data_1KKQ
# 
_entry.id   1KKQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KKQ         
RCSB  RCSB015057   
WWPDB D_1000015057 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1k7L 
;THE 2.5 ANGSTROM RESOLUTION CRYSTAL STRUCTURE OF THE HUMAN PPARALPHA LIGAND BINDING DOMAIN BOUND WITH GW409544 AND A CO-ACTIVATOR PEPTIDE
;
unspecified 
PDB 1k74 
;THE 2.3 ANGSTROM RESOLUTION CRYSTAL STRUCTURE OF THE HETERODIMER OF THE HUMAN PPARGAMMA AND RXRALPHA LIGAND BINDING DOMAINS RESPECTIVELY BOUND WITH GW409544 AND 9-CIS RETINOIC ACID AND CO-ACTIVATOR PEPTIDES
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KKQ 
_pdbx_database_status.recvd_initial_deposition_date   2001-12-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xu, H.E.'      1  
'Stanley, T.B.' 2  
'Montana, V.G.' 3  
'Lambert, M.H.' 4  
'Shearer, B.G.' 5  
'Cobb, J.E.'    6  
'McKee, D.D.'   7  
'Galardi, C.M.' 8  
'Nolte, R.T.'   9  
'Parks, D.J.'   10 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural basis for antagonist-mediated recruitment of nuclear co-repressors by PPARalpha.'                   Nature 415 
813   817   2002 NATUAS UK 0028-0836 0006 ? 11845213 ?                      
1       'Structural determinants of ligand binding selectivity between the peroxisome proliferator-activated receptors' 
Proc.Natl.Acad.Sci.USA 98  13919 13924 2001 PNASA6 US 0027-8424 0040 ? ?        10.1073/pnas.241410198 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xu, H.E.'      1  
primary 'Stanley, T.B.' 2  
primary 'Montana, V.G.' 3  
primary 'Lambert, M.H.' 4  
primary 'Shearer, B.G.' 5  
primary 'Cobb, J.E.'    6  
primary 'McKee, D.D.'   7  
primary 'Galardi, C.M.' 8  
primary 'Plunket, K.D.' 9  
primary 'Nolte, R.T.'   10 
primary 'Parks, D.J.'   11 
primary 'Moore, J.T.'   12 
primary 'Kliewer, S.A.' 13 
primary 'Willson, T.M.' 14 
primary 'Stimmel, J.B.' 15 
1       'Xu, H.E.'      16 
1       'Lambert, M.H.' 17 
1       'Montana, V.G.' 18 
1       'Willson, T.M.' 19 
# 
_cell.entry_id           1KKQ 
_cell.length_a           103.409 
_cell.length_b           112.773 
_cell.length_c           123.954 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1KKQ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR' 30442.582 4   ? ? 'PPAR-alpha LBD'                  ? 
2 polymer     syn 'NUCLEAR RECEPTOR CO-REPRESSOR 2' 2240.667  4   ? ? 'SMRT receptor interacting motif' ? 
3 non-polymer syn 
;N-((2S)-2-({(1Z)-1-METHYL-3-OXO-3-[4-(TRIFLUOROMETHYL) PHENYL]PROP-1-ENYL}AMINO)-3-{4-[2-(5-METHYL-2-PHENYL-1,3-OXAZOL-4-YL)ETHOXY]PHENYL}PROPYL)PROPANAMIDE
;
619.673   4   ? ? 'PPAR-alpha antagonist'           ? 
4 water       nat water 18.015    330 ? ? ?                                 ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'PPAR-alpha ligand-binding domain'                               
2 'nuclear corepressor SMRT C-terminal receptor interacting motif' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;TADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCT
SVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKF
DFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTE
HAQLVQIIKKTESDAALHPLLQEIYRDMY
;
;TADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCT
SVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKF
DFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTE
HAQLVQIIKKTESDAALHPLLQEIYRDMY
;
A,B,C,D ? 
2 'polypeptide(L)' no no NMGLEAIIRKALMGKYDQW NMGLEAIIRKALMGKYDQW E,F,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   ALA n 
1 3   ASP n 
1 4   LEU n 
1 5   LYS n 
1 6   SER n 
1 7   LEU n 
1 8   ALA n 
1 9   LYS n 
1 10  ARG n 
1 11  ILE n 
1 12  TYR n 
1 13  GLU n 
1 14  ALA n 
1 15  TYR n 
1 16  LEU n 
1 17  LYS n 
1 18  ASN n 
1 19  PHE n 
1 20  ASN n 
1 21  MET n 
1 22  ASN n 
1 23  LYS n 
1 24  VAL n 
1 25  LYS n 
1 26  ALA n 
1 27  ARG n 
1 28  VAL n 
1 29  ILE n 
1 30  LEU n 
1 31  SER n 
1 32  GLY n 
1 33  LYS n 
1 34  ALA n 
1 35  SER n 
1 36  ASN n 
1 37  ASN n 
1 38  PRO n 
1 39  PRO n 
1 40  PHE n 
1 41  VAL n 
1 42  ILE n 
1 43  HIS n 
1 44  ASP n 
1 45  MET n 
1 46  GLU n 
1 47  THR n 
1 48  LEU n 
1 49  CYS n 
1 50  MET n 
1 51  ALA n 
1 52  GLU n 
1 53  LYS n 
1 54  THR n 
1 55  LEU n 
1 56  VAL n 
1 57  ALA n 
1 58  LYS n 
1 59  LEU n 
1 60  VAL n 
1 61  ALA n 
1 62  ASN n 
1 63  GLY n 
1 64  ILE n 
1 65  GLN n 
1 66  ASN n 
1 67  LYS n 
1 68  GLU n 
1 69  ALA n 
1 70  GLU n 
1 71  VAL n 
1 72  ARG n 
1 73  ILE n 
1 74  PHE n 
1 75  HIS n 
1 76  CYS n 
1 77  CYS n 
1 78  GLN n 
1 79  CYS n 
1 80  THR n 
1 81  SER n 
1 82  VAL n 
1 83  GLU n 
1 84  THR n 
1 85  VAL n 
1 86  THR n 
1 87  GLU n 
1 88  LEU n 
1 89  THR n 
1 90  GLU n 
1 91  PHE n 
1 92  ALA n 
1 93  LYS n 
1 94  ALA n 
1 95  ILE n 
1 96  PRO n 
1 97  GLY n 
1 98  PHE n 
1 99  ALA n 
1 100 ASN n 
1 101 LEU n 
1 102 ASP n 
1 103 LEU n 
1 104 ASN n 
1 105 ASP n 
1 106 GLN n 
1 107 VAL n 
1 108 THR n 
1 109 LEU n 
1 110 LEU n 
1 111 LYS n 
1 112 TYR n 
1 113 GLY n 
1 114 VAL n 
1 115 TYR n 
1 116 GLU n 
1 117 ALA n 
1 118 ILE n 
1 119 PHE n 
1 120 ALA n 
1 121 MET n 
1 122 LEU n 
1 123 SER n 
1 124 SER n 
1 125 VAL n 
1 126 MET n 
1 127 ASN n 
1 128 LYS n 
1 129 ASP n 
1 130 GLY n 
1 131 MET n 
1 132 LEU n 
1 133 VAL n 
1 134 ALA n 
1 135 TYR n 
1 136 GLY n 
1 137 ASN n 
1 138 GLY n 
1 139 PHE n 
1 140 ILE n 
1 141 THR n 
1 142 ARG n 
1 143 GLU n 
1 144 PHE n 
1 145 LEU n 
1 146 LYS n 
1 147 SER n 
1 148 LEU n 
1 149 ARG n 
1 150 LYS n 
1 151 PRO n 
1 152 PHE n 
1 153 CYS n 
1 154 ASP n 
1 155 ILE n 
1 156 MET n 
1 157 GLU n 
1 158 PRO n 
1 159 LYS n 
1 160 PHE n 
1 161 ASP n 
1 162 PHE n 
1 163 ALA n 
1 164 MET n 
1 165 LYS n 
1 166 PHE n 
1 167 ASN n 
1 168 ALA n 
1 169 LEU n 
1 170 GLU n 
1 171 LEU n 
1 172 ASP n 
1 173 ASP n 
1 174 SER n 
1 175 ASP n 
1 176 ILE n 
1 177 SER n 
1 178 LEU n 
1 179 PHE n 
1 180 VAL n 
1 181 ALA n 
1 182 ALA n 
1 183 ILE n 
1 184 ILE n 
1 185 CYS n 
1 186 CYS n 
1 187 GLY n 
1 188 ASP n 
1 189 ARG n 
1 190 PRO n 
1 191 GLY n 
1 192 LEU n 
1 193 LEU n 
1 194 ASN n 
1 195 VAL n 
1 196 GLY n 
1 197 HIS n 
1 198 ILE n 
1 199 GLU n 
1 200 LYS n 
1 201 MET n 
1 202 GLN n 
1 203 GLU n 
1 204 GLY n 
1 205 ILE n 
1 206 VAL n 
1 207 HIS n 
1 208 VAL n 
1 209 LEU n 
1 210 ARG n 
1 211 LEU n 
1 212 HIS n 
1 213 LEU n 
1 214 GLN n 
1 215 SER n 
1 216 ASN n 
1 217 HIS n 
1 218 PRO n 
1 219 ASP n 
1 220 ASP n 
1 221 ILE n 
1 222 PHE n 
1 223 LEU n 
1 224 PHE n 
1 225 PRO n 
1 226 LYS n 
1 227 LEU n 
1 228 LEU n 
1 229 GLN n 
1 230 LYS n 
1 231 MET n 
1 232 ALA n 
1 233 ASP n 
1 234 LEU n 
1 235 ARG n 
1 236 GLN n 
1 237 LEU n 
1 238 VAL n 
1 239 THR n 
1 240 GLU n 
1 241 HIS n 
1 242 ALA n 
1 243 GLN n 
1 244 LEU n 
1 245 VAL n 
1 246 GLN n 
1 247 ILE n 
1 248 ILE n 
1 249 LYS n 
1 250 LYS n 
1 251 THR n 
1 252 GLU n 
1 253 SER n 
1 254 ASP n 
1 255 ALA n 
1 256 ALA n 
1 257 LEU n 
1 258 HIS n 
1 259 PRO n 
1 260 LEU n 
1 261 LEU n 
1 262 GLN n 
1 263 GLU n 
1 264 ILE n 
1 265 TYR n 
1 266 ARG n 
1 267 ASP n 
1 268 MET n 
1 269 TYR n 
2 1   ASN n 
2 2   MET n 
2 3   GLY n 
2 4   LEU n 
2 5   GLU n 
2 6   ALA n 
2 7   ILE n 
2 8   ILE n 
2 9   ARG n 
2 10  LYS n 
2 11  ALA n 
2 12  LEU n 
2 13  MET n 
2 14  GLY n 
2 15  LYS n 
2 16  TYR n 
2 17  ASP n 
2 18  GLN n 
2 19  TRP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 human 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                LIVER 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 DE3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          'T7 promoter from PRSETA' 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PRSETA 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'SMRT receptor interacting motif: This sequence occurs naturally in humans.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP PPAR_HUMAN  1 
;TADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCT
SVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKF
DFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTE
HAQLVQIIKKTESDAALHPLLQEIYRDMY
;
200  Q07869 ? 
2 UNP NCOR2_HUMAN 2 NMGLEAIIRKALMGKYDQW 2339 Q9Y618 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KKQ A 1 ? 269 ? Q07869 200  ? 468  ? 200 468 
2 1 1KKQ B 1 ? 269 ? Q07869 200  ? 468  ? 200 468 
3 1 1KKQ C 1 ? 269 ? Q07869 200  ? 468  ? 200 468 
4 1 1KKQ D 1 ? 269 ? Q07869 200  ? 468  ? 200 468 
5 2 1KKQ E 1 ? 19  ? Q9Y618 2339 ? 2357 ? 682 700 
6 2 1KKQ G 1 ? 19  ? Q9Y618 2339 ? 2357 ? 682 700 
7 2 1KKQ H 1 ? 19  ? Q9Y618 2339 ? 2357 ? 682 700 
8 2 1KKQ F 1 ? 19  ? Q9Y618 2339 ? 2357 ? 682 700 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
471 non-polymer         . 
;N-((2S)-2-({(1Z)-1-METHYL-3-OXO-3-[4-(TRIFLUOROMETHYL) PHENYL]PROP-1-ENYL}AMINO)-3-{4-[2-(5-METHYL-2-PHENYL-1,3-OXAZOL-4-YL)ETHOXY]PHENYL}PROPYL)PROPANAMIDE
;
? 'C35 H36 F3 N3 O4' 619.673 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1KKQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   55.49 
_exptl_crystal.density_Matthews      2.76 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'PEG35K, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2001-03-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Monochromator crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     1KKQ 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20.99 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   29380 
_reflns.number_all                   29727 
_reflns.percent_possible_obs         99 
_reflns.pdbx_Rmerge_I_obs            0.0230040 
_reflns.pdbx_Rsym_value              0.0660000 
_reflns.pdbx_netI_over_sigmaI        23.3 
_reflns.B_iso_Wilson_estimate        50 
_reflns.pdbx_redundancy              4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   96.1 
_reflns_shell.Rmerge_I_obs           0.1580000 
_reflns_shell.pdbx_Rsym_value        0.0620000 
_reflns_shell.meanI_over_sigI_obs    2 
_reflns_shell.pdbx_redundancy        4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2810 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1KKQ 
_refine.ls_number_reflns_obs                     29242 
_refine.ls_number_reflns_all                     29737 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               4983740.50 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             20.99 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    98.8 
_refine.ls_R_factor_obs                          0.2900000 
_refine.ls_R_factor_all                          0.2900000 
_refine.ls_R_factor_R_work                       0.2580000 
_refine.ls_R_factor_R_free                       0.2900000 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 8.0 
_refine.ls_number_reflns_R_free                  2335 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               50.1 
_refine.aniso_B[1][1]                            31.36 
_refine.aniso_B[2][2]                            -10.76 
_refine.aniso_B[3][3]                            -20.60 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1k7L 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           4983740.50 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1KKQ 
_refine_analyze.Luzzati_coordinate_error_obs    0.45 
_refine_analyze.Luzzati_sigma_a_obs             0.55 
_refine_analyze.Luzzati_d_res_low_obs           50.00 
_refine_analyze.Luzzati_coordinate_error_free   0.53 
_refine_analyze.Luzzati_sigma_a_free            0.60 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9096 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         180 
_refine_hist.number_atoms_solvent             330 
_refine_hist.number_atoms_total               9606 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        20.99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        2.0   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 24.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.05  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.58  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.89  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.65  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.85  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.19 
_refine_ls_shell.number_reflns_R_work             4271 
_refine_ls_shell.R_factor_R_work                  0.3860000 
_refine_ls_shell.percent_reflns_obs               95.6 
_refine_ls_shell.R_factor_R_free                  0.4210000 
_refine_ls_shell.R_factor_R_free_error            0.022 
_refine_ls_shell.percent_reflns_R_free            7.9 
_refine_ls_shell.number_reflns_R_free             367 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM INFILE_1 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   INFILE_2 'X-RAY DIFFRACTION' 
3 LOCALPARM.XPL     INFILE_3 'X-RAY DIFFRACTION' 
4 BSXPI3_BOND.XPL   INFILE_4 'X-RAY DIFFRACTION' 
5 ?                 INFILE_5 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1KKQ 
_struct.title                     
'Crystal structure of the human PPAR-alpha ligand-binding domain in complex with an antagonist GW6471 and a SMRT corepressor motif' 
_struct.pdbx_descriptor           
;The human PPAR-alpha ligand-binding domain, The human nuclear corepressor SMRT C-terminal receptor interacting motif, N-((2S)-2-({(1Z)-1-METHYL-3-OXO-3-[4-(TRIFLUOROMETHYL) PHENYL]PROP-1-ENYL}AMINO)-3-{4-[2-(5-METHYL-2-PHENYL-1,3-OXAZOL-4-YL)ETHOXY]PHENYL}PROPYL)PROPANAMIDE
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KKQ 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'nuclear corepressor nuclear hormone receptors antagonist, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 4 ? 
T N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 5   ? LEU A 16  ? LYS A 204 LEU A 215 1 ? 12 
HELX_P HELX_P2  2  ASN A 22  ? SER A 31  ? ASN A 221 SER A 230 1 ? 10 
HELX_P HELX_P3  3  ASP A 44  ? VAL A 56  ? ASP A 243 VAL A 255 1 ? 13 
HELX_P HELX_P4  4  ARG A 72  ? CYS A 77  ? ARG A 271 CYS A 276 1 ? 6  
HELX_P HELX_P5  5  VAL A 82  ? LYS A 93  ? VAL A 281 LYS A 292 1 ? 12 
HELX_P HELX_P6  6  ASP A 102 ? TYR A 112 ? ASP A 301 TYR A 311 1 ? 11 
HELX_P HELX_P7  7  GLY A 113 ? SER A 123 ? GLY A 312 SER A 322 1 ? 11 
HELX_P HELX_P8  8  ALA A 134 ? GLY A 136 ? ALA A 333 GLY A 335 5 ? 3  
HELX_P HELX_P9  9  ARG A 142 ? LYS A 146 ? ARG A 341 LYS A 345 1 ? 5  
HELX_P HELX_P10 10 PRO A 151 ? ASP A 154 ? PRO A 350 ASP A 353 5 ? 4  
HELX_P HELX_P11 11 ILE A 155 ? ASN A 167 ? ILE A 354 ASN A 366 1 ? 13 
HELX_P HELX_P12 12 ASP A 172 ? CYS A 185 ? ASP A 371 CYS A 384 1 ? 14 
HELX_P HELX_P13 13 GLY A 196 ? LEU A 213 ? GLY A 395 LEU A 412 1 ? 18 
HELX_P HELX_P14 14 PHE A 222 ? LEU A 234 ? PHE A 421 LEU A 433 1 ? 13 
HELX_P HELX_P15 15 LEU A 234 ? GLN A 246 ? LEU A 433 GLN A 445 1 ? 13 
HELX_P HELX_P16 16 SER B 6   ? PHE B 19  ? SER B 205 PHE B 218 1 ? 14 
HELX_P HELX_P17 17 ASN B 22  ? SER B 31  ? ASN B 221 SER B 230 1 ? 10 
HELX_P HELX_P18 18 THR B 47  ? VAL B 56  ? THR B 246 VAL B 255 1 ? 10 
HELX_P HELX_P19 19 ALA B 69  ? CYS B 76  ? ALA B 268 CYS B 275 1 ? 8  
HELX_P HELX_P20 20 SER B 81  ? LYS B 93  ? SER B 280 LYS B 292 1 ? 13 
HELX_P HELX_P21 21 ASP B 102 ? SER B 123 ? ASP B 301 SER B 322 1 ? 22 
HELX_P HELX_P22 22 ARG B 142 ? LYS B 146 ? ARG B 341 LYS B 345 1 ? 5  
HELX_P HELX_P23 23 MET B 156 ? ASN B 167 ? MET B 355 ASN B 366 1 ? 12 
HELX_P HELX_P24 24 ALA B 168 ? GLU B 170 ? ALA B 367 GLU B 369 5 ? 3  
HELX_P HELX_P25 25 ASP B 172 ? CYS B 185 ? ASP B 371 CYS B 384 1 ? 14 
HELX_P HELX_P26 26 ASN B 194 ? HIS B 217 ? ASN B 393 HIS B 416 1 ? 24 
HELX_P HELX_P27 27 PHE B 222 ? ILE B 247 ? PHE B 421 ILE B 446 1 ? 26 
HELX_P HELX_P28 28 LYS C 5   ? ALA C 14  ? LYS C 204 ALA C 213 1 ? 10 
HELX_P HELX_P29 29 ALA C 14  ? PHE C 19  ? ALA C 213 PHE C 218 1 ? 6  
HELX_P HELX_P30 30 ASN C 22  ? SER C 31  ? ASN C 221 SER C 230 1 ? 10 
HELX_P HELX_P31 31 ASP C 44  ? VAL C 56  ? ASP C 243 VAL C 255 1 ? 13 
HELX_P HELX_P32 32 GLU C 68  ? ILE C 73  ? GLU C 267 ILE C 272 1 ? 6  
HELX_P HELX_P33 33 GLU C 83  ? ILE C 95  ? GLU C 282 ILE C 294 1 ? 13 
HELX_P HELX_P34 34 ASP C 102 ? GLY C 113 ? ASP C 301 GLY C 312 1 ? 12 
HELX_P HELX_P35 35 TYR C 115 ? LEU C 122 ? TYR C 314 LEU C 321 1 ? 8  
HELX_P HELX_P36 36 SER C 123 ? MET C 126 ? SER C 322 MET C 325 5 ? 4  
HELX_P HELX_P37 37 ALA C 134 ? GLY C 136 ? ALA C 333 GLY C 335 5 ? 3  
HELX_P HELX_P38 38 ARG C 142 ? SER C 147 ? ARG C 341 SER C 346 1 ? 6  
HELX_P HELX_P39 39 PRO C 151 ? ILE C 155 ? PRO C 350 ILE C 354 5 ? 5  
HELX_P HELX_P40 40 MET C 156 ? ASN C 167 ? MET C 355 ASN C 366 1 ? 12 
HELX_P HELX_P41 41 ALA C 168 ? GLU C 170 ? ALA C 367 GLU C 369 5 ? 3  
HELX_P HELX_P42 42 ASP C 172 ? CYS C 185 ? ASP C 371 CYS C 384 1 ? 14 
HELX_P HELX_P43 43 GLY C 196 ? HIS C 217 ? GLY C 395 HIS C 416 1 ? 22 
HELX_P HELX_P44 44 LEU C 223 ? GLN C 243 ? LEU C 422 GLN C 442 1 ? 21 
HELX_P HELX_P45 45 LEU D 4   ? PHE D 19  ? LEU D 203 PHE D 218 1 ? 16 
HELX_P HELX_P46 46 ASN D 22  ? LEU D 30  ? ASN D 221 LEU D 229 1 ? 9  
HELX_P HELX_P47 47 ASP D 44  ? THR D 54  ? ASP D 243 THR D 253 1 ? 11 
HELX_P HELX_P48 48 LYS D 58  ? GLY D 63  ? LYS D 257 GLY D 262 1 ? 6  
HELX_P HELX_P49 49 HIS D 75  ? ILE D 95  ? HIS D 274 ILE D 294 1 ? 21 
HELX_P HELX_P50 50 GLY D 97  ? LEU D 101 ? GLY D 296 LEU D 300 5 ? 5  
HELX_P HELX_P51 51 ASP D 102 ? SER D 123 ? ASP D 301 SER D 322 1 ? 22 
HELX_P HELX_P52 52 ALA D 134 ? GLY D 136 ? ALA D 333 GLY D 335 5 ? 3  
HELX_P HELX_P53 53 ARG D 142 ? LYS D 146 ? ARG D 341 LYS D 345 1 ? 5  
HELX_P HELX_P54 54 PHE D 152 ? ASN D 167 ? PHE D 351 ASN D 366 1 ? 16 
HELX_P HELX_P55 55 ALA D 168 ? GLU D 170 ? ALA D 367 GLU D 369 5 ? 3  
HELX_P HELX_P56 56 ASP D 172 ? ILE D 183 ? ASP D 371 ILE D 382 1 ? 12 
HELX_P HELX_P57 57 GLY D 196 ? GLN D 214 ? GLY D 395 GLN D 413 1 ? 19 
HELX_P HELX_P58 58 PHE D 222 ? GLN D 246 ? PHE D 421 GLN D 445 1 ? 25 
HELX_P HELX_P59 59 LEU E 4   ? ALA E 11  ? LEU E 685 ALA E 692 1 ? 8  
HELX_P HELX_P60 60 LEU F 4   ? LEU F 12  ? LEU F 685 LEU F 693 1 ? 9  
HELX_P HELX_P61 61 LEU G 4   ? LYS G 10  ? LEU G 685 LYS G 691 1 ? 7  
HELX_P HELX_P62 62 LEU H 4   ? LYS H 10  ? LEU H 685 LYS H 691 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 150 A . ? LYS 349 A PRO 151 A ? PRO 350 A 1 0.05  
2 LYS 150 B . ? LYS 349 B PRO 151 B ? PRO 350 B 1 0.38  
3 LYS 150 C . ? LYS 349 C PRO 151 C ? PRO 350 C 1 -0.34 
4 LYS 150 D . ? LYS 349 D PRO 151 D ? PRO 350 D 1 0.28  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 3 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 40  ? ILE A 42  ? PHE A 239 ILE A 241 
A 2 GLY A 138 ? THR A 141 ? GLY A 337 THR A 340 
A 3 GLY A 130 ? VAL A 133 ? GLY A 329 VAL A 332 
B 1 PHE B 40  ? ILE B 42  ? PHE B 239 ILE B 241 
B 2 GLY B 138 ? THR B 141 ? GLY B 337 THR B 340 
B 3 GLY B 130 ? VAL B 133 ? GLY B 329 VAL B 332 
B 4 MET B 126 ? ASN B 127 ? MET B 325 ASN B 326 
C 1 PHE C 40  ? ILE C 42  ? PHE C 239 ILE C 241 
C 2 GLY C 138 ? THR C 141 ? GLY C 337 THR C 340 
C 3 GLY C 130 ? VAL C 133 ? GLY C 329 VAL C 332 
D 1 PHE D 40  ? ILE D 42  ? PHE D 239 ILE D 241 
D 2 GLY D 138 ? THR D 141 ? GLY D 337 THR D 340 
D 3 GLY D 130 ? VAL D 133 ? GLY D 329 VAL D 332 
D 4 MET D 126 ? ASN D 127 ? MET D 325 ASN D 326 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 40  ? N PHE A 239 O PHE A 139 ? O PHE A 338 
A 2 3 O GLY A 138 ? O GLY A 337 N VAL A 133 ? N VAL A 332 
B 1 2 N ILE B 42  ? N ILE B 241 O THR B 141 ? O THR B 340 
B 2 3 O GLY B 138 ? O GLY B 337 N VAL B 133 ? N VAL B 332 
B 3 4 O GLY B 130 ? O GLY B 329 N ASN B 127 ? N ASN B 326 
C 1 2 N PHE C 40  ? N PHE C 239 O PHE C 139 ? O PHE C 338 
C 2 3 O GLY C 138 ? O GLY C 337 N VAL C 133 ? N VAL C 332 
D 1 2 N ILE D 42  ? N ILE D 241 O PHE D 139 ? O PHE D 338 
D 2 3 O ILE D 140 ? O ILE D 339 N MET D 131 ? N MET D 330 
D 3 4 O GLY D 130 ? O GLY D 329 N ASN D 127 ? N ASN D 326 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE 471 A 775' 
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE 471 B 776' 
AC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE 471 C 777' 
AC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE 471 D 778' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 LEU A 55  ? LEU A 254 . ? 1_555 ? 
2  AC1 15 GLU A 70  ? GLU A 269 . ? 1_555 ? 
3  AC1 15 ILE A 73  ? ILE A 272 . ? 1_555 ? 
4  AC1 15 PHE A 74  ? PHE A 273 . ? 1_555 ? 
5  AC1 15 CYS A 76  ? CYS A 275 . ? 1_555 ? 
6  AC1 15 CYS A 77  ? CYS A 276 . ? 1_555 ? 
7  AC1 15 SER A 81  ? SER A 280 . ? 1_555 ? 
8  AC1 15 TYR A 115 ? TYR A 314 . ? 1_555 ? 
9  AC1 15 VAL A 133 ? VAL A 332 . ? 1_555 ? 
10 AC1 15 PHE A 152 ? PHE A 351 . ? 1_555 ? 
11 AC1 15 ILE A 155 ? ILE A 354 . ? 1_555 ? 
12 AC1 15 HIS A 241 ? HIS A 440 . ? 1_555 ? 
13 AC1 15 VAL A 245 ? VAL A 444 . ? 1_555 ? 
14 AC1 15 LEU A 257 ? LEU A 456 . ? 1_555 ? 
15 AC1 15 HOH M .   ? HOH A 798 . ? 1_555 ? 
16 AC2 14 LEU B 55  ? LEU B 254 . ? 1_555 ? 
17 AC2 14 ILE B 73  ? ILE B 272 . ? 1_555 ? 
18 AC2 14 CYS B 77  ? CYS B 276 . ? 1_555 ? 
19 AC2 14 THR B 80  ? THR B 279 . ? 1_555 ? 
20 AC2 14 SER B 81  ? SER B 280 . ? 1_555 ? 
21 AC2 14 TYR B 115 ? TYR B 314 . ? 1_555 ? 
22 AC2 14 MET B 131 ? MET B 330 . ? 1_555 ? 
23 AC2 14 VAL B 133 ? VAL B 332 . ? 1_555 ? 
24 AC2 14 LEU B 145 ? LEU B 344 . ? 1_555 ? 
25 AC2 14 PHE B 152 ? PHE B 351 . ? 1_555 ? 
26 AC2 14 ILE B 155 ? ILE B 354 . ? 1_555 ? 
27 AC2 14 MET B 156 ? MET B 355 . ? 1_555 ? 
28 AC2 14 HIS B 241 ? HIS B 440 . ? 1_555 ? 
29 AC2 14 HOH N .   ? HOH B 794 . ? 1_555 ? 
30 AC3 15 ILE C 42  ? ILE C 241 . ? 1_555 ? 
31 AC3 15 ILE C 73  ? ILE C 272 . ? 1_555 ? 
32 AC3 15 PHE C 74  ? PHE C 273 . ? 1_555 ? 
33 AC3 15 CYS C 76  ? CYS C 275 . ? 1_555 ? 
34 AC3 15 CYS C 77  ? CYS C 276 . ? 1_555 ? 
35 AC3 15 GLN C 78  ? GLN C 277 . ? 1_555 ? 
36 AC3 15 THR C 80  ? THR C 279 . ? 1_555 ? 
37 AC3 15 SER C 81  ? SER C 280 . ? 1_555 ? 
38 AC3 15 TYR C 115 ? TYR C 314 . ? 1_555 ? 
39 AC3 15 MET C 131 ? MET C 330 . ? 1_555 ? 
40 AC3 15 VAL C 133 ? VAL C 332 . ? 1_555 ? 
41 AC3 15 PHE C 152 ? PHE C 351 . ? 1_555 ? 
42 AC3 15 ILE C 155 ? ILE C 354 . ? 1_555 ? 
43 AC3 15 HIS C 241 ? HIS C 440 . ? 1_555 ? 
44 AC3 15 HOH O .   ? HOH C 816 . ? 1_555 ? 
45 AC4 13 LEU D 55  ? LEU D 254 . ? 1_555 ? 
46 AC4 13 GLU D 70  ? GLU D 269 . ? 1_555 ? 
47 AC4 13 ILE D 73  ? ILE D 272 . ? 1_555 ? 
48 AC4 13 PHE D 74  ? PHE D 273 . ? 1_555 ? 
49 AC4 13 CYS D 77  ? CYS D 276 . ? 1_555 ? 
50 AC4 13 GLN D 78  ? GLN D 277 . ? 1_555 ? 
51 AC4 13 SER D 81  ? SER D 280 . ? 1_555 ? 
52 AC4 13 TYR D 115 ? TYR D 314 . ? 1_555 ? 
53 AC4 13 MET D 131 ? MET D 330 . ? 1_555 ? 
54 AC4 13 VAL D 133 ? VAL D 332 . ? 1_555 ? 
55 AC4 13 LEU D 145 ? LEU D 344 . ? 1_555 ? 
56 AC4 13 PHE D 152 ? PHE D 351 . ? 1_555 ? 
57 AC4 13 HOH P .   ? HOH D 779 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1KKQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KKQ 
_atom_sites.fract_transf_matrix[1][1]   0.009670 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008867 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008068 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 1   ? 79.760  25.923 65.336 1.00 84.82  ? 200 THR A N   1 
ATOM   2    C CA  . THR A 1 1   ? 81.182  25.498 65.177 1.00 84.99  ? 200 THR A CA  1 
ATOM   3    C C   . THR A 1 1   ? 81.333  23.999 65.431 1.00 84.94  ? 200 THR A C   1 
ATOM   4    O O   . THR A 1 1   ? 82.020  23.580 66.364 1.00 85.40  ? 200 THR A O   1 
ATOM   5    C CB  . THR A 1 1   ? 82.072  26.286 66.135 1.00 84.71  ? 200 THR A CB  1 
ATOM   6    N N   . ALA A 1 2   ? 80.688  23.197 64.591 1.00 84.24  ? 201 ALA A N   1 
ATOM   7    C CA  . ALA A 1 2   ? 80.733  21.744 64.710 1.00 83.40  ? 201 ALA A CA  1 
ATOM   8    C C   . ALA A 1 2   ? 80.120  21.150 63.453 1.00 82.90  ? 201 ALA A C   1 
ATOM   9    O O   . ALA A 1 2   ? 80.757  20.387 62.726 1.00 82.83  ? 201 ALA A O   1 
ATOM   10   C CB  . ALA A 1 2   ? 79.944  21.299 65.931 1.00 83.76  ? 201 ALA A CB  1 
ATOM   11   N N   . ASP A 1 3   ? 78.864  21.517 63.221 1.00 82.25  ? 202 ASP A N   1 
ATOM   12   C CA  . ASP A 1 3   ? 78.090  21.077 62.067 1.00 80.69  ? 202 ASP A CA  1 
ATOM   13   C C   . ASP A 1 3   ? 78.246  22.106 60.957 1.00 78.87  ? 202 ASP A C   1 
ATOM   14   O O   . ASP A 1 3   ? 77.959  21.836 59.790 1.00 78.53  ? 202 ASP A O   1 
ATOM   15   C CB  . ASP A 1 3   ? 76.614  20.949 62.451 1.00 81.48  ? 202 ASP A CB  1 
ATOM   16   C CG  . ASP A 1 3   ? 76.232  21.854 63.616 1.00 81.76  ? 202 ASP A CG  1 
ATOM   17   O OD1 . ASP A 1 3   ? 76.966  22.828 63.895 1.00 81.94  ? 202 ASP A OD1 1 
ATOM   18   O OD2 . ASP A 1 3   ? 75.188  21.593 64.250 1.00 82.22  ? 202 ASP A OD2 1 
ATOM   19   N N   . LEU A 1 4   ? 78.696  23.295 61.339 1.00 76.53  ? 203 LEU A N   1 
ATOM   20   C CA  . LEU A 1 4   ? 78.908  24.364 60.386 1.00 74.47  ? 203 LEU A CA  1 
ATOM   21   C C   . LEU A 1 4   ? 80.350  24.256 59.923 1.00 73.13  ? 203 LEU A C   1 
ATOM   22   O O   . LEU A 1 4   ? 80.808  25.041 59.096 1.00 73.45  ? 203 LEU A O   1 
ATOM   23   C CB  . LEU A 1 4   ? 78.678  25.725 61.043 1.00 74.94  ? 203 LEU A CB  1 
ATOM   24   C CG  . LEU A 1 4   ? 78.237  26.819 60.069 1.00 75.62  ? 203 LEU A CG  1 
ATOM   25   C CD1 . LEU A 1 4   ? 76.860  26.448 59.527 1.00 76.06  ? 203 LEU A CD1 1 
ATOM   26   C CD2 . LEU A 1 4   ? 78.189  28.179 60.758 1.00 75.35  ? 203 LEU A CD2 1 
ATOM   27   N N   . LYS A 1 5   ? 81.063  23.273 60.462 1.00 71.11  ? 204 LYS A N   1 
ATOM   28   C CA  . LYS A 1 5   ? 82.456  23.080 60.099 1.00 68.95  ? 204 LYS A CA  1 
ATOM   29   C C   . LYS A 1 5   ? 82.619  22.033 59.015 1.00 67.21  ? 204 LYS A C   1 
ATOM   30   O O   . LYS A 1 5   ? 83.363  22.224 58.057 1.00 67.21  ? 204 LYS A O   1 
ATOM   31   C CB  . LYS A 1 5   ? 83.280  22.702 61.326 1.00 70.03  ? 204 LYS A CB  1 
ATOM   32   C CG  . LYS A 1 5   ? 84.710  23.199 61.224 1.00 71.51  ? 204 LYS A CG  1 
ATOM   33   C CD  . LYS A 1 5   ? 84.769  24.371 60.251 1.00 72.43  ? 204 LYS A CD  1 
ATOM   34   C CE  . LYS A 1 5   ? 86.066  25.151 60.343 1.00 74.02  ? 204 LYS A CE  1 
ATOM   35   N NZ  . LYS A 1 5   ? 85.808  26.526 60.865 1.00 74.75  ? 204 LYS A NZ  1 
ATOM   36   N N   . SER A 1 6   ? 81.926  20.917 59.171 1.00 65.18  ? 205 SER A N   1 
ATOM   37   C CA  . SER A 1 6   ? 81.979  19.869 58.174 1.00 63.27  ? 205 SER A CA  1 
ATOM   38   C C   . SER A 1 6   ? 81.078  20.331 57.031 1.00 62.77  ? 205 SER A C   1 
ATOM   39   O O   . SER A 1 6   ? 80.892  19.625 56.042 1.00 63.48  ? 205 SER A O   1 
ATOM   40   C CB  . SER A 1 6   ? 81.457  18.564 58.767 1.00 62.84  ? 205 SER A CB  1 
ATOM   41   O OG  . SER A 1 6   ? 80.169  18.748 59.325 1.00 61.62  ? 205 SER A OG  1 
ATOM   42   N N   . LEU A 1 7   ? 80.522  21.530 57.181 1.00 61.25  ? 206 LEU A N   1 
ATOM   43   C CA  . LEU A 1 7   ? 79.635  22.105 56.177 1.00 59.67  ? 206 LEU A CA  1 
ATOM   44   C C   . LEU A 1 7   ? 80.355  22.424 54.879 1.00 59.43  ? 206 LEU A C   1 
ATOM   45   O O   . LEU A 1 7   ? 79.794  22.261 53.799 1.00 59.50  ? 206 LEU A O   1 
ATOM   46   C CB  . LEU A 1 7   ? 78.991  23.388 56.695 1.00 58.48  ? 206 LEU A CB  1 
ATOM   47   C CG  . LEU A 1 7   ? 78.259  24.177 55.604 1.00 57.86  ? 206 LEU A CG  1 
ATOM   48   C CD1 . LEU A 1 7   ? 77.022  23.414 55.163 1.00 57.74  ? 206 LEU A CD1 1 
ATOM   49   C CD2 . LEU A 1 7   ? 77.882  25.550 56.115 1.00 58.20  ? 206 LEU A CD2 1 
ATOM   50   N N   . ALA A 1 8   ? 81.591  22.899 54.992 1.00 59.49  ? 207 ALA A N   1 
ATOM   51   C CA  . ALA A 1 8   ? 82.390  23.253 53.822 1.00 59.92  ? 207 ALA A CA  1 
ATOM   52   C C   . ALA A 1 8   ? 82.815  21.996 53.091 1.00 60.41  ? 207 ALA A C   1 
ATOM   53   O O   . ALA A 1 8   ? 82.854  21.953 51.860 1.00 61.04  ? 207 ALA A O   1 
ATOM   54   C CB  . ALA A 1 8   ? 83.619  24.033 54.245 1.00 59.35  ? 207 ALA A CB  1 
ATOM   55   N N   . LYS A 1 9   ? 83.153  20.977 53.870 1.00 60.55  ? 208 LYS A N   1 
ATOM   56   C CA  . LYS A 1 9   ? 83.578  19.703 53.323 1.00 59.81  ? 208 LYS A CA  1 
ATOM   57   C C   . LYS A 1 9   ? 82.414  19.151 52.517 1.00 58.25  ? 208 LYS A C   1 
ATOM   58   O O   . LYS A 1 9   ? 82.506  18.976 51.306 1.00 58.54  ? 208 LYS A O   1 
ATOM   59   C CB  . LYS A 1 9   ? 83.935  18.748 54.464 1.00 61.66  ? 208 LYS A CB  1 
ATOM   60   C CG  . LYS A 1 9   ? 84.610  17.462 54.019 1.00 64.91  ? 208 LYS A CG  1 
ATOM   61   C CD  . LYS A 1 9   ? 84.968  16.582 55.207 1.00 66.46  ? 208 LYS A CD  1 
ATOM   62   C CE  . LYS A 1 9   ? 85.818  15.393 54.782 1.00 67.98  ? 208 LYS A CE  1 
ATOM   63   N NZ  . LYS A 1 9   ? 87.184  15.784 54.304 1.00 68.33  ? 208 LYS A NZ  1 
ATOM   64   N N   . ARG A 1 10  ? 81.313  18.899 53.210 1.00 56.58  ? 209 ARG A N   1 
ATOM   65   C CA  . ARG A 1 10  ? 80.105  18.369 52.604 1.00 55.61  ? 209 ARG A CA  1 
ATOM   66   C C   . ARG A 1 10  ? 79.671  19.063 51.322 1.00 53.07  ? 209 ARG A C   1 
ATOM   67   O O   . ARG A 1 10  ? 78.896  18.508 50.546 1.00 53.37  ? 209 ARG A O   1 
ATOM   68   C CB  . ARG A 1 10  ? 78.980  18.423 53.625 1.00 58.86  ? 209 ARG A CB  1 
ATOM   69   C CG  . ARG A 1 10  ? 78.757  17.091 54.305 1.00 64.43  ? 209 ARG A CG  1 
ATOM   70   C CD  . ARG A 1 10  ? 77.676  16.333 53.563 1.00 68.88  ? 209 ARG A CD  1 
ATOM   71   N NE  . ARG A 1 10  ? 76.393  16.509 54.225 1.00 72.81  ? 209 ARG A NE  1 
ATOM   72   C CZ  . ARG A 1 10  ? 75.216  16.390 53.624 1.00 74.74  ? 209 ARG A CZ  1 
ATOM   73   N NH1 . ARG A 1 10  ? 75.149  16.096 52.329 1.00 75.00  ? 209 ARG A NH1 1 
ATOM   74   N NH2 . ARG A 1 10  ? 74.106  16.559 54.330 1.00 76.03  ? 209 ARG A NH2 1 
ATOM   75   N N   . ILE A 1 11  ? 80.169  20.277 51.109 1.00 49.99  ? 210 ILE A N   1 
ATOM   76   C CA  . ILE A 1 11  ? 79.840  21.059 49.921 1.00 46.59  ? 210 ILE A CA  1 
ATOM   77   C C   . ILE A 1 11  ? 80.921  20.888 48.855 1.00 44.63  ? 210 ILE A C   1 
ATOM   78   O O   . ILE A 1 11  ? 80.709  21.189 47.682 1.00 44.37  ? 210 ILE A O   1 
ATOM   79   C CB  . ILE A 1 11  ? 79.670  22.560 50.291 1.00 46.04  ? 210 ILE A CB  1 
ATOM   80   C CG1 . ILE A 1 11  ? 78.291  22.770 50.919 1.00 45.51  ? 210 ILE A CG1 1 
ATOM   81   C CG2 . ILE A 1 11  ? 79.855  23.448 49.069 1.00 45.42  ? 210 ILE A CG2 1 
ATOM   82   C CD1 . ILE A 1 11  ? 78.070  24.155 51.477 1.00 45.55  ? 210 ILE A CD1 1 
ATOM   83   N N   . TYR A 1 12  ? 82.079  20.394 49.275 1.00 42.28  ? 211 TYR A N   1 
ATOM   84   C CA  . TYR A 1 12  ? 83.186  20.165 48.361 1.00 39.81  ? 211 TYR A CA  1 
ATOM   85   C C   . TYR A 1 12  ? 83.022  18.790 47.746 1.00 38.90  ? 211 TYR A C   1 
ATOM   86   O O   . TYR A 1 12  ? 83.450  18.536 46.624 1.00 39.26  ? 211 TYR A O   1 
ATOM   87   C CB  . TYR A 1 12  ? 84.518  20.233 49.101 1.00 39.18  ? 211 TYR A CB  1 
ATOM   88   C CG  . TYR A 1 12  ? 85.704  20.022 48.196 1.00 38.81  ? 211 TYR A CG  1 
ATOM   89   C CD1 . TYR A 1 12  ? 85.715  20.548 46.908 1.00 39.19  ? 211 TYR A CD1 1 
ATOM   90   C CD2 . TYR A 1 12  ? 86.837  19.345 48.639 1.00 39.41  ? 211 TYR A CD2 1 
ATOM   91   C CE1 . TYR A 1 12  ? 86.823  20.411 46.080 1.00 40.30  ? 211 TYR A CE1 1 
ATOM   92   C CE2 . TYR A 1 12  ? 87.960  19.202 47.817 1.00 40.36  ? 211 TYR A CE2 1 
ATOM   93   C CZ  . TYR A 1 12  ? 87.945  19.741 46.537 1.00 40.73  ? 211 TYR A CZ  1 
ATOM   94   O OH  . TYR A 1 12  ? 89.052  19.637 45.718 1.00 40.83  ? 211 TYR A OH  1 
ATOM   95   N N   . GLU A 1 13  ? 82.400  17.895 48.495 1.00 37.51  ? 212 GLU A N   1 
ATOM   96   C CA  . GLU A 1 13  ? 82.180  16.557 48.004 1.00 36.35  ? 212 GLU A CA  1 
ATOM   97   C C   . GLU A 1 13  ? 80.992  16.615 47.076 1.00 34.30  ? 212 GLU A C   1 
ATOM   98   O O   . GLU A 1 13  ? 80.974  15.953 46.047 1.00 34.73  ? 212 GLU A O   1 
ATOM   99   C CB  . GLU A 1 13  ? 81.930  15.608 49.168 1.00 39.11  ? 212 GLU A CB  1 
ATOM   100  C CG  . GLU A 1 13  ? 83.018  15.702 50.227 1.00 42.96  ? 212 GLU A CG  1 
ATOM   101  C CD  . GLU A 1 13  ? 83.115  14.459 51.076 1.00 45.10  ? 212 GLU A CD  1 
ATOM   102  O OE1 . GLU A 1 13  ? 82.053  13.956 51.487 1.00 45.00  ? 212 GLU A OE1 1 
ATOM   103  O OE2 . GLU A 1 13  ? 84.251  13.993 51.333 1.00 46.63  ? 212 GLU A OE2 1 
ATOM   104  N N   . ALA A 1 14  ? 80.001  17.425 47.434 1.00 32.58  ? 213 ALA A N   1 
ATOM   105  C CA  . ALA A 1 14  ? 78.822  17.578 46.590 1.00 31.05  ? 213 ALA A CA  1 
ATOM   106  C C   . ALA A 1 14  ? 79.319  17.967 45.201 1.00 29.63  ? 213 ALA A C   1 
ATOM   107  O O   . ALA A 1 14  ? 78.798  17.505 44.188 1.00 30.33  ? 213 ALA A O   1 
ATOM   108  C CB  . ALA A 1 14  ? 77.904  18.664 47.146 1.00 29.78  ? 213 ALA A CB  1 
ATOM   109  N N   . TYR A 1 15  ? 80.352  18.804 45.177 1.00 26.77  ? 214 TYR A N   1 
ATOM   110  C CA  . TYR A 1 15  ? 80.966  19.286 43.947 1.00 23.87  ? 214 TYR A CA  1 
ATOM   111  C C   . TYR A 1 15  ? 81.849  18.209 43.329 1.00 24.46  ? 214 TYR A C   1 
ATOM   112  O O   . TYR A 1 15  ? 81.767  17.939 42.137 1.00 24.49  ? 214 TYR A O   1 
ATOM   113  C CB  . TYR A 1 15  ? 81.781  20.535 44.266 1.00 20.12  ? 214 TYR A CB  1 
ATOM   114  C CG  . TYR A 1 15  ? 82.462  21.207 43.101 1.00 15.32  ? 214 TYR A CG  1 
ATOM   115  C CD1 . TYR A 1 15  ? 83.752  20.848 42.720 1.00 12.42  ? 214 TYR A CD1 1 
ATOM   116  C CD2 . TYR A 1 15  ? 81.848  22.265 42.434 1.00 13.30  ? 214 TYR A CD2 1 
ATOM   117  C CE1 . TYR A 1 15  ? 84.418  21.536 41.714 1.00 10.39  ? 214 TYR A CE1 1 
ATOM   118  C CE2 . TYR A 1 15  ? 82.504  22.955 41.429 1.00 11.67  ? 214 TYR A CE2 1 
ATOM   119  C CZ  . TYR A 1 15  ? 83.791  22.588 41.076 1.00 10.86  ? 214 TYR A CZ  1 
ATOM   120  O OH  . TYR A 1 15  ? 84.454  23.284 40.097 1.00 10.75  ? 214 TYR A OH  1 
ATOM   121  N N   . LEU A 1 16  ? 82.694  17.588 44.141 1.00 25.94  ? 215 LEU A N   1 
ATOM   122  C CA  . LEU A 1 16  ? 83.566  16.528 43.640 1.00 27.98  ? 215 LEU A CA  1 
ATOM   123  C C   . LEU A 1 16  ? 82.785  15.228 43.421 1.00 29.95  ? 215 LEU A C   1 
ATOM   124  O O   . LEU A 1 16  ? 83.337  14.132 43.558 1.00 32.21  ? 215 LEU A O   1 
ATOM   125  C CB  . LEU A 1 16  ? 84.708  16.252 44.627 1.00 25.55  ? 215 LEU A CB  1 
ATOM   126  C CG  . LEU A 1 16  ? 85.941  17.147 44.650 1.00 24.24  ? 215 LEU A CG  1 
ATOM   127  C CD1 . LEU A 1 16  ? 86.995  16.452 45.466 1.00 24.48  ? 215 LEU A CD1 1 
ATOM   128  C CD2 . LEU A 1 16  ? 86.469  17.386 43.245 1.00 25.53  ? 215 LEU A CD2 1 
ATOM   129  N N   . LYS A 1 17  ? 81.507  15.334 43.080 1.00 29.68  ? 216 LYS A N   1 
ATOM   130  C CA  . LYS A 1 17  ? 80.714  14.133 42.887 1.00 29.59  ? 216 LYS A CA  1 
ATOM   131  C C   . LYS A 1 17  ? 79.558  14.400 41.939 1.00 29.95  ? 216 LYS A C   1 
ATOM   132  O O   . LYS A 1 17  ? 78.866  13.475 41.511 1.00 30.40  ? 216 LYS A O   1 
ATOM   133  C CB  . LYS A 1 17  ? 80.214  13.648 44.252 1.00 28.88  ? 216 LYS A CB  1 
ATOM   134  C CG  . LYS A 1 17  ? 79.533  12.288 44.272 1.00 30.78  ? 216 LYS A CG  1 
ATOM   135  C CD  . LYS A 1 17  ? 78.042  12.399 43.990 1.00 32.56  ? 216 LYS A CD  1 
ATOM   136  C CE  . LYS A 1 17  ? 77.329  11.062 44.150 1.00 33.22  ? 216 LYS A CE  1 
ATOM   137  N NZ  . LYS A 1 17  ? 75.870  11.157 43.817 1.00 33.15  ? 216 LYS A NZ  1 
ATOM   138  N N   . ASN A 1 18  ? 79.373  15.668 41.589 1.00 29.54  ? 217 ASN A N   1 
ATOM   139  C CA  . ASN A 1 18  ? 78.294  16.064 40.694 1.00 29.26  ? 217 ASN A CA  1 
ATOM   140  C C   . ASN A 1 18  ? 78.741  16.849 39.464 1.00 30.10  ? 217 ASN A C   1 
ATOM   141  O O   . ASN A 1 18  ? 77.917  17.201 38.617 1.00 31.84  ? 217 ASN A O   1 
ATOM   142  C CB  . ASN A 1 18  ? 77.265  16.880 41.468 1.00 28.04  ? 217 ASN A CB  1 
ATOM   143  C CG  . ASN A 1 18  ? 76.396  16.023 42.344 1.00 26.54  ? 217 ASN A CG  1 
ATOM   144  O OD1 . ASN A 1 18  ? 75.466  15.383 41.864 1.00 26.99  ? 217 ASN A OD1 1 
ATOM   145  N ND2 . ASN A 1 18  ? 76.700  15.990 43.634 1.00 25.80  ? 217 ASN A ND2 1 
ATOM   146  N N   . PHE A 1 19  ? 80.033  17.132 39.357 1.00 29.25  ? 218 PHE A N   1 
ATOM   147  C CA  . PHE A 1 19  ? 80.522  17.874 38.207 1.00 28.59  ? 218 PHE A CA  1 
ATOM   148  C C   . PHE A 1 19  ? 81.537  17.070 37.431 1.00 29.77  ? 218 PHE A C   1 
ATOM   149  O O   . PHE A 1 19  ? 82.680  16.890 37.855 1.00 29.63  ? 218 PHE A O   1 
ATOM   150  C CB  . PHE A 1 19  ? 81.089  19.225 38.652 1.00 26.08  ? 218 PHE A CB  1 
ATOM   151  C CG  . PHE A 1 19  ? 80.030  20.177 39.135 1.00 24.14  ? 218 PHE A CG  1 
ATOM   152  C CD1 . PHE A 1 19  ? 79.072  20.663 38.256 1.00 23.35  ? 218 PHE A CD1 1 
ATOM   153  C CD2 . PHE A 1 19  ? 79.942  20.528 40.473 1.00 22.46  ? 218 PHE A CD2 1 
ATOM   154  C CE1 . PHE A 1 19  ? 78.044  21.473 38.702 1.00 22.15  ? 218 PHE A CE1 1 
ATOM   155  C CE2 . PHE A 1 19  ? 78.920  21.336 40.923 1.00 21.91  ? 218 PHE A CE2 1 
ATOM   156  C CZ  . PHE A 1 19  ? 77.967  21.808 40.034 1.00 21.84  ? 218 PHE A CZ  1 
ATOM   157  N N   . ASN A 1 20  ? 81.086  16.573 36.287 1.00 31.29  ? 219 ASN A N   1 
ATOM   158  C CA  . ASN A 1 20  ? 81.914  15.760 35.409 1.00 33.18  ? 219 ASN A CA  1 
ATOM   159  C C   . ASN A 1 20  ? 83.225  16.441 35.047 1.00 31.33  ? 219 ASN A C   1 
ATOM   160  O O   . ASN A 1 20  ? 84.208  15.778 34.740 1.00 30.16  ? 219 ASN A O   1 
ATOM   161  C CB  . ASN A 1 20  ? 81.144  15.423 34.120 1.00 37.70  ? 219 ASN A CB  1 
ATOM   162  C CG  . ASN A 1 20  ? 81.938  14.519 33.170 1.00 40.13  ? 219 ASN A CG  1 
ATOM   163  O OD1 . ASN A 1 20  ? 82.849  14.965 32.457 1.00 40.34  ? 219 ASN A OD1 1 
ATOM   164  N ND2 . ASN A 1 20  ? 81.594  13.238 33.168 1.00 42.69  ? 219 ASN A ND2 1 
ATOM   165  N N   . MET A 1 21  ? 83.238  17.764 35.064 1.00 29.12  ? 220 MET A N   1 
ATOM   166  C CA  . MET A 1 21  ? 84.449  18.464 34.708 1.00 28.48  ? 220 MET A CA  1 
ATOM   167  C C   . MET A 1 21  ? 84.733  19.566 35.693 1.00 28.24  ? 220 MET A C   1 
ATOM   168  O O   . MET A 1 21  ? 83.949  20.505 35.816 1.00 30.48  ? 220 MET A O   1 
ATOM   169  C CB  . MET A 1 21  ? 84.322  19.057 33.305 1.00 29.59  ? 220 MET A CB  1 
ATOM   170  C CG  . MET A 1 21  ? 85.532  19.863 32.874 1.00 30.52  ? 220 MET A CG  1 
ATOM   171  S SD  . MET A 1 21  ? 87.021  18.852 32.829 1.00 34.18  ? 220 MET A SD  1 
ATOM   172  C CE  . MET A 1 21  ? 87.204  18.584 31.068 1.00 31.66  ? 220 MET A CE  1 
ATOM   173  N N   . ASN A 1 22  ? 85.843  19.442 36.414 1.00 26.00  ? 221 ASN A N   1 
ATOM   174  C CA  . ASN A 1 22  ? 86.236  20.469 37.366 1.00 22.40  ? 221 ASN A CA  1 
ATOM   175  C C   . ASN A 1 22  ? 87.509  21.146 36.869 1.00 21.60  ? 221 ASN A C   1 
ATOM   176  O O   . ASN A 1 22  ? 87.969  20.876 35.762 1.00 21.90  ? 221 ASN A O   1 
ATOM   177  C CB  . ASN A 1 22  ? 86.440  19.889 38.758 1.00 18.48  ? 221 ASN A CB  1 
ATOM   178  C CG  . ASN A 1 22  ? 87.268  18.661 38.741 1.00 15.26  ? 221 ASN A CG  1 
ATOM   179  O OD1 . ASN A 1 22  ? 88.379  18.658 38.226 1.00 13.19  ? 221 ASN A OD1 1 
ATOM   180  N ND2 . ASN A 1 22  ? 86.734  17.592 39.300 1.00 16.02  ? 221 ASN A ND2 1 
ATOM   181  N N   . LYS A 1 23  ? 88.081  22.013 37.694 1.00 20.42  ? 222 LYS A N   1 
ATOM   182  C CA  . LYS A 1 23  ? 89.251  22.778 37.301 1.00 19.20  ? 222 LYS A CA  1 
ATOM   183  C C   . LYS A 1 23  ? 90.559  22.018 37.173 1.00 18.10  ? 222 LYS A C   1 
ATOM   184  O O   . LYS A 1 23  ? 91.401  22.375 36.360 1.00 16.91  ? 222 LYS A O   1 
ATOM   185  C CB  . LYS A 1 23  ? 89.414  23.966 38.257 1.00 20.51  ? 222 LYS A CB  1 
ATOM   186  C CG  . LYS A 1 23  ? 90.270  25.101 37.715 1.00 22.95  ? 222 LYS A CG  1 
ATOM   187  C CD  . LYS A 1 23  ? 90.156  26.334 38.594 1.00 23.79  ? 222 LYS A CD  1 
ATOM   188  C CE  . LYS A 1 23  ? 91.058  27.457 38.110 1.00 25.43  ? 222 LYS A CE  1 
ATOM   189  N NZ  . LYS A 1 23  ? 90.845  28.720 38.887 1.00 25.97  ? 222 LYS A NZ  1 
ATOM   190  N N   . VAL A 1 24  ? 90.740  20.967 37.959 1.00 18.31  ? 223 VAL A N   1 
ATOM   191  C CA  . VAL A 1 24  ? 91.984  20.213 37.883 1.00 19.24  ? 223 VAL A CA  1 
ATOM   192  C C   . VAL A 1 24  ? 92.032  19.391 36.599 1.00 21.17  ? 223 VAL A C   1 
ATOM   193  O O   . VAL A 1 24  ? 92.987  19.493 35.836 1.00 22.04  ? 223 VAL A O   1 
ATOM   194  C CB  . VAL A 1 24  ? 92.146  19.286 39.082 1.00 18.14  ? 223 VAL A CB  1 
ATOM   195  C CG1 . VAL A 1 24  ? 93.622  19.142 39.408 1.00 16.81  ? 223 VAL A CG1 1 
ATOM   196  C CG2 . VAL A 1 24  ? 91.363  19.830 40.268 1.00 18.38  ? 223 VAL A CG2 1 
ATOM   197  N N   . LYS A 1 25  ? 91.012  18.570 36.364 1.00 21.68  ? 224 LYS A N   1 
ATOM   198  C CA  . LYS A 1 25  ? 90.963  17.792 35.139 1.00 22.45  ? 224 LYS A CA  1 
ATOM   199  C C   . LYS A 1 25  ? 91.067  18.806 34.014 1.00 22.83  ? 224 LYS A C   1 
ATOM   200  O O   . LYS A 1 25  ? 91.939  18.713 33.153 1.00 23.46  ? 224 LYS A O   1 
ATOM   201  C CB  . LYS A 1 25  ? 89.640  17.042 35.038 1.00 23.47  ? 224 LYS A CB  1 
ATOM   202  C CG  . LYS A 1 25  ? 89.653  15.700 35.746 1.00 28.71  ? 224 LYS A CG  1 
ATOM   203  C CD  . LYS A 1 25  ? 88.289  15.333 36.302 1.00 30.93  ? 224 LYS A CD  1 
ATOM   204  C CE  . LYS A 1 25  ? 87.213  15.341 35.235 1.00 32.18  ? 224 LYS A CE  1 
ATOM   205  N NZ  . LYS A 1 25  ? 85.954  15.722 35.907 1.00 33.71  ? 224 LYS A NZ  1 
ATOM   206  N N   . ALA A 1 26  ? 90.180  19.796 34.055 1.00 22.76  ? 225 ALA A N   1 
ATOM   207  C CA  . ALA A 1 26  ? 90.142  20.854 33.057 1.00 22.16  ? 225 ALA A CA  1 
ATOM   208  C C   . ALA A 1 26  ? 91.506  21.485 32.842 1.00 22.78  ? 225 ALA A C   1 
ATOM   209  O O   . ALA A 1 26  ? 91.925  21.680 31.709 1.00 24.25  ? 225 ALA A O   1 
ATOM   210  C CB  . ALA A 1 26  ? 89.145  21.924 33.470 1.00 22.18  ? 225 ALA A CB  1 
ATOM   211  N N   . ARG A 1 27  ? 92.205  21.807 33.925 1.00 23.59  ? 226 ARG A N   1 
ATOM   212  C CA  . ARG A 1 27  ? 93.517  22.431 33.799 1.00 23.93  ? 226 ARG A CA  1 
ATOM   213  C C   . ARG A 1 27  ? 94.585  21.511 33.222 1.00 22.84  ? 226 ARG A C   1 
ATOM   214  O O   . ARG A 1 27  ? 95.592  21.992 32.714 1.00 23.10  ? 226 ARG A O   1 
ATOM   215  C CB  . ARG A 1 27  ? 93.986  22.972 35.152 1.00 25.77  ? 226 ARG A CB  1 
ATOM   216  C CG  . ARG A 1 27  ? 93.267  24.234 35.604 1.00 29.04  ? 226 ARG A CG  1 
ATOM   217  C CD  . ARG A 1 27  ? 93.729  25.461 34.836 1.00 30.92  ? 226 ARG A CD  1 
ATOM   218  N NE  . ARG A 1 27  ? 92.595  26.250 34.363 1.00 34.26  ? 226 ARG A NE  1 
ATOM   219  C CZ  . ARG A 1 27  ? 92.703  27.315 33.576 1.00 34.95  ? 226 ARG A CZ  1 
ATOM   220  N NH1 . ARG A 1 27  ? 93.902  27.724 33.177 1.00 35.30  ? 226 ARG A NH1 1 
ATOM   221  N NH2 . ARG A 1 27  ? 91.613  27.952 33.167 1.00 33.80  ? 226 ARG A NH2 1 
ATOM   222  N N   . VAL A 1 28  ? 94.379  20.198 33.288 1.00 20.90  ? 227 VAL A N   1 
ATOM   223  C CA  . VAL A 1 28  ? 95.381  19.281 32.759 1.00 20.15  ? 227 VAL A CA  1 
ATOM   224  C C   . VAL A 1 28  ? 95.173  19.008 31.288 1.00 21.14  ? 227 VAL A C   1 
ATOM   225  O O   . VAL A 1 28  ? 96.100  18.653 30.583 1.00 22.31  ? 227 VAL A O   1 
ATOM   226  C CB  . VAL A 1 28  ? 95.379  17.926 33.462 1.00 18.90  ? 227 VAL A CB  1 
ATOM   227  C CG1 . VAL A 1 28  ? 96.739  17.300 33.321 1.00 17.45  ? 227 VAL A CG1 1 
ATOM   228  C CG2 . VAL A 1 28  ? 95.016  18.074 34.907 1.00 19.33  ? 227 VAL A CG2 1 
ATOM   229  N N   . ILE A 1 29  ? 93.944  19.127 30.819 1.00 21.43  ? 228 ILE A N   1 
ATOM   230  C CA  . ILE A 1 29  ? 93.702  18.904 29.407 1.00 21.78  ? 228 ILE A CA  1 
ATOM   231  C C   . ILE A 1 29  ? 94.343  20.091 28.702 1.00 25.00  ? 228 ILE A C   1 
ATOM   232  O O   . ILE A 1 29  ? 95.192  19.913 27.832 1.00 25.80  ? 228 ILE A O   1 
ATOM   233  C CB  . ILE A 1 29  ? 92.191  18.834 29.107 1.00 19.14  ? 228 ILE A CB  1 
ATOM   234  C CG1 . ILE A 1 29  ? 91.599  17.608 29.801 1.00 16.08  ? 228 ILE A CG1 1 
ATOM   235  C CG2 . ILE A 1 29  ? 91.946  18.774 27.613 1.00 18.38  ? 228 ILE A CG2 1 
ATOM   236  C CD1 . ILE A 1 29  ? 90.101  17.537 29.767 1.00 13.36  ? 228 ILE A CD1 1 
ATOM   237  N N   . LEU A 1 30  ? 93.958  21.300 29.112 1.00 28.23  ? 229 LEU A N   1 
ATOM   238  C CA  . LEU A 1 30  ? 94.495  22.530 28.532 1.00 31.42  ? 229 LEU A CA  1 
ATOM   239  C C   . LEU A 1 30  ? 96.018  22.553 28.631 1.00 35.32  ? 229 LEU A C   1 
ATOM   240  O O   . LEU A 1 30  ? 96.711  22.206 27.683 1.00 35.78  ? 229 LEU A O   1 
ATOM   241  C CB  . LEU A 1 30  ? 93.917  23.759 29.245 1.00 28.66  ? 229 LEU A CB  1 
ATOM   242  C CG  . LEU A 1 30  ? 92.429  24.069 29.046 1.00 27.10  ? 229 LEU A CG  1 
ATOM   243  C CD1 . LEU A 1 30  ? 92.001  25.218 29.944 1.00 26.65  ? 229 LEU A CD1 1 
ATOM   244  C CD2 . LEU A 1 30  ? 92.175  24.413 27.595 1.00 26.69  ? 229 LEU A CD2 1 
ATOM   245  N N   . SER A 1 31  ? 96.528  22.963 29.789 1.00 41.08  ? 230 SER A N   1 
ATOM   246  C CA  . SER A 1 31  ? 97.974  23.041 30.041 1.00 45.76  ? 230 SER A CA  1 
ATOM   247  C C   . SER A 1 31  ? 98.629  21.681 30.027 1.00 46.72  ? 230 SER A C   1 
ATOM   248  O O   . SER A 1 31  ? 99.846  21.551 29.923 1.00 47.92  ? 230 SER A O   1 
ATOM   249  C CB  . SER A 1 31  ? 98.258  23.624 31.431 1.00 47.64  ? 230 SER A CB  1 
ATOM   250  O OG  . SER A 1 31  ? 99.066  22.727 32.196 1.00 50.32  ? 230 SER A OG  1 
ATOM   251  N N   . GLY A 1 32  ? 97.809  20.664 30.149 1.00 47.21  ? 231 GLY A N   1 
ATOM   252  C CA  . GLY A 1 32  ? 98.360  19.347 30.247 1.00 49.24  ? 231 GLY A CA  1 
ATOM   253  C C   . GLY A 1 32  ? 99.102  18.613 29.171 1.00 50.89  ? 231 GLY A C   1 
ATOM   254  O O   . GLY A 1 32  ? 99.430  19.074 28.067 1.00 49.34  ? 231 GLY A O   1 
ATOM   255  N N   . LYS A 1 33  ? 99.342  17.385 29.594 1.00 52.70  ? 232 LYS A N   1 
ATOM   256  C CA  . LYS A 1 33  ? 100.045 16.376 28.865 1.00 53.47  ? 232 LYS A CA  1 
ATOM   257  C C   . LYS A 1 33  ? 99.663  15.071 29.547 1.00 53.55  ? 232 LYS A C   1 
ATOM   258  O O   . LYS A 1 33  ? 98.753  15.044 30.386 1.00 53.49  ? 232 LYS A O   1 
ATOM   259  C CB  . LYS A 1 33  ? 101.529 16.644 28.971 1.00 54.36  ? 232 LYS A CB  1 
ATOM   260  C CG  . LYS A 1 33  ? 101.908 17.384 30.243 1.00 56.15  ? 232 LYS A CG  1 
ATOM   261  C CD  . LYS A 1 33  ? 103.024 18.375 29.957 1.00 57.77  ? 232 LYS A CD  1 
ATOM   262  C CE  . LYS A 1 33  ? 104.020 17.829 28.940 1.00 58.32  ? 232 LYS A CE  1 
ATOM   263  N NZ  . LYS A 1 33  ? 104.900 16.747 29.476 1.00 59.11  ? 232 LYS A NZ  1 
ATOM   264  N N   . ALA A 1 34  ? 100.383 14.007 29.210 1.00 53.30  ? 233 ALA A N   1 
ATOM   265  C CA  . ALA A 1 34  ? 100.086 12.673 29.717 1.00 52.19  ? 233 ALA A CA  1 
ATOM   266  C C   . ALA A 1 34  ? 98.822  12.336 28.936 1.00 50.61  ? 233 ALA A C   1 
ATOM   267  O O   . ALA A 1 34  ? 97.771  12.029 29.497 1.00 51.56  ? 233 ALA A O   1 
ATOM   268  C CB  . ALA A 1 34  ? 99.808  12.695 31.219 1.00 52.53  ? 233 ALA A CB  1 
ATOM   269  N N   . SER A 1 35  ? 98.944  12.439 27.621 1.00 46.93  ? 234 SER A N   1 
ATOM   270  C CA  . SER A 1 35  ? 97.853  12.175 26.716 1.00 43.90  ? 234 SER A CA  1 
ATOM   271  C C   . SER A 1 35  ? 98.332  12.837 25.451 1.00 43.24  ? 234 SER A C   1 
ATOM   272  O O   . SER A 1 35  ? 98.543  14.047 25.434 1.00 44.31  ? 234 SER A O   1 
ATOM   273  C CB  . SER A 1 35  ? 96.579  12.859 27.206 1.00 42.46  ? 234 SER A CB  1 
ATOM   274  O OG  . SER A 1 35  ? 95.430  12.225 26.675 1.00 42.44  ? 234 SER A OG  1 
ATOM   275  N N   . ASN A 1 36  ? 98.547  12.063 24.397 1.00 41.67  ? 235 ASN A N   1 
ATOM   276  C CA  . ASN A 1 36  ? 98.995  12.682 23.167 1.00 39.53  ? 235 ASN A CA  1 
ATOM   277  C C   . ASN A 1 36  ? 97.980  12.585 22.088 1.00 35.92  ? 235 ASN A C   1 
ATOM   278  O O   . ASN A 1 36  ? 98.249  12.197 20.956 1.00 37.37  ? 235 ASN A O   1 
ATOM   279  C CB  . ASN A 1 36  ? 100.301 12.100 22.714 1.00 41.48  ? 235 ASN A CB  1 
ATOM   280  C CG  . ASN A 1 36  ? 101.377 13.112 22.791 1.00 45.49  ? 235 ASN A CG  1 
ATOM   281  O OD1 . ASN A 1 36  ? 102.443 12.859 23.335 1.00 48.26  ? 235 ASN A OD1 1 
ATOM   282  N ND2 . ASN A 1 36  ? 101.097 14.305 22.266 1.00 47.82  ? 235 ASN A ND2 1 
ATOM   283  N N   . ASN A 1 37  ? 96.804  13.019 22.463 1.00 30.38  ? 236 ASN A N   1 
ATOM   284  C CA  . ASN A 1 37  ? 95.682  12.951 21.607 1.00 26.00  ? 236 ASN A CA  1 
ATOM   285  C C   . ASN A 1 37  ? 94.884  13.959 22.358 1.00 24.34  ? 236 ASN A C   1 
ATOM   286  O O   . ASN A 1 37  ? 93.970  13.623 23.103 1.00 25.36  ? 236 ASN A O   1 
ATOM   287  C CB  . ASN A 1 37  ? 95.158  11.535 21.731 1.00 24.08  ? 236 ASN A CB  1 
ATOM   288  C CG  . ASN A 1 37  ? 93.796  11.369 21.180 1.00 22.82  ? 236 ASN A CG  1 
ATOM   289  O OD1 . ASN A 1 37  ? 93.358  12.133 20.328 1.00 22.73  ? 236 ASN A OD1 1 
ATOM   290  N ND2 . ASN A 1 37  ? 93.104  10.348 21.650 1.00 22.14  ? 236 ASN A ND2 1 
ATOM   291  N N   . PRO A 1 38  ? 95.267  15.229 22.209 1.00 22.54  ? 237 PRO A N   1 
ATOM   292  C CA  . PRO A 1 38  ? 94.554  16.283 22.913 1.00 21.81  ? 237 PRO A CA  1 
ATOM   293  C C   . PRO A 1 38  ? 93.241  16.617 22.264 1.00 20.43  ? 237 PRO A C   1 
ATOM   294  O O   . PRO A 1 38  ? 92.865  16.032 21.253 1.00 20.86  ? 237 PRO A O   1 
ATOM   295  C CB  . PRO A 1 38  ? 95.529  17.442 22.852 1.00 23.70  ? 237 PRO A CB  1 
ATOM   296  C CG  . PRO A 1 38  ? 96.091  17.284 21.472 1.00 22.57  ? 237 PRO A CG  1 
ATOM   297  C CD  . PRO A 1 38  ? 96.333  15.792 21.359 1.00 20.17  ? 237 PRO A CD  1 
ATOM   298  N N   . PRO A 1 39  ? 92.516  17.555 22.864 1.00 18.88  ? 238 PRO A N   1 
ATOM   299  C CA  . PRO A 1 39  ? 91.229  18.005 22.371 1.00 17.41  ? 238 PRO A CA  1 
ATOM   300  C C   . PRO A 1 39  ? 91.328  18.224 20.882 1.00 16.60  ? 238 PRO A C   1 
ATOM   301  O O   . PRO A 1 39  ? 92.422  18.382 20.333 1.00 16.79  ? 238 PRO A O   1 
ATOM   302  C CB  . PRO A 1 39  ? 90.995  19.301 23.151 1.00 19.44  ? 238 PRO A CB  1 
ATOM   303  C CG  . PRO A 1 39  ? 92.308  19.523 23.964 1.00 20.21  ? 238 PRO A CG  1 
ATOM   304  C CD  . PRO A 1 39  ? 92.806  18.156 24.169 1.00 19.33  ? 238 PRO A CD  1 
ATOM   305  N N   . PHE A 1 40  ? 90.179  18.201 20.229 1.00 15.17  ? 239 PHE A N   1 
ATOM   306  C CA  . PHE A 1 40  ? 90.119  18.411 18.802 1.00 15.38  ? 239 PHE A CA  1 
ATOM   307  C C   . PHE A 1 40  ? 89.872  19.901 18.683 1.00 16.11  ? 239 PHE A C   1 
ATOM   308  O O   . PHE A 1 40  ? 88.925  20.413 19.271 1.00 16.53  ? 239 PHE A O   1 
ATOM   309  C CB  . PHE A 1 40  ? 88.966  17.589 18.227 1.00 13.72  ? 239 PHE A CB  1 
ATOM   310  C CG  . PHE A 1 40  ? 88.517  18.036 16.882 1.00 14.00  ? 239 PHE A CG  1 
ATOM   311  C CD1 . PHE A 1 40  ? 89.424  18.199 15.847 1.00 12.59  ? 239 PHE A CD1 1 
ATOM   312  C CD2 . PHE A 1 40  ? 87.173  18.300 16.646 1.00 14.30  ? 239 PHE A CD2 1 
ATOM   313  C CE1 . PHE A 1 40  ? 88.994  18.620 14.597 1.00 12.89  ? 239 PHE A CE1 1 
ATOM   314  C CE2 . PHE A 1 40  ? 86.736  18.721 15.398 1.00 12.98  ? 239 PHE A CE2 1 
ATOM   315  C CZ  . PHE A 1 40  ? 87.647  18.880 14.374 1.00 12.22  ? 239 PHE A CZ  1 
ATOM   316  N N   . VAL A 1 41  ? 90.734  20.607 17.956 1.00 16.94  ? 240 VAL A N   1 
ATOM   317  C CA  . VAL A 1 41  ? 90.572  22.051 17.817 1.00 17.50  ? 240 VAL A CA  1 
ATOM   318  C C   . VAL A 1 41  ? 89.544  22.465 16.773 1.00 19.17  ? 240 VAL A C   1 
ATOM   319  O O   . VAL A 1 41  ? 89.586  22.016 15.622 1.00 19.94  ? 240 VAL A O   1 
ATOM   320  C CB  . VAL A 1 41  ? 91.900  22.740 17.464 1.00 15.94  ? 240 VAL A CB  1 
ATOM   321  C CG1 . VAL A 1 41  ? 91.695  24.236 17.403 1.00 15.41  ? 240 VAL A CG1 1 
ATOM   322  C CG2 . VAL A 1 41  ? 92.951  22.395 18.483 1.00 14.93  ? 240 VAL A CG2 1 
ATOM   323  N N   . ILE A 1 42  ? 88.615  23.316 17.194 1.00 19.60  ? 241 ILE A N   1 
ATOM   324  C CA  . ILE A 1 42  ? 87.590  23.840 16.306 1.00 21.46  ? 241 ILE A CA  1 
ATOM   325  C C   . ILE A 1 42  ? 88.017  25.282 16.051 1.00 25.57  ? 241 ILE A C   1 
ATOM   326  O O   . ILE A 1 42  ? 87.672  26.179 16.825 1.00 26.01  ? 241 ILE A O   1 
ATOM   327  C CB  . ILE A 1 42  ? 86.202  23.845 16.975 1.00 18.39  ? 241 ILE A CB  1 
ATOM   328  C CG1 . ILE A 1 42  ? 85.781  22.416 17.312 1.00 16.75  ? 241 ILE A CG1 1 
ATOM   329  C CG2 . ILE A 1 42  ? 85.185  24.501 16.058 1.00 16.82  ? 241 ILE A CG2 1 
ATOM   330  C CD1 . ILE A 1 42  ? 84.445  22.320 18.024 1.00 15.00  ? 241 ILE A CD1 1 
ATOM   331  N N   . HIS A 1 43  ? 88.776  25.506 14.978 1.00 28.88  ? 242 HIS A N   1 
ATOM   332  C CA  . HIS A 1 43  ? 89.254  26.852 14.676 1.00 32.18  ? 242 HIS A CA  1 
ATOM   333  C C   . HIS A 1 43  ? 88.618  27.562 13.482 1.00 33.82  ? 242 HIS A C   1 
ATOM   334  O O   . HIS A 1 43  ? 89.003  28.684 13.154 1.00 35.58  ? 242 HIS A O   1 
ATOM   335  C CB  . HIS A 1 43  ? 90.775  26.847 14.510 1.00 32.90  ? 242 HIS A CB  1 
ATOM   336  C CG  . HIS A 1 43  ? 91.255  26.083 13.318 1.00 34.47  ? 242 HIS A CG  1 
ATOM   337  N ND1 . HIS A 1 43  ? 92.017  24.939 13.425 1.00 36.14  ? 242 HIS A ND1 1 
ATOM   338  C CD2 . HIS A 1 43  ? 91.101  26.310 11.993 1.00 34.37  ? 242 HIS A CD2 1 
ATOM   339  C CE1 . HIS A 1 43  ? 92.312  24.494 12.216 1.00 35.76  ? 242 HIS A CE1 1 
ATOM   340  N NE2 . HIS A 1 43  ? 91.768  25.308 11.330 1.00 35.83  ? 242 HIS A NE2 1 
ATOM   341  N N   . ASP A 1 44  ? 87.661  26.921 12.822 1.00 34.49  ? 243 ASP A N   1 
ATOM   342  C CA  . ASP A 1 44  ? 86.987  27.559 11.701 1.00 34.84  ? 243 ASP A CA  1 
ATOM   343  C C   . ASP A 1 44  ? 85.675  26.868 11.359 1.00 33.78  ? 243 ASP A C   1 
ATOM   344  O O   . ASP A 1 44  ? 85.204  26.006 12.097 1.00 34.69  ? 243 ASP A O   1 
ATOM   345  C CB  . ASP A 1 44  ? 87.905  27.629 10.471 1.00 37.88  ? 243 ASP A CB  1 
ATOM   346  C CG  . ASP A 1 44  ? 88.331  26.265 9.969  1.00 41.24  ? 243 ASP A CG  1 
ATOM   347  O OD1 . ASP A 1 44  ? 87.450  25.398 9.783  1.00 43.74  ? 243 ASP A OD1 1 
ATOM   348  O OD2 . ASP A 1 44  ? 89.546  26.067 9.739  1.00 42.83  ? 243 ASP A OD2 1 
ATOM   349  N N   . MET A 1 45  ? 85.082  27.258 10.241 1.00 32.23  ? 244 MET A N   1 
ATOM   350  C CA  . MET A 1 45  ? 83.816  26.691 9.816  1.00 30.94  ? 244 MET A CA  1 
ATOM   351  C C   . MET A 1 45  ? 83.864  25.227 9.398  1.00 29.52  ? 244 MET A C   1 
ATOM   352  O O   . MET A 1 45  ? 82.890  24.500 9.579  1.00 28.91  ? 244 MET A O   1 
ATOM   353  C CB  . MET A 1 45  ? 83.251  27.529 8.677  1.00 32.70  ? 244 MET A CB  1 
ATOM   354  C CG  . MET A 1 45  ? 82.619  28.833 9.127  1.00 35.38  ? 244 MET A CG  1 
ATOM   355  S SD  . MET A 1 45  ? 81.064  28.556 9.994  1.00 39.64  ? 244 MET A SD  1 
ATOM   356  C CE  . MET A 1 45  ? 80.576  26.938 9.388  1.00 37.44  ? 244 MET A CE  1 
ATOM   357  N N   . GLU A 1 46  ? 84.987  24.792 8.836  1.00 28.39  ? 245 GLU A N   1 
ATOM   358  C CA  . GLU A 1 46  ? 85.115  23.410 8.388  1.00 27.70  ? 245 GLU A CA  1 
ATOM   359  C C   . GLU A 1 46  ? 85.179  22.456 9.568  1.00 26.77  ? 245 GLU A C   1 
ATOM   360  O O   . GLU A 1 46  ? 84.432  21.473 9.629  1.00 27.14  ? 245 GLU A O   1 
ATOM   361  C CB  . GLU A 1 46  ? 86.370  23.231 7.544  1.00 28.31  ? 245 GLU A CB  1 
ATOM   362  C CG  . GLU A 1 46  ? 86.402  21.910 6.797  1.00 33.62  ? 245 GLU A CG  1 
ATOM   363  C CD  . GLU A 1 46  ? 87.815  21.384 6.592  1.00 37.96  ? 245 GLU A CD  1 
ATOM   364  O OE1 . GLU A 1 46  ? 88.730  22.202 6.344  1.00 41.23  ? 245 GLU A OE1 1 
ATOM   365  O OE2 . GLU A 1 46  ? 88.012  20.149 6.667  1.00 39.56  ? 245 GLU A OE2 1 
ATOM   366  N N   . THR A 1 47  ? 86.086  22.746 10.501 1.00 24.96  ? 246 THR A N   1 
ATOM   367  C CA  . THR A 1 47  ? 86.257  21.918 11.688 1.00 21.67  ? 246 THR A CA  1 
ATOM   368  C C   . THR A 1 47  ? 85.021  22.016 12.574 1.00 21.75  ? 246 THR A C   1 
ATOM   369  O O   . THR A 1 47  ? 84.653  21.043 13.236 1.00 20.35  ? 246 THR A O   1 
ATOM   370  C CB  . THR A 1 47  ? 87.520  22.319 12.493 1.00 18.80  ? 246 THR A CB  1 
ATOM   371  O OG1 . THR A 1 47  ? 87.521  23.730 12.712 1.00 18.21  ? 246 THR A OG1 1 
ATOM   372  C CG2 . THR A 1 47  ? 88.780  21.933 11.746 1.00 15.50  ? 246 THR A CG2 1 
ATOM   373  N N   . LEU A 1 48  ? 84.373  23.181 12.580 1.00 21.79  ? 247 LEU A N   1 
ATOM   374  C CA  . LEU A 1 48  ? 83.162  23.340 13.373 1.00 24.23  ? 247 LEU A CA  1 
ATOM   375  C C   . LEU A 1 48  ? 82.069  22.475 12.775 1.00 27.85  ? 247 LEU A C   1 
ATOM   376  O O   . LEU A 1 48  ? 81.087  22.157 13.446 1.00 30.51  ? 247 LEU A O   1 
ATOM   377  C CB  . LEU A 1 48  ? 82.657  24.783 13.391 1.00 22.11  ? 247 LEU A CB  1 
ATOM   378  C CG  . LEU A 1 48  ? 81.225  24.867 13.965 1.00 20.40  ? 247 LEU A CG  1 
ATOM   379  C CD1 . LEU A 1 48  ? 81.264  24.685 15.468 1.00 18.99  ? 247 LEU A CD1 1 
ATOM   380  C CD2 . LEU A 1 48  ? 80.572  26.185 13.616 1.00 19.72  ? 247 LEU A CD2 1 
ATOM   381  N N   . CYS A 1 49  ? 82.214  22.105 11.508 1.00 30.59  ? 248 CYS A N   1 
ATOM   382  C CA  . CYS A 1 49  ? 81.198  21.269 10.898 1.00 33.00  ? 248 CYS A CA  1 
ATOM   383  C C   . CYS A 1 49  ? 81.398  19.817 11.235 1.00 34.75  ? 248 CYS A C   1 
ATOM   384  O O   . CYS A 1 49  ? 80.428  19.085 11.423 1.00 35.64  ? 248 CYS A O   1 
ATOM   385  C CB  . CYS A 1 49  ? 81.157  21.477 9.401  1.00 33.09  ? 248 CYS A CB  1 
ATOM   386  S SG  . CYS A 1 49  ? 79.975  22.760 9.049  1.00 36.83  ? 248 CYS A SG  1 
ATOM   387  N N   . MET A 1 50  ? 82.653  19.399 11.320 1.00 35.90  ? 249 MET A N   1 
ATOM   388  C CA  . MET A 1 50  ? 82.934  18.029 11.692 1.00 36.95  ? 249 MET A CA  1 
ATOM   389  C C   . MET A 1 50  ? 82.357  17.926 13.092 1.00 38.51  ? 249 MET A C   1 
ATOM   390  O O   . MET A 1 50  ? 81.390  17.205 13.329 1.00 39.02  ? 249 MET A O   1 
ATOM   391  C CB  . MET A 1 50  ? 84.432  17.801 11.712 1.00 35.05  ? 249 MET A CB  1 
ATOM   392  C CG  . MET A 1 50  ? 85.093  18.284 10.441 1.00 34.21  ? 249 MET A CG  1 
ATOM   393  S SD  . MET A 1 50  ? 86.666  17.454 10.175 1.00 37.75  ? 249 MET A SD  1 
ATOM   394  C CE  . MET A 1 50  ? 87.775  18.829 9.883  1.00 37.38  ? 249 MET A CE  1 
ATOM   395  N N   . ALA A 1 51  ? 82.937  18.702 13.999 1.00 40.31  ? 250 ALA A N   1 
ATOM   396  C CA  . ALA A 1 51  ? 82.517  18.744 15.391 1.00 42.70  ? 250 ALA A CA  1 
ATOM   397  C C   . ALA A 1 51  ? 81.011  18.641 15.582 1.00 44.62  ? 250 ALA A C   1 
ATOM   398  O O   . ALA A 1 51  ? 80.495  17.617 16.027 1.00 45.71  ? 250 ALA A O   1 
ATOM   399  C CB  . ALA A 1 51  ? 83.017  20.018 16.028 1.00 42.37  ? 250 ALA A CB  1 
ATOM   400  N N   . GLU A 1 52  ? 80.311  19.714 15.246 1.00 46.96  ? 251 GLU A N   1 
ATOM   401  C CA  . GLU A 1 52  ? 78.863  19.770 15.403 1.00 50.35  ? 251 GLU A CA  1 
ATOM   402  C C   . GLU A 1 52  ? 78.114  18.636 14.687 1.00 51.70  ? 251 GLU A C   1 
ATOM   403  O O   . GLU A 1 52  ? 77.020  18.237 15.107 1.00 51.04  ? 251 GLU A O   1 
ATOM   404  C CB  . GLU A 1 52  ? 78.375  21.160 14.951 1.00 51.79  ? 251 GLU A CB  1 
ATOM   405  C CG  . GLU A 1 52  ? 77.531  21.226 13.688 1.00 53.54  ? 251 GLU A CG  1 
ATOM   406  C CD  . GLU A 1 52  ? 76.044  21.253 13.989 1.00 54.57  ? 251 GLU A CD  1 
ATOM   407  O OE1 . GLU A 1 52  ? 75.270  21.634 13.090 1.00 54.88  ? 251 GLU A OE1 1 
ATOM   408  O OE2 . GLU A 1 52  ? 75.646  20.887 15.117 1.00 55.25  ? 251 GLU A OE2 1 
ATOM   409  N N   . LYS A 1 53  ? 78.722  18.101 13.632 1.00 53.27  ? 252 LYS A N   1 
ATOM   410  C CA  . LYS A 1 53  ? 78.119  17.022 12.850 1.00 55.80  ? 252 LYS A CA  1 
ATOM   411  C C   . LYS A 1 53  ? 78.067  15.691 13.604 1.00 57.05  ? 252 LYS A C   1 
ATOM   412  O O   . LYS A 1 53  ? 77.009  15.074 13.713 1.00 57.55  ? 252 LYS A O   1 
ATOM   413  C CB  . LYS A 1 53  ? 78.899  16.825 11.551 1.00 56.65  ? 252 LYS A CB  1 
ATOM   414  C CG  . LYS A 1 53  ? 78.160  16.057 10.467 1.00 57.95  ? 252 LYS A CG  1 
ATOM   415  C CD  . LYS A 1 53  ? 79.128  15.573 9.399  1.00 58.19  ? 252 LYS A CD  1 
ATOM   416  C CE  . LYS A 1 53  ? 79.945  16.715 8.816  1.00 57.65  ? 252 LYS A CE  1 
ATOM   417  N NZ  . LYS A 1 53  ? 81.249  16.217 8.298  1.00 58.37  ? 252 LYS A NZ  1 
ATOM   418  N N   . THR A 1 54  ? 79.212  15.242 14.106 1.00 58.25  ? 253 THR A N   1 
ATOM   419  C CA  . THR A 1 54  ? 79.273  13.985 14.840 1.00 59.34  ? 253 THR A CA  1 
ATOM   420  C C   . THR A 1 54  ? 78.486  14.120 16.120 1.00 61.81  ? 253 THR A C   1 
ATOM   421  O O   . THR A 1 54  ? 77.910  13.155 16.623 1.00 62.36  ? 253 THR A O   1 
ATOM   422  C CB  . THR A 1 54  ? 80.700  13.622 15.261 1.00 57.95  ? 253 THR A CB  1 
ATOM   423  O OG1 . THR A 1 54  ? 80.786  13.664 16.689 1.00 55.94  ? 253 THR A OG1 1 
ATOM   424  C CG2 . THR A 1 54  ? 81.703  14.595 14.679 1.00 57.59  ? 253 THR A CG2 1 
ATOM   425  N N   . LEU A 1 55  ? 78.479  15.337 16.643 1.00 65.04  ? 254 LEU A N   1 
ATOM   426  C CA  . LEU A 1 55  ? 77.806  15.635 17.889 1.00 69.08  ? 254 LEU A CA  1 
ATOM   427  C C   . LEU A 1 55  ? 76.325  15.295 17.948 1.00 72.74  ? 254 LEU A C   1 
ATOM   428  O O   . LEU A 1 55  ? 75.874  14.671 18.907 1.00 73.40  ? 254 LEU A O   1 
ATOM   429  C CB  . LEU A 1 55  ? 77.999  17.102 18.242 1.00 67.84  ? 254 LEU A CB  1 
ATOM   430  C CG  . LEU A 1 55  ? 78.380  17.261 19.708 1.00 66.98  ? 254 LEU A CG  1 
ATOM   431  C CD1 . LEU A 1 55  ? 79.803  16.802 19.912 1.00 66.81  ? 254 LEU A CD1 1 
ATOM   432  C CD2 . LEU A 1 55  ? 78.232  18.692 20.115 1.00 67.17  ? 254 LEU A CD2 1 
ATOM   433  N N   . VAL A 1 56  ? 75.558  15.693 16.943 1.00 76.94  ? 255 VAL A N   1 
ATOM   434  C CA  . VAL A 1 56  ? 74.137  15.394 16.988 1.00 81.92  ? 255 VAL A CA  1 
ATOM   435  C C   . VAL A 1 56  ? 73.817  14.007 16.428 1.00 86.21  ? 255 VAL A C   1 
ATOM   436  O O   . VAL A 1 56  ? 72.660  13.584 16.419 1.00 86.36  ? 255 VAL A O   1 
ATOM   437  C CB  . VAL A 1 56  ? 73.340  16.474 16.261 1.00 81.15  ? 255 VAL A CB  1 
ATOM   438  C CG1 . VAL A 1 56  ? 71.884  16.418 16.695 1.00 81.19  ? 255 VAL A CG1 1 
ATOM   439  C CG2 . VAL A 1 56  ? 73.939  17.840 16.576 1.00 81.34  ? 255 VAL A CG2 1 
ATOM   440  N N   . ALA A 1 57  ? 74.869  13.309 15.991 1.00 91.60  ? 256 ALA A N   1 
ATOM   441  C CA  . ALA A 1 57  ? 74.823  11.946 15.435 1.00 96.98  ? 256 ALA A CA  1 
ATOM   442  C C   . ALA A 1 57  ? 73.591  11.550 14.609 1.00 101.13 ? 256 ALA A C   1 
ATOM   443  O O   . ALA A 1 57  ? 73.250  10.366 14.497 1.00 102.11 ? 256 ALA A O   1 
ATOM   444  C CB  . ALA A 1 57  ? 75.051  10.927 16.558 1.00 96.05  ? 256 ALA A CB  1 
ATOM   445  N N   . LYS A 1 58  ? 72.944  12.553 14.026 1.00 105.29 ? 257 LYS A N   1 
ATOM   446  C CA  . LYS A 1 58  ? 71.765  12.379 13.180 1.00 109.06 ? 257 LYS A CA  1 
ATOM   447  C C   . LYS A 1 58  ? 72.041  13.299 11.988 1.00 111.99 ? 257 LYS A C   1 
ATOM   448  O O   . LYS A 1 58  ? 71.130  13.721 11.272 1.00 112.78 ? 257 LYS A O   1 
ATOM   449  C CB  . LYS A 1 58  ? 70.509  12.834 13.951 1.00 108.26 ? 257 LYS A CB  1 
ATOM   450  C CG  . LYS A 1 58  ? 69.368  13.376 13.101 1.00 107.58 ? 257 LYS A CG  1 
ATOM   451  C CD  . LYS A 1 58  ? 68.297  14.047 13.945 1.00 106.65 ? 257 LYS A CD  1 
ATOM   452  C CE  . LYS A 1 58  ? 67.332  14.850 13.087 1.00 106.18 ? 257 LYS A CE  1 
ATOM   453  N NZ  . LYS A 1 58  ? 67.524  16.314 13.263 1.00 106.35 ? 257 LYS A NZ  1 
ATOM   454  N N   . LEU A 1 59  ? 73.322  13.604 11.779 1.00 114.74 ? 258 LEU A N   1 
ATOM   455  C CA  . LEU A 1 59  ? 73.699  14.521 10.713 1.00 117.13 ? 258 LEU A CA  1 
ATOM   456  C C   . LEU A 1 59  ? 74.809  14.093 9.730  1.00 118.42 ? 258 LEU A C   1 
ATOM   457  O O   . LEU A 1 59  ? 75.743  14.857 9.471  1.00 118.40 ? 258 LEU A O   1 
ATOM   458  C CB  . LEU A 1 59  ? 74.048  15.885 11.337 1.00 117.52 ? 258 LEU A CB  1 
ATOM   459  C CG  . LEU A 1 59  ? 73.574  16.213 12.770 1.00 118.15 ? 258 LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 59  ? 73.870  17.675 13.030 1.00 118.74 ? 258 LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 59  ? 72.083  15.956 12.983 1.00 118.22 ? 258 LEU A CD2 1 
ATOM   462  N N   . VAL A 1 60  ? 74.702  12.876 9.193  1.00 119.93 ? 259 VAL A N   1 
ATOM   463  C CA  . VAL A 1 60  ? 75.643  12.360 8.187  1.00 121.24 ? 259 VAL A CA  1 
ATOM   464  C C   . VAL A 1 60  ? 74.808  11.502 7.229  1.00 122.19 ? 259 VAL A C   1 
ATOM   465  O O   . VAL A 1 60  ? 75.265  10.530 6.629  1.00 122.59 ? 259 VAL A O   1 
ATOM   466  C CB  . VAL A 1 60  ? 76.862  11.583 8.832  1.00 121.10 ? 259 VAL A CB  1 
ATOM   467  C CG1 . VAL A 1 60  ? 76.996  10.159 8.301  1.00 120.33 ? 259 VAL A CG1 1 
ATOM   468  C CG2 . VAL A 1 60  ? 78.148  12.344 8.521  1.00 120.95 ? 259 VAL A CG2 1 
ATOM   469  N N   . ALA A 1 61  ? 73.554  11.922 7.095  1.00 123.04 ? 260 ALA A N   1 
ATOM   470  C CA  . ALA A 1 61  ? 72.572  11.294 6.226  1.00 123.84 ? 260 ALA A CA  1 
ATOM   471  C C   . ALA A 1 61  ? 71.424  12.292 6.099  1.00 124.45 ? 260 ALA A C   1 
ATOM   472  O O   . ALA A 1 61  ? 70.846  12.459 5.026  1.00 124.55 ? 260 ALA A O   1 
ATOM   473  C CB  . ALA A 1 61  ? 72.072  9.987  6.841  1.00 123.71 ? 260 ALA A CB  1 
ATOM   474  N N   . ASN A 1 62  ? 71.141  12.978 7.207  1.00 125.37 ? 261 ASN A N   1 
ATOM   475  C CA  . ASN A 1 62  ? 70.055  13.959 7.316  1.00 126.40 ? 261 ASN A CA  1 
ATOM   476  C C   . ASN A 1 62  ? 70.105  15.275 6.530  1.00 127.00 ? 261 ASN A C   1 
ATOM   477  O O   . ASN A 1 62  ? 69.226  15.529 5.704  1.00 127.41 ? 261 ASN A O   1 
ATOM   478  C CB  . ASN A 1 62  ? 69.812  14.277 8.793  1.00 126.28 ? 261 ASN A CB  1 
ATOM   479  C CG  . ASN A 1 62  ? 68.730  13.410 9.402  1.00 126.47 ? 261 ASN A CG  1 
ATOM   480  O OD1 . ASN A 1 62  ? 68.345  12.387 8.835  1.00 127.00 ? 261 ASN A OD1 1 
ATOM   481  N ND2 . ASN A 1 62  ? 68.234  13.811 10.563 1.00 125.95 ? 261 ASN A ND2 1 
ATOM   482  N N   . GLY A 1 63  ? 71.093  16.126 6.803  1.00 127.23 ? 262 GLY A N   1 
ATOM   483  C CA  . GLY A 1 63  ? 71.174  17.390 6.087  1.00 127.10 ? 262 GLY A CA  1 
ATOM   484  C C   . GLY A 1 63  ? 71.719  18.562 6.888  1.00 127.06 ? 262 GLY A C   1 
ATOM   485  O O   . GLY A 1 63  ? 72.121  19.575 6.310  1.00 127.57 ? 262 GLY A O   1 
ATOM   486  N N   . ILE A 1 64  ? 71.718  18.442 8.212  1.00 126.51 ? 263 ILE A N   1 
ATOM   487  C CA  . ILE A 1 64  ? 72.241  19.500 9.070  1.00 125.66 ? 263 ILE A CA  1 
ATOM   488  C C   . ILE A 1 64  ? 73.767  19.494 8.944  1.00 125.45 ? 263 ILE A C   1 
ATOM   489  O O   . ILE A 1 64  ? 74.473  18.902 9.769  1.00 124.83 ? 263 ILE A O   1 
ATOM   490  C CB  . ILE A 1 64  ? 71.820  19.291 10.552 1.00 125.48 ? 263 ILE A CB  1 
ATOM   491  C CG1 . ILE A 1 64  ? 71.461  17.825 10.796 1.00 125.13 ? 263 ILE A CG1 1 
ATOM   492  C CG2 . ILE A 1 64  ? 70.633  20.187 10.902 1.00 125.13 ? 263 ILE A CG2 1 
ATOM   493  C CD1 . ILE A 1 64  ? 70.088  17.399 10.307 1.00 125.24 ? 263 ILE A CD1 1 
ATOM   494  N N   . GLN A 1 65  ? 74.258  20.155 7.892  1.00 125.39 ? 264 GLN A N   1 
ATOM   495  C CA  . GLN A 1 65  ? 75.690  20.232 7.601  1.00 124.77 ? 264 GLN A CA  1 
ATOM   496  C C   . GLN A 1 65  ? 76.138  21.541 6.936  1.00 124.17 ? 264 GLN A C   1 
ATOM   497  O O   . GLN A 1 65  ? 77.265  21.606 6.445  1.00 124.18 ? 264 GLN A O   1 
ATOM   498  C CB  . GLN A 1 65  ? 76.103  19.077 6.675  1.00 124.83 ? 264 GLN A CB  1 
ATOM   499  C CG  . GLN A 1 65  ? 75.999  19.436 5.196  1.00 124.87 ? 264 GLN A CG  1 
ATOM   500  C CD  . GLN A 1 65  ? 75.202  18.440 4.381  1.00 124.77 ? 264 GLN A CD  1 
ATOM   501  O OE1 . GLN A 1 65  ? 74.632  18.787 3.345  1.00 124.93 ? 264 GLN A OE1 1 
ATOM   502  N NE2 . GLN A 1 65  ? 75.165  17.194 4.835  1.00 124.24 ? 264 GLN A NE2 1 
ATOM   503  N N   . ASN A 1 66  ? 75.289  22.569 6.880  1.00 123.49 ? 265 ASN A N   1 
ATOM   504  C CA  . ASN A 1 66  ? 75.735  23.812 6.242  1.00 122.63 ? 265 ASN A CA  1 
ATOM   505  C C   . ASN A 1 66  ? 74.860  25.070 6.384  1.00 121.54 ? 265 ASN A C   1 
ATOM   506  O O   . ASN A 1 66  ? 75.059  26.059 5.671  1.00 121.40 ? 265 ASN A O   1 
ATOM   507  C CB  . ASN A 1 66  ? 76.092  23.513 4.762  1.00 122.94 ? 265 ASN A CB  1 
ATOM   508  C CG  . ASN A 1 66  ? 75.102  24.088 3.759  1.00 122.98 ? 265 ASN A CG  1 
ATOM   509  O OD1 . ASN A 1 66  ? 73.885  23.986 3.921  1.00 122.89 ? 265 ASN A OD1 1 
ATOM   510  N ND2 . ASN A 1 66  ? 75.635  24.674 2.691  1.00 122.99 ? 265 ASN A ND2 1 
ATOM   511  N N   . LYS A 1 67  ? 73.910  25.046 7.317  1.00 119.86 ? 266 LYS A N   1 
ATOM   512  C CA  . LYS A 1 67  ? 73.069  26.217 7.553  1.00 117.78 ? 266 LYS A CA  1 
ATOM   513  C C   . LYS A 1 67  ? 73.995  27.248 8.171  1.00 116.55 ? 266 LYS A C   1 
ATOM   514  O O   . LYS A 1 67  ? 75.108  26.897 8.572  1.00 116.59 ? 266 LYS A O   1 
ATOM   515  C CB  . LYS A 1 67  ? 71.949  25.901 8.543  1.00 117.51 ? 266 LYS A CB  1 
ATOM   516  C CG  . LYS A 1 67  ? 70.854  25.007 7.996  1.00 117.51 ? 266 LYS A CG  1 
ATOM   517  C CD  . LYS A 1 67  ? 71.187  23.534 8.143  1.00 117.17 ? 266 LYS A CD  1 
ATOM   518  C CE  . LYS A 1 67  ? 69.913  22.716 8.025  1.00 116.71 ? 266 LYS A CE  1 
ATOM   519  N NZ  . LYS A 1 67  ? 70.084  21.329 8.505  1.00 115.61 ? 266 LYS A NZ  1 
ATOM   520  N N   . GLU A 1 68  ? 73.567  28.509 8.246  1.00 114.84 ? 267 GLU A N   1 
ATOM   521  C CA  . GLU A 1 68  ? 74.428  29.513 8.858  1.00 112.63 ? 267 GLU A CA  1 
ATOM   522  C C   . GLU A 1 68  ? 75.047  28.768 10.026 1.00 111.40 ? 267 GLU A C   1 
ATOM   523  O O   . GLU A 1 68  ? 74.378  27.964 10.676 1.00 111.87 ? 267 GLU A O   1 
ATOM   524  C CB  . GLU A 1 68  ? 73.621  30.717 9.347  1.00 112.21 ? 267 GLU A CB  1 
ATOM   525  C CG  . GLU A 1 68  ? 72.200  30.408 9.783  1.00 111.52 ? 267 GLU A CG  1 
ATOM   526  C CD  . GLU A 1 68  ? 71.483  31.648 10.260 1.00 111.41 ? 267 GLU A CD  1 
ATOM   527  O OE1 . GLU A 1 68  ? 72.142  32.702 10.357 1.00 111.87 ? 267 GLU A OE1 1 
ATOM   528  O OE2 . GLU A 1 68  ? 70.271  31.575 10.545 1.00 110.76 ? 267 GLU A OE2 1 
ATOM   529  N N   . ALA A 1 69  ? 76.330  28.980 10.269 1.00 109.00 ? 268 ALA A N   1 
ATOM   530  C CA  . ALA A 1 69  ? 76.969  28.261 11.354 1.00 106.36 ? 268 ALA A CA  1 
ATOM   531  C C   . ALA A 1 69  ? 76.745  28.981 12.653 1.00 104.52 ? 268 ALA A C   1 
ATOM   532  O O   . ALA A 1 69  ? 76.579  28.367 13.703 1.00 104.51 ? 268 ALA A O   1 
ATOM   533  C CB  . ALA A 1 69  ? 78.412  28.137 11.092 1.00 106.26 ? 268 ALA A CB  1 
ATOM   534  N N   . GLU A 1 70  ? 76.753  30.300 12.571 1.00 102.17 ? 269 GLU A N   1 
ATOM   535  C CA  . GLU A 1 70  ? 76.538  31.122 13.734 1.00 99.59  ? 269 GLU A CA  1 
ATOM   536  C C   . GLU A 1 70  ? 75.386  30.533 14.563 1.00 97.85  ? 269 GLU A C   1 
ATOM   537  O O   . GLU A 1 70  ? 75.383  30.638 15.784 1.00 98.00  ? 269 GLU A O   1 
ATOM   538  C CB  . GLU A 1 70  ? 76.232  32.546 13.273 1.00 99.31  ? 269 GLU A CB  1 
ATOM   539  C CG  . GLU A 1 70  ? 76.085  32.702 11.760 1.00 99.19  ? 269 GLU A CG  1 
ATOM   540  C CD  . GLU A 1 70  ? 77.396  32.927 11.006 1.00 99.02  ? 269 GLU A CD  1 
ATOM   541  O OE1 . GLU A 1 70  ? 78.219  33.752 11.454 1.00 98.84  ? 269 GLU A OE1 1 
ATOM   542  O OE2 . GLU A 1 70  ? 77.592  32.294 9.944  1.00 98.72  ? 269 GLU A OE2 1 
ATOM   543  N N   . VAL A 1 71  ? 74.438  29.873 13.899 1.00 95.93  ? 270 VAL A N   1 
ATOM   544  C CA  . VAL A 1 71  ? 73.277  29.278 14.571 1.00 94.18  ? 270 VAL A CA  1 
ATOM   545  C C   . VAL A 1 71  ? 73.396  27.776 14.876 1.00 92.52  ? 270 VAL A C   1 
ATOM   546  O O   . VAL A 1 71  ? 72.520  27.191 15.520 1.00 92.36  ? 270 VAL A O   1 
ATOM   547  C CB  . VAL A 1 71  ? 71.995  29.515 13.736 1.00 95.01  ? 270 VAL A CB  1 
ATOM   548  C CG1 . VAL A 1 71  ? 70.756  29.119 14.536 1.00 95.11  ? 270 VAL A CG1 1 
ATOM   549  C CG2 . VAL A 1 71  ? 71.918  30.977 13.319 1.00 95.87  ? 270 VAL A CG2 1 
ATOM   550  N N   . ARG A 1 72  ? 74.473  27.154 14.407 1.00 90.45  ? 271 ARG A N   1 
ATOM   551  C CA  . ARG A 1 72  ? 74.718  25.731 14.648 1.00 88.49  ? 271 ARG A CA  1 
ATOM   552  C C   . ARG A 1 72  ? 75.314  25.583 16.047 1.00 87.90  ? 271 ARG A C   1 
ATOM   553  O O   . ARG A 1 72  ? 74.986  24.663 16.797 1.00 87.54  ? 271 ARG A O   1 
ATOM   554  C CB  . ARG A 1 72  ? 75.712  25.183 13.614 1.00 87.20  ? 271 ARG A CB  1 
ATOM   555  C CG  . ARG A 1 72  ? 75.117  24.219 12.598 1.00 85.13  ? 271 ARG A CG  1 
ATOM   556  C CD  . ARG A 1 72  ? 75.078  24.790 11.190 1.00 82.82  ? 271 ARG A CD  1 
ATOM   557  N NE  . ARG A 1 72  ? 76.404  25.133 10.684 1.00 80.15  ? 271 ARG A NE  1 
ATOM   558  C CZ  . ARG A 1 72  ? 77.376  24.260 10.449 1.00 78.18  ? 271 ARG A CZ  1 
ATOM   559  N NH1 . ARG A 1 72  ? 77.193  22.963 10.668 1.00 76.59  ? 271 ARG A NH1 1 
ATOM   560  N NH2 . ARG A 1 72  ? 78.537  24.698 9.989  1.00 76.69  ? 271 ARG A NH2 1 
ATOM   561  N N   . ILE A 1 73  ? 76.196  26.519 16.373 1.00 87.49  ? 272 ILE A N   1 
ATOM   562  C CA  . ILE A 1 73  ? 76.893  26.569 17.650 1.00 86.99  ? 272 ILE A CA  1 
ATOM   563  C C   . ILE A 1 73  ? 75.897  26.837 18.774 1.00 88.43  ? 272 ILE A C   1 
ATOM   564  O O   . ILE A 1 73  ? 76.114  26.479 19.928 1.00 88.72  ? 272 ILE A O   1 
ATOM   565  C CB  . ILE A 1 73  ? 77.946  27.685 17.609 1.00 85.14  ? 272 ILE A CB  1 
ATOM   566  C CG1 . ILE A 1 73  ? 78.557  27.745 16.207 1.00 84.32  ? 272 ILE A CG1 1 
ATOM   567  C CG2 . ILE A 1 73  ? 79.037  27.418 18.618 1.00 85.02  ? 272 ILE A CG2 1 
ATOM   568  C CD1 . ILE A 1 73  ? 79.718  28.687 16.072 1.00 83.51  ? 272 ILE A CD1 1 
ATOM   569  N N   . PHE A 1 74  ? 74.795  27.470 18.401 1.00 90.39  ? 273 PHE A N   1 
ATOM   570  C CA  . PHE A 1 74  ? 73.708  27.824 19.300 1.00 92.31  ? 273 PHE A CA  1 
ATOM   571  C C   . PHE A 1 74  ? 72.887  26.547 19.553 1.00 92.30  ? 273 PHE A C   1 
ATOM   572  O O   . PHE A 1 74  ? 71.903  26.547 20.281 1.00 91.83  ? 273 PHE A O   1 
ATOM   573  C CB  . PHE A 1 74  ? 72.976  29.001 18.606 1.00 94.90  ? 273 PHE A CB  1 
ATOM   574  C CG  . PHE A 1 74  ? 71.486  29.118 18.839 1.00 98.09  ? 273 PHE A CG  1 
ATOM   575  C CD1 . PHE A 1 74  ? 70.752  29.923 17.973 1.00 99.71  ? 273 PHE A CD1 1 
ATOM   576  C CD2 . PHE A 1 74  ? 70.817  28.498 19.886 1.00 99.07  ? 273 PHE A CD2 1 
ATOM   577  C CE1 . PHE A 1 74  ? 69.395  30.108 18.143 1.00 100.84 ? 273 PHE A CE1 1 
ATOM   578  C CE2 . PHE A 1 74  ? 69.453  28.674 20.065 1.00 100.32 ? 273 PHE A CE2 1 
ATOM   579  C CZ  . PHE A 1 74  ? 68.747  29.484 19.191 1.00 101.17 ? 273 PHE A CZ  1 
ATOM   580  N N   . HIS A 1 75  ? 73.332  25.429 18.993 1.00 92.76  ? 274 HIS A N   1 
ATOM   581  C CA  . HIS A 1 75  ? 72.613  24.183 19.221 1.00 92.56  ? 274 HIS A CA  1 
ATOM   582  C C   . HIS A 1 75  ? 73.364  23.276 20.188 1.00 90.48  ? 274 HIS A C   1 
ATOM   583  O O   . HIS A 1 75  ? 72.805  22.824 21.187 1.00 90.21  ? 274 HIS A O   1 
ATOM   584  C CB  . HIS A 1 75  ? 72.354  23.444 17.908 1.00 95.69  ? 274 HIS A CB  1 
ATOM   585  C CG  . HIS A 1 75  ? 71.264  22.424 18.014 1.00 98.86  ? 274 HIS A CG  1 
ATOM   586  N ND1 . HIS A 1 75  ? 71.507  21.091 18.271 1.00 100.05 ? 274 HIS A ND1 1 
ATOM   587  C CD2 . HIS A 1 75  ? 69.917  22.562 17.985 1.00 100.23 ? 274 HIS A CD2 1 
ATOM   588  C CE1 . HIS A 1 75  ? 70.357  20.453 18.400 1.00 100.86 ? 274 HIS A CE1 1 
ATOM   589  N NE2 . HIS A 1 75  ? 69.377  21.323 18.231 1.00 101.43 ? 274 HIS A NE2 1 
ATOM   590  N N   . CYS A 1 76  ? 74.630  23.015 19.890 1.00 88.06  ? 275 CYS A N   1 
ATOM   591  C CA  . CYS A 1 76  ? 75.448  22.177 20.751 1.00 86.22  ? 275 CYS A CA  1 
ATOM   592  C C   . CYS A 1 76  ? 75.229  22.612 22.194 1.00 85.08  ? 275 CYS A C   1 
ATOM   593  O O   . CYS A 1 76  ? 74.753  21.843 23.025 1.00 85.26  ? 275 CYS A O   1 
ATOM   594  C CB  . CYS A 1 76  ? 76.919  22.349 20.394 1.00 85.68  ? 275 CYS A CB  1 
ATOM   595  S SG  . CYS A 1 76  ? 77.220  22.412 18.633 1.00 85.12  ? 275 CYS A SG  1 
ATOM   596  N N   . CYS A 1 77  ? 75.573  23.863 22.471 1.00 83.36  ? 276 CYS A N   1 
ATOM   597  C CA  . CYS A 1 77  ? 75.442  24.445 23.798 1.00 81.71  ? 276 CYS A CA  1 
ATOM   598  C C   . CYS A 1 77  ? 74.176  24.052 24.558 1.00 81.16  ? 276 CYS A C   1 
ATOM   599  O O   . CYS A 1 77  ? 74.107  24.235 25.772 1.00 81.20  ? 276 CYS A O   1 
ATOM   600  C CB  . CYS A 1 77  ? 75.526  25.962 23.690 1.00 81.29  ? 276 CYS A CB  1 
ATOM   601  S SG  . CYS A 1 77  ? 77.035  26.513 22.892 1.00 80.75  ? 276 CYS A SG  1 
ATOM   602  N N   . GLN A 1 78  ? 73.176  23.532 23.849 1.00 80.06  ? 277 GLN A N   1 
ATOM   603  C CA  . GLN A 1 78  ? 71.930  23.094 24.481 1.00 78.99  ? 277 GLN A CA  1 
ATOM   604  C C   . GLN A 1 78  ? 72.055  21.603 24.749 1.00 77.71  ? 277 GLN A C   1 
ATOM   605  O O   . GLN A 1 78  ? 71.604  21.099 25.778 1.00 77.07  ? 277 GLN A O   1 
ATOM   606  C CB  . GLN A 1 78  ? 70.735  23.341 23.566 1.00 79.98  ? 277 GLN A CB  1 
ATOM   607  C CG  . GLN A 1 78  ? 70.487  24.798 23.221 1.00 80.63  ? 277 GLN A CG  1 
ATOM   608  C CD  . GLN A 1 78  ? 69.426  24.952 22.149 1.00 81.25  ? 277 GLN A CD  1 
ATOM   609  O OE1 . GLN A 1 78  ? 68.244  25.156 22.443 1.00 81.16  ? 277 GLN A OE1 1 
ATOM   610  N NE2 . GLN A 1 78  ? 69.843  24.835 20.893 1.00 81.23  ? 277 GLN A NE2 1 
ATOM   611  N N   . CYS A 1 79  ? 72.660  20.902 23.796 1.00 76.85  ? 278 CYS A N   1 
ATOM   612  C CA  . CYS A 1 79  ? 72.907  19.472 23.926 1.00 76.55  ? 278 CYS A CA  1 
ATOM   613  C C   . CYS A 1 79  ? 74.089  19.410 24.896 1.00 75.82  ? 278 CYS A C   1 
ATOM   614  O O   . CYS A 1 79  ? 74.839  18.430 24.962 1.00 75.72  ? 278 CYS A O   1 
ATOM   615  C CB  . CYS A 1 79  ? 73.283  18.872 22.564 1.00 76.88  ? 278 CYS A CB  1 
ATOM   616  S SG  . CYS A 1 79  ? 71.957  18.925 21.304 1.00 76.08  ? 278 CYS A SG  1 
ATOM   617  N N   . THR A 1 80  ? 74.224  20.500 25.646 1.00 74.82  ? 279 THR A N   1 
ATOM   618  C CA  . THR A 1 80  ? 75.276  20.692 26.633 1.00 72.71  ? 279 THR A CA  1 
ATOM   619  C C   . THR A 1 80  ? 74.712  21.538 27.793 1.00 70.65  ? 279 THR A C   1 
ATOM   620  O O   . THR A 1 80  ? 75.431  21.905 28.725 1.00 70.28  ? 279 THR A O   1 
ATOM   621  C CB  . THR A 1 80  ? 76.486  21.423 25.982 1.00 72.89  ? 279 THR A CB  1 
ATOM   622  O OG1 . THR A 1 80  ? 76.969  20.657 24.867 1.00 70.99  ? 279 THR A OG1 1 
ATOM   623  C CG2 . THR A 1 80  ? 77.609  21.608 26.986 1.00 73.66  ? 279 THR A CG2 1 
ATOM   624  N N   . SER A 1 81  ? 73.415  21.834 27.732 1.00 67.80  ? 280 SER A N   1 
ATOM   625  C CA  . SER A 1 81  ? 72.768  22.636 28.761 1.00 64.61  ? 280 SER A CA  1 
ATOM   626  C C   . SER A 1 81  ? 71.528  21.946 29.299 1.00 62.20  ? 280 SER A C   1 
ATOM   627  O O   . SER A 1 81  ? 70.455  22.535 29.372 1.00 62.54  ? 280 SER A O   1 
ATOM   628  C CB  . SER A 1 81  ? 72.387  24.009 28.202 1.00 64.83  ? 280 SER A CB  1 
ATOM   629  O OG  . SER A 1 81  ? 72.844  25.048 29.049 1.00 64.29  ? 280 SER A OG  1 
ATOM   630  N N   . VAL A 1 82  ? 71.686  20.680 29.648 1.00 59.27  ? 281 VAL A N   1 
ATOM   631  C CA  . VAL A 1 82  ? 70.616  19.873 30.216 1.00 57.09  ? 281 VAL A CA  1 
ATOM   632  C C   . VAL A 1 82  ? 71.466  19.004 31.099 1.00 55.93  ? 281 VAL A C   1 
ATOM   633  O O   . VAL A 1 82  ? 71.086  18.601 32.198 1.00 55.32  ? 281 VAL A O   1 
ATOM   634  C CB  . VAL A 1 82  ? 69.911  19.021 29.151 1.00 56.09  ? 281 VAL A CB  1 
ATOM   635  C CG1 . VAL A 1 82  ? 68.799  18.210 29.786 1.00 54.36  ? 281 VAL A CG1 1 
ATOM   636  C CG2 . VAL A 1 82  ? 69.342  19.920 28.075 1.00 56.28  ? 281 VAL A CG2 1 
ATOM   637  N N   . GLU A 1 83  ? 72.652  18.741 30.573 1.00 54.66  ? 282 GLU A N   1 
ATOM   638  C CA  . GLU A 1 83  ? 73.662  17.986 31.272 1.00 53.24  ? 282 GLU A CA  1 
ATOM   639  C C   . GLU A 1 83  ? 73.987  18.922 32.419 1.00 51.13  ? 282 GLU A C   1 
ATOM   640  O O   . GLU A 1 83  ? 73.778  18.611 33.593 1.00 51.46  ? 282 GLU A O   1 
ATOM   641  C CB  . GLU A 1 83  ? 74.896  17.842 30.380 1.00 54.87  ? 282 GLU A CB  1 
ATOM   642  C CG  . GLU A 1 83  ? 74.816  16.725 29.363 1.00 57.28  ? 282 GLU A CG  1 
ATOM   643  C CD  . GLU A 1 83  ? 75.410  15.443 29.902 1.00 59.32  ? 282 GLU A CD  1 
ATOM   644  O OE1 . GLU A 1 83  ? 75.360  15.239 31.136 1.00 60.52  ? 282 GLU A OE1 1 
ATOM   645  O OE2 . GLU A 1 83  ? 75.921  14.634 29.100 1.00 60.60  ? 282 GLU A OE2 1 
ATOM   646  N N   . THR A 1 84  ? 74.468  20.097 32.021 1.00 48.38  ? 283 THR A N   1 
ATOM   647  C CA  . THR A 1 84  ? 74.883  21.180 32.905 1.00 44.65  ? 283 THR A CA  1 
ATOM   648  C C   . THR A 1 84  ? 73.882  21.611 33.971 1.00 41.21  ? 283 THR A C   1 
ATOM   649  O O   . THR A 1 84  ? 74.254  21.814 35.131 1.00 39.98  ? 283 THR A O   1 
ATOM   650  C CB  . THR A 1 84  ? 75.283  22.417 32.060 1.00 45.25  ? 283 THR A CB  1 
ATOM   651  O OG1 . THR A 1 84  ? 76.687  22.372 31.782 1.00 45.93  ? 283 THR A OG1 1 
ATOM   652  C CG2 . THR A 1 84  ? 74.958  23.702 32.783 1.00 45.60  ? 283 THR A CG2 1 
ATOM   653  N N   . VAL A 1 85  ? 72.622  21.761 33.584 1.00 37.38  ? 284 VAL A N   1 
ATOM   654  C CA  . VAL A 1 85  ? 71.606  22.189 34.531 1.00 33.62  ? 284 VAL A CA  1 
ATOM   655  C C   . VAL A 1 85  ? 71.245  21.116 35.555 1.00 33.20  ? 284 VAL A C   1 
ATOM   656  O O   . VAL A 1 85  ? 70.855  21.434 36.674 1.00 33.40  ? 284 VAL A O   1 
ATOM   657  C CB  . VAL A 1 85  ? 70.330  22.648 33.794 1.00 31.62  ? 284 VAL A CB  1 
ATOM   658  C CG1 . VAL A 1 85  ? 69.243  23.001 34.795 1.00 29.02  ? 284 VAL A CG1 1 
ATOM   659  C CG2 . VAL A 1 85  ? 70.650  23.847 32.916 1.00 29.16  ? 284 VAL A CG2 1 
ATOM   660  N N   . THR A 1 86  ? 71.390  19.847 35.187 1.00 31.73  ? 285 THR A N   1 
ATOM   661  C CA  . THR A 1 86  ? 71.046  18.766 36.101 1.00 30.35  ? 285 THR A CA  1 
ATOM   662  C C   . THR A 1 86  ? 72.105  18.519 37.164 1.00 28.45  ? 285 THR A C   1 
ATOM   663  O O   . THR A 1 86  ? 71.783  18.150 38.287 1.00 28.54  ? 285 THR A O   1 
ATOM   664  C CB  . THR A 1 86  ? 70.798  17.456 35.338 1.00 31.74  ? 285 THR A CB  1 
ATOM   665  O OG1 . THR A 1 86  ? 69.923  17.712 34.232 1.00 34.20  ? 285 THR A OG1 1 
ATOM   666  C CG2 . THR A 1 86  ? 70.151  16.421 36.255 1.00 32.10  ? 285 THR A CG2 1 
ATOM   667  N N   . GLU A 1 87  ? 73.369  18.716 36.815 1.00 27.04  ? 286 GLU A N   1 
ATOM   668  C CA  . GLU A 1 87  ? 74.444  18.504 37.775 1.00 25.92  ? 286 GLU A CA  1 
ATOM   669  C C   . GLU A 1 87  ? 74.395  19.591 38.833 1.00 25.53  ? 286 GLU A C   1 
ATOM   670  O O   . GLU A 1 87  ? 74.782  19.369 39.974 1.00 26.20  ? 286 GLU A O   1 
ATOM   671  C CB  . GLU A 1 87  ? 75.806  18.552 37.090 1.00 25.83  ? 286 GLU A CB  1 
ATOM   672  C CG  . GLU A 1 87  ? 76.002  17.573 35.949 1.00 26.74  ? 286 GLU A CG  1 
ATOM   673  C CD  . GLU A 1 87  ? 77.398  17.676 35.361 1.00 28.41  ? 286 GLU A CD  1 
ATOM   674  O OE1 . GLU A 1 87  ? 77.836  18.806 35.075 1.00 30.55  ? 286 GLU A OE1 1 
ATOM   675  O OE2 . GLU A 1 87  ? 78.063  16.636 35.177 1.00 30.32  ? 286 GLU A OE2 1 
ATOM   676  N N   . LEU A 1 88  ? 73.939  20.777 38.439 1.00 24.77  ? 287 LEU A N   1 
ATOM   677  C CA  . LEU A 1 88  ? 73.832  21.900 39.361 1.00 23.39  ? 287 LEU A CA  1 
ATOM   678  C C   . LEU A 1 88  ? 72.618  21.722 40.260 1.00 24.21  ? 287 LEU A C   1 
ATOM   679  O O   . LEU A 1 88  ? 72.513  22.360 41.303 1.00 25.08  ? 287 LEU A O   1 
ATOM   680  C CB  . LEU A 1 88  ? 73.690  23.213 38.597 1.00 20.98  ? 287 LEU A CB  1 
ATOM   681  C CG  . LEU A 1 88  ? 74.911  24.115 38.464 1.00 19.65  ? 287 LEU A CG  1 
ATOM   682  C CD1 . LEU A 1 88  ? 74.482  25.410 37.796 1.00 19.44  ? 287 LEU A CD1 1 
ATOM   683  C CD2 . LEU A 1 88  ? 75.504  24.396 39.829 1.00 18.73  ? 287 LEU A CD2 1 
ATOM   684  N N   . THR A 1 89  ? 71.698  20.857 39.843 1.00 24.76  ? 288 THR A N   1 
ATOM   685  C CA  . THR A 1 89  ? 70.482  20.588 40.607 1.00 24.04  ? 288 THR A CA  1 
ATOM   686  C C   . THR A 1 89  ? 70.751  19.475 41.613 1.00 25.17  ? 288 THR A C   1 
ATOM   687  O O   . THR A 1 89  ? 70.159  19.445 42.691 1.00 25.58  ? 288 THR A O   1 
ATOM   688  C CB  . THR A 1 89  ? 69.313  20.143 39.688 1.00 22.73  ? 288 THR A CB  1 
ATOM   689  O OG1 . THR A 1 89  ? 69.007  21.180 38.749 1.00 21.69  ? 288 THR A OG1 1 
ATOM   690  C CG2 . THR A 1 89  ? 68.073  19.834 40.513 1.00 21.47  ? 288 THR A CG2 1 
ATOM   691  N N   . GLU A 1 90  ? 71.640  18.555 41.246 1.00 26.12  ? 289 GLU A N   1 
ATOM   692  C CA  . GLU A 1 90  ? 71.994  17.434 42.115 1.00 27.29  ? 289 GLU A CA  1 
ATOM   693  C C   . GLU A 1 90  ? 72.942  17.967 43.167 1.00 26.71  ? 289 GLU A C   1 
ATOM   694  O O   . GLU A 1 90  ? 72.795  17.705 44.360 1.00 26.99  ? 289 GLU A O   1 
ATOM   695  C CB  . GLU A 1 90  ? 72.690  16.323 41.316 1.00 28.83  ? 289 GLU A CB  1 
ATOM   696  C CG  . GLU A 1 90  ? 71.804  15.551 40.342 1.00 30.39  ? 289 GLU A CG  1 
ATOM   697  C CD  . GLU A 1 90  ? 70.709  14.752 41.035 1.00 31.36  ? 289 GLU A CD  1 
ATOM   698  O OE1 . GLU A 1 90  ? 71.029  14.019 41.997 1.00 31.44  ? 289 GLU A OE1 1 
ATOM   699  O OE2 . GLU A 1 90  ? 69.534  14.850 40.611 1.00 31.87  ? 289 GLU A OE2 1 
ATOM   700  N N   . PHE A 1 91  ? 73.924  18.720 42.696 1.00 26.96  ? 290 PHE A N   1 
ATOM   701  C CA  . PHE A 1 91  ? 74.921  19.332 43.556 1.00 26.98  ? 290 PHE A CA  1 
ATOM   702  C C   . PHE A 1 91  ? 74.243  20.226 44.582 1.00 27.98  ? 290 PHE A C   1 
ATOM   703  O O   . PHE A 1 91  ? 74.718  20.364 45.709 1.00 28.68  ? 290 PHE A O   1 
ATOM   704  C CB  . PHE A 1 91  ? 75.878  20.175 42.724 1.00 24.24  ? 290 PHE A CB  1 
ATOM   705  C CG  . PHE A 1 91  ? 76.539  21.252 43.505 1.00 21.44  ? 290 PHE A CG  1 
ATOM   706  C CD1 . PHE A 1 91  ? 77.553  20.949 44.402 1.00 19.93  ? 290 PHE A CD1 1 
ATOM   707  C CD2 . PHE A 1 91  ? 76.107  22.569 43.388 1.00 20.66  ? 290 PHE A CD2 1 
ATOM   708  C CE1 . PHE A 1 91  ? 78.127  21.943 45.176 1.00 19.55  ? 290 PHE A CE1 1 
ATOM   709  C CE2 . PHE A 1 91  ? 76.671  23.571 44.157 1.00 19.70  ? 290 PHE A CE2 1 
ATOM   710  C CZ  . PHE A 1 91  ? 77.685  23.259 45.055 1.00 19.74  ? 290 PHE A CZ  1 
ATOM   711  N N   . ALA A 1 92  ? 73.140  20.843 44.172 1.00 28.19  ? 291 ALA A N   1 
ATOM   712  C CA  . ALA A 1 92  ? 72.390  21.729 45.044 1.00 29.40  ? 291 ALA A CA  1 
ATOM   713  C C   . ALA A 1 92  ? 71.582  20.953 46.082 1.00 30.92  ? 291 ALA A C   1 
ATOM   714  O O   . ALA A 1 92  ? 71.518  21.351 47.247 1.00 31.61  ? 291 ALA A O   1 
ATOM   715  C CB  . ALA A 1 92  ? 71.474  22.609 44.218 1.00 27.86  ? 291 ALA A CB  1 
ATOM   716  N N   . LYS A 1 93  ? 70.962  19.849 45.677 1.00 32.50  ? 292 LYS A N   1 
ATOM   717  C CA  . LYS A 1 93  ? 70.189  19.081 46.638 1.00 33.92  ? 292 LYS A CA  1 
ATOM   718  C C   . LYS A 1 93  ? 71.110  18.152 47.407 1.00 33.05  ? 292 LYS A C   1 
ATOM   719  O O   . LYS A 1 93  ? 70.683  17.185 48.030 1.00 34.10  ? 292 LYS A O   1 
ATOM   720  C CB  . LYS A 1 93  ? 69.009  18.335 45.967 1.00 36.85  ? 292 LYS A CB  1 
ATOM   721  C CG  . LYS A 1 93  ? 69.261  17.065 45.164 1.00 39.96  ? 292 LYS A CG  1 
ATOM   722  C CD  . LYS A 1 93  ? 67.907  16.554 44.673 1.00 43.72  ? 292 LYS A CD  1 
ATOM   723  C CE  . LYS A 1 93  ? 67.949  15.154 44.073 1.00 46.53  ? 292 LYS A CE  1 
ATOM   724  N NZ  . LYS A 1 93  ? 66.573  14.618 43.790 1.00 49.09  ? 292 LYS A NZ  1 
ATOM   725  N N   . ALA A 1 94  ? 72.392  18.483 47.362 1.00 31.89  ? 293 ALA A N   1 
ATOM   726  C CA  . ALA A 1 94  ? 73.416  17.746 48.075 1.00 32.36  ? 293 ALA A CA  1 
ATOM   727  C C   . ALA A 1 94  ? 74.013  18.757 49.047 1.00 33.43  ? 293 ALA A C   1 
ATOM   728  O O   . ALA A 1 94  ? 74.872  18.424 49.873 1.00 33.21  ? 293 ALA A O   1 
ATOM   729  C CB  . ALA A 1 94  ? 74.472  17.252 47.113 1.00 32.73  ? 293 ALA A CB  1 
ATOM   730  N N   . ILE A 1 95  ? 73.542  20.001 48.924 1.00 34.52  ? 294 ILE A N   1 
ATOM   731  C CA  . ILE A 1 95  ? 73.979  21.108 49.773 1.00 34.61  ? 294 ILE A CA  1 
ATOM   732  C C   . ILE A 1 95  ? 73.183  21.046 51.064 1.00 34.61  ? 294 ILE A C   1 
ATOM   733  O O   . ILE A 1 95  ? 71.960  21.204 51.060 1.00 34.23  ? 294 ILE A O   1 
ATOM   734  C CB  . ILE A 1 95  ? 73.724  22.484 49.116 1.00 34.36  ? 294 ILE A CB  1 
ATOM   735  C CG1 . ILE A 1 95  ? 74.494  22.590 47.795 1.00 34.08  ? 294 ILE A CG1 1 
ATOM   736  C CG2 . ILE A 1 95  ? 74.158  23.586 50.062 1.00 33.71  ? 294 ILE A CG2 1 
ATOM   737  C CD1 . ILE A 1 95  ? 74.347  23.925 47.087 1.00 32.69  ? 294 ILE A CD1 1 
ATOM   738  N N   . PRO A 1 96  ? 73.874  20.815 52.188 1.00 35.14  ? 295 PRO A N   1 
ATOM   739  C CA  . PRO A 1 96  ? 73.238  20.724 53.500 1.00 35.48  ? 295 PRO A CA  1 
ATOM   740  C C   . PRO A 1 96  ? 72.030  21.636 53.675 1.00 35.37  ? 295 PRO A C   1 
ATOM   741  O O   . PRO A 1 96  ? 72.105  22.844 53.465 1.00 34.31  ? 295 PRO A O   1 
ATOM   742  C CB  . PRO A 1 96  ? 74.381  21.064 54.450 1.00 35.74  ? 295 PRO A CB  1 
ATOM   743  C CG  . PRO A 1 96  ? 75.544  20.401 53.784 1.00 35.22  ? 295 PRO A CG  1 
ATOM   744  C CD  . PRO A 1 96  ? 75.344  20.796 52.323 1.00 35.72  ? 295 PRO A CD  1 
ATOM   745  N N   . GLY A 1 97  ? 70.907  21.033 54.039 1.00 36.26  ? 296 GLY A N   1 
ATOM   746  C CA  . GLY A 1 97  ? 69.701  21.798 54.271 1.00 37.42  ? 296 GLY A CA  1 
ATOM   747  C C   . GLY A 1 97  ? 68.955  22.232 53.037 1.00 38.59  ? 296 GLY A C   1 
ATOM   748  O O   . GLY A 1 97  ? 67.761  22.504 53.115 1.00 38.16  ? 296 GLY A O   1 
ATOM   749  N N   . PHE A 1 98  ? 69.636  22.302 51.899 1.00 40.66  ? 297 PHE A N   1 
ATOM   750  C CA  . PHE A 1 98  ? 68.966  22.726 50.677 1.00 42.68  ? 297 PHE A CA  1 
ATOM   751  C C   . PHE A 1 98  ? 67.771  21.847 50.344 1.00 44.48  ? 297 PHE A C   1 
ATOM   752  O O   . PHE A 1 98  ? 66.745  22.343 49.886 1.00 44.03  ? 297 PHE A O   1 
ATOM   753  C CB  . PHE A 1 98  ? 69.928  22.741 49.486 1.00 41.37  ? 297 PHE A CB  1 
ATOM   754  C CG  . PHE A 1 98  ? 69.246  23.025 48.172 1.00 40.50  ? 297 PHE A CG  1 
ATOM   755  C CD1 . PHE A 1 98  ? 68.640  22.003 47.451 1.00 38.46  ? 297 PHE A CD1 1 
ATOM   756  C CD2 . PHE A 1 98  ? 69.161  24.324 47.682 1.00 40.46  ? 297 PHE A CD2 1 
ATOM   757  C CE1 . PHE A 1 98  ? 67.960  22.271 46.269 1.00 36.75  ? 297 PHE A CE1 1 
ATOM   758  C CE2 . PHE A 1 98  ? 68.477  24.598 46.494 1.00 38.21  ? 297 PHE A CE2 1 
ATOM   759  C CZ  . PHE A 1 98  ? 67.878  23.569 45.792 1.00 36.69  ? 297 PHE A CZ  1 
ATOM   760  N N   . ALA A 1 99  ? 67.906  20.545 50.571 1.00 48.02  ? 298 ALA A N   1 
ATOM   761  C CA  . ALA A 1 99  ? 66.827  19.601 50.284 1.00 51.13  ? 298 ALA A CA  1 
ATOM   762  C C   . ALA A 1 99  ? 65.582  19.884 51.126 1.00 52.79  ? 298 ALA A C   1 
ATOM   763  O O   . ALA A 1 99  ? 64.500  19.370 50.839 1.00 52.36  ? 298 ALA A O   1 
ATOM   764  C CB  . ALA A 1 99  ? 67.307  18.173 50.518 1.00 50.91  ? 298 ALA A CB  1 
ATOM   765  N N   . ASN A 1 100 ? 65.742  20.703 52.162 1.00 55.37  ? 299 ASN A N   1 
ATOM   766  C CA  . ASN A 1 100 ? 64.630  21.063 53.042 1.00 57.87  ? 299 ASN A CA  1 
ATOM   767  C C   . ASN A 1 100 ? 63.607  21.915 52.306 1.00 57.98  ? 299 ASN A C   1 
ATOM   768  O O   . ASN A 1 100 ? 62.480  21.486 52.061 1.00 58.98  ? 299 ASN A O   1 
ATOM   769  C CB  . ASN A 1 100 ? 65.129  21.851 54.260 1.00 59.77  ? 299 ASN A CB  1 
ATOM   770  C CG  . ASN A 1 100 ? 65.904  20.996 55.238 1.00 61.45  ? 299 ASN A CG  1 
ATOM   771  O OD1 . ASN A 1 100 ? 66.130  21.397 56.380 1.00 62.94  ? 299 ASN A OD1 1 
ATOM   772  N ND2 . ASN A 1 100 ? 66.314  19.809 54.801 1.00 62.07  ? 299 ASN A ND2 1 
ATOM   773  N N   . LEU A 1 101 ? 64.020  23.134 51.979 1.00 57.13  ? 300 LEU A N   1 
ATOM   774  C CA  . LEU A 1 101 ? 63.199  24.104 51.274 1.00 57.13  ? 300 LEU A CA  1 
ATOM   775  C C   . LEU A 1 101 ? 62.084  23.431 50.485 1.00 57.81  ? 300 LEU A C   1 
ATOM   776  O O   . LEU A 1 101 ? 62.324  22.460 49.774 1.00 56.99  ? 300 LEU A O   1 
ATOM   777  C CB  . LEU A 1 101 ? 64.091  24.905 50.330 1.00 57.42  ? 300 LEU A CB  1 
ATOM   778  C CG  . LEU A 1 101 ? 65.536  25.014 50.834 1.00 57.36  ? 300 LEU A CG  1 
ATOM   779  C CD1 . LEU A 1 101 ? 66.420  25.634 49.771 1.00 57.27  ? 300 LEU A CD1 1 
ATOM   780  C CD2 . LEU A 1 101 ? 65.570  25.826 52.116 1.00 57.23  ? 300 LEU A CD2 1 
ATOM   781  N N   . ASP A 1 102 ? 60.863  23.939 50.619 1.00 59.91  ? 301 ASP A N   1 
ATOM   782  C CA  . ASP A 1 102 ? 59.738  23.364 49.891 1.00 61.61  ? 301 ASP A CA  1 
ATOM   783  C C   . ASP A 1 102 ? 60.099  23.322 48.409 1.00 61.73  ? 301 ASP A C   1 
ATOM   784  O O   . ASP A 1 102 ? 60.504  24.329 47.833 1.00 61.93  ? 301 ASP A O   1 
ATOM   785  C CB  . ASP A 1 102 ? 58.451  24.187 50.157 1.00 62.81  ? 301 ASP A CB  1 
