE ILE A . n 
A 1 782 ILE 782 782 782 ILE ILE A . n 
A 1 783 SER 783 783 783 SER SER A . n 
A 1 784 MET 784 784 784 MET MET A . n 
A 1 785 PHE 785 785 785 PHE PHE A . n 
A 1 786 GLN 786 786 786 GLN GLN A . n 
A 1 787 ALA 787 787 787 ALA ALA A . n 
A 1 788 HIS 788 788 788 HIS HIS A . n 
A 1 789 ILE 789 789 789 ILE ILE A . n 
A 1 790 ARG 790 790 790 ARG ARG A . n 
A 1 791 GLY 791 791 791 GLY GLY A . n 
A 1 792 TYR 792 792 792 TYR TYR A . n 
A 1 793 LEU 793 793 793 LEU LEU A . n 
A 1 794 ILE 794 794 794 ILE ILE A . n 
A 1 795 ARG 795 795 795 ARG ARG A . n 
A 1 796 LYS 796 796 796 LYS LYS A . n 
A 1 797 ALA 797 797 797 ALA ALA A . n 
A 1 798 TYR 798 798 798 TYR TYR A . n 
A 1 799 LYS 799 799 799 LYS LYS A . n 
A 1 800 LYS 800 800 800 LYS LYS A . n 
A 1 801 LEU 801 801 801 LEU LEU A . n 
A 1 802 GLN 802 802 802 GLN GLN A . n 
A 1 803 ASP 803 803 803 ASP ASP A . n 
A 1 804 GLN 804 804 804 GLN GLN A . n 
A 1 805 ARG 805 805 805 ARG ARG A . n 
A 1 806 ILE 806 806 806 ILE ILE A . n 
A 1 807 GLY 807 807 807 GLY GLY A . n 
A 1 808 LEU 808 808 808 LEU LEU A . n 
A 1 809 SER 809 809 809 SER SER A . n 
A 1 810 VAL 810 810 810 VAL VAL A . n 
A 1 811 ILE 811 811 811 ILE ILE A . n 
A 1 812 GLN 812 812 812 GLN GLN A . n 
A 1 813 ARG 813 813 813 ARG ARG A . n 
A 1 814 ASN 814 814 814 ASN ASN A . n 
A 1 815 ILE 815 815 815 ILE ILE A . n 
A 1 816 ARG 816 816 816 ARG ARG A . n 
A 1 817 LYS 817 817 817 LYS LYS A . n 
A 1 818 TRP 818 818 818 TRP TRP A . n 
A 1 819 LEU 819 819 819 LEU LEU A . n 
A 1 820 VAL 820 820 820 VAL VAL A . n 
A 1 821 LEU 821 821 821 LEU LEU A . n 
A 1 822 ARG 822 822 822 ARG ARG A . n 
A 1 823 ASN 823 823 823 ASN ASN A . n 
A 1 824 TRP 824 824 824 TRP TRP A . n 
A 1 825 GLN 825 825 825 GLN GLN A . n 
A 1 826 TRP 826 826 826 TRP TRP A . n 
A 1 827 TRP 827 827 827 TRP TRP A . n 
A 1 828 LYS 828 828 828 LYS LYS A . n 
A 1 829 LEU 829 829 829 LEU LEU A . n 
A 1 830 TYR 830 830 830 TYR TYR A . n 
A 1 831 SER 831 831 831 SER SER A . n 
A 1 832 LYS 832 832 832 LYS LYS A . n 
A 1 833 VAL 833 833 833 VAL VAL A . n 
A 1 834 LYS 834 834 834 LYS LYS A . n 
A 1 835 PRO 835 835 835 PRO PRO A . n 
A 1 836 LEU 836 836 836 LEU LEU A . n 
A 1 837 LEU 837 837 837 LEU LEU A . n 
B 2 1   PRO 1   13  13  PRO PRO B . n 
B 2 2   GLN 2   14  14  GLN GLN B . n 
B 2 3   LYS 3   15  15  LYS LYS B . n 
B 2 4   GLN 4   16  16  GLN GLN B . n 
B 2 5   ILE 5   17  17  ILE ILE B . n 
B 2 6   GLN 6   18  18  GLN GLN B . n 
B 2 7   GLU 7   19  19  GLU GLU B . n 
B 2 8   MET 8   20  20  MET MET B . n 
B 2 9   LYS 9   21  21  LYS LYS B . n 
B 2 10  GLU 10  22  22  GLU GLU B . n 
B 2 11  ALA 11  23  23  ALA ALA B . n 
B 2 12  PHE 12  24  24  PHE PHE B . n 
B 2 13  SER 13  25  25  SER SER B . n 
B 2 14  MET 14  26  26  MET MET B . n 
B 2 15  ILE 15  27  27  ILE ILE B . n 
B 2 16  ASP 16  28  28  ASP ASP B . n 
B 2 17  VAL 17  29  29  VAL VAL B . n 
B 2 18  ASP 18  30  30  ASP ASP B . n 
B 2 19  ARG 19  31  31  ARG ARG B . n 
B 2 20  ASP 20  32  32  ASP ASP B . n 
B 2 21  GLY 21  33  33  GLY GLY B . n 
B 2 22  PHE 22  34  34  PHE PHE B . n 
B 2 23  VAL 23  35  35  VAL VAL B . n 
B 2 24  SER 24  36  36  SER SER B . n 
B 2 25  LYS 25  37  37  LYS LYS B . n 
B 2 26  GLU 26  38  38  GLU GLU B . n 
B 2 27  ASP 27  39  39  ASP ASP B . n 
B 2 28  ILE 28  40  40  ILE ILE B . n 
B 2 29  LYS 29  41  41  LYS LYS B . n 
B 2 30  ALA 30  42  42  ALA ALA B . n 
B 2 31  ILE 31  43  43  ILE ILE B . n 
B 2 32  SER 32  44  44  SER SER B . n 
B 2 33  GLU 33  45  45  GLU GLU B . n 
B 2 34  GLN 34  46  46  GLN GLN B . n 
B 2 35  LEU 35  47  47  LEU LEU B . n 
B 2 36  GLY 36  48  48  GLY GLY B . n 
B 2 37  ARG 37  49  49  ARG ARG B . n 
B 2 38  ALA 38  50  50  ALA ALA B . n 
B 2 39  PRO 39  51  51  PRO PRO B . n 
B 2 40  ASP 40  52  52  ASP ASP B . n 
B 2 41  ASP 41  53  53  ASP ASP B . n 
B 2 42  LYS 42  54  54  LYS LYS B . n 
B 2 43  GLU 43  55  55  GLU GLU B . n 
B 2 44  LEU 44  56  56  LEU LEU B . n 
B 2 45  THR 45  57  57  THR THR B . n 
B 2 46  ALA 46  58  58  ALA ALA B . n 
B 2 47  MET 47  59  59  MET MET B . n 
B 2 48  LEU 48  60  60  LEU LEU B . n 
B 2 49  LYS 49  61  61  LYS LYS B . n 
B 2 50  GLU 50  62  62  GLU GLU B . n 
B 2 51  ALA 51  63  63  ALA ALA B . n 
B 2 52  PRO 52  64  64  PRO PRO B . n 
B 2 53  GLY 53  65  65  GLY GLY B . n 
B 2 54  PRO 54  66  66  PRO PRO B . n 
B 2 55  LEU 55  67  67  LEU LEU B . n 
B 2 56  ASN 56  68  68  ASN ASN B . n 
B 2 57  PHE 57  69  69  PHE PHE B . n 
B 2 58  THR 58  70  70  THR THR B . n 
B 2 59  MET 59  71  71  MET MET B . n 
B 2 60  PHE 60  72  72  PHE PHE B . n 
B 2 61  LEU 61  73  73  LEU LEU B . n 
B 2 62  SER 62  74  74  SER SER B . n 
B 2 63  ILE 63  75  75  ILE ILE B . n 
B 2 64  PHE 64  76  76  PHE PHE B . n 
B 2 65  SER 65  77  77  SER SER B . n 
B 2 66  ASP 66  78  78  ASP ASP B . n 
B 2 67  LYS 67  79  79  LYS LYS B . n 
B 2 68  LEU 68  80  80  LEU LEU B . n 
B 2 69  SER 69  81  81  SER SER B . n 
B 2 70  GLY 70  82  82  GLY GLY B . n 
B 2 71  THR 71  83  83  THR THR B . n 
B 2 72  ASP 72  84  84  ASP ASP B . n 
B 2 73  SER 73  85  85  SER SER B . n 
B 2 74  GLU 74  86  86  GLU GLU B . n 
B 2 75  GLU 75  87  87  GLU GLU B . n 
B 2 76  THR 76  88  88  THR THR B . n 
B 2 77  ILE 77  89  89  ILE ILE B . n 
B 2 78  ARG 78  90  90  ARG ARG B . n 
B 2 79  ASN 79  91  91  ASN ASN B . n 
B 2 80  ALA 80  92  92  ALA ALA B . n 
B 2 81  PHE 81  93  93  PHE PHE B . n 
B 2 82  ALA 82  94  94  ALA ALA B . n 
B 2 83  MET 83  95  95  MET MET B . n 
B 2 84  PHE 84  96  96  PHE PHE B . n 
B 2 85  ASP 85  97  97  ASP ASP B . n 
B 2 86  GLU 86  98  98  GLU GLU B . n 
B 2 87  GLN 87  99  99  GLN GLN B . n 
B 2 88  GLU 88  100 100 GLU GLU B . n 
B 2 89  THR 89  101 101 THR THR B . n 
B 2 90  LYS 90  102 102 LYS LYS B . n 
B 2 91  LYS 91  103 103 LYS LYS B . n 
B 2 92  LEU 92  104 104 LEU LEU B . n 
B 2 93  ASN 93  105 105 ASN ASN B . n 
B 2 94  ILE 94  106 106 ILE ILE B . n 
B 2 95  GLU 95  107 107 GLU GLU B . n 
B 2 96  TYR 96  108 108 TYR TYR B . n 
B 2 97  ILE 97  109 109 ILE ILE B . n 
B 2 98  LYS 98  110 110 LYS LYS B . n 
B 2 99  ASP 99  111 111 ASP ASP B . n 
B 2 100 LEU 100 112 112 LEU LEU B . n 
B 2 101 LEU 101 113 113 LEU LEU B . n 
B 2 102 GLU 102 114 114 GLU GLU B . n 
B 2 103 ASN 103 115 115 ASN ASN B . n 
B 2 104 MET 104 116 116 MET MET B . n 
B 2 105 GLY 105 117 117 GLY GLY B . n 
B 2 106 ASP 106 118 118 ASP ASP B . n 
B 2 107 ASN 107 119 119 ASN ASN B . n 
B 2 108 PHE 108 120 120 PHE PHE B . n 
B 2 109 ASN 109 121 121 ASN ASN B . n 
B 2 110 LYS 110 122 122 LYS LYS B . n 
B 2 111 ASP 111 123 123 ASP ASP B . n 
B 2 112 GLU 112 124 124 GLU GLU B . n 
B 2 113 MET 113 125 125 MET MET B . n 
B 2 114 ARG 114 126 126 ARG ARG B . n 
B 2 115 MET 115 127 127 MET MET B . n 
B 2 116 THR 116 128 128 THR THR B . n 
B 2 117 PHE 117 129 129 PHE PHE B . n 
B 2 118 LYS 118 130 130 LYS LYS B . n 
B 2 119 GLU 119 131 131 GLU GLU B . n 
B 2 120 ALA 120 132 132 ALA ALA B . n 
B 2 121 PRO 121 133 133 PRO PRO B . n 
B 2 122 VAL 122 134 134 VAL VAL B . n 
B 2 123 GLU 123 135 135 GLU GLU B . n 
B 2 124 GLY 124 136 136 GLY GLY B . n 
B 2 125 GLY 125 137 137 GLY GLY B . n 
B 2 126 LYS 126 138 138 LYS LYS B . n 
B 2 127 PHE 127 139 139 PHE PHE B . n 
B 2 128 ASP 128 140 140 ASP ASP B . n 
B 2 129 TYR 129 141 141 TYR TYR B . n 
B 2 130 VAL 130 142 142 VAL VAL B . n 
B 2 131 LYS 131 143 143 LYS LYS B . n 
B 2 132 PHE 132 144 144 PHE PHE B . n 
B 2 133 THR 133 145 145 THR THR B . n 
B 2 134 ALA 134 146 146 ALA ALA B . n 
B 2 135 MET 135 147 147 MET MET B . n 
B 2 136 ILE 136 148 148 ILE ILE B . n 
B 2 137 LYS 137 149 149 LYS LYS B . n 
B 2 138 GLY 138 150 150 GLY GLY B . n 
B 2 139 SER 139 151 151 SER SER B . n 
C 3 1   PRO 1   1   1   PRO PRO C . n 
C 3 2   LYS 2   2   2   LYS LYS C . n 
C 3 3   LEU 3   3   3   LEU LEU C . n 
C 3 4   SER 4   4   4   SER SER C . n 
C 3 5   GLN 5   5   5   GLN GLN C . n 
C 3 6   ASP 6   6   6   ASP ASP C . n 
C 3 7   GLU 7   7   7   GLU GLU C . n 
C 3 8   ILE 8   8   8   ILE ILE C . n 
C 3 9   ASP 9   9   9   ASP ASP C . n 
C 3 10  ASP 10  10  10  ASP ASP C . n 
C 3 11  LEU 11  11  11  LEU LEU C . n 
C 3 12  LYS 12  12  12  LYS LYS C . n 
C 3 13  ASP 13  13  13  ASP ASP C . n 
C 3 14  VAL 14  14  14  VAL VAL C . n 
C 3 15  PHE 15  15  15  PHE PHE C . n 
C 3 16  GLU 16  16  16  GLU GLU C . n 
C 3 17  LEU 17  17  17  LEU LEU C . n 
C 3 18  PHE 18  18  18  PHE PHE C . n 
C 3 19  ASP 19  19  19  ASP ASP C . n 
C 3 20  PHE 20  20  20  PHE PHE C . n 
C 3 21  TRP 21  21  21  TRP TRP C . n 
C 3 22  ASP 22  22  22  ASP ASP C . n 
C 3 23  GLY 23  23  23  GLY GLY C . n 
C 3 24  ARG 24  24  24  ARG ARG C . n 
C 3 25  ASP 25  25  25  ASP ASP C . n 
C 3 26  GLY 26  26  26  GLY GLY C . n 
C 3 27  ALA 27  27  27  ALA ALA C . n 
C 3 28  VAL 28  28  28  VAL VAL C . n 
C 3 29  ASP 29  29  29  ASP ASP C . n 
C 3 30  ALA 30  30  30  ALA ALA C . n 
C 3 31  PHE 31  31  31  PHE PHE C . n 
C 3 32  LYS 32  32  32  LYS LYS C . n 
C 3 33  LEU 33  33  33  LEU LEU C . n 
C 3 34  GLY 34  34  34  GLY GLY C . n 
C 3 35  ASP 35  35  35  ASP ASP C . n 
C 3 36  VAL 36  36  36  VAL VAL C . n 
C 3 37  CYS 37  37  37  CYS CYS C . n 
C 3 38  ARG 38  38  38  ARG ARG C . n 
C 3 39  CYS 39  39  39  CYS CYS C . n 
C 3 40  LEU 40  40  40  LEU LEU C . n 
C 3 41  GLY 41  41  41  GLY GLY C . n 
C 3 42  ILE 42  42  42  ILE ILE C . n 
C 3 43  ASN 43  43  43  ASN ASN C . n 
C 3 44  PRO 44  44  44  PRO PRO C . n 
C 3 45  ARG 45  45  45  ARG ARG C . n 
C 3 46  ASN 46  46  46  ASN ASN C . n 
C 3 47  GLU 47  47  47  GLU GLU C . n 
C 3 48  ASP 48  48  48  ASP ASP C . n 
C 3 49  VAL 49  49  49  VAL VAL C . n 
C 3 50  PHE 50  50  50  PHE PHE C . n 
C 3 51  ALA 51  51  51  ALA ALA C . n 
C 3 52  VAL 52  52  52  VAL VAL C . n 
C 3 53  GLY 53  53  53  GLY GLY C . n 
C 3 54  GLY 54  54  54  GLY GLY C . n 
C 3 55  THR 55  55  55  THR THR C . n 
C 3 56  HIS 56  56  56  HIS HIS C . n 
C 3 57  LYS 57  57  57  LYS LYS C . n 
C 3 58  MET 58  58  58  MET MET C . n 
C 3 59  GLY 59  59  59  GLY GLY C . n 
C 3 60  GLU 60  60  60  GLU GLU C . n 
C 3 61  LYS 61  61  61  LYS LYS C . n 
C 3 62  SER 62  62  62  SER SER C . n 
C 3 63  LEU 63  63  63  LEU LEU C . n 
C 3 64  PRO 64  64  64  PRO PRO C . n 
C 3 65  PHE 65  65  65  PHE PHE C . n 
C 3 66  GLU 66  66  66  GLU GLU C . n 
C 3 67  GLU 67  67  67  GLU GLU C . n 
C 3 68  PHE 68  68  68  PHE PHE C . n 
C 3 69  LEU 69  69  69  LEU LEU C . n 
C 3 70  PRO 70  70  70  PRO PRO C . n 
C 3 71  ALA 71  71  71  ALA ALA C . n 
C 3 72  TYR 72  72  72  TYR TYR C . n 
C 3 73  GLU 73  73  73  GLU GLU C . n 
C 3 74  GLY 74  74  74  GLY GLY C . n 
C 3 75  LEU 75  75  75  LEU LEU C . n 
C 3 76  MET 76  76  76  MET MET C . n 
C 3 77  ASP 77  77  77  ASP ASP C . n 
C 3 78  CYS 78  78  78  CYS CYS C . n 
C 3 79  GLU 79  79  79  GLU GLU C . n 
C 3 80  GLN 80  80  80  GLN GLN C . n 
C 3 81  GLY 81  81  81  GLY GLY C . n 
C 3 82  THR 82  82  82  THR THR C . n 
C 3 83  PHE 83  83  83  PHE PHE C . n 
C 3 84  ALA 84  84  84  ALA ALA C . n 
C 3 85  ASP 85  85  85  ASP ASP C . n 