ATOM   786  C CG  . ASP A 1 102 ? 57.749  24.677 48.876 1.00 63.04  ? 301 ASP A CG  1 
ATOM   787  O OD1 . ASP A 1 102 ? 57.879  24.054 47.802 1.00 62.12  ? 301 ASP A OD1 1 
ATOM   788  O OD2 . ASP A 1 102 ? 57.028  25.697 48.959 1.00 63.44  ? 301 ASP A OD2 1 
ATOM   789  N N   . LEU A 1 103 ? 59.969  22.144 47.807 1.00 61.68  ? 302 LEU A N   1 
ATOM   790  C CA  . LEU A 1 103 ? 60.280  21.951 46.392 1.00 62.15  ? 302 LEU A CA  1 
ATOM   791  C C   . LEU A 1 103 ? 60.023  23.200 45.541 1.00 63.12  ? 302 LEU A C   1 
ATOM   792  O O   . LEU A 1 103 ? 60.932  23.704 44.878 1.00 63.37  ? 302 LEU A O   1 
ATOM   793  C CB  . LEU A 1 103 ? 59.485  20.752 45.853 1.00 60.66  ? 302 LEU A CB  1 
ATOM   794  C CG  . LEU A 1 103 ? 59.108  20.640 44.370 1.00 60.55  ? 302 LEU A CG  1 
ATOM   795  C CD1 . LEU A 1 103 ? 60.280  20.963 43.465 1.00 60.59  ? 302 LEU A CD1 1 
ATOM   796  C CD2 . LEU A 1 103 ? 58.608  19.235 44.110 1.00 60.16  ? 302 LEU A CD2 1 
ATOM   797  N N   . ASN A 1 104 ? 58.788  23.694 45.567 1.00 63.66  ? 303 ASN A N   1 
ATOM   798  C CA  . ASN A 1 104 ? 58.407  24.878 44.803 1.00 63.67  ? 303 ASN A CA  1 
ATOM   799  C C   . ASN A 1 104 ? 59.500  25.941 44.941 1.00 63.07  ? 303 ASN A C   1 
ATOM   800  O O   . ASN A 1 104 ? 59.850  26.628 43.979 1.00 63.46  ? 303 ASN A O   1 
ATOM   801  C CB  . ASN A 1 104 ? 57.073  25.422 45.333 1.00 64.61  ? 303 ASN A CB  1 
ATOM   802  C CG  . ASN A 1 104 ? 56.266  26.152 44.271 1.00 65.85  ? 303 ASN A CG  1 
ATOM   803  O OD1 . ASN A 1 104 ? 56.765  27.060 43.602 1.00 66.07  ? 303 ASN A OD1 1 
ATOM   804  N ND2 . ASN A 1 104 ? 55.003  25.761 44.119 1.00 66.52  ? 303 ASN A ND2 1 
ATOM   805  N N   . ASP A 1 105 ? 60.044  26.046 46.151 1.00 61.87  ? 304 ASP A N   1 
ATOM   806  C CA  . ASP A 1 105 ? 61.090  27.011 46.488 1.00 60.51  ? 304 ASP A CA  1 
ATOM   807  C C   . ASP A 1 105 ? 62.457  26.586 45.967 1.00 58.20  ? 304 ASP A C   1 
ATOM   808  O O   . ASP A 1 105 ? 63.296  27.429 45.653 1.00 57.48  ? 304 ASP A O   1 
ATOM   809  C CB  . ASP A 1 105 ? 61.152  27.186 48.013 1.00 62.33  ? 304 ASP A CB  1 
ATOM   810  C CG  . ASP A 1 105 ? 60.912  28.624 48.458 1.00 63.28  ? 304 ASP A CG  1 
ATOM   811  O OD1 . ASP A 1 105 ? 60.065  29.315 47.848 1.00 64.20  ? 304 ASP A OD1 1 
ATOM   812  O OD2 . ASP A 1 105 ? 61.563  29.054 49.434 1.00 62.88  ? 304 ASP A OD2 1 
ATOM   813  N N   . GLN A 1 106 ? 62.679  25.278 45.888 1.00 56.35  ? 305 GLN A N   1 
ATOM   814  C CA  . GLN A 1 106 ? 63.945  24.747 45.399 1.00 54.76  ? 305 GLN A CA  1 
ATOM   815  C C   . GLN A 1 106 ? 64.069  24.946 43.889 1.00 53.59  ? 305 GLN A C   1 
ATOM   816  O O   . GLN A 1 106 ? 65.151  24.805 43.318 1.00 52.79  ? 305 GLN A O   1 
ATOM   817  C CB  . GLN A 1 106 ? 64.067  23.264 45.756 1.00 54.78  ? 305 GLN A CB  1 
ATOM   818  C CG  . GLN A 1 106 ? 64.202  23.006 47.249 1.00 54.75  ? 305 GLN A CG  1 
ATOM   819  C CD  . GLN A 1 106 ? 64.476  21.543 47.580 1.00 54.91  ? 305 GLN A CD  1 
ATOM   820  O OE1 . GLN A 1 106 ? 63.568  20.713 47.603 1.00 55.09  ? 305 GLN A OE1 1 
ATOM   821  N NE2 . GLN A 1 106 ? 65.737  21.224 47.830 1.00 54.42  ? 305 GLN A NE2 1 
ATOM   822  N N   . VAL A 1 107 ? 62.953  25.276 43.250 1.00 52.22  ? 306 VAL A N   1 
ATOM   823  C CA  . VAL A 1 107 ? 62.941  25.521 41.817 1.00 51.23  ? 306 VAL A CA  1 
ATOM   824  C C   . VAL A 1 107 ? 63.301  26.979 41.597 1.00 51.14  ? 306 VAL A C   1 
ATOM   825  O O   . VAL A 1 107 ? 63.945  27.331 40.608 1.00 51.09  ? 306 VAL A O   1 
ATOM   826  C CB  . VAL A 1 107 ? 61.547  25.261 41.212 1.00 51.16  ? 306 VAL A CB  1 
ATOM   827  C CG1 . VAL A 1 107 ? 61.463  25.865 39.818 1.00 51.74  ? 306 VAL A CG1 1 
ATOM   828  C CG2 . VAL A 1 107 ? 61.281  23.770 41.146 1.00 50.83  ? 306 VAL A CG2 1 
ATOM   829  N N   . THR A 1 108 ? 62.885  27.819 42.539 1.00 51.23  ? 307 THR A N   1 
ATOM   830  C CA  . THR A 1 108 ? 63.138  29.254 42.467 1.00 51.26  ? 307 THR A CA  1 
ATOM   831  C C   . THR A 1 108 ? 64.597  29.595 42.728 1.00 49.97  ? 307 THR A C   1 
ATOM   832  O O   . THR A 1 108 ? 65.130  30.549 42.162 1.00 50.09  ? 307 THR A O   1 
ATOM   833  C CB  . THR A 1 108 ? 62.299  30.028 43.496 1.00 52.87  ? 307 THR A CB  1 
ATOM   834  O OG1 . THR A 1 108 ? 60.949  29.542 43.491 1.00 54.42  ? 307 THR A OG1 1 
ATOM   835  C CG2 . THR A 1 108 ? 62.314  31.524 43.162 1.00 52.88  ? 307 THR A CG2 1 
ATOM   836  N N   . LEU A 1 109 ? 65.233  28.820 43.600 1.00 47.78  ? 308 LEU A N   1 
ATOM   837  C CA  . LEU A 1 109 ? 66.628  29.048 43.941 1.00 46.42  ? 308 LEU A CA  1 
ATOM   838  C C   . LEU A 1 109 ? 67.583  28.626 42.838 1.00 46.24  ? 308 LEU A C   1 
ATOM   839  O O   . LEU A 1 109 ? 68.677  29.183 42.710 1.00 47.68  ? 308 LEU A O   1 
ATOM   840  C CB  . LEU A 1 109 ? 66.984  28.301 45.221 1.00 45.65  ? 308 LEU A CB  1 
ATOM   841  C CG  . LEU A 1 109 ? 66.659  29.029 46.519 1.00 44.67  ? 308 LEU A CG  1 
ATOM   842  C CD1 . LEU A 1 109 ? 66.951  28.131 47.697 1.00 44.35  ? 308 LEU A CD1 1 
ATOM   843  C CD2 . LEU A 1 109 ? 67.492  30.289 46.596 1.00 45.55  ? 308 LEU A CD2 1 
ATOM   844  N N   . LEU A 1 110 ? 67.163  27.645 42.047 1.00 44.63  ? 309 LEU A N   1 
ATOM   845  C CA  . LEU A 1 110 ? 67.976  27.118 40.956 1.00 42.58  ? 309 LEU A CA  1 
ATOM   846  C C   . LEU A 1 110 ? 67.653  27.712 39.594 1.00 42.53  ? 309 LEU A C   1 
ATOM   847  O O   . LEU A 1 110 ? 68.399  27.507 38.637 1.00 42.79  ? 309 LEU A O   1 
ATOM   848  C CB  . LEU A 1 110 ? 67.807  25.604 40.877 1.00 40.93  ? 309 LEU A CB  1 
ATOM   849  C CG  . LEU A 1 110 ? 68.653  24.739 41.800 1.00 38.77  ? 309 LEU A CG  1 
ATOM   850  C CD1 . LEU A 1 110 ? 68.046  23.365 41.896 1.00 37.98  ? 309 LEU A CD1 1 
ATOM   851  C CD2 . LEU A 1 110 ? 70.061  24.666 41.262 1.00 39.08  ? 309 LEU A CD2 1 
ATOM   852  N N   . LYS A 1 111 ? 66.545  28.439 39.509 1.00 41.86  ? 310 LYS A N   1 
ATOM   853  C CA  . LYS A 1 111 ? 66.109  29.032 38.254 1.00 41.80  ? 310 LYS A CA  1 
ATOM   854  C C   . LYS A 1 111 ? 66.808  30.338 37.915 1.00 42.18  ? 310 LYS A C   1 
ATOM   855  O O   . LYS A 1 111 ? 67.133  30.599 36.755 1.00 40.49  ? 310 LYS A O   1 
ATOM   856  C CB  . LYS A 1 111 ? 64.605  29.246 38.307 1.00 41.90  ? 310 LYS A CB  1 
ATOM   857  C CG  . LYS A 1 111 ? 64.033  29.984 37.115 1.00 43.86  ? 310 LYS A CG  1 
ATOM   858  C CD  . LYS A 1 111 ? 62.523  30.079 37.250 1.00 44.45  ? 310 LYS A CD  1 
ATOM   859  C CE  . LYS A 1 111 ? 61.937  31.085 36.278 1.00 44.63  ? 310 LYS A CE  1 
ATOM   860  N NZ  . LYS A 1 111 ? 60.471  31.195 36.475 1.00 45.61  ? 310 LYS A NZ  1 
ATOM   861  N N   . TYR A 1 112 ? 67.029  31.162 38.932 1.00 44.32  ? 311 TYR A N   1 
ATOM   862  C CA  . TYR A 1 112 ? 67.698  32.444 38.741 1.00 46.26  ? 311 TYR A CA  1 
ATOM   863  C C   . TYR A 1 112 ? 69.190  32.270 39.012 1.00 46.54  ? 311 TYR A C   1 
ATOM   864  O O   . TYR A 1 112 ? 70.008  33.064 38.543 1.00 47.38  ? 311 TYR A O   1 
ATOM   865  C CB  . TYR A 1 112 ? 67.108  33.512 39.684 1.00 47.41  ? 311 TYR A CB  1 
ATOM   866  C CG  . TYR A 1 112 ? 65.635  33.803 39.451 1.00 48.47  ? 311 TYR A CG  1 
ATOM   867  C CD1 . TYR A 1 112 ? 65.195  34.382 38.256 1.00 47.46  ? 311 TYR A CD1 1 
ATOM   868  C CD2 . TYR A 1 112 ? 64.675  33.451 40.406 1.00 49.16  ? 311 TYR A CD2 1 
ATOM   869  C CE1 . TYR A 1 112 ? 63.836  34.597 38.015 1.00 48.50  ? 311 TYR A CE1 1 
ATOM   870  C CE2 . TYR A 1 112 ? 63.311  33.660 40.175 1.00 49.59  ? 311 TYR A CE2 1 
ATOM   871  C CZ  . TYR A 1 112 ? 62.899  34.233 38.978 1.00 49.67  ? 311 TYR A CZ  1 
ATOM   872  O OH  . TYR A 1 112 ? 61.553  34.429 38.741 1.00 50.43  ? 311 TYR A OH  1 
ATOM   873  N N   . GLY A 1 113 ? 69.535  31.218 39.755 1.00 45.47  ? 312 GLY A N   1 
ATOM   874  C CA  . GLY A 1 113 ? 70.928  30.965 40.083 1.00 44.27  ? 312 GLY A CA  1 
ATOM   875  C C   . GLY A 1 113 ? 71.699  30.127 39.076 1.00 43.46  ? 312 GLY A C   1 
ATOM   876  O O   . GLY A 1 113 ? 72.926  30.167 39.025 1.00 42.82  ? 312 GLY A O   1 
ATOM   877  N N   . VAL A 1 114 ? 70.981  29.367 38.263 1.00 43.22  ? 313 VAL A N   1 
ATOM   878  C CA  . VAL A 1 114 ? 71.606  28.502 37.273 1.00 42.99  ? 313 VAL A CA  1 
ATOM   879  C C   . VAL A 1 114 ? 72.667  29.159 36.385 1.00 41.43  ? 313 VAL A C   1 
ATOM   880  O O   . VAL A 1 114 ? 73.795  28.665 36.310 1.00 41.12  ? 313 VAL A O   1 
ATOM   881  C CB  . VAL A 1 114 ? 70.534  27.861 36.365 1.00 44.84  ? 313 VAL A CB  1 
ATOM   882  C CG1 . VAL A 1 114 ? 69.593  28.947 35.841 1.00 46.79  ? 313 VAL A CG1 1 
ATOM   883  C CG2 . VAL A 1 114 ? 71.197  27.113 35.205 1.00 45.08  ? 313 VAL A CG2 1 
ATOM   884  N N   . TYR A 1 115 ? 72.317  30.263 35.722 1.00 39.36  ? 314 TYR A N   1 
ATOM   885  C CA  . TYR A 1 115 ? 73.249  30.929 34.808 1.00 36.61  ? 314 TYR A CA  1 
ATOM   886  C C   . TYR A 1 115 ? 74.493  31.547 35.408 1.00 34.17  ? 314 TYR A C   1 
ATOM   887  O O   . TYR A 1 115 ? 75.567  31.464 34.817 1.00 33.37  ? 314 TYR A O   1 
ATOM   888  C CB  . TYR A 1 115 ? 72.516  31.972 33.985 1.00 37.49  ? 314 TYR A CB  1 
ATOM   889  C CG  . TYR A 1 115 ? 71.478  31.348 33.103 1.00 40.63  ? 314 TYR A CG  1 
ATOM   890  C CD1 . TYR A 1 115 ? 71.800  30.275 32.276 1.00 41.66  ? 314 TYR A CD1 1 
ATOM   891  C CD2 . TYR A 1 115 ? 70.168  31.818 33.095 1.00 43.78  ? 314 TYR A CD2 1 
ATOM   892  C CE1 . TYR A 1 115 ? 70.837  29.677 31.457 1.00 43.23  ? 314 TYR A CE1 1 
ATOM   893  C CE2 . TYR A 1 115 ? 69.193  31.231 32.274 1.00 45.08  ? 314 TYR A CE2 1 
ATOM   894  C CZ  . TYR A 1 115 ? 69.534  30.162 31.459 1.00 44.18  ? 314 TYR A CZ  1 
ATOM   895  O OH  . TYR A 1 115 ? 68.571  29.603 30.647 1.00 43.37  ? 314 TYR A OH  1 
ATOM   896  N N   . GLU A 1 116 ? 74.351  32.180 36.565 1.00 31.23  ? 315 GLU A N   1 
ATOM   897  C CA  . GLU A 1 116 ? 75.494  32.780 37.234 1.00 27.93  ? 315 GLU A CA  1 
ATOM   898  C C   . GLU A 1 116 ? 76.484  31.662 37.535 1.00 25.27  ? 315 GLU A C   1 
ATOM   899  O O   . GLU A 1 116 ? 77.683  31.788 37.279 1.00 24.22  ? 315 GLU A O   1 
ATOM   900  C CB  . GLU A 1 116 ? 75.049  33.441 38.536 1.00 29.74  ? 315 GLU A CB  1 
ATOM   901  C CG  . GLU A 1 116 ? 74.282  34.741 38.355 1.00 32.92  ? 315 GLU A CG  1 
ATOM   902  C CD  . GLU A 1 116 ? 73.370  35.045 39.533 1.00 35.12  ? 315 GLU A CD  1 
ATOM   903  O OE1 . GLU A 1 116 ? 73.789  34.830 40.692 1.00 35.74  ? 315 GLU A OE1 1 
ATOM   904  O OE2 . GLU A 1 116 ? 72.233  35.506 39.299 1.00 36.43  ? 315 GLU A OE2 1 
ATOM   905  N N   . ALA A 1 117 ? 75.958  30.559 38.064 1.00 22.60  ? 316 ALA A N   1 
ATOM   906  C CA  . ALA A 1 117 ? 76.752  29.385 38.425 1.00 18.03  ? 316 ALA A CA  1 
ATOM   907  C C   . ALA A 1 117 ? 77.544  28.825 37.246 1.00 16.02  ? 316 ALA A C   1 
ATOM   908  O O   . ALA A 1 117 ? 78.727  28.502 37.380 1.00 14.57  ? 316 ALA A O   1 
ATOM   909  C CB  . ALA A 1 117 ? 75.839  28.306 39.007 1.00 14.66  ? 316 ALA A CB  1 
ATOM   910  N N   . ILE A 1 118 ? 76.889  28.721 36.094 1.00 14.58  ? 317 ILE A N   1 
ATOM   911  C CA  . ILE A 1 118 ? 77.517  28.197 34.886 1.00 14.25  ? 317 ILE A CA  1 
ATOM   912  C C   . ILE A 1 118 ? 78.743  28.988 34.442 1.00 15.16  ? 317 ILE A C   1 
ATOM   913  O O   . ILE A 1 118 ? 79.834  28.431 34.274 1.00 14.64  ? 317 ILE A O   1 
ATOM   914  C CB  . ILE A 1 118 ? 76.498  28.151 33.745 1.00 13.27  ? 317 ILE A CB  1 
ATOM   915  C CG1 . ILE A 1 118 ? 75.604  26.922 33.941 1.00 13.91  ? 317 ILE A CG1 1 
ATOM   916  C CG2 . ILE A 1 118 ? 77.211  28.170 32.391 1.00 10.73  ? 317 ILE A CG2 1 
ATOM   917  C CD1 . ILE A 1 118 ? 74.293  26.966 33.187 1.00 14.23  ? 317 ILE A CD1 1 
ATOM   918  N N   . PHE A 1 119 ? 78.555  30.288 34.251 1.00 15.44  ? 318 PHE A N   1 
ATOM   919  C CA  . PHE A 1 119 ? 79.637  31.159 33.835 1.00 14.09  ? 318 PHE A CA  1 
ATOM   920  C C   . PHE A 1 119 ? 80.764  31.170 34.851 1.00 13.70  ? 318 PHE A C   1 
ATOM   921  O O   . PHE A 1 119 ? 81.923  31.352 34.495 1.00 13.89  ? 318 PHE A O   1 
ATOM   922  C CB  . PHE A 1 119 ? 79.101  32.562 33.623 1.00 15.23  ? 318 PHE A CB  1 
ATOM   923  C CG  . PHE A 1 119 ? 78.097  32.653 32.516 1.00 17.32  ? 318 PHE A CG  1 
ATOM   924  C CD1 . PHE A 1 119 ? 78.411  32.179 31.250 1.00 19.20  ? 318 PHE A CD1 1 
ATOM   925  C CD2 . PHE A 1 119 ? 76.846  33.224 32.729 1.00 17.80  ? 318 PHE A CD2 1 
ATOM   926  C CE1 . PHE A 1 119 ? 77.499  32.272 30.210 1.00 20.09  ? 318 PHE A CE1 1 
ATOM   927  C CE2 . PHE A 1 119 ? 75.929  33.322 31.702 1.00 18.51  ? 318 PHE A CE2 1 
ATOM   928  C CZ  . PHE A 1 119 ? 76.255  32.844 30.435 1.00 20.48  ? 318 PHE A CZ  1 
ATOM   929  N N   . ALA A 1 120 ? 80.425  30.978 36.119 1.00 12.68  ? 319 ALA A N   1 
ATOM   930  C CA  . ALA A 1 120 ? 81.440  30.943 37.160 1.00 11.47  ? 319 ALA A CA  1 
ATOM   931  C C   . ALA A 1 120 ? 82.380  29.772 36.873 1.00 11.73  ? 319 ALA A C   1 
ATOM   932  O O   . ALA A 1 120 ? 83.598  29.934 36.782 1.00 11.04  ? 319 ALA A O   1 
ATOM   933  C CB  . ALA A 1 120 ? 80.784  30.774 38.531 1.00 7.52   ? 319 ALA A CB  1 
ATOM   934  N N   . MET A 1 121 ? 81.802  28.590 36.709 1.00 12.36  ? 320 MET A N   1 
ATOM   935  C CA  . MET A 1 121 ? 82.596  27.405 36.448 1.00 13.58  ? 320 MET A CA  1 
ATOM   936  C C   . MET A 1 121 ? 83.123  27.428 35.034 1.00 14.09  ? 320 MET A C   1 
ATOM   937  O O   . MET A 1 121 ? 84.218  26.936 34.752 1.00 13.76  ? 320 MET A O   1 
ATOM   938  C CB  . MET A 1 121 ? 81.748  26.167 36.682 1.00 13.90  ? 320 MET A CB  1 
ATOM   939  C CG  . MET A 1 121 ? 81.157  26.154 38.074 1.00 15.81  ? 320 MET A CG  1 
ATOM   940  S SD  . MET A 1 121 ? 80.465  24.554 38.503 1.00 19.45  ? 320 MET A SD  1 
ATOM   941  C CE  . MET A 1 121 ? 78.734  24.828 38.134 1.00 17.04  ? 320 MET A CE  1 
ATOM   942  N N   . LEU A 1 122 ? 82.335  28.016 34.143 1.00 14.50  ? 321 LEU A N   1 
ATOM   943  C CA  . LEU A 1 122 ? 82.719  28.125 32.746 1.00 15.14  ? 321 LEU A CA  1 
ATOM   944  C C   . LEU A 1 122 ? 84.154  28.629 32.667 1.00 15.62  ? 321 LEU A C   1 
ATOM   945  O O   . LEU A 1 122 ? 84.862  28.373 31.691 1.00 15.22  ? 321 LEU A O   1 
ATOM   946  C CB  . LEU A 1 122 ? 81.795  29.109 32.040 1.00 15.14  ? 321 LEU A CB  1 
ATOM   947  C CG  . LEU A 1 122 ? 81.089  28.668 30.758 1.00 16.63  ? 321 LEU A CG  1 
ATOM   948  C CD1 . LEU A 1 122 ? 81.486  29.652 29.661 1.00 16.07  ? 321 LEU A CD1 1 
ATOM   949  C CD2 . LEU A 1 122 ? 81.433  27.216 30.383 1.00 15.09  ? 321 LEU A CD2 1 
ATOM   950  N N   . SER A 1 123 ? 84.567  29.339 33.718 1.00 15.75  ? 322 SER A N   1 
ATOM   951  C CA  . SER A 1 123 ? 85.901  29.922 33.821 1.00 13.39  ? 322 SER A CA  1 
ATOM   952  C C   . SER A 1 123 ? 86.973  28.870 34.068 1.00 14.17  ? 322 SER A C   1 
ATOM   953  O O   . SER A 1 123 ? 88.133  29.070 33.720 1.00 16.09  ? 322 SER A O   1 
ATOM   954  C CB  . SER A 1 123 ? 85.949  30.954 34.954 1.00 10.45  ? 322 SER A CB  1 
ATOM   955  O OG  . SER A 1 123 ? 84.881  31.877 34.871 1.00 6.55   ? 322 SER A OG  1 
ATOM   956  N N   . SER A 1 124 ? 86.599  27.750 34.672 1.00 12.65  ? 323 SER A N   1 
ATOM   957  C CA  . SER A 1 124 ? 87.576  26.711 34.949 1.00 11.79  ? 323 SER A CA  1 
ATOM   958  C C   . SER A 1 124 ? 88.140  26.137 33.645 1.00 12.31  ? 323 SER A C   1 
ATOM   959  O O   . SER A 1 124 ? 89.348  25.927 33.517 1.00 10.70  ? 323 SER A O   1 
ATOM   960  C CB  . SER A 1 124 ? 86.922  25.613 35.782 1.00 11.62  ? 323 SER A CB  1 
ATOM   961  O OG  . SER A 1 124 ? 86.237  26.164 36.897 1.00 9.47   ? 323 SER A OG  1 
ATOM   962  N N   . VAL A 1 125 ? 87.252  25.924 32.674 1.00 13.84  ? 324 VAL A N   1 
ATOM   963  C CA  . VAL A 1 125 ? 87.602  25.358 31.364 1.00 13.62  ? 324 VAL A CA  1 
ATOM   964  C C   . VAL A 1 125 ? 88.096  26.335 30.299 1.00 14.16  ? 324 VAL A C   1 
ATOM   965  O O   . VAL A 1 125 ? 88.420  25.922 29.185 1.00 13.27  ? 324 VAL A O   1 
ATOM   966  C CB  . VAL A 1 125 ? 86.413  24.614 30.756 1.00 12.10  ? 324 VAL A CB  1 
ATOM   967  C CG1 . VAL A 1 125 ? 86.094  23.391 31.574 1.00 10.51  ? 324 VAL A CG1 1 
ATOM   968  C CG2 . VAL A 1 125 ? 85.214  25.542 30.693 1.00 13.24  ? 324 VAL A CG2 1 
ATOM   969  N N   . MET A 1 126 ? 88.144  27.622 30.623 1.00 14.36  ? 325 MET A N   1 
ATOM   970  C CA  . MET A 1 126 ? 88.620  28.607 29.663 1.00 14.16  ? 325 MET A CA  1 
ATOM   971  C C   . MET A 1 126 ? 90.059  29.004 29.921 1.00 14.62  ? 325 MET A C   1 
ATOM   972  O O   . MET A 1 126 ? 90.665  28.637 30.923 1.00 15.21  ? 325 MET A O   1 
ATOM   973  C CB  . MET A 1 126 ? 87.779  29.869 29.722 1.00 12.92  ? 325 MET A CB  1 
ATOM   974  C CG  . MET A 1 126 ? 86.293  29.634 29.645 1.00 13.58  ? 325 MET A CG  1 
ATOM   975  S SD  . MET A 1 126 ? 85.466  31.227 29.539 1.00 14.91  ? 325 MET A SD  1 
ATOM   976  C CE  . MET A 1 126 ? 84.647  31.107 27.951 1.00 15.27  ? 325 MET A CE  1 
ATOM   977  N N   . ASN A 1 127 ? 90.596  29.765 28.987 1.00 16.53  ? 326 ASN A N   1 
ATOM   978  C CA  . ASN A 1 127 ? 91.941  30.293 29.082 1.00 19.76  ? 326 ASN A CA  1 
ATOM   979  C C   . ASN A 1 127 ? 91.969  31.354 27.976 1.00 21.41  ? 326 ASN A C   1 
ATOM   980  O O   . ASN A 1 127 ? 91.087  31.364 27.112 1.00 21.08  ? 326 ASN A O   1 
ATOM   981  C CB  . ASN A 1 127 ? 92.988  29.174 28.916 1.00 20.12  ? 326 ASN A CB  1 
ATOM   982  C CG  . ASN A 1 127 ? 93.297  28.849 27.474 1.00 22.16  ? 326 ASN A CG  1 
ATOM   983  O OD1 . ASN A 1 127 ? 92.547  29.204 26.560 1.00 25.08  ? 326 ASN A OD1 1 
ATOM   984  N ND2 . ASN A 1 127 ? 94.412  28.151 27.260 1.00 19.37  ? 326 ASN A ND2 1 
ATOM   985  N N   . LYS A 1 128 ? 92.952  32.248 28.001 1.00 23.38  ? 327 LYS A N   1 
ATOM   986  C CA  . LYS A 1 128 ? 93.000  33.344 27.032 1.00 26.23  ? 327 LYS A CA  1 
ATOM   987  C C   . LYS A 1 128 ? 92.965  33.039 25.541 1.00 26.25  ? 327 LYS A C   1 
ATOM   988  O O   . LYS A 1 128 ? 92.920  33.975 24.735 1.00 26.70  ? 327 LYS A O   1 
ATOM   989  C CB  . LYS A 1 128 ? 94.206  34.231 27.291 1.00 27.66  ? 327 LYS A CB  1 
ATOM   990  C CG  . LYS A 1 128 ? 95.510  33.544 26.964 1.00 29.48  ? 327 LYS A CG  1 
ATOM   991  C CD  . LYS A 1 128 ? 96.507  34.523 26.377 1.00 32.05  ? 327 LYS A CD  1 
ATOM   992  C CE  . LYS A 1 128 ? 97.897  33.917 26.417 1.00 33.87  ? 327 LYS A CE  1 
ATOM   993  N NZ  . LYS A 1 128 ? 97.835  32.451 26.167 1.00 36.23  ? 327 LYS A NZ  1 
ATOM   994  N N   . ASP A 1 129 ? 92.991  31.764 25.161 1.00 25.21  ? 328 ASP A N   1 
ATOM   995  C CA  . ASP A 1 129 ? 92.955  31.431 23.739 1.00 24.00  ? 328 ASP A CA  1 
ATOM   996  C C   . ASP A 1 129 ? 91.740  30.630 23.286 1.00 21.81  ? 328 ASP A C   1 
ATOM   997  O O   . ASP A 1 129 ? 91.509  30.480 22.087 1.00 22.13  ? 328 ASP A O   1 
ATOM   998  C CB  . ASP A 1 129 ? 94.237  30.706 23.324 1.00 26.12  ? 328 ASP A CB  1 
ATOM   999  C CG  . ASP A 1 129 ? 95.403  31.659 23.116 1.00 28.46  ? 328 ASP A CG  1 
ATOM   1000 O OD1 . ASP A 1 129 ? 95.238  32.654 22.373 1.00 30.05  ? 328 ASP A OD1 1 
ATOM   1001 O OD2 . ASP A 1 129 ? 96.485  31.409 23.688 1.00 29.94  ? 328 ASP A OD2 1 
ATOM   1002 N N   . GLY A 1 130 ? 90.958  30.126 24.232 1.00 18.16  ? 329 GLY A N   1 
ATOM   1003 C CA  . GLY A 1 130 ? 89.783  29.365 23.859 1.00 15.44  ? 329 GLY A CA  1 
ATOM   1004 C C   . GLY A 1 130 ? 89.300  28.501 24.996 1.00 13.83  ? 329 GLY A C   1 
ATOM   1005 O O   . GLY A 1 130 ? 90.051  28.231 25.924 1.00 13.48  ? 329 GLY A O   1 
ATOM   1006 N N   . MET A 1 131 ? 88.049  28.061 24.936 1.00 12.41  ? 330 MET A N   1 
ATOM   1007 C CA  . MET A 1 131 ? 87.518  27.221 25.997 1.00 12.89  ? 330 MET A CA  1 
ATOM   1008 C C   . MET A 1 131 ? 87.455  25.755 25.574 1.00 12.33  ? 330 MET A C   1 
ATOM   1009 O O   . MET A 1 131 ? 87.706  25.427 24.415 1.00 12.83  ? 330 MET A O   1 
ATOM   1010 C CB  . MET A 1 131 ? 86.128  27.708 26.406 1.00 13.76  ? 330 MET A CB  1 
ATOM   1011 C CG  . MET A 1 131 ? 85.055  27.531 25.351 1.00 14.84  ? 330 MET A CG  1 
ATOM   1012 S SD  . MET A 1 131 ? 83.512  28.329 25.840 1.00 17.50  ? 330 MET A SD  1 
ATOM   1013 C CE  . MET A 1 131 ? 83.247  27.626 27.461 1.00 15.54  ? 330 MET A CE  1 
ATOM   1014 N N   . LEU A 1 132 ? 87.150  24.873 26.524 1.00 11.33  ? 331 LEU A N   1 
ATOM   1015 C CA  . LEU A 1 132 ? 87.036  23.446 26.239 1.00 9.09   ? 331 LEU A CA  1 
ATOM   1016 C C   . LEU A 1 132 ? 85.563  23.106 26.101 1.00 10.27  ? 331 LEU A C   1 
ATOM   1017 O O   . LEU A 1 132 ? 84.722  23.574 26.868 1.00 9.82   ? 331 LEU A O   1 
ATOM   1018 C CB  . LEU A 1 132 ? 87.646  22.590 27.359 1.00 6.55   ? 331 LEU A CB  1 
ATOM   1019 C CG  . LEU A 1 132 ? 89.165  22.379 27.461 1.00 6.55   ? 331 LEU A CG  1 
ATOM   1020 C CD1 . LEU A 1 132 ? 89.479  21.522 28.656 1.00 6.55   ? 331 LEU A CD1 1 
ATOM   1021 C CD2 . LEU A 1 132 ? 89.698  21.698 26.236 1.00 6.55   ? 331 LEU A CD2 1 
ATOM   1022 N N   . VAL A 1 133 ? 85.252  22.289 25.107 1.00 11.08  ? 332 VAL A N   1 
ATOM   1023 C CA  . VAL A 1 133 ? 83.879  21.894 24.870 1.00 10.94  ? 332 VAL A CA  1 
ATOM   1024 C C   . VAL A 1 133 ? 83.789  20.383 24.902 1.00 12.15  ? 332 VAL A C   1 
ATOM   1025 O O   . VAL A 1 133 ? 84.803  19.696 24.810 1.00 12.80  ? 332 VAL A O   1 
ATOM   1026 C CB  . VAL A 1 133 ? 83.409  22.389 23.510 1.00 9.49   ? 332 VAL A CB  1 
ATOM   1027 C CG1 . VAL A 1 133 ? 83.568  23.897 23.434 1.00 10.07  ? 332 VAL A CG1 1 
ATOM   1028 C CG2 . VAL A 1 133 ? 84.214  21.722 22.421 1.00 7.38   ? 332 VAL A CG2 1 
ATOM   1029 N N   . ALA A 1 134 ? 82.572  19.874 25.042 1.00 13.01  ? 333 ALA A N   1 
ATOM   1030 C CA  . ALA A 1 134 ? 82.328  18.440 25.071 1.00 14.37  ? 333 ALA A CA  1 
ATOM   1031 C C   . ALA A 1 134 ? 83.227  17.603 25.994 1.00 15.18  ? 333 ALA A C   1 
ATOM   1032 O O   . ALA A 1 134 ? 84.011  16.755 25.546 1.00 15.14  ? 333 ALA A O   1 
ATOM   1033 C CB  . ALA A 1 134 ? 82.367  17.878 23.651 1.00 14.10  ? 333 ALA A CB  1 
ATOM   1034 N N   . TYR A 1 135 ? 83.087  17.849 27.291 1.00 15.18  ? 334 TYR A N   1 
ATOM   1035 C CA  . TYR A 1 135 ? 83.793  17.100 28.319 1.00 15.96  ? 334 TYR A CA  1 
ATOM   1036 C C   . TYR A 1 135 ? 85.311  17.071 28.198 1.00 15.57  ? 334 TYR A C   1 
ATOM   1037 O O   . TYR A 1 135 ? 85.959  16.159 28.714 1.00 17.05  ? 334 TYR A O   1 
ATOM   1038 C CB  . TYR A 1 135 ? 83.226  15.676 28.362 1.00 17.60  ? 334 TYR A CB  1 
ATOM   1039 C CG  . TYR A 1 135 ? 81.715  15.652 28.230 1.00 21.56  ? 334 TYR A CG  1 
ATOM   1040 C CD1 . TYR A 1 135 ? 80.907  15.081 29.206 1.00 23.83  ? 334 TYR A CD1 1 
ATOM   1041 C CD2 . TYR A 1 135 ? 81.090  16.248 27.137 1.00 23.92  ? 334 TYR A CD2 1 
ATOM   1042 C CE1 . TYR A 1 135 ? 79.507  15.115 29.085 1.00 26.25  ? 334 TYR A CE1 1 
ATOM   1043 C CE2 . TYR A 1 135 ? 79.719  16.293 27.008 1.00 25.79  ? 334 TYR A CE2 1 
ATOM   1044 C CZ  . TYR A 1 135 ? 78.927  15.731 27.977 1.00 26.43  ? 334 TYR A CZ  1 
ATOM   1045 O OH  . TYR A 1 135 ? 77.562  15.819 27.821 1.00 27.60  ? 334 TYR A OH  1 
ATOM   1046 N N   . GLY A 1 136 ? 85.872  18.079 27.534 1.00 14.18  ? 335 GLY A N   1 
ATOM   1047 C CA  . GLY A 1 136 ? 87.315  18.166 27.381 1.00 13.84  ? 335 GLY A CA  1 
ATOM   1048 C C   . GLY A 1 136 ? 87.839  17.577 26.091 1.00 14.22  ? 335 GLY A C   1 
ATOM   1049 O O   . GLY A 1 136 ? 89.037  17.633 25.808 1.00 12.49  ? 335 GLY A O   1 
ATOM   1050 N N   . ASN A 1 137 ? 86.925  17.022 25.304 1.00 15.78  ? 336 ASN A N   1 
ATOM   1051 C CA  . ASN A 1 137 ? 87.261  16.392 24.035 1.00 17.60  ? 336 ASN A CA  1 
ATOM   1052 C C   . ASN A 1 137 ? 87.620  17.364 22.919 1.00 18.50  ? 336 ASN A C   1 
ATOM   1053 O O   . ASN A 1 137 ? 88.504  17.094 22.100 1.00 19.56  ? 336 ASN A O   1 
ATOM   1054 C CB  . ASN A 1 137 ? 86.103  15.519 23.589 1.00 17.01  ? 336 ASN A CB  1 
ATOM   1055 C CG  . ASN A 1 137 ? 85.816  14.411 24.563 1.00 18.16  ? 336 ASN A CG  1 
ATOM   1056 O OD1 . ASN A 1 137 ? 84.678  14.218 24.967 1.00 20.46  ? 336 ASN A OD1 1 
ATOM   1057 N ND2 . ASN A 1 137 ? 86.849  13.669 24.946 1.00 18.49  ? 336 ASN A ND2 1 
ATOM   1058 N N   . GLY A 1 138 ? 86.926  18.490 22.877 1.00 17.71  ? 337 GLY A N   1 
ATOM   1059 C CA  . GLY A 1 138 ? 87.211  19.465 21.854 1.00 18.09  ? 337 GLY A CA  1 
ATOM   1060 C C   . GLY A 1 138 ? 87.627  20.763 22.495 1.00 18.39  ? 337 GLY A C   1 
ATOM   1061 O O   . GLY A 1 138 ? 87.394  20.972 23.679 1.00 17.86  ? 337 GLY A O   1 
ATOM   1062 N N   . PHE A 1 139 ? 88.241  21.634 21.706 1.00 19.36  ? 338 PHE A N   1 
ATOM   1063 C CA  . PHE A 1 139 ? 88.693  22.928 22.186 1.00 19.78  ? 338 PHE A CA  1 
ATOM   1064 C C   . PHE A 1 139 ? 88.441  23.993 21.139 1.00 20.54  ? 338 PHE A C   1 
ATOM   1065 O O   . PHE A 1 139 ? 89.150  24.071 20.142 1.00 21.09  ? 338 PHE A O   1 
ATOM   1066 C CB  . PHE A 1 139 ? 90.178  22.879 22.508 1.00 19.76  ? 338 PHE A CB  1 
ATOM   1067 C CG  . PHE A 1 139 ? 90.766  24.214 22.790 1.00 20.87  ? 338 PHE A CG  1 
ATOM   1068 C CD1 . PHE A 1 139 ? 91.439  24.905 21.803 1.00 21.02  ? 338 PHE A CD1 1 
ATOM   1069 C CD2 . PHE A 1 139 ? 90.604  24.807 24.036 1.00 22.40  ? 338 PHE A CD2 1 
ATOM   1070 C CE1 . PHE A 1 139 ? 91.943  26.176 22.050 1.00 22.40  ? 338 PHE A CE1 1 
ATOM   1071 C CE2 . PHE A 1 139 ? 91.103  26.075 24.293 1.00 22.18  ? 338 PHE A CE2 1 
ATOM   1072 C CZ  . PHE A 1 139 ? 91.774  26.763 23.298 1.00 22.16  ? 338 PHE A CZ  1 
ATOM   1073 N N   . ILE A 1 140 ? 87.429  24.816 21.374 1.00 21.94  ? 339 ILE A N   1 
ATOM   1074 C CA  . ILE A 1 140 ? 87.075  25.876 20.443 1.00 23.45  ? 339 ILE A CA  1 
ATOM   1075 C C   . ILE A 1 140 ? 87.918  27.113 20.736 1.00 24.67  ? 339 ILE A C   1 
ATOM   1076 O O   . ILE A 1 140 ? 87.966  27.583 21.870 1.00 24.85  ? 339 ILE A O   1 
ATOM   1077 C CB  . ILE A 1 140 ? 85.555  26.181 20.546 1.00 22.96  ? 339 ILE A CB  1 
ATOM   1078 C CG1 . ILE A 1 140 ? 85.122  27.119 19.424 1.00 23.12  ? 339 ILE A CG1 1 
ATOM   1079 C CG2 . ILE A 1 140 ? 85.222  26.751 21.912 1.00 22.08  ? 339 ILE A CG2 1 
ATOM   1080 C CD1 . ILE A 1 140 ? 83.613  27.099 19.185 1.00 23.77  ? 339 ILE A CD1 1 
ATOM   1081 N N   . THR A 1 141 ? 88.602  27.624 19.715 1.00 26.83  ? 340 THR A N   1 
ATOM   1082 C CA  . THR A 1 141 ? 89.465  28.793 19.884 1.00 29.20  ? 340 THR A CA  1 
ATOM   1083 C C   . THR A 1 141 ? 88.681  30.077 20.126 1.00 30.66  ? 340 THR A C   1 
ATOM   1084 O O   . THR A 1 141 ? 87.600  30.281 19.571 1.00 30.82  ? 340 THR A O   1 
ATOM   1085 C CB  . THR A 1 141 ? 90.377  29.013 18.657 1.00 29.33  ? 340 THR A CB  1 
ATOM   1086 O OG1 . THR A 1 141 ? 89.632  29.628 17.597 1.00 30.99  ? 340 THR A OG1 1 
ATOM   1087 C CG2 . THR A 1 141 ? 90.921  27.689 18.171 1.00 29.52  ? 340 THR A CG2 1 
ATOM   1088 N N   . ARG A 1 142 ? 89.238  30.948 20.958 1.00 31.85  ? 341 ARG A N   1 
ATOM   1089 C CA  . ARG A 1 142 ? 88.588  32.206 21.272 1.00 33.52  ? 341 ARG A CA  1 
ATOM   1090 C C   . ARG A 1 142 ? 88.370  33.022 20.002 1.00 35.63  ? 341 ARG A C   1 
ATOM   1091 O O   . ARG A 1 142 ? 87.288  33.564 19.791 1.00 37.03  ? 341 ARG A O   1 
ATOM   1092 C CB  . ARG A 1 142 ? 89.437  32.996 22.264 1.00 32.08  ? 341 ARG A CB  1 
ATOM   1093 C CG  . ARG A 1 142 ? 88.760  34.229 22.835 1.00 30.73  ? 341 ARG A CG  1 
ATOM   1094 C CD  . ARG A 1 142 ? 89.697  34.904 23.821 1.00 30.37  ? 341 ARG A CD  1 
ATOM   1095 N NE  . ARG A 1 142 ? 89.073  36.009 24.541 1.00 29.65  ? 341 ARG A NE  1 
ATOM   1096 C CZ  . ARG A 1 142 ? 89.687  36.727 25.477 1.00 27.58  ? 341 ARG A CZ  1 
ATOM   1097 N NH1 . ARG A 1 142 ? 90.947  36.456 25.805 1.00 24.01  ? 341 ARG A NH1 1 
ATOM   1098 N NH2 . ARG A 1 142 ? 89.039  37.711 26.088 1.00 26.56  ? 341 ARG A NH2 1 
ATOM   1099 N N   . GLU A 1 143 ? 89.393  33.103 19.154 1.00 36.90  ? 342 GLU A N   1 
ATOM   1100 C CA  . GLU A 1 143 ? 89.292  33.862 17.910 1.00 38.31  ? 342 GLU A CA  1 
ATOM   1101 C C   . GLU A 1 143 ? 88.086  33.485 17.063 1.00 37.92  ? 342 GLU A C   1 
ATOM   1102 O O   . GLU A 1 143 ? 87.253  34.333 16.732 1.00 37.73  ? 342 GLU A O   1 
ATOM   1103 C CB  . GLU A 1 143 ? 90.557  33.685 17.067 1.00 40.56  ? 342 GLU A CB  1 
ATOM   1104 C CG  . GLU A 1 143 ? 91.621  34.744 17.309 1.00 46.16  ? 342 GLU A CG  1 
ATOM   1105 C CD  . GLU A 1 143 ? 91.078  36.169 17.181 1.00 49.94  ? 342 GLU A CD  1 
ATOM   1106 O OE1 . GLU A 1 143 ? 90.527  36.506 16.106 1.00 51.95  ? 342 GLU A OE1 1 
ATOM   1107 O OE2 . GLU A 1 143 ? 91.202  36.952 18.155 1.00 50.91  ? 342 GLU A OE2 1 
ATOM   1108 N N   . PHE A 1 144 ? 88.008  32.208 16.713 1.00 36.94  ? 343 PHE A N   1 
ATOM   1109 C CA  . PHE A 1 144 ? 86.933  31.698 15.883 1.00 37.11  ? 343 PHE A CA  1 
ATOM   1110 C C   . PHE A 1 144 ? 85.528  32.203 16.219 1.00 38.78  ? 343 PHE A C   1 
ATOM   1111 O O   . PHE A 1 144 ? 84.714  32.388 15.315 1.00 39.64  ? 343 PHE A O   1 
ATOM   1112 C CB  . PHE A 1 144 ? 86.963  30.168 15.895 1.00 35.58  ? 343 PHE A CB  1 
ATOM   1113 C CG  . PHE A 1 144 ? 85.780  29.533 15.223 1.00 34.14  ? 343 PHE A CG  1 
ATOM   1114 C CD1 . PHE A 1 144 ? 85.486  29.805 13.897 1.00 33.21  ? 343 PHE A CD1 1 
ATOM   1115 C CD2 . PHE A 1 144 ? 84.941  28.686 15.928 1.00 33.89  ? 343 PHE A CD2 1 
ATOM   1116 C CE1 . PHE A 1 144 ? 84.372  29.246 13.288 1.00 32.59  ? 343 PHE A CE1 1 
ATOM   1117 C CE2 . PHE A 1 144 ? 83.828  28.126 15.326 1.00 33.41  ? 343 PHE A CE2 1 
ATOM   1118 C CZ  . PHE A 1 144 ? 83.543  28.408 14.004 1.00 32.32  ? 343 PHE A CZ  1 
ATOM   1119 N N   . LEU A 1 145 ? 85.231  32.434 17.496 1.00 40.13  ? 344 LEU A N   1 
ATOM   1120 C CA  . LEU A 1 145 ? 83.895  32.910 17.870 1.00 42.46  ? 344 LEU A CA  1 
ATOM   1121 C C   . LEU A 1 145 ? 83.721  34.404 17.577 1.00 44.92  ? 344 LEU A C   1 
ATOM   1122 O O   . LEU A 1 145 ? 82.666  34.844 17.105 1.00 45.80  ? 344 LEU A O   1 
ATOM   1123 C CB  . LEU A 1 145 ? 83.612  32.628 19.352 1.00 40.58  ? 344 LEU A CB  1 
ATOM   1124 C CG  . LEU A 1 145 ? 83.767  31.177 19.817 1.00 38.37  ? 344 LEU A CG  1 
ATOM   1125 C CD1 . LEU A 1 145 ? 85.103  31.044 20.517 1.00 36.58  ? 344 LEU A CD1 1 
ATOM   1126 C CD2 . LEU A 1 145 ? 82.630  30.776 20.753 1.00 35.72  ? 344 LEU A CD2 1 
ATOM   1127 N N   . LYS A 1 146 ? 84.755  35.181 17.879 1.00 47.11  ? 345 LYS A N   1 
ATOM   1128 C CA  . LYS A 1 146 ? 84.733  36.608 17.608 1.00 48.39  ? 345 LYS A CA  1 
ATOM   1129 C C   . LYS A 1 146 ? 85.269  36.693 16.185 1.00 49.31  ? 345 LYS A C   1 
ATOM   1130 O O   . LYS A 1 146 ? 86.455  36.934 15.956 1.00 49.01  ? 345 LYS A O   1 
ATOM   1131 C CB  . LYS A 1 146 ? 85.653  37.355 18.573 1.00 48.56  ? 345 LYS A CB  1 
ATOM   1132 C CG  . LYS A 1 146 ? 87.112  36.961 18.429 1.00 48.53  ? 345 LYS A CG  1 
ATOM   1133 C CD  . LYS A 1 146 ? 87.956  37.398 19.610 1.00 49.87  ? 345 LYS A CD  1 
ATOM   1134 C CE  . LYS A 1 146 ? 88.046  38.908 19.737 1.00 50.01  ? 345 LYS A CE  1 
ATOM   1135 N NZ  . LYS A 1 146 ? 89.033  39.277 20.793 1.00 49.61  ? 345 LYS A NZ  1 
ATOM   1136 N N   . SER A 1 147 ? 84.380  36.429 15.235 1.00 50.01  ? 346 SER A N   1 
ATOM   1137 C CA  . SER A 1 147 ? 84.699  36.470 13.816 1.00 50.42  ? 346 SER A CA  1 
ATOM   1138 C C   . SER A 1 147 ? 83.404  36.057 13.151 1.00 51.50  ? 346 SER A C   1 
ATOM   1139 O O   . SER A 1 147 ? 83.193  36.298 11.965 1.00 52.63  ? 346 SER A O   1 
ATOM   1140 C CB  . SER A 1 147 ? 85.817  35.487 13.461 1.00 48.23  ? 346 SER A CB  1 
ATOM   1141 O OG  . SER A 1 147 ? 85.305  34.187 13.262 1.00 46.89  ? 346 SER A OG  1 
ATOM   1142 N N   . LEU A 1 148 ? 82.534  35.429 13.936 1.00 52.40  ? 347 LEU A N   1 
ATOM   1143 C CA  . LEU A 1 148 ? 81.241  35.012 13.432 1.00 53.91  ? 347 LEU A CA  1 
ATOM   1144 C C   . LEU A 1 148 ? 80.510  36.303 13.119 1.00 56.22  ? 347 LEU A C   1 
ATOM   1145 O O   . LEU A 1 148 ? 80.786  37.337 13.729 1.00 55.04  ? 347 LEU A O   1 
ATOM   1146 C CB  . LEU A 1 148 ? 80.470  34.234 14.494 1.00 52.71  ? 347 LEU A CB  1 
ATOM   1147 C CG  . LEU A 1 148 ? 81.215  33.089 15.175 1.00 51.93  ? 347 LEU A CG  1 
ATOM   1148 C CD1 . LEU A 1 148 ? 80.238  32.291 16.031 1.00 51.19  ? 347 LEU A CD1 1 
ATOM   1149 C CD2 . LEU A 1 148 ? 81.869  32.206 14.127 1.00 51.09  ? 347 LEU A CD2 1 
ATOM   1150 N N   . ARG A 1 149 ? 79.588  36.246 12.164 1.00 60.19  ? 348 ARG A N   1 
ATOM   1151 C CA  . ARG A 1 149 ? 78.828  37.428 11.775 1.00 63.80  ? 348 ARG A CA  1 
ATOM   1152 C C   . ARG A 1 149 ? 78.046  37.953 12.979 1.00 64.28  ? 348 ARG A C   1 
ATOM   1153 O O   . ARG A 1 149 ? 77.458  37.175 13.737 1.00 64.32  ? 348 ARG A O   1 
ATOM   1154 C CB  . ARG A 1 149 ? 77.868  37.095 10.618 1.00 66.15  ? 348 ARG A CB  1 
ATOM   1155 C CG  . ARG A 1 149 ? 76.622  36.312 11.008 1.00 69.26  ? 348 ARG A CG  1 
ATOM   1156 C CD  . ARG A 1 149 ? 75.692  36.140 9.817  1.00 72.38  ? 348 ARG A CD  1 
ATOM   1157 N NE  . ARG A 1 149 ? 74.283  36.239 10.200 1.00 76.07  ? 348 ARG A NE  1 
ATOM   1158 C CZ  . ARG A 1 149 ? 73.565  35.257 10.745 1.00 78.10  ? 348 ARG A CZ  1 
ATOM   1159 N NH1 . ARG A 1 149 ? 74.108  34.075 10.977 1.00 78.79  ? 348 ARG A NH1 1 
ATOM   1160 N NH2 . ARG A 1 149 ? 72.294  35.461 11.072 1.00 79.57  ? 348 ARG A NH2 1 
ATOM   1161 N N   . LYS A 1 150 ? 78.049  39.271 13.163 1.00 64.71  ? 349 LYS A N   1 
ATOM   1162 C CA  . LYS A 1 150 ? 77.329  39.862 14.283 1.00 64.52  ? 349 LYS A CA  1 
ATOM   1163 C C   . LYS A 1 150 ? 75.900  39.340 14.312 1.00 64.41  ? 349 LYS A C   1 
ATOM   1164 O O   . LYS A 1 150 ? 75.378  38.882 13.294 1.00 63.80  ? 349 LYS A O   1 
ATOM   1165 C CB  . LYS A 1 150 ? 77.338  41.395 14.195 1.00 64.17  ? 349 LYS A CB  1 
ATOM   1166 C CG  . LYS A 1 150 ? 78.479  42.032 14.975 1.00 64.54  ? 349 LYS A CG  1 
ATOM   1167 C CD  . LYS A 1 150 ? 78.210  43.494 15.296 1.00 65.52  ? 349 LYS A CD  1 
ATOM   1168 C CE  . LYS A 1 150 ? 78.944  43.940 16.555 1.00 65.27  ? 349 LYS A CE  1 
ATOM   1169 N NZ  . LYS A 1 150 ? 78.304  43.423 17.801 1.00 65.15  ? 349 LYS A NZ  1 
ATOM   1170 N N   . PRO A 1 151 ? 75.249  39.390 15.485 1.00 64.77  ? 350 PRO A N   1 
ATOM   1171 C CA  . PRO A 1 151 ? 75.749  39.895 16.769 1.00 64.53  ? 350 PRO A CA  1 
ATOM   1172 C C   . PRO A 1 151 ? 76.397  38.771 17.564 1.00 64.15  ? 350 PRO A C   1 
ATOM   1173 O O   . PRO A 1 151 ? 76.702  38.925 18.746 1.00 64.21  ? 350 PRO A O   1 
ATOM   1174 C CB  . PRO A 1 151 ? 74.481  40.379 17.443 1.00 64.91  ? 350 PRO A CB  1 
ATOM   1175 C CG  . PRO A 1 151 ? 73.529  39.261 17.092 1.00 65.36  ? 350 PRO A CG  1 
ATOM   1176 C CD  . PRO A 1 151 ? 73.835  38.988 15.610 1.00 65.42  ? 350 PRO A CD  1 
ATOM   1177 N N   . PHE A 1 152 ? 76.587  37.637 16.901 1.00 63.54  ? 351 PHE A N   1 
ATOM   1178 C CA  . PHE A 1 152 ? 77.166  36.458 17.524 1.00 62.82  ? 351 PHE A CA  1 
ATOM   1179 C C   . PHE A 1 152 ? 78.530  36.666 18.155 1.00 61.49  ? 351 PHE A C   1 
ATOM   1180 O O   . PHE A 1 152 ? 78.711  36.412 19.347 1.00 62.06  ? 351 PHE A O   1 
ATOM   1181 C CB  . PHE A 1 152 ? 77.222  35.329 16.500 1.00 63.80  ? 351 PHE A CB  1 
ATOM   1182 C CG  . PHE A 1 152 ? 75.872  34.853 16.090 1.00 65.45  ? 351 PHE A CG  1 
ATOM   1183 C CD1 . PHE A 1 152 ? 75.052  34.201 17.007 1.00 66.18  ? 351 PHE A CD1 1 
ATOM   1184 C CD2 . PHE A 1 152 ? 75.385  35.108 14.816 1.00 67.06  ? 351 PHE A CD2 1 
ATOM   1185 C CE1 . PHE A 1 152 ? 73.761  33.810 16.666 1.00 67.56  ? 351 PHE A CE1 1 
ATOM   1186 C CE2 . PHE A 1 152 ? 74.090  34.721 14.457 1.00 68.71  ? 351 PHE A CE2 1 
ATOM   1187 C CZ  . PHE A 1 152 ? 73.276  34.070 15.386 1.00 68.78  ? 351 PHE A CZ  1 
ATOM   1188 N N   . CYS A 1 153 ? 79.482  37.132 17.358 1.00 59.45  ? 352 CYS A N   1 
ATOM   1189 C CA  . CYS A 1 153 ? 80.839  37.364 17.829 1.00 57.13  ? 352 CYS A CA  1 
ATOM   1190 C C   . CYS A 1 153 ? 80.952  38.059 19.191 1.00 56.29  ? 352 CYS A C   1 
ATOM   1191 O O   . CYS A 1 153 ? 82.054  38.149 19.734 1.00 55.95  ? 352 CYS A O   1 
ATOM   1192 C CB  . CYS A 1 153 ? 81.605  38.162 16.787 1.00 56.47  ? 352 CYS A CB  1 
ATOM   1193 S SG  . CYS A 1 153 ? 80.782  39.688 16.380 1.00 56.58  ? 352 CYS A SG  1 
ATOM   1194 N N   . ASP A 1 154 ? 79.838  38.558 19.739 1.00 55.00  ? 353 ASP A N   1 
ATOM   1195 C CA  . ASP A 1 154 ? 79.874  39.208 21.055 1.00 53.26  ? 353 ASP A CA  1 
ATOM   1196 C C   . ASP A 1 154 ? 79.132  38.421 22.129 1.00 50.77  ? 353 ASP A C   1 
ATOM   1197 O O   . ASP A 1 154 ? 78.747  39.008 23.140 1.00 51.24  ? 353 ASP A O   1 
ATOM   1198 C CB  . ASP A 1 154 ? 79.242  40.611 21.065 1.00 56.69  ? 353 ASP A CB  1 
ATOM   1199 C CG  . ASP A 1 154 ? 79.252  41.293 19.719 1.00 60.00  ? 353 ASP A CG  1 
ATOM   1200 O OD1 . ASP A 1 154 ? 80.247  41.981 19.391 1.00 60.70  ? 353 ASP A OD1 1 
ATOM   1201 O OD2 . ASP A 1 154 ? 78.244  41.145 18.994 1.00 62.15  ? 353 ASP A OD2 1 
ATOM   1202 N N   . ILE A 1 155 ? 78.893  37.126 21.940 1.00 47.42  ? 354 ILE A N   1 
ATOM   1203 C CA  . ILE A 1 155 ? 78.198  36.400 22.999 1.00 44.34  ? 354 ILE A CA  1 
ATOM   1204 C C   . ILE A 1 155 ? 79.230  35.842 23.953 1.00 42.66  ? 354 ILE A C   1 
ATOM   1205 O O   . ILE A 1 155 ? 79.140  36.019 25.168 1.00 41.06  ? 354 ILE A O   1 
ATOM   1206 C CB  . ILE A 1 155 ? 77.351  35.199 22.497 1.00 44.25  ? 354 ILE A CB  1 
ATOM   1207 C CG1 . ILE A 1 155 ? 76.375  35.628 21.402 1.00 44.32  ? 354 ILE A CG1 1 
ATOM   1208 C CG2 . ILE A 1 155 ? 76.538  34.628 23.667 1.00 43.83  ? 354 ILE A CG2 1 
ATOM   1209 C CD1 . ILE A 1 155 ? 75.285  34.592 21.110 1.00 44.27  ? 354 ILE A CD1 1 
ATOM   1210 N N   . MET A 1 156 ? 80.230  35.185 23.383 1.00 41.20  ? 355 MET A N   1 
ATOM   1211 C CA  . MET A 1 156 ? 81.266  34.554 24.178 1.00 40.84  ? 355 MET A CA  1 
ATOM   1212 C C   . MET A 1 156 ? 82.417  35.438 24.595 1.00 40.58  ? 355 MET A C   1 
ATOM   1213 O O   . MET A 1 156 ? 83.204  35.047 25.453 1.00 42.35  ? 355 MET A O   1 
ATOM   1214 C CB  . MET A 1 156 ? 81.823  33.343 23.435 1.00 39.87  ? 355 MET A CB  1 
ATOM   1215 C CG  . MET A 1 156 ? 81.869  32.093 24.287 1.00 37.30  ? 355 MET A CG  1 
ATOM   1216 S SD  . MET A 1 156 ? 80.248  31.809 25.017 1.00 34.99  ? 355 MET A SD  1 
ATOM   1217 C CE  . MET A 1 156 ? 80.718  30.968 26.523 1.00 37.82  ? 355 MET A CE  1 
ATOM   1218 N N   . GLU A 1 157 ? 82.532  36.620 24.000 1.00 39.63  ? 356 GLU A N   1 
ATOM   1219 C CA  . GLU A 1 157 ? 83.632  37.511 24.349 1.00 38.98  ? 356 GLU A CA  1 
ATOM   1220 C C   . GLU A 1 157 ? 83.501  38.146 25.730 1.00 38.63  ? 356 GLU A C   1 
ATOM   1221 O O   . GLU A 1 157 ? 84.508  38.391 26.400 1.00 38.38  ? 356 GLU A O   1 
ATOM   1222 C CB  . GLU A 1 157 ? 83.793  38.604 23.296 1.00 40.16  ? 356 GLU A CB  1 
ATOM   1223 C CG  . GLU A 1 157 ? 85.137  39.312 23.372 1.00 42.15  ? 356 GLU A CG  1 
ATOM   1224 C CD  . GLU A 1 157 ? 86.302  38.338 23.471 1.00 42.99  ? 356 GLU A CD  1 
ATOM   1225 O OE1 . GLU A 1 157 ? 86.341  37.370 22.681 1.00 44.01  ? 356 GLU A OE1 1 
ATOM   1226 O OE2 . GLU A 1 157 ? 87.181  38.545 24.335 1.00 42.08  ? 356 GLU A OE2 1 
ATOM   1227 N N   . PRO A 1 158 ? 82.262  38.433 26.174 1.00 38.22  ? 357 PRO A N   1 
ATOM   1228 C CA  . PRO A 1 158 ? 82.084  39.040 27.497 1.00 37.16  ? 357 PRO A CA  1 
ATOM   1229 C C   . PRO A 1 158 ? 82.457  38.040 28.593 1.00 36.27  ? 357 PRO A C   1 
ATOM   1230 O O   . PRO A 1 158 ? 83.041  38.405 29.615 1.00 36.68  ? 357 PRO A O   1 
ATOM   1231 C CB  . PRO A 1 158 ? 80.592  39.389 27.524 1.00 37.63  ? 357 PRO A CB  1 
ATOM   1232 C CG  . PRO A 1 158 ? 80.224  39.514 26.071 1.00 37.67  ? 357 PRO A CG  1 
ATOM   1233 C CD  . PRO A 1 158 ? 80.974  38.367 25.460 1.00 38.10  ? 357 PRO A CD  1 
ATOM   1234 N N   . LYS A 1 159 ? 82.114  36.774 28.365 1.00 34.46  ? 358 LYS A N   1 
ATOM   1235 C CA  . LYS A 1 159 ? 82.406  35.719 29.321 1.00 32.60  ? 358 LYS A CA  1 
ATOM   1236 C C   . LYS A 1 159 ? 83.897  35.421 29.422 1.00 31.90  ? 358 LYS A C   1 
ATOM   1237 O O   . LYS A 1 159 ? 84.424  35.277 30.519 1.00 31.71  ? 358 LYS A O   1 
ATOM   1238 C CB  . LYS A 1 159 ? 81.652  34.437 28.957 1.00 33.65  ? 358 LYS A CB  1 
ATOM   1239 C CG  . LYS A 1 159 ? 80.167  34.456 29.287 1.00 33.52  ? 358 LYS A CG  1 
ATOM   1240 C CD  . LYS A 1 159 ? 79.348  35.056 28.161 1.00 35.03  ? 358 LYS A CD  1 
ATOM   1241 C CE  . LYS A 1 159 ? 77.908  35.272 28.589 1.00 35.14  ? 358 LYS A CE  1 
ATOM   1242 N NZ  . LYS A 1 159 ? 77.111  35.886 27.487 1.00 36.94  ? 358 LYS A NZ  1 
ATOM   1243 N N   . PHE A 1 160 ? 84.574  35.322 28.281 1.00 30.77  ? 359 PHE A N   1 
ATOM   1244 C CA  . PHE A 1 160 ? 86.011  35.041 28.248 1.00 29.84  ? 359 PHE A CA  1 
ATOM   1245 C C   . PHE A 1 160 ? 86.799  36.074 29.031 1.00 29.90  ? 359 PHE A C   1 
ATOM   1246 O O   . PHE A 1 160 ? 87.748  35.757 29.747 1.00 28.95  ? 359 PHE A O   1 
ATOM   1247 C CB  . PHE A 1 160 ? 86.495  35.027 26.808 1.00 29.35  ? 359 PHE A CB  1 
ATOM   1248 C CG  . PHE A 1 160 ? 86.746  33.656 26.274 1.00 30.66  ? 359 PHE A CG  1 
ATOM   1249 C CD1 . PHE A 1 160 ? 87.915  32.980 26.597 1.00 31.59  ? 359 PHE A CD1 1 
ATOM   1250 C CD2 . PHE A 1 160 ? 85.811  33.031 25.456 1.00 30.27  ? 359 PHE A CD2 1 
ATOM   1251 C CE1 . PHE A 1 160 ? 88.152  31.704 26.114 1.00 32.14  ? 359 PHE A CE1 1 
ATOM   1252 C CE2 . PHE A 1 160 ? 86.037  31.757 24.969 1.00 29.78  ? 359 PHE A CE2 1 
ATOM   1253 C CZ  . PHE A 1 160 ? 87.209  31.090 25.297 1.00 31.21  ? 359 PHE A CZ  1 
ATOM   1254 N N   . ASP A 1 161 ? 86.389  37.320 28.863 1.00 30.73  ? 360 ASP A N   1 
ATOM   1255 C CA  . ASP A 1 161 ? 86.987  38.461 29.529 1.00 30.57  ? 360 ASP A CA  1 
ATOM   1256 C C   . ASP A 1 161 ? 86.825  38.319 31.044 1.00 27.66  ? 360 ASP A C   1 
ATOM   1257 O O   . ASP A 1 161 ? 87.802  38.351 31.790 1.00 27.12  ? 360 ASP A O   1 
ATOM   1258 C CB  . ASP A 1 161 ? 86.289  39.725 29.026 1.00 35.20  ? 360 ASP A CB  1 
ATOM   1259 C CG  . ASP A 1 161 ? 86.637  40.954 29.829 1.00 40.01  ? 360 ASP A CG  1 
ATOM   1260 O OD1 . ASP A 1 161 ? 85.997  41.998 29.578 1.00 43.29  ? 360 ASP A OD1 1 
ATOM   1261 O OD2 . ASP A 1 161 ? 87.538  40.888 30.700 1.00 42.54  ? 360 ASP A OD2 1 
ATOM   1262 N N   . PHE A 1 162 ? 85.584  38.163 31.488 1.00 24.58  ? 361 PHE A N   1 
ATOM   1263 C CA  . PHE A 1 162 ? 85.293  38.016 32.909 1.00 22.57  ? 361 PHE A CA  1 
ATOM   1264 C C   . PHE A 1 162 ? 86.075  36.864 33.522 1.00 22.36  ? 361 PHE A C   1 
ATOM   1265 O O   . PHE A 1 162 ? 86.458  36.893 34.688 1.00 20.96  ? 361 PHE A O   1 
ATOM   1266 C CB  . PHE A 1 162 ? 83.795  37.765 33.119 1.00 19.98  ? 361 PHE A CB  1 
ATOM   1267 C CG  . PHE A 1 162 ? 83.479  37.068 34.409 1.00 17.03  ? 361 PHE A CG  1 
ATOM   1268 C CD1 . PHE A 1 162 ? 83.845  35.744 34.609 1.00 16.79  ? 361 PHE A CD1 1 
ATOM   1269 C CD2 . PHE A 1 162 ? 82.891  37.752 35.450 1.00 17.54  ? 361 PHE A CD2 1 
ATOM   1270 C CE1 . PHE A 1 162 ? 83.642  35.119 35.823 1.00 17.25  ? 361 PHE A CE1 1 
ATOM   1271 C CE2 . PHE A 1 162 ? 82.682  37.134 36.673 1.00 17.93  ? 361 PHE A CE2 1 
ATOM   1272 C CZ  . PHE A 1 162 ? 83.061  35.814 36.860 1.00 16.59  ? 361 PHE A CZ  1 
ATOM   1273 N N   . ALA A 1 163 ? 86.280  35.834 32.721 1.00 23.99  ? 362 ALA A N   1 
ATOM   1274 C CA  . ALA A 1 163 ? 86.966  34.648 33.174 1.00 25.26  ? 362 ALA A CA  1 
ATOM   1275 C C   . ALA A 1 163 ? 88.461  34.815 33.258 1.00 26.02  ? 362 ALA A C   1 
ATOM   1276 O O   . ALA A 1 163 ? 89.108  34.123 34.034 1.00 27.52  ? 362 ALA A O   1 
ATOM   1277 C CB  . ALA A 1 163 ? 86.631  33.487 32.264 1.00 26.56  ? 362 ALA A CB  1 
ATOM   1278 N N   . MET A 1 164 ? 89.024  35.715 32.463 1.00 26.21  ? 363 MET A N   1 
ATOM   1279 C CA  . MET A 1 164 ? 90.468  35.896 32.501 1.00 26.68  ? 363 MET A CA  1 
ATOM   1280 C C   . MET A 1 164 ? 90.909  36.584 33.767 1.00 26.02  ? 363 MET A C   1 
ATOM   1281 O O   . MET A 1 164 ? 92.013  36.354 34.255 1.00 25.06  ? 363 MET A O   1 
ATOM   1282 C CB  . MET A 1 164 ? 90.955  36.670 31.282 1.00 28.44  ? 363 MET A CB  1 
ATOM   1283 C CG  . MET A 1 164 ? 91.754  35.799 30.328 1.00 30.46  ? 363 MET A CG  1 
ATOM   1284 S SD  . MET A 1 164 ? 90.824  34.328 29.853 1.00 33.36  ? 363 MET A SD  1 
ATOM   1285 C CE  . MET A 1 164 ? 91.211  33.187 31.180 1.00 33.29  ? 363 MET A CE  1 
ATOM   1286 N N   . LYS A 1 165 ? 90.031  37.424 34.299 1.00 25.83  ? 364 LYS A N   1 
ATOM   1287 C CA  . LYS A 1 165 ? 90.320  38.139 35.522 1.00 25.38  ? 364 LYS A CA  1 
ATOM   1288 C C   . LYS A 1 165 ? 89.919  37.264 36.699 1.00 25.03  ? 364 LYS A C   1 
ATOM   1289 O O   . LYS A 1 165 ? 90.609  37.225 37.718 1.00 27.07  ? 364 LYS A O   1 
ATOM   1290 C CB  . LYS A 1 165 ? 89.550  39.464 35.565 1.00 25.31  ? 364 LYS A CB  1 
ATOM   1291 C CG  . LYS A 1 165 ? 89.925  40.442 34.463 1.00 25.92  ? 364 LYS A CG  1 
ATOM   1292 C CD  . LYS A 1 165 ? 89.214  41.778 34.625 1.00 27.55  ? 364 LYS A CD  1 
ATOM   1293 C CE  . LYS A 1 165 ? 87.723  41.590 34.862 1.00 28.37  ? 364 LYS A CE  1 
ATOM   1294 N NZ  . LYS A 1 165 ? 86.892  42.593 34.145 1.00 27.95  ? 364 LYS A NZ  1 
ATOM   1295 N N   . PHE A 1 166 ? 88.806  36.553 36.555 1.00 23.41  ? 365 PHE A N   1 
ATOM   1296 C CA  . PHE A 1 166 ? 88.328  35.691 37.630 1.00 21.79  ? 365 PHE A CA  1 
ATOM   1297 C C   . PHE A 1 166 ? 89.299  34.552 37.906 1.00 21.70  ? 365 PHE A C   1 
ATOM   1298 O O   . PHE A 1 166 ? 89.375  34.061 39.027 1.00 21.57  ? 365 PHE A O   1 
ATOM   1299 C CB  . PHE A 1 166 ? 86.961  35.106 37.287 1.00 20.23  ? 365 PHE A CB  1 
ATOM   1300 C CG  . PHE A 1 166 ? 86.312  34.388 38.428 1.00 16.13  ? 365 PHE A CG  1 
ATOM   1301 C CD1 . PHE A 1 166 ? 85.406  35.038 39.246 1.00 15.16  ? 365 PHE A CD1 1 
ATOM   1302 C CD2 . PHE A 1 166 ? 86.617  33.066 38.691 1.00 15.75  ? 365 PHE A CD2 1 
ATOM   1303 C CE1 . PHE A 1 166 ? 84.809  34.382 40.312 1.00 15.51  ? 365 PHE A CE1 1 
ATOM   1304 C CE2 . PHE A 1 166 ? 86.027  32.399 39.758 1.00 17.00  ? 365 PHE A CE2 1 
ATOM   1305 C CZ  . PHE A 1 166 ? 85.120  33.059 40.570 1.00 15.45  ? 365 PHE A CZ  1 
ATOM   1306 N N   . ASN A 1 167 ? 90.025  34.127 36.873 1.00 22.13  ? 366 ASN A N   1 
ATOM   1307 C CA  . ASN A 1 167 ? 91.005  33.044 36.995 1.00 22.06  ? 366 ASN A CA  1 
ATOM   1308 C C   . ASN A 1 167 ? 92.290  33.586 37.585 1.00 21.62  ? 366 ASN A C   1 
ATOM   1309 O O   . ASN A 1 167 ? 93.161  32.829 38.004 1.00 21.62  ? 366 ASN A O   1 
ATOM   1310 C CB  . ASN A 1 167 ? 91.312  32.426 35.626 1.00 22.32  ? 366 ASN A CB  1 
ATOM   1311 C CG  . ASN A 1 167 ? 90.434  31.236 35.305 1.00 22.43  ? 366 ASN A CG  1 
ATOM   1312 O OD1 . ASN A 1 167 ? 90.507  30.689 34.208 1.00 22.02  ? 366 ASN A OD1 1 
ATOM   1313 N ND2 . ASN A 1 167 ? 89.604  30.821 36.264 1.00 23.80  ? 366 ASN A ND2 1 
ATOM   1314 N N   . ALA A 1 168 ? 92.404  34.908 37.587 1.00 21.73  ? 367 ALA A N   1 
ATOM   1315 C CA  . ALA A 1 168 ? 93.572  35.572 38.129 1.00 20.74  ? 367 ALA A CA  1 
ATOM   1316 C C   . ALA A 1 168 ? 93.530  35.424 39.644 1.00 20.80  ? 367 ALA A C   1 
ATOM   1317 O O   . ALA A 1 168 ? 94.570  35.315 40.285 1.00 21.68  ? 367 ALA A O   1 
ATOM   1318 C CB  . ALA A 1 168 ? 93.557  37.021 37.740 1.00 18.99  ? 367 ALA A CB  1 
ATOM   1319 N N   . LEU A 1 169 ? 92.322  35.407 40.204 1.00 20.53  ? 368 LEU A N   1 
ATOM   1320 C CA  . LEU A 1 169 ? 92.133  35.253 41.647 1.00 20.84  ? 368 LEU A CA  1 
ATOM   1321 C C   . LEU A 1 169 ? 92.744  33.947 42.152 1.00 21.73  ? 368 LEU A C   1 
ATOM   1322 O O   . LEU A 1 169 ? 93.054  33.813 43.330 1.00 22.86  ? 368 LEU A O   1 
ATOM   1323 C CB  . LEU A 1 169 ? 90.647  35.282 42.002 1.00 19.41  ? 368 LEU A CB  1 
ATOM   1324 C CG  . LEU A 1 169 ? 89.895  36.564 41.684 1.00 18.71  ? 368 LEU A CG  1 
ATOM   1325 C CD1 . LEU A 1 169 ? 88.463  36.437 42.166 1.00 19.35  ? 368 LEU A CD1 1 
ATOM   1326 C CD2 . LEU A 1 169 ? 90.580  37.723 42.363 1.00 19.01  ? 368 LEU A CD2 1 
ATOM   1327 N N   . GLU A 1 170 ? 92.884  32.978 41.258 1.00 22.75  ? 369 GLU A N   1 
ATOM   1328 C CA  . GLU A 1 170 ? 93.483  31.696 41.590 1.00 24.12  ? 369 GLU A CA  1 
ATOM   1329 C C   . GLU A 1 170 ? 92.761  30.799 42.585 1.00 24.05  ? 369 GLU A C   1 
ATOM   1330 O O   . GLU A 1 170 ? 93.376  30.263 43.509 1.00 24.55  ? 369 GLU A O   1 
ATOM   1331 C CB  . GLU A 1 170 ? 94.911  31.920 42.066 1.00 25.37  ? 369 GLU A CB  1 
ATOM   1332 C CG  . GLU A 1 170 ? 95.730  32.713 41.072 1.00 30.14  ? 369 GLU A CG  1 
ATOM   1333 C CD  . GLU A 1 170 ? 97.163  32.253 41.018 1.00 33.56  ? 369 GLU A CD  1 
ATOM   1334 O OE1 . GLU A 1 170 ? 97.389  31.038 40.851 1.00 35.78  ? 369 GLU A OE1 1 
ATOM   1335 O OE2 . GLU A 1 170 ? 98.066  33.100 41.136 1.00 35.87  ? 369 GLU A OE2 1 
ATOM   1336 N N   . LEU A 1 171 ? 91.464  30.607 42.394 1.00 23.07  ? 370 LEU A N   1 
ATOM   1337 C CA  . LEU A 1 171 ? 90.731  29.736 43.290 1.00 22.35  ? 370 LEU A CA  1 
ATOM   1338 C C   . LEU A 1 171 ? 90.881  28.306 42.792 1.00 21.66  ? 370 LEU A C   1 
ATOM   1339 O O   . LEU A 1 171 ? 91.467  28.049 41.743 1.00 20.58  ? 370 LEU A O   1 
ATOM   1340 C CB  . LEU A 1 171 ? 89.255  30.120 43.306 1.00 23.97  ? 370 LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 171 ? 89.010  31.625 43.333 1.00 24.06  ? 370 LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 171 ? 87.520  31.915 43.307 1.00 24.12  ? 370 LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 171 ? 89.652  32.205 44.572 1.00 24.64  ? 370 LEU A CD2 1 
ATOM   1344 N N   . ASP A 1 172 ? 90.360  27.374 43.568 1.00 22.07  ? 371 ASP A N   1 
ATOM   1345 C CA  . ASP A 1 172 ? 90.396  25.978 43.201 1.00 22.58  ? 371 ASP A CA  1 
ATOM   1346 C C   . ASP A 1 172 ? 89.022  25.440 43.496 1.00 22.22  ? 371 ASP A C   1 
ATOM   1347 O O   . ASP A 1 172 ? 88.155  26.161 43.984 1.00 22.01  ? 371 ASP A O   1 
ATOM   1348 C CB  . ASP A 1 172 ? 91.461  25.230 43.992 1.00 24.63  ? 371 ASP A CB  1 
ATOM   1349 C CG  . ASP A 1 172 ? 91.651  25.785 45.388 1.00 27.26  ? 371 ASP A CG  1 
ATOM   1350 O OD1 . ASP A 1 172 ? 90.770  25.579 46.247 1.00 28.28  ? 371 ASP A OD1 1 
ATOM   1351 O OD2 . ASP A 1 172 ? 92.689  26.437 45.624 1.00 30.37  ? 371 ASP A OD2 1 
ATOM   1352 N N   . ASP A 1 173 ? 88.820  24.169 43.208 1.00 22.63  ? 372 ASP A N   1 
ATOM   1353 C CA  . ASP A 1 173 ? 87.522  23.566 43.405 1.00 23.61  ? 372 ASP A CA  1 
ATOM   1354 C C   . ASP A 1 173 ? 86.929  23.685 44.798 1.00 22.97  ? 372 ASP A C   1 
ATOM   1355 O O   . ASP A 1 173 ? 85.715  23.821 44.945 1.00 24.63  ? 372 ASP A O   1 
ATOM   1356 C CB  . ASP A 1 173 ? 87.582  22.119 42.941 1.00 24.88  ? 372 ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 173 ? 87.803  22.016 41.440 1.00 25.20  ? 372 ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 173 ? 86.889  22.409 40.679 1.00 22.49  ? 372 ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 173 ? 88.894  21.562 41.029 1.00 25.99  ? 372 ASP A OD2 1 
ATOM   1360 N N   . SER A 1 174 ? 87.764  23.646 45.825 1.00 21.46  ? 373 SER A N   1 
ATOM   1361 C CA  . SER A 1 174 ? 87.236  23.786 47.173 1.00 20.04  ? 373 SER A CA  1 
ATOM   1362 C C   . SER A 1 174 ? 86.651  25.183 47.322 1.00 19.29  ? 373 SER A C   1 
ATOM   1363 O O   . SER A 1 174 ? 85.657  25.379 48.014 1.00 20.86  ? 373 SER A O   1 
ATOM   1364 C CB  . SER A 1 174 ? 88.333  23.545 48.207 1.00 18.70  ? 373 SER A CB  1 
ATOM   1365 O OG  . SER A 1 174 ? 89.595  23.927 47.704 1.00 19.17  ? 373 SER A OG  1 
ATOM   1366 N N   . ASP A 1 175 ? 87.255  26.155 46.654 1.00 17.74  ? 374 ASP A N   1 
ATOM   1367 C CA  . ASP A 1 175 ? 86.751  27.512 46.731 1.00 16.90  ? 374 ASP A CA  1 
ATOM   1368 C C   . ASP A 1 175 ? 85.522  27.655 45.849 1.00 15.47  ? 374 ASP A C   1 
ATOM   1369 O O   . ASP A 1 175 ? 84.453  28.077 46.301 1.00 16.51  ? 374 ASP A O   1 
ATOM   1370 C CB  . ASP A 1 175 ? 87.816  28.505 46.272 1.00 18.62  ? 374 ASP A CB  1 
ATOM   1371 C CG  . ASP A 1 175 ? 89.121  28.336 47.011 1.00 21.21  ? 374 ASP A CG  1 
ATOM   1372 O OD1 . ASP A 1 175 ? 89.116  27.819 48.147 1.00 23.48  ? 374 ASP A OD1 1 
ATOM   1373 O OD2 . ASP A 1 175 ? 90.157  28.735 46.458 1.00 21.87  ? 374 ASP A OD2 1 
ATOM   1374 N N   . ILE A 1 176 ? 85.684  27.283 44.586 1.00 11.59  ? 375 ILE A N   1 
ATOM   1375 C CA  . ILE A 1 176 ? 84.621  27.391 43.612 1.00 7.35   ? 375 ILE A CA  1 
ATOM   1376 C C   . ILE A 1 176 ? 83.332  26.744 44.056 1.00 6.55   ? 375 ILE A C   1 
ATOM   1377 O O   . ILE A 1 176 ? 82.252  27.268 43.801 1.00 6.55   ? 375 ILE A O   1 
ATOM   1378 C CB  . ILE A 1 176 ? 85.081  26.820 42.284 1.00 6.55   ? 375 ILE A CB  1 
ATOM   1379 C CG1 . ILE A 1 176 ? 86.438  27.446 41.938 1.00 6.55   ? 375 ILE A CG1 1 
ATOM   1380 C CG2 . ILE A 1 176 ? 84.047  27.116 41.207 1.00 6.55   ? 375 ILE A CG2 1 
ATOM   1381 C CD1 . ILE A 1 176 ? 86.924  27.187 40.559 1.00 6.55   ? 375 ILE A CD1 1 
ATOM   1382 N N   . SER A 1 177 ? 83.448  25.618 44.744 1.00 6.55   ? 376 SER A N   1 
ATOM   1383 C CA  . SER A 1 177 ? 82.278  24.908 45.240 1.00 9.27   ? 376 SER A CA  1 
ATOM   1384 C C   . SER A 1 177 ? 81.445  25.759 46.201 1.00 11.51  ? 376 SER A C   1 
ATOM   1385 O O   . SER A 1 177 ? 80.223  25.862 46.053 1.00 12.74  ? 376 SER A O   1 
ATOM   1386 C CB  . SER A 1 177 ? 82.713  23.622 45.930 1.00 8.53   ? 376 SER A CB  1 
ATOM   1387 O OG  . SER A 1 177 ? 83.812  23.873 46.777 1.00 8.93   ? 376 SER A OG  1 
ATOM   1388 N N   . LEU A 1 178 ? 82.101  26.364 47.190 1.00 12.08  ? 377 LEU A N   1 
ATOM   1389 C CA  . LEU A 1 178 ? 81.403  27.215 48.151 1.00 11.67  ? 377 LEU A CA  1 
ATOM   1390 C C   . LEU A 1 178 ? 80.825  28.428 47.426 1.00 13.19  ? 377 LEU A C   1 
ATOM   1391 O O   . LEU A 1 178 ? 79.652  28.784 47.606 1.00 12.27  ? 377 LEU A O   1 
ATOM   1392 C CB  . LEU A 1 178 ? 82.376  27.667 49.229 1.00 9.66   ? 377 LEU A CB  1 
ATOM   1393 C CG  . LEU A 1 178 ? 83.014  26.503 49.973 1.00 9.32   ? 377 LEU A CG  1 
ATOM   1394 C CD1 . LEU A 1 178 ? 84.104  26.998 50.901 1.00 9.15   ? 377 LEU A CD1 1 
ATOM   1395 C CD2 . LEU A 1 178 ? 81.939  25.779 50.743 1.00 11.31  ? 377 LEU A CD2 1 
ATOM   1396 N N   . PHE A 1 179 ? 81.665  29.050 46.602 1.00 14.14  ? 378 PHE A N   1 
ATOM   1397 C CA  . PHE A 1 179 ? 81.276  30.210 45.827 1.00 15.43  ? 378 PHE A CA  1 
ATOM   1398 C C   . PHE A 1 179 ? 79.993  29.910 45.083 1.00 17.38  ? 378 PHE A C   1 
ATOM   1399 O O   . PHE A 1 179 ? 79.028  30.667 45.157 1.00 19.09  ? 378 PHE A O   1 
ATOM   1400 C CB  . PHE A 1 179 ? 82.356  30.544 44.817 1.00 14.96  ? 378 PHE A CB  1 
ATOM   1401 C CG  . PHE A 1 179 ? 82.088  31.801 44.052 1.00 18.79  ? 378 PHE A CG  1 
ATOM   1402 C CD1 . PHE A 1 179 ? 82.086  33.034 44.696 1.00 20.00  ? 378 PHE A CD1 1 
ATOM   1403 C CD2 . PHE A 1 179 ? 81.841  31.760 42.687 1.00 20.98  ? 378 PHE A CD2 1 
ATOM   1404 C CE1 . PHE A 1 179 ? 81.844  34.204 43.991 1.00 21.25  ? 378 PHE A CE1 1 
ATOM   1405 C CE2 . PHE A 1 179 ? 81.597  32.927 41.968 1.00 21.77  ? 378 PHE A CE2 1 
ATOM   1406 C CZ  . PHE A 1 179 ? 81.599  34.149 42.621 1.00 22.29  ? 378 PHE A CZ  1 
ATOM   1407 N N   . VAL A 1 180 ? 79.999  28.789 44.368 1.00 18.09  ? 379 VAL A N   1 
ATOM   1408 C CA  . VAL A 1 180 ? 78.854  28.353 43.585 1.00 18.41  ? 379 VAL A CA  1 
ATOM   1409 C C   . VAL A 1 180 ? 77.642  27.972 44.441 1.00 20.29  ? 379 VAL A C   1 
ATOM   1410 O O   . VAL A 1 180 ? 76.509  28.003 43.970 1.00 19.88  ? 379 VAL A O   1 
ATOM   1411 C CB  . VAL A 1 180 ? 79.248  27.163 42.683 1.00 17.34  ? 379 VAL A CB  1 
ATOM   1412 C CG1 . VAL A 1 180 ? 78.045  26.635 41.948 1.00 17.65  ? 379 VAL A CG1 1 
ATOM   1413 C CG2 . VAL A 1 180 ? 80.304  27.601 41.687 1.00 15.88  ? 379 VAL A CG2 1 
ATOM   1414 N N   . ALA A 1 181 ? 77.870  27.613 45.698 1.00 22.69  ? 380 ALA A N   1 
ATOM   1415 C CA  . ALA A 1 181 ? 76.754  27.249 46.564 1.00 26.15  ? 380 ALA A CA  1 
ATOM   1416 C C   . ALA A 1 181 ? 76.105  28.537 47.047 1.00 28.52  ? 380 ALA A C   1 
ATOM   1417 O O   . ALA A 1 181 ? 74.880  28.637 47.177 1.00 29.52  ? 380 ALA A O   1 
ATOM   1418 C CB  . ALA A 1 181 ? 77.251  26.427 47.749 1.00 24.01  ? 380 ALA A CB  1 
ATOM   1419 N N   . ALA A 1 182 ? 76.956  29.528 47.285 1.00 30.40  ? 381 ALA A N   1 
ATOM   1420 C CA  . ALA A 1 182 ? 76.536  30.833 47.768 1.00 31.80  ? 381 ALA A CA  1 
ATOM   1421 C C   . ALA A 1 182 ? 75.739  31.637 46.752 1.00 31.83  ? 381 ALA A C   1 
ATOM   1422 O O   . ALA A 1 182 ? 75.038  32.577 47.119 1.00 33.15  ? 381 ALA A O   1 
ATOM   1423 C CB  . ALA A 1 182 ? 77.755  31.626 48.205 1.00 32.93  ? 381 ALA A CB  1 
ATOM   1424 N N   . ILE A 1 183 ? 75.846  31.283 45.479 1.00 31.20  ? 382 ILE A N   1 
ATOM   1425 C CA  . ILE A 1 183 ? 75.112  32.020 44.463 1.00 32.20  ? 382 ILE A CA  1 
ATOM   1426 C C   . ILE A 1 183 ? 73.743  31.374 44.240 1.00 33.66  ? 382 ILE A C   1 
ATOM   1427 O O   . ILE A 1 183 ? 72.798  32.026 43.785 1.00 33.36  ? 382 ILE A O   1 
ATOM   1428 C CB  . ILE A 1 183 ? 75.927  32.108 43.134 1.00 31.42  ? 382 ILE A CB  1 
ATOM   1429 C CG1 . ILE A 1 183 ? 75.483  31.039 42.145 1.00 30.98  ? 382 ILE A CG1 1 
ATOM   1430 C CG2 . ILE A 1 183 ? 77.411  31.967 43.421 1.00 30.14  ? 382 ILE A CG2 1 
ATOM   1431 C CD1 . ILE A 1 183 ? 74.459  31.536 41.168 1.00 31.26  ? 382 ILE A CD1 1 
ATOM   1432 N N   . ILE A 1 184 ? 73.641  30.089 44.571 1.00 35.82  ? 383 ILE A N   1 
ATOM   1433 C CA  . ILE A 1 184 ? 72.378  29.373 44.438 1.00 37.04  ? 383 ILE A CA  1 
ATOM   1434 C C   . ILE A 1 184 ? 71.554  29.792 45.640 1.00 39.44  ? 383 ILE A C   1 
ATOM   1435 O O   . ILE A 1 184 ? 70.430  30.280 45.497 1.00 40.44  ? 383 ILE A O   1 
ATOM   1436 C CB  . ILE A 1 184 ? 72.565  27.841 44.487 1.00 34.81  ? 383 ILE A CB  1 
ATOM   1437 C CG1 . ILE A 1 184 ? 73.617  27.418 43.462 1.00 33.51  ? 383 ILE A CG1 1 
ATOM   1438 C CG2 . ILE A 1 184 ? 71.234  27.153 44.225 1.00 34.28  ? 383 ILE A CG2 1 
ATOM   1439 C CD1 . ILE A 1 184 ? 73.453  26.023 42.924 1.00 31.51  ? 383 ILE A CD1 1 
ATOM   1440 N N   . CYS A 1 185 ? 72.151  29.616 46.821 1.00 40.90  ? 384 CYS A N   1 
ATOM   1441 C CA  . CYS A 1 185 ? 71.533  29.962 48.096 1.00 42.32  ? 384 CYS A CA  1 
ATOM   1442 C C   . CYS A 1 185 ? 71.574  31.445 48.411 1.00 43.02  ? 384 CYS A C   1 
ATOM   1443 O O   . CYS A 1 185 ? 72.276  31.872 49.323 1.00 42.54  ? 384 CYS A O   1 
ATOM   1444 C CB  . CYS A 1 185 ? 72.223  29.227 49.237 1.00 42.62  ? 384 CYS A CB  1 
ATOM   1445 S SG  . CYS A 1 185 ? 72.104  27.465 49.142 1.00 47.12  ? 384 CYS A SG  1 
ATOM   1446 N N   . CYS A 1 186 ? 70.834  32.236 47.655 1.00 45.00  ? 385 CYS A N   1 
ATOM   1447 C CA  . CYS A 1 186 ? 70.787  33.656 47.923 1.00 48.52  ? 385 CYS A CA  1 
ATOM   1448 C C   . CYS A 1 186 ? 69.306  33.982 48.062 1.00 49.88  ? 385 CYS A C   1 
ATOM   1449 O O   . CYS A 1 186 ? 68.516  33.724 47.155 1.00 49.92  ? 385 CYS A O   1 
ATOM   1450 C CB  . CYS A 1 186 ? 71.448  34.456 46.788 1.00 49.82  ? 385 CYS A CB  1 
ATOM   1451 S SG  . CYS A 1 186 ? 70.411  34.875 45.364 1.00 54.58  ? 385 CYS A SG  1 
ATOM   1452 N N   . GLY A 1 187 ? 68.935  34.523 49.219 1.00 51.81  ? 386 GLY A N   1 
ATOM   1453 C CA  . GLY A 1 187 ? 67.546  34.851 49.492 1.00 52.85  ? 386 GLY A CA  1 
ATOM   1454 C C   . GLY A 1 187 ? 66.937  36.047 48.780 1.00 53.70  ? 386 GLY A C   1 
ATOM   1455 O O   . GLY A 1 187 ? 65.874  36.510 49.185 1.00 53.78  ? 386 GLY A O   1 
ATOM   1456 N N   . ASP A 1 188 ? 67.585  36.557 47.736 1.00 54.57  ? 387 ASP A N   1 
ATOM   1457 C CA  . ASP A 1 188 ? 67.032  37.696 47.012 1.00 56.10  ? 387 ASP A CA  1 
ATOM   1458 C C   . ASP A 1 188 ? 66.477  37.279 45.662 1.00 56.87  ? 387 ASP A C   1 
ATOM   1459 O O   . ASP A 1 188 ? 66.650  37.987 44.664 1.00 58.02  ? 387 ASP A O   1 
ATOM   1460 C CB  . ASP A 1 188 ? 68.060  38.824 46.783 1.00 58.46  ? 387 ASP A CB  1 
ATOM   1461 C CG  . ASP A 1 188 ? 69.449  38.509 47.323 1.00 61.26  ? 387 ASP A CG  1 
ATOM   1462 O OD1 . ASP A 1 188 ? 70.379  39.293 47.022 1.00 61.78  ? 387 ASP A OD1 1 
ATOM   1463 O OD2 . ASP A 1 188 ? 69.624  37.508 48.047 1.00 63.43  ? 387 ASP A OD2 1 
ATOM   1464 N N   . ARG A 1 189 ? 65.828  36.120 45.621 1.00 56.45  ? 388 ARG A N   1 
ATOM   1465 C CA  . ARG A 1 189 ? 65.227  35.646 44.382 1.00 55.72  ? 388 ARG A CA  1 
ATOM   1466 C C   . ARG A 1 189 ? 63.734  35.912 44.508 1.00 55.60  ? 388 ARG A C   1 
ATOM   1467 O O   . ARG A 1 189 ? 63.140  35.694 45.563 1.00 54.60  ? 388 ARG A O   1 
ATOM   1468 C CB  . ARG A 1 189 ? 65.470  34.147 44.174 1.00 55.22  ? 388 ARG A CB  1 
ATOM   1469 C CG  . ARG A 1 189 ? 66.931  33.718 44.148 1.00 52.38  ? 388 ARG A CG  1 
ATOM   1470 C CD  . ARG A 1 189 ? 67.720  34.247 42.959 1.00 48.24  ? 388 ARG A CD  1 
ATOM   1471 N NE  . ARG A 1 189 ? 69.105  33.799 43.065 1.00 45.41  ? 388 ARG A NE  1 
ATOM   1472 C CZ  . ARG A 1 189 ? 70.070  34.098 42.205 1.00 44.02  ? 388 ARG A CZ  1 
ATOM   1473 N NH1 . ARG A 1 189 ? 69.814  34.853 41.149 1.00 43.38  ? 388 ARG A NH1 1 
ATOM   1474 N NH2 . ARG A 1 189 ? 71.297  33.647 42.411 1.00 42.85  ? 388 ARG A NH2 1 
ATOM   1475 N N   . PRO A 1 190 ? 63.112  36.396 43.428 1.00 56.26  ? 389 PRO A N   1 
ATOM   1476 C CA  . PRO A 1 190 ? 61.682  36.717 43.361 1.00 56.78  ? 389 PRO A CA  1 
ATOM   1477 C C   . PRO A 1 190 ? 60.739  35.537 43.582 1.00 56.79  ? 389 PRO A C   1 
ATOM   1478 O O   . PRO A 1 190 ? 60.842  34.519 42.902 1.00 57.09  ? 389 PRO A O   1 
ATOM   1479 C CB  . PRO A 1 190 ? 61.522  37.306 41.955 1.00 57.51  ? 389 PRO A CB  1 
ATOM   1480 C CG  . PRO A 1 190 ? 62.898  37.847 41.637 1.00 58.32  ? 389 PRO A CG  1 
ATOM   1481 C CD  . PRO A 1 190 ? 63.789  36.755 42.170 1.00 57.19  ? 389 PRO A CD  1 
ATOM   1482 N N   . GLY A 1 191 ? 59.823  35.680 44.535 1.00 56.99  ? 390 GLY A N   1 
ATOM   1483 C CA  . GLY A 1 191 ? 58.849  34.633 44.790 1.00 57.74  ? 390 GLY A CA  1 
ATOM   1484 C C   . GLY A 1 191 ? 59.200  33.569 45.808 1.00 58.42  ? 390 GLY A C   1 
ATOM   1485 O O   . GLY A 1 191 ? 58.562  32.515 45.853 1.00 57.56  ? 390 GLY A O   1 
ATOM   1486 N N   . LEU A 1 192 ? 60.205  33.834 46.632 1.00 60.18  ? 391 LEU A N   1 
ATOM   1487 C CA  . LEU A 1 192 ? 60.613  32.868 47.644 1.00 62.31  ? 391 LEU A CA  1 
ATOM   1488 C C   . LEU A 1 192 ? 59.655  32.874 48.835 1.00 63.19  ? 391 LEU A C   1 
ATOM   1489 O O   . LEU A 1 192 ? 59.444  33.915 49.463 1.00 64.30  ? 391 LEU A O   1 
ATOM   1490 C CB  . LEU A 1 192 ? 62.039  33.173 48.127 1.00 62.72  ? 391 LEU A CB  1 
ATOM   1491 C CG  . LEU A 1 192 ? 63.171  33.092 47.098 1.00 62.33  ? 391 LEU A CG  1 
ATOM   1492 C CD1 . LEU A 1 192 ? 64.503  33.309 47.787 1.00 61.92  ? 391 LEU A CD1 1 
ATOM   1493 C CD2 . LEU A 1 192 ? 63.155  31.736 46.426 1.00 62.72  ? 391 LEU A CD2 1 
ATOM   1494 N N   . LEU A 1 193 ? 59.078  31.715 49.146 1.00 63.34  ? 392 LEU A N   1 
ATOM   1495 C CA  . LEU A 1 193 ? 58.153  31.618 50.270 1.00 63.44  ? 392 LEU A CA  1 
ATOM   1496 C C   . LEU A 1 193 ? 58.851  31.859 51.603 1.00 62.87  ? 392 LEU A C   1 
ATOM   1497 O O   . LEU A 1 193 ? 58.594  32.860 52.263 1.00 63.48  ? 392 LEU A O   1 
ATOM   1498 C CB  . LEU A 1 193 ? 57.453  30.256 50.284 1.00 63.60  ? 392 LEU A CB  1 
ATOM   1499 C CG  . LEU A 1 193 ? 55.971  30.295 49.894 1.00 64.28  ? 392 LEU A CG  1 
ATOM   1500 C CD1 . LEU A 1 193 ? 55.210  31.227 50.840 1.00 64.31  ? 392 LEU A CD1 1 
ATOM   1501 C CD2 . LEU A 1 193 ? 55.832  30.770 48.455 1.00 64.75  ? 392 LEU A CD2 1 
ATOM   1502 N N   . ASN A 1 194 ? 59.730  30.947 52.001 1.00 62.26  ? 393 ASN A N   1 
ATOM   1503 C CA  . ASN A 1 194 ? 60.459  31.103 53.255 1.00 61.93  ? 393 ASN A CA  1 
ATOM   1504 C C   . ASN A 1 194 ? 61.755  31.881 53.024 1.00 62.24  ? 393 ASN A C   1 
ATOM   1505 O O   . ASN A 1 194 ? 62.853  31.356 53.203 1.00 62.56  ? 393 ASN A O   1 
ATOM   1506 C CB  . ASN A 1 194 ? 60.772  29.734 53.849 1.00 61.40  ? 393 ASN A CB  1 
ATOM   1507 C CG  . ASN A 1 194 ? 59.530  29.003 54.302 1.00 60.80  ? 393 ASN A CG  1 
ATOM   1508 O OD1 . ASN A 1 194 ? 59.610  27.941 54.917 1.00 60.66  ? 393 ASN A OD1 1 
ATOM   1509 N ND2 . ASN A 1 194 ? 58.368  29.568 53.997 1.00 60.37  ? 393 ASN A ND2 1 
ATOM   1510 N N   . VAL A 1 195 ? 61.606  33.145 52.637 1.00 62.17  ? 394 VAL A N   1 
ATOM   1511 C CA  . VAL A 1 195 ? 62.724  34.035 52.339 1.00 61.12  ? 394 VAL A CA  1 
ATOM   1512 C C   . VAL A 1 195 ? 63.693  34.260 53.504 1.00 61.43  ? 394 VAL A C   1 
ATOM   1513 O O   . VAL A 1 195 ? 64.553  35.134 53.431 1.00 61.35  ? 394 VAL A O   1 
ATOM   1514 C CB  . VAL A 1 195 ? 62.194  35.407 51.863 1.00 59.79  ? 394 VAL A CB  1 
ATOM   1515 C CG1 . VAL A 1 195 ? 61.788  36.252 53.061 1.00 59.09  ? 394 VAL A CG1 1 
ATOM   1516 C CG2 . VAL A 1 195 ? 63.231  36.106 51.015 1.00 59.44  ? 394 VAL A CG2 1 
ATOM   1517 N N   . GLY A 1 196 ? 63.562  33.472 54.567 1.00 61.85  ? 395 GLY A N   1 
ATOM   1518 C CA  . GLY A 1 196 ? 64.438  33.632 55.716 1.00 63.21  ? 395 GLY A CA  1 
ATOM   1519 C C   . GLY A 1 196 ? 65.338  32.442 55.985 1.00 64.34  ? 395 GLY A C   1 
ATOM   1520 O O   . GLY A 1 196 ? 66.462  32.594 56.458 1.00 64.50  ? 395 GLY A O   1 
ATOM   1521 N N   . HIS A 1 197 ? 64.837  31.250 55.691 1.00 65.60  ? 396 HIS A N   1 
ATOM   1522 C CA  . HIS A 1 197 ? 65.595  30.020 55.890 1.00 66.82  ? 396 HIS A CA  1 
ATOM   1523 C C   . HIS A 1 197 ? 66.762  30.042 54.916 1.00 65.96  ? 396 HIS A C   1 
ATOM   1524 O O   . HIS A 1 197 ? 67.853  29.555 55.202 1.00 66.28  ? 396 HIS A O   1 
ATOM   1525 C CB  . HIS A 1 197 ? 64.715  28.811 55.576 1.00 69.55  ? 396 HIS A CB  1 
ATOM   1526 C CG  . HIS A 1 197 ? 63.335  28.911 56.144 1.00 72.60  ? 396 HIS A CG  1 
ATOM   1527 N ND1 . HIS A 1 197 ? 62.733  30.121 56.423 1.00 73.50  ? 396 HIS A ND1 1 
ATOM   1528 C CD2 . HIS A 1 197 ? 62.425  27.957 56.451 1.00 73.45  ? 396 HIS A CD2 1 
ATOM   1529 C CE1 . HIS A 1 197 ? 61.513  29.907 56.880 1.00 74.01  ? 396 HIS A CE1 1 
ATOM   1530 N NE2 . HIS A 1 197 ? 61.300  28.603 56.906 1.00 74.65  ? 396 HIS A NE2 1 
ATOM   1531 N N   . ILE A 1 198 ? 66.507  30.616 53.751 1.00 64.51  ? 397 ILE A N   1 
ATOM   1532 C CA  . ILE A 1 198 ? 67.506  30.704 52.710 1.00 62.49  ? 397 ILE A CA  1 
ATOM   1533 C C   . ILE A 1 198 ? 68.654  31.620 53.125 1.00 62.38  ? 397 ILE A C   1 
ATOM   1534 O O   . ILE A 1 198 ? 69.803  31.397 52.743 1.00 62.76  ? 397 ILE A O   1 
ATOM   1535 C CB  . ILE A 1 198 ? 66.841  31.173 51.408 1.00 61.31  ? 397 ILE A CB  1 
ATOM   1536 C CG1 . ILE A 1 198 ? 65.712  30.193 51.061 1.00 60.25  ? 397 ILE A CG1 1 
ATOM   1537 C CG2 . ILE A 1 198 ? 67.859  31.256 50.291 1.00 60.64  ? 397 ILE A CG2 1 
ATOM   1538 C CD1 . ILE A 1 198 ? 65.091  30.388 49.698 1.00 59.90  ? 397 ILE A CD1 1 
ATOM   1539 N N   . GLU A 1 199 ? 68.353  32.636 53.927 1.00 61.87  ? 398 GLU A N   1 
ATOM   1540 C CA  . GLU A 1 199 ? 69.397  33.544 54.384 1.00 61.24  ? 398 GLU A CA  1 
ATOM   1541 C C   . GLU A 1 199 ? 70.170  32.867 55.506 1.00 61.02  ? 398 GLU A C   1 
ATOM   1542 O O   . GLU A 1 199 ? 71.399  32.801 55.468 1.00 60.42  ? 398 GLU A O   1 
ATOM   1543 C CB  . GLU A 1 199 ? 68.792  34.850 54.884 1.00 60.77  ? 398 GLU A CB  1 
ATOM   1544 C CG  . GLU A 1 199 ? 67.789  35.452 53.922 1.00 62.37  ? 398 GLU A CG  1 
ATOM   1545 C CD  . GLU A 1 199 ? 67.858  36.962 53.881 1.00 63.10  ? 398 GLU A CD  1 
ATOM   1546 O OE1 . GLU A 1 199 ? 67.864  37.591 54.961 1.00 62.52  ? 398 GLU A OE1 1 
ATOM   1547 O OE2 . GLU A 1 199 ? 67.902  37.518 52.763 1.00 63.96  ? 398 GLU A OE2 1 
ATOM   1548 N N   . LYS A 1 200 ? 69.441  32.361 56.500 1.00 61.36  ? 399 LYS A N   1 
ATOM   1549 C CA  . LYS A 1 200 ? 70.056  31.670 57.631 1.00 61.42  ? 399 LYS A CA  1 
ATOM   1550 C C   . LYS A 1 200 ? 71.028  30.664 57.028 1.00 60.99  ? 399 LYS A C   1 
ATOM   1551 O O   . LYS A 1 200 ? 72.205  30.607 57.393 1.00 61.03  ? 399 LYS A O   1 
ATOM   1552 C CB  . LYS A 1 200 ? 68.995  30.918 58.462 1.00 62.31  ? 399 LYS A CB  1 
ATOM   1553 C CG  . LYS A 1 200 ? 68.485  29.632 57.809 1.00 64.86  ? 399 LYS A CG  1 
ATOM   1554 C CD  . LYS A 1 200 ? 67.547  28.804 58.683 1.00 66.07  ? 399 LYS A CD  1 
ATOM   1555 C CE  . LYS A 1 200 ? 67.426  27.348 58.212 1.00 65.50  ? 399 LYS A CE  1 
ATOM   1556 N NZ  . LYS A 1 200 ? 66.468  27.066 57.094 1.00 62.92  ? 399 LYS A NZ  1 
ATOM   1557 N N   . MET A 1 201 ? 70.510  29.889 56.078 1.00 59.79  ? 400 MET A N   1 
ATOM   1558 C CA  . MET A 1 201 ? 71.270  28.860 55.392 1.00 58.00  ? 400 MET A CA  1 
ATOM   1559 C C   . MET A 1 201 ? 72.469  29.500 54.721 1.00 56.66  ? 400 MET A C   1 
ATOM   1560 O O   . MET A 1 201 ? 73.606  29.073 54.918 1.00 57.56  ? 400 MET A O   1 
ATOM   1561 C CB  . MET A 1 201 ? 70.400  28.184 54.330 1.00 58.39  ? 400 MET A CB  1 
ATOM   1562 C CG  . MET A 1 201 ? 70.734  26.723 54.087 1.00 58.27  ? 400 MET A CG  1 
ATOM   1563 S SD  . MET A 1 201 ? 70.525  26.226 52.367 1.00 58.78  ? 400 MET A SD  1 
ATOM   1564 C CE  . MET A 1 201 ? 68.743  26.107 52.241 1.00 58.98  ? 400 MET A CE  1 
ATOM   1565 N N   . GLN A 1 202 ? 72.203  30.537 53.936 1.00 53.91  ? 401 GLN A N   1 
ATOM   1566 C CA  . GLN A 1 202 ? 73.249  31.236 53.215 1.00 51.77  ? 401 GLN A CA  1 
ATOM   1567 C C   . GLN A 1 202 ? 74.347  31.821 54.095 1.00 51.74  ? 401 GLN A C   1 
ATOM   1568 O O   . GLN A 1 202 ? 75.498  31.908 53.673 1.00 51.12  ? 401 GLN A O   1 
ATOM   1569 C CB  . GLN A 1 202 ? 72.635  32.334 52.363 1.00 49.83  ? 401 GLN A CB  1 
ATOM   1570 C CG  . GLN A 1 202 ? 73.665  33.189 51.662 1.00 49.62  ? 401 GLN A CG  1 
ATOM   1571 C CD  . GLN A 1 202 ? 73.034  34.356 50.967 1.00 50.18  ? 401 GLN A CD  1 
ATOM   1572 O OE1 . GLN A 1 202 ? 72.065  34.934 51.462 1.00 49.96  ? 401 GLN A OE1 1 
ATOM   1573 N NE2 . GLN A 1 202 ? 73.583  34.729 49.819 1.00 51.12  ? 401 GLN A NE2 1 
ATOM   1574 N N   . GLU A 1 203 ? 74.005  32.231 55.310 1.00 52.62  ? 402 GLU A N   1 
ATOM   1575 C CA  . GLU A 1 203 ? 75.015  32.792 56.198 1.00 53.71  ? 402 GLU A CA  1 
ATOM   1576 C C   . GLU A 1 203 ? 76.141  31.795 56.418 1.00 53.14  ? 402 GLU A C   1 
ATOM   1577 O O   . GLU A 1 203 ? 77.304  32.178 56.510 1.00 52.97  ? 402 GLU A O   1 
ATOM   1578 C CB  . GLU A 1 203 ? 74.410  33.173 57.549 1.00 56.04  ? 402 GLU A CB  1 
ATOM   1579 C CG  . GLU A 1 203 ? 73.724  34.530 57.571 1.00 59.91  ? 402 GLU A CG  1 
ATOM   1580 C CD  . GLU A 1 203 ? 73.336  34.972 58.978 1.00 62.55  ? 402 GLU A CD  1 
ATOM   1581 O OE1 . GLU A 1 203 ? 72.665  36.022 59.102 1.00 63.88  ? 402 GLU A OE1 1 
ATOM   1582 O OE2 . GLU A 1 203 ? 73.704  34.277 59.957 1.00 63.04  ? 402 GLU A OE2 1 
ATOM   1583 N N   . GLY A 1 204 ? 75.787  30.516 56.499 1.00 52.89  ? 403 GLY A N   1 
ATOM   1584 C CA  . GLY A 1 204 ? 76.779  29.477 56.713 1.00 52.41  ? 403 GLY A CA  1 
ATOM   1585 C C   . GLY A 1 204 ? 77.759  29.370 55.565 1.00 52.40  ? 403 GLY A C   1 
ATOM   1586 O O   . GLY A 1 204 ? 78.970  29.454 55.754 1.00 52.59  ? 403 GLY A O   1 
ATOM   1587 N N   . ILE A 1 205 ? 77.227  29.181 54.365 1.00 52.04  ? 404 ILE A N   1 
ATOM   1588 C CA  . ILE A 1 205 ? 78.045  29.073 53.168 1.00 51.26  ? 404 ILE A CA  1 
ATOM   1589 C C   . ILE A 1 205 ? 79.013  30.270 53.068 1.00 51.47  ? 404 ILE A C   1 
ATOM   1590 O O   . ILE A 1 205 ? 80.229  30.079 52.982 1.00 52.61  ? 404 ILE A O   1 
ATOM   1591 C CB  . ILE A 1 205 ? 77.121  28.972 51.924 1.00 49.90  ? 404 ILE A CB  1 
ATOM   1592 C CG1 . ILE A 1 205 ? 76.217  27.745 52.080 1.00 48.42  ? 404 ILE A CG1 1 
ATOM   1593 C CG2 . ILE A 1 205 ? 77.938  28.854 50.645 1.00 49.89  ? 404 ILE A CG2 1 
ATOM   1594 C CD1 . ILE A 1 205 ? 74.940  27.815 51.290 1.00 47.86  ? 404 ILE A CD1 1 
ATOM   1595 N N   . VAL A 1 206 ? 78.483  31.495 53.110 1.00 50.28  ? 405 VAL A N   1 
ATOM   1596 C CA  . VAL A 1 206 ? 79.315  32.703 53.023 1.00 48.42  ? 405 VAL A CA  1 
ATOM   1597 C C   . VAL A 1 206 ? 80.242  32.844 54.228 1.00 47.65  ? 405 VAL A C   1 
ATOM   1598 O O   . VAL A 1 206 ? 81.289  33.484 54.152 1.00 47.69  ? 405 VAL A O   1 
ATOM   1599 C CB  . VAL A 1 206 ? 78.447  33.989 52.920 1.00 47.66  ? 405 VAL A CB  1 
ATOM   1600 C CG1 . VAL A 1 206 ? 79.335  35.224 52.844 1.00 46.08  ? 405 VAL A CG1 1 
ATOM   1601 C CG2 . VAL A 1 206 ? 77.557  33.919 51.695 1.00 47.11  ? 405 VAL A CG2 1 
ATOM   1602 N N   . HIS A 1 207 ? 79.855  32.247 55.345 1.00 46.85  ? 406 HIS A N   1 
ATOM   1603 C CA  . HIS A 1 207 ? 80.674  32.327 56.544 1.00 46.63  ? 406 HIS A CA  1 
ATOM   1604 C C   . HIS A 1 207 ? 81.866  31.377 56.413 1.00 44.78  ? 406 HIS A C   1 
ATOM   1605 O O   . HIS A 1 207 ? 82.982  31.689 56.845 1.00 44.58  ? 406 HIS A O   1 
ATOM   1606 C CB  . HIS A 1 207 ? 79.841  31.969 57.782 1.00 48.42  ? 406 HIS A CB  1 
ATOM   1607 C CG  . HIS A 1 207 ? 80.595  32.090 59.066 1.00 49.67  ? 406 HIS A CG  1 
ATOM   1608 N ND1 . HIS A 1 207 ? 81.110  33.288 59.512 1.00 50.33  ? 406 HIS A ND1 1 
ATOM   1609 C CD2 . HIS A 1 207 ? 80.975  31.155 59.969 1.00 49.83  ? 406 HIS A CD2 1 
ATOM   1610 C CE1 . HIS A 1 207 ? 81.780  33.085 60.632 1.00 51.48  ? 406 HIS A CE1 1 
ATOM   1611 N NE2 . HIS A 1 207 ? 81.714  31.799 60.930 1.00 51.19  ? 406 HIS A NE2 1 
ATOM   1612 N N   . VAL A 1 208 ? 81.615  30.216 55.815 1.00 41.76  ? 407 VAL A N   1 
ATOM   1613 C CA  . VAL A 1 208 ? 82.650  29.216 55.609 1.00 38.31  ? 407 VAL A CA  1 
ATOM   1614 C C   . VAL A 1 208 ? 83.496  29.692 54.448 1.00 37.10  ? 407 VAL A C   1 
ATOM   1615 O O   . VAL A 1 208 ? 84.702  29.454 54.389 1.00 36.28  ? 407 VAL A O   1 
ATOM   1616 C CB  . VAL A 1 208 ? 82.051  27.868 55.229 1.00 37.59  ? 407 VAL A CB  1 
ATOM   1617 C CG1 . VAL A 1 208 ? 83.149  26.851 55.124 1.00 37.90  ? 407 VAL A CG1 1 
ATOM   1618 C CG2 . VAL A 1 208 ? 81.023  27.447 56.249 1.00 37.08  ? 407 VAL A CG2 1 
ATOM   1619 N N   . LEU A 1 209 ? 82.831  30.365 53.518 1.00 35.18  ? 408 LEU A N   1 
ATOM   1620 C CA  . LEU A 1 209 ? 83.483  30.901 52.343 1.00 33.44  ? 408 LEU A CA  1 
ATOM   1621 C C   . LEU A 1 209 ? 84.577  31.852 52.794 1.00 34.47  ? 408 LEU A C   1 
ATOM   1622 O O   . LEU A 1 209 ? 85.714  31.751 52.336 1.00 34.23  ? 408 LEU A O   1 
ATOM   1623 C CB  . LEU A 1 209 ? 82.452  31.622 51.469 1.00 30.13  ? 408 LEU A CB  1 
ATOM   1624 C CG  . LEU A 1 209 ? 82.890  32.323 50.182 1.00 28.28  ? 408 LEU A CG  1 
ATOM   1625 C CD1 . LEU A 1 209 ? 83.924  31.506 49.443 1.00 27.28  ? 408 LEU A CD1 1 
ATOM   1626 C CD2 . LEU A 1 209 ? 81.670  32.552 49.315 1.00 27.52  ? 408 LEU A CD2 1 
ATOM   1627 N N   . ARG A 1 210 ? 84.240  32.756 53.713 1.00 36.04  ? 409 ARG A N   1 
ATOM   1628 C CA  . ARG A 1 210 ? 85.209  33.727 54.222 1.00 37.27  ? 409 ARG A CA  1 
ATOM   1629 C C   . ARG A 1 210 ? 86.352  33.058 54.970 1.00 36.61  ? 409 ARG A C   1 
ATOM   1630 O O   . ARG A 1 210 ? 87.517  33.405 54.777 1.00 36.65  ? 409 ARG A O   1 
ATOM   1631 C CB  . ARG A 1 210 ? 84.545  34.736 55.162 1.00 39.08  ? 409 ARG A CB  1 
ATOM   1632 C CG  . ARG A 1 210 ? 85.477  35.860 55.606 1.00 42.66  ? 409 ARG A CG  1 
ATOM   1633 C CD  . ARG A 1 210 ? 84.895  36.639 56.774 1.00 45.83  ? 409 ARG A CD  1 
ATOM   1634 N NE  . ARG A 1 210 ? 83.476  36.905 56.562 1.00 50.86  ? 409 ARG A NE  1 
ATOM   1635 C CZ  . ARG A 1 210 ? 82.527  36.691 57.472 1.00 52.79  ? 409 ARG A CZ  1 
ATOM   1636 N NH1 . ARG A 1 210 ? 82.848  36.209 58.671 1.00 53.44  ? 409 ARG A NH1 1 
ATOM   1637 N NH2 . ARG A 1 210 ? 81.252  36.931 57.175 1.00 53.12  ? 409 ARG A NH2 1 
ATOM   1638 N N   . LEU A 1 211 ? 86.011  32.105 55.830 1.00 36.27  ? 410 LEU A N   1 
ATOM   1639 C CA  . LEU A 1 211 ? 87.009  31.397 56.620 1.00 37.11  ? 410 LEU A CA  1 
ATOM   1640 C C   . LEU A 1 211 ? 87.903  30.480 55.796 1.00 37.12  ? 410 LEU A C   1 
ATOM   1641 O O   . LEU A 1 211 ? 89.105  30.370 56.064 1.00 37.82  ? 410 LEU A O   1 
ATOM   1642 C CB  . LEU A 1 211 ? 86.324  30.598 57.734 1.00 38.14  ? 410 LEU A CB  1 
ATOM   1643 C CG  . LEU A 1 211 ? 86.398  31.231 59.128 1.00 39.11  ? 410 LEU A CG  1 
ATOM   1644 C CD1 . LEU A 1 211 ? 85.019  31.237 59.769 1.00 38.76  ? 410 LEU A CD1 1 
ATOM   1645 C CD2 . LEU A 1 211 ? 87.416  30.472 59.985 1.00 39.19  ? 410 LEU A CD2 1 
ATOM   1646 N N   . HIS A 1 212 ? 87.323  29.816 54.800 1.00 35.90  ? 411 HIS A N   1 
ATOM   1647 C CA  . HIS A 1 212 ? 88.103  28.923 53.953 1.00 33.89  ? 411 HIS A CA  1 
ATOM   1648 C C   . HIS A 1 212 ? 89.071  29.758 53.125 1.00 33.39  ? 411 HIS A C   1 
ATOM   1649 O O   . HIS A 1 212 ? 90.235  29.393 52.945 1.00 32.23  ? 411 HIS A O   1 
ATOM   1650 C CB  . HIS A 1 212 ? 87.186  28.119 53.031 1.00 32.35  ? 411 HIS A CB  1 
ATOM   1651 C CG  . HIS A 1 212 ? 87.906  27.067 52.245 1.00 29.78  ? 411 HIS A CG  1 
ATOM   1652 N ND1 . HIS A 1 212 ? 88.157  27.186 50.896 1.00 27.03  ? 411 HIS A ND1 1 
ATOM   1653 C CD2 . HIS A 1 212 ? 88.466  25.897 52.632 1.00 28.33  ? 411 HIS A CD2 1 
ATOM   1654 C CE1 . HIS A 1 212 ? 88.842  26.134 50.487 1.00 27.25  ? 411 HIS A CE1 1 
ATOM   1655 N NE2 . HIS A 1 212 ? 89.043  25.338 51.521 1.00 27.39  ? 411 HIS A NE2 1 
ATOM   1656 N N   . LEU A 1 213 ? 88.562  30.889 52.639 1.00 33.19  ? 412 LEU A N   1 
ATOM   1657 C CA  . LEU A 1 213 ? 89.314  31.844 51.829 1.00 32.97  ? 412 LEU A CA  1 
ATOM   1658 C C   . LEU A 1 213 ? 90.416  32.575 52.586 1.00 34.69  ? 412 LEU A C   1 
ATOM   1659 O O   . LEU A 1 213 ? 91.253  33.249 51.985 1.00 34.19  ? 412 LEU A O   1 
ATOM   1660 C CB  . LEU A 1 213 ? 88.366  32.879 51.247 1.00 28.97  ? 412 LEU A CB  1 
ATOM   1661 C CG  . LEU A 1 213 ? 87.821  32.540 49.879 1.00 26.26  ? 412 LEU A CG  1 
ATOM   1662 C CD1 . LEU A 1 213 ? 86.786  33.569 49.497 1.00 24.88  ? 412 LEU A CD1 1 
ATOM   1663 C CD2 . LEU A 1 213 ? 88.969  32.501 48.888 1.00 24.84  ? 412 LEU A CD2 1 
ATOM   1664 N N   . GLN A 1 214 ? 90.398  32.468 53.907 1.00 36.89  ? 413 GLN A N   1 
ATOM   1665 C CA  . GLN A 1 214 ? 91.416  33.107 54.719 1.00 39.76  ? 413 GLN A CA  1 
ATOM   1666 C C   . GLN A 1 214 ? 92.549  32.104 54.910 1.00 40.68  ? 413 GLN A C   1 
ATOM   1667 O O   . GLN A 1 214 ? 93.728  32.450 54.833 1.00 40.94  ? 413 GLN A O   1 
ATOM   1668 C CB  . GLN A 1 214 ? 90.829  33.526 56.076 1.00 41.73  ? 413 GLN A CB  1 
ATOM   1669 C CG  . GLN A 1 214 ? 90.036  34.832 56.055 1.00 43.26  ? 413 GLN A CG  1 
ATOM   1670 C CD  . GLN A 1 214 ? 89.299  35.106 57.367 1.00 43.12  ? 413 GLN A CD  1 
ATOM   1671 O OE1 . GLN A 1 214 ? 89.844  34.911 58.457 1.00 41.46  ? 413 GLN A OE1 1 
ATOM   1672 N NE2 . GLN A 1 214 ? 88.055  35.573 57.262 1.00 43.01  ? 413 GLN A NE2 1 
ATOM   1673 N N   . SER A 1 215 ? 92.175  30.851 55.131 1.00 41.63  ? 414 SER A N   1 
ATOM   1674 C CA  . SER A 1 215 ? 93.139  29.784 55.344 1.00 42.89  ? 414 SER A CA  1 
ATOM   1675 C C   . SER A 1 215 ? 93.374  28.958 54.082 1.00 43.86  ? 414 SER A C   1 
ATOM   1676 O O   . SER A 1 215 ? 93.626  27.755 54.157 1.00 44.67  ? 414 SER A O   1 
ATOM   1677 C CB  . SER A 1 215 ? 92.642  28.881 56.466 1.00 43.07  ? 414 SER A CB  1 
ATOM   1678 O OG  . SER A 1 215 ? 91.281  28.547 56.248 1.00 43.06  ? 414 SER A OG  1 
ATOM   1679 N N   . ASN A 1 216 ? 93.286  29.601 52.924 1.00 44.00  ? 415 ASN A N   1 
ATOM   1680 C CA  . ASN A 1 216 ? 93.504  28.902 51.664 1.00 44.05  ? 415 ASN A CA  1 
ATOM   1681 C C   . ASN A 1 216 ? 94.311  29.792 50.731 1.00 43.92  ? 415 ASN A C   1 
ATOM   1682 O O   . ASN A 1 216 ? 95.092  29.311 49.903 1.00 45.13  ? 415 ASN A O   1 
ATOM   1683 C CB  . ASN A 1 216 ? 92.172  28.551 51.014 1.00 45.34  ? 415 ASN A CB  1 
ATOM   1684 C CG  . ASN A 1 216 ? 92.217  27.224 50.301 1.00 46.89  ? 415 ASN A CG  1 
ATOM   1685 O OD1 . ASN A 1 216 ? 91.706  27.081 49.188 1.00 46.82  ? 415 ASN A OD1 1 
ATOM   1686 N ND2 . ASN A 1 216 ? 92.826  26.233 50.946 1.00 47.99  ? 415 ASN A ND2 1 
ATOM   1687 N N   . HIS A 1 217 ? 94.088  31.095 50.869 1.00 42.67  ? 416 HIS A N   1 
ATOM   1688 C CA  . HIS A 1 217 ? 94.779  32.123 50.099 1.00 42.28  ? 416 HIS A CA  1 
ATOM   1689 C C   . HIS A 1 217 ? 94.965  33.231 51.116 1.00 42.69  ? 416 HIS A C   1 
ATOM   1690 O O   . HIS A 1 217 ? 94.423  34.333 50.983 1.00 42.27  ? 416 HIS A O   1 
ATOM   1691 C CB  . HIS A 1 217 ? 93.925  32.583 48.917 1.00 40.32  ? 416 HIS A CB  1 
ATOM   1692 C CG  . HIS A 1 217 ? 93.551  31.469 47.998 1.00 37.74  ? 416 HIS A CG  1 
ATOM   1693 N ND1 . HIS A 1 217 ? 92.319  30.853 48.044 1.00 37.32  ? 416 HIS A ND1 1 
ATOM   1694 C CD2 . HIS A 1 217 ? 94.287  30.776 47.100 1.00 36.79  ? 416 HIS A CD2 1 
ATOM   1695 C CE1 . HIS A 1 217 ? 92.317  29.824 47.218 1.00 36.80  ? 416 HIS A CE1 1 
ATOM   1696 N NE2 . HIS A 1 217 ? 93.499  29.753 46.634 1.00 37.60  ? 416 HIS A NE2 1 
ATOM   1697 N N   . PRO A 1 218 ? 95.753  32.931 52.159 1.00 42.89  ? 417 PRO A N   1 
ATOM   1698 C CA  . PRO A 1 218 ? 96.096  33.794 53.287 1.00 43.60  ? 417 PRO A CA  1 
ATOM   1699 C C   . PRO A 1 218 ? 96.776  35.095 52.913 1.00 43.97  ? 417 PRO A C   1 
ATOM   1700 O O   . PRO A 1 218 ? 97.078  35.908 53.780 1.00 44.43  ? 417 PRO A O   1 
ATOM   1701 C CB  . PRO A 1 218 ? 97.001  32.898 54.119 1.00 42.36  ? 417 PRO A CB  1 
ATOM   1702 C CG  . PRO A 1 218 ? 97.750  32.163 53.071 1.00 41.82  ? 417 PRO A CG  1 
ATOM   1703 C CD  . PRO A 1 218 ? 96.634  31.747 52.148 1.00 42.32  ? 417 PRO A CD  1 
ATOM   1704 N N   . ASP A 1 219 ? 97.006  35.315 51.630 1.00 44.94  ? 418 ASP A N   1 
ATOM   1705 C CA  . ASP A 1 219 ? 97.699  36.527 51.243 1.00 46.74  ? 418 ASP A CA  1 
ATOM   1706 C C   . ASP A 1 219 ? 96.897  37.485 50.382 1.00 46.45  ? 418 ASP A C   1 
ATOM   1707 O O   . ASP A 1 219 ? 97.396  38.531 49.962 1.00 47.08  ? 418 ASP A O   1 
ATOM   1708 C CB  . ASP A 1 219 ? 99.007  36.136 50.569 1.00 49.10  ? 418 ASP A CB  1 
ATOM   1709 C CG  . ASP A 1 219 ? 99.706  35.012 51.307 1.00 52.03  ? 418 ASP A CG  1 
ATOM   1710 O OD1 . ASP A 1 219 ? 99.579  34.957 52.552 1.00 53.16  ? 418 ASP A OD1 1 
ATOM   1711 O OD2 . ASP A 1 219 ? 100.379 34.190 50.654 1.00 53.94  ? 418 ASP A OD2 1 
ATOM   1712 N N   . ASP A 1 220 ? 95.650  37.122 50.122 1.00 45.47  ? 419 ASP A N   1 
ATOM   1713 C CA  . ASP A 1 220 ? 94.761  37.960 49.340 1.00 44.72  ? 419 ASP A CA  1 
ATOM   1714 C C   . ASP A 1 220 ? 93.697  38.314 50.366 1.00 43.66  ? 419 ASP A C   1 
ATOM   1715 O O   . ASP A 1 220 ? 92.519  37.993 50.201 1.00 43.97  ? 419 ASP A O   1 
ATOM   1716 C CB  . ASP A 1 220 ? 94.148  37.154 48.198 1.00 45.90  ? 419 ASP A CB  1 
ATOM   1717 C CG  . ASP A 1 220 ? 93.707  38.023 47.041 1.00 47.05  ? 419 ASP A CG  1 
ATOM   1718 O OD1 . ASP A 1 220 ? 93.316  39.189 47.281 1.00 47.14  ? 419 ASP A OD1 1 
ATOM   1719 O OD2 . ASP A 1 220 ? 93.743  37.526 45.893 1.00 47.52  ? 419 ASP A OD2 1 
ATOM   1720 N N   . ILE A 1 221 ? 94.130  38.961 51.443 1.00 41.95  ? 420 ILE A N   1 
ATOM   1721 C CA  . ILE A 1 221 ? 93.227  39.313 52.530 1.00 40.07  ? 420 ILE A CA  1 
ATOM   1722 C C   . ILE A 1 221 ? 91.894  39.849 52.005 1.00 38.05  ? 420 ILE A C   1 
ATOM   1723 O O   . ILE A 1 221 ? 90.831  39.528 52.533 1.00 37.82  ? 420 ILE A O   1 
ATOM   1724 C CB  . ILE A 1 221 ? 93.892  40.339 53.521 1.00 40.30  ? 420 ILE A CB  1 
ATOM   1725 C CG1 . ILE A 1 221 ? 93.631  41.773 53.074 1.00 41.74  ? 420 ILE A CG1 1 
ATOM   1726 C CG2 . ILE A 1 221 ? 95.401  40.120 53.580 1.00 38.88  ? 420 ILE A CG2 1 
ATOM   1727 C CD1 . ILE A 1 221 ? 94.115  42.055 51.705 1.00 42.71  ? 420 ILE A CD1 1 
ATOM   1728 N N   . PHE A 1 222 ? 91.946  40.629 50.935 1.00 36.04  ? 421 PHE A N   1 
ATOM   1729 C CA  . PHE A 1 222 ? 90.734  41.200 50.380 1.00 35.29  ? 421 PHE A CA  1 
ATOM   1730 C C   . PHE A 1 222 ? 90.105  40.330 49.295 1.00 35.56  ? 421 PHE A C   1 
ATOM   1731 O O   . PHE A 1 222 ? 89.234  40.784 48.552 1.00 35.88  ? 421 PHE A O   1 
ATOM   1732 C CB  . PHE A 1 222 ? 91.037  42.602 49.850 1.00 34.59  ? 421 PHE A CB  1 
ATOM   1733 C CG  . PHE A 1 222 ? 91.325  43.611 50.937 1.00 33.62  ? 421 PHE A CG  1 
ATOM   1734 C CD1 . PHE A 1 222 ? 92.346  44.543 50.789 1.00 32.27  ? 421 PHE A CD1 1 
ATOM   1735 C CD2 . PHE A 1 222 ? 90.566  43.633 52.104 1.00 32.25  ? 421 PHE A CD2 1 
ATOM   1736 C CE1 . PHE A 1 222 ? 92.605  45.474 51.783 1.00 30.63  ? 421 PHE A CE1 1 
ATOM   1737 C CE2 . PHE A 1 222 ? 90.821  44.563 53.099 1.00 30.77  ? 421 PHE A CE2 1 
ATOM   1738 C CZ  . PHE A 1 222 ? 91.840  45.483 52.938 1.00 30.47  ? 421 PHE A CZ  1 
ATOM   1739 N N   . LEU A 1 223 ? 90.530  39.072 49.221 1.00 34.66  ? 422 LEU A N   1 
ATOM   1740 C CA  . LEU A 1 223 ? 89.996  38.153 48.222 1.00 32.58  ? 422 LEU A CA  1 
ATOM   1741 C C   . LEU A 1 223 ? 88.513  37.882 48.447 1.00 33.37  ? 422 LEU A C   1 
ATOM   1742 O O   . LEU A 1 223 ? 87.759  37.743 47.484 1.00 34.54  ? 422 LEU A O   1 
ATOM   1743 C CB  . LEU A 1 223 ? 90.763  36.822 48.233 1.00 29.06  ? 422 LEU A CB  1 
ATOM   1744 C CG  . LEU A 1 223 ? 90.333  35.733 47.236 1.00 25.46  ? 422 LEU A CG  1 
ATOM   1745 C CD1 . LEU A 1 223 ? 90.549  36.210 45.827 1.00 25.06  ? 422 LEU A CD1 1 
ATOM   1746 C CD2 . LEU A 1 223 ? 91.134  34.476 47.460 1.00 23.94  ? 422 LEU A CD2 1 
ATOM   1747 N N   . PHE A 1 224 ? 88.092  37.813 49.709 1.00 32.44  ? 423 PHE A N   1 
ATOM   1748 C CA  . PHE A 1 224 ? 86.689  37.538 50.016 1.00 32.02  ? 423 PHE A CA  1 
ATOM   1749 C C   . PHE A 1 224 ? 85.771  38.661 49.568 1.00 30.37  ? 423 PHE A C   1 
ATOM   1750 O O   . PHE A 1 224 ? 84.730  38.423 48.958 1.00 30.33  ? 423 PHE A O   1 
ATOM   1751 C CB  . PHE A 1 224 ? 86.501  37.302 51.509 1.00 35.71  ? 423 PHE A CB  1 
ATOM   1752 C CG  . PHE A 1 224 ? 85.070  37.083 51.910 1.00 39.25  ? 423 PHE A CG  1 
ATOM   1753 C CD1 . PHE A 1 224 ? 84.369  35.970 51.464 1.00 40.40  ? 423 PHE A CD1 1 
ATOM   1754 C CD2 . PHE A 1 224 ? 84.422  37.993 52.738 1.00 41.67  ? 423 PHE A CD2 1 
ATOM   1755 C CE1 . PHE A 1 224 ? 83.039  35.766 51.839 1.00 42.48  ? 423 PHE A CE1 1 
ATOM   1756 C CE2 . PHE A 1 224 ? 83.093  37.798 53.119 1.00 43.36  ? 423 PHE A CE2 1 
ATOM   1757 C CZ  . PHE A 1 224 ? 82.400  36.683 52.669 1.00 42.74  ? 423 PHE A CZ  1 
ATOM   1758 N N   . PRO A 1 225 ? 86.126  39.904 49.895 1.00 28.50  ? 424 PRO A N   1 
ATOM   1759 C CA  . PRO A 1 225 ? 85.259  41.000 49.465 1.00 26.51  ? 424 PRO A CA  1 
ATOM   1760 C C   . PRO A 1 225 ? 85.312  41.021 47.955 1.00 24.82  ? 424 PRO A C   1 
ATOM   1761 O O   . PRO A 1 225 ? 84.354  41.402 47.295 1.00 24.53  ? 424 PRO A O   1 
ATOM   1762 C CB  . PRO A 1 225 ? 85.923  42.224 50.072 1.00 27.33  ? 424 PRO A CB  1 
ATOM   1763 C CG  . PRO A 1 225 ? 86.559  41.668 51.310 1.00 28.95  ? 424 PRO A CG  1 
ATOM   1764 C CD  . PRO A 1 225 ? 87.163  40.383 50.820 1.00 28.32  ? 424 PRO A CD  1 
ATOM   1765 N N   . LYS A 1 226 ? 86.456  40.603 47.420 1.00 23.25  ? 425 LYS A N   1 
ATOM   1766 C CA  . LYS A 1 226 ? 86.657  40.551 45.982 1.00 21.70  ? 425 LYS A CA  1 
ATOM   1767 C C   . LYS A 1 226 ? 85.621  39.634 45.380 1.00 22.40  ? 425 LYS A C   1 
ATOM   1768 O O   . LYS A 1 226 ? 84.925  40.011 44.436 1.00 22.77  ? 425 LYS A O   1 
ATOM   1769 C CB  . LYS A 1 226 ? 88.046  40.026 45.654 1.00 19.18  ? 425 LYS A CB  1 
ATOM   1770 C CG  . LYS A 1 226 ? 89.097  41.108 45.603 1.00 18.16  ? 425 LYS A CG  1 
ATOM   1771 C CD  . LYS A 1 226 ? 90.471  40.509 45.404 1.00 19.17  ? 425 LYS A CD  1 
ATOM   1772 C CE  . LYS A 1 226 ? 91.493  41.601 45.170 1.00 20.05  ? 425 LYS A CE  1 
ATOM   1773 N NZ  . LYS A 1 226 ? 92.878  41.075 45.207 1.00 22.06  ? 425 LYS A NZ  1 
ATOM   1774 N N   . LEU A 1 227 ? 85.518  38.430 45.940 1.00 21.98  ? 426 LEU A N   1 
ATOM   1775 C CA  . LEU A 1 227 ? 84.559  37.444 45.467 1.00 20.88  ? 426 LEU A CA  1 
ATOM   1776 C C   . LEU A 1 227 ? 83.119  37.888 45.707 1.00 21.57  ? 426 LEU A C   1 
ATOM   1777 O O   . LEU A 1 227 ? 82.215  37.466 44.983 1.00 22.16  ? 426 LEU A O   1 
ATOM   1778 C CB  . LEU A 1 227 ? 84.819  36.080 46.123 1.00 18.82  ? 426 LEU A CB  1 
ATOM   1779 C CG  . LEU A 1 227 ? 86.003  35.268 45.577 1.00 15.89  ? 426 LEU A CG  1 
ATOM   1780 C CD1 . LEU A 1 227 ? 86.221  34.025 46.394 1.00 14.23  ? 426 LEU A CD1 1 
ATOM   1781 C CD2 . LEU A 1 227 ? 85.728  34.879 44.154 1.00 16.09  ? 426 LEU A CD2 1 
ATOM   1782 N N   . LEU A 1 228 ? 82.895  38.735 46.710 1.00 21.75  ? 427 LEU A N   1 
ATOM   1783 C CA  . LEU A 1 228 ? 81.541  39.221 46.958 1.00 23.26  ? 427 LEU A CA  1 
ATOM   1784 C C   . LEU A 1 228 ? 81.167  40.175 45.830 1.00 23.98  ? 427 LEU A C   1 
ATOM   1785 O O   . LEU A 1 228 ? 79.988  40.383 45.529 1.00 23.66  ? 427 LEU A O   1 
ATOM   1786 C CB  . LEU A 1 228 ? 81.441  39.955 48.295 1.00 24.60  ? 427 LEU A CB  1 
ATOM   1787 C CG  . LEU A 1 228 ? 81.401  39.161 49.606 1.00 25.95  ? 427 LEU A CG  1 
ATOM   1788 C CD1 . LEU A 1 228 ? 80.811  40.053 50.700 1.00 25.26  ? 427 LEU A CD1 1 
ATOM   1789 C CD2 . LEU A 1 228 ? 80.539  37.921 49.450 1.00 26.20  ? 427 LEU A CD2 1 
ATOM   1790 N N   . GLN A 1 229 ? 82.189  40.750 45.205 1.00 24.69  ? 428 GLN A N   1 
ATOM   1791 C CA  . GLN A 1 229 ? 81.983  41.676 44.106 1.00 27.00  ? 428 GLN A CA  1 
ATOM   1792 C C   . GLN A 1 229 ? 81.691  40.901 42.824 1.00 28.29  ? 428 GLN A C   1 
ATOM   1793 O O   . GLN A 1 229 ? 80.859  41.334 42.016 1.00 29.24  ? 428 GLN A O   1 
ATOM   1794 C CB  . GLN A 1 229 ? 83.219  42.562 43.915 1.00 28.29  ? 428 GLN A CB  1 
ATOM   1795 C CG  . GLN A 1 229 ? 82.949  44.060 44.048 1.00 29.75  ? 428 GLN A CG  1 
ATOM   1796 C CD  . GLN A 1 229 ? 81.866  44.558 43.093 1.00 30.35  ? 428 GLN A CD  1 
ATOM   1797 O OE1 . GLN A 1 229 ? 80.671  44.536 43.413 1.00 29.16  ? 428 GLN A OE1 1 
ATOM   1798 N NE2 . GLN A 1 229 ? 82.284  44.996 41.906 1.00 29.72  ? 428 GLN A NE2 1 
ATOM   1799 N N   . LYS A 1 230 ? 82.377  39.763 42.643 1.00 27.96  ? 429 LYS A N   1 
ATOM   1800 C CA  . LYS A 1 230 ? 82.189  38.906 41.463 1.00 24.48  ? 429 LYS A CA  1 
ATOM   1801 C C   . LYS A 1 230 ? 80.777  38.357 41.487 1.00 23.83  ? 429 LYS A C   1 
ATOM   1802 O O   . LYS A 1 230 ? 80.130  38.235 40.448 1.00 22.25  ? 429 LYS A O   1 
ATOM   1803 C CB  . LYS A 1 230 ? 83.174  37.735 41.451 1.00 21.47  ? 429 LYS A CB  1 
ATOM   1804 C CG  . LYS A 1 230 ? 84.640  38.112 41.332 1.00 17.95  ? 429 LYS A CG  1 
ATOM   1805 C CD  . LYS A 1 230 ? 84.913  39.109 40.215 1.00 15.30  ? 429 LYS A CD  1 
ATOM   1806 C CE  . LYS A 1 230 ? 86.402  39.122 39.892 1.00 15.05  ? 429 LYS A CE  1 
ATOM   1807 N NZ  . LYS A 1 230 ? 86.900  40.346 39.211 1.00 12.40  ? 429 LYS A NZ  1 
ATOM   1808 N N   . MET A 1 231 ? 80.300  38.022 42.681 1.00 24.48  ? 430 MET A N   1 
ATOM   1809 C CA  . MET A 1 231 ? 78.943  37.528 42.806 1.00 27.39  ? 430 MET A CA  1 
ATOM   1810 C C   . MET A 1 231 ? 78.016  38.587 42.209 1.00 29.34  ? 430 MET A C   1 
ATOM   1811 O O   . MET A 1 231 ? 76.835  38.339 41.949 1.00 30.30  ? 430 MET A O   1 
ATOM   1812 C CB  . MET A 1 231 ? 78.608  37.258 44.278 1.00 27.33  ? 430 MET A CB  1 
ATOM   1813 C CG  . MET A 1 231 ? 79.159  35.924 44.763 1.00 28.04  ? 430 MET A CG  1 
ATOM   1814 S SD  . MET A 1 231 ? 78.610  35.359 46.385 1.00 30.03  ? 430 MET A SD  1 
ATOM   1815 C CE  . MET A 1 231 ? 76.833  35.569 46.287 1.00 28.64  ? 430 MET A CE  1 
ATOM   1816 N N   . ALA A 1 232 ? 78.584  39.766 41.972 1.00 31.11  ? 431 ALA A N   1 
ATOM   1817 C CA  . ALA A 1 232 ? 77.861  40.890 41.398 1.00 31.49  ? 431 ALA A CA  1 
ATOM   1818 C C   . ALA A 1 232 ? 78.173  41.044 39.914 1.00 32.22  ? 431 ALA A C   1 
ATOM   1819 O O   . ALA A 1 232 ? 77.281  41.341 39.121 1.00 32.93  ? 431 ALA A O   1 
ATOM   1820 C CB  . ALA A 1 232 ? 78.221  42.159 42.135 1.00 32.44  ? 431 ALA A CB  1 
ATOM   1821 N N   . ASP A 1 233 ? 79.435  40.852 39.535 1.00 32.63  ? 432 ASP A N   1 
ATOM   1822 C CA  . ASP A 1 233 ? 79.819  40.965 38.128 1.00 33.45  ? 432 ASP A CA  1 
ATOM   1823 C C   . ASP A 1 233 ? 79.093  39.874 37.341 1.00 33.20  ? 432 ASP A C   1 
ATOM   1824 O O   . ASP A 1 233 ? 78.882  39.987 36.130 1.00 32.91  ? 432 ASP A O   1 
ATOM   1825 C CB  . ASP A 1 233 ? 81.335  40.787 37.945 1.00 34.35  ? 432 ASP A CB  1 
ATOM   1826 C CG  . ASP A 1 233 ? 82.151  41.766 38.765 1.00 35.85  ? 432 ASP A CG  1 
ATOM   1827 O OD1 . ASP A 1 233 ? 81.765  42.950 38.841 1.00 38.37  ? 432 ASP A OD1 1 
ATOM   1828 O OD2 . ASP A 1 233 ? 83.193  41.353 39.322 1.00 35.53  ? 432 ASP A OD2 1 
ATOM   1829 N N   . LEU A 1 234 ? 78.711  38.816 38.048 1.00 32.69  ? 433 LEU A N   1 
ATOM   1830 C CA  . LEU A 1 234 ? 78.022  37.699 37.427 1.00 32.77  ? 433 LEU A CA  1 
ATOM   1831 C C   . LEU A 1 234 ? 76.511  37.857 37.326 1.00 34.35  ? 433 LEU A C   1 
ATOM   1832 O O   . LEU A 1 234 ? 75.911  37.357 36.375 1.00 36.65  ? 433 LEU A O   1 