C 3 86  TYR 86  86  86  TYR TYR C . n 
C 3 87  MET 87  87  87  MET MET C . n 
C 3 88  GLU 88  88  88  GLU GLU C . n 
C 3 89  ALA 89  89  89  ALA ALA C . n 
C 3 90  PHE 90  90  90  PHE PHE C . n 
C 3 91  LYS 91  91  91  LYS LYS C . n 
C 3 92  THR 92  92  92  THR THR C . n 
C 3 93  PHE 93  93  93  PHE PHE C . n 
C 3 94  ASP 94  94  94  ASP ASP C . n 
C 3 95  ARG 95  95  95  ARG ARG C . n 
C 3 96  GLU 96  96  96  GLU GLU C . n 
C 3 97  GLY 97  97  97  GLY GLY C . n 
C 3 98  GLN 98  98  98  GLN GLN C . n 
C 3 99  GLY 99  99  99  GLY GLY C . n 
C 3 100 PHE 100 100 100 PHE PHE C . n 
C 3 101 ILE 101 101 101 ILE ILE C . n 
C 3 102 SER 102 102 102 SER SER C . n 
C 3 103 GLY 103 103 103 GLY GLY C . n 
C 3 104 ALA 104 104 104 ALA ALA C . n 
C 3 105 GLU 105 105 105 GLU GLU C . n 
C 3 106 LEU 106 106 106 LEU LEU C . n 
C 3 107 ARG 107 107 107 ARG ARG C . n 
C 3 108 HIS 108 108 108 HIS HIS C . n 
C 3 109 VAL 109 109 109 VAL VAL C . n 
C 3 110 LEU 110 110 110 LEU LEU C . n 
C 3 111 THR 111 111 111 THR THR C . n 
C 3 112 ALA 112 112 112 ALA ALA C . n 
C 3 113 LEU 113 113 113 LEU LEU C . n 
C 3 114 GLY 114 114 114 GLY GLY C . n 
C 3 115 GLU 115 115 115 GLU GLU C . n 
C 3 116 ARG 116 116 116 ARG ARG C . n 
C 3 117 LEU 117 117 117 LEU LEU C . n 
C 3 118 SER 118 118 118 SER SER C . n 
C 3 119 ASP 119 119 119 ASP ASP C . n 
C 3 120 GLU 120 120 120 GLU GLU C . n 
C 3 121 ASP 121 121 121 ASP ASP C . n 
C 3 122 VAL 122 122 122 VAL VAL C . n 
C 3 123 ASP 123 123 123 ASP ASP C . n 
C 3 124 GLU 124 124 124 GLU GLU C . n 
C 3 125 ILE 125 125 125 ILE ILE C . n 
C 3 126 ILE 126 126 126 ILE ILE C . n 
C 3 127 LYS 127 127 127 LYS LYS C . n 
C 3 128 LEU 128 128 128 LEU LEU C . n 
C 3 129 THR 129 129 129 THR THR C . n 
C 3 130 ASP 130 130 130 ASP ASP C . n 
C 3 131 LEU 131 131 131 LEU LEU C . n 
C 3 132 GLN 132 132 132 GLN GLN C . n 
C 3 133 GLU 133 133 133 GLU GLU C . n 
C 3 134 ASP 134 134 134 ASP ASP C . n 
C 3 135 LEU 135 135 135 LEU LEU C . n 
C 3 136 GLU 136 136 136 GLU GLU C . n 
C 3 137 GLY 137 137 137 GLY GLY C . n 
C 3 138 ASN 138 138 138 ASN ASN C . n 
C 3 139 VAL 139 139 139 VAL VAL C . n 
C 3 140 LYS 140 140 140 LYS LYS C . n 
C 3 141 TYR 141 141 141 TYR TYR C . n 
C 3 142 GLU 142 142 142 GLU GLU C . n 
C 3 143 ASP 143 143 143 ASP ASP C . n 
C 3 144 PHE 144 144 144 PHE PHE C . n 
C 3 145 VAL 145 145 145 VAL VAL C . n 
C 3 146 LYS 146 146 146 LYS LYS C . n 
C 3 147 LYS 147 147 147 LYS LYS C . n 
C 3 148 VAL 148 148 148 VAL VAL C . n 
C 3 149 MET 149 149 149 MET MET C . n 
C 3 150 ALA 150 150 150 ALA ALA C . n 
C 3 151 GLY 151 151 151 GLY GLY C . n 
C 3 152 PRO 152 152 152 PRO PRO C . n 
C 3 153 TYR 153 153 153 TYR TYR C . n 
C 3 154 PRO 154 154 154 PRO PRO C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10290 ? 
1 MORE         -102  ? 
1 'SSA (A^2)'  50830 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O3B ? F ADP .   ? A ADP 996  ? 1_555 BE ? E BEF . ? A BEF 995 ? 1_555 F1  ? E BEF .   ? A BEF 995  ? 1_555 108.4 ? 
2  O3B ? F ADP .   ? A ADP 996  ? 1_555 BE ? E BEF . ? A BEF 995 ? 1_555 F2  ? E BEF .   ? A BEF 995  ? 1_555 109.6 ? 
3  F1  ? E BEF .   ? A BEF 995  ? 1_555 BE ? E BEF . ? A BEF 995 ? 1_555 F2  ? E BEF .   ? A BEF 995  ? 1_555 111.2 ? 
4  O3B ? F ADP .   ? A ADP 996  ? 1_555 BE ? E BEF . ? A BEF 995 ? 1_555 F3  ? E BEF .   ? A BEF 995  ? 1_555 108.5 ? 
5  F1  ? E BEF .   ? A BEF 995  ? 1_555 BE ? E BEF . ? A BEF 995 ? 1_555 F3  ? E BEF .   ? A BEF 995  ? 1_555 107.9 ? 
6  F2  ? E BEF .   ? A BEF 995  ? 1_555 BE ? E BEF . ? A BEF 995 ? 1_555 F3  ? E BEF .   ? A BEF 995  ? 1_555 111.2 ? 
7  F3  ? E BEF .   ? A BEF 995  ? 1_555 MG ? D MG  . ? A MG  997 ? 1_555 OG  ? A SER 241 ? A SER 241  ? 1_555 107.1 ? 
8  F3  ? E BEF .   ? A BEF 995  ? 1_555 MG ? D MG  . ? A MG  997 ? 1_555 O   ? J HOH .   ? A HOH 1041 ? 1_555 110.3 ? 
9  OG  ? A SER 241 ? A SER 241  ? 1_555 MG ? D MG  . ? A MG  997 ? 1_555 O   ? J HOH .   ? A HOH 1041 ? 1_555 96.2  ? 
10 F3  ? E BEF .   ? A BEF 995  ? 1_555 MG ? D MG  . ? A MG  997 ? 1_555 O2B ? F ADP .   ? A ADP 996  ? 1_555 83.5  ? 
11 OG  ? A SER 241 ? A SER 241  ? 1_555 MG ? D MG  . ? A MG  997 ? 1_555 O2B ? F ADP .   ? A ADP 996  ? 1_555 165.6 ? 
12 O   ? J HOH .   ? A HOH 1041 ? 1_555 MG ? D MG  . ? A MG  997 ? 1_555 O2B ? F ADP .   ? A ADP 996  ? 1_555 88.9  ? 
13 F3  ? E BEF .   ? A BEF 995  ? 1_555 MG ? D MG  . ? A MG  997 ? 1_555 O   ? J HOH .   ? A HOH 1042 ? 1_555 81.2  ? 
14 OG  ? A SER 241 ? A SER 241  ? 1_555 MG ? D MG  . ? A MG  997 ? 1_555 O   ? J HOH .   ? A HOH 1042 ? 1_555 89.7  ? 
15 O   ? J HOH .   ? A HOH 1041 ? 1_555 MG ? D MG  . ? A MG  997 ? 1_555 O   ? J HOH .   ? A HOH 1042 ? 1_555 164.6 ? 
16 O2B ? F ADP .   ? A ADP 996  ? 1_555 MG ? D MG  . ? A MG  997 ? 1_555 O   ? J HOH .   ? A HOH 1042 ? 1_555 82.2  ? 
17 F3  ? E BEF .   ? A BEF 995  ? 1_555 MG ? D MG  . ? A MG  997 ? 1_555 OG1 ? A THR 183 ? A THR 183  ? 1_555 156.0 ? 
18 OG  ? A SER 241 ? A SER 241  ? 1_555 MG ? D MG  . ? A MG  997 ? 1_555 OG1 ? A THR 183 ? A THR 183  ? 1_555 80.4  ? 
19 O   ? J HOH .   ? A HOH 1041 ? 1_555 MG ? D MG  . ? A MG  997 ? 1_555 OG1 ? A THR 183 ? A THR 183  ? 1_555 91.0  ? 
20 O2B ? F ADP .   ? A ADP 996  ? 1_555 MG ? D MG  . ? A MG  997 ? 1_555 OG1 ? A THR 183 ? A THR 183  ? 1_555 86.1  ? 
21 O   ? J HOH .   ? A HOH 1042 ? 1_555 MG ? D MG  . ? A MG  997 ? 1_555 OG1 ? A THR 183 ? A THR 183  ? 1_555 75.9  ? 
22 OD1 ? B ASP 20  ? B ASP 32   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 O   ? B PHE 22  ? B PHE 34   ? 1_555 95.8  ? 
23 OD1 ? B ASP 20  ? B ASP 32   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD1 ? B ASP 27  ? B ASP 39   ? 1_555 140.6 ? 
24 O   ? B PHE 22  ? B PHE 34   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD1 ? B ASP 27  ? B ASP 39   ? 1_555 120.0 ? 
25 OD1 ? B ASP 20  ? B ASP 32   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD2 ? B ASP 27  ? B ASP 39   ? 1_555 164.0 ? 
26 O   ? B PHE 22  ? B PHE 34   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD2 ? B ASP 27  ? B ASP 39   ? 1_555 86.4  ? 
27 OD1 ? B ASP 27  ? B ASP 39   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD2 ? B ASP 27  ? B ASP 39   ? 1_555 46.0  ? 
28 OD1 ? B ASP 20  ? B ASP 32   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD2 ? B ASP 18  ? B ASP 30   ? 1_555 95.2  ? 
29 O   ? B PHE 22  ? B PHE 34   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD2 ? B ASP 18  ? B ASP 30   ? 1_555 150.8 ? 
30 OD1 ? B ASP 27  ? B ASP 39   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD2 ? B ASP 18  ? B ASP 30   ? 1_555 62.0  ? 
31 OD2 ? B ASP 27  ? B ASP 39   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD2 ? B ASP 18  ? B ASP 30   ? 1_555 76.0  ? 
32 OD1 ? B ASP 20  ? B ASP 32   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD1 ? B ASP 18  ? B ASP 30   ? 1_555 59.3  ? 
33 O   ? B PHE 22  ? B PHE 34   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD1 ? B ASP 18  ? B ASP 30   ? 1_555 155.2 ? 
34 OD1 ? B ASP 27  ? B ASP 39   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD1 ? B ASP 18  ? B ASP 30   ? 1_555 83.9  ? 
35 OD2 ? B ASP 27  ? B ASP 39   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD1 ? B ASP 18  ? B ASP 30   ? 1_555 117.5 ? 
36 OD2 ? B ASP 18  ? B ASP 30   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD1 ? B ASP 18  ? B ASP 30   ? 1_555 44.5  ? 
37 OD1 ? B ASP 20  ? B ASP 32   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD1 ? B ASP 16  ? B ASP 28   ? 1_555 79.9  ? 
38 O   ? B PHE 22  ? B PHE 34   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD1 ? B ASP 16  ? B ASP 28   ? 1_555 93.0  ? 
39 OD1 ? B ASP 27  ? B ASP 39   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD1 ? B ASP 16  ? B ASP 28   ? 1_555 82.2  ? 
40 OD2 ? B ASP 27  ? B ASP 39   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD1 ? B ASP 16  ? B ASP 28   ? 1_555 115.8 ? 
41 OD2 ? B ASP 18  ? B ASP 30   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD1 ? B ASP 16  ? B ASP 28   ? 1_555 115.5 ? 
42 OD1 ? B ASP 18  ? B ASP 30   ? 1_555 MG ? H MG  . ? B MG  998 ? 1_555 OD1 ? B ASP 16  ? B ASP 28   ? 1_555 82.7  ? 
43 O   ? L HOH .   ? C HOH 1001 ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 O   ? C ASP 19  ? C ASP 19   ? 1_555 148.3 ? 
44 O   ? L HOH .   ? C HOH 1001 ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 OD1 ? C ASP 22  ? C ASP 22   ? 1_555 77.5  ? 
45 O   ? C ASP 19  ? C ASP 19   ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 OD1 ? C ASP 22  ? C ASP 22   ? 1_555 86.4  ? 
46 O   ? L HOH .   ? C HOH 1001 ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 OD2 ? C ASP 25  ? C ASP 25   ? 1_555 70.2  ? 
47 O   ? C ASP 19  ? C ASP 19   ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 OD2 ? C ASP 25  ? C ASP 25   ? 1_555 124.0 ? 
48 OD1 ? C ASP 22  ? C ASP 22   ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 OD2 ? C ASP 25  ? C ASP 25   ? 1_555 147.4 ? 
49 O   ? L HOH .   ? C HOH 1001 ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 O   ? C GLY 23  ? C GLY 23   ? 1_555 85.6  ? 
50 O   ? C ASP 19  ? C ASP 19   ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 O   ? C GLY 23  ? C GLY 23   ? 1_555 70.8  ? 
51 OD1 ? C ASP 22  ? C ASP 22   ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 O   ? C GLY 23  ? C GLY 23   ? 1_555 101.3 ? 
52 OD2 ? C ASP 25  ? C ASP 25   ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 O   ? C GLY 23  ? C GLY 23   ? 1_555 81.0  ? 
53 O   ? L HOH .   ? C HOH 1001 ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 OD1 ? C ASP 19  ? C ASP 19   ? 1_555 141.6 ? 
54 O   ? C ASP 19  ? C ASP 19   ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 OD1 ? C ASP 19  ? C ASP 19   ? 1_555 64.6  ? 
55 OD1 ? C ASP 22  ? C ASP 22   ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 OD1 ? C ASP 19  ? C ASP 19   ? 1_555 138.2 ? 
56 OD2 ? C ASP 25  ? C ASP 25   ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 OD1 ? C ASP 19  ? C ASP 19   ? 1_555 72.4  ? 
57 O   ? C GLY 23  ? C GLY 23   ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 OD1 ? C ASP 19  ? C ASP 19   ? 1_555 96.9  ? 
58 O   ? L HOH .   ? C HOH 1001 ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 O   ? C ALA 27  ? C ALA 27   ? 1_555 99.8  ? 
59 O   ? C ASP 19  ? C ASP 19   ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 O   ? C ALA 27  ? C ALA 27   ? 1_555 110.1 ? 
60 OD1 ? C ASP 22  ? C ASP 22   ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 O   ? C ALA 27  ? C ALA 27   ? 1_555 101.4 ? 
61 OD2 ? C ASP 25  ? C ASP 25   ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 O   ? C ALA 27  ? C ALA 27   ? 1_555 80.3  ? 
62 O   ? C GLY 23  ? C GLY 23   ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 O   ? C ALA 27  ? C ALA 27   ? 1_555 157.3 ? 