ATOM   1833 C CB  . LEU A 1 234 ? 78.361  36.395 38.153 1.00 28.66  ? 433 LEU A CB  1 
ATOM   1834 C CG  . LEU A 1 234 ? 79.721  35.822 37.765 1.00 24.71  ? 433 LEU A CG  1 
ATOM   1835 C CD1 . LEU A 1 234 ? 80.024  34.631 38.621 1.00 21.54  ? 433 LEU A CD1 1 
ATOM   1836 C CD2 . LEU A 1 234 ? 79.723  35.454 36.293 1.00 22.95  ? 433 LEU A CD2 1 
ATOM   1837 N N   . ARG A 1 235 ? 75.879  38.529 38.285 1.00 34.26  ? 434 ARG A N   1 
ATOM   1838 C CA  . ARG A 1 235 ? 74.438  38.694 38.180 1.00 33.34  ? 434 ARG A CA  1 
ATOM   1839 C C   . ARG A 1 235 ? 74.145  39.646 37.025 1.00 33.22  ? 434 ARG A C   1 
ATOM   1840 O O   . ARG A 1 235 ? 73.071  39.596 36.425 1.00 32.98  ? 434 ARG A O   1 
ATOM   1841 C CB  . ARG A 1 235 ? 73.842  39.241 39.473 1.00 33.44  ? 434 ARG A CB  1 
ATOM   1842 C CG  . ARG A 1 235 ? 72.333  39.409 39.389 1.00 35.39  ? 434 ARG A CG  1 
ATOM   1843 C CD  . ARG A 1 235 ? 71.712  39.669 40.750 1.00 36.98  ? 434 ARG A CD  1 
ATOM   1844 N NE  . ARG A 1 235 ? 72.237  38.738 41.745 1.00 38.46  ? 434 ARG A NE  1 
ATOM   1845 C CZ  . ARG A 1 235 ? 71.631  38.436 42.890 1.00 39.51  ? 434 ARG A CZ  1 
ATOM   1846 N NH1 . ARG A 1 235 ? 70.462  38.987 43.198 1.00 41.20  ? 434 ARG A NH1 1 
ATOM   1847 N NH2 . ARG A 1 235 ? 72.194  37.580 43.732 1.00 39.16  ? 434 ARG A NH2 1 
ATOM   1848 N N   . GLN A 1 236 ? 75.122  40.494 36.706 1.00 32.81  ? 435 GLN A N   1 
ATOM   1849 C CA  . GLN A 1 236 ? 75.000  41.475 35.627 1.00 32.98  ? 435 GLN A CA  1 
ATOM   1850 C C   . GLN A 1 236 ? 75.539  40.967 34.287 1.00 32.22  ? 435 GLN A C   1 
ATOM   1851 O O   . GLN A 1 236 ? 75.287  41.569 33.245 1.00 31.85  ? 435 GLN A O   1 
ATOM   1852 C CB  . GLN A 1 236 ? 75.711  42.785 36.027 1.00 34.62  ? 435 GLN A CB  1 
ATOM   1853 C CG  . GLN A 1 236 ? 76.374  43.549 34.880 1.00 37.77  ? 435 GLN A CG  1 
ATOM   1854 C CD  . GLN A 1 236 ? 75.709  44.887 34.544 1.00 38.54  ? 435 GLN A CD  1 
ATOM   1855 O OE1 . GLN A 1 236 ? 74.515  44.953 34.237 1.00 38.39  ? 435 GLN A OE1 1 
ATOM   1856 N NE2 . GLN A 1 236 ? 76.494  45.959 34.586 1.00 38.60  ? 435 GLN A NE2 1 
ATOM   1857 N N   . LEU A 1 237 ? 76.279  39.864 34.308 1.00 31.57  ? 436 LEU A N   1 
ATOM   1858 C CA  . LEU A 1 237 ? 76.824  39.300 33.075 1.00 29.79  ? 436 LEU A CA  1 
ATOM   1859 C C   . LEU A 1 237 ? 75.713  38.473 32.426 1.00 29.85  ? 436 LEU A C   1 
ATOM   1860 O O   . LEU A 1 237 ? 75.553  38.445 31.200 1.00 27.37  ? 436 LEU A O   1 
ATOM   1861 C CB  . LEU A 1 237 ? 78.020  38.417 33.407 1.00 28.13  ? 436 LEU A CB  1 
ATOM   1862 C CG  . LEU A 1 237 ? 78.898  37.978 32.246 1.00 27.76  ? 436 LEU A CG  1 
ATOM   1863 C CD1 . LEU A 1 237 ? 79.559  39.176 31.594 1.00 25.62  ? 436 LEU A CD1 1 
ATOM   1864 C CD2 . LEU A 1 237 ? 79.940  37.024 32.784 1.00 28.79  ? 436 LEU A CD2 1 
ATOM   1865 N N   . VAL A 1 238 ? 74.947  37.811 33.288 1.00 30.63  ? 437 VAL A N   1 
ATOM   1866 C CA  . VAL A 1 238 ? 73.822  36.983 32.892 1.00 31.73  ? 437 VAL A CA  1 
ATOM   1867 C C   . VAL A 1 238 ? 72.738  37.883 32.359 1.00 32.82  ? 437 VAL A C   1 
ATOM   1868 O O   . VAL A 1 238 ? 72.080  37.564 31.375 1.00 33.54  ? 437 VAL A O   1 
ATOM   1869 C CB  . VAL A 1 238 ? 73.263  36.220 34.095 1.00 32.14  ? 437 VAL A CB  1 
ATOM   1870 C CG1 . VAL A 1 238 ? 71.858  35.735 33.801 1.00 32.27  ? 437 VAL A CG1 1 
ATOM   1871 C CG2 . VAL A 1 238 ? 74.173  35.045 34.425 1.00 34.27  ? 437 VAL A CG2 1 
ATOM   1872 N N   . THR A 1 239 ? 72.556  39.007 33.039 1.00 34.62  ? 438 THR A N   1 
ATOM   1873 C CA  . THR A 1 239 ? 71.562  40.002 32.666 1.00 36.38  ? 438 THR A CA  1 
ATOM   1874 C C   . THR A 1 239 ? 71.760  40.474 31.236 1.00 37.15  ? 438 THR A C   1 
ATOM   1875 O O   . THR A 1 239 ? 70.805  40.586 30.469 1.00 36.30  ? 438 THR A O   1 
ATOM   1876 C CB  . THR A 1 239 ? 71.648  41.216 33.599 1.00 37.06  ? 438 THR A CB  1 
ATOM   1877 O OG1 . THR A 1 239 ? 70.797  41.009 34.731 1.00 38.42  ? 438 THR A OG1 1 
ATOM   1878 C CG2 . THR A 1 239 ? 71.238  42.480 32.879 1.00 39.07  ? 438 THR A CG2 1 
ATOM   1879 N N   . GLU A 1 240 ? 73.011  40.759 30.895 1.00 39.47  ? 439 GLU A N   1 
ATOM   1880 C CA  . GLU A 1 240 ? 73.372  41.233 29.567 1.00 42.62  ? 439 GLU A CA  1 
ATOM   1881 C C   . GLU A 1 240 ? 73.311  40.088 28.571 1.00 43.86  ? 439 GLU A C   1 
ATOM   1882 O O   . GLU A 1 240 ? 73.024  40.297 27.391 1.00 43.69  ? 439 GLU A O   1 
ATOM   1883 C CB  . GLU A 1 240 ? 74.772  41.839 29.614 1.00 44.57  ? 439 GLU A CB  1 
ATOM   1884 C CG  . GLU A 1 240 ? 74.903  42.882 30.715 1.00 47.83  ? 439 GLU A CG  1 
ATOM   1885 C CD  . GLU A 1 240 ? 76.339  43.242 31.034 1.00 49.30  ? 439 GLU A CD  1 
ATOM   1886 O OE1 . GLU A 1 240 ? 77.160  42.317 31.198 1.00 51.88  ? 439 GLU A OE1 1 
ATOM   1887 O OE2 . GLU A 1 240 ? 76.646  44.449 31.136 1.00 49.53  ? 439 GLU A OE2 1 
ATOM   1888 N N   . HIS A 1 241 ? 73.590  38.879 29.053 1.00 45.30  ? 440 HIS A N   1 
ATOM   1889 C CA  . HIS A 1 241 ? 73.531  37.692 28.209 1.00 46.46  ? 440 HIS A CA  1 
ATOM   1890 C C   . HIS A 1 241 ? 72.077  37.586 27.778 1.00 48.37  ? 440 HIS A C   1 
ATOM   1891 O O   . HIS A 1 241 ? 71.770  37.611 26.587 1.00 49.15  ? 440 HIS A O   1 
ATOM   1892 C CB  . HIS A 1 241 ? 73.932  36.446 29.006 1.00 44.89  ? 440 HIS A CB  1 
ATOM   1893 C CG  . HIS A 1 241 ? 73.905  35.171 28.212 1.00 43.66  ? 440 HIS A CG  1 
ATOM   1894 N ND1 . HIS A 1 241 ? 74.750  34.933 27.149 1.00 42.58  ? 440 HIS A ND1 1 
ATOM   1895 C CD2 . HIS A 1 241 ? 73.157  34.050 28.353 1.00 43.03  ? 440 HIS A CD2 1 
ATOM   1896 C CE1 . HIS A 1 241 ? 74.525  33.722 26.671 1.00 42.12  ? 440 HIS A CE1 1 
ATOM   1897 N NE2 . HIS A 1 241 ? 73.563  33.165 27.385 1.00 42.15  ? 440 HIS A NE2 1 
ATOM   1898 N N   . ALA A 1 242 ? 71.187  37.490 28.763 1.00 50.59  ? 441 ALA A N   1 
ATOM   1899 C CA  . ALA A 1 242 ? 69.753  37.390 28.517 1.00 52.97  ? 441 ALA A CA  1 
ATOM   1900 C C   . ALA A 1 242 ? 69.325  38.319 27.382 1.00 54.77  ? 441 ALA A C   1 
ATOM   1901 O O   . ALA A 1 242 ? 68.543  37.920 26.517 1.00 56.20  ? 441 ALA A O   1 
ATOM   1902 C CB  . ALA A 1 242 ? 68.981  37.722 29.788 1.00 52.79  ? 441 ALA A CB  1 
ATOM   1903 N N   . GLN A 1 243 ? 69.840  39.550 27.386 1.00 56.03  ? 442 GLN A N   1 
ATOM   1904 C CA  . GLN A 1 243 ? 69.523  40.528 26.342 1.00 56.99  ? 442 GLN A CA  1 
ATOM   1905 C C   . GLN A 1 243 ? 70.053  40.072 24.991 1.00 58.10  ? 442 GLN A C   1 
ATOM   1906 O O   . GLN A 1 243 ? 69.285  39.718 24.099 1.00 57.75  ? 442 GLN A O   1 
ATOM   1907 C CB  . GLN A 1 243 ? 70.148  41.888 26.652 1.00 56.42  ? 442 GLN A CB  1 
ATOM   1908 C CG  . GLN A 1 243 ? 69.493  42.682 27.767 1.00 56.71  ? 442 GLN A CG  1 
ATOM   1909 C CD  . GLN A 1 243 ? 70.177  44.025 27.980 1.00 57.08  ? 442 GLN A CD  1 
ATOM   1910 O OE1 . GLN A 1 243 ? 69.793  44.808 28.850 1.00 56.57  ? 442 GLN A OE1 1 
ATOM   1911 N NE2 . GLN A 1 243 ? 71.200  44.296 27.179 1.00 57.75  ? 442 GLN A NE2 1 
ATOM   1912 N N   . LEU A 1 244 ? 71.376  40.092 24.855 1.00 60.03  ? 443 LEU A N   1 
ATOM   1913 C CA  . LEU A 1 244 ? 72.051  39.701 23.623 1.00 62.23  ? 443 LEU A CA  1 
ATOM   1914 C C   . LEU A 1 244 ? 71.439  38.460 22.996 1.00 64.57  ? 443 LEU A C   1 
ATOM   1915 O O   . LEU A 1 244 ? 71.399  38.331 21.775 1.00 65.25  ? 443 LEU A O   1 
ATOM   1916 C CB  . LEU A 1 244 ? 73.533  39.460 23.898 1.00 61.06  ? 443 LEU A CB  1 
ATOM   1917 C CG  . LEU A 1 244 ? 74.458  39.607 22.694 1.00 60.61  ? 443 LEU A CG  1 
ATOM   1918 C CD1 . LEU A 1 244 ? 74.111  40.870 21.920 1.00 61.71  ? 443 LEU A CD1 1 
ATOM   1919 C CD2 . LEU A 1 244 ? 75.891  39.662 23.181 1.00 60.70  ? 443 LEU A CD2 1 
ATOM   1920 N N   . VAL A 1 245 ? 70.962  37.552 23.839 1.00 67.66  ? 444 VAL A N   1 
ATOM   1921 C CA  . VAL A 1 245 ? 70.339  36.320 23.374 1.00 70.90  ? 444 VAL A CA  1 
ATOM   1922 C C   . VAL A 1 245 ? 68.951  36.536 22.793 1.00 73.62  ? 444 VAL A C   1 
ATOM   1923 O O   . VAL A 1 245 ? 68.473  35.717 22.009 1.00 73.76  ? 444 VAL A O   1 
ATOM   1924 C CB  . VAL A 1 245 ? 70.228  35.279 24.516 1.00 70.52  ? 444 VAL A CB  1 
ATOM   1925 C CG1 . VAL A 1 245 ? 68.869  34.572 24.480 1.00 70.41  ? 444 VAL A CG1 1 
ATOM   1926 C CG2 . VAL A 1 245 ? 71.341  34.261 24.378 1.00 70.97  ? 444 VAL A CG2 1 
ATOM   1927 N N   . GLN A 1 246 ? 68.288  37.625 23.155 1.00 76.71  ? 445 GLN A N   1 
ATOM   1928 C CA  . GLN A 1 246 ? 66.956  37.800 22.620 1.00 80.08  ? 445 GLN A CA  1 
ATOM   1929 C C   . GLN A 1 246 ? 66.852  38.417 21.237 1.00 82.08  ? 445 GLN A C   1 
ATOM   1930 O O   . GLN A 1 246 ? 65.755  38.555 20.702 1.00 82.51  ? 445 GLN A O   1 
ATOM   1931 C CB  . GLN A 1 246 ? 66.072  38.497 23.642 1.00 80.15  ? 445 GLN A CB  1 
ATOM   1932 C CG  . GLN A 1 246 ? 65.959  37.636 24.893 1.00 81.34  ? 445 GLN A CG  1 
ATOM   1933 C CD  . GLN A 1 246 ? 64.572  37.621 25.487 1.00 82.13  ? 445 GLN A CD  1 
ATOM   1934 O OE1 . GLN A 1 246 ? 63.769  38.516 25.231 1.00 82.62  ? 445 GLN A OE1 1 
ATOM   1935 N NE2 . GLN A 1 246 ? 64.287  36.609 26.303 1.00 82.18  ? 445 GLN A NE2 1 
ATOM   1936 N N   . ILE A 1 247 ? 67.986  38.778 20.645 1.00 84.49  ? 446 ILE A N   1 
ATOM   1937 C CA  . ILE A 1 247 ? 67.943  39.269 19.281 1.00 87.15  ? 446 ILE A CA  1 
ATOM   1938 C C   . ILE A 1 247 ? 67.937  37.954 18.502 1.00 89.73  ? 446 ILE A C   1 
ATOM   1939 O O   . ILE A 1 247 ? 67.908  37.937 17.276 1.00 90.17  ? 446 ILE A O   1 
ATOM   1940 C CB  . ILE A 1 247 ? 69.175  40.120 18.900 1.00 86.38  ? 446 ILE A CB  1 
ATOM   1941 C CG1 . ILE A 1 247 ? 69.248  41.349 19.806 1.00 86.39  ? 446 ILE A CG1 1 
ATOM   1942 C CG2 . ILE A 1 247 ? 69.041  40.612 17.458 1.00 86.51  ? 446 ILE A CG2 1 
ATOM   1943 C CD1 . ILE A 1 247 ? 70.652  41.809 20.107 1.00 85.43  ? 446 ILE A CD1 1 
ATOM   1944 N N   . ILE A 1 248 ? 67.970  36.836 19.224 1.00 92.55  ? 447 ILE A N   1 
ATOM   1945 C CA  . ILE A 1 248 ? 67.909  35.561 18.538 1.00 95.62  ? 447 ILE A CA  1 
ATOM   1946 C C   . ILE A 1 248 ? 66.556  34.849 18.708 1.00 98.06  ? 447 ILE A C   1 
ATOM   1947 O O   . ILE A 1 248 ? 66.285  33.891 17.986 1.00 98.44  ? 447 ILE A O   1 
ATOM   1948 C CB  . ILE A 1 248 ? 69.126  34.646 18.888 1.00 95.63  ? 447 ILE A CB  1 
ATOM   1949 C CG1 . ILE A 1 248 ? 70.367  35.163 18.139 1.00 95.27  ? 447 ILE A CG1 1 
ATOM   1950 C CG2 . ILE A 1 248 ? 68.887  33.221 18.389 1.00 95.57  ? 447 ILE A CG2 1 
ATOM   1951 C CD1 . ILE A 1 248 ? 71.625  35.311 18.968 1.00 95.10  ? 447 ILE A CD1 1 
ATOM   1952 N N   . LYS A 1 249 ? 65.690  35.300 19.623 1.00 100.92 ? 448 LYS A N   1 
ATOM   1953 C CA  . LYS A 1 249 ? 64.365  34.664 19.712 1.00 104.07 ? 448 LYS A CA  1 
ATOM   1954 C C   . LYS A 1 249 ? 63.499  35.341 18.648 1.00 106.57 ? 448 LYS A C   1 
ATOM   1955 O O   . LYS A 1 249 ? 62.862  34.670 17.851 1.00 106.99 ? 448 LYS A O   1 
ATOM   1956 C CB  . LYS A 1 249 ? 63.675  34.829 21.087 1.00 103.27 ? 448 LYS A CB  1 
ATOM   1957 C CG  . LYS A 1 249 ? 62.523  33.834 21.320 1.00 102.99 ? 448 LYS A CG  1 
ATOM   1958 C CD  . LYS A 1 249 ? 61.139  34.470 21.465 1.00 102.45 ? 448 LYS A CD  1 
ATOM   1959 C CE  . LYS A 1 249 ? 60.051  33.463 21.847 1.00 102.36 ? 448 LYS A CE  1 
ATOM   1960 N NZ  . LYS A 1 249 ? 59.298  32.861 20.700 1.00 102.21 ? 448 LYS A NZ  1 
ATOM   1961 N N   . LYS A 1 250 ? 63.503  36.671 18.624 1.00 109.51 ? 449 LYS A N   1 
ATOM   1962 C CA  . LYS A 1 250 ? 62.706  37.442 17.665 1.00 112.87 ? 449 LYS A CA  1 
ATOM   1963 C C   . LYS A 1 250 ? 63.122  37.315 16.197 1.00 115.73 ? 449 LYS A C   1 
ATOM   1964 O O   . LYS A 1 250 ? 62.293  37.061 15.312 1.00 116.45 ? 449 LYS A O   1 
ATOM   1965 C CB  . LYS A 1 250 ? 62.738  38.929 18.042 1.00 112.02 ? 449 LYS A CB  1 
ATOM   1966 C CG  . LYS A 1 250 ? 62.047  39.250 19.352 1.00 111.13 ? 449 LYS A CG  1 
ATOM   1967 C CD  . LYS A 1 250 ? 60.554  38.991 19.247 1.00 110.27 ? 449 LYS A CD  1 
ATOM   1968 C CE  . LYS A 1 250 ? 59.963  38.592 20.587 1.00 110.09 ? 449 LYS A CE  1 
ATOM   1969 N NZ  . LYS A 1 250 ? 60.277  37.176 20.918 1.00 109.85 ? 449 LYS A NZ  1 
ATOM   1970 N N   . THR A 1 251 ? 64.415  37.506 15.966 1.00 118.53 ? 450 THR A N   1 
ATOM   1971 C CA  . THR A 1 251 ? 65.029  37.492 14.641 1.00 121.71 ? 450 THR A CA  1 
ATOM   1972 C C   . THR A 1 251 ? 65.242  36.155 13.967 1.00 124.11 ? 450 THR A C   1 
ATOM   1973 O O   . THR A 1 251 ? 64.651  35.837 12.926 1.00 124.44 ? 450 THR A O   1 
ATOM   1974 C CB  . THR A 1 251 ? 66.416  38.159 14.704 1.00 120.97 ? 450 THR A CB  1 
ATOM   1975 O OG1 . THR A 1 251 ? 66.275  39.502 15.174 1.00 120.47 ? 450 THR A OG1 1 
ATOM   1976 C CG2 . THR A 1 251 ? 67.094  38.150 13.335 1.00 120.57 ? 450 THR A CG2 1 
ATOM   1977 N N   . GLU A 1 252 ? 66.139  35.391 14.562 1.00 126.94 ? 451 GLU A N   1 
ATOM   1978 C CA  . GLU A 1 252 ? 66.491  34.129 14.000 1.00 130.13 ? 451 GLU A CA  1 
ATOM   1979 C C   . GLU A 1 252 ? 65.291  33.155 14.107 1.00 132.75 ? 451 GLU A C   1 
ATOM   1980 O O   . GLU A 1 252 ? 64.854  32.662 13.072 1.00 133.36 ? 451 GLU A O   1 
ATOM   1981 C CB  . GLU A 1 252 ? 67.844  33.718 14.624 1.00 129.68 ? 451 GLU A CB  1 
ATOM   1982 C CG  . GLU A 1 252 ? 68.900  34.811 14.360 1.00 129.56 ? 451 GLU A CG  1 
ATOM   1983 C CD  . GLU A 1 252 ? 69.415  34.829 12.919 1.00 129.21 ? 451 GLU A CD  1 
ATOM   1984 O OE1 . GLU A 1 252 ? 70.251  33.960 12.591 1.00 128.52 ? 451 GLU A OE1 1 
ATOM   1985 O OE2 . GLU A 1 252 ? 68.986  35.696 12.120 1.00 129.03 ? 451 GLU A OE2 1 
ATOM   1986 N N   . SER A 1 253 ? 64.680  32.980 15.285 1.00 135.69 ? 452 SER A N   1 
ATOM   1987 C CA  . SER A 1 253 ? 63.514  32.070 15.475 1.00 138.23 ? 452 SER A CA  1 
ATOM   1988 C C   . SER A 1 253 ? 63.399  30.823 14.608 1.00 139.75 ? 452 SER A C   1 
ATOM   1989 O O   . SER A 1 253 ? 62.302  30.510 14.143 1.00 139.79 ? 452 SER A O   1 
ATOM   1990 C CB  . SER A 1 253 ? 62.154  32.794 15.342 1.00 138.16 ? 452 SER A CB  1 
ATOM   1991 O OG  . SER A 1 253 ? 61.696  33.332 16.569 1.00 138.28 ? 452 SER A OG  1 
ATOM   1992 N N   . ASP A 1 254 ? 64.501  30.124 14.359 1.00 141.71 ? 453 ASP A N   1 
ATOM   1993 C CA  . ASP A 1 254 ? 64.419  28.878 13.599 1.00 143.55 ? 453 ASP A CA  1 
ATOM   1994 C C   . ASP A 1 254 ? 64.773  27.798 14.601 1.00 144.99 ? 453 ASP A C   1 
ATOM   1995 O O   . ASP A 1 254 ? 64.082  26.785 14.717 1.00 144.81 ? 453 ASP A O   1 
ATOM   1996 C CB  . ASP A 1 254 ? 65.387  28.822 12.396 1.00 143.61 ? 453 ASP A CB  1 
ATOM   1997 C CG  . ASP A 1 254 ? 66.740  29.454 12.678 1.00 143.66 ? 453 ASP A CG  1 
ATOM   1998 O OD1 . ASP A 1 254 ? 66.822  30.696 12.648 1.00 143.75 ? 453 ASP A OD1 1 
ATOM   1999 O OD2 . ASP A 1 254 ? 67.723  28.720 12.919 1.00 143.82 ? 453 ASP A OD2 1 
ATOM   2000 N N   . ALA A 1 255 ? 65.848  28.042 15.343 1.00 146.73 ? 454 ALA A N   1 
ATOM   2001 C CA  . ALA A 1 255 ? 66.308  27.113 16.361 1.00 148.06 ? 454 ALA A CA  1 
ATOM   2002 C C   . ALA A 1 255 ? 66.039  27.690 17.742 1.00 148.86 ? 454 ALA A C   1 
ATOM   2003 O O   . ALA A 1 255 ? 66.928  28.233 18.367 1.00 149.19 ? 454 ALA A O   1 
ATOM   2004 C CB  . ALA A 1 255 ? 67.804  26.840 16.194 1.00 147.98 ? 454 ALA A CB  1 
ATOM   2005 N N   . ALA A 1 256 ? 64.806  27.597 18.214 1.00 149.65 ? 455 ALA A N   1 
ATOM   2006 C CA  . ALA A 1 256 ? 64.494  28.101 19.540 1.00 150.72 ? 455 ALA A CA  1 
ATOM   2007 C C   . ALA A 1 256 ? 64.222  26.859 20.365 1.00 151.63 ? 455 ALA A C   1 
ATOM   2008 O O   . ALA A 1 256 ? 64.553  25.748 19.947 1.00 151.79 ? 455 ALA A O   1 
ATOM   2009 C CB  . ALA A 1 256 ? 63.261  28.991 19.495 1.00 150.31 ? 455 ALA A CB  1 
ATOM   2010 N N   . LEU A 1 257 ? 63.636  27.045 21.540 1.00 152.70 ? 456 LEU A N   1 
ATOM   2011 C CA  . LEU A 1 257 ? 63.285  25.924 22.399 1.00 153.35 ? 456 LEU A CA  1 
ATOM   2012 C C   . LEU A 1 257 ? 61.911  25.506 21.892 1.00 153.70 ? 456 LEU A C   1 
ATOM   2013 O O   . LEU A 1 257 ? 60.909  25.639 22.595 1.00 153.62 ? 456 LEU A O   1 
ATOM   2014 C CB  . LEU A 1 257 ? 63.150  26.355 23.861 1.00 153.26 ? 456 LEU A CB  1 
ATOM   2015 C CG  . LEU A 1 257 ? 63.837  27.610 24.409 1.00 152.81 ? 456 LEU A CG  1 
ATOM   2016 C CD1 . LEU A 1 257 ? 65.305  27.337 24.584 1.00 152.34 ? 456 LEU A CD1 1 
ATOM   2017 C CD2 . LEU A 1 257 ? 63.592  28.805 23.495 1.00 152.43 ? 456 LEU A CD2 1 
ATOM   2018 N N   . HIS A 1 258 ? 61.875  25.046 20.649 1.00 154.39 ? 457 HIS A N   1 
ATOM   2019 C CA  . HIS A 1 258 ? 60.656  24.587 19.987 1.00 155.08 ? 457 HIS A CA  1 
ATOM   2020 C C   . HIS A 1 258 ? 60.199  23.379 20.834 1.00 155.53 ? 457 HIS A C   1 
ATOM   2021 O O   . HIS A 1 258 ? 60.932  22.960 21.735 1.00 155.76 ? 457 HIS A O   1 
ATOM   2022 C CB  . HIS A 1 258 ? 61.060  24.222 18.543 1.00 154.85 ? 457 HIS A CB  1 
ATOM   2023 C CG  . HIS A 1 258 ? 59.930  23.836 17.640 1.00 154.33 ? 457 HIS A CG  1 
ATOM   2024 N ND1 . HIS A 1 258 ? 59.765  22.546 17.184 1.00 154.27 ? 457 HIS A ND1 1 
ATOM   2025 C CD2 . HIS A 1 258 ? 58.942  24.567 17.068 1.00 154.08 ? 457 HIS A CD2 1 
ATOM   2026 C CE1 . HIS A 1 258 ? 58.726  22.497 16.370 1.00 154.38 ? 457 HIS A CE1 1 
ATOM   2027 N NE2 . HIS A 1 258 ? 58.209  23.710 16.282 1.00 154.37 ? 457 HIS A NE2 1 
ATOM   2028 N N   . PRO A 1 259 ? 58.988  22.824 20.597 1.00 155.62 ? 458 PRO A N   1 
ATOM   2029 C CA  . PRO A 1 259 ? 58.624  21.680 21.440 1.00 155.31 ? 458 PRO A CA  1 
ATOM   2030 C C   . PRO A 1 259 ? 59.309  20.421 20.907 1.00 154.91 ? 458 PRO A C   1 
ATOM   2031 O O   . PRO A 1 259 ? 58.689  19.363 20.772 1.00 154.71 ? 458 PRO A O   1 
ATOM   2032 C CB  . PRO A 1 259 ? 57.109  21.630 21.299 1.00 155.24 ? 458 PRO A CB  1 
ATOM   2033 C CG  . PRO A 1 259 ? 56.926  21.959 19.860 1.00 155.24 ? 458 PRO A CG  1 
ATOM   2034 C CD  . PRO A 1 259 ? 57.915  23.102 19.623 1.00 155.52 ? 458 PRO A CD  1 
ATOM   2035 N N   . LEU A 1 260 ? 60.596  20.564 20.600 1.00 154.32 ? 459 LEU A N   1 
ATOM   2036 C CA  . LEU A 1 260 ? 61.410  19.480 20.063 1.00 153.46 ? 459 LEU A CA  1 
ATOM   2037 C C   . LEU A 1 260 ? 62.564  19.181 21.013 1.00 153.03 ? 459 LEU A C   1 
ATOM   2038 O O   . LEU A 1 260 ? 63.419  18.341 20.728 1.00 153.02 ? 459 LEU A O   1 
ATOM   2039 C CB  . LEU A 1 260 ? 61.983  19.885 18.708 1.00 153.25 ? 459 LEU A CB  1 
ATOM   2040 C CG  . LEU A 1 260 ? 63.366  20.546 18.786 1.00 153.13 ? 459 LEU A CG  1 
ATOM   2041 C CD1 . LEU A 1 260 ? 63.769  21.003 17.406 1.00 152.90 ? 459 LEU A CD1 1 
ATOM   2042 C CD2 . LEU A 1 260 ? 63.362  21.725 19.758 1.00 152.78 ? 459 LEU A CD2 1 
ATOM   2043 N N   . LEU A 1 261 ? 62.607  19.911 22.121 1.00 152.29 ? 460 LEU A N   1 
ATOM   2044 C CA  . LEU A 1 261 ? 63.644  19.703 23.114 1.00 151.02 ? 460 LEU A CA  1 
ATOM   2045 C C   . LEU A 1 261 ? 63.285  18.329 23.709 1.00 150.33 ? 460 LEU A C   1 
ATOM   2046 O O   . LEU A 1 261 ? 64.112  17.686 24.361 1.00 150.10 ? 460 LEU A O   1 
ATOM   2047 C CB  . LEU A 1 261 ? 63.586  20.835 24.160 1.00 150.70 ? 460 LEU A CB  1 
ATOM   2048 C CG  . LEU A 1 261 ? 64.860  21.287 24.889 1.00 150.24 ? 460 LEU A CG  1 
ATOM   2049 C CD1 . LEU A 1 261 ? 64.886  22.808 25.017 1.00 149.77 ? 460 LEU A CD1 1 
ATOM   2050 C CD2 . LEU A 1 261 ? 64.921  20.632 26.253 1.00 150.35 ? 460 LEU A CD2 1 
ATOM   2051 N N   . GLN A 1 262 ? 62.046  17.892 23.421 1.00 149.55 ? 461 GLN A N   1 
ATOM   2052 C CA  . GLN A 1 262 ? 61.460  16.606 23.867 1.00 148.54 ? 461 GLN A CA  1 
ATOM   2053 C C   . GLN A 1 262 ? 61.494  15.496 22.829 1.00 147.83 ? 461 GLN A C   1 
ATOM   2054 O O   . GLN A 1 262 ? 60.690  15.487 21.901 1.00 148.10 ? 461 GLN A O   1 
ATOM   2055 C CB  . GLN A 1 262 ? 59.964  16.703 24.200 1.00 148.45 ? 461 GLN A CB  1 
ATOM   2056 C CG  . GLN A 1 262 ? 59.493  17.836 25.076 1.00 148.43 ? 461 GLN A CG  1 
ATOM   2057 C CD  . GLN A 1 262 ? 59.493  19.145 24.357 1.00 148.29 ? 461 GLN A CD  1 
ATOM   2058 O OE1 . GLN A 1 262 ? 58.508  19.524 23.722 1.00 148.06 ? 461 GLN A OE1 1 
ATOM   2059 N NE2 . GLN A 1 262 ? 60.610  19.850 24.435 1.00 148.26 ? 461 GLN A NE2 1 
ATOM   2060 N N   . GLU A 1 263 ? 62.362  14.525 23.024 1.00 146.66 ? 462 GLU A N   1 
ATOM   2061 C CA  . GLU A 1 263 ? 62.463  13.392 22.119 1.00 145.08 ? 462 GLU A CA  1 
ATOM   2062 C C   . GLU A 1 263 ? 63.394  12.543 22.937 1.00 144.36 ? 462 GLU A C   1 
ATOM   2063 O O   . GLU A 1 263 ? 63.516  11.331 22.771 1.00 143.55 ? 462 GLU A O   1 
ATOM   2064 C CB  . GLU A 1 263 ? 63.105  13.840 20.801 1.00 144.42 ? 462 GLU A CB  1 
ATOM   2065 C CG  . GLU A 1 263 ? 63.886  12.767 20.067 1.00 143.04 ? 462 GLU A CG  1 
ATOM   2066 C CD  . GLU A 1 263 ? 64.134  13.128 18.620 1.00 142.20 ? 462 GLU A CD  1 
ATOM   2067 O OE1 . GLU A 1 263 ? 64.823  14.135 18.355 1.00 141.55 ? 462 GLU A OE1 1 
ATOM   2068 O OE2 . GLU A 1 263 ? 63.627  12.398 17.746 1.00 141.60 ? 462 GLU A OE2 1 
ATOM   2069 N N   . ILE A 1 264 ? 63.993  13.250 23.886 1.00 144.02 ? 463 ILE A N   1 
ATOM   2070 C CA  . ILE A 1 264 ? 64.966  12.742 24.825 1.00 143.59 ? 463 ILE A CA  1 
ATOM   2071 C C   . ILE A 1 264 ? 64.625  13.298 26.220 1.00 143.36 ? 463 ILE A C   1 
ATOM   2072 O O   . ILE A 1 264 ? 64.821  12.630 27.235 1.00 142.98 ? 463 ILE A O   1 
ATOM   2073 C CB  . ILE A 1 264 ? 66.368  13.222 24.384 1.00 143.61 ? 463 ILE A CB  1 
ATOM   2074 C CG1 . ILE A 1 264 ? 66.216  14.304 23.297 1.00 143.40 ? 463 ILE A CG1 1 
ATOM   2075 C CG2 . ILE A 1 264 ? 67.181  12.051 23.859 1.00 143.41 ? 463 ILE A CG2 1 
ATOM   2076 C CD1 . ILE A 1 264 ? 67.515  14.891 22.771 1.00 142.63 ? 463 ILE A CD1 1 
ATOM   2077 N N   . TYR A 1 265 ? 64.095  14.521 26.232 1.00 143.00 ? 464 TYR A N   1 
ATOM   2078 C CA  . TYR A 1 265 ? 63.701  15.273 27.434 1.00 142.50 ? 464 TYR A CA  1 
ATOM   2079 C C   . TYR A 1 265 ? 62.926  14.552 28.552 1.00 142.19 ? 464 TYR A C   1 
ATOM   2080 O O   . TYR A 1 265 ? 63.322  14.627 29.716 1.00 142.04 ? 464 TYR A O   1 
ATOM   2081 C CB  . TYR A 1 265 ? 62.943  16.531 26.965 1.00 142.40 ? 464 TYR A CB  1 
ATOM   2082 C CG  . TYR A 1 265 ? 61.968  17.190 27.929 1.00 142.04 ? 464 TYR A CG  1 
ATOM   2083 C CD1 . TYR A 1 265 ? 62.406  17.896 29.052 1.00 141.69 ? 464 TYR A CD1 1 
ATOM   2084 C CD2 . TYR A 1 265 ? 60.601  17.180 27.658 1.00 141.61 ? 464 TYR A CD2 1 
ATOM   2085 C CE1 . TYR A 1 265 ? 61.495  18.580 29.870 1.00 141.22 ? 464 TYR A CE1 1 
ATOM   2086 C CE2 . TYR A 1 265 ? 59.691  17.856 28.457 1.00 141.01 ? 464 TYR A CE2 1 
ATOM   2087 C CZ  . TYR A 1 265 ? 60.139  18.554 29.558 1.00 141.10 ? 464 TYR A CZ  1 
ATOM   2088 O OH  . TYR A 1 265 ? 59.227  19.231 30.332 1.00 140.83 ? 464 TYR A OH  1 
ATOM   2089 N N   . ARG A 1 266 ? 61.835  13.866 28.218 1.00 141.90 ? 465 ARG A N   1 
ATOM   2090 C CA  . ARG A 1 266 ? 61.033  13.166 29.230 1.00 141.29 ? 465 ARG A CA  1 
ATOM   2091 C C   . ARG A 1 266 ? 61.751  11.948 29.805 1.00 141.62 ? 465 ARG A C   1 
ATOM   2092 O O   . ARG A 1 266 ? 62.515  12.053 30.763 1.00 141.68 ? 465 ARG A O   1 
ATOM   2093 C CB  . ARG A 1 266 ? 59.702  12.689 28.642 1.00 140.42 ? 465 ARG A CB  1 
ATOM   2094 C CG  . ARG A 1 266 ? 58.867  13.735 27.928 1.00 138.98 ? 465 ARG A CG  1 
ATOM   2095 C CD  . ARG A 1 266 ? 57.689  13.050 27.254 1.00 137.50 ? 465 ARG A CD  1 
ATOM   2096 N NE  . ARG A 1 266 ? 58.128  11.877 26.499 1.00 136.68 ? 465 ARG A NE  1 
ATOM   2097 C CZ  . ARG A 1 266 ? 58.858  11.926 25.388 1.00 136.37 ? 465 ARG A CZ  1 
ATOM   2098 N NH1 . ARG A 1 266 ? 59.233  13.094 24.886 1.00 136.30 ? 465 ARG A NH1 1 
ATOM   2099 N NH2 . ARG A 1 266 ? 59.227  10.805 24.785 1.00 136.02 ? 465 ARG A NH2 1 
ATOM   2100 N N   . ASP A 1 267 ? 61.473  10.792 29.207 1.00 141.88 ? 466 ASP A N   1 
ATOM   2101 C CA  . ASP A 1 267 ? 62.055  9.516  29.613 1.00 142.03 ? 466 ASP A CA  1 
ATOM   2102 C C   . ASP A 1 267 ? 63.574  9.528  29.575 1.00 142.36 ? 466 ASP A C   1 
ATOM   2103 O O   . ASP A 1 267 ? 64.185  9.012  28.635 1.00 142.34 ? 466 ASP A O   1 
ATOM   2104 C CB  . ASP A 1 267 ? 61.544  8.400  28.705 1.00 141.63 ? 466 ASP A CB  1 
ATOM   2105 C CG  . ASP A 1 267 ? 60.073  8.127  28.893 1.00 141.17 ? 466 ASP A CG  1 
ATOM   2106 O OD1 . ASP A 1 267 ? 59.261  9.065  28.746 1.00 141.00 ? 466 ASP A OD1 1 
ATOM   2107 O OD2 . ASP A 1 267 ? 59.735  6.967  29.191 1.00 140.58 ? 466 ASP A OD2 1 
ATOM   2108 N N   . MET A 1 268 ? 64.181  10.107 30.604 1.00 142.68 ? 467 MET A N   1 
ATOM   2109 C CA  . MET A 1 268 ? 65.631  10.176 30.674 1.00 142.73 ? 467 MET A CA  1 
ATOM   2110 C C   . MET A 1 268 ? 66.106  10.364 32.111 1.00 143.08 ? 467 MET A C   1 
ATOM   2111 O O   . MET A 1 268 ? 67.137  9.819  32.508 1.00 142.70 ? 467 MET A O   1 
ATOM   2112 C CB  . MET A 1 268 ? 66.141  11.320 29.796 1.00 142.10 ? 467 MET A CB  1 
ATOM   2113 C CG  . MET A 1 268 ? 67.564  11.116 29.312 1.00 141.01 ? 467 MET A CG  1 
ATOM   2114 S SD  . MET A 1 268 ? 67.740  9.512  28.507 1.00 139.58 ? 467 MET A SD  1 
ATOM   2115 C CE  . MET A 1 268 ? 68.178  8.482  29.906 1.00 139.59 ? 467 MET A CE  1 
ATOM   2116 N N   . TYR A 1 269 ? 65.342  11.131 32.886 1.00 143.69 ? 468 TYR A N   1 
ATOM   2117 C CA  . TYR A 1 269 ? 65.670  11.394 34.283 1.00 144.30 ? 468 TYR A CA  1 
ATOM   2118 C C   . TYR A 1 269 ? 64.451  11.474 35.194 1.00 144.42 ? 468 TYR A C   1 
ATOM   2119 O O   . TYR A 1 269 ? 63.325  11.593 34.666 1.00 144.80 ? 468 TYR A O   1 
ATOM   2120 C CB  . TYR A 1 269 ? 66.477  12.689 34.391 1.00 144.65 ? 468 TYR A CB  1 
ATOM   2121 C CG  . TYR A 1 269 ? 67.958  12.438 34.360 1.00 145.08 ? 468 TYR A CG  1 
ATOM   2122 C CD1 . TYR A 1 269 ? 68.602  11.871 35.459 1.00 145.24 ? 468 TYR A CD1 1 
ATOM   2123 C CD2 . TYR A 1 269 ? 68.706  12.699 33.214 1.00 145.03 ? 468 TYR A CD2 1 
ATOM   2124 C CE1 . TYR A 1 269 ? 69.953  11.563 35.418 1.00 145.41 ? 468 TYR A CE1 1 
ATOM   2125 C CE2 . TYR A 1 269 ? 70.061  12.393 33.161 1.00 145.42 ? 468 TYR A CE2 1 
ATOM   2126 C CZ  . TYR A 1 269 ? 70.677  11.824 34.267 1.00 145.51 ? 468 TYR A CZ  1 
ATOM   2127 O OH  . TYR A 1 269 ? 72.014  11.503 34.216 1.00 145.57 ? 468 TYR A OH  1 
ATOM   2128 O OXT . TYR A 1 269 ? 64.642  11.424 36.429 1.00 144.15 ? 468 TYR A OXT 1 
ATOM   2129 N N   . THR B 1 1   ? 26.518  63.200 24.414 1.00 69.37  ? 200 THR B N   1 
ATOM   2130 C CA  . THR B 1 1   ? 27.296  62.714 23.240 1.00 68.87  ? 200 THR B CA  1 
ATOM   2131 C C   . THR B 1 1   ? 28.786  62.966 23.441 1.00 68.30  ? 200 THR B C   1 
ATOM   2132 O O   . THR B 1 1   ? 29.498  63.114 22.456 1.00 68.52  ? 200 THR B O   1 
ATOM   2133 C CB  . THR B 1 1   ? 26.823  63.433 21.963 1.00 68.54  ? 200 THR B CB  1 
ATOM   2134 N N   . ALA B 1 2   ? 29.249  63.003 24.699 1.00 67.00  ? 201 ALA B N   1 
ATOM   2135 C CA  . ALA B 1 2   ? 30.664  63.288 25.013 1.00 65.29  ? 201 ALA B CA  1 
ATOM   2136 C C   . ALA B 1 2   ? 31.562  62.161 25.570 1.00 63.67  ? 201 ALA B C   1 
ATOM   2137 O O   . ALA B 1 2   ? 32.755  62.093 25.266 1.00 63.60  ? 201 ALA B O   1 
ATOM   2138 C CB  . ALA B 1 2   ? 30.741  64.499 25.937 1.00 65.41  ? 201 ALA B CB  1 
ATOM   2139 N N   . ASP B 1 3   ? 31.010  61.304 26.414 1.00 61.47  ? 202 ASP B N   1 
ATOM   2140 C CA  . ASP B 1 3   ? 31.763  60.183 26.969 1.00 58.34  ? 202 ASP B CA  1 
ATOM   2141 C C   . ASP B 1 3   ? 30.796  59.035 26.761 1.00 55.48  ? 202 ASP B C   1 
ATOM   2142 O O   . ASP B 1 3   ? 30.915  57.947 27.330 1.00 54.96  ? 202 ASP B O   1 
ATOM   2143 C CB  . ASP B 1 3   ? 32.034  60.406 28.451 1.00 60.24  ? 202 ASP B CB  1 
ATOM   2144 C CG  . ASP B 1 3   ? 32.384  59.128 29.174 1.00 62.47  ? 202 ASP B CG  1 
ATOM   2145 O OD1 . ASP B 1 3   ? 31.797  58.884 30.249 1.00 64.53  ? 202 ASP B OD1 1 
ATOM   2146 O OD2 . ASP B 1 3   ? 33.238  58.367 28.670 1.00 63.28  ? 202 ASP B OD2 1 
ATOM   2147 N N   . LEU B 1 4   ? 29.820  59.346 25.917 1.00 51.60  ? 203 LEU B N   1 
ATOM   2148 C CA  . LEU B 1 4   ? 28.743  58.466 25.511 1.00 47.17  ? 203 LEU B CA  1 
ATOM   2149 C C   . LEU B 1 4   ? 29.175  57.997 24.131 1.00 45.97  ? 203 LEU B C   1 
ATOM   2150 O O   . LEU B 1 4   ? 28.809  56.922 23.647 1.00 46.12  ? 203 LEU B O   1 
ATOM   2151 C CB  . LEU B 1 4   ? 27.473  59.291 25.393 1.00 43.96  ? 203 LEU B CB  1 
ATOM   2152 C CG  . LEU B 1 4   ? 26.146  58.564 25.482 1.00 42.05  ? 203 LEU B CG  1 
ATOM   2153 C CD1 . LEU B 1 4   ? 25.933  58.120 26.912 1.00 41.29  ? 203 LEU B CD1 1 
ATOM   2154 C CD2 . LEU B 1 4   ? 25.035  59.485 25.046 1.00 41.99  ? 203 LEU B CD2 1 
ATOM   2155 N N   . LYS B 1 5   ? 29.971  58.852 23.509 1.00 44.05  ? 204 LYS B N   1 
ATOM   2156 C CA  . LYS B 1 5   ? 30.505  58.613 22.191 1.00 41.41  ? 204 LYS B CA  1 
ATOM   2157 C C   . LYS B 1 5   ? 31.542  57.493 22.224 1.00 38.31  ? 204 LYS B C   1 
ATOM   2158 O O   . LYS B 1 5   ? 31.589  56.652 21.325 1.00 39.12  ? 204 LYS B O   1 
ATOM   2159 C CB  . LYS B 1 5   ? 31.088  59.926 21.665 1.00 44.13  ? 204 LYS B CB  1 
ATOM   2160 C CG  . LYS B 1 5   ? 31.538  60.916 22.747 1.00 47.42  ? 204 LYS B CG  1 
ATOM   2161 C CD  . LYS B 1 5   ? 31.759  62.325 22.169 1.00 50.47  ? 204 LYS B CD  1 
ATOM   2162 C CE  . LYS B 1 5   ? 32.814  63.165 22.895 1.00 51.42  ? 204 LYS B CE  1 
ATOM   2163 N NZ  . LYS B 1 5   ? 33.020  64.543 22.335 1.00 50.08  ? 204 LYS B NZ  1 
ATOM   2164 N N   . SER B 1 6   ? 32.352  57.460 23.276 1.00 33.52  ? 205 SER B N   1 
ATOM   2165 C CA  . SER B 1 6   ? 33.367  56.422 23.401 1.00 27.98  ? 205 SER B CA  1 
ATOM   2166 C C   . SER B 1 6   ? 32.775  55.140 23.992 1.00 24.03  ? 205 SER B C   1 
ATOM   2167 O O   . SER B 1 6   ? 33.464  54.127 24.096 1.00 23.52  ? 205 SER B O   1 
ATOM   2168 C CB  . SER B 1 6   ? 34.509  56.903 24.296 1.00 27.57  ? 205 SER B CB  1 
ATOM   2169 O OG  . SER B 1 6   ? 34.317  56.464 25.625 1.00 28.46  ? 205 SER B OG  1 
ATOM   2170 N N   . LEU B 1 7   ? 31.496  55.181 24.361 1.00 19.30  ? 206 LEU B N   1 
ATOM   2171 C CA  . LEU B 1 7   ? 30.828  54.028 24.970 1.00 14.97  ? 206 LEU B CA  1 
ATOM   2172 C C   . LEU B 1 7   ? 30.884  52.725 24.178 1.00 13.70  ? 206 LEU B C   1 
ATOM   2173 O O   . LEU B 1 7   ? 31.504  51.758 24.616 1.00 13.55  ? 206 LEU B O   1 
ATOM   2174 C CB  . LEU B 1 7   ? 29.354  54.340 25.267 1.00 10.90  ? 206 LEU B CB  1 
ATOM   2175 C CG  . LEU B 1 7   ? 28.770  53.836 26.600 1.00 6.65   ? 206 LEU B CG  1 
ATOM   2176 C CD1 . LEU B 1 7   ? 27.265  53.814 26.512 1.00 6.55   ? 206 LEU B CD1 1 
ATOM   2177 C CD2 . LEU B 1 7   ? 29.267  52.454 26.927 1.00 6.55   ? 206 LEU B CD2 1 
ATOM   2178 N N   . ALA B 1 8   ? 30.224  52.700 23.025 1.00 11.56  ? 207 ALA B N   1 
ATOM   2179 C CA  . ALA B 1 8   ? 30.169  51.500 22.209 1.00 8.72   ? 207 ALA B CA  1 
ATOM   2180 C C   . ALA B 1 8   ? 31.516  50.927 21.805 1.00 8.27   ? 207 ALA B C   1 
ATOM   2181 O O   . ALA B 1 8   ? 31.640  49.729 21.632 1.00 8.10   ? 207 ALA B O   1 
ATOM   2182 C CB  . ALA B 1 8   ? 29.329  51.753 20.991 1.00 9.64   ? 207 ALA B CB  1 
ATOM   2183 N N   . LYS B 1 9   ? 32.527  51.766 21.636 1.00 8.99   ? 208 LYS B N   1 
ATOM   2184 C CA  . LYS B 1 9   ? 33.846  51.260 21.269 1.00 10.23  ? 208 LYS B CA  1 
ATOM   2185 C C   . LYS B 1 9   ? 34.493  50.617 22.487 1.00 10.78  ? 208 LYS B C   1 
ATOM   2186 O O   . LYS B 1 9   ? 35.331  49.728 22.360 1.00 10.72  ? 208 LYS B O   1 
ATOM   2187 C CB  . LYS B 1 9   ? 34.729  52.390 20.752 1.00 13.13  ? 208 LYS B CB  1 
ATOM   2188 C CG  . LYS B 1 9   ? 36.212  52.184 20.997 1.00 15.48  ? 208 LYS B CG  1 
ATOM   2189 C CD  . LYS B 1 9   ? 37.032  52.584 19.785 1.00 19.74  ? 208 LYS B CD  1 
ATOM   2190 C CE  . LYS B 1 9   ? 38.502  52.735 20.146 1.00 22.80  ? 208 LYS B CE  1 
ATOM   2191 N NZ  . LYS B 1 9   ? 39.127  51.490 20.695 1.00 26.60  ? 208 LYS B NZ  1 
ATOM   2192 N N   . ARG B 1 10  ? 34.099  51.089 23.669 1.00 11.04  ? 209 ARG B N   1 
ATOM   2193 C CA  . ARG B 1 10  ? 34.599  50.567 24.935 1.00 9.30   ? 209 ARG B CA  1 
ATOM   2194 C C   . ARG B 1 10  ? 33.934  49.217 25.227 1.00 8.25   ? 209 ARG B C   1 
ATOM   2195 O O   . ARG B 1 10  ? 34.599  48.253 25.600 1.00 7.71   ? 209 ARG B O   1 
ATOM   2196 C CB  . ARG B 1 10  ? 34.285  51.552 26.067 1.00 11.53  ? 209 ARG B CB  1 
ATOM   2197 C CG  . ARG B 1 10  ? 35.259  52.711 26.243 1.00 16.49  ? 209 ARG B CG  1 
ATOM   2198 C CD  . ARG B 1 10  ? 36.623  52.234 26.721 1.00 23.52  ? 209 ARG B CD  1 
ATOM   2199 N NE  . ARG B 1 10  ? 36.529  51.047 27.579 1.00 33.65  ? 209 ARG B NE  1 
ATOM   2200 C CZ  . ARG B 1 10  ? 36.339  51.051 28.904 1.00 37.98  ? 209 ARG B CZ  1 
ATOM   2201 N NH1 . ARG B 1 10  ? 36.224  52.201 29.572 1.00 38.41  ? 209 ARG B NH1 1 
ATOM   2202 N NH2 . ARG B 1 10  ? 36.243  49.891 29.562 1.00 37.41  ? 209 ARG B NH2 1 
ATOM   2203 N N   . ILE B 1 11  ? 32.616  49.158 25.055 1.00 6.55   ? 210 ILE B N   1 
ATOM   2204 C CA  . ILE B 1 11  ? 31.858  47.935 25.293 1.00 6.55   ? 210 ILE B CA  1 
ATOM   2205 C C   . ILE B 1 11  ? 32.186  46.826 24.312 1.00 6.55   ? 210 ILE B C   1 
ATOM   2206 O O   . ILE B 1 11  ? 32.189  45.667 24.665 1.00 6.55   ? 210 ILE B O   1 
ATOM   2207 C CB  . ILE B 1 11  ? 30.353  48.200 25.227 1.00 6.55   ? 210 ILE B CB  1 
ATOM   2208 C CG1 . ILE B 1 11  ? 29.938  49.051 26.427 1.00 6.55   ? 210 ILE B CG1 1 
ATOM   2209 C CG2 . ILE B 1 11  ? 29.595  46.889 25.166 1.00 6.55   ? 210 ILE B CG2 1 
ATOM   2210 C CD1 . ILE B 1 11  ? 28.443  49.244 26.572 1.00 6.55   ? 210 ILE B CD1 1 
ATOM   2211 N N   . TYR B 1 12  ? 32.464  47.183 23.073 1.00 6.55   ? 211 TYR B N   1 
ATOM   2212 C CA  . TYR B 1 12  ? 32.785  46.189 22.067 1.00 6.55   ? 211 TYR B CA  1 
ATOM   2213 C C   . TYR B 1 12  ? 34.167  45.597 22.284 1.00 6.55   ? 211 TYR B C   1 
ATOM   2214 O O   . TYR B 1 12  ? 34.386  44.428 21.995 1.00 6.55   ? 211 TYR B O   1 
ATOM   2215 C CB  . TYR B 1 12  ? 32.670  46.814 20.678 1.00 6.73   ? 211 TYR B CB  1 
ATOM   2216 C CG  . TYR B 1 12  ? 33.096  45.934 19.523 1.00 7.10   ? 211 TYR B CG  1 
ATOM   2217 C CD1 . TYR B 1 12  ? 32.834  44.571 19.520 1.00 7.50   ? 211 TYR B CD1 1 
ATOM   2218 C CD2 . TYR B 1 12  ? 33.721  46.483 18.407 1.00 7.77   ? 211 TYR B CD2 1 
ATOM   2219 C CE1 . TYR B 1 12  ? 33.180  43.779 18.443 1.00 7.17   ? 211 TYR B CE1 1 
ATOM   2220 C CE2 . TYR B 1 12  ? 34.070  45.697 17.326 1.00 8.50   ? 211 TYR B CE2 1 
ATOM   2221 C CZ  . TYR B 1 12  ? 33.794  44.347 17.354 1.00 8.13   ? 211 TYR B CZ  1 
ATOM   2222 O OH  . TYR B 1 12  ? 34.126  43.564 16.283 1.00 11.98  ? 211 TYR B OH  1 
ATOM   2223 N N   . GLU B 1 13  ? 35.100  46.399 22.790 1.00 8.68   ? 212 GLU B N   1 
ATOM   2224 C CA  . GLU B 1 13  ? 36.455  45.909 23.054 1.00 11.03  ? 212 GLU B CA  1 
ATOM   2225 C C   . GLU B 1 13  ? 36.452  45.081 24.323 1.00 9.63   ? 212 GLU B C   1 
ATOM   2226 O O   . GLU B 1 13  ? 37.276  44.191 24.492 1.00 9.66   ? 212 GLU B O   1 
ATOM   2227 C CB  . GLU B 1 13  ? 37.448  47.060 23.212 1.00 15.09  ? 212 GLU B CB  1 
ATOM   2228 C CG  . GLU B 1 13  ? 37.882  47.705 21.904 1.00 24.48  ? 212 GLU B CG  1 
ATOM   2229 C CD  . GLU B 1 13  ? 38.849  48.865 22.121 1.00 29.59  ? 212 GLU B CD  1 
ATOM   2230 O OE1 . GLU B 1 13  ? 38.597  49.656 23.059 1.00 32.42  ? 212 GLU B OE1 1 
ATOM   2231 O OE2 . GLU B 1 13  ? 39.844  48.991 21.359 1.00 29.95  ? 212 GLU B OE2 1 
ATOM   2232 N N   . ALA B 1 14  ? 35.525  45.388 25.221 1.00 7.98   ? 213 ALA B N   1 
ATOM   2233 C CA  . ALA B 1 14  ? 35.409  44.644 26.459 1.00 6.55   ? 213 ALA B CA  1 
ATOM   2234 C C   . ALA B 1 14  ? 34.773  43.293 26.132 1.00 6.55   ? 213 ALA B C   1 
ATOM   2235 O O   . ALA B 1 14  ? 35.010  42.297 26.807 1.00 7.25   ? 213 ALA B O   1 
ATOM   2236 C CB  . ALA B 1 14  ? 34.546  45.405 27.439 1.00 6.55   ? 213 ALA B CB  1 
ATOM   2237 N N   . TYR B 1 15  ? 33.969  43.273 25.077 1.00 6.55   ? 214 TYR B N   1 
ATOM   2238 C CA  . TYR B 1 15  ? 33.281  42.071 24.638 1.00 6.55   ? 214 TYR B CA  1 
ATOM   2239 C C   . TYR B 1 15  ? 34.213  41.160 23.882 1.00 6.81   ? 214 TYR B C   1 
ATOM   2240 O O   . TYR B 1 15  ? 34.165  39.944 24.025 1.00 7.38   ? 214 TYR B O   1 
ATOM   2241 C CB  . TYR B 1 15  ? 32.126  42.460 23.734 1.00 6.55   ? 214 TYR B CB  1 
ATOM   2242 C CG  . TYR B 1 15  ? 31.480  41.316 22.995 1.00 6.55   ? 214 TYR B CG  1 
ATOM   2243 C CD1 . TYR B 1 15  ? 32.109  40.702 21.914 1.00 6.55   ? 214 TYR B CD1 1 
ATOM   2244 C CD2 . TYR B 1 15  ? 30.219  40.864 23.362 1.00 6.55   ? 214 TYR B CD2 1 
ATOM   2245 C CE1 . TYR B 1 15  ? 31.491  39.670 21.223 1.00 6.55   ? 214 TYR B CE1 1 
ATOM   2246 C CE2 . TYR B 1 15  ? 29.597  39.833 22.677 1.00 6.55   ? 214 TYR B CE2 1 
ATOM   2247 C CZ  . TYR B 1 15  ? 30.235  39.243 21.615 1.00 6.55   ? 214 TYR B CZ  1 
ATOM   2248 O OH  . TYR B 1 15  ? 29.613  38.218 20.958 1.00 6.55   ? 214 TYR B OH  1 
ATOM   2249 N N   . LEU B 1 16  ? 35.040  41.763 23.041 1.00 8.48   ? 215 LEU B N   1 
ATOM   2250 C CA  . LEU B 1 16  ? 36.000  41.025 22.237 1.00 9.07   ? 215 LEU B CA  1 
ATOM   2251 C C   . LEU B 1 16  ? 37.096  40.473 23.126 1.00 9.20   ? 215 LEU B C   1 
ATOM   2252 O O   . LEU B 1 16  ? 37.628  39.394 22.889 1.00 9.15   ? 215 LEU B O   1 
ATOM   2253 C CB  . LEU B 1 16  ? 36.609  41.952 21.179 1.00 6.98   ? 215 LEU B CB  1 
ATOM   2254 C CG  . LEU B 1 16  ? 36.306  41.660 19.705 1.00 7.16   ? 215 LEU B CG  1 
ATOM   2255 C CD1 . LEU B 1 16  ? 34.974  40.944 19.538 1.00 7.38   ? 215 LEU B CD1 1 
ATOM   2256 C CD2 . LEU B 1 16  ? 36.316  42.965 18.951 1.00 7.73   ? 215 LEU B CD2 1 
ATOM   2257 N N   . LYS B 1 17  ? 37.419  41.211 24.170 1.00 9.39   ? 216 LYS B N   1 
ATOM   2258 C CA  . LYS B 1 17  ? 38.476  40.783 25.049 1.00 11.21  ? 216 LYS B CA  1 
ATOM   2259 C C   . LYS B 1 17  ? 38.116  39.599 25.931 1.00 12.52  ? 216 LYS B C   1 
ATOM   2260 O O   . LYS B 1 17  ? 38.879  38.636 25.997 1.00 14.10  ? 216 LYS B O   1 
ATOM   2261 C CB  . LYS B 1 17  ? 38.933  41.958 25.906 1.00 11.58  ? 216 LYS B CB  1 
ATOM   2262 C CG  . LYS B 1 17  ? 40.435  42.010 26.105 1.00 14.18  ? 216 LYS B CG  1 
ATOM   2263 C CD  . LYS B 1 17  ? 40.840  41.441 27.448 1.00 15.87  ? 216 LYS B CD  1 
ATOM   2264 C CE  . LYS B 1 17  ? 40.562  42.431 28.568 1.00 19.29  ? 216 LYS B CE  1 
ATOM   2265 N NZ  . LYS B 1 17  ? 40.615  41.764 29.914 1.00 22.97  ? 216 LYS B NZ  1 
ATOM   2266 N N   . ASN B 1 18  ? 36.948  39.650 26.575 1.00 12.41  ? 217 ASN B N   1 
ATOM   2267 C CA  . ASN B 1 18  ? 36.527  38.601 27.514 1.00 11.32  ? 217 ASN B CA  1 
ATOM   2268 C C   . ASN B 1 18  ? 35.770  37.345 27.069 1.00 12.66  ? 217 ASN B C   1 
ATOM   2269 O O   . ASN B 1 18  ? 35.674  36.391 27.841 1.00 14.40  ? 217 ASN B O   1 
ATOM   2270 C CB  . ASN B 1 18  ? 35.749  39.233 28.671 1.00 8.51   ? 217 ASN B CB  1 
ATOM   2271 C CG  . ASN B 1 18  ? 36.619  40.106 29.551 1.00 7.90   ? 217 ASN B CG  1 
ATOM   2272 O OD1 . ASN B 1 18  ? 36.554  41.329 29.485 1.00 6.77   ? 217 ASN B OD1 1 
ATOM   2273 N ND2 . ASN B 1 18  ? 37.447  39.478 30.378 1.00 8.53   ? 217 ASN B ND2 1 
ATOM   2274 N N   . PHE B 1 19  ? 35.218  37.319 25.863 1.00 12.69  ? 218 PHE B N   1 
ATOM   2275 C CA  . PHE B 1 19  ? 34.505  36.127 25.420 1.00 12.74  ? 218 PHE B CA  1 
ATOM   2276 C C   . PHE B 1 19  ? 35.395  35.361 24.474 1.00 14.29  ? 218 PHE B C   1 
ATOM   2277 O O   . PHE B 1 19  ? 35.836  35.902 23.469 1.00 15.43  ? 218 PHE B O   1 
ATOM   2278 C CB  . PHE B 1 19  ? 33.214  36.505 24.706 1.00 13.26  ? 218 PHE B CB  1 
ATOM   2279 C CG  . PHE B 1 19  ? 32.159  37.057 25.617 1.00 13.48  ? 218 PHE B CG  1 
ATOM   2280 C CD1 . PHE B 1 19  ? 31.598  36.263 26.615 1.00 12.95  ? 218 PHE B CD1 1 
ATOM   2281 C CD2 . PHE B 1 19  ? 31.730  38.371 25.485 1.00 12.20  ? 218 PHE B CD2 1 
ATOM   2282 C CE1 . PHE B 1 19  ? 30.625  36.770 27.470 1.00 12.44  ? 218 PHE B CE1 1 
ATOM   2283 C CE2 . PHE B 1 19  ? 30.763  38.882 26.336 1.00 13.69  ? 218 PHE B CE2 1 
ATOM   2284 C CZ  . PHE B 1 19  ? 30.208  38.077 27.333 1.00 12.51  ? 218 PHE B CZ  1 
ATOM   2285 N N   . ASN B 1 20  ? 35.652  34.097 24.788 1.00 16.39  ? 219 ASN B N   1 
ATOM   2286 C CA  . ASN B 1 20  ? 36.512  33.266 23.955 1.00 17.24  ? 219 ASN B CA  1 
ATOM   2287 C C   . ASN B 1 20  ? 35.872  32.755 22.665 1.00 15.62  ? 219 ASN B C   1 
ATOM   2288 O O   . ASN B 1 20  ? 36.567  32.336 21.750 1.00 15.23  ? 219 ASN B O   1 
ATOM   2289 C CB  . ASN B 1 20  ? 37.037  32.085 24.768 1.00 21.73  ? 219 ASN B CB  1 
ATOM   2290 C CG  . ASN B 1 20  ? 37.861  31.131 23.933 1.00 25.14  ? 219 ASN B CG  1 
ATOM   2291 O OD1 . ASN B 1 20  ? 37.326  30.203 23.323 1.00 27.29  ? 219 ASN B OD1 1 
ATOM   2292 N ND2 . ASN B 1 20  ? 39.172  31.365 23.883 1.00 26.66  ? 219 ASN B ND2 1 
ATOM   2293 N N   . MET B 1 21  ? 34.553  32.783 22.587 1.00 14.59  ? 220 MET B N   1 
ATOM   2294 C CA  . MET B 1 21  ? 33.880  32.335 21.385 1.00 13.75  ? 220 MET B CA  1 
ATOM   2295 C C   . MET B 1 21  ? 32.985  33.455 20.876 1.00 13.28  ? 220 MET B C   1 
ATOM   2296 O O   . MET B 1 21  ? 31.882  33.630 21.377 1.00 14.11  ? 220 MET B O   1 
ATOM   2297 C CB  . MET B 1 21  ? 33.028  31.115 21.701 1.00 15.28  ? 220 MET B CB  1 
ATOM   2298 C CG  . MET B 1 21  ? 33.366  29.875 20.897 1.00 17.15  ? 220 MET B CG  1 
ATOM   2299 S SD  . MET B 1 21  ? 33.278  30.146 19.120 1.00 18.90  ? 220 MET B SD  1 
ATOM   2300 C CE  . MET B 1 21  ? 35.021  30.045 18.718 1.00 22.27  ? 220 MET B CE  1 
ATOM   2301 N N   . ASN B 1 22  ? 33.447  34.236 19.908 1.00 11.76  ? 221 ASN B N   1 
ATOM   2302 C CA  . ASN B 1 22  ? 32.593  35.298 19.394 1.00 11.01  ? 221 ASN B CA  1 
ATOM   2303 C C   . ASN B 1 22  ? 31.788  34.724 18.251 1.00 9.93   ? 221 ASN B C   1 
ATOM   2304 O O   . ASN B 1 22  ? 31.858  33.527 18.002 1.00 9.15   ? 221 ASN B O   1 
ATOM   2305 C CB  . ASN B 1 22  ? 33.406  36.507 18.932 1.00 12.50  ? 221 ASN B CB  1 
ATOM   2306 C CG  . ASN B 1 22  ? 34.614  36.124 18.137 1.00 14.20  ? 221 ASN B CG  1 
ATOM   2307 O OD1 . ASN B 1 22  ? 34.515  35.363 17.179 1.00 16.44  ? 221 ASN B OD1 1 
ATOM   2308 N ND2 . ASN B 1 22  ? 35.775  36.657 18.520 1.00 14.71  ? 221 ASN B ND2 1 
ATOM   2309 N N   . LYS B 1 23  ? 31.017  35.561 17.564 1.00 9.06   ? 222 LYS B N   1 
ATOM   2310 C CA  . LYS B 1 23  ? 30.187  35.085 16.464 1.00 8.86   ? 222 LYS B CA  1 
ATOM   2311 C C   . LYS B 1 23  ? 30.966  35.008 15.182 1.00 9.86   ? 222 LYS B C   1 
ATOM   2312 O O   . LYS B 1 23  ? 30.611  34.255 14.286 1.00 11.25  ? 222 LYS B O   1 
ATOM   2313 C CB  . LYS B 1 23  ? 28.982  35.993 16.258 1.00 8.35   ? 222 LYS B CB  1 
ATOM   2314 C CG  . LYS B 1 23  ? 28.015  35.523 15.185 1.00 7.18   ? 222 LYS B CG  1 
ATOM   2315 C CD  . LYS B 1 23  ? 26.807  36.444 15.148 1.00 7.95   ? 222 LYS B CD  1 
ATOM   2316 C CE  . LYS B 1 23  ? 25.601  35.786 14.504 1.00 8.83   ? 222 LYS B CE  1 
ATOM   2317 N NZ  . LYS B 1 23  ? 24.362  36.595 14.682 1.00 6.55   ? 222 LYS B NZ  1 
ATOM   2318 N N   . VAL B 1 24  ? 32.018  35.804 15.074 1.00 10.53  ? 223 VAL B N   1 
ATOM   2319 C CA  . VAL B 1 24  ? 32.825  35.753 13.875 1.00 10.65  ? 223 VAL B CA  1 
ATOM   2320 C C   . VAL B 1 24  ? 33.439  34.361 13.875 1.00 10.73  ? 223 VAL B C   1 
ATOM   2321 O O   . VAL B 1 24  ? 33.189  33.582 12.973 1.00 10.46  ? 223 VAL B O   1 
ATOM   2322 C CB  . VAL B 1 24  ? 33.911  36.854 13.880 1.00 10.77  ? 223 VAL B CB  1 
ATOM   2323 C CG1 . VAL B 1 24  ? 35.006  36.530 12.892 1.00 10.38  ? 223 VAL B CG1 1 
ATOM   2324 C CG2 . VAL B 1 24  ? 33.280  38.190 13.516 1.00 11.37  ? 223 VAL B CG2 1 
ATOM   2325 N N   . LYS B 1 25  ? 34.200  34.034 14.911 1.00 12.20  ? 224 LYS B N   1 
ATOM   2326 C CA  . LYS B 1 25  ? 34.834  32.725 15.005 1.00 16.07  ? 224 LYS B CA  1 
ATOM   2327 C C   . LYS B 1 25  ? 33.876  31.557 14.802 1.00 18.00  ? 224 LYS B C   1 
ATOM   2328 O O   . LYS B 1 25  ? 34.188  30.621 14.076 1.00 19.00  ? 224 LYS B O   1 
ATOM   2329 C CB  . LYS B 1 25  ? 35.509  32.537 16.368 1.00 17.56  ? 224 LYS B CB  1 
ATOM   2330 C CG  . LYS B 1 25  ? 36.662  33.475 16.684 1.00 20.88  ? 224 LYS B CG  1 
ATOM   2331 C CD  . LYS B 1 25  ? 37.189  33.199 18.088 1.00 22.01  ? 224 LYS B CD  1 
ATOM   2332 C CE  . LYS B 1 25  ? 38.158  34.275 18.559 1.00 23.89  ? 224 LYS B CE  1 
ATOM   2333 N NZ  . LYS B 1 25  ? 38.522  34.129 20.009 1.00 25.37  ? 224 LYS B NZ  1 
ATOM   2334 N N   . ALA B 1 26  ? 32.719  31.604 15.455 1.00 20.86  ? 225 ALA B N   1 
ATOM   2335 C CA  . ALA B 1 26  ? 31.735  30.520 15.376 1.00 22.51  ? 225 ALA B CA  1 
ATOM   2336 C C   . ALA B 1 26  ? 31.155  30.280 13.991 1.00 23.56  ? 225 ALA B C   1 
ATOM   2337 O O   . ALA B 1 26  ? 30.901  29.142 13.617 1.00 22.68  ? 225 ALA B O   1 
ATOM   2338 C CB  . ALA B 1 26  ? 30.604  30.767 16.374 1.00 21.93  ? 225 ALA B CB  1 
ATOM   2339 N N   . ARG B 1 27  ? 30.939  31.356 13.242 1.00 26.66  ? 226 ARG B N   1 
ATOM   2340 C CA  . ARG B 1 27  ? 30.382  31.281 11.891 1.00 30.32  ? 226 ARG B CA  1 
ATOM   2341 C C   . ARG B 1 27  ? 31.384  30.782 10.853 1.00 31.65  ? 226 ARG B C   1 
ATOM   2342 O O   . ARG B 1 27  ? 31.029  30.506 9.710  1.00 32.40  ? 226 ARG B O   1 
ATOM   2343 C CB  . ARG B 1 27  ? 29.864  32.660 11.475 1.00 32.19  ? 226 ARG B CB  1 
ATOM   2344 C CG  . ARG B 1 27  ? 28.440  32.935 11.923 1.00 36.35  ? 226 ARG B CG  1 
ATOM   2345 C CD  . ARG B 1 27  ? 27.466  32.233 10.992 1.00 40.05  ? 226 ARG B CD  1 
ATOM   2346 N NE  . ARG B 1 27  ? 26.078  32.257 11.455 1.00 43.97  ? 226 ARG B NE  1 
ATOM   2347 C CZ  . ARG B 1 27  ? 25.599  31.510 12.449 1.00 46.06  ? 226 ARG B CZ  1 
ATOM   2348 N NH1 . ARG B 1 27  ? 26.395  30.675 13.104 1.00 46.42  ? 226 ARG B NH1 1 
ATOM   2349 N NH2 . ARG B 1 27  ? 24.312  31.577 12.770 1.00 47.08  ? 226 ARG B NH2 1 
ATOM   2350 N N   . VAL B 1 28  ? 32.639  30.668 11.265 1.00 33.53  ? 227 VAL B N   1 
ATOM   2351 C CA  . VAL B 1 28  ? 33.718  30.225 10.393 1.00 33.68  ? 227 VAL B CA  1 
ATOM   2352 C C   . VAL B 1 28  ? 34.056  28.769 10.662 1.00 33.70  ? 227 VAL B C   1 
ATOM   2353 O O   . VAL B 1 28  ? 34.755  28.122 9.889  1.00 34.44  ? 227 VAL B O   1 
ATOM   2354 C CB  . VAL B 1 28  ? 34.966  31.123 10.602 1.00 34.01  ? 227 VAL B CB  1 
ATOM   2355 C CG1 . VAL B 1 28  ? 36.250  30.338 10.403 1.00 34.31  ? 227 VAL B CG1 1 
ATOM   2356 C CG2 . VAL B 1 28  ? 34.909  32.293 9.634  1.00 35.71  ? 227 VAL B CG2 1 
ATOM   2357 N N   . ILE B 1 29  ? 33.553  28.253 11.770 1.00 33.81  ? 228 ILE B N   1 
ATOM   2358 C CA  . ILE B 1 29  ? 33.796  26.873 12.113 1.00 34.13  ? 228 ILE B CA  1 
ATOM   2359 C C   . ILE B 1 29  ? 32.646  26.067 11.534 1.00 36.39  ? 228 ILE B C   1 
ATOM   2360 O O   . ILE B 1 29  ? 32.847  25.009 10.948 1.00 37.80  ? 228 ILE B O   1 
ATOM   2361 C CB  . ILE B 1 29  ? 33.846  26.684 13.648 1.00 31.91  ? 228 ILE B CB  1 
ATOM   2362 C CG1 . ILE B 1 29  ? 35.089  27.369 14.216 1.00 31.51  ? 228 ILE B CG1 1 
ATOM   2363 C CG2 . ILE B 1 29  ? 33.840  25.210 13.998 1.00 30.46  ? 228 ILE B CG2 1 
ATOM   2364 C CD1 . ILE B 1 29  ? 35.235  27.233 15.718 1.00 32.76  ? 228 ILE B CD1 1 
ATOM   2365 N N   . LEU B 1 30  ? 31.445  26.612 11.670 1.00 38.97  ? 229 LEU B N   1 
ATOM   2366 C CA  . LEU B 1 30  ? 30.217  25.961 11.234 1.00 42.78  ? 229 LEU B CA  1 
ATOM   2367 C C   . LEU B 1 30  ? 30.029  25.727 9.753  1.00 47.77  ? 229 LEU B C   1 
ATOM   2368 O O   . LEU B 1 30  ? 30.076  24.593 9.278  1.00 50.28  ? 229 LEU B O   1 
ATOM   2369 C CB  . LEU B 1 30  ? 29.013  26.746 11.734 1.00 39.04  ? 229 LEU B CB  1 
ATOM   2370 C CG  . LEU B 1 30  ? 28.792  26.875 13.232 1.00 36.07  ? 229 LEU B CG  1 
ATOM   2371 C CD1 . LEU B 1 30  ? 27.737  27.920 13.429 1.00 35.90  ? 229 LEU B CD1 1 
ATOM   2372 C CD2 . LEU B 1 30  ? 28.369  25.561 13.852 1.00 34.02  ? 229 LEU B CD2 1 
ATOM   2373 N N   . SER B 1 31  ? 29.737  26.802 9.038  1.00 52.37  ? 230 SER B N   1 
ATOM   2374 C CA  . SER B 1 31  ? 29.528  26.728 7.604  1.00 57.00  ? 230 SER B CA  1 
ATOM   2375 C C   . SER B 1 31  ? 30.757  27.390 7.049  1.00 59.25  ? 230 SER B C   1 
ATOM   2376 O O   . SER B 1 31  ? 31.255  27.015 6.002  1.00 60.51  ? 230 SER B O   1 
ATOM   2377 C CB  . SER B 1 31  ? 28.267  27.506 7.189  1.00 58.05  ? 230 SER B CB  1 
ATOM   2378 O OG  . SER B 1 31  ? 28.086  27.515 5.777  1.00 59.31  ? 230 SER B OG  1 
ATOM   2379 N N   . GLY B 1 32  ? 31.251  28.389 7.767  1.00 61.30  ? 231 GLY B N   1 
ATOM   2380 C CA  . GLY B 1 32  ? 32.438  29.068 7.305  1.00 63.07  ? 231 GLY B CA  1 
ATOM   2381 C C   . GLY B 1 32  ? 33.427  28.025 6.823  1.00 64.15  ? 231 GLY B C   1 
ATOM   2382 O O   . GLY B 1 32  ? 34.008  28.170 5.743  1.00 65.05  ? 231 GLY B O   1 
ATOM   2383 N N   . LYS B 1 33  ? 33.570  26.951 7.607  1.00 64.25  ? 232 LYS B N   1 
ATOM   2384 C CA  . LYS B 1 33  ? 34.507  25.854 7.331  1.00 64.09  ? 232 LYS B CA  1 
ATOM   2385 C C   . LYS B 1 33  ? 35.662  26.169 6.353  1.00 63.87  ? 232 LYS B C   1 
ATOM   2386 O O   . LYS B 1 33  ? 35.756  25.605 5.257  1.00 63.87  ? 232 LYS B O   1 
ATOM   2387 C CB  . LYS B 1 33  ? 33.749  24.567 6.911  1.00 63.69  ? 232 LYS B CB  1 
ATOM   2388 C CG  . LYS B 1 33  ? 32.391  24.743 6.240  1.00 63.46  ? 232 LYS B CG  1 
ATOM   2389 C CD  . LYS B 1 33  ? 32.483  24.838 4.719  1.00 64.61  ? 232 LYS B CD  1 
ATOM   2390 C CE  . LYS B 1 33  ? 31.187  25.322 4.067  1.00 64.16  ? 232 LYS B CE  1 
ATOM   2391 N NZ  . LYS B 1 33  ? 29.963  24.568 4.468  1.00 63.68  ? 232 LYS B NZ  1 
ATOM   2392 N N   . ALA B 1 34  ? 36.545  27.073 6.787  1.00 62.83  ? 233 ALA B N   1 
ATOM   2393 C CA  . ALA B 1 34  ? 37.716  27.503 6.018  1.00 61.03  ? 233 ALA B CA  1 
ATOM   2394 C C   . ALA B 1 34  ? 38.975  26.829 6.569  1.00 60.00  ? 233 ALA B C   1 
ATOM   2395 O O   . ALA B 1 34  ? 39.962  27.488 6.911  1.00 58.82  ? 233 ALA B O   1 
ATOM   2396 C CB  . ALA B 1 34  ? 37.859  29.019 6.094  1.00 61.37  ? 233 ALA B CB  1 
ATOM   2397 N N   . SER B 1 35  ? 38.911  25.503 6.642  1.00 59.30  ? 234 SER B N   1 
ATOM   2398 C CA  . SER B 1 35  ? 39.983  24.645 7.145  1.00 58.48  ? 234 SER B CA  1 
ATOM   2399 C C   . SER B 1 35  ? 39.348  23.283 7.363  1.00 57.85  ? 234 SER B C   1 
ATOM   2400 O O   . SER B 1 35  ? 38.256  23.195 7.931  1.00 57.87  ? 234 SER B O   1 
ATOM   2401 C CB  . SER B 1 35  ? 40.523  25.155 8.485  1.00 58.42  ? 234 SER B CB  1 
ATOM   2402 O OG  . SER B 1 35  ? 40.961  24.077 9.302  1.00 57.01  ? 234 SER B OG  1 
ATOM   2403 N N   . ASN B 1 36  ? 40.008  22.222 6.908  1.00 56.64  ? 235 ASN B N   1 
ATOM   2404 C CA  . ASN B 1 36  ? 39.446  20.894 7.102  1.00 55.14  ? 235 ASN B CA  1 
ATOM   2405 C C   . ASN B 1 36  ? 39.667  20.485 8.561  1.00 52.91  ? 235 ASN B C   1 
ATOM   2406 O O   . ASN B 1 36  ? 40.261  21.242 9.343  1.00 53.20  ? 235 ASN B O   1 
ATOM   2407 C CB  . ASN B 1 36  ? 40.089  19.881 6.154  1.00 56.53  ? 235 ASN B CB  1 
ATOM   2408 C CG  . ASN B 1 36  ? 39.263  18.610 6.017  1.00 57.77  ? 235 ASN B CG  1 
ATOM   2409 O OD1 . ASN B 1 36  ? 39.032  17.889 6.989  1.00 56.37  ? 235 ASN B OD1 1 
ATOM   2410 N ND2 . ASN B 1 36  ? 38.809  18.334 4.800  1.00 59.65  ? 235 ASN B ND2 1 
ATOM   2411 N N   . ASN B 1 37  ? 39.196  19.294 8.925  1.00 48.46  ? 236 ASN B N   1 
ATOM   2412 C CA  . ASN B 1 37  ? 39.317  18.827 10.298 1.00 43.17  ? 236 ASN B CA  1 
ATOM   2413 C C   . ASN B 1 37  ? 38.305  19.661 11.063 1.00 40.01  ? 236 ASN B C   1 
ATOM   2414 O O   . ASN B 1 37  ? 38.665  20.504 11.876 1.00 40.22  ? 236 ASN B O   1 
ATOM   2415 C CB  . ASN B 1 37  ? 40.738  19.073 10.809 1.00 40.81  ? 236 ASN B CB  1 
ATOM   2416 C CG  . ASN B 1 37  ? 40.829  19.063 12.304 1.00 39.48  ? 236 ASN B CG  1 
ATOM   2417 O OD1 . ASN B 1 37  ? 39.917  18.607 12.995 1.00 38.81  ? 236 ASN B OD1 1 
ATOM   2418 N ND2 . ASN B 1 37  ? 41.940  19.561 12.823 1.00 39.78  ? 236 ASN B ND2 1 
ATOM   2419 N N   . PRO B 1 38  ? 37.012  19.448 10.785 1.00 37.31  ? 237 PRO B N   1 
ATOM   2420 C CA  . PRO B 1 38  ? 35.957  20.197 11.454 1.00 37.08  ? 237 PRO B CA  1 
ATOM   2421 C C   . PRO B 1 38  ? 35.716  19.675 12.859 1.00 36.22  ? 237 PRO B C   1 
ATOM   2422 O O   . PRO B 1 38  ? 36.318  18.679 13.272 1.00 36.61  ? 237 PRO B O   1 
ATOM   2423 C CB  . PRO B 1 38  ? 34.765  19.973 10.535 1.00 37.02  ? 237 PRO B CB  1 
ATOM   2424 C CG  . PRO B 1 38  ? 34.950  18.563 10.145 1.00 36.81  ? 237 PRO B CG  1 
ATOM   2425 C CD  . PRO B 1 38  ? 36.431  18.503 9.817  1.00 37.07  ? 237 PRO B CD  1 
ATOM   2426 N N   . PRO B 1 39  ? 34.826  20.342 13.613 1.00 34.87  ? 238 PRO B N   1 
ATOM   2427 C CA  . PRO B 1 39  ? 34.530  19.909 14.977 1.00 33.29  ? 238 PRO B CA  1 
ATOM   2428 C C   . PRO B 1 39  ? 34.052  18.466 15.030 1.00 30.82  ? 238 PRO B C   1 
ATOM   2429 O O   . PRO B 1 39  ? 33.347  17.998 14.138 1.00 30.48  ? 238 PRO B O   1 
ATOM   2430 C CB  . PRO B 1 39  ? 33.451  20.893 15.424 1.00 34.02  ? 238 PRO B CB  1 
ATOM   2431 C CG  . PRO B 1 39  ? 32.751  21.225 14.136 1.00 34.91  ? 238 PRO B CG  1 
ATOM   2432 C CD  . PRO B 1 39  ? 33.921  21.435 13.211 1.00 34.97  ? 238 PRO B CD  1 
ATOM   2433 N N   . PHE B 1 40  ? 34.455  17.775 16.087 1.00 28.65  ? 239 PHE B N   1 
ATOM   2434 C CA  . PHE B 1 40  ? 34.092  16.387 16.313 1.00 27.19  ? 239 PHE B CA  1 
ATOM   2435 C C   . PHE B 1 40  ? 32.604  16.280 16.659 1.00 26.73  ? 239 PHE B C   1 
ATOM   2436 O O   . PHE B 1 40  ? 32.195  16.635 17.758 1.00 27.71  ? 239 PHE B O   1 
ATOM   2437 C CB  . PHE B 1 40  ? 34.943  15.843 17.452 1.00 25.48  ? 239 PHE B CB  1 
ATOM   2438 C CG  . PHE B 1 40  ? 34.514  14.507 17.930 1.00 26.29  ? 239 PHE B CG  1 
ATOM   2439 C CD1 . PHE B 1 40  ? 34.640  13.390 17.117 1.00 27.47  ? 239 PHE B CD1 1 
ATOM   2440 C CD2 . PHE B 1 40  ? 33.969  14.362 19.195 1.00 26.85  ? 239 PHE B CD2 1 
ATOM   2441 C CE1 . PHE B 1 40  ? 34.229  12.142 17.564 1.00 28.29  ? 239 PHE B CE1 1 
ATOM   2442 C CE2 . PHE B 1 40  ? 33.553  13.123 19.654 1.00 27.35  ? 239 PHE B CE2 1 
ATOM   2443 C CZ  . PHE B 1 40  ? 33.683  12.009 18.840 1.00 28.09  ? 239 PHE B CZ  1 
ATOM   2444 N N   . VAL B 1 41  ? 31.805  15.774 15.723 1.00 26.03  ? 240 VAL B N   1 
ATOM   2445 C CA  . VAL B 1 41  ? 30.356  15.642 15.896 1.00 25.26  ? 240 VAL B CA  1 
ATOM   2446 C C   . VAL B 1 41  ? 29.839  14.670 16.964 1.00 28.03  ? 240 VAL B C   1 
ATOM   2447 O O   . VAL B 1 41  ? 30.398  13.597 17.165 1.00 30.54  ? 240 VAL B O   1 
ATOM   2448 C CB  . VAL B 1 41  ? 29.708  15.256 14.568 1.00 21.87  ? 240 VAL B CB  1 
ATOM   2449 C CG1 . VAL B 1 41  ? 28.217  15.068 14.748 1.00 20.59  ? 240 VAL B CG1 1 
ATOM   2450 C CG2 . VAL B 1 41  ? 29.999  16.321 13.543 1.00 19.73  ? 240 VAL B CG2 1 
ATOM   2451 N N   . ILE B 1 42  ? 28.758  15.066 17.636 1.00 29.34  ? 241 ILE B N   1 
ATOM   2452 C CA  . ILE B 1 42  ? 28.100  14.261 18.668 1.00 30.24  ? 241 ILE B CA  1 
ATOM   2453 C C   . ILE B 1 42  ? 26.654  14.105 18.203 1.00 33.04  ? 241 ILE B C   1 
ATOM   2454 O O   . ILE B 1 42  ? 25.957  15.100 18.009 1.00 33.22  ? 241 ILE B O   1 
ATOM   2455 C CB  . ILE B 1 42  ? 28.099  14.968 20.032 1.00 28.35  ? 241 ILE B CB  1 
ATOM   2456 C CG1 . ILE B 1 42  ? 29.524  15.090 20.562 1.00 27.85  ? 241 ILE B CG1 1 
ATOM   2457 C CG2 . ILE B 1 42  ? 27.245  14.197 21.012 1.00 28.67  ? 241 ILE B CG2 1 
ATOM   2458 C CD1 . ILE B 1 42  ? 29.621  15.893 21.847 1.00 26.18  ? 241 ILE B CD1 1 
ATOM   2459 N N   . HIS B 1 43  ? 26.205  12.863 18.032 1.00 36.15  ? 242 HIS B N   1 
ATOM   2460 C CA  . HIS B 1 43  ? 24.851  12.593 17.545 1.00 39.06  ? 242 HIS B CA  1 
ATOM   2461 C C   . HIS B 1 43  ? 24.202  11.342 18.134 1.00 40.40  ? 242 HIS B C   1 
ATOM   2462 O O   . HIS B 1 43  ? 23.090  10.973 17.749 1.00 40.53  ? 242 HIS B O   1 
ATOM   2463 C CB  . HIS B 1 43  ? 24.896  12.467 16.029 1.00 39.94  ? 242 HIS B CB  1 
ATOM   2464 C CG  . HIS B 1 43  ? 25.950  11.518 15.553 1.00 42.03  ? 242 HIS B CG  1 
ATOM   2465 N ND1 . HIS B 1 43  ? 25.666  10.239 15.129 1.00 42.60  ? 242 HIS B ND1 1 
ATOM   2466 C CD2 . HIS B 1 43  ? 27.298  11.640 15.504 1.00 42.69  ? 242 HIS B CD2 1 
ATOM   2467 C CE1 . HIS B 1 43  ? 26.792  9.612  14.841 1.00 42.39  ? 242 HIS B CE1 1 
ATOM   2468 N NE2 . HIS B 1 43  ? 27.798  10.440 15.061 1.00 42.85  ? 242 HIS B NE2 1 
ATOM   2469 N N   . ASP B 1 44  ? 24.897  10.675 19.048 1.00 42.21  ? 243 ASP B N   1 
ATOM   2470 C CA  . ASP B 1 44  ? 24.344  9.489  19.686 1.00 44.65  ? 243 ASP B CA  1 
ATOM   2471 C C   . ASP B 1 44  ? 25.107  9.154  20.956 1.00 44.66  ? 243 ASP B C   1 
ATOM   2472 O O   . ASP B 1 44  ? 26.280  9.492  21.095 1.00 43.45  ? 243 ASP B O   1 
ATOM   2473 C CB  . ASP B 1 44  ? 24.340  8.297  18.722 1.00 47.93  ? 243 ASP B CB  1 
ATOM   2474 C CG  . ASP B 1 44  ? 25.725  7.924  18.246 1.00 51.05  ? 243 ASP B CG  1 
ATOM   2475 O OD1 . ASP B 1 44  ? 26.594  7.655  19.101 1.00 52.29  ? 243 ASP B OD1 1 
ATOM   2476 O OD2 . ASP B 1 44  ? 25.941  7.892  17.015 1.00 52.97  ? 243 ASP B OD2 1 
ATOM   2477 N N   . MET B 1 45  ? 24.426  8.491  21.882 1.00 46.19  ? 244 MET B N   1 
ATOM   2478 C CA  . MET B 1 45  ? 25.018  8.140  23.161 1.00 48.32  ? 244 MET B CA  1 
ATOM   2479 C C   . MET B 1 45  ? 26.413  7.557  23.063 1.00 48.75  ? 244 MET B C   1 
ATOM   2480 O O   . MET B 1 45  ? 27.119  7.474  24.061 1.00 49.04  ? 244 MET B O   1 
ATOM   2481 C CB  . MET B 1 45  ? 24.106  7.182  23.926 1.00 50.36  ? 244 MET B CB  1 
ATOM   2482 C CG  . MET B 1 45  ? 23.450  7.790  25.163 1.00 53.60  ? 244 MET B CG  1 
ATOM   2483 S SD  . MET B 1 45  ? 22.215  9.068  24.836 1.00 57.96  ? 244 MET B SD  1 
ATOM   2484 C CE  . MET B 1 45  ? 22.422  10.154 26.246 1.00 57.51  ? 244 MET B CE  1 
ATOM   2485 N N   . GLU B 1 46  ? 26.814  7.154  21.866 1.00 49.94  ? 245 GLU B N   1 
ATOM   2486 C CA  . GLU B 1 46  ? 28.149  6.598  21.675 1.00 51.51  ? 245 GLU B CA  1 
ATOM   2487 C C   . GLU B 1 46  ? 29.143  7.741  21.518 1.00 50.98  ? 245 GLU B C   1 
ATOM   2488 O O   . GLU B 1 46  ? 30.111  7.847  22.271 1.00 50.40  ? 245 GLU B O   1 
ATOM   2489 C CB  . GLU B 1 46  ? 28.173  5.702  20.432 1.00 53.41  ? 245 GLU B CB  1 
ATOM   2490 C CG  . GLU B 1 46  ? 29.560  5.421  19.875 1.00 56.65  ? 245 GLU B CG  1 
ATOM   2491 C CD  . GLU B 1 46  ? 29.515  4.684  18.543 1.00 59.12  ? 245 GLU B CD  1 
ATOM   2492 O OE1 . GLU B 1 46  ? 29.846  3.477  18.513 1.00 61.17  ? 245 GLU B OE1 1 
ATOM   2493 O OE2 . GLU B 1 46  ? 29.140  5.312  17.525 1.00 58.79  ? 245 GLU B OE2 1 
ATOM   2494 N N   . THR B 1 47  ? 28.888  8.594  20.530 1.00 51.17  ? 246 THR B N   1 
ATOM   2495 C CA  . THR B 1 47  ? 29.736  9.745  20.244 1.00 50.19  ? 246 THR B CA  1 
ATOM   2496 C C   . THR B 1 47  ? 29.736  10.639 21.462 1.00 49.41  ? 246 THR B C   1 
ATOM   2497 O O   . THR B 1 47  ? 30.789  11.035 21.946 1.00 49.43  ? 246 THR B O   1 
ATOM   2498 C CB  . THR B 1 47  ? 29.202  10.545 19.049 1.00 50.48  ? 246 THR B CB  1 
ATOM   2499 O OG1 . THR B 1 47  ? 27.834  10.896 19.293 1.00 52.35  ? 246 THR B OG1 1 
ATOM   2500 C CG2 . THR B 1 47  ? 29.302  9.727  17.765 1.00 48.74  ? 246 THR B CG2 1 
ATOM   2501 N N   . LEU B 1 48  ? 28.545  10.957 21.954 1.00 49.00  ? 247 LEU B N   1 
ATOM   2502 C CA  . LEU B 1 48  ? 28.429  11.784 23.141 1.00 49.87  ? 247 LEU B CA  1 
ATOM   2503 C C   . LEU B 1 48  ? 29.275  11.132 24.227 1.00 50.61  ? 247 LEU B C   1 
ATOM   2504 O O   . LEU B 1 48  ? 29.640  11.766 25.214 1.00 48.32  ? 247 LEU B O   1 
ATOM   2505 C CB  . LEU B 1 48  ? 26.963  11.875 23.579 1.00 49.27  ? 247 LEU B CB  1 
ATOM   2506 C CG  . LEU B 1 48  ? 26.633  11.982 25.074 1.00 48.79  ? 247 LEU B CG  1 
ATOM   2507 C CD1 . LEU B 1 48  ? 27.346  13.152 25.724 1.00 49.08  ? 247 LEU B CD1 1 
ATOM   2508 C CD2 . LEU B 1 48  ? 25.134  12.128 25.220 1.00 48.45  ? 247 LEU B CD2 1 
ATOM   2509 N N   . CYS B 1 49  ? 29.600  9.858  24.026 1.00 53.48  ? 248 CYS B N   1 
ATOM   2510 C CA  . CYS B 1 49  ? 30.403  9.135  25.002 1.00 57.70  ? 248 CYS B CA  1 
ATOM   2511 C C   . CYS B 1 49  ? 31.910  9.105  24.722 1.00 59.51  ? 248 CYS B C   1 
ATOM   2512 O O   . CYS B 1 49  ? 32.695  8.710  25.588 1.00 60.70  ? 248 CYS B O   1 
ATOM   2513 C CB  . CYS B 1 49  ? 29.867  7.711  25.195 1.00 58.17  ? 248 CYS B CB  1 
ATOM   2514 S SG  . CYS B 1 49  ? 29.164  7.423  26.865 1.00 58.73  ? 248 CYS B SG  1 
ATOM   2515 N N   . MET B 1 50  ? 32.324  9.510  23.526 1.00 60.41  ? 249 MET B N   1 
ATOM   2516 C CA  . MET B 1 50  ? 33.750  9.568  23.227 1.00 60.31  ? 249 MET B CA  1 
ATOM   2517 C C   . MET B 1 50  ? 34.154  10.959 23.683 1.00 60.91  ? 249 MET B C   1 
ATOM   2518 O O   . MET B 1 50  ? 35.252  11.176 24.189 1.00 60.15  ? 249 MET B O   1 
ATOM   2519 C CB  . MET B 1 50  ? 34.002  9.424  21.731 1.00 59.77  ? 249 MET B CB  1 
ATOM   2520 C CG  . MET B 1 50  ? 33.942  7.997  21.232 1.00 58.89  ? 249 MET B CG  1 
ATOM   2521 S SD  . MET B 1 50  ? 33.594  7.971  19.468 1.00 59.60  ? 249 MET B SD  1 
ATOM   2522 C CE  . MET B 1 50  ? 35.191  7.526  18.787 1.00 60.73  ? 249 MET B CE  1 
ATOM   2523 N N   . ALA B 1 51  ? 33.227  11.894 23.507 1.00 62.19  ? 250 ALA B N   1 
ATOM   2524 C CA  . ALA B 1 51  ? 33.431  13.279 23.890 1.00 64.26  ? 250 ALA B CA  1 
ATOM   2525 C C   . ALA B 1 51  ? 33.699  13.389 25.387 1.00 65.81  ? 250 ALA B C   1 
ATOM   2526 O O   . ALA B 1 51  ? 34.854  13.391 25.811 1.00 66.27  ? 250 ALA B O   1 
ATOM   2527 C CB  . ALA B 1 51  ? 32.211  14.104 23.514 1.00 64.38  ? 250 ALA B CB  1 
ATOM   2528 N N   . GLU B 1 52  ? 32.635  13.477 26.183 1.00 67.55  ? 251 GLU B N   1 
ATOM   2529 C CA  . GLU B 1 52  ? 32.768  13.591 27.636 1.00 69.13  ? 251 GLU B CA  1 
ATOM   2530 C C   . GLU B 1 52  ? 33.854  12.668 28.186 1.00 70.11  ? 251 GLU B C   1 
ATOM   2531 O O   . GLU B 1 52  ? 34.447  12.937 29.231 1.00 69.87  ? 251 GLU B O   1 
ATOM   2532 C CB  . GLU B 1 52  ? 31.427  13.294 28.339 1.00 69.22  ? 251 GLU B CB  1 
ATOM   2533 C CG  . GLU B 1 52  ? 30.671  12.060 27.862 1.00 70.38  ? 251 GLU B CG  1 
ATOM   2534 C CD  . GLU B 1 52  ? 31.579  10.967 27.333 1.00 71.41  ? 251 GLU B CD  1 
ATOM   2535 O OE1 . GLU B 1 52  ? 32.135  11.154 26.231 1.00 71.18  ? 251 GLU B OE1 1 
ATOM   2536 O OE2 . GLU B 1 52  ? 31.747  9.930  28.013 1.00 72.57  ? 251 GLU B OE2 1 
ATOM   2537 N N   . LYS B 1 53  ? 34.112  11.586 27.464 1.00 71.43  ? 252 LYS B N   1 
ATOM   2538 C CA  . LYS B 1 53  ? 35.112  10.614 27.858 1.00 73.36  ? 252 LYS B CA  1 
ATOM   2539 C C   . LYS B 1 53  ? 36.430  11.334 28.084 1.00 73.97  ? 252 LYS B C   1 
ATOM   2540 O O   . LYS B 1 53  ? 37.000  11.270 29.171 1.00 74.33  ? 252 LYS B O   1 
ATOM   2541 C CB  . LYS B 1 53  ? 35.268  9.563  26.757 1.00 75.25  ? 252 LYS B CB  1 
ATOM   2542 C CG  . LYS B 1 53  ? 36.088  8.340  27.138 1.00 77.70  ? 252 LYS B CG  1 
ATOM   2543 C CD  . LYS B 1 53  ? 36.185  7.370  25.966 1.00 79.15  ? 252 LYS B CD  1 
ATOM   2544 C CE  . LYS B 1 53  ? 36.942  6.102  26.337 1.00 79.37  ? 252 LYS B CE  1 
ATOM   2545 N NZ  . LYS B 1 53  ? 36.249  5.323  27.405 1.00 79.25  ? 252 LYS B NZ  1 
ATOM   2546 N N   . THR B 1 54  ? 36.894  12.037 27.055 1.00 74.59  ? 253 THR B N   1 
ATOM   2547 C CA  . THR B 1 54  ? 38.155  12.767 27.122 1.00 74.97  ? 253 THR B CA  1 
ATOM   2548 C C   . THR B 1 54  ? 37.995  14.165 27.685 1.00 76.05  ? 253 THR B C   1 
ATOM   2549 O O   . THR B 1 54  ? 38.912  14.689 28.316 1.00 76.24  ? 253 THR B O   1 
ATOM   2550 C CB  . THR B 1 54  ? 38.789  12.911 25.738 1.00 73.92  ? 253 THR B CB  1 
ATOM   2551 O OG1 . THR B 1 54  ? 37.938  13.711 24.910 1.00 71.95  ? 253 THR B OG1 1 
ATOM   2552 C CG2 . THR B 1 54  ? 38.981  11.551 25.098 1.00 74.26  ? 253 THR B CG2 1 
ATOM   2553 N N   . LEU B 1 55  ? 36.836  14.769 27.448 1.00 77.50  ? 254 LEU B N   1 
ATOM   2554 C CA  . LEU B 1 55  ? 36.581  16.120 27.924 1.00 79.88  ? 254 LEU B CA  1 
ATOM   2555 C C   . LEU B 1 55  ? 37.105  16.292 29.335 1.00 82.96  ? 254 LEU B C   1 
ATOM   2556 O O   . LEU B 1 55  ? 37.819  17.250 29.628 1.00 83.72  ? 254 LEU B O   1 
ATOM   2557 C CB  . LEU B 1 55  ? 35.092  16.424 27.881 1.00 77.93  ? 254 LEU B CB  1 
ATOM   2558 C CG  . LEU B 1 55  ? 34.768  17.907 28.012 1.00 76.89  ? 254 LEU B CG  1 
ATOM   2559 C CD1 . LEU B 1 55  ? 35.669  18.760 27.129 1.00 76.24  ? 254 LEU B CD1 1 
ATOM   2560 C CD2 . LEU B 1 55  ? 33.345  18.090 27.625 1.00 76.59  ? 254 LEU B CD2 1 
ATOM   2561 N N   . VAL B 1 56  ? 36.747  15.360 30.211 1.00 86.77  ? 255 VAL B N   1 
ATOM   2562 C CA  . VAL B 1 56  ? 37.227  15.401 31.582 1.00 89.95  ? 255 VAL B CA  1 
ATOM   2563 C C   . VAL B 1 56  ? 38.522  14.614 31.619 1.00 92.81  ? 255 VAL B C   1 
ATOM   2564 O O   . VAL B 1 56  ? 38.517  13.394 31.462 1.00 92.37  ? 255 VAL B O   1 
ATOM   2565 C CB  . VAL B 1 56  ? 36.237  14.752 32.560 1.00 89.27  ? 255 VAL B CB  1 
ATOM   2566 C CG1 . VAL B 1 56  ? 36.898  14.582 33.922 1.00 89.06  ? 255 VAL B CG1 1 
ATOM   2567 C CG2 . VAL B 1 56  ? 34.991  15.615 32.683 1.00 89.23  ? 255 VAL B CG2 1 
ATOM   2568 N N   . ALA B 1 57  ? 39.631  15.318 31.809 1.00 96.72  ? 256 ALA B N   1 
ATOM   2569 C CA  . ALA B 1 57  ? 40.930  14.670 31.864 1.00 101.54 ? 256 ALA B CA  1 
ATOM   2570 C C   . ALA B 1 57  ? 40.865  13.490 32.837 1.00 105.27 ? 256 ALA B C   1 
ATOM   2571 O O   . ALA B 1 57  ? 41.564  12.486 32.666 1.00 106.13 ? 256 ALA B O   1 
ATOM   2572 C CB  . ALA B 1 57  ? 41.990  15.675 32.316 1.00 100.50 ? 256 ALA B CB  1 
ATOM   2573 N N   . LYS B 1 58  ? 39.989  13.614 33.834 1.00 109.17 ? 257 LYS B N   1 
ATOM   2574 C CA  . LYS B 1 58  ? 39.817  12.606 34.885 1.00 112.50 ? 257 LYS B CA  1 
ATOM   2575 C C   . LYS B 1 58  ? 38.728  11.542 34.656 1.00 114.98 ? 257 LYS B C   1 
ATOM   2576 O O   . LYS B 1 58  ? 38.239  10.940 35.614 1.00 115.42 ? 257 LYS B O   1 
ATOM   2577 C CB  . LYS B 1 58  ? 39.575  13.334 36.221 1.00 111.91 ? 257 LYS B CB  1 
ATOM   2578 C CG  . LYS B 1 58  ? 39.452  12.459 37.460 1.00 110.75 ? 257 LYS B CG  1 
ATOM   2579 C CD  . LYS B 1 58  ? 39.384  13.326 38.706 1.00 109.89 ? 257 LYS B CD  1 
ATOM   2580 C CE  . LYS B 1 58  ? 38.817  12.564 39.891 1.00 109.16 ? 257 LYS B CE  1 
ATOM   2581 N NZ  . LYS B 1 58  ? 37.383  12.230 39.684 1.00 108.38 ? 257 LYS B NZ  1 
ATOM   2582 N N   . LEU B 1 59  ? 38.348  11.300 33.402 1.00 117.65 ? 258 LEU B N   1 
ATOM   2583 C CA  . LEU B 1 59  ? 37.333  10.282 33.119 1.00 120.07 ? 258 LEU B CA  1 
ATOM   2584 C C   . LEU B 1 59  ? 37.745  9.253  32.060 1.00 121.54 ? 258 LEU B C   1 
ATOM   2585 O O   . LEU B 1 59  ? 36.943  8.889  31.196 1.00 122.14 ? 258 LEU B O   1 
ATOM   2586 C CB  . LEU B 1 59  ? 35.997  10.927 32.709 1.00 120.08 ? 258 LEU B CB  1 
ATOM   2587 C CG  . LEU B 1 59  ? 35.136  11.643 33.761 1.00 120.17 ? 258 LEU B CG  1 
ATOM   2588 C CD1 . LEU B 1 59  ? 33.781  11.970 33.146 1.00 119.59 ? 258 LEU B CD1 1 
ATOM   2589 C CD2 . LEU B 1 59  ? 34.945  10.770 34.999 1.00 119.70 ? 258 LEU B CD2 1 
ATOM   2590 N N   . VAL B 1 60  ? 38.992  8.789  32.126 1.00 122.87 ? 259 VAL B N   1 
ATOM   2591 C CA  . VAL B 1 60  ? 39.481  7.781  31.187 1.00 123.92 ? 259 VAL B CA  1 
ATOM   2592 C C   . VAL B 1 60  ? 40.080  6.617  31.979 1.00 124.66 ? 259 VAL B C   1 
ATOM   2593 O O   . VAL B 1 60  ? 40.647  5.677  31.417 1.00 124.64 ? 259 VAL B O   1 
ATOM   2594 C CB  . VAL B 1 60  ? 40.540  8.362  30.220 1.00 123.75 ? 259 VAL B CB  1 
ATOM   2595 C CG1 . VAL B 1 60  ? 41.815  8.728  30.975 1.00 123.08 ? 259 VAL B CG1 1 
ATOM   2596 C CG2 . VAL B 1 60  ? 40.807  7.364  29.110 1.00 123.58 ? 259 VAL B CG2 1 
ATOM   2597 N N   . ALA B 1 61  ? 39.926  6.707  33.298 1.00 125.44 ? 260 ALA B N   1 
ATOM   2598 C CA  . ALA B 1 61  ? 40.401  5.709  34.254 1.00 126.13 ? 260 ALA B CA  1 
ATOM   2599 C C   . ALA B 1 61  ? 39.965  6.181  35.646 1.00 126.53 ? 260 ALA B C   1 
ATOM   2600 O O   . ALA B 1 61  ? 40.775  6.253  36.573 1.00 126.54 ? 260 ALA B O   1 
ATOM   2601 C CB  . ALA B 1 61  ? 41.925  5.587  34.185 1.00 125.89 ? 260 ALA B CB  1 
ATOM   2602 N N   . ASN B 1 62  ? 38.677  6.501  35.777 1.00 126.80 ? 261 ASN B N   1 
ATOM   2603 C CA  . ASN B 1 62  ? 38.117  6.993  37.036 1.00 126.80 ? 261 ASN B CA  1 
ATOM   2604 C C   . ASN B 1 62  ? 36.964  6.133  37.560 1.00 127.35 ? 261 ASN B C   1 
ATOM   2605 O O   . ASN B 1 62  ? 37.088  5.492  38.604 1.00 127.70 ? 261 ASN B O   1 
ATOM   2606 C CB  . ASN B 1 62  ? 37.637  8.436  36.857 1.00 125.92 ? 261 ASN B CB  1 
ATOM   2607 C CG  . ASN B 1 62  ? 37.477  9.170  38.174 1.00 125.08 ? 261 ASN B CG  1 
ATOM   2608 O OD1 . ASN B 1 62  ? 38.431  9.306  38.940 1.00 124.38 ? 261 ASN B OD1 1 
ATOM   2609 N ND2 . ASN B 1 62  ? 36.270  9.655  38.440 1.00 124.88 ? 261 ASN B ND2 1 
ATOM   2610 N N   . GLY B 1 63  ? 35.841  6.128  36.847 1.00 127.50 ? 262 GLY B N   1 
ATOM   2611 C CA  . GLY B 1 63  ? 34.707  5.335  37.291 1.00 127.73 ? 262 GLY B CA  1 
ATOM   2612 C C   . GLY B 1 63  ? 33.369  5.776  36.732 1.00 127.72 ? 262 GLY B C   1 
ATOM   2613 O O   . GLY B 1 63  ? 32.386  5.036  36.802 1.00 128.29 ? 262 GLY B O   1 
ATOM   2614 N N   . ILE B 1 64  ? 33.322  6.987  36.189 1.00 127.31 ? 263 ILE B N   1 
ATOM   2615 C CA  . ILE B 1 64  ? 32.094  7.508  35.607 1.00 126.54 ? 263 ILE B CA  1 
ATOM   2616 C C   . ILE B 1 64  ? 32.074  7.105  34.134 1.00 125.64 ? 263 ILE B C   1 
ATOM   2617 O O   . ILE B 1 64  ? 32.979  7.470  33.378 1.00 125.68 ? 263 ILE B O   1 
ATOM   2618 C CB  . ILE B 1 64  ? 32.036  9.065  35.701 1.00 126.47 ? 263 ILE B CB  1 
ATOM   2619 C CG1 . ILE B 1 64  ? 32.318  9.522  37.138 1.00 125.92 ? 263 ILE B CG1 1 
ATOM   2620 C CG2 . ILE B 1 64  ? 30.665  9.565  35.262 1.00 126.69 ? 263 ILE B CG2 1 
ATOM   2621 C CD1 . ILE B 1 64  ? 32.396  11.032 37.310 1.00 124.90 ? 263 ILE B CD1 1 
ATOM   2622 N N   . GLN B 1 65  ? 31.079  6.323  33.724 1.00 124.37 ? 264 GLN B N   1 
ATOM   2623 C CA  . GLN B 1 65  ? 31.006  5.972  32.316 1.00 123.09 ? 264 GLN B CA  1 
ATOM   2624 C C   . GLN B 1 65  ? 29.658  5.440  31.771 1.00 122.01 ? 264 GLN B C   1 
ATOM   2625 O O   . GLN B 1 65  ? 29.465  5.408  30.554 1.00 122.09 ? 264 GLN B O   1 
ATOM   2626 C CB  . GLN B 1 65  ? 32.201  5.044  31.941 1.00 123.30 ? 264 GLN B CB  1 
ATOM   2627 C CG  . GLN B 1 65  ? 32.443  3.810  32.800 1.00 123.57 ? 264 GLN B CG  1 
ATOM   2628 C CD  . GLN B 1 65  ? 33.530  2.907  32.229 1.00 123.85 ? 264 GLN B CD  1 
ATOM   2629 O OE1 . GLN B 1 65  ? 34.000  1.987  32.898 1.00 123.65 ? 264 GLN B OE1 1 
ATOM   2630 N NE2 . GLN B 1 65  ? 33.923  3.161  30.983 1.00 124.16 ? 264 GLN B NE2 1 
ATOM   2631 N N   . ASN B 1 66  ? 28.685  5.196  32.659 1.00 120.37 ? 265 ASN B N   1 
ATOM   2632 C CA  . ASN B 1 66  ? 27.406  4.565  32.277 1.00 118.59 ? 265 ASN B CA  1 
ATOM   2633 C C   . ASN B 1 66  ? 26.197  4.738  33.149 1.00 116.94 ? 265 ASN B C   1 
ATOM   2634 O O   . ASN B 1 66  ? 25.270  3.919  33.050 1.00 116.99 ? 265 ASN B O   1 
ATOM   2635 C CB  . ASN B 1 66  ? 27.582  3.100  32.411 1.00 119.02 ? 265 ASN B CB  1 
ATOM   2636 C CG  . ASN B 1 66  ? 26.421  2.344  31.896 1.00 118.84 ? 265 ASN B CG  1 
ATOM   2637 O OD1 . ASN B 1 66  ? 25.727  1.621  32.623 1.00 119.09 ? 265 ASN B OD1 1 
ATOM   2638 N ND2 . ASN B 1 66  ? 26.194  2.495  30.607 1.00 118.57 ? 265 ASN B ND2 1 
ATOM   2639 N N   . LYS B 1 67  ? 26.197  5.702  34.039 1.00 114.58 ? 266 LYS B N   1 
ATOM   2640 C CA  . LYS B 1 67  ? 25.124  5.709  34.993 1.00 112.04 ? 266 LYS B CA  1 
ATOM   2641 C C   . LYS B 1 67  ? 23.689  5.881  34.420 1.00 111.14 ? 266 LYS B C   1 
ATOM   2642 O O   . LYS B 1 67  ? 22.853  5.010  34.642 1.00 110.85 ? 266 LYS B O   1 
ATOM   2643 C CB  . LYS B 1 67  ? 25.587  6.593  36.190 1.00 110.54 ? 266 LYS B CB  1 
ATOM   2644 C CG  . LYS B 1 67  ? 26.839  7.429  35.888 1.00 108.48 ? 266 LYS B CG  1 
ATOM   2645 C CD  . LYS B 1 67  ? 27.523  7.990  37.128 1.00 106.77 ? 266 LYS B CD  1 
ATOM   2646 C CE  . LYS B 1 67  ? 28.805  7.241  37.451 1.00 105.02 ? 266 LYS B CE  1 
ATOM   2647 N NZ  . LYS B 1 67  ? 29.479  7.857  38.623 1.00 104.80 ? 266 LYS B NZ  1 
ATOM   2648 N N   . GLU B 1 68  ? 23.438  6.891  33.601 1.00 109.76 ? 267 GLU B N   1 
ATOM   2649 C CA  . GLU B 1 68  ? 22.142  7.112  32.954 1.00 108.15 ? 267 GLU B CA  1 
ATOM   2650 C C   . GLU B 1 68  ? 22.711  8.237  32.128 1.00 107.26 ? 267 GLU B C   1 
ATOM   2651 O O   . GLU B 1 68  ? 22.911  9.322  32.647 1.00 107.20 ? 267 GLU B O   1 
ATOM   2652 C CB  . GLU B 1 68  ? 21.125  7.602  33.983 1.00 107.47 ? 267 GLU B CB  1 
ATOM   2653 C CG  . GLU B 1 68  ? 19.965  8.420  33.451 1.00 105.41 ? 267 GLU B CG  1 
ATOM   2654 C CD  . GLU B 1 68  ? 19.248  9.137  34.576 1.00 104.36 ? 267 GLU B CD  1 
ATOM   2655 O OE1 . GLU B 1 68  ? 18.329  9.921  34.291 1.00 103.84 ? 267 GLU B OE1 1 
ATOM   2656 O OE2 . GLU B 1 68  ? 19.607  8.920  35.754 1.00 103.18 ? 267 GLU B OE2 1 
ATOM   2657 N N   . ALA B 1 69  ? 23.041  7.947  30.873 1.00 106.42 ? 268 ALA B N   1 
ATOM   2658 C CA  . ALA B 1 69  ? 23.681  8.900  29.959 1.00 105.36 ? 268 ALA B CA  1 
ATOM   2659 C C   . ALA B 1 69  ? 23.117  10.319 29.787 1.00 104.29 ? 268 ALA B C   1 
ATOM   2660 O O   . ALA B 1 69  ? 23.857  11.235 29.414 1.00 103.76 ? 268 ALA B O   1 
ATOM   2661 C CB  . ALA B 1 69  ? 23.826  8.246  28.590 1.00 105.80 ? 268 ALA B CB  1 
ATOM   2662 N N   . GLU B 1 70  ? 21.825  10.503 30.045 1.00 102.96 ? 269 GLU B N   1 
ATOM   2663 C CA  . GLU B 1 70  ? 21.183  11.811 29.890 1.00 101.48 ? 269 GLU B CA  1 
ATOM   2664 C C   . GLU B 1 70  ? 21.644  12.813 30.954 1.00 101.64 ? 269 GLU B C   1 
ATOM   2665 O O   . GLU B 1 70  ? 21.650  14.024 30.722 1.00 101.49 ? 269 GLU B O   1 
ATOM   2666 C CB  . GLU B 1 70  ? 19.665  11.653 29.979 1.00 99.98  ? 269 GLU B CB  1 
ATOM   2667 C CG  . GLU B 1 70  ? 19.135  10.309 29.501 1.00 97.25  ? 269 GLU B CG  1 
ATOM   2668 C CD  . GLU B 1 70  ? 18.768  10.296 28.033 1.00 95.72  ? 269 GLU B CD  1 
ATOM   2669 O OE1 . GLU B 1 70  ? 17.981  11.163 27.618 1.00 95.41  ? 269 GLU B OE1 1 
ATOM   2670 O OE2 . GLU B 1 70  ? 19.252  9.416  27.294 1.00 94.57  ? 269 GLU B OE2 1 
ATOM   2671 N N   . VAL B 1 71  ? 22.009  12.292 32.123 1.00 101.94 ? 270 VAL B N   1 
ATOM   2672 C CA  . VAL B 1 71  ? 22.483  13.094 33.253 1.00 102.15 ? 270 VAL B CA  1 
ATOM   2673 C C   . VAL B 1 71  ? 23.963  13.446 33.085 1.00 102.35 ? 270 VAL B C   1 
ATOM   2674 O O   . VAL B 1 71  ? 24.511  14.291 33.800 1.00 102.74 ? 270 VAL B O   1 
ATOM   2675 C CB  . VAL B 1 71  ? 22.273  12.319 34.577 1.00 101.75 ? 270 VAL B CB  1 
ATOM   2676 C CG1 . VAL B 1 71  ? 23.108  12.905 35.677 1.00 100.79 ? 270 VAL B CG1 1 
ATOM   2677 C CG2 . VAL B 1 71  ? 20.805  12.345 34.948 1.00 101.86 ? 270 VAL B CG2 1 
ATOM   2678 N N   . ARG B 1 72  ? 24.599  12.783 32.127 1.00 102.19 ? 271 ARG B N   1 
ATOM   2679 C CA  . ARG B 1 72  ? 26.004  13.001 31.821 1.00 101.49 ? 271 ARG B CA  1 
ATOM   2680 C C   . ARG B 1 72  ? 26.084  14.314 31.048 1.00 101.58 ? 271 ARG B C   1 
ATOM   2681 O O   . ARG B 1 72  ? 26.915  15.175 31.342 1.00 101.56 ? 271 ARG B O   1 
ATOM   2682 C CB  . ARG B 1 72  ? 26.513  11.834 30.972 1.00 100.72 ? 271 ARG B CB  1 
ATOM   2683 C CG  . ARG B 1 72  ? 28.020  11.729 30.832 1.00 99.76  ? 271 ARG B CG  1 
ATOM   2684 C CD  . ARG B 1 72  ? 28.387  10.325 30.380 1.00 99.05  ? 271 ARG B CD  1 
ATOM   2685 N NE  . ARG B 1 72  ? 27.736  9.964  29.123 1.00 98.45  ? 271 ARG B NE  1 
ATOM   2686 C CZ  . ARG B 1 72  ? 27.054  8.839  28.928 1.00 97.72  ? 271 ARG B CZ  1 
ATOM   2687 N NH1 . ARG B 1 72  ? 26.923  7.958  29.911 1.00 97.46  ? 271 ARG B NH1 1 
ATOM   2688 N NH2 . ARG B 1 72  ? 26.515  8.590  27.743 1.00 96.75  ? 271 ARG B NH2 1 
ATOM   2689 N N   . ILE B 1 73  ? 25.190  14.455 30.070 1.00 101.48 ? 272 ILE B N   1 
ATOM   2690 C CA  . ILE B 1 73  ? 25.104  15.645 29.225 1.00 100.77 ? 272 ILE B CA  1 
ATOM   2691 C C   . ILE B 1 73  ? 24.829  16.868 30.081 1.00 100.27 ? 272 ILE B C   1 
ATOM   2692 O O   . ILE B 1 73  ? 25.327  17.950 29.803 1.00 100.01 ? 272 ILE B O   1 
ATOM   2693 C CB  . ILE B 1 73  ? 23.959  15.530 28.215 1.00 101.01 ? 272 ILE B CB  1 
ATOM   2694 C CG1 . ILE B 1 73  ? 23.898  14.107 27.658 1.00 101.31 ? 272 ILE B CG1 1 
ATOM   2695 C CG2 . ILE B 1 73  ? 24.157  16.549 27.103 1.00 100.26 ? 272 ILE B CG2 1 
ATOM   2696 C CD1 . ILE B 1 73  ? 22.629  13.803 26.891 1.00 101.74 ? 272 ILE B CD1 1 
ATOM   2697 N N   . PHE B 1 74  ? 24.005  16.688 31.107 1.00 99.94  ? 273 PHE B N   1 
ATOM   2698 C CA  . PHE B 1 74  ? 23.675  17.769 32.021 1.00 99.68  ? 273 PHE B CA  1 
ATOM   2699 C C   . PHE B 1 74  ? 24.940  18.172 32.764 1.00 99.85  ? 273 PHE B C   1 
ATOM   2700 O O   . PHE B 1 74  ? 25.281  19.349 32.838 1.00 99.92  ? 273 PHE B O   1 
ATOM   2701 C CB  . PHE B 1 74  ? 22.633  17.309 33.040 1.00 99.62  ? 273 PHE B CB  1 
ATOM   2702 C CG  . PHE B 1 74  ? 22.578  18.168 34.270 1.00 100.05 ? 273 PHE B CG  1 
ATOM   2703 C CD1 . PHE B 1 74  ? 21.825  19.337 34.287 1.00 100.38 ? 273 PHE B CD1 1 
ATOM   2704 C CD2 . PHE B 1 74  ? 23.319  17.830 35.400 1.00 100.27 ? 273 PHE B CD2 1 
ATOM   2705 C CE1 . PHE B 1 74  ? 21.810  20.160 35.413 1.00 100.76 ? 273 PHE B CE1 1 
ATOM   2706 C CE2 . PHE B 1 74  ? 23.312  18.644 36.530 1.00 100.42 ? 273 PHE B CE2 1 
ATOM   2707 C CZ  . PHE B 1 74  ? 22.557  19.811 36.537 1.00 100.78 ? 273 PHE B CZ  1 
ATOM   2708 N N   . HIS B 1 75  ? 25.625  17.174 33.318 1.00 100.20 ? 274 HIS B N   1 
ATOM   2709 C CA  . HIS B 1 75  ? 26.852  17.390 34.080 1.00 99.93  ? 274 HIS B CA  1 
ATOM   2710 C C   . HIS B 1 75  ? 27.842  18.321 33.389 1.00 98.63  ? 274 HIS B C   1 
ATOM   2711 O O   . HIS B 1 75  ? 28.065  19.442 33.845 1.00 98.77  ? 274 HIS B O   1 
ATOM   2712 C CB  . HIS B 1 75  ? 27.543  16.050 34.380 1.00 101.01 ? 274 HIS B CB  1 
ATOM   2713 C CG  . HIS B 1 75  ? 28.845  16.190 35.112 1.00 102.11 ? 274 HIS B CG  1 
ATOM   2714 N ND1 . HIS B 1 75  ? 29.922  16.878 34.592 1.00 102.40 ? 274 HIS B ND1 1 
ATOM   2715 C CD2 . HIS B 1 75  ? 29.241  15.738 36.326 1.00 102.34 ? 274 HIS B CD2 1 
ATOM   2716 C CE1 . HIS B 1 75  ? 30.923  16.844 35.453 1.00 102.24 ? 274 HIS B CE1 1 
ATOM   2717 N NE2 . HIS B 1 75  ? 30.536  16.158 36.513 1.00 102.44 ? 274 HIS B NE2 1 
ATOM   2718 N N   . CYS B 1 76  ? 28.439  17.854 32.295 1.00 96.70  ? 275 CYS B N   1 
ATOM   2719 C CA  . CYS B 1 76  ? 29.417  18.661 31.574 1.00 94.47  ? 275 CYS B CA  1 
ATOM   2720 C C   . CYS B 1 76  ? 28.810  19.754 30.698 1.00 92.83  ? 275 CYS B C   1 
ATOM   2721 O O   . CYS B 1 76  ? 29.494  20.371 29.881 1.00 92.63  ? 275 CYS B O   1 
ATOM   2722 C CB  . CYS B 1 76  ? 30.352  17.760 30.762 1.00 94.50  ? 275 CYS B CB  1 
ATOM   2723 S SG  . CYS B 1 76  ? 31.623  16.957 31.786 1.00 94.07  ? 275 CYS B SG  1 
ATOM   2724 N N   . CYS B 1 77  ? 27.516  19.982 30.879 1.00 90.67  ? 276 CYS B N   1 
ATOM   2725 C CA  . CYS B 1 77  ? 26.807  21.035 30.170 1.00 88.43  ? 276 CYS B CA  1 
ATOM   2726 C C   . CYS B 1 77  ? 26.704  22.071 31.283 1.00 87.86  ? 276 CYS B C   1 
ATOM   2727 O O   . CYS B 1 77  ? 25.910  23.010 31.226 1.00 87.94  ? 276 CYS B O   1 
ATOM   2728 C CB  . CYS B 1 77  ? 25.415  20.556 29.760 1.00 87.63  ? 276 CYS B CB  1 
ATOM   2729 S SG  . CYS B 1 77  ? 24.531  21.612 28.614 1.00 85.07  ? 276 CYS B SG  1 
ATOM   2730 N N   . GLN B 1 78  ? 27.527  21.854 32.308 1.00 86.40  ? 277 GLN B N   1 
ATOM   2731 C CA  . GLN B 1 78  ? 27.583  22.711 33.481 1.00 84.81  ? 277 GLN B CA  1 
ATOM   2732 C C   . GLN B 1 78  ? 29.017  23.197 33.684 1.00 83.67  ? 277 GLN B C   1 
ATOM   2733 O O   . GLN B 1 78  ? 29.283  23.998 34.581 1.00 84.31  ? 277 GLN B O   1 
ATOM   2734 C CB  . GLN B 1 78  ? 27.102  21.936 34.711 1.00 85.05  ? 277 GLN B CB  1 
ATOM   2735 C CG  . GLN B 1 78  ? 26.465  22.793 35.794 1.00 85.98  ? 277 GLN B CG  1 
ATOM   2736 C CD  . GLN B 1 78  ? 25.910  21.965 36.945 1.00 86.49  ? 277 GLN B CD  1 
ATOM   2737 O OE1 . GLN B 1 78  ? 25.349  22.509 37.898 1.00 86.37  ? 277 GLN B OE1 1 
ATOM   2738 N NE2 . GLN B 1 78  ? 26.066  20.644 36.861 1.00 86.18  ? 277 GLN B NE2 1 
ATOM   2739 N N   . CYS B 1 79  ? 29.940  22.690 32.863 1.00 81.78  ? 278 CYS B N   1 
ATOM   2740 C CA  . CYS B 1 79  ? 31.342  23.116 32.924 1.00 79.23  ? 278 CYS B CA  1 
ATOM   2741 C C   . CYS B 1 79  ? 31.293  24.330 32.023 1.00 76.97  ? 278 CYS B C   1 
ATOM   2742 O O   . CYS B 1 79  ? 31.785  25.414 32.346 1.00 76.72  ? 278 CYS B O   1 
ATOM   2743 C CB  . CYS B 1 79  ? 32.298  22.105 32.266 1.00 79.68  ? 278 CYS B CB  1 
ATOM   2744 S SG  . CYS B 1 79  ? 31.927  20.337 32.409 1.00 80.36  ? 278 CYS B SG  1 
ATOM   2745 N N   . THR B 1 80  ? 30.666  24.095 30.876 1.00 74.51  ? 279 THR B N   1 
ATOM   2746 C CA  . THR B 1 80  ? 30.473  25.081 29.830 1.00 72.13  ? 279 THR B CA  1 
ATOM   2747 C C   . THR B 1 80  ? 29.476  26.117 30.311 1.00 69.13  ? 279 THR B C   1 
ATOM   2748 O O   . THR B 1 80  ? 28.821  26.782 29.508 1.00 69.03  ? 279 THR B O   1 
ATOM   2749 C CB  . THR B 1 80  ? 29.905  24.420 28.561 1.00 73.34  ? 279 THR B CB  1 
ATOM   2750 O OG1 . THR B 1 80  ? 30.679  23.255 28.240 1.00 74.82  ? 279 THR B OG1 1 
ATOM   2751 C CG2 . THR B 1 80  ? 29.939  25.398 27.392 1.00 74.33  ? 279 THR B CG2 1 
ATOM   2752 N N   . SER B 1 81  ? 29.357  26.238 31.629 1.00 65.60  ? 280 SER B N   1 
ATOM   2753 C CA  . SER B 1 81  ? 28.435  27.194 32.212 1.00 61.11  ? 280 SER B CA  1 
ATOM   2754 C C   . SER B 1 81  ? 29.031  27.903 33.422 1.00 58.32  ? 280 SER B C   1 
ATOM   2755 O O   . SER B 1 81  ? 28.440  28.843 33.941 1.00 59.24  ? 280 SER B O   1 
ATOM   2756 C CB  . SER B 1 81  ? 27.135  26.499 32.601 1.00 60.35  ? 280 SER B CB  1 
ATOM   2757 O OG  . SER B 1 81  ? 26.099  27.452 32.688 1.00 58.73  ? 280 SER B OG  1 
ATOM   2758 N N   . VAL B 1 82  ? 30.194  27.448 33.877 1.00 54.06  ? 281 VAL B N   1 
ATOM   2759 C CA  . VAL B 1 82  ? 30.860  28.081 35.010 1.00 50.09  ? 281 VAL B CA  1 
ATOM   2760 C C   . VAL B 1 82  ? 32.063  28.851 34.478 1.00 47.34  ? 281 VAL B C   1 
ATOM   2761 O O   . VAL B 1 82  ? 32.707  29.626 35.187 1.00 47.34  ? 281 VAL B O   1 
ATOM   2762 C CB  . VAL B 1 82  ? 31.292  27.042 36.063 1.00 50.28  ? 281 VAL B CB  1 
ATOM   2763 C CG1 . VAL B 1 82  ? 32.229  27.677 37.092 1.00 49.17  ? 281 VAL B CG1 1 
ATOM   2764 C CG2 . VAL B 1 82  ? 30.048  26.499 36.765 1.00 49.79  ? 281 VAL B CG2 1 
ATOM   2765 N N   . GLU B 1 83  ? 32.360  28.618 33.209 1.00 43.41  ? 282 GLU B N   1 
ATOM   2766 C CA  . GLU B 1 83  ? 33.432  29.319 32.540 1.00 38.45  ? 282 GLU B CA  1 
ATOM   2767 C C   . GLU B 1 83  ? 32.695  30.527 31.997 1.00 33.50  ? 282 GLU B C   1 
ATOM   2768 O O   . GLU B 1 83  ? 33.144  31.667 32.120 1.00 31.84  ? 282 GLU B O   1 
ATOM   2769 C CB  . GLU B 1 83  ? 33.973  28.479 31.382 1.00 41.50  ? 282 GLU B CB  1 
ATOM   2770 C CG  . GLU B 1 83  ? 35.195  27.640 31.716 1.00 46.63  ? 282 GLU B CG  1 
ATOM   2771 C CD  . GLU B 1 83  ? 36.453  28.146 31.015 1.00 50.66  ? 282 GLU B CD  1 
ATOM   2772 O OE1 . GLU B 1 83  ? 36.387  29.212 30.352 1.00 51.21  ? 282 GLU B OE1 1 
ATOM   2773 O OE2 . GLU B 1 83  ? 37.508  27.477 31.130 1.00 52.92  ? 282 GLU B OE2 1 
ATOM   2774 N N   . THR B 1 84  ? 31.527  30.244 31.425 1.00 28.34  ? 283 THR B N   1 
ATOM   2775 C CA  . THR B 1 84  ? 30.678  31.257 30.820 1.00 23.72  ? 283 THR B CA  1 
ATOM   2776 C C   . THR B 1 84  ? 30.255  32.297 31.834 1.00 20.27  ? 283 THR B C   1 
ATOM   2777 O O   . THR B 1 84  ? 30.295  33.493 31.562 1.00 20.21  ? 283 THR B O   1 
ATOM   2778 C CB  . THR B 1 84  ? 29.415  30.623 30.165 1.00 22.83  ? 283 THR B CB  1 
ATOM   2779 O OG1 . THR B 1 84  ? 29.812  29.741 29.108 1.00 23.40  ? 283 THR B OG1 1 
ATOM   2780 C CG2 . THR B 1 84  ? 28.523  31.692 29.565 1.00 22.30  ? 283 THR B CG2 1 
ATOM   2781 N N   . VAL B 1 85  ? 29.847  31.845 33.008 1.00 16.91  ? 284 VAL B N   1 
ATOM   2782 C CA  . VAL B 1 85  ? 29.426  32.777 34.043 1.00 13.79  ? 284 VAL B CA  1 
ATOM   2783 C C   . VAL B 1 85  ? 30.564  33.746 34.325 1.00 12.28  ? 284 VAL B C   1 
ATOM   2784 O O   . VAL B 1 85  ? 30.352  34.950 34.442 1.00 10.68  ? 284 VAL B O   1 
ATOM   2785 C CB  . VAL B 1 85  ? 29.034  32.033 35.370 1.00 12.32  ? 284 VAL B CB  1 
ATOM   2786 C CG1 . VAL B 1 85  ? 28.972  33.010 36.543 1.00 7.45   ? 284 VAL B CG1 1 
ATOM   2787 C CG2 . VAL B 1 85  ? 27.676  31.356 35.206 1.00 10.56  ? 284 VAL B CG2 1 
ATOM   2788 N N   . THR B 1 86  ? 31.780  33.217 34.395 1.00 11.60  ? 285 THR B N   1 
ATOM   2789 C CA  . THR B 1 86  ? 32.932  34.038 34.714 1.00 11.00  ? 285 THR B CA  1 
ATOM   2790 C C   . THR B 1 86  ? 33.312  35.085 33.691 1.00 10.45  ? 285 THR B C   1 
ATOM   2791 O O   . THR B 1 86  ? 33.656  36.203 34.071 1.00 10.59  ? 285 THR B O   1 
ATOM   2792 C CB  . THR B 1 86  ? 34.153  33.186 35.005 1.00 11.39  ? 285 THR B CB  1 
ATOM   2793 O OG1 . THR B 1 86  ? 33.785  32.115 35.882 1.00 12.60  ? 285 THR B OG1 1 
ATOM   2794 C CG2 . THR B 1 86  ? 35.211  34.032 35.692 1.00 12.34  ? 285 THR B CG2 1 
ATOM   2795 N N   . GLU B 1 87  ? 33.279  34.743 32.402 1.00 10.44  ? 286 GLU B N   1 
ATOM   2796 C CA  . GLU B 1 87  ? 33.617  35.743 31.392 1.00 8.64   ? 286 GLU B CA  1 
ATOM   2797 C C   . GLU B 1 87  ? 32.484  36.760 31.259 1.00 7.44   ? 286 GLU B C   1 
ATOM   2798 O O   . GLU B 1 87  ? 32.718  37.906 30.910 1.00 8.04   ? 286 GLU B O   1 
ATOM   2799 C CB  . GLU B 1 87  ? 33.968  35.112 30.023 1.00 7.65   ? 286 GLU B CB  1 
ATOM   2800 C CG  . GLU B 1 87  ? 33.514  33.683 29.763 1.00 7.67   ? 286 GLU B CG  1 
ATOM   2801 C CD  . GLU B 1 87  ? 34.041  33.133 28.429 1.00 8.02   ? 286 GLU B CD  1 
ATOM   2802 O OE1 . GLU B 1 87  ? 35.252  32.863 28.308 1.00 9.47   ? 286 GLU B OE1 1 
ATOM   2803 O OE2 . GLU B 1 87  ? 33.245  32.971 27.489 1.00 7.95   ? 286 GLU B OE2 1 
ATOM   2804 N N   . LEU B 1 88  ? 31.256  36.348 31.551 1.00 7.18   ? 287 LEU B N   1 
ATOM   2805 C CA  . LEU B 1 88  ? 30.135  37.273 31.499 1.00 6.66   ? 287 LEU B CA  1 
ATOM   2806 C C   . LEU B 1 88  ? 30.327  38.280 32.638 1.00 6.55   ? 287 LEU B C   1 
ATOM   2807 O O   . LEU B 1 88  ? 29.909  39.427 32.545 1.00 8.29   ? 287 LEU B O   1 
ATOM   2808 C CB  . LEU B 1 88  ? 28.807  36.529 31.676 1.00 6.55   ? 287 LEU B CB  1 
ATOM   2809 C CG  . LEU B 1 88  ? 27.855  36.586 30.479 1.00 7.16   ? 287 LEU B CG  1 
ATOM   2810 C CD1 . LEU B 1 88  ? 26.663  35.703 30.745 1.00 9.08   ? 287 LEU B CD1 1 
ATOM   2811 C CD2 . LEU B 1 88  ? 27.406  38.018 30.224 1.00 7.96   ? 287 LEU B CD2 1 
ATOM   2812 N N   . THR B 1 89  ? 30.970  37.844 33.710 1.00 6.55   ? 288 THR B N   1 
ATOM   2813 C CA  . THR B 1 89  ? 31.220  38.711 34.846 1.00 6.55   ? 288 THR B CA  1 
ATOM   2814 C C   . THR B 1 89  ? 32.379  39.643 34.547 1.00 6.55   ? 288 THR B C   1 
ATOM   2815 O O   . THR B 1 89  ? 32.406  40.777 34.999 1.00 6.55   ? 288 THR B O   1 
ATOM   2816 C CB  . THR B 1 89  ? 31.547  37.889 36.097 1.00 6.55   ? 288 THR B CB  1 
ATOM   2817 O OG1 . THR B 1 89  ? 30.401  37.131 36.471 1.00 6.55   ? 288 THR B OG1 1 
ATOM   2818 C CG2 . THR B 1 89  ? 31.915  38.783 37.246 1.00 6.55   ? 288 THR B CG2 1 
ATOM   2819 N N   . GLU B 1 90  ? 33.343  39.159 33.781 1.00 6.55   ? 289 GLU B N   1 
ATOM   2820 C CA  . GLU B 1 90  ? 34.499  39.970 33.435 1.00 6.55   ? 289 GLU B CA  1 
ATOM   2821 C C   . GLU B 1 90  ? 34.128  41.034 32.418 1.00 6.55   ? 289 GLU B C   1 
ATOM   2822 O O   . GLU B 1 90  ? 34.578  42.169 32.509 1.00 7.50   ? 289 GLU B O   1 
ATOM   2823 C CB  . GLU B 1 90  ? 35.613  39.087 32.892 1.00 7.71   ? 289 GLU B CB  1 
ATOM   2824 C CG  . GLU B 1 90  ? 36.317  38.252 33.955 1.00 13.91  ? 289 GLU B CG  1 
ATOM   2825 C CD  . GLU B 1 90  ? 37.241  39.076 34.851 1.00 17.02  ? 289 GLU B CD  1 
ATOM   2826 O OE1 . GLU B 1 90  ? 37.597  40.211 34.454 1.00 20.22  ? 289 GLU B OE1 1 
ATOM   2827 O OE2 . GLU B 1 90  ? 37.622  38.582 35.940 1.00 16.07  ? 289 GLU B OE2 1 
ATOM   2828 N N   . PHE B 1 91  ? 33.313  40.661 31.441 1.00 6.55   ? 290 PHE B N   1 
ATOM   2829 C CA  . PHE B 1 91  ? 32.849  41.601 30.430 1.00 6.55   ? 290 PHE B CA  1 
ATOM   2830 C C   . PHE B 1 91  ? 32.140  42.699 31.209 1.00 6.55   ? 290 PHE B C   1 
ATOM   2831 O O   . PHE B 1 91  ? 32.476  43.868 31.097 1.00 6.59   ? 290 PHE B O   1 
ATOM   2832 C CB  . PHE B 1 91  ? 31.880  40.887 29.481 1.00 6.55   ? 290 PHE B CB  1 
ATOM   2833 C CG  . PHE B 1 91  ? 31.025  41.801 28.656 1.00 6.55   ? 290 PHE B CG  1 
ATOM   2834 C CD1 . PHE B 1 91  ? 31.587  42.695 27.771 1.00 6.55   ? 290 PHE B CD1 1 
ATOM   2835 C CD2 . PHE B 1 91  ? 29.643  41.723 28.732 1.00 6.55   ? 290 PHE B CD2 1 
ATOM   2836 C CE1 . PHE B 1 91  ? 30.783  43.489 26.974 1.00 6.55   ? 290 PHE B CE1 1 
ATOM   2837 C CE2 . PHE B 1 91  ? 28.839  42.520 27.931 1.00 6.55   ? 290 PHE B CE2 1 
ATOM   2838 C CZ  . PHE B 1 91  ? 29.408  43.401 27.054 1.00 6.55   ? 290 PHE B CZ  1 
ATOM   2839 N N   . ALA B 1 92  ? 31.188  42.294 32.041 1.00 6.55   ? 291 ALA B N   1 
ATOM   2840 C CA  . ALA B 1 92  ? 30.407  43.215 32.842 1.00 6.55   ? 291 ALA B CA  1 
ATOM   2841 C C   . ALA B 1 92  ? 31.209  44.263 33.590 1.00 6.55   ? 291 ALA B C   1 
ATOM   2842 O O   . ALA B 1 92  ? 30.749  45.388 33.730 1.00 8.93   ? 291 ALA B O   1 
ATOM   2843 C CB  . ALA B 1 92  ? 29.541  42.446 33.810 1.00 6.55   ? 291 ALA B CB  1 
ATOM   2844 N N   . LYS B 1 93  ? 32.395  43.944 34.087 1.00 6.55   ? 292 LYS B N   1 
ATOM   2845 C CA  . LYS B 1 93  ? 33.094  45.002 34.789 1.00 6.55   ? 292 LYS B CA  1 
ATOM   2846 C C   . LYS B 1 93  ? 34.003  45.839 33.917 1.00 6.55   ? 292 LYS B C   1 
ATOM   2847 O O   . LYS B 1 93  ? 34.685  46.747 34.396 1.00 6.78   ? 292 LYS B O   1 
ATOM   2848 C CB  . LYS B 1 93  ? 33.820  44.482 36.032 1.00 6.55   ? 292 LYS B CB  1 
ATOM   2849 C CG  . LYS B 1 93  ? 34.779  43.322 35.889 1.00 7.73   ? 292 LYS B CG  1 
ATOM   2850 C CD  . LYS B 1 93  ? 35.089  42.849 37.300 1.00 8.13   ? 292 LYS B CD  1 
ATOM   2851 C CE  . LYS B 1 93  ? 36.331  41.991 37.377 1.00 10.80  ? 292 LYS B CE  1 
ATOM   2852 N NZ  . LYS B 1 93  ? 36.677  41.718 38.807 1.00 11.03  ? 292 LYS B NZ  1 
ATOM   2853 N N   . ALA B 1 94  ? 33.989  45.544 32.624 1.00 6.55   ? 293 ALA B N   1 
ATOM   2854 C CA  . ALA B 1 94  ? 34.765  46.307 31.655 1.00 6.55   ? 293 ALA B CA  1 
ATOM   2855 C C   . ALA B 1 94  ? 33.778  47.329 31.058 1.00 6.55   ? 293 ALA B C   1 
ATOM   2856 O O   . ALA B 1 94  ? 34.172  48.274 30.350 1.00 6.55   ? 293 ALA B O   1 
ATOM   2857 C CB  . ALA B 1 94  ? 35.316  45.386 30.573 1.00 6.55   ? 293 ALA B CB  1 
ATOM   2858 N N   . ILE B 1 95  ? 32.493  47.126 31.377 1.00 6.55   ? 294 ILE B N   1 
ATOM   2859 C CA  . ILE B 1 95  ? 31.412  47.991 30.921 1.00 6.55   ? 294 ILE B CA  1 
ATOM   2860 C C   . ILE B 1 95  ? 31.436  49.279 31.697 1.00 6.55   ? 294 ILE B C   1 
ATOM   2861 O O   . ILE B 1 95  ? 31.242  49.285 32.909 1.00 8.44   ? 294 ILE B O   1 
ATOM   2862 C CB  . ILE B 1 95  ? 30.022  47.395 31.164 1.00 6.55   ? 294 ILE B CB  1 
ATOM   2863 C CG1 . ILE B 1 95  ? 29.796  46.182 30.277 1.00 6.55   ? 294 ILE B CG1 1 
ATOM   2864 C CG2 . ILE B 1 95  ? 28.960  48.444 30.882 1.00 6.55   ? 294 ILE B CG2 1 
ATOM   2865 C CD1 . ILE B 1 95  ? 28.441  45.537 30.461 1.00 6.55   ? 294 ILE B CD1 1 
ATOM   2866 N N   . PRO B 1 96  ? 31.668  50.391 31.005 1.00 6.55   ? 295 PRO B N   1 
ATOM   2867 C CA  . PRO B 1 96  ? 31.723  51.731 31.573 1.00 6.82   ? 295 PRO B CA  1 
ATOM   2868 C C   . PRO B 1 96  ? 30.825  51.989 32.789 1.00 6.71   ? 295 PRO B C   1 
ATOM   2869 O O   . PRO B 1 96  ? 29.603  51.876 32.715 1.00 6.55   ? 295 PRO B O   1 
ATOM   2870 C CB  . PRO B 1 96  ? 31.341  52.590 30.384 1.00 8.08   ? 295 PRO B CB  1 
ATOM   2871 C CG  . PRO B 1 96  ? 32.088  51.909 29.287 1.00 7.74   ? 295 PRO B CG  1 
ATOM   2872 C CD  . PRO B 1 96  ? 31.891  50.435 29.551 1.00 6.55   ? 295 PRO B CD  1 
ATOM   2873 N N   . GLY B 1 97  ? 31.456  52.328 33.908 1.00 8.36   ? 296 GLY B N   1 
ATOM   2874 C CA  . GLY B 1 97  ? 30.725  52.655 35.121 1.00 11.87  ? 296 GLY B CA  1 
ATOM   2875 C C   . GLY B 1 97  ? 29.868  51.609 35.811 1.00 13.05  ? 296 GLY B C   1 
ATOM   2876 O O   . GLY B 1 97  ? 28.899  51.946 36.506 1.00 14.74  ? 296 GLY B O   1 
ATOM   2877 N N   . PHE B 1 98  ? 30.221  50.344 35.625 1.00 12.18  ? 297 PHE B N   1 
ATOM   2878 C CA  . PHE B 1 98  ? 29.507  49.242 36.251 1.00 9.46   ? 297 PHE B CA  1 
ATOM   2879 C C   . PHE B 1 98  ? 30.269  48.952 37.539 1.00 8.36   ? 297 PHE B C   1 
ATOM   2880 O O   . PHE B 1 98  ? 29.686  48.832 38.609 1.00 6.55   ? 297 PHE B O   1 