63 OD1 ? C ASP 19  ? C ASP 19   ? 1_555 CA ? I CA  . ? C CA  999 ? 1_555 O   ? C ALA 27  ? C ALA 27   ? 1_555 65.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-10-09 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2016-06-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Source and taxonomy'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
CNS       refinement       0.9 ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A SER 546 ? ? O A HOH 1118 ? ? 1.93 
2 1 OH  A TYR 661 ? ? O A HOH 1074 ? ? 1.95 
3 1 O   A ILE 137 ? ? O A HOH 1104 ? ? 1.96 
4 1 OD2 A ASP 460 ? ? O A HOH 1012 ? ? 2.09 
5 1 OE2 B GLU 107 ? ? O B HOH 1000 ? ? 2.13 
6 1 O   A LYS 52  ? ? O A HOH 1053 ? ? 2.15 
7 1 N   A ARG 141 ? ? O A HOH 1104 ? ? 2.18 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N  A LYS 19  ? ? CA A LYS 19  ? ? C  A LYS 19  ? ? 90.38  111.00 -20.62 2.70 N 
2 1 N  A MET 21  ? ? CA A MET 21  ? ? C  A MET 21  ? ? 93.47  111.00 -17.53 2.70 N 
3 1 CA A LEU 173 ? ? CB A LEU 173 ? ? CG A LEU 173 ? ? 130.23 115.30 14.93  2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 4   ? ? -173.78 139.19  
2  1 PHE A 5   ? ? -99.83  -136.97 
3  1 SER A 6   ? ? -86.47  33.41   
4  1 ARG A 17  ? ? -45.92  52.20   
5  1 LYS A 18  ? ? -176.38 41.54   
6  1 LYS A 19  ? ? -164.42 9.14    
7  1 LEU A 20  ? ? -175.59 60.77   
8  1 MET A 21  ? ? -154.24 -12.04  
9  1 ALA A 26  ? ? -170.19 143.71  
10 1 GLU A 41  ? ? -140.36 13.94   
11 1 LEU A 94  ? ? -116.45 67.19   
12 1 SER A 116 ? ? -166.09 80.26   
13 1 GLU A 147 ? ? -99.20  34.39   
14 1 ILE A 148 ? ? -178.30 144.31  
15 1 ASN A 291 ? ? 70.02   31.34   
16 1 PRO A 304 ? ? -61.96  64.91   
17 1 MET A 361 ? ? -59.02  102.22  
18 1 THR A 377 ? ? -144.93 -8.96   
19 1 ALA A 397 ? ? -59.45  -3.01   
20 1 LYS A 400 ? ? -150.44 87.48   
21 1 VAL A 403 ? ? -86.73  -155.42 
22 1 LYS A 449 ? ? -85.08  37.90   
23 1 ASN A 453 ? ? -123.87 -58.07  
24 1 SER A 471 ? ? -134.40 -157.77 
25 1 ILE A 510 ? ? -122.64 -169.49 
26 1 ASP A 511 ? ? -168.75 92.73   
27 1 PRO A 526 ? ? -63.87  8.97    
28 1 MET A 527 ? ? -142.50 10.10   
29 1 PRO A 601 ? ? -87.63  34.03   
30 1 ASN A 603 ? ? -48.08  109.45  
31 1 CYS A 693 ? ? -151.90 69.70   
32 1 ASN A 694 ? ? -150.11 18.19   
33 1 LEU A 697 ? ? -57.04  15.81   
34 1 TYR A 713 ? ? -27.61  -44.34  
35 1 ALA A 724 ? ? -160.14 62.93   
36 1 GLN B 14  ? ? -127.15 -57.65  
37 1 ASP B 30  ? ? -64.97  1.31    
38 1 ARG B 31  ? ? 44.47   86.62   
39 1 ASP B 32  ? ? -148.37 -1.09   
40 1 ARG B 49  ? ? 77.54   58.69   
41 1 ASP B 53  ? ? -48.98  -19.32  
42 1 PRO B 64  ? ? -60.55  77.62   
43 1 PRO B 66  ? ? -39.74  136.59  
44 1 ASP C 25  ? ? -161.20 24.10   
45 1 ASN C 43  ? ? -118.95 69.80   
46 1 GLU C 60  ? ? -157.78 -57.12  
47 1 ASP C 134 ? ? -66.62  -167.67 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A MET 1   ? CG  ? A MET 1   CG  
2   1 Y 1 A MET 1   ? SD  ? A MET 1   SD  
3   1 Y 1 A MET 1   ? CE  ? A MET 1   CE  
4   1 Y 1 A ASN 2   ? CG  ? A ASN 2   CG  
5   1 Y 1 A ASN 2   ? OD1 ? A ASN 2   OD1 
6   1 Y 1 A ASN 2   ? ND2 ? A ASN 2   ND2 
7   1 Y 1 A ASP 4   ? CG  ? A ASP 4   CG  
8   1 Y 1 A ASP 4   ? OD1 ? A ASP 4   OD1 
9   1 Y 1 A ASP 4   ? OD2 ? A ASP 4   OD2 
10  1 Y 1 A LYS 18  ? CG  ? A LYS 18  CG  
11  1 Y 1 A LYS 18  ? CD  ? A LYS 18  CD  
12  1 Y 1 A LYS 18  ? CE  ? A LYS 18  CE  
13  1 Y 1 A LYS 18  ? NZ  ? A LYS 18  NZ  
14  1 Y 1 A LEU 20  ? CG  ? A LEU 20  CG  
15  1 Y 1 A LEU 20  ? CD1 ? A LEU 20  CD1 
16  1 Y 1 A LEU 20  ? CD2 ? A LEU 20  CD2 
17  1 Y 1 A MET 21  ? CG  ? A MET 21  CG  
18  1 Y 1 A MET 21  ? SD  ? A MET 21  SD  
19  1 Y 1 A MET 21  ? CE  ? A MET 21  CE  
20  1 Y 1 A LYS 22  ? CG  ? A LYS 22  CG  
21  1 Y 1 A LYS 22  ? CD  ? A LYS 22  CD  
22  1 Y 1 A LYS 22  ? CE  ? A LYS 22  CE  
23  1 Y 1 A LYS 22  ? NZ  ? A LYS 22  NZ  
24  1 Y 1 A THR 25  ? OG1 ? A THR 25  OG1 
25  1 Y 1 A THR 25  ? CG2 ? A THR 25  CG2 
26  1 Y 1 A VAL 200 ? CG1 ? A VAL 200 CG1 
27  1 Y 1 A VAL 200 ? CG2 ? A VAL 200 CG2 
28  1 Y 1 A LYS 210 ? CG  ? A LYS 210 CG  
29  1 Y 1 A LYS 210 ? CD  ? A LYS 210 CD  
30  1 Y 1 A LYS 210 ? CE  ? A LYS 210 CE  
31  1 Y 1 A LYS 210 ? NZ  ? A LYS 210 NZ  
32  1 Y 1 A GLU 295 ? CG  ? A GLU 295 CG  
33  1 Y 1 A GLU 295 ? CD  ? A GLU 295 CD  
34  1 Y 1 A GLU 295 ? OE1 ? A GLU 295 OE1 
35  1 Y 1 A GLU 295 ? OE2 ? A GLU 295 OE2 
36  1 Y 1 A LYS 364 ? CG  ? A LYS 364 CG  
37  1 Y 1 A LYS 364 ? CD  ? A LYS 364 CD  
38  1 Y 1 A LYS 364 ? CE  ? A LYS 364 CE  
39  1 Y 1 A LYS 364 ? NZ  ? A LYS 364 NZ  
40  1 Y 1 A GLU 370 ? CG  ? A GLU 370 CG  
41  1 Y 1 A GLU 370 ? CD  ? A GLU 370 CD  
42  1 Y 1 A GLU 370 ? OE1 ? A GLU 370 OE1 
43  1 Y 1 A GLU 370 ? OE2 ? A GLU 370 OE2 
44  1 Y 1 A LYS 396 ? CG  ? A LYS 396 CG  
45  1 Y 1 A LYS 396 ? CD  ? A LYS 396 CD  
46  1 Y 1 A LYS 396 ? CE  ? A LYS 396 CE  
47  1 Y 1 A LYS 396 ? NZ  ? A LYS 396 NZ  
48  1 Y 1 A LYS 402 ? CG  ? A LYS 402 CG  
49  1 Y 1 A LYS 402 ? CD  ? A LYS 402 CD  
50  1 Y 1 A LYS 402 ? CE  ? A LYS 402 CE  
51  1 Y 1 A LYS 402 ? NZ  ? A LYS 402 NZ  
52  1 Y 1 A LYS 412 ? CG  ? A LYS 412 CG  
53  1 Y 1 A LYS 412 ? CD  ? A LYS 412 CD  
54  1 Y 1 A LYS 412 ? CE  ? A LYS 412 CE  
55  1 Y 1 A LYS 412 ? NZ  ? A LYS 412 NZ  
56  1 Y 1 A GLU 465 ? CG  ? A GLU 465 CG  
57  1 Y 1 A GLU 465 ? CD  ? A GLU 465 CD  
58  1 Y 1 A GLU 465 ? OE1 ? A GLU 465 OE1 
59  1 Y 1 A GLU 465 ? OE2 ? A GLU 465 OE2 