ATOM   2881 C CB  . PHE B 1 98  ? 29.507  48.034 35.297 1.00 6.73   ? 297 PHE B CB  1 
ATOM   2882 C CG  . PHE B 1 98  ? 29.022  46.754 35.915 1.00 6.55   ? 297 PHE B CG  1 
ATOM   2883 C CD1 . PHE B 1 98  ? 29.889  45.945 36.634 1.00 6.55   ? 297 PHE B CD1 1 
ATOM   2884 C CD2 . PHE B 1 98  ? 27.704  46.339 35.749 1.00 6.55   ? 297 PHE B CD2 1 
ATOM   2885 C CE1 . PHE B 1 98  ? 29.458  44.740 37.174 1.00 6.55   ? 297 PHE B CE1 1 
ATOM   2886 C CE2 . PHE B 1 98  ? 27.264  45.139 36.285 1.00 6.55   ? 297 PHE B CE2 1 
ATOM   2887 C CZ  . PHE B 1 98  ? 28.149  44.337 36.999 1.00 6.55   ? 297 PHE B CZ  1 
ATOM   2888 N N   . ALA B 1 99  ? 31.587  48.894 37.410 1.00 9.36   ? 298 ALA B N   1 
ATOM   2889 C CA  . ALA B 1 99  ? 32.497  48.623 38.510 1.00 11.94  ? 298 ALA B CA  1 
ATOM   2890 C C   . ALA B 1 99  ? 32.414  49.648 39.642 1.00 13.63  ? 298 ALA B C   1 
ATOM   2891 O O   . ALA B 1 99  ? 32.953  49.433 40.733 1.00 12.83  ? 298 ALA B O   1 
ATOM   2892 C CB  . ALA B 1 99  ? 33.915  48.561 37.973 1.00 11.43  ? 298 ALA B CB  1 
ATOM   2893 N N   . ASN B 1 100 ? 31.742  50.762 39.384 1.00 15.96  ? 299 ASN B N   1 
ATOM   2894 C CA  . ASN B 1 100 ? 31.601  51.809 40.391 1.00 18.30  ? 299 ASN B CA  1 
ATOM   2895 C C   . ASN B 1 100 ? 30.214  51.756 41.009 1.00 17.13  ? 299 ASN B C   1 
ATOM   2896 O O   . ASN B 1 100 ? 29.688  52.769 41.478 1.00 17.63  ? 299 ASN B O   1 
ATOM   2897 C CB  . ASN B 1 100 ? 31.831  53.178 39.752 1.00 22.17  ? 299 ASN B CB  1 
ATOM   2898 C CG  . ASN B 1 100 ? 33.203  53.294 39.118 1.00 25.98  ? 299 ASN B CG  1 
ATOM   2899 O OD1 . ASN B 1 100 ? 33.365  53.941 38.082 1.00 28.84  ? 299 ASN B OD1 1 
ATOM   2900 N ND2 . ASN B 1 100 ? 34.205  52.673 39.743 1.00 27.73  ? 299 ASN B ND2 1 
ATOM   2901 N N   . LEU B 1 101 ? 29.622  50.567 40.987 1.00 14.07  ? 300 LEU B N   1 
ATOM   2902 C CA  . LEU B 1 101 ? 28.299  50.361 41.542 1.00 11.18  ? 300 LEU B CA  1 
ATOM   2903 C C   . LEU B 1 101 ? 28.470  49.718 42.886 1.00 11.66  ? 300 LEU B C   1 
ATOM   2904 O O   . LEU B 1 101 ? 29.575  49.346 43.268 1.00 10.71  ? 300 LEU B O   1 
ATOM   2905 C CB  . LEU B 1 101 ? 27.486  49.415 40.676 1.00 8.47   ? 300 LEU B CB  1 
ATOM   2906 C CG  . LEU B 1 101 ? 26.954  49.804 39.307 1.00 6.55   ? 300 LEU B CG  1 
ATOM   2907 C CD1 . LEU B 1 101 ? 26.534  48.545 38.572 1.00 6.76   ? 300 LEU B CD1 1 
ATOM   2908 C CD2 . LEU B 1 101 ? 25.777  50.732 39.462 1.00 7.41   ? 300 LEU B CD2 1 
ATOM   2909 N N   . ASP B 1 102 ? 27.364  49.584 43.599 1.00 14.08  ? 301 ASP B N   1 
ATOM   2910 C CA  . ASP B 1 102 ? 27.385  48.954 44.901 1.00 16.65  ? 301 ASP B CA  1 
ATOM   2911 C C   . ASP B 1 102 ? 27.782  47.511 44.603 1.00 16.57  ? 301 ASP B C   1 
ATOM   2912 O O   . ASP B 1 102 ? 27.042  46.785 43.944 1.00 16.42  ? 301 ASP B O   1 
ATOM   2913 C CB  . ASP B 1 102 ? 25.987  49.030 45.531 1.00 19.96  ? 301 ASP B CB  1 
ATOM   2914 C CG  . ASP B 1 102 ? 25.982  48.691 47.017 1.00 24.30  ? 301 ASP B CG  1 
ATOM   2915 O OD1 . ASP B 1 102 ? 26.790  49.287 47.774 1.00 27.59  ? 301 ASP B OD1 1 
ATOM   2916 O OD2 . ASP B 1 102 ? 25.156  47.841 47.430 1.00 24.99  ? 301 ASP B OD2 1 
ATOM   2917 N N   . LEU B 1 103 ? 28.966  47.114 45.062 1.00 17.19  ? 302 LEU B N   1 
ATOM   2918 C CA  . LEU B 1 103 ? 29.463  45.762 44.842 1.00 16.68  ? 302 LEU B CA  1 
ATOM   2919 C C   . LEU B 1 103 ? 28.336  44.781 45.022 1.00 14.61  ? 302 LEU B C   1 
ATOM   2920 O O   . LEU B 1 103 ? 28.380  43.676 44.513 1.00 14.19  ? 302 LEU B O   1 
ATOM   2921 C CB  . LEU B 1 103 ? 30.594  45.444 45.823 1.00 20.99  ? 302 LEU B CB  1 
ATOM   2922 C CG  . LEU B 1 103 ? 31.031  43.980 46.013 1.00 24.72  ? 302 LEU B CG  1 
ATOM   2923 C CD1 . LEU B 1 103 ? 32.446  43.933 46.602 1.00 27.10  ? 302 LEU B CD1 1 
ATOM   2924 C CD2 . LEU B 1 103 ? 30.044  43.246 46.931 1.00 24.96  ? 302 LEU B CD2 1 
ATOM   2925 N N   . ASN B 1 104 ? 27.316  45.197 45.751 1.00 13.34  ? 303 ASN B N   1 
ATOM   2926 C CA  . ASN B 1 104 ? 26.174  44.345 45.993 1.00 14.36  ? 303 ASN B CA  1 
ATOM   2927 C C   . ASN B 1 104 ? 25.252  44.277 44.780 1.00 13.27  ? 303 ASN B C   1 
ATOM   2928 O O   . ASN B 1 104 ? 24.839  43.189 44.375 1.00 12.37  ? 303 ASN B O   1 
ATOM   2929 C CB  . ASN B 1 104 ? 25.412  44.851 47.209 1.00 17.88  ? 303 ASN B CB  1 
ATOM   2930 C CG  . ASN B 1 104 ? 25.037  43.735 48.150 1.00 20.97  ? 303 ASN B CG  1 
ATOM   2931 O OD1 . ASN B 1 104 ? 23.857  43.394 48.288 1.00 23.55  ? 303 ASN B OD1 1 
ATOM   2932 N ND2 . ASN B 1 104 ? 26.044  43.140 48.797 1.00 21.33  ? 303 ASN B ND2 1 
ATOM   2933 N N   . ASP B 1 105 ? 24.923  45.435 44.208 1.00 11.41  ? 304 ASP B N   1 
ATOM   2934 C CA  . ASP B 1 105 ? 24.068  45.483 43.026 1.00 8.94   ? 304 ASP B CA  1 
ATOM   2935 C C   . ASP B 1 105 ? 24.790  44.830 41.849 1.00 6.55   ? 304 ASP B C   1 
ATOM   2936 O O   . ASP B 1 105 ? 24.163  44.347 40.915 1.00 6.55   ? 304 ASP B O   1 
ATOM   2937 C CB  . ASP B 1 105 ? 23.709  46.927 42.655 1.00 11.68  ? 304 ASP B CB  1 
ATOM   2938 C CG  . ASP B 1 105 ? 22.719  47.564 43.619 1.00 12.51  ? 304 ASP B CG  1 
ATOM   2939 O OD1 . ASP B 1 105 ? 21.821  46.858 44.133 1.00 12.28  ? 304 ASP B OD1 1 
ATOM   2940 O OD2 . ASP B 1 105 ? 22.835  48.788 43.839 1.00 13.66  ? 304 ASP B OD2 1 
ATOM   2941 N N   . GLN B 1 106 ? 26.117  44.839 41.889 1.00 6.55   ? 305 GLN B N   1 
ATOM   2942 C CA  . GLN B 1 106 ? 26.906  44.206 40.842 1.00 6.55   ? 305 GLN B CA  1 
ATOM   2943 C C   . GLN B 1 106 ? 26.602  42.713 40.845 1.00 6.55   ? 305 GLN B C   1 
ATOM   2944 O O   . GLN B 1 106 ? 26.606  42.061 39.816 1.00 6.55   ? 305 GLN B O   1 
ATOM   2945 C CB  . GLN B 1 106 ? 28.396  44.421 41.096 1.00 6.55   ? 305 GLN B CB  1 
ATOM   2946 C CG  . GLN B 1 106 ? 28.919  45.759 40.623 1.00 6.55   ? 305 GLN B CG  1 
ATOM   2947 C CD  . GLN B 1 106 ? 30.368  45.952 40.973 1.00 8.10   ? 305 GLN B CD  1 
ATOM   2948 O OE1 . GLN B 1 106 ? 31.146  45.014 40.937 1.00 9.99   ? 305 GLN B OE1 1 
ATOM   2949 N NE2 . GLN B 1 106 ? 30.745  47.177 41.303 1.00 11.91  ? 305 GLN B NE2 1 
ATOM   2950 N N   . VAL B 1 107 ? 26.341  42.177 42.024 1.00 6.55   ? 306 VAL B N   1 
ATOM   2951 C CA  . VAL B 1 107 ? 26.025  40.773 42.155 1.00 6.55   ? 306 VAL B CA  1 
ATOM   2952 C C   . VAL B 1 107 ? 24.581  40.556 41.772 1.00 6.55   ? 306 VAL B C   1 
ATOM   2953 O O   . VAL B 1 107 ? 24.229  39.505 41.269 1.00 6.55   ? 306 VAL B O   1 
ATOM   2954 C CB  . VAL B 1 107 ? 26.253  40.279 43.599 1.00 6.55   ? 306 VAL B CB  1 
ATOM   2955 C CG1 . VAL B 1 107 ? 25.438  39.036 43.868 1.00 6.55   ? 306 VAL B CG1 1 
ATOM   2956 C CG2 . VAL B 1 107 ? 27.716  39.961 43.799 1.00 6.55   ? 306 VAL B CG2 1 
ATOM   2957 N N   . THR B 1 108 ? 23.743  41.554 42.000 1.00 6.55   ? 307 THR B N   1 
ATOM   2958 C CA  . THR B 1 108 ? 22.328  41.433 41.674 1.00 6.55   ? 307 THR B CA  1 
ATOM   2959 C C   . THR B 1 108 ? 22.055  41.469 40.169 1.00 6.55   ? 307 THR B C   1 
ATOM   2960 O O   . THR B 1 108 ? 21.268  40.674 39.656 1.00 6.55   ? 307 THR B O   1 
ATOM   2961 C CB  . THR B 1 108 ? 21.516  42.553 42.349 1.00 6.55   ? 307 THR B CB  1 
ATOM   2962 O OG1 . THR B 1 108 ? 21.819  42.579 43.749 1.00 6.84   ? 307 THR B OG1 1 
ATOM   2963 C CG2 . THR B 1 108 ? 20.022  42.323 42.163 1.00 6.55   ? 307 THR B CG2 1 
ATOM   2964 N N   . LEU B 1 109 ? 22.708  42.394 39.466 1.00 6.55   ? 308 LEU B N   1 
ATOM   2965 C CA  . LEU B 1 109 ? 22.525  42.543 38.020 1.00 6.55   ? 308 LEU B CA  1 
ATOM   2966 C C   . LEU B 1 109 ? 23.017  41.316 37.266 1.00 6.55   ? 308 LEU B C   1 
ATOM   2967 O O   . LEU B 1 109 ? 22.370  40.858 36.324 1.00 6.55   ? 308 LEU B O   1 
ATOM   2968 C CB  . LEU B 1 109 ? 23.272  43.778 37.498 1.00 6.55   ? 308 LEU B CB  1 
ATOM   2969 C CG  . LEU B 1 109 ? 22.887  45.191 37.935 1.00 6.55   ? 308 LEU B CG  1 
ATOM   2970 C CD1 . LEU B 1 109 ? 23.817  46.177 37.243 1.00 6.55   ? 308 LEU B CD1 1 
ATOM   2971 C CD2 . LEU B 1 109 ? 21.445  45.486 37.592 1.00 6.55   ? 308 LEU B CD2 1 
ATOM   2972 N N   . LEU B 1 110 ? 24.171  40.805 37.685 1.00 6.55   ? 309 LEU B N   1 
ATOM   2973 C CA  . LEU B 1 110 ? 24.772  39.637 37.066 1.00 6.55   ? 309 LEU B CA  1 
ATOM   2974 C C   . LEU B 1 110 ? 24.007  38.377 37.392 1.00 6.81   ? 309 LEU B C   1 
ATOM   2975 O O   . LEU B 1 110 ? 23.811  37.532 36.531 1.00 10.24  ? 309 LEU B O   1 
ATOM   2976 C CB  . LEU B 1 110 ? 26.216  39.476 37.519 1.00 6.55   ? 309 LEU B CB  1 
ATOM   2977 C CG  . LEU B 1 110 ? 27.259  40.012 36.547 1.00 6.55   ? 309 LEU B CG  1 
ATOM   2978 C CD1 . LEU B 1 110 ? 28.641  39.649 37.060 1.00 6.55   ? 309 LEU B CD1 1 
ATOM   2979 C CD2 . LEU B 1 110 ? 27.021  39.412 35.158 1.00 6.55   ? 309 LEU B CD2 1 
ATOM   2980 N N   . LYS B 1 111 ? 23.587  38.250 38.643 1.00 7.37   ? 310 LYS B N   1 
ATOM   2981 C CA  . LYS B 1 111 ? 22.829  37.099 39.096 1.00 6.61   ? 310 LYS B CA  1 
ATOM   2982 C C   . LYS B 1 111 ? 21.498  37.025 38.361 1.00 6.55   ? 310 LYS B C   1 
ATOM   2983 O O   . LYS B 1 111 ? 21.159  36.018 37.765 1.00 6.55   ? 310 LYS B O   1 
ATOM   2984 C CB  . LYS B 1 111 ? 22.583  37.226 40.598 1.00 11.42  ? 310 LYS B CB  1 
ATOM   2985 C CG  . LYS B 1 111 ? 21.558  36.272 41.183 1.00 17.11  ? 310 LYS B CG  1 
ATOM   2986 C CD  . LYS B 1 111 ? 21.059  36.787 42.524 1.00 22.23  ? 310 LYS B CD  1 
ATOM   2987 C CE  . LYS B 1 111 ? 20.038  35.838 43.134 1.00 27.86  ? 310 LYS B CE  1 
ATOM   2988 N NZ  . LYS B 1 111 ? 19.322  36.459 44.294 1.00 29.98  ? 310 LYS B NZ  1 
ATOM   2989 N N   . TYR B 1 112 ? 20.750  38.111 38.388 1.00 6.55   ? 311 TYR B N   1 
ATOM   2990 C CA  . TYR B 1 112 ? 19.444  38.131 37.755 1.00 7.00   ? 311 TYR B CA  1 
ATOM   2991 C C   . TYR B 1 112 ? 19.354  38.106 36.246 1.00 6.95   ? 311 TYR B C   1 
ATOM   2992 O O   . TYR B 1 112 ? 18.319  37.746 35.692 1.00 8.27   ? 311 TYR B O   1 
ATOM   2993 C CB  . TYR B 1 112 ? 18.648  39.320 38.277 1.00 9.88   ? 311 TYR B CB  1 
ATOM   2994 C CG  . TYR B 1 112 ? 17.857  38.970 39.504 1.00 12.61  ? 311 TYR B CG  1 
ATOM   2995 C CD1 . TYR B 1 112 ? 16.725  38.171 39.412 1.00 14.05  ? 311 TYR B CD1 1 
ATOM   2996 C CD2 . TYR B 1 112 ? 18.258  39.399 40.755 1.00 14.26  ? 311 TYR B CD2 1 
ATOM   2997 C CE1 . TYR B 1 112 ? 16.016  37.809 40.529 1.00 15.85  ? 311 TYR B CE1 1 
ATOM   2998 C CE2 . TYR B 1 112 ? 17.555  39.043 41.885 1.00 17.90  ? 311 TYR B CE2 1 
ATOM   2999 C CZ  . TYR B 1 112 ? 16.431  38.246 41.768 1.00 18.24  ? 311 TYR B CZ  1 
ATOM   3000 O OH  . TYR B 1 112 ? 15.714  37.895 42.894 1.00 21.57  ? 311 TYR B OH  1 
ATOM   3001 N N   . GLY B 1 113 ? 20.417  38.490 35.565 1.00 6.57   ? 312 GLY B N   1 
ATOM   3002 C CA  . GLY B 1 113 ? 20.333  38.493 34.129 1.00 6.60   ? 312 GLY B CA  1 
ATOM   3003 C C   . GLY B 1 113 ? 21.461  37.738 33.498 1.00 7.61   ? 312 GLY B C   1 
ATOM   3004 O O   . GLY B 1 113 ? 21.767  37.960 32.338 1.00 9.58   ? 312 GLY B O   1 
ATOM   3005 N N   . VAL B 1 114 ? 22.095  36.840 34.232 1.00 8.19   ? 313 VAL B N   1 
ATOM   3006 C CA  . VAL B 1 114 ? 23.192  36.114 33.625 1.00 8.94   ? 313 VAL B CA  1 
ATOM   3007 C C   . VAL B 1 114 ? 22.647  35.120 32.610 1.00 12.35  ? 313 VAL B C   1 
ATOM   3008 O O   . VAL B 1 114 ? 23.284  34.860 31.588 1.00 14.31  ? 313 VAL B O   1 
ATOM   3009 C CB  . VAL B 1 114 ? 24.035  35.371 34.663 1.00 6.67   ? 313 VAL B CB  1 
ATOM   3010 C CG1 . VAL B 1 114 ? 23.419  34.023 34.988 1.00 6.55   ? 313 VAL B CG1 1 
ATOM   3011 C CG2 . VAL B 1 114 ? 25.441  35.230 34.149 1.00 6.67   ? 313 VAL B CG2 1 
ATOM   3012 N N   . TYR B 1 115 ? 21.460  34.578 32.883 1.00 14.47  ? 314 TYR B N   1 
ATOM   3013 C CA  . TYR B 1 115 ? 20.839  33.613 31.978 1.00 13.81  ? 314 TYR B CA  1 
ATOM   3014 C C   . TYR B 1 115 ? 20.378  34.234 30.680 1.00 11.79  ? 314 TYR B C   1 
ATOM   3015 O O   . TYR B 1 115 ? 20.623  33.695 29.606 1.00 10.43  ? 314 TYR B O   1 
ATOM   3016 C CB  . TYR B 1 115 ? 19.641  32.949 32.635 1.00 17.53  ? 314 TYR B CB  1 
ATOM   3017 C CG  . TYR B 1 115 ? 20.003  31.897 33.631 1.00 19.28  ? 314 TYR B CG  1 
ATOM   3018 C CD1 . TYR B 1 115 ? 21.027  31.000 33.372 1.00 19.90  ? 314 TYR B CD1 1 
ATOM   3019 C CD2 . TYR B 1 115 ? 19.307  31.782 34.826 1.00 21.48  ? 314 TYR B CD2 1 
ATOM   3020 C CE1 . TYR B 1 115 ? 21.353  30.017 34.277 1.00 23.71  ? 314 TYR B CE1 1 
ATOM   3021 C CE2 . TYR B 1 115 ? 19.622  30.797 35.743 1.00 24.66  ? 314 TYR B CE2 1 
ATOM   3022 C CZ  . TYR B 1 115 ? 20.649  29.914 35.466 1.00 25.19  ? 314 TYR B CZ  1 
ATOM   3023 O OH  . TYR B 1 115 ? 20.970  28.932 36.381 1.00 28.16  ? 314 TYR B OH  1 
ATOM   3024 N N   . GLU B 1 116 ? 19.683  35.356 30.783 1.00 10.20  ? 315 GLU B N   1 
ATOM   3025 C CA  . GLU B 1 116 ? 19.211  36.030 29.595 1.00 10.85  ? 315 GLU B CA  1 
ATOM   3026 C C   . GLU B 1 116 ? 20.367  36.252 28.634 1.00 9.80   ? 315 GLU B C   1 
ATOM   3027 O O   . GLU B 1 116 ? 20.212  36.114 27.423 1.00 10.05  ? 315 GLU B O   1 
ATOM   3028 C CB  . GLU B 1 116 ? 18.579  37.365 29.967 1.00 13.16  ? 315 GLU B CB  1 
ATOM   3029 C CG  . GLU B 1 116 ? 17.141  37.254 30.444 1.00 17.08  ? 315 GLU B CG  1 
ATOM   3030 C CD  . GLU B 1 116 ? 16.592  38.571 30.958 1.00 18.55  ? 315 GLU B CD  1 
ATOM   3031 O OE1 . GLU B 1 116 ? 16.841  39.621 30.318 1.00 20.02  ? 315 GLU B OE1 1 
ATOM   3032 O OE2 . GLU B 1 116 ? 15.902  38.551 31.999 1.00 18.33  ? 315 GLU B OE2 1 
ATOM   3033 N N   . ALA B 1 117 ? 21.531  36.580 29.186 1.00 7.84   ? 316 ALA B N   1 
ATOM   3034 C CA  . ALA B 1 117 ? 22.720  36.835 28.383 1.00 6.83   ? 316 ALA B CA  1 
ATOM   3035 C C   . ALA B 1 117 ? 23.249  35.596 27.681 1.00 7.07   ? 316 ALA B C   1 
ATOM   3036 O O   . ALA B 1 117 ? 23.699  35.673 26.537 1.00 7.87   ? 316 ALA B O   1 
ATOM   3037 C CB  . ALA B 1 117 ? 23.810  37.430 29.248 1.00 6.55   ? 316 ALA B CB  1 
ATOM   3038 N N   . ILE B 1 118 ? 23.200  34.456 28.363 1.00 6.80   ? 317 ILE B N   1 
ATOM   3039 C CA  . ILE B 1 118 ? 23.693  33.211 27.790 1.00 6.55   ? 317 ILE B CA  1 
ATOM   3040 C C   . ILE B 1 118 ? 22.909  32.727 26.574 1.00 6.55   ? 317 ILE B C   1 
ATOM   3041 O O   . ILE B 1 118 ? 23.503  32.302 25.576 1.00 6.55   ? 317 ILE B O   1 
ATOM   3042 C CB  . ILE B 1 118 ? 23.726  32.105 28.843 1.00 6.55   ? 317 ILE B CB  1 
ATOM   3043 C CG1 . ILE B 1 118 ? 24.808  32.427 29.874 1.00 7.67   ? 317 ILE B CG1 1 
ATOM   3044 C CG2 . ILE B 1 118 ? 24.001  30.764 28.192 1.00 6.55   ? 317 ILE B CG2 1 
ATOM   3045 C CD1 . ILE B 1 118 ? 25.093  31.291 30.840 1.00 10.24  ? 317 ILE B CD1 1 
ATOM   3046 N N   . PHE B 1 119 ? 21.582  32.786 26.649 1.00 6.55   ? 318 PHE B N   1 
ATOM   3047 C CA  . PHE B 1 119 ? 20.757  32.354 25.526 1.00 6.55   ? 318 PHE B CA  1 
ATOM   3048 C C   . PHE B 1 119 ? 20.865  33.335 24.363 1.00 6.55   ? 318 PHE B C   1 
ATOM   3049 O O   . PHE B 1 119 ? 20.843  32.931 23.205 1.00 6.55   ? 318 PHE B O   1 
ATOM   3050 C CB  . PHE B 1 119 ? 19.300  32.174 25.966 1.00 6.55   ? 318 PHE B CB  1 
ATOM   3051 C CG  . PHE B 1 119 ? 19.124  31.138 27.043 1.00 6.55   ? 318 PHE B CG  1 
ATOM   3052 C CD1 . PHE B 1 119 ? 19.857  29.955 27.012 1.00 6.55   ? 318 PHE B CD1 1 
ATOM   3053 C CD2 . PHE B 1 119 ? 18.250  31.353 28.097 1.00 6.55   ? 318 PHE B CD2 1 
ATOM   3054 C CE1 . PHE B 1 119 ? 19.724  29.008 28.020 1.00 6.55   ? 318 PHE B CE1 1 
ATOM   3055 C CE2 . PHE B 1 119 ? 18.111  30.413 29.107 1.00 6.55   ? 318 PHE B CE2 1 
ATOM   3056 C CZ  . PHE B 1 119 ? 18.851  29.238 29.070 1.00 6.55   ? 318 PHE B CZ  1 
ATOM   3057 N N   . ALA B 1 120 ? 21.001  34.619 24.671 1.00 6.55   ? 319 ALA B N   1 
ATOM   3058 C CA  . ALA B 1 120 ? 21.144  35.628 23.637 1.00 6.55   ? 319 ALA B CA  1 
ATOM   3059 C C   . ALA B 1 120 ? 22.406  35.325 22.851 1.00 6.55   ? 319 ALA B C   1 
ATOM   3060 O O   . ALA B 1 120 ? 22.440  35.431 21.626 1.00 6.55   ? 319 ALA B O   1 
ATOM   3061 C CB  . ALA B 1 120 ? 21.254  36.990 24.257 1.00 6.55   ? 319 ALA B CB  1 
ATOM   3062 N N   . MET B 1 121 ? 23.452  34.932 23.566 1.00 7.14   ? 320 MET B N   1 
ATOM   3063 C CA  . MET B 1 121 ? 24.725  34.640 22.925 1.00 9.27   ? 320 MET B CA  1 
ATOM   3064 C C   . MET B 1 121 ? 24.886  33.235 22.352 1.00 12.31  ? 320 MET B C   1 
ATOM   3065 O O   . MET B 1 121 ? 25.723  33.020 21.476 1.00 15.25  ? 320 MET B O   1 
ATOM   3066 C CB  . MET B 1 121 ? 25.869  34.908 23.895 1.00 6.55   ? 320 MET B CB  1 
ATOM   3067 C CG  . MET B 1 121 ? 25.937  36.332 24.396 1.00 6.55   ? 320 MET B CG  1 
ATOM   3068 S SD  . MET B 1 121 ? 27.610  36.694 24.947 1.00 6.55   ? 320 MET B SD  1 
ATOM   3069 C CE  . MET B 1 121 ? 27.589  35.983 26.588 1.00 6.55   ? 320 MET B CE  1 
ATOM   3070 N N   . LEU B 1 122 ? 24.107  32.276 22.839 1.00 13.64  ? 321 LEU B N   1 
ATOM   3071 C CA  . LEU B 1 122 ? 24.232  30.913 22.330 1.00 13.89  ? 321 LEU B CA  1 
ATOM   3072 C C   . LEU B 1 122 ? 23.926  30.862 20.835 1.00 13.55  ? 321 LEU B C   1 
ATOM   3073 O O   . LEU B 1 122 ? 24.587  30.155 20.077 1.00 13.75  ? 321 LEU B O   1 
ATOM   3074 C CB  . LEU B 1 122 ? 23.282  29.959 23.075 1.00 13.95  ? 321 LEU B CB  1 
ATOM   3075 C CG  . LEU B 1 122 ? 23.781  28.972 24.142 1.00 11.51  ? 321 LEU B CG  1 
ATOM   3076 C CD1 . LEU B 1 122 ? 22.611  28.075 24.542 1.00 11.86  ? 321 LEU B CD1 1 
ATOM   3077 C CD2 . LEU B 1 122 ? 24.927  28.115 23.616 1.00 10.54  ? 321 LEU B CD2 1 
ATOM   3078 N N   . SER B 1 123 ? 22.929  31.631 20.422 1.00 13.55  ? 322 SER B N   1 
ATOM   3079 C CA  . SER B 1 123 ? 22.488  31.661 19.033 1.00 15.24  ? 322 SER B CA  1 
ATOM   3080 C C   . SER B 1 123 ? 23.574  31.976 18.012 1.00 15.38  ? 322 SER B C   1 
ATOM   3081 O O   . SER B 1 123 ? 23.392  31.770 16.811 1.00 15.10  ? 322 SER B O   1 
ATOM   3082 C CB  . SER B 1 123 ? 21.354  32.667 18.889 1.00 16.37  ? 322 SER B CB  1 
ATOM   3083 O OG  . SER B 1 123 ? 20.834  32.991 20.164 1.00 19.46  ? 322 SER B OG  1 
ATOM   3084 N N   . SER B 1 124 ? 24.703  32.482 18.480 1.00 14.75  ? 323 SER B N   1 
ATOM   3085 C CA  . SER B 1 124 ? 25.790  32.817 17.577 1.00 14.15  ? 323 SER B CA  1 
ATOM   3086 C C   . SER B 1 124 ? 26.562  31.541 17.264 1.00 14.01  ? 323 SER B C   1 
ATOM   3087 O O   . SER B 1 124 ? 27.277  31.440 16.259 1.00 14.60  ? 323 SER B O   1 
ATOM   3088 C CB  . SER B 1 124 ? 26.702  33.831 18.258 1.00 12.32  ? 323 SER B CB  1 
ATOM   3089 O OG  . SER B 1 124 ? 25.921  34.807 18.919 1.00 12.39  ? 323 SER B OG  1 
ATOM   3090 N N   . VAL B 1 125 ? 26.364  30.557 18.130 1.00 13.22  ? 324 VAL B N   1 
ATOM   3091 C CA  . VAL B 1 125 ? 27.050  29.279 18.056 1.00 11.86  ? 324 VAL B CA  1 
ATOM   3092 C C   . VAL B 1 125 ? 26.168  28.130 17.551 1.00 10.65  ? 324 VAL B C   1 
ATOM   3093 O O   . VAL B 1 125 ? 26.565  26.968 17.565 1.00 7.64   ? 324 VAL B O   1 
ATOM   3094 C CB  . VAL B 1 125 ? 27.653  28.987 19.465 1.00 12.59  ? 324 VAL B CB  1 
ATOM   3095 C CG1 . VAL B 1 125 ? 27.081  27.732 20.056 1.00 15.24  ? 324 VAL B CG1 1 
ATOM   3096 C CG2 . VAL B 1 125 ? 29.158  28.929 19.383 1.00 13.17  ? 324 VAL B CG2 1 
ATOM   3097 N N   . MET B 1 126 ? 24.978  28.471 17.074 1.00 12.23  ? 325 MET B N   1 
ATOM   3098 C CA  . MET B 1 126 ? 24.040  27.479 16.555 1.00 15.17  ? 325 MET B CA  1 
ATOM   3099 C C   . MET B 1 126 ? 23.711  27.693 15.059 1.00 16.56  ? 325 MET B C   1 
ATOM   3100 O O   . MET B 1 126 ? 24.099  28.691 14.452 1.00 16.76  ? 325 MET B O   1 
ATOM   3101 C CB  . MET B 1 126 ? 22.723  27.537 17.351 1.00 14.41  ? 325 MET B CB  1 
ATOM   3102 C CG  . MET B 1 126 ? 22.833  27.375 18.862 1.00 14.22  ? 325 MET B CG  1 
ATOM   3103 S SD  . MET B 1 126 ? 21.224  27.488 19.679 1.00 12.18  ? 325 MET B SD  1 
ATOM   3104 C CE  . MET B 1 126 ? 21.480  26.397 21.072 1.00 13.56  ? 325 MET B CE  1 
ATOM   3105 N N   . ASN B 1 127 ? 23.008  26.725 14.479 1.00 18.08  ? 326 ASN B N   1 
ATOM   3106 C CA  . ASN B 1 127 ? 22.535  26.781 13.096 1.00 21.03  ? 326 ASN B CA  1 
ATOM   3107 C C   . ASN B 1 127 ? 21.304  25.876 13.105 1.00 22.60  ? 326 ASN B C   1 
ATOM   3108 O O   . ASN B 1 127 ? 20.995  25.278 14.137 1.00 22.18  ? 326 ASN B O   1 
ATOM   3109 C CB  . ASN B 1 127 ? 23.594  26.298 12.077 1.00 21.12  ? 326 ASN B CB  1 
ATOM   3110 C CG  . ASN B 1 127 ? 24.026  24.855 12.293 1.00 21.86  ? 326 ASN B CG  1 
ATOM   3111 O OD1 . ASN B 1 127 ? 23.379  24.097 13.011 1.00 22.19  ? 326 ASN B OD1 1 
ATOM   3112 N ND2 . ASN B 1 127 ? 25.124  24.466 11.651 1.00 21.23  ? 326 ASN B ND2 1 
ATOM   3113 N N   . LYS B 1 128 ? 20.592  25.759 11.991 1.00 24.04  ? 327 LYS B N   1 
ATOM   3114 C CA  . LYS B 1 128 ? 19.389  24.931 12.000 1.00 25.44  ? 327 LYS B CA  1 
ATOM   3115 C C   . LYS B 1 128 ? 19.611  23.471 12.381 1.00 24.66  ? 327 LYS B C   1 
ATOM   3116 O O   . LYS B 1 128 ? 18.649  22.787 12.727 1.00 24.77  ? 327 LYS B O   1 
ATOM   3117 C CB  . LYS B 1 128 ? 18.683  24.973 10.642 1.00 29.13  ? 327 LYS B CB  1 
ATOM   3118 C CG  . LYS B 1 128 ? 19.136  23.889 9.673  1.00 34.24  ? 327 LYS B CG  1 
ATOM   3119 C CD  . LYS B 1 128 ? 18.089  23.619 8.598  1.00 39.53  ? 327 LYS B CD  1 
ATOM   3120 C CE  . LYS B 1 128 ? 18.362  22.322 7.838  1.00 41.28  ? 327 LYS B CE  1 
ATOM   3121 N NZ  . LYS B 1 128 ? 19.654  22.326 7.079  1.00 42.03  ? 327 LYS B NZ  1 
ATOM   3122 N N   . ASP B 1 129 ? 20.861  23.000 12.333 1.00 24.24  ? 328 ASP B N   1 
ATOM   3123 C CA  . ASP B 1 129 ? 21.186  21.593 12.634 1.00 23.72  ? 328 ASP B CA  1 
ATOM   3124 C C   . ASP B 1 129 ? 21.882  21.255 13.959 1.00 23.20  ? 328 ASP B C   1 
ATOM   3125 O O   . ASP B 1 129 ? 22.163  20.087 14.230 1.00 23.29  ? 328 ASP B O   1 
ATOM   3126 C CB  . ASP B 1 129 ? 22.035  20.987 11.507 1.00 22.65  ? 328 ASP B CB  1 
ATOM   3127 C CG  . ASP B 1 129 ? 21.380  21.101 10.154 1.00 23.19  ? 328 ASP B CG  1 
ATOM   3128 O OD1 . ASP B 1 129 ? 20.194  20.726 10.043 1.00 23.96  ? 328 ASP B OD1 1 
ATOM   3129 O OD2 . ASP B 1 129 ? 22.051  21.559 9.201  1.00 23.65  ? 328 ASP B OD2 1 
ATOM   3130 N N   . GLY B 1 130 ? 22.169  22.246 14.788 1.00 23.11  ? 329 GLY B N   1 
ATOM   3131 C CA  . GLY B 1 130 ? 22.838  21.936 16.039 1.00 21.16  ? 329 GLY B CA  1 
ATOM   3132 C C   . GLY B 1 130 ? 23.693  23.076 16.542 1.00 19.88  ? 329 GLY B C   1 
ATOM   3133 O O   . GLY B 1 130 ? 23.616  24.190 16.026 1.00 20.33  ? 329 GLY B O   1 
ATOM   3134 N N   . MET B 1 131 ? 24.531  22.805 17.533 1.00 18.24  ? 330 MET B N   1 
ATOM   3135 C CA  . MET B 1 131 ? 25.352  23.867 18.089 1.00 17.46  ? 330 MET B CA  1 
ATOM   3136 C C   . MET B 1 131 ? 26.748  23.461 18.536 1.00 15.96  ? 330 MET B C   1 
ATOM   3137 O O   . MET B 1 131 ? 26.971  22.369 19.049 1.00 15.16  ? 330 MET B O   1 
ATOM   3138 C CB  . MET B 1 131 ? 24.628  24.494 19.270 1.00 19.38  ? 330 MET B CB  1 
ATOM   3139 C CG  . MET B 1 131 ? 24.397  23.510 20.400 1.00 21.73  ? 330 MET B CG  1 
ATOM   3140 S SD  . MET B 1 131 ? 24.251  24.366 21.973 1.00 27.56  ? 330 MET B SD  1 
ATOM   3141 C CE  . MET B 1 131 ? 25.921  24.987 22.175 1.00 26.82  ? 330 MET B CE  1 
ATOM   3142 N N   . LEU B 1 132 ? 27.682  24.383 18.351 1.00 14.85  ? 331 LEU B N   1 
ATOM   3143 C CA  . LEU B 1 132 ? 29.069  24.181 18.723 1.00 13.80  ? 331 LEU B CA  1 
ATOM   3144 C C   . LEU B 1 132 ? 29.247  24.075 20.225 1.00 14.08  ? 331 LEU B C   1 
ATOM   3145 O O   . LEU B 1 132 ? 28.648  24.835 20.987 1.00 13.24  ? 331 LEU B O   1 
ATOM   3146 C CB  . LEU B 1 132 ? 29.909  25.345 18.210 1.00 12.23  ? 331 LEU B CB  1 
ATOM   3147 C CG  . LEU B 1 132 ? 30.362  25.278 16.761 1.00 12.54  ? 331 LEU B CG  1 
ATOM   3148 C CD1 . LEU B 1 132 ? 30.702  26.659 16.243 1.00 12.04  ? 331 LEU B CD1 1 
ATOM   3149 C CD2 . LEU B 1 132 ? 31.557  24.354 16.694 1.00 14.10  ? 331 LEU B CD2 1 
ATOM   3150 N N   . VAL B 1 133 ? 30.088  23.136 20.647 1.00 15.70  ? 332 VAL B N   1 
ATOM   3151 C CA  . VAL B 1 133 ? 30.376  22.943 22.065 1.00 17.60  ? 332 VAL B CA  1 
ATOM   3152 C C   . VAL B 1 133 ? 31.885  22.853 22.310 1.00 17.67  ? 332 VAL B C   1 
ATOM   3153 O O   . VAL B 1 133 ? 32.661  22.597 21.401 1.00 17.48  ? 332 VAL B O   1 
ATOM   3154 C CB  . VAL B 1 133 ? 29.713  21.646 22.612 1.00 18.08  ? 332 VAL B CB  1 
ATOM   3155 C CG1 . VAL B 1 133 ? 28.241  21.618 22.256 1.00 18.94  ? 332 VAL B CG1 1 
ATOM   3156 C CG2 . VAL B 1 133 ? 30.405  20.422 22.050 1.00 19.84  ? 332 VAL B CG2 1 
ATOM   3157 N N   . ALA B 1 134 ? 32.295  23.092 23.543 1.00 19.42  ? 333 ALA B N   1 
ATOM   3158 C CA  . ALA B 1 134 ? 33.699  22.986 23.917 1.00 22.06  ? 333 ALA B CA  1 
ATOM   3159 C C   . ALA B 1 134 ? 34.701  23.847 23.172 1.00 23.42  ? 333 ALA B C   1 
ATOM   3160 O O   . ALA B 1 134 ? 35.715  23.352 22.695 1.00 23.91  ? 333 ALA B O   1 
ATOM   3161 C CB  . ALA B 1 134 ? 34.132  21.534 23.838 1.00 22.20  ? 333 ALA B CB  1 
ATOM   3162 N N   . TYR B 1 135 ? 34.435  25.137 23.081 1.00 26.12  ? 334 TYR B N   1 
ATOM   3163 C CA  . TYR B 1 135 ? 35.372  26.026 22.422 1.00 28.90  ? 334 TYR B CA  1 
ATOM   3164 C C   . TYR B 1 135 ? 35.387  25.682 20.942 1.00 29.19  ? 334 TYR B C   1 
ATOM   3165 O O   . TYR B 1 135 ? 36.446  25.454 20.359 1.00 30.34  ? 334 TYR B O   1 
ATOM   3166 C CB  . TYR B 1 135 ? 36.769  25.854 23.045 1.00 31.53  ? 334 TYR B CB  1 
ATOM   3167 C CG  . TYR B 1 135 ? 36.764  25.845 24.565 1.00 36.11  ? 334 TYR B CG  1 
ATOM   3168 C CD1 . TYR B 1 135 ? 35.565  25.847 25.275 1.00 39.40  ? 334 TYR B CD1 1 
ATOM   3169 C CD2 . TYR B 1 135 ? 37.950  25.797 25.295 1.00 39.14  ? 334 TYR B CD2 1 
ATOM   3170 C CE1 . TYR B 1 135 ? 35.534  25.795 26.662 1.00 42.13  ? 334 TYR B CE1 1 
ATOM   3171 C CE2 . TYR B 1 135 ? 37.934  25.748 26.701 1.00 41.85  ? 334 TYR B CE2 1 
ATOM   3172 C CZ  . TYR B 1 135 ? 36.715  25.742 27.372 1.00 42.54  ? 334 TYR B CZ  1 
ATOM   3173 O OH  . TYR B 1 135 ? 36.657  25.646 28.744 1.00 43.11  ? 334 TYR B OH  1 
ATOM   3174 N N   . GLY B 1 136 ? 34.189  25.636 20.356 1.00 29.12  ? 335 GLY B N   1 
ATOM   3175 C CA  . GLY B 1 136 ? 34.016  25.333 18.943 1.00 27.33  ? 335 GLY B CA  1 
ATOM   3176 C C   . GLY B 1 136 ? 34.644  24.033 18.473 1.00 26.56  ? 335 GLY B C   1 
ATOM   3177 O O   . GLY B 1 136 ? 34.614  23.710 17.288 1.00 26.57  ? 335 GLY B O   1 
ATOM   3178 N N   . ASN B 1 137 ? 35.210  23.277 19.401 1.00 25.18  ? 336 ASN B N   1 
ATOM   3179 C CA  . ASN B 1 137 ? 35.858  22.025 19.058 1.00 24.16  ? 336 ASN B CA  1 
ATOM   3180 C C   . ASN B 1 137 ? 34.898  20.916 18.651 1.00 23.26  ? 336 ASN B C   1 
ATOM   3181 O O   . ASN B 1 137 ? 35.179  20.172 17.724 1.00 23.84  ? 336 ASN B O   1 
ATOM   3182 C CB  . ASN B 1 137 ? 36.715  21.565 20.227 1.00 25.04  ? 336 ASN B CB  1 
ATOM   3183 C CG  . ASN B 1 137 ? 38.022  22.321 20.322 1.00 26.03  ? 336 ASN B CG  1 
ATOM   3184 O OD1 . ASN B 1 137 ? 38.733  22.248 21.329 1.00 24.31  ? 336 ASN B OD1 1 
ATOM   3185 N ND2 . ASN B 1 137 ? 38.356  23.045 19.261 1.00 28.90  ? 336 ASN B ND2 1 
ATOM   3186 N N   . GLY B 1 138 ? 33.774  20.800 19.349 1.00 22.06  ? 337 GLY B N   1 
ATOM   3187 C CA  . GLY B 1 138 ? 32.803  19.773 19.022 1.00 19.15  ? 337 GLY B CA  1 
ATOM   3188 C C   . GLY B 1 138 ? 31.519  20.396 18.526 1.00 18.04  ? 337 GLY B C   1 
ATOM   3189 O O   . GLY B 1 138 ? 31.325  21.597 18.657 1.00 18.66  ? 337 GLY B O   1 
ATOM   3190 N N   . PHE B 1 139 ? 30.641  19.592 17.944 1.00 17.14  ? 338 PHE B N   1 
ATOM   3191 C CA  . PHE B 1 139 ? 29.372  20.098 17.440 1.00 16.80  ? 338 PHE B CA  1 
ATOM   3192 C C   . PHE B 1 139 ? 28.313  19.054 17.693 1.00 16.91  ? 338 PHE B C   1 
ATOM   3193 O O   . PHE B 1 139 ? 28.268  18.054 16.989 1.00 18.16  ? 338 PHE B O   1 
ATOM   3194 C CB  . PHE B 1 139 ? 29.465  20.384 15.946 1.00 14.40  ? 338 PHE B CB  1 
ATOM   3195 C CG  . PHE B 1 139 ? 28.141  20.639 15.295 1.00 15.51  ? 338 PHE B CG  1 
ATOM   3196 C CD1 . PHE B 1 139 ? 27.247  19.602 15.077 1.00 16.84  ? 338 PHE B CD1 1 
ATOM   3197 C CD2 . PHE B 1 139 ? 27.789  21.912 14.879 1.00 18.32  ? 338 PHE B CD2 1 
ATOM   3198 C CE1 . PHE B 1 139 ? 26.018  19.824 14.451 1.00 18.97  ? 338 PHE B CE1 1 
ATOM   3199 C CE2 . PHE B 1 139 ? 26.554  22.150 14.246 1.00 19.59  ? 338 PHE B CE2 1 
ATOM   3200 C CZ  . PHE B 1 139 ? 25.671  21.103 14.034 1.00 18.85  ? 338 PHE B CZ  1 
ATOM   3201 N N   . ILE B 1 140 ? 27.463  19.290 18.691 1.00 16.80  ? 339 ILE B N   1 
ATOM   3202 C CA  . ILE B 1 140 ? 26.401  18.354 19.053 1.00 16.30  ? 339 ILE B CA  1 
ATOM   3203 C C   . ILE B 1 140 ? 25.115  18.604 18.268 1.00 16.60  ? 339 ILE B C   1 
ATOM   3204 O O   . ILE B 1 140 ? 24.553  19.694 18.305 1.00 15.53  ? 339 ILE B O   1 
ATOM   3205 C CB  . ILE B 1 140 ? 26.123  18.429 20.561 1.00 15.85  ? 339 ILE B CB  1 
ATOM   3206 C CG1 . ILE B 1 140 ? 25.043  17.428 20.956 1.00 15.10  ? 339 ILE B CG1 1 
ATOM   3207 C CG2 . ILE B 1 140 ? 25.711  19.829 20.933 1.00 18.73  ? 339 ILE B CG2 1 
ATOM   3208 C CD1 . ILE B 1 140 ? 24.872  17.305 22.447 1.00 10.91  ? 339 ILE B CD1 1 
ATOM   3209 N N   . THR B 1 141 ? 24.661  17.569 17.564 1.00 19.41  ? 340 THR B N   1 
ATOM   3210 C CA  . THR B 1 141 ? 23.472  17.628 16.713 1.00 21.82  ? 340 THR B CA  1 
ATOM   3211 C C   . THR B 1 141 ? 22.139  17.927 17.367 1.00 22.83  ? 340 THR B C   1 
ATOM   3212 O O   . THR B 1 141 ? 21.770  17.335 18.376 1.00 22.61  ? 340 THR B O   1 
ATOM   3213 C CB  . THR B 1 141 ? 23.325  16.339 15.905 1.00 22.30  ? 340 THR B CB  1 
ATOM   3214 O OG1 . THR B 1 141 ? 24.265  16.364 14.824 1.00 23.56  ? 340 THR B OG1 1 
ATOM   3215 C CG2 . THR B 1 141 ? 21.912  16.205 15.358 1.00 22.83  ? 340 THR B CG2 1 
ATOM   3216 N N   . ARG B 1 142 ? 21.408  18.846 16.750 1.00 24.30  ? 341 ARG B N   1 
ATOM   3217 C CA  . ARG B 1 142 ? 20.114  19.253 17.257 1.00 26.34  ? 341 ARG B CA  1 
ATOM   3218 C C   . ARG B 1 142 ? 19.176  18.068 17.370 1.00 29.20  ? 341 ARG B C   1 
ATOM   3219 O O   . ARG B 1 142 ? 18.472  17.923 18.367 1.00 30.50  ? 341 ARG B O   1 
ATOM   3220 C CB  . ARG B 1 142 ? 19.508  20.295 16.329 1.00 23.77  ? 341 ARG B CB  1 
ATOM   3221 C CG  . ARG B 1 142 ? 18.119  20.774 16.712 1.00 22.11  ? 341 ARG B CG  1 
ATOM   3222 C CD  . ARG B 1 142 ? 17.637  21.736 15.638 1.00 22.43  ? 341 ARG B CD  1 
ATOM   3223 N NE  . ARG B 1 142 ? 16.443  22.488 16.003 1.00 20.52  ? 341 ARG B NE  1 
ATOM   3224 C CZ  . ARG B 1 142 ? 15.944  23.473 15.264 1.00 19.94  ? 341 ARG B CZ  1 
ATOM   3225 N NH1 . ARG B 1 142 ? 16.531  23.820 14.123 1.00 17.53  ? 341 ARG B NH1 1 
ATOM   3226 N NH2 . ARG B 1 142 ? 14.863  24.116 15.667 1.00 21.30  ? 341 ARG B NH2 1 
ATOM   3227 N N   . GLU B 1 143 ? 19.180  17.216 16.350 1.00 31.78  ? 342 GLU B N   1 
ATOM   3228 C CA  . GLU B 1 143 ? 18.302  16.053 16.323 1.00 32.92  ? 342 GLU B CA  1 
ATOM   3229 C C   . GLU B 1 143 ? 18.663  15.032 17.385 1.00 31.90  ? 342 GLU B C   1 
ATOM   3230 O O   . GLU B 1 143 ? 17.816  14.244 17.788 1.00 32.14  ? 342 GLU B O   1 
ATOM   3231 C CB  . GLU B 1 143 ? 18.331  15.407 14.938 1.00 37.02  ? 342 GLU B CB  1 
ATOM   3232 C CG  . GLU B 1 143 ? 17.030  14.732 14.522 1.00 42.71  ? 342 GLU B CG  1 
ATOM   3233 C CD  . GLU B 1 143 ? 15.812  15.648 14.641 1.00 46.20  ? 342 GLU B CD  1 
ATOM   3234 O OE1 . GLU B 1 143 ? 15.942  16.873 14.402 1.00 46.84  ? 342 GLU B OE1 1 
ATOM   3235 O OE2 . GLU B 1 143 ? 14.716  15.131 14.962 1.00 48.17  ? 342 GLU B OE2 1 
ATOM   3236 N N   . PHE B 1 144 ? 19.915  15.041 17.835 1.00 31.38  ? 343 PHE B N   1 
ATOM   3237 C CA  . PHE B 1 144 ? 20.344  14.111 18.878 1.00 31.48  ? 343 PHE B CA  1 
ATOM   3238 C C   . PHE B 1 144 ? 19.837  14.541 20.250 1.00 32.54  ? 343 PHE B C   1 
ATOM   3239 O O   . PHE B 1 144 ? 19.557  13.706 21.095 1.00 31.04  ? 343 PHE B O   1 
ATOM   3240 C CB  . PHE B 1 144 ? 21.876  13.995 18.929 1.00 30.00  ? 343 PHE B CB  1 
ATOM   3241 C CG  . PHE B 1 144 ? 22.400  13.358 20.205 1.00 28.72  ? 343 PHE B CG  1 
ATOM   3242 C CD1 . PHE B 1 144 ? 21.764  12.251 20.764 1.00 30.18  ? 343 PHE B CD1 1 
ATOM   3243 C CD2 . PHE B 1 144 ? 23.538  13.855 20.838 1.00 27.65  ? 343 PHE B CD2 1 
ATOM   3244 C CE1 . PHE B 1 144 ? 22.249  11.647 21.936 1.00 30.24  ? 343 PHE B CE1 1 
ATOM   3245 C CE2 . PHE B 1 144 ? 24.033  13.255 22.011 1.00 28.17  ? 343 PHE B CE2 1 
ATOM   3246 C CZ  . PHE B 1 144 ? 23.385  12.151 22.557 1.00 28.40  ? 343 PHE B CZ  1 
ATOM   3247 N N   . LEU B 1 145 ? 19.720  15.846 20.467 1.00 34.57  ? 344 LEU B N   1 
ATOM   3248 C CA  . LEU B 1 145 ? 19.257  16.364 21.748 1.00 35.90  ? 344 LEU B CA  1 
ATOM   3249 C C   . LEU B 1 145 ? 17.771  16.123 21.994 1.00 38.42  ? 344 LEU B C   1 
ATOM   3250 O O   . LEU B 1 145 ? 17.367  15.760 23.102 1.00 38.73  ? 344 LEU B O   1 
ATOM   3251 C CB  . LEU B 1 145 ? 19.570  17.858 21.835 1.00 33.28  ? 344 LEU B CB  1 
ATOM   3252 C CG  . LEU B 1 145 ? 21.047  18.128 22.090 1.00 29.73  ? 344 LEU B CG  1 
ATOM   3253 C CD1 . LEU B 1 145 ? 21.371  19.583 21.864 1.00 28.42  ? 344 LEU B CD1 1 
ATOM   3254 C CD2 . LEU B 1 145 ? 21.366  17.701 23.504 1.00 27.41  ? 344 LEU B CD2 1 
ATOM   3255 N N   . LYS B 1 146 ? 16.964  16.314 20.956 1.00 40.41  ? 345 LYS B N   1 
ATOM   3256 C CA  . LYS B 1 146 ? 15.528  16.127 21.068 1.00 42.84  ? 345 LYS B CA  1 
ATOM   3257 C C   . LYS B 1 146 ? 15.130  14.660 21.110 1.00 44.36  ? 345 LYS B C   1 
ATOM   3258 O O   . LYS B 1 146 ? 13.961  14.325 21.307 1.00 45.21  ? 345 LYS B O   1 
ATOM   3259 C CB  . LYS B 1 146 ? 14.829  16.831 19.911 1.00 42.81  ? 345 LYS B CB  1 
ATOM   3260 C CG  . LYS B 1 146 ? 15.397  16.508 18.541 1.00 45.11  ? 345 LYS B CG  1 
ATOM   3261 C CD  . LYS B 1 146 ? 14.706  17.352 17.480 1.00 47.56  ? 345 LYS B CD  1 
ATOM   3262 C CE  . LYS B 1 146 ? 13.193  17.317 17.663 1.00 49.22  ? 345 LYS B CE  1 
ATOM   3263 N NZ  . LYS B 1 146 ? 12.451  18.119 16.650 1.00 49.46  ? 345 LYS B NZ  1 
ATOM   3264 N N   . SER B 1 147 ? 16.108  13.782 20.935 1.00 46.24  ? 346 SER B N   1 
ATOM   3265 C CA  . SER B 1 147 ? 15.843  12.354 20.960 1.00 48.40  ? 346 SER B CA  1 
ATOM   3266 C C   . SER B 1 147 ? 16.447  11.711 22.210 1.00 49.52  ? 346 SER B C   1 
ATOM   3267 O O   . SER B 1 147 ? 17.060  10.644 22.141 1.00 50.80  ? 346 SER B O   1 
ATOM   3268 C CB  . SER B 1 147 ? 16.410  11.703 19.699 1.00 48.51  ? 346 SER B CB  1 
ATOM   3269 O OG  . SER B 1 147 ? 17.809  11.907 19.625 1.00 50.29  ? 346 SER B OG  1 
ATOM   3270 N N   . LEU B 1 148 ? 16.280  12.374 23.349 1.00 50.12  ? 347 LEU B N   1 
ATOM   3271 C CA  . LEU B 1 148 ? 16.790  11.868 24.618 1.00 50.99  ? 347 LEU B CA  1 
ATOM   3272 C C   . LEU B 1 148 ? 15.621  11.497 25.504 1.00 52.95  ? 347 LEU B C   1 
ATOM   3273 O O   . LEU B 1 148 ? 14.499  11.969 25.300 1.00 52.57  ? 347 LEU B O   1 
ATOM   3274 C CB  . LEU B 1 148 ? 17.623  12.928 25.339 1.00 49.50  ? 347 LEU B CB  1 
ATOM   3275 C CG  . LEU B 1 148 ? 19.096  13.089 25.001 1.00 47.92  ? 347 LEU B CG  1 
ATOM   3276 C CD1 . LEU B 1 148 ? 19.249  13.230 23.526 1.00 48.43  ? 347 LEU B CD1 1 
ATOM   3277 C CD2 . LEU B 1 148 ? 19.644  14.304 25.708 1.00 47.27  ? 347 LEU B CD2 1 
ATOM   3278 N N   . ARG B 1 149 ? 15.891  10.652 26.492 1.00 55.63  ? 348 ARG B N   1 
ATOM   3279 C CA  . ARG B 1 149 ? 14.860  10.234 27.428 1.00 58.54  ? 348 ARG B CA  1 
ATOM   3280 C C   . ARG B 1 149 ? 14.216  11.487 28.001 1.00 58.92  ? 348 ARG B C   1 
ATOM   3281 O O   . ARG B 1 149 ? 14.884  12.286 28.646 1.00 59.90  ? 348 ARG B O   1 
ATOM   3282 C CB  . ARG B 1 149 ? 15.472  9.403  28.562 1.00 60.11  ? 348 ARG B CB  1 
ATOM   3283 C CG  . ARG B 1 149 ? 14.464  8.926  29.597 1.00 62.51  ? 348 ARG B CG  1 
ATOM   3284 C CD  . ARG B 1 149 ? 15.131  8.119  30.702 1.00 65.24  ? 348 ARG B CD  1 
ATOM   3285 N NE  . ARG B 1 149 ? 16.117  8.903  31.441 1.00 67.57  ? 348 ARG B NE  1 
ATOM   3286 C CZ  . ARG B 1 149 ? 15.836  10.010 32.122 1.00 68.68  ? 348 ARG B CZ  1 
ATOM   3287 N NH1 . ARG B 1 149 ? 14.593  10.476 32.164 1.00 68.78  ? 348 ARG B NH1 1 
ATOM   3288 N NH2 . ARG B 1 149 ? 16.803  10.654 32.758 1.00 69.49  ? 348 ARG B NH2 1 
ATOM   3289 N N   . LYS B 1 150 ? 12.928  11.671 27.744 1.00 59.40  ? 349 LYS B N   1 
ATOM   3290 C CA  . LYS B 1 150 ? 12.207  12.829 28.260 1.00 60.00  ? 349 LYS B CA  1 
ATOM   3291 C C   . LYS B 1 150 ? 12.371  12.789 29.789 1.00 60.25  ? 349 LYS B C   1 
ATOM   3292 O O   . LYS B 1 150 ? 12.553  11.711 30.359 1.00 60.40  ? 349 LYS B O   1 
ATOM   3293 C CB  . LYS B 1 150 ? 10.741  12.709 27.839 1.00 60.11  ? 349 LYS B CB  1 
ATOM   3294 C CG  . LYS B 1 150 ? 9.882   13.936 28.071 1.00 60.26  ? 349 LYS B CG  1 
ATOM   3295 C CD  . LYS B 1 150 ? 8.706   13.928 27.108 1.00 60.48  ? 349 LYS B CD  1 
ATOM   3296 C CE  . LYS B 1 150 ? 7.657   14.956 27.492 1.00 61.16  ? 349 LYS B CE  1 
ATOM   3297 N NZ  . LYS B 1 150 ? 6.752   15.266 26.349 1.00 62.44  ? 349 LYS B NZ  1 
ATOM   3298 N N   . PRO B 1 151 ? 12.299  13.943 30.483 1.00 60.52  ? 350 PRO B N   1 
ATOM   3299 C CA  . PRO B 1 151 ? 12.081  15.357 30.151 1.00 60.93  ? 350 PRO B CA  1 
ATOM   3300 C C   . PRO B 1 151 ? 13.342  16.068 29.676 1.00 60.98  ? 350 PRO B C   1 
ATOM   3301 O O   . PRO B 1 151 ? 13.618  17.180 30.116 1.00 62.30  ? 350 PRO B O   1 
ATOM   3302 C CB  . PRO B 1 151 ? 11.648  15.928 31.480 1.00 61.17  ? 350 PRO B CB  1 
ATOM   3303 C CG  . PRO B 1 151 ? 12.678  15.285 32.385 1.00 60.64  ? 350 PRO B CG  1 
ATOM   3304 C CD  . PRO B 1 151 ? 12.661  13.824 31.911 1.00 60.60  ? 350 PRO B CD  1 
ATOM   3305 N N   . PHE B 1 152 ? 14.106  15.451 28.789 1.00 59.82  ? 351 PHE B N   1 
ATOM   3306 C CA  . PHE B 1 152 ? 15.337  16.081 28.346 1.00 57.70  ? 351 PHE B CA  1 
ATOM   3307 C C   . PHE B 1 152 ? 15.309  16.561 26.910 1.00 56.20  ? 351 PHE B C   1 
ATOM   3308 O O   . PHE B 1 152 ? 16.168  17.332 26.488 1.00 56.24  ? 351 PHE B O   1 
ATOM   3309 C CB  . PHE B 1 152 ? 16.498  15.118 28.578 1.00 58.32  ? 351 PHE B CB  1 
ATOM   3310 C CG  . PHE B 1 152 ? 16.734  14.809 30.031 1.00 58.91  ? 351 PHE B CG  1 
ATOM   3311 C CD1 . PHE B 1 152 ? 17.165  15.804 30.898 1.00 59.52  ? 351 PHE B CD1 1 
ATOM   3312 C CD2 . PHE B 1 152 ? 16.506  13.536 30.538 1.00 59.23  ? 351 PHE B CD2 1 
ATOM   3313 C CE1 . PHE B 1 152 ? 17.367  15.536 32.245 1.00 60.31  ? 351 PHE B CE1 1 
ATOM   3314 C CE2 . PHE B 1 152 ? 16.705  13.260 31.883 1.00 59.60  ? 351 PHE B CE2 1 
ATOM   3315 C CZ  . PHE B 1 152 ? 17.135  14.258 32.738 1.00 60.24  ? 351 PHE B CZ  1 
ATOM   3316 N N   . CYS B 1 153 ? 14.309  16.113 26.165 1.00 54.40  ? 352 CYS B N   1 
ATOM   3317 C CA  . CYS B 1 153 ? 14.167  16.506 24.771 1.00 52.27  ? 352 CYS B CA  1 
ATOM   3318 C C   . CYS B 1 153 ? 13.417  17.836 24.667 1.00 50.47  ? 352 CYS B C   1 
ATOM   3319 O O   . CYS B 1 153 ? 13.108  18.308 23.567 1.00 50.79  ? 352 CYS B O   1 
ATOM   3320 C CB  . CYS B 1 153 ? 13.420  15.409 23.996 1.00 52.13  ? 352 CYS B CB  1 
ATOM   3321 S SG  . CYS B 1 153 ? 11.925  14.768 24.800 1.00 48.83  ? 352 CYS B SG  1 
ATOM   3322 N N   . ASP B 1 154 ? 13.164  18.453 25.818 1.00 46.87  ? 353 ASP B N   1 
ATOM   3323 C CA  . ASP B 1 154 ? 12.411  19.701 25.866 1.00 43.33  ? 353 ASP B CA  1 
ATOM   3324 C C   . ASP B 1 154 ? 13.225  20.910 26.331 1.00 40.11  ? 353 ASP B C   1 
ATOM   3325 O O   . ASP B 1 154 ? 12.743  22.047 26.317 1.00 37.78  ? 353 ASP B O   1 
ATOM   3326 C CB  . ASP B 1 154 ? 11.221  19.489 26.793 1.00 44.30  ? 353 ASP B CB  1 
ATOM   3327 C CG  . ASP B 1 154 ? 10.854  18.023 26.930 1.00 43.44  ? 353 ASP B CG  1 
ATOM   3328 O OD1 . ASP B 1 154 ? 10.306  17.450 25.962 1.00 44.34  ? 353 ASP B OD1 1 
ATOM   3329 O OD2 . ASP B 1 154 ? 11.134  17.443 28.002 1.00 40.99  ? 353 ASP B OD2 1 
ATOM   3330 N N   . ILE B 1 155 ? 14.463  20.657 26.735 1.00 36.93  ? 354 ILE B N   1 
ATOM   3331 C CA  . ILE B 1 155 ? 15.336  21.710 27.225 1.00 34.22  ? 354 ILE B CA  1 
ATOM   3332 C C   . ILE B 1 155 ? 15.943  22.601 26.150 1.00 32.56  ? 354 ILE B C   1 
ATOM   3333 O O   . ILE B 1 155 ? 15.605  23.773 26.037 1.00 31.85  ? 354 ILE B O   1 
ATOM   3334 C CB  . ILE B 1 155 ? 16.496  21.124 28.049 1.00 33.95  ? 354 ILE B CB  1 
ATOM   3335 C CG1 . ILE B 1 155 ? 15.964  20.494 29.334 1.00 33.34  ? 354 ILE B CG1 1 
ATOM   3336 C CG2 . ILE B 1 155 ? 17.491  22.217 28.380 1.00 34.41  ? 354 ILE B CG2 1 
ATOM   3337 C CD1 . ILE B 1 155 ? 17.019  19.759 30.129 1.00 33.50  ? 354 ILE B CD1 1 
ATOM   3338 N N   . MET B 1 156 ? 16.850  22.033 25.368 1.00 31.20  ? 355 MET B N   1 
ATOM   3339 C CA  . MET B 1 156 ? 17.540  22.776 24.333 1.00 28.56  ? 355 MET B CA  1 
ATOM   3340 C C   . MET B 1 156 ? 16.775  23.137 23.078 1.00 27.95  ? 355 MET B C   1 
ATOM   3341 O O   . MET B 1 156 ? 17.201  24.015 22.337 1.00 27.94  ? 355 MET B O   1 
ATOM   3342 C CB  . MET B 1 156 ? 18.811  22.033 23.948 1.00 27.69  ? 355 MET B CB  1 
ATOM   3343 C CG  . MET B 1 156 ? 19.937  22.287 24.923 1.00 25.14  ? 355 MET B CG  1 
ATOM   3344 S SD  . MET B 1 156 ? 20.192  24.067 24.970 1.00 25.02  ? 355 MET B SD  1 
ATOM   3345 C CE  . MET B 1 156 ? 21.582  24.140 26.090 1.00 27.32  ? 355 MET B CE  1 
ATOM   3346 N N   . GLU B 1 157 ? 15.651  22.489 22.824 1.00 27.64  ? 356 GLU B N   1 
ATOM   3347 C CA  . GLU B 1 157 ? 14.926  22.818 21.609 1.00 28.99  ? 356 GLU B CA  1 
ATOM   3348 C C   . GLU B 1 157 ? 14.328  24.237 21.599 1.00 28.88  ? 356 GLU B C   1 
ATOM   3349 O O   . GLU B 1 157 ? 14.384  24.927 20.580 1.00 29.05  ? 356 GLU B O   1 
ATOM   3350 C CB  . GLU B 1 157 ? 13.852  21.761 21.334 1.00 29.28  ? 356 GLU B CB  1 
ATOM   3351 C CG  . GLU B 1 157 ? 13.303  21.770 19.906 1.00 31.46  ? 356 GLU B CG  1 
ATOM   3352 C CD  . GLU B 1 157 ? 14.382  21.717 18.807 1.00 32.34  ? 356 GLU B CD  1 
ATOM   3353 O OE1 . GLU B 1 157 ? 15.465  21.129 19.033 1.00 33.75  ? 356 GLU B OE1 1 
ATOM   3354 O OE2 . GLU B 1 157 ? 14.135  22.252 17.701 1.00 30.01  ? 356 GLU B OE2 1 
ATOM   3355 N N   . PRO B 1 158 ? 13.764  24.699 22.730 1.00 28.53  ? 357 PRO B N   1 
ATOM   3356 C CA  . PRO B 1 158 ? 13.183  26.051 22.754 1.00 27.73  ? 357 PRO B CA  1 
ATOM   3357 C C   . PRO B 1 158 ? 14.210  27.134 22.422 1.00 26.81  ? 357 PRO B C   1 
ATOM   3358 O O   . PRO B 1 158 ? 13.873  28.195 21.886 1.00 26.11  ? 357 PRO B O   1 
ATOM   3359 C CB  . PRO B 1 158 ? 12.658  26.176 24.181 1.00 29.03  ? 357 PRO B CB  1 
ATOM   3360 C CG  . PRO B 1 158 ? 12.334  24.753 24.552 1.00 30.36  ? 357 PRO B CG  1 
ATOM   3361 C CD  . PRO B 1 158 ? 13.516  23.996 24.000 1.00 29.08  ? 357 PRO B CD  1 
ATOM   3362 N N   . LYS B 1 159 ? 15.465  26.858 22.762 1.00 25.77  ? 358 LYS B N   1 
ATOM   3363 C CA  . LYS B 1 159 ? 16.549  27.786 22.495 1.00 24.66  ? 358 LYS B CA  1 
ATOM   3364 C C   . LYS B 1 159 ? 16.885  27.755 21.001 1.00 24.75  ? 358 LYS B C   1 
ATOM   3365 O O   . LYS B 1 159 ? 17.141  28.800 20.402 1.00 24.58  ? 358 LYS B O   1 
ATOM   3366 C CB  . LYS B 1 159 ? 17.776  27.427 23.338 1.00 24.41  ? 358 LYS B CB  1 
ATOM   3367 C CG  . LYS B 1 159 ? 17.642  27.778 24.815 1.00 24.81  ? 358 LYS B CG  1 
ATOM   3368 C CD  . LYS B 1 159 ? 16.959  26.700 25.654 1.00 25.51  ? 358 LYS B CD  1 
ATOM   3369 C CE  . LYS B 1 159 ? 15.813  27.272 26.489 1.00 26.28  ? 358 LYS B CE  1 
ATOM   3370 N NZ  . LYS B 1 159 ? 15.338  26.428 27.640 1.00 21.72  ? 358 LYS B NZ  1 
ATOM   3371 N N   . PHE B 1 160 ? 16.883  26.564 20.398 1.00 23.79  ? 359 PHE B N   1 
ATOM   3372 C CA  . PHE B 1 160 ? 17.146  26.448 18.961 1.00 21.40  ? 359 PHE B CA  1 
ATOM   3373 C C   . PHE B 1 160 ? 16.049  27.229 18.276 1.00 21.86  ? 359 PHE B C   1 
ATOM   3374 O O   . PHE B 1 160 ? 16.290  27.971 17.331 1.00 21.82  ? 359 PHE B O   1 
ATOM   3375 C CB  . PHE B 1 160 ? 17.103  24.987 18.499 1.00 16.17  ? 359 PHE B CB  1 
ATOM   3376 C CG  . PHE B 1 160 ? 18.444  24.319 18.508 1.00 13.56  ? 359 PHE B CG  1 
ATOM   3377 C CD1 . PHE B 1 160 ? 19.406  24.656 17.564 1.00 11.31  ? 359 PHE B CD1 1 
ATOM   3378 C CD2 . PHE B 1 160 ? 18.774  23.394 19.495 1.00 12.17  ? 359 PHE B CD2 1 
ATOM   3379 C CE1 . PHE B 1 160 ? 20.678  24.085 17.607 1.00 8.82   ? 359 PHE B CE1 1 
ATOM   3380 C CE2 . PHE B 1 160 ? 20.044  22.821 19.543 1.00 9.35   ? 359 PHE B CE2 1 
ATOM   3381 C CZ  . PHE B 1 160 ? 20.995  23.170 18.598 1.00 7.67   ? 359 PHE B CZ  1 
ATOM   3382 N N   . ASP B 1 161 ? 14.835  27.060 18.779 1.00 23.21  ? 360 ASP B N   1 
ATOM   3383 C CA  . ASP B 1 161 ? 13.690  27.754 18.236 1.00 24.74  ? 360 ASP B CA  1 
ATOM   3384 C C   . ASP B 1 161 ? 14.021  29.242 18.267 1.00 24.65  ? 360 ASP B C   1 
ATOM   3385 O O   . ASP B 1 161 ? 13.903  29.940 17.255 1.00 25.14  ? 360 ASP B O   1 
ATOM   3386 C CB  . ASP B 1 161 ? 12.458  27.463 19.093 1.00 27.62  ? 360 ASP B CB  1 
ATOM   3387 C CG  . ASP B 1 161 ? 11.155  27.610 18.321 1.00 30.85  ? 360 ASP B CG  1 
ATOM   3388 O OD1 . ASP B 1 161 ? 10.831  28.731 17.853 1.00 31.51  ? 360 ASP B OD1 1 
ATOM   3389 O OD2 . ASP B 1 161 ? 10.448  26.589 18.186 1.00 32.58  ? 360 ASP B OD2 1 
ATOM   3390 N N   . PHE B 1 162 ? 14.457  29.722 19.428 1.00 23.59  ? 361 PHE B N   1 
ATOM   3391 C CA  . PHE B 1 162 ? 14.800  31.132 19.574 1.00 22.74  ? 361 PHE B CA  1 
ATOM   3392 C C   . PHE B 1 162 ? 15.937  31.555 18.644 1.00 21.94  ? 361 PHE B C   1 
ATOM   3393 O O   . PHE B 1 162 ? 15.797  32.488 17.851 1.00 20.96  ? 361 PHE B O   1 
ATOM   3394 C CB  . PHE B 1 162 ? 15.200  31.441 21.020 1.00 21.94  ? 361 PHE B CB  1 
ATOM   3395 C CG  . PHE B 1 162 ? 15.686  32.846 21.216 1.00 20.10  ? 361 PHE B CG  1 
ATOM   3396 C CD1 . PHE B 1 162 ? 14.788  33.902 21.282 1.00 19.18  ? 361 PHE B CD1 1 
ATOM   3397 C CD2 . PHE B 1 162 ? 17.047  33.121 21.266 1.00 20.47  ? 361 PHE B CD2 1 
ATOM   3398 C CE1 . PHE B 1 162 ? 15.237  35.208 21.390 1.00 19.63  ? 361 PHE B CE1 1 
ATOM   3399 C CE2 . PHE B 1 162 ? 17.505  34.426 21.373 1.00 20.46  ? 361 PHE B CE2 1 
ATOM   3400 C CZ  . PHE B 1 162 ? 16.599  35.470 21.435 1.00 19.97  ? 361 PHE B CZ  1 
ATOM   3401 N N   . ALA B 1 163 ? 17.060  30.853 18.754 1.00 21.31  ? 362 ALA B N   1 
ATOM   3402 C CA  . ALA B 1 163 ? 18.255  31.137 17.968 1.00 21.45  ? 362 ALA B CA  1 
ATOM   3403 C C   . ALA B 1 163 ? 18.013  31.390 16.485 1.00 21.58  ? 362 ALA B C   1 
ATOM   3404 O O   . ALA B 1 163 ? 18.582  32.310 15.903 1.00 20.46  ? 362 ALA B O   1 
ATOM   3405 C CB  . ALA B 1 163 ? 19.259  30.004 18.141 1.00 21.16  ? 362 ALA B CB  1 
ATOM   3406 N N   . MET B 1 164 ? 17.174  30.568 15.873 1.00 23.41  ? 363 MET B N   1 
ATOM   3407 C CA  . MET B 1 164 ? 16.880  30.707 14.456 1.00 25.21  ? 363 MET B CA  1 
ATOM   3408 C C   . MET B 1 164 ? 16.183  32.012 14.116 1.00 25.22  ? 363 MET B C   1 
ATOM   3409 O O   . MET B 1 164 ? 16.492  32.627 13.102 1.00 25.94  ? 363 MET B O   1 
ATOM   3410 C CB  . MET B 1 164 ? 16.045  29.522 13.982 1.00 27.95  ? 363 MET B CB  1 
ATOM   3411 C CG  . MET B 1 164 ? 16.869  28.386 13.393 1.00 32.46  ? 363 MET B CG  1 
ATOM   3412 S SD  . MET B 1 164 ? 18.409  28.045 14.268 1.00 36.15  ? 363 MET B SD  1 
ATOM   3413 C CE  . MET B 1 164 ? 19.583  28.873 13.197 1.00 37.13  ? 363 MET B CE  1 
ATOM   3414 N N   . LYS B 1 165 ? 15.243  32.438 14.952 1.00 24.92  ? 364 LYS B N   1 
ATOM   3415 C CA  . LYS B 1 165 ? 14.547  33.693 14.703 1.00 24.39  ? 364 LYS B CA  1 
ATOM   3416 C C   . LYS B 1 165 ? 15.477  34.875 14.984 1.00 22.57  ? 364 LYS B C   1 
ATOM   3417 O O   . LYS B 1 165 ? 15.457  35.878 14.267 1.00 23.19  ? 364 LYS B O   1 
ATOM   3418 C CB  . LYS B 1 165 ? 13.314  33.805 15.591 1.00 26.97  ? 364 LYS B CB  1 
ATOM   3419 C CG  . LYS B 1 165 ? 12.221  32.797 15.294 1.00 30.54  ? 364 LYS B CG  1 
ATOM   3420 C CD  . LYS B 1 165 ? 11.089  32.939 16.302 1.00 35.25  ? 364 LYS B CD  1 
ATOM   3421 C CE  . LYS B 1 165 ? 10.005  31.892 16.081 1.00 38.99  ? 364 LYS B CE  1 
ATOM   3422 N NZ  . LYS B 1 165 ? 9.143   31.678 17.288 1.00 40.47  ? 364 LYS B NZ  1 
ATOM   3423 N N   . PHE B 1 166 ? 16.290  34.746 16.028 1.00 18.94  ? 365 PHE B N   1 
ATOM   3424 C CA  . PHE B 1 166 ? 17.218  35.798 16.413 1.00 16.03  ? 365 PHE B CA  1 
ATOM   3425 C C   . PHE B 1 166 ? 18.330  35.983 15.383 1.00 16.13  ? 365 PHE B C   1 
ATOM   3426 O O   . PHE B 1 166 ? 18.649  37.114 15.025 1.00 16.43  ? 365 PHE B O   1 
ATOM   3427 C CB  . PHE B 1 166 ? 17.828  35.491 17.797 1.00 14.04  ? 365 PHE B CB  1 
ATOM   3428 C CG  . PHE B 1 166 ? 18.585  36.655 18.423 1.00 9.95   ? 365 PHE B CG  1 
ATOM   3429 C CD1 . PHE B 1 166 ? 17.922  37.819 18.811 1.00 8.52   ? 365 PHE B CD1 1 
ATOM   3430 C CD2 . PHE B 1 166 ? 19.957  36.589 18.609 1.00 6.55   ? 365 PHE B CD2 1 
ATOM   3431 C CE1 . PHE B 1 166 ? 18.613  38.886 19.366 1.00 6.55   ? 365 PHE B CE1 1 
ATOM   3432 C CE2 . PHE B 1 166 ? 20.648  37.654 19.163 1.00 6.55   ? 365 PHE B CE2 1 
ATOM   3433 C CZ  . PHE B 1 166 ? 19.975  38.799 19.539 1.00 6.55   ? 365 PHE B CZ  1 
ATOM   3434 N N   . ASN B 1 167 ? 18.911  34.887 14.895 1.00 16.37  ? 366 ASN B N   1 
ATOM   3435 C CA  . ASN B 1 167 ? 20.006  34.987 13.922 1.00 16.95  ? 366 ASN B CA  1 
ATOM   3436 C C   . ASN B 1 167 ? 19.625  35.538 12.566 1.00 17.11  ? 366 ASN B C   1 
ATOM   3437 O O   . ASN B 1 167 ? 20.497  35.864 11.761 1.00 17.53  ? 366 ASN B O   1 
ATOM   3438 C CB  . ASN B 1 167 ? 20.693  33.641 13.721 1.00 17.17  ? 366 ASN B CB  1 
ATOM   3439 C CG  . ASN B 1 167 ? 21.534  33.246 14.901 1.00 17.63  ? 366 ASN B CG  1 
ATOM   3440 O OD1 . ASN B 1 167 ? 22.240  34.070 15.478 1.00 20.13  ? 366 ASN B OD1 1 
ATOM   3441 N ND2 . ASN B 1 167 ? 21.476  31.980 15.265 1.00 17.43  ? 366 ASN B ND2 1 
ATOM   3442 N N   . ALA B 1 168 ? 18.325  35.636 12.313 1.00 17.36  ? 367 ALA B N   1 
ATOM   3443 C CA  . ALA B 1 168 ? 17.831  36.165 11.051 1.00 16.55  ? 367 ALA B CA  1 
ATOM   3444 C C   . ALA B 1 168 ? 18.018  37.686 11.004 1.00 15.09  ? 367 ALA B C   1 
ATOM   3445 O O   . ALA B 1 168 ? 18.146  38.285 9.937  1.00 13.33  ? 367 ALA B O   1 
ATOM   3446 C CB  . ALA B 1 168 ? 16.379  35.813 10.893 1.00 16.61  ? 367 ALA B CB  1 
ATOM   3447 N N   . LEU B 1 169 ? 18.032  38.305 12.173 1.00 13.62  ? 368 LEU B N   1 
ATOM   3448 C CA  . LEU B 1 169 ? 18.219  39.733 12.247 1.00 13.88  ? 368 LEU B CA  1 
ATOM   3449 C C   . LEU B 1 169 ? 19.639  40.042 11.778 1.00 15.08  ? 368 LEU B C   1 
ATOM   3450 O O   . LEU B 1 169 ? 20.010  41.204 11.625 1.00 17.51  ? 368 LEU B O   1 
ATOM   3451 C CB  . LEU B 1 169 ? 18.022  40.202 13.680 1.00 13.10  ? 368 LEU B CB  1 
ATOM   3452 C CG  . LEU B 1 169 ? 16.709  39.782 14.336 1.00 13.72  ? 368 LEU B CG  1 
ATOM   3453 C CD1 . LEU B 1 169 ? 16.854  39.865 15.834 1.00 15.03  ? 368 LEU B CD1 1 
ATOM   3454 C CD2 . LEU B 1 169 ? 15.583  40.665 13.867 1.00 14.59  ? 368 LEU B CD2 1 
ATOM   3455 N N   . GLU B 1 170 ? 20.435  38.999 11.553 1.00 14.41  ? 369 GLU B N   1 
ATOM   3456 C CA  . GLU B 1 170 ? 21.813  39.170 11.091 1.00 13.15  ? 369 GLU B CA  1 
ATOM   3457 C C   . GLU B 1 170 ? 22.599  40.246 11.839 1.00 10.23  ? 369 GLU B C   1 
ATOM   3458 O O   . GLU B 1 170 ? 23.109  41.170 11.224 1.00 7.70   ? 369 GLU B O   1 
ATOM   3459 C CB  . GLU B 1 170 ? 21.821  39.493 9.591  1.00 17.00  ? 369 GLU B CB  1 
ATOM   3460 C CG  . GLU B 1 170 ? 21.781  38.275 8.672  1.00 22.86  ? 369 GLU B CG  1 
ATOM   3461 C CD  . GLU B 1 170 ? 21.107  38.564 7.331  1.00 26.02  ? 369 GLU B CD  1 
ATOM   3462 O OE1 . GLU B 1 170 ? 21.257  39.698 6.818  1.00 26.59  ? 369 GLU B OE1 1 
ATOM   3463 O OE2 . GLU B 1 170 ? 20.434  37.653 6.789  1.00 27.42  ? 369 GLU B OE2 1 
ATOM   3464 N N   . LEU B 1 171 ? 22.694  40.126 13.161 1.00 9.85   ? 370 LEU B N   1 
ATOM   3465 C CA  . LEU B 1 171 ? 23.442  41.089 13.971 1.00 9.56   ? 370 LEU B CA  1 
ATOM   3466 C C   . LEU B 1 171 ? 24.885  40.633 13.999 1.00 10.55  ? 370 LEU B C   1 
ATOM   3467 O O   . LEU B 1 171 ? 25.159  39.446 13.836 1.00 11.75  ? 370 LEU B O   1 
ATOM   3468 C CB  . LEU B 1 171 ? 22.930  41.115 15.410 1.00 7.70   ? 370 LEU B CB  1 
ATOM   3469 C CG  . LEU B 1 171 ? 21.455  41.367 15.710 1.00 8.17   ? 370 LEU B CG  1 
ATOM   3470 C CD1 . LEU B 1 171 ? 21.281  41.346 17.203 1.00 9.68   ? 370 LEU B CD1 1 
ATOM   3471 C CD2 . LEU B 1 171 ? 20.992  42.701 15.157 1.00 10.18  ? 370 LEU B CD2 1 
ATOM   3472 N N   . ASP B 1 172 ? 25.813  41.557 14.207 1.00 11.47  ? 371 ASP B N   1 
ATOM   3473 C CA  . ASP B 1 172 ? 27.216  41.169 14.264 1.00 14.27  ? 371 ASP B CA  1 
ATOM   3474 C C   . ASP B 1 172 ? 27.708  41.318 15.690 1.00 14.09  ? 371 ASP B C   1 
ATOM   3475 O O   . ASP B 1 172 ? 26.970  41.774 16.553 1.00 14.66  ? 371 ASP B O   1 
ATOM   3476 C CB  . ASP B 1 172 ? 28.056  42.025 13.326 1.00 18.21  ? 371 ASP B CB  1 
ATOM   3477 C CG  . ASP B 1 172 ? 28.176  43.446 13.797 1.00 22.35  ? 371 ASP B CG  1 
ATOM   3478 O OD1 . ASP B 1 172 ? 27.184  43.958 14.354 1.00 24.95  ? 371 ASP B OD1 1 
ATOM   3479 O OD2 . ASP B 1 172 ? 29.252  44.055 13.601 1.00 25.26  ? 371 ASP B OD2 1 
ATOM   3480 N N   . ASP B 1 173 ? 28.954  40.938 15.939 1.00 14.04  ? 372 ASP B N   1 
ATOM   3481 C CA  . ASP B 1 173 ? 29.507  41.008 17.284 1.00 13.30  ? 372 ASP B CA  1 
ATOM   3482 C C   . ASP B 1 173 ? 29.429  42.359 17.956 1.00 11.11  ? 372 ASP B C   1 
ATOM   3483 O O   . ASP B 1 173 ? 29.281  42.428 19.163 1.00 9.78   ? 372 ASP B O   1 
ATOM   3484 C CB  . ASP B 1 173 ? 30.955  40.523 17.292 1.00 14.86  ? 372 ASP B CB  1 
ATOM   3485 C CG  . ASP B 1 173 ? 31.056  39.018 17.312 1.00 15.27  ? 372 ASP B CG  1 
ATOM   3486 O OD1 . ASP B 1 173 ? 30.404  38.406 18.181 1.00 15.58  ? 372 ASP B OD1 1 
ATOM   3487 O OD2 . ASP B 1 173 ? 31.783  38.447 16.474 1.00 15.64  ? 372 ASP B OD2 1 
ATOM   3488 N N   . SER B 1 174 ? 29.531  43.436 17.194 1.00 10.90  ? 373 SER B N   1 
ATOM   3489 C CA  . SER B 1 174 ? 29.460  44.746 17.814 1.00 12.26  ? 373 SER B CA  1 
ATOM   3490 C C   . SER B 1 174 ? 28.055  45.007 18.363 1.00 12.58  ? 373 SER B C   1 
ATOM   3491 O O   . SER B 1 174 ? 27.900  45.703 19.372 1.00 14.61  ? 373 SER B O   1 
ATOM   3492 C CB  . SER B 1 174 ? 29.872  45.851 16.826 1.00 13.12  ? 373 SER B CB  1 
ATOM   3493 O OG  . SER B 1 174 ? 28.955  45.998 15.756 1.00 15.49  ? 373 SER B OG  1 
ATOM   3494 N N   . ASP B 1 175 ? 27.035  44.439 17.718 1.00 10.37  ? 374 ASP B N   1 
ATOM   3495 C CA  . ASP B 1 175 ? 25.659  44.629 18.172 1.00 7.77   ? 374 ASP B CA  1 
ATOM   3496 C C   . ASP B 1 175 ? 25.366  43.739 19.366 1.00 6.55   ? 374 ASP B C   1 
ATOM   3497 O O   . ASP B 1 175 ? 24.638  44.132 20.265 1.00 6.58   ? 374 ASP B O   1 
ATOM   3498 C CB  . ASP B 1 175 ? 24.646  44.308 17.068 1.00 8.70   ? 374 ASP B CB  1 
ATOM   3499 C CG  . ASP B 1 175 ? 24.927  45.041 15.773 1.00 10.34  ? 374 ASP B CG  1 
ATOM   3500 O OD1 . ASP B 1 175 ? 25.215  46.257 15.794 1.00 12.76  ? 374 ASP B OD1 1 
ATOM   3501 O OD2 . ASP B 1 175 ? 24.841  44.389 14.719 1.00 10.22  ? 374 ASP B OD2 1 
ATOM   3502 N N   . ILE B 1 176 ? 25.923  42.534 19.375 1.00 6.55   ? 375 ILE B N   1 
ATOM   3503 C CA  . ILE B 1 176 ? 25.694  41.628 20.486 1.00 6.55   ? 375 ILE B CA  1 
ATOM   3504 C C   . ILE B 1 176 ? 26.312  42.264 21.708 1.00 6.55   ? 375 ILE B C   1 
ATOM   3505 O O   . ILE B 1 176 ? 25.789  42.139 22.799 1.00 6.55   ? 375 ILE B O   1 
ATOM   3506 C CB  . ILE B 1 176 ? 26.343  40.250 20.280 1.00 6.55   ? 375 ILE B CB  1 
ATOM   3507 C CG1 . ILE B 1 176 ? 25.975  39.675 18.907 1.00 6.55   ? 375 ILE B CG1 1 
ATOM   3508 C CG2 . ILE B 1 176 ? 25.876  39.312 21.360 1.00 6.55   ? 375 ILE B CG2 1 
ATOM   3509 C CD1 . ILE B 1 176 ? 24.504  39.483 18.698 1.00 6.55   ? 375 ILE B CD1 1 
ATOM   3510 N N   . SER B 1 177 ? 27.433  42.946 21.519 1.00 6.55   ? 376 SER B N   1 
ATOM   3511 C CA  . SER B 1 177 ? 28.106  43.627 22.615 1.00 6.55   ? 376 SER B CA  1 
ATOM   3512 C C   . SER B 1 177 ? 27.116  44.491 23.351 1.00 6.55   ? 376 SER B C   1 
ATOM   3513 O O   . SER B 1 177 ? 26.811  44.281 24.520 1.00 6.55   ? 376 SER B O   1 
ATOM   3514 C CB  . SER B 1 177 ? 29.188  44.550 22.091 1.00 6.55   ? 376 SER B CB  1 
ATOM   3515 O OG  . SER B 1 177 ? 30.288  43.808 21.664 1.00 7.09   ? 376 SER B OG  1 
ATOM   3516 N N   . LEU B 1 178 ? 26.637  45.494 22.636 1.00 6.55   ? 377 LEU B N   1 
ATOM   3517 C CA  . LEU B 1 178 ? 25.698  46.441 23.177 1.00 6.55   ? 377 LEU B CA  1 
ATOM   3518 C C   . LEU B 1 178 ? 24.406  45.788 23.652 1.00 6.55   ? 377 LEU B C   1 
ATOM   3519 O O   . LEU B 1 178 ? 23.868  46.174 24.677 1.00 6.55   ? 377 LEU B O   1 
ATOM   3520 C CB  . LEU B 1 178 ? 25.430  47.533 22.128 1.00 6.55   ? 377 LEU B CB  1 
ATOM   3521 C CG  . LEU B 1 178 ? 26.477  48.643 21.913 1.00 6.55   ? 377 LEU B CG  1 
ATOM   3522 C CD1 . LEU B 1 178 ? 27.797  48.305 22.545 1.00 6.55   ? 377 LEU B CD1 1 
ATOM   3523 C CD2 . LEU B 1 178 ? 26.673  48.854 20.457 1.00 6.55   ? 377 LEU B CD2 1 
ATOM   3524 N N   . PHE B 1 179 ? 23.911  44.792 22.932 1.00 6.55   ? 378 PHE B N   1 
ATOM   3525 C CA  . PHE B 1 179 ? 22.667  44.143 23.334 1.00 6.55   ? 378 PHE B CA  1 
ATOM   3526 C C   . PHE B 1 179 ? 22.830  43.454 24.687 1.00 6.55   ? 378 PHE B C   1 
ATOM   3527 O O   . PHE B 1 179 ? 22.015  43.650 25.596 1.00 8.20   ? 378 PHE B O   1 
ATOM   3528 C CB  . PHE B 1 179 ? 22.238  43.131 22.266 1.00 6.55   ? 378 PHE B CB  1 
ATOM   3529 C CG  . PHE B 1 179 ? 20.923  42.451 22.545 1.00 6.55   ? 378 PHE B CG  1 
ATOM   3530 C CD1 . PHE B 1 179 ? 19.737  43.162 22.534 1.00 6.55   ? 378 PHE B CD1 1 
ATOM   3531 C CD2 . PHE B 1 179 ? 20.876  41.091 22.811 1.00 6.55   ? 378 PHE B CD2 1 
ATOM   3532 C CE1 . PHE B 1 179 ? 18.527  42.527 22.786 1.00 6.55   ? 378 PHE B CE1 1 
ATOM   3533 C CE2 . PHE B 1 179 ? 19.671  40.452 23.064 1.00 6.55   ? 378 PHE B CE2 1 
ATOM   3534 C CZ  . PHE B 1 179 ? 18.495  41.172 23.052 1.00 6.55   ? 378 PHE B CZ  1 
ATOM   3535 N N   . VAL B 1 180 ? 23.891  42.663 24.827 1.00 6.55   ? 379 VAL B N   1 
ATOM   3536 C CA  . VAL B 1 180 ? 24.165  41.943 26.071 1.00 6.55   ? 379 VAL B CA  1 
ATOM   3537 C C   . VAL B 1 180 ? 24.427  42.857 27.262 1.00 6.55   ? 379 VAL B C   1 
ATOM   3538 O O   . VAL B 1 180 ? 24.201  42.476 28.395 1.00 6.55   ? 379 VAL B O   1 
ATOM   3539 C CB  . VAL B 1 180 ? 25.346  40.963 25.885 1.00 6.55   ? 379 VAL B CB  1 
ATOM   3540 C CG1 . VAL B 1 180 ? 25.898  40.519 27.214 1.00 6.55   ? 379 VAL B CG1 1 
ATOM   3541 C CG2 . VAL B 1 180 ? 24.868  39.760 25.116 1.00 6.55   ? 379 VAL B CG2 1 
ATOM   3542 N N   . ALA B 1 181 ? 24.897  44.066 27.007 1.00 6.55   ? 380 ALA B N   1 
ATOM   3543 C CA  . ALA B 1 181 ? 25.163  45.011 28.086 1.00 6.55   ? 380 ALA B CA  1 
ATOM   3544 C C   . ALA B 1 181 ? 23.844  45.613 28.515 1.00 6.55   ? 380 ALA B C   1 
ATOM   3545 O O   . ALA B 1 181 ? 23.629  45.902 29.690 1.00 6.55   ? 380 ALA B O   1 
ATOM   3546 C CB  . ALA B 1 181 ? 26.117  46.125 27.612 1.00 6.55   ? 380 ALA B CB  1 
ATOM   3547 N N   . ALA B 1 182 ? 22.967  45.810 27.539 1.00 6.55   ? 381 ALA B N   1 
ATOM   3548 C CA  . ALA B 1 182 ? 21.664  46.384 27.791 1.00 6.55   ? 381 ALA B CA  1 
ATOM   3549 C C   . ALA B 1 182 ? 20.921  45.399 28.650 1.00 6.55   ? 381 ALA B C   1 
ATOM   3550 O O   . ALA B 1 182 ? 20.073  45.771 29.460 1.00 6.90   ? 381 ALA B O   1 
ATOM   3551 C CB  . ALA B 1 182 ? 20.930  46.589 26.494 1.00 6.55   ? 381 ALA B CB  1 
ATOM   3552 N N   . ILE B 1 183 ? 21.262  44.130 28.468 1.00 6.55   ? 382 ILE B N   1 
ATOM   3553 C CA  . ILE B 1 183 ? 20.626  43.054 29.207 1.00 6.67   ? 382 ILE B CA  1 
ATOM   3554 C C   . ILE B 1 183 ? 21.056  42.956 30.658 1.00 6.55   ? 382 ILE B C   1 
ATOM   3555 O O   . ILE B 1 183 ? 20.218  42.810 31.539 1.00 9.24   ? 382 ILE B O   1 
ATOM   3556 C CB  . ILE B 1 183 ? 20.880  41.718 28.531 1.00 6.55   ? 382 ILE B CB  1 
ATOM   3557 C CG1 . ILE B 1 183 ? 19.963  41.592 27.322 1.00 6.55   ? 382 ILE B CG1 1 
ATOM   3558 C CG2 . ILE B 1 183 ? 20.688  40.597 29.521 1.00 6.55   ? 382 ILE B CG2 1 
ATOM   3559 C CD1 . ILE B 1 183 ? 20.114  40.304 26.583 1.00 6.55   ? 382 ILE B CD1 1 
ATOM   3560 N N   . ILE B 1 184 ? 22.360  43.017 30.901 1.00 6.55   ? 383 ILE B N   1 
ATOM   3561 C CA  . ILE B 1 184 ? 22.892  42.945 32.251 1.00 6.55   ? 383 ILE B CA  1 
ATOM   3562 C C   . ILE B 1 184 ? 22.539  44.185 33.071 1.00 6.70   ? 383 ILE B C   1 
ATOM   3563 O O   . ILE B 1 184 ? 21.981  44.069 34.158 1.00 8.62   ? 383 ILE B O   1 
ATOM   3564 C CB  . ILE B 1 184 ? 24.416  42.783 32.224 1.00 6.55   ? 383 ILE B CB  1 
ATOM   3565 C CG1 . ILE B 1 184 ? 24.765  41.356 31.815 1.00 6.55   ? 383 ILE B CG1 1 
ATOM   3566 C CG2 . ILE B 1 184 ? 25.012  43.158 33.572 1.00 6.55   ? 383 ILE B CG2 1 
ATOM   3567 C CD1 . ILE B 1 184 ? 26.232  41.143 31.553 1.00 6.55   ? 383 ILE B CD1 1 
ATOM   3568 N N   . CYS B 1 185 ? 22.851  45.364 32.539 1.00 6.55   ? 384 CYS B N   1 
ATOM   3569 C CA  . CYS B 1 185 ? 22.593  46.630 33.223 1.00 6.55   ? 384 CYS B CA  1 
ATOM   3570 C C   . CYS B 1 185 ? 21.192  47.177 33.075 1.00 6.55   ? 384 CYS B C   1 
ATOM   3571 O O   . CYS B 1 185 ? 21.005  48.190 32.432 1.00 6.55   ? 384 CYS B O   1 
ATOM   3572 C CB  . CYS B 1 185 ? 23.546  47.713 32.721 1.00 6.55   ? 384 CYS B CB  1 
ATOM   3573 S SG  . CYS B 1 185 ? 25.291  47.326 32.768 1.00 8.57   ? 384 CYS B SG  1 
ATOM   3574 N N   . CYS B 1 186 ? 20.198  46.530 33.649 1.00 6.55   ? 385 CYS B N   1 
ATOM   3575 C CA  . CYS B 1 186 ? 18.858  47.080 33.551 1.00 11.04  ? 385 CYS B CA  1 
ATOM   3576 C C   . CYS B 1 186 ? 18.396  47.193 34.985 1.00 12.66  ? 385 CYS B C   1 
ATOM   3577 O O   . CYS B 1 186 ? 18.823  46.410 35.822 1.00 14.66  ? 385 CYS B O   1 
ATOM   3578 C CB  . CYS B 1 186 ? 17.933  46.150 32.770 1.00 14.13  ? 385 CYS B CB  1 
ATOM   3579 S SG  . CYS B 1 186 ? 17.163  44.877 33.767 1.00 19.41  ? 385 CYS B SG  1 
ATOM   3580 N N   . GLY B 1 187 ? 17.536  48.159 35.286 1.00 14.39  ? 386 GLY B N   1 
ATOM   3581 C CA  . GLY B 1 187 ? 17.082  48.310 36.661 1.00 15.42  ? 386 GLY B CA  1 
ATOM   3582 C C   . GLY B 1 187 ? 15.787  47.621 37.066 1.00 16.52  ? 386 GLY B C   1 
ATOM   3583 O O   . GLY B 1 187 ? 15.190  47.995 38.070 1.00 15.52  ? 386 GLY B O   1 
ATOM   3584 N N   . ASP B 1 188 ? 15.348  46.621 36.305 1.00 18.62  ? 387 ASP B N   1 
ATOM   3585 C CA  . ASP B 1 188 ? 14.115  45.914 36.629 1.00 21.06  ? 387 ASP B CA  1 
ATOM   3586 C C   . ASP B 1 188 ? 14.353  44.803 37.614 1.00 20.27  ? 387 ASP B C   1 
ATOM   3587 O O   . ASP B 1 188 ? 13.402  44.195 38.101 1.00 21.15  ? 387 ASP B O   1 
ATOM   3588 C CB  . ASP B 1 188 ? 13.468  45.317 35.382 1.00 27.59  ? 387 ASP B CB  1 
ATOM   3589 C CG  . ASP B 1 188 ? 12.893  46.369 34.477 1.00 34.76  ? 387 ASP B CG  1 
ATOM   3590 O OD1 . ASP B 1 188 ? 13.651  46.911 33.639 1.00 39.33  ? 387 ASP B OD1 1 
ATOM   3591 O OD2 . ASP B 1 188 ? 11.685  46.667 34.621 1.00 38.76  ? 387 ASP B OD2 1 
ATOM   3592 N N   . ARG B 1 189 ? 15.623  44.532 37.901 1.00 18.13  ? 388 ARG B N   1 
ATOM   3593 C CA  . ARG B 1 189 ? 15.982  43.477 38.841 1.00 15.39  ? 388 ARG B CA  1 
ATOM   3594 C C   . ARG B 1 189 ? 15.697  43.890 40.291 1.00 16.12  ? 388 ARG B C   1 
ATOM   3595 O O   . ARG B 1 189 ? 15.991  45.021 40.707 1.00 16.26  ? 388 ARG B O   1 
ATOM   3596 C CB  . ARG B 1 189 ? 17.460  43.126 38.716 1.00 11.89  ? 388 ARG B CB  1 
ATOM   3597 C CG  . ARG B 1 189 ? 17.994  43.101 37.306 1.00 10.22  ? 388 ARG B CG  1 
ATOM   3598 C CD  . ARG B 1 189 ? 17.242  42.133 36.422 1.00 8.83   ? 388 ARG B CD  1 
ATOM   3599 N NE  . ARG B 1 189 ? 18.044  41.830 35.243 1.00 9.77   ? 388 ARG B NE  1 
ATOM   3600 C CZ  . ARG B 1 189 ? 17.564  41.287 34.134 1.00 10.65  ? 388 ARG B CZ  1 
ATOM   3601 N NH1 . ARG B 1 189 ? 16.275  40.990 34.042 1.00 10.93  ? 388 ARG B NH1 1 
ATOM   3602 N NH2 . ARG B 1 189 ? 18.378  41.031 33.123 1.00 11.31  ? 388 ARG B NH2 1 
ATOM   3603 N N   . PRO B 1 190 ? 15.134  42.964 41.084 1.00 15.37  ? 389 PRO B N   1 
ATOM   3604 C CA  . PRO B 1 190 ? 14.797  43.195 42.490 1.00 15.13  ? 389 PRO B CA  1 
ATOM   3605 C C   . PRO B 1 190 ? 15.963  43.228 43.487 1.00 15.25  ? 389 PRO B C   1 
ATOM   3606 O O   . PRO B 1 190 ? 16.915  42.434 43.414 1.00 13.26  ? 389 PRO B O   1 
ATOM   3607 C CB  . PRO B 1 190 ? 13.827  42.060 42.787 1.00 16.07  ? 389 PRO B CB  1 
ATOM   3608 C CG  . PRO B 1 190 ? 14.375  40.946 41.953 1.00 12.55  ? 389 PRO B CG  1 
ATOM   3609 C CD  . PRO B 1 190 ? 14.637  41.647 40.646 1.00 13.52  ? 389 PRO B CD  1 
ATOM   3610 N N   . GLY B 1 191 ? 15.861  44.150 44.437 1.00 15.10  ? 390 GLY B N   1 
ATOM   3611 C CA  . GLY B 1 191 ? 16.889  44.262 45.445 1.00 15.85  ? 390 GLY B CA  1 
ATOM   3612 C C   . GLY B 1 191 ? 18.036  45.151 45.035 1.00 16.23  ? 390 GLY B C   1 
ATOM   3613 O O   . GLY B 1 191 ? 19.160  44.995 45.514 1.00 16.98  ? 390 GLY B O   1 
ATOM   3614 N N   . LEU B 1 192 ? 17.775  46.075 44.123 1.00 16.95  ? 391 LEU B N   1 
ATOM   3615 C CA  . LEU B 1 192 ? 18.828  46.993 43.711 1.00 16.40  ? 391 LEU B CA  1 
ATOM   3616 C C   . LEU B 1 192 ? 18.697  48.166 44.671 1.00 15.62  ? 391 LEU B C   1 
ATOM   3617 O O   . LEU B 1 192 ? 17.580  48.599 44.984 1.00 15.97  ? 391 LEU B O   1 
ATOM   3618 C CB  . LEU B 1 192 ? 18.638  47.431 42.251 1.00 14.98  ? 391 LEU B CB  1 
ATOM   3619 C CG  . LEU B 1 192 ? 18.874  46.372 41.167 1.00 11.38  ? 391 LEU B CG  1 
ATOM   3620 C CD1 . LEU B 1 192 ? 18.692  47.004 39.816 1.00 12.58  ? 391 LEU B CD1 1 
ATOM   3621 C CD2 . LEU B 1 192 ? 20.272  45.812 41.269 1.00 10.47  ? 391 LEU B CD2 1 
ATOM   3622 N N   . LEU B 1 193 ? 19.826  48.655 45.169 1.00 13.81  ? 392 LEU B N   1 
ATOM   3623 C CA  . LEU B 1 193 ? 19.791  49.756 46.114 1.00 14.87  ? 392 LEU B CA  1 
ATOM   3624 C C   . LEU B 1 193 ? 19.661  51.062 45.359 1.00 14.66  ? 392 LEU B C   1 
ATOM   3625 O O   . LEU B 1 193 ? 18.912  51.960 45.754 1.00 14.84  ? 392 LEU B O   1 
ATOM   3626 C CB  . LEU B 1 193 ? 21.066  49.767 46.959 1.00 16.00  ? 392 LEU B CB  1 
ATOM   3627 C CG  . LEU B 1 193 ? 21.084  50.511 48.304 1.00 17.21  ? 392 LEU B CG  1 
ATOM   3628 C CD1 . LEU B 1 193 ? 22.331  51.379 48.348 1.00 17.26  ? 392 LEU B CD1 1 
ATOM   3629 C CD2 . LEU B 1 193 ? 19.830  51.364 48.504 1.00 17.20  ? 392 LEU B CD2 1 
ATOM   3630 N N   . ASN B 1 194 ? 20.385  51.146 44.252 1.00 15.08  ? 393 ASN B N   1 
ATOM   3631 C CA  . ASN B 1 194 ? 20.383  52.334 43.414 1.00 15.18  ? 393 ASN B CA  1 
ATOM   3632 C C   . ASN B 1 194 ? 19.705  52.110 42.055 1.00 13.43  ? 393 ASN B C   1 
ATOM   3633 O O   . ASN B 1 194 ? 20.304  52.347 41.010 1.00 13.55  ? 393 ASN B O   1 
ATOM   3634 C CB  . ASN B 1 194 ? 21.828  52.797 43.226 1.00 17.24  ? 393 ASN B CB  1 
ATOM   3635 C CG  . ASN B 1 194 ? 22.482  53.201 44.537 1.00 18.07  ? 393 ASN B CG  1 
ATOM   3636 O OD1 . ASN B 1 194 ? 22.336  54.333 45.000 1.00 20.69  ? 393 ASN B OD1 1 
ATOM   3637 N ND2 . ASN B 1 194 ? 23.192  52.270 45.146 1.00 18.05  ? 393 ASN B ND2 1 
ATOM   3638 N N   . VAL B 1 195 ? 18.447  51.675 42.079 1.00 11.92  ? 394 VAL B N   1 
ATOM   3639 C CA  . VAL B 1 195 ? 17.694  51.408 40.856 1.00 10.72  ? 394 VAL B CA  1 
ATOM   3640 C C   . VAL B 1 195 ? 17.586  52.617 39.922 1.00 10.50  ? 394 VAL B C   1 
ATOM   3641 O O   . VAL B 1 195 ? 17.327  52.477 38.738 1.00 10.83  ? 394 VAL B O   1 
ATOM   3642 C CB  . VAL B 1 195 ? 16.270  50.875 41.187 1.00 9.91   ? 394 VAL B CB  1 
ATOM   3643 C CG1 . VAL B 1 195 ? 15.197  51.827 40.678 1.00 12.06  ? 394 VAL B CG1 1 
ATOM   3644 C CG2 . VAL B 1 195 ? 16.075  49.519 40.560 1.00 11.13  ? 394 VAL B CG2 1 
ATOM   3645 N N   . GLY B 1 196 ? 17.775  53.813 40.447 1.00 10.52  ? 395 GLY B N   1 
ATOM   3646 C CA  . GLY B 1 196 ? 17.682  54.962 39.579 1.00 10.16  ? 395 GLY B CA  1 
ATOM   3647 C C   . GLY B 1 196 ? 18.979  55.151 38.824 1.00 10.33  ? 395 GLY B C   1 
ATOM   3648 O O   . GLY B 1 196 ? 18.980  55.495 37.643 1.00 10.44  ? 395 GLY B O   1 
ATOM   3649 N N   . HIS B 1 197 ? 20.097  54.931 39.502 1.00 9.63   ? 396 HIS B N   1 
ATOM   3650 C CA  . HIS B 1 197 ? 21.363  55.115 38.835 1.00 8.68   ? 396 HIS B CA  1 
ATOM   3651 C C   . HIS B 1 197 ? 21.557  54.120 37.727 1.00 8.21   ? 396 HIS B C   1 
ATOM   3652 O O   . HIS B 1 197 ? 22.020  54.482 36.655 1.00 10.63  ? 396 HIS B O   1 
ATOM   3653 C CB  . HIS B 1 197 ? 22.544  54.975 39.777 1.00 8.66   ? 396 HIS B CB  1 
ATOM   3654 C CG  . HIS B 1 197 ? 23.856  55.184 39.089 1.00 8.22   ? 396 HIS B CG  1 
ATOM   3655 N ND1 . HIS B 1 197 ? 24.968  54.408 39.337 1.00 8.25   ? 396 HIS B ND1 1 
ATOM   3656 C CD2 . HIS B 1 197 ? 24.217  56.062 38.125 1.00 7.47   ? 396 HIS B CD2 1 
ATOM   3657 C CE1 . HIS B 1 197 ? 25.957  54.795 38.552 1.00 8.32   ? 396 HIS B CE1 1 
ATOM   3658 N NE2 . HIS B 1 197 ? 25.526  55.797 37.808 1.00 10.09  ? 396 HIS B NE2 1 
ATOM   3659 N N   . ILE B 1 198 ? 21.232  52.862 37.992 1.00 6.55   ? 397 ILE B N   1 
ATOM   3660 C CA  . ILE B 1 198 ? 21.397  51.823 36.992 1.00 6.55   ? 397 ILE B CA  1 
ATOM   3661 C C   . ILE B 1 198 ? 20.521  52.132 35.785 1.00 7.11   ? 397 ILE B C   1 
ATOM   3662 O O   . ILE B 1 198 ? 20.901  51.899 34.640 1.00 9.06   ? 397 ILE B O   1 
ATOM   3663 C CB  . ILE B 1 198 ? 21.030  50.438 37.571 1.00 6.55   ? 397 ILE B CB  1 
ATOM   3664 C CG1 . ILE B 1 198 ? 21.888  50.157 38.803 1.00 6.55   ? 397 ILE B CG1 1 
ATOM   3665 C CG2 . ILE B 1 198 ? 21.272  49.350 36.543 1.00 6.55   ? 397 ILE B CG2 1 
ATOM   3666 C CD1 . ILE B 1 198 ? 21.653  48.794 39.418 1.00 6.55   ? 397 ILE B CD1 1 
ATOM   3667 N N   . GLU B 1 199 ? 19.356  52.696 36.046 1.00 6.89   ? 398 GLU B N   1 
ATOM   3668 C CA  . GLU B 1 199 ? 18.426  53.028 34.989 1.00 7.29   ? 398 GLU B CA  1 
ATOM   3669 C C   . GLU B 1 199 ? 18.927  54.075 34.011 1.00 8.25   ? 398 GLU B C   1 
ATOM   3670 O O   . GLU B 1 199 ? 18.599  54.026 32.836 1.00 10.32  ? 398 GLU B O   1 
ATOM   3671 C CB  . GLU B 1 199 ? 17.135  53.502 35.607 1.00 6.66   ? 398 GLU B CB  1 
ATOM   3672 C CG  . GLU B 1 199 ? 15.953  52.655 35.222 1.00 11.16  ? 398 GLU B CG  1 
ATOM   3673 C CD  . GLU B 1 199 ? 14.711  53.133 35.903 1.00 15.17  ? 398 GLU B CD  1 
ATOM   3674 O OE1 . GLU B 1 199 ? 14.588  54.368 36.053 1.00 18.09  ? 398 GLU B OE1 1 
ATOM   3675 O OE2 . GLU B 1 199 ? 13.863  52.290 36.280 1.00 16.66  ? 398 GLU B OE2 1 
ATOM   3676 N N   . LYS B 1 200 ? 19.692  55.040 34.506 1.00 9.90   ? 399 LYS B N   1 
ATOM   3677 C CA  . LYS B 1 200 ? 20.249  56.108 33.682 1.00 10.94  ? 399 LYS B CA  1 
ATOM   3678 C C   . LYS B 1 200 ? 21.483  55.537 32.981 1.00 10.77  ? 399 LYS B C   1 
ATOM   3679 O O   . LYS B 1 200 ? 21.913  56.020 31.933 1.00 11.60  ? 399 LYS B O   1 
ATOM   3680 C CB  . LYS B 1 200 ? 20.609  57.292 34.593 1.00 12.57  ? 399 LYS B CB  1 
ATOM   3681 C CG  . LYS B 1 200 ? 21.701  58.239 34.108 1.00 16.97  ? 399 LYS B CG  1 
ATOM   3682 C CD  . LYS B 1 200 ? 21.193  59.335 33.176 1.00 21.23  ? 399 LYS B CD  1 
ATOM   3683 C CE  . LYS B 1 200 ? 22.116  60.553 33.204 1.00 24.19  ? 399 LYS B CE  1 
ATOM   3684 N NZ  . LYS B 1 200 ? 23.580  60.210 33.314 1.00 28.04  ? 399 LYS B NZ  1 
ATOM   3685 N N   . MET B 1 201 ? 22.025  54.477 33.566 1.00 9.91   ? 400 MET B N   1 
ATOM   3686 C CA  . MET B 1 201 ? 23.209  53.812 33.039 1.00 8.36   ? 400 MET B CA  1 
ATOM   3687 C C   . MET B 1 201 ? 22.849  53.026 31.801 1.00 6.72   ? 400 MET B C   1 
ATOM   3688 O O   . MET B 1 201 ? 23.545  53.067 30.798 1.00 6.55   ? 400 MET B O   1 
ATOM   3689 C CB  . MET B 1 201 ? 23.785  52.876 34.097 1.00 7.63   ? 400 MET B CB  1 
ATOM   3690 C CG  . MET B 1 201 ? 25.064  52.189 33.684 1.00 7.57   ? 400 MET B CG  1 
ATOM   3691 S SD  . MET B 1 201 ? 25.872  51.497 35.133 1.00 10.75  ? 400 MET B SD  1 
ATOM   3692 C CE  . MET B 1 201 ? 26.834  50.193 34.370 1.00 7.60   ? 400 MET B CE  1 
ATOM   3693 N N   . GLN B 1 202 ? 21.750  52.303 31.890 1.00 6.55   ? 401 GLN B N   1 
ATOM   3694 C CA  . GLN B 1 202 ? 21.278  51.505 30.785 1.00 6.55   ? 401 GLN B CA  1 
ATOM   3695 C C   . GLN B 1 202 ? 20.625  52.400 29.761 1.00 7.12   ? 401 GLN B C   1 
ATOM   3696 O O   . GLN B 1 202 ? 20.679  52.150 28.570 1.00 8.97   ? 401 GLN B O   1 
ATOM   3697 C CB  . GLN B 1 202 ? 20.255  50.504 31.275 1.00 6.55   ? 401 GLN B CB  1 
ATOM   3698 C CG  . GLN B 1 202 ? 19.432  49.910 30.155 1.00 7.03   ? 401 GLN B CG  1 
ATOM   3699 C CD  . GLN B 1 202 ? 18.168  49.290 30.654 1.00 7.67   ? 401 GLN B CD  1 
ATOM   3700 O OE1 . GLN B 1 202 ? 17.400  49.927 31.373 1.00 11.29  ? 401 GLN B OE1 1 
ATOM   3701 N NE2 . GLN B 1 202 ? 17.930  48.042 30.274 1.00 6.55   ? 401 GLN B NE2 1 
ATOM   3702 N N   . GLU B 1 203 ? 19.974  53.439 30.237 1.00 9.14   ? 402 GLU B N   1 
ATOM   3703 C CA  . GLU B 1 203 ? 19.311  54.374 29.355 1.00 10.34  ? 402 GLU B CA  1 
ATOM   3704 C C   . GLU B 1 203 ? 20.357  54.889 28.374 1.00 9.52   ? 402 GLU B C   1 
ATOM   3705 O O   . GLU B 1 203 ? 20.029  55.330 27.275 1.00 9.60   ? 402 GLU B O   1 
ATOM   3706 C CB  . GLU B 1 203 ? 18.742  55.517 30.192 1.00 13.45  ? 402 GLU B CB  1 
ATOM   3707 C CG  . GLU B 1 203 ? 18.093  56.644 29.420 1.00 18.72  ? 402 GLU B CG  1 
ATOM   3708 C CD  . GLU B 1 203 ? 17.780  57.828 30.317 1.00 22.65  ? 402 GLU B CD  1 
ATOM   3709 O OE1 . GLU B 1 203 ? 16.903  57.686 31.203 1.00 24.72  ? 402 GLU B OE1 1 
ATOM   3710 O OE2 . GLU B 1 203 ? 18.420  58.893 30.140 1.00 22.70  ? 402 GLU B OE2 1 
ATOM   3711 N N   . GLY B 1 204 ? 21.623  54.803 28.777 1.00 8.73   ? 403 GLY B N   1 
ATOM   3712 C CA  . GLY B 1 204 ? 22.713  55.281 27.943 1.00 7.64   ? 403 GLY B CA  1 
ATOM   3713 C C   . GLY B 1 204 ? 23.348  54.211 27.090 1.00 6.75   ? 403 GLY B C   1 
ATOM   3714 O O   . GLY B 1 204 ? 23.955  54.500 26.074 1.00 6.73   ? 403 GLY B O   1 
ATOM   3715 N N   . ILE B 1 205 ? 23.232  52.967 27.519 1.00 7.87   ? 404 ILE B N   1 
ATOM   3716 C CA  . ILE B 1 205 ? 23.781  51.864 26.759 1.00 7.09   ? 404 ILE B CA  1 
ATOM   3717 C C   . ILE B 1 205 ? 22.818  51.707 25.618 1.00 6.55   ? 404 ILE B C   1 
ATOM   3718 O O   . ILE B 1 205 ? 23.229  51.636 24.472 1.00 6.85   ? 404 ILE B O   1 
ATOM   3719 C CB  . ILE B 1 205 ? 23.803  50.560 27.580 1.00 7.34   ? 404 ILE B CB  1 
ATOM   3720 C CG1 . ILE B 1 205 ? 24.853  50.668 28.688 1.00 7.49   ? 404 ILE B CG1 1 
ATOM   3721 C CG2 . ILE B 1 205 ? 24.084  49.376 26.673 1.00 6.88   ? 404 ILE B CG2 1 
ATOM   3722 C CD1 . ILE B 1 205 ? 24.882  49.487 29.634 1.00 9.23   ? 404 ILE B CD1 1 
ATOM   3723 N N   . VAL B 1 206 ? 21.531  51.686 25.954 1.00 6.55   ? 405 VAL B N   1 
ATOM   3724 C CA  . VAL B 1 206 ? 20.456  51.534 24.982 1.00 6.55   ? 405 VAL B CA  1 
ATOM   3725 C C   . VAL B 1 206 ? 20.331  52.676 23.974 1.00 9.01   ? 405 VAL B C   1 
ATOM   3726 O O   . VAL B 1 206 ? 19.735  52.503 22.916 1.00 9.97   ? 405 VAL B O   1 
ATOM   3727 C CB  . VAL B 1 206 ? 19.115  51.298 25.700 1.00 6.55   ? 405 VAL B CB  1 
ATOM   3728 C CG1 . VAL B 1 206 ? 17.949  51.740 24.852 1.00 6.55   ? 405 VAL B CG1 1 
ATOM   3729 C CG2 . VAL B 1 206 ? 18.980  49.837 25.995 1.00 6.55   ? 405 VAL B CG2 1 
ATOM   3730 N N   . HIS B 1 207 ? 20.888  53.842 24.279 1.00 10.98  ? 406 HIS B N   1 
ATOM   3731 C CA  . HIS B 1 207 ? 20.821  54.940 23.320 1.00 11.68  ? 406 HIS B CA  1 
ATOM   3732 C C   . HIS B 1 207 ? 21.917  54.714 22.304 1.00 9.48   ? 406 HIS B C   1 
ATOM   3733 O O   . HIS B 1 207 ? 21.712  54.844 21.109 1.00 12.35  ? 406 HIS B O   1 
ATOM   3734 C CB  . HIS B 1 207 ? 21.039  56.291 23.999 1.00 17.37  ? 406 HIS B CB  1 
ATOM   3735 C CG  . HIS B 1 207 ? 21.209  57.431 23.036 1.00 22.31  ? 406 HIS B CG  1 
ATOM   3736 N ND1 . HIS B 1 207 ? 22.445  57.904 22.648 1.00 23.53  ? 406 HIS B ND1 1 
ATOM   3737 C CD2 . HIS B 1 207 ? 20.295  58.172 22.361 1.00 23.70  ? 406 HIS B CD2 1 
ATOM   3738 C CE1 . HIS B 1 207 ? 22.285  58.887 21.777 1.00 23.68  ? 406 HIS B CE1 1 
ATOM   3739 N NE2 . HIS B 1 207 ? 20.990  59.068 21.585 1.00 23.36  ? 406 HIS B NE2 1 
ATOM   3740 N N   . VAL B 1 208 ? 23.094  54.384 22.802 1.00 6.55   ? 407 VAL B N   1 
ATOM   3741 C CA  . VAL B 1 208 ? 24.228  54.113 21.958 1.00 6.55   ? 407 VAL B CA  1 
ATOM   3742 C C   . VAL B 1 208 ? 23.896  52.899 21.090 1.00 6.55   ? 407 VAL B C   1 
ATOM   3743 O O   . VAL B 1 208 ? 24.475  52.720 20.028 1.00 6.55   ? 407 VAL B O   1 
ATOM   3744 C CB  . VAL B 1 208 ? 25.473  53.862 22.845 1.00 6.55   ? 407 VAL B CB  1 
ATOM   3745 C CG1 . VAL B 1 208 ? 26.215  52.635 22.410 1.00 6.55   ? 407 VAL B CG1 1 
ATOM   3746 C CG2 . VAL B 1 208 ? 26.382  55.058 22.798 1.00 6.55   ? 407 VAL B CG2 1 
ATOM   3747 N N   . LEU B 1 209 ? 22.941  52.084 21.539 1.00 6.55   ? 408 LEU B N   1 
ATOM   3748 C CA  . LEU B 1 209 ? 22.519  50.870 20.822 1.00 6.55   ? 408 LEU B CA  1 
ATOM   3749 C C   . LEU B 1 209 ? 21.621  51.248 19.664 1.00 8.22   ? 408 LEU B C   1 
ATOM   3750 O O   . LEU B 1 209 ? 21.893  50.914 18.514 1.00 11.33  ? 408 LEU B O   1 
ATOM   3751 C CB  . LEU B 1 209 ? 21.737  49.932 21.745 1.00 6.55   ? 408 LEU B CB  1 
ATOM   3752 C CG  . LEU B 1 209 ? 21.779  48.413 21.542 1.00 6.55   ? 408 LEU B CG  1 
ATOM   3753 C CD1 . LEU B 1 209 ? 20.401  47.846 21.784 1.00 6.55   ? 408 LEU B CD1 1 
ATOM   3754 C CD2 . LEU B 1 209 ? 22.240  48.059 20.152 1.00 6.55   ? 408 LEU B CD2 1 
ATOM   3755 N N   . ARG B 1 210 ? 20.532  51.934 19.984 1.00 9.39   ? 409 ARG B N   1 
ATOM   3756 C CA  . ARG B 1 210 ? 19.580  52.390 18.981 1.00 9.92   ? 409 ARG B CA  1 
ATOM   3757 C C   . ARG B 1 210 ? 20.343  52.990 17.809 1.00 7.04   ? 409 ARG B C   1 
ATOM   3758 O O   . ARG B 1 210 ? 20.083  52.670 16.663 1.00 6.80   ? 409 ARG B O   1 
ATOM   3759 C CB  . ARG B 1 210 ? 18.667  53.451 19.588 1.00 15.01  ? 409 ARG B CB  1 
ATOM   3760 C CG  . ARG B 1 210 ? 17.413  53.766 18.793 1.00 22.66  ? 409 ARG B CG  1 
ATOM   3761 C CD  . ARG B 1 210 ? 16.631  54.892 19.467 1.00 29.71  ? 409 ARG B CD  1 
ATOM   3762 N NE  . ARG B 1 210 ? 16.297  54.608 20.871 1.00 33.55  ? 409 ARG B NE  1 
ATOM   3763 C CZ  . ARG B 1 210 ? 16.735  55.314 21.915 1.00 33.97  ? 409 ARG B CZ  1 
ATOM   3764 N NH1 . ARG B 1 210 ? 17.535  56.360 21.740 1.00 35.04  ? 409 ARG B NH1 1 
ATOM   3765 N NH2 . ARG B 1 210 ? 16.369  54.972 23.141 1.00 33.87  ? 409 ARG B NH2 1 
ATOM   3766 N N   . LEU B 1 211 ? 21.299  53.854 18.107 1.00 6.55   ? 410 LEU B N   1 
ATOM   3767 C CA  . LEU B 1 211 ? 22.081  54.490 17.068 1.00 6.55   ? 410 LEU B CA  1 
ATOM   3768 C C   . LEU B 1 211 ? 22.980  53.556 16.268 1.00 6.55   ? 410 LEU B C   1 
ATOM   3769 O O   . LEU B 1 211 ? 22.882  53.503 15.044 1.00 6.55   ? 410 LEU B O   1 
ATOM   3770 C CB  . LEU B 1 211 ? 22.927  55.610 17.666 1.00 6.55   ? 410 LEU B CB  1 
ATOM   3771 C CG  . LEU B 1 211 ? 22.132  56.817 18.146 1.00 6.55   ? 410 LEU B CG  1 
ATOM   3772 C CD1 . LEU B 1 211 ? 23.076  57.990 18.264 1.00 6.55   ? 410 LEU B CD1 1 
ATOM   3773 C CD2 . LEU B 1 211 ? 21.006  57.142 17.161 1.00 6.55   ? 410 LEU B CD2 1 
ATOM   3774 N N   . HIS B 1 212 ? 23.862  52.834 16.955 1.00 6.55   ? 411 HIS B N   1 
ATOM   3775 C CA  . HIS B 1 212 ? 24.796  51.919 16.301 1.00 6.55   ? 411 HIS B CA  1 
ATOM   3776 C C   . HIS B 1 212 ? 24.043  50.962 15.408 1.00 6.81   ? 411 HIS B C   1 
ATOM   3777 O O   . HIS B 1 212 ? 24.599  50.418 14.467 1.00 7.69   ? 411 HIS B O   1 
ATOM   3778 C CB  . HIS B 1 212 ? 25.600  51.142 17.350 1.00 6.55   ? 411 HIS B CB  1 
ATOM   3779 C CG  . HIS B 1 212 ? 26.600  50.183 16.774 1.00 6.55   ? 411 HIS B CG  1 
ATOM   3780 N ND1 . HIS B 1 212 ? 26.290  48.878 16.463 1.00 6.55   ? 411 HIS B ND1 1 
ATOM   3781 C CD2 . HIS B 1 212 ? 27.915  50.332 16.486 1.00 6.55   ? 411 HIS B CD2 1 
ATOM   3782 C CE1 . HIS B 1 212 ? 27.370  48.262 16.014 1.00 6.55   ? 411 HIS B CE1 1 
ATOM   3783 N NE2 . HIS B 1 212 ? 28.371  49.122 16.019 1.00 6.55   ? 411 HIS B NE2 1 
ATOM   3784 N N   . LEU B 1 213 ? 22.762  50.786 15.700 1.00 7.26   ? 412 LEU B N   1 
ATOM   3785 C CA  . LEU B 1 213 ? 21.907  49.879 14.951 1.00 7.92   ? 412 LEU B CA  1 
ATOM   3786 C C   . LEU B 1 213 ? 21.195  50.584 13.798 1.00 10.48  ? 412 LEU B C   1 
ATOM   3787 O O   . LEU B 1 213 ? 21.023  50.022 12.716 1.00 9.72   ? 412 LEU B O   1 
ATOM   3788 C CB  . LEU B 1 213 ? 20.870  49.286 15.896 1.00 6.55   ? 412 LEU B CB  1 
ATOM   3789 C CG  . LEU B 1 213 ? 20.680  47.783 15.921 1.00 6.55   ? 412 LEU B CG  1 
ATOM   3790 C CD1 . LEU B 1 213 ? 21.922  47.127 16.469 1.00 6.55   ? 412 LEU B CD1 1 
ATOM   3791 C CD2 . LEU B 1 213 ? 19.481  47.457 16.773 1.00 6.55   ? 412 LEU B CD2 1 
ATOM   3792 N N   . GLN B 1 214 ? 20.749  51.810 14.045 1.00 14.66  ? 413 GLN B N   1 
ATOM   3793 C CA  . GLN B 1 214 ? 20.054  52.570 13.013 1.00 18.28  ? 413 GLN B CA  1 
ATOM   3794 C C   . GLN B 1 214 ? 20.984  52.578 11.840 1.00 17.35  ? 413 GLN B C   1 
ATOM   3795 O O   . GLN B 1 214 ? 20.719  52.013 10.785 1.00 18.55  ? 413 GLN B O   1 
ATOM   3796 C CB  . GLN B 1 214 ? 19.842  54.028 13.433 1.00 21.59  ? 413 GLN B CB  1 
ATOM   3797 C CG  . GLN B 1 214 ? 18.407  54.425 13.732 1.00 27.54  ? 413 GLN B CG  1 
ATOM   3798 C CD  . GLN B 1 214 ? 18.228  55.933 13.710 1.00 32.40  ? 413 GLN B CD  1 
ATOM   3799 O OE1 . GLN B 1 214 ? 19.211  56.689 13.657 1.00 35.10  ? 413 GLN B OE1 1 
ATOM   3800 N NE2 . GLN B 1 214 ? 16.972  56.382 13.753 1.00 34.15  ? 413 GLN B NE2 1 
ATOM   3801 N N   . SER B 1 215 ? 22.109  53.217 12.084 1.00 15.72  ? 414 SER B N   1 
ATOM   3802 C CA  . SER B 1 215 ? 23.131  53.399 11.101 1.00 14.02  ? 414 SER B CA  1 
ATOM   3803 C C   . SER B 1 215 ? 23.827  52.138 10.507 1.00 12.33  ? 414 SER B C   1 
ATOM   3804 O O   . SER B 1 215 ? 24.046  52.088 9.298  1.00 14.77  ? 414 SER B O   1 
ATOM   3805 C CB  . SER B 1 215 ? 24.118  54.397 11.696 1.00 13.00  ? 414 SER B CB  1 
ATOM   3806 O OG  . SER B 1 215 ? 24.977  53.765 12.624 1.00 16.63  ? 414 SER B OG  1 
ATOM   3807 N N   . ASN B 1 216 ? 24.160  51.123 11.303 1.00 9.81   ? 415 ASN B N   1 
ATOM   3808 C CA  . ASN B 1 216 ? 24.834  49.932 10.756 1.00 6.55   ? 415 ASN B CA  1 
ATOM   3809 C C   . ASN B 1 216 ? 23.983  48.900 10.043 1.00 6.88   ? 415 ASN B C   1 
ATOM   3810 O O   . ASN B 1 216 ? 24.504  48.041 9.361  1.00 7.72   ? 415 ASN B O   1 
ATOM   3811 C CB  . ASN B 1 216 ? 25.621  49.202 11.835 1.00 6.55   ? 415 ASN B CB  1 
ATOM   3812 C CG  . ASN B 1 216 ? 27.028  49.693 11.946 1.00 6.55   ? 415 ASN B CG  1 
ATOM   3813 O OD1 . ASN B 1 216 ? 27.273  50.805 12.388 1.00 6.55   ? 415 ASN B OD1 1 
ATOM   3814 N ND2 . ASN B 1 216 ? 27.971  48.867 11.535 1.00 6.55   ? 415 ASN B ND2 1 
ATOM   3815 N N   . HIS B 1 217 ? 22.679  48.940 10.235 1.00 9.86   ? 416 HIS B N   1 
ATOM   3816 C CA  . HIS B 1 217 ? 21.785  48.003 9.565  1.00 13.01  ? 416 HIS B CA  1 
ATOM   3817 C C   . HIS B 1 217 ? 20.666  48.898 9.089  1.00 15.86  ? 416 HIS B C   1 
ATOM   3818 O O   . HIS B 1 217 ? 19.504  48.699 9.442  1.00 16.73  ? 416 HIS B O   1 
ATOM   3819 C CB  . HIS B 1 217 ? 21.232  46.967 10.542 1.00 12.67  ? 416 HIS B CB  1 
ATOM   3820 C CG  . HIS B 1 217 ? 22.279  46.104 11.170 1.00 12.83  ? 416 HIS B CG  1 
ATOM   3821 N ND1 . HIS B 1 217 ? 22.143  44.739 11.283 1.00 12.47  ? 416 HIS B ND1 1 
ATOM   3822 C CD2 . HIS B 1 217 ? 23.459  46.414 11.754 1.00 13.45  ? 416 HIS B CD2 1 
ATOM   3823 C CE1 . HIS B 1 217 ? 23.194  44.245 11.910 1.00 12.34  ? 416 HIS B CE1 1 
ATOM   3824 N NE2 . HIS B 1 217 ? 24.007  45.241 12.207 1.00 13.75  ? 416 HIS B NE2 1 
ATOM   3825 N N   . PRO B 1 218 ? 21.009  49.902 8.267  1.00 17.87  ? 417 PRO B N   1 
ATOM   3826 C CA  . PRO B 1 218 ? 20.054  50.870 7.728  1.00 19.19  ? 417 PRO B CA  1 
ATOM   3827 C C   . PRO B 1 218 ? 18.937  50.280 6.874  1.00 20.07  ? 417 PRO B C   1 
ATOM   3828 O O   . PRO B 1 218 ? 17.897  50.905 6.671  1.00 19.44  ? 417 PRO B O   1 
ATOM   3829 C CB  . PRO B 1 218 ? 20.955  51.833 6.963  1.00 18.82  ? 417 PRO B CB  1 
ATOM   3830 C CG  . PRO B 1 218 ? 21.994  50.925 6.418  1.00 18.48  ? 417 PRO B CG  1 
ATOM   3831 C CD  . PRO B 1 218 ? 22.310  50.013 7.574  1.00 18.02  ? 417 PRO B CD  1 
ATOM   3832 N N   . ASP B 1 219 ? 19.142  49.073 6.374  1.00 21.85  ? 418 ASP B N   1 
ATOM   3833 C CA  . ASP B 1 219 ? 18.104  48.465 5.566  1.00 23.34  ? 418 ASP B CA  1 
ATOM   3834 C C   . ASP B 1 219 ? 17.016  47.965 6.492  1.00 21.18  ? 418 ASP B C   1 
ATOM   3835 O O   . ASP B 1 219 ? 15.832  48.148 6.217  1.00 20.99  ? 418 ASP B O   1 
ATOM   3836 C CB  . ASP B 1 219 ? 18.674  47.324 4.716  1.00 28.32  ? 418 ASP B CB  1 
ATOM   3837 C CG  . ASP B 1 219 ? 19.642  47.826 3.631  1.00 31.61  ? 418 ASP B CG  1 
ATOM   3838 O OD1 . ASP B 1 219 ? 19.664  49.056 3.367  1.00 31.55  ? 418 ASP B OD1 1 
ATOM   3839 O OD2 . ASP B 1 219 ? 20.367  46.989 3.039  1.00 32.38  ? 418 ASP B OD2 1 
ATOM   3840 N N   . ASP B 1 220 ? 17.426  47.345 7.594  1.00 18.37  ? 419 ASP B N   1 
ATOM   3841 C CA  . ASP B 1 220 ? 16.479  46.841 8.580  1.00 15.58  ? 419 ASP B CA  1 
ATOM   3842 C C   . ASP B 1 220 ? 16.093  48.045 9.413  1.00 14.95  ? 419 ASP B C   1 
ATOM   3843 O O   . ASP B 1 220 ? 16.587  48.214 10.523 1.00 15.76  ? 419 ASP B O   1 
ATOM   3844 C CB  . ASP B 1 220 ? 17.139  45.806 9.478  1.00 12.74  ? 419 ASP B CB  1 
ATOM   3845 C CG  . ASP B 1 220 ? 16.136  44.891 10.112 1.00 13.03  ? 419 ASP B CG  1 
ATOM   3846 O OD1 . ASP B 1 220 ? 15.090  45.395 10.572 1.00 13.19  ? 419 ASP B OD1 1 
ATOM   3847 O OD2 . ASP B 1 220 ? 16.388  43.670 10.151 1.00 14.22  ? 419 ASP B OD2 1 
ATOM   3848 N N   . ILE B 1 221 ? 15.198  48.873 8.887  1.00 14.44  ? 420 ILE B N   1 
ATOM   3849 C CA  . ILE B 1 221 ? 14.826  50.097 9.579  1.00 13.88  ? 420 ILE B CA  1 
ATOM   3850 C C   . ILE B 1 221 ? 14.074  49.975 10.895 1.00 13.09  ? 420 ILE B C   1 
ATOM   3851 O O   . ILE B 1 221 ? 14.033  50.936 11.653 1.00 14.68  ? 420 ILE B O   1 
ATOM   3852 C CB  . ILE B 1 221 ? 14.104  51.099 8.606  1.00 14.08  ? 420 ILE B CB  1 
ATOM   3853 C CG1 . ILE B 1 221 ? 12.656  51.335 9.009  1.00 13.52  ? 420 ILE B CG1 1 
ATOM   3854 C CG2 . ILE B 1 221 ? 14.170  50.585 7.183  1.00 15.30  ? 420 ILE B CG2 1 
ATOM   3855 C CD1 . ILE B 1 221 ? 11.965  52.303 8.083  1.00 12.91  ? 420 ILE B CD1 1 
ATOM   3856 N N   . PHE B 1 222 ? 13.487  48.817 11.183 1.00 12.31  ? 421 PHE B N   1 
ATOM   3857 C CA  . PHE B 1 222 ? 12.797  48.631 12.467 1.00 11.97  ? 421 PHE B CA  1 
ATOM   3858 C C   . PHE B 1 222 ? 13.547  47.571 13.282 1.00 12.16  ? 421 PHE B C   1 
ATOM   3859 O O   . PHE B 1 222 ? 12.937  46.764 13.991 1.00 12.66  ? 421 PHE B O   1 
ATOM   3860 C CB  . PHE B 1 222 ? 11.329  48.197 12.272 1.00 11.69  ? 421 PHE B CB  1 
ATOM   3861 C CG  . PHE B 1 222 ? 10.407  49.315 11.845 1.00 10.97  ? 421 PHE B CG  1 
ATOM   3862 C CD1 . PHE B 1 222 ? 9.623   49.193 10.705 1.00 10.06  ? 421 PHE B CD1 1 
ATOM   3863 C CD2 . PHE B 1 222 ? 10.343  50.499 12.566 1.00 10.89  ? 421 PHE B CD2 1 
ATOM   3864 C CE1 . PHE B 1 222 ? 8.800   50.231 10.292 1.00 8.49   ? 421 PHE B CE1 1 
ATOM   3865 C CE2 . PHE B 1 222 ? 9.518   51.541 12.155 1.00 9.61   ? 421 PHE B CE2 1 
ATOM   3866 C CZ  . PHE B 1 222 ? 8.749   51.405 11.018 1.00 8.42   ? 421 PHE B CZ  1 
ATOM   3867 N N   . LEU B 1 223 ? 14.876  47.587 13.183 1.00 10.30  ? 422 LEU B N   1 
ATOM   3868 C CA  . LEU B 1 223 ? 15.701  46.627 13.897 1.00 7.94   ? 422 LEU B CA  1 
ATOM   3869 C C   . LEU B 1 223 ? 15.687  46.858 15.401 1.00 8.89   ? 422 LEU B C   1 
ATOM   3870 O O   . LEU B 1 223 ? 15.785  45.902 16.155 1.00 10.08  ? 422 LEU B O   1 
ATOM   3871 C CB  . LEU B 1 223 ? 17.149  46.674 13.408 1.00 6.55   ? 422 LEU B CB  1 
ATOM   3872 C CG  . LEU B 1 223 ? 17.885  45.332 13.283 1.00 6.55   ? 422 LEU B CG  1 
ATOM   3873 C CD1 . LEU B 1 223 ? 19.377  45.577 13.258 1.00 6.55   ? 422 LEU B CD1 1 
ATOM   3874 C CD2 . LEU B 1 223 ? 17.535  44.413 14.425 1.00 6.55   ? 422 LEU B CD2 1 
ATOM   3875 N N   . PHE B 1 224 ? 15.580  48.108 15.853 1.00 9.22   ? 423 PHE B N   1 
ATOM   3876 C CA  . PHE B 1 224 ? 15.558  48.357 17.297 1.00 7.65   ? 423 PHE B CA  1 
ATOM   3877 C C   . PHE B 1 224 ? 14.299  47.772 17.907 1.00 7.05   ? 423 PHE B C   1 
ATOM   3878 O O   . PHE B 1 224 ? 14.377  46.878 18.736 1.00 7.05   ? 423 PHE B O   1 
ATOM   3879 C CB  . PHE B 1 224 ? 15.632  49.847 17.627 1.00 8.96   ? 423 PHE B CB  1 
ATOM   3880 C CG  . PHE B 1 224 ? 15.760  50.131 19.102 1.00 8.29   ? 423 PHE B CG  1 
ATOM   3881 C CD1 . PHE B 1 224 ? 16.843  49.647 19.821 1.00 7.63   ? 423 PHE B CD1 1 
ATOM   3882 C CD2 . PHE B 1 224 ? 14.796  50.872 19.771 1.00 8.32   ? 423 PHE B CD2 1 
ATOM   3883 C CE1 . PHE B 1 224 ? 16.960  49.894 21.172 1.00 6.55   ? 423 PHE B CE1 1 
ATOM   3884 C CE2 . PHE B 1 224 ? 14.912  51.122 21.127 1.00 6.55   ? 423 PHE B CE2 1 
ATOM   3885 C CZ  . PHE B 1 224 ? 15.992  50.632 21.825 1.00 6.55   ? 423 PHE B CZ  1 
ATOM   3886 N N   . PRO B 1 225 ? 13.116  48.274 17.518 1.00 6.96   ? 424 PRO B N   1 
ATOM   3887 C CA  . PRO B 1 225 ? 11.908  47.694 18.105 1.00 8.11   ? 424 PRO B CA  1 
ATOM   3888 C C   . PRO B 1 225 ? 11.873  46.191 17.865 1.00 9.38   ? 424 PRO B C   1 
ATOM   3889 O O   . PRO B 1 225 ? 11.166  45.452 18.546 1.00 10.08  ? 424 PRO B O   1 
ATOM   3890 C CB  . PRO B 1 225 ? 10.776  48.444 17.400 1.00 6.55   ? 424 PRO B CB  1 
ATOM   3891 C CG  . PRO B 1 225 ? 11.394  48.921 16.153 1.00 7.08   ? 424 PRO B CG  1 
ATOM   3892 C CD  . PRO B 1 225 ? 12.760  49.355 16.592 1.00 7.43   ? 424 PRO B CD  1 
ATOM   3893 N N   . LYS B 1 226 ? 12.642  45.737 16.887 1.00 10.11  ? 425 LYS B N   1 
ATOM   3894 C CA  . LYS B 1 226 ? 12.706  44.315 16.616 1.00 11.90  ? 425 LYS B CA  1 
ATOM   3895 C C   . LYS B 1 226 ? 13.577  43.689 17.704 1.00 13.11  ? 425 LYS B C   1 
ATOM   3896 O O   . LYS B 1 226 ? 13.304  42.591 18.172 1.00 15.48  ? 425 LYS B O   1 
ATOM   3897 C CB  . LYS B 1 226 ? 13.325  44.051 15.241 1.00 13.03  ? 425 LYS B CB  1 
ATOM   3898 C CG  . LYS B 1 226 ? 12.342  44.001 14.082 1.00 14.12  ? 425 LYS B CG  1 
ATOM   3899 C CD  . LYS B 1 226 ? 13.072  43.680 12.784 1.00 15.60  ? 425 LYS B CD  1 
ATOM   3900 C CE  . LYS B 1 226 ? 12.123  43.500 11.607 1.00 17.50  ? 425 LYS B CE  1 
ATOM   3901 N NZ  . LYS B 1 226 ? 12.828  43.103 10.345 1.00 15.94  ? 425 LYS B NZ  1 
ATOM   3902 N N   . LEU B 1 227 ? 14.625  44.397 18.113 1.00 13.20  ? 426 LEU B N   1 
ATOM   3903 C CA  . LEU B 1 227 ? 15.529  43.894 19.139 1.00 12.96  ? 426 LEU B CA  1 
ATOM   3904 C C   . LEU B 1 227 ? 14.979  44.033 20.540 1.00 14.04  ? 426 LEU B C   1 
ATOM   3905 O O   . LEU B 1 227 ? 15.441  43.354 21.447 1.00 14.53  ? 426 LEU B O   1 
ATOM   3906 C CB  . LEU B 1 227 ? 16.875  44.607 19.074 1.00 13.06  ? 426 LEU B CB  1 
ATOM   3907 C CG  . LEU B 1 227 ? 17.998  43.859 18.366 1.00 14.97  ? 426 LEU B CG  1 
ATOM   3908 C CD1 . LEU B 1 227 ? 19.299  44.633 18.526 1.00 15.83  ? 426 LEU B CD1 1 
ATOM   3909 C CD2 . LEU B 1 227 ? 18.131  42.470 18.962 1.00 15.88  ? 426 LEU B CD2 1 
ATOM   3910 N N   . LEU B 1 228 ? 14.013  44.925 20.732 1.00 15.01  ? 427 LEU B N   1 
ATOM   3911 C CA  . LEU B 1 228 ? 13.435  45.096 22.056 1.00 15.14  ? 427 LEU B CA  1 
ATOM   3912 C C   . LEU B 1 228 ? 12.492  43.940 22.283 1.00 16.58  ? 427 LEU B C   1 
ATOM   3913 O O   . LEU B 1 228 ? 12.414  43.398 23.379 1.00 18.69  ? 427 LEU B O   1 
ATOM   3914 C CB  . LEU B 1 228 ? 12.653  46.403 22.172 1.00 13.15  ? 427 LEU B CB  1 
ATOM   3915 C CG  . LEU B 1 228 ? 13.396  47.730 22.028 1.00 14.78  ? 427 LEU B CG  1 
ATOM   3916 C CD1 . LEU B 1 228 ? 12.446  48.822 22.473 1.00 16.12  ? 427 LEU B CD1 1 
ATOM   3917 C CD2 . LEU B 1 228 ? 14.671  47.768 22.859 1.00 12.08  ? 427 LEU B CD2 1 
ATOM   3918 N N   . GLN B 1 229 ? 11.774  43.556 21.240 1.00 18.20  ? 428 GLN B N   1 
ATOM   3919 C CA  . GLN B 1 229 ? 10.838  42.457 21.364 1.00 20.70  ? 428 GLN B CA  1 
ATOM   3920 C C   . GLN B 1 229 ? 11.582  41.168 21.681 1.00 21.13  ? 428 GLN B C   1 
ATOM   3921 O O   . GLN B 1 229 ? 10.979  40.188 22.117 1.00 21.19  ? 428 GLN B O   1 
ATOM   3922 C CB  . GLN B 1 229 ? 10.021  42.306 20.078 1.00 25.42  ? 428 GLN B CB  1 
ATOM   3923 C CG  . GLN B 1 229 ? 8.971   41.197 20.109 1.00 30.41  ? 428 GLN B CG  1 
ATOM   3924 C CD  . GLN B 1 229 ? 8.003   41.308 21.287 1.00 32.87  ? 428 GLN B CD  1 
ATOM   3925 O OE1 . GLN B 1 229 ? 7.386   42.355 21.511 1.00 34.06  ? 428 GLN B OE1 1 
ATOM   3926 N NE2 . GLN B 1 229 ? 7.862   40.220 22.038 1.00 32.68  ? 428 GLN B NE2 1 
ATOM   3927 N N   . LYS B 1 230 ? 12.894  41.167 21.463 1.00 21.20  ? 429 LYS B N   1 
ATOM   3928 C CA  . LYS B 1 230 ? 13.695  39.983 21.760 1.00 20.74  ? 429 LYS B CA  1 
ATOM   3929 C C   . LYS B 1 230 ? 14.162  39.990 23.211 1.00 21.49  ? 429 LYS B C   1 
ATOM   3930 O O   . LYS B 1 230 ? 14.194  38.941 23.836 1.00 20.76  ? 429 LYS B O   1 
ATOM   3931 C CB  . LYS B 1 230 ? 14.901  39.883 20.826 1.00 18.61  ? 429 LYS B CB  1 
ATOM   3932 C CG  . LYS B 1 230 ? 14.548  39.680 19.362 1.00 16.55  ? 429 LYS B CG  1 
ATOM   3933 C CD  . LYS B 1 230 ? 13.651  38.471 19.136 1.00 15.38  ? 429 LYS B CD  1 
ATOM   3934 C CE  . LYS B 1 230 ? 13.494  38.185 17.649 1.00 14.76  ? 429 LYS B CE  1 
ATOM   3935 N NZ  . LYS B 1 230 ? 12.430  37.192 17.350 1.00 13.21  ? 429 LYS B NZ  1 
ATOM   3936 N N   . MET B 1 231 ? 14.528  41.161 23.746 1.00 24.33  ? 430 MET B N   1 
ATOM   3937 C CA  . MET B 1 231 ? 14.964  41.268 25.151 1.00 26.26  ? 430 MET B CA  1 
ATOM   3938 C C   . MET B 1 231 ? 13.815  40.767 26.006 1.00 25.84  ? 430 MET B C   1 
ATOM   3939 O O   . MET B 1 231 ? 14.000  40.420 27.170 1.00 26.37  ? 430 MET B O   1 
ATOM   3940 C CB  . MET B 1 231 ? 15.269  42.723 25.574 1.00 27.27  ? 430 MET B CB  1 
ATOM   3941 C CG  . MET B 1 231 ? 16.501  43.358 24.943 1.00 31.00  ? 430 MET B CG  1 
ATOM   3942 S SD  . MET B 1 231 ? 16.983  44.968 25.616 1.00 37.03  ? 430 MET B SD  1 
ATOM   3943 C CE  . MET B 1 231 ? 15.576  45.993 25.205 1.00 35.93  ? 430 MET B CE  1 
ATOM   3944 N N   . ALA B 1 232 ? 12.631  40.727 25.399 1.00 25.14  ? 431 ALA B N   1 
ATOM   3945 C CA  . ALA B 1 232 ? 11.416  40.300 26.067 1.00 25.80  ? 431 ALA B CA  1 
ATOM   3946 C C   . ALA B 1 232 ? 11.117  38.810 25.943 1.00 27.15  ? 431 ALA B C   1 
ATOM   3947 O O   . ALA B 1 232 ? 10.711  38.180 26.915 1.00 28.40  ? 431 ALA B O   1 
ATOM   3948 C CB  . ALA B 1 232 ? 10.251  41.106 25.545 1.00 25.50  ? 431 ALA B CB  1 
ATOM   3949 N N   . ASP B 1 233 ? 11.296  38.246 24.753 1.00 28.73  ? 432 ASP B N   1 
ATOM   3950 C CA  . ASP B 1 233 ? 11.044  36.816 24.553 1.00 28.45  ? 432 ASP B CA  1 
ATOM   3951 C C   . ASP B 1 233 ? 12.164  36.040 25.245 1.00 26.06  ? 432 ASP B C   1 
ATOM   3952 O O   . ASP B 1 233 ? 12.026  34.866 25.564 1.00 25.63  ? 432 ASP B O   1 
ATOM   3953 C CB  . ASP B 1 233 ? 11.027  36.456 23.052 1.00 32.88  ? 432 ASP B CB  1 
ATOM   3954 C CG  . ASP B 1 233 ? 10.004  37.269 22.247 1.00 36.88  ? 432 ASP B CG  1 
ATOM   3955 O OD1 . ASP B 1 233 ? 8.839   37.380 22.690 1.00 40.64  ? 432 ASP B OD1 1 
ATOM   3956 O OD2 . ASP B 1 233 ? 10.362  37.783 21.161 1.00 36.91  ? 432 ASP B OD2 1 
ATOM   3957 N N   . LEU B 1 234 ? 13.279  36.723 25.467 1.00 24.86  ? 433 LEU B N   1 
ATOM   3958 C CA  . LEU B 1 234 ? 14.449  36.147 26.109 1.00 23.93  ? 433 LEU B CA  1 
ATOM   3959 C C   . LEU B 1 234 ? 14.224  36.076 27.598 1.00 24.31  ? 433 LEU B C   1 
ATOM   3960 O O   . LEU B 1 234 ? 14.701  35.160 28.262 1.00 24.18  ? 433 LEU B O   1 
ATOM   3961 C CB  . LEU B 1 234 ? 15.670  37.025 25.860 1.00 23.90  ? 433 LEU B CB  1 
ATOM   3962 C CG  . LEU B 1 234 ? 16.859  36.510 25.063 1.00 23.12  ? 433 LEU B CG  1 
ATOM   3963 C CD1 . LEU B 1 234 ? 17.926  37.567 25.088 1.00 24.16  ? 433 LEU B CD1 1 
ATOM   3964 C CD2 . LEU B 1 234 ? 17.395  35.234 25.664 1.00 25.39  ? 433 LEU B CD2 1 
ATOM   3965 N N   . ARG B 1 235 ? 13.518  37.072 28.121 1.00 24.57  ? 434 ARG B N   1 
ATOM   3966 C CA  . ARG B 1 235 ? 13.236  37.130 29.542 1.00 25.17  ? 434 ARG B CA  1 
ATOM   3967 C C   . ARG B 1 235 ? 12.305  35.965 29.865 1.00 25.54  ? 434 ARG B C   1 
ATOM   3968 O O   . ARG B 1 235 ? 12.406  35.339 30.924 1.00 26.27  ? 434 ARG B O   1 
ATOM   3969 C CB  . ARG B 1 235 ? 12.599  38.482 29.887 1.00 25.47  ? 434 ARG B CB  1 
ATOM   3970 C CG  . ARG B 1 235 ? 12.570  38.798 31.373 1.00 27.71  ? 434 ARG B CG  1 
ATOM   3971 C CD  . ARG B 1 235 ? 12.386  40.284 31.651 1.00 28.93  ? 434 ARG B CD  1 
ATOM   3972 N NE  . ARG B 1 235 ? 13.622  41.038 31.474 1.00 30.53  ? 434 ARG B NE  1 
ATOM   3973 C CZ  . ARG B 1 235 ? 13.844  42.245 31.989 1.00 33.41  ? 434 ARG B CZ  1 
ATOM   3974 N NH1 . ARG B 1 235 ? 12.916  42.852 32.720 1.00 35.38  ? 434 ARG B NH1 1 
ATOM   3975 N NH2 . ARG B 1 235 ? 15.001  42.847 31.787 1.00 34.98  ? 434 ARG B NH2 1 
ATOM   3976 N N   . GLN B 1 236 ? 11.417  35.664 28.923 1.00 24.94  ? 435 GLN B N   1 
ATOM   3977 C CA  . GLN B 1 236 ? 10.462  34.573 29.061 1.00 24.69  ? 435 GLN B CA  1 
ATOM   3978 C C   . GLN B 1 236 ? 11.161  33.227 28.910 1.00 23.65  ? 435 GLN B C   1 
ATOM   3979 O O   . GLN B 1 236 ? 11.098  32.384 29.798 1.00 24.91  ? 435 GLN B O   1 
ATOM   3980 C CB  . GLN B 1 236 ? 9.377   34.716 27.999 1.00 26.68  ? 435 GLN B CB  1 
ATOM   3981 C CG  . GLN B 1 236 ? 8.689   33.416 27.634 1.00 31.04  ? 435 GLN B CG  1 
ATOM   3982 C CD  . GLN B 1 236 ? 7.301   33.308 28.214 1.00 33.67  ? 435 GLN B CD  1 
ATOM   3983 O OE1 . GLN B 1 236 ? 7.104   33.491 29.417 1.00 34.56  ? 435 GLN B OE1 1 
ATOM   3984 N NE2 . GLN B 1 236 ? 6.325   33.003 27.359 1.00 34.43  ? 435 GLN B NE2 1 
ATOM   3985 N N   . LEU B 1 237 ? 11.818  33.036 27.773 1.00 22.33  ? 436 LEU B N   1 
ATOM   3986 C CA  . LEU B 1 237 ? 12.547  31.810 27.478 1.00 22.33  ? 436 LEU B CA  1 
ATOM   3987 C C   . LEU B 1 237 ? 13.325  31.365 28.710 1.00 24.23  ? 436 LEU B C   1 
ATOM   3988 O O   . LEU B 1 237 ? 13.376  30.181 29.058 1.00 23.87  ? 436 LEU B O   1 
ATOM   3989 C CB  . LEU B 1 237 ? 13.531  32.075 26.347 1.00 20.31  ? 436 LEU B CB  1 
ATOM   3990 C CG  . LEU B 1 237 ? 14.034  30.923 25.478 1.00 20.44  ? 436 LEU B CG  1 
ATOM   3991 C CD1 . LEU B 1 237 ? 15.525  31.087 25.306 1.00 19.13  ? 436 LEU B CD1 1 
ATOM   3992 C CD2 . LEU B 1 237 ? 13.701  29.571 26.091 1.00 19.64  ? 436 LEU B CD2 1 
ATOM   3993 N N   . VAL B 1 238 ? 13.938  32.350 29.355 1.00 27.16  ? 437 VAL B N   1 
ATOM   3994 C CA  . VAL B 1 238 ? 14.742  32.150 30.553 1.00 28.68  ? 437 VAL B CA  1 
ATOM   3995 C C   . VAL B 1 238 ? 13.896  31.538 31.666 1.00 30.11  ? 437 VAL B C   1 
ATOM   3996 O O   . VAL B 1 238 ? 14.309  30.572 32.309 1.00 30.74  ? 437 VAL B O   1 
ATOM   3997 C CB  . VAL B 1 238 ? 15.355  33.507 31.016 1.00 27.77  ? 437 VAL B CB  1 
ATOM   3998 C CG1 . VAL B 1 238 ? 14.667  34.018 32.274 1.00 28.18  ? 437 VAL B CG1 1 
ATOM   3999 C CG2 . VAL B 1 238 ? 16.833  33.354 31.229 1.00 26.76  ? 437 VAL B CG2 1 
ATOM   4000 N N   . THR B 1 239 ? 12.713  32.108 31.883 1.00 30.98  ? 438 THR B N   1 
ATOM   4001 C CA  . THR B 1 239 ? 11.785  31.625 32.901 1.00 32.05  ? 438 THR B CA  1 
ATOM   4002 C C   . THR B 1 239 ? 11.510  30.145 32.665 1.00 33.29  ? 438 THR B C   1 
ATOM   4003 O O   . THR B 1 239 ? 11.908  29.280 33.450 1.00 33.79  ? 438 THR B O   1 
ATOM   4004 C CB  . THR B 1 239 ? 10.440  32.384 32.827 1.00 31.11  ? 438 THR B CB  1 
ATOM   4005 O OG1 . THR B 1 239 ? 10.612  33.718 33.316 1.00 30.74  ? 438 THR B OG1 1 
ATOM   4006 C CG2 . THR B 1 239 ? 9.370   31.672 33.641 1.00 31.23  ? 438 THR B CG2 1 
ATOM   4007 N N   . GLU B 1 240 ? 10.827  29.875 31.561 1.00 33.95  ? 439 GLU B N   1 
ATOM   4008 C CA  . GLU B 1 240 ? 10.462  28.527 31.179 1.00 34.89  ? 439 GLU B CA  1 
ATOM   4009 C C   . GLU B 1 240 ? 11.626  27.563 31.333 1.00 35.10  ? 439 GLU B C   1 
ATOM   4010 O O   . GLU B 1 240 ? 11.453  26.440 31.792 1.00 35.03  ? 439 GLU B O   1 
ATOM   4011 C CB  . GLU B 1 240 ? 9.949   28.553 29.748 1.00 34.96  ? 439 GLU B CB  1 
ATOM   4012 C CG  . GLU B 1 240 ? 9.091   29.781 29.514 1.00 37.10  ? 439 GLU B CG  1 
ATOM   4013 C CD  . GLU B 1 240 ? 8.441   29.799 28.159 1.00 40.39  ? 439 GLU B CD  1 
ATOM   4014 O OE1 . GLU B 1 240 ? 9.145   29.548 27.153 1.00 41.84  ? 439 GLU B OE1 1 
ATOM   4015 O OE2 . GLU B 1 240 ? 7.223   30.077 28.101 1.00 41.63  ? 439 GLU B OE2 1 
ATOM   4016 N N   . HIS B 1 241 ? 12.824  27.996 30.973 1.00 36.07  ? 440 HIS B N   1 
ATOM   4017 C CA  . HIS B 1 241 ? 13.955  27.102 31.111 1.00 37.00  ? 440 HIS B CA  1 
ATOM   4018 C C   . HIS B 1 241 ? 14.078  26.597 32.542 1.00 37.12  ? 440 HIS B C   1 
ATOM   4019 O O   . HIS B 1 241 ? 14.447  25.454 32.769 1.00 35.68  ? 440 HIS B O   1 
ATOM   4020 C CB  . HIS B 1 241 ? 15.253  27.792 30.718 1.00 36.29  ? 440 HIS B CB  1 
ATOM   4021 C CG  . HIS B 1 241 ? 16.467  26.957 30.981 1.00 35.42  ? 440 HIS B CG  1 
ATOM   4022 N ND1 . HIS B 1 241 ? 16.862  25.930 30.150 1.00 34.04  ? 440 HIS B ND1 1 
ATOM   4023 C CD2 . HIS B 1 241 ? 17.337  26.956 32.018 1.00 35.35  ? 440 HIS B CD2 1 
ATOM   4024 C CE1 . HIS B 1 241 ? 17.922  25.333 30.664 1.00 34.34  ? 440 HIS B CE1 1 
ATOM   4025 N NE2 . HIS B 1 241 ? 18.230  25.936 31.799 1.00 35.50  ? 440 HIS B NE2 1 
ATOM   4026 N N   . ALA B 1 242 ? 13.767  27.452 33.505 1.00 39.94  ? 441 ALA B N   1 
ATOM   4027 C CA  . ALA B 1 242 ? 13.862  27.078 34.914 1.00 44.63  ? 441 ALA B CA  1 
ATOM   4028 C C   . ALA B 1 242 ? 12.675  26.238 35.381 1.00 47.57  ? 441 ALA B C   1 
ATOM   4029 O O   . ALA B 1 242 ? 12.836  25.266 36.124 1.00 47.46  ? 441 ALA B O   1 
ATOM   4030 C CB  . ALA B 1 242 ? 13.980  28.326 35.774 1.00 44.38  ? 441 ALA B CB  1 
ATOM   4031 N N   . GLN B 1 243 ? 11.479  26.624 34.954 1.00 50.35  ? 442 GLN B N   1 
ATOM   4032 C CA  . GLN B 1 243 ? 10.284  25.898 35.335 1.00 53.28  ? 442 GLN B CA  1 
ATOM   4033 C C   . GLN B 1 243 ? 10.259  24.569 34.577 1.00 55.25  ? 442 GLN B C   1 
ATOM   4034 O O   . GLN B 1 243 ? 9.622   23.610 35.010 1.00 56.57  ? 442 GLN B O   1 
ATOM   4035 C CB  . GLN B 1 243 ? 9.052   26.779 35.062 1.00 54.24  ? 442 GLN B CB  1 
ATOM   4036 C CG  . GLN B 1 243 ? 8.086   26.351 33.968 1.00 56.65  ? 442 GLN B CG  1 
ATOM   4037 C CD  . GLN B 1 243 ? 7.122   27.482 33.597 1.00 58.80  ? 442 GLN B CD  1 
ATOM   4038 O OE1 . GLN B 1 243 ? 6.622   28.202 34.470 1.00 59.99  ? 442 GLN B OE1 1 
ATOM   4039 N NE2 . GLN B 1 243 ? 6.857   27.639 32.302 1.00 58.69  ? 442 GLN B NE2 1 
ATOM   4040 N N   . LEU B 1 244 ? 10.991  24.517 33.463 1.00 56.96  ? 443 LEU B N   1 
ATOM   4041 C CA  . LEU B 1 244 ? 11.099  23.316 32.626 1.00 58.40  ? 443 LEU B CA  1 
ATOM   4042 C C   . LEU B 1 244 ? 12.362  22.558 33.012 1.00 59.67  ? 443 LEU B C   1 
ATOM   4043 O O   . LEU B 1 244 ? 12.783  21.614 32.342 1.00 58.67  ? 443 LEU B O   1 
ATOM   4044 C CB  . LEU B 1 244 ? 11.155  23.703 31.142 1.00 57.61  ? 443 LEU B CB  1 
ATOM   4045 C CG  . LEU B 1 244 ? 11.680  22.698 30.109 1.00 56.79  ? 443 LEU B CG  1 
ATOM   4046 C CD1 . LEU B 1 244 ? 10.859  21.426 30.143 1.00 56.70  ? 443 LEU B CD1 1 
ATOM   4047 C CD2 . LEU B 1 244 ? 11.635  23.328 28.727 1.00 56.47  ? 443 LEU B CD2 1 
ATOM   4048 N N   . VAL B 1 245 ? 12.967  22.998 34.105 1.00 62.45  ? 444 VAL B N   1 
ATOM   4049 C CA  . VAL B 1 245 ? 14.174  22.380 34.625 1.00 65.89  ? 444 VAL B CA  1 
ATOM   4050 C C   . VAL B 1 245 ? 13.894  22.067 36.086 1.00 67.84  ? 444 VAL B C   1 
ATOM   4051 O O   . VAL B 1 245 ? 14.628  21.319 36.734 1.00 68.41  ? 444 VAL B O   1 
ATOM   4052 C CB  . VAL B 1 245 ? 15.395  23.331 34.482 1.00 66.66  ? 444 VAL B CB  1 
ATOM   4053 C CG1 . VAL B 1 245 ? 16.057  23.582 35.838 1.00 66.15  ? 444 VAL B CG1 1 
ATOM   4054 C CG2 . VAL B 1 245 ? 16.391  22.732 33.497 1.00 67.08  ? 444 VAL B CG2 1 
ATOM   4055 N N   . GLN B 1 246 ? 12.817  22.655 36.597 1.00 69.93  ? 445 GLN B N   1 
ATOM   4056 C CA  . GLN B 1 246 ? 12.399  22.422 37.972 1.00 72.21  ? 445 GLN B CA  1 
ATOM   4057 C C   . GLN B 1 246 ? 11.851  20.997 37.946 1.00 73.66  ? 445 GLN B C   1 
ATOM   4058 O O   . GLN B 1 246 ? 12.174  20.161 38.793 1.00 73.52  ? 445 GLN B O   1 
ATOM   4059 C CB  . GLN B 1 246 ? 11.296  23.419 38.356 1.00 71.89  ? 445 GLN B CB  1 
ATOM   4060 C CG  . GLN B 1 246 ? 10.889  23.437 39.827 1.00 70.94  ? 445 GLN B CG  1 
ATOM   4061 C CD  . GLN B 1 246 ? 11.989  23.930 40.767 1.00 70.47  ? 445 GLN B CD  1 
ATOM   4062 O OE1 . GLN B 1 246 ? 11.710  24.556 41.792 1.00 69.21  ? 445 GLN B OE1 1 
ATOM   4063 N NE2 . GLN B 1 246 ? 13.240  23.634 40.429 1.00 70.90  ? 445 GLN B NE2 1 
ATOM   4064 N N   . ILE B 1 247 ? 11.040  20.739 36.926 1.00 75.41  ? 446 ILE B N   1 
ATOM   4065 C CA  . ILE B 1 247 ? 10.413  19.447 36.700 1.00 77.15  ? 446 ILE B CA  1 
ATOM   4066 C C   . ILE B 1 247 ? 11.491  18.382 36.395 1.00 79.25  ? 446 ILE B C   1 
ATOM   4067 O O   . ILE B 1 247 ? 11.245  17.392 35.709 1.00 78.89  ? 446 ILE B O   1 
ATOM   4068 C CB  . ILE B 1 247 ? 9.367   19.603 35.543 1.00 76.50  ? 446 ILE B CB  1 
ATOM   4069 C CG1 . ILE B 1 247 ? 8.041   18.974 35.952 1.00 76.06  ? 446 ILE B CG1 1 
ATOM   4070 C CG2 . ILE B 1 247 ? 9.891   19.041 34.235 1.00 76.79  ? 446 ILE B CG2 1 
ATOM   4071 C CD1 . ILE B 1 247 ? 6.916   19.984 36.046 1.00 75.59  ? 446 ILE B CD1 1 
ATOM   4072 N N   . ILE B 1 248 ? 12.685  18.599 36.942 1.00 82.32  ? 447 ILE B N   1 
ATOM   4073 C CA  . ILE B 1 248 ? 13.829  17.704 36.767 1.00 86.07  ? 447 ILE B CA  1 
ATOM   4074 C C   . ILE B 1 248 ? 14.635  17.693 38.066 1.00 89.81  ? 447 ILE B C   1 
ATOM   4075 O O   . ILE B 1 248 ? 15.557  16.893 38.232 1.00 89.86  ? 447 ILE B O   1 
ATOM   4076 C CB  . ILE B 1 248 ? 14.762  18.206 35.637 1.00 85.28  ? 447 ILE B CB  1 
ATOM   4077 C CG1 . ILE B 1 248 ? 13.990  18.299 34.323 1.00 85.25  ? 447 ILE B CG1 1 
ATOM   4078 C CG2 . ILE B 1 248 ? 15.960  17.279 35.481 1.00 83.97  ? 447 ILE B CG2 1 
ATOM   4079 C CD1 . ILE B 1 248 ? 14.681  19.147 33.280 1.00 85.62  ? 447 ILE B CD1 1 
ATOM   4080 N N   . LYS B 1 249 ? 14.271  18.589 38.981 1.00 94.31  ? 448 LYS B N   1 
ATOM   4081 C CA  . LYS B 1 249 ? 14.956  18.733 40.264 1.00 99.23  ? 448 LYS B CA  1 
ATOM   4082 C C   . LYS B 1 249 ? 15.011  17.452 41.106 1.00 103.01 ? 448 LYS B C   1 
ATOM   4083 O O   . LYS B 1 249 ? 15.810  16.557 40.819 1.00 103.83 ? 448 LYS B O   1 
ATOM   4084 C CB  . LYS B 1 249 ? 14.312  19.868 41.069 1.00 98.50  ? 448 LYS B CB  1 
ATOM   4085 C CG  . LYS B 1 249 ? 15.211  20.463 42.145 1.00 98.39  ? 448 LYS B CG  1 
ATOM   4086 C CD  . LYS B 1 249 ? 14.613  21.733 42.733 1.00 97.35  ? 448 LYS B CD  1 
ATOM   4087 C CE  . LYS B 1 249 ? 15.565  22.413 43.707 1.00 96.60  ? 448 LYS B CE  1 
ATOM   4088 N NZ  . LYS B 1 249 ? 15.851  21.583 44.912 1.00 95.49  ? 448 LYS B NZ  1 
ATOM   4089 N N   . LYS B 1 250 ? 14.176  17.363 42.141 1.00 106.89 ? 449 LYS B N   1 
ATOM   4090 C CA  . LYS B 1 250 ? 14.171  16.182 43.005 1.00 110.89 ? 449 LYS B CA  1 
ATOM   4091 C C   . LYS B 1 250 ? 13.442  14.986 42.389 1.00 113.52 ? 449 LYS B C   1 
ATOM   4092 O O   . LYS B 1 250 ? 13.189  13.982 43.063 1.00 113.74 ? 449 LYS B O   1 
ATOM   4093 C CB  . LYS B 1 250 ? 13.575  16.528 44.375 1.00 110.94 ? 449 LYS B CB  1 
ATOM   4094 C CG  . LYS B 1 250 ? 14.363  17.594 45.125 1.00 111.39 ? 449 LYS B CG  1 
ATOM   4095 C CD  . LYS B 1 250 ? 13.724  17.938 46.461 1.00 111.67 ? 449 LYS B CD  1 
ATOM   4096 C CE  . LYS B 1 250 ? 14.304  19.225 47.027 1.00 111.58 ? 449 LYS B CE  1 
ATOM   4097 N NZ  . LYS B 1 250 ? 13.348  19.887 47.958 1.00 111.76 ? 449 LYS B NZ  1 
ATOM   4098 N N   . THR B 1 251 ? 13.116  15.106 41.102 1.00 116.49 ? 450 THR B N   1 
ATOM   4099 C CA  . THR B 1 251 ? 12.441  14.049 40.346 1.00 119.15 ? 450 THR B CA  1 
ATOM   4100 C C   . THR B 1 251 ? 13.452  12.932 40.108 1.00 121.60 ? 450 THR B C   1 
ATOM   4101 O O   . THR B 1 251 ? 13.273  11.794 40.551 1.00 121.55 ? 450 THR B O   1 
ATOM   4102 C CB  . THR B 1 251 ? 11.908  14.602 38.989 1.00 118.39 ? 450 THR B CB  1 
ATOM   4103 O OG1 . THR B 1 251 ? 10.506  14.871 39.107 1.00 117.89 ? 450 THR B OG1 1 
ATOM   4104 C CG2 . THR B 1 251 ? 12.137  13.621 37.850 1.00 117.76 ? 450 THR B CG2 1 
ATOM   4105 N N   . GLU B 1 252 ? 14.518  13.269 39.400 1.00 124.36 ? 451 GLU B N   1 
ATOM   4106 C CA  . GLU B 1 252 ? 15.574  12.320 39.138 1.00 127.25 ? 451 GLU B CA  1 
ATOM   4107 C C   . GLU B 1 252 ? 16.823  13.008 39.646 1.00 129.48 ? 451 GLU B C   1 
ATOM   4108 O O   . GLU B 1 252 ? 17.727  13.308 38.873 1.00 129.79 ? 451 GLU B O   1 
ATOM   4109 C CB  . GLU B 1 252 ? 15.662  12.019 37.643 1.00 126.77 ? 451 GLU B CB  1 
ATOM   4110 C CG  . GLU B 1 252 ? 14.341  11.511 37.095 1.00 127.28 ? 451 GLU B CG  1 
ATOM   4111 C CD  . GLU B 1 252 ? 14.462  10.862 35.740 1.00 127.72 ? 451 GLU B CD  1 
ATOM   4112 O OE1 . GLU B 1 252 ? 14.911  11.539 34.791 1.00 127.90 ? 451 GLU B OE1 1 
ATOM   4113 O OE2 . GLU B 1 252 ? 14.100  9.671  35.627 1.00 127.59 ? 451 GLU B OE2 1 
ATOM   4114 N N   . SER B 1 253 ? 16.816  13.296 40.952 1.00 132.10 ? 452 SER B N   1 
ATOM   4115 C CA  . SER B 1 253 ? 17.920  13.945 41.659 1.00 134.65 ? 452 SER B CA  1 
ATOM   4116 C C   . SER B 1 253 ? 19.031  12.955 41.900 1.00 136.97 ? 452 SER B C   1 
ATOM   4117 O O   . SER B 1 253 ? 18.921  12.036 42.710 1.00 137.37 ? 452 SER B O   1 
ATOM   4118 C CB  . SER B 1 253 ? 17.477  14.489 43.016 1.00 134.05 ? 452 SER B CB  1 
ATOM   4119 O OG  . SER B 1 253 ? 16.797  15.717 42.888 1.00 133.69 ? 452 SER B OG  1 
ATOM   4120 N N   . ASP B 1 254 ? 20.114  13.181 41.188 1.00 139.52 ? 453 ASP B N   1 
ATOM   4121 C CA  . ASP B 1 254 ? 21.291  12.358 41.249 1.00 142.01 ? 453 ASP B CA  1 
ATOM   4122 C C   . ASP B 1 254 ? 22.328  13.440 41.204 1.00 143.67 ? 453 ASP B C   1 
ATOM   4123 O O   . ASP B 1 254 ? 22.903  13.862 42.215 1.00 143.32 ? 453 ASP B O   1 
ATOM   4124 C CB  . ASP B 1 254 ? 21.380  11.543 39.955 1.00 142.34 ? 453 ASP B CB  1 
ATOM   4125 C CG  . ASP B 1 254 ? 20.396  12.039 38.912 1.00 142.62 ? 453 ASP B CG  1 
ATOM   4126 O OD1 . ASP B 1 254 ? 19.247  12.224 39.316 1.00 142.81 ? 453 ASP B OD1 1 
ATOM   4127 O OD2 . ASP B 1 254 ? 20.736  12.245 37.728 1.00 142.86 ? 453 ASP B OD2 1 
ATOM   4128 N N   . ALA B 1 255 ? 22.410  13.894 39.953 1.00 145.87 ? 454 ALA B N   1 
ATOM   4129 C CA  . ALA B 1 255 ? 23.273  14.867 39.302 1.00 147.88 ? 454 ALA B CA  1 
ATOM   4130 C C   . ALA B 1 255 ? 22.816  16.311 39.361 1.00 149.32 ? 454 ALA B C   1 
ATOM   4131 O O   . ALA B 1 255 ? 21.767  16.658 38.810 1.00 149.70 ? 454 ALA B O   1 
ATOM   4132 C CB  . ALA B 1 255 ? 23.385  14.439 37.859 1.00 147.50 ? 454 ALA B CB  1 
ATOM   4133 N N   . ALA B 1 256 ? 23.620  17.158 39.993 1.00 150.97 ? 455 ALA B N   1 
ATOM   4134 C CA  . ALA B 1 256 ? 23.247  18.557 40.122 1.00 152.53 ? 455 ALA B CA  1 
ATOM   4135 C C   . ALA B 1 256 ? 23.969  19.224 41.288 1.00 153.60 ? 455 ALA B C   1 
ATOM   4136 O O   . ALA B 1 256 ? 24.917  18.682 41.843 1.00 153.78 ? 455 ALA B O   1 
ATOM   4137 C CB  . ALA B 1 256 ? 21.738  18.656 40.328 1.00 152.32 ? 455 ALA B CB  1 
ATOM   4138 N N   . LEU B 1 257 ? 23.510  20.409 41.655 1.00 154.72 ? 456 LEU B N   1 
ATOM   4139 C CA  . LEU B 1 257 ? 24.089  21.154 42.768 1.00 155.28 ? 456 LEU B CA  1 
ATOM   4140 C C   . LEU B 1 257 ? 24.222  20.173 43.946 1.00 155.92 ? 456 LEU B C   1 
ATOM   4141 O O   . LEU B 1 257 ? 23.381  20.139 44.821 1.00 155.91 ? 456 LEU B O   1 
ATOM   4142 C CB  . LEU B 1 257 ? 23.129  22.301 43.119 1.00 154.67 ? 456 LEU B CB  1 
ATOM   4143 C CG  . LEU B 1 257 ? 22.310  22.815 41.910 1.00 154.01 ? 456 LEU B CG  1 
ATOM   4144 C CD1 . LEU B 1 257 ? 22.033  24.297 42.050 1.00 153.18 ? 456 LEU B CD1 1 
ATOM   4145 C CD2 . LEU B 1 257 ? 23.071  22.608 40.604 1.00 153.39 ? 456 LEU B CD2 1 
ATOM   4146 N N   . HIS B 1 258 ? 25.253  19.363 44.024 1.00 156.79 ? 457 HIS B N   1 
ATOM   4147 C CA  . HIS B 1 258 ? 25.205  18.458 45.147 1.00 157.69 ? 457 HIS B CA  1 
ATOM   4148 C C   . HIS B 1 258 ? 26.154  19.002 46.177 1.00 157.99 ? 457 HIS B C   1 
ATOM   4149 O O   . HIS B 1 258 ? 26.878  19.957 45.897 1.00 158.31 ? 457 HIS B O   1 
ATOM   4150 C CB  . HIS B 1 258 ? 25.535  17.052 44.624 1.00 158.14 ? 457 HIS B CB  1 
ATOM   4151 C CG  . HIS B 1 258 ? 26.113  16.123 45.639 1.00 158.30 ? 457 HIS B CG  1 
ATOM   4152 N ND1 . HIS B 1 258 ? 27.454  16.113 45.951 1.00 158.38 ? 457 HIS B ND1 1 
ATOM   4153 C CD2 . HIS B 1 258 ? 25.545  15.148 46.386 1.00 158.03 ? 457 HIS B CD2 1 
ATOM   4154 C CE1 . HIS B 1 258 ? 27.689  15.173 46.846 1.00 158.10 ? 457 HIS B CE1 1 
ATOM   4155 N NE2 . HIS B 1 258 ? 26.548  14.571 47.127 1.00 158.07 ? 457 HIS B NE2 1 
ATOM   4156 N N   . PRO B 1 259 ? 26.088  18.502 47.415 1.00 157.96 ? 458 PRO B N   1 
ATOM   4157 C CA  . PRO B 1 259 ? 27.069  19.089 48.327 1.00 157.79 ? 458 PRO B CA  1 
ATOM   4158 C C   . PRO B 1 259 ? 28.470  18.660 47.856 1.00 157.69 ? 458 PRO B C   1 
ATOM   4159 O O   . PRO B 1 259 ? 29.408  18.577 48.646 1.00 157.71 ? 458 PRO B O   1 
ATOM   4160 C CB  . PRO B 1 259 ? 26.671  18.517 49.697 1.00 157.79 ? 458 PRO B CB  1 
ATOM   4161 C CG  . PRO B 1 259 ? 25.593  17.466 49.399 1.00 157.93 ? 458 PRO B CG  1 
ATOM   4162 C CD  . PRO B 1 259 ? 24.943  17.942 48.150 1.00 157.89 ? 458 PRO B CD  1 
ATOM   4163 N N   . LEU B 1 260 ? 28.589  18.395 46.551 1.00 157.62 ? 459 LEU B N   1 
ATOM   4164 C CA  . LEU B 1 260 ? 29.842  17.967 45.918 1.00 157.25 ? 459 LEU B CA  1 
ATOM   4165 C C   . LEU B 1 260 ? 30.751  19.135 45.621 1.00 157.14 ? 459 LEU B C   1 
ATOM   4166 O O   . LEU B 1 260 ? 31.935  18.964 45.363 1.00 156.98 ? 459 LEU B O   1 
ATOM   4167 C CB  . LEU B 1 260 ? 29.574  17.256 44.581 1.00 156.97 ? 459 LEU B CB  1 
ATOM   4168 C CG  . LEU B 1 260 ? 30.707  16.642 43.725 1.00 156.53 ? 459 LEU B CG  1 
ATOM   4169 C CD1 . LEU B 1 260 ? 32.102  16.971 44.211 1.00 155.89 ? 459 LEU B CD1 1 
ATOM   4170 C CD2 . LEU B 1 260 ? 30.546  15.150 43.771 1.00 156.22 ? 459 LEU B CD2 1 
ATOM   4171 N N   . LEU B 1 261 ? 30.234  20.341 45.652 1.00 156.90 ? 460 LEU B N   1 
ATOM   4172 C CA  . LEU B 1 261 ? 31.126  21.407 45.299 1.00 156.54 ? 460 LEU B CA  1 
ATOM   4173 C C   . LEU B 1 261 ? 32.164  21.625 46.409 1.00 156.97 ? 460 LEU B C   1 
ATOM   4174 O O   . LEU B 1 261 ? 33.290  22.028 46.133 1.00 157.15 ? 460 LEU B O   1 
ATOM   4175 C CB  . LEU B 1 261 ? 30.285  22.623 44.905 1.00 155.20 ? 460 LEU B CB  1 
ATOM   4176 C CG  . LEU B 1 261 ? 29.091  22.155 44.023 1.00 153.88 ? 460 LEU B CG  1 
ATOM   4177 C CD1 . LEU B 1 261 ? 28.807  23.197 42.974 1.00 153.00 ? 460 LEU B CD1 1 
ATOM   4178 C CD2 . LEU B 1 261 ? 29.363  20.820 43.300 1.00 153.26 ? 460 LEU B CD2 1 
ATOM   4179 N N   . GLN B 1 262 ? 31.810  21.280 47.647 1.00 157.37 ? 461 GLN B N   1 
ATOM   4180 C CA  . GLN B 1 262 ? 32.732  21.394 48.786 1.00 157.75 ? 461 GLN B CA  1 
ATOM   4181 C C   . GLN B 1 262 ? 34.110  20.812 48.398 1.00 157.94 ? 461 GLN B C   1 
ATOM   4182 O O   . GLN B 1 262 ? 35.141  21.197 48.962 1.00 158.13 ? 461 GLN B O   1 
ATOM   4183 C CB  . GLN B 1 262 ? 32.143  20.641 49.991 1.00 157.79 ? 461 GLN B CB  1 
ATOM   4184 C CG  . GLN B 1 262 ? 32.793  20.906 51.345 1.00 157.64 ? 461 GLN B CG  1 
ATOM   4185 C CD  . GLN B 1 262 ? 34.055  20.091 51.580 1.00 157.47 ? 461 GLN B CD  1 
ATOM   4186 O OE1 . GLN B 1 262 ? 34.112  18.903 51.258 1.00 157.14 ? 461 GLN B OE1 1 
ATOM   4187 N NE2 . GLN B 1 262 ? 35.067  20.724 52.165 1.00 157.10 ? 461 GLN B NE2 1 
ATOM   4188 N N   . GLU B 1 263 ? 34.109  19.884 47.437 1.00 157.64 ? 462 GLU B N   1 
ATOM   4189 C CA  . GLU B 1 263 ? 35.334  19.259 46.921 1.00 156.91 ? 462 GLU B CA  1 
ATOM   4190 C C   . GLU B 1 263 ? 35.545  19.809 45.505 1.00 155.89 ? 462 GLU B C   1 
ATOM   4191 O O   . GLU B 1 263 ? 34.762  20.633 45.046 1.00 156.13 ? 462 GLU B O   1 
ATOM   4192 C CB  . GLU B 1 263 ? 35.187  17.735 46.857 1.00 157.33 ? 462 GLU B CB  1 
ATOM   4193 C CG  . GLU B 1 263 ? 34.649  17.101 48.128 1.00 157.97 ? 462 GLU B CG  1 
ATOM   4194 C CD  . GLU B 1 263 ? 34.709  15.588 48.090 1.00 158.51 ? 462 GLU B CD  1 
ATOM   4195 O OE1 . GLU B 1 263 ? 34.050  14.948 48.937 1.00 159.15 ? 462 GLU B OE1 1 
ATOM   4196 O OE2 . GLU B 1 263 ? 35.420  15.038 47.222 1.00 158.42 ? 462 GLU B OE2 1 
ATOM   4197 N N   . ILE B 1 264 ? 36.579  19.353 44.805 1.00 154.40 ? 463 ILE B N   1 
ATOM   4198 C CA  . ILE B 1 264 ? 36.857  19.850 43.451 1.00 152.47 ? 463 ILE B CA  1 
ATOM   4199 C C   . ILE B 1 264 ? 37.174  21.344 43.507 1.00 151.06 ? 463 ILE B C   1 
ATOM   4200 O O   . ILE B 1 264 ? 37.503  21.951 42.489 1.00 150.79 ? 463 ILE B O   1 
ATOM   4201 C CB  . ILE B 1 264 ? 35.649  19.716 42.486 1.00 152.37 ? 463 ILE B CB  1 
ATOM   4202 C CG1 . ILE B 1 264 ? 34.926  18.386 42.679 1.00 151.65 ? 463 ILE B CG1 1 
ATOM   4203 C CG2 . ILE B 1 264 ? 36.134  19.839 41.042 1.00 152.14 ? 463 ILE B CG2 1 
ATOM   4204 C CD1 . ILE B 1 264 ? 33.620  18.330 41.916 1.00 150.71 ? 463 ILE B CD1 1 
ATOM   4205 N N   . TYR B 1 265 ? 37.032  21.932 44.693 1.00 149.32 ? 464 TYR B N   1 
ATOM   4206 C CA  . TYR B 1 265 ? 37.298  23.351 44.921 1.00 147.56 ? 464 TYR B CA  1 
ATOM   4207 C C   . TYR B 1 265 ? 37.731  23.448 46.397 1.00 146.81 ? 464 TYR B C   1 
ATOM   4208 O O   . TYR B 1 265 ? 37.298  24.343 47.127 1.00 146.65 ? 464 TYR B O   1 
ATOM   4209 C CB  . TYR B 1 265 ? 36.027  24.215 44.693 1.00 146.39 ? 464 TYR B CB  1 
ATOM   4210 C CG  . TYR B 1 265 ? 35.076  23.803 43.557 1.00 145.10 ? 464 TYR B CG  1 
ATOM   4211 C CD1 . TYR B 1 265 ? 35.540  23.540 42.266 1.00 144.64 ? 464 TYR B CD1 1 
ATOM   4212 C CD2 . TYR B 1 265 ? 33.703  23.668 43.788 1.00 144.54 ? 464 TYR B CD2 1 
ATOM   4213 C CE1 . TYR B 1 265 ? 34.666  23.141 41.238 1.00 143.30 ? 464 TYR B CE1 1 
ATOM   4214 C CE2 . TYR B 1 265 ? 32.822  23.276 42.764 1.00 143.44 ? 464 TYR B CE2 1 
ATOM   4215 C CZ  . TYR B 1 265 ? 33.312  23.010 41.497 1.00 142.72 ? 464 TYR B CZ  1 
ATOM   4216 O OH  . TYR B 1 265 ? 32.457  22.590 40.503 1.00 140.97 ? 464 TYR B OH  1 
ATOM   4217 N N   . ARG B 1 266 ? 38.586  22.511 46.817 1.00 145.93 ? 465 ARG B N   1 
ATOM   4218 C CA  . ARG B 1 266 ? 39.087  22.418 48.196 1.00 144.81 ? 465 ARG B CA  1 
ATOM   4219 C C   . ARG B 1 266 ? 40.442  23.100 48.460 1.00 144.29 ? 465 ARG B C   1 
ATOM   4220 O O   . ARG B 1 266 ? 41.489  22.447 48.417 1.00 144.50 ? 465 ARG B O   1 
ATOM   4221 C CB  . ARG B 1 266 ? 39.170  20.933 48.596 1.00 144.26 ? 465 ARG B CB  1 
ATOM   4222 C CG  . ARG B 1 266 ? 39.857  20.667 49.925 1.00 143.50 ? 465 ARG B CG  1 
ATOM   4223 C CD  . ARG B 1 266 ? 39.571  19.267 50.446 1.00 142.73 ? 465 ARG B CD  1 
ATOM   4224 N NE  . ARG B 1 266 ? 39.557  19.262 51.907 1.00 142.20 ? 465 ARG B NE  1 
ATOM   4225 C CZ  . ARG B 1 266 ? 39.053  18.288 52.657 1.00 141.58 ? 465 ARG B CZ  1 
ATOM   4226 N NH1 . ARG B 1 266 ? 38.513  17.218 52.091 1.00 141.25 ? 465 ARG B NH1 1 
ATOM   4227 N NH2 . ARG B 1 266 ? 39.070  18.396 53.979 1.00 141.52 ? 465 ARG B NH2 1 
ATOM   4228 N N   . ASP B 1 267 ? 40.410  24.404 48.752 1.00 143.18 ? 466 ASP B N   1 
ATOM   4229 C CA  . ASP B 1 267 ? 41.620  25.197 49.023 1.00 141.72 ? 466 ASP B CA  1 
ATOM   4230 C C   . ASP B 1 267 ? 42.490  25.315 47.757 1.00 141.13 ? 466 ASP B C   1 
ATOM   4231 O O   . ASP B 1 267 ? 43.607  24.790 47.705 1.00 141.15 ? 466 ASP B O   1 
ATOM   4232 C CB  . ASP B 1 267 ? 42.416  24.555 50.174 1.00 140.84 ? 466 ASP B CB  1 
ATOM   4233 C CG  . ASP B 1 267 ? 41.719  24.699 51.527 1.00 139.86 ? 466 ASP B CG  1 
ATOM   4234 O OD1 . ASP B 1 267 ? 40.486  24.505 51.599 1.00 138.76 ? 466 ASP B OD1 1 
ATOM   4235 O OD2 . ASP B 1 267 ? 42.410  24.995 52.526 1.00 139.50 ? 466 ASP B OD2 1 
ATOM   4236 N N   . MET B 1 268 ? 41.977  26.039 46.758 1.00 140.23 ? 467 MET B N   1 
ATOM   4237 C CA  . MET B 1 268 ? 42.649  26.193 45.461 1.00 139.30 ? 467 MET B CA  1 
ATOM   4238 C C   . MET B 1 268 ? 43.291  27.550 45.100 1.00 139.19 ? 467 MET B C   1 
ATOM   4239 O O   . MET B 1 268 ? 44.465  27.587 44.729 1.00 138.88 ? 467 MET B O   1 
ATOM   4240 C CB  . MET B 1 268 ? 41.663  25.788 44.347 1.00 138.35 ? 467 MET B CB  1 
ATOM   4241 C CG  . MET B 1 268 ? 42.266  25.555 42.966 1.00 136.65 ? 467 MET B CG  1 
ATOM   4242 S SD  . MET B 1 268 ? 43.062  23.949 42.745 1.00 134.89 ? 467 MET B SD  1 
ATOM   4243 C CE  . MET B 1 268 ? 41.724  22.974 42.062 1.00 134.49 ? 467 MET B CE  1 
ATOM   4244 N N   . TYR B 1 269 ? 42.544  28.653 45.190 1.00 139.18 ? 468 TYR B N   1 
ATOM   4245 C CA  . TYR B 1 269 ? 43.102  29.963 44.821 1.00 139.10 ? 468 TYR B CA  1 
ATOM   4246 C C   . TYR B 1 269 ? 43.415  30.929 45.969 1.00 139.02 ? 468 TYR B C   1 
ATOM   4247 O O   . TYR B 1 269 ? 42.728  30.881 47.010 1.00 139.12 ? 468 TYR B O   1 
ATOM   4248 C CB  . TYR B 1 269 ? 42.173  30.675 43.825 1.00 139.25 ? 468 TYR B CB  1 
ATOM   4249 C CG  . TYR B 1 269 ? 41.975  29.959 42.501 1.00 139.65 ? 468 TYR B CG  1 
ATOM   4250 C CD1 . TYR B 1 269 ? 41.078  28.894 42.383 1.00 139.93 ? 468 TYR B CD1 1 
ATOM   4251 C CD2 . TYR B 1 269 ? 42.680  30.353 41.362 1.00 139.44 ? 468 TYR B CD2 1 
ATOM   4252 C CE1 . TYR B 1 269 ? 40.884  28.241 41.160 1.00 139.84 ? 468 TYR B CE1 1 
ATOM   4253 C CE2 . TYR B 1 269 ? 42.495  29.706 40.135 1.00 139.49 ? 468 TYR B CE2 1 
ATOM   4254 C CZ  . TYR B 1 269 ? 41.595  28.653 40.041 1.00 139.73 ? 468 TYR B CZ  1 
ATOM   4255 O OH  . TYR B 1 269 ? 41.398  28.020 38.832 1.00 139.52 ? 468 TYR B OH  1 
ATOM   4256 O OXT . TYR B 1 269 ? 44.339  31.754 45.794 1.00 138.65 ? 468 TYR B OXT 1 
ATOM   4257 N N   . THR C 1 1   ? 50.378  60.523 27.516 1.00 94.39  ? 200 THR C N   1 
ATOM   4258 C CA  . THR C 1 1   ? 49.720  61.858 27.590 1.00 94.04  ? 200 THR C CA  1 
ATOM   4259 C C   . THR C 1 1   ? 48.202  61.761 27.409 1.00 93.98  ? 200 THR C C   1 
ATOM   4260 O O   . THR C 1 1   ? 47.497  62.761 27.547 1.00 94.38  ? 200 THR C O   1 
ATOM   4261 C CB  . THR C 1 1   ? 50.315  62.781 26.526 1.00 93.45  ? 200 THR C CB  1 
ATOM   4262 N N   . ALA C 1 2   ? 47.701  60.559 27.118 1.00 93.46  ? 201 ALA C N   1 
ATOM   4263 C CA  . ALA C 1 2   ? 46.265  60.349 26.892 1.00 92.11  ? 201 ALA C CA  1 
ATOM   4264 C C   . ALA C 1 2   ? 45.508  59.589 27.989 1.00 91.11  ? 201 ALA C C   1 
ATOM   4265 O O   . ALA C 1 2   ? 44.278  59.521 27.966 1.00 91.04  ? 201 ALA C O   1 
ATOM   4266 C CB  . ALA C 1 2   ? 46.057  59.655 25.551 1.00 92.75  ? 201 ALA C CB  1 
ATOM   4267 N N   . ASP C 1 3   ? 46.245  59.004 28.928 1.00 89.79  ? 202 ASP C N   1 
ATOM   4268 C CA  . ASP C 1 3   ? 45.664  58.268 30.057 1.00 87.39  ? 202 ASP C CA  1 
ATOM   4269 C C   . ASP C 1 3   ? 46.690  58.503 31.154 1.00 85.37  ? 202 ASP C C   1 
ATOM   4270 O O   . ASP C 1 3   ? 46.432  58.326 32.347 1.00 84.28  ? 202 ASP C O   1 
ATOM   4271 C CB  . ASP C 1 3   ? 45.558  56.768 29.751 1.00 87.15  ? 202 ASP C CB  1 
ATOM   4272 C CG  . ASP C 1 3   ? 44.394  56.104 30.474 1.00 86.06  ? 202 ASP C CG  1 
ATOM   4273 O OD1 . ASP C 1 3   ? 44.470  54.888 30.746 1.00 85.76  ? 202 ASP C OD1 1 
ATOM   4274 O OD2 . ASP C 1 3   ? 43.394  56.796 30.756 1.00 85.80  ? 202 ASP C OD2 1 
ATOM   4275 N N   . LEU C 1 4   ? 47.874  58.899 30.700 1.00 83.55  ? 203 LEU C N   1 
ATOM   4276 C CA  . LEU C 1 4   ? 48.986  59.227 31.568 1.00 81.72  ? 203 LEU C CA  1 
ATOM   4277 C C   . LEU C 1 4   ? 48.643  60.622 32.041 1.00 80.02  ? 203 LEU C C   1 
ATOM   4278 O O   . LEU C 1 4   ? 49.368  61.233 32.824 1.00 80.18  ? 203 LEU C O   1 
ATOM   4279 C CB  . LEU C 1 4   ? 50.298  59.263 30.778 1.00 82.17  ? 203 LEU C CB  1 
ATOM   4280 C CG  . LEU C 1 4   ? 51.543  59.738 31.538 1.00 81.84  ? 203 LEU C CG  1 
ATOM   4281 C CD1 . LEU C 1 4   ? 51.868  58.742 32.635 1.00 81.77  ? 203 LEU C CD1 1 
ATOM   4282 C CD2 . LEU C 1 4   ? 52.723  59.884 30.587 1.00 81.52  ? 203 LEU C CD2 1 
ATOM   4283 N N   . LYS C 1 5   ? 47.526  61.134 31.541 1.00 77.72  ? 204 LYS C N   1 
ATOM   4284 C CA  . LYS C 1 5   ? 47.105  62.455 31.936 1.00 75.90  ? 204 LYS C CA  1 
ATOM   4285 C C   . LYS C 1 5   ? 46.030  62.356 33.015 1.00 74.17  ? 204 LYS C C   1 
ATOM   4286 O O   . LYS C 1 5   ? 45.862  63.277 33.813 1.00 74.22  ? 204 LYS C O   1 
ATOM   4287 C CB  . LYS C 1 5   ? 46.604  63.241 30.725 1.00 76.28  ? 204 LYS C CB  1 
ATOM   4288 C CG  . LYS C 1 5   ? 46.746  64.742 30.914 1.00 76.68  ? 204 LYS C CG  1 
ATOM   4289 C CD  . LYS C 1 5   ? 48.191  65.130 31.200 1.00 77.10  ? 204 LYS C CD  1 
ATOM   4290 C CE  . LYS C 1 5   ? 48.254  66.447 31.959 1.00 77.25  ? 204 LYS C CE  1 
ATOM   4291 N NZ  . LYS C 1 5   ? 49.563  67.146 31.817 1.00 77.00  ? 204 LYS C NZ  1 
ATOM   4292 N N   . SER C 1 6   ? 45.311  61.237 33.049 1.00 71.37  ? 205 SER C N   1 
ATOM   4293 C CA  . SER C 1 6   ? 44.276  61.040 34.062 1.00 68.48  ? 205 SER C CA  1 
ATOM   4294 C C   . SER C 1 6   ? 44.952  60.653 35.370 1.00 66.11  ? 205 SER C C   1 
ATOM   4295 O O   . SER C 1 6   ? 44.403  60.846 36.454 1.00 66.20  ? 205 SER C O   1 
ATOM   4296 C CB  . SER C 1 6   ? 43.312  59.925 33.649 1.00 69.15  ? 205 SER C CB  1 
ATOM   4297 O OG  . SER C 1 6   ? 43.900  58.646 33.827 1.00 69.73  ? 205 SER C OG  1 
ATOM   4298 N N   . LEU C 1 7   ? 46.154  60.103 35.247 1.00 62.74  ? 206 LEU C N   1 
ATOM   4299 C CA  . LEU C 1 7   ? 46.936  59.665 36.393 1.00 59.40  ? 206 LEU C CA  1 
ATOM   4300 C C   . LEU C 1 7   ? 46.967  60.725 37.496 1.00 58.54  ? 206 LEU C C   1 
ATOM   4301 O O   . LEU C 1 7   ? 46.400  60.538 38.572 1.00 59.11  ? 206 LEU C O   1 
ATOM   4302 C CB  . LEU C 1 7   ? 48.362  59.345 35.942 1.00 56.64  ? 206 LEU C CB  1 
ATOM   4303 C CG  . LEU C 1 7   ? 49.091  58.263 36.725 1.00 54.05  ? 206 LEU C CG  1 
ATOM   4304 C CD1 . LEU C 1 7   ? 48.359  56.951 36.556 1.00 54.33  ? 206 LEU C CD1 1 
ATOM   4305 C CD2 . LEU C 1 7   ? 50.503  58.133 36.221 1.00 52.63  ? 206 LEU C CD2 1 
ATOM   4306 N N   . ALA C 1 8   ? 47.627  61.840 37.210 1.00 56.89  ? 207 ALA C N   1 
ATOM   4307 C CA  . ALA C 1 8   ? 47.766  62.944 38.155 1.00 54.70  ? 207 ALA C CA  1 
ATOM   4308 C C   . ALA C 1 8   ? 46.548  63.228 39.026 1.00 53.10  ? 207 ALA C C   1 
ATOM   4309 O O   . ALA C 1 8   ? 46.662  63.331 40.242 1.00 52.66  ? 207 ALA C O   1 
ATOM   4310 C CB  . ALA C 1 8   ? 48.149  64.202 37.404 1.00 54.75  ? 207 ALA C CB  1 
ATOM   4311 N N   . LYS C 1 9   ? 45.387  63.365 38.398 1.00 51.51  ? 208 LYS C N   1 
ATOM   4312 C CA  . LYS C 1 9   ? 44.156  63.672 39.116 1.00 50.60  ? 208 LYS C CA  1 
ATOM   4313 C C   . LYS C 1 9   ? 43.412  62.494 39.733 1.00 49.57  ? 208 LYS C C   1 
ATOM   4314 O O   . LYS C 1 9   ? 42.760  62.650 40.761 1.00 49.82  ? 208 LYS C O   1 
ATOM   4315 C CB  . LYS C 1 9   ? 43.188  64.416 38.195 1.00 52.08  ? 208 LYS C CB  1 
ATOM   4316 C CG  . LYS C 1 9   ? 41.758  64.452 38.718 1.00 54.10  ? 208 LYS C CG  1 
ATOM   4317 C CD  . LYS C 1 9   ? 40.718  64.375 37.604 1.00 56.09  ? 208 LYS C CD  1 
ATOM   4318 C CE  . LYS C 1 9   ? 40.413  65.731 36.975 1.00 57.48  ? 208 LYS C CE  1 
ATOM   4319 N NZ  . LYS C 1 9   ? 41.547  66.318 36.206 1.00 58.21  ? 208 LYS C NZ  1 
ATOM   4320 N N   . ARG C 1 10  ? 43.484  61.319 39.119 1.00 47.83  ? 209 ARG C N   1 
ATOM   4321 C CA  . ARG C 1 10  ? 42.748  60.188 39.667 1.00 45.40  ? 209 ARG C CA  1 
ATOM   4322 C C   . ARG C 1 10  ? 43.468  59.563 40.872 1.00 41.64  ? 209 ARG C C   1 
ATOM   4323 O O   . ARG C 1 10  ? 42.895  58.764 41.613 1.00 40.79  ? 209 ARG C O   1 
ATOM   4324 C CB  . ARG C 1 10  ? 42.421  59.190 38.526 1.00 47.15  ? 209 ARG C CB  1 
ATOM   4325 C CG  . ARG C 1 10  ? 43.232  57.915 38.403 1.00 50.59  ? 209 ARG C CG  1 
ATOM   4326 C CD  . ARG C 1 10  ? 42.431  56.724 38.914 1.00 54.84  ? 209 ARG C CD  1 
ATOM   4327 N NE  . ARG C 1 10  ? 42.880  56.338 40.247 1.00 59.04  ? 209 ARG C NE  1 
ATOM   4328 C CZ  . ARG C 1 10  ? 42.259  55.476 41.045 1.00 60.05  ? 209 ARG C CZ  1 
ATOM   4329 N NH1 . ARG C 1 10  ? 41.134  54.884 40.658 1.00 59.75  ? 209 ARG C NH1 1 
ATOM   4330 N NH2 . ARG C 1 10  ? 42.768  55.213 42.242 1.00 60.10  ? 209 ARG C NH2 1 
ATOM   4331 N N   . ILE C 1 11  ? 44.709  59.993 41.090 1.00 37.87  ? 210 ILE C N   1 
ATOM   4332 C CA  . ILE C 1 11  ? 45.523  59.521 42.208 1.00 33.94  ? 210 ILE C CA  1 
ATOM   4333 C C   . ILE C 1 11  ? 45.321  60.462 43.400 1.00 33.22  ? 210 ILE C C   1 
ATOM   4334 O O   . ILE C 1 11  ? 45.258  60.027 44.550 1.00 33.53  ? 210 ILE C O   1 
ATOM   4335 C CB  . ILE C 1 11  ? 47.036  59.450 41.800 1.00 31.71  ? 210 ILE C CB  1 
ATOM   4336 C CG1 . ILE C 1 11  ? 47.337  58.080 41.188 1.00 29.88  ? 210 ILE C CG1 1 
ATOM   4337 C CG2 . ILE C 1 11  ? 47.942  59.702 42.996 1.00 30.86  ? 210 ILE C CG2 1 
ATOM   4338 C CD1 . ILE C 1 11  ? 48.753  57.909 40.716 1.00 26.90  ? 210 ILE C CD1 1 
ATOM   4339 N N   . TYR C 1 12  ? 45.208  61.754 43.113 1.00 31.56  ? 211 TYR C N   1 
ATOM   4340 C CA  . TYR C 1 12  ? 44.993  62.759 44.146 1.00 29.93  ? 211 TYR C CA  1 
ATOM   4341 C C   . TYR C 1 12  ? 43.615  62.510 44.720 1.00 30.72  ? 211 TYR C C   1 
ATOM   4342 O O   . TYR C 1 12  ? 43.386  62.686 45.912 1.00 31.74  ? 211 TYR C O   1 
ATOM   4343 C CB  . TYR C 1 12  ? 45.064  64.161 43.531 1.00 27.16  ? 211 TYR C CB  1 
ATOM   4344 C CG  . TYR C 1 12  ? 44.631  65.306 44.426 1.00 25.48  ? 211 TYR C CG  1 
ATOM   4345 C CD1 . TYR C 1 12  ? 45.195  65.492 45.686 1.00 25.34  ? 211 TYR C CD1 1 
ATOM   4346 C CD2 . TYR C 1 12  ? 43.713  66.257 43.971 1.00 26.17  ? 211 TYR C CD2 1 
ATOM   4347 C CE1 . TYR C 1 12  ? 44.864  66.601 46.469 1.00 25.58  ? 211 TYR C CE1 1 
ATOM   4348 C CE2 . TYR C 1 12  ? 43.373  67.372 44.743 1.00 25.84  ? 211 TYR C CE2 1 
ATOM   4349 C CZ  . TYR C 1 12  ? 43.956  67.539 45.988 1.00 26.45  ? 211 TYR C CZ  1 
ATOM   4350 O OH  . TYR C 1 12  ? 43.662  68.658 46.738 1.00 27.28  ? 211 TYR C OH  1 
ATOM   4351 N N   . GLU C 1 13  ? 42.699  62.086 43.857 1.00 31.93  ? 212 GLU C N   1 
ATOM   4352 C CA  . GLU C 1 13  ? 41.330  61.811 44.264 1.00 33.72  ? 212 GLU C CA  1 
ATOM   4353 C C   . GLU C 1 13  ? 41.274  60.649 45.237 1.00 34.12  ? 212 GLU C C   1 
ATOM   4354 O O   . GLU C 1 13  ? 40.492  60.667 46.195 1.00 34.59  ? 212 GLU C O   1 
ATOM   4355 C CB  . GLU C 1 13  ? 40.465  61.494 43.040 1.00 36.00  ? 212 GLU C CB  1 
ATOM   4356 C CG  . GLU C 1 13  ? 40.026  62.714 42.245 1.00 39.82  ? 212 GLU C CG  1 
ATOM   4357 C CD  . GLU C 1 13  ? 39.182  62.351 41.039 1.00 42.13  ? 212 GLU C CD  1 
ATOM   4358 O OE1 . GLU C 1 13  ? 38.115  61.731 41.236 1.00 44.44  ? 212 GLU C OE1 1 
ATOM   4359 O OE2 . GLU C 1 13  ? 39.583  62.682 39.899 1.00 42.60  ? 212 GLU C OE2 1 
ATOM   4360 N N   . ALA C 1 14  ? 42.109  59.641 44.980 1.00 33.37  ? 213 ALA C N   1 
ATOM   4361 C CA  . ALA C 1 14  ? 42.178  58.441 45.812 1.00 31.38  ? 213 ALA C CA  1 
ATOM   4362 C C   . ALA C 1 14  ? 42.813  58.756 47.159 1.00 29.49  ? 213 ALA C C   1 
ATOM   4363 O O   . ALA C 1 14  ? 42.787  57.948 48.085 1.00 29.43  ? 213 ALA C O   1 
ATOM   4364 C CB  . ALA C 1 14  ? 42.979  57.368 45.098 1.00 31.12  ? 213 ALA C CB  1 
ATOM   4365 N N   . TYR C 1 15  ? 43.380  59.949 47.248 1.00 26.97  ? 214 TYR C N   1 
ATOM   4366 C CA  . TYR C 1 15  ? 44.034  60.421 48.452 1.00 25.17  ? 214 TYR C CA  1 
ATOM   4367 C C   . TYR C 1 15  ? 42.978  61.065 49.343 1.00 26.30  ? 214 TYR C C   1 
ATOM   4368 O O   . TYR C 1 15  ? 42.757  60.657 50.487 1.00 25.81  ? 214 TYR C O   1 
ATOM   4369 C CB  . TYR C 1 15  ? 45.104  61.429 48.043 1.00 20.28  ? 214 TYR C CB  1 
ATOM   4370 C CG  . TYR C 1 15  ? 45.948  61.979 49.157 1.00 16.00  ? 214 TYR C CG  1 
ATOM   4371 C CD1 . TYR C 1 15  ? 45.586  63.157 49.813 1.00 14.18  ? 214 TYR C CD1 1 
ATOM   4372 C CD2 . TYR C 1 15  ? 47.148  61.367 49.507 1.00 13.52  ? 214 TYR C CD2 1 
ATOM   4373 C CE1 . TYR C 1 15  ? 46.401  63.717 50.776 1.00 11.37  ? 214 TYR C CE1 1 
ATOM   4374 C CE2 . TYR C 1 15  ? 47.969  61.916 50.468 1.00 12.68  ? 214 TYR C CE2 1 
ATOM   4375 C CZ  . TYR C 1 15  ? 47.590  63.094 51.093 1.00 12.52  ? 214 TYR C CZ  1 
ATOM   4376 O OH  . TYR C 1 15  ? 48.421  63.669 52.011 1.00 13.43  ? 214 TYR C OH  1 
ATOM   4377 N N   . LEU C 1 16  ? 42.315  62.070 48.787 1.00 28.36  ? 215 LEU C N   1 
ATOM   4378 C CA  . LEU C 1 16  ? 41.271  62.800 49.486 1.00 29.51  ? 215 LEU C CA  1 
ATOM   4379 C C   . LEU C 1 16  ? 40.127  61.851 49.709 1.00 30.60  ? 215 LEU C C   1 
ATOM   4380 O O   . LEU C 1 16  ? 39.072  62.230 50.201 1.00 31.13  ? 215 LEU C O   1 
ATOM   4381 C CB  . LEU C 1 16  ? 40.779  63.953 48.625 1.00 28.52  ? 215 LEU C CB  1 
ATOM   4382 C CG  . LEU C 1 16  ? 41.873  64.854 48.076 1.00 27.89  ? 215 LEU C CG  1 
ATOM   4383 C CD1 . LEU C 1 16  ? 41.294  65.680 46.952 1.00 28.39  ? 215 LEU C CD1 1 
ATOM   4384 C CD2 . LEU C 1 16  ? 42.440  65.723 49.187 1.00 27.78  ? 215 LEU C CD2 1 
ATOM   4385 N N   . LYS C 1 17  ? 40.334  60.604 49.339 1.00 32.27  ? 216 LYS C N   1 
ATOM   4386 C CA  . LYS C 1 17  ? 39.270  59.657 49.492 1.00 35.50  ? 216 LYS C CA  1 
ATOM   4387 C C   . LYS C 1 17  ? 39.632  58.533 50.430 1.00 36.43  ? 216 LYS C C   1 
ATOM   4388 O O   . LYS C 1 17  ? 38.758  57.962 51.071 1.00 37.90  ? 216 LYS C O   1 
ATOM   4389 C CB  . LYS C 1 17  ? 38.883  59.116 48.117 1.00 36.76  ? 216 LYS C CB  1 
ATOM   4390 C CG  . LYS C 1 17  ? 37.610  58.290 48.104 1.00 39.48  ? 216 LYS C CG  1 
ATOM   4391 C CD  . LYS C 1 17  ? 37.925  56.817 48.284 1.00 41.02  ? 216 LYS C CD  1 
ATOM   4392 C CE  . LYS C 1 17  ? 36.664  55.999 48.505 1.00 41.26  ? 216 LYS C CE  1 
ATOM   4393 N NZ  . LYS C 1 17  ? 37.024  54.571 48.706 1.00 41.58  ? 216 LYS C NZ  1 
ATOM   4394 N N   . ASN C 1 18  ? 40.918  58.228 50.545 1.00 36.82  ? 217 ASN C N   1 
ATOM   4395 C CA  . ASN C 1 18  ? 41.312  57.123 51.402 1.00 36.67  ? 217 ASN C CA  1 
ATOM   4396 C C   . ASN C 1 18  ? 42.132  57.439 52.641 1.00 35.72  ? 217 ASN C C   1 
ATOM   4397 O O   . ASN C 1 18  ? 42.510  56.527 53.375 1.00 36.85  ? 217 ASN C O   1 
ATOM   4398 C CB  . ASN C 1 18  ? 41.995  56.051 50.550 1.00 38.05  ? 217 ASN C CB  1 
ATOM   4399 C CG  . ASN C 1 18  ? 40.998  55.273 49.698 1.00 39.59  ? 217 ASN C CG  1 
ATOM   4400 O OD1 . ASN C 1 18  ? 40.252  54.439 50.213 1.00 41.71  ? 217 ASN C OD1 1 
ATOM   4401 N ND2 . ASN C 1 18  ? 40.964  55.560 48.401 1.00 38.81  ? 217 ASN C ND2 1 
ATOM   4402 N N   . PHE C 1 19  ? 42.398  58.722 52.877 1.00 34.06  ? 218 PHE C N   1 
ATOM   4403 C CA  . PHE C 1 19  ? 43.144  59.150 54.061 1.00 32.17  ? 218 PHE C CA  1 
ATOM   4404 C C   . PHE C 1 19  ? 42.263  60.095 54.859 1.00 32.88  ? 218 PHE C C   1 
ATOM   4405 O O   . PHE C 1 19  ? 41.884  61.163 54.379 1.00 34.53  ? 218 PHE C O   1 
ATOM   4406 C CB  . PHE C 1 19  ? 44.452  59.837 53.668 1.00 28.38  ? 218 PHE C CB  1 
ATOM   4407 C CG  . PHE C 1 19  ? 45.471  58.892 53.130 1.00 25.81  ? 218 PHE C CG  1 
ATOM   4408 C CD1 . PHE C 1 19  ? 46.034  57.925 53.949 1.00 24.26  ? 218 PHE C CD1 1 
ATOM   4409 C CD2 . PHE C 1 19  ? 45.809  58.910 51.785 1.00 25.93  ? 218 PHE C CD2 1 
ATOM   4410 C CE1 . PHE C 1 19  ? 46.913  56.986 53.436 1.00 23.72  ? 218 PHE C CE1 1 
ATOM   4411 C CE2 . PHE C 1 19  ? 46.687  57.975 51.261 1.00 24.76  ? 218 PHE C CE2 1 
ATOM   4412 C CZ  . PHE C 1 19  ? 47.239  57.009 52.089 1.00 24.19  ? 218 PHE C CZ  1 
ATOM   4413 N N   . ASN C 1 20  ? 41.927  59.684 56.076 1.00 32.59  ? 219 ASN C N   1 
ATOM   4414 C CA  . ASN C 1 20  ? 41.070  60.472 56.947 1.00 31.36  ? 219 ASN C CA  1 
ATOM   4415 C C   . ASN C 1 20  ? 41.676  61.839 57.242 1.00 28.95  ? 219 ASN C C   1 
ATOM   4416 O O   . ASN C 1 20  ? 40.994  62.864 57.182 1.00 28.04  ? 219 ASN C O   1 
ATOM   4417 C CB  . ASN C 1 20  ? 40.832  59.695 58.243 1.00 35.17  ? 219 ASN C CB  1 
ATOM   4418 C CG  . ASN C 1 20  ? 39.781  60.334 59.131 1.00 39.19  ? 219 ASN C CG  1 
ATOM   4419 O OD1 . ASN C 1 20  ? 40.057  61.299 59.852 1.00 42.06  ? 219 ASN C OD1 1 
ATOM   4420 N ND2 . ASN C 1 20  ? 38.562  59.798 59.082 1.00 40.76  ? 219 ASN C ND2 1 
ATOM   4421 N N   . MET C 1 21  ? 42.967  61.856 57.542 1.00 25.82  ? 220 MET C N   1 
ATOM   4422 C CA  . MET C 1 21  ? 43.629  63.107 57.849 1.00 23.73  ? 220 MET C CA  1 
ATOM   4423 C C   . MET C 1 21  ? 44.555  63.600 56.745 1.00 23.48  ? 220 MET C C   1 
ATOM   4424 O O   . MET C 1 21  ? 45.698  63.149 56.650 1.00 23.80  ? 220 MET C O   1 
ATOM   4425 C CB  . MET C 1 21  ? 44.429  62.963 59.138 1.00 23.56  ? 220 MET C CB  1 
ATOM   4426 C CG  . MET C 1 21  ? 45.066  64.263 59.586 1.00 21.82  ? 220 MET C CG  1 
ATOM   4427 S SD  . MET C 1 21  ? 43.784  65.486 59.902 1.00 21.05  ? 220 MET C SD  1 
ATOM   4428 C CE  . MET C 1 21  ? 44.363  66.201 61.436 1.00 22.58  ? 220 MET C CE  1 
ATOM   4429 N N   . ASN C 1 22  ? 44.074  64.522 55.913 1.00 22.49  ? 221 ASN C N   1 
ATOM   4430 C CA  . ASN C 1 22  ? 44.911  65.065 54.851 1.00 21.06  ? 221 ASN C CA  1 
ATOM   4431 C C   . ASN C 1 22  ? 45.753  66.190 55.445 1.00 20.68  ? 221 ASN C C   1 
ATOM   4432 O O   . ASN C 1 22  ? 45.864  66.285 56.660 1.00 21.35  ? 221 ASN C O   1 
ATOM   4433 C CB  . ASN C 1 22  ? 44.062  65.554 53.674 1.00 20.58  ? 221 ASN C CB  1 
ATOM   4434 C CG  . ASN C 1 22  ? 43.058  66.600 54.066 1.00 20.92  ? 221 ASN C CG  1 
ATOM   4435 O OD1 . ASN C 1 22  ? 43.415  67.681 54.529 1.00 20.08  ? 221 ASN C OD1 1 
ATOM   4436 N ND2 . ASN C 1 22  ? 41.782  66.290 53.868 1.00 23.10  ? 221 ASN C ND2 1 
ATOM   4437 N N   . LYS C 1 23  ? 46.358  67.034 54.620 1.00 20.32  ? 222 LYS C N   1 
ATOM   4438 C CA  . LYS C 1 23  ? 47.194  68.103 55.162 1.00 19.50  ? 222 LYS C CA  1 
ATOM   4439 C C   . LYS C 1 23  ? 46.457  69.419 55.359 1.00 20.47  ? 222 LYS C C   1 
ATOM   4440 O O   . LYS C 1 23  ? 46.834  70.233 56.204 1.00 19.54  ? 222 LYS C O   1 
ATOM   4441 C CB  . LYS C 1 23  ? 48.405  68.332 54.264 1.00 17.79  ? 222 LYS C CB  1 
ATOM   4442 C CG  . LYS C 1 23  ? 49.258  69.511 54.699 1.00 17.15  ? 222 LYS C CG  1 
ATOM   4443 C CD  . LYS C 1 23  ? 50.496  69.663 53.832 1.00 14.99  ? 222 LYS C CD  1 
ATOM   4444 C CE  . LYS C 1 23  ? 51.450  70.702 54.399 1.00 13.86  ? 222 LYS C CE  1 
ATOM   4445 N NZ  . LYS C 1 23  ? 52.845  70.481 53.922 1.00 12.17  ? 222 LYS C NZ  1 
ATOM   4446 N N   . VAL C 1 24  ? 45.410  69.629 54.571 1.00 21.40  ? 223 VAL C N   1 
ATOM   4447 C CA  . VAL C 1 24  ? 44.627  70.844 54.677 1.00 21.78  ? 223 VAL C CA  1 
ATOM   4448 C C   . VAL C 1 24  ? 43.875  70.849 56.009 1.00 22.97  ? 223 VAL C C   1 
ATOM   4449 O O   . VAL C 1 24  ? 43.882  71.847 56.731 1.00 22.56  ? 223 VAL C O   1 
ATOM   4450 C CB  . VAL C 1 24  ? 43.642  70.939 53.518 1.00 20.92  ? 223 VAL C CB  1 
ATOM   4451 C CG1 . VAL C 1 24  ? 42.978  72.296 53.518 1.00 21.38  ? 223 VAL C CG1 1 
ATOM   4452 C CG2 . VAL C 1 24  ? 44.374  70.704 52.218 1.00 20.64  ? 223 VAL C CG2 1 
ATOM   4453 N N   . LYS C 1 25  ? 43.234  69.729 56.335 1.00 24.02  ? 224 LYS C N   1 
ATOM   4454 C CA  . LYS C 1 25  ? 42.509  69.618 57.590 1.00 25.56  ? 224 LYS C CA  1 
ATOM   4455 C C   . LYS C 1 25  ? 43.478  69.871 58.724 1.00 27.04  ? 224 LYS C C   1 
ATOM   4456 O O   . LYS C 1 25  ? 43.333  70.838 59.463 1.00 28.86  ? 224 LYS C O   1 
ATOM   4457 C CB  . LYS C 1 25  ? 41.898  68.226 57.753 1.00 25.62  ? 224 LYS C CB  1 
ATOM   4458 C CG  . LYS C 1 25  ? 40.654  67.993 56.913 1.00 28.21  ? 224 LYS C CG  1 
ATOM   4459 C CD  . LYS C 1 25  ? 40.173  66.555 57.008 1.00 28.55  ? 224 LYS C CD  1 
ATOM   4460 C CE  . LYS C 1 25  ? 39.059  66.295 56.008 1.00 28.91  ? 224 LYS C CE  1 
ATOM   4461 N NZ  . LYS C 1 25  ? 38.934  64.842 55.729 1.00 28.83  ? 224 LYS C NZ  1 
ATOM   4462 N N   . ALA C 1 26  ? 44.476  69.002 58.845 1.00 27.74  ? 225 ALA C N   1 
ATOM   4463 C CA  . ALA C 1 26  ? 45.479  69.114 59.899 1.00 28.67  ? 225 ALA C CA  1 
ATOM   4464 C C   . ALA C 1 26  ? 46.014  70.526 60.057 1.00 30.12  ? 225 ALA C C   1 
ATOM   4465 O O   . ALA C 1 26  ? 46.043  71.064 61.157 1.00 30.26  ? 225 ALA C O   1 
ATOM   4466 C CB  . ALA C 1 26  ? 46.627  68.162 59.626 1.00 27.63  ? 225 ALA C CB  1 
ATOM   4467 N N   . ARG C 1 27  ? 46.433  71.126 58.951 1.00 32.90  ? 226 ARG C N   1 
ATOM   4468 C CA  . ARG C 1 27  ? 46.984  72.473 58.977 1.00 35.50  ? 226 ARG C CA  1 
ATOM   4469 C C   . ARG C 1 27  ? 46.075  73.532 59.582 1.00 36.18  ? 226 ARG C C   1 
ATOM   4470 O O   . ARG C 1 27  ? 46.540  74.566 60.053 1.00 36.42  ? 226 ARG C O   1 
ATOM   4471 C CB  . ARG C 1 27  ? 47.395  72.895 57.563 1.00 38.09  ? 226 ARG C CB  1 
ATOM   4472 C CG  . ARG C 1 27  ? 48.886  72.735 57.309 1.00 40.99  ? 226 ARG C CG  1 
ATOM   4473 C CD  . ARG C 1 27  ? 49.676  73.601 58.285 1.00 43.44  ? 226 ARG C CD  1 
ATOM   4474 N NE  . ARG C 1 27  ? 51.067  73.173 58.461 1.00 44.40  ? 226 ARG C NE  1 
ATOM   4475 C CZ  . ARG C 1 27  ? 51.442  72.007 58.989 1.00 43.83  ? 226 ARG C CZ  1 
ATOM   4476 N NH1 . ARG C 1 27  ? 50.534  71.127 59.398 1.00 43.20  ? 226 ARG C NH1 1 
ATOM   4477 N NH2 . ARG C 1 27  ? 52.733  71.727 59.129 1.00 42.04  ? 226 ARG C NH2 1 
ATOM   4478 N N   . VAL C 1 28  ? 44.779  73.270 59.577 1.00 37.15  ? 227 VAL C N   1 
ATOM   4479 C CA  . VAL C 1 28  ? 43.814  74.215 60.114 1.00 38.85  ? 227 VAL C CA  1 
ATOM   4480 C C   . VAL C 1 28  ? 43.545  73.984 61.597 1.00 40.07  ? 227 VAL C C   1 
ATOM   4481 O O   . VAL C 1 28  ? 43.013  74.851 62.293 1.00 41.24  ? 227 VAL C O   1 
ATOM   4482 C CB  . VAL C 1 28  ? 42.509  74.112 59.327 1.00 38.59  ? 227 VAL C CB  1 
ATOM   4483 C CG1 . VAL C 1 28  ? 41.438  75.007 59.937 1.00 38.05  ? 227 VAL C CG1 1 
ATOM   4484 C CG2 . VAL C 1 28  ? 42.781  74.490 57.883 1.00 40.63  ? 227 VAL C CG2 1 
ATOM   4485 N N   . ILE C 1 29  ? 43.915  72.802 62.071 1.00 40.11  ? 228 ILE C N   1 
ATOM   4486 C CA  . ILE C 1 29  ? 43.727  72.448 63.464 1.00 39.49  ? 228 ILE C CA  1 
ATOM   4487 C C   . ILE C 1 29  ? 44.858  73.082 64.253 1.00 40.93  ? 228 ILE C C   1 
ATOM   4488 O O   . ILE C 1 29  ? 44.648  73.648 65.326 1.00 41.68  ? 228 ILE C O   1 
ATOM   4489 C CB  . ILE C 1 29  ? 43.768  70.914 63.644 1.00 37.61  ? 228 ILE C CB  1 
ATOM   4490 C CG1 . ILE C 1 29  ? 42.518  70.292 63.022 1.00 34.95  ? 228 ILE C CG1 1 
ATOM   4491 C CG2 . ILE C 1 29  ? 43.899  70.556 65.119 1.00 38.62  ? 228 ILE C CG2 1 
ATOM   4492 C CD1 . ILE C 1 29  ? 42.430  68.803 63.192 1.00 32.66  ? 228 ILE C CD1 1 
ATOM   4493 N N   . LEU C 1 30  ? 46.056  73.000 63.684 1.00 42.28  ? 229 LEU C N   1 
ATOM   4494 C CA  . LEU C 1 30  ? 47.269  73.520 64.305 1.00 44.16  ? 229 LEU C CA  1 
ATOM   4495 C C   . LEU C 1 30  ? 47.459  75.022 64.217 1.00 46.57  ? 229 LEU C C   1 
ATOM   4496 O O   . LEU C 1 30  ? 47.500  75.730 65.225 1.00 46.23  ? 229 LEU C O   1 
ATOM   4497 C CB  . LEU C 1 30  ? 48.492  72.866 63.673 1.00 41.04  ? 229 LEU C CB  1 
ATOM   4498 C CG  . LEU C 1 30  ? 48.625  71.358 63.778 1.00 38.58  ? 229 LEU C CG  1 
ATOM   4499 C CD1 . LEU C 1 30  ? 48.823  70.790 62.396 1.00 38.82  ? 229 LEU C CD1 1 
ATOM   4500 C CD2 . LEU C 1 30  ? 49.786  71.012 64.674 1.00 37.92  ? 229 LEU C CD2 1 
ATOM   4501 N N   . SER C 1 31  ? 47.608  75.498 62.991 1.00 50.01  ? 230 SER C N   1 
ATOM   4502 C CA  . SER C 1 31  ? 47.848  76.907 62.767 1.00 53.09  ? 230 SER C CA  1 
ATOM   4503 C C   . SER C 1 31  ? 46.575  77.693 62.857 1.00 54.54  ? 230 SER C C   1 
ATOM   4504 O O   . SER C 1 31  ? 46.274  78.290 63.885 1.00 54.21  ? 230 SER C O   1 
ATOM   4505 C CB  . SER C 1 31  ? 48.466  77.134 61.387 1.00 53.42  ? 230 SER C CB  1 
ATOM   4506 O OG  . SER C 1 31  ? 49.376  78.220 61.407 1.00 52.87  ? 230 SER C OG  1 
ATOM   4507 N N   . GLY C 1 32  ? 45.841  77.684 61.753 1.00 56.54  ? 231 GLY C N   1 
ATOM   4508 C CA  . GLY C 1 32  ? 44.606  78.422 61.679 1.00 59.37  ? 231 GLY C CA  1 
ATOM   4509 C C   . GLY C 1 32  ? 43.687  78.175 62.849 1.00 60.48  ? 231 GLY C C   1 
ATOM   4510 O O   . GLY C 1 32  ? 42.505  77.979 62.625 1.00 62.55  ? 231 GLY C O   1 
ATOM   4511 N N   . LYS C 1 33  ? 44.220  78.168 64.068 1.00 59.42  ? 232 LYS C N   1 
ATOM   4512 C CA  . LYS C 1 33  ? 43.441  77.968 65.283 1.00 58.97  ? 232 LYS C CA  1 
ATOM   4513 C C   . LYS C 1 33  ? 42.106  78.719 65.159 1.00 57.65  ? 232 LYS C C   1 
ATOM   4514 O O   . LYS C 1 33  ? 41.725  79.519 66.005 1.00 57.51  ? 232 LYS C O   1 
ATOM   4515 C CB  . LYS C 1 33  ? 44.267  78.462 66.484 1.00 61.27  ? 232 LYS C CB  1 
ATOM   4516 C CG  . LYS C 1 33  ? 43.478  79.073 67.634 1.00 63.08  ? 232 LYS C CG  1 
ATOM   4517 C CD  . LYS C 1 33  ? 43.665  80.585 67.702 1.00 63.00  ? 232 LYS C CD  1 
ATOM   4518 C CE  . LYS C 1 33  ? 44.975  80.934 68.386 1.00 61.61  ? 232 LYS C CE  1 
ATOM   4519 N NZ  . LYS C 1 33  ? 44.767  82.029 69.366 1.00 58.66  ? 232 LYS C NZ  1 
ATOM   4520 N N   . ALA C 1 34  ? 41.382  78.426 64.090 1.00 56.42  ? 233 ALA C N   1 
ATOM   4521 C CA  . ALA C 1 34  ? 40.115  79.069 63.795 1.00 55.29  ? 233 ALA C CA  1 
ATOM   4522 C C   . ALA C 1 34  ? 38.942  78.251 64.310 1.00 54.92  ? 233 ALA C C   1 
ATOM   4523 O O   . ALA C 1 34  ? 38.125  77.733 63.544 1.00 54.99  ? 233 ALA C O   1 
ATOM   4524 C CB  . ALA C 1 34  ? 39.990  79.301 62.299 1.00 53.49  ? 233 ALA C CB  1 
ATOM   4525 N N   . SER C 1 35  ? 38.889  78.167 65.633 1.00 53.42  ? 234 SER C N   1 
ATOM   4526 C CA  . SER C 1 35  ? 37.879  77.463 66.405 1.00 51.08  ? 234 SER C CA  1 
ATOM   4527 C C   . SER C 1 35  ? 38.611  77.258 67.702 1.00 49.29  ? 234 SER C C   1 
ATOM   4528 O O   . SER C 1 35  ? 39.718  76.709 67.712 1.00 49.59  ? 234 SER C O   1 
ATOM   4529 C CB  . SER C 1 35  ? 37.528  76.093 65.810 1.00 52.07  ? 234 SER C CB  1 
ATOM   4530 O OG  . SER C 1 35  ? 36.882  75.269 66.777 1.00 52.63  ? 234 SER C OG  1 
ATOM   4531 N N   . ASN C 1 36  ? 38.035  77.744 68.792 1.00 46.06  ? 235 ASN C N   1 
ATOM   4532 C CA  . ASN C 1 36  ? 38.680  77.542 70.065 1.00 43.17  ? 235 ASN C CA  1 
ATOM   4533 C C   . ASN C 1 36  ? 38.308  76.136 70.493 1.00 39.64  ? 235 ASN C C   1 
ATOM   4534 O O   . ASN C 1 36  ? 37.635  75.423 69.748 1.00 39.65  ? 235 ASN C O   1 
ATOM   4535 C CB  . ASN C 1 36  ? 38.225  78.573 71.082 1.00 44.85  ? 235 ASN C CB  1 
ATOM   4536 C CG  . ASN C 1 36  ? 38.533  78.150 72.501 1.00 47.19  ? 235 ASN C CG  1 
ATOM   4537 O OD1 . ASN C 1 36  ? 37.907  77.235 73.027 1.00 48.78  ? 235 ASN C OD1 1 
ATOM   4538 N ND2 . ASN C 1 36  ? 39.507  78.801 73.125 1.00 47.52  ? 235 ASN C ND2 1 
ATOM   4539 N N   . ASN C 1 37  ? 38.713  75.738 71.690 1.00 35.66  ? 236 ASN C N   1 
ATOM   4540 C CA  . ASN C 1 37  ? 38.455  74.383 72.118 1.00 32.39  ? 236 ASN C CA  1 
ATOM   4541 C C   . ASN C 1 37  ? 39.338  73.774 71.056 1.00 29.27  ? 236 ASN C C   1 
ATOM   4542 O O   . ASN C 1 37  ? 38.895  73.392 69.981 1.00 28.75  ? 236 ASN C O   1 
ATOM   4543 C CB  . ASN C 1 37  ? 36.977  73.995 71.929 1.00 30.81  ? 236 ASN C CB  1 
ATOM   4544 C CG  . ASN C 1 37  ? 36.793  72.580 71.410 1.00 29.33  ? 236 ASN C CG  1 
ATOM   4545 O OD1 . ASN C 1 37  ? 37.344  72.208 70.380 1.00 32.66  ? 236 ASN C OD1 1 
ATOM   4546 N ND2 . ASN C 1 37  ? 35.998  71.792 72.109 1.00 26.58  ? 236 ASN C ND2 1 
ATOM   4547 N N   . PRO C 1 38  ? 40.643  73.835 71.284 1.00 26.28  ? 237 PRO C N   1 
ATOM   4548 C CA  . PRO C 1 38  ? 41.487  73.236 70.268 1.00 24.93  ? 237 PRO C CA  1 
ATOM   4549 C C   . PRO C 1 38  ? 41.718  71.863 70.823 1.00 22.97  ? 237 PRO C C   1 
ATOM   4550 O O   . PRO C 1 38  ? 41.139  71.496 71.838 1.00 22.61  ? 237 PRO C O   1 
ATOM   4551 C CB  . PRO C 1 38  ? 42.732  74.090 70.323 1.00 24.19  ? 237 PRO C CB  1 
ATOM   4552 C CG  . PRO C 1 38  ? 42.846  74.376 71.761 1.00 25.21  ? 237 PRO C CG  1 
ATOM   4553 C CD  . PRO C 1 38  ? 41.429  74.710 72.166 1.00 25.97  ? 237 PRO C CD  1 
ATOM   4554 N N   . PRO C 1 39  ? 42.608  71.100 70.214 1.00 21.34  ? 238 PRO C N   1 
ATOM   4555 C CA  . PRO C 1 39  ? 42.819  69.765 70.758 1.00 21.86  ? 238 PRO C CA  1 
ATOM   4556 C C   . PRO C 1 39  ? 43.349  69.661 72.201 1.00 21.84  ? 238 PRO C C   1 
ATOM   4557 O O   . PRO C 1 39  ? 43.862  70.620 72.774 1.00 22.20  ? 238 PRO C O   1 
ATOM   4558 C CB  . PRO C 1 39  ? 43.767  69.159 69.748 1.00 21.27  ? 238 PRO C CB  1 
ATOM   4559 C CG  . PRO C 1 39  ? 44.626  70.312 69.400 1.00 21.13  ? 238 PRO C CG  1 
ATOM   4560 C CD  . PRO C 1 39  ? 43.662  71.449 69.248 1.00 21.01  ? 238 PRO C CD  1 
ATOM   4561 N N   . PHE C 1 40  ? 43.206  68.474 72.782 1.00 22.20  ? 239 PHE C N   1 
ATOM   4562 C CA  . PHE C 1 40  ? 43.676  68.215 74.137 1.00 22.88  ? 239 PHE C CA  1 
ATOM   4563 C C   . PHE C 1 40  ? 45.190  68.032 74.040 1.00 24.80  ? 239 PHE C C   1 
ATOM   4564 O O   . PHE C 1 40  ? 45.662  67.143 73.326 1.00 25.25  ? 239 PHE C O   1 
ATOM   4565 C CB  . PHE C 1 40  ? 43.015  66.940 74.681 1.00 21.05  ? 239 PHE C CB  1 
ATOM   4566 C CG  . PHE C 1 40  ? 43.505  66.530 76.041 1.00 21.08  ? 239 PHE C CG  1 
ATOM   4567 C CD1 . PHE C 1 40  ? 43.231  67.309 77.160 1.00 21.38  ? 239 PHE C CD1 1 
ATOM   4568 C CD2 . PHE C 1 40  ? 44.254  65.367 76.206 1.00 20.73  ? 239 PHE C CD2 1 
ATOM   4569 C CE1 . PHE C 1 40  ? 43.698  66.935 78.428 1.00 20.08  ? 239 PHE C CE1 1 
ATOM   4570 C CE2 . PHE C 1 40  ? 44.724  64.986 77.466 1.00 19.60  ? 239 PHE C CE2 1 
ATOM   4571 C CZ  . PHE C 1 40  ? 44.444  65.773 78.577 1.00 19.07  ? 239 PHE C CZ  1 
ATOM   4572 N N   . VAL C 1 41  ? 45.955  68.871 74.741 1.00 25.54  ? 240 VAL C N   1 
ATOM   4573 C CA  . VAL C 1 41  ? 47.414  68.769 74.693 1.00 25.15  ? 240 VAL C CA  1 
ATOM   4574 C C   . VAL C 1 41  ? 47.982  67.748 75.657 1.00 26.07  ? 240 VAL C C   1 
ATOM   4575 O O   . VAL C 1 41  ? 47.695  67.794 76.843 1.00 27.04  ? 240 VAL C O   1 
ATOM   4576 C CB  . VAL C 1 41  ? 48.091  70.095 75.017 1.00 22.82  ? 240 VAL C CB  1 
ATOM   4577 C CG1 . VAL C 1 41  ? 49.589  69.945 74.868 1.00 22.93  ? 240 VAL C CG1 1 
ATOM   4578 C CG2 . VAL C 1 41  ? 47.583  71.171 74.107 1.00 22.37  ? 240 VAL C CG2 1 
ATOM   4579 N N   . ILE C 1 42  ? 48.801  66.839 75.139 1.00 27.86  ? 241 ILE C N   1 
ATOM   4580 C CA  . ILE C 1 42  ? 49.442  65.808 75.951 1.00 31.08  ? 241 ILE C CA  1 
ATOM   4581 C C   . ILE C 1 42  ? 50.903  66.193 76.184 1.00 34.37  ? 241 ILE C C   1 
ATOM   4582 O O   . ILE C 1 42  ? 51.742  65.977 75.312 1.00 35.45  ? 241 ILE C O   1 
ATOM   4583 C CB  . ILE C 1 42  ? 49.416  64.444 75.237 1.00 29.97  ? 241 ILE C CB  1 
ATOM   4584 C CG1 . ILE C 1 42  ? 47.974  63.976 75.068 1.00 29.68  ? 241 ILE C CG1 1 
ATOM   4585 C CG2 . ILE C 1 42  ? 50.241  63.425 76.013 1.00 28.33  ? 241 ILE C CG2 1 
ATOM   4586 C CD1 . ILE C 1 42  ? 47.857  62.610 74.424 1.00 28.89  ? 241 ILE C CD1 1 
ATOM   4587 N N   . HIS C 1 43  ? 51.213  66.738 77.359 1.00 37.88  ? 242 HIS C N   1 
ATOM   4588 C CA  . HIS C 1 43  ? 52.581  67.165 77.652 1.00 40.94  ? 242 HIS C CA  1 
ATOM   4589 C C   . HIS C 1 43  ? 53.254  66.574 78.896 1.00 42.05  ? 242 HIS C C   1 
ATOM   4590 O O   . HIS C 1 43  ? 54.453  66.749 79.089 1.00 42.33  ? 242 HIS C O   1 
ATOM   4591 C CB  . HIS C 1 43  ? 52.620  68.691 77.734 1.00 42.41  ? 242 HIS C CB  1 
ATOM   4592 C CG  . HIS C 1 43  ? 51.710  69.263 78.775 1.00 44.58  ? 242 HIS C CG  1 
ATOM   4593 N ND1 . HIS C 1 43  ? 52.062  69.357 80.105 1.00 44.82  ? 242 HIS C ND1 1 
ATOM   4594 C CD2 . HIS C 1 43  ? 50.456  69.767 78.681 1.00 45.32  ? 242 HIS C CD2 1 
ATOM   4595 C CE1 . HIS C 1 43  ? 51.065  69.899 80.782 1.00 45.74  ? 242 HIS C CE1 1 
ATOM   4596 N NE2 . HIS C 1 43  ? 50.079  70.156 79.943 1.00 45.38  ? 242 HIS C NE2 1 
ATOM   4597 N N   . ASP C 1 44  ? 52.496  65.878 79.735 1.00 43.35  ? 243 ASP C N   1 
ATOM   4598 C CA  . ASP C 1 44  ? 53.054  65.285 80.947 1.00 44.56  ? 243 ASP C CA  1 
ATOM   4599 C C   . ASP C 1 44  ? 52.317  63.984 81.250 1.00 45.85  ? 243 ASP C C   1 
ATOM   4600 O O   . ASP C 1 44  ? 51.180  63.816 80.821 1.00 46.90  ? 243 ASP C O   1 
ATOM   4601 C CB  . ASP C 1 44  ? 52.907  66.264 82.111 1.00 43.91  ? 243 ASP C CB  1 
ATOM   4602 C CG  . ASP C 1 44  ? 51.464  66.604 82.406 1.00 42.97  ? 243 ASP C CG  1 
ATOM   4603 O OD1 . ASP C 1 44  ? 50.699  65.688 82.760 1.00 42.94  ? 243 ASP C OD1 1 
ATOM   4604 O OD2 . ASP C 1 44  ? 51.087  67.782 82.288 1.00 42.38  ? 243 ASP C OD2 1 
ATOM   4605 N N   . MET C 1 45  ? 52.943  63.072 81.995 1.00 46.67  ? 244 MET C N   1 
ATOM   4606 C CA  . MET C 1 45  ? 52.310  61.781 82.295 1.00 48.18  ? 244 MET C CA  1 
ATOM   4607 C C   . MET C 1 45  ? 50.887  61.809 82.847 1.00 47.20  ? 244 MET C C   1 
ATOM   4608 O O   . MET C 1 45  ? 50.173  60.808 82.769 1.00 46.44  ? 244 MET C O   1 
ATOM   4609 C CB  . MET C 1 45  ? 53.179  60.939 83.233 1.00 50.98  ? 244 MET C CB  1 
ATOM   4610 C CG  . MET C 1 45  ? 54.027  59.899 82.520 1.00 55.64  ? 244 MET C CG  1 
ATOM   4611 S SD  . MET C 1 45  ? 55.531  60.619 81.833 1.00 63.32  ? 244 MET C SD  1 
ATOM   4612 C CE  . MET C 1 45  ? 56.356  59.181 81.150 1.00 61.16  ? 244 MET C CE  1 
ATOM   4613 N N   . GLU C 1 46  ? 50.471  62.928 83.423 1.00 46.25  ? 245 GLU C N   1 
ATOM   4614 C CA  . GLU C 1 46  ? 49.114  62.997 83.933 1.00 45.70  ? 245 GLU C CA  1 
ATOM   4615 C C   . GLU C 1 46  ? 48.217  63.055 82.711 1.00 43.88  ? 245 GLU C C   1 
ATOM   4616 O O   . GLU C 1 46  ? 47.479  62.111 82.435 1.00 44.02  ? 245 GLU C O   1 
ATOM   4617 C CB  . GLU C 1 46  ? 48.911  64.244 84.786 1.00 48.05  ? 245 GLU C CB  1 
ATOM   4618 C CG  . GLU C 1 46  ? 47.445  64.562 85.030 1.00 52.33  ? 245 GLU C CG  1 
ATOM   4619 C CD  . GLU C 1 46  ? 47.246  65.935 85.636 1.00 55.33  ? 245 GLU C CD  1 
ATOM   4620 O OE1 . GLU C 1 46  ? 48.098  66.819 85.372 1.00 56.43  ? 245 GLU C OE1 1 
ATOM   4621 O OE2 . GLU C 1 46  ? 46.236  66.131 86.356 1.00 55.77  ? 245 GLU C OE2 1 
ATOM   4622 N N   . THR C 1 47  ? 48.300  64.169 81.981 1.00 42.08  ? 246 THR C N   1 
ATOM   4623 C CA  . THR C 1 47  ? 47.516  64.381 80.762 1.00 38.94  ? 246 THR C CA  1 
ATOM   4624 C C   . THR C 1 47  ? 47.627  63.153 79.870 1.00 39.19  ? 246 THR C C   1 
ATOM   4625 O O   . THR C 1 47  ? 46.643  62.699 79.289 1.00 38.52  ? 246 THR C O   1 
ATOM   4626 C CB  . THR C 1 47  ? 48.009  65.624 79.964 1.00 35.75  ? 246 THR C CB  1 
ATOM   4627 O OG1 . THR C 1 47  ? 49.438  65.625 79.905 1.00 31.98  ? 246 THR C OG1 1 
ATOM   4628 C CG2 . THR C 1 47  ? 47.536  66.912 80.615 1.00 34.18  ? 246 THR C CG2 1 
ATOM   4629 N N   . LEU C 1 48  ? 48.839  62.618 79.778 1.00 39.99  ? 247 LEU C N   1 
ATOM   4630 C CA  . LEU C 1 48  ? 49.107  61.435 78.975 1.00 41.09  ? 247 LEU C CA  1 
ATOM   4631 C C   . LEU C 1 48  ? 48.201  60.290 79.390 1.00 43.05  ? 247 LEU C C   1 
ATOM   4632 O O   . LEU C 1 48  ? 47.869  59.422 78.583 1.00 42.41  ? 247 LEU C O   1 
ATOM   4633 C CB  . LEU C 1 48  ? 50.562  61.020 79.136 1.00 39.43  ? 247 LEU C CB  1 
ATOM   4634 C CG  . LEU C 1 48  ? 50.864  59.610 78.651 1.00 39.53  ? 247 LEU C CG  1 
ATOM   4635 C CD1 . LEU C 1 48  ? 50.417  59.441 77.206 1.00 38.21  ? 247 LEU C CD1 1 
ATOM   4636 C CD2 . LEU C 1 48  ? 52.345  59.350 78.816 1.00 39.82  ? 247 LEU C CD2 1 
ATOM   4637 N N   . CYS C 1 49  ? 47.815  60.286 80.661 1.00 46.46  ? 248 CYS C N   1 
ATOM   4638 C CA  . CYS C 1 49  ? 46.924  59.261 81.189 1.00 49.92  ? 248 CYS C CA  1 
ATOM   4639 C C   . CYS C 1 49  ? 45.491  59.597 80.810 1.00 50.89  ? 248 CYS C C   1 
ATOM   4640 O O   . CYS C 1 49  ? 44.811  58.807 80.158 1.00 50.40  ? 248 CYS C O   1 
ATOM   4641 C CB  . CYS C 1 49  ? 47.045  59.174 82.709 1.00 51.54  ? 248 CYS C CB  1 
ATOM   4642 S SG  . CYS C 1 49  ? 48.471  58.229 83.279 1.00 55.03  ? 248 CYS C SG  1 
ATOM   4643 N N   . MET C 1 50  ? 45.040  60.779 81.218 1.00 52.70  ? 249 MET C N   1 
ATOM   4644 C CA  . MET C 1 50  ? 43.690  61.227 80.906 1.00 54.86  ? 249 MET C CA  1 
ATOM   4645 C C   . MET C 1 50  ? 43.347  60.932 79.440 1.00 55.69  ? 249 MET C C   1 
ATOM   4646 O O   . MET C 1 50  ? 42.174  60.839 79.088 1.00 55.72  ? 249 MET C O   1 
ATOM   4647 C CB  . MET C 1 50  ? 43.551  62.737 81.147 1.00 56.51  ? 249 MET C CB  1 
ATOM   4648 C CG  . MET C 1 50  ? 43.886  63.235 82.549 1.00 57.83  ? 249 MET C CG  1 
ATOM   4649 S SD  . MET C 1 50  ? 43.364  64.947 82.826 1.00 61.03  ? 249 MET C SD  1 
ATOM   4650 C CE  . MET C 1 50  ? 44.881  65.877 82.621 1.00 58.12  ? 249 MET C CE  1 
ATOM   4651 N N   . ALA C 1 51  ? 44.374  60.783 78.601 1.00 56.70  ? 250 ALA C N   1 
ATOM   4652 C CA  . ALA C 1 51  ? 44.202  60.524 77.170 1.00 57.43  ? 250 ALA C CA  1 
ATOM   4653 C C   . ALA C 1 51  ? 43.877  59.083 76.790 1.00 58.55  ? 250 ALA C C   1 
ATOM   4654 O O   . ALA C 1 51  ? 42.708  58.708 76.754 1.00 59.85  ? 250 ALA C O   1 
ATOM   4655 C CB  . ALA C 1 51  ? 45.432  60.983 76.412 1.00 56.74  ? 250 ALA C CB  1 
ATOM   4656 N N   . GLU C 1 52  ? 44.896  58.276 76.497 1.00 60.15  ? 251 GLU C N   1 
ATOM   4657 C CA  . GLU C 1 52  ? 44.665  56.880 76.097 1.00 61.65  ? 251 GLU C CA  1 
ATOM   4658 C C   . GLU C 1 52  ? 43.713  56.126 77.022 1.00 61.25  ? 251 GLU C C   1 
ATOM   4659 O O   . GLU C 1 52  ? 43.246  55.031 76.704 1.00 60.66  ? 251 GLU C O   1 
ATOM   4660 C CB  . GLU C 1 52  ? 45.992  56.111 75.954 1.00 62.75  ? 251 GLU C CB  1 
ATOM   4661 C CG  . GLU C 1 52  ? 47.200  56.718 76.646 1.00 64.97  ? 251 GLU C CG  1 
ATOM   4662 C CD  . GLU C 1 52  ? 47.131  56.607 78.145 1.00 66.61  ? 251 GLU C CD  1 
ATOM   4663 O OE1 . GLU C 1 52  ? 46.269  57.281 78.749 1.00 67.83  ? 251 GLU C OE1 1 
ATOM   4664 O OE2 . GLU C 1 52  ? 47.938  55.840 78.713 1.00 67.25  ? 251 GLU C OE2 1 
ATOM   4665 N N   . LYS C 1 53  ? 43.428  56.737 78.163 1.00 60.96  ? 252 LYS C N   1 
ATOM   4666 C CA  . LYS C 1 53  ? 42.513  56.184 79.144 1.00 61.36  ? 252 LYS C CA  1 
ATOM   4667 C C   . LYS C 1 53  ? 41.129  56.195 78.497 1.00 61.08  ? 252 LYS C C   1 
ATOM   4668 O O   . LYS C 1 53  ? 40.455  55.168 78.446 1.00 60.73  ? 252 LYS C O   1 
ATOM   4669 C CB  . LYS C 1 53  ? 42.551  57.068 80.392 1.00 62.94  ? 252 LYS C CB  1 
ATOM   4670 C CG  . LYS C 1 53  ? 41.776  56.601 81.611 1.00 63.63  ? 252 LYS C CG  1 
ATOM   4671 C CD  . LYS C 1 53  ? 42.219  57.453 82.791 1.00 64.89  ? 252 LYS C CD  1 
ATOM   4672 C CE  . LYS C 1 53  ? 41.118  57.680 83.815 1.00 67.64  ? 252 LYS C CE  1 
ATOM   4673 N NZ  . LYS C 1 53  ? 40.803  56.485 84.655 1.00 69.88  ? 252 LYS C NZ  1 
ATOM   4674 N N   . THR C 1 54  ? 40.718  57.359 77.991 1.00 61.56  ? 253 THR C N   1 
ATOM   4675 C CA  . THR C 1 54  ? 39.421  57.496 77.324 1.00 62.33  ? 253 THR C CA  1 
ATOM   4676 C C   . THR C 1 54  ? 39.460  56.833 75.956 1.00 64.55  ? 253 THR C C   1 
ATOM   4677 O O   . THR C 1 54  ? 38.420  56.482 75.390 1.00 64.32  ? 253 THR C O   1 
ATOM   4678 C CB  . THR C 1 54  ? 39.003  58.980 77.123 1.00 60.29  ? 253 THR C CB  1 
ATOM   4679 O OG1 . THR C 1 54  ? 40.135  59.756 76.722 1.00 58.00  ? 253 THR C OG1 1 
ATOM   4680 C CG2 . THR C 1 54  ? 38.404  59.548 78.394 1.00 59.86  ? 253 THR C CG2 1 
ATOM   4681 N N   . LEU C 1 55  ? 40.667  56.672 75.425 1.00 67.19  ? 254 LEU C N   1 
ATOM   4682 C CA  . LEU C 1 55  ? 40.845  56.038 74.130 1.00 70.36  ? 254 LEU C CA  1 
ATOM   4683 C C   . LEU C 1 55  ? 40.276  54.640 74.245 1.00 73.65  ? 254 LEU C C   1 
ATOM   4684 O O   . LEU C 1 55  ? 39.167  54.372 73.781 1.00 73.66  ? 254 LEU C O   1 
ATOM   4685 C CB  . LEU C 1 55  ? 42.332  55.997 73.763 1.00 69.20  ? 254 LEU C CB  1 
ATOM   4686 C CG  . LEU C 1 55  ? 42.765  56.953 72.644 1.00 68.50  ? 254 LEU C CG  1 
ATOM   4687 C CD1 . LEU C 1 55  ? 42.027  58.268 72.765 1.00 68.46  ? 254 LEU C CD1 1 
ATOM   4688 C CD2 . LEU C 1 55  ? 44.265  57.173 72.698 1.00 67.50  ? 254 LEU C CD2 1 
ATOM   4689 N N   . VAL C 1 56  ? 41.030  53.748 74.875 1.00 78.06  ? 255 VAL C N   1 
ATOM   4690 C CA  . VAL C 1 56  ? 40.547  52.393 75.058 1.00 82.92  ? 255 VAL C CA  1 
ATOM   4691 C C   . VAL C 1 56  ? 39.392  52.493 76.034 1.00 86.32  ? 255 VAL C C   1 
ATOM   4692 O O   . VAL C 1 56  ? 39.600  52.705 77.227 1.00 86.19  ? 255 VAL C O   1 
ATOM   4693 C CB  . VAL C 1 56  ? 41.602  51.469 75.692 1.00 82.67  ? 255 VAL C CB  1 
ATOM   4694 C CG1 . VAL C 1 56  ? 41.123  50.025 75.628 1.00 82.62  ? 255 VAL C CG1 1 
ATOM   4695 C CG2 . VAL C 1 56  ? 42.935  51.632 74.993 1.00 83.05  ? 255 VAL C CG2 1 
ATOM   4696 N N   . ALA C 1 57  ? 38.172  52.376 75.530 1.00 90.77  ? 256 ALA C N   1 
ATOM   4697 C CA  . ALA C 1 57  ? 37.021  52.428 76.411 1.00 95.46  ? 256 ALA C CA  1 
ATOM   4698 C C   . ALA C 1 57  ? 36.924  51.040 77.057 1.00 98.66  ? 256 ALA C C   1 
ATOM   4699 O O   . ALA C 1 57  ? 35.975  50.290 76.806 1.00 99.27  ? 256 ALA C O   1 
ATOM   4700 C CB  . ALA C 1 57  ? 35.762  52.745 75.611 1.00 95.42  ? 256 ALA C CB  1 
ATOM   4701 N N   . LYS C 1 58  ? 37.921  50.704 77.882 1.00 101.89 ? 257 LYS C N   1 
ATOM   4702 C CA  . LYS C 1 58  ? 37.970  49.401 78.556 1.00 104.80 ? 257 LYS C CA  1 
ATOM   4703 C C   . LYS C 1 58  ? 39.182  49.199 79.493 1.00 106.68 ? 257 LYS C C   1 
ATOM   4704 O O   . LYS C 1 58  ? 39.303  48.145 80.124 1.00 106.86 ? 257 LYS C O   1 
ATOM   4705 C CB  . LYS C 1 58  ? 37.956  48.281 77.498 1.00 104.96 ? 257 LYS C CB  1 
ATOM   4706 C CG  . LYS C 1 58  ? 38.162  46.864 78.026 1.00 104.88 ? 257 LYS C CG  1 
ATOM   4707 C CD  . LYS C 1 58  ? 38.875  46.002 76.992 1.00 104.47 ? 257 LYS C CD  1 
ATOM   4708 C CE  . LYS C 1 58  ? 40.095  45.315 77.590 1.00 103.86 ? 257 LYS C CE  1 
ATOM   4709 N NZ  . LYS C 1 58  ? 41.087  44.902 76.551 1.00 103.14 ? 257 LYS C NZ  1 
ATOM   4710 N N   . LEU C 1 59  ? 40.069  50.189 79.606 1.00 108.56 ? 258 LEU C N   1 
ATOM   4711 C CA  . LEU C 1 59  ? 41.248  50.019 80.462 1.00 110.27 ? 258 LEU C CA  1 
ATOM   4712 C C   . LEU C 1 59  ? 41.132  50.410 81.932 1.00 111.10 ? 258 LEU C C   1 
ATOM   4713 O O   . LEU C 1 59  ? 41.872  49.884 82.765 1.00 111.05 ? 258 LEU C O   1 
ATOM   4714 C CB  . LEU C 1 59  ? 42.471  50.717 79.853 1.00 110.79 ? 258 LEU C CB  1 
ATOM   4715 C CG  . LEU C 1 59  ? 43.075  50.076 78.596 1.00 111.13 ? 258 LEU C CG  1 
ATOM   4716 C CD1 . LEU C 1 59  ? 44.550  50.447 78.511 1.00 111.37 ? 258 LEU C CD1 1 
ATOM   4717 C CD2 . LEU C 1 59  ? 42.928  48.558 78.644 1.00 110.67 ? 258 LEU C CD2 1 
ATOM   4718 N N   . VAL C 1 60  ? 40.228  51.327 82.265 1.00 112.24 ? 259 VAL C N   1 
ATOM   4719 C CA  . VAL C 1 60  ? 40.070  51.710 83.664 1.00 113.55 ? 259 VAL C CA  1 
ATOM   4720 C C   . VAL C 1 60  ? 39.528  50.475 84.391 1.00 114.66 ? 259 VAL C C   1 
ATOM   4721 O O   . VAL C 1 60  ? 39.856  50.225 85.555 1.00 114.72 ? 259 VAL C O   1 
ATOM   4722 C CB  . VAL C 1 60  ? 39.089  52.914 83.825 1.00 113.29 ? 259 VAL C CB  1 
ATOM   4723 C CG1 . VAL C 1 60  ? 37.682  52.433 84.178 1.00 113.43 ? 259 VAL C CG1 1 
ATOM   4724 C CG2 . VAL C 1 60  ? 39.613  53.863 84.884 1.00 112.37 ? 259 VAL C CG2 1 
ATOM   4725 N N   . ALA C 1 61  ? 38.713  49.698 83.677 1.00 115.77 ? 260 ALA C N   1 
ATOM   4726 C CA  . ALA C 1 61  ? 38.115  48.476 84.207 1.00 116.39 ? 260 ALA C CA  1 
ATOM   4727 C C   . ALA C 1 61  ? 39.009  47.275 83.898 1.00 116.94 ? 260 ALA C C   1 
ATOM   4728 O O   . ALA C 1 61  ? 38.530  46.226 83.464 1.00 116.74 ? 260 ALA C O   1 
ATOM   4729 C CB  . ALA C 1 61  ? 36.726  48.267 83.603 1.00 116.05 ? 260 ALA C CB  1 
ATOM   4730 N N   . ASN C 1 62  ? 40.311  47.445 84.120 1.00 117.81 ? 261 ASN C N   1 
ATOM   4731 C CA  . ASN C 1 62  ? 41.294  46.391 83.879 1.00 118.79 ? 261 ASN C CA  1 
ATOM   4732 C C   . ASN C 1 62  ? 42.431  46.414 84.902 1.00 119.39 ? 261 ASN C C   1 
ATOM   4733 O O   . ASN C 1 62  ? 42.648  45.445 85.629 1.00 119.78 ? 261 ASN C O   1 
ATOM   4734 C CB  . ASN C 1 62  ? 41.884  46.524 82.472 1.00 118.84 ? 261 ASN C CB  1 
ATOM   4735 C CG  . ASN C 1 62  ? 41.227  45.594 81.472 1.00 119.16 ? 261 ASN C CG  1 
ATOM   4736 O OD1 . ASN C 1 62  ? 40.015  45.644 81.259 1.00 119.30 ? 261 ASN C OD1 1 
ATOM   4737 N ND2 . ASN C 1 62  ? 42.030  44.738 80.850 1.00 119.49 ? 261 ASN C ND2 1 
ATOM   4738 N N   . GLY C 1 63  ? 43.150  47.529 84.953 1.00 119.76 ? 262 GLY C N   1 
ATOM   4739 C CA  . GLY C 1 63  ? 44.267  47.660 85.872 1.00 120.12 ? 262 GLY C CA  1 
ATOM   4740 C C   . GLY C 1 63  ? 45.369  48.393 85.141 1.00 120.49 ? 262 GLY C C   1 
ATOM   4741 O O   . GLY C 1 63  ? 46.554  48.276 85.468 1.00 120.19 ? 262 GLY C O   1 
ATOM   4742 N N   . ILE C 1 64  ? 44.950  49.149 84.128 1.00 121.04 ? 263 ILE C N   1 
ATOM   4743 C CA  . ILE C 1 64  ? 45.846  49.937 83.292 1.00 121.44 ? 263 ILE C CA  1 
ATOM   4744 C C   . ILE C 1 64  ? 45.545  51.421 83.524 1.00 121.48 ? 263 ILE C C   1 
ATOM   4745 O O   . ILE C 1 64  ? 44.831  52.050 82.742 1.00 121.47 ? 263 ILE C O   1 
ATOM   4746 C CB  . ILE C 1 64  ? 45.634  49.596 81.793 1.00 121.67 ? 263 ILE C CB  1 
ATOM   4747 C CG1 . ILE C 1 64  ? 45.499  48.078 81.628 1.00 122.00 ? 263 ILE C CG1 1 
ATOM   4748 C CG2 . ILE C 1 64  ? 46.806  50.116 80.961 1.00 121.37 ? 263 ILE C CG2 1 
ATOM   4749 C CD1 . ILE C 1 64  ? 45.410  47.599 80.194 1.00 121.87 ? 263 ILE C CD1 1 
ATOM   4750 N N   . GLN C 1 65  ? 46.083  51.964 84.615 1.00 121.54 ? 264 GLN C N   1 
ATOM   4751 C CA  . GLN C 1 65  ? 45.887  53.369 84.977 1.00 121.37 ? 264 GLN C CA  1 
ATOM   4752 C C   . GLN C 1 65  ? 47.231  54.078 84.994 1.00 121.50 ? 264 GLN C C   1 
ATOM   4753 O O   . GLN C 1 65  ? 47.313  55.298 85.137 1.00 121.61 ? 264 GLN C O   1 
ATOM   4754 C CB  . GLN C 1 65  ? 45.251  53.488 86.366 1.00 121.12 ? 264 GLN C CB  1 
ATOM   4755 C CG  . GLN C 1 65  ? 46.066  52.847 87.480 1.00 121.15 ? 264 GLN C CG  1 
ATOM   4756 C CD  . GLN C 1 65  ? 45.677  51.401 87.735 1.00 121.19 ? 264 GLN C CD  1 
ATOM   4757 O OE1 . GLN C 1 65  ? 46.447  50.629 88.310 1.00 121.77 ? 264 GLN C OE1 1 
ATOM   4758 N NE2 . GLN C 1 65  ? 44.470  51.030 87.321 1.00 120.55 ? 264 GLN C NE2 1 
ATOM   4759 N N   . ASN C 1 66  ? 48.285  53.287 84.863 1.00 121.49 ? 265 ASN C N   1 
ATOM   4760 C CA  . ASN C 1 66  ? 49.634  53.804 84.859 1.00 121.04 ? 265 ASN C CA  1 
ATOM   4761 C C   . ASN C 1 66  ? 50.563  52.621 84.833 1.00 120.53 ? 265 ASN C C   1 
ATOM   4762 O O   . ASN C 1 66  ? 50.474  51.702 85.644 1.00 120.87 ? 265 ASN C O   1 
ATOM   4763 C CB  . ASN C 1 66  ? 49.918  54.637 86.116 1.00 121.14 ? 265 ASN C CB  1 
ATOM   4764 C CG  . ASN C 1 66  ? 51.168  55.503 85.979 1.00 121.07 ? 265 ASN C CG  1 
ATOM   4765 O OD1 . ASN C 1 66  ? 52.206  55.236 86.592 1.00 120.70 ? 265 ASN C OD1 1 
ATOM   4766 N ND2 . ASN C 1 66  ? 51.068  56.547 85.164 1.00 121.13 ? 265 ASN C ND2 1 
ATOM   4767 N N   . LYS C 1 67  ? 51.433  52.637 83.852 1.00 119.52 ? 266 LYS C N   1 
ATOM   4768 C CA  . LYS C 1 67  ? 52.436  51.624 83.707 1.00 118.18 ? 266 LYS C CA  1 
ATOM   4769 C C   . LYS C 1 67  ? 53.429  52.562 83.085 1.00 117.24 ? 266 LYS C C   1 
ATOM   4770 O O   . LYS C 1 67  ? 53.046  53.659 82.674 1.00 117.66 ? 266 LYS C O   1 
ATOM   4771 C CB  . LYS C 1 67  ? 51.931  50.505 82.779 1.00 117.94 ? 266 LYS C CB  1 
ATOM   4772 C CG  . LYS C 1 67  ? 51.029  49.552 83.563 1.00 117.48 ? 266 LYS C CG  1 
ATOM   4773 C CD  . LYS C 1 67  ? 50.178  48.586 82.752 1.00 117.27 ? 266 LYS C CD  1 
ATOM   4774 C CE  . LYS C 1 67  ? 49.232  47.844 83.692 1.00 116.55 ? 266 LYS C CE  1 
ATOM   4775 N NZ  . LYS C 1 67  ? 48.247  46.972 82.996 1.00 116.12 ? 266 LYS C NZ  1 
ATOM   4776 N N   . GLU C 1 68  ? 54.702  52.211 83.120 1.00 115.46 ? 267 GLU C N   1 
ATOM   4777 C CA  . GLU C 1 68  ? 55.720  53.042 82.503 1.00 113.67 ? 267 GLU C CA  1 
ATOM   4778 C C   . GLU C 1 68  ? 54.959  53.590 81.304 1.00 112.63 ? 267 GLU C C   1 
ATOM   4779 O O   . GLU C 1 68  ? 54.446  52.817 80.497 1.00 112.91 ? 267 GLU C O   1 
ATOM   4780 C CB  . GLU C 1 68  ? 56.824  52.113 82.080 1.00 113.42 ? 267 GLU C CB  1 
ATOM   4781 C CG  . GLU C 1 68  ? 56.396  50.714 82.474 1.00 113.44 ? 267 GLU C CG  1 
ATOM   4782 C CD  . GLU C 1 68  ? 57.306  49.653 81.991 1.00 113.97 ? 267 GLU C CD  1 
ATOM   4783 O OE1 . GLU C 1 68  ? 58.522  49.778 82.230 1.00 114.05 ? 267 GLU C OE1 1 
ATOM   4784 O OE2 . GLU C 1 68  ? 56.797  48.689 81.384 1.00 114.44 ? 267 GLU C OE2 1 
ATOM   4785 N N   . ALA C 1 69  ? 54.836  54.910 81.218 1.00 111.17 ? 268 ALA C N   1 
ATOM   4786 C CA  . ALA C 1 69  ? 54.080  55.537 80.137 1.00 109.56 ? 268 ALA C CA  1 
ATOM   4787 C C   . ALA C 1 69  ? 54.371  54.981 78.752 1.00 108.34 ? 268 ALA C C   1 
ATOM   4788 O O   . ALA C 1 69  ? 53.480  54.443 78.101 1.00 108.08 ? 268 ALA C O   1 
ATOM   4789 C CB  . ALA C 1 69  ? 54.304  57.038 80.148 1.00 109.25 ? 268 ALA C CB  1 
ATOM   4790 N N   . GLU C 1 70  ? 55.618  55.123 78.314 1.00 106.96 ? 269 GLU C N   1 
ATOM   4791 C CA  . GLU C 1 70  ? 56.077  54.667 77.003 1.00 105.30 ? 269 GLU C CA  1 
ATOM   4792 C C   . GLU C 1 70  ? 55.567  53.310 76.502 1.00 104.59 ? 269 GLU C C   1 
ATOM   4793 O O   . GLU C 1 70  ? 55.889  52.893 75.388 1.00 103.62 ? 269 GLU C O   1 
ATOM   4794 C CB  . GLU C 1 70  ? 57.599  54.678 76.976 1.00 104.64 ? 269 GLU C CB  1 
ATOM   4795 C CG  . GLU C 1 70  ? 58.249  54.239 78.278 1.00 103.22 ? 269 GLU C CG  1 
ATOM   4796 C CD  . GLU C 1 70  ? 58.580  55.409 79.179 1.00 102.54 ? 269 GLU C CD  1 
ATOM   4797 O OE1 . GLU C 1 70  ? 59.414  56.244 78.776 1.00 101.88 ? 269 GLU C OE1 1 
ATOM   4798 O OE2 . GLU C 1 70  ? 58.010  55.494 80.287 1.00 102.67 ? 269 GLU C OE2 1 
ATOM   4799 N N   . VAL C 1 71  ? 54.797  52.618 77.334 1.00 104.44 ? 270 VAL C N   1 
ATOM   4800 C CA  . VAL C 1 71  ? 54.197  51.340 76.966 1.00 104.00 ? 270 VAL C CA  1 
ATOM   4801 C C   . VAL C 1 71  ? 52.828  51.743 76.422 1.00 103.75 ? 270 VAL C C   1 
ATOM   4802 O O   . VAL C 1 71  ? 52.346  51.207 75.423 1.00 103.64 ? 270 VAL C O   1 
ATOM   4803 C CB  . VAL C 1 71  ? 53.999  50.432 78.202 1.00 104.15 ? 270 VAL C CB  1 
ATOM   4804 C CG1 . VAL C 1 71  ? 53.354  49.123 77.789 1.00 104.14 ? 270 VAL C CG1 1 
ATOM   4805 C CG2 . VAL C 1 71  ? 55.335  50.177 78.884 1.00 104.54 ? 270 VAL C CG2 1 
ATOM   4806 N N   . ARG C 1 72  ? 52.225  52.713 77.107 1.00 103.33 ? 271 ARG C N   1 
ATOM   4807 C CA  . ARG C 1 72  ? 50.926  53.274 76.755 1.00 102.72 ? 271 ARG C CA  1 
ATOM   4808 C C   . ARG C 1 72  ? 51.045  54.046 75.431 1.00 102.02 ? 271 ARG C C   1 
ATOM   4809 O O   . ARG C 1 72  ? 50.143  54.006 74.592 1.00 102.12 ? 271 ARG C O   1 
ATOM   4810 C CB  . ARG C 1 72  ? 50.445  54.213 77.883 1.00 102.71 ? 271 ARG C CB  1 
ATOM   4811 C CG  . ARG C 1 72  ? 50.123  53.516 79.204 1.00 103.13 ? 271 ARG C CG  1 
ATOM   4812 C CD  . ARG C 1 72  ? 50.782  54.178 80.411 1.00 103.14 ? 271 ARG C CD  1 
ATOM   4813 N NE  . ARG C 1 72  ? 50.292  55.530 80.671 1.00 103.67 ? 271 ARG C NE  1 
ATOM   4814 C CZ  . ARG C 1 72  ? 50.869  56.391 81.507 1.00 104.40 ? 271 ARG C CZ  1 
ATOM   4815 N NH1 . ARG C 1 72  ? 51.962  56.052 82.178 1.00 104.60 ? 271 ARG C NH1 1 
ATOM   4816 N NH2 . ARG C 1 72  ? 50.370  57.608 81.654 1.00 104.54 ? 271 ARG C NH2 1 
ATOM   4817 N N   . ILE C 1 73  ? 52.169  54.739 75.249 1.00 100.99 ? 272 ILE C N   1 
ATOM   4818 C CA  . ILE C 1 73  ? 52.417  55.518 74.037 1.00 99.37  ? 272 ILE C CA  1 
ATOM   4819 C C   . ILE C 1 73  ? 53.177  54.705 72.993 1.00 99.18  ? 272 ILE C C   1 
ATOM   4820 O O   . ILE C 1 73  ? 54.020  55.228 72.264 1.00 99.13  ? 272 ILE C O   1 
ATOM   4821 C CB  . ILE C 1 73  ? 53.217  56.800 74.348 1.00 98.45  ? 272 ILE C CB  1 
ATOM   4822 C CG1 . ILE C 1 73  ? 52.496  57.612 75.417 1.00 97.76  ? 272 ILE C CG1 1 
ATOM   4823 C CG2 . ILE C 1 73  ? 53.352  57.655 73.098 1.00 98.20  ? 272 ILE C CG2 1 
ATOM   4824 C CD1 . ILE C 1 73  ? 53.170  58.923 75.720 1.00 97.47  ? 272 ILE C CD1 1 
ATOM   4825 N N   . PHE C 1 74  ? 52.890  53.411 72.948 1.00 98.65  ? 273 PHE C N   1 
ATOM   4826 C CA  . PHE C 1 74  ? 53.499  52.522 71.972 1.00 98.83  ? 273 PHE C CA  1 
ATOM   4827 C C   . PHE C 1 74  ? 52.495  51.422 71.717 1.00 99.13  ? 273 PHE C C   1 
ATOM   4828 O O   . PHE C 1 74  ? 52.755  50.476 70.976 1.00 99.24  ? 273 PHE C O   1 
ATOM   4829 C CB  . PHE C 1 74  ? 54.817  51.921 72.468 1.00 98.79  ? 273 PHE C CB  1 
ATOM   4830 C CG  . PHE C 1 74  ? 55.481  51.017 71.456 1.00 98.66  ? 273 PHE C CG  1 
ATOM   4831 C CD1 . PHE C 1 74  ? 55.673  51.446 70.146 1.00 98.73  ? 273 PHE C CD1 1 
ATOM   4832 C CD2 . PHE C 1 74  ? 55.888  49.733 71.802 1.00 98.40  ? 273 PHE C CD2 1 
ATOM   4833 C CE1 . PHE C 1 74  ? 56.257  50.613 69.195 1.00 98.57  ? 273 PHE C CE1 1 
ATOM   4834 C CE2 . PHE C 1 74  ? 56.475  48.891 70.855 1.00 98.43  ? 273 PHE C CE2 1 
ATOM   4835 C CZ  . PHE C 1 74  ? 56.658  49.333 69.550 1.00 98.46  ? 273 PHE C CZ  1 
ATOM   4836 N N   . HIS C 1 75  ? 51.347  51.549 72.369 1.00 99.57  ? 274 HIS C N   1 
ATOM   4837 C CA  . HIS C 1 75  ? 50.262  50.601 72.191 1.00 100.18 ? 274 HIS C CA  1 
ATOM   4838 C C   . HIS C 1 75  ? 49.088  51.418 71.676 1.00 99.62  ? 274 HIS C C   1 
ATOM   4839 O O   . HIS C 1 75  ? 48.149  50.881 71.086 1.00 99.61  ? 274 HIS C O   1 
ATOM   4840 C CB  . HIS C 1 75  ? 49.893  49.910 73.504 1.00 101.31 ? 274 HIS C CB  1 
ATOM   4841 C CG  . HIS C 1 75  ? 48.882  48.819 73.334 1.00 102.29 ? 274 HIS C CG  1 
ATOM   4842 N ND1 . HIS C 1 75  ? 47.532  49.066 73.207 1.00 102.54 ? 274 HIS C ND1 1 
ATOM   4843 C CD2 . HIS C 1 75  ? 49.034  47.480 73.200 1.00 102.98 ? 274 HIS C CD2 1 
ATOM   4844 C CE1 . HIS C 1 75  ? 46.896  47.926 73.001 1.00 102.87 ? 274 HIS C CE1 1 
ATOM   4845 N NE2 . HIS C 1 75  ? 47.784  46.949 72.992 1.00 103.26 ? 274 HIS C NE2 1 
ATOM   4846 N N   . CYS C 1 76  ? 49.160  52.727 71.913 1.00 98.69  ? 275 CYS C N   1 
ATOM   4847 C CA  . CYS C 1 76  ? 48.142  53.667 71.457 1.00 97.52  ? 275 CYS C CA  1 
ATOM   4848 C C   . CYS C 1 76  ? 48.765  54.530 70.369 1.00 96.67  ? 275 CYS C C   1 
ATOM   4849 O O   . CYS C 1 76  ? 48.215  55.551 69.955 1.00 96.32  ? 275 CYS C O   1 
ATOM   4850 C CB  . CYS C 1 76  ? 47.643  54.525 72.616 1.00 97.47  ? 275 CYS C CB  1 
ATOM   4851 S SG  . CYS C 1 76  ? 46.607  53.598 73.765 1.00 97.26  ? 275 CYS C SG  1 
ATOM   4852 N N   . CYS C 1 77  ? 49.941  54.095 69.932 1.00 95.62  ? 276 CYS C N   1 
ATOM   4853 C CA  . CYS C 1 77  ? 50.683  54.734 68.862 1.00 94.27  ? 276 CYS C CA  1 
ATOM   4854 C C   . CYS C 1 77  ? 50.511  53.685 67.768 1.00 94.35  ? 276 CYS C C   1 
ATOM   4855 O O   . CYS C 1 77  ? 50.862  53.894 66.609 1.00 93.99  ? 276 CYS C O   1 
ATOM   4856 C CB  . CYS C 1 77  ? 52.152  54.874 69.255 1.00 93.35  ? 276 CYS C CB  1 
ATOM   4857 S SG  . CYS C 1 77  ? 53.052  56.126 68.347 1.00 90.74  ? 276 CYS C SG  1 
ATOM   4858 N N   . GLN C 1 78  ? 49.944  52.553 68.185 1.00 94.48  ? 277 GLN C N   1 
ATOM   4859 C CA  . GLN C 1 78  ? 49.660  51.402 67.331 1.00 94.11  ? 277 GLN C CA  1 
ATOM   4860 C C   . GLN C 1 78  ? 48.154  51.359 67.052 1.00 93.98  ? 277 GLN C C   1 
ATOM   4861 O O   . GLN C 1 78  ? 47.689  50.610 66.190 1.00 93.68  ? 277 GLN C O   1 
ATOM   4862 C CB  . GLN C 1 78  ? 50.114  50.128 68.032 1.00 93.98  ? 277 GLN C CB  1 
ATOM   4863 C CG  . GLN C 1 78  ? 51.482  50.285 68.666 1.00 93.65  ? 277 GLN C CG  1 
ATOM   4864 C CD  . GLN C 1 78  ? 52.511  49.334 68.103 1.00 93.91  ? 277 GLN C CD  1 
ATOM   4865 O OE1 . GLN C 1 78  ? 52.677  49.226 66.888 1.00 94.02  ? 277 GLN C OE1 1 
ATOM   4866 N NE2 . GLN C 1 78  ? 53.219  48.643 68.986 1.00 93.87  ? 277 GLN C NE2 1 
ATOM   4867 N N   . CYS C 1 79  ? 47.400  52.151 67.816 1.00 93.93  ? 278 CYS C N   1 
ATOM   4868 C CA  . CYS C 1 79  ? 45.957  52.291 67.623 1.00 93.49  ? 278 CYS C CA  1 
ATOM   4869 C C   . CYS C 1 79  ? 45.953  53.386 66.558 1.00 92.41  ? 278 CYS C C   1 
ATOM   4870 O O   . CYS C 1 79  ? 44.918  53.950 66.191 1.00 93.31  ? 278 CYS C O   1 
ATOM   4871 C CB  . CYS C 1 79  ? 45.262  52.807 68.896 1.00 93.98  ? 278 CYS C CB  1 
ATOM   4872 S SG  . CYS C 1 79  ? 45.156  51.654 70.300 1.00 96.00  ? 278 CYS C SG  1 
ATOM   4873 N N   . THR C 1 80  ? 47.163  53.680 66.091 1.00 90.38  ? 279 THR C N   1 
ATOM   4874 C CA  . THR C 1 80  ? 47.422  54.686 65.077 1.00 87.75  ? 279 THR C CA  1 
ATOM   4875 C C   . THR C 1 80  ? 48.500  54.129 64.148 1.00 86.37  ? 279 THR C C   1 
ATOM   4876 O O   . THR C 1 80  ? 49.472  54.811 63.825 1.00 86.46  ? 279 THR C O   1 
ATOM   4877 C CB  . THR C 1 80  ? 47.941  55.995 65.712 1.00 87.04  ? 279 THR C CB  1 
ATOM   4878 O OG1 . THR C 1 80  ? 47.009  56.453 66.698 1.00 86.07  ? 279 THR C OG1 1 
ATOM   4879 C CG2 . THR C 1 80  ? 48.115  57.070 64.649 1.00 86.21  ? 279 THR C CG2 1 
ATOM   4880 N N   . SER C 1 81  ? 48.334  52.876 63.738 1.00 83.89  ? 280 SER C N   1 
ATOM   4881 C CA  . SER C 1 81  ? 49.290  52.243 62.842 1.00 81.10  ? 280 SER C CA  1 
ATOM   4882 C C   . SER C 1 81  ? 48.522  51.283 61.954 1.00 79.32  ? 280 SER C C   1 
ATOM   4883 O O   . SER C 1 81  ? 48.192  51.624 60.819 1.00 79.42  ? 280 SER C O   1 
ATOM   4884 C CB  . SER C 1 81  ? 50.356  51.493 63.638 1.00 81.16  ? 280 SER C CB  1 
ATOM   4885 O OG  . SER C 1 81  ? 51.582  51.482 62.931 1.00 80.50  ? 280 SER C OG  1 
ATOM   4886 N N   . VAL C 1 82  ? 48.227  50.092 62.473 1.00 76.76  ? 281 VAL C N   1 
ATOM   4887 C CA  . VAL C 1 82  ? 47.467  49.098 61.724 1.00 74.20  ? 281 VAL C CA  1 
ATOM   4888 C C   . VAL C 1 82  ? 46.288  49.792 61.054 1.00 72.49  ? 281 VAL C C   1 
ATOM   4889 O O   . VAL C 1 82  ? 45.690  49.270 60.110 1.00 72.50  ? 281 VAL C O   1 
ATOM   4890 C CB  . VAL C 1 82  ? 46.965  47.976 62.655 1.00 74.33  ? 281 VAL C CB  1 
ATOM   4891 C CG1 . VAL C 1 82  ? 45.761  47.265 62.046 1.00 73.87  ? 281 VAL C CG1 1 
ATOM   4892 C CG2 . VAL C 1 82  ? 48.091  46.984 62.890 1.00 75.13  ? 281 VAL C CG2 1 
ATOM   4893 N N   . GLU C 1 83  ? 45.969  50.983 61.550 1.00 69.74  ? 282 GLU C N   1 
ATOM   4894 C CA  . GLU C 1 83  ? 44.894  51.778 60.992 1.00 66.25  ? 282 GLU C CA  1 
ATOM   4895 C C   . GLU C 1 83  ? 45.417  52.515 59.752 1.00 62.68  ? 282 GLU C C   1 
ATOM   4896 O O   . GLU C 1 83  ? 44.843  52.415 58.668 1.00 61.76  ? 282 GLU C O   1 
ATOM   4897 C CB  . GLU C 1 83  ? 44.394  52.786 62.025 1.00 67.63  ? 282 GLU C CB  1 
ATOM   4898 C CG  . GLU C 1 83  ? 42.894  53.018 61.951 1.00 70.52  ? 282 GLU C CG  1 
ATOM   4899 C CD  . GLU C 1 83  ? 42.387  53.174 60.520 1.00 72.18  ? 282 GLU C CD  1 
ATOM   4900 O OE1 . GLU C 1 83  ? 42.582  52.240 59.707 1.00 72.14  ? 282 GLU C OE1 1 
ATOM   4901 O OE2 . GLU C 1 83  ? 41.788  54.229 60.209 1.00 72.78  ? 282 GLU C OE2 1 
ATOM   4902 N N   . THR C 1 84  ? 46.514  53.248 59.923 1.00 58.45  ? 283 THR C N   1 
ATOM   4903 C CA  . THR C 1 84  ? 47.130  53.996 58.833 1.00 55.17  ? 283 THR C CA  1 
ATOM   4904 C C   . THR C 1 84  ? 47.694  53.091 57.732 1.00 53.12  ? 283 THR C C   1 
ATOM   4905 O O   . THR C 1 84  ? 47.931  53.547 56.612 1.00 52.81  ? 283 THR C O   1 
ATOM   4906 C CB  . THR C 1 84  ? 48.259  54.909 59.372 1.00 55.42  ? 283 THR C CB  1 
ATOM   4907 O OG1 . THR C 1 84  ? 47.680  56.007 60.086 1.00 55.51  ? 283 THR C OG1 1 
ATOM   4908 C CG2 . THR C 1 84  ? 49.124  55.449 58.235 1.00 55.52  ? 283 THR C CG2 1 
ATOM   4909 N N   . VAL C 1 85  ? 47.905  51.814 58.052 1.00 50.95  ? 284 VAL C N   1 
ATOM   4910 C CA  . VAL C 1 85  ? 48.440  50.843 57.086 1.00 48.40  ? 284 VAL C CA  1 
ATOM   4911 C C   . VAL C 1 85  ? 47.344  50.292 56.185 1.00 47.27  ? 284 VAL C C   1 
ATOM   4912 O O   . VAL C 1 85  ? 47.618  49.732 55.127 1.00 47.18  ? 284 VAL C O   1 
ATOM   4913 C CB  . VAL C 1 85  ? 49.119  49.636 57.790 1.00 47.54  ? 284 VAL C CB  1 
ATOM   4914 C CG1 . VAL C 1 85  ? 49.503  48.572 56.770 1.00 45.60  ? 284 VAL C CG1 1 
ATOM   4915 C CG2 . VAL C 1 85  ? 50.354  50.095 58.526 1.00 48.48  ? 284 VAL C CG2 1 
ATOM   4916 N N   . THR C 1 86  ? 46.099  50.443 56.613 1.00 45.80  ? 285 THR C N   1 
ATOM   4917 C CA  . THR C 1 86  ? 44.982  49.949 55.831 1.00 43.49  ? 285 THR C CA  1 
ATOM   4918 C C   . THR C 1 86  ? 44.576  51.033 54.852 1.00 41.60  ? 285 THR C C   1 
ATOM   4919 O O   . THR C 1 86  ? 44.200  50.748 53.716 1.00 41.19  ? 285 THR C O   1 
ATOM   4920 C CB  . THR C 1 86  ? 43.799  49.591 56.737 1.00 44.00  ? 285 THR C CB  1 
ATOM   4921 O OG1 . THR C 1 86  ? 44.295  49.014 57.952 1.00 43.83  ? 285 THR C OG1 1 
ATOM   4922 C CG2 . THR C 1 86  ? 42.891  48.576 56.045 1.00 44.19  ? 285 THR C CG2 1 
ATOM   4923 N N   . GLU C 1 87  ? 44.661  52.281 55.299 1.00 39.41  ? 286 GLU C N   1 
ATOM   4924 C CA  . GLU C 1 87  ? 44.325  53.405 54.446 1.00 37.78  ? 286 GLU C CA  1 
ATOM   4925 C C   . GLU C 1 87  ? 45.290  53.357 53.278 1.00 36.98  ? 286 GLU C C   1 
ATOM   4926 O O   . GLU C 1 87  ? 44.898  53.494 52.118 1.00 37.41  ? 286 GLU C O   1 
ATOM   4927 C CB  . GLU C 1 87  ? 44.519  54.722 55.187 1.00 38.28  ? 286 GLU C CB  1 
ATOM   4928 C CG  . GLU C 1 87  ? 43.638  54.923 56.404 1.00 39.47  ? 286 GLU C CG  1 
ATOM   4929 C CD  . GLU C 1 87  ? 43.682  56.361 56.897 1.00 40.38  ? 286 GLU C CD  1 
ATOM   4930 O OE1 . GLU C 1 87  ? 44.773  56.827 57.284 1.00 40.62  ? 286 GLU C OE1 1 
ATOM   4931 O OE2 . GLU C 1 87  ? 42.629  57.033 56.886 1.00 40.94  ? 286 GLU C OE2 1 
ATOM   4932 N N   . LEU C 1 88  ? 46.560  53.152 53.601 1.00 35.27  ? 287 LEU C N   1 
ATOM   4933 C CA  . LEU C 1 88  ? 47.606  53.086 52.596 1.00 34.78  ? 287 LEU C CA  1 
ATOM   4934 C C   . LEU C 1 88  ? 47.428  51.972 51.573 1.00 34.31  ? 287 LEU C C   1 
ATOM   4935 O O   . LEU C 1 88  ? 47.845  52.108 50.424 1.00 35.04  ? 287 LEU C O   1 
ATOM   4936 C CB  . LEU C 1 88  ? 48.968  52.935 53.266 1.00 33.85  ? 287 LEU C CB  1 
ATOM   4937 C CG  . LEU C 1 88  ? 49.710  54.244 53.501 1.00 33.83  ? 287 LEU C CG  1 
ATOM   4938 C CD1 . LEU C 1 88  ? 51.055  53.947 54.112 1.00 34.80  ? 287 LEU C CD1 1 
ATOM   4939 C CD2 . LEU C 1 88  ? 49.886  54.975 52.183 1.00 33.95  ? 287 LEU C CD2 1 
ATOM   4940 N N   . THR C 1 89  ? 46.816  50.868 51.983 1.00 33.46  ? 288 THR C N   1 
ATOM   4941 C CA  . THR C 1 89  ? 46.613  49.750 51.074 1.00 32.04  ? 288 THR C CA  1 
ATOM   4942 C C   . THR C 1 89  ? 45.437  50.035 50.151 1.00 31.70  ? 288 THR C C   1 
ATOM   4943 O O   . THR C 1 89  ? 45.426  49.635 48.979 1.00 30.80  ? 288 THR C O   1 
ATOM   4944 C CB  . THR C 1 89  ? 46.348  48.454 51.850 1.00 31.56  ? 288 THR C CB  1 
ATOM   4945 O OG1 . THR C 1 89  ? 47.436  48.196 52.742 1.00 31.23  ? 288 THR C OG1 1 
ATOM   4946 C CG2 . THR C 1 89  ? 46.226  47.294 50.895 1.00 32.52  ? 288 THR C CG2 1 
ATOM   4947 N N   . GLU C 1 90  ? 44.446  50.733 50.695 1.00 30.82  ? 289 GLU C N   1 
ATOM   4948 C CA  . GLU C 1 90  ? 43.258  51.102 49.941 1.00 30.21  ? 289 GLU C CA  1 
ATOM   4949 C C   . GLU C 1 90  ? 43.641  52.162 48.921 1.00 29.01  ? 289 GLU C C   1 
ATOM   4950 O O   . GLU C 1 90  ? 43.131  52.181 47.799 1.00 28.16  ? 289 GLU C O   1 
ATOM   4951 C CB  . GLU C 1 90  ? 42.191  51.648 50.892 1.00 32.15  ? 289 GLU C CB  1 
ATOM   4952 C CG  . GLU C 1 90  ? 41.539  50.579 51.749 1.00 34.15  ? 289 GLU C CG  1 
ATOM   4953 C CD  . GLU C 1 90  ? 40.681  49.632 50.927 1.00 35.48  ? 289 GLU C CD  1 
ATOM   4954 O OE1 . GLU C 1 90  ? 40.921  49.521 49.699 1.00 33.50  ? 289 GLU C OE1 1 
ATOM   4955 O OE2 . GLU C 1 90  ? 39.777  48.994 51.518 1.00 36.44  ? 289 GLU C OE2 1 
ATOM   4956 N N   . PHE C 1 91  ? 44.547  53.044 49.332 1.00 27.20  ? 290 PHE C N   1 
ATOM   4957 C CA  . PHE C 1 91  ? 45.031  54.119 48.481 1.00 25.47  ? 290 PHE C CA  1 
ATOM   4958 C C   . PHE C 1 91  ? 45.828  53.558 47.314 1.00 25.14  ? 290 PHE C C   1 
ATOM   4959 O O   . PHE C 1 91  ? 45.774  54.089 46.210 1.00 25.07  ? 290 PHE C O   1 
ATOM   4960 C CB  . PHE C 1 91  ? 45.907  55.075 49.293 1.00 23.42  ? 290 PHE C CB  1 
ATOM   4961 C CG  . PHE C 1 91  ? 46.710  56.029 48.451 1.00 21.17  ? 290 PHE C CG  1 
ATOM   4962 C CD1 . PHE C 1 91  ? 46.077  56.940 47.609 1.00 18.87  ? 290 PHE C CD1 1 
ATOM   4963 C CD2 . PHE C 1 91  ? 48.103  56.017 48.505 1.00 19.88  ? 290 PHE C CD2 1 
ATOM   4964 C CE1 . PHE C 1 91  ? 46.814  57.823 46.838 1.00 16.93  ? 290 PHE C CE1 1 
ATOM   4965 C CE2 . PHE C 1 91  ? 48.851  56.898 47.737 1.00 18.25  ? 290 PHE C CE2 1 
ATOM   4966 C CZ  . PHE C 1 91  ? 48.203  57.803 46.902 1.00 17.95  ? 290 PHE C CZ  1 
ATOM   4967 N N   . ALA C 1 92  ? 46.574  52.488 47.566 1.00 24.72  ? 291 ALA C N   1 
ATOM   4968 C CA  . ALA C 1 92  ? 47.376  51.872 46.529 1.00 25.02  ? 291 ALA C CA  1 
ATOM   4969 C C   . ALA C 1 92  ? 46.473  51.087 45.594 1.00 26.96  ? 291 ALA C C   1 
ATOM   4970 O O   . ALA C 1 92  ? 46.581  51.211 44.374 1.00 28.11  ? 291 ALA C O   1 
ATOM   4971 C CB  . ALA C 1 92  ? 48.415  50.966 47.140 1.00 22.19  ? 291 ALA C CB  1 
ATOM   4972 N N   . LYS C 1 93  ? 45.569  50.287 46.151 1.00 28.55  ? 292 LYS C N   1 
ATOM   4973 C CA  . LYS C 1 93  ? 44.670  49.511 45.299 1.00 30.35  ? 292 LYS C CA  1 
ATOM   4974 C C   . LYS C 1 93  ? 43.978  50.456 44.325 1.00 29.39  ? 292 LYS C C   1 
ATOM   4975 O O   . LYS C 1 93  ? 43.419  50.036 43.311 1.00 28.87  ? 292 LYS C O   1 