60  1 Y 1 A GLU 508 ? CG  ? A GLU 508 CG  
61  1 Y 1 A GLU 508 ? CD  ? A GLU 508 CD  
62  1 Y 1 A GLU 508 ? OE1 ? A GLU 508 OE1 
63  1 Y 1 A GLU 508 ? OE2 ? A GLU 508 OE2 
64  1 Y 1 A PHE 509 ? CG  ? A PHE 509 CG  
65  1 Y 1 A PHE 509 ? CD1 ? A PHE 509 CD1 
66  1 Y 1 A PHE 509 ? CD2 ? A PHE 509 CD2 
67  1 Y 1 A PHE 509 ? CE1 ? A PHE 509 CE1 
68  1 Y 1 A PHE 509 ? CE2 ? A PHE 509 CE2 
69  1 Y 1 A PHE 509 ? CZ  ? A PHE 509 CZ  
70  1 Y 1 A ASP 511 ? CG  ? A ASP 511 CG  
71  1 Y 1 A ASP 511 ? OD1 ? A ASP 511 OD1 
72  1 Y 1 A ASP 511 ? OD2 ? A ASP 511 OD2 
73  1 Y 1 A GLU 535 ? CG  ? A GLU 535 CG  
74  1 Y 1 A GLU 535 ? CD  ? A GLU 535 CD  
75  1 Y 1 A GLU 535 ? OE1 ? A GLU 535 OE1 
76  1 Y 1 A GLU 535 ? OE2 ? A GLU 535 OE2 
77  1 Y 1 A LYS 541 ? CG  ? A LYS 541 CG  
78  1 Y 1 A LYS 541 ? CD  ? A LYS 541 CD  
79  1 Y 1 A LYS 541 ? CE  ? A LYS 541 CE  
80  1 Y 1 A LYS 541 ? NZ  ? A LYS 541 NZ  
81  1 Y 0 A LYS 550 ? CD  ? A LYS 550 CD  
82  1 Y 0 A LYS 550 ? CE  ? A LYS 550 CE  
83  1 Y 0 A LYS 550 ? NZ  ? A LYS 550 NZ  
84  1 Y 1 A LYS 564 ? CG  ? A LYS 564 CG  
85  1 Y 1 A LYS 564 ? CD  ? A LYS 564 CD  
86  1 Y 1 A LYS 564 ? CE  ? A LYS 564 CE  
87  1 Y 1 A LYS 564 ? NZ  ? A LYS 564 NZ  
88  1 Y 1 A LYS 567 ? CG  ? A LYS 567 CG  
89  1 Y 1 A LYS 567 ? CD  ? A LYS 567 CD  
90  1 Y 1 A LYS 567 ? CE  ? A LYS 567 CE  
91  1 Y 1 A LYS 567 ? NZ  ? A LYS 567 NZ  
92  1 Y 1 A THR 569 ? OG1 ? A THR 569 OG1 
93  1 Y 1 A THR 569 ? CG2 ? A THR 569 CG2 
94  1 Y 1 A ARG 570 ? CG  ? A ARG 570 CG  
95  1 Y 1 A ARG 570 ? CD  ? A ARG 570 CD  
96  1 Y 1 A ARG 570 ? NE  ? A ARG 570 NE  
97  1 Y 1 A ARG 570 ? CZ  ? A ARG 570 CZ  
98  1 Y 1 A ARG 570 ? NH1 ? A ARG 570 NH1 
99  1 Y 1 A ARG 570 ? NH2 ? A ARG 570 NH2 
100 1 Y 1 A ASN 572 ? CG  ? A ASN 572 CG  
101 1 Y 1 A ASN 572 ? OD1 ? A ASN 572 OD1 
102 1 Y 1 A ASN 572 ? ND2 ? A ASN 572 ND2 
103 1 Y 1 A GLU 604 ? CG  ? A GLU 604 CG  
104 1 Y 1 A GLU 604 ? CD  ? A GLU 604 CD  
105 1 Y 1 A GLU 604 ? OE1 ? A GLU 604 OE1 
106 1 Y 1 A GLU 604 ? OE2 ? A GLU 604 OE2 
107 1 Y 1 A LYS 658 ? CG  ? A LYS 658 CG  
108 1 Y 1 A LYS 658 ? CD  ? A LYS 658 CD  
109 1 Y 1 A LYS 658 ? CE  ? A LYS 658 CE  
110 1 Y 1 A LYS 658 ? NZ  ? A LYS 658 NZ  
111 1 Y 1 A VAL 696 ? CG1 ? A VAL 696 CG1 
112 1 Y 1 A VAL 696 ? CG2 ? A VAL 696 CG2 
113 1 Y 1 A LEU 697 ? CG  ? A LEU 697 CG  
114 1 Y 1 A LEU 697 ? CD1 ? A LEU 697 CD1 
115 1 Y 1 A LEU 697 ? CD2 ? A LEU 697 CD2 
116 1 Y 1 A GLU 698 ? CG  ? A GLU 698 CG  
117 1 Y 1 A GLU 698 ? CD  ? A GLU 698 CD  
118 1 Y 1 A GLU 698 ? OE1 ? A GLU 698 OE1 
119 1 Y 1 A GLU 698 ? OE2 ? A GLU 698 OE2 
120 1 Y 1 A ARG 704 ? CG  ? A ARG 704 CG  
121 1 Y 1 A ARG 704 ? CD  ? A ARG 704 CD  
122 1 Y 1 A ARG 704 ? NE  ? A ARG 704 NE  
123 1 Y 1 A ARG 704 ? CZ  ? A ARG 704 CZ  
124 1 Y 1 A ARG 704 ? NH1 ? A ARG 704 NH1 
125 1 Y 1 A ARG 704 ? NH2 ? A ARG 704 NH2 
126 1 Y 1 A GLU 715 ? CG  ? A GLU 715 CG  
127 1 Y 1 A GLU 715 ? CD  ? A GLU 715 CD  
128 1 Y 1 A GLU 715 ? OE1 ? A GLU 715 OE1 
129 1 Y 1 A GLU 715 ? OE2 ? A GLU 715 OE2 
130 1 Y 1 A LYS 717 ? CG  ? A LYS 717 CG  
131 1 Y 1 A LYS 717 ? CD  ? A LYS 717 CD  
132 1 Y 1 A LYS 717 ? CE  ? A LYS 717 CE  
133 1 Y 1 A LYS 717 ? NZ  ? A LYS 717 NZ  
134 1 Y 1 A LYS 741 ? CG  ? A LYS 741 CG  
135 1 Y 1 A LYS 741 ? CD  ? A LYS 741 CD  
136 1 Y 1 A LYS 741 ? CE  ? A LYS 741 CE  
137 1 Y 1 A LYS 741 ? NZ  ? A LYS 741 NZ  
138 1 Y 1 A GLU 752 ? CG  ? A GLU 752 CG  
139 1 Y 1 A GLU 752 ? CD  ? A GLU 752 CD  
140 1 Y 1 A GLU 752 ? OE1 ? A GLU 752 OE1 
141 1 Y 1 A GLU 752 ? OE2 ? A GLU 752 OE2 
142 1 Y 1 A LYS 834 ? CG  ? A LYS 834 CG  
143 1 Y 1 A LYS 834 ? CD  ? A LYS 834 CD  
144 1 Y 1 A LYS 834 ? CE  ? A LYS 834 CE  
145 1 Y 1 A LYS 834 ? NZ  ? A LYS 834 NZ  
146 1 Y 1 A LEU 837 ? CG  ? A LEU 837 CG  
147 1 Y 1 A LEU 837 ? CD1 ? A LEU 837 CD1 
148 1 Y 1 A LEU 837 ? CD2 ? A LEU 837 CD2 
149 1 Y 1 B GLN 16  ? CG  ? B GLN 4   CG  
150 1 Y 1 B GLN 16  ? CD  ? B GLN 4   CD  
151 1 Y 1 B GLN 16  ? OE1 ? B GLN 4   OE1 
152 1 Y 1 B GLN 16  ? NE2 ? B GLN 4   NE2 
153 1 Y 1 B GLU 19  ? CG  ? B GLU 7   CG  
154 1 Y 1 B GLU 19  ? CD  ? B GLU 7   CD  
155 1 Y 1 B GLU 19  ? OE1 ? B GLU 7   OE1 
156 1 Y 1 B GLU 19  ? OE2 ? B GLU 7   OE2 
157 1 Y 1 B LYS 21  ? CG  ? B LYS 9   CG  
158 1 Y 1 B LYS 21  ? CD  ? B LYS 9   CD  
159 1 Y 1 B LYS 21  ? CE  ? B LYS 9   CE  
160 1 Y 1 B LYS 21  ? NZ  ? B LYS 9   NZ  
161 1 Y 1 B GLU 22  ? CG  ? B GLU 10  CG  
162 1 Y 1 B GLU 22  ? CD  ? B GLU 10  CD  
163 1 Y 1 B GLU 22  ? OE1 ? B GLU 10  OE1 
164 1 Y 1 B GLU 22  ? OE2 ? B GLU 10  OE2 
165 1 Y 1 B ARG 31  ? CG  ? B ARG 19  CG  
166 1 Y 1 B ARG 31  ? CD  ? B ARG 19  CD  
167 1 Y 1 B ARG 31  ? NE  ? B ARG 19  NE  
168 1 Y 1 B ARG 31  ? CZ  ? B ARG 19  CZ  
169 1 Y 1 B ARG 31  ? NH1 ? B ARG 19  NH1 
170 1 Y 1 B ARG 31  ? NH2 ? B ARG 19  NH2 
171 1 Y 1 B GLU 45  ? CG  ? B GLU 33  CG  
172 1 Y 1 B GLU 45  ? CD  ? B GLU 33  CD  
173 1 Y 1 B GLU 45  ? OE1 ? B GLU 33  OE1 
174 1 Y 1 B GLU 45  ? OE2 ? B GLU 33  OE2 
175 1 Y 1 B ARG 49  ? CG  ? B ARG 37  CG  
176 1 Y 1 B ARG 49  ? CD  ? B ARG 37  CD  
177 1 Y 1 B ARG 49  ? NE  ? B ARG 37  NE  
178 1 Y 1 B ARG 49  ? CZ  ? B ARG 37  CZ  
179 1 Y 1 B ARG 49  ? NH1 ? B ARG 37  NH1 
180 1 Y 1 B ARG 49  ? NH2 ? B ARG 37  NH2 
181 1 Y 1 B ASP 52  ? CG  ? B ASP 40  CG  
182 1 Y 1 B ASP 52  ? OD1 ? B ASP 40  OD1 
183 1 Y 1 B ASP 52  ? OD2 ? B ASP 40  OD2 
184 1 Y 1 B ASP 53  ? CG  ? B ASP 41  CG  