ATOM   4976 C CB  . LYS C 1 93  ? 43.614  48.762 46.130 1.00 32.94  ? 292 LYS C CB  1 
ATOM   4977 C CG  . LYS C 1 93  ? 44.150  47.627 46.997 1.00 34.26  ? 292 LYS C CG  1 
ATOM   4978 C CD  . LYS C 1 93  ? 43.105  46.533 47.234 1.00 34.67  ? 292 LYS C CD  1 
ATOM   4979 C CE  . LYS C 1 93  ? 41.829  47.049 47.898 1.00 34.62  ? 292 LYS C CE  1 
ATOM   4980 N NZ  . LYS C 1 93  ? 40.870  45.958 48.274 1.00 31.23  ? 292 LYS C NZ  1 
ATOM   4981 N N   . ALA C 1 94  ? 44.023  51.741 44.650 1.00 28.49  ? 293 ALA C N   1 
ATOM   4982 C CA  . ALA C 1 94  ? 43.419  52.761 43.815 1.00 28.78  ? 293 ALA C CA  1 
ATOM   4983 C C   . ALA C 1 94  ? 44.397  53.222 42.735 1.00 28.60  ? 293 ALA C C   1 
ATOM   4984 O O   . ALA C 1 94  ? 44.038  53.269 41.568 1.00 30.61  ? 293 ALA C O   1 
ATOM   4985 C CB  . ALA C 1 94  ? 42.979  53.937 44.668 1.00 28.67  ? 293 ALA C CB  1 
ATOM   4986 N N   . ILE C 1 95  ? 45.627  53.562 43.110 1.00 27.59  ? 294 ILE C N   1 
ATOM   4987 C CA  . ILE C 1 95  ? 46.611  54.004 42.126 1.00 26.65  ? 294 ILE C CA  1 
ATOM   4988 C C   . ILE C 1 95  ? 46.470  53.196 40.857 1.00 28.67  ? 294 ILE C C   1 
ATOM   4989 O O   . ILE C 1 95  ? 46.616  51.976 40.865 1.00 29.70  ? 294 ILE C O   1 
ATOM   4990 C CB  . ILE C 1 95  ? 48.036  53.786 42.582 1.00 25.72  ? 294 ILE C CB  1 
ATOM   4991 C CG1 . ILE C 1 95  ? 48.292  54.519 43.894 1.00 25.46  ? 294 ILE C CG1 1 
ATOM   4992 C CG2 . ILE C 1 95  ? 48.982  54.241 41.481 1.00 24.35  ? 294 ILE C CG2 1 
ATOM   4993 C CD1 . ILE C 1 95  ? 49.602  54.139 44.546 1.00 25.21  ? 294 ILE C CD1 1 
ATOM   4994 N N   . PRO C 1 96  ? 46.206  53.869 39.741 1.00 29.93  ? 295 PRO C N   1 
ATOM   4995 C CA  . PRO C 1 96  ? 46.045  53.200 38.454 1.00 31.50  ? 295 PRO C CA  1 
ATOM   4996 C C   . PRO C 1 96  ? 47.087  52.122 38.190 1.00 33.02  ? 295 PRO C C   1 
ATOM   4997 O O   . PRO C 1 96  ? 48.288  52.359 38.323 1.00 33.21  ? 295 PRO C O   1 
ATOM   4998 C CB  . PRO C 1 96  ? 46.135  54.355 37.465 1.00 32.07  ? 295 PRO C CB  1 
ATOM   4999 C CG  . PRO C 1 96  ? 45.478  55.457 38.220 1.00 31.16  ? 295 PRO C CG  1 
ATOM   5000 C CD  . PRO C 1 96  ? 46.114  55.329 39.584 1.00 30.19  ? 295 PRO C CD  1 
ATOM   5001 N N   . GLY C 1 97  ? 46.608  50.936 37.826 1.00 34.08  ? 296 GLY C N   1 
ATOM   5002 C CA  . GLY C 1 97  ? 47.494  49.829 37.521 1.00 35.71  ? 296 GLY C CA  1 
ATOM   5003 C C   . GLY C 1 97  ? 47.884  48.967 38.702 1.00 36.58  ? 296 GLY C C   1 
ATOM   5004 O O   . GLY C 1 97  ? 48.348  47.842 38.521 1.00 35.77  ? 296 GLY C O   1 
ATOM   5005 N N   . PHE C 1 98  ? 47.695  49.481 39.911 1.00 37.91  ? 297 PHE C N   1 
ATOM   5006 C CA  . PHE C 1 98  ? 48.066  48.732 41.101 1.00 40.03  ? 297 PHE C CA  1 
ATOM   5007 C C   . PHE C 1 98  ? 47.246  47.454 41.331 1.00 42.80  ? 297 PHE C C   1 
ATOM   5008 O O   . PHE C 1 98  ? 47.724  46.518 41.978 1.00 44.85  ? 297 PHE C O   1 
ATOM   5009 C CB  . PHE C 1 98  ? 48.012  49.638 42.341 1.00 37.73  ? 297 PHE C CB  1 
ATOM   5010 C CG  . PHE C 1 98  ? 48.680  49.045 43.564 1.00 36.13  ? 297 PHE C CG  1 
ATOM   5011 C CD1 . PHE C 1 98  ? 47.974  48.219 44.437 1.00 35.34  ? 297 PHE C CD1 1 
ATOM   5012 C CD2 . PHE C 1 98  ? 50.026  49.294 43.827 1.00 35.16  ? 297 PHE C CD2 1 
ATOM   5013 C CE1 . PHE C 1 98  ? 48.596  47.652 45.549 1.00 33.70  ? 297 PHE C CE1 1 
ATOM   5014 C CE2 . PHE C 1 98  ? 50.657  48.732 44.937 1.00 33.70  ? 297 PHE C CE2 1 
ATOM   5015 C CZ  . PHE C 1 98  ? 49.940  47.911 45.797 1.00 33.92  ? 297 PHE C CZ  1 
ATOM   5016 N N   . ALA C 1 99  ? 46.029  47.383 40.805 1.00 44.60  ? 298 ALA C N   1 
ATOM   5017 C CA  . ALA C 1 99  ? 45.231  46.171 41.003 1.00 45.22  ? 298 ALA C CA  1 
ATOM   5018 C C   . ALA C 1 99  ? 45.570  45.094 39.975 1.00 45.43  ? 298 ALA C C   1 
ATOM   5019 O O   . ALA C 1 99  ? 44.799  44.160 39.767 1.00 44.75  ? 298 ALA C O   1 
ATOM   5020 C CB  . ALA C 1 99  ? 43.752  46.499 40.939 1.00 44.89  ? 298 ALA C CB  1 
ATOM   5021 N N   . ASN C 1 100 ? 46.722  45.224 39.331 1.00 46.07  ? 299 ASN C N   1 
ATOM   5022 C CA  . ASN C 1 100 ? 47.127  44.254 38.327 1.00 47.52  ? 299 ASN C CA  1 
ATOM   5023 C C   . ASN C 1 100 ? 48.183  43.374 38.884 1.00 47.79  ? 299 ASN C C   1 
ATOM   5024 O O   . ASN C 1 100 ? 48.072  42.149 38.883 1.00 49.73  ? 299 ASN C O   1 
ATOM   5025 C CB  . ASN C 1 100 ? 47.735  44.937 37.114 1.00 48.94  ? 299 ASN C CB  1 
ATOM   5026 C CG  . ASN C 1 100 ? 46.716  45.646 36.284 1.00 50.70  ? 299 ASN C CG  1 
ATOM   5027 O OD1 . ASN C 1 100 ? 47.059  46.380 35.359 1.00 51.05  ? 299 ASN C OD1 1 
ATOM   5028 N ND2 . ASN C 1 100 ? 45.444  45.429 36.597 1.00 51.08  ? 299 ASN C ND2 1 
ATOM   5029 N N   . LEU C 1 101 ? 49.234  44.044 39.326 1.00 47.25  ? 300 LEU C N   1 
ATOM   5030 C CA  . LEU C 1 101 ? 50.395  43.400 39.873 1.00 47.20  ? 300 LEU C CA  1 
ATOM   5031 C C   . LEU C 1 101 ? 50.019  42.092 40.473 1.00 47.92  ? 300 LEU C C   1 
ATOM   5032 O O   . LEU C 1 101 ? 48.920  41.919 41.022 1.00 47.69  ? 300 LEU C O   1 
ATOM   5033 C CB  . LEU C 1 101 ? 51.049  44.281 40.919 1.00 46.20  ? 300 LEU C CB  1 
ATOM   5034 C CG  . LEU C 1 101 ? 51.108  45.665 40.309 1.00 44.88  ? 300 LEU C CG  1 
ATOM   5035 C CD1 . LEU C 1 101 ? 49.801  46.297 40.561 1.00 45.19  ? 300 LEU C CD1 1 
ATOM   5036 C CD2 . LEU C 1 101 ? 52.194  46.495 40.899 1.00 44.15  ? 300 LEU C CD2 1 
ATOM   5037 N N   . ASP C 1 102 ? 50.937  41.152 40.335 1.00 48.23  ? 301 ASP C N   1 
ATOM   5038 C CA  . ASP C 1 102 ? 50.689  39.857 40.884 1.00 48.82  ? 301 ASP C CA  1 
ATOM   5039 C C   . ASP C 1 102 ? 50.388  40.114 42.347 1.00 48.34  ? 301 ASP C C   1 
ATOM   5040 O O   . ASP C 1 102 ? 51.137  40.800 43.043 1.00 48.01  ? 301 ASP C O   1 
ATOM   5041 C CB  . ASP C 1 102 ? 51.903  38.959 40.728 1.00 48.65  ? 301 ASP C CB  1 
ATOM   5042 C CG  . ASP C 1 102 ? 51.643  37.585 41.262 1.00 49.34  ? 301 ASP C CG  1 
ATOM   5043 O OD1 . ASP C 1 102 ? 50.573  37.035 40.924 1.00 50.66  ? 301 ASP C OD1 1 
ATOM   5044 O OD2 . ASP C 1 102 ? 52.488  37.063 42.018 1.00 47.81  ? 301 ASP C OD2 1 
ATOM   5045 N N   . LEU C 1 103 ? 49.263  39.584 42.795 1.00 47.79  ? 302 LEU C N   1 
ATOM   5046 C CA  . LEU C 1 103 ? 48.845  39.771 44.162 1.00 47.08  ? 302 LEU C CA  1 
ATOM   5047 C C   . LEU C 1 103 ? 50.028  39.793 45.102 1.00 46.45  ? 302 LEU C C   1 
ATOM   5048 O O   . LEU C 1 103 ? 50.025  40.524 46.089 1.00 46.67  ? 302 LEU C O   1 
ATOM   5049 C CB  . LEU C 1 103 ? 47.892  38.665 44.586 1.00 48.07  ? 302 LEU C CB  1 
ATOM   5050 C CG  . LEU C 1 103 ? 46.992  39.220 45.687 1.00 48.27  ? 302 LEU C CG  1 
ATOM   5051 C CD1 . LEU C 1 103 ? 45.770  39.876 45.042 1.00 49.23  ? 302 LEU C CD1 1 
ATOM   5052 C CD2 . LEU C 1 103 ? 46.579  38.123 46.632 1.00 47.09  ? 302 LEU C CD2 1 
ATOM   5053 N N   . ASN C 1 104 ? 51.046  38.997 44.801 1.00 45.60  ? 303 ASN C N   1 
ATOM   5054 C CA  . ASN C 1 104 ? 52.209  38.970 45.666 1.00 46.33  ? 303 ASN C CA  1 
ATOM   5055 C C   . ASN C 1 104 ? 53.137  40.166 45.490 1.00 46.45  ? 303 ASN C C   1 
ATOM   5056 O O   . ASN C 1 104 ? 53.718  40.647 46.466 1.00 46.53  ? 303 ASN C O   1 
ATOM   5057 C CB  . ASN C 1 104 ? 52.967  37.655 45.495 1.00 46.03  ? 303 ASN C CB  1 
ATOM   5058 C CG  . ASN C 1 104 ? 52.827  36.758 46.710 1.00 46.70  ? 303 ASN C CG  1 
ATOM   5059 O OD1 . ASN C 1 104 ? 53.784  36.549 47.464 1.00 45.79  ? 303 ASN C OD1 1 
ATOM   5060 N ND2 . ASN C 1 104 ? 51.618  36.241 46.924 1.00 47.91  ? 303 ASN C ND2 1 
ATOM   5061 N N   . ASP C 1 105 ? 53.277  40.656 44.261 1.00 46.51  ? 304 ASP C N   1 
ATOM   5062 C CA  . ASP C 1 105 ? 54.127  41.820 44.028 1.00 46.19  ? 304 ASP C CA  1 
ATOM   5063 C C   . ASP C 1 105 ? 53.546  42.997 44.795 1.00 45.74  ? 304 ASP C C   1 
ATOM   5064 O O   . ASP C 1 105 ? 54.269  43.901 45.204 1.00 46.51  ? 304 ASP C O   1 
ATOM   5065 C CB  . ASP C 1 105 ? 54.216  42.166 42.538 1.00 46.40  ? 304 ASP C CB  1 
ATOM   5066 C CG  . ASP C 1 105 ? 55.342  41.426 41.829 1.00 46.33  ? 304 ASP C CG  1 
ATOM   5067 O OD1 . ASP C 1 105 ? 56.448  41.325 42.408 1.00 45.39  ? 304 ASP C OD1 1 
ATOM   5068 O OD2 . ASP C 1 105 ? 55.126  40.960 40.689 1.00 45.60  ? 304 ASP C OD2 1 
ATOM   5069 N N   . GLN C 1 106 ? 52.234  42.980 44.992 1.00 44.67  ? 305 GLN C N   1 
ATOM   5070 C CA  . GLN C 1 106 ? 51.585  44.039 45.738 1.00 44.02  ? 305 GLN C CA  1 
ATOM   5071 C C   . GLN C 1 106 ? 52.101  44.006 47.174 1.00 44.65  ? 305 GLN C C   1 
ATOM   5072 O O   . GLN C 1 106 ? 52.840  44.895 47.599 1.00 45.56  ? 305 GLN C O   1 
ATOM   5073 C CB  . GLN C 1 106 ? 50.068  43.853 45.705 1.00 42.48  ? 305 GLN C CB  1 
ATOM   5074 C CG  . GLN C 1 106 ? 49.473  44.148 44.341 1.00 40.72  ? 305 GLN C CG  1 
ATOM   5075 C CD  . GLN C 1 106 ? 47.965  44.181 44.350 1.00 39.31  ? 305 GLN C CD  1 
ATOM   5076 O OE1 . GLN C 1 106 ? 47.337  44.205 45.407 1.00 39.36  ? 305 GLN C OE1 1 
ATOM   5077 N NE2 . GLN C 1 106 ? 47.371  44.196 43.163 1.00 38.35  ? 305 GLN C NE2 1 
ATOM   5078 N N   . VAL C 1 107 ? 51.721  42.965 47.907 1.00 44.44  ? 306 VAL C N   1 
ATOM   5079 C CA  . VAL C 1 107 ? 52.130  42.788 49.296 1.00 43.80  ? 306 VAL C CA  1 
ATOM   5080 C C   . VAL C 1 107 ? 53.579  43.209 49.550 1.00 43.82  ? 306 VAL C C   1 
ATOM   5081 O O   . VAL C 1 107 ? 53.913  43.733 50.618 1.00 43.73  ? 306 VAL C O   1 
ATOM   5082 C CB  . VAL C 1 107 ? 51.955  41.316 49.713 1.00 42.71  ? 306 VAL C CB  1 
ATOM   5083 C CG1 . VAL C 1 107 ? 52.621  41.060 51.049 1.00 42.93  ? 306 VAL C CG1 1 
ATOM   5084 C CG2 . VAL C 1 107 ? 50.482  40.982 49.793 1.00 41.02  ? 306 VAL C CG2 1 
ATOM   5085 N N   . THR C 1 108 ? 54.431  42.981 48.558 1.00 43.24  ? 307 THR C N   1 
ATOM   5086 C CA  . THR C 1 108 ? 55.846  43.312 48.670 1.00 42.98  ? 307 THR C CA  1 
ATOM   5087 C C   . THR C 1 108 ? 56.073  44.817 48.574 1.00 42.78  ? 307 THR C C   1 
ATOM   5088 O O   . THR C 1 108 ? 56.836  45.395 49.352 1.00 42.69  ? 307 THR C O   1 
ATOM   5089 C CB  . THR C 1 108 ? 56.658  42.600 47.568 1.00 42.51  ? 307 THR C CB  1 
ATOM   5090 O OG1 . THR C 1 108 ? 56.272  41.222 47.515 1.00 41.95  ? 307 THR C OG1 1 
ATOM   5091 C CG2 . THR C 1 108 ? 58.146  42.676 47.867 1.00 41.89  ? 307 THR C CG2 1 
ATOM   5092 N N   . LEU C 1 109 ? 55.403  45.445 47.614 1.00 42.17  ? 308 LEU C N   1 
ATOM   5093 C CA  . LEU C 1 109 ? 55.521  46.883 47.411 1.00 40.81  ? 308 LEU C CA  1 
ATOM   5094 C C   . LEU C 1 109 ? 55.030  47.656 48.633 1.00 39.97  ? 308 LEU C C   1 
ATOM   5095 O O   . LEU C 1 109 ? 55.695  48.584 49.102 1.00 39.02  ? 308 LEU C O   1 
ATOM   5096 C CB  . LEU C 1 109 ? 54.710  47.317 46.182 1.00 40.35  ? 308 LEU C CB  1 
ATOM   5097 C CG  . LEU C 1 109 ? 55.200  46.960 44.774 1.00 40.25  ? 308 LEU C CG  1 
ATOM   5098 C CD1 . LEU C 1 109 ? 54.267  47.590 43.759 1.00 40.69  ? 308 LEU C CD1 1 
ATOM   5099 C CD2 . LEU C 1 109 ? 56.617  47.466 44.553 1.00 40.16  ? 308 LEU C CD2 1 
ATOM   5100 N N   . LEU C 1 110 ? 53.866  47.253 49.140 1.00 39.27  ? 309 LEU C N   1 
ATOM   5101 C CA  . LEU C 1 110 ? 53.237  47.901 50.284 1.00 38.60  ? 309 LEU C CA  1 
ATOM   5102 C C   . LEU C 1 110 ? 53.849  47.624 51.642 1.00 39.25  ? 309 LEU C C   1 
ATOM   5103 O O   . LEU C 1 110 ? 53.556  48.340 52.592 1.00 39.74  ? 309 LEU C O   1 
ATOM   5104 C CB  . LEU C 1 110 ? 51.750  47.544 50.358 1.00 37.35  ? 309 LEU C CB  1 
ATOM   5105 C CG  . LEU C 1 110 ? 50.713  48.516 49.795 1.00 35.85  ? 309 LEU C CG  1 
ATOM   5106 C CD1 . LEU C 1 110 ? 49.343  47.973 50.121 1.00 35.54  ? 309 LEU C CD1 1 
ATOM   5107 C CD2 . LEU C 1 110 ? 50.871  49.897 50.399 1.00 35.32  ? 309 LEU C CD2 1 
ATOM   5108 N N   . LYS C 1 111 ? 54.682  46.594 51.757 1.00 39.94  ? 310 LYS C N   1 
ATOM   5109 C CA  . LYS C 1 111 ? 55.283  46.282 53.055 1.00 39.49  ? 310 LYS C CA  1 
ATOM   5110 C C   . LYS C 1 111 ? 56.683  46.881 53.225 1.00 39.12  ? 310 LYS C C   1 
ATOM   5111 O O   . LYS C 1 111 ? 57.178  47.027 54.344 1.00 37.87  ? 310 LYS C O   1 
ATOM   5112 C CB  . LYS C 1 111 ? 55.322  44.769 53.264 1.00 37.88  ? 310 LYS C CB  1 
ATOM   5113 C CG  . LYS C 1 111 ? 56.697  44.153 53.113 1.00 36.88  ? 310 LYS C CG  1 
ATOM   5114 C CD  . LYS C 1 111 ? 56.590  42.807 52.428 1.00 37.64  ? 310 LYS C CD  1 
ATOM   5115 C CE  . LYS C 1 111 ? 57.920  42.081 52.429 1.00 37.94  ? 310 LYS C CE  1 
ATOM   5116 N NZ  . LYS C 1 111 ? 58.295  41.704 53.814 1.00 39.35  ? 310 LYS C NZ  1 
ATOM   5117 N N   . TYR C 1 112 ? 57.319  47.226 52.111 1.00 39.53  ? 311 TYR C N   1 
ATOM   5118 C CA  . TYR C 1 112 ? 58.640  47.826 52.166 1.00 40.23  ? 311 TYR C CA  1 
ATOM   5119 C C   . TYR C 1 112 ? 58.527  49.329 52.294 1.00 39.46  ? 311 TYR C C   1 
ATOM   5120 O O   . TYR C 1 112 ? 58.990  49.921 53.273 1.00 39.96  ? 311 TYR C O   1 
ATOM   5121 C CB  . TYR C 1 112 ? 59.441  47.477 50.916 1.00 42.75  ? 311 TYR C CB  1 
ATOM   5122 C CG  . TYR C 1 112 ? 60.173  46.167 51.048 1.00 46.05  ? 311 TYR C CG  1 
ATOM   5123 C CD1 . TYR C 1 112 ? 61.140  45.993 52.038 1.00 46.94  ? 311 TYR C CD1 1 
ATOM   5124 C CD2 . TYR C 1 112 ? 59.879  45.088 50.213 1.00 47.89  ? 311 TYR C CD2 1 
ATOM   5125 C CE1 . TYR C 1 112 ? 61.796  44.776 52.202 1.00 47.96  ? 311 TYR C CE1 1 
ATOM   5126 C CE2 . TYR C 1 112 ? 60.532  43.860 50.366 1.00 48.97  ? 311 TYR C CE2 1 
ATOM   5127 C CZ  . TYR C 1 112 ? 61.489  43.713 51.366 1.00 48.91  ? 311 TYR C CZ  1 
ATOM   5128 O OH  . TYR C 1 112 ? 62.130  42.504 51.541 1.00 48.67  ? 311 TYR C OH  1 
ATOM   5129 N N   . GLY C 1 113 ? 57.894  49.944 51.306 1.00 37.68  ? 312 GLY C N   1 
ATOM   5130 C CA  . GLY C 1 113 ? 57.743  51.379 51.337 1.00 37.36  ? 312 GLY C CA  1 
ATOM   5131 C C   . GLY C 1 113 ? 56.468  51.849 51.996 1.00 37.00  ? 312 GLY C C   1 
ATOM   5132 O O   . GLY C 1 113 ? 55.810  52.744 51.485 1.00 38.11  ? 312 GLY C O   1 
ATOM   5133 N N   . VAL C 1 114 ? 56.096  51.260 53.121 1.00 36.84  ? 313 VAL C N   1 
ATOM   5134 C CA  . VAL C 1 114 ? 54.882  51.699 53.788 1.00 37.39  ? 313 VAL C CA  1 
ATOM   5135 C C   . VAL C 1 114 ? 55.267  52.656 54.903 1.00 37.70  ? 313 VAL C C   1 
ATOM   5136 O O   . VAL C 1 114 ? 54.483  53.514 55.303 1.00 37.96  ? 313 VAL C O   1 
ATOM   5137 C CB  . VAL C 1 114 ? 54.102  50.522 54.400 1.00 38.15  ? 313 VAL C CB  1 
ATOM   5138 C CG1 . VAL C 1 114 ? 54.906  49.901 55.540 1.00 39.94  ? 313 VAL C CG1 1 
ATOM   5139 C CG2 . VAL C 1 114 ? 52.741  51.003 54.896 1.00 38.09  ? 313 VAL C CG2 1 
ATOM   5140 N N   . TYR C 1 115 ? 56.486  52.506 55.404 1.00 36.94  ? 314 TYR C N   1 
ATOM   5141 C CA  . TYR C 1 115 ? 56.950  53.361 56.479 1.00 36.47  ? 314 TYR C CA  1 
ATOM   5142 C C   . TYR C 1 115 ? 57.441  54.695 55.963 1.00 35.68  ? 314 TYR C C   1 
ATOM   5143 O O   . TYR C 1 115 ? 57.380  55.699 56.668 1.00 36.55  ? 314 TYR C O   1 
ATOM   5144 C CB  . TYR C 1 115 ? 58.063  52.675 57.264 1.00 37.84  ? 314 TYR C CB  1 
ATOM   5145 C CG  . TYR C 1 115 ? 57.597  51.469 58.045 1.00 38.47  ? 314 TYR C CG  1 
ATOM   5146 C CD1 . TYR C 1 115 ? 56.389  51.493 58.745 1.00 38.07  ? 314 TYR C CD1 1 
ATOM   5147 C CD2 . TYR C 1 115 ? 58.377  50.316 58.114 1.00 38.14  ? 314 TYR C CD2 1 
ATOM   5148 C CE1 . TYR C 1 115 ? 55.972  50.401 59.491 1.00 38.44  ? 314 TYR C CE1 1 
ATOM   5149 C CE2 . TYR C 1 115 ? 57.973  49.220 58.859 1.00 37.99  ? 314 TYR C CE2 1 
ATOM   5150 C CZ  . TYR C 1 115 ? 56.770  49.267 59.546 1.00 38.85  ? 314 TYR C CZ  1 
ATOM   5151 O OH  . TYR C 1 115 ? 56.371  48.179 60.293 1.00 40.29  ? 314 TYR C OH  1 
ATOM   5152 N N   . GLU C 1 116 ? 57.934  54.707 54.732 1.00 34.18  ? 315 GLU C N   1 
ATOM   5153 C CA  . GLU C 1 116 ? 58.429  55.937 54.144 1.00 31.51  ? 315 GLU C CA  1 
ATOM   5154 C C   . GLU C 1 116 ? 57.223  56.829 53.906 1.00 30.22  ? 315 GLU C C   1 
ATOM   5155 O O   . GLU C 1 116 ? 57.280  58.040 54.121 1.00 30.50  ? 315 GLU C O   1 
ATOM   5156 C CB  . GLU C 1 116 ? 59.146  55.626 52.837 1.00 31.30  ? 315 GLU C CB  1 
ATOM   5157 C CG  . GLU C 1 116 ? 59.963  54.353 52.931 1.00 32.47  ? 315 GLU C CG  1 
ATOM   5158 C CD  . GLU C 1 116 ? 60.743  54.054 51.679 1.00 33.73  ? 315 GLU C CD  1 
ATOM   5159 O OE1 . GLU C 1 116 ? 60.242  54.342 50.573 1.00 35.05  ? 315 GLU C OE1 1 
ATOM   5160 O OE2 . GLU C 1 116 ? 61.857  53.510 51.806 1.00 34.53  ? 315 GLU C OE2 1 
ATOM   5161 N N   . ALA C 1 117 ? 56.120  56.213 53.495 1.00 27.68  ? 316 ALA C N   1 
ATOM   5162 C CA  . ALA C 1 117 ? 54.888  56.941 53.227 1.00 26.24  ? 316 ALA C CA  1 
ATOM   5163 C C   . ALA C 1 117 ? 54.199  57.405 54.504 1.00 25.55  ? 316 ALA C C   1 
ATOM   5164 O O   . ALA C 1 117 ? 53.329  58.279 54.466 1.00 25.17  ? 316 ALA C O   1 
ATOM   5165 C CB  . ALA C 1 117 ? 53.944  56.075 52.422 1.00 26.37  ? 316 ALA C CB  1 
ATOM   5166 N N   . ILE C 1 118 ? 54.575  56.814 55.634 1.00 24.54  ? 317 ILE C N   1 
ATOM   5167 C CA  . ILE C 1 118 ? 53.977  57.196 56.905 1.00 23.13  ? 317 ILE C CA  1 
ATOM   5168 C C   . ILE C 1 118 ? 54.738  58.351 57.525 1.00 23.00  ? 317 ILE C C   1 
ATOM   5169 O O   . ILE C 1 118 ? 54.151  59.205 58.180 1.00 23.07  ? 317 ILE C O   1 
ATOM   5170 C CB  . ILE C 1 118 ? 53.952  56.031 57.903 1.00 21.95  ? 317 ILE C CB  1 
ATOM   5171 C CG1 . ILE C 1 118 ? 53.090  54.902 57.344 1.00 20.88  ? 317 ILE C CG1 1 
ATOM   5172 C CG2 . ILE C 1 118 ? 53.417  56.514 59.244 1.00 22.65  ? 317 ILE C CG2 1 
ATOM   5173 C CD1 . ILE C 1 118 ? 52.437  54.051 58.384 1.00 20.68  ? 317 ILE C CD1 1 
ATOM   5174 N N   . PHE C 1 119 ? 56.048  58.373 57.314 1.00 22.87  ? 318 PHE C N   1 
ATOM   5175 C CA  . PHE C 1 119 ? 56.865  59.440 57.850 1.00 23.25  ? 318 PHE C CA  1 
ATOM   5176 C C   . PHE C 1 119 ? 56.864  60.625 56.908 1.00 23.69  ? 318 PHE C C   1 
ATOM   5177 O O   . PHE C 1 119 ? 57.343  61.704 57.252 1.00 26.01  ? 318 PHE C O   1 
ATOM   5178 C CB  . PHE C 1 119 ? 58.272  58.924 58.135 1.00 23.53  ? 318 PHE C CB  1 
ATOM   5179 C CG  . PHE C 1 119 ? 58.303  57.930 59.255 1.00 26.65  ? 318 PHE C CG  1 
ATOM   5180 C CD1 . PHE C 1 119 ? 57.583  58.188 60.427 1.00 27.67  ? 318 PHE C CD1 1 
ATOM   5181 C CD2 . PHE C 1 119 ? 58.980  56.720 59.132 1.00 26.72  ? 318 PHE C CD2 1 
ATOM   5182 C CE1 . PHE C 1 119 ? 57.527  57.257 61.460 1.00 27.91  ? 318 PHE C CE1 1 
ATOM   5183 C CE2 . PHE C 1 119 ? 58.931  55.777 60.161 1.00 28.04  ? 318 PHE C CE2 1 
ATOM   5184 C CZ  . PHE C 1 119 ? 58.199  56.049 61.329 1.00 28.32  ? 318 PHE C CZ  1 
ATOM   5185 N N   . ALA C 1 120 ? 56.298  60.420 55.722 1.00 22.24  ? 319 ALA C N   1 
ATOM   5186 C CA  . ALA C 1 120 ? 56.168  61.479 54.732 1.00 19.92  ? 319 ALA C CA  1 
ATOM   5187 C C   . ALA C 1 120 ? 54.913  62.230 55.133 1.00 19.17  ? 319 ALA C C   1 
ATOM   5188 O O   . ALA C 1 120 ? 54.941  63.410 55.476 1.00 19.33  ? 319 ALA C O   1 
ATOM   5189 C CB  . ALA C 1 120 ? 55.986  60.886 53.361 1.00 19.09  ? 319 ALA C CB  1 
ATOM   5190 N N   . MET C 1 121 ? 53.804  61.510 55.099 1.00 18.35  ? 320 MET C N   1 
ATOM   5191 C CA  . MET C 1 121 ? 52.524  62.072 55.469 1.00 17.69  ? 320 MET C CA  1 
ATOM   5192 C C   . MET C 1 121 ? 52.495  62.425 56.953 1.00 17.30  ? 320 MET C C   1 
ATOM   5193 O O   . MET C 1 121 ? 51.683  63.232 57.392 1.00 18.18  ? 320 MET C O   1 
ATOM   5194 C CB  . MET C 1 121 ? 51.418  61.070 55.161 1.00 17.95  ? 320 MET C CB  1 
ATOM   5195 C CG  . MET C 1 121 ? 51.402  60.586 53.723 1.00 17.84  ? 320 MET C CG  1 
ATOM   5196 S SD  . MET C 1 121 ? 49.853  59.745 53.362 1.00 16.58  ? 320 MET C SD  1 
ATOM   5197 C CE  . MET C 1 121 ? 50.196  58.137 54.068 1.00 16.63  ? 320 MET C CE  1 
ATOM   5198 N N   . LEU C 1 122 ? 53.380  61.826 57.734 1.00 16.37  ? 321 LEU C N   1 
ATOM   5199 C CA  . LEU C 1 122 ? 53.395  62.109 59.156 1.00 16.66  ? 321 LEU C CA  1 
ATOM   5200 C C   . LEU C 1 122 ? 53.774  63.550 59.432 1.00 17.01  ? 321 LEU C C   1 
ATOM   5201 O O   . LEU C 1 122 ? 53.613  64.041 60.549 1.00 16.05  ? 321 LEU C O   1 
ATOM   5202 C CB  . LEU C 1 122 ? 54.388  61.213 59.870 1.00 17.71  ? 321 LEU C CB  1 
ATOM   5203 C CG  . LEU C 1 122 ? 54.090  61.122 61.357 1.00 18.57  ? 321 LEU C CG  1 
ATOM   5204 C CD1 . LEU C 1 122 ? 52.911  60.169 61.565 1.00 18.93  ? 321 LEU C CD1 1 
ATOM   5205 C CD2 . LEU C 1 122 ? 55.320  60.640 62.089 1.00 17.87  ? 321 LEU C CD2 1 
ATOM   5206 N N   . SER C 1 123 ? 54.293  64.223 58.412 1.00 17.97  ? 322 SER C N   1 
ATOM   5207 C CA  . SER C 1 123 ? 54.709  65.613 58.558 1.00 17.61  ? 322 SER C CA  1 
ATOM   5208 C C   . SER C 1 123 ? 53.540  66.578 58.441 1.00 18.35  ? 322 SER C C   1 
ATOM   5209 O O   . SER C 1 123 ? 53.595  67.675 58.983 1.00 19.95  ? 322 SER C O   1 
ATOM   5210 C CB  . SER C 1 123 ? 55.769  65.972 57.508 1.00 16.35  ? 322 SER C CB  1 
ATOM   5211 O OG  . SER C 1 123 ? 56.994  65.299 57.736 1.00 12.70  ? 322 SER C OG  1 
ATOM   5212 N N   . SER C 1 124 ? 52.485  66.167 57.740 1.00 17.79  ? 323 SER C N   1 
ATOM   5213 C CA  . SER C 1 124 ? 51.315  67.016 57.539 1.00 17.98  ? 323 SER C CA  1 
ATOM   5214 C C   . SER C 1 124 ? 50.592  67.311 58.843 1.00 18.76  ? 323 SER C C   1 
ATOM   5215 O O   . SER C 1 124 ? 49.673  68.135 58.883 1.00 19.09  ? 323 SER C O   1 
ATOM   5216 C CB  . SER C 1 124 ? 50.352  66.350 56.556 1.00 17.45  ? 323 SER C CB  1 
ATOM   5217 O OG  . SER C 1 124 ? 51.041  65.914 55.394 1.00 17.31  ? 323 SER C OG  1 
ATOM   5218 N N   . VAL C 1 125 ? 51.027  66.646 59.910 1.00 19.84  ? 324 VAL C N   1 
ATOM   5219 C CA  . VAL C 1 125 ? 50.418  66.806 61.228 1.00 20.44  ? 324 VAL C CA  1 
ATOM   5220 C C   . VAL C 1 125 ? 51.382  67.253 62.326 1.00 21.19  ? 324 VAL C C   1 
ATOM   5221 O O   . VAL C 1 125 ? 51.072  67.134 63.509 1.00 21.02  ? 324 VAL C O   1 
ATOM   5222 C CB  . VAL C 1 125 ? 49.773  65.496 61.674 1.00 20.05  ? 324 VAL C CB  1 
ATOM   5223 C CG1 . VAL C 1 125 ? 48.580  65.175 60.789 1.00 20.09  ? 324 VAL C CG1 1 
ATOM   5224 C CG2 . VAL C 1 125 ? 50.804  64.384 61.604 1.00 20.85  ? 324 VAL C CG2 1 
ATOM   5225 N N   . MET C 1 126 ? 52.544  67.766 61.935 1.00 22.37  ? 325 MET C N   1 
ATOM   5226 C CA  . MET C 1 126 ? 53.535  68.235 62.894 1.00 22.66  ? 325 MET C CA  1 
ATOM   5227 C C   . MET C 1 126 ? 53.938  69.682 62.625 1.00 23.33  ? 325 MET C C   1 
ATOM   5228 O O   . MET C 1 126 ? 53.702  70.232 61.544 1.00 24.12  ? 325 MET C O   1 
ATOM   5229 C CB  . MET C 1 126 ? 54.804  67.389 62.814 1.00 22.59  ? 325 MET C CB  1 
ATOM   5230 C CG  . MET C 1 126 ? 54.596  65.892 62.863 1.00 26.21  ? 325 MET C CG  1 
ATOM   5231 S SD  . MET C 1 126 ? 56.141  65.040 62.484 1.00 31.17  ? 325 MET C SD  1 
ATOM   5232 C CE  . MET C 1 126 ? 56.715  64.528 64.101 1.00 29.33  ? 325 MET C CE  1 
ATOM   5233 N N   . ASN C 1 127 ? 54.541  70.292 63.636 1.00 23.14  ? 326 ASN C N   1 
ATOM   5234 C CA  . ASN C 1 127 ? 55.079  71.636 63.534 1.00 22.87  ? 326 ASN C CA  1 
ATOM   5235 C C   . ASN C 1 127 ? 56.295  71.595 64.439 1.00 23.76  ? 326 ASN C C   1 
ATOM   5236 O O   . ASN C 1 127 ? 56.696  70.519 64.877 1.00 22.85  ? 326 ASN C O   1 
ATOM   5237 C CB  . ASN C 1 127 ? 54.084  72.705 63.979 1.00 21.64  ? 326 ASN C CB  1 
ATOM   5238 C CG  . ASN C 1 127 ? 53.432  72.386 65.282 1.00 21.80  ? 326 ASN C CG  1 
ATOM   5239 O OD1 . ASN C 1 127 ? 54.072  71.900 66.206 1.00 23.84  ? 326 ASN C OD1 1 
ATOM   5240 N ND2 . ASN C 1 127 ? 52.144  72.675 65.378 1.00 22.59  ? 326 ASN C ND2 1 
ATOM   5241 N N   . LYS C 1 128 ? 56.887  72.743 64.729 1.00 25.42  ? 327 LYS C N   1 
ATOM   5242 C CA  . LYS C 1 128 ? 58.086  72.759 65.557 1.00 27.55  ? 327 LYS C CA  1 
ATOM   5243 C C   . LYS C 1 128 ? 57.874  72.418 67.030 1.00 27.12  ? 327 LYS C C   1 
ATOM   5244 O O   . LYS C 1 128 ? 58.837  72.185 67.760 1.00 26.87  ? 327 LYS C O   1 
ATOM   5245 C CB  . LYS C 1 128 ? 58.773  74.121 65.442 1.00 30.19  ? 327 LYS C CB  1 
ATOM   5246 C CG  . LYS C 1 128 ? 57.969  75.277 66.013 1.00 33.40  ? 327 LYS C CG  1 
ATOM   5247 C CD  . LYS C 1 128 ? 58.656  76.614 65.766 1.00 35.96  ? 327 LYS C CD  1 
ATOM   5248 C CE  . LYS C 1 128 ? 57.869  77.756 66.389 1.00 37.41  ? 327 LYS C CE  1 
ATOM   5249 N NZ  . LYS C 1 128 ? 56.437  77.715 65.974 1.00 40.09  ? 327 LYS C NZ  1 
ATOM   5250 N N   . ASP C 1 129 ? 56.623  72.367 67.467 1.00 27.65  ? 328 ASP C N   1 
ATOM   5251 C CA  . ASP C 1 129 ? 56.343  72.084 68.870 1.00 28.18  ? 328 ASP C CA  1 
ATOM   5252 C C   . ASP C 1 129 ? 55.695  70.743 69.179 1.00 27.37  ? 328 ASP C C   1 
ATOM   5253 O O   . ASP C 1 129 ? 55.764  70.285 70.314 1.00 26.90  ? 328 ASP C O   1 
ATOM   5254 C CB  . ASP C 1 129 ? 55.485  73.205 69.463 1.00 31.15  ? 328 ASP C CB  1 
ATOM   5255 C CG  . ASP C 1 129 ? 56.185  74.561 69.428 1.00 34.62  ? 328 ASP C CG  1 
ATOM   5256 O OD1 . ASP C 1 129 ? 57.336  74.640 69.912 1.00 36.51  ? 328 ASP C OD1 1 
ATOM   5257 O OD2 . ASP C 1 129 ? 55.590  75.546 68.925 1.00 34.54  ? 328 ASP C OD2 1 
ATOM   5258 N N   . GLY C 1 130 ? 55.065  70.116 68.190 1.00 27.00  ? 329 GLY C N   1 
ATOM   5259 C CA  . GLY C 1 130 ? 54.428  68.831 68.432 1.00 25.93  ? 329 GLY C CA  1 
ATOM   5260 C C   . GLY C 1 130 ? 53.581  68.348 67.271 1.00 25.10  ? 329 GLY C C   1 
ATOM   5261 O O   . GLY C 1 130 ? 53.390  69.081 66.305 1.00 25.36  ? 329 GLY C O   1 
ATOM   5262 N N   . MET C 1 131 ? 53.059  67.125 67.373 1.00 23.86  ? 330 MET C N   1 
ATOM   5263 C CA  . MET C 1 131 ? 52.242  66.541 66.310 1.00 22.60  ? 330 MET C CA  1 
ATOM   5264 C C   . MET C 1 131 ? 50.819  66.177 66.723 1.00 22.79  ? 330 MET C C   1 
ATOM   5265 O O   . MET C 1 131 ? 50.571  65.803 67.865 1.00 24.82  ? 330 MET C O   1 
ATOM   5266 C CB  . MET C 1 131 ? 52.915  65.286 65.781 1.00 22.03  ? 330 MET C CB  1 
ATOM   5267 C CG  . MET C 1 131 ? 52.958  64.157 66.791 1.00 21.88  ? 330 MET C CG  1 
ATOM   5268 S SD  . MET C 1 131 ? 53.600  62.652 66.042 1.00 24.03  ? 330 MET C SD  1 
ATOM   5269 C CE  . MET C 1 131 ? 52.265  62.254 64.916 1.00 23.24  ? 330 MET C CE  1 
ATOM   5270 N N   . LEU C 1 132 ? 49.892  66.272 65.775 1.00 21.98  ? 331 LEU C N   1 
ATOM   5271 C CA  . LEU C 1 132 ? 48.491  65.936 66.017 1.00 21.85  ? 331 LEU C CA  1 
ATOM   5272 C C   . LEU C 1 132 ? 48.277  64.428 66.125 1.00 21.71  ? 331 LEU C C   1 
ATOM   5273 O O   . LEU C 1 132 ? 48.663  63.658 65.248 1.00 22.20  ? 331 LEU C O   1 
ATOM   5274 C CB  . LEU C 1 132 ? 47.608  66.472 64.890 1.00 22.06  ? 331 LEU C CB  1 
ATOM   5275 C CG  . LEU C 1 132 ? 47.323  67.967 64.811 1.00 22.33  ? 331 LEU C CG  1 
ATOM   5276 C CD1 . LEU C 1 132 ? 46.641  68.269 63.492 1.00 22.51  ? 331 LEU C CD1 1 
ATOM   5277 C CD2 . LEU C 1 132 ? 46.440  68.390 65.969 1.00 22.70  ? 331 LEU C CD2 1 
ATOM   5278 N N   . VAL C 1 133 ? 47.635  64.010 67.201 1.00 21.60  ? 332 VAL C N   1 
ATOM   5279 C CA  . VAL C 1 133 ? 47.369  62.600 67.410 1.00 21.26  ? 332 VAL C CA  1 
ATOM   5280 C C   . VAL C 1 133 ? 45.849  62.327 67.403 1.00 20.61  ? 332 VAL C C   1 
ATOM   5281 O O   . VAL C 1 133 ? 45.038  63.253 67.476 1.00 20.63  ? 332 VAL C O   1 
ATOM   5282 C CB  . VAL C 1 133 ? 48.013  62.151 68.743 1.00 22.34  ? 332 VAL C CB  1 
ATOM   5283 C CG1 . VAL C 1 133 ? 49.503  62.471 68.719 1.00 22.54  ? 332 VAL C CG1 1 
ATOM   5284 C CG2 . VAL C 1 133 ? 47.366  62.877 69.919 1.00 22.41  ? 332 VAL C CG2 1 
ATOM   5285 N N   . ALA C 1 134 ? 45.476  61.055 67.289 1.00 19.43  ? 333 ALA C N   1 
ATOM   5286 C CA  . ALA C 1 134 ? 44.074  60.623 67.275 1.00 18.75  ? 333 ALA C CA  1 
ATOM   5287 C C   . ALA C 1 134 ? 43.077  61.480 66.496 1.00 18.68  ? 333 ALA C C   1 
ATOM   5288 O O   . ALA C 1 134 ? 42.252  62.178 67.084 1.00 17.95  ? 333 ALA C O   1 
ATOM   5289 C CB  . ALA C 1 134 ? 43.574  60.436 68.699 1.00 17.61  ? 333 ALA C CB  1 
ATOM   5290 N N   . TYR C 1 135 ? 43.154  61.404 65.170 1.00 19.38  ? 334 TYR C N   1 
ATOM   5291 C CA  . TYR C 1 135 ? 42.244  62.119 64.284 1.00 19.52  ? 334 TYR C CA  1 
ATOM   5292 C C   . TYR C 1 135 ? 42.251  63.612 64.461 1.00 18.82  ? 334 TYR C C   1 
ATOM   5293 O O   . TYR C 1 135 ? 41.381  64.310 63.945 1.00 17.66  ? 334 TYR C O   1 
ATOM   5294 C CB  . TYR C 1 135 ? 40.842  61.583 64.487 1.00 23.21  ? 334 TYR C CB  1 
ATOM   5295 C CG  . TYR C 1 135 ? 40.846  60.091 64.436 1.00 28.11  ? 334 TYR C CG  1 
ATOM   5296 C CD1 . TYR C 1 135 ? 40.809  59.421 63.217 1.00 29.96  ? 334 TYR C CD1 1 
ATOM   5297 C CD2 . TYR C 1 135 ? 41.012  59.347 65.601 1.00 31.62  ? 334 TYR C CD2 1 
ATOM   5298 C CE1 . TYR C 1 135 ? 40.948  58.041 63.152 1.00 34.00  ? 334 TYR C CE1 1 
ATOM   5299 C CE2 . TYR C 1 135 ? 41.157  57.967 65.558 1.00 35.73  ? 334 TYR C CE2 1 
ATOM   5300 C CZ  . TYR C 1 135 ? 41.128  57.315 64.329 1.00 36.83  ? 334 TYR C CZ  1 
ATOM   5301 O OH  . TYR C 1 135 ? 41.305  55.945 64.281 1.00 39.30  ? 334 TYR C OH  1 
ATOM   5302 N N   . GLY C 1 136 ? 43.232  64.102 65.202 1.00 18.85  ? 335 GLY C N   1 
ATOM   5303 C CA  . GLY C 1 136 ? 43.341  65.530 65.400 1.00 19.88  ? 335 GLY C CA  1 
ATOM   5304 C C   . GLY C 1 136 ? 42.628  66.104 66.603 1.00 19.86  ? 335 GLY C C   1 
ATOM   5305 O O   . GLY C 1 136 ? 42.453  67.321 66.670 1.00 21.85  ? 335 GLY C O   1 
ATOM   5306 N N   . ASN C 1 137 ? 42.208  65.259 67.545 1.00 18.35  ? 336 ASN C N   1 
ATOM   5307 C CA  . ASN C 1 137 ? 41.534  65.769 68.740 1.00 17.39  ? 336 ASN C CA  1 
ATOM   5308 C C   . ASN C 1 137 ? 42.591  66.026 69.793 1.00 16.79  ? 336 ASN C C   1 
ATOM   5309 O O   . ASN C 1 137 ? 42.392  66.814 70.711 1.00 17.31  ? 336 ASN C O   1 
ATOM   5310 C CB  . ASN C 1 137 ? 40.524  64.769 69.307 1.00 16.84  ? 336 ASN C CB  1 
ATOM   5311 C CG  . ASN C 1 137 ? 39.601  64.208 68.257 1.00 16.33  ? 336 ASN C CG  1 
ATOM   5312 O OD1 . ASN C 1 137 ? 39.869  63.147 67.678 1.00 15.42  ? 336 ASN C OD1 1 
ATOM   5313 N ND2 . ASN C 1 137 ? 38.504  64.914 67.998 1.00 14.57  ? 336 ASN C ND2 1 
ATOM   5314 N N   . GLY C 1 138 ? 43.716  65.339 69.655 1.00 16.32  ? 337 GLY C N   1 
ATOM   5315 C CA  . GLY C 1 138 ? 44.796  65.510 70.599 1.00 17.53  ? 337 GLY C CA  1 
ATOM   5316 C C   . GLY C 1 138 ? 46.025  66.058 69.910 1.00 18.26  ? 337 GLY C C   1 
ATOM   5317 O O   . GLY C 1 138 ? 46.161  65.954 68.694 1.00 18.17  ? 337 GLY C O   1 
ATOM   5318 N N   . PHE C 1 139 ? 46.918  66.654 70.691 1.00 18.83  ? 338 PHE C N   1 
ATOM   5319 C CA  . PHE C 1 139 ? 48.155  67.218 70.170 1.00 18.02  ? 338 PHE C CA  1 
ATOM   5320 C C   . PHE C 1 139 ? 49.257  66.957 71.181 1.00 18.50  ? 338 PHE C C   1 
ATOM   5321 O O   . PHE C 1 139 ? 49.422  67.714 72.133 1.00 18.83  ? 338 PHE C O   1 
ATOM   5322 C CB  . PHE C 1 139 ? 47.993  68.722 69.943 1.00 16.77  ? 338 PHE C CB  1 
ATOM   5323 C CG  . PHE C 1 139 ? 49.275  69.429 69.600 1.00 15.54  ? 338 PHE C CG  1 
ATOM   5324 C CD1 . PHE C 1 139 ? 50.006  70.081 70.581 1.00 14.94  ? 338 PHE C CD1 1 
ATOM   5325 C CD2 . PHE C 1 139 ? 49.760  69.429 68.296 1.00 15.54  ? 338 PHE C CD2 1 
ATOM   5326 C CE1 . PHE C 1 139 ? 51.203  70.723 70.269 1.00 14.34  ? 338 PHE C CE1 1 
ATOM   5327 C CE2 . PHE C 1 139 ? 50.959  70.070 67.975 1.00 13.42  ? 338 PHE C CE2 1 
ATOM   5328 C CZ  . PHE C 1 139 ? 51.680  70.716 68.962 1.00 12.75  ? 338 PHE C CZ  1 
ATOM   5329 N N   . ILE C 1 140 ? 50.002  65.875 70.983 1.00 18.89  ? 339 ILE C N   1 
ATOM   5330 C CA  . ILE C 1 140 ? 51.073  65.537 71.907 1.00 19.91  ? 339 ILE C CA  1 
ATOM   5331 C C   . ILE C 1 140 ? 52.259  66.425 71.594 1.00 22.12  ? 339 ILE C C   1 
ATOM   5332 O O   . ILE C 1 140 ? 52.646  66.559 70.436 1.00 22.50  ? 339 ILE C O   1 
ATOM   5333 C CB  . ILE C 1 140 ? 51.465  64.046 71.795 1.00 18.49  ? 339 ILE C CB  1 
ATOM   5334 C CG1 . ILE C 1 140 ? 52.229  63.618 73.048 1.00 17.34  ? 339 ILE C CG1 1 
ATOM   5335 C CG2 . ILE C 1 140 ? 52.302  63.810 70.560 1.00 17.48  ? 339 ILE C CG2 1 
ATOM   5336 C CD1 . ILE C 1 140 ? 52.332  62.132 73.210 1.00 15.37  ? 339 ILE C CD1 1 
ATOM   5337 N N   . THR C 1 141 ? 52.828  67.044 72.623 1.00 25.43  ? 340 THR C N   1 
ATOM   5338 C CA  . THR C 1 141 ? 53.957  67.949 72.423 1.00 28.89  ? 340 THR C CA  1 
ATOM   5339 C C   . THR C 1 141 ? 55.257  67.232 72.062 1.00 31.19  ? 340 THR C C   1 
ATOM   5340 O O   . THR C 1 141 ? 55.488  66.086 72.456 1.00 31.56  ? 340 THR C O   1 
ATOM   5341 C CB  . THR C 1 141 ? 54.210  68.852 73.672 1.00 28.57  ? 340 THR C CB  1 
ATOM   5342 O OG1 . THR C 1 141 ? 55.107  68.197 74.578 1.00 28.32  ? 340 THR C OG1 1 
ATOM   5343 C CG2 . THR C 1 141 ? 52.895  69.153 74.390 1.00 27.70  ? 340 THR C CG2 1 
ATOM   5344 N N   . ARG C 1 142 ? 56.094  67.929 71.298 1.00 33.24  ? 341 ARG C N   1 
ATOM   5345 C CA  . ARG C 1 142 ? 57.383  67.415 70.854 1.00 35.72  ? 341 ARG C CA  1 
ATOM   5346 C C   . ARG C 1 142 ? 58.331  67.315 72.040 1.00 37.72  ? 341 ARG C C   1 
ATOM   5347 O O   . ARG C 1 142 ? 59.090  66.352 72.166 1.00 38.07  ? 341 ARG C O   1 
ATOM   5348 C CB  . ARG C 1 142 ? 57.971  68.355 69.802 1.00 35.70  ? 341 ARG C CB  1 
ATOM   5349 C CG  . ARG C 1 142 ? 59.320  67.942 69.242 1.00 33.99  ? 341 ARG C CG  1 
ATOM   5350 C CD  . ARG C 1 142 ? 59.830  69.024 68.310 1.00 34.08  ? 341 ARG C CD  1 
ATOM   5351 N NE  . ARG C 1 142 ? 61.062  68.643 67.631 1.00 34.82  ? 341 ARG C NE  1 
ATOM   5352 C CZ  . ARG C 1 142 ? 61.694  69.409 66.745 1.00 35.29  ? 341 ARG C CZ  1 
ATOM   5353 N NH1 . ARG C 1 142 ? 61.216  70.605 66.421 1.00 34.82  ? 341 ARG C NH1 1 
ATOM   5354 N NH2 . ARG C 1 142 ? 62.807  68.977 66.177 1.00 35.18  ? 341 ARG C NH2 1 
ATOM   5355 N N   . GLU C 1 143 ? 58.293  68.326 72.899 1.00 39.87  ? 342 GLU C N   1 
ATOM   5356 C CA  . GLU C 1 143 ? 59.131  68.345 74.088 1.00 42.21  ? 342 GLU C CA  1 
ATOM   5357 C C   . GLU C 1 143 ? 58.985  67.040 74.849 1.00 41.96  ? 342 GLU C C   1 
ATOM   5358 O O   . GLU C 1 143 ? 59.891  66.211 74.882 1.00 41.09  ? 342 GLU C O   1 
ATOM   5359 C CB  . GLU C 1 143 ? 58.717  69.494 75.008 1.00 45.24  ? 342 GLU C CB  1 
ATOM   5360 C CG  . GLU C 1 143 ? 59.551  70.748 74.836 1.00 48.99  ? 342 GLU C CG  1 
ATOM   5361 C CD  . GLU C 1 143 ? 61.035  70.451 74.915 1.00 50.28  ? 342 GLU C CD  1 
ATOM   5362 O OE1 . GLU C 1 143 ? 61.477  69.907 75.952 1.00 50.64  ? 342 GLU C OE1 1 
ATOM   5363 O OE2 . GLU C 1 143 ? 61.755  70.754 73.938 1.00 51.23  ? 342 GLU C OE2 1 
ATOM   5364 N N   . PHE C 1 144 ? 57.815  66.885 75.454 1.00 42.35  ? 343 PHE C N   1 
ATOM   5365 C CA  . PHE C 1 144 ? 57.462  65.727 76.249 1.00 43.17  ? 343 PHE C CA  1 
ATOM   5366 C C   . PHE C 1 144 ? 57.848  64.364 75.680 1.00 42.69  ? 343 PHE C C   1 
ATOM   5367 O O   . PHE C 1 144 ? 57.790  63.367 76.390 1.00 42.50  ? 343 PHE C O   1 
ATOM   5368 C CB  . PHE C 1 144 ? 55.964  65.770 76.540 1.00 45.61  ? 343 PHE C CB  1 
ATOM   5369 C CG  . PHE C 1 144 ? 55.429  64.499 77.097 1.00 49.30  ? 343 PHE C CG  1 
ATOM   5370 C CD1 . PHE C 1 144 ? 55.875  64.020 78.324 1.00 50.45  ? 343 PHE C CD1 1 
ATOM   5371 C CD2 . PHE C 1 144 ? 54.520  63.743 76.365 1.00 51.88  ? 343 PHE C CD2 1 
ATOM   5372 C CE1 . PHE C 1 144 ? 55.428  62.799 78.814 1.00 52.87  ? 343 PHE C CE1 1 
ATOM   5373 C CE2 . PHE C 1 144 ? 54.063  62.518 76.842 1.00 54.11  ? 343 PHE C CE2 1 
ATOM   5374 C CZ  . PHE C 1 144 ? 54.520  62.042 78.072 1.00 54.00  ? 343 PHE C CZ  1 
ATOM   5375 N N   . LEU C 1 145 ? 58.238  64.302 74.413 1.00 43.40  ? 344 LEU C N   1 
ATOM   5376 C CA  . LEU C 1 145 ? 58.631  63.019 73.827 1.00 44.98  ? 344 LEU C CA  1 
ATOM   5377 C C   . LEU C 1 145 ? 60.149  62.821 73.885 1.00 47.00  ? 344 LEU C C   1 
ATOM   5378 O O   . LEU C 1 145 ? 60.636  61.717 74.149 1.00 45.45  ? 344 LEU C O   1 
ATOM   5379 C CB  . LEU C 1 145 ? 58.136  62.913 72.377 1.00 42.53  ? 344 LEU C CB  1 
ATOM   5380 C CG  . LEU C 1 145 ? 56.639  62.657 72.154 1.00 40.04  ? 344 LEU C CG  1 
ATOM   5381 C CD1 . LEU C 1 145 ? 56.333  62.795 70.688 1.00 39.24  ? 344 LEU C CD1 1 
ATOM   5382 C CD2 . LEU C 1 145 ? 56.244  61.272 72.640 1.00 38.98  ? 344 LEU C CD2 1 
ATOM   5383 N N   . LYS C 1 146 ? 60.889  63.902 73.641 1.00 50.53  ? 345 LYS C N   1 
ATOM   5384 C CA  . LYS C 1 146 ? 62.348  63.863 73.672 1.00 52.96  ? 345 LYS C CA  1 
ATOM   5385 C C   . LYS C 1 146 ? 62.808  63.794 75.123 1.00 53.72  ? 345 LYS C C   1 
ATOM   5386 O O   . LYS C 1 146 ? 64.006  63.717 75.402 1.00 53.83  ? 345 LYS C O   1 
ATOM   5387 C CB  . LYS C 1 146 ? 62.947  65.111 73.013 1.00 53.78  ? 345 LYS C CB  1 
ATOM   5388 C CG  . LYS C 1 146 ? 62.916  66.356 73.888 1.00 54.55  ? 345 LYS C CG  1 
ATOM   5389 C CD  . LYS C 1 146 ? 64.187  67.172 73.703 1.00 54.85  ? 345 LYS C CD  1 
ATOM   5390 C CE  . LYS C 1 146 ? 65.421  66.354 74.061 1.00 54.76  ? 345 LYS C CE  1 
ATOM   5391 N NZ  . LYS C 1 146 ? 66.072  66.813 75.322 1.00 54.22  ? 345 LYS C NZ  1 
ATOM   5392 N N   . SER C 1 147 ? 61.844  63.848 76.039 1.00 54.70  ? 346 SER C N   1 
ATOM   5393 C CA  . SER C 1 147 ? 62.125  63.766 77.468 1.00 55.19  ? 346 SER C CA  1 
ATOM   5394 C C   . SER C 1 147 ? 61.413  62.528 78.018 1.00 55.72  ? 346 SER C C   1 
ATOM   5395 O O   . SER C 1 147 ? 60.373  62.625 78.674 1.00 55.12  ? 346 SER C O   1 
ATOM   5396 C CB  . SER C 1 147 ? 61.648  65.031 78.200 1.00 54.35  ? 346 SER C CB  1 
ATOM   5397 O OG  . SER C 1 147 ? 60.248  65.025 78.421 1.00 53.02  ? 346 SER C OG  1 
ATOM   5398 N N   . LEU C 1 148 ? 61.984  61.366 77.713 1.00 56.83  ? 347 LEU C N   1 
ATOM   5399 C CA  . LEU C 1 148 ? 61.464  60.075 78.151 1.00 58.35  ? 347 LEU C CA  1 
ATOM   5400 C C   . LEU C 1 148 ? 62.626  59.101 78.334 1.00 59.94  ? 347 LEU C C   1 
ATOM   5401 O O   . LEU C 1 148 ? 63.752  59.374 77.911 1.00 59.73  ? 347 LEU C O   1 
ATOM   5402 C CB  . LEU C 1 148 ? 60.486  59.501 77.121 1.00 58.50  ? 347 LEU C CB  1 
ATOM   5403 C CG  . LEU C 1 148 ? 59.173  60.235 76.833 1.00 58.80  ? 347 LEU C CG  1 
ATOM   5404 C CD1 . LEU C 1 148 ? 58.311  59.365 75.919 1.00 57.95  ? 347 LEU C CD1 1 
ATOM   5405 C CD2 . LEU C 1 148 ? 58.433  60.531 78.135 1.00 58.51  ? 347 LEU C CD2 1 
ATOM   5406 N N   . ARG C 1 149 ? 62.347  57.961 78.957 1.00 61.86  ? 348 ARG C N   1 
ATOM   5407 C CA  . ARG C 1 149 ? 63.372  56.953 79.204 1.00 63.68  ? 348 ARG C CA  1 
ATOM   5408 C C   . ARG C 1 149 ? 64.010  56.420 77.924 1.00 63.38  ? 348 ARG C C   1 
ATOM   5409 O O   . ARG C 1 149 ? 63.346  55.793 77.099 1.00 63.39  ? 348 ARG C O   1 
ATOM   5410 C CB  . ARG C 1 149 ? 62.782  55.793 80.016 1.00 65.52  ? 348 ARG C CB  1 
ATOM   5411 C CG  . ARG C 1 149 ? 63.762  54.662 80.303 1.00 68.09  ? 348 ARG C CG  1 
ATOM   5412 C CD  . ARG C 1 149 ? 63.249  53.737 81.400 1.00 69.99  ? 348 ARG C CD  1 
ATOM   5413 N NE  . ARG C 1 149 ? 61.976  53.106 81.062 1.00 72.08  ? 348 ARG C NE  1 
ATOM   5414 C CZ  . ARG C 1 149 ? 61.820  52.196 80.105 1.00 73.29  ? 348 ARG C CZ  1 
ATOM   5415 N NH1 . ARG C 1 149 ? 62.861  51.799 79.382 1.00 73.42  ? 348 ARG C NH1 1 
ATOM   5416 N NH2 . ARG C 1 149 ? 60.618  51.684 79.871 1.00 73.52  ? 348 ARG C NH2 1 
ATOM   5417 N N   . LYS C 1 150 ? 65.306  56.675 77.777 1.00 63.13  ? 349 LYS C N   1 
ATOM   5418 C CA  . LYS C 1 150 ? 66.071  56.230 76.619 1.00 63.12  ? 349 LYS C CA  1 
ATOM   5419 C C   . LYS C 1 150 ? 65.771  54.778 76.262 1.00 63.43  ? 349 LYS C C   1 
ATOM   5420 O O   . LYS C 1 150 ? 65.422  53.974 77.128 1.00 62.56  ? 349 LYS C O   1 
ATOM   5421 C CB  . LYS C 1 150 ? 67.564  56.345 76.903 1.00 63.07  ? 349 LYS C CB  1 
ATOM   5422 C CG  . LYS C 1 150 ? 68.076  57.741 77.215 1.00 63.34  ? 349 LYS C CG  1 
ATOM   5423 C CD  . LYS C 1 150 ? 68.854  58.304 76.038 1.00 63.38  ? 349 LYS C CD  1 
ATOM   5424 C CE  . LYS C 1 150 ? 69.583  57.208 75.276 1.00 63.07  ? 349 LYS C CE  1 
ATOM   5425 N NZ  . LYS C 1 150 ? 70.243  57.743 74.059 1.00 64.23  ? 349 LYS C NZ  1 
ATOM   5426 N N   . PRO C 1 151 ? 65.895  54.429 74.969 1.00 64.32  ? 350 PRO C N   1 
ATOM   5427 C CA  . PRO C 1 151 ? 66.290  55.369 73.918 1.00 63.98  ? 350 PRO C CA  1 
ATOM   5428 C C   . PRO C 1 151 ? 64.995  55.789 73.227 1.00 63.48  ? 350 PRO C C   1 
ATOM   5429 O O   . PRO C 1 151 ? 64.932  55.957 72.010 1.00 63.30  ? 350 PRO C O   1 
ATOM   5430 C CB  . PRO C 1 151 ? 67.204  54.524 73.039 1.00 64.08  ? 350 PRO C CB  1 
ATOM   5431 C CG  . PRO C 1 151 ? 66.556  53.150 73.092 1.00 64.02  ? 350 PRO C CG  1 
ATOM   5432 C CD  . PRO C 1 151 ? 65.825  53.051 74.441 1.00 64.30  ? 350 PRO C CD  1 
ATOM   5433 N N   . PHE C 1 152 ? 63.965  55.950 74.052 1.00 62.53  ? 351 PHE C N   1 
ATOM   5434 C CA  . PHE C 1 152 ? 62.627  56.313 73.615 1.00 61.38  ? 351 PHE C CA  1 
ATOM   5435 C C   . PHE C 1 152 ? 62.462  57.751 73.177 1.00 60.53  ? 351 PHE C C   1 
ATOM   5436 O O   . PHE C 1 152 ? 61.655  58.052 72.300 1.00 60.57  ? 351 PHE C O   1 
ATOM   5437 C CB  . PHE C 1 152 ? 61.638  55.987 74.732 1.00 61.80  ? 351 PHE C CB  1 
ATOM   5438 C CG  . PHE C 1 152 ? 61.284  54.529 74.812 1.00 62.72  ? 351 PHE C CG  1 
ATOM   5439 C CD1 . PHE C 1 152 ? 61.979  53.587 74.056 1.00 63.18  ? 351 PHE C CD1 1 
ATOM   5440 C CD2 . PHE C 1 152 ? 60.227  54.100 75.595 1.00 62.89  ? 351 PHE C CD2 1 
ATOM   5441 C CE1 . PHE C 1 152 ? 61.616  52.242 74.078 1.00 62.56  ? 351 PHE C CE1 1 
ATOM   5442 C CE2 . PHE C 1 152 ? 59.857  52.756 75.623 1.00 62.64  ? 351 PHE C CE2 1 
ATOM   5443 C CZ  . PHE C 1 152 ? 60.552  51.827 74.861 1.00 61.90  ? 351 PHE C CZ  1 
ATOM   5444 N N   . CYS C 1 153 ? 63.225  58.639 73.794 1.00 59.47  ? 352 CYS C N   1 
ATOM   5445 C CA  . CYS C 1 153 ? 63.171  60.054 73.469 1.00 59.07  ? 352 CYS C CA  1 
ATOM   5446 C C   . CYS C 1 153 ? 64.009  60.297 72.230 1.00 57.81  ? 352 CYS C C   1 
ATOM   5447 O O   . CYS C 1 153 ? 64.356  61.435 71.924 1.00 57.41  ? 352 CYS C O   1 
ATOM   5448 C CB  . CYS C 1 153 ? 63.774  60.854 74.600 1.00 60.65  ? 352 CYS C CB  1 
ATOM   5449 S SG  . CYS C 1 153 ? 65.517  60.446 74.802 1.00 64.85  ? 352 CYS C SG  1 
ATOM   5450 N N   . ASP C 1 154 ? 64.351  59.222 71.532 1.00 56.71  ? 353 ASP C N   1 
ATOM   5451 C CA  . ASP C 1 154 ? 65.173  59.329 70.337 1.00 55.54  ? 353 ASP C CA  1 
ATOM   5452 C C   . ASP C 1 154 ? 64.517  58.655 69.144 1.00 54.38  ? 353 ASP C C   1 
ATOM   5453 O O   . ASP C 1 154 ? 65.150  58.434 68.115 1.00 54.02  ? 353 ASP C O   1 
ATOM   5454 C CB  . ASP C 1 154 ? 66.546  58.712 70.604 1.00 56.89  ? 353 ASP C CB  1 
ATOM   5455 C CG  . ASP C 1 154 ? 67.281  59.405 71.740 1.00 58.02  ? 353 ASP C CG  1 
ATOM   5456 O OD1 . ASP C 1 154 ? 67.410  60.644 71.676 1.00 59.65  ? 353 ASP C OD1 1 
ATOM   5457 O OD2 . ASP C 1 154 ? 67.730  58.720 72.689 1.00 57.35  ? 353 ASP C OD2 1 
ATOM   5458 N N   . ILE C 1 155 ? 63.241  58.326 69.294 1.00 53.30  ? 354 ILE C N   1 
ATOM   5459 C CA  . ILE C 1 155 ? 62.490  57.691 68.223 1.00 51.99  ? 354 ILE C CA  1 
ATOM   5460 C C   . ILE C 1 155 ? 61.802  58.760 67.376 1.00 51.02  ? 354 ILE C C   1 
ATOM   5461 O O   . ILE C 1 155 ? 62.058  58.880 66.176 1.00 51.26  ? 354 ILE C O   1 
ATOM   5462 C CB  . ILE C 1 155 ? 61.423  56.691 68.791 1.00 51.94  ? 354 ILE C CB  1 
ATOM   5463 C CG1 . ILE C 1 155 ? 62.092  55.348 69.108 1.00 52.30  ? 354 ILE C CG1 1 
ATOM   5464 C CG2 . ILE C 1 155 ? 60.272  56.500 67.804 1.00 51.97  ? 354 ILE C CG2 1 
ATOM   5465 C CD1 . ILE C 1 155 ? 61.131  54.210 69.412 1.00 50.78  ? 354 ILE C CD1 1 
ATOM   5466 N N   . MET C 1 156 ? 60.955  59.552 68.023 1.00 48.60  ? 355 MET C N   1 
ATOM   5467 C CA  . MET C 1 156 ? 60.190  60.593 67.356 1.00 46.27  ? 355 MET C CA  1 
ATOM   5468 C C   . MET C 1 156 ? 60.949  61.807 66.813 1.00 46.31  ? 355 MET C C   1 
ATOM   5469 O O   . MET C 1 156 ? 60.558  62.358 65.784 1.00 46.63  ? 355 MET C O   1 
ATOM   5470 C CB  . MET C 1 156 ? 59.083  61.076 68.290 1.00 43.57  ? 355 MET C CB  1 
ATOM   5471 C CG  . MET C 1 156 ? 57.739  61.194 67.617 1.00 39.74  ? 355 MET C CG  1 
ATOM   5472 S SD  . MET C 1 156 ? 57.418  59.657 66.744 1.00 35.77  ? 355 MET C SD  1 
ATOM   5473 C CE  . MET C 1 156 ? 56.117  60.220 65.651 1.00 38.19  ? 355 MET C CE  1 
ATOM   5474 N N   . GLU C 1 157 ? 62.019  62.234 67.480 1.00 45.34  ? 356 GLU C N   1 
ATOM   5475 C CA  . GLU C 1 157 ? 62.752  63.410 67.009 1.00 45.03  ? 356 GLU C CA  1 
ATOM   5476 C C   . GLU C 1 157 ? 63.300  63.343 65.579 1.00 44.46  ? 356 GLU C C   1 
ATOM   5477 O O   . GLU C 1 157 ? 63.158  64.300 64.810 1.00 45.09  ? 356 GLU C O   1 
ATOM   5478 C CB  . GLU C 1 157 ? 63.883  63.763 67.976 1.00 45.83  ? 356 GLU C CB  1 
ATOM   5479 C CG  . GLU C 1 157 ? 63.480  64.713 69.100 1.00 48.57  ? 356 GLU C CG  1 
ATOM   5480 C CD  . GLU C 1 157 ? 63.210  66.138 68.622 1.00 49.50  ? 356 GLU C CD  1 
ATOM   5481 O OE1 . GLU C 1 157 ? 62.033  66.564 68.651 1.00 50.28  ? 356 GLU C OE1 1 
ATOM   5482 O OE2 . GLU C 1 157 ? 64.173  66.832 68.218 1.00 48.38  ? 356 GLU C OE2 1 
ATOM   5483 N N   . PRO C 1 158 ? 63.936  62.224 65.195 1.00 43.15  ? 357 PRO C N   1 
ATOM   5484 C CA  . PRO C 1 158 ? 64.453  62.175 63.826 1.00 41.49  ? 357 PRO C CA  1 
ATOM   5485 C C   . PRO C 1 158 ? 63.355  62.473 62.812 1.00 40.63  ? 357 PRO C C   1 
ATOM   5486 O O   . PRO C 1 158 ? 63.619  63.024 61.742 1.00 42.04  ? 357 PRO C O   1 
ATOM   5487 C CB  . PRO C 1 158 ? 64.985  60.752 63.715 1.00 40.90  ? 357 PRO C CB  1 
ATOM   5488 C CG  . PRO C 1 158 ? 65.447  60.468 65.106 1.00 41.15  ? 357 PRO C CG  1 
ATOM   5489 C CD  . PRO C 1 158 ? 64.296  61.000 65.931 1.00 42.93  ? 357 PRO C CD  1 
ATOM   5490 N N   . LYS C 1 159 ? 62.122  62.111 63.159 1.00 38.52  ? 358 LYS C N   1 
ATOM   5491 C CA  . LYS C 1 159 ? 60.980  62.346 62.281 1.00 36.76  ? 358 LYS C CA  1 
ATOM   5492 C C   . LYS C 1 159 ? 60.523  63.801 62.367 1.00 35.19  ? 358 LYS C C   1 
ATOM   5493 O O   . LYS C 1 159 ? 59.932  64.339 61.432 1.00 35.01  ? 358 LYS C O   1 
ATOM   5494 C CB  . LYS C 1 159 ? 59.806  61.416 62.638 1.00 37.07  ? 358 LYS C CB  1 
ATOM   5495 C CG  . LYS C 1 159 ? 60.015  59.940 62.319 1.00 36.18  ? 358 LYS C CG  1 
ATOM   5496 C CD  . LYS C 1 159 ? 60.765  59.225 63.431 1.00 35.91  ? 358 LYS C CD  1 
ATOM   5497 C CE  . LYS C 1 159 ? 61.228  57.840 63.005 1.00 35.34  ? 358 LYS C CE  1 
ATOM   5498 N NZ  . LYS C 1 159 ? 62.196  57.265 63.988 1.00 32.61  ? 358 LYS C NZ  1 
ATOM   5499 N N   . PHE C 1 160 ? 60.788  64.442 63.495 1.00 33.14  ? 359 PHE C N   1 
ATOM   5500 C CA  . PHE C 1 160 ? 60.395  65.829 63.643 1.00 32.07  ? 359 PHE C CA  1 
ATOM   5501 C C   . PHE C 1 160 ? 61.306  66.696 62.806 1.00 32.13  ? 359 PHE C C   1 
ATOM   5502 O O   . PHE C 1 160 ? 60.898  67.739 62.299 1.00 33.77  ? 359 PHE C O   1 
ATOM   5503 C CB  . PHE C 1 160 ? 60.469  66.263 65.104 1.00 30.53  ? 359 PHE C CB  1 
ATOM   5504 C CG  . PHE C 1 160 ? 59.137  66.314 65.778 1.00 29.17  ? 359 PHE C CG  1 
ATOM   5505 C CD1 . PHE C 1 160 ? 58.193  67.253 65.394 1.00 28.98  ? 359 PHE C CD1 1 
ATOM   5506 C CD2 . PHE C 1 160 ? 58.813  65.409 66.777 1.00 29.18  ? 359 PHE C CD2 1 
ATOM   5507 C CE1 . PHE C 1 160 ? 56.946  67.293 65.995 1.00 29.09  ? 359 PHE C CE1 1 
ATOM   5508 C CE2 . PHE C 1 160 ? 57.569  65.438 67.385 1.00 29.24  ? 359 PHE C CE2 1 
ATOM   5509 C CZ  . PHE C 1 160 ? 56.632  66.383 66.994 1.00 29.21  ? 359 PHE C CZ  1 
ATOM   5510 N N   . ASP C 1 161 ? 62.547  66.261 62.648 1.00 30.38  ? 360 ASP C N   1 
ATOM   5511 C CA  . ASP C 1 161 ? 63.475  67.042 61.865 1.00 29.44  ? 360 ASP C CA  1 
ATOM   5512 C C   . ASP C 1 161 ? 63.158  66.961 60.373 1.00 27.14  ? 360 ASP C C   1 
ATOM   5513 O O   . ASP C 1 161 ? 63.065  67.982 59.686 1.00 26.40  ? 360 ASP C O   1 
ATOM   5514 C CB  . ASP C 1 161 ? 64.904  66.584 62.132 1.00 32.45  ? 360 ASP C CB  1 
ATOM   5515 C CG  . ASP C 1 161 ? 65.925  67.468 61.447 1.00 37.78  ? 360 ASP C CG  1 
ATOM   5516 O OD1 . ASP C 1 161 ? 67.135  67.302 61.704 1.00 41.39  ? 360 ASP C OD1 1 
ATOM   5517 O OD2 . ASP C 1 161 ? 65.515  68.334 60.644 1.00 40.95  ? 360 ASP C OD2 1 
ATOM   5518 N N   . PHE C 1 162 ? 62.989  65.746 59.869 1.00 24.73  ? 361 PHE C N   1 
ATOM   5519 C CA  . PHE C 1 162 ? 62.693  65.573 58.461 1.00 21.76  ? 361 PHE C CA  1 
ATOM   5520 C C   . PHE C 1 162 ? 61.475  66.402 58.128 1.00 21.26  ? 361 PHE C C   1 
ATOM   5521 O O   . PHE C 1 162 ? 61.393  67.006 57.060 1.00 22.19  ? 361 PHE C O   1 
ATOM   5522 C CB  . PHE C 1 162 ? 62.434  64.104 58.157 1.00 19.93  ? 361 PHE C CB  1 
ATOM   5523 C CG  . PHE C 1 162 ? 61.923  63.855 56.777 1.00 19.99  ? 361 PHE C CG  1 
ATOM   5524 C CD1 . PHE C 1 162 ? 60.580  64.047 56.464 1.00 20.21  ? 361 PHE C CD1 1 
ATOM   5525 C CD2 . PHE C 1 162 ? 62.780  63.422 55.785 1.00 21.13  ? 361 PHE C CD2 1 
ATOM   5526 C CE1 . PHE C 1 162 ? 60.102  63.807 55.184 1.00 19.68  ? 361 PHE C CE1 1 
ATOM   5527 C CE2 . PHE C 1 162 ? 62.311  63.180 54.499 1.00 21.79  ? 361 PHE C CE2 1 
ATOM   5528 C CZ  . PHE C 1 162 ? 60.969  63.373 54.201 1.00 21.12  ? 361 PHE C CZ  1 
ATOM   5529 N N   . ALA C 1 163 ? 60.541  66.442 59.068 1.00 20.33  ? 362 ALA C N   1 
ATOM   5530 C CA  . ALA C 1 163 ? 59.308  67.180 58.888 1.00 20.86  ? 362 ALA C CA  1 
ATOM   5531 C C   . ALA C 1 163 ? 59.532  68.679 58.705 1.00 22.51  ? 362 ALA C C   1 
ATOM   5532 O O   . ALA C 1 163 ? 59.040  69.274 57.746 1.00 22.07  ? 362 ALA C O   1 
ATOM   5533 C CB  . ALA C 1 163 ? 58.389  66.929 60.065 1.00 20.08  ? 362 ALA C CB  1 
ATOM   5534 N N   . MET C 1 164 ? 60.281  69.292 59.613 1.00 23.89  ? 363 MET C N   1 
ATOM   5535 C CA  . MET C 1 164 ? 60.517  70.727 59.528 1.00 26.15  ? 363 MET C CA  1 
ATOM   5536 C C   . MET C 1 164 ? 61.050  71.203 58.184 1.00 26.90  ? 363 MET C C   1 
ATOM   5537 O O   . MET C 1 164 ? 60.780  72.333 57.767 1.00 28.10  ? 363 MET C O   1 
ATOM   5538 C CB  . MET C 1 164 ? 61.468  71.177 60.635 1.00 28.53  ? 363 MET C CB  1 
ATOM   5539 C CG  . MET C 1 164 ? 60.835  72.139 61.625 1.00 31.03  ? 363 MET C CG  1 
ATOM   5540 S SD  . MET C 1 164 ? 59.626  71.274 62.635 1.00 35.93  ? 363 MET C SD  1 
ATOM   5541 C CE  . MET C 1 164 ? 58.215  71.171 61.537 1.00 34.28  ? 363 MET C CE  1 
ATOM   5542 N N   . LYS C 1 165 ? 61.805  70.345 57.508 1.00 26.35  ? 364 LYS C N   1 
ATOM   5543 C CA  . LYS C 1 165 ? 62.387  70.702 56.221 1.00 24.70  ? 364 LYS C CA  1 
ATOM   5544 C C   . LYS C 1 165 ? 61.478  70.266 55.094 1.00 22.41  ? 364 LYS C C   1 
ATOM   5545 O O   . LYS C 1 165 ? 61.360  70.957 54.082 1.00 22.77  ? 364 LYS C O   1 
ATOM   5546 C CB  . LYS C 1 165 ? 63.746  70.032 56.056 1.00 27.31  ? 364 LYS C CB  1 
ATOM   5547 C CG  . LYS C 1 165 ? 64.666  70.163 57.259 1.00 29.01  ? 364 LYS C CG  1 
ATOM   5548 C CD  . LYS C 1 165 ? 65.841  69.211 57.112 1.00 30.61  ? 364 LYS C CD  1 
ATOM   5549 C CE  . LYS C 1 165 ? 66.689  69.152 58.369 1.00 31.81  ? 364 LYS C CE  1 
ATOM   5550 N NZ  . LYS C 1 165 ? 67.589  67.952 58.373 1.00 32.14  ? 364 LYS C NZ  1 
ATOM   5551 N N   . PHE C 1 166 ? 60.845  69.111 55.265 1.00 19.37  ? 365 PHE C N   1 
ATOM   5552 C CA  . PHE C 1 166 ? 59.939  68.608 54.245 1.00 18.22  ? 365 PHE C CA  1 
ATOM   5553 C C   . PHE C 1 166 ? 58.807  69.623 54.072 1.00 18.08  ? 365 PHE C C   1 
ATOM   5554 O O   . PHE C 1 166 ? 58.341  69.880 52.960 1.00 17.48  ? 365 PHE C O   1 
ATOM   5555 C CB  . PHE C 1 166 ? 59.364  67.242 54.650 1.00 14.85  ? 365 PHE C CB  1 
ATOM   5556 C CG  . PHE C 1 166 ? 58.721  66.504 53.513 1.00 10.30  ? 365 PHE C CG  1 
ATOM   5557 C CD1 . PHE C 1 166 ? 59.501  65.933 52.520 1.00 8.63   ? 365 PHE C CD1 1 
ATOM   5558 C CD2 . PHE C 1 166 ? 57.342  66.445 53.394 1.00 8.58   ? 365 PHE C CD2 1 
ATOM   5559 C CE1 . PHE C 1 166 ? 58.921  65.322 51.421 1.00 8.82   ? 365 PHE C CE1 1 
ATOM   5560 C CE2 . PHE C 1 166 ? 56.754  65.835 52.294 1.00 9.00   ? 365 PHE C CE2 1 
ATOM   5561 C CZ  . PHE C 1 166 ? 57.546  65.274 51.306 1.00 8.09   ? 365 PHE C CZ  1 
ATOM   5562 N N   . ASN C 1 167 ? 58.379  70.201 55.190 1.00 18.56  ? 366 ASN C N   1 
ATOM   5563 C CA  . ASN C 1 167 ? 57.316  71.199 55.190 1.00 18.80  ? 366 ASN C CA  1 
ATOM   5564 C C   . ASN C 1 167 ? 57.801  72.515 54.568 1.00 19.27  ? 366 ASN C C   1 
ATOM   5565 O O   . ASN C 1 167 ? 56.998  73.295 54.064 1.00 20.85  ? 366 ASN C O   1 
ATOM   5566 C CB  . ASN C 1 167 ? 56.821  71.431 56.623 1.00 17.05  ? 366 ASN C CB  1 
ATOM   5567 C CG  . ASN C 1 167 ? 56.148  70.204 57.213 1.00 15.34  ? 366 ASN C CG  1 
ATOM   5568 O OD1 . ASN C 1 167 ? 55.869  70.146 58.412 1.00 14.30  ? 366 ASN C OD1 1 
ATOM   5569 N ND2 . ASN C 1 167 ? 55.874  69.219 56.367 1.00 14.22  ? 366 ASN C ND2 1 
ATOM   5570 N N   . ALA C 1 168 ? 59.113  72.752 54.606 1.00 18.39  ? 367 ALA C N   1 
ATOM   5571 C CA  . ALA C 1 168 ? 59.704  73.949 54.022 1.00 16.41  ? 367 ALA C CA  1 
ATOM   5572 C C   . ALA C 1 168 ? 59.440  73.939 52.514 1.00 16.63  ? 367 ALA C C   1 
ATOM   5573 O O   . ALA C 1 168 ? 59.327  74.986 51.886 1.00 16.40  ? 367 ALA C O   1 
ATOM   5574 C CB  . ALA C 1 168 ? 61.196  73.971 54.292 1.00 14.64  ? 367 ALA C CB  1 
ATOM   5575 N N   . LEU C 1 169 ? 59.332  72.746 51.940 1.00 17.62  ? 368 LEU C N   1 
ATOM   5576 C CA  . LEU C 1 169 ? 59.074  72.608 50.513 1.00 18.91  ? 368 LEU C CA  1 
ATOM   5577 C C   . LEU C 1 169 ? 57.682  73.089 50.140 1.00 20.30  ? 368 LEU C C   1 
ATOM   5578 O O   . LEU C 1 169 ? 57.278  72.989 48.984 1.00 21.30  ? 368 LEU C O   1 
ATOM   5579 C CB  . LEU C 1 169 ? 59.229  71.153 50.066 1.00 17.49  ? 368 LEU C CB  1 
ATOM   5580 C CG  . LEU C 1 169 ? 60.565  70.476 50.346 1.00 15.32  ? 368 LEU C CG  1 
ATOM   5581 C CD1 . LEU C 1 169 ? 60.609  69.171 49.578 1.00 14.99  ? 368 LEU C CD1 1 
ATOM   5582 C CD2 . LEU C 1 169 ? 61.709  71.379 49.928 1.00 13.04  ? 368 LEU C CD2 1 
ATOM   5583 N N   . GLU C 1 170 ? 56.940  73.588 51.120 1.00 21.71  ? 369 GLU C N   1 
ATOM   5584 C CA  . GLU C 1 170 ? 55.603  74.110 50.859 1.00 24.88  ? 369 GLU C CA  1 
ATOM   5585 C C   . GLU C 1 170 ? 54.719  73.181 50.029 1.00 24.45  ? 369 GLU C C   1 
ATOM   5586 O O   . GLU C 1 170 ? 53.873  73.657 49.269 1.00 24.25  ? 369 GLU C O   1 
ATOM   5587 C CB  . GLU C 1 170 ? 55.716  75.447 50.124 1.00 28.90  ? 369 GLU C CB  1 
ATOM   5588 C CG  . GLU C 1 170 ? 56.379  76.568 50.904 1.00 34.33  ? 369 GLU C CG  1 
ATOM   5589 C CD  . GLU C 1 170 ? 55.412  77.238 51.842 1.00 39.09  ? 369 GLU C CD  1 
ATOM   5590 O OE1 . GLU C 1 170 ? 55.447  76.937 53.059 1.00 41.57  ? 369 GLU C OE1 1 
ATOM   5591 O OE2 . GLU C 1 170 ? 54.602  78.057 51.347 1.00 41.22  ? 369 GLU C OE2 1 
ATOM   5592 N N   . LEU C 1 171 ? 54.901  71.871 50.163 1.00 24.49  ? 370 LEU C N   1 
ATOM   5593 C CA  . LEU C 1 171 ? 54.095  70.930 49.386 1.00 24.17  ? 370 LEU C CA  1 
ATOM   5594 C C   . LEU C 1 171 ? 52.652  70.891 49.864 1.00 23.71  ? 370 LEU C C   1 
ATOM   5595 O O   . LEU C 1 171 ? 52.373  71.146 51.030 1.00 23.03  ? 370 LEU C O   1 
ATOM   5596 C CB  . LEU C 1 171 ? 54.679  69.511 49.459 1.00 23.97  ? 370 LEU C CB  1 
ATOM   5597 C CG  . LEU C 1 171 ? 56.074  69.194 48.905 1.00 24.07  ? 370 LEU C CG  1 
ATOM   5598 C CD1 . LEU C 1 171 ? 56.260  67.678 48.910 1.00 24.78  ? 370 LEU C CD1 1 
ATOM   5599 C CD2 . LEU C 1 171 ? 56.237  69.726 47.489 1.00 23.49  ? 370 LEU C CD2 1 
ATOM   5600 N N   . ASP C 1 172 ? 51.736  70.578 48.955 1.00 24.39  ? 371 ASP C N   1 
ATOM   5601 C CA  . ASP C 1 172 ? 50.330  70.478 49.314 1.00 26.01  ? 371 ASP C CA  1 
ATOM   5602 C C   . ASP C 1 172 ? 49.831  69.068 48.987 1.00 26.96  ? 371 ASP C C   1 
ATOM   5603 O O   . ASP C 1 172 ? 50.547  68.273 48.368 1.00 27.85  ? 371 ASP C O   1 
ATOM   5604 C CB  . ASP C 1 172 ? 49.513  71.547 48.581 1.00 26.83  ? 371 ASP C CB  1 
ATOM   5605 C CG  . ASP C 1 172 ? 49.439  71.316 47.085 1.00 29.03  ? 371 ASP C CG  1 
ATOM   5606 O OD1 . ASP C 1 172 ? 48.434  70.731 46.625 1.00 29.53  ? 371 ASP C OD1 1 
ATOM   5607 O OD2 . ASP C 1 172 ? 50.381  71.719 46.369 1.00 30.37  ? 371 ASP C OD2 1 
ATOM   5608 N N   . ASP C 1 173 ? 48.612  68.754 49.411 1.00 26.95  ? 372 ASP C N   1 
ATOM   5609 C CA  . ASP C 1 173 ? 48.047  67.428 49.188 1.00 27.02  ? 372 ASP C CA  1 
ATOM   5610 C C   . ASP C 1 173 ? 48.210  66.876 47.779 1.00 26.95  ? 372 ASP C C   1 
ATOM   5611 O O   . ASP C 1 173 ? 48.475  65.690 47.600 1.00 26.83  ? 372 ASP C O   1 
ATOM   5612 C CB  . ASP C 1 173 ? 46.565  67.410 49.581 1.00 27.73  ? 372 ASP C CB  1 
ATOM   5613 C CG  . ASP C 1 173 ? 46.362  67.460 51.089 1.00 27.83  ? 372 ASP C CG  1 
ATOM   5614 O OD1 . ASP C 1 173 ? 47.098  66.748 51.808 1.00 27.44  ? 372 ASP C OD1 1 
ATOM   5615 O OD2 . ASP C 1 173 ? 45.465  68.196 51.554 1.00 26.27  ? 372 ASP C OD2 1 
ATOM   5616 N N   . SER C 1 174 ? 48.061  67.731 46.777 1.00 27.34  ? 373 SER C N   1 
ATOM   5617 C CA  . SER C 1 174 ? 48.183  67.288 45.391 1.00 27.70  ? 373 SER C CA  1 
ATOM   5618 C C   . SER C 1 174 ? 49.556  66.711 45.078 1.00 26.42  ? 373 SER C C   1 
ATOM   5619 O O   . SER C 1 174 ? 49.680  65.710 44.365 1.00 26.11  ? 373 SER C O   1 
ATOM   5620 C CB  . SER C 1 174 ? 47.902  68.450 44.440 1.00 27.94  ? 373 SER C CB  1 
ATOM   5621 O OG  . SER C 1 174 ? 48.839  69.490 44.641 1.00 29.58  ? 373 SER C OG  1 
ATOM   5622 N N   . ASP C 1 175 ? 50.585  67.344 45.618 1.00 24.71  ? 374 ASP C N   1 
ATOM   5623 C CA  . ASP C 1 175 ? 51.940  66.902 45.367 1.00 24.39  ? 374 ASP C CA  1 
ATOM   5624 C C   . ASP C 1 175 ? 52.281  65.621 46.115 1.00 23.07  ? 374 ASP C C   1 
ATOM   5625 O O   . ASP C 1 175 ? 52.880  64.697 45.547 1.00 23.41  ? 374 ASP C O   1 
ATOM   5626 C CB  . ASP C 1 175 ? 52.923  68.001 45.764 1.00 25.80  ? 374 ASP C CB  1 
ATOM   5627 C CG  . ASP C 1 175 ? 52.528  69.361 45.226 1.00 27.40  ? 374 ASP C CG  1 
ATOM   5628 O OD1 . ASP C 1 175 ? 52.336  69.494 43.994 1.00 26.05  ? 374 ASP C OD1 1 
ATOM   5629 O OD2 . ASP C 1 175 ? 52.417  70.297 46.049 1.00 27.29  ? 374 ASP C OD2 1 
ATOM   5630 N N   . ILE C 1 176 ? 51.890  65.565 47.386 1.00 19.93  ? 375 ILE C N   1 
ATOM   5631 C CA  . ILE C 1 176 ? 52.188  64.414 48.227 1.00 16.69  ? 375 ILE C CA  1 
ATOM   5632 C C   . ILE C 1 176 ? 51.510  63.128 47.810 1.00 15.87  ? 375 ILE C C   1 
ATOM   5633 O O   . ILE C 1 176 ? 52.061  62.049 48.004 1.00 15.82  ? 375 ILE C O   1 
ATOM   5634 C CB  . ILE C 1 176 ? 51.839  64.700 49.666 1.00 15.48  ? 375 ILE C CB  1 
ATOM   5635 C CG1 . ILE C 1 176 ? 52.514  66.003 50.088 1.00 14.77  ? 375 ILE C CG1 1 
ATOM   5636 C CG2 . ILE C 1 176 ? 52.296  63.547 50.537 1.00 13.95  ? 375 ILE C CG2 1 
ATOM   5637 C CD1 . ILE C 1 176 ? 51.764  66.747 51.147 1.00 15.27  ? 375 ILE C CD1 1 
ATOM   5638 N N   . SER C 1 177 ? 50.311  63.228 47.256 1.00 15.25  ? 376 SER C N   1 
ATOM   5639 C CA  . SER C 1 177 ? 49.632  62.029 46.801 1.00 16.50  ? 376 SER C CA  1 
ATOM   5640 C C   . SER C 1 177 ? 50.552  61.395 45.763 1.00 17.37  ? 376 SER C C   1 
ATOM   5641 O O   . SER C 1 177 ? 50.797  60.194 45.784 1.00 17.93  ? 376 SER C O   1 
ATOM   5642 C CB  . SER C 1 177 ? 48.280  62.381 46.179 1.00 16.01  ? 376 SER C CB  1 
ATOM   5643 O OG  . SER C 1 177 ? 48.401  63.435 45.245 1.00 16.48  ? 376 SER C OG  1 
ATOM   5644 N N   . LEU C 1 178 ? 51.081  62.228 44.872 1.00 18.98  ? 377 LEU C N   1 
ATOM   5645 C CA  . LEU C 1 178 ? 51.994  61.780 43.822 1.00 19.33  ? 377 LEU C CA  1 
ATOM   5646 C C   . LEU C 1 178 ? 53.352  61.383 44.403 1.00 19.32  ? 377 LEU C C   1 
ATOM   5647 O O   . LEU C 1 178 ? 54.069  60.567 43.824 1.00 20.88  ? 377 LEU C O   1 
ATOM   5648 C CB  . LEU C 1 178 ? 52.172  62.884 42.775 1.00 19.41  ? 377 LEU C CB  1 
ATOM   5649 C CG  . LEU C 1 178 ? 50.897  63.248 42.005 1.00 19.44  ? 377 LEU C CG  1 
ATOM   5650 C CD1 . LEU C 1 178 ? 51.145  64.441 41.097 1.00 19.07  ? 377 LEU C CD1 1 
ATOM   5651 C CD2 . LEU C 1 178 ? 50.445  62.041 41.204 1.00 19.79  ? 377 LEU C CD2 1 
ATOM   5652 N N   . PHE C 1 179 ? 53.708  61.963 45.542 1.00 17.76  ? 378 PHE C N   1 
ATOM   5653 C CA  . PHE C 1 179 ? 54.968  61.627 46.191 1.00 16.70  ? 378 PHE C CA  1 
ATOM   5654 C C   . PHE C 1 179 ? 54.790  60.258 46.834 1.00 16.36  ? 378 PHE C C   1 
ATOM   5655 O O   . PHE C 1 179 ? 55.585  59.347 46.622 1.00 17.33  ? 378 PHE C O   1 
ATOM   5656 C CB  . PHE C 1 179 ? 55.302  62.654 47.265 1.00 15.69  ? 378 PHE C CB  1 
ATOM   5657 C CG  . PHE C 1 179 ? 56.632  62.435 47.928 1.00 15.16  ? 378 PHE C CG  1 
ATOM   5658 C CD1 . PHE C 1 179 ? 57.798  62.458 47.191 1.00 15.09  ? 378 PHE C CD1 1 
ATOM   5659 C CD2 . PHE C 1 179 ? 56.723  62.261 49.304 1.00 16.28  ? 378 PHE C CD2 1 
ATOM   5660 C CE1 . PHE C 1 179 ? 59.033  62.320 47.813 1.00 15.68  ? 378 PHE C CE1 1 
ATOM   5661 C CE2 . PHE C 1 179 ? 57.962  62.121 49.936 1.00 14.59  ? 378 PHE C CE2 1 
ATOM   5662 C CZ  . PHE C 1 179 ? 59.114  62.152 49.188 1.00 15.39  ? 378 PHE C CZ  1 
ATOM   5663 N N   . VAL C 1 180 ? 53.729  60.126 47.619 1.00 15.11  ? 379 VAL C N   1 
ATOM   5664 C CA  . VAL C 1 180 ? 53.420  58.879 48.296 1.00 13.78  ? 379 VAL C CA  1 
ATOM   5665 C C   . VAL C 1 180 ? 53.106  57.779 47.293 1.00 14.46  ? 379 VAL C C   1 
ATOM   5666 O O   . VAL C 1 180 ? 53.307  56.602 47.569 1.00 14.73  ? 379 VAL C O   1 
ATOM   5667 C CB  . VAL C 1 180 ? 52.217  59.052 49.232 1.00 12.26  ? 379 VAL C CB  1 
ATOM   5668 C CG1 . VAL C 1 180 ? 51.815  57.722 49.818 1.00 9.87   ? 379 VAL C CG1 1 
ATOM   5669 C CG2 . VAL C 1 180 ? 52.564  60.028 50.332 1.00 11.29  ? 379 VAL C CG2 1 
ATOM   5670 N N   . ALA C 1 181 ? 52.609  58.159 46.124 1.00 14.85  ? 380 ALA C N   1 
ATOM   5671 C CA  . ALA C 1 181 ? 52.285  57.171 45.108 1.00 15.88  ? 380 ALA C CA  1 
ATOM   5672 C C   . ALA C 1 181 ? 53.569  56.644 44.492 1.00 17.24  ? 380 ALA C C   1 
ATOM   5673 O O   . ALA C 1 181 ? 53.679  55.458 44.183 1.00 18.45  ? 380 ALA C O   1 
ATOM   5674 C CB  . ALA C 1 181 ? 51.401  57.784 44.031 1.00 14.45  ? 380 ALA C CB  1 
ATOM   5675 N N   . ALA C 1 182 ? 54.548  57.530 44.339 1.00 18.23  ? 381 ALA C N   1 
ATOM   5676 C CA  . ALA C 1 182 ? 55.825  57.170 43.740 1.00 19.44  ? 381 ALA C CA  1 
ATOM   5677 C C   . ALA C 1 182 ? 56.796  56.432 44.664 1.00 20.69  ? 381 ALA C C   1 
ATOM   5678 O O   . ALA C 1 182 ? 57.662  55.695 44.183 1.00 21.16  ? 381 ALA C O   1 
ATOM   5679 C CB  . ALA C 1 182 ? 56.488  58.414 43.184 1.00 17.86  ? 381 ALA C CB  1 
ATOM   5680 N N   . ILE C 1 183 ? 56.674  56.619 45.977 1.00 20.96  ? 382 ILE C N   1 
ATOM   5681 C CA  . ILE C 1 183 ? 57.589  55.934 46.886 1.00 21.14  ? 382 ILE C CA  1 
ATOM   5682 C C   . ILE C 1 183 ? 57.166  54.472 47.027 1.00 21.74  ? 382 ILE C C   1 
ATOM   5683 O O   . ILE C 1 183 ? 58.006  53.586 47.211 1.00 21.94  ? 382 ILE C O   1 
ATOM   5684 C CB  . ILE C 1 183 ? 57.660  56.623 48.292 1.00 19.67  ? 382 ILE C CB  1 
ATOM   5685 C CG1 . ILE C 1 183 ? 56.492  56.197 49.160 1.00 19.20  ? 382 ILE C CG1 1 
ATOM   5686 C CG2 . ILE C 1 183 ? 57.659  58.125 48.151 1.00 19.22  ? 382 ILE C CG2 1 
ATOM   5687 C CD1 . ILE C 1 183 ? 56.892  55.195 50.196 1.00 21.42  ? 382 ILE C CD1 1 
ATOM   5688 N N   . ILE C 1 184 ? 55.864  54.220 46.912 1.00 22.33  ? 383 ILE C N   1 
ATOM   5689 C CA  . ILE C 1 184 ? 55.339  52.860 47.017 1.00 22.75  ? 383 ILE C CA  1 
ATOM   5690 C C   . ILE C 1 184 ? 55.702  52.030 45.787 1.00 23.39  ? 383 ILE C C   1 
ATOM   5691 O O   . ILE C 1 184 ? 56.380  51.009 45.899 1.00 22.12  ? 383 ILE C O   1 
ATOM   5692 C CB  . ILE C 1 184 ? 53.791  52.861 47.209 1.00 20.38  ? 383 ILE C CB  1 
ATOM   5693 C CG1 . ILE C 1 184 ? 53.450  53.158 48.670 1.00 16.81  ? 383 ILE C CG1 1 
ATOM   5694 C CG2 . ILE C 1 184 ? 53.202  51.520 46.799 1.00 19.67  ? 383 ILE C CG2 1 
ATOM   5695 C CD1 . ILE C 1 184 ? 51.974  53.170 48.967 1.00 14.82  ? 383 ILE C CD1 1 
ATOM   5696 N N   . CYS C 1 185 ? 55.262  52.492 44.620 1.00 25.46  ? 384 CYS C N   1 
ATOM   5697 C CA  . CYS C 1 185 ? 55.509  51.809 43.354 1.00 28.16  ? 384 CYS C CA  1 
ATOM   5698 C C   . CYS C 1 185 ? 56.903  52.019 42.769 1.00 30.65  ? 384 CYS C C   1 
ATOM   5699 O O   . CYS C 1 185 ? 57.036  52.611 41.700 1.00 30.45  ? 384 CYS C O   1 
ATOM   5700 C CB  . CYS C 1 185 ? 54.500  52.269 42.306 1.00 28.02  ? 384 CYS C CB  1 
ATOM   5701 S SG  . CYS C 1 185 ? 52.800  52.305 42.843 1.00 29.83  ? 384 CYS C SG  1 
ATOM   5702 N N   . CYS C 1 186 ? 57.941  51.546 43.450 1.00 34.13  ? 385 CYS C N   1 
ATOM   5703 C CA  . CYS C 1 186 ? 59.297  51.689 42.919 1.00 36.87  ? 385 CYS C CA  1 
ATOM   5704 C C   . CYS C 1 186 ? 59.742  50.315 42.425 1.00 38.12  ? 385 CYS C C   1 
ATOM   5705 O O   . CYS C 1 186 ? 59.441  49.298 43.054 1.00 37.91  ? 385 CYS C O   1 
ATOM   5706 C CB  . CYS C 1 186 ? 60.257  52.194 43.993 1.00 37.52  ? 385 CYS C CB  1 
ATOM   5707 S SG  . CYS C 1 186 ? 60.561  50.994 45.272 1.00 41.33  ? 385 CYS C SG  1 
ATOM   5708 N N   . GLY C 1 187 ? 60.458  50.290 41.303 1.00 39.91  ? 386 GLY C N   1 
ATOM   5709 C CA  . GLY C 1 187 ? 60.899  49.032 40.726 1.00 41.18  ? 386 GLY C CA  1 
ATOM   5710 C C   . GLY C 1 187 ? 62.189  48.451 41.263 1.00 42.09  ? 386 GLY C C   1 
ATOM   5711 O O   . GLY C 1 187 ? 62.895  47.748 40.549 1.00 42.52  ? 386 GLY C O   1 
ATOM   5712 N N   . ASP C 1 188 ? 62.505  48.735 42.520 1.00 43.84  ? 387 ASP C N   1 
ATOM   5713 C CA  . ASP C 1 188 ? 63.725  48.210 43.115 1.00 44.76  ? 387 ASP C CA  1 
ATOM   5714 C C   . ASP C 1 188 ? 63.532  47.613 44.512 1.00 44.76  ? 387 ASP C C   1 
ATOM   5715 O O   . ASP C 1 188 ? 64.475  47.549 45.301 1.00 45.30  ? 387 ASP C O   1 
ATOM   5716 C CB  . ASP C 1 188 ? 64.825  49.289 43.136 1.00 46.16  ? 387 ASP C CB  1 
ATOM   5717 C CG  . ASP C 1 188 ? 64.360  50.610 43.747 1.00 48.92  ? 387 ASP C CG  1 
ATOM   5718 O OD1 . ASP C 1 188 ? 63.428  51.241 43.197 1.00 50.44  ? 387 ASP C OD1 1 
ATOM   5719 O OD2 . ASP C 1 188 ? 64.937  51.024 44.776 1.00 49.68  ? 387 ASP C OD2 1 
ATOM   5720 N N   . ARG C 1 189 ? 62.311  47.181 44.822 1.00 44.04  ? 388 ARG C N   1 
ATOM   5721 C CA  . ARG C 1 189 ? 62.044  46.557 46.114 1.00 43.23  ? 388 ARG C CA  1 
ATOM   5722 C C   . ARG C 1 189 ? 62.553  45.140 45.948 1.00 44.17  ? 388 ARG C C   1 
ATOM   5723 O O   . ARG C 1 189 ? 62.431  44.557 44.869 1.00 44.50  ? 388 ARG C O   1 
ATOM   5724 C CB  . ARG C 1 189 ? 60.548  46.524 46.412 1.00 41.81  ? 388 ARG C CB  1 
ATOM   5725 C CG  . ARG C 1 189 ? 59.899  47.890 46.556 1.00 39.76  ? 388 ARG C CG  1 
ATOM   5726 C CD  . ARG C 1 189 ? 60.512  48.695 47.691 1.00 36.45  ? 388 ARG C CD  1 
ATOM   5727 N NE  . ARG C 1 189 ? 59.777  49.934 47.912 1.00 33.32  ? 388 ARG C NE  1 
ATOM   5728 C CZ  . ARG C 1 189 ? 60.227  50.943 48.646 1.00 31.72  ? 388 ARG C CZ  1 
ATOM   5729 N NH1 . ARG C 1 189 ? 61.411  50.860 49.235 1.00 28.97  ? 388 ARG C NH1 1 
ATOM   5730 N NH2 . ARG C 1 189 ? 59.499  52.040 48.772 1.00 31.09  ? 388 ARG C NH2 1 
ATOM   5731 N N   . PRO C 1 190 ? 63.127  44.555 47.005 1.00 44.83  ? 389 PRO C N   1 
ATOM   5732 C CA  . PRO C 1 190 ? 63.619  43.187 46.812 1.00 45.01  ? 389 PRO C CA  1 
ATOM   5733 C C   . PRO C 1 190 ? 62.541  42.110 46.746 1.00 44.38  ? 389 PRO C C   1 
ATOM   5734 O O   . PRO C 1 190 ? 61.642  42.064 47.583 1.00 44.42  ? 389 PRO C O   1 
ATOM   5735 C CB  . PRO C 1 190 ? 64.567  43.001 47.990 1.00 45.07  ? 389 PRO C CB  1 
ATOM   5736 C CG  . PRO C 1 190 ? 63.884  43.789 49.069 1.00 45.23  ? 389 PRO C CG  1 
ATOM   5737 C CD  . PRO C 1 190 ? 63.448  45.055 48.353 1.00 43.97  ? 389 PRO C CD  1 
ATOM   5738 N N   . GLY C 1 191 ? 62.638  41.249 45.739 1.00 43.98  ? 390 GLY C N   1 
ATOM   5739 C CA  . GLY C 1 191 ? 61.678  40.175 45.602 1.00 45.68  ? 390 GLY C CA  1 
ATOM   5740 C C   . GLY C 1 191 ? 60.500  40.476 44.701 1.00 47.51  ? 390 GLY C C   1 
ATOM   5741 O O   . GLY C 1 191 ? 59.403  39.951 44.909 1.00 48.78  ? 390 GLY C O   1 
ATOM   5742 N N   . LEU C 1 192 ? 60.702  41.324 43.701 1.00 47.94  ? 391 LEU C N   1 
ATOM   5743 C CA  . LEU C 1 192 ? 59.611  41.630 42.791 1.00 48.85  ? 391 LEU C CA  1 
ATOM   5744 C C   . LEU C 1 192 ? 59.763  40.747 41.568 1.00 48.54  ? 391 LEU C C   1 
ATOM   5745 O O   . LEU C 1 192 ? 60.841  40.645 40.985 1.00 47.41  ? 391 LEU C O   1 
ATOM   5746 C CB  . LEU C 1 192 ? 59.616  43.117 42.411 1.00 50.40  ? 391 LEU C CB  1 
ATOM   5747 C CG  . LEU C 1 192 ? 59.226  44.102 43.529 1.00 51.31  ? 391 LEU C CG  1 
ATOM   5748 C CD1 . LEU C 1 192 ? 59.546  45.527 43.093 1.00 51.94  ? 391 LEU C CD1 1 
ATOM   5749 C CD2 . LEU C 1 192 ? 57.745  43.956 43.878 1.00 49.87  ? 391 LEU C CD2 1 
ATOM   5750 N N   . LEU C 1 193 ? 58.675  40.086 41.202 1.00 49.59  ? 392 LEU C N   1 
ATOM   5751 C CA  . LEU C 1 193 ? 58.676  39.190 40.061 1.00 51.73  ? 392 LEU C CA  1 
ATOM   5752 C C   . LEU C 1 193 ? 58.599  39.942 38.736 1.00 52.48  ? 392 LEU C C   1 
ATOM   5753 O O   . LEU C 1 193 ? 59.459  39.773 37.868 1.00 53.81  ? 392 LEU C O   1 
ATOM   5754 C CB  . LEU C 1 193 ? 57.494  38.223 40.160 1.00 53.09  ? 392 LEU C CB  1 
ATOM   5755 C CG  . LEU C 1 193 ? 57.348  37.185 39.042 1.00 54.93  ? 392 LEU C CG  1 
ATOM   5756 C CD1 . LEU C 1 193 ? 58.322  36.029 39.284 1.00 55.66  ? 392 LEU C CD1 1 
ATOM   5757 C CD2 . LEU C 1 193 ? 55.911  36.673 38.998 1.00 55.23  ? 392 LEU C CD2 1 
ATOM   5758 N N   . ASN C 1 194 ? 57.565  40.768 38.585 1.00 52.22  ? 393 ASN C N   1 
ATOM   5759 C CA  . ASN C 1 194 ? 57.353  41.533 37.356 1.00 51.40  ? 393 ASN C CA  1 
ATOM   5760 C C   . ASN C 1 194 ? 58.040  42.891 37.407 1.00 50.11  ? 393 ASN C C   1 
ATOM   5761 O O   . ASN C 1 194 ? 57.475  43.896 36.986 1.00 49.40  ? 393 ASN C O   1 
ATOM   5762 C CB  . ASN C 1 194 ? 55.855  41.731 37.124 1.00 52.36  ? 393 ASN C CB  1 
ATOM   5763 C CG  . ASN C 1 194 ? 55.059  40.469 37.378 1.00 53.63  ? 393 ASN C CG  1 
ATOM   5764 O OD1 . ASN C 1 194 ? 55.256  39.453 36.712 1.00 54.56  ? 393 ASN C OD1 1 
ATOM   5765 N ND2 . ASN C 1 194 ? 54.155  40.524 38.354 1.00 54.27  ? 393 ASN C ND2 1 
ATOM   5766 N N   . VAL C 1 195 ? 59.264  42.903 37.924 1.00 49.12  ? 394 VAL C N   1 
ATOM   5767 C CA  . VAL C 1 195 ? 60.067  44.113 38.058 1.00 48.59  ? 394 VAL C CA  1 
ATOM   5768 C C   . VAL C 1 195 ? 59.994  45.082 36.872 1.00 49.12  ? 394 VAL C C   1 
ATOM   5769 O O   . VAL C 1 195 ? 60.561  46.172 36.919 1.00 48.78  ? 394 VAL C O   1 
ATOM   5770 C CB  . VAL C 1 195 ? 61.544  43.723 38.362 1.00 47.63  ? 394 VAL C CB  1 
ATOM   5771 C CG1 . VAL C 1 195 ? 62.526  44.671 37.693 1.00 46.94  ? 394 VAL C CG1 1 
ATOM   5772 C CG2 . VAL C 1 195 ? 61.765  43.743 39.859 1.00 48.32  ? 394 VAL C CG2 1 
ATOM   5773 N N   . GLY C 1 196 ? 59.275  44.700 35.823 1.00 49.51  ? 395 GLY C N   1 
ATOM   5774 C CA  . GLY C 1 196 ? 59.161  45.559 34.661 1.00 51.49  ? 395 GLY C CA  1 
ATOM   5775 C C   . GLY C 1 196 ? 58.009  46.547 34.692 1.00 53.28  ? 395 GLY C C   1 
ATOM   5776 O O   . GLY C 1 196 ? 58.207  47.743 34.478 1.00 52.83  ? 395 GLY C O   1 
ATOM   5777 N N   . HIS C 1 197 ? 56.801  46.051 34.942 1.00 55.51  ? 396 HIS C N   1 
ATOM   5778 C CA  . HIS C 1 197 ? 55.620  46.910 34.995 1.00 57.10  ? 396 HIS C CA  1 
ATOM   5779 C C   . HIS C 1 197 ? 55.768  47.862 36.168 1.00 56.37  ? 396 HIS C C   1 
ATOM   5780 O O   . HIS C 1 197 ? 55.384  49.022 36.081 1.00 57.28  ? 396 HIS C O   1 
ATOM   5781 C CB  . HIS C 1 197 ? 54.348  46.089 35.209 1.00 59.69  ? 396 HIS C CB  1 
ATOM   5782 C CG  . HIS C 1 197 ? 54.390  44.732 34.588 1.00 63.01  ? 396 HIS C CG  1 
ATOM   5783 N ND1 . HIS C 1 197 ? 55.533  43.962 34.563 1.00 64.79  ? 396 HIS C ND1 1 
ATOM   5784 C CD2 . HIS C 1 197 ? 53.417  43.980 34.023 1.00 64.71  ? 396 HIS C CD2 1 
ATOM   5785 C CE1 . HIS C 1 197 ? 55.261  42.794 34.011 1.00 66.18  ? 396 HIS C CE1 1 
ATOM   5786 N NE2 . HIS C 1 197 ? 53.984  42.778 33.675 1.00 66.32  ? 396 HIS C NE2 1 
ATOM   5787 N N   . ILE C 1 198 ? 56.320  47.361 37.269 1.00 54.66  ? 397 ILE C N   1 
ATOM   5788 C CA  . ILE C 1 198 ? 56.499  48.177 38.458 1.00 52.73  ? 397 ILE C CA  1 
ATOM   5789 C C   . ILE C 1 198 ? 57.449  49.317 38.169 1.00 52.68  ? 397 ILE C C   1 
ATOM   5790 O O   . ILE C 1 198 ? 57.290  50.416 38.696 1.00 52.86  ? 397 ILE C O   1 
ATOM   5791 C CB  . ILE C 1 198 ? 57.055  47.356 39.621 1.00 51.45  ? 397 ILE C CB  1 
ATOM   5792 C CG1 . ILE C 1 198 ? 56.230  46.078 39.782 1.00 50.63  ? 397 ILE C CG1 1 
ATOM   5793 C CG2 . ILE C 1 198 ? 57.002  48.179 40.897 1.00 50.61  ? 397 ILE C CG2 1 
ATOM   5794 C CD1 . ILE C 1 198 ? 56.600  45.253 40.987 1.00 49.78  ? 397 ILE C CD1 1 
ATOM   5795 N N   . GLU C 1 199 ? 58.438  49.055 37.325 1.00 52.66  ? 398 GLU C N   1 
ATOM   5796 C CA  . GLU C 1 199 ? 59.398  50.084 36.971 1.00 53.21  ? 398 GLU C CA  1 
ATOM   5797 C C   . GLU C 1 199 ? 58.857  51.053 35.917 1.00 53.04  ? 398 GLU C C   1 
ATOM   5798 O O   . GLU C 1 199 ? 58.997  52.265 36.070 1.00 54.13  ? 398 GLU C O   1 
ATOM   5799 C CB  . GLU C 1 199 ? 60.712  49.452 36.497 1.00 54.64  ? 398 GLU C CB  1 
ATOM   5800 C CG  . GLU C 1 199 ? 61.851  49.610 37.499 1.00 56.17  ? 398 GLU C CG  1 
ATOM   5801 C CD  . GLU C 1 199 ? 63.181  49.055 37.000 1.00 57.13  ? 398 GLU C CD  1 
ATOM   5802 O OE1 . GLU C 1 199 ? 63.343  48.894 35.768 1.00 56.85  ? 398 GLU C OE1 1 
ATOM   5803 O OE2 . GLU C 1 199 ? 64.070  48.796 37.844 1.00 57.32  ? 398 GLU C OE2 1 
ATOM   5804 N N   . LYS C 1 200 ? 58.230  50.542 34.859 1.00 52.00  ? 399 LYS C N   1 
ATOM   5805 C CA  . LYS C 1 200 ? 57.694  51.431 33.825 1.00 50.76  ? 399 LYS C CA  1 
ATOM   5806 C C   . LYS C 1 200 ? 56.420  52.101 34.322 1.00 48.90  ? 399 LYS C C   1 
ATOM   5807 O O   . LYS C 1 200 ? 55.959  53.080 33.740 1.00 48.83  ? 399 LYS C O   1 
ATOM   5808 C CB  . LYS C 1 200 ? 57.396  50.671 32.527 1.00 52.38  ? 399 LYS C CB  1 
ATOM   5809 C CG  . LYS C 1 200 ? 56.066  49.937 32.525 1.00 54.07  ? 399 LYS C CG  1 
ATOM   5810 C CD  . LYS C 1 200 ? 55.865  49.135 31.249 1.00 55.25  ? 399 LYS C CD  1 
ATOM   5811 C CE  . LYS C 1 200 ? 54.657  48.219 31.383 1.00 56.43  ? 399 LYS C CE  1 
ATOM   5812 N NZ  . LYS C 1 200 ? 54.585  47.181 30.316 1.00 56.30  ? 399 LYS C NZ  1 
ATOM   5813 N N   . MET C 1 201 ? 55.849  51.553 35.391 1.00 47.28  ? 400 MET C N   1 
ATOM   5814 C CA  . MET C 1 201 ? 54.640  52.107 35.996 1.00 45.57  ? 400 MET C CA  1 
ATOM   5815 C C   . MET C 1 201 ? 55.107  53.294 36.823 1.00 44.75  ? 400 MET C C   1 
ATOM   5816 O O   . MET C 1 201 ? 54.517  54.373 36.775 1.00 45.54  ? 400 MET C O   1 
ATOM   5817 C CB  . MET C 1 201 ? 53.981  51.076 36.906 1.00 44.50  ? 400 MET C CB  1 
ATOM   5818 C CG  . MET C 1 201 ? 52.719  51.546 37.593 1.00 43.93  ? 400 MET C CG  1 
ATOM   5819 S SD  . MET C 1 201 ? 52.388  50.488 39.012 1.00 46.27  ? 400 MET C SD  1 
ATOM   5820 C CE  . MET C 1 201 ? 50.769  49.841 38.610 1.00 46.39  ? 400 MET C CE  1 
ATOM   5821 N N   . GLN C 1 202 ? 56.177  53.077 37.583 1.00 42.98  ? 401 GLN C N   1 
ATOM   5822 C CA  . GLN C 1 202 ? 56.768  54.119 38.407 1.00 41.44  ? 401 GLN C CA  1 
ATOM   5823 C C   . GLN C 1 202 ? 57.137  55.281 37.510 1.00 41.81  ? 401 GLN C C   1 
ATOM   5824 O O   . GLN C 1 202 ? 57.055  56.442 37.901 1.00 41.67  ? 401 GLN C O   1 
ATOM   5825 C CB  . GLN C 1 202 ? 58.028  53.602 39.087 1.00 40.53  ? 401 GLN C CB  1 
ATOM   5826 C CG  . GLN C 1 202 ? 59.048  54.696 39.350 1.00 40.47  ? 401 GLN C CG  1 
ATOM   5827 C CD  . GLN C 1 202 ? 59.998  54.364 40.483 1.00 40.99  ? 401 GLN C CD  1 
ATOM   5828 O OE1 . GLN C 1 202 ? 60.974  53.632 40.310 1.00 40.78  ? 401 GLN C OE1 1 
ATOM   5829 N NE2 . GLN C 1 202 ? 59.706  54.900 41.663 1.00 40.57  ? 401 GLN C NE2 1 
ATOM   5830 N N   . GLU C 1 203 ? 57.564  54.943 36.302 1.00 43.19  ? 402 GLU C N   1 
ATOM   5831 C CA  . GLU C 1 203 ? 57.951  55.931 35.305 1.00 44.80  ? 402 GLU C CA  1 
ATOM   5832 C C   . GLU C 1 203 ? 56.793  56.918 35.088 1.00 43.45  ? 402 GLU C C   1 
ATOM   5833 O O   . GLU C 1 203 ? 56.988  58.133 35.050 1.00 42.59  ? 402 GLU C O   1 
ATOM   5834 C CB  . GLU C 1 203 ? 58.306  55.210 33.988 1.00 47.61  ? 402 GLU C CB  1 
ATOM   5835 C CG  . GLU C 1 203 ? 58.839  56.101 32.871 1.00 51.80  ? 402 GLU C CG  1 
ATOM   5836 C CD  . GLU C 1 203 ? 59.021  55.357 31.542 1.00 53.89  ? 402 GLU C CD  1 
ATOM   5837 O OE1 . GLU C 1 203 ? 59.941  54.513 31.437 1.00 54.98  ? 402 GLU C OE1 1 
ATOM   5838 O OE2 . GLU C 1 203 ? 58.235  55.617 30.601 1.00 54.74  ? 402 GLU C OE2 1 
ATOM   5839 N N   . GLY C 1 204 ? 55.583  56.383 34.972 1.00 42.25  ? 403 GLY C N   1 
ATOM   5840 C CA  . GLY C 1 204 ? 54.422  57.219 34.743 1.00 40.55  ? 403 GLY C CA  1 
ATOM   5841 C C   . GLY C 1 204 ? 53.961  58.053 35.921 1.00 39.32  ? 403 GLY C C   1 
ATOM   5842 O O   . GLY C 1 204 ? 53.222  59.018 35.741 1.00 40.55  ? 403 GLY C O   1 
ATOM   5843 N N   . ILE C 1 205 ? 54.379  57.687 37.126 1.00 36.91  ? 404 ILE C N   1 
ATOM   5844 C CA  . ILE C 1 205 ? 53.979  58.433 38.309 1.00 34.43  ? 404 ILE C CA  1 
ATOM   5845 C C   . ILE C 1 205 ? 55.035  59.483 38.567 1.00 34.60  ? 404 ILE C C   1 
ATOM   5846 O O   . ILE C 1 205 ? 54.744  60.582 39.041 1.00 35.17  ? 404 ILE C O   1 
ATOM   5847 C CB  . ILE C 1 205 ? 53.870  57.514 39.530 1.00 32.57  ? 404 ILE C CB  1 
ATOM   5848 C CG1 . ILE C 1 205 ? 52.792  56.459 39.280 1.00 30.69  ? 404 ILE C CG1 1 
ATOM   5849 C CG2 . ILE C 1 205 ? 53.549  58.335 40.771 1.00 31.92  ? 404 ILE C CG2 1 
ATOM   5850 C CD1 . ILE C 1 205 ? 52.886  55.261 40.191 1.00 29.03  ? 404 ILE C CD1 1 
ATOM   5851 N N   . VAL C 1 206 ? 56.269  59.125 38.243 1.00 34.36  ? 405 VAL C N   1 
ATOM   5852 C CA  . VAL C 1 206 ? 57.405  60.015 38.414 1.00 34.58  ? 405 VAL C CA  1 
ATOM   5853 C C   . VAL C 1 206 ? 57.369  61.087 37.335 1.00 34.88  ? 405 VAL C C   1 
ATOM   5854 O O   . VAL C 1 206 ? 57.882  62.191 37.518 1.00 33.70  ? 405 VAL C O   1 
ATOM   5855 C CB  . VAL C 1 206 ? 58.720  59.227 38.315 1.00 33.87  ? 405 VAL C CB  1 
ATOM   5856 C CG1 . VAL C 1 206 ? 59.885  60.171 38.106 1.00 34.14  ? 405 VAL C CG1 1 
ATOM   5857 C CG2 . VAL C 1 206 ? 58.922  58.416 39.576 1.00 33.83  ? 405 VAL C CG2 1 
ATOM   5858 N N   . HIS C 1 207 ? 56.758  60.745 36.207 1.00 36.24  ? 406 HIS C N   1 
ATOM   5859 C CA  . HIS C 1 207 ? 56.642  61.672 35.095 1.00 36.86  ? 406 HIS C CA  1 
ATOM   5860 C C   . HIS C 1 207 ? 55.633  62.725 35.493 1.00 35.52  ? 406 HIS C C   1 
ATOM   5861 O O   . HIS C 1 207 ? 55.903  63.922 35.419 1.00 35.36  ? 406 HIS C O   1 
ATOM   5862 C CB  . HIS C 1 207 ? 56.157  60.943 33.839 1.00 39.97  ? 406 HIS C CB  1 
ATOM   5863 C CG  . HIS C 1 207 ? 55.958  61.845 32.659 1.00 42.63  ? 406 HIS C CG  1 
ATOM   5864 N ND1 . HIS C 1 207 ? 57.001  62.497 32.034 1.00 42.89  ? 406 HIS C ND1 1 
ATOM   5865 C CD2 . HIS C 1 207 ? 54.831  62.231 32.013 1.00 43.70  ? 406 HIS C CD2 1 
ATOM   5866 C CE1 . HIS C 1 207 ? 56.524  63.247 31.056 1.00 44.07  ? 406 HIS C CE1 1 
ATOM   5867 N NE2 . HIS C 1 207 ? 55.210  63.104 31.022 1.00 44.20  ? 406 HIS C NE2 1 
ATOM   5868 N N   . VAL C 1 208 ? 54.467  62.257 35.922 1.00 34.24  ? 407 VAL C N   1 
ATOM   5869 C CA  . VAL C 1 208 ? 53.391  63.134 36.348 1.00 33.37  ? 407 VAL C CA  1 
ATOM   5870 C C   . VAL C 1 208 ? 53.793  63.991 37.550 1.00 32.64  ? 407 VAL C C   1 
ATOM   5871 O O   . VAL C 1 208 ? 53.432  65.161 37.622 1.00 32.23  ? 407 VAL C O   1 
ATOM   5872 C CB  . VAL C 1 208 ? 52.124  62.315 36.669 1.00 33.08  ? 407 VAL C CB  1 
ATOM   5873 C CG1 . VAL C 1 208 ? 51.172  63.122 37.515 1.00 33.39  ? 407 VAL C CG1 1 
ATOM   5874 C CG2 . VAL C 1 208 ? 51.442  61.911 35.375 1.00 33.10  ? 407 VAL C CG2 1 
ATOM   5875 N N   . LEU C 1 209 ? 54.534  63.424 38.494 1.00 32.31  ? 408 LEU C N   1 
ATOM   5876 C CA  . LEU C 1 209 ? 54.966  64.218 39.640 1.00 33.82  ? 408 LEU C CA  1 
ATOM   5877 C C   . LEU C 1 209 ? 55.712  65.417 39.077 1.00 35.03  ? 408 LEU C C   1 
ATOM   5878 O O   . LEU C 1 209 ? 55.235  66.545 39.127 1.00 35.52  ? 408 LEU C O   1 
ATOM   5879 C CB  . LEU C 1 209 ? 55.918  63.424 40.557 1.00 33.03  ? 408 LEU C CB  1 
ATOM   5880 C CG  . LEU C 1 209 ? 56.592  64.226 41.690 1.00 30.22  ? 408 LEU C CG  1 
ATOM   5881 C CD1 . LEU C 1 209 ? 55.546  64.659 42.695 1.00 29.75  ? 408 LEU C CD1 1 
ATOM   5882 C CD2 . LEU C 1 209 ? 57.652  63.397 42.381 1.00 27.48  ? 408 LEU C CD2 1 
ATOM   5883 N N   . ARG C 1 210 ? 56.886  65.142 38.524 1.00 36.95  ? 409 ARG C N   1 
ATOM   5884 C CA  . ARG C 1 210 ? 57.752  66.151 37.934 1.00 37.85  ? 409 ARG C CA  1 
ATOM   5885 C C   . ARG C 1 210 ? 57.006  67.233 37.159 1.00 36.55  ? 409 ARG C C   1 
ATOM   5886 O O   . ARG C 1 210 ? 57.375  68.393 37.236 1.00 36.22  ? 409 ARG C O   1 
ATOM   5887 C CB  . ARG C 1 210 ? 58.764  65.471 37.009 1.00 41.34  ? 409 ARG C CB  1 
ATOM   5888 C CG  . ARG C 1 210 ? 59.821  66.379 36.401 1.00 46.38  ? 409 ARG C CG  1 
ATOM   5889 C CD  . ARG C 1 210 ? 60.130  65.923 34.981 1.00 51.61  ? 409 ARG C CD  1 
ATOM   5890 N NE  . ARG C 1 210 ? 60.275  64.467 34.893 1.00 56.95  ? 409 ARG C NE  1 
ATOM   5891 C CZ  . ARG C 1 210 ? 59.886  63.726 33.853 1.00 58.75  ? 409 ARG C CZ  1 
ATOM   5892 N NH1 . ARG C 1 210 ? 59.318  64.300 32.797 1.00 59.75  ? 409 ARG C NH1 1 
ATOM   5893 N NH2 . ARG C 1 210 ? 60.072  62.408 33.864 1.00 58.37  ? 409 ARG C NH2 1 
ATOM   5894 N N   . LEU C 1 211 ? 55.963  66.868 36.419 1.00 35.17  ? 410 LEU C N   1 
ATOM   5895 C CA  . LEU C 1 211 ? 55.227  67.857 35.636 1.00 34.62  ? 410 LEU C CA  1 
ATOM   5896 C C   . LEU C 1 211 ? 54.148  68.638 36.362 1.00 34.45  ? 410 LEU C C   1 
ATOM   5897 O O   . LEU C 1 211 ? 53.852  69.776 35.993 1.00 34.63  ? 410 LEU C O   1 
ATOM   5898 C CB  . LEU C 1 211 ? 54.623  67.219 34.388 1.00 35.41  ? 410 LEU C CB  1 
ATOM   5899 C CG  . LEU C 1 211 ? 55.478  67.353 33.126 1.00 35.62  ? 410 LEU C CG  1 
ATOM   5900 C CD1 . LEU C 1 211 ? 54.614  67.013 31.916 1.00 34.76  ? 410 LEU C CD1 1 
ATOM   5901 C CD2 . LEU C 1 211 ? 56.033  68.782 33.009 1.00 34.34  ? 410 LEU C CD2 1 
ATOM   5902 N N   . HIS C 1 212 ? 53.537  68.026 37.368 1.00 35.27  ? 411 HIS C N   1 
ATOM   5903 C CA  . HIS C 1 212 ? 52.511  68.701 38.160 1.00 35.51  ? 411 HIS C CA  1 
ATOM   5904 C C   . HIS C 1 212 ? 53.268  69.591 39.138 1.00 34.59  ? 411 HIS C C   1 
ATOM   5905 O O   . HIS C 1 212 ? 52.967  70.770 39.314 1.00 33.43  ? 411 HIS C O   1 
ATOM   5906 C CB  . HIS C 1 212 ? 51.673  67.675 38.924 1.00 35.68  ? 411 HIS C CB  1 
ATOM   5907 C CG  . HIS C 1 212 ? 50.841  68.269 40.012 1.00 36.80  ? 411 HIS C CG  1 
ATOM   5908 N ND1 . HIS C 1 212 ? 51.386  68.781 41.170 1.00 37.38  ? 411 HIS C ND1 1 
ATOM   5909 C CD2 . HIS C 1 212 ? 49.504  68.456 40.109 1.00 38.55  ? 411 HIS C CD2 1 
ATOM   5910 C CE1 . HIS C 1 212 ? 50.420  69.259 41.934 1.00 38.46  ? 411 HIS C CE1 1 
ATOM   5911 N NE2 . HIS C 1 212 ? 49.269  69.074 41.314 1.00 39.61  ? 411 HIS C NE2 1 
ATOM   5912 N N   . LEU C 1 213 ? 54.276  68.990 39.750 1.00 34.85  ? 412 LEU C N   1 
ATOM   5913 C CA  . LEU C 1 213 ? 55.140  69.645 40.714 1.00 35.68  ? 412 LEU C CA  1 
ATOM   5914 C C   . LEU C 1 213 ? 55.859  70.804 40.033 1.00 36.35  ? 412 LEU C C   1 
ATOM   5915 O O   . LEU C 1 213 ? 56.264  71.772 40.673 1.00 36.49  ? 412 LEU C O   1 
ATOM   5916 C CB  . LEU C 1 213 ? 56.161  68.618 41.219 1.00 35.67  ? 412 LEU C CB  1 
ATOM   5917 C CG  . LEU C 1 213 ? 56.515  68.502 42.702 1.00 36.00  ? 412 LEU C CG  1 
ATOM   5918 C CD1 . LEU C 1 213 ? 57.902  69.047 42.937 1.00 36.20  ? 412 LEU C CD1 1 
ATOM   5919 C CD2 . LEU C 1 213 ? 55.483  69.225 43.546 1.00 36.45  ? 412 LEU C CD2 1 
ATOM   5920 N N   . GLN C 1 214 ? 55.986  70.700 38.718 1.00 37.78  ? 413 GLN C N   1 
ATOM   5921 C CA  . GLN C 1 214 ? 56.693  71.689 37.919 1.00 38.54  ? 413 GLN C CA  1 
ATOM   5922 C C   . GLN C 1 214 ? 55.843  72.819 37.369 1.00 38.16  ? 413 GLN C C   1 
ATOM   5923 O O   . GLN C 1 214 ? 56.337  73.654 36.623 1.00 38.69  ? 413 GLN C O   1 
ATOM   5924 C CB  . GLN C 1 214 ? 57.377  70.974 36.768 1.00 40.56  ? 413 GLN C CB  1 
ATOM   5925 C CG  . GLN C 1 214 ? 58.493  71.727 36.081 1.00 43.81  ? 413 GLN C CG  1 
ATOM   5926 C CD  . GLN C 1 214 ? 59.100  70.888 34.977 1.00 46.94  ? 413 GLN C CD  1 
ATOM   5927 O OE1 . GLN C 1 214 ? 58.390  70.426 34.073 1.00 48.15  ? 413 GLN C OE1 1 
ATOM   5928 N NE2 . GLN C 1 214 ? 60.415  70.673 35.045 1.00 47.33  ? 413 GLN C NE2 1 
ATOM   5929 N N   . SER C 1 215 ? 54.565  72.845 37.713 1.00 38.26  ? 414 SER C N   1 
ATOM   5930 C CA  . SER C 1 215 ? 53.704  73.914 37.235 1.00 38.95  ? 414 SER C CA  1 
ATOM   5931 C C   . SER C 1 215 ? 52.840  74.376 38.391 1.00 40.51  ? 414 SER C C   1 
ATOM   5932 O O   . SER C 1 215 ? 52.089  75.342 38.274 1.00 41.21  ? 414 SER C O   1 
ATOM   5933 C CB  . SER C 1 215 ? 52.817  73.430 36.090 1.00 37.91  ? 414 SER C CB  1 
ATOM   5934 O OG  . SER C 1 215 ? 51.761  72.621 36.570 1.00 36.09  ? 414 SER C OG  1 
ATOM   5935 N N   . ASN C 1 216 ? 52.952  73.671 39.512 1.00 41.33  ? 415 ASN C N   1 
ATOM   5936 C CA  . ASN C 1 216 ? 52.186  74.002 40.703 1.00 41.77  ? 415 ASN C CA  1 
ATOM   5937 C C   . ASN C 1 216 ? 53.127  74.707 41.659 1.00 40.86  ? 415 ASN C C   1 
ATOM   5938 O O   . ASN C 1 216 ? 52.704  75.329 42.634 1.00 40.85  ? 415 ASN C O   1 
ATOM   5939 C CB  . ASN C 1 216 ? 51.641  72.733 41.356 1.00 45.24  ? 415 ASN C CB  1 
ATOM   5940 C CG  . ASN C 1 216 ? 50.236  72.914 41.902 1.00 47.78  ? 415 ASN C CG  1 
ATOM   5941 O OD1 . ASN C 1 216 ? 49.936  72.503 43.028 1.00 47.56  ? 415 ASN C OD1 1 
ATOM   5942 N ND2 . ASN C 1 216 ? 49.361  73.522 41.097 1.00 49.65  ? 415 ASN C ND2 1 
ATOM   5943 N N   . HIS C 1 217 ? 54.415  74.584 41.370 1.00 39.66  ? 416 HIS C N   1 
ATOM   5944 C CA  . HIS C 1 217 ? 55.454  75.222 42.158 1.00 39.99  ? 416 HIS C CA  1 
ATOM   5945 C C   . HIS C 1 217 ? 56.524  75.680 41.177 1.00 41.60  ? 416 HIS C C   1 
ATOM   5946 O O   . HIS C 1 217 ? 57.688  75.289 41.290 1.00 42.27  ? 416 HIS C O   1 
ATOM   5947 C CB  . HIS C 1 217 ? 56.041  74.236 43.164 1.00 37.77  ? 416 HIS C CB  1 
ATOM   5948 C CG  . HIS C 1 217 ? 55.037  73.714 44.138 1.00 36.41  ? 416 HIS C CG  1 
ATOM   5949 N ND1 . HIS C 1 217 ? 54.010  72.875 43.765 1.00 36.04  ? 416 HIS C ND1 1 
ATOM   5950 C CD2 . HIS C 1 217 ? 54.865  73.957 45.458 1.00 36.03  ? 416 HIS C CD2 1 
ATOM   5951 C CE1 . HIS C 1 217 ? 53.246  72.626 44.813 1.00 35.79  ? 416 HIS C CE1 1 
ATOM   5952 N NE2 . HIS C 1 217 ? 53.743  73.271 45.853 1.00 36.15  ? 416 HIS C NE2 1 
ATOM   5953 N N   . PRO C 1 218 ? 56.137  76.525 40.198 1.00 42.39  ? 417 PRO C N   1 
ATOM   5954 C CA  . PRO C 1 218 ? 57.031  77.059 39.165 1.00 42.65  ? 417 PRO C CA  1 
ATOM   5955 C C   . PRO C 1 218 ? 58.212  77.923 39.627 1.00 43.16  ? 417 PRO C C   1 
ATOM   5956 O O   . PRO C 1 218 ? 59.184  78.091 38.891 1.00 43.22  ? 417 PRO C O   1 
ATOM   5957 C CB  . PRO C 1 218 ? 56.072  77.821 38.251 1.00 42.06  ? 417 PRO C CB  1 
ATOM   5958 C CG  . PRO C 1 218 ? 55.045  78.314 39.196 1.00 41.47  ? 417 PRO C CG  1 
ATOM   5959 C CD  . PRO C 1 218 ? 54.785  77.091 40.038 1.00 42.37  ? 417 PRO C CD  1 
ATOM   5960 N N   . ASP C 1 219 ? 58.147  78.462 40.837 1.00 43.44  ? 418 ASP C N   1 
ATOM   5961 C CA  . ASP C 1 219 ? 59.233  79.304 41.310 1.00 44.01  ? 418 ASP C CA  1 
ATOM   5962 C C   . ASP C 1 219 ? 60.340  78.546 42.032 1.00 43.45  ? 418 ASP C C   1 
ATOM   5963 O O   . ASP C 1 219 ? 61.364  79.119 42.397 1.00 43.36  ? 418 ASP C O   1 
ATOM   5964 C CB  . ASP C 1 219 ? 58.657  80.414 42.177 1.00 47.21  ? 418 ASP C CB  1 
ATOM   5965 C CG  . ASP C 1 219 ? 57.721  81.321 41.393 1.00 49.22  ? 418 ASP C CG  1 
ATOM   5966 O OD1 . ASP C 1 219 ? 58.194  81.975 40.433 1.00 49.54  ? 418 ASP C OD1 1 
ATOM   5967 O OD2 . ASP C 1 219 ? 56.516  81.371 41.729 1.00 51.13  ? 418 ASP C OD2 1 
ATOM   5968 N N   . ASP C 1 220 ? 60.118  77.254 42.238 1.00 43.02  ? 419 ASP C N   1 
ATOM   5969 C CA  . ASP C 1 220 ? 61.097  76.369 42.863 1.00 41.86  ? 419 ASP C CA  1 
ATOM   5970 C C   . ASP C 1 220 ? 61.360  75.424 41.705 1.00 40.70  ? 419 ASP C C   1 
ATOM   5971 O O   . ASP C 1 220 ? 60.691  74.397 41.566 1.00 39.54  ? 419 ASP C O   1 
ATOM   5972 C CB  . ASP C 1 220 ? 60.477  75.593 44.028 1.00 42.46  ? 419 ASP C CB  1 
ATOM   5973 C CG  . ASP C 1 220 ? 61.523  74.996 44.962 1.00 42.89  ? 419 ASP C CG  1 
ATOM   5974 O OD1 . ASP C 1 220 ? 62.571  74.519 44.473 1.00 42.74  ? 419 ASP C OD1 1 
ATOM   5975 O OD2 . ASP C 1 220 ? 61.286  74.992 46.190 1.00 42.42  ? 419 ASP C OD2 1 
ATOM   5976 N N   . ILE C 1 221 ? 62.321  75.787 40.864 1.00 40.01  ? 420 ILE C N   1 
ATOM   5977 C CA  . ILE C 1 221 ? 62.628  74.999 39.676 1.00 39.75  ? 420 ILE C CA  1 
ATOM   5978 C C   . ILE C 1 221 ? 63.429  73.716 39.933 1.00 37.85  ? 420 ILE C C   1 
ATOM   5979 O O   . ILE C 1 221 ? 63.419  72.801 39.112 1.00 37.17  ? 420 ILE C O   1 
ATOM   5980 C CB  . ILE C 1 221 ? 63.333  75.895 38.602 1.00 41.64  ? 420 ILE C CB  1 
ATOM   5981 C CG1 . ILE C 1 221 ? 64.847  75.882 38.792 1.00 42.43  ? 420 ILE C CG1 1 
ATOM   5982 C CG2 . ILE C 1 221 ? 62.807  77.335 38.700 1.00 41.49  ? 420 ILE C CG2 1 
ATOM   5983 C CD1 . ILE C 1 221 ? 65.264  76.021 40.210 1.00 44.09  ? 420 ILE C CD1 1 
ATOM   5984 N N   . PHE C 1 222 ? 64.127  73.654 41.065 1.00 36.22  ? 421 PHE C N   1 
ATOM   5985 C CA  . PHE C 1 222 ? 64.891  72.459 41.437 1.00 34.16  ? 421 PHE C CA  1 
ATOM   5986 C C   . PHE C 1 222 ? 64.146  71.761 42.578 1.00 33.66  ? 421 PHE C C   1 
ATOM   5987 O O   . PHE C 1 222 ? 64.767  71.217 43.495 1.00 32.97  ? 421 PHE C O   1 
ATOM   5988 C CB  . PHE C 1 222 ? 66.304  72.818 41.912 1.00 32.11  ? 421 PHE C CB  1 
ATOM   5989 C CG  . PHE C 1 222 ? 67.209  73.319 40.824 1.00 29.54  ? 421 PHE C CG  1 
ATOM   5990 C CD1 . PHE C 1 222 ? 67.322  72.634 39.613 1.00 26.45  ? 421 PHE C CD1 1 
ATOM   5991 C CD2 . PHE C 1 222 ? 67.976  74.462 41.022 1.00 28.46  ? 421 PHE C CD2 1 
ATOM   5992 C CE1 . PHE C 1 222 ? 68.187  73.079 38.619 1.00 24.54  ? 421 PHE C CE1 1 
ATOM   5993 C CE2 . PHE C 1 222 ? 68.845  74.915 40.029 1.00 28.12  ? 421 PHE C CE2 1 
ATOM   5994 C CZ  . PHE C 1 222 ? 68.949  74.218 38.824 1.00 25.88  ? 421 PHE C CZ  1 
ATOM   5995 N N   . LEU C 1 223 ? 62.812  71.805 42.512 1.00 32.80  ? 422 LEU C N   1 
ATOM   5996 C CA  . LEU C 1 223 ? 61.940  71.196 43.514 1.00 29.69  ? 422 LEU C CA  1 
ATOM   5997 C C   . LEU C 1 223 ? 61.700  69.723 43.208 1.00 29.41  ? 422 LEU C C   1 
ATOM   5998 O O   . LEU C 1 223 ? 61.214  68.986 44.061 1.00 29.44  ? 422 LEU C O   1 
ATOM   5999 C CB  . LEU C 1 223 ? 60.593  71.929 43.583 1.00 26.42  ? 422 LEU C CB  1 
ATOM   6000 C CG  . LEU C 1 223 ? 59.555  71.300 44.520 1.00 24.01  ? 422 LEU C CG  1 
ATOM   6001 C CD1 . LEU C 1 223 ? 60.058  71.339 45.948 1.00 23.40  ? 422 LEU C CD1 1 
ATOM   6002 C CD2 . LEU C 1 223 ? 58.234  72.024 44.405 1.00 22.27  ? 422 LEU C CD2 1 
ATOM   6003 N N   . PHE C 1 224 ? 62.018  69.290 41.989 1.00 29.01  ? 423 PHE C N   1 
ATOM   6004 C CA  . PHE C 1 224 ? 61.850  67.880 41.658 1.00 27.73  ? 423 PHE C CA  1 
ATOM   6005 C C   . PHE C 1 224 ? 63.070  67.111 42.174 1.00 27.77  ? 423 PHE C C   1 
ATOM   6006 O O   . PHE C 1 224 ? 62.934  66.150 42.939 1.00 26.64  ? 423 PHE C O   1 
ATOM   6007 C CB  . PHE C 1 224 ? 61.695  67.651 40.157 1.00 26.55  ? 423 PHE C CB  1 
ATOM   6008 C CG  . PHE C 1 224 ? 61.484  66.218 39.817 1.00 26.57  ? 423 PHE C CG  1 
ATOM   6009 C CD1 . PHE C 1 224 ? 60.375  65.548 40.306 1.00 27.11  ? 423 PHE C CD1 1 
ATOM   6010 C CD2 . PHE C 1 224 ? 62.433  65.505 39.110 1.00 27.73  ? 423 PHE C CD2 1 
ATOM   6011 C CE1 . PHE C 1 224 ? 60.213  64.186 40.109 1.00 27.03  ? 423 PHE C CE1 1 
ATOM   6012 C CE2 . PHE C 1 224 ? 62.278  64.135 38.907 1.00 28.50  ? 423 PHE C CE2 1 
ATOM   6013 C CZ  . PHE C 1 224 ? 61.164  63.477 39.412 1.00 26.91  ? 423 PHE C CZ  1 
ATOM   6014 N N   . PRO C 1 225 ? 64.282  67.513 41.744 1.00 27.66  ? 424 PRO C N   1 
ATOM   6015 C CA  . PRO C 1 225 ? 65.494  66.836 42.209 1.00 26.81  ? 424 PRO C CA  1 
ATOM   6016 C C   . PRO C 1 225 ? 65.627  67.093 43.699 1.00 26.12  ? 424 PRO C C   1 
ATOM   6017 O O   . PRO C 1 225 ? 66.448  66.485 44.382 1.00 25.82  ? 424 PRO C O   1 
ATOM   6018 C CB  . PRO C 1 225 ? 66.599  67.514 41.403 1.00 26.73  ? 424 PRO C CB  1 
ATOM   6019 C CG  . PRO C 1 225 ? 66.037  68.867 41.113 1.00 27.06  ? 424 PRO C CG  1 
ATOM   6020 C CD  . PRO C 1 225 ? 64.626  68.525 40.732 1.00 27.63  ? 424 PRO C CD  1 
ATOM   6021 N N   . LYS C 1 226 ? 64.806  68.017 44.188 1.00 25.52  ? 425 LYS C N   1 
ATOM   6022 C CA  . LYS C 1 226 ? 64.801  68.368 45.595 1.00 25.54  ? 425 LYS C CA  1 
ATOM   6023 C C   . LYS C 1 226 ? 64.044  67.277 46.326 1.00 26.43  ? 425 LYS C C   1 
ATOM   6024 O O   . LYS C 1 226 ? 64.419  66.896 47.437 1.00 27.62  ? 425 LYS C O   1 
ATOM   6025 C CB  . LYS C 1 226 ? 64.111  69.717 45.808 1.00 25.02  ? 425 LYS C CB  1 
ATOM   6026 C CG  . LYS C 1 226 ? 64.974  70.761 46.503 1.00 23.38  ? 425 LYS C CG  1 
ATOM   6027 C CD  . LYS C 1 226 ? 64.336  72.143 46.443 1.00 20.12  ? 425 LYS C CD  1 
ATOM   6028 C CE  . LYS C 1 226 ? 65.321  73.233 46.838 1.00 17.48  ? 425 LYS C CE  1 
ATOM   6029 N NZ  . LYS C 1 226 ? 64.705  74.584 46.795 1.00 12.38  ? 425 LYS C NZ  1 
ATOM   6030 N N   . LEU C 1 227 ? 62.980  66.773 45.700 1.00 25.44  ? 426 LEU C N   1 
ATOM   6031 C CA  . LEU C 1 227 ? 62.185  65.712 46.309 1.00 24.33  ? 426 LEU C CA  1 
ATOM   6032 C C   . LEU C 1 227 ? 62.860  64.349 46.175 1.00 24.86  ? 426 LEU C C   1 
ATOM   6033 O O   . LEU C 1 227 ? 62.920  63.603 47.148 1.00 25.98  ? 426 LEU C O   1 
ATOM   6034 C CB  . LEU C 1 227 ? 60.773  65.662 45.709 1.00 21.20  ? 426 LEU C CB  1 
ATOM   6035 C CG  . LEU C 1 227 ? 59.772  66.694 46.234 1.00 18.06  ? 426 LEU C CG  1 
ATOM   6036 C CD1 . LEU C 1 227 ? 58.456  66.520 45.514 1.00 16.93  ? 426 LEU C CD1 1 
ATOM   6037 C CD2 . LEU C 1 227 ? 59.585  66.531 47.728 1.00 16.17  ? 426 LEU C CD2 1 
ATOM   6038 N N   . LEU C 1 228 ? 63.378  64.020 44.992 1.00 25.00  ? 427 LEU C N   1 
ATOM   6039 C CA  . LEU C 1 228 ? 64.041  62.722 44.808 1.00 24.10  ? 427 LEU C CA  1 
ATOM   6040 C C   . LEU C 1 228 ? 65.098  62.523 45.888 1.00 22.95  ? 427 LEU C C   1 
ATOM   6041 O O   . LEU C 1 228 ? 65.550  61.411 46.134 1.00 21.44  ? 427 LEU C O   1 
ATOM   6042 C CB  . LEU C 1 228 ? 64.704  62.618 43.426 1.00 24.48  ? 427 LEU C CB  1 
ATOM   6043 C CG  . LEU C 1 228 ? 63.891  62.910 42.156 1.00 24.71  ? 427 LEU C CG  1 
ATOM   6044 C CD1 . LEU C 1 228 ? 64.695  62.414 40.972 1.00 25.22  ? 427 LEU C CD1 1 
ATOM   6045 C CD2 . LEU C 1 228 ? 62.540  62.225 42.177 1.00 24.64  ? 427 LEU C CD2 1 
ATOM   6046 N N   . GLN C 1 229 ? 65.496  63.615 46.526 1.00 23.13  ? 428 GLN C N   1 
ATOM   6047 C CA  . GLN C 1 229 ? 66.479  63.544 47.589 1.00 25.26  ? 428 GLN C CA  1 
ATOM   6048 C C   . GLN C 1 229 ? 65.766  63.170 48.881 1.00 26.54  ? 428 GLN C C   1 
ATOM   6049 O O   . GLN C 1 229 ? 66.300  62.422 49.705 1.00 26.84  ? 428 GLN C O   1 
ATOM   6050 C CB  . GLN C 1 229 ? 67.180  64.889 47.755 1.00 27.40  ? 428 GLN C CB  1 
ATOM   6051 C CG  . GLN C 1 229 ? 68.201  64.894 48.883 1.00 30.67  ? 428 GLN C CG  1 
ATOM   6052 C CD  . GLN C 1 229 ? 69.261  63.819 48.711 1.00 32.94  ? 428 GLN C CD  1 
ATOM   6053 O OE1 . GLN C 1 229 ? 70.114  63.900 47.816 1.00 35.54  ? 428 GLN C OE1 1 
ATOM   6054 N NE2 . GLN C 1 229 ? 69.207  62.797 49.562 1.00 31.03  ? 428 GLN C NE2 1 
ATOM   6055 N N   . LYS C 1 230 ? 64.556  63.708 49.047 1.00 27.80  ? 429 LYS C N   1 
ATOM   6056 C CA  . LYS C 1 230 ? 63.710  63.446 50.217 1.00 26.17  ? 429 LYS C CA  1 
ATOM   6057 C C   . LYS C 1 230 ? 63.301  61.981 50.226 1.00 26.13  ? 429 LYS C C   1 
ATOM   6058 O O   . LYS C 1 230 ? 63.201  61.372 51.281 1.00 25.84  ? 429 LYS C O   1 
ATOM   6059 C CB  . LYS C 1 230 ? 62.447  64.319 50.183 1.00 23.33  ? 429 LYS C CB  1 
ATOM   6060 C CG  . LYS C 1 230 ? 62.694  65.804 50.380 1.00 19.25  ? 429 LYS C CG  1 
ATOM   6061 C CD  . LYS C 1 230 ? 63.526  66.052 51.628 1.00 17.48  ? 429 LYS C CD  1 
ATOM   6062 C CE  . LYS C 1 230 ? 63.254  67.428 52.210 1.00 16.12  ? 429 LYS C CE  1 
ATOM   6063 N NZ  . LYS C 1 230 ? 64.260  67.814 53.229 1.00 13.74  ? 429 LYS C NZ  1 
ATOM   6064 N N   . MET C 1 231 ? 63.058  61.427 49.041 1.00 26.77  ? 430 MET C N   1 
ATOM   6065 C CA  . MET C 1 231 ? 62.683  60.024 48.905 1.00 27.86  ? 430 MET C CA  1 
ATOM   6066 C C   . MET C 1 231 ? 63.834  59.130 49.350 1.00 28.96  ? 430 MET C C   1 
ATOM   6067 O O   . MET C 1 231 ? 63.619  57.985 49.746 1.00 29.64  ? 430 MET C O   1 
ATOM   6068 C CB  . MET C 1 231 ? 62.367  59.668 47.451 1.00 28.11  ? 430 MET C CB  1 
ATOM   6069 C CG  . MET C 1 231 ? 61.081  60.221 46.877 1.00 28.73  ? 430 MET C CG  1 
ATOM   6070 S SD  . MET C 1 231 ? 60.882  59.683 45.167 1.00 29.82  ? 430 MET C SD  1 
ATOM   6071 C CE  . MET C 1 231 ? 59.200  59.069 45.160 1.00 30.66  ? 430 MET C CE  1 
ATOM   6072 N N   . ALA C 1 232 ? 65.057  59.643 49.257 1.00 29.03  ? 431 ALA C N   1 
ATOM   6073 C CA  . ALA C 1 232 ? 66.227  58.873 49.640 1.00 29.26  ? 431 ALA C CA  1 
ATOM   6074 C C   . ALA C 1 232 ? 66.560  59.090 51.108 1.00 30.06  ? 431 ALA C C   1 
ATOM   6075 O O   . ALA C 1 232 ? 67.285  58.302 51.713 1.00 31.11  ? 431 ALA C O   1 
ATOM   6076 C CB  . ALA C 1 232 ? 67.406  59.254 48.768 1.00 28.69  ? 431 ALA C CB  1 
ATOM   6077 N N   . ASP C 1 233 ? 66.029  60.162 51.681 1.00 30.89  ? 432 ASP C N   1 
ATOM   6078 C CA  . ASP C 1 233 ? 66.277  60.453 53.087 1.00 32.39  ? 432 ASP C CA  1 
ATOM   6079 C C   . ASP C 1 233 ? 65.310  59.638 53.930 1.00 32.62  ? 432 ASP C C   1 
ATOM   6080 O O   . ASP C 1 233 ? 65.543  59.415 55.120 1.00 32.35  ? 432 ASP C O   1 
ATOM   6081 C CB  . ASP C 1 233 ? 66.061  61.940 53.376 1.00 33.89  ? 432 ASP C CB  1 
ATOM   6082 C CG  . ASP C 1 233 ? 67.011  62.828 52.615 1.00 34.94  ? 432 ASP C CG  1 
ATOM   6083 O OD1 . ASP C 1 233 ? 67.855  62.296 51.865 1.00 37.94  ? 432 ASP C OD1 1 
ATOM   6084 O OD2 . ASP C 1 233 ? 66.912  64.061 52.771 1.00 35.25  ? 432 ASP C OD2 1 
ATOM   6085 N N   . LEU C 1 234 ? 64.218  59.209 53.296 1.00 32.54  ? 433 LEU C N   1 
ATOM   6086 C CA  . LEU C 1 234 ? 63.181  58.419 53.956 1.00 32.39  ? 433 LEU C CA  1 
ATOM   6087 C C   . LEU C 1 234 ? 63.521  56.931 53.998 1.00 33.31  ? 433 LEU C C   1 
ATOM   6088 O O   . LEU C 1 234 ? 62.979  56.192 54.823 1.00 33.58  ? 433 LEU C O   1 
ATOM   6089 C CB  . LEU C 1 234 ? 61.826  58.623 53.262 1.00 29.80  ? 433 LEU C CB  1 
ATOM   6090 C CG  . LEU C 1 234 ? 61.122  59.965 53.490 1.00 28.61  ? 433 LEU C CG  1 
ATOM   6091 C CD1 . LEU C 1 234 ? 59.846  60.003 52.675 1.00 27.48  ? 433 LEU C CD1 1 
ATOM   6092 C CD2 . LEU C 1 234 ? 60.816  60.161 54.972 1.00 28.36  ? 433 LEU C CD2 1 
ATOM   6093 N N   . ARG C 1 235 ? 64.405  56.492 53.103 1.00 33.41  ? 434 ARG C N   1 
ATOM   6094 C CA  . ARG C 1 235 ? 64.819  55.097 53.079 1.00 32.65  ? 434 ARG C CA  1 
ATOM   6095 C C   . ARG C 1 235 ? 65.865  54.938 54.150 1.00 32.63  ? 434 ARG C C   1 
ATOM   6096 O O   . ARG C 1 235 ? 66.125  53.837 54.631 1.00 34.29  ? 434 ARG C O   1 
ATOM   6097 C CB  . ARG C 1 235 ? 65.425  54.720 51.738 1.00 32.63  ? 434 ARG C CB  1 
ATOM   6098 C CG  . ARG C 1 235 ? 64.406  54.587 50.627 1.00 35.44  ? 434 ARG C CG  1 
ATOM   6099 C CD  . ARG C 1 235 ? 64.857  53.548 49.617 1.00 37.03  ? 434 ARG C CD  1 
ATOM   6100 N NE  . ARG C 1 235 ? 63.898  53.405 48.528 1.00 39.21  ? 434 ARG C NE  1 
ATOM   6101 C CZ  . ARG C 1 235 ? 64.095  52.638 47.462 1.00 40.50  ? 434 ARG C CZ  1 
ATOM   6102 N NH1 . ARG C 1 235 ? 65.220  51.941 47.348 1.00 40.81  ? 434 ARG C NH1 1 
ATOM   6103 N NH2 . ARG C 1 235 ? 63.178  52.581 46.504 1.00 40.96  ? 434 ARG C NH2 1 
ATOM   6104 N N   . GLN C 1 236 ? 66.464  56.063 54.513 1.00 31.95  ? 435 GLN C N   1 
ATOM   6105 C CA  . GLN C 1 236 ? 67.491  56.108 55.537 1.00 32.14  ? 435 GLN C CA  1 
ATOM   6106 C C   . GLN C 1 236 ? 66.823  56.374 56.891 1.00 31.99  ? 435 GLN C C   1 
ATOM   6107 O O   . GLN C 1 236 ? 67.253  55.857 57.921 1.00 31.14  ? 435 GLN C O   1 
ATOM   6108 C CB  . GLN C 1 236 ? 68.494  57.215 55.179 1.00 32.68  ? 435 GLN C CB  1 
ATOM   6109 C CG  . GLN C 1 236 ? 69.557  57.534 56.222 1.00 33.22  ? 435 GLN C CG  1 
ATOM   6110 C CD  . GLN C 1 236 ? 70.475  56.373 56.505 1.00 33.71  ? 435 GLN C CD  1 
ATOM   6111 O OE1 . GLN C 1 236 ? 70.927  55.695 55.586 1.00 34.50  ? 435 GLN C OE1 1 
ATOM   6112 N NE2 . GLN C 1 236 ? 70.768  56.142 57.784 1.00 33.45  ? 435 GLN C NE2 1 
ATOM   6113 N N   . LEU C 1 237 ? 65.756  57.169 56.876 1.00 31.98  ? 436 LEU C N   1 
ATOM   6114 C CA  . LEU C 1 237 ? 65.036  57.498 58.099 1.00 32.07  ? 436 LEU C CA  1 
ATOM   6115 C C   . LEU C 1 237 ? 64.370  56.243 58.632 1.00 32.26  ? 436 LEU C C   1 
ATOM   6116 O O   . LEU C 1 237 ? 64.274  56.039 59.839 1.00 32.33  ? 436 LEU C O   1 
ATOM   6117 C CB  . LEU C 1 237 ? 63.971  58.562 57.825 1.00 31.42  ? 436 LEU C CB  1 
ATOM   6118 C CG  . LEU C 1 237 ? 63.367  59.259 59.047 1.00 30.48  ? 436 LEU C CG  1 
ATOM   6119 C CD1 . LEU C 1 237 ? 64.443  60.113 59.705 1.00 31.78  ? 436 LEU C CD1 1 
ATOM   6120 C CD2 . LEU C 1 237 ? 62.188  60.122 58.636 1.00 28.88  ? 436 LEU C CD2 1 
ATOM   6121 N N   . VAL C 1 238 ? 63.903  55.406 57.716 1.00 33.00  ? 437 VAL C N   1 
ATOM   6122 C CA  . VAL C 1 238 ? 63.251  54.157 58.078 1.00 34.34  ? 437 VAL C CA  1 
ATOM   6123 C C   . VAL C 1 238 ? 64.292  53.223 58.688 1.00 36.18  ? 437 VAL C C   1 
ATOM   6124 O O   . VAL C 1 238 ? 64.096  52.665 59.770 1.00 35.84  ? 437 VAL C O   1 
ATOM   6125 C CB  . VAL C 1 238 ? 62.619  53.494 56.829 1.00 33.40  ? 437 VAL C CB  1 
ATOM   6126 C CG1 . VAL C 1 238 ? 62.287  52.056 57.109 1.00 33.76  ? 437 VAL C CG1 1 
ATOM   6127 C CG2 . VAL C 1 238 ? 61.360  54.235 56.434 1.00 32.87  ? 437 VAL C CG2 1 
ATOM   6128 N N   . THR C 1 239 ? 65.404  53.071 57.979 1.00 38.66  ? 438 THR C N   1 
ATOM   6129 C CA  . THR C 1 239 ? 66.509  52.225 58.406 1.00 41.22  ? 438 THR C CA  1 
ATOM   6130 C C   . THR C 1 239 ? 66.825  52.368 59.895 1.00 42.99  ? 438 THR C C   1 
ATOM   6131 O O   . THR C 1 239 ? 66.782  51.396 60.650 1.00 43.44  ? 438 THR C O   1 
ATOM   6132 C CB  . THR C 1 239 ? 67.777  52.555 57.570 1.00 41.59  ? 438 THR C CB  1 
ATOM   6133 O OG1 . THR C 1 239 ? 68.025  51.492 56.646 1.00 41.47  ? 438 THR C OG1 1 
ATOM   6134 C CG2 . THR C 1 239 ? 69.007  52.773 58.464 1.00 42.32  ? 438 THR C CG2 1 
ATOM   6135 N N   . GLU C 1 240 ? 67.133  53.591 60.305 1.00 44.58  ? 439 GLU C N   1 
ATOM   6136 C CA  . GLU C 1 240 ? 67.484  53.884 61.684 1.00 46.33  ? 439 GLU C CA  1 
ATOM   6137 C C   . GLU C 1 240 ? 66.317  53.641 62.636 1.00 47.15  ? 439 GLU C C   1 
ATOM   6138 O O   . GLU C 1 240 ? 66.510  53.122 63.732 1.00 46.28  ? 439 GLU C O   1 
ATOM   6139 C CB  . GLU C 1 240 ? 67.985  55.325 61.756 1.00 47.63  ? 439 GLU C CB  1 
ATOM   6140 C CG  . GLU C 1 240 ? 68.947  55.624 60.609 1.00 50.73  ? 439 GLU C CG  1 
ATOM   6141 C CD  . GLU C 1 240 ? 69.364  57.086 60.501 1.00 52.15  ? 439 GLU C CD  1 
ATOM   6142 O OE1 . GLU C 1 240 ? 68.476  57.962 60.417 1.00 53.75  ? 439 GLU C OE1 1 
ATOM   6143 O OE2 . GLU C 1 240 ? 70.586  57.358 60.481 1.00 51.72  ? 439 GLU C OE2 1 
ATOM   6144 N N   . HIS C 1 241 ? 65.105  53.995 62.218 1.00 48.69  ? 440 HIS C N   1 
ATOM   6145 C CA  . HIS C 1 241 ? 63.938  53.782 63.068 1.00 49.97  ? 440 HIS C CA  1 
ATOM   6146 C C   . HIS C 1 241 ? 63.706  52.302 63.264 1.00 52.09  ? 440 HIS C C   1 
ATOM   6147 O O   . HIS C 1 241 ? 63.195  51.879 64.296 1.00 52.51  ? 440 HIS C O   1 
ATOM   6148 C CB  . HIS C 1 241 ? 62.682  54.411 62.466 1.00 47.87  ? 440 HIS C CB  1 
ATOM   6149 C CG  . HIS C 1 241 ? 61.427  54.088 63.222 1.00 45.80  ? 440 HIS C CG  1 
ATOM   6150 N ND1 . HIS C 1 241 ? 60.697  52.940 63.000 1.00 44.32  ? 440 HIS C ND1 1 
ATOM   6151 C CD2 . HIS C 1 241 ? 60.788  54.753 64.214 1.00 45.09  ? 440 HIS C CD2 1 
ATOM   6152 C CE1 . HIS C 1 241 ? 59.662  52.914 63.820 1.00 44.60  ? 440 HIS C CE1 1 
ATOM   6153 N NE2 . HIS C 1 241 ? 59.694  54.002 64.568 1.00 44.50  ? 440 HIS C NE2 1 
ATOM   6154 N N   . ALA C 1 242 ? 64.073  51.517 62.260 1.00 55.21  ? 441 ALA C N   1 
ATOM   6155 C CA  . ALA C 1 242 ? 63.916  50.074 62.333 1.00 58.95  ? 441 ALA C CA  1 
ATOM   6156 C C   . ALA C 1 242 ? 65.037  49.524 63.210 1.00 62.02  ? 441 ALA C C   1 
ATOM   6157 O O   . ALA C 1 242 ? 64.853  48.568 63.967 1.00 62.03  ? 441 ALA C O   1 
ATOM   6158 C CB  . ALA C 1 242 ? 63.998  49.478 60.943 1.00 57.92  ? 441 ALA C CB  1 
ATOM   6159 N N   . GLN C 1 243 ? 66.197  50.161 63.109 1.00 65.61  ? 442 GLN C N   1 
ATOM   6160 C CA  . GLN C 1 243 ? 67.379  49.763 63.859 1.00 69.30  ? 442 GLN C CA  1 
ATOM   6161 C C   . GLN C 1 243 ? 67.556  50.622 65.127 1.00 70.89  ? 442 GLN C C   1 
ATOM   6162 O O   . GLN C 1 243 ? 68.673  50.908 65.566 1.00 70.99  ? 442 GLN C O   1 
ATOM   6163 C CB  . GLN C 1 243 ? 68.587  49.864 62.920 1.00 70.20  ? 442 GLN C CB  1 
ATOM   6164 C CG  . GLN C 1 243 ? 69.929  49.461 63.497 1.00 71.32  ? 442 GLN C CG  1 
ATOM   6165 C CD  . GLN C 1 243 ? 70.897  50.616 63.458 1.00 71.92  ? 442 GLN C CD  1 
ATOM   6166 O OE1 . GLN C 1 243 ? 70.830  51.461 62.558 1.00 72.34  ? 442 GLN C OE1 1 
ATOM   6167 N NE2 . GLN C 1 243 ? 71.810  50.663 64.424 1.00 71.39  ? 442 GLN C NE2 1 
ATOM   6168 N N   . LEU C 1 244 ? 66.426  51.025 65.701 1.00 72.64  ? 443 LEU C N   1 
ATOM   6169 C CA  . LEU C 1 244 ? 66.372  51.830 66.923 1.00 74.53  ? 443 LEU C CA  1 
ATOM   6170 C C   . LEU C 1 244 ? 65.125  51.379 67.668 1.00 76.74  ? 443 LEU C C   1 
ATOM   6171 O O   . LEU C 1 244 ? 64.683  52.005 68.627 1.00 76.53  ? 443 LEU C O   1 
ATOM   6172 C CB  . LEU C 1 244 ? 66.260  53.321 66.595 1.00 73.29  ? 443 LEU C CB  1 
ATOM   6173 C CG  . LEU C 1 244 ? 65.914  54.283 67.741 1.00 71.90  ? 443 LEU C CG  1 
ATOM   6174 C CD1 . LEU C 1 244 ? 67.064  54.379 68.731 1.00 71.05  ? 443 LEU C CD1 1 
ATOM   6175 C CD2 . LEU C 1 244 ? 65.595  55.649 67.165 1.00 71.49  ? 443 LEU C CD2 1 
ATOM   6176 N N   . VAL C 1 245 ? 64.548  50.290 67.180 1.00 80.18  ? 444 VAL C N   1 
ATOM   6177 C CA  . VAL C 1 245 ? 63.366  49.685 67.776 1.00 83.77  ? 444 VAL C CA  1 
ATOM   6178 C C   . VAL C 1 245 ? 63.788  48.252 68.063 1.00 86.66  ? 444 VAL C C   1 
ATOM   6179 O O   . VAL C 1 245 ? 63.219  47.577 68.922 1.00 87.64  ? 444 VAL C O   1 
ATOM   6180 C CB  . VAL C 1 245 ? 62.159  49.718 66.807 1.00 83.14  ? 444 VAL C CB  1 
ATOM   6181 C CG1 . VAL C 1 245 ? 61.083  48.742 67.260 1.00 82.13  ? 444 VAL C CG1 1 
ATOM   6182 C CG2 . VAL C 1 245 ? 61.589  51.125 66.762 1.00 82.77  ? 444 VAL C CG2 1 
ATOM   6183 N N   . GLN C 1 246 ? 64.805  47.801 67.330 1.00 89.19  ? 445 GLN C N   1 
ATOM   6184 C CA  . GLN C 1 246 ? 65.361  46.470 67.524 1.00 91.40  ? 445 GLN C CA  1 
ATOM   6185 C C   . GLN C 1 246 ? 66.250  46.629 68.753 1.00 92.90  ? 445 GLN C C   1 
ATOM   6186 O O   . GLN C 1 246 ? 67.443  46.325 68.737 1.00 92.98  ? 445 GLN C O   1 
ATOM   6187 C CB  . GLN C 1 246 ? 66.198  46.051 66.315 1.00 91.86  ? 445 GLN C CB  1 
ATOM   6188 C CG  . GLN C 1 246 ? 66.796  44.661 66.445 1.00 92.16  ? 445 GLN C CG  1 
ATOM   6189 C CD  . GLN C 1 246 ? 65.739  43.577 66.519 1.00 92.12  ? 445 GLN C CD  1 
ATOM   6190 O OE1 . GLN C 1 246 ? 66.008  42.464 66.974 1.00 92.36  ? 445 GLN C OE1 1 
ATOM   6191 N NE2 . GLN C 1 246 ? 64.532  43.893 66.062 1.00 91.66  ? 445 GLN C NE2 1 
ATOM   6192 N N   . ILE C 1 247 ? 65.631  47.159 69.801 1.00 94.63  ? 446 ILE C N   1 
ATOM   6193 C CA  . ILE C 1 247 ? 66.239  47.427 71.098 1.00 96.51  ? 446 ILE C CA  1 
ATOM   6194 C C   . ILE C 1 247 ? 65.007  47.482 71.995 1.00 97.89  ? 446 ILE C C   1 
ATOM   6195 O O   . ILE C 1 247 ? 64.929  48.237 72.966 1.00 97.97  ? 446 ILE C O   1 
ATOM   6196 C CB  . ILE C 1 247 ? 66.993  48.792 71.098 1.00 96.62  ? 446 ILE C CB  1 
ATOM   6197 C CG1 . ILE C 1 247 ? 68.310  48.657 70.328 1.00 96.56  ? 446 ILE C CG1 1 
ATOM   6198 C CG2 . ILE C 1 247 ? 67.283  49.249 72.519 1.00 97.06  ? 446 ILE C CG2 1 
ATOM   6199 C CD1 . ILE C 1 247 ? 69.060  49.962 70.153 1.00 96.00  ? 446 ILE C CD1 1 
ATOM   6200 N N   . ILE C 1 248 ? 64.027  46.672 71.608 1.00 99.56  ? 447 ILE C N   1 
ATOM   6201 C CA  . ILE C 1 248 ? 62.755  46.537 72.305 1.00 101.30 ? 447 ILE C CA  1 
ATOM   6202 C C   . ILE C 1 248 ? 62.183  45.198 71.854 1.00 103.07 ? 447 ILE C C   1 
ATOM   6203 O O   . ILE C 1 248 ? 61.142  45.141 71.201 1.00 103.33 ? 447 ILE C O   1 
ATOM   6204 C CB  . ILE C 1 248 ? 61.747  47.640 71.912 1.00 100.82 ? 447 ILE C CB  1 
ATOM   6205 C CG1 . ILE C 1 248 ? 62.388  49.023 72.035 1.00 100.88 ? 447 ILE C CG1 1 
ATOM   6206 C CG2 . ILE C 1 248 ? 60.527  47.559 72.815 1.00 100.25 ? 447 ILE C CG2 1 
ATOM   6207 C CD1 . ILE C 1 248 ? 61.524  50.143 71.505 1.00 100.61 ? 447 ILE C CD1 1 
ATOM   6208 N N   . LYS C 1 249 ? 62.894  44.126 72.182 1.00 105.21 ? 448 LYS C N   1 
ATOM   6209 C CA  . LYS C 1 249 ? 62.476  42.775 71.829 1.00 107.35 ? 448 LYS C CA  1 
ATOM   6210 C C   . LYS C 1 249 ? 63.113  41.841 72.851 1.00 108.55 ? 448 LYS C C   1 
ATOM   6211 O O   . LYS C 1 249 ? 62.502  40.864 73.294 1.00 108.86 ? 448 LYS C O   1 
ATOM   6212 C CB  . LYS C 1 249 ? 62.949  42.424 70.421 1.00 107.60 ? 448 LYS C CB  1 
ATOM   6213 C CG  . LYS C 1 249 ? 62.311  41.161 69.873 1.00 108.42 ? 448 LYS C CG  1 
ATOM   6214 C CD  . LYS C 1 249 ? 63.363  40.149 69.459 1.00 109.04 ? 448 LYS C CD  1 
ATOM   6215 C CE  . LYS C 1 249 ? 62.717  38.849 69.016 1.00 109.15 ? 448 LYS C CE  1 
ATOM   6216 N NZ  . LYS C 1 249 ? 63.742  37.840 68.648 1.00 109.41 ? 448 LYS C NZ  1 
ATOM   6217 N N   . LYS C 1 250 ? 64.356  42.157 73.209 1.00 109.60 ? 449 LYS C N   1 
ATOM   6218 C CA  . LYS C 1 250 ? 65.103  41.412 74.213 1.00 110.60 ? 449 LYS C CA  1 
ATOM   6219 C C   . LYS C 1 250 ? 65.631  42.410 75.249 1.00 112.09 ? 449 LYS C C   1 
ATOM   6220 O O   . LYS C 1 250 ? 66.194  42.016 76.270 1.00 112.08 ? 449 LYS C O   1 
ATOM   6221 C CB  . LYS C 1 250 ? 66.254  40.624 73.570 1.00 109.61 ? 449 LYS C CB  1 
ATOM   6222 C CG  . LYS C 1 250 ? 65.813  39.289 72.981 1.00 108.59 ? 449 LYS C CG  1 
ATOM   6223 C CD  . LYS C 1 250 ? 66.969  38.471 72.426 1.00 107.47 ? 449 LYS C CD  1 
ATOM   6224 C CE  . LYS C 1 250 ? 66.492  37.088 72.012 1.00 106.78 ? 449 LYS C CE  1 
ATOM   6225 N NZ  . LYS C 1 250 ? 65.300  37.170 71.127 1.00 106.15 ? 449 LYS C NZ  1 
ATOM   6226 N N   . THR C 1 251 ? 65.418  43.702 74.983 1.00 113.91 ? 450 THR C N   1 
ATOM   6227 C CA  . THR C 1 251 ? 65.846  44.802 75.867 1.00 115.82 ? 450 THR C CA  1 
ATOM   6228 C C   . THR C 1 251 ? 64.640  45.466 76.550 1.00 117.75 ? 450 THR C C   1 
ATOM   6229 O O   . THR C 1 251 ? 64.739  46.488 77.226 1.00 117.73 ? 450 THR C O   1 
ATOM   6230 C CB  . THR C 1 251 ? 66.637  45.856 75.068 1.00 115.19 ? 450 THR C CB  1 
ATOM   6231 O OG1 . THR C 1 251 ? 67.860  45.272 74.610 1.00 114.85 ? 450 THR C OG1 1 
ATOM   6232 C CG2 . THR C 1 251 ? 66.958  47.067 75.926 1.00 114.55 ? 450 THR C CG2 1 
ATOM   6233 N N   . GLU C 1 252 ? 63.503  44.835 76.334 1.00 120.53 ? 451 GLU C N   1 
ATOM   6234 C CA  . GLU C 1 252 ? 62.192  45.179 76.854 1.00 122.81 ? 451 GLU C CA  1 
ATOM   6235 C C   . GLU C 1 252 ? 61.604  43.945 76.191 1.00 124.58 ? 451 GLU C C   1 
ATOM   6236 O O   . GLU C 1 252 ? 62.154  43.452 75.207 1.00 125.56 ? 451 GLU C O   1 
ATOM   6237 C CB  . GLU C 1 252 ? 61.620  46.467 76.226 1.00 122.76 ? 451 GLU C CB  1 
ATOM   6238 C CG  . GLU C 1 252 ? 62.286  47.784 76.635 1.00 123.02 ? 451 GLU C CG  1 
ATOM   6239 C CD  . GLU C 1 252 ? 61.704  48.427 77.900 1.00 122.95 ? 451 GLU C CD  1 
ATOM   6240 O OE1 . GLU C 1 252 ? 60.465  48.460 78.047 1.00 123.03 ? 451 GLU C OE1 1 
ATOM   6241 O OE2 . GLU C 1 252 ? 62.488  48.926 78.737 1.00 122.94 ? 451 GLU C OE2 1 
ATOM   6242 N N   . SER C 1 253 ? 60.539  43.407 76.742 1.00 125.99 ? 452 SER C N   1 
ATOM   6243 C CA  . SER C 1 253 ? 59.930  42.219 76.184 1.00 127.71 ? 452 SER C CA  1 
ATOM   6244 C C   . SER C 1 253 ? 58.651  42.228 76.953 1.00 128.99 ? 452 SER C C   1 
ATOM   6245 O O   . SER C 1 253 ? 58.293  41.269 77.630 1.00 129.18 ? 452 SER C O   1 
ATOM   6246 C CB  . SER C 1 253 ? 60.743  40.964 76.516 1.00 127.58 ? 452 SER C CB  1 
ATOM   6247 O OG  . SER C 1 253 ? 61.193  40.300 75.345 1.00 127.55 ? 452 SER C OG  1 
ATOM   6248 N N   . ASP C 1 254 ? 58.025  43.392 76.923 1.00 130.57 ? 453 ASP C N   1 
ATOM   6249 C CA  . ASP C 1 254 ? 56.746  43.588 77.552 1.00 131.84 ? 453 ASP C CA  1 
ATOM   6250 C C   . ASP C 1 254 ? 55.982  44.082 76.332 1.00 132.70 ? 453 ASP C C   1 
ATOM   6251 O O   . ASP C 1 254 ? 55.297  43.295 75.679 1.00 132.43 ? 453 ASP C O   1 
ATOM   6252 C CB  . ASP C 1 254 ? 56.828  44.606 78.718 1.00 131.48 ? 453 ASP C CB  1 
ATOM   6253 C CG  . ASP C 1 254 ? 57.114  46.028 78.271 1.00 131.18 ? 453 ASP C CG  1 
ATOM   6254 O OD1 . ASP C 1 254 ? 58.245  46.316 77.826 1.00 131.41 ? 453 ASP C OD1 1 
ATOM   6255 O OD2 . ASP C 1 254 ? 56.192  46.864 78.380 1.00 130.71 ? 453 ASP C OD2 1 
ATOM   6256 N N   . ALA C 1 255 ? 56.147  45.348 75.967 1.00 133.74 ? 454 ALA C N   1 
ATOM   6257 C CA  . ALA C 1 255 ? 55.469  45.846 74.785 1.00 134.94 ? 454 ALA C CA  1 
ATOM   6258 C C   . ALA C 1 255 ? 56.086  45.192 73.548 1.00 135.94 ? 454 ALA C C   1 
ATOM   6259 O O   . ALA C 1 255 ? 57.304  45.189 73.365 1.00 135.80 ? 454 ALA C O   1 
ATOM   6260 C CB  . ALA C 1 255 ? 55.590  47.358 74.699 1.00 134.48 ? 454 ALA C CB  1 
ATOM   6261 N N   . ALA C 1 256 ? 55.218  44.628 72.718 1.00 137.43 ? 455 ALA C N   1 
ATOM   6262 C CA  . ALA C 1 256 ? 55.585  43.956 71.476 1.00 138.91 ? 455 ALA C CA  1 
ATOM   6263 C C   . ALA C 1 256 ? 54.237  43.550 70.909 1.00 140.13 ? 455 ALA C C   1 
ATOM   6264 O O   . ALA C 1 256 ? 53.202  43.912 71.470 1.00 140.66 ? 455 ALA C O   1 
ATOM   6265 C CB  . ALA C 1 256 ? 56.423  42.711 71.770 1.00 138.65 ? 455 ALA C CB  1 
ATOM   6266 N N   . LEU C 1 257 ? 54.224  42.835 69.791 1.00 141.30 ? 456 LEU C N   1 
ATOM   6267 C CA  . LEU C 1 257 ? 52.949  42.373 69.277 1.00 142.27 ? 456 LEU C CA  1 
ATOM   6268 C C   . LEU C 1 257 ? 52.867  41.197 70.217 1.00 143.35 ? 456 LEU C C   1 
ATOM   6269 O O   . LEU C 1 257 ? 53.881  40.792 70.784 1.00 143.77 ? 456 LEU C O   1 
ATOM   6270 C CB  . LEU C 1 257 ? 53.044  41.906 67.831 1.00 141.69 ? 456 LEU C CB  1 
ATOM   6271 C CG  . LEU C 1 257 ? 54.008  42.673 66.929 1.00 141.55 ? 456 LEU C CG  1 
ATOM   6272 C CD1 . LEU C 1 257 ? 54.400  44.039 67.514 1.00 141.16 ? 456 LEU C CD1 1 
ATOM   6273 C CD2 . LEU C 1 257 ? 55.231  41.799 66.759 1.00 141.34 ? 456 LEU C CD2 1 
ATOM   6274 N N   . HIS C 1 258 ? 51.693  40.631 70.392 1.00 144.25 ? 457 HIS C N   1 
ATOM   6275 C CA  . HIS C 1 258 ? 51.566  39.552 71.351 1.00 145.03 ? 457 HIS C CA  1 
ATOM   6276 C C   . HIS C 1 258 ? 50.634  38.576 70.666 1.00 145.32 ? 457 HIS C C   1 
ATOM   6277 O O   . HIS C 1 258 ? 50.368  38.709 69.467 1.00 145.20 ? 457 HIS C O   1 
ATOM   6278 C CB  . HIS C 1 258 ? 50.909  40.161 72.608 1.00 145.20 ? 457 HIS C CB  1 
ATOM   6279 C CG  . HIS C 1 258 ? 51.054  39.349 73.859 1.00 144.78 ? 457 HIS C CG  1 
ATOM   6280 N ND1 . HIS C 1 258 ? 50.022  39.201 74.762 1.00 144.41 ? 457 HIS C ND1 1 
ATOM   6281 C CD2 . HIS C 1 258 ? 52.094  38.637 74.356 1.00 144.42 ? 457 HIS C CD2 1 
ATOM   6282 C CE1 . HIS C 1 258 ? 50.417  38.427 75.756 1.00 144.26 ? 457 HIS C CE1 1 
ATOM   6283 N NE2 . HIS C 1 258 ? 51.669  38.069 75.533 1.00 144.24 ? 457 HIS C NE2 1 
ATOM   6284 N N   . PRO C 1 259 ? 50.202  37.528 71.382 1.00 145.69 ? 458 PRO C N   1 
ATOM   6285 C CA  . PRO C 1 259 ? 49.278  36.642 70.697 1.00 145.50 ? 458 PRO C CA  1 
ATOM   6286 C C   . PRO C 1 259 ? 47.981  37.129 71.360 1.00 145.03 ? 458 PRO C C   1 
ATOM   6287 O O   . PRO C 1 259 ? 47.035  36.365 71.545 1.00 144.94 ? 458 PRO C O   1 
ATOM   6288 C CB  . PRO C 1 259 ? 49.694  35.241 71.171 1.00 145.71 ? 458 PRO C CB  1 
ATOM   6289 C CG  . PRO C 1 259 ? 50.871  35.455 72.110 1.00 145.80 ? 458 PRO C CG  1 
ATOM   6290 C CD  . PRO C 1 259 ? 50.730  36.853 72.576 1.00 145.95 ? 458 PRO C CD  1 
ATOM   6291 N N   . LEU C 1 260 ? 47.995  38.409 71.765 1.00 144.36 ? 459 LEU C N   1 
ATOM   6292 C CA  . LEU C 1 260 ? 46.854  39.084 72.404 1.00 143.44 ? 459 LEU C CA  1 
ATOM   6293 C C   . LEU C 1 260 ? 45.869  39.344 71.296 1.00 143.24 ? 459 LEU C C   1 
ATOM   6294 O O   . LEU C 1 260 ? 44.770  39.861 71.509 1.00 142.98 ? 459 LEU C O   1 
ATOM   6295 C CB  . LEU C 1 260 ? 47.255  40.432 73.025 1.00 142.66 ? 459 LEU C CB  1 
ATOM   6296 C CG  . LEU C 1 260 ? 46.100  41.446 73.145 1.00 141.77 ? 459 LEU C CG  1 
ATOM   6297 C CD1 . LEU C 1 260 ? 45.838  41.802 74.595 1.00 141.66 ? 459 LEU C CD1 1 
ATOM   6298 C CD2 . LEU C 1 260 ? 46.424  42.685 72.328 1.00 141.13 ? 459 LEU C CD2 1 
ATOM   6299 N N   . LEU C 1 261 ? 46.310  39.003 70.095 1.00 143.17 ? 460 LEU C N   1 
ATOM   6300 C CA  . LEU C 1 261 ? 45.502  39.152 68.916 1.00 143.02 ? 460 LEU C CA  1 
ATOM   6301 C C   . LEU C 1 261 ? 44.955  37.779 68.617 1.00 143.33 ? 460 LEU C C   1 
ATOM   6302 O O   . LEU C 1 261 ? 44.825  37.389 67.461 1.00 143.62 ? 460 LEU C O   1 
ATOM   6303 C CB  . LEU C 1 261 ? 46.334  39.659 67.749 1.00 142.20 ? 460 LEU C CB  1 
ATOM   6304 C CG  . LEU C 1 261 ? 47.206  40.837 68.169 1.00 141.50 ? 460 LEU C CG  1 
ATOM   6305 C CD1 . LEU C 1 261 ? 48.628  40.545 67.792 1.00 141.05 ? 460 LEU C CD1 1 
ATOM   6306 C CD2 . LEU C 1 261 ? 46.753  42.101 67.525 1.00 141.28 ? 460 LEU C CD2 1 
ATOM   6307 N N   . GLN C 1 262 ? 44.731  37.000 69.667 1.00 143.44 ? 461 GLN C N   1 
ATOM   6308 C CA  . GLN C 1 262 ? 44.073  35.734 69.449 1.00 143.52 ? 461 GLN C CA  1 
ATOM   6309 C C   . GLN C 1 262 ? 42.734  36.351 69.787 1.00 143.69 ? 461 GLN C C   1 
ATOM   6310 O O   . GLN C 1 262 ? 41.710  36.018 69.211 1.00 143.63 ? 461 GLN C O   1 
ATOM   6311 C CB  . GLN C 1 262 ? 44.446  34.657 70.467 1.00 143.20 ? 461 GLN C CB  1 
ATOM   6312 C CG  . GLN C 1 262 ? 43.838  33.303 70.108 1.00 142.86 ? 461 GLN C CG  1 
ATOM   6313 C CD  . GLN C 1 262 ? 42.311  33.299 70.148 1.00 142.53 ? 461 GLN C CD  1 
ATOM   6314 O OE1 . GLN C 1 262 ? 41.665  32.367 69.667 1.00 142.08 ? 461 GLN C OE1 1 
ATOM   6315 N NE2 . GLN C 1 262 ? 41.732  34.332 70.741 1.00 142.37 ? 461 GLN C NE2 1 
ATOM   6316 N N   . GLU C 1 263 ? 42.781  37.291 70.727 1.00 143.95 ? 462 GLU C N   1 
ATOM   6317 C CA  . GLU C 1 263 ? 41.610  38.043 71.149 1.00 143.75 ? 462 GLU C CA  1 
ATOM   6318 C C   . GLU C 1 263 ? 41.771  39.404 70.480 1.00 143.79 ? 462 GLU C C   1 
ATOM   6319 O O   . GLU C 1 263 ? 42.874  39.755 70.059 1.00 144.16 ? 462 GLU C O   1 
ATOM   6320 C CB  . GLU C 1 263 ? 41.585  38.185 72.678 1.00 143.24 ? 462 GLU C CB  1 
ATOM   6321 C CG  . GLU C 1 263 ? 42.928  37.940 73.352 1.00 142.09 ? 462 GLU C CG  1 
ATOM   6322 C CD  . GLU C 1 263 ? 42.828  36.979 74.525 1.00 141.19 ? 462 GLU C CD  1 
ATOM   6323 O OE1 . GLU C 1 263 ? 43.875  36.441 74.943 1.00 140.64 ? 462 GLU C OE1 1 
ATOM   6324 O OE2 . GLU C 1 263 ? 41.707  36.764 75.031 1.00 140.58 ? 462 GLU C OE2 1 
ATOM   6325 N N   . ILE C 1 264 ? 40.683  40.156 70.347 1.00 143.41 ? 463 ILE C N   1 
ATOM   6326 C CA  . ILE C 1 264 ? 40.769  41.473 69.725 1.00 142.87 ? 463 ILE C CA  1 
ATOM   6327 C C   . ILE C 1 264 ? 41.138  41.316 68.240 1.00 142.42 ? 463 ILE C C   1 
ATOM   6328 O O   . ILE C 1 264 ? 41.436  42.302 67.569 1.00 142.39 ? 463 ILE C O   1 
ATOM   6329 C CB  . ILE C 1 264 ? 41.849  42.345 70.484 1.00 142.90 ? 463 ILE C CB  1 
ATOM   6330 C CG1 . ILE C 1 264 ? 41.277  43.709 70.868 1.00 142.48 ? 463 ILE C CG1 1 
ATOM   6331 C CG2 . ILE C 1 264 ? 43.105  42.537 69.639 1.00 143.17 ? 463 ILE C CG2 1 
ATOM   6332 C CD1 . ILE C 1 264 ? 42.208  44.509 71.771 1.00 141.53 ? 463 ILE C CD1 1 
ATOM   6333 N N   . TYR C 1 265 ? 41.075  40.084 67.726 1.00 141.89 ? 464 TYR C N   1 
ATOM   6334 C CA  . TYR C 1 265 ? 41.459  39.810 66.336 1.00 141.53 ? 464 TYR C CA  1 
ATOM   6335 C C   . TYR C 1 265 ? 40.797  38.650 65.623 1.00 142.11 ? 464 TYR C C   1 
ATOM   6336 O O   . TYR C 1 265 ? 40.645  38.663 64.397 1.00 142.18 ? 464 TYR C O   1 
ATOM   6337 C CB  . TYR C 1 265 ? 42.953  39.578 66.264 1.00 140.08 ? 464 TYR C CB  1 
ATOM   6338 C CG  . TYR C 1 265 ? 43.693  40.790 65.822 1.00 138.48 ? 464 TYR C CG  1 
ATOM   6339 C CD1 . TYR C 1 265 ? 44.338  40.820 64.595 1.00 137.73 ? 464 TYR C CD1 1 
ATOM   6340 C CD2 . TYR C 1 265 ? 43.734  41.919 66.620 1.00 137.71 ? 464 TYR C CD2 1 
ATOM   6341 C CE1 . TYR C 1 265 ? 45.011  41.950 64.181 1.00 136.79 ? 464 TYR C CE1 1 
ATOM   6342 C CE2 . TYR C 1 265 ? 44.388  43.053 66.220 1.00 137.03 ? 464 TYR C CE2 1 
ATOM   6343 C CZ  . TYR C 1 265 ? 45.033  43.063 65.002 1.00 136.66 ? 464 TYR C CZ  1 
ATOM   6344 O OH  . TYR C 1 265 ? 45.740  44.176 64.634 1.00 136.31 ? 464 TYR C OH  1 
ATOM   6345 N N   . ARG C 1 266 ? 40.478  37.614 66.380 1.00 142.64 ? 465 ARG C N   1 
ATOM   6346 C CA  . ARG C 1 266 ? 39.818  36.461 65.808 1.00 143.21 ? 465 ARG C CA  1 
ATOM   6347 C C   . ARG C 1 266 ? 38.362  36.867 65.939 1.00 143.76 ? 465 ARG C C   1 
ATOM   6348 O O   . ARG C 1 266 ? 38.034  37.696 66.790 1.00 143.87 ? 465 ARG C O   1 
ATOM   6349 C CB  . ARG C 1 266 ? 40.101  35.210 66.645 1.00 142.67 ? 465 ARG C CB  1 
ATOM   6350 C CG  . ARG C 1 266 ? 39.149  35.004 67.816 1.00 142.21 ? 465 ARG C CG  1 
ATOM   6351 C CD  . ARG C 1 266 ? 39.139  36.182 68.782 1.00 141.67 ? 465 ARG C CD  1 
ATOM   6352 N NE  . ARG C 1 266 ? 38.109  36.052 69.809 1.00 140.92 ? 465 ARG C NE  1 
ATOM   6353 C CZ  . ARG C 1 266 ? 38.039  35.049 70.678 1.00 140.65 ? 465 ARG C CZ  1 
ATOM   6354 N NH1 . ARG C 1 266 ? 38.942  34.077 70.652 1.00 140.91 ? 465 ARG C NH1 1 
ATOM   6355 N NH2 . ARG C 1 266 ? 37.063  35.014 71.573 1.00 140.02 ? 465 ARG C NH2 1 
ATOM   6356 N N   . ASP C 1 267 ? 37.492  36.318 65.101 1.00 144.31 ? 466 ASP C N   1 
ATOM   6357 C CA  . ASP C 1 267 ? 36.077  36.657 65.183 1.00 144.59 ? 466 ASP C CA  1 
ATOM   6358 C C   . ASP C 1 267 ? 35.832  38.159 65.383 1.00 144.51 ? 466 ASP C C   1 
ATOM   6359 O O   . ASP C 1 267 ? 34.773  38.560 65.872 1.00 144.73 ? 466 ASP C O   1 
ATOM   6360 C CB  . ASP C 1 267 ? 35.430  35.874 66.330 1.00 144.62 ? 466 ASP C CB  1 
ATOM   6361 C CG  . ASP C 1 267 ? 35.160  34.423 65.972 1.00 144.55 ? 466 ASP C CG  1 
ATOM   6362 O OD1 . ASP C 1 267 ? 36.051  33.768 65.388 1.00 144.20 ? 466 ASP C OD1 1 
ATOM   6363 O OD2 . ASP C 1 267 ? 34.054  33.936 66.284 1.00 144.46 ? 466 ASP C OD2 1 
ATOM   6364 N N   . MET C 1 268 ? 36.811  38.983 65.012 1.00 144.03 ? 467 MET C N   1 
ATOM   6365 C CA  . MET C 1 268 ? 36.688  40.432 65.148 1.00 143.17 ? 467 MET C CA  1 
ATOM   6366 C C   . MET C 1 268 ? 36.364  41.018 63.771 1.00 143.34 ? 467 MET C C   1 
ATOM   6367 O O   . MET C 1 268 ? 36.911  42.054 63.394 1.00 143.41 ? 467 MET C O   1 
ATOM   6368 C CB  . MET C 1 268 ? 37.999  41.035 65.679 1.00 141.75 ? 467 MET C CB  1 
ATOM   6369 C CG  . MET C 1 268 ? 37.876  42.415 66.317 1.00 140.12 ? 467 MET C CG  1 
ATOM   6370 S SD  . MET C 1 268 ? 37.264  42.402 68.016 1.00 138.41 ? 467 MET C SD  1 
ATOM   6371 C CE  . MET C 1 268 ? 35.791  43.412 67.878 1.00 137.70 ? 467 MET C CE  1 
ATOM   6372 N N   . TYR C 1 269 ? 35.484  40.326 63.038 1.00 143.10 ? 468 TYR C N   1 
ATOM   6373 C CA  . TYR C 1 269 ? 35.024  40.711 61.694 1.00 142.42 ? 468 TYR C CA  1 
ATOM   6374 C C   . TYR C 1 269 ? 34.337  39.551 60.964 1.00 142.03 ? 468 TYR C C   1 
ATOM   6375 O O   . TYR C 1 269 ? 34.279  38.436 61.529 1.00 141.43 ? 468 TYR C O   1 
ATOM   6376 C CB  . TYR C 1 269 ? 36.189  41.227 60.835 1.00 142.25 ? 468 TYR C CB  1 
ATOM   6377 C CG  . TYR C 1 269 ? 36.425  42.721 60.940 1.00 141.42 ? 468 TYR C CG  1 
ATOM   6378 C CD1 . TYR C 1 269 ? 37.678  43.270 60.661 1.00 140.99 ? 468 TYR C CD1 1 
ATOM   6379 C CD2 . TYR C 1 269 ? 35.402  43.583 61.341 1.00 141.27 ? 468 TYR C CD2 1 
ATOM   6380 C CE1 . TYR C 1 269 ? 37.908  44.636 60.786 1.00 141.03 ? 468 TYR C CE1 1 
ATOM   6381 C CE2 . TYR C 1 269 ? 35.620  44.950 61.468 1.00 141.30 ? 468 TYR C CE2 1 
ATOM   6382 C CZ  . TYR C 1 269 ? 36.875  45.470 61.191 1.00 141.28 ? 468 TYR C CZ  1 
ATOM   6383 O OH  . TYR C 1 269 ? 37.098  46.821 61.334 1.00 141.17 ? 468 TYR C OH  1 
ATOM   6384 O OXT . TYR C 1 269 ? 33.863  39.774 59.828 1.00 141.68 ? 468 TYR C OXT 1 
ATOM   6385 N N   . THR D 1 1   ? 32.485  57.435 55.681 1.00 74.83  ? 200 THR D N   1 
ATOM   6386 C CA  . THR D 1 1   ? 32.406  56.563 54.471 1.00 74.48  ? 200 THR D CA  1 
ATOM   6387 C C   . THR D 1 1   ? 32.578  55.095 54.880 1.00 74.56  ? 200 THR D C   1 
ATOM   6388 O O   . THR D 1 1   ? 32.226  54.172 54.126 1.00 74.48  ? 200 THR D O   1 
ATOM   6389 C CB  . THR D 1 1   ? 33.497  56.972 53.468 1.00 73.59  ? 200 THR D CB  1 
ATOM   6390 N N   . ALA D 1 2   ? 33.103  54.904 56.092 1.00 73.48  ? 201 ALA D N   1 
ATOM   6391 C CA  . ALA D 1 2   ? 33.377  53.583 56.664 1.00 71.54  ? 201 ALA D CA  1 
ATOM   6392 C C   . ALA D 1 2   ? 32.134  52.758 57.014 1.00 69.84  ? 201 ALA D C   1 
ATOM   6393 O O   . ALA D 1 2   ? 31.871  51.718 56.398 1.00 70.10  ? 201 ALA D O   1 
ATOM   6394 C CB  . ALA D 1 2   ? 34.260  53.743 57.897 1.00 71.61  ? 201 ALA D CB  1 
ATOM   6395 N N   . ASP D 1 3   ? 31.388  53.202 58.018 1.00 66.21  ? 202 ASP D N   1 
ATOM   6396 C CA  . ASP D 1 3   ? 30.179  52.496 58.410 1.00 62.79  ? 202 ASP D CA  1 
ATOM   6397 C C   . ASP D 1 3   ? 29.002  53.257 57.826 1.00 59.24  ? 202 ASP D C   1 
ATOM   6398 O O   . ASP D 1 3   ? 27.838  52.971 58.120 1.00 58.98  ? 202 ASP D O   1 
ATOM   6399 C CB  . ASP D 1 3   ? 30.073  52.426 59.934 1.00 65.16  ? 202 ASP D CB  1 
ATOM   6400 C CG  . ASP D 1 3   ? 30.224  51.007 60.463 1.00 67.04  ? 202 ASP D CG  1 
ATOM   6401 O OD1 . ASP D 1 3   ? 30.212  50.809 61.702 1.00 66.79  ? 202 ASP D OD1 1 
ATOM   6402 O OD2 . ASP D 1 3   ? 30.353  50.084 59.628 1.00 68.32  ? 202 ASP D OD2 1 
ATOM   6403 N N   . LEU D 1 4   ? 29.336  54.223 56.977 1.00 54.26  ? 203 LEU D N   1 
ATOM   6404 C CA  . LEU D 1 4   ? 28.358  55.071 56.326 1.00 49.41  ? 203 LEU D CA  1 
ATOM   6405 C C   . LEU D 1 4   ? 28.032  54.578 54.916 1.00 46.77  ? 203 LEU D C   1 
ATOM   6406 O O   . LEU D 1 4   ? 27.096  55.062 54.285 1.00 46.14  ? 203 LEU D O   1 
ATOM   6407 C CB  . LEU D 1 4   ? 28.891  56.503 56.278 1.00 48.41  ? 203 LEU D CB  1 
ATOM   6408 C CG  . LEU D 1 4   ? 27.916  57.628 56.631 1.00 46.99  ? 203 LEU D CG  1 
ATOM   6409 C CD1 . LEU D 1 4   ? 27.442  57.456 58.066 1.00 46.41  ? 203 LEU D CD1 1 
ATOM   6410 C CD2 . LEU D 1 4   ? 28.598  58.969 56.450 1.00 45.82  ? 203 LEU D CD2 1 
ATOM   6411 N N   . LYS D 1 5   ? 28.805  53.622 54.417 1.00 44.62  ? 204 LYS D N   1 
ATOM   6412 C CA  . LYS D 1 5   ? 28.554  53.080 53.082 1.00 42.98  ? 204 LYS D CA  1 
ATOM   6413 C C   . LYS D 1 5   ? 27.489  51.985 53.209 1.00 38.88  ? 204 LYS D C   1 
ATOM   6414 O O   . LYS D 1 5   ? 26.615  51.804 52.348 1.00 37.81  ? 204 LYS D O   1 
ATOM   6415 C CB  . LYS D 1 5   ? 29.851  52.495 52.493 1.00 46.28  ? 204 LYS D CB  1 
ATOM   6416 C CG  . LYS D 1 5   ? 29.704  51.913 51.084 1.00 49.81  ? 204 LYS D CG  1 
ATOM   6417 C CD  . LYS D 1 5   ? 29.345  52.970 50.043 1.00 50.19  ? 204 LYS D CD  1 
ATOM   6418 C CE  . LYS D 1 5   ? 28.539  52.375 48.897 1.00 50.46  ? 204 LYS D CE  1 
ATOM   6419 N NZ  . LYS D 1 5   ? 27.495  53.328 48.407 1.00 50.12  ? 204 LYS D NZ  1 
ATOM   6420 N N   . SER D 1 6   ? 27.584  51.271 54.318 1.00 33.97  ? 205 SER D N   1 
ATOM   6421 C CA  . SER D 1 6   ? 26.689  50.181 54.653 1.00 28.70  ? 205 SER D CA  1 
ATOM   6422 C C   . SER D 1 6   ? 25.400  50.711 55.264 1.00 24.33  ? 205 SER D C   1 
ATOM   6423 O O   . SER D 1 6   ? 24.445  49.959 55.477 1.00 24.67  ? 205 SER D O   1 
ATOM   6424 C CB  . SER D 1 6   ? 27.394  49.294 55.660 1.00 29.39  ? 205 SER D CB  1 
ATOM   6425 O OG  . SER D 1 6   ? 28.086  50.117 56.589 1.00 30.56  ? 205 SER D OG  1 
ATOM   6426 N N   . LEU D 1 7   ? 25.384  52.009 55.545 1.00 17.83  ? 206 LEU D N   1 
ATOM   6427 C CA  . LEU D 1 7   ? 24.237  52.644 56.166 1.00 12.21  ? 206 LEU D CA  1 
ATOM   6428 C C   . LEU D 1 7   ? 22.948  52.624 55.352 1.00 11.51  ? 206 LEU D C   1 
ATOM   6429 O O   . LEU D 1 7   ? 21.911  52.190 55.848 1.00 12.31  ? 206 LEU D O   1 
ATOM   6430 C CB  . LEU D 1 7   ? 24.598  54.078 56.551 1.00 8.62   ? 206 LEU D CB  1 
ATOM   6431 C CG  . LEU D 1 7   ? 23.504  54.976 57.135 1.00 6.55   ? 206 LEU D CG  1 
ATOM   6432 C CD1 . LEU D 1 7   ? 22.786  54.272 58.249 1.00 6.55   ? 206 LEU D CD1 1 
ATOM   6433 C CD2 . LEU D 1 7   ? 24.120  56.265 57.626 1.00 6.55   ? 206 LEU D CD2 1 
ATOM   6434 N N   . ALA D 1 8   ? 23.002  53.086 54.107 1.00 10.88  ? 207 ALA D N   1 
ATOM   6435 C CA  . ALA D 1 8   ? 21.809  53.120 53.261 1.00 8.99   ? 207 ALA D CA  1 
ATOM   6436 C C   . ALA D 1 8   ? 21.331  51.727 52.924 1.00 7.51   ? 207 ALA D C   1 
ATOM   6437 O O   . ALA D 1 8   ? 20.137  51.462 52.921 1.00 6.55   ? 207 ALA D O   1 
ATOM   6438 C CB  . ALA D 1 8   ? 22.087  53.890 51.992 1.00 9.79   ? 207 ALA D CB  1 
ATOM   6439 N N   . LYS D 1 9   ? 22.265  50.836 52.628 1.00 7.93   ? 208 LYS D N   1 
ATOM   6440 C CA  . LYS D 1 9   ? 21.889  49.472 52.319 1.00 9.87   ? 208 LYS D CA  1 
ATOM   6441 C C   . LYS D 1 9   ? 21.195  48.877 53.522 1.00 10.89  ? 208 LYS D C   1 
ATOM   6442 O O   . LYS D 1 9   ? 20.175  48.204 53.388 1.00 12.63  ? 208 LYS D O   1 
ATOM   6443 C CB  . LYS D 1 9   ? 23.104  48.623 51.988 1.00 10.27  ? 208 LYS D CB  1 
ATOM   6444 C CG  . LYS D 1 9   ? 22.761  47.146 51.924 1.00 13.70  ? 208 LYS D CG  1 
ATOM   6445 C CD  . LYS D 1 9   ? 23.380  46.484 50.709 1.00 18.57  ? 208 LYS D CD  1 
ATOM   6446 C CE  . LYS D 1 9   ? 22.314  45.812 49.848 1.00 21.40  ? 208 LYS D CE  1 
ATOM   6447 N NZ  . LYS D 1 9   ? 22.440  46.155 48.385 1.00 22.68  ? 208 LYS D NZ  1 
ATOM   6448 N N   . ARG D 1 10  ? 21.756  49.127 54.701 1.00 11.36  ? 209 ARG D N   1 
ATOM   6449 C CA  . ARG D 1 10  ? 21.193  48.620 55.941 1.00 10.79  ? 209 ARG D CA  1 
ATOM   6450 C C   . ARG D 1 10  ? 19.793  49.163 56.195 1.00 8.50   ? 209 ARG D C   1 
ATOM   6451 O O   . ARG D 1 10  ? 18.867  48.397 56.476 1.00 7.11   ? 209 ARG D O   1 
ATOM   6452 C CB  . ARG D 1 10  ? 22.098  48.981 57.114 1.00 15.38  ? 209 ARG D CB  1 
ATOM   6453 C CG  . ARG D 1 10  ? 22.699  47.782 57.824 1.00 26.55  ? 209 ARG D CG  1 
ATOM   6454 C CD  . ARG D 1 10  ? 21.645  46.730 58.174 1.00 37.47  ? 209 ARG D CD  1 
ATOM   6455 N NE  . ARG D 1 10  ? 20.593  47.151 59.112 1.00 45.03  ? 209 ARG D NE  1 
ATOM   6456 C CZ  . ARG D 1 10  ? 20.317  46.531 60.264 1.00 47.70  ? 209 ARG D CZ  1 
ATOM   6457 N NH1 . ARG D 1 10  ? 21.016  45.461 60.636 1.00 49.21  ? 209 ARG D NH1 1 
ATOM   6458 N NH2 . ARG D 1 10  ? 19.331  46.967 61.041 1.00 48.00  ? 209 ARG D NH2 1 
ATOM   6459 N N   . ILE D 1 11  ? 19.637  50.482 56.096 1.00 6.90   ? 210 ILE D N   1 
ATOM   6460 C CA  . ILE D 1 11  ? 18.339  51.111 56.327 1.00 6.87   ? 210 ILE D CA  1 
ATOM   6461 C C   . ILE D 1 11  ? 17.288  50.603 55.357 1.00 8.60   ? 210 ILE D C   1 
ATOM   6462 O O   . ILE D 1 11  ? 16.169  50.281 55.749 1.00 9.32   ? 210 ILE D O   1 
ATOM   6463 C CB  . ILE D 1 11  ? 18.393  52.646 56.190 1.00 6.55   ? 210 ILE D CB  1 
ATOM   6464 C CG1 . ILE D 1 11  ? 19.255  53.246 57.297 1.00 6.55   ? 210 ILE D CG1 1 
ATOM   6465 C CG2 . ILE D 1 11  ? 16.991  53.208 56.271 1.00 6.55   ? 210 ILE D CG2 1 
ATOM   6466 C CD1 . ILE D 1 11  ? 19.357  54.755 57.258 1.00 6.55   ? 210 ILE D CD1 1 
ATOM   6467 N N   . TYR D 1 12  ? 17.658  50.533 54.085 1.00 10.37  ? 211 TYR D N   1 
ATOM   6468 C CA  . TYR D 1 12  ? 16.748  50.088 53.039 1.00 10.24  ? 211 TYR D CA  1 
ATOM   6469 C C   . TYR D 1 12  ? 16.249  48.679 53.274 1.00 8.91   ? 211 TYR D C   1 
ATOM   6470 O O   . TYR D 1 12  ? 15.052  48.424 53.235 1.00 8.00   ? 211 TYR D O   1 
ATOM   6471 C CB  . TYR D 1 12  ? 17.437  50.188 51.679 1.00 12.21  ? 211 TYR D CB  1 
ATOM   6472 C CG  . TYR D 1 12  ? 16.586  49.724 50.518 1.00 15.31  ? 211 TYR D CG  1 
ATOM   6473 C CD1 . TYR D 1 12  ? 15.207  49.973 50.492 1.00 15.86  ? 211 TYR D CD1 1 
ATOM   6474 C CD2 . TYR D 1 12  ? 17.163  49.067 49.429 1.00 14.71  ? 211 TYR D CD2 1 
ATOM   6475 C CE1 . TYR D 1 12  ? 14.426  49.580 49.412 1.00 16.20  ? 211 TYR D CE1 1 
ATOM   6476 C CE2 . TYR D 1 12  ? 16.395  48.671 48.345 1.00 15.98  ? 211 TYR D CE2 1 
ATOM   6477 C CZ  . TYR D 1 12  ? 15.028  48.929 48.339 1.00 18.27  ? 211 TYR D CZ  1 
ATOM   6478 O OH  . TYR D 1 12  ? 14.269  48.541 47.253 1.00 20.57  ? 211 TYR D OH  1 
ATOM   6479 N N   . GLU D 1 13  ? 17.172  47.764 53.520 1.00 8.81   ? 212 GLU D N   1 
ATOM   6480 C CA  . GLU D 1 13  ? 16.794  46.389 53.774 1.00 10.75  ? 212 GLU D CA  1 
ATOM   6481 C C   . GLU D 1 13  ? 15.758  46.352 54.893 1.00 9.03   ? 212 GLU D C   1 
ATOM   6482 O O   . GLU D 1 13  ? 14.813  45.565 54.853 1.00 9.87   ? 212 GLU D O   1 
ATOM   6483 C CB  . GLU D 1 13  ? 18.022  45.577 54.191 1.00 14.59  ? 212 GLU D CB  1 
ATOM   6484 C CG  . GLU D 1 13  ? 19.179  45.670 53.216 1.00 21.09  ? 212 GLU D CG  1 
ATOM   6485 C CD  . GLU D 1 13  ? 19.293  44.465 52.299 1.00 25.71  ? 212 GLU D CD  1 
ATOM   6486 O OE1 . GLU D 1 13  ? 20.251  43.688 52.497 1.00 28.72  ? 212 GLU D OE1 1 
ATOM   6487 O OE2 . GLU D 1 13  ? 18.441  44.294 51.390 1.00 26.80  ? 212 GLU D OE2 1 
ATOM   6488 N N   . ALA D 1 14  ? 15.937  47.221 55.882 1.00 6.67   ? 213 ALA D N   1 
ATOM   6489 C CA  . ALA D 1 14  ? 15.049  47.279 57.033 1.00 6.55   ? 213 ALA D CA  1 
ATOM   6490 C C   . ALA D 1 14  ? 13.637  47.746 56.714 1.00 6.55   ? 213 ALA D C   1 
ATOM   6491 O O   . ALA D 1 14  ? 12.696  47.455 57.444 1.00 6.55   ? 213 ALA D O   1 
ATOM   6492 C CB  . ALA D 1 14  ? 15.657  48.164 58.076 1.00 6.55   ? 213 ALA D CB  1 
ATOM   6493 N N   . TYR D 1 15  ? 13.499  48.475 55.619 1.00 6.55   ? 214 TYR D N   1 
ATOM   6494 C CA  . TYR D 1 15  ? 12.214  48.997 55.183 1.00 6.60   ? 214 TYR D CA  1 
ATOM   6495 C C   . TYR D 1 15  ? 11.461  47.867 54.483 1.00 8.15   ? 214 TYR D C   1 
ATOM   6496 O O   . TYR D 1 15  ? 10.255  47.682 54.677 1.00 7.37   ? 214 TYR D O   1 
ATOM   6497 C CB  . TYR D 1 15  ? 12.491  50.182 54.250 1.00 8.16   ? 214 TYR D CB  1 
ATOM   6498 C CG  . TYR D 1 15  ? 11.322  50.802 53.520 1.00 7.96   ? 214 TYR D CG  1 
ATOM   6499 C CD1 . TYR D 1 15  ? 10.783  50.195 52.389 1.00 7.86   ? 214 TYR D CD1 1 
ATOM   6500 C CD2 . TYR D 1 15  ? 10.826  52.044 53.896 1.00 7.46   ? 214 TYR D CD2 1 
ATOM   6501 C CE1 . TYR D 1 15  ? 9.793   50.813 51.642 1.00 7.56   ? 214 TYR D CE1 1 
ATOM   6502 C CE2 . TYR D 1 15  ? 9.834   52.668 53.155 1.00 9.21   ? 214 TYR D CE2 1 
ATOM   6503 C CZ  . TYR D 1 15  ? 9.325   52.046 52.025 1.00 8.48   ? 214 TYR D CZ  1 
ATOM   6504 O OH  . TYR D 1 15  ? 8.369   52.664 51.258 1.00 11.27  ? 214 TYR D OH  1 
ATOM   6505 N N   . LEU D 1 16  ? 12.200  47.100 53.688 1.00 9.88   ? 215 LEU D N   1 
ATOM   6506 C CA  . LEU D 1 16  ? 11.653  45.965 52.954 1.00 12.77  ? 215 LEU D CA  1 
ATOM   6507 C C   . LEU D 1 16  ? 11.173  44.864 53.892 1.00 14.71  ? 215 LEU D C   1 
ATOM   6508 O O   . LEU D 1 16  ? 10.153  44.210 53.649 1.00 17.13  ? 215 LEU D O   1 
ATOM   6509 C CB  . LEU D 1 16  ? 12.719  45.387 52.031 1.00 13.00  ? 215 LEU D CB  1 
ATOM   6510 C CG  . LEU D 1 16  ? 13.052  46.203 50.786 1.00 15.53  ? 215 LEU D CG  1 
ATOM   6511 C CD1 . LEU D 1 16  ? 14.224  45.579 50.041 1.00 14.96  ? 215 LEU D CD1 1 
ATOM   6512 C CD2 . LEU D 1 16  ? 11.821  46.264 49.898 1.00 16.61  ? 215 LEU D CD2 1 
ATOM   6513 N N   . LYS D 1 17  ? 11.929  44.658 54.961 1.00 15.14  ? 216 LYS D N   1 
ATOM   6514 C CA  . LYS D 1 17  ? 11.626  43.636 55.947 1.00 14.65  ? 216 LYS D CA  1 
ATOM   6515 C C   . LYS D 1 17  ? 10.481  43.974 56.885 1.00 13.98  ? 216 LYS D C   1 
ATOM   6516 O O   . LYS D 1 17  ? 9.739   43.095 57.290 1.00 13.76  ? 216 LYS D O   1 
ATOM   6517 C CB  . LYS D 1 17  ? 12.875  43.353 56.771 1.00 16.26  ? 216 LYS D CB  1 
ATOM   6518 C CG  . LYS D 1 17  ? 12.647  42.502 58.007 1.00 19.97  ? 216 LYS D CG  1 
ATOM   6519 C CD  . LYS D 1 17  ? 13.954  42.359 58.769 1.00 24.35  ? 216 LYS D CD  1 
ATOM   6520 C CE  . LYS D 1 17  ? 13.847  41.378 59.924 1.00 26.96  ? 216 LYS D CE  1 
ATOM   6521 N NZ  . LYS D 1 17  ? 15.215  41.018 60.405 1.00 29.14  ? 216 LYS D NZ  1 
ATOM   6522 N N   . ASN D 1 18  ? 10.323  45.246 57.219 1.00 13.38  ? 217 ASN D N   1 
ATOM   6523 C CA  . ASN D 1 18  ? 9.288   45.634 58.161 1.00 12.84  ? 217 ASN D CA  1 
ATOM   6524 C C   . ASN D 1 18  ? 7.973   46.216 57.673 1.00 13.16  ? 217 ASN D C   1 
ATOM   6525 O O   . ASN D 1 18  ? 6.985   46.186 58.410 1.00 13.72  ? 217 ASN D O   1 
ATOM   6526 C CB  . ASN D 1 18  ? 9.893   46.574 59.181 1.00 12.44  ? 217 ASN D CB  1 
ATOM   6527 C CG  . ASN D 1 18  ? 10.778  45.862 60.138 1.00 11.37  ? 217 ASN D CG  1 
ATOM   6528 O OD1 . ASN D 1 18  ? 10.305  45.212 61.063 1.00 12.94  ? 217 ASN D OD1 1 
ATOM   6529 N ND2 . ASN D 1 18  ? 12.076  45.954 59.917 1.00 11.98  ? 217 ASN D ND2 1 
ATOM   6530 N N   . PHE D 1 19  ? 7.938   46.758 56.464 1.00 11.98  ? 218 PHE D N   1 
ATOM   6531 C CA  . PHE D 1 19  ? 6.688   47.322 55.973 1.00 11.85  ? 218 PHE D CA  1 
ATOM   6532 C C   . PHE D 1 19  ? 6.011   46.397 54.978 1.00 13.88  ? 218 PHE D C   1 
ATOM   6533 O O   . PHE D 1 19  ? 6.576   46.068 53.935 1.00 15.16  ? 218 PHE D O   1 
ATOM   6534 C CB  . PHE D 1 19  ? 6.947   48.684 55.357 1.00 9.08   ? 218 PHE D CB  1 
ATOM   6535 C CG  . PHE D 1 19  ? 7.408   49.696 56.349 1.00 6.64   ? 218 PHE D CG  1 
ATOM   6536 C CD1 . PHE D 1 19  ? 6.528   50.199 57.298 1.00 6.55   ? 218 PHE D CD1 1 
ATOM   6537 C CD2 . PHE D 1 19  ? 8.730   50.120 56.366 1.00 6.55   ? 218 PHE D CD2 1 
ATOM   6538 C CE1 . PHE D 1 19  ? 6.954   51.107 58.249 1.00 6.55   ? 218 PHE D CE1 1 
ATOM   6539 C CE2 . PHE D 1 19  ? 9.167   51.026 57.312 1.00 6.55   ? 218 PHE D CE2 1 
ATOM   6540 C CZ  . PHE D 1 19  ? 8.275   51.523 58.260 1.00 6.55   ? 218 PHE D CZ  1 
ATOM   6541 N N   . ASN D 1 20  ? 4.797   45.970 55.318 1.00 14.51  ? 219 ASN D N   1 
ATOM   6542 C CA  . ASN D 1 20  ? 4.050   45.059 54.469 1.00 14.68  ? 219 ASN D CA  1 
ATOM   6543 C C   . ASN D 1 20  ? 3.876   45.652 53.097 1.00 14.53  ? 219 ASN D C   1 
ATOM   6544 O O   . ASN D 1 20  ? 4.255   45.051 52.097 1.00 15.36  ? 219 ASN D O   1 
ATOM   6545 C CB  . ASN D 1 20  ? 2.671   44.776 55.045 1.00 15.34  ? 219 ASN D CB  1 
ATOM   6546 C CG  . ASN D 1 20  ? 1.982   43.641 54.327 1.00 18.77  ? 219 ASN D CG  1 
ATOM   6547 O OD1 . ASN D 1 20  ? 0.812   43.737 53.943 1.00 19.94  ? 219 ASN D OD1 1 
ATOM   6548 N ND2 . ASN D 1 20  ? 2.712   42.544 54.136 1.00 20.73  ? 219 ASN D ND2 1 
ATOM   6549 N N   . MET D 1 21  ? 3.287   46.838 53.067 1.00 14.37  ? 220 MET D N   1 
ATOM   6550 C CA  . MET D 1 21  ? 3.043   47.548 51.829 1.00 13.10  ? 220 MET D CA  1 
ATOM   6551 C C   . MET D 1 21  ? 4.174   48.539 51.617 1.00 12.66  ? 220 MET D C   1 
ATOM   6552 O O   . MET D 1 21  ? 4.606   49.187 52.566 1.00 13.60  ? 220 MET D O   1 
ATOM   6553 C CB  . MET D 1 21  ? 1.722   48.302 51.928 1.00 13.36  ? 220 MET D CB  1 
ATOM   6554 C CG  . MET D 1 21  ? 1.205   48.776 50.591 1.00 16.29  ? 220 MET D CG  1 
ATOM   6555 S SD  . MET D 1 21  ? 0.982   47.336 49.539 1.00 20.77  ? 220 MET D SD  1 
ATOM   6556 C CE  . MET D 1 21  ? -0.699  46.915 49.983 1.00 20.52  ? 220 MET D CE  1 
ATOM   6557 N N   . ASN D 1 22  ? 4.672   48.635 50.388 1.00 11.32  ? 221 ASN D N   1 
ATOM   6558 C CA  . ASN D 1 22  ? 5.724   49.591 50.060 1.00 11.57  ? 221 ASN D CA  1 
ATOM   6559 C C   . ASN D 1 22  ? 5.296   50.239 48.743 1.00 10.38  ? 221 ASN D C   1 
ATOM   6560 O O   . ASN D 1 22  ? 4.226   49.903 48.236 1.00 9.02   ? 221 ASN D O   1 
ATOM   6561 C CB  . ASN D 1 22  ? 7.078   48.898 49.936 1.00 13.74  ? 221 ASN D CB  1 
ATOM   6562 C CG  . ASN D 1 22  ? 7.120   47.915 48.814 1.00 17.64  ? 221 ASN D CG  1 
ATOM   6563 O OD1 . ASN D 1 22  ? 6.182   47.816 48.024 1.00 21.17  ? 221 ASN D OD1 1 
ATOM   6564 N ND2 . ASN D 1 22  ? 8.217   47.178 48.722 1.00 20.91  ? 221 ASN D ND2 1 
ATOM   6565 N N   . LYS D 1 23  ? 6.094   51.146 48.176 1.00 9.60   ? 222 LYS D N   1 
ATOM   6566 C CA  . LYS D 1 23  ? 5.659   51.797 46.939 1.00 8.88   ? 222 LYS D CA  1 
ATOM   6567 C C   . LYS D 1 23  ? 5.507   50.861 45.761 1.00 8.78   ? 222 LYS D C   1 
ATOM   6568 O O   . LYS D 1 23  ? 4.455   50.831 45.132 1.00 7.13   ? 222 LYS D O   1 
ATOM   6569 C CB  . LYS D 1 23  ? 6.580   52.951 46.535 1.00 8.43   ? 222 LYS D CB  1 
ATOM   6570 C CG  . LYS D 1 23  ? 5.882   53.982 45.647 1.00 7.09   ? 222 LYS D CG  1 
ATOM   6571 C CD  . LYS D 1 23  ? 6.814   55.114 45.231 1.00 7.59   ? 222 LYS D CD  1 
ATOM   6572 C CE  . LYS D 1 23  ? 6.058   56.428 45.062 1.00 9.45   ? 222 LYS D CE  1 
ATOM   6573 N NZ  . LYS D 1 23  ? 6.940   57.642 44.987 1.00 8.65   ? 222 LYS D NZ  1 
ATOM   6574 N N   . VAL D 1 24  ? 6.550   50.098 45.461 1.00 10.47  ? 223 VAL D N   1 
ATOM   6575 C CA  . VAL D 1 24  ? 6.502   49.166 44.333 1.00 13.68  ? 223 VAL D CA  1 
ATOM   6576 C C   . VAL D 1 24  ? 5.191   48.396 44.309 1.00 14.70  ? 223 VAL D C   1 
ATOM   6577 O O   . VAL D 1 24  ? 4.319   48.645 43.474 1.00 14.33  ? 223 VAL D O   1 
ATOM   6578 C CB  . VAL D 1 24  ? 7.638   48.129 44.388 1.00 13.18  ? 223 VAL D CB  1 
ATOM   6579 C CG1 . VAL D 1 24  ? 8.225   47.951 43.004 1.00 12.60  ? 223 VAL D CG1 1 
ATOM   6580 C CG2 . VAL D 1 24  ? 8.708   48.559 45.377 1.00 15.97  ? 223 VAL D CG2 1 
ATOM   6581 N N   . LYS D 1 25  ? 5.073   47.452 45.235 1.00 16.24  ? 224 LYS D N   1 
ATOM   6582 C CA  . LYS D 1 25  ? 3.885   46.623 45.374 1.00 19.00  ? 224 LYS D CA  1 
ATOM   6583 C C   . LYS D 1 25  ? 2.579   47.402 45.236 1.00 20.83  ? 224 LYS D C   1 
ATOM   6584 O O   . LYS D 1 25  ? 1.646   46.950 44.573 1.00 21.08  ? 224 LYS D O   1 
ATOM   6585 C CB  . LYS D 1 25  ? 3.903   45.947 46.734 1.00 18.83  ? 224 LYS D CB  1 
ATOM   6586 C CG  . LYS D 1 25  ? 5.203   45.228 47.030 1.00 21.06  ? 224 LYS D CG  1 
ATOM   6587 C CD  . LYS D 1 25  ? 5.138   44.570 48.393 1.00 22.30  ? 224 LYS D CD  1 
ATOM   6588 C CE  . LYS D 1 25  ? 3.910   43.682 48.492 1.00 23.61  ? 224 LYS D CE  1 
ATOM   6589 N NZ  . LYS D 1 25  ? 3.827   43.053 49.827 1.00 27.67  ? 224 LYS D NZ  1 
ATOM   6590 N N   . ALA D 1 26  ? 2.513   48.563 45.885 1.00 22.86  ? 225 ALA D N   1 
ATOM   6591 C CA  . ALA D 1 26  ? 1.325   49.413 45.846 1.00 22.62  ? 225 ALA D CA  1 
ATOM   6592 C C   . ALA D 1 26  ? 1.056   49.876 44.429 1.00 22.72  ? 225 ALA D C   1 
ATOM   6593 O O   . ALA D 1 26  ? -0.091  49.958 43.999 1.00 22.13  ? 225 ALA D O   1 
ATOM   6594 C CB  . ALA D 1 26  ? 1.521   50.618 46.746 1.00 22.66  ? 225 ALA D CB  1 
ATOM   6595 N N   . ARG D 1 27  ? 2.133   50.176 43.714 1.00 23.52  ? 226 ARG D N   1 
ATOM   6596 C CA  . ARG D 1 27  ? 2.057   50.642 42.340 1.00 24.68  ? 226 ARG D CA  1 
ATOM   6597 C C   . ARG D 1 27  ? 1.834   49.532 41.325 1.00 24.38  ? 226 ARG D C   1 
ATOM   6598 O O   . ARG D 1 27  ? 1.581   49.800 40.160 1.00 25.22  ? 226 ARG D O   1 
ATOM   6599 C CB  . ARG D 1 27  ? 3.323   51.417 42.000 1.00 26.52  ? 226 ARG D CB  1 
ATOM   6600 C CG  . ARG D 1 27  ? 3.306   52.834 42.541 1.00 29.24  ? 226 ARG D CG  1 
ATOM   6601 C CD  . ARG D 1 27  ? 2.309   53.663 41.756 1.00 32.03  ? 226 ARG D CD  1 
ATOM   6602 N NE  . ARG D 1 27  ? 2.155   55.025 42.255 1.00 34.38  ? 226 ARG D NE  1 
ATOM   6603 C CZ  . ARG D 1 27  ? 1.463   55.347 43.340 1.00 35.20  ? 226 ARG D CZ  1 
ATOM   6604 N NH1 . ARG D 1 27  ? 0.864   54.403 44.053 1.00 35.33  ? 226 ARG D NH1 1 
ATOM   6605 N NH2 . ARG D 1 27  ? 1.338   56.617 43.690 1.00 36.53  ? 226 ARG D NH2 1 
ATOM   6606 N N   . VAL D 1 28  ? 1.941   48.286 41.761 1.00 24.58  ? 227 VAL D N   1 
ATOM   6607 C CA  . VAL D 1 28  ? 1.711   47.153 40.876 1.00 23.81  ? 227 VAL D CA  1 
ATOM   6608 C C   . VAL D 1 28  ? 0.238   46.775 40.965 1.00 24.70  ? 227 VAL D C   1 
ATOM   6609 O O   . VAL D 1 28  ? -0.342  46.265 40.012 1.00 25.19  ? 227 VAL D O   1 
ATOM   6610 C CB  . VAL D 1 28  ? 2.550   45.941 41.287 1.00 21.52  ? 227 VAL D CB  1 
ATOM   6611 C CG1 . VAL D 1 28  ? 2.064   44.721 40.568 1.00 20.34  ? 227 VAL D CG1 1 
ATOM   6612 C CG2 . VAL D 1 28  ? 3.999   46.185 40.957 1.00 21.08  ? 227 VAL D CG2 1 
ATOM   6613 N N   . ILE D 1 29  ? -0.354  47.030 42.125 1.00 25.37  ? 228 ILE D N   1 
ATOM   6614 C CA  . ILE D 1 29  ? -1.753  46.726 42.358 1.00 26.31  ? 228 ILE D CA  1 
ATOM   6615 C C   . ILE D 1 29  ? -2.608  47.791 41.697 1.00 28.88  ? 228 ILE D C   1 
ATOM   6616 O O   . ILE D 1 29  ? -3.541  47.481 40.965 1.00 30.37  ? 228 ILE D O   1 
ATOM   6617 C CB  . ILE D 1 29  ? -2.076  46.687 43.871 1.00 24.55  ? 228 ILE D CB  1 
ATOM   6618 C CG1 . ILE D 1 29  ? -1.195  45.654 44.563 1.00 23.52  ? 228 ILE D CG1 1 
ATOM   6619 C CG2 . ILE D 1 29  ? -3.537  46.334 44.094 1.00 23.69  ? 228 ILE D CG2 1 
ATOM   6620 C CD1 . ILE D 1 29  ? -1.511  45.481 46.021 1.00 23.23  ? 228 ILE D CD1 1 
ATOM   6621 N N   . LEU D 1 30  ? -2.288  49.053 41.951 1.00 32.20  ? 229 LEU D N   1 
ATOM   6622 C CA  . LEU D 1 30  ? -3.053  50.150 41.373 1.00 36.19  ? 229 LEU D CA  1 
ATOM   6623 C C   . LEU D 1 30  ? -2.944  50.110 39.864 1.00 40.24  ? 229 LEU D C   1 
ATOM   6624 O O   . LEU D 1 30  ? -3.853  49.658 39.162 1.00 41.03  ? 229 LEU D O   1 
ATOM   6625 C CB  . LEU D 1 30  ? -2.516  51.491 41.868 1.00 34.19  ? 229 LEU D CB  1 
ATOM   6626 C CG  . LEU D 1 30  ? -2.698  51.832 43.341 1.00 32.57  ? 229 LEU D CG  1 
ATOM   6627 C CD1 . LEU D 1 30  ? -1.790  52.983 43.700 1.00 32.94  ? 229 LEU D CD1 1 
ATOM   6628 C CD2 . LEU D 1 30  ? -4.140  52.175 43.608 1.00 30.65  ? 229 LEU D CD2 1 
ATOM   6629 N N   . SER D 1 31  ? -1.802  50.591 39.383 1.00 44.83  ? 230 SER D N   1 
ATOM   6630 C CA  . SER D 1 31  ? -1.499  50.653 37.960 1.00 48.27  ? 230 SER D CA  1 
ATOM   6631 C C   . SER D 1 31  ? -1.178  49.269 37.425 1.00 49.45  ? 230 SER D C   1 
ATOM   6632 O O   . SER D 1 31  ? -1.992  48.650 36.770 1.00 48.07  ? 230 SER D O   1 
ATOM   6633 C CB  . SER D 1 31  ? -0.292  51.575 37.705 1.00 49.41  ? 230 SER D CB  1 
ATOM   6634 O OG  . SER D 1 31  ? 0.008   52.390 38.829 1.00 50.84  ? 230 SER D OG  1 
ATOM   6635 N N   . GLY D 1 32  ? 0.029   48.803 37.714 1.00 52.47  ? 231 GLY D N   1 
ATOM   6636 C CA  . GLY D 1 32  ? 0.485   47.498 37.258 1.00 56.43  ? 231 GLY D CA  1 
ATOM   6637 C C   . GLY D 1 32  ? -0.502  46.446 36.756 1.00 58.50  ? 231 GLY D C   1 
ATOM   6638 O O   . GLY D 1 32  ? -0.230  45.780 35.743 1.00 58.87  ? 231 GLY D O   1 
ATOM   6639 N N   . LYS D 1 33  ? -1.640  46.293 37.436 1.00 58.93  ? 232 LYS D N   1 
ATOM   6640 C CA  . LYS D 1 33  ? -2.620  45.277 37.052 1.00 58.53  ? 232 LYS D CA  1 
ATOM   6641 C C   . LYS D 1 33  ? -1.833  44.036 36.651 1.00 57.88  ? 232 LYS D C   1 
ATOM   6642 O O   . LYS D 1 33  ? -1.780  43.680 35.478 1.00 56.74  ? 232 LYS D O   1 
ATOM   6643 C CB  . LYS D 1 33  ? -3.488  45.743 35.872 1.00 58.97  ? 232 LYS D CB  1 
ATOM   6644 C CG  . LYS D 1 33  ? -4.661  46.652 36.234 1.00 60.11  ? 232 LYS D CG  1 
ATOM   6645 C CD  . LYS D 1 33  ? -4.226  48.094 36.428 1.00 60.32  ? 232 LYS D CD  1 
ATOM   6646 C CE  . LYS D 1 33  ? -5.378  49.052 36.671 1.00 60.70  ? 232 LYS D CE  1 
ATOM   6647 N NZ  . LYS D 1 33  ? -6.289  49.158 35.499 1.00 61.49  ? 232 LYS D NZ  1 
ATOM   6648 N N   . ALA D 1 34  ? -1.195  43.403 37.632 1.00 58.01  ? 233 ALA D N   1 
ATOM   6649 C CA  . ALA D 1 34  ? -0.388  42.208 37.388 1.00 58.28  ? 233 ALA D CA  1 
ATOM   6650 C C   . ALA D 1 34  ? -1.294  41.008 37.204 1.00 57.57  ? 233 ALA D C   1 
ATOM   6651 O O   . ALA D 1 34  ? -1.421  40.481 36.100 1.00 59.91  ? 233 ALA D O   1 
ATOM   6652 C CB  . ALA D 1 34  ? 0.568   41.968 38.548 1.00 59.02  ? 233 ALA D CB  1 
ATOM   6653 N N   . SER D 1 35  ? -1.896  40.555 38.295 1.00 55.80  ? 234 SER D N   1 
ATOM   6654 C CA  . SER D 1 35  ? -2.831  39.444 38.228 1.00 54.06  ? 234 SER D CA  1 
ATOM   6655 C C   . SER D 1 35  ? -4.138  40.213 38.138 1.00 51.60  ? 234 SER D C   1 
ATOM   6656 O O   . SER D 1 35  ? -4.189  41.369 38.545 1.00 51.35  ? 234 SER D O   1 
ATOM   6657 C CB  . SER D 1 35  ? -2.797  38.615 39.517 1.00 55.70  ? 234 SER D CB  1 
ATOM   6658 O OG  . SER D 1 35  ? -3.491  39.272 40.568 1.00 56.66  ? 234 SER D OG  1 
ATOM   6659 N N   . ASN D 1 36  ? -5.188  39.612 37.600 1.00 49.31  ? 235 ASN D N   1 
ATOM   6660 C CA  . ASN D 1 36  ? -6.435  40.348 37.514 1.00 47.17  ? 235 ASN D CA  1 
ATOM   6661 C C   . ASN D 1 36  ? -7.531  39.889 38.443 1.00 45.60  ? 235 ASN D C   1 
ATOM   6662 O O   . ASN D 1 36  ? -8.426  39.147 38.056 1.00 46.58  ? 235 ASN D O   1 
ATOM   6663 C CB  . ASN D 1 36  ? -7.014  40.333 36.117 1.00 47.84  ? 235 ASN D CB  1 
ATOM   6664 C CG  . ASN D 1 36  ? -8.460  40.791 36.108 1.00 48.72  ? 235 ASN D CG  1 
ATOM   6665 O OD1 . ASN D 1 36  ? -9.208  40.486 35.191 1.00 51.36  ? 235 ASN D OD1 1 
ATOM   6666 N ND2 . ASN D 1 36  ? -8.861  41.526 37.144 1.00 49.35  ? 235 ASN D ND2 1 
ATOM   6667 N N   . ASN D 1 37  ? -7.479  40.393 39.656 1.00 42.41  ? 236 ASN D N   1 
ATOM   6668 C CA  . ASN D 1 37  ? -8.447  40.096 40.690 1.00 39.14  ? 236 ASN D CA  1 
ATOM   6669 C C   . ASN D 1 37  ? -8.096  41.357 41.442 1.00 37.25  ? 236 ASN D C   1 
ATOM   6670 O O   . ASN D 1 37  ? -7.332  41.346 42.403 1.00 37.87  ? 236 ASN D O   1 
ATOM   6671 C CB  . ASN D 1 37  ? -8.015  38.807 41.391 1.00 35.93  ? 236 ASN D CB  1 
ATOM   6672 C CG  . ASN D 1 37  ? -8.801  38.518 42.640 1.00 32.75  ? 236 ASN D CG  1 
ATOM   6673 O OD1 . ASN D 1 37  ? -9.971  38.864 42.754 1.00 31.94  ? 236 ASN D OD1 1 
ATOM   6674 N ND2 . ASN D 1 37  ? -8.158  37.852 43.587 1.00 31.97  ? 236 ASN D ND2 1 
ATOM   6675 N N   . PRO D 1 38  ? -8.630  42.488 40.965 1.00 35.21  ? 237 PRO D N   1 
ATOM   6676 C CA  . PRO D 1 38  ? -8.376  43.798 41.551 1.00 35.95  ? 237 PRO D CA  1 
ATOM   6677 C C   . PRO D 1 38  ? -8.928  43.982 42.949 1.00 32.58  ? 237 PRO D C   1 
ATOM   6678 O O   . PRO D 1 38  ? -9.580  43.094 43.497 1.00 32.42  ? 237 PRO D O   1 
ATOM   6679 C CB  . PRO D 1 38  ? -9.012  44.735 40.541 1.00 35.84  ? 237 PRO D CB  1 
ATOM   6680 C CG  . PRO D 1 38  ? -10.270 44.003 40.232 1.00 36.57  ? 237 PRO D CG  1 
ATOM   6681 C CD  . PRO D 1 38  ? -9.812  42.547 40.086 1.00 35.33  ? 237 PRO D CD  1 
ATOM   6682 N N   . PRO D 1 39  ? -8.661  45.148 43.545 1.00 29.55  ? 238 PRO D N   1 
ATOM   6683 C CA  . PRO D 1 39  ? -9.130  45.453 44.896 1.00 30.36  ? 238 PRO D CA  1 
ATOM   6684 C C   . PRO D 1 39  ? -10.625 45.767 44.989 1.00 28.81  ? 238 PRO D C   1 
ATOM   6685 O O   . PRO D 1 39  ? -11.176 46.483 44.152 1.00 28.98  ? 238 PRO D O   1 
ATOM   6686 C CB  . PRO D 1 39  ? -8.261  46.647 45.296 1.00 30.17  ? 238 PRO D CB  1 
ATOM   6687 C CG  . PRO D 1 39  ? -7.030  46.508 44.416 1.00 28.91  ? 238 PRO D CG  1 
ATOM   6688 C CD  . PRO D 1 39  ? -7.644  46.122 43.114 1.00 28.97  ? 238 PRO D CD  1 
ATOM   6689 N N   . PHE D 1 40  ? -11.279 45.226 46.010 1.00 27.61  ? 239 PHE D N   1 
ATOM   6690 C CA  . PHE D 1 40  ? -12.696 45.483 46.212 1.00 27.67  ? 239 PHE D CA  1 
ATOM   6691 C C   . PHE D 1 40  ? -12.807 46.987 46.350 1.00 27.50  ? 239 PHE D C   1 
ATOM   6692 O O   . PHE D 1 40  ? -12.050 47.580 47.108 1.00 29.08  ? 239 PHE D O   1 
ATOM   6693 C CB  . PHE D 1 40  ? -13.169 44.797 47.488 1.00 27.93  ? 239 PHE D CB  1 
ATOM   6694 C CG  . PHE D 1 40  ? -14.576 45.137 47.877 1.00 30.30  ? 239 PHE D CG  1 
ATOM   6695 C CD1 . PHE D 1 40  ? -15.601 45.114 46.937 1.00 32.85  ? 239 PHE D CD1 1 
ATOM   6696 C CD2 . PHE D 1 40  ? -14.886 45.446 49.195 1.00 31.32  ? 239 PHE D CD2 1 
ATOM   6697 C CE1 . PHE D 1 40  ? -16.924 45.393 47.309 1.00 34.07  ? 239 PHE D CE1 1 
ATOM   6698 C CE2 . PHE D 1 40  ? -16.202 45.725 49.576 1.00 32.63  ? 239 PHE D CE2 1 
ATOM   6699 C CZ  . PHE D 1 40  ? -17.221 45.698 48.631 1.00 32.61  ? 239 PHE D CZ  1 
ATOM   6700 N N   . VAL D 1 41  ? -13.732 47.608 45.621 1.00 26.87  ? 240 VAL D N   1 
ATOM   6701 C CA  . VAL D 1 41  ? -13.881 49.065 45.678 1.00 26.01  ? 240 VAL D CA  1 
ATOM   6702 C C   . VAL D 1 41  ? -14.965 49.608 46.602 1.00 27.57  ? 240 VAL D C   1 
ATOM   6703 O O   . VAL D 1 41  ? -16.131 49.236 46.510 1.00 27.99  ? 240 VAL D O   1 
ATOM   6704 C CB  . VAL D 1 41  ? -14.118 49.661 44.278 1.00 23.54  ? 240 VAL D CB  1 
ATOM   6705 C CG1 . VAL D 1 41  ? -14.523 51.109 44.401 1.00 20.86  ? 240 VAL D CG1 1 
ATOM   6706 C CG2 . VAL D 1 41  ? -12.858 49.542 43.444 1.00 20.77  ? 240 VAL D CG2 1 
ATOM   6707 N N   . ILE D 1 42  ? -14.556 50.514 47.483 1.00 29.29  ? 241 ILE D N   1 
ATOM   6708 C CA  . ILE D 1 42  ? -15.457 51.147 48.437 1.00 30.42  ? 241 ILE D CA  1 
ATOM   6709 C C   . ILE D 1 42  ? -15.732 52.554 47.918 1.00 33.55  ? 241 ILE D C   1 
ATOM   6710 O O   . ILE D 1 42  ? -14.817 53.370 47.811 1.00 33.22  ? 241 ILE D O   1 
ATOM   6711 C CB  . ILE D 1 42  ? -14.801 51.251 49.824 1.00 27.41  ? 241 ILE D CB  1 
ATOM   6712 C CG1 . ILE D 1 42  ? -13.950 50.012 50.081 1.00 25.05  ? 241 ILE D CG1 1 
ATOM   6713 C CG2 . ILE D 1 42  ? -15.864 51.358 50.897 1.00 25.96  ? 241 ILE D CG2 1 
ATOM   6714 C CD1 . ILE D 1 42  ? -13.106 50.107 51.304 1.00 25.29  ? 241 ILE D CD1 1 
ATOM   6715 N N   . HIS D 1 43  ? -16.987 52.840 47.588 1.00 37.25  ? 242 HIS D N   1 
ATOM   6716 C CA  . HIS D 1 43  ? -17.340 54.159 47.070 1.00 41.00  ? 242 HIS D CA  1 
ATOM   6717 C C   . HIS D 1 43  ? -18.642 54.703 47.632 1.00 41.33  ? 242 HIS D C   1 
ATOM   6718 O O   . HIS D 1 43  ? -18.897 55.905 47.556 1.00 41.18  ? 242 HIS D O   1 
ATOM   6719 C CB  . HIS D 1 43  ? -17.429 54.112 45.547 1.00 44.34  ? 242 HIS D CB  1 
ATOM   6720 C CG  . HIS D 1 43  ? -18.361 53.059 45.030 1.00 47.69  ? 242 HIS D CG  1 
ATOM   6721 N ND1 . HIS D 1 43  ? -19.725 53.107 45.223 1.00 48.78  ? 242 HIS D ND1 1 
ATOM   6722 C CD2 . HIS D 1 43  ? -18.120 51.927 44.328 1.00 49.01  ? 242 HIS D CD2 1 
ATOM   6723 C CE1 . HIS D 1 43  ? -20.283 52.052 44.658 1.00 48.81  ? 242 HIS D CE1 1 
ATOM   6724 N NE2 . HIS D 1 43  ? -19.332 51.320 44.109 1.00 50.09  ? 242 HIS D NE2 1 
ATOM   6725 N N   . ASP D 1 44  ? -19.471 53.820 48.179 1.00 41.96  ? 243 ASP D N   1 
ATOM   6726 C CA  . ASP D 1 44  ? -20.734 54.248 48.749 1.00 43.22  ? 243 ASP D CA  1 
ATOM   6727 C C   . ASP D 1 44  ? -21.001 53.618 50.107 1.00 44.77  ? 243 ASP D C   1 
ATOM   6728 O O   . ASP D 1 44  ? -20.390 52.618 50.484 1.00 45.62  ? 243 ASP D O   1 
ATOM   6729 C CB  . ASP D 1 44  ? -21.893 53.953 47.784 1.00 42.98  ? 243 ASP D CB  1 
ATOM   6730 C CG  . ASP D 1 44  ? -22.106 52.472 47.545 1.00 42.01  ? 243 ASP D CG  1 
ATOM   6731 O OD1 . ASP D 1 44  ? -22.351 51.732 48.518 1.00 43.33  ? 243 ASP D OD1 1 
ATOM   6732 O OD2 . ASP D 1 44  ? -22.047 52.047 46.378 1.00 39.80  ? 243 ASP D OD2 1 
ATOM   6733 N N   . MET D 1 45  ? -21.922 54.230 50.840 1.00 46.07  ? 244 MET D N   1 
ATOM   6734 C CA  . MET D 1 45  ? -22.300 53.783 52.168 1.00 47.24  ? 244 MET D CA  1 
ATOM   6735 C C   . MET D 1 45  ? -22.489 52.286 52.298 1.00 48.05  ? 244 MET D C   1 
ATOM   6736 O O   . MET D 1 45  ? -22.194 51.710 53.341 1.00 48.62  ? 244 MET D O   1 
ATOM   6737 C CB  . MET D 1 45  ? -23.571 54.504 52.587 1.00 47.96  ? 244 MET D CB  1 
ATOM   6738 C CG  . MET D 1 45  ? -23.344 55.988 52.798 1.00 50.25  ? 244 MET D CG  1 
ATOM   6739 S SD  . MET D 1 45  ? -22.023 56.211 54.001 1.00 51.54  ? 244 MET D SD  1 
ATOM   6740 C CE  . MET D 1 45  ? -22.669 55.158 55.297 1.00 51.21  ? 244 MET D CE  1 
ATOM   6741 N N   . GLU D 1 46  ? -22.986 51.660 51.240 1.00 49.54  ? 245 GLU D N   1 
ATOM   6742 C CA  . GLU D 1 46  ? -23.221 50.222 51.238 1.00 50.58  ? 245 GLU D CA  1 
ATOM   6743 C C   . GLU D 1 46  ? -21.915 49.429 51.120 1.00 49.63  ? 245 GLU D C   1 
ATOM   6744 O O   . GLU D 1 46  ? -21.593 48.612 51.986 1.00 48.59  ? 245 GLU D O   1 
ATOM   6745 C CB  . GLU D 1 46  ? -24.156 49.859 50.084 1.00 52.57  ? 245 GLU D CB  1 
ATOM   6746 C CG  . GLU D 1 46  ? -24.437 48.372 49.959 1.00 56.24  ? 245 GLU D CG  1 
ATOM   6747 C CD  . GLU D 1 46  ? -24.861 47.980 48.555 1.00 58.43  ? 245 GLU D CD  1 
ATOM   6748 O OE1 . GLU D 1 46  ? -24.820 48.850 47.654 1.00 59.69  ? 245 GLU D OE1 1 
ATOM   6749 O OE2 . GLU D 1 46  ? -25.225 46.800 48.352 1.00 59.05  ? 245 GLU D OE2 1 
ATOM   6750 N N   . THR D 1 47  ? -21.168 49.673 50.048 1.00 48.81  ? 246 THR D N   1 
ATOM   6751 C CA  . THR D 1 47  ? -19.912 48.974 49.832 1.00 49.65  ? 246 THR D CA  1 
ATOM   6752 C C   . THR D 1 47  ? -19.048 49.119 51.072 1.00 51.07  ? 246 THR D C   1 
ATOM   6753 O O   . THR D 1 47  ? -18.219 48.264 51.370 1.00 51.10  ? 246 THR D O   1 
ATOM   6754 C CB  . THR D 1 47  ? -19.158 49.536 48.620 1.00 48.70  ? 246 THR D CB  1 
ATOM   6755 O OG1 . THR D 1 47  ? -18.572 50.795 48.956 1.00 49.75  ? 246 THR D OG1 1 
ATOM   6756 C CG2 . THR D 1 47  ? -20.108 49.745 47.468 1.00 49.64  ? 246 THR D CG2 1 
ATOM   6757 N N   . LEU D 1 48  ? -19.248 50.208 51.801 1.00 53.44  ? 247 LEU D N   1 
ATOM   6758 C CA  . LEU D 1 48  ? -18.486 50.436 53.018 1.00 56.48  ? 247 LEU D CA  1 
ATOM   6759 C C   . LEU D 1 48  ? -18.953 49.487 54.122 1.00 58.70  ? 247 LEU D C   1 
ATOM   6760 O O   . LEU D 1 48  ? -18.174 49.107 54.990 1.00 58.68  ? 247 LEU D O   1 
ATOM   6761 C CB  . LEU D 1 48  ? -18.645 51.882 53.496 1.00 55.91  ? 247 LEU D CB  1 
ATOM   6762 C CG  . LEU D 1 48  ? -18.089 52.136 54.900 1.00 54.90  ? 247 LEU D CG  1 
ATOM   6763 C CD1 . LEU D 1 48  ? -16.571 52.073 54.875 1.00 54.92  ? 247 LEU D CD1 1 
ATOM   6764 C CD2 . LEU D 1 48  ? -18.554 53.483 55.398 1.00 54.99  ? 247 LEU D CD2 1 
ATOM   6765 N N   . CYS D 1 49  ? -20.228 49.110 54.088 1.00 61.31  ? 248 CYS D N   1 
ATOM   6766 C CA  . CYS D 1 49  ? -20.779 48.214 55.098 1.00 63.78  ? 248 CYS D CA  1 
ATOM   6767 C C   . CYS D 1 49  ? -20.277 46.789 54.911 1.00 65.03  ? 248 CYS D C   1 
ATOM   6768 O O   . CYS D 1 49  ? -20.051 46.073 55.885 1.00 64.60  ? 248 CYS D O   1 
ATOM   6769 C CB  . CYS D 1 49  ? -22.310 48.247 55.064 1.00 64.29  ? 248 CYS D CB  1 
ATOM   6770 S SG  . CYS D 1 49  ? -23.025 49.822 55.610 1.00 66.11  ? 248 CYS D SG  1 
ATOM   6771 N N   . MET D 1 50  ? -20.110 46.372 53.661 1.00 66.26  ? 249 MET D N   1 
ATOM   6772 C CA  . MET D 1 50  ? -19.602 45.036 53.393 1.00 67.06  ? 249 MET D CA  1 
ATOM   6773 C C   . MET D 1 50  ? -18.116 45.085 53.709 1.00 67.68  ? 249 MET D C   1 
ATOM   6774 O O   . MET D 1 50  ? -17.609 44.275 54.480 1.00 67.38  ? 249 MET D O   1 
ATOM   6775 C CB  . MET D 1 50  ? -19.785 44.667 51.926 1.00 67.09  ? 249 MET D CB  1 
ATOM   6776 C CG  . MET D 1 50  ? -21.213 44.729 51.420 1.00 67.46  ? 249 MET D CG  1 
ATOM   6777 S SD  . MET D 1 50  ? -21.210 44.538 49.627 1.00 70.11  ? 249 MET D SD  1 
ATOM   6778 C CE  . MET D 1 50  ? -22.137 43.022 49.423 1.00 69.88  ? 249 MET D CE  1 
ATOM   6779 N N   . ALA D 1 51  ? -17.431 46.057 53.112 1.00 68.59  ? 250 ALA D N   1 
ATOM   6780 C CA  . ALA D 1 51  ? -15.999 46.228 53.309 1.00 70.18  ? 250 ALA D CA  1 
ATOM   6781 C C   . ALA D 1 51  ? -15.583 45.882 54.730 1.00 71.85  ? 250 ALA D C   1 
ATOM   6782 O O   . ALA D 1 51  ? -14.934 44.863 54.952 1.00 72.24  ? 250 ALA D O   1 
ATOM   6783 C CB  . ALA D 1 51  ? -15.588 47.652 52.975 1.00 69.81  ? 250 ALA D CB  1 
ATOM   6784 N N   . GLU D 1 52  ? -15.967 46.707 55.699 1.00 74.01  ? 251 GLU D N   1 
ATOM   6785 C CA  . GLU D 1 52  ? -15.583 46.433 57.078 1.00 76.71  ? 251 GLU D CA  1 
ATOM   6786 C C   . GLU D 1 52  ? -16.385 45.358 57.802 1.00 77.88  ? 251 GLU D C   1 
ATOM   6787 O O   . GLU D 1 52  ? -15.880 44.758 58.745 1.00 77.93  ? 251 GLU D O   1 
ATOM   6788 C CB  . GLU D 1 52  ? -15.558 47.723 57.917 1.00 77.21  ? 251 GLU D CB  1 
ATOM   6789 C CG  . GLU D 1 52  ? -16.413 48.868 57.408 1.00 77.56  ? 251 GLU D CG  1 
ATOM   6790 C CD  . GLU D 1 52  ? -17.889 48.612 57.571 1.00 77.77  ? 251 GLU D CD  1 
ATOM   6791 O OE1 . GLU D 1 52  ? -18.386 47.621 56.995 1.00 77.60  ? 251 GLU D OE1 1 
ATOM   6792 O OE2 . GLU D 1 52  ? -18.552 49.405 58.272 1.00 77.98  ? 251 GLU D OE2 1 
ATOM   6793 N N   . LYS D 1 53  ? -17.616 45.098 57.372 1.00 79.71  ? 252 LYS D N   1 
ATOM   6794 C CA  . LYS D 1 53  ? -18.407 44.060 58.025 1.00 81.66  ? 252 LYS D CA  1 
ATOM   6795 C C   . LYS D 1 53  ? -17.679 42.728 57.938 1.00 82.41  ? 252 LYS D C   1 
ATOM   6796 O O   . LYS D 1 53  ? -17.772 41.899 58.842 1.00 82.28  ? 252 LYS D O   1 
ATOM   6797 C CB  . LYS D 1 53  ? -19.777 43.905 57.371 1.00 82.41  ? 252 LYS D CB  1 
ATOM   6798 C CG  . LYS D 1 53  ? -20.567 42.739 57.937 1.00 83.71  ? 252 LYS D CG  1 
ATOM   6799 C CD  . LYS D 1 53  ? -21.979 42.688 57.386 1.00 85.03  ? 252 LYS D CD  1 
ATOM   6800 C CE  . LYS D 1 53  ? -22.831 41.783 58.254 1.00 85.89  ? 252 LYS D CE  1 
ATOM   6801 N NZ  . LYS D 1 53  ? -22.740 42.228 59.672 1.00 86.86  ? 252 LYS D NZ  1 
ATOM   6802 N N   . THR D 1 54  ? -16.966 42.528 56.835 1.00 83.65  ? 253 THR D N   1 
ATOM   6803 C CA  . THR D 1 54  ? -16.213 41.299 56.618 1.00 84.67  ? 253 THR D CA  1 
ATOM   6804 C C   . THR D 1 54  ? -14.786 41.532 57.082 1.00 85.76  ? 253 THR D C   1 
ATOM   6805 O O   . THR D 1 54  ? -13.929 40.659 56.953 1.00 85.55  ? 253 THR D O   1 
ATOM   6806 C CB  . THR D 1 54  ? -16.172 40.905 55.124 1.00 84.43  ? 253 THR D CB  1 
ATOM   6807 O OG1 . THR D 1 54  ? -15.003 41.464 54.507 1.00 83.08  ? 253 THR D OG1 1 
ATOM   6808 C CG2 . THR D 1 54  ? -17.407 41.424 54.407 1.00 84.39  ? 253 THR D CG2 1 
ATOM   6809 N N   . LEU D 1 55  ? -14.537 42.719 57.624 1.00 87.27  ? 254 LEU D N   1 
ATOM   6810 C CA  . LEU D 1 55  ? -13.206 43.070 58.092 1.00 89.31  ? 254 LEU D CA  1 
ATOM   6811 C C   . LEU D 1 55  ? -12.943 42.495 59.479 1.00 91.96  ? 254 LEU D C   1 
ATOM   6812 O O   . LEU D 1 55  ? -12.028 41.691 59.665 1.00 92.47  ? 254 LEU D O   1 
ATOM   6813 C CB  . LEU D 1 55  ? -13.048 44.589 58.090 1.00 86.85  ? 254 LEU D CB  1 
ATOM   6814 C CG  . LEU D 1 55  ? -11.636 45.171 58.070 1.00 85.50  ? 254 LEU D CG  1 
ATOM   6815 C CD1 . LEU D 1 55  ? -10.631 44.207 57.470 1.00 84.77  ? 254 LEU D CD1 1 
ATOM   6816 C CD2 . LEU D 1 55  ? -11.678 46.440 57.265 1.00 84.97  ? 254 LEU D CD2 1 
ATOM   6817 N N   . VAL D 1 56  ? -13.744 42.900 60.455 1.00 95.08  ? 255 VAL D N   1 
ATOM   6818 C CA  . VAL D 1 56  ? -13.580 42.377 61.802 1.00 98.53  ? 255 VAL D CA  1 
ATOM   6819 C C   . VAL D 1 56  ? -14.358 41.077 61.882 1.00 101.15 ? 255 VAL D C   1 
ATOM   6820 O O   . VAL D 1 56  ? -15.581 41.084 61.788 1.00 101.01 ? 255 VAL D O   1 
ATOM   6821 C CB  . VAL D 1 56  ? -14.147 43.339 62.860 1.00 98.30  ? 255 VAL D CB  1 
ATOM   6822 C CG1 . VAL D 1 56  ? -14.028 42.721 64.246 1.00 98.04  ? 255 VAL D CG1 1 
ATOM   6823 C CG2 . VAL D 1 56  ? -13.424 44.668 62.794 1.00 98.68  ? 255 VAL D CG2 1 
ATOM   6824 N N   . ALA D 1 57  ? -13.660 39.959 62.039 1.00 104.94 ? 256 ALA D N   1 
ATOM   6825 C CA  . ALA D 1 57  ? -14.346 38.677 62.138 1.00 109.66 ? 256 ALA D CA  1 
ATOM   6826 C C   . ALA D 1 57  ? -15.089 38.594 63.483 1.00 113.06 ? 256 ALA D C   1 
ATOM   6827 O O   . ALA D 1 57  ? -14.838 37.692 64.290 1.00 113.43 ? 256 ALA D O   1 
ATOM   6828 C CB  . ALA D 1 57  ? -13.342 37.536 62.005 1.00 109.21 ? 256 ALA D CB  1 
ATOM   6829 N N   . LYS D 1 58  ? -16.000 39.547 63.706 1.00 116.62 ? 257 LYS D N   1 
ATOM   6830 C CA  . LYS D 1 58  ? -16.803 39.640 64.936 1.00 119.71 ? 257 LYS D CA  1 
ATOM   6831 C C   . LYS D 1 58  ? -17.978 40.626 64.801 1.00 121.71 ? 257 LYS D C   1 
ATOM   6832 O O   . LYS D 1 58  ? -18.854 40.686 65.668 1.00 121.87 ? 257 LYS D O   1 
ATOM   6833 C CB  . LYS D 1 58  ? -15.925 40.092 66.117 1.00 119.78 ? 257 LYS D CB  1 
ATOM   6834 C CG  . LYS D 1 58  ? -16.713 40.492 67.363 1.00 119.60 ? 257 LYS D CG  1 
ATOM   6835 C CD  . LYS D 1 58  ? -15.842 41.069 68.471 1.00 119.38 ? 257 LYS D CD  1 
ATOM   6836 C CE  . LYS D 1 58  ? -15.911 42.588 68.513 1.00 119.46 ? 257 LYS D CE  1 
ATOM   6837 N NZ  . LYS D 1 58  ? -17.316 43.081 68.602 1.00 119.71 ? 257 LYS D NZ  1 
ATOM   6838 N N   . LEU D 1 59  ? -17.992 41.392 63.714 1.00 124.03 ? 258 LEU D N   1 
ATOM   6839 C CA  . LEU D 1 59  ? -19.032 42.398 63.482 1.00 126.09 ? 258 LEU D CA  1 
ATOM   6840 C C   . LEU D 1 59  ? -20.424 41.828 63.221 1.00 127.26 ? 258 LEU D C   1 
ATOM   6841 O O   . LEU D 1 59  ? -21.429 42.496 63.473 1.00 127.01 ? 258 LEU D O   1 
ATOM   6842 C CB  . LEU D 1 59  ? -18.636 43.287 62.298 1.00 126.18 ? 258 LEU D CB  1 
ATOM   6843 C CG  . LEU D 1 59  ? -17.176 43.743 62.232 1.00 125.90 ? 258 LEU D CG  1 
ATOM   6844 C CD1 . LEU D 1 59  ? -16.648 43.434 60.861 1.00 125.50 ? 258 LEU D CD1 1 
ATOM   6845 C CD2 . LEU D 1 59  ? -17.036 45.225 62.539 1.00 125.22 ? 258 LEU D CD2 1 
ATOM   6846 N N   . VAL D 1 60  ? -20.477 40.597 62.720 1.00 129.06 ? 259 VAL D N   1 
ATOM   6847 C CA  . VAL D 1 60  ? -21.745 39.952 62.394 1.00 130.86 ? 259 VAL D CA  1 
ATOM   6848 C C   . VAL D 1 60  ? -22.517 39.370 63.592 1.00 131.72 ? 259 VAL D C   1 
ATOM   6849 O O   . VAL D 1 60  ? -22.820 38.172 63.630 1.00 132.32 ? 259 VAL D O   1 
ATOM   6850 C CB  . VAL D 1 60  ? -21.527 38.848 61.304 1.00 131.00 ? 259 VAL D CB  1 
ATOM   6851 C CG1 . VAL D 1 60  ? -20.681 37.706 61.859 1.00 131.16 ? 259 VAL D CG1 1 
ATOM   6852 C CG2 . VAL D 1 60  ? -22.869 38.345 60.783 1.00 131.14 ? 259 VAL D CG2 1 
ATOM   6853 N N   . ALA D 1 61  ? -22.839 40.234 64.558 1.00 132.11 ? 260 ALA D N   1 
ATOM   6854 C CA  . ALA D 1 61  ? -23.591 39.839 65.752 1.00 132.32 ? 260 ALA D CA  1 
ATOM   6855 C C   . ALA D 1 61  ? -23.585 40.889 66.860 1.00 132.53 ? 260 ALA D C   1 
ATOM   6856 O O   . ALA D 1 61  ? -24.597 41.090 67.531 1.00 132.66 ? 260 ALA D O   1 
ATOM   6857 C CB  . ALA D 1 61  ? -23.054 38.518 66.310 1.00 132.26 ? 260 ALA D CB  1 
ATOM   6858 N N   . ASN D 1 62  ? -22.453 41.563 67.042 1.00 132.84 ? 261 ASN D N   1 
ATOM   6859 C CA  . ASN D 1 62  ? -22.316 42.550 68.113 1.00 133.03 ? 261 ASN D CA  1 
ATOM   6860 C C   . ASN D 1 62  ? -23.022 43.912 68.003 1.00 132.78 ? 261 ASN D C   1 
ATOM   6861 O O   . ASN D 1 62  ? -23.083 44.649 68.989 1.00 132.71 ? 261 ASN D O   1 
ATOM   6862 C CB  . ASN D 1 62  ? -20.827 42.739 68.428 1.00 133.24 ? 261 ASN D CB  1 
ATOM   6863 C CG  . ASN D 1 62  ? -20.227 41.524 69.130 1.00 133.30 ? 261 ASN D CG  1 
ATOM   6864 O OD1 . ASN D 1 62  ? -20.366 40.391 68.665 1.00 133.19 ? 261 ASN D OD1 1 
ATOM   6865 N ND2 . ASN D 1 62  ? -19.560 41.758 70.254 1.00 133.30 ? 261 ASN D ND2 1 
ATOM   6866 N N   . GLY D 1 63  ? -23.556 44.247 66.829 1.00 132.42 ? 262 GLY D N   1 
ATOM   6867 C CA  . GLY D 1 63  ? -24.275 45.508 66.682 1.00 131.43 ? 262 GLY D CA  1 
ATOM   6868 C C   . GLY D 1 63  ? -23.531 46.650 66.017 1.00 130.69 ? 262 GLY D C   1 
ATOM   6869 O O   . GLY D 1 63  ? -24.025 47.779 65.959 1.00 130.48 ? 262 GLY D O   1 
ATOM   6870 N N   . ILE D 1 64  ? -22.347 46.347 65.502 1.00 130.03 ? 263 ILE D N   1 
ATOM   6871 C CA  . ILE D 1 64  ? -21.510 47.340 64.845 1.00 129.22 ? 263 ILE D CA  1 
ATOM   6872 C C   . ILE D 1 64  ? -21.730 47.374 63.331 1.00 129.11 ? 263 ILE D C   1 
ATOM   6873 O O   . ILE D 1 64  ? -20.867 47.843 62.589 1.00 129.46 ? 263 ILE D O   1 
ATOM   6874 C CB  . ILE D 1 64  ? -20.013 47.055 65.123 1.00 128.60 ? 263 ILE D CB  1 
ATOM   6875 C CG1 . ILE D 1 64  ? -19.886 45.897 66.120 1.00 127.94 ? 263 ILE D CG1 1 
ATOM   6876 C CG2 . ILE D 1 64  ? -19.334 48.308 65.670 1.00 128.03 ? 263 ILE D CG2 1 
ATOM   6877 C CD1 . ILE D 1 64  ? -18.473 45.406 66.331 1.00 127.19 ? 263 ILE D CD1 1 
ATOM   6878 N N   . GLN D 1 65  ? -22.878 46.882 62.869 1.00 128.55 ? 264 GLN D N   1 
ATOM   6879 C CA  . GLN D 1 65  ? -23.158 46.878 61.435 1.00 127.69 ? 264 GLN D CA  1 
ATOM   6880 C C   . GLN D 1 65  ? -23.803 48.197 61.001 1.00 127.21 ? 264 GLN D C   1 
ATOM   6881 O O   . GLN D 1 65  ? -23.824 48.521 59.811 1.00 127.04 ? 264 GLN D O   1 
ATOM   6882 C CB  . GLN D 1 65  ? -24.064 45.691 61.056 1.00 127.30 ? 264 GLN D CB  1 
ATOM   6883 C CG  . GLN D 1 65  ? -25.552 46.004 60.977 1.00 126.74 ? 264 GLN D CG  1 
ATOM   6884 C CD  . GLN D 1 65  ? -26.177 46.298 62.327 1.00 126.28 ? 264 GLN D CD  1 
ATOM   6885 O OE1 . GLN D 1 65  ? -27.254 46.890 62.407 1.00 125.84 ? 264 GLN D OE1 1 
ATOM   6886 N NE2 . GLN D 1 65  ? -25.513 45.874 63.396 1.00 126.00 ? 264 GLN D NE2 1 
ATOM   6887 N N   . ASN D 1 66  ? -24.317 48.956 61.969 1.00 126.42 ? 265 ASN D N   1 
ATOM   6888 C CA  . ASN D 1 66  ? -24.958 50.236 61.673 1.00 125.36 ? 265 ASN D CA  1 
ATOM   6889 C C   . ASN D 1 66  ? -24.850 51.286 62.785 1.00 124.60 ? 265 ASN D C   1 
ATOM   6890 O O   . ASN D 1 66  ? -25.787 51.487 63.561 1.00 124.10 ? 265 ASN D O   1 
ATOM   6891 C CB  . ASN D 1 66  ? -26.434 50.021 61.337 1.00 125.14 ? 265 ASN D CB  1 
ATOM   6892 C CG  . ASN D 1 66  ? -27.119 51.300 60.908 1.00 125.12 ? 265 ASN D CG  1 
ATOM   6893 O OD1 . ASN D 1 66  ? -28.154 51.679 61.454 1.00 125.05 ? 265 ASN D OD1 1 
ATOM   6894 N ND2 . ASN D 1 66  ? -26.541 51.976 59.922 1.00 125.47 ? 265 ASN D ND2 1 
ATOM   6895 N N   . LYS D 1 67  ? -23.704 51.958 62.844 1.00 123.84 ? 266 LYS D N   1 
ATOM   6896 C CA  . LYS D 1 67  ? -23.449 53.010 63.827 1.00 122.92 ? 266 LYS D CA  1 
ATOM   6897 C C   . LYS D 1 67  ? -22.907 54.216 63.057 1.00 122.64 ? 266 LYS D C   1 
ATOM   6898 O O   . LYS D 1 67  ? -21.742 54.582 63.206 1.00 122.53 ? 266 LYS D O   1 
ATOM   6899 C CB  . LYS D 1 67  ? -22.418 52.530 64.856 1.00 122.30 ? 266 LYS D CB  1 
ATOM   6900 C CG  . LYS D 1 67  ? -22.833 51.266 65.594 1.00 121.45 ? 266 LYS D CG  1 
ATOM   6901 C CD  . LYS D 1 67  ? -21.803 50.837 66.627 1.00 120.19 ? 266 LYS D CD  1 
ATOM   6902 C CE  . LYS D 1 67  ? -22.283 49.601 67.368 1.00 119.63 ? 266 LYS D CE  1 
ATOM   6903 N NZ  . LYS D 1 67  ? -21.343 49.176 68.434 1.00 119.36 ? 266 LYS D NZ  1 
ATOM   6904 N N   . GLU D 1 68  ? -23.773 54.825 62.244 1.00 122.55 ? 267 GLU D N   1 
ATOM   6905 C CA  . GLU D 1 68  ? -23.425 55.966 61.386 1.00 122.54 ? 267 GLU D CA  1 
ATOM   6906 C C   . GLU D 1 68  ? -22.101 55.713 60.672 1.00 122.39 ? 267 GLU D C   1 
ATOM   6907 O O   . GLU D 1 68  ? -21.035 56.117 61.141 1.00 122.85 ? 267 GLU D O   1 
ATOM   6908 C CB  . GLU D 1 68  ? -23.325 57.284 62.168 1.00 122.47 ? 267 GLU D CB  1 
ATOM   6909 C CG  . GLU D 1 68  ? -23.757 57.251 63.622 1.00 122.42 ? 267 GLU D CG  1 
ATOM   6910 C CD  . GLU D 1 68  ? -23.650 58.622 64.269 1.00 122.25 ? 267 GLU D CD  1 
ATOM   6911 O OE1 . GLU D 1 68  ? -22.554 59.226 64.222 1.00 121.61 ? 267 GLU D OE1 1 
ATOM   6912 O OE2 . GLU D 1 68  ? -24.664 59.096 64.824 1.00 122.30 ? 267 GLU D OE2 1 
ATOM   6913 N N   . ALA D 1 69  ? -22.188 55.053 59.523 1.00 121.83 ? 268 ALA D N   1 
ATOM   6914 C CA  . ALA D 1 69  ? -21.020 54.698 58.727 1.00 121.13 ? 268 ALA D CA  1 
ATOM   6915 C C   . ALA D 1 69  ? -20.201 55.845 58.124 1.00 120.58 ? 268 ALA D C   1 
ATOM   6916 O O   . ALA D 1 69  ? -20.140 56.004 56.905 1.00 121.38 ? 268 ALA D O   1 
ATOM   6917 C CB  . ALA D 1 69  ? -21.438 53.743 57.629 1.00 121.14 ? 268 ALA D CB  1 
ATOM   6918 N N   . GLU D 1 70  ? -19.579 56.638 58.987 1.00 118.87 ? 269 GLU D N   1 
ATOM   6919 C CA  . GLU D 1 70  ? -18.708 57.746 58.593 1.00 116.91 ? 269 GLU D CA  1 
ATOM   6920 C C   . GLU D 1 70  ? -18.042 58.102 59.907 1.00 115.79 ? 269 GLU D C   1 
ATOM   6921 O O   . GLU D 1 70  ? -17.033 58.805 59.962 1.00 116.08 ? 269 GLU D O   1 
ATOM   6922 C CB  . GLU D 1 70  ? -19.487 58.941 58.016 1.00 116.21 ? 269 GLU D CB  1 
ATOM   6923 C CG  . GLU D 1 70  ? -20.582 59.524 58.893 1.00 115.64 ? 269 GLU D CG  1 
ATOM   6924 C CD  . GLU D 1 70  ? -21.977 59.144 58.419 1.00 115.42 ? 269 GLU D CD  1 
ATOM   6925 O OE1 . GLU D 1 70  ? -22.312 59.417 57.244 1.00 115.88 ? 269 GLU D OE1 1 
ATOM   6926 O OE2 . GLU D 1 70  ? -22.741 58.576 59.224 1.00 114.29 ? 269 GLU D OE2 1 
ATOM   6927 N N   . VAL D 1 71  ? -18.638 57.565 60.966 1.00 113.90 ? 270 VAL D N   1 
ATOM   6928 C CA  . VAL D 1 71  ? -18.166 57.721 62.331 1.00 111.80 ? 270 VAL D CA  1 
ATOM   6929 C C   . VAL D 1 71  ? -17.578 56.351 62.696 1.00 110.46 ? 270 VAL D C   1 
ATOM   6930 O O   . VAL D 1 71  ? -17.217 56.092 63.843 1.00 110.59 ? 270 VAL D O   1 
ATOM   6931 C CB  . VAL D 1 71  ? -19.353 58.102 63.280 1.00 111.78 ? 270 VAL D CB  1 
ATOM   6932 C CG1 . VAL D 1 71  ? -19.008 57.827 64.735 1.00 111.26 ? 270 VAL D CG1 1 
ATOM   6933 C CG2 . VAL D 1 71  ? -19.684 59.572 63.115 1.00 111.38 ? 270 VAL D CG2 1 
ATOM   6934 N N   . ARG D 1 72  ? -17.468 55.483 61.689 1.00 109.02 ? 271 ARG D N   1 
ATOM   6935 C CA  . ARG D 1 72  ? -16.936 54.128 61.867 1.00 107.37 ? 271 ARG D CA  1 
ATOM   6936 C C   . ARG D 1 72  ? -15.614 53.881 61.146 1.00 106.30 ? 271 ARG D C   1 
ATOM   6937 O O   . ARG D 1 72  ? -14.845 53.000 61.534 1.00 106.03 ? 271 ARG D O   1 
ATOM   6938 C CB  . ARG D 1 72  ? -17.944 53.099 61.370 1.00 107.16 ? 271 ARG D CB  1 
ATOM   6939 C CG  . ARG D 1 72  ? -18.439 52.121 62.419 1.00 106.13 ? 271 ARG D CG  1 
ATOM   6940 C CD  . ARG D 1 72  ? -19.240 51.033 61.726 1.00 104.73 ? 271 ARG D CD  1 
ATOM   6941 N NE  . ARG D 1 72  ? -19.827 51.535 60.485 1.00 103.39 ? 271 ARG D NE  1 
ATOM   6942 C CZ  . ARG D 1 72  ? -20.538 50.799 59.638 1.00 102.30 ? 271 ARG D CZ  1 
ATOM   6943 N NH1 . ARG D 1 72  ? -20.761 49.522 59.894 1.00 101.86 ? 271 ARG D NH1 1 
ATOM   6944 N NH2 . ARG D 1 72  ? -21.018 51.332 58.528 1.00 101.46 ? 271 ARG D NH2 1 
ATOM   6945 N N   . ILE D 1 73  ? -15.365 54.634 60.080 1.00 104.83 ? 272 ILE D N   1 
ATOM   6946 C CA  . ILE D 1 73  ? -14.127 54.487 59.331 1.00 102.90 ? 272 ILE D CA  1 
ATOM   6947 C C   . ILE D 1 73  ? -13.008 54.925 60.253 1.00 103.38 ? 272 ILE D C   1 
ATOM   6948 O O   . ILE D 1 73  ? -11.851 54.955 59.864 1.00 103.01 ? 272 ILE D O   1 
ATOM   6949 C CB  . ILE D 1 73  ? -14.125 55.367 58.077 1.00 101.14 ? 272 ILE D CB  1 
ATOM   6950 C CG1 . ILE D 1 73  ? -15.369 55.066 57.248 1.00 99.87  ? 272 ILE D CG1 1 
ATOM   6951 C CG2 . ILE D 1 73  ? -12.882 55.094 57.246 1.00 100.08 ? 272 ILE D CG2 1 
ATOM   6952 C CD1 . ILE D 1 73  ? -15.866 56.242 56.462 1.00 99.28  ? 272 ILE D CD1 1 
ATOM   6953 N N   . PHE D 1 74  ? -13.372 55.286 61.480 1.00 104.44 ? 273 PHE D N   1 
ATOM   6954 C CA  . PHE D 1 74  ? -12.392 55.697 62.470 1.00 105.93 ? 273 PHE D CA  1 
ATOM   6955 C C   . PHE D 1 74  ? -11.975 54.413 63.173 1.00 107.16 ? 273 PHE D C   1 
ATOM   6956 O O   . PHE D 1 74  ? -10.800 54.214 63.484 1.00 107.82 ? 273 PHE D O   1 
ATOM   6957 C CB  . PHE D 1 74  ? -13.002 56.681 63.475 1.00 105.48 ? 273 PHE D CB  1 
ATOM   6958 C CG  . PHE D 1 74  ? -12.033 57.731 63.955 1.00 105.12 ? 273 PHE D CG  1 
ATOM   6959 C CD1 . PHE D 1 74  ? -12.239 59.076 63.657 1.00 104.48 ? 273 PHE D CD1 1 
ATOM   6960 C CD2 . PHE D 1 74  ? -10.889 57.370 64.665 1.00 104.66 ? 273 PHE D CD2 1 
ATOM   6961 C CE1 . PHE D 1 74  ? -11.318 60.047 64.057 1.00 103.69 ? 273 PHE D CE1 1 
ATOM   6962 C CE2 . PHE D 1 74  ? -9.962  58.335 65.069 1.00 103.81 ? 273 PHE D CE2 1 
ATOM   6963 C CZ  . PHE D 1 74  ? -10.178 59.674 64.763 1.00 103.32 ? 273 PHE D CZ  1 
ATOM   6964 N N   . HIS D 1 75  ? -12.955 53.543 63.411 1.00 108.08 ? 274 HIS D N   1 
ATOM   6965 C CA  . HIS D 1 75  ? -12.716 52.251 64.047 1.00 108.44 ? 274 HIS D CA  1 
ATOM   6966 C C   . HIS D 1 75  ? -11.755 51.540 63.098 1.00 108.16 ? 274 HIS D C   1 
ATOM   6967 O O   . HIS D 1 75  ? -10.562 51.449 63.351 1.00 108.40 ? 274 HIS D O   1 
ATOM   6968 C CB  . HIS D 1 75  ? -14.028 51.462 64.138 1.00 109.37 ? 274 HIS D CB  1 
ATOM   6969 C CG  . HIS D 1 75  ? -14.097 50.509 65.293 1.00 110.21 ? 274 HIS D CG  1 
ATOM   6970 N ND1 . HIS D 1 75  ? -13.109 49.585 65.566 1.00 110.87 ? 274 HIS D ND1 1 
ATOM   6971 C CD2 . HIS D 1 75  ? -15.060 50.314 66.226 1.00 110.24 ? 274 HIS D CD2 1 
ATOM   6972 C CE1 . HIS D 1 75  ? -13.462 48.863 66.615 1.00 110.86 ? 274 HIS D CE1 1 
ATOM   6973 N NE2 . HIS D 1 75  ? -14.642 49.285 67.034 1.00 110.53 ? 274 HIS D NE2 1 
ATOM   6974 N N   . CYS D 1 76  ? -12.294 51.058 61.988 1.00 107.29 ? 275 CYS D N   1 
ATOM   6975 C CA  . CYS D 1 76  ? -11.507 50.369 60.980 1.00 106.30 ? 275 CYS D CA  1 
ATOM   6976 C C   . CYS D 1 76  ? -10.185 51.106 60.686 1.00 105.27 ? 275 CYS D C   1 
ATOM   6977 O O   . CYS D 1 76  ? -9.194  50.482 60.304 1.00 105.57 ? 275 CYS D O   1 
ATOM   6978 C CB  . CYS D 1 76  ? -12.360 50.237 59.720 1.00 106.76 ? 275 CYS D CB  1 
ATOM   6979 S SG  . CYS D 1 76  ? -14.104 49.883 60.112 1.00 106.68 ? 275 CYS D SG  1 
ATOM   6980 N N   . CYS D 1 77  ? -10.172 52.428 60.871 1.00 103.59 ? 276 CYS D N   1 
ATOM   6981 C CA  . CYS D 1 77  ? -8.967  53.237 60.644 1.00 101.26 ? 276 CYS D CA  1 
ATOM   6982 C C   . CYS D 1 77  ? -8.072  53.181 61.877 1.00 100.25 ? 276 CYS D C   1 
ATOM   6983 O O   . CYS D 1 77  ? -7.005  53.791 61.907 1.00 99.97  ? 276 CYS D O   1 
ATOM   6984 C CB  . CYS D 1 77  ? -9.333  54.699 60.380 1.00 100.53 ? 276 CYS D CB  1 
ATOM   6985 S SG  . CYS D 1 77  ? -8.830  55.348 58.771 1.00 99.55  ? 276 CYS D SG  1 
ATOM   6986 N N   . GLN D 1 78  ? -8.528  52.443 62.886 1.00 99.26  ? 277 GLN D N   1 
ATOM   6987 C CA  . GLN D 1 78  ? -7.829  52.271 64.165 1.00 97.87  ? 277 GLN D CA  1 
ATOM   6988 C C   . GLN D 1 78  ? -6.723  51.224 64.150 1.00 95.80  ? 277 GLN D C   1 
ATOM   6989 O O   . GLN D 1 78  ? -5.558  51.526 64.416 1.00 95.22  ? 277 GLN D O   1 
ATOM   6990 C CB  . GLN D 1 78  ? -8.835  51.895 65.255 1.00 99.34  ? 277 GLN D CB  1 
ATOM   6991 C CG  . GLN D 1 78  ? -9.542  53.083 65.873 1.00 101.24 ? 277 GLN D CG  1 
ATOM   6992 C CD  . GLN D 1 78  ? -8.581  53.944 66.663 1.00 102.62 ? 277 GLN D CD  1 
ATOM   6993 O OE1 . GLN D 1 78  ? -7.563  54.397 66.137 1.00 102.86 ? 277 GLN D OE1 1 
ATOM   6994 N NE2 . GLN D 1 78  ? -8.893  54.169 67.937 1.00 103.39 ? 277 GLN D NE2 1 
ATOM   6995 N N   . CYS D 1 79  ? -7.115  49.985 63.878 1.00 93.33  ? 278 CYS D N   1 
ATOM   6996 C CA  . CYS D 1 79  ? -6.190  48.863 63.806 1.00 90.60  ? 278 CYS D CA  1 
ATOM   6997 C C   . CYS D 1 79  ? -5.027  49.243 62.904 1.00 87.54  ? 278 CYS D C   1 
ATOM   6998 O O   . CYS D 1 79  ? -3.861  49.160 63.293 1.00 87.17  ? 278 CYS D O   1 
ATOM   6999 C CB  . CYS D 1 79  ? -6.920  47.659 63.219 1.00 91.91  ? 278 CYS D CB  1 
ATOM   7000 S SG  . CYS D 1 79  ? -8.036  48.112 61.859 1.00 94.20  ? 278 CYS D SG  1 
ATOM   7001 N N   . THR D 1 80  ? -5.386  49.667 61.696 1.00 84.00  ? 279 THR D N   1 
ATOM   7002 C CA  . THR D 1 80  ? -4.456  50.088 60.653 1.00 80.14  ? 279 THR D CA  1 
ATOM   7003 C C   . THR D 1 80  ? -3.318  50.978 61.162 1.00 76.58  ? 279 THR D C   1 
ATOM   7004 O O   . THR D 1 80  ? -2.271  51.088 60.517 1.00 76.80  ? 279 THR D O   1 
ATOM   7005 C CB  . THR D 1 80  ? -5.230  50.829 59.530 1.00 80.85  ? 279 THR D CB  1 
ATOM   7006 O OG1 . THR D 1 80  ? -6.217  49.948 58.974 1.00 81.32  ? 279 THR D OG1 1 
ATOM   7007 C CG2 . THR D 1 80  ? -4.286  51.293 58.428 1.00 80.92  ? 279 THR D CG2 1 
ATOM   7008 N N   . SER D 1 81  ? -3.524  51.608 62.315 1.00 71.39  ? 280 SER D N   1 
ATOM   7009 C CA  . SER D 1 81  ? -2.514  52.475 62.908 1.00 65.82  ? 280 SER D CA  1 
ATOM   7010 C C   . SER D 1 81  ? -1.644  51.660 63.857 1.00 62.11  ? 280 SER D C   1 
ATOM   7011 O O   . SER D 1 81  ? -0.422  51.628 63.722 1.00 61.69  ? 280 SER D O   1 
ATOM   7012 C CB  . SER D 1 81  ? -3.185  53.614 63.664 1.00 65.30  ? 280 SER D CB  1 
ATOM   7013 O OG  . SER D 1 81  ? -4.081  54.307 62.820 1.00 63.91  ? 280 SER D OG  1 
ATOM   7014 N N   . VAL D 1 82  ? -2.280  51.003 64.821 1.00 57.48  ? 281 VAL D N   1 
ATOM   7015 C CA  . VAL D 1 82  ? -1.551  50.170 65.764 1.00 52.59  ? 281 VAL D CA  1 
ATOM   7016 C C   . VAL D 1 82  ? -0.621  49.263 64.966 1.00 49.65  ? 281 VAL D C   1 
ATOM   7017 O O   . VAL D 1 82  ? 0.528   49.047 65.353 1.00 50.36  ? 281 VAL D O   1 
ATOM   7018 C CB  . VAL D 1 82  ? -2.512  49.300 66.605 1.00 52.13  ? 281 VAL D CB  1 
ATOM   7019 C CG1 . VAL D 1 82  ? -1.729  48.274 67.413 1.00 50.38  ? 281 VAL D CG1 1 
ATOM   7020 C CG2 . VAL D 1 82  ? -3.320  50.185 67.533 1.00 51.75  ? 281 VAL D CG2 1 
ATOM   7021 N N   . GLU D 1 83  ? -1.122  48.749 63.843 1.00 44.80  ? 282 GLU D N   1 
ATOM   7022 C CA  . GLU D 1 83  ? -0.342  47.872 62.973 1.00 39.25  ? 282 GLU D CA  1 
ATOM   7023 C C   . GLU D 1 83  ? 0.877   48.610 62.440 1.00 34.41  ? 282 GLU D C   1 
ATOM   7024 O O   . GLU D 1 83  ? 1.988   48.077 62.451 1.00 33.22  ? 282 GLU D O   1 
ATOM   7025 C CB  . GLU D 1 83  ? -1.201  47.392 61.797 1.00 42.02  ? 282 GLU D CB  1 
ATOM   7026 C CG  . GLU D 1 83  ? -1.366  45.878 61.690 1.00 46.40  ? 282 GLU D CG  1 
ATOM   7027 C CD  . GLU D 1 83  ? -0.215  45.176 60.958 1.00 48.70  ? 282 GLU D CD  1 
ATOM   7028 O OE1 . GLU D 1 83  ? 0.959   45.328 61.373 1.00 49.75  ? 282 GLU D OE1 1 
ATOM   7029 O OE2 . GLU D 1 83  ? -0.491  44.459 59.966 1.00 48.57  ? 282 GLU D OE2 1 
ATOM   7030 N N   . THR D 1 84  ? 0.662   49.843 61.984 1.00 28.43  ? 283 THR D N   1 
ATOM   7031 C CA  . THR D 1 84  ? 1.732   50.665 61.425 1.00 22.37  ? 283 THR D CA  1 
ATOM   7032 C C   . THR D 1 84  ? 2.700   51.212 62.450 1.00 18.11  ? 283 THR D C   1 
ATOM   7033 O O   . THR D 1 84  ? 3.889   51.347 62.184 1.00 15.85  ? 283 THR D O   1 
ATOM   7034 C CB  . THR D 1 84  ? 1.170   51.854 60.633 1.00 21.58  ? 283 THR D CB  1 
ATOM   7035 O OG1 . THR D 1 84  ? 0.184   52.526 61.421 1.00 21.22  ? 283 THR D OG1 1 
ATOM   7036 C CG2 . THR D 1 84  ? 0.547   51.379 59.327 1.00 21.83  ? 283 THR D CG2 1 
ATOM   7037 N N   . VAL D 1 85  ? 2.200   51.542 63.628 1.00 15.76  ? 284 VAL D N   1 
ATOM   7038 C CA  . VAL D 1 85  ? 3.088   52.081 64.635 1.00 14.34  ? 284 VAL D CA  1 
ATOM   7039 C C   . VAL D 1 85  ? 4.093   51.015 64.958 1.00 12.62  ? 284 VAL D C   1 
ATOM   7040 O O   . VAL D 1 85  ? 5.250   51.295 65.272 1.00 13.04  ? 284 VAL D O   1 
ATOM   7041 C CB  . VAL D 1 85  ? 2.353   52.447 65.916 1.00 14.21  ? 284 VAL D CB  1 
ATOM   7042 C CG1 . VAL D 1 85  ? 3.314   53.150 66.855 1.00 12.77  ? 284 VAL D CG1 1 
ATOM   7043 C CG2 . VAL D 1 85  ? 1.156   53.332 65.598 1.00 14.11  ? 284 VAL D CG2 1 
ATOM   7044 N N   . THR D 1 86  ? 3.636   49.778 64.865 1.00 10.89  ? 285 THR D N   1 
ATOM   7045 C CA  . THR D 1 86  ? 4.488   48.655 65.157 1.00 10.43  ? 285 THR D CA  1 
ATOM   7046 C C   . THR D 1 86  ? 5.503   48.443 64.050 1.00 10.67  ? 285 THR D C   1 
ATOM   7047 O O   . THR D 1 86  ? 6.664   48.154 64.332 1.00 11.31  ? 285 THR D O   1 
ATOM   7048 C CB  . THR D 1 86  ? 3.659   47.405 65.356 1.00 10.00  ? 285 THR D CB  1 
ATOM   7049 O OG1 . THR D 1 86  ? 2.538   47.721 66.193 1.00 9.38   ? 285 THR D OG1 1 
ATOM   7050 C CG2 . THR D 1 86  ? 4.490   46.336 66.031 1.00 9.50   ? 285 THR D CG2 1 
ATOM   7051 N N   . GLU D 1 87  ? 5.073   48.589 62.797 1.00 10.36  ? 286 GLU D N   1 
ATOM   7052 C CA  . GLU D 1 87  ? 5.980   48.428 61.661 1.00 9.71   ? 286 GLU D CA  1 
ATOM   7053 C C   . GLU D 1 87  ? 7.084   49.461 61.811 1.00 8.61   ? 286 GLU D C   1 
ATOM   7054 O O   . GLU D 1 87  ? 8.264   49.165 61.628 1.00 7.21   ? 286 GLU D O   1 
ATOM   7055 C CB  . GLU D 1 87  ? 5.266   48.697 60.334 1.00 12.81  ? 286 GLU D CB  1 
ATOM   7056 C CG  . GLU D 1 87  ? 4.244   47.670 59.873 1.00 16.92  ? 286 GLU D CG  1 
ATOM   7057 C CD  . GLU D 1 87  ? 3.669   48.015 58.491 1.00 19.90  ? 286 GLU D CD  1 
ATOM   7058 O OE1 . GLU D 1 87  ? 2.923   49.015 58.371 1.00 19.25  ? 286 GLU D OE1 1 
ATOM   7059 O OE2 . GLU D 1 87  ? 3.975   47.290 57.518 1.00 21.50  ? 286 GLU D OE2 1 
ATOM   7060 N N   . LEU D 1 88  ? 6.663   50.681 62.138 1.00 7.70   ? 287 LEU D N   1 
ATOM   7061 C CA  . LEU D 1 88  ? 7.551   51.817 62.321 1.00 6.55   ? 287 LEU D CA  1 
ATOM   7062 C C   . LEU D 1 88  ? 8.498   51.627 63.475 1.00 6.55   ? 287 LEU D C   1 
ATOM   7063 O O   . LEU D 1 88  ? 9.677   51.948 63.375 1.00 6.55   ? 287 LEU D O   1 
ATOM   7064 C CB  . LEU D 1 88  ? 6.733   53.076 62.546 1.00 6.55   ? 287 LEU D CB  1 
ATOM   7065 C CG  . LEU D 1 88  ? 6.511   53.853 61.265 1.00 6.55   ? 287 LEU D CG  1 
ATOM   7066 C CD1 . LEU D 1 88  ? 5.449   54.895 61.486 1.00 6.55   ? 287 LEU D CD1 1 
ATOM   7067 C CD2 . LEU D 1 88  ? 7.821   54.477 60.832 1.00 6.55   ? 287 LEU D CD2 1 
ATOM   7068 N N   . THR D 1 89  ? 7.982   51.115 64.580 1.00 6.55   ? 288 THR D N   1 
ATOM   7069 C CA  . THR D 1 89  ? 8.827   50.898 65.728 1.00 6.55   ? 288 THR D CA  1 
ATOM   7070 C C   . THR D 1 89  ? 9.867   49.834 65.376 1.00 7.26   ? 288 THR D C   1 
ATOM   7071 O O   . THR D 1 89  ? 11.061  50.003 65.650 1.00 7.52   ? 288 THR D O   1 