185 1 Y 1 B ASP 53  ? OD1 ? B ASP 41  OD1 
186 1 Y 1 B ASP 53  ? OD2 ? B ASP 41  OD2 
187 1 Y 1 B LYS 54  ? CG  ? B LYS 42  CG  
188 1 Y 1 B LYS 54  ? CD  ? B LYS 42  CD  
189 1 Y 1 B LYS 54  ? CE  ? B LYS 42  CE  
190 1 Y 1 B LYS 54  ? NZ  ? B LYS 42  NZ  
191 1 Y 1 B LYS 122 ? CG  ? B LYS 110 CG  
192 1 Y 1 B LYS 122 ? CD  ? B LYS 110 CD  
193 1 Y 1 B LYS 122 ? CE  ? B LYS 110 CE  
194 1 Y 1 B LYS 122 ? NZ  ? B LYS 110 NZ  
195 1 Y 1 B GLU 131 ? CG  ? B GLU 119 CG  
196 1 Y 1 B GLU 131 ? CD  ? B GLU 119 CD  
197 1 Y 1 B GLU 131 ? OE1 ? B GLU 119 OE1 
198 1 Y 1 B GLU 131 ? OE2 ? B GLU 119 OE2 
199 1 Y 1 C PRO 1   ? CG  ? C PRO 1   CG  
200 1 Y 1 C PRO 1   ? CD  ? C PRO 1   CD  
201 1 Y 1 C ASP 6   ? CG  ? C ASP 6   CG  
202 1 Y 1 C ASP 6   ? OD1 ? C ASP 6   OD1 
203 1 Y 1 C ASP 6   ? OD2 ? C ASP 6   OD2 
204 1 Y 1 C ASP 13  ? CG  ? C ASP 13  CG  
205 1 Y 1 C ASP 13  ? OD1 ? C ASP 13  OD1 
206 1 Y 1 C ASP 13  ? OD2 ? C ASP 13  OD2 
207 1 Y 1 C GLU 16  ? CG  ? C GLU 16  CG  
208 1 Y 1 C GLU 16  ? CD  ? C GLU 16  CD  
209 1 Y 1 C GLU 16  ? OE1 ? C GLU 16  OE1 
210 1 Y 1 C GLU 16  ? OE2 ? C GLU 16  OE2 
211 1 Y 1 C GLU 66  ? CG  ? C GLU 66  CG  
212 1 Y 1 C GLU 66  ? CD  ? C GLU 66  CD  
213 1 Y 1 C GLU 66  ? OE1 ? C GLU 66  OE1 
214 1 Y 1 C GLU 66  ? OE2 ? C GLU 66  OE2 
215 1 Y 1 C ASP 77  ? CG  ? C ASP 77  CG  
216 1 Y 1 C ASP 77  ? OD1 ? C ASP 77  OD1 
217 1 Y 1 C ASP 77  ? OD2 ? C ASP 77  OD2 
218 1 Y 1 C GLN 80  ? CG  ? C GLN 80  CG  
219 1 Y 1 C GLN 80  ? CD  ? C GLN 80  CD  
220 1 Y 1 C GLN 80  ? OE1 ? C GLN 80  OE1 
221 1 Y 1 C GLN 80  ? NE2 ? C GLN 80  NE2 
222 1 Y 1 C GLU 120 ? CG  ? C GLU 120 CG  
223 1 Y 1 C GLU 120 ? CD  ? C GLU 120 CD  
224 1 Y 1 C GLU 120 ? OE1 ? C GLU 120 OE1 
225 1 Y 1 C GLU 120 ? OE2 ? C GLU 120 OE2 
226 1 Y 0 C GLU 124 ? CD  ? C GLU 124 CD  
227 1 Y 0 C GLU 124 ? OE1 ? C GLU 124 OE1 
228 1 Y 0 C GLU 124 ? OE2 ? C GLU 124 OE2 
229 1 Y 1 C LYS 127 ? CG  ? C LYS 127 CG  
230 1 Y 1 C LYS 127 ? CD  ? C LYS 127 CD  
231 1 Y 1 C LYS 127 ? CE  ? C LYS 127 CE  
232 1 Y 1 C LYS 127 ? NZ  ? C LYS 127 NZ  
233 1 Y 1 C ASP 130 ? CG  ? C ASP 130 CG  
234 1 Y 1 C ASP 130 ? OD1 ? C ASP 130 OD1 
235 1 Y 1 C ASP 130 ? OD2 ? C ASP 130 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 23  ? A GLU 23  
2  1 Y 1 A GLN 24  ? A GLN 24  
3  1 Y 1 A LYS 202 ? A LYS 202 
4  1 Y 1 A LYS 203 ? A LYS 203 
5  1 Y 1 A ASP 204 ? A ASP 204 
6  1 Y 1 A GLU 205 ? A GLU 205 
7  1 Y 1 A GLU 206 ? A GLU 206 
8  1 Y 1 A ALA 207 ? A ALA 207 
9  1 Y 1 A SER 208 ? A SER 208 
10 1 Y 1 A ASP 209 ? A ASP 209 
11 1 Y 1 A ARG 366 ? A ARG 366 
12 1 Y 1 A PRO 367 ? A PRO 367 
13 1 Y 1 A ARG 368 ? A ARG 368 
14 1 Y 1 A GLU 369 ? A GLU 369 
15 1 Y 1 A VAL 405 ? A VAL 405 
16 1 Y 1 A GLY 406 ? A GLY 406 
17 1 Y 1 A THR 407 ? A THR 407 
18 1 Y 1 A GLU 408 ? A GLU 408 
19 1 Y 1 A PRO 625 ? A PRO 625 
20 1 Y 1 A GLU 626 ? A GLU 626 
21 1 Y 1 A GLU 627 ? A GLU 627 
22 1 Y 1 A PRO 628 ? A PRO 628 
23 1 Y 1 A ALA 629 ? A ALA 629 
24 1 Y 1 A GLY 630 ? A GLY 630 
25 1 Y 1 A GLY 631 ? A GLY 631 
26 1 Y 1 A GLY 632 ? A GLY 632 
27 1 Y 1 A LYS 633 ? A LYS 633 
28 1 Y 1 A LYS 634 ? A LYS 634 
29 1 Y 1 A LYS 635 ? A LYS 635 
30 1 Y 1 A LYS 636 ? A LYS 636 
31 1 Y 1 A GLY 637 ? A GLY 637 
32 1 Y 1 A LYS 638 ? A LYS 638 
33 1 Y 1 A SER 639 ? A SER 639 
34 1 Y 1 A SER 640 ? A SER 640 
35 1 Y 1 A ALA 641 ? A ALA 641 
36 1 Y 1 A PHE 642 ? A PHE 642 
37 1 Y 1 A GLY 699 ? A GLY 699 
38 1 Y 1 A ILE 700 ? A ILE 700 
39 1 Y 1 A ARG 701 ? A ARG 701 
40 1 Y 1 A ILE 702 ? A ILE 702 
41 1 Y 1 A CYS 703 ? A CYS 703 
42 1 Y 1 A GLY 731 ? A GLY 731 
43 1 Y 1 A PHE 732 ? A PHE 732 
44 1 Y 1 A VAL 733 ? A VAL 733 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION'             MG  
5 'BERYLLIUM TRIFLUORIDE ION' BEF 
6 "ADENOSINE-5'-DIPHOSPHATE"  ADP 
7 GLYCEROL                    GOL 
8 'CALCIUM ION'               CA  
9 water                       HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1   997  997 MG  MG  A . 
E 5 BEF 1   995  995 BEF BEF A . 
F 6 ADP 1   996  996 ADP ADP A . 
G 7 GOL 1   998  529 GOL GOL A . 
H 4 MG  1   998  998 MG  MG  B . 
I 8 CA  1   999  999 CA  CA  C . 
J 9 HOH 1   999  1   HOH HOH A . 
J 9 HOH 2   1000 3   HOH HOH A . 
J 9 HOH 3   1001 4   HOH HOH A . 
J 9 HOH 4   1002 5   HOH HOH A . 
J 9 HOH 5   1003 6   HOH HOH A . 
J 9 HOH 6   1004 7   HOH HOH A . 
J 9 HOH 7   1005 8   HOH HOH A . 
J 9 HOH 8   1006 9   HOH HOH A . 
J 9 HOH 9   1007 10  HOH HOH A . 
J 9 HOH 10  1008 11  HOH HOH A . 
J 9 HOH 11  1009 12  HOH HOH A . 
J 9 HOH 12  1010 13  HOH HOH A . 
J 9 HOH 13  1011 14  HOH HOH A . 
J 9 HOH 14  1012 15  HOH HOH A . 
J 9 HOH 15  1013 16  HOH HOH A . 
J 9 HOH 16  1014 17  HOH HOH A . 
J 9 HOH 17  1015 18  HOH HOH A . 
J 9 HOH 18  1016 19  HOH HOH A . 
J 9 HOH 19  1017 20  HOH HOH A . 
J 9 HOH 20  1018 22  HOH HOH A . 
J 9 HOH 21  1019 23  HOH HOH A . 
J 9 HOH 22  1020 24  HOH HOH A . 
J 9 HOH 23  1021 25  HOH HOH A . 
J 9 HOH 24  1022 26  HOH HOH A . 
J 9 HOH 25  1023 27  HOH HOH A . 
J 9 HOH 26  1024 28  HOH HOH A . 
J 9 HOH 27  1025 29  HOH HOH A . 
J 9 HOH 28  1026 30  HOH HOH A . 
J 9 HOH 29  1027 31  HOH HOH A . 
J 9 HOH 30  1028 32  HOH HOH A . 
J 9 HOH 31  1029 33  HOH HOH A . 
J 9 HOH 32  1030 43  HOH HOH A . 
J 9 HOH 33  1031 46  HOH HOH A . 
J 9 HOH 34  1032 47  HOH HOH A . 
J 9 HOH 35  1033 48  HOH HOH A . 
J 9 HOH 36  1034 50  HOH HOH A . 
J 9 HOH 37  1035 51  HOH HOH A . 
J 9 HOH 38  1036 52  HOH HOH A . 
J 9 HOH 39  1037 54  HOH HOH A . 
J 9 HOH 40  1038 56  HOH HOH A . 
J 9 HOH 41  1039 57  HOH HOH A . 
J 9 HOH 42  1040 58  HOH HOH A . 
J 9 HOH 43  1041 59  HOH HOH A . 
J 9 HOH 44  1042 60  HOH HOH A . 
J 9 HOH 45  1043 65  HOH HOH A . 
J 9 HOH 46  1044 69  HOH HOH A . 
J 9 HOH 47  1045 71  HOH HOH A . 
J 9 HOH 48  1046 73  HOH HOH A . 
J 9 HOH 49  1047 74  HOH HOH A . 
J 9 HOH 50  1048 75  HOH HOH A . 
J 9 HOH 51  1049 76  HOH HOH A . 
J 9 HOH 52  1050 77  HOH HOH A . 
J 9 HOH 53  1051 83  HOH HOH A . 
J 9 HOH 54  1052 84  HOH HOH A . 
J 9 HOH 55  1053 87  HOH HOH A . 
J 9 HOH 56  1054 88  HOH HOH A . 
J 9 HOH 57  1055 90  HOH HOH A . 
J 9 HOH 58  1056 92  HOH HOH A . 
J 9 HOH 59  1057 93  HOH HOH A . 
J 9 HOH 60  1058 95  HOH HOH A . 
J 9 HOH 61  1059 96  HOH HOH A . 
J 9 HOH 62  1060 97  HOH HOH A . 
J 9 HOH 63  1061 99  HOH HOH A . 
J 9 HOH 64  1062 101 HOH HOH A . 
J 9 HOH 65  1063 102 HOH HOH A . 
J 9 HOH 66  1064 103 HOH HOH A . 
J 9 HOH 67  1065 105 HOH HOH A . 
J 9 HOH 68  1066 106 HOH HOH A . 
J 9 HOH 69  1067 108 HOH HOH A . 
J 9 HOH 70  1068 109 HOH HOH A . 
J 9 HOH 71  1069 110 HOH HOH A . 
J 9 HOH 72  1070 111 HOH HOH A . 
J 9 HOH 73  1071 112 HOH HOH A . 
J 9 HOH 74  1072 116 HOH HOH A . 
J 9 HOH 75  1073 122 HOH HOH A . 
J 9 HOH 76  1074 123 HOH HOH A . 
J 9 HOH 77  1075 124 HOH HOH A . 
J 9 HOH 78  1076 125 HOH HOH A . 
J 9 HOH 79  1077 126 HOH HOH A . 
J 9 HOH 80  1078 130 HOH HOH A . 
J 9 HOH 81  1079 132 HOH HOH A . 
J 9 HOH 82  1080 133 HOH HOH A . 
J 9 HOH 83  1081 135 HOH HOH A . 
J 9 HOH 84  1082 137 HOH HOH A . 
J 9 HOH 85  1083 141 HOH HOH A . 
J 9 HOH 86  1084 143 HOH HOH A . 
J 9 HOH 87  1085 145 HOH HOH A . 
J 9 HOH 88  1086 146 HOH HOH A . 
J 9 HOH 89  1087 147 HOH HOH A . 
J 9 HOH 90  1088 149 HOH HOH A . 
J 9 HOH 91  1089 151 HOH HOH A . 
J 9 HOH 92  1090 152 HOH HOH A . 
J 9 HOH 93  1091 153 HOH HOH A . 
J 9 HOH 94  1092 154 HOH HOH A . 
J 9 HOH 95  1093 162 HOH HOH A . 
J 9 HOH 96  1094 165 HOH HOH A . 
J 9 HOH 97  1095 168 HOH HOH A . 
J 9 HOH 98  1096 169 HOH HOH A . 
J 9 HOH 99  1097 171 HOH HOH A . 
J 9 HOH 100 1098 172 HOH HOH A . 
J 9 HOH 101 1099 173 HOH HOH A . 
J 9 HOH 102 1100 175 HOH HOH A . 
J 9 HOH 103 1101 176 HOH HOH A . 
J 9 HOH 104 1102 177 HOH HOH A . 
J 9 HOH 105 1103 178 HOH HOH A . 
J 9 HOH 106 1104 179 HOH HOH A . 
J 9 HOH 107 1105 181 HOH HOH A . 
J 9 HOH 108 1106 182 HOH HOH A . 
J 9 HOH 109 1107 183 HOH HOH A . 
J 9 HOH 110 1108 184 HOH HOH A . 
J 9 HOH 111 1109 187 HOH HOH A . 
J 9 HOH 112 1110 193 HOH HOH A . 
J 9 HOH 113 1111 196 HOH HOH A . 
J 9 HOH 114 1112 198 HOH HOH A . 
J 9 HOH 115 1113 199 HOH HOH A . 
J 9 HOH 116 1114 200 HOH HOH A . 
J 9 HOH 117 1115 201 HOH HOH A . 
J 9 HOH 118 1116 202 HOH HOH A . 
J 9 HOH 119 1117 203 HOH HOH A . 
J 9 HOH 120 1118 208 HOH HOH A . 
J 9 HOH 121 1119 211 HOH HOH A . 
J 9 HOH 122 1120 212 HOH HOH A . 
J 9 HOH 123 1121 213 HOH HOH A . 
J 9 HOH 124 1122 215 HOH HOH A . 
J 9 HOH 125 1123 216 HOH HOH A . 
J 9 HOH 126 1124 217 HOH HOH A . 
J 9 HOH 127 1125 218 HOH HOH A . 
J 9 HOH 128 1126 219 HOH HOH A . 
J 9 HOH 129 1127 220 HOH HOH A . 
J 9 HOH 130 1128 221 HOH HOH A . 
J 9 HOH 131 1129 222 HOH HOH A . 
J 9 HOH 132 1130 223 HOH HOH A . 
J 9 HOH 133 1131 224 HOH HOH A . 
J 9 HOH 134 1132 225 HOH HOH A . 
J 9 HOH 135 1133 226 HOH HOH A . 
J 9 HOH 136 1134 227 HOH HOH A . 
J 9 HOH 137 1135 228 HOH HOH A . 
J 9 HOH 138 1136 230 HOH HOH A . 
J 9 HOH 139 1137 231 HOH HOH A . 
J 9 HOH 140 1138 233 HOH HOH A . 
J 9 HOH 141 1139 234 HOH HOH A . 
J 9 HOH 142 1140 235 HOH HOH A . 
J 9 HOH 143 1141 238 HOH HOH A . 
J 9 HOH 144 1142 239 HOH HOH A . 
J 9 HOH 145 1143 240 HOH HOH A . 
K 9 HOH 1   999  34  HOH HOH B . 
K 9 HOH 2   1000 35  HOH HOH B . 
K 9 HOH 3   1001 41  HOH HOH B . 
K 9 HOH 4   1002 44  HOH HOH B . 
K 9 HOH 5   1003 45  HOH HOH B . 
K 9 HOH 6   1004 72  HOH HOH B . 
K 9 HOH 7   1005 78  HOH HOH B . 
K 9 HOH 8   1006 79  HOH HOH B . 
K 9 HOH 9   1007 127 HOH HOH B . 
K 9 HOH 10  1008 144 HOH HOH B . 
K 9 HOH 11  1009 155 HOH HOH B . 
K 9 HOH 12  1010 174 HOH HOH B . 
K 9 HOH 13  1011 191 HOH HOH B . 
K 9 HOH 14  1012 194 HOH HOH B . 
K 9 HOH 15  1013 195 HOH HOH B . 
K 9 HOH 16  1014 204 HOH HOH B . 
K 9 HOH 17  1015 205 HOH HOH B . 
K 9 HOH 18  1016 206 HOH HOH B . 
K 9 HOH 19  1017 207 HOH HOH B . 
K 9 HOH 20  1018 229 HOH HOH B . 
L 9 HOH 1   1000 2   HOH HOH C . 
L 9 HOH 2   1001 21  HOH HOH C . 
L 9 HOH 3   1002 36  HOH HOH C . 
L 9 HOH 4   1003 37  HOH HOH C . 
L 9 HOH 5   1004 38  HOH HOH C . 
L 9 HOH 6   1005 39  HOH HOH C . 
L 9 HOH 7   1006 40  HOH HOH C . 
L 9 HOH 8   1007 42  HOH HOH C . 
L 9 HOH 9   1008 81  HOH HOH C . 
L 9 HOH 10  1009 82  HOH HOH C . 
L 9 HOH 11  1010 94  HOH HOH C . 
L 9 HOH 12  1011 129 HOH HOH C . 
L 9 HOH 13  1012 150 HOH HOH C . 
L 9 HOH 14  1013 180 HOH HOH C . 
L 9 HOH 15  1014 190 HOH HOH C . 
L 9 HOH 16  1015 192 HOH HOH C . 
L 9 HOH 17  1016 209 HOH HOH C . 
L 9 HOH 18  1017 210 HOH HOH C . 
L 9 HOH 19  1018 236 HOH HOH C . 
L 9 HOH 20  1019 237 HOH HOH C . 
#