ATOM   7072 C CB  . THR D 1 89  ? 7.994   50.483 66.932 1.00 6.55   ? 288 THR D CB  1 
ATOM   7073 O OG1 . THR D 1 89  ? 7.062   51.521 67.238 1.00 6.55   ? 288 THR D OG1 1 
ATOM   7074 C CG2 . THR D 1 89  ? 8.869   50.285 68.117 1.00 6.55   ? 288 THR D CG2 1 
ATOM   7075 N N   . GLU D 1 90  ? 9.426   48.749 64.747 1.00 8.36   ? 289 GLU D N   1 
ATOM   7076 C CA  . GLU D 1 90  ? 10.353  47.695 64.348 1.00 9.56   ? 289 GLU D CA  1 
ATOM   7077 C C   . GLU D 1 90  ? 11.365  48.233 63.334 1.00 9.04   ? 289 GLU D C   1 
ATOM   7078 O O   . GLU D 1 90  ? 12.555  47.932 63.420 1.00 9.95   ? 289 GLU D O   1 
ATOM   7079 C CB  . GLU D 1 90  ? 9.598   46.501 63.760 1.00 11.93  ? 289 GLU D CB  1 
ATOM   7080 C CG  . GLU D 1 90  ? 8.941   45.597 64.799 1.00 15.75  ? 289 GLU D CG  1 
ATOM   7081 C CD  . GLU D 1 90  ? 9.911   45.103 65.874 1.00 17.83  ? 289 GLU D CD  1 
ATOM   7082 O OE1 . GLU D 1 90  ? 11.051  44.701 65.540 1.00 18.59  ? 289 GLU D OE1 1 
ATOM   7083 O OE2 . GLU D 1 90  ? 9.523   45.103 67.061 1.00 19.11  ? 289 GLU D OE2 1 
ATOM   7084 N N   . PHE D 1 91  ? 10.891  49.028 62.378 1.00 7.65   ? 290 PHE D N   1 
ATOM   7085 C CA  . PHE D 1 91  ? 11.762  49.632 61.373 1.00 6.55   ? 290 PHE D CA  1 
ATOM   7086 C C   . PHE D 1 91  ? 12.783  50.554 62.033 1.00 6.55   ? 290 PHE D C   1 
ATOM   7087 O O   . PHE D 1 91  ? 13.945  50.584 61.638 1.00 6.55   ? 290 PHE D O   1 
ATOM   7088 C CB  . PHE D 1 91  ? 10.941  50.442 60.369 1.00 6.55   ? 290 PHE D CB  1 
ATOM   7089 C CG  . PHE D 1 91  ? 11.773  51.327 59.473 1.00 6.55   ? 290 PHE D CG  1 
ATOM   7090 C CD1 . PHE D 1 91  ? 12.882  50.823 58.807 1.00 6.55   ? 290 PHE D CD1 1 
ATOM   7091 C CD2 . PHE D 1 91  ? 11.440  52.658 59.285 1.00 6.55   ? 290 PHE D CD2 1 
ATOM   7092 C CE1 . PHE D 1 91  ? 13.643  51.626 57.972 1.00 6.55   ? 290 PHE D CE1 1 
ATOM   7093 C CE2 . PHE D 1 91  ? 12.196  53.465 58.449 1.00 6.55   ? 290 PHE D CE2 1 
ATOM   7094 C CZ  . PHE D 1 91  ? 13.300  52.944 57.793 1.00 6.55   ? 290 PHE D CZ  1 
ATOM   7095 N N   . ALA D 1 92  ? 12.337  51.315 63.031 1.00 7.34   ? 291 ALA D N   1 
ATOM   7096 C CA  . ALA D 1 92  ? 13.208  52.240 63.753 1.00 7.17   ? 291 ALA D CA  1 
ATOM   7097 C C   . ALA D 1 92  ? 14.279  51.436 64.455 1.00 6.99   ? 291 ALA D C   1 
ATOM   7098 O O   . ALA D 1 92  ? 15.454  51.802 64.446 1.00 7.06   ? 291 ALA D O   1 
ATOM   7099 C CB  . ALA D 1 92  ? 12.409  53.038 64.771 1.00 6.55   ? 291 ALA D CB  1 
ATOM   7100 N N   . LYS D 1 93  ? 13.862  50.333 65.063 1.00 6.70   ? 292 LYS D N   1 
ATOM   7101 C CA  . LYS D 1 93  ? 14.790  49.462 65.757 1.00 8.69   ? 292 LYS D CA  1 
ATOM   7102 C C   . LYS D 1 93  ? 15.987  49.094 64.894 1.00 9.44   ? 292 LYS D C   1 
ATOM   7103 O O   . LYS D 1 93  ? 17.114  49.008 65.389 1.00 11.38  ? 292 LYS D O   1 
ATOM   7104 C CB  . LYS D 1 93  ? 14.104  48.176 66.176 1.00 10.43  ? 292 LYS D CB  1 
ATOM   7105 C CG  . LYS D 1 93  ? 13.011  48.335 67.216 1.00 14.13  ? 292 LYS D CG  1 
ATOM   7106 C CD  . LYS D 1 93  ? 12.987  47.084 68.082 1.00 16.05  ? 292 LYS D CD  1 
ATOM   7107 C CE  . LYS D 1 93  ? 11.587  46.684 68.507 1.00 17.46  ? 292 LYS D CE  1 
ATOM   7108 N NZ  . LYS D 1 93  ? 11.624  45.369 69.214 1.00 19.34  ? 292 LYS D NZ  1 
ATOM   7109 N N   . ALA D 1 94  ? 15.745  48.872 63.605 1.00 8.36   ? 293 ALA D N   1 
ATOM   7110 C CA  . ALA D 1 94  ? 16.812  48.491 62.690 1.00 6.55   ? 293 ALA D CA  1 
ATOM   7111 C C   . ALA D 1 94  ? 17.699  49.635 62.203 1.00 6.55   ? 293 ALA D C   1 
ATOM   7112 O O   . ALA D 1 94  ? 18.754  49.386 61.624 1.00 6.55   ? 293 ALA D O   1 
ATOM   7113 C CB  . ALA D 1 94  ? 16.235  47.733 61.509 1.00 6.55   ? 293 ALA D CB  1 
ATOM   7114 N N   . ILE D 1 95  ? 17.294  50.883 62.430 1.00 6.55   ? 294 ILE D N   1 
ATOM   7115 C CA  . ILE D 1 95  ? 18.131  52.000 61.992 1.00 8.40   ? 294 ILE D CA  1 
ATOM   7116 C C   . ILE D 1 95  ? 19.436  51.922 62.775 1.00 11.51  ? 294 ILE D C   1 
ATOM   7117 O O   . ILE D 1 95  ? 19.453  52.072 63.992 1.00 13.76  ? 294 ILE D O   1 
ATOM   7118 C CB  . ILE D 1 95  ? 17.474  53.380 62.240 1.00 6.55   ? 294 ILE D CB  1 
ATOM   7119 C CG1 . ILE D 1 95  ? 16.207  53.522 61.396 1.00 6.55   ? 294 ILE D CG1 1 
ATOM   7120 C CG2 . ILE D 1 95  ? 18.454  54.480 61.882 1.00 6.55   ? 294 ILE D CG2 1 
ATOM   7121 C CD1 . ILE D 1 95  ? 15.314  54.647 61.809 1.00 6.55   ? 294 ILE D CD1 1 
ATOM   7122 N N   . PRO D 1 96  ? 20.545  51.661 62.076 1.00 13.81  ? 295 PRO D N   1 
ATOM   7123 C CA  . PRO D 1 96  ? 21.909  51.530 62.592 1.00 15.07  ? 295 PRO D CA  1 
ATOM   7124 C C   . PRO D 1 96  ? 22.360  52.562 63.612 1.00 15.95  ? 295 PRO D C   1 
ATOM   7125 O O   . PRO D 1 96  ? 23.240  53.376 63.323 1.00 17.50  ? 295 PRO D O   1 
ATOM   7126 C CB  . PRO D 1 96  ? 22.750  51.574 61.326 1.00 15.80  ? 295 PRO D CB  1 
ATOM   7127 C CG  . PRO D 1 96  ? 21.885  50.827 60.369 1.00 16.77  ? 295 PRO D CG  1 
ATOM   7128 C CD  . PRO D 1 96  ? 20.526  51.439 60.620 1.00 15.44  ? 295 PRO D CD  1 
ATOM   7129 N N   . GLY D 1 97  ? 21.772  52.511 64.804 1.00 15.73  ? 296 GLY D N   1 
ATOM   7130 C CA  . GLY D 1 97  ? 22.148  53.435 65.862 1.00 16.65  ? 296 GLY D CA  1 
ATOM   7131 C C   . GLY D 1 97  ? 21.045  53.655 66.882 1.00 16.59  ? 296 GLY D C   1 
ATOM   7132 O O   . GLY D 1 97  ? 21.295  54.044 68.029 1.00 15.32  ? 296 GLY D O   1 
ATOM   7133 N N   . PHE D 1 98  ? 19.821  53.382 66.437 1.00 15.96  ? 297 PHE D N   1 
ATOM   7134 C CA  . PHE D 1 98  ? 18.603  53.543 67.215 1.00 13.81  ? 297 PHE D CA  1 
ATOM   7135 C C   . PHE D 1 98  ? 18.505  52.673 68.462 1.00 15.26  ? 297 PHE D C   1 
ATOM   7136 O O   . PHE D 1 98  ? 17.996  53.105 69.493 1.00 14.54  ? 297 PHE D O   1 
ATOM   7137 C CB  . PHE D 1 98  ? 17.408  53.254 66.319 1.00 9.69   ? 297 PHE D CB  1 
ATOM   7138 C CG  . PHE D 1 98  ? 16.102  53.657 66.909 1.00 6.55   ? 297 PHE D CG  1 
ATOM   7139 C CD1 . PHE D 1 98  ? 15.644  54.957 66.782 1.00 6.55   ? 297 PHE D CD1 1 
ATOM   7140 C CD2 . PHE D 1 98  ? 15.324  52.736 67.596 1.00 6.55   ? 297 PHE D CD2 1 
ATOM   7141 C CE1 . PHE D 1 98  ? 14.428  55.332 67.327 1.00 6.55   ? 297 PHE D CE1 1 
ATOM   7142 C CE2 . PHE D 1 98  ? 14.105  53.106 68.148 1.00 6.55   ? 297 PHE D CE2 1 
ATOM   7143 C CZ  . PHE D 1 98  ? 13.656  54.405 68.012 1.00 6.55   ? 297 PHE D CZ  1 
ATOM   7144 N N   . ALA D 1 99  ? 18.977  51.439 68.374 1.00 17.96  ? 298 ALA D N   1 
ATOM   7145 C CA  . ALA D 1 99  ? 18.897  50.535 69.517 1.00 19.69  ? 298 ALA D CA  1 
ATOM   7146 C C   . ALA D 1 99  ? 19.829  50.911 70.674 1.00 20.86  ? 298 ALA D C   1 
ATOM   7147 O O   . ALA D 1 99  ? 19.871  50.226 71.694 1.00 21.12  ? 298 ALA D O   1 
ATOM   7148 C CB  . ALA D 1 99  ? 19.181  49.114 69.058 1.00 19.61  ? 298 ALA D CB  1 
ATOM   7149 N N   . ASN D 1 100 ? 20.552  52.013 70.528 1.00 23.07  ? 299 ASN D N   1 
ATOM   7150 C CA  . ASN D 1 100 ? 21.499  52.433 71.553 1.00 24.66  ? 299 ASN D CA  1 
ATOM   7151 C C   . ASN D 1 100 ? 21.145  53.685 72.317 1.00 23.78  ? 299 ASN D C   1 
ATOM   7152 O O   . ASN D 1 100 ? 21.937  54.154 73.127 1.00 23.82  ? 299 ASN D O   1 
ATOM   7153 C CB  . ASN D 1 100 ? 22.888  52.627 70.940 1.00 29.68  ? 299 ASN D CB  1 
ATOM   7154 C CG  . ASN D 1 100 ? 23.620  51.317 70.723 1.00 34.16  ? 299 ASN D CG  1 
ATOM   7155 O OD1 . ASN D 1 100 ? 24.756  51.304 70.240 1.00 36.48  ? 299 ASN D OD1 1 
ATOM   7156 N ND2 . ASN D 1 100 ? 22.977  50.204 71.084 1.00 35.86  ? 299 ASN D ND2 1 
ATOM   7157 N N   . LEU D 1 101 ? 19.982  54.255 72.060 1.00 23.82  ? 300 LEU D N   1 
ATOM   7158 C CA  . LEU D 1 101 ? 19.627  55.456 72.791 1.00 24.84  ? 300 LEU D CA  1 
ATOM   7159 C C   . LEU D 1 101 ? 18.851  54.973 73.981 1.00 24.69  ? 300 LEU D C   1 
ATOM   7160 O O   . LEU D 1 101 ? 18.775  53.777 74.236 1.00 24.60  ? 300 LEU D O   1 
ATOM   7161 C CB  . LEU D 1 101 ? 18.728  56.382 71.968 1.00 25.30  ? 300 LEU D CB  1 
ATOM   7162 C CG  . LEU D 1 101 ? 19.049  56.661 70.506 1.00 24.47  ? 300 LEU D CG  1 
ATOM   7163 C CD1 . LEU D 1 101 ? 18.860  55.404 69.738 1.00 23.20  ? 300 LEU D CD1 1 
ATOM   7164 C CD2 . LEU D 1 101 ? 18.135  57.735 69.956 1.00 24.60  ? 300 LEU D CD2 1 
ATOM   7165 N N   . ASP D 1 102 ? 18.268  55.913 74.704 1.00 25.32  ? 301 ASP D N   1 
ATOM   7166 C CA  . ASP D 1 102 ? 17.459  55.579 75.848 1.00 25.52  ? 301 ASP D CA  1 
ATOM   7167 C C   . ASP D 1 102 ? 16.212  54.866 75.392 1.00 25.28  ? 301 ASP D C   1 
ATOM   7168 O O   . ASP D 1 102 ? 15.841  54.910 74.225 1.00 25.80  ? 301 ASP D O   1 
ATOM   7169 C CB  . ASP D 1 102 ? 17.047  56.837 76.582 1.00 27.03  ? 301 ASP D CB  1 
ATOM   7170 C CG  . ASP D 1 102 ? 17.859  57.061 77.804 1.00 30.47  ? 301 ASP D CG  1 
ATOM   7171 O OD1 . ASP D 1 102 ? 19.103  57.061 77.678 1.00 32.42  ? 301 ASP D OD1 1 
ATOM   7172 O OD2 . ASP D 1 102 ? 17.255  57.225 78.887 1.00 33.77  ? 301 ASP D OD2 1 
ATOM   7173 N N   . LEU D 1 103 ? 15.567  54.197 76.328 1.00 24.49  ? 302 LEU D N   1 
ATOM   7174 C CA  . LEU D 1 103 ? 14.338  53.522 76.022 1.00 24.63  ? 302 LEU D CA  1 
ATOM   7175 C C   . LEU D 1 103 ? 13.360  54.674 76.104 1.00 24.21  ? 302 LEU D C   1 
ATOM   7176 O O   . LEU D 1 103 ? 12.208  54.566 75.722 1.00 25.67  ? 302 LEU D O   1 
ATOM   7177 C CB  . LEU D 1 103 ? 14.038  52.481 77.091 1.00 27.07  ? 302 LEU D CB  1 
ATOM   7178 C CG  . LEU D 1 103 ? 12.910  51.488 76.801 1.00 30.65  ? 302 LEU D CG  1 
ATOM   7179 C CD1 . LEU D 1 103 ? 11.550  52.182 76.837 1.00 30.14  ? 302 LEU D CD1 1 
ATOM   7180 C CD2 . LEU D 1 103 ? 13.170  50.832 75.452 1.00 31.33  ? 302 LEU D CD2 1 
ATOM   7181 N N   . ASN D 1 104 ? 13.848  55.797 76.607 1.00 23.62  ? 303 ASN D N   1 
ATOM   7182 C CA  . ASN D 1 104 ? 13.021  56.976 76.739 1.00 23.47  ? 303 ASN D CA  1 
ATOM   7183 C C   . ASN D 1 104 ? 13.184  57.844 75.518 1.00 21.63  ? 303 ASN D C   1 
ATOM   7184 O O   . ASN D 1 104 ? 12.239  58.484 75.074 1.00 21.55  ? 303 ASN D O   1 
ATOM   7185 C CB  . ASN D 1 104 ? 13.412  57.766 77.983 1.00 26.22  ? 303 ASN D CB  1 
ATOM   7186 C CG  . ASN D 1 104 ? 12.352  57.710 79.058 1.00 27.63  ? 303 ASN D CG  1 
ATOM   7187 O OD1 . ASN D 1 104 ? 12.313  58.565 79.940 1.00 29.37  ? 303 ASN D OD1 1 
ATOM   7188 N ND2 . ASN D 1 104 ? 11.487  56.698 78.995 1.00 27.52  ? 303 ASN D ND2 1 
ATOM   7189 N N   . ASP D 1 105 ? 14.398  57.884 74.988 1.00 19.84  ? 304 ASP D N   1 
ATOM   7190 C CA  . ASP D 1 105 ? 14.642  58.677 73.802 1.00 18.56  ? 304 ASP D CA  1 
ATOM   7191 C C   . ASP D 1 105 ? 13.985  57.954 72.643 1.00 16.19  ? 304 ASP D C   1 
ATOM   7192 O O   . ASP D 1 105 ? 13.434  58.585 71.752 1.00 17.57  ? 304 ASP D O   1 
ATOM   7193 C CB  . ASP D 1 105 ? 16.146  58.854 73.541 1.00 20.22  ? 304 ASP D CB  1 
ATOM   7194 C CG  . ASP D 1 105 ? 16.787  59.910 74.447 1.00 22.78  ? 304 ASP D CG  1 
ATOM   7195 O OD1 . ASP D 1 105 ? 16.049  60.755 75.011 1.00 23.41  ? 304 ASP D OD1 1 
ATOM   7196 O OD2 . ASP D 1 105 ? 18.034  59.905 74.577 1.00 22.05  ? 304 ASP D OD2 1 
ATOM   7197 N N   . GLN D 1 106 ? 14.024  56.626 72.668 1.00 13.58  ? 305 GLN D N   1 
ATOM   7198 C CA  . GLN D 1 106 ? 13.417  55.828 71.609 1.00 10.39  ? 305 GLN D CA  1 
ATOM   7199 C C   . GLN D 1 106 ? 11.909  56.035 71.516 1.00 8.64   ? 305 GLN D C   1 
ATOM   7200 O O   . GLN D 1 106 ? 11.339  56.002 70.430 1.00 8.99   ? 305 GLN D O   1 
ATOM   7201 C CB  . GLN D 1 106 ? 13.715  54.353 71.830 1.00 9.05   ? 305 GLN D CB  1 
ATOM   7202 C CG  . GLN D 1 106 ? 15.143  53.965 71.501 1.00 11.19  ? 305 GLN D CG  1 
ATOM   7203 C CD  . GLN D 1 106 ? 15.419  52.501 71.791 1.00 12.97  ? 305 GLN D CD  1 
ATOM   7204 O OE1 . GLN D 1 106 ? 14.496  51.699 71.893 1.00 12.19  ? 305 GLN D OE1 1 
ATOM   7205 N NE2 . GLN D 1 106 ? 16.694  52.145 71.910 1.00 14.91  ? 305 GLN D NE2 1 
ATOM   7206 N N   . VAL D 1 107 ? 11.273  56.256 72.662 1.00 7.21   ? 306 VAL D N   1 
ATOM   7207 C CA  . VAL D 1 107 ? 9.828   56.473 72.738 1.00 6.55   ? 306 VAL D CA  1 
ATOM   7208 C C   . VAL D 1 107 ? 9.448   57.893 72.374 1.00 6.55   ? 306 VAL D C   1 
ATOM   7209 O O   . VAL D 1 107 ? 8.328   58.151 71.941 1.00 6.55   ? 306 VAL D O   1 
ATOM   7210 C CB  . VAL D 1 107 ? 9.302   56.231 74.151 1.00 6.55   ? 306 VAL D CB  1 
ATOM   7211 C CG1 . VAL D 1 107 ? 7.823   56.497 74.202 1.00 6.55   ? 306 VAL D CG1 1 
ATOM   7212 C CG2 . VAL D 1 107 ? 9.605   54.827 74.568 1.00 6.91   ? 306 VAL D CG2 1 
ATOM   7213 N N   . THR D 1 108 ? 10.375  58.818 72.588 1.00 6.55   ? 307 THR D N   1 
ATOM   7214 C CA  . THR D 1 108 ? 10.130  60.215 72.283 1.00 6.55   ? 307 THR D CA  1 
ATOM   7215 C C   . THR D 1 108 ? 10.222  60.361 70.773 1.00 6.55   ? 307 THR D C   1 
ATOM   7216 O O   . THR D 1 108 ? 9.339   60.928 70.142 1.00 6.55   ? 307 THR D O   1 
ATOM   7217 C CB  . THR D 1 108 ? 11.178  61.142 72.972 1.00 6.55   ? 307 THR D CB  1 
ATOM   7218 O OG1 . THR D 1 108 ? 11.183  60.915 74.393 1.00 6.55   ? 307 THR D OG1 1 
ATOM   7219 C CG2 . THR D 1 108 ? 10.844  62.603 72.710 1.00 6.55   ? 307 THR D CG2 1 
ATOM   7220 N N   . LEU D 1 109 ? 11.293  59.821 70.202 1.00 6.55   ? 308 LEU D N   1 
ATOM   7221 C CA  . LEU D 1 109 ? 11.511  59.882 68.772 1.00 6.55   ? 308 LEU D CA  1 
ATOM   7222 C C   . LEU D 1 109 ? 10.309  59.325 68.035 1.00 6.55   ? 308 LEU D C   1 
ATOM   7223 O O   . LEU D 1 109 ? 9.702   60.016 67.211 1.00 8.03   ? 308 LEU D O   1 
ATOM   7224 C CB  . LEU D 1 109 ? 12.770  59.105 68.392 1.00 6.55   ? 308 LEU D CB  1 
ATOM   7225 C CG  . LEU D 1 109 ? 14.065  59.751 68.878 1.00 6.55   ? 308 LEU D CG  1 
ATOM   7226 C CD1 . LEU D 1 109 ? 15.256  59.034 68.298 1.00 6.55   ? 308 LEU D CD1 1 
ATOM   7227 C CD2 . LEU D 1 109 ? 14.087  61.200 68.468 1.00 6.55   ? 308 LEU D CD2 1 
ATOM   7228 N N   . LEU D 1 110 ? 9.953   58.083 68.335 1.00 6.55   ? 309 LEU D N   1 
ATOM   7229 C CA  . LEU D 1 110 ? 8.816   57.455 67.682 1.00 6.55   ? 309 LEU D CA  1 
ATOM   7230 C C   . LEU D 1 110 ? 7.474   58.122 67.952 1.00 6.57   ? 309 LEU D C   1 
ATOM   7231 O O   . LEU D 1 110 ? 6.599   58.144 67.092 1.00 7.95   ? 309 LEU D O   1 
ATOM   7232 C CB  . LEU D 1 110 ? 8.738   55.992 68.083 1.00 6.55   ? 309 LEU D CB  1 
ATOM   7233 C CG  . LEU D 1 110 ? 9.442   55.056 67.125 1.00 6.55   ? 309 LEU D CG  1 
ATOM   7234 C CD1 . LEU D 1 110 ? 9.423   53.670 67.689 1.00 6.55   ? 309 LEU D CD1 1 
ATOM   7235 C CD2 . LEU D 1 110 ? 8.737   55.096 65.785 1.00 6.55   ? 309 LEU D CD2 1 
ATOM   7236 N N   . LYS D 1 111 ? 7.318   58.673 69.145 1.00 8.33   ? 310 LYS D N   1 
ATOM   7237 C CA  . LYS D 1 111 ? 6.078   59.320 69.535 1.00 11.09  ? 310 LYS D CA  1 
ATOM   7238 C C   . LYS D 1 111 ? 5.781   60.611 68.782 1.00 13.15  ? 310 LYS D C   1 
ATOM   7239 O O   . LYS D 1 111 ? 4.622   60.944 68.555 1.00 13.75  ? 310 LYS D O   1 
ATOM   7240 C CB  . LYS D 1 111 ? 6.110   59.600 71.037 1.00 13.22  ? 310 LYS D CB  1 
ATOM   7241 C CG  . LYS D 1 111 ? 5.096   60.628 71.502 1.00 18.76  ? 310 LYS D CG  1 
ATOM   7242 C CD  . LYS D 1 111 ? 5.362   61.099 72.927 1.00 22.38  ? 310 LYS D CD  1 
ATOM   7243 C CE  . LYS D 1 111 ? 4.401   62.219 73.324 1.00 25.55  ? 310 LYS D CE  1 
ATOM   7244 N NZ  . LYS D 1 111 ? 4.351   62.489 74.799 1.00 25.17  ? 310 LYS D NZ  1 
ATOM   7245 N N   . TYR D 1 112 ? 6.824   61.338 68.396 1.00 15.64  ? 311 TYR D N   1 
ATOM   7246 C CA  . TYR D 1 112 ? 6.652   62.608 67.698 1.00 18.12  ? 311 TYR D CA  1 
ATOM   7247 C C   . TYR D 1 112 ? 6.704   62.539 66.188 1.00 19.33  ? 311 TYR D C   1 
ATOM   7248 O O   . TYR D 1 112 ? 6.094   63.364 65.499 1.00 20.44  ? 311 TYR D O   1 
ATOM   7249 C CB  . TYR D 1 112 ? 7.690   63.609 68.190 1.00 20.61  ? 311 TYR D CB  1 
ATOM   7250 C CG  . TYR D 1 112 ? 7.361   64.121 69.562 1.00 24.58  ? 311 TYR D CG  1 
ATOM   7251 C CD1 . TYR D 1 112 ? 6.254   64.946 69.764 1.00 25.20  ? 311 TYR D CD1 1 
ATOM   7252 C CD2 . TYR D 1 112 ? 8.098   63.721 70.672 1.00 26.07  ? 311 TYR D CD2 1 
ATOM   7253 C CE1 . TYR D 1 112 ? 5.888   65.352 71.034 1.00 26.69  ? 311 TYR D CE1 1 
ATOM   7254 C CE2 . TYR D 1 112 ? 7.736   64.120 71.949 1.00 27.83  ? 311 TYR D CE2 1 
ATOM   7255 C CZ  . TYR D 1 112 ? 6.630   64.933 72.121 1.00 28.00  ? 311 TYR D CZ  1 
ATOM   7256 O OH  . TYR D 1 112 ? 6.257   65.306 73.387 1.00 31.82  ? 311 TYR D OH  1 
ATOM   7257 N N   . GLY D 1 113 ? 7.426   61.555 65.667 1.00 19.08  ? 312 GLY D N   1 
ATOM   7258 C CA  . GLY D 1 113 ? 7.532   61.433 64.228 1.00 18.01  ? 312 GLY D CA  1 
ATOM   7259 C C   . GLY D 1 113 ? 6.799   60.254 63.622 1.00 15.59  ? 312 GLY D C   1 
ATOM   7260 O O   . GLY D 1 113 ? 7.035   59.907 62.464 1.00 15.60  ? 312 GLY D O   1 
ATOM   7261 N N   . VAL D 1 114 ? 5.905   59.635 64.378 1.00 13.33  ? 313 VAL D N   1 
ATOM   7262 C CA  . VAL D 1 114 ? 5.195   58.497 63.832 1.00 12.29  ? 313 VAL D CA  1 
ATOM   7263 C C   . VAL D 1 114 ? 4.171   58.929 62.780 1.00 12.25  ? 313 VAL D C   1 
ATOM   7264 O O   . VAL D 1 114 ? 3.958   58.234 61.792 1.00 11.11  ? 313 VAL D O   1 
ATOM   7265 C CB  . VAL D 1 114 ? 4.506   57.679 64.949 1.00 11.02  ? 313 VAL D CB  1 
ATOM   7266 C CG1 . VAL D 1 114 ? 3.073   58.128 65.147 1.00 11.01  ? 313 VAL D CG1 1 
ATOM   7267 C CG2 . VAL D 1 114 ? 4.555   56.222 64.603 1.00 10.25  ? 313 VAL D CG2 1 
ATOM   7268 N N   . TYR D 1 115 ? 3.539   60.077 62.981 1.00 12.89  ? 314 TYR D N   1 
ATOM   7269 C CA  . TYR D 1 115 ? 2.557   60.533 62.018 1.00 14.28  ? 314 TYR D CA  1 
ATOM   7270 C C   . TYR D 1 115 ? 3.266   61.117 60.829 1.00 14.99  ? 314 TYR D C   1 
ATOM   7271 O O   . TYR D 1 115 ? 2.790   61.031 59.704 1.00 16.25  ? 314 TYR D O   1 
ATOM   7272 C CB  . TYR D 1 115 ? 1.632   61.572 62.636 1.00 16.76  ? 314 TYR D CB  1 
ATOM   7273 C CG  . TYR D 1 115 ? 0.719   60.970 63.660 1.00 22.00  ? 314 TYR D CG  1 
ATOM   7274 C CD1 . TYR D 1 115 ? -0.076  59.875 63.338 1.00 24.88  ? 314 TYR D CD1 1 
ATOM   7275 C CD2 . TYR D 1 115 ? 0.700   61.434 64.970 1.00 24.97  ? 314 TYR D CD2 1 
ATOM   7276 C CE1 . TYR D 1 115 ? -0.857  59.245 64.298 1.00 26.79  ? 314 TYR D CE1 1 
ATOM   7277 C CE2 . TYR D 1 115 ? -0.087  60.810 65.942 1.00 27.21  ? 314 TYR D CE2 1 
ATOM   7278 C CZ  . TYR D 1 115 ? -0.856  59.713 65.597 1.00 27.02  ? 314 TYR D CZ  1 
ATOM   7279 O OH  . TYR D 1 115 ? -1.601  59.067 66.552 1.00 29.64  ? 314 TYR D OH  1 
ATOM   7280 N N   . GLU D 1 116 ? 4.419   61.715 61.080 1.00 14.55  ? 315 GLU D N   1 
ATOM   7281 C CA  . GLU D 1 116 ? 5.189   62.311 60.009 1.00 12.48  ? 315 GLU D CA  1 
ATOM   7282 C C   . GLU D 1 116 ? 5.730   61.233 59.104 1.00 10.37  ? 315 GLU D C   1 
ATOM   7283 O O   . GLU D 1 116 ? 6.097   61.497 57.964 1.00 11.51  ? 315 GLU D O   1 
ATOM   7284 C CB  . GLU D 1 116 ? 6.333   63.122 60.583 1.00 13.58  ? 315 GLU D CB  1 
ATOM   7285 C CG  . GLU D 1 116 ? 5.872   64.392 61.252 1.00 15.68  ? 315 GLU D CG  1 
ATOM   7286 C CD  . GLU D 1 116 ? 7.029   65.191 61.755 1.00 18.15  ? 315 GLU D CD  1 
ATOM   7287 O OE1 . GLU D 1 116 ? 8.065   65.245 61.052 1.00 17.76  ? 315 GLU D OE1 1 
ATOM   7288 O OE2 . GLU D 1 116 ? 6.900   65.770 62.851 1.00 20.37  ? 315 GLU D OE2 1 
ATOM   7289 N N   . ALA D 1 117 ? 5.794   60.014 59.619 1.00 7.91   ? 316 ALA D N   1 
ATOM   7290 C CA  . ALA D 1 117 ? 6.283   58.906 58.826 1.00 6.55   ? 316 ALA D CA  1 
ATOM   7291 C C   . ALA D 1 117 ? 5.087   58.295 58.119 1.00 6.55   ? 316 ALA D C   1 
ATOM   7292 O O   . ALA D 1 117 ? 5.145   57.985 56.934 1.00 6.69   ? 316 ALA D O   1 
ATOM   7293 C CB  . ALA D 1 117 ? 6.956   57.883 59.711 1.00 6.55   ? 316 ALA D CB  1 
ATOM   7294 N N   . ILE D 1 118 ? 3.984   58.160 58.843 1.00 6.55   ? 317 ILE D N   1 
ATOM   7295 C CA  . ILE D 1 118 ? 2.781   57.569 58.283 1.00 6.77   ? 317 ILE D CA  1 
ATOM   7296 C C   . ILE D 1 118 ? 2.204   58.314 57.082 1.00 6.68   ? 317 ILE D C   1 
ATOM   7297 O O   . ILE D 1 118 ? 1.778   57.693 56.114 1.00 7.84   ? 317 ILE D O   1 
ATOM   7298 C CB  . ILE D 1 118 ? 1.711   57.390 59.387 1.00 6.55   ? 317 ILE D CB  1 
ATOM   7299 C CG1 . ILE D 1 118 ? 2.095   56.181 60.246 1.00 9.28   ? 317 ILE D CG1 1 
ATOM   7300 C CG2 . ILE D 1 118 ? 0.332   57.219 58.786 1.00 6.55   ? 317 ILE D CG2 1 
ATOM   7301 C CD1 . ILE D 1 118 ? 1.071   55.783 61.275 1.00 11.24  ? 317 ILE D CD1 1 
ATOM   7302 N N   . PHE D 1 119 ? 2.201   59.637 57.121 1.00 6.55   ? 318 PHE D N   1 
ATOM   7303 C CA  . PHE D 1 119 ? 1.660   60.383 56.004 1.00 6.55   ? 318 PHE D CA  1 
ATOM   7304 C C   . PHE D 1 119 ? 2.625   60.421 54.846 1.00 6.55   ? 318 PHE D C   1 
ATOM   7305 O O   . PHE D 1 119 ? 2.211   60.436 53.694 1.00 7.91   ? 318 PHE D O   1 
ATOM   7306 C CB  . PHE D 1 119 ? 1.287   61.804 56.421 1.00 6.55   ? 318 PHE D CB  1 
ATOM   7307 C CG  . PHE D 1 119 ? 0.181   61.859 57.429 1.00 6.55   ? 318 PHE D CG  1 
ATOM   7308 C CD1 . PHE D 1 119 ? -0.919  61.021 57.307 1.00 6.55   ? 318 PHE D CD1 1 
ATOM   7309 C CD2 . PHE D 1 119 ? 0.247   62.719 58.510 1.00 6.55   ? 318 PHE D CD2 1 
ATOM   7310 C CE1 . PHE D 1 119 ? -1.932  61.034 58.250 1.00 6.55   ? 318 PHE D CE1 1 
ATOM   7311 C CE2 . PHE D 1 119 ? -0.762  62.738 59.455 1.00 6.55   ? 318 PHE D CE2 1 
ATOM   7312 C CZ  . PHE D 1 119 ? -1.855  61.890 59.324 1.00 6.55   ? 318 PHE D CZ  1 
ATOM   7313 N N   . ALA D 1 120 ? 3.915   60.444 55.131 1.00 6.55   ? 319 ALA D N   1 
ATOM   7314 C CA  . ALA D 1 120 ? 4.877   60.458 54.046 1.00 6.87   ? 319 ALA D CA  1 
ATOM   7315 C C   . ALA D 1 120 ? 4.676   59.182 53.232 1.00 8.25   ? 319 ALA D C   1 
ATOM   7316 O O   . ALA D 1 120 ? 4.432   59.222 52.021 1.00 8.51   ? 319 ALA D O   1 
ATOM   7317 C CB  . ALA D 1 120 ? 6.268   60.501 54.599 1.00 6.80   ? 319 ALA D CB  1 
ATOM   7318 N N   . MET D 1 121 ? 4.767   58.045 53.914 1.00 8.27   ? 320 MET D N   1 
ATOM   7319 C CA  . MET D 1 121 ? 4.600   56.756 53.261 1.00 8.60   ? 320 MET D CA  1 
ATOM   7320 C C   . MET D 1 121 ? 3.199   56.579 52.711 1.00 8.04   ? 320 MET D C   1 
ATOM   7321 O O   . MET D 1 121 ? 2.996   55.909 51.711 1.00 8.86   ? 320 MET D O   1 
ATOM   7322 C CB  . MET D 1 121 ? 4.911   55.613 54.229 1.00 8.05   ? 320 MET D CB  1 
ATOM   7323 C CG  . MET D 1 121 ? 6.372   55.507 54.634 1.00 6.91   ? 320 MET D CG  1 
ATOM   7324 S SD  . MET D 1 121 ? 6.685   53.986 55.545 1.00 6.55   ? 320 MET D SD  1 
ATOM   7325 C CE  . MET D 1 121 ? 5.499   54.131 56.877 1.00 6.55   ? 320 MET D CE  1 
ATOM   7326 N N   . LEU D 1 122 ? 2.229   57.183 53.366 1.00 8.53   ? 321 LEU D N   1 
ATOM   7327 C CA  . LEU D 1 122 ? 0.851   57.078 52.920 1.00 10.43  ? 321 LEU D CA  1 
ATOM   7328 C C   . LEU D 1 122 ? 0.669   57.505 51.464 1.00 10.94  ? 321 LEU D C   1 
ATOM   7329 O O   . LEU D 1 122 ? -0.252  57.052 50.794 1.00 10.69  ? 321 LEU D O   1 
ATOM   7330 C CB  . LEU D 1 122 ? -0.048  57.940 53.801 1.00 11.54  ? 321 LEU D CB  1 
ATOM   7331 C CG  . LEU D 1 122 ? -1.539  57.834 53.509 1.00 11.98  ? 321 LEU D CG  1 
ATOM   7332 C CD1 . LEU D 1 122 ? -2.085  56.554 54.133 1.00 12.72  ? 321 LEU D CD1 1 
ATOM   7333 C CD2 . LEU D 1 122 ? -2.249  59.045 54.072 1.00 11.76  ? 321 LEU D CD2 1 
ATOM   7334 N N   . SER D 1 123 ? 1.536   58.385 50.979 1.00 11.64  ? 322 SER D N   1 
ATOM   7335 C CA  . SER D 1 123 ? 1.434   58.863 49.604 1.00 13.86  ? 322 SER D CA  1 
ATOM   7336 C C   . SER D 1 123 ? 1.599   57.719 48.611 1.00 14.82  ? 322 SER D C   1 
ATOM   7337 O O   . SER D 1 123 ? 1.091   57.773 47.487 1.00 15.40  ? 322 SER D O   1 
ATOM   7338 C CB  . SER D 1 123 ? 2.515   59.913 49.324 1.00 14.28  ? 322 SER D CB  1 
ATOM   7339 O OG  . SER D 1 123 ? 2.433   60.995 50.227 1.00 15.67  ? 322 SER D OG  1 
ATOM   7340 N N   . SER D 1 124 ? 2.312   56.684 49.046 1.00 14.36  ? 323 SER D N   1 
ATOM   7341 C CA  . SER D 1 124 ? 2.619   55.519 48.217 1.00 12.59  ? 323 SER D CA  1 
ATOM   7342 C C   . SER D 1 124 ? 1.448   54.594 47.857 1.00 11.47  ? 323 SER D C   1 
ATOM   7343 O O   . SER D 1 124 ? 1.475   53.923 46.827 1.00 11.52  ? 323 SER D O   1 
ATOM   7344 C CB  . SER D 1 124 ? 3.737   54.731 48.898 1.00 11.87  ? 323 SER D CB  1 
ATOM   7345 O OG  . SER D 1 124 ? 4.749   55.620 49.352 1.00 9.87   ? 323 SER D OG  1 
ATOM   7346 N N   . VAL D 1 125 ? 0.424   54.555 48.697 1.00 9.61   ? 324 VAL D N   1 
ATOM   7347 C CA  . VAL D 1 125 ? -0.729  53.718 48.423 1.00 10.43  ? 324 VAL D CA  1 
ATOM   7348 C C   . VAL D 1 125 ? -1.851  54.577 47.828 1.00 12.14  ? 324 VAL D C   1 
ATOM   7349 O O   . VAL D 1 125 ? -3.020  54.163 47.790 1.00 12.50  ? 324 VAL D O   1 
ATOM   7350 C CB  . VAL D 1 125 ? -1.228  53.033 49.719 1.00 9.77   ? 324 VAL D CB  1 
ATOM   7351 C CG1 . VAL D 1 125 ? -0.156  52.129 50.267 1.00 9.92   ? 324 VAL D CG1 1 
ATOM   7352 C CG2 . VAL D 1 125 ? -1.579  54.066 50.759 1.00 10.64  ? 324 VAL D CG2 1 
ATOM   7353 N N   . MET D 1 126 ? -1.479  55.768 47.352 1.00 13.13  ? 325 MET D N   1 
ATOM   7354 C CA  . MET D 1 126 ? -2.436  56.724 46.781 1.00 13.12  ? 325 MET D CA  1 
ATOM   7355 C C   . MET D 1 126 ? -2.192  57.138 45.329 1.00 13.51  ? 325 MET D C   1 
ATOM   7356 O O   . MET D 1 126 ? -1.074  57.078 44.809 1.00 12.28  ? 325 MET D O   1 
ATOM   7357 C CB  . MET D 1 126 ? -2.464  58.024 47.613 1.00 13.42  ? 325 MET D CB  1 
ATOM   7358 C CG  . MET D 1 126 ? -2.918  57.916 49.066 1.00 12.68  ? 325 MET D CG  1 
ATOM   7359 S SD  . MET D 1 126 ? -2.963  59.519 49.904 1.00 10.84  ? 325 MET D SD  1 
ATOM   7360 C CE  . MET D 1 126 ? -4.379  59.346 50.984 1.00 6.55   ? 325 MET D CE  1 
ATOM   7361 N N   . ASN D 1 127 ? -3.272  57.565 44.690 1.00 13.90  ? 326 ASN D N   1 
ATOM   7362 C CA  . ASN D 1 127 ? -3.226  58.077 43.331 1.00 15.80  ? 326 ASN D CA  1 
ATOM   7363 C C   . ASN D 1 127 ? -4.378  59.065 43.286 1.00 16.72  ? 326 ASN D C   1 
ATOM   7364 O O   . ASN D 1 127 ? -5.220  59.084 44.192 1.00 15.59  ? 326 ASN D O   1 
ATOM   7365 C CB  . ASN D 1 127 ? -3.373  56.971 42.262 1.00 15.64  ? 326 ASN D CB  1 
ATOM   7366 C CG  . ASN D 1 127 ? -4.792  56.418 42.141 1.00 15.67  ? 326 ASN D CG  1 
ATOM   7367 O OD1 . ASN D 1 127 ? -5.710  56.820 42.860 1.00 17.05  ? 326 ASN D OD1 1 
ATOM   7368 N ND2 . ASN D 1 127 ? -4.969  55.478 41.217 1.00 13.52  ? 326 ASN D ND2 1 
ATOM   7369 N N   . LYS D 1 128 ? -4.398  59.889 42.245 1.00 16.84  ? 327 LYS D N   1 
ATOM   7370 C CA  . LYS D 1 128 ? -5.411  60.918 42.079 1.00 16.01  ? 327 LYS D CA  1 
ATOM   7371 C C   . LYS D 1 128 ? -6.830  60.533 42.473 1.00 17.28  ? 327 LYS D C   1 
ATOM   7372 O O   . LYS D 1 128 ? -7.561  61.365 42.999 1.00 17.77  ? 327 LYS D O   1 
ATOM   7373 C CB  . LYS D 1 128 ? -5.374  61.414 40.633 1.00 13.46  ? 327 LYS D CB  1 
ATOM   7374 C CG  . LYS D 1 128 ? -6.687  61.383 39.872 1.00 11.98  ? 327 LYS D CG  1 
ATOM   7375 C CD  . LYS D 1 128 ? -6.406  61.526 38.382 1.00 14.13  ? 327 LYS D CD  1 
ATOM   7376 C CE  . LYS D 1 128 ? -7.670  61.738 37.566 1.00 14.55  ? 327 LYS D CE  1 
ATOM   7377 N NZ  . LYS D 1 128 ? -8.618  60.611 37.731 1.00 16.53  ? 327 LYS D NZ  1 
ATOM   7378 N N   . ASP D 1 129 ? -7.206  59.273 42.266 1.00 19.17  ? 328 ASP D N   1 
ATOM   7379 C CA  . ASP D 1 129 ? -8.572  58.824 42.545 1.00 20.68  ? 328 ASP D CA  1 
ATOM   7380 C C   . ASP D 1 129 ? -8.897  58.115 43.848 1.00 21.02  ? 328 ASP D C   1 
ATOM   7381 O O   . ASP D 1 129 ? -10.070 57.919 44.165 1.00 22.45  ? 328 ASP D O   1 
ATOM   7382 C CB  . ASP D 1 129 ? -9.064  57.950 41.393 1.00 23.23  ? 328 ASP D CB  1 
ATOM   7383 C CG  . ASP D 1 129 ? -9.111  58.702 40.074 1.00 26.71  ? 328 ASP D CG  1 
ATOM   7384 O OD1 . ASP D 1 129 ? -9.704  59.807 40.052 1.00 28.29  ? 328 ASP D OD1 1 
ATOM   7385 O OD2 . ASP D 1 129 ? -8.564  58.190 39.066 1.00 26.58  ? 328 ASP D OD2 1 
ATOM   7386 N N   . GLY D 1 130 ? -7.885  57.721 44.604 1.00 20.87  ? 329 GLY D N   1 
ATOM   7387 C CA  . GLY D 1 130 ? -8.160  57.040 45.851 1.00 18.88  ? 329 GLY D CA  1 
ATOM   7388 C C   . GLY D 1 130 ? -6.875  56.530 46.447 1.00 19.27  ? 329 GLY D C   1 
ATOM   7389 O O   . GLY D 1 130 ? -5.778  56.925 46.023 1.00 18.01  ? 329 GLY D O   1 
ATOM   7390 N N   . MET D 1 131 ? -7.017  55.643 47.427 1.00 19.00  ? 330 MET D N   1 
ATOM   7391 C CA  . MET D 1 131 ? -5.881  55.051 48.127 1.00 18.70  ? 330 MET D CA  1 
ATOM   7392 C C   . MET D 1 131 ? -6.273  53.632 48.480 1.00 18.38  ? 330 MET D C   1 
ATOM   7393 O O   . MET D 1 131 ? -7.460  53.346 48.641 1.00 19.31  ? 330 MET D O   1 
ATOM   7394 C CB  . MET D 1 131 ? -5.617  55.811 49.420 1.00 19.44  ? 330 MET D CB  1 
ATOM   7395 C CG  . MET D 1 131 ? -6.780  55.698 50.391 1.00 20.32  ? 330 MET D CG  1 
ATOM   7396 S SD  . MET D 1 131 ? -6.518  56.571 51.941 1.00 23.79  ? 330 MET D SD  1 
ATOM   7397 C CE  . MET D 1 131 ? -5.036  55.756 52.531 1.00 22.86  ? 330 MET D CE  1 
ATOM   7398 N N   . LEU D 1 132 ? -5.286  52.751 48.620 1.00 17.60  ? 331 LEU D N   1 
ATOM   7399 C CA  . LEU D 1 132 ? -5.556  51.357 48.975 1.00 17.03  ? 331 LEU D CA  1 
ATOM   7400 C C   . LEU D 1 132 ? -5.783  51.195 50.468 1.00 16.40  ? 331 LEU D C   1 
ATOM   7401 O O   . LEU D 1 132 ? -5.290  51.984 51.278 1.00 16.32  ? 331 LEU D O   1 
ATOM   7402 C CB  . LEU D 1 132 ? -4.386  50.458 48.595 1.00 15.91  ? 331 LEU D CB  1 
ATOM   7403 C CG  . LEU D 1 132 ? -3.894  50.492 47.161 1.00 15.90  ? 331 LEU D CG  1 
ATOM   7404 C CD1 . LEU D 1 132 ? -2.636  49.671 47.070 1.00 16.63  ? 331 LEU D CD1 1 
ATOM   7405 C CD2 . LEU D 1 132 ? -4.953  49.965 46.235 1.00 15.41  ? 331 LEU D CD2 1 
ATOM   7406 N N   . VAL D 1 133 ? -6.523  50.155 50.831 1.00 15.33  ? 332 VAL D N   1 
ATOM   7407 C CA  . VAL D 1 133 ? -6.779  49.877 52.235 1.00 14.04  ? 332 VAL D CA  1 
ATOM   7408 C C   . VAL D 1 133 ? -6.532  48.393 52.510 1.00 12.83  ? 332 VAL D C   1 
ATOM   7409 O O   . VAL D 1 133 ? -6.096  47.656 51.630 1.00 12.60  ? 332 VAL D O   1 
ATOM   7410 C CB  . VAL D 1 133 ? -8.227  50.291 52.651 1.00 12.83  ? 332 VAL D CB  1 
ATOM   7411 C CG1 . VAL D 1 133 ? -8.450  51.748 52.303 1.00 11.81  ? 332 VAL D CG1 1 
ATOM   7412 C CG2 . VAL D 1 133 ? -9.262  49.428 51.960 1.00 13.21  ? 332 VAL D CG2 1 
ATOM   7413 N N   . ALA D 1 134 ? -6.785  47.975 53.742 1.00 11.75  ? 333 ALA D N   1 
ATOM   7414 C CA  . ALA D 1 134 ? -6.600  46.597 54.159 1.00 10.42  ? 333 ALA D CA  1 
ATOM   7415 C C   . ALA D 1 134 ? -5.557  45.799 53.383 1.00 11.05  ? 333 ALA D C   1 
ATOM   7416 O O   . ALA D 1 134 ? -5.889  44.856 52.685 1.00 11.48  ? 333 ALA D O   1 
ATOM   7417 C CB  . ALA D 1 134 ? -7.936  45.876 54.127 1.00 8.91   ? 333 ALA D CB  1 
ATOM   7418 N N   . TYR D 1 135 ? -4.295  46.188 53.487 1.00 13.43  ? 334 TYR D N   1 
ATOM   7419 C CA  . TYR D 1 135 ? -3.216  45.448 52.838 1.00 15.94  ? 334 TYR D CA  1 
ATOM   7420 C C   . TYR D 1 135 ? -3.250  45.357 51.316 1.00 16.40  ? 334 TYR D C   1 
ATOM   7421 O O   . TYR D 1 135 ? -2.858  44.347 50.746 1.00 17.67  ? 334 TYR D O   1 
ATOM   7422 C CB  . TYR D 1 135 ? -3.173  44.040 53.433 1.00 18.65  ? 334 TYR D CB  1 
ATOM   7423 C CG  . TYR D 1 135 ? -3.205  44.061 54.941 1.00 24.39  ? 334 TYR D CG  1 
ATOM   7424 C CD1 . TYR D 1 135 ? -2.056  44.355 55.670 1.00 27.62  ? 334 TYR D CD1 1 
ATOM   7425 C CD2 . TYR D 1 135 ? -4.405  43.875 55.644 1.00 24.61  ? 334 TYR D CD2 1 
ATOM   7426 C CE1 . TYR D 1 135 ? -2.092  44.471 57.062 1.00 29.59  ? 334 TYR D CE1 1 
ATOM   7427 C CE2 . TYR D 1 135 ? -4.454  43.992 57.034 1.00 26.64  ? 334 TYR D CE2 1 
ATOM   7428 C CZ  . TYR D 1 135 ? -3.288  44.292 57.738 1.00 29.81  ? 334 TYR D CZ  1 
ATOM   7429 O OH  . TYR D 1 135 ? -3.297  44.426 59.115 1.00 31.88  ? 334 TYR D OH  1 
ATOM   7430 N N   . GLY D 1 136 ? -3.705  46.406 50.648 1.00 17.66  ? 335 GLY D N   1 
ATOM   7431 C CA  . GLY D 1 136 ? -3.740  46.379 49.195 1.00 17.96  ? 335 GLY D CA  1 
ATOM   7432 C C   . GLY D 1 136 ? -4.910  45.616 48.614 1.00 18.18  ? 335 GLY D C   1 
ATOM   7433 O O   . GLY D 1 136 ? -5.005  45.428 47.397 1.00 18.59  ? 335 GLY D O   1 
ATOM   7434 N N   . ASN D 1 137 ? -5.810  45.187 49.487 1.00 17.29  ? 336 ASN D N   1 
ATOM   7435 C CA  . ASN D 1 137 ? -6.981  44.438 49.067 1.00 17.61  ? 336 ASN D CA  1 
ATOM   7436 C C   . ASN D 1 137 ? -8.161  45.328 48.709 1.00 16.70  ? 336 ASN D C   1 
ATOM   7437 O O   . ASN D 1 137 ? -8.943  45.014 47.813 1.00 16.12  ? 336 ASN D O   1 
ATOM   7438 C CB  . ASN D 1 137 ? -7.412  43.478 50.169 1.00 18.81  ? 336 ASN D CB  1 
ATOM   7439 C CG  . ASN D 1 137 ? -6.575  42.205 50.217 1.00 19.55  ? 336 ASN D CG  1 
ATOM   7440 O OD1 . ASN D 1 137 ? -5.775  42.008 51.131 1.00 19.57  ? 336 ASN D OD1 1 
ATOM   7441 N ND2 . ASN D 1 137 ? -6.770  41.329 49.235 1.00 19.33  ? 336 ASN D ND2 1 
ATOM   7442 N N   . GLY D 1 138 ? -8.298  46.436 49.418 1.00 16.57  ? 337 GLY D N   1 
ATOM   7443 C CA  . GLY D 1 138 ? -9.406  47.327 49.142 1.00 17.22  ? 337 GLY D CA  1 
ATOM   7444 C C   . GLY D 1 138 ? -9.016  48.613 48.452 1.00 17.12  ? 337 GLY D C   1 
ATOM   7445 O O   . GLY D 1 138 ? -7.861  48.835 48.095 1.00 18.34  ? 337 GLY D O   1 
ATOM   7446 N N   . PHE D 1 139 ? -9.991  49.480 48.261 1.00 16.45  ? 338 PHE D N   1 
ATOM   7447 C CA  . PHE D 1 139 ? -9.709  50.736 47.613 1.00 15.57  ? 338 PHE D CA  1 
ATOM   7448 C C   . PHE D 1 139 ? -10.854 51.686 47.853 1.00 17.09  ? 338 PHE D C   1 
ATOM   7449 O O   . PHE D 1 139 ? -11.903 51.575 47.226 1.00 18.12  ? 338 PHE D O   1 
ATOM   7450 C CB  . PHE D 1 139 ? -9.508  50.500 46.134 1.00 9.42   ? 338 PHE D CB  1 
ATOM   7451 C CG  . PHE D 1 139 ? -9.002  51.685 45.401 1.00 7.39   ? 338 PHE D CG  1 
ATOM   7452 C CD1 . PHE D 1 139 ? -9.854  52.710 45.024 1.00 6.55   ? 338 PHE D CD1 1 
ATOM   7453 C CD2 . PHE D 1 139 ? -7.677  51.740 45.005 1.00 8.48   ? 338 PHE D CD2 1 
ATOM   7454 C CE1 . PHE D 1 139 ? -9.388  53.774 44.246 1.00 7.38   ? 338 PHE D CE1 1 
ATOM   7455 C CE2 . PHE D 1 139 ? -7.201  52.800 44.228 1.00 8.54   ? 338 PHE D CE2 1 
ATOM   7456 C CZ  . PHE D 1 139 ? -8.057  53.816 43.845 1.00 6.79   ? 338 PHE D CZ  1 
ATOM   7457 N N   . ILE D 1 140 ? -10.652 52.603 48.795 1.00 18.40  ? 339 ILE D N   1 
ATOM   7458 C CA  . ILE D 1 140 ? -11.663 53.592 49.122 1.00 18.75  ? 339 ILE D CA  1 
ATOM   7459 C C   . ILE D 1 140 ? -11.368 54.776 48.193 1.00 20.47  ? 339 ILE D C   1 
ATOM   7460 O O   . ILE D 1 140 ? -10.225 55.244 48.082 1.00 19.06  ? 339 ILE D O   1 
ATOM   7461 C CB  . ILE D 1 140 ? -11.595 53.954 50.633 1.00 16.81  ? 339 ILE D CB  1 
ATOM   7462 C CG1 . ILE D 1 140 ? -12.902 54.599 51.081 1.00 13.09  ? 339 ILE D CG1 1 
ATOM   7463 C CG2 . ILE D 1 140 ? -10.409 54.843 50.911 1.00 17.91  ? 339 ILE D CG2 1 
ATOM   7464 C CD1 . ILE D 1 140 ? -13.020 54.692 52.564 1.00 9.72   ? 339 ILE D CD1 1 
ATOM   7465 N N   . THR D 1 141 ? -12.405 55.216 47.485 1.00 23.21  ? 340 THR D N   1 
ATOM   7466 C CA  . THR D 1 141 ? -12.277 56.291 46.506 1.00 26.01  ? 340 THR D CA  1 
ATOM   7467 C C   . THR D 1 141 ? -12.264 57.688 47.085 1.00 28.20  ? 340 THR D C   1 
ATOM   7468 O O   . THR D 1 141 ? -13.080 58.042 47.938 1.00 29.32  ? 340 THR D O   1 
ATOM   7469 C CB  . THR D 1 141 ? -13.402 56.229 45.458 1.00 25.01  ? 340 THR D CB  1 
ATOM   7470 O OG1 . THR D 1 141 ? -14.598 56.810 45.993 1.00 25.22  ? 340 THR D OG1 1 
ATOM   7471 C CG2 . THR D 1 141 ? -13.682 54.789 45.083 1.00 24.53  ? 340 THR D CG2 1 
ATOM   7472 N N   . ARG D 1 142 ? -11.331 58.487 46.590 1.00 29.68  ? 341 ARG D N   1 
ATOM   7473 C CA  . ARG D 1 142 ? -11.176 59.858 47.040 1.00 31.23  ? 341 ARG D CA  1 
ATOM   7474 C C   . ARG D 1 142 ? -12.489 60.622 47.115 1.00 32.56  ? 341 ARG D C   1 
ATOM   7475 O O   . ARG D 1 142 ? -12.729 61.370 48.064 1.00 33.31  ? 341 ARG D O   1 
ATOM   7476 C CB  . ARG D 1 142 ? -10.226 60.598 46.107 1.00 29.86  ? 341 ARG D CB  1 
ATOM   7477 C CG  . ARG D 1 142 ? -10.010 62.049 46.476 1.00 26.82  ? 341 ARG D CG  1 
ATOM   7478 C CD  . ARG D 1 142 ? -8.981  62.636 45.543 1.00 26.23  ? 341 ARG D CD  1 
ATOM   7479 N NE  . ARG D 1 142 ? -8.428  63.876 46.062 1.00 26.50  ? 341 ARG D NE  1 
ATOM   7480 C CZ  . ARG D 1 142 ? -7.434  64.541 45.482 1.00 27.44  ? 341 ARG D CZ  1 
ATOM   7481 N NH1 . ARG D 1 142 ? -6.888  64.078 44.361 1.00 26.50  ? 341 ARG D NH1 1 
ATOM   7482 N NH2 . ARG D 1 142 ? -6.981  65.663 46.025 1.00 26.25  ? 341 ARG D NH2 1 
ATOM   7483 N N   . GLU D 1 143 ? -13.334 60.429 46.108 1.00 33.58  ? 342 GLU D N   1 
ATOM   7484 C CA  . GLU D 1 143 ? -14.605 61.123 46.044 1.00 34.43  ? 342 GLU D CA  1 
ATOM   7485 C C   . GLU D 1 143 ? -15.632 60.707 47.074 1.00 33.57  ? 342 GLU D C   1 
ATOM   7486 O O   . GLU D 1 143 ? -16.471 61.513 47.466 1.00 33.56  ? 342 GLU D O   1 
ATOM   7487 C CB  . GLU D 1 143 ? -15.196 60.991 44.651 1.00 37.90  ? 342 GLU D CB  1 
ATOM   7488 C CG  . GLU D 1 143 ? -14.992 62.233 43.801 1.00 45.24  ? 342 GLU D CG  1 
ATOM   7489 C CD  . GLU D 1 143 ? -15.626 63.472 44.427 1.00 49.11  ? 342 GLU D CD  1 
ATOM   7490 O OE1 . GLU D 1 143 ? -16.429 63.321 45.380 1.00 50.60  ? 342 GLU D OE1 1 
ATOM   7491 O OE2 . GLU D 1 143 ? -15.329 64.597 43.958 1.00 51.66  ? 342 GLU D OE2 1 
ATOM   7492 N N   . PHE D 1 144 ? -15.583 59.453 47.509 1.00 32.88  ? 343 PHE D N   1 
ATOM   7493 C CA  . PHE D 1 144 ? -16.529 58.978 48.515 1.00 32.80  ? 343 PHE D CA  1 
ATOM   7494 C C   . PHE D 1 144 ? -16.150 59.540 49.879 1.00 35.27  ? 343 PHE D C   1 
ATOM   7495 O O   . PHE D 1 144 ? -17.007 59.799 50.725 1.00 36.95  ? 343 PHE D O   1 
ATOM   7496 C CB  . PHE D 1 144 ? -16.537 57.443 48.573 1.00 27.93  ? 343 PHE D CB  1 
ATOM   7497 C CG  . PHE D 1 144 ? -17.166 56.871 49.833 1.00 23.70  ? 343 PHE D CG  1 
ATOM   7498 C CD1 . PHE D 1 144 ? -18.452 57.229 50.224 1.00 21.92  ? 343 PHE D CD1 1 
ATOM   7499 C CD2 . PHE D 1 144 ? -16.474 55.948 50.611 1.00 22.04  ? 343 PHE D CD2 1 
ATOM   7500 C CE1 . PHE D 1 144 ? -19.033 56.674 51.363 1.00 19.67  ? 343 PHE D CE1 1 
ATOM   7501 C CE2 . PHE D 1 144 ? -17.050 55.389 51.751 1.00 18.88  ? 343 PHE D CE2 1 
ATOM   7502 C CZ  . PHE D 1 144 ? -18.329 55.752 52.125 1.00 18.80  ? 343 PHE D CZ  1 
ATOM   7503 N N   . LEU D 1 145 ? -14.859 59.734 50.095 1.00 36.57  ? 344 LEU D N   1 
ATOM   7504 C CA  . LEU D 1 145 ? -14.416 60.245 51.371 1.00 37.86  ? 344 LEU D CA  1 
ATOM   7505 C C   . LEU D 1 145 ? -14.946 61.635 51.669 1.00 39.95  ? 344 LEU D C   1 
ATOM   7506 O O   . LEU D 1 145 ? -15.507 61.863 52.741 1.00 40.45  ? 344 LEU D O   1 
ATOM   7507 C CB  . LEU D 1 145 ? -12.895 60.227 51.430 1.00 36.78  ? 344 LEU D CB  1 
ATOM   7508 C CG  . LEU D 1 145 ? -12.355 58.823 51.690 1.00 36.16  ? 344 LEU D CG  1 
ATOM   7509 C CD1 . LEU D 1 145 ? -10.859 58.792 51.460 1.00 35.84  ? 344 LEU D CD1 1 
ATOM   7510 C CD2 . LEU D 1 145 ? -12.706 58.408 53.113 1.00 35.32  ? 344 LEU D CD2 1 
ATOM   7511 N N   . LYS D 1 146 ? -14.793 62.554 50.718 1.00 41.84  ? 345 LYS D N   1 
ATOM   7512 C CA  . LYS D 1 146 ? -15.237 63.930 50.919 1.00 44.50  ? 345 LYS D CA  1 
ATOM   7513 C C   . LYS D 1 146 ? -16.754 64.126 50.957 1.00 47.51  ? 345 LYS D C   1 
ATOM   7514 O O   . LYS D 1 146 ? -17.253 65.201 51.290 1.00 48.43  ? 345 LYS D O   1 
ATOM   7515 C CB  . LYS D 1 146 ? -14.600 64.831 49.863 1.00 41.72  ? 345 LYS D CB  1 
ATOM   7516 C CG  . LYS D 1 146 ? -14.863 64.386 48.443 1.00 39.49  ? 345 LYS D CG  1 
ATOM   7517 C CD  . LYS D 1 146 ? -13.758 64.853 47.512 1.00 37.88  ? 345 LYS D CD  1 
ATOM   7518 C CE  . LYS D 1 146 ? -13.580 66.361 47.530 1.00 36.23  ? 345 LYS D CE  1 
ATOM   7519 N NZ  . LYS D 1 146 ? -12.487 66.757 46.606 1.00 33.68  ? 345 LYS D NZ  1 
ATOM   7520 N N   . SER D 1 147 ? -17.502 63.089 50.635 1.00 50.52  ? 346 SER D N   1 
ATOM   7521 C CA  . SER D 1 147 ? -18.949 63.205 50.680 1.00 53.02  ? 346 SER D CA  1 
ATOM   7522 C C   . SER D 1 147 ? -19.523 63.155 52.104 1.00 54.29  ? 346 SER D C   1 
ATOM   7523 O O   . SER D 1 147 ? -20.702 63.431 52.294 1.00 55.03  ? 346 SER D O   1 
ATOM   7524 C CB  . SER D 1 147 ? -19.542 62.080 49.865 1.00 53.15  ? 346 SER D CB  1 
ATOM   7525 O OG  . SER D 1 147 ? -18.625 61.011 49.880 1.00 53.53  ? 346 SER D OG  1 
ATOM   7526 N N   . LEU D 1 148 ? -18.713 62.810 53.103 1.00 55.82  ? 347 LEU D N   1 
ATOM   7527 C CA  . LEU D 1 148 ? -19.233 62.708 54.465 1.00 57.14  ? 347 LEU D CA  1 
ATOM   7528 C C   . LEU D 1 148 ? -19.393 64.068 55.151 1.00 58.98  ? 347 LEU D C   1 
ATOM   7529 O O   . LEU D 1 148 ? -18.599 64.999 54.974 1.00 59.48  ? 347 LEU D O   1 
ATOM   7530 C CB  . LEU D 1 148 ? -18.389 61.704 55.263 1.00 56.18  ? 347 LEU D CB  1 
ATOM   7531 C CG  . LEU D 1 148 ? -18.110 60.421 54.433 1.00 54.40  ? 347 LEU D CG  1 
ATOM   7532 C CD1 . LEU D 1 148 ? -16.850 59.743 54.924 1.00 52.65  ? 347 LEU D CD1 1 
ATOM   7533 C CD2 . LEU D 1 148 ? -19.273 59.438 54.483 1.00 53.84  ? 347 LEU D CD2 1 
ATOM   7534 N N   . ARG D 1 149 ? -20.471 64.125 55.924 1.00 61.33  ? 348 ARG D N   1 
ATOM   7535 C CA  . ARG D 1 149 ? -20.964 65.303 56.580 1.00 63.96  ? 348 ARG D CA  1 
ATOM   7536 C C   . ARG D 1 149 ? -20.031 66.172 57.177 1.00 63.73  ? 348 ARG D C   1 
ATOM   7537 O O   . ARG D 1 149 ? -20.095 67.298 56.867 1.00 63.66  ? 348 ARG D O   1 
ATOM   7538 C CB  . ARG D 1 149 ? -21.964 64.992 57.654 1.00 66.59  ? 348 ARG D CB  1 
ATOM   7539 C CG  . ARG D 1 149 ? -21.272 64.361 58.836 1.00 68.88  ? 348 ARG D CG  1 
ATOM   7540 C CD  . ARG D 1 149 ? -22.275 63.848 59.828 1.00 71.79  ? 348 ARG D CD  1 
ATOM   7541 N NE  . ARG D 1 149 ? -21.770 62.730 60.608 1.00 74.09  ? 348 ARG D NE  1 
ATOM   7542 C CZ  . ARG D 1 149 ? -21.305 62.870 61.839 1.00 75.34  ? 348 ARG D CZ  1 
ATOM   7543 N NH1 . ARG D 1 149 ? -21.278 64.080 62.379 1.00 76.00  ? 348 ARG D NH1 1 
ATOM   7544 N NH2 . ARG D 1 149 ? -20.950 61.815 62.558 1.00 75.63  ? 348 ARG D NH2 1 
ATOM   7545 N N   . LYS D 1 150 ? -19.202 65.715 58.071 1.00 63.22  ? 349 LYS D N   1 
ATOM   7546 C CA  . LYS D 1 150 ? -18.377 66.733 58.584 1.00 63.03  ? 349 LYS D CA  1 
ATOM   7547 C C   . LYS D 1 150 ? -18.234 66.429 60.013 1.00 62.62  ? 349 LYS D C   1 
ATOM   7548 O O   . LYS D 1 150 ? -19.214 66.277 60.743 1.00 62.49  ? 349 LYS D O   1 
ATOM   7549 C CB  . LYS D 1 150 ? -18.991 68.111 58.306 1.00 63.21  ? 349 LYS D CB  1 
ATOM   7550 C CG  . LYS D 1 150 ? -18.890 68.547 56.819 1.00 63.95  ? 349 LYS D CG  1 
ATOM   7551 C CD  . LYS D 1 150 ? -17.615 69.212 56.456 1.00 64.20  ? 349 LYS D CD  1 
ATOM   7552 C CE  . LYS D 1 150 ? -17.853 70.700 56.358 1.00 64.93  ? 349 LYS D CE  1 
ATOM   7553 N NZ  . LYS D 1 150 ? -16.542 71.384 56.273 1.00 64.68  ? 349 LYS D NZ  1 
ATOM   7554 N N   . PRO D 1 151 ? -17.060 66.765 60.489 1.00 62.58  ? 350 PRO D N   1 
ATOM   7555 C CA  . PRO D 1 151 ? -16.064 67.378 59.616 1.00 62.27  ? 350 PRO D CA  1 
ATOM   7556 C C   . PRO D 1 151 ? -15.262 66.629 58.561 1.00 61.36  ? 350 PRO D C   1 
ATOM   7557 O O   . PRO D 1 151 ? -14.534 67.240 57.782 1.00 61.20  ? 350 PRO D O   1 
ATOM   7558 C CB  . PRO D 1 151 ? -15.184 68.038 60.652 1.00 63.35  ? 350 PRO D CB  1 
ATOM   7559 C CG  . PRO D 1 151 ? -15.097 66.912 61.745 1.00 63.61  ? 350 PRO D CG  1 
ATOM   7560 C CD  . PRO D 1 151 ? -16.358 66.035 61.556 1.00 63.22  ? 350 PRO D CD  1 
ATOM   7561 N N   . PHE D 1 152 ? -15.461 65.322 58.495 1.00 59.62  ? 351 PHE D N   1 
ATOM   7562 C CA  . PHE D 1 152 ? -14.719 64.416 57.623 1.00 57.52  ? 351 PHE D CA  1 
ATOM   7563 C C   . PHE D 1 152 ? -14.134 64.760 56.282 1.00 56.93  ? 351 PHE D C   1 
ATOM   7564 O O   . PHE D 1 152 ? -12.918 64.732 56.129 1.00 56.93  ? 351 PHE D O   1 
ATOM   7565 C CB  . PHE D 1 152 ? -15.522 63.157 57.478 1.00 56.02  ? 351 PHE D CB  1 
ATOM   7566 C CG  . PHE D 1 152 ? -16.102 62.722 58.757 1.00 55.27  ? 351 PHE D CG  1 
ATOM   7567 C CD1 . PHE D 1 152 ? -15.278 62.307 59.797 1.00 55.11  ? 351 PHE D CD1 1 
ATOM   7568 C CD2 . PHE D 1 152 ? -17.460 62.833 58.975 1.00 54.82  ? 351 PHE D CD2 1 
ATOM   7569 C CE1 . PHE D 1 152 ? -15.801 62.013 61.038 1.00 53.74  ? 351 PHE D CE1 1 
ATOM   7570 C CE2 . PHE D 1 152 ? -17.994 62.542 60.210 1.00 53.98  ? 351 PHE D CE2 1 
ATOM   7571 C CZ  . PHE D 1 152 ? -17.163 62.133 61.248 1.00 53.30  ? 351 PHE D CZ  1 
ATOM   7572 N N   . CYS D 1 153 ? -14.991 65.015 55.301 1.00 55.88  ? 352 CYS D N   1 
ATOM   7573 C CA  . CYS D 1 153 ? -14.543 65.344 53.951 1.00 54.84  ? 352 CYS D CA  1 
ATOM   7574 C C   . CYS D 1 153 ? -13.202 66.057 53.939 1.00 54.18  ? 352 CYS D C   1 
ATOM   7575 O O   . CYS D 1 153 ? -12.451 65.995 52.964 1.00 54.71  ? 352 CYS D O   1 
ATOM   7576 C CB  . CYS D 1 153 ? -15.582 66.231 53.265 1.00 54.86  ? 352 CYS D CB  1 
ATOM   7577 S SG  . CYS D 1 153 ? -16.772 66.979 54.402 1.00 54.51  ? 352 CYS D SG  1 
ATOM   7578 N N   . ASP D 1 154 ? -12.911 66.718 55.049 1.00 52.45  ? 353 ASP D N   1 
ATOM   7579 C CA  . ASP D 1 154 ? -11.706 67.501 55.206 1.00 49.80  ? 353 ASP D CA  1 
ATOM   7580 C C   . ASP D 1 154 ? -10.545 66.764 55.858 1.00 46.10  ? 353 ASP D C   1 
ATOM   7581 O O   . ASP D 1 154 ? -9.412  67.213 55.778 1.00 45.95  ? 353 ASP D O   1 
ATOM   7582 C CB  . ASP D 1 154 ? -12.095 68.741 55.991 1.00 52.38  ? 353 ASP D CB  1 
ATOM   7583 C CG  . ASP D 1 154 ? -13.498 69.212 55.632 1.00 53.85  ? 353 ASP D CG  1 
ATOM   7584 O OD1 . ASP D 1 154 ? -13.703 69.677 54.486 1.00 54.15  ? 353 ASP D OD1 1 
ATOM   7585 O OD2 . ASP D 1 154 ? -14.403 69.088 56.484 1.00 54.63  ? 353 ASP D OD2 1 
ATOM   7586 N N   . ILE D 1 155 ? -10.823 65.634 56.495 1.00 41.55  ? 354 ILE D N   1 
ATOM   7587 C CA  . ILE D 1 155 ? -9.774  64.854 57.134 1.00 37.03  ? 354 ILE D CA  1 
ATOM   7588 C C   . ILE D 1 155 ? -8.802  64.265 56.112 1.00 34.94  ? 354 ILE D C   1 
ATOM   7589 O O   . ILE D 1 155 ? -7.599  64.496 56.197 1.00 35.19  ? 354 ILE D O   1 
ATOM   7590 C CB  . ILE D 1 155 ? -10.361 63.696 57.980 1.00 35.75  ? 354 ILE D CB  1 
ATOM   7591 C CG1 . ILE D 1 155 ? -11.197 64.265 59.129 1.00 35.79  ? 354 ILE D CG1 1 
ATOM   7592 C CG2 . ILE D 1 155 ? -9.239  62.828 58.529 1.00 34.13  ? 354 ILE D CG2 1 
ATOM   7593 C CD1 . ILE D 1 155 ? -11.762 63.221 60.070 1.00 33.76  ? 354 ILE D CD1 1 
ATOM   7594 N N   . MET D 1 156 ? -9.323  63.518 55.141 1.00 32.07  ? 355 MET D N   1 
ATOM   7595 C CA  . MET D 1 156 ? -8.481  62.877 54.129 1.00 28.28  ? 355 MET D CA  1 
ATOM   7596 C C   . MET D 1 156 ? -7.969  63.744 52.973 1.00 26.75  ? 355 MET D C   1 
ATOM   7597 O O   . MET D 1 156 ? -6.814  63.623 52.562 1.00 26.93  ? 355 MET D O   1 
ATOM   7598 C CB  . MET D 1 156 ? -9.200  61.654 53.560 1.00 26.51  ? 355 MET D CB  1 
ATOM   7599 C CG  . MET D 1 156 ? -9.137  60.433 54.458 1.00 25.12  ? 355 MET D CG  1 
ATOM   7600 S SD  . MET D 1 156 ? -7.455  60.050 54.990 1.00 25.52  ? 355 MET D SD  1 
ATOM   7601 C CE  . MET D 1 156 ? -6.593  59.928 53.426 1.00 22.23  ? 355 MET D CE  1 
ATOM   7602 N N   . GLU D 1 157 ? -8.822  64.614 52.449 1.00 24.55  ? 356 GLU D N   1 
ATOM   7603 C CA  . GLU D 1 157 ? -8.447  65.481 51.338 1.00 20.85  ? 356 GLU D CA  1 
ATOM   7604 C C   . GLU D 1 157 ? -7.077  66.134 51.523 1.00 19.80  ? 356 GLU D C   1 
ATOM   7605 O O   . GLU D 1 157 ? -6.309  66.257 50.573 1.00 19.52  ? 356 GLU D O   1 
ATOM   7606 C CB  . GLU D 1 157 ? -9.522  66.552 51.143 1.00 19.34  ? 356 GLU D CB  1 
ATOM   7607 C CG  . GLU D 1 157 ? -9.692  66.989 49.704 1.00 16.96  ? 356 GLU D CG  1 
ATOM   7608 C CD  . GLU D 1 157 ? -9.572  65.829 48.743 1.00 17.29  ? 356 GLU D CD  1 
ATOM   7609 O OE1 . GLU D 1 157 ? -10.103 64.734 49.048 1.00 17.70  ? 356 GLU D OE1 1 
ATOM   7610 O OE2 . GLU D 1 157 ? -8.946  66.015 47.679 1.00 15.50  ? 356 GLU D OE2 1 
ATOM   7611 N N   . PRO D 1 158 ? -6.754  66.561 52.754 1.00 19.15  ? 357 PRO D N   1 
ATOM   7612 C CA  . PRO D 1 158 ? -5.472  67.201 53.055 1.00 18.91  ? 357 PRO D CA  1 
ATOM   7613 C C   . PRO D 1 158 ? -4.286  66.363 52.631 1.00 19.39  ? 357 PRO D C   1 
ATOM   7614 O O   . PRO D 1 158 ? -3.284  66.893 52.142 1.00 19.52  ? 357 PRO D O   1 
ATOM   7615 C CB  . PRO D 1 158 ? -5.525  67.367 54.564 1.00 19.65  ? 357 PRO D CB  1 
ATOM   7616 C CG  . PRO D 1 158 ? -6.960  67.613 54.797 1.00 20.37  ? 357 PRO D CG  1 
ATOM   7617 C CD  . PRO D 1 158 ? -7.611  66.563 53.949 1.00 18.41  ? 357 PRO D CD  1 
ATOM   7618 N N   . LYS D 1 159 ? -4.401  65.052 52.837 1.00 18.61  ? 358 LYS D N   1 
ATOM   7619 C CA  . LYS D 1 159 ? -3.338  64.123 52.482 1.00 16.79  ? 358 LYS D CA  1 
ATOM   7620 C C   . LYS D 1 159 ? -3.263  63.864 50.988 1.00 17.13  ? 358 LYS D C   1 
ATOM   7621 O O   . LYS D 1 159 ? -2.173  63.819 50.422 1.00 17.49  ? 358 LYS D O   1 
ATOM   7622 C CB  . LYS D 1 159 ? -3.512  62.796 53.212 1.00 14.48  ? 358 LYS D CB  1 
ATOM   7623 C CG  . LYS D 1 159 ? -3.291  62.883 54.705 1.00 12.98  ? 358 LYS D CG  1 
ATOM   7624 C CD  . LYS D 1 159 ? -4.486  63.520 55.374 1.00 13.26  ? 358 LYS D CD  1 
ATOM   7625 C CE  . LYS D 1 159 ? -4.156  63.907 56.798 1.00 14.23  ? 358 LYS D CE  1 
ATOM   7626 N NZ  . LYS D 1 159 ? -5.327  64.535 57.446 1.00 15.16  ? 358 LYS D NZ  1 
ATOM   7627 N N   . PHE D 1 160 ? -4.409  63.686 50.339 1.00 17.43  ? 359 PHE D N   1 
ATOM   7628 C CA  . PHE D 1 160 ? -4.384  63.439 48.905 1.00 18.46  ? 359 PHE D CA  1 
ATOM   7629 C C   . PHE D 1 160 ? -3.665  64.596 48.237 1.00 19.74  ? 359 PHE D C   1 
ATOM   7630 O O   . PHE D 1 160 ? -2.934  64.399 47.270 1.00 20.36  ? 359 PHE D O   1 
ATOM   7631 C CB  . PHE D 1 160 ? -5.803  63.289 48.330 1.00 17.47  ? 359 PHE D CB  1 
ATOM   7632 C CG  . PHE D 1 160 ? -6.394  61.909 48.503 1.00 14.93  ? 359 PHE D CG  1 
ATOM   7633 C CD1 . PHE D 1 160 ? -5.844  60.816 47.852 1.00 13.71  ? 359 PHE D CD1 1 
ATOM   7634 C CD2 . PHE D 1 160 ? -7.487  61.699 49.343 1.00 16.23  ? 359 PHE D CD2 1 
ATOM   7635 C CE1 . PHE D 1 160 ? -6.368  59.537 48.036 1.00 13.38  ? 359 PHE D CE1 1 
ATOM   7636 C CE2 . PHE D 1 160 ? -8.020  60.413 49.534 1.00 14.67  ? 359 PHE D CE2 1 
ATOM   7637 C CZ  . PHE D 1 160 ? -7.458  59.338 48.881 1.00 13.28  ? 359 PHE D CZ  1 
ATOM   7638 N N   . ASP D 1 161 ? -3.860  65.799 48.771 1.00 21.11  ? 360 ASP D N   1 
ATOM   7639 C CA  . ASP D 1 161 ? -3.220  66.994 48.226 1.00 22.89  ? 360 ASP D CA  1 
ATOM   7640 C C   . ASP D 1 161 ? -1.690  66.908 48.331 1.00 21.57  ? 360 ASP D C   1 
ATOM   7641 O O   . ASP D 1 161 ? -0.962  67.214 47.381 1.00 20.72  ? 360 ASP D O   1 
ATOM   7642 C CB  . ASP D 1 161 ? -3.709  68.240 48.974 1.00 27.38  ? 360 ASP D CB  1 
ATOM   7643 C CG  . ASP D 1 161 ? -3.152  69.534 48.382 1.00 31.76  ? 360 ASP D CG  1 
ATOM   7644 O OD1 . ASP D 1 161 ? -2.459  70.302 49.104 1.00 31.73  ? 360 ASP D OD1 1 
ATOM   7645 O OD2 . ASP D 1 161 ? -3.415  69.772 47.180 1.00 34.80  ? 360 ASP D OD2 1 
ATOM   7646 N N   . PHE D 1 162 ? -1.216  66.494 49.499 1.00 19.31  ? 361 PHE D N   1 
ATOM   7647 C CA  . PHE D 1 162 ? 0.207   66.368 49.754 1.00 17.18  ? 361 PHE D CA  1 
ATOM   7648 C C   . PHE D 1 162 ? 0.780   65.258 48.902 1.00 16.90  ? 361 PHE D C   1 
ATOM   7649 O O   . PHE D 1 162 ? 1.865   65.377 48.341 1.00 15.98  ? 361 PHE D O   1 
ATOM   7650 C CB  . PHE D 1 162 ? 0.428   66.072 51.239 1.00 15.55  ? 361 PHE D CB  1 
ATOM   7651 C CG  . PHE D 1 162 ? 1.842   65.751 51.588 1.00 14.45  ? 361 PHE D CG  1 
ATOM   7652 C CD1 . PHE D 1 162 ? 2.277   64.435 51.620 1.00 14.68  ? 361 PHE D CD1 1 
ATOM   7653 C CD2 . PHE D 1 162 ? 2.747   66.765 51.878 1.00 14.79  ? 361 PHE D CD2 1 
ATOM   7654 C CE1 . PHE D 1 162 ? 3.598   64.130 51.938 1.00 16.56  ? 361 PHE D CE1 1 
ATOM   7655 C CE2 . PHE D 1 162 ? 4.072   66.474 52.197 1.00 16.42  ? 361 PHE D CE2 1 
ATOM   7656 C CZ  . PHE D 1 162 ? 4.498   65.153 52.228 1.00 16.80  ? 361 PHE D CZ  1 
ATOM   7657 N N   . ALA D 1 163 ? 0.020   64.179 48.802 1.00 17.85  ? 362 ALA D N   1 
ATOM   7658 C CA  . ALA D 1 163 ? 0.426   63.017 48.041 1.00 19.89  ? 362 ALA D CA  1 
ATOM   7659 C C   . ALA D 1 163 ? 0.756   63.326 46.590 1.00 21.58  ? 362 ALA D C   1 
ATOM   7660 O O   . ALA D 1 163 ? 1.878   63.094 46.146 1.00 21.14  ? 362 ALA D O   1 
ATOM   7661 C CB  . ALA D 1 163 ? -0.659  61.950 48.112 1.00 19.34  ? 362 ALA D CB  1 
ATOM   7662 N N   . MET D 1 164 ? -0.215  63.852 45.852 1.00 24.66  ? 363 MET D N   1 
ATOM   7663 C CA  . MET D 1 164 ? -0.002  64.149 44.436 1.00 28.14  ? 363 MET D CA  1 
ATOM   7664 C C   . MET D 1 164 ? 1.209   65.027 44.143 1.00 28.17  ? 363 MET D C   1 
ATOM   7665 O O   . MET D 1 164 ? 1.836   64.906 43.084 1.00 27.52  ? 363 MET D O   1 
ATOM   7666 C CB  . MET D 1 164 ? -1.273  64.748 43.821 1.00 30.15  ? 363 MET D CB  1 
ATOM   7667 C CG  . MET D 1 164 ? -2.211  63.698 43.222 1.00 33.10  ? 363 MET D CG  1 
ATOM   7668 S SD  . MET D 1 164 ? -2.649  62.337 44.331 1.00 35.85  ? 363 MET D SD  1 
ATOM   7669 C CE  . MET D 1 164 ? -1.363  61.141 43.967 1.00 34.06  ? 363 MET D CE  1 
ATOM   7670 N N   . LYS D 1 165 ? 1.549   65.900 45.080 1.00 28.04  ? 364 LYS D N   1 
ATOM   7671 C CA  . LYS D 1 165 ? 2.708   66.749 44.882 1.00 28.47  ? 364 LYS D CA  1 
ATOM   7672 C C   . LYS D 1 165 ? 3.964   65.981 45.294 1.00 27.04  ? 364 LYS D C   1 
ATOM   7673 O O   . LYS D 1 165 ? 5.039   66.177 44.725 1.00 28.64  ? 364 LYS D O   1 
ATOM   7674 C CB  . LYS D 1 165 ? 2.591   68.027 45.712 1.00 30.92  ? 364 LYS D CB  1 
ATOM   7675 C CG  . LYS D 1 165 ? 1.419   68.926 45.357 1.00 33.91  ? 364 LYS D CG  1 
ATOM   7676 C CD  . LYS D 1 165 ? 1.488   70.193 46.195 1.00 36.78  ? 364 LYS D CD  1 
ATOM   7677 C CE  . LYS D 1 165 ? 0.161   70.930 46.228 1.00 38.90  ? 364 LYS D CE  1 
ATOM   7678 N NZ  . LYS D 1 165 ? 0.032   71.707 47.497 1.00 40.25  ? 364 LYS D NZ  1 
ATOM   7679 N N   . PHE D 1 166 ? 3.822   65.102 46.281 1.00 23.79  ? 365 PHE D N   1 
ATOM   7680 C CA  . PHE D 1 166 ? 4.948   64.316 46.768 1.00 20.55  ? 365 PHE D CA  1 
ATOM   7681 C C   . PHE D 1 166 ? 5.389   63.299 45.714 1.00 19.42  ? 365 PHE D C   1 
ATOM   7682 O O   . PHE D 1 166 ? 6.585   63.153 45.439 1.00 18.55  ? 365 PHE D O   1 
ATOM   7683 C CB  . PHE D 1 166 ? 4.549   63.598 48.068 1.00 20.20  ? 365 PHE D CB  1 
ATOM   7684 C CG  . PHE D 1 166 ? 5.715   63.044 48.850 1.00 19.46  ? 365 PHE D CG  1 
ATOM   7685 C CD1 . PHE D 1 166 ? 6.765   63.873 49.237 1.00 20.84  ? 365 PHE D CD1 1 
ATOM   7686 C CD2 . PHE D 1 166 ? 5.771   61.698 49.195 1.00 18.42  ? 365 PHE D CD2 1 
ATOM   7687 C CE1 . PHE D 1 166 ? 7.857   63.370 49.953 1.00 19.81  ? 365 PHE D CE1 1 
ATOM   7688 C CE2 . PHE D 1 166 ? 6.861   61.186 49.912 1.00 17.27  ? 365 PHE D CE2 1 
ATOM   7689 C CZ  . PHE D 1 166 ? 7.901   62.024 50.288 1.00 18.34  ? 365 PHE D CZ  1 
ATOM   7690 N N   . ASN D 1 167 ? 4.407   62.615 45.124 1.00 17.55  ? 366 ASN D N   1 
ATOM   7691 C CA  . ASN D 1 167 ? 4.633   61.582 44.112 1.00 14.48  ? 366 ASN D CA  1 
ATOM   7692 C C   . ASN D 1 167 ? 5.226   62.105 42.826 1.00 13.07  ? 366 ASN D C   1 
ATOM   7693 O O   . ASN D 1 167 ? 5.817   61.346 42.052 1.00 12.68  ? 366 ASN D O   1 
ATOM   7694 C CB  . ASN D 1 167 ? 3.324   60.876 43.795 1.00 12.21  ? 366 ASN D CB  1 
ATOM   7695 C CG  . ASN D 1 167 ? 2.787   60.116 44.971 1.00 12.37  ? 366 ASN D CG  1 
ATOM   7696 O OD1 . ASN D 1 167 ? 1.573   60.016 45.147 1.00 13.56  ? 366 ASN D OD1 1 
ATOM   7697 N ND2 . ASN D 1 167 ? 3.687   59.560 45.788 1.00 10.39  ? 366 ASN D ND2 1 
ATOM   7698 N N   . ALA D 1 168 ? 5.055   63.400 42.595 1.00 10.85  ? 367 ALA D N   1 
ATOM   7699 C CA  . ALA D 1 168 ? 5.574   64.019 41.394 1.00 10.43  ? 367 ALA D CA  1 
ATOM   7700 C C   . ALA D 1 168 ? 7.093   64.083 41.461 1.00 9.99   ? 367 ALA D C   1 
ATOM   7701 O O   . ALA D 1 168 ? 7.762   64.334 40.451 1.00 9.73   ? 367 ALA D O   1 
ATOM   7702 C CB  . ALA D 1 168 ? 4.984   65.399 41.232 1.00 10.57  ? 367 ALA D CB  1 
ATOM   7703 N N   . LEU D 1 169 ? 7.626   63.852 42.660 1.00 9.89   ? 368 LEU D N   1 
ATOM   7704 C CA  . LEU D 1 169 ? 9.070   63.856 42.887 1.00 10.29  ? 368 LEU D CA  1 
ATOM   7705 C C   . LEU D 1 169 ? 9.591   62.497 42.439 1.00 12.06  ? 368 LEU D C   1 
ATOM   7706 O O   . LEU D 1 169 ? 10.795  62.310 42.258 1.00 11.95  ? 368 LEU D O   1 
ATOM   7707 C CB  . LEU D 1 169 ? 9.389   64.066 44.372 1.00 8.34   ? 368 LEU D CB  1 
ATOM   7708 C CG  . LEU D 1 169 ? 8.964   65.378 45.026 1.00 6.55   ? 368 LEU D CG  1 
ATOM   7709 C CD1 . LEU D 1 169 ? 9.312   65.375 46.488 1.00 6.55   ? 368 LEU D CD1 1 
ATOM   7710 C CD2 . LEU D 1 169 ? 9.663   66.508 44.342 1.00 6.55   ? 368 LEU D CD2 1 
ATOM   7711 N N   . GLU D 1 170 ? 8.655   61.563 42.266 1.00 14.20  ? 369 GLU D N   1 
ATOM   7712 C CA  . GLU D 1 170 ? 8.927   60.194 41.827 1.00 15.96  ? 369 GLU D CA  1 
ATOM   7713 C C   . GLU D 1 170 ? 10.006  59.471 42.636 1.00 15.01  ? 369 GLU D C   1 
ATOM   7714 O O   . GLU D 1 170 ? 11.007  59.012 42.075 1.00 13.79  ? 369 GLU D O   1 
ATOM   7715 C CB  . GLU D 1 170 ? 9.321   60.175 40.341 1.00 19.77  ? 369 GLU D CB  1 
ATOM   7716 C CG  . GLU D 1 170 ? 8.394   60.959 39.419 1.00 24.77  ? 369 GLU D CG  1 
ATOM   7717 C CD  . GLU D 1 170 ? 8.744   60.799 37.939 1.00 27.80  ? 369 GLU D CD  1 
ATOM   7718 O OE1 . GLU D 1 170 ? 7.891   60.289 37.180 1.00 30.09  ? 369 GLU D OE1 1 
ATOM   7719 O OE2 . GLU D 1 170 ? 9.863   61.180 37.530 1.00 29.59  ? 369 GLU D OE2 1 
ATOM   7720 N N   . LEU D 1 171 ? 9.795   59.360 43.947 1.00 13.64  ? 370 LEU D N   1 
ATOM   7721 C CA  . LEU D 1 171 ? 10.755  58.679 44.808 1.00 11.28  ? 370 LEU D CA  1 
ATOM   7722 C C   . LEU D 1 171 ? 10.477  57.190 44.753 1.00 10.25  ? 370 LEU D C   1 
ATOM   7723 O O   . LEU D 1 171 ? 9.327   56.771 44.634 1.00 9.39   ? 370 LEU D O   1 
ATOM   7724 C CB  . LEU D 1 171 ? 10.622  59.155 46.262 1.00 10.54  ? 370 LEU D CB  1 
ATOM   7725 C CG  . LEU D 1 171 ? 10.811  60.633 46.619 1.00 8.35   ? 370 LEU D CG  1 
ATOM   7726 C CD1 . LEU D 1 171 ? 10.638  60.843 48.121 1.00 6.55   ? 370 LEU D CD1 1 
ATOM   7727 C CD2 . LEU D 1 171 ? 12.189  61.074 46.180 1.00 8.48   ? 370 LEU D CD2 1 
ATOM   7728 N N   . ASP D 1 172 ? 11.529  56.387 44.811 1.00 10.53  ? 371 ASP D N   1 
ATOM   7729 C CA  . ASP D 1 172 ? 11.337  54.948 44.813 1.00 11.56  ? 371 ASP D CA  1 
ATOM   7730 C C   . ASP D 1 172 ? 11.454  54.533 46.263 1.00 11.33  ? 371 ASP D C   1 
ATOM   7731 O O   . ASP D 1 172 ? 11.739  55.360 47.123 1.00 11.72  ? 371 ASP D O   1 
ATOM   7732 C CB  . ASP D 1 172 ? 12.380  54.217 43.953 1.00 12.87  ? 371 ASP D CB  1 
ATOM   7733 C CG  . ASP D 1 172 ? 13.802  54.467 44.403 1.00 14.01  ? 371 ASP D CG  1 
ATOM   7734 O OD1 . ASP D 1 172 ? 13.992  54.738 45.606 1.00 14.23  ? 371 ASP D OD1 1 
ATOM   7735 O OD2 . ASP D 1 172 ? 14.728  54.374 43.556 1.00 15.15  ? 371 ASP D OD2 1 
ATOM   7736 N N   . ASP D 1 173 ? 11.240  53.258 46.542 1.00 11.60  ? 372 ASP D N   1 
ATOM   7737 C CA  . ASP D 1 173 ? 11.297  52.786 47.918 1.00 11.32  ? 372 ASP D CA  1 
ATOM   7738 C C   . ASP D 1 173 ? 12.654  52.906 48.609 1.00 9.53   ? 372 ASP D C   1 
ATOM   7739 O O   . ASP D 1 173 ? 12.731  52.738 49.810 1.00 11.72  ? 372 ASP D O   1 
ATOM   7740 C CB  . ASP D 1 173 ? 10.782  51.332 48.010 1.00 10.05  ? 372 ASP D CB  1 
ATOM   7741 C CG  . ASP D 1 173 ? 9.252   51.243 48.030 1.00 8.39   ? 372 ASP D CG  1 
ATOM   7742 O OD1 . ASP D 1 173 ? 8.620   51.802 48.952 1.00 6.55   ? 372 ASP D OD1 1 
ATOM   7743 O OD2 . ASP D 1 173 ? 8.678   50.612 47.124 1.00 6.55   ? 372 ASP D OD2 1 
ATOM   7744 N N   . SER D 1 174 ? 13.722  53.203 47.884 1.00 7.86   ? 373 SER D N   1 
ATOM   7745 C CA  . SER D 1 174 ? 15.004  53.302 48.558 1.00 7.47   ? 373 SER D CA  1 
ATOM   7746 C C   . SER D 1 174 ? 15.258  54.735 48.977 1.00 8.37   ? 373 SER D C   1 
ATOM   7747 O O   . SER D 1 174 ? 16.141  55.011 49.783 1.00 9.89   ? 373 SER D O   1 
ATOM   7748 C CB  . SER D 1 174 ? 16.147  52.791 47.675 1.00 7.73   ? 373 SER D CB  1 
ATOM   7749 O OG  . SER D 1 174 ? 16.732  53.834 46.927 1.00 7.17   ? 373 SER D OG  1 
ATOM   7750 N N   . ASP D 1 175 ? 14.486  55.660 48.430 1.00 7.86   ? 374 ASP D N   1 
ATOM   7751 C CA  . ASP D 1 175 ? 14.650  57.050 48.817 1.00 7.02   ? 374 ASP D CA  1 
ATOM   7752 C C   . ASP D 1 175 ? 13.732  57.218 50.023 1.00 6.55   ? 374 ASP D C   1 
ATOM   7753 O O   . ASP D 1 175 ? 14.086  57.822 51.025 1.00 6.55   ? 374 ASP D O   1 
ATOM   7754 C CB  . ASP D 1 175 ? 14.203  58.001 47.691 1.00 8.49   ? 374 ASP D CB  1 
ATOM   7755 C CG  . ASP D 1 175 ? 14.875  57.706 46.345 1.00 9.31   ? 374 ASP D CG  1 
ATOM   7756 O OD1 . ASP D 1 175 ? 16.113  57.560 46.285 1.00 8.42   ? 374 ASP D OD1 1 
ATOM   7757 O OD2 . ASP D 1 175 ? 14.149  57.640 45.331 1.00 9.77   ? 374 ASP D OD2 1 
ATOM   7758 N N   . ILE D 1 176 ? 12.546  56.640 49.910 1.00 6.55   ? 375 ILE D N   1 
ATOM   7759 C CA  . ILE D 1 176 ? 11.543  56.716 50.948 1.00 6.55   ? 375 ILE D CA  1 
ATOM   7760 C C   . ILE D 1 176 ? 11.999  56.130 52.264 1.00 6.55   ? 375 ILE D C   1 
ATOM   7761 O O   . ILE D 1 176 ? 11.550  56.572 53.310 1.00 6.55   ? 375 ILE D O   1 
ATOM   7762 C CB  . ILE D 1 176 ? 10.265  56.009 50.496 1.00 6.55   ? 375 ILE D CB  1 
ATOM   7763 C CG1 . ILE D 1 176 ? 9.785   56.637 49.191 1.00 6.55   ? 375 ILE D CG1 1 
ATOM   7764 C CG2 . ILE D 1 176 ? 9.208   56.106 51.561 1.00 6.55   ? 375 ILE D CG2 1 
ATOM   7765 C CD1 . ILE D 1 176 ? 8.474   56.127 48.714 1.00 6.55   ? 375 ILE D CD1 1 
ATOM   7766 N N   . SER D 1 177 ? 12.894  55.149 52.230 1.00 6.55   ? 376 SER D N   1 
ATOM   7767 C CA  . SER D 1 177 ? 13.349  54.531 53.472 1.00 6.55   ? 376 SER D CA  1 
ATOM   7768 C C   . SER D 1 177 ? 14.376  55.373 54.230 1.00 6.55   ? 376 SER D C   1 
ATOM   7769 O O   . SER D 1 177 ? 14.428  55.326 55.455 1.00 7.95   ? 376 SER D O   1 
ATOM   7770 C CB  . SER D 1 177 ? 13.920  53.140 53.209 1.00 6.55   ? 376 SER D CB  1 
ATOM   7771 O OG  . SER D 1 177 ? 15.215  53.220 52.655 1.00 6.55   ? 376 SER D OG  1 
ATOM   7772 N N   . LEU D 1 178 ? 15.197  56.134 53.517 1.00 7.01   ? 377 LEU D N   1 
ATOM   7773 C CA  . LEU D 1 178 ? 16.182  56.978 54.178 1.00 6.55   ? 377 LEU D CA  1 
ATOM   7774 C C   . LEU D 1 178 ? 15.481  58.275 54.596 1.00 6.55   ? 377 LEU D C   1 
ATOM   7775 O O   . LEU D 1 178 ? 15.954  58.996 55.468 1.00 6.55   ? 377 LEU D O   1 
ATOM   7776 C CB  . LEU D 1 178 ? 17.348  57.276 53.232 1.00 6.55   ? 377 LEU D CB  1 
ATOM   7777 C CG  . LEU D 1 178 ? 18.084  56.070 52.654 1.00 6.55   ? 377 LEU D CG  1 
ATOM   7778 C CD1 . LEU D 1 178 ? 19.201  56.518 51.751 1.00 6.55   ? 377 LEU D CD1 1 
ATOM   7779 C CD2 . LEU D 1 178 ? 18.628  55.244 53.780 1.00 6.55   ? 377 LEU D CD2 1 
ATOM   7780 N N   . PHE D 1 179 ? 14.344  58.557 53.968 1.00 6.55   ? 378 PHE D N   1 
ATOM   7781 C CA  . PHE D 1 179 ? 13.562  59.747 54.270 1.00 6.55   ? 378 PHE D CA  1 
ATOM   7782 C C   . PHE D 1 179 ? 12.822  59.513 55.571 1.00 6.55   ? 378 PHE D C   1 
ATOM   7783 O O   . PHE D 1 179 ? 12.956  60.275 56.506 1.00 6.55   ? 378 PHE D O   1 
ATOM   7784 C CB  . PHE D 1 179 ? 12.561  60.003 53.148 1.00 6.55   ? 378 PHE D CB  1 
ATOM   7785 C CG  . PHE D 1 179 ? 11.741  61.250 53.330 1.00 6.55   ? 378 PHE D CG  1 
ATOM   7786 C CD1 . PHE D 1 179 ? 12.351  62.500 53.382 1.00 6.55   ? 378 PHE D CD1 1 
ATOM   7787 C CD2 . PHE D 1 179 ? 10.358  61.179 53.433 1.00 6.55   ? 378 PHE D CD2 1 
ATOM   7788 C CE1 . PHE D 1 179 ? 11.592  63.658 53.535 1.00 6.55   ? 378 PHE D CE1 1 
ATOM   7789 C CE2 . PHE D 1 179 ? 9.596   62.327 53.586 1.00 6.55   ? 378 PHE D CE2 1 
ATOM   7790 C CZ  . PHE D 1 179 ? 10.212  63.569 53.637 1.00 6.55   ? 378 PHE D CZ  1 
ATOM   7791 N N   . VAL D 1 180 ? 12.042  58.439 55.610 1.00 6.55   ? 379 VAL D N   1 
ATOM   7792 C CA  . VAL D 1 180 ? 11.271  58.054 56.786 1.00 6.55   ? 379 VAL D CA  1 
ATOM   7793 C C   . VAL D 1 180 ? 12.172  57.837 57.999 1.00 6.55   ? 379 VAL D C   1 
ATOM   7794 O O   . VAL D 1 180 ? 11.722  57.911 59.137 1.00 6.55   ? 379 VAL D O   1 
ATOM   7795 C CB  . VAL D 1 180 ? 10.452  56.763 56.501 1.00 6.55   ? 379 VAL D CB  1 
ATOM   7796 C CG1 . VAL D 1 180 ? 10.083  56.048 57.792 1.00 6.55   ? 379 VAL D CG1 1 
ATOM   7797 C CG2 . VAL D 1 180 ? 9.193   57.129 55.748 1.00 6.55   ? 379 VAL D CG2 1 
ATOM   7798 N N   . ALA D 1 181 ? 13.450  57.579 57.756 1.00 6.55   ? 380 ALA D N   1 
ATOM   7799 C CA  . ALA D 1 181 ? 14.391  57.361 58.841 1.00 6.55   ? 380 ALA D CA  1 
ATOM   7800 C C   . ALA D 1 181 ? 14.888  58.695 59.344 1.00 6.55   ? 380 ALA D C   1 
ATOM   7801 O O   . ALA D 1 181 ? 14.844  58.978 60.536 1.00 6.55   ? 380 ALA D O   1 
ATOM   7802 C CB  . ALA D 1 181 ? 15.558  56.527 58.360 1.00 6.55   ? 380 ALA D CB  1 
ATOM   7803 N N   . ALA D 1 182 ? 15.365  59.516 58.418 1.00 6.55   ? 381 ALA D N   1 
ATOM   7804 C CA  . ALA D 1 182 ? 15.877  60.835 58.754 1.00 6.55   ? 381 ALA D CA  1 
ATOM   7805 C C   . ALA D 1 182 ? 14.828  61.655 59.490 1.00 6.55   ? 381 ALA D C   1 
ATOM   7806 O O   . ALA D 1 182 ? 15.170  62.600 60.199 1.00 6.65   ? 381 ALA D O   1 
ATOM   7807 C CB  . ALA D 1 182 ? 16.314  61.562 57.494 1.00 6.55   ? 381 ALA D CB  1 
ATOM   7808 N N   . ILE D 1 183 ? 13.553  61.298 59.334 1.00 6.55   ? 382 ILE D N   1 
ATOM   7809 C CA  . ILE D 1 183 ? 12.502  62.037 60.011 1.00 6.55   ? 382 ILE D CA  1 
ATOM   7810 C C   . ILE D 1 183 ? 12.145  61.443 61.356 1.00 6.55   ? 382 ILE D C   1 
ATOM   7811 O O   . ILE D 1 183 ? 11.428  62.064 62.130 1.00 6.55   ? 382 ILE D O   1 
ATOM   7812 C CB  . ILE D 1 183 ? 11.221  62.181 59.150 1.00 6.55   ? 382 ILE D CB  1 
ATOM   7813 C CG1 . ILE D 1 183 ? 10.292  60.994 59.350 1.00 6.55   ? 382 ILE D CG1 1 
ATOM   7814 C CG2 . ILE D 1 183 ? 11.589  62.344 57.710 1.00 6.55   ? 382 ILE D CG2 1 
ATOM   7815 C CD1 . ILE D 1 183 ? 9.331   61.167 60.505 1.00 7.88   ? 382 ILE D CD1 1 
ATOM   7816 N N   . ILE D 1 184 ? 12.614  60.238 61.641 1.00 6.55   ? 383 ILE D N   1 
ATOM   7817 C CA  . ILE D 1 184 ? 12.354  59.665 62.955 1.00 8.30   ? 383 ILE D CA  1 
ATOM   7818 C C   . ILE D 1 184 ? 13.519  60.092 63.837 1.00 10.26  ? 383 ILE D C   1 
ATOM   7819 O O   . ILE D 1 184 ? 13.320  60.720 64.877 1.00 12.53  ? 383 ILE D O   1 
ATOM   7820 C CB  . ILE D 1 184 ? 12.295  58.136 62.943 1.00 7.31   ? 383 ILE D CB  1 
ATOM   7821 C CG1 . ILE D 1 184 ? 10.980  57.676 62.317 1.00 7.25   ? 383 ILE D CG1 1 
ATOM   7822 C CG2 . ILE D 1 184 ? 12.439  57.607 64.366 1.00 6.55   ? 383 ILE D CG2 1 
ATOM   7823 C CD1 . ILE D 1 184 ? 10.832  56.161 62.232 1.00 7.85   ? 383 ILE D CD1 1 
ATOM   7824 N N   . CYS D 1 185 ? 14.729  59.753 63.400 1.00 10.05  ? 384 CYS D N   1 
ATOM   7825 C CA  . CYS D 1 185 ? 15.948  60.104 64.106 1.00 11.23  ? 384 CYS D CA  1 
ATOM   7826 C C   . CYS D 1 185 ? 16.147  61.605 64.018 1.00 14.13  ? 384 CYS D C   1 
ATOM   7827 O O   . CYS D 1 185 ? 17.218  62.074 63.661 1.00 15.66  ? 384 CYS D O   1 
ATOM   7828 C CB  . CYS D 1 185 ? 17.140  59.427 63.455 1.00 9.93   ? 384 CYS D CB  1 
ATOM   7829 S SG  . CYS D 1 185 ? 16.964  57.677 63.259 1.00 11.29  ? 384 CYS D SG  1 
ATOM   7830 N N   . CYS D 1 186 ? 15.106  62.360 64.328 1.00 17.09  ? 385 CYS D N   1 
ATOM   7831 C CA  . CYS D 1 186 ? 15.171  63.809 64.279 1.00 19.31  ? 385 CYS D CA  1 
ATOM   7832 C C   . CYS D 1 186 ? 15.548  64.347 65.653 1.00 19.76  ? 385 CYS D C   1 
ATOM   7833 O O   . CYS D 1 186 ? 14.764  64.265 66.595 1.00 19.57  ? 385 CYS D O   1 
ATOM   7834 C CB  . CYS D 1 186 ? 13.816  64.365 63.838 1.00 21.36  ? 385 CYS D CB  1 
ATOM   7835 S SG  . CYS D 1 186 ? 13.542  66.093 64.255 1.00 27.33  ? 385 CYS D SG  1 
ATOM   7836 N N   . GLY D 1 187 ? 16.745  64.917 65.750 1.00 21.09  ? 386 GLY D N   1 
ATOM   7837 C CA  . GLY D 1 187 ? 17.234  65.440 67.019 1.00 22.75  ? 386 GLY D CA  1 
ATOM   7838 C C   . GLY D 1 187 ? 16.757  66.769 67.603 1.00 22.45  ? 386 GLY D C   1 
ATOM   7839 O O   . GLY D 1 187 ? 17.574  67.532 68.125 1.00 21.91  ? 386 GLY D O   1 
ATOM   7840 N N   . ASP D 1 188 ? 15.457  67.054 67.528 1.00 21.89  ? 387 ASP D N   1 
ATOM   7841 C CA  . ASP D 1 188 ? 14.910  68.288 68.095 1.00 20.52  ? 387 ASP D CA  1 
ATOM   7842 C C   . ASP D 1 188 ? 13.480  68.077 68.573 1.00 19.63  ? 387 ASP D C   1 
ATOM   7843 O O   . ASP D 1 188 ? 12.651  68.983 68.526 1.00 18.90  ? 387 ASP D O   1 
ATOM   7844 C CB  . ASP D 1 188 ? 14.968  69.455 67.091 1.00 21.02  ? 387 ASP D CB  1 
ATOM   7845 C CG  . ASP D 1 188 ? 14.195  69.182 65.815 1.00 21.23  ? 387 ASP D CG  1 
ATOM   7846 O OD1 . ASP D 1 188 ? 14.835  68.934 64.769 1.00 23.06  ? 387 ASP D OD1 1 
ATOM   7847 O OD2 . ASP D 1 188 ? 12.950  69.219 65.853 1.00 20.47  ? 387 ASP D OD2 1 
ATOM   7848 N N   . ARG D 1 189 ? 13.199  66.861 69.027 1.00 18.62  ? 388 ARG D N   1 
ATOM   7849 C CA  . ARG D 1 189 ? 11.881  66.526 69.537 1.00 16.87  ? 388 ARG D CA  1 
ATOM   7850 C C   . ARG D 1 189 ? 11.916  66.847 71.023 1.00 16.73  ? 388 ARG D C   1 
ATOM   7851 O O   . ARG D 1 189 ? 12.921  66.606 71.699 1.00 17.21  ? 388 ARG D O   1 
ATOM   7852 C CB  . ARG D 1 189 ? 11.588  65.043 69.336 1.00 15.48  ? 388 ARG D CB  1 
ATOM   7853 C CG  . ARG D 1 189 ? 11.707  64.570 67.900 1.00 15.84  ? 388 ARG D CG  1 
ATOM   7854 C CD  . ARG D 1 189 ? 10.569  65.077 67.033 1.00 15.25  ? 388 ARG D CD  1 
ATOM   7855 N NE  . ARG D 1 189 ? 10.558  64.413 65.731 1.00 16.18  ? 388 ARG D NE  1 
ATOM   7856 C CZ  . ARG D 1 189 ? 9.685   64.684 64.768 1.00 16.08  ? 388 ARG D CZ  1 
ATOM   7857 N NH1 . ARG D 1 189 ? 8.752   65.604 64.966 1.00 15.86  ? 388 ARG D NH1 1 
ATOM   7858 N NH2 . ARG D 1 189 ? 9.749   64.044 63.606 1.00 14.45  ? 388 ARG D NH2 1 
ATOM   7859 N N   . PRO D 1 190 ? 10.821  67.402 71.553 1.00 15.28  ? 389 PRO D N   1 
ATOM   7860 C CA  . PRO D 1 190 ? 10.723  67.764 72.963 1.00 15.02  ? 389 PRO D CA  1 
ATOM   7861 C C   . PRO D 1 190 ? 11.002  66.660 73.991 1.00 14.35  ? 389 PRO D C   1 
ATOM   7862 O O   . PRO D 1 190 ? 10.381  65.595 73.963 1.00 16.84  ? 389 PRO D O   1 
ATOM   7863 C CB  . PRO D 1 190 ? 9.300   68.318 73.064 1.00 15.15  ? 389 PRO D CB  1 
ATOM   7864 C CG  . PRO D 1 190 ? 8.572   67.623 71.965 1.00 11.74  ? 389 PRO D CG  1 
ATOM   7865 C CD  . PRO D 1 190 ? 9.565   67.723 70.860 1.00 15.06  ? 389 PRO D CD  1 
ATOM   7866 N N   . GLY D 1 191 ? 11.943  66.920 74.894 1.00 10.89  ? 390 GLY D N   1 
ATOM   7867 C CA  . GLY D 1 191 ? 12.237  65.950 75.926 1.00 9.41   ? 390 GLY D CA  1 
ATOM   7868 C C   . GLY D 1 191 ? 13.285  64.903 75.630 1.00 8.56   ? 390 GLY D C   1 
ATOM   7869 O O   . GLY D 1 191 ? 13.215  63.788 76.139 1.00 10.16  ? 390 GLY D O   1 
ATOM   7870 N N   . LEU D 1 192 ? 14.260  65.240 74.807 1.00 7.50   ? 391 LEU D N   1 
ATOM   7871 C CA  . LEU D 1 192 ? 15.313  64.288 74.499 1.00 7.81   ? 391 LEU D CA  1 
ATOM   7872 C C   . LEU D 1 192 ? 16.437  64.459 75.521 1.00 8.39   ? 391 LEU D C   1 
ATOM   7873 O O   . LEU D 1 192 ? 16.754  65.589 75.904 1.00 9.97   ? 391 LEU D O   1 
ATOM   7874 C CB  . LEU D 1 192 ? 15.847  64.556 73.091 1.00 8.52   ? 391 LEU D CB  1 
ATOM   7875 C CG  . LEU D 1 192 ? 15.164  63.953 71.862 1.00 9.19   ? 391 LEU D CG  1 
ATOM   7876 C CD1 . LEU D 1 192 ? 15.869  62.689 71.458 1.00 9.03   ? 391 LEU D CD1 1 
ATOM   7877 C CD2 . LEU D 1 192 ? 13.717  63.674 72.154 1.00 9.29   ? 391 LEU D CD2 1 
ATOM   7878 N N   . LEU D 1 193 ? 17.029  63.358 75.985 1.00 7.89   ? 392 LEU D N   1 
ATOM   7879 C CA  . LEU D 1 193 ? 18.139  63.475 76.933 1.00 7.61   ? 392 LEU D CA  1 
ATOM   7880 C C   . LEU D 1 193 ? 19.416  63.528 76.108 1.00 6.82   ? 392 LEU D C   1 
ATOM   7881 O O   . LEU D 1 193 ? 20.235  64.435 76.271 1.00 6.55   ? 392 LEU D O   1 
ATOM   7882 C CB  . LEU D 1 193 ? 18.208  62.278 77.889 1.00 7.79   ? 392 LEU D CB  1 
ATOM   7883 C CG  . LEU D 1 193 ? 19.100  62.326 79.156 1.00 9.37   ? 392 LEU D CG  1 
ATOM   7884 C CD1 . LEU D 1 193 ? 19.872  61.022 79.221 1.00 8.04   ? 392 LEU D CD1 1 
ATOM   7885 C CD2 . LEU D 1 193 ? 20.084  63.501 79.178 1.00 7.54   ? 392 LEU D CD2 1 
ATOM   7886 N N   . ASN D 1 194 ? 19.562  62.560 75.208 1.00 6.55   ? 393 ASN D N   1 
ATOM   7887 C CA  . ASN D 1 194 ? 20.730  62.474 74.337 1.00 6.55   ? 393 ASN D CA  1 
ATOM   7888 C C   . ASN D 1 194 ? 20.571  63.145 72.969 1.00 6.55   ? 393 ASN D C   1 
ATOM   7889 O O   . ASN D 1 194 ? 20.886  62.557 71.941 1.00 6.55   ? 393 ASN D O   1 
ATOM   7890 C CB  . ASN D 1 194 ? 21.091  61.015 74.150 1.00 8.37   ? 393 ASN D CB  1 
ATOM   7891 C CG  . ASN D 1 194 ? 21.667  60.408 75.403 1.00 13.55  ? 393 ASN D CG  1 
ATOM   7892 O OD1 . ASN D 1 194 ? 22.888  60.302 75.562 1.00 15.41  ? 393 ASN D OD1 1 
ATOM   7893 N ND2 . ASN D 1 194 ? 20.791  60.021 76.317 1.00 16.51  ? 393 ASN D ND2 1 
ATOM   7894 N N   . VAL D 1 195 ? 20.115  64.393 72.968 1.00 6.55   ? 394 VAL D N   1 
ATOM   7895 C CA  . VAL D 1 195 ? 19.897  65.138 71.738 1.00 6.55   ? 394 VAL D CA  1 
ATOM   7896 C C   . VAL D 1 195 ? 21.206  65.451 71.011 1.00 6.55   ? 394 VAL D C   1 
ATOM   7897 O O   . VAL D 1 195 ? 21.304  66.433 70.300 1.00 6.55   ? 394 VAL D O   1 
ATOM   7898 C CB  . VAL D 1 195 ? 19.078  66.447 72.048 1.00 6.55   ? 394 VAL D CB  1 
ATOM   7899 C CG1 . VAL D 1 195 ? 19.951  67.673 72.045 1.00 6.55   ? 394 VAL D CG1 1 
ATOM   7900 C CG2 . VAL D 1 195 ? 17.955  66.599 71.060 1.00 6.55   ? 394 VAL D CG2 1 
ATOM   7901 N N   . GLY D 1 196 ? 22.206  64.593 71.171 1.00 6.55   ? 395 GLY D N   1 
ATOM   7902 C CA  . GLY D 1 196 ? 23.485  64.826 70.525 1.00 6.81   ? 395 GLY D CA  1 
ATOM   7903 C C   . GLY D 1 196 ? 23.911  63.662 69.657 1.00 10.94  ? 395 GLY D C   1 
ATOM   7904 O O   . GLY D 1 196 ? 24.682  63.831 68.709 1.00 12.18  ? 395 GLY D O   1 
ATOM   7905 N N   . HIS D 1 197 ? 23.441  62.467 70.002 1.00 13.42  ? 396 HIS D N   1 
ATOM   7906 C CA  . HIS D 1 197 ? 23.737  61.277 69.212 1.00 16.40  ? 396 HIS D CA  1 
ATOM   7907 C C   . HIS D 1 197 ? 22.853  61.446 68.047 1.00 14.08  ? 396 HIS D C   1 
ATOM   7908 O O   . HIS D 1 197 ? 23.251  61.367 66.903 1.00 15.84  ? 396 HIS D O   1 
ATOM   7909 C CB  . HIS D 1 197 ? 23.196  60.023 69.837 1.00 24.13  ? 396 HIS D CB  1 
ATOM   7910 C CG  . HIS D 1 197 ? 23.861  59.648 71.102 1.00 34.94  ? 396 HIS D CG  1 
ATOM   7911 N ND1 . HIS D 1 197 ? 25.222  59.490 71.185 1.00 39.47  ? 396 HIS D ND1 1 
ATOM   7912 C CD2 . HIS D 1 197 ? 23.358  59.329 72.320 1.00 39.33  ? 396 HIS D CD2 1 
ATOM   7913 C CE1 . HIS D 1 197 ? 25.527  59.084 72.401 1.00 40.61  ? 396 HIS D CE1 1 
ATOM   7914 N NE2 . HIS D 1 197 ? 24.420  58.978 73.112 1.00 40.12  ? 396 HIS D NE2 1 
ATOM   7915 N N   . ILE D 1 198 ? 21.596  61.613 68.412 1.00 10.75  ? 397 ILE D N   1 
ATOM   7916 C CA  . ILE D 1 198 ? 20.522  61.765 67.486 1.00 7.38   ? 397 ILE D CA  1 
ATOM   7917 C C   . ILE D 1 198 ? 20.877  62.796 66.458 1.00 6.55   ? 397 ILE D C   1 
ATOM   7918 O O   . ILE D 1 198 ? 20.786  62.527 65.270 1.00 6.55   ? 397 ILE D O   1 
ATOM   7919 C CB  . ILE D 1 198 ? 19.258  62.109 68.254 1.00 6.68   ? 397 ILE D CB  1 
ATOM   7920 C CG1 . ILE D 1 198 ? 19.167  61.137 69.437 1.00 6.55   ? 397 ILE D CG1 1 
ATOM   7921 C CG2 . ILE D 1 198 ? 18.034  62.019 67.343 1.00 6.55   ? 397 ILE D CG2 1 
ATOM   7922 C CD1 . ILE D 1 198 ? 17.831  61.012 70.043 1.00 6.55   ? 397 ILE D CD1 1 
ATOM   7923 N N   . GLU D 1 199 ? 21.315  63.968 66.880 1.00 6.55   ? 398 GLU D N   1 
ATOM   7924 C CA  . GLU D 1 199 ? 21.669  64.938 65.869 1.00 9.54   ? 398 GLU D CA  1 
ATOM   7925 C C   . GLU D 1 199 ? 22.727  64.315 64.957 1.00 9.45   ? 398 GLU D C   1 
ATOM   7926 O O   . GLU D 1 199 ? 22.495  64.154 63.764 1.00 11.15  ? 398 GLU D O   1 
ATOM   7927 C CB  . GLU D 1 199 ? 22.137  66.254 66.500 1.00 10.22  ? 398 GLU D CB  1 
ATOM   7928 C CG  . GLU D 1 199 ? 20.979  67.002 67.144 1.00 16.54  ? 398 GLU D CG  1 
ATOM   7929 C CD  . GLU D 1 199 ? 21.290  68.454 67.486 1.00 22.19  ? 398 GLU D CD  1 
ATOM   7930 O OE1 . GLU D 1 199 ? 22.419  68.746 67.949 1.00 25.08  ? 398 GLU D OE1 1 
ATOM   7931 O OE2 . GLU D 1 199 ? 20.388  69.308 67.310 1.00 25.32  ? 398 GLU D OE2 1 
ATOM   7932 N N   . LYS D 1 200 ? 23.863  63.919 65.512 1.00 9.71   ? 399 LYS D N   1 
ATOM   7933 C CA  . LYS D 1 200 ? 24.916  63.301 64.709 1.00 10.27  ? 399 LYS D CA  1 
ATOM   7934 C C   . LYS D 1 200 ? 24.488  62.007 63.990 1.00 12.01  ? 399 LYS D C   1 
ATOM   7935 O O   . LYS D 1 200 ? 25.125  61.580 63.029 1.00 12.73  ? 399 LYS D O   1 
ATOM   7936 C CB  . LYS D 1 200 ? 26.123  62.994 65.587 1.00 8.64   ? 399 LYS D CB  1 
ATOM   7937 C CG  . LYS D 1 200 ? 26.658  61.587 65.386 1.00 6.55   ? 399 LYS D CG  1 
ATOM   7938 C CD  . LYS D 1 200 ? 28.157  61.614 65.197 1.00 6.90   ? 399 LYS D CD  1 
ATOM   7939 C CE  . LYS D 1 200 ? 28.559  62.624 64.138 1.00 6.89   ? 399 LYS D CE  1 
ATOM   7940 N NZ  . LYS D 1 200 ? 30.028  62.820 64.141 1.00 9.37   ? 399 LYS D NZ  1 
ATOM   7941 N N   . MET D 1 201 ? 23.426  61.369 64.469 1.00 13.69  ? 400 MET D N   1 
ATOM   7942 C CA  . MET D 1 201 ? 22.937  60.126 63.872 1.00 11.78  ? 400 MET D CA  1 
ATOM   7943 C C   . MET D 1 201 ? 22.246  60.516 62.580 1.00 11.13  ? 400 MET D C   1 
ATOM   7944 O O   . MET D 1 201 ? 22.460  59.918 61.526 1.00 9.61   ? 400 MET D O   1 
ATOM   7945 C CB  . MET D 1 201 ? 21.934  59.463 64.813 1.00 10.01  ? 400 MET D CB  1 
ATOM   7946 C CG  . MET D 1 201 ? 22.059  57.960 64.904 1.00 11.20  ? 400 MET D CG  1 
ATOM   7947 S SD  . MET D 1 201 ? 20.830  57.295 66.040 1.00 12.17  ? 400 MET D SD  1 
ATOM   7948 C CE  . MET D 1 201 ? 19.327  57.666 65.148 1.00 13.59  ? 400 MET D CE  1 
ATOM   7949 N N   . GLN D 1 202 ? 21.425  61.552 62.693 1.00 10.04  ? 401 GLN D N   1 
ATOM   7950 C CA  . GLN D 1 202 ? 20.676  62.069 61.581 1.00 9.04   ? 401 GLN D CA  1 
ATOM   7951 C C   . GLN D 1 202 ? 21.616  62.678 60.571 1.00 10.58  ? 401 GLN D C   1 
ATOM   7952 O O   . GLN D 1 202 ? 21.466  62.455 59.375 1.00 13.15  ? 401 GLN D O   1 
ATOM   7953 C CB  . GLN D 1 202 ? 19.698  63.126 62.058 1.00 6.55   ? 401 GLN D CB  1 
ATOM   7954 C CG  . GLN D 1 202 ? 18.659  63.484 61.017 1.00 8.74   ? 401 GLN D CG  1 
ATOM   7955 C CD  . GLN D 1 202 ? 17.773  64.617 61.455 1.00 9.68   ? 401 GLN D CD  1 
ATOM   7956 O OE1 . GLN D 1 202 ? 16.672  64.804 60.927 1.00 7.83   ? 401 GLN D OE1 1 
ATOM   7957 N NE2 . GLN D 1 202 ? 18.249  65.393 62.426 1.00 11.70  ? 401 GLN D NE2 1 
ATOM   7958 N N   . GLU D 1 203 ? 22.596  63.447 61.030 1.00 11.20  ? 402 GLU D N   1 
ATOM   7959 C CA  . GLU D 1 203 ? 23.510  64.058 60.078 1.00 12.93  ? 402 GLU D CA  1 
ATOM   7960 C C   . GLU D 1 203 ? 24.181  62.953 59.280 1.00 12.05  ? 402 GLU D C   1 
ATOM   7961 O O   . GLU D 1 203 ? 24.759  63.189 58.221 1.00 11.84  ? 402 GLU D O   1 
ATOM   7962 C CB  . GLU D 1 203 ? 24.556  64.929 60.776 1.00 14.64  ? 402 GLU D CB  1 
ATOM   7963 C CG  . GLU D 1 203 ? 25.811  64.201 61.207 1.00 19.89  ? 402 GLU D CG  1 
ATOM   7964 C CD  . GLU D 1 203 ? 26.986  65.142 61.383 1.00 23.41  ? 402 GLU D CD  1 
ATOM   7965 O OE1 . GLU D 1 203 ? 26.805  66.218 61.994 1.00 25.80  ? 402 GLU D OE1 1 
ATOM   7966 O OE2 . GLU D 1 203 ? 28.094  64.800 60.916 1.00 25.42  ? 402 GLU D OE2 1 
ATOM   7967 N N   . GLY D 1 204 ? 24.088  61.736 59.800 1.00 11.98  ? 403 GLY D N   1 
ATOM   7968 C CA  . GLY D 1 204 ? 24.664  60.599 59.114 1.00 11.22  ? 403 GLY D CA  1 
ATOM   7969 C C   . GLY D 1 204 ? 23.670  60.089 58.090 1.00 10.16  ? 403 GLY D C   1 
ATOM   7970 O O   . GLY D 1 204 ? 24.037  59.817 56.954 1.00 10.26  ? 403 GLY D O   1 
ATOM   7971 N N   . ILE D 1 205 ? 22.407  59.961 58.493 1.00 8.93   ? 404 ILE D N   1 
ATOM   7972 C CA  . ILE D 1 205 ? 21.365  59.487 57.593 1.00 7.50   ? 404 ILE D CA  1 
ATOM   7973 C C   . ILE D 1 205 ? 21.107  60.516 56.508 1.00 7.92   ? 404 ILE D C   1 
ATOM   7974 O O   . ILE D 1 205 ? 21.015  60.163 55.335 1.00 8.91   ? 404 ILE D O   1 
ATOM   7975 C CB  . ILE D 1 205 ? 20.037  59.220 58.330 1.00 6.55   ? 404 ILE D CB  1 
ATOM   7976 C CG1 . ILE D 1 205 ? 20.234  58.126 59.375 1.00 6.57   ? 404 ILE D CG1 1 
ATOM   7977 C CG2 . ILE D 1 205 ? 18.961  58.805 57.336 1.00 6.55   ? 404 ILE D CG2 1 
ATOM   7978 C CD1 . ILE D 1 205 ? 18.983  57.778 60.157 1.00 6.55   ? 404 ILE D CD1 1 
ATOM   7979 N N   . VAL D 1 206 ? 20.994  61.786 56.896 1.00 6.56   ? 405 VAL D N   1 
ATOM   7980 C CA  . VAL D 1 206 ? 20.739  62.845 55.931 1.00 6.55   ? 405 VAL D CA  1 
ATOM   7981 C C   . VAL D 1 206 ? 21.887  62.977 54.935 1.00 6.55   ? 405 VAL D C   1 
ATOM   7982 O O   . VAL D 1 206 ? 21.674  63.310 53.777 1.00 6.55   ? 405 VAL D O   1 
ATOM   7983 C CB  . VAL D 1 206 ? 20.483  64.183 56.638 1.00 6.55   ? 405 VAL D CB  1 
ATOM   7984 C CG1 . VAL D 1 206 ? 21.304  65.279 56.007 1.00 6.55   ? 405 VAL D CG1 1 
ATOM   7985 C CG2 . VAL D 1 206 ? 19.014  64.531 56.541 1.00 6.55   ? 405 VAL D CG2 1 
ATOM   7986 N N   . HIS D 1 207 ? 23.103  62.704 55.389 1.00 7.14   ? 406 HIS D N   1 
ATOM   7987 C CA  . HIS D 1 207 ? 24.284  62.778 54.527 1.00 8.36   ? 406 HIS D CA  1 
ATOM   7988 C C   . HIS D 1 207 ? 24.234  61.717 53.440 1.00 7.27   ? 406 HIS D C   1 
ATOM   7989 O O   . HIS D 1 207 ? 24.501  61.971 52.270 1.00 7.29   ? 406 HIS D O   1 
ATOM   7990 C CB  . HIS D 1 207 ? 25.557  62.553 55.341 1.00 10.86  ? 406 HIS D CB  1 
ATOM   7991 C CG  . HIS D 1 207 ? 26.786  62.397 54.500 1.00 12.79  ? 406 HIS D CG  1 
ATOM   7992 N ND1 . HIS D 1 207 ? 27.305  63.425 53.742 1.00 13.73  ? 406 HIS D ND1 1 
ATOM   7993 C CD2 . HIS D 1 207 ? 27.592  61.329 54.288 1.00 14.53  ? 406 HIS D CD2 1 
ATOM   7994 C CE1 . HIS D 1 207 ? 28.379  62.998 53.102 1.00 14.14  ? 406 HIS D CE1 1 
ATOM   7995 N NE2 . HIS D 1 207 ? 28.575  61.730 53.414 1.00 14.42  ? 406 HIS D NE2 1 
ATOM   7996 N N   . VAL D 1 208 ? 23.923  60.505 53.856 1.00 6.55   ? 407 VAL D N   1 
ATOM   7997 C CA  . VAL D 1 208 ? 23.839  59.395 52.944 1.00 6.55   ? 407 VAL D CA  1 
ATOM   7998 C C   . VAL D 1 208 ? 22.611  59.524 52.045 1.00 6.55   ? 407 VAL D C   1 
ATOM   7999 O O   . VAL D 1 208 ? 22.562  58.949 50.964 1.00 6.55   ? 407 VAL D O   1 
ATOM   8000 C CB  . VAL D 1 208 ? 23.818  58.091 53.747 1.00 6.55   ? 407 VAL D CB  1 
ATOM   8001 C CG1 . VAL D 1 208 ? 22.978  57.050 53.075 1.00 6.55   ? 407 VAL D CG1 1 
ATOM   8002 C CG2 . VAL D 1 208 ? 25.220  57.596 53.903 1.00 6.55   ? 407 VAL D CG2 1 
ATOM   8003 N N   . LEU D 1 209 ? 21.623  60.295 52.485 1.00 6.65   ? 408 LEU D N   1 
ATOM   8004 C CA  . LEU D 1 209 ? 20.401  60.489 51.703 1.00 6.55   ? 408 LEU D CA  1 
ATOM   8005 C C   . LEU D 1 209 ? 20.670  61.333 50.483 1.00 6.55   ? 408 LEU D C   1 
ATOM   8006 O O   . LEU D 1 209 ? 20.170  61.041 49.412 1.00 8.02   ? 408 LEU D O   1 
ATOM   8007 C CB  . LEU D 1 209 ? 19.313  61.161 52.547 1.00 6.55   ? 408 LEU D CB  1 
ATOM   8008 C CG  . LEU D 1 209 ? 18.079  61.741 51.853 1.00 6.55   ? 408 LEU D CG  1 
ATOM   8009 C CD1 . LEU D 1 209 ? 17.446  60.720 50.959 1.00 6.55   ? 408 LEU D CD1 1 
ATOM   8010 C CD2 . LEU D 1 209 ? 17.091  62.202 52.902 1.00 6.55   ? 408 LEU D CD2 1 
ATOM   8011 N N   . ARG D 1 210 ? 21.458  62.387 50.652 1.00 7.86   ? 409 ARG D N   1 
ATOM   8012 C CA  . ARG D 1 210 ? 21.784  63.276 49.547 1.00 10.04  ? 409 ARG D CA  1 
ATOM   8013 C C   . ARG D 1 210 ? 22.517  62.531 48.432 1.00 10.62  ? 409 ARG D C   1 
ATOM   8014 O O   . ARG D 1 210 ? 22.113  62.580 47.271 1.00 12.57  ? 409 ARG D O   1 
ATOM   8015 C CB  . ARG D 1 210 ? 22.652  64.442 50.035 1.00 10.48  ? 409 ARG D CB  1 
ATOM   8016 C CG  . ARG D 1 210 ? 23.985  64.557 49.304 1.00 14.61  ? 409 ARG D CG  1 
ATOM   8017 C CD  . ARG D 1 210 ? 24.916  65.619 49.863 1.00 16.04  ? 409 ARG D CD  1 
ATOM   8018 N NE  . ARG D 1 210 ? 24.365  66.956 49.700 1.00 19.84  ? 409 ARG D NE  1 
ATOM   8019 C CZ  . ARG D 1 210 ? 23.410  67.477 50.470 1.00 22.57  ? 409 ARG D CZ  1 
ATOM   8020 N NH1 . ARG D 1 210 ? 22.894  66.766 51.468 1.00 21.24  ? 409 ARG D NH1 1 
ATOM   8021 N NH2 . ARG D 1 210 ? 22.976  68.720 50.250 1.00 22.67  ? 409 ARG D NH2 1 
ATOM   8022 N N   . LEU D 1 211 ? 23.594  61.842 48.789 1.00 10.05  ? 410 LEU D N   1 
ATOM   8023 C CA  . LEU D 1 211 ? 24.385  61.117 47.810 1.00 9.65   ? 410 LEU D CA  1 
ATOM   8024 C C   . LEU D 1 211 ? 23.548  60.127 47.026 1.00 9.14   ? 410 LEU D C   1 
ATOM   8025 O O   . LEU D 1 211 ? 23.754  59.931 45.833 1.00 10.62  ? 410 LEU D O   1 
ATOM   8026 C CB  . LEU D 1 211 ? 25.540  60.397 48.501 1.00 10.44  ? 410 LEU D CB  1 
ATOM   8027 C CG  . LEU D 1 211 ? 26.476  61.301 49.313 1.00 12.90  ? 410 LEU D CG  1 
ATOM   8028 C CD1 . LEU D 1 211 ? 27.808  60.594 49.455 1.00 14.05  ? 410 LEU D CD1 1 
ATOM   8029 C CD2 . LEU D 1 211 ? 26.694  62.653 48.624 1.00 12.05  ? 410 LEU D CD2 1 
ATOM   8030 N N   . HIS D 1 212 ? 22.589  59.514 47.698 1.00 8.19   ? 411 HIS D N   1 
ATOM   8031 C CA  . HIS D 1 212 ? 21.726  58.546 47.056 1.00 7.02   ? 411 HIS D CA  1 
ATOM   8032 C C   . HIS D 1 212 ? 20.614  59.234 46.292 1.00 6.91   ? 411 HIS D C   1 
ATOM   8033 O O   . HIS D 1 212 ? 19.911  58.606 45.526 1.00 10.57  ? 411 HIS D O   1 
ATOM   8034 C CB  . HIS D 1 212 ? 21.155  57.601 48.105 1.00 6.55   ? 411 HIS D CB  1 
ATOM   8035 C CG  . HIS D 1 212 ? 20.216  56.583 47.551 1.00 6.55   ? 411 HIS D CG  1 
ATOM   8036 N ND1 . HIS D 1 212 ? 18.913  56.881 47.227 1.00 6.55   ? 411 HIS D ND1 1 
ATOM   8037 C CD2 . HIS D 1 212 ? 20.389  55.273 47.258 1.00 6.92   ? 411 HIS D CD2 1 
ATOM   8038 C CE1 . HIS D 1 212 ? 18.321  55.799 46.757 1.00 6.76   ? 411 HIS D CE1 1 
ATOM   8039 N NE2 . HIS D 1 212 ? 19.194  54.809 46.766 1.00 7.32   ? 411 HIS D NE2 1 
ATOM   8040 N N   . LEU D 1 213 ? 20.448  60.529 46.496 1.00 6.55   ? 412 LEU D N   1 
ATOM   8041 C CA  . LEU D 1 213 ? 19.417  61.258 45.783 1.00 7.26   ? 412 LEU D CA  1 
ATOM   8042 C C   . LEU D 1 213 ? 20.049  61.954 44.591 1.00 11.24  ? 412 LEU D C   1 
ATOM   8043 O O   . LEU D 1 213 ? 19.362  62.341 43.645 1.00 12.21  ? 412 LEU D O   1 
ATOM   8044 C CB  . LEU D 1 213 ? 18.766  62.307 46.684 1.00 6.55   ? 412 LEU D CB  1 
ATOM   8045 C CG  . LEU D 1 213 ? 17.579  61.874 47.528 1.00 6.55   ? 412 LEU D CG  1 
ATOM   8046 C CD1 . LEU D 1 213 ? 16.873  63.092 48.066 1.00 6.55   ? 412 LEU D CD1 1 
ATOM   8047 C CD2 . LEU D 1 213 ? 16.638  61.064 46.682 1.00 6.55   ? 412 LEU D CD2 1 
ATOM   8048 N N   . GLN D 1 214 ? 21.366  62.113 44.637 1.00 14.75  ? 413 GLN D N   1 
ATOM   8049 C CA  . GLN D 1 214 ? 22.081  62.786 43.564 1.00 19.12  ? 413 GLN D CA  1 
ATOM   8050 C C   . GLN D 1 214 ? 22.653  61.847 42.529 1.00 20.26  ? 413 GLN D C   1 
ATOM   8051 O O   . GLN D 1 214 ? 23.229  62.302 41.544 1.00 22.92  ? 413 GLN D O   1 
ATOM   8052 C CB  . GLN D 1 214 ? 23.248  63.589 44.101 1.00 23.50  ? 413 GLN D CB  1 
ATOM   8053 C CG  . GLN D 1 214 ? 22.938  64.538 45.234 1.00 33.09  ? 413 GLN D CG  1 
ATOM   8054 C CD  . GLN D 1 214 ? 24.109  65.469 45.485 1.00 39.24  ? 413 GLN D CD  1 
ATOM   8055 O OE1 . GLN D 1 214 ? 25.268  65.118 45.210 1.00 41.91  ? 413 GLN D OE1 1 
ATOM   8056 N NE2 . GLN D 1 214 ? 23.822  66.660 46.008 1.00 41.89  ? 413 GLN D NE2 1 
ATOM   8057 N N   . SER D 1 215 ? 22.544  60.545 42.755 1.00 18.19  ? 414 SER D N   1 
ATOM   8058 C CA  . SER D 1 215 ? 23.079  59.607 41.790 1.00 14.94  ? 414 SER D CA  1 
ATOM   8059 C C   . SER D 1 215 ? 21.959  58.722 41.299 1.00 14.55  ? 414 SER D C   1 
ATOM   8060 O O   . SER D 1 215 ? 22.173  57.861 40.460 1.00 18.54  ? 414 SER D O   1 
ATOM   8061 C CB  . SER D 1 215 ? 24.207  58.768 42.407 1.00 13.66  ? 414 SER D CB  1 
ATOM   8062 O OG  . SER D 1 215 ? 23.850  57.401 42.560 1.00 11.44  ? 414 SER D OG  1 
ATOM   8063 N N   . ASN D 1 216 ? 20.757  58.933 41.811 1.00 12.09  ? 415 ASN D N   1 
ATOM   8064 C CA  . ASN D 1 216 ? 19.633  58.128 41.373 1.00 11.47  ? 415 ASN D CA  1 
ATOM   8065 C C   . ASN D 1 216 ? 18.584  59.014 40.739 1.00 11.85  ? 415 ASN D C   1 
ATOM   8066 O O   . ASN D 1 216 ? 17.656  58.542 40.091 1.00 12.45  ? 415 ASN D O   1 
ATOM   8067 C CB  . ASN D 1 216 ? 19.050  57.337 42.541 1.00 12.43  ? 415 ASN D CB  1 
ATOM   8068 C CG  . ASN D 1 216 ? 19.867  56.113 42.867 1.00 12.63  ? 415 ASN D CG  1 
ATOM   8069 O OD1 . ASN D 1 216 ? 19.335  55.014 42.956 1.00 14.40  ? 415 ASN D OD1 1 
ATOM   8070 N ND2 . ASN D 1 216 ? 21.169  56.295 43.042 1.00 13.67  ? 415 ASN D ND2 1 
ATOM   8071 N N   . HIS D 1 217 ? 18.735  60.313 40.936 1.00 12.13  ? 416 HIS D N   1 
ATOM   8072 C CA  . HIS D 1 217 ? 17.831  61.280 40.340 1.00 13.83  ? 416 HIS D CA  1 
ATOM   8073 C C   . HIS D 1 217 ? 18.715  62.463 39.955 1.00 17.11  ? 416 HIS D C   1 
ATOM   8074 O O   . HIS D 1 217 ? 18.622  63.533 40.565 1.00 19.33  ? 416 HIS D O   1 
ATOM   8075 C CB  . HIS D 1 217 ? 16.778  61.754 41.337 1.00 10.65  ? 416 HIS D CB  1 
ATOM   8076 C CG  . HIS D 1 217 ? 15.908  60.669 41.879 1.00 8.00   ? 416 HIS D CG  1 
ATOM   8077 N ND1 . HIS D 1 217 ? 16.372  59.707 42.747 1.00 9.64   ? 416 HIS D ND1 1 
ATOM   8078 C CD2 . HIS D 1 217 ? 14.584  60.438 41.736 1.00 8.03   ? 416 HIS D CD2 1 
ATOM   8079 C CE1 . HIS D 1 217 ? 15.370  58.931 43.121 1.00 9.16   ? 416 HIS D CE1 1 
ATOM   8080 N NE2 . HIS D 1 217 ? 14.273  59.355 42.522 1.00 9.19   ? 416 HIS D NE2 1 
ATOM   8081 N N   . PRO D 1 218 ? 19.600  62.289 38.951 1.00 17.98  ? 417 PRO D N   1 
ATOM   8082 C CA  . PRO D 1 218 ? 20.464  63.403 38.563 1.00 18.81  ? 417 PRO D CA  1 
ATOM   8083 C C   . PRO D 1 218 ? 19.757  64.415 37.677 1.00 19.48  ? 417 PRO D C   1 
ATOM   8084 O O   . PRO D 1 218 ? 20.233  65.531 37.499 1.00 20.00  ? 417 PRO D O   1 
ATOM   8085 C CB  . PRO D 1 218 ? 21.619  62.701 37.851 1.00 17.09  ? 417 PRO D CB  1 
ATOM   8086 C CG  . PRO D 1 218 ? 20.941  61.607 37.159 1.00 15.27  ? 417 PRO D CG  1 
ATOM   8087 C CD  . PRO D 1 218 ? 19.964  61.076 38.194 1.00 16.96  ? 417 PRO D CD  1 
ATOM   8088 N N   . ASP D 1 219 ? 18.610  64.032 37.133 1.00 20.94  ? 418 ASP D N   1 
ATOM   8089 C CA  . ASP D 1 219 ? 17.879  64.931 36.254 1.00 23.49  ? 418 ASP D CA  1 
ATOM   8090 C C   . ASP D 1 219 ? 16.872  65.775 37.036 1.00 23.22  ? 418 ASP D C   1 
ATOM   8091 O O   . ASP D 1 219 ? 15.869  66.262 36.506 1.00 24.52  ? 418 ASP D O   1 
ATOM   8092 C CB  . ASP D 1 219 ? 17.223  64.122 35.123 1.00 25.95  ? 418 ASP D CB  1 
ATOM   8093 C CG  . ASP D 1 219 ? 18.256  63.356 34.278 1.00 28.51  ? 418 ASP D CG  1 
ATOM   8094 O OD1 . ASP D 1 219 ? 19.289  63.959 33.900 1.00 31.19  ? 418 ASP D OD1 1 
ATOM   8095 O OD2 . ASP D 1 219 ? 18.043  62.157 33.990 1.00 28.47  ? 418 ASP D OD2 1 
ATOM   8096 N N   . ASP D 1 220 ? 17.191  65.944 38.314 1.00 21.63  ? 419 ASP D N   1 
ATOM   8097 C CA  . ASP D 1 220 ? 16.425  66.729 39.280 1.00 18.96  ? 419 ASP D CA  1 
ATOM   8098 C C   . ASP D 1 220 ? 17.531  66.953 40.294 1.00 17.99  ? 419 ASP D C   1 
ATOM   8099 O O   . ASP D 1 220 ? 17.661  66.174 41.236 1.00 18.00  ? 419 ASP D O   1 
ATOM   8100 C CB  . ASP D 1 220 ? 15.318  65.884 39.925 1.00 16.58  ? 419 ASP D CB  1 
ATOM   8101 C CG  . ASP D 1 220 ? 14.218  66.729 40.549 1.00 15.14  ? 419 ASP D CG  1 
ATOM   8102 O OD1 . ASP D 1 220 ? 14.455  67.928 40.821 1.00 16.34  ? 419 ASP D OD1 1 
ATOM   8103 O OD2 . ASP D 1 220 ? 13.115  66.186 40.773 1.00 11.98  ? 419 ASP D OD2 1 
ATOM   8104 N N   . ILE D 1 221 ? 18.346  67.987 40.102 1.00 16.39  ? 420 ILE D N   1 
ATOM   8105 C CA  . ILE D 1 221 ? 19.458  68.189 41.021 1.00 14.34  ? 420 ILE D CA  1 
ATOM   8106 C C   . ILE D 1 221 ? 19.115  68.835 42.351 1.00 13.35  ? 420 ILE D C   1 
ATOM   8107 O O   . ILE D 1 221 ? 19.805  68.603 43.336 1.00 14.77  ? 420 ILE D O   1 
ATOM   8108 C CB  . ILE D 1 221 ? 20.645  68.951 40.348 1.00 13.60  ? 420 ILE D CB  1 
ATOM   8109 C CG1 . ILE D 1 221 ? 20.718  70.386 40.848 1.00 13.43  ? 420 ILE D CG1 1 
ATOM   8110 C CG2 . ILE D 1 221 ? 20.508  68.903 38.831 1.00 10.70  ? 420 ILE D CG2 1 
ATOM   8111 C CD1 . ILE D 1 221 ? 19.790  71.307 40.146 1.00 17.02  ? 420 ILE D CD1 1 
ATOM   8112 N N   . PHE D 1 222 ? 18.056  69.633 42.397 1.00 12.09  ? 421 PHE D N   1 
ATOM   8113 C CA  . PHE D 1 222 ? 17.673  70.265 43.653 1.00 11.09  ? 421 PHE D CA  1 
ATOM   8114 C C   . PHE D 1 222 ? 16.563  69.447 44.291 1.00 11.15  ? 421 PHE D C   1 
ATOM   8115 O O   . PHE D 1 222 ? 15.591  69.996 44.807 1.00 13.04  ? 421 PHE D O   1 
ATOM   8116 C CB  . PHE D 1 222 ? 17.206  71.713 43.418 1.00 9.32   ? 421 PHE D CB  1 
ATOM   8117 C CG  . PHE D 1 222 ? 18.289  72.622 42.896 1.00 7.29   ? 421 PHE D CG  1 
ATOM   8118 C CD1 . PHE D 1 222 ? 18.085  73.388 41.750 1.00 6.55   ? 421 PHE D CD1 1 
ATOM   8119 C CD2 . PHE D 1 222 ? 19.530  72.676 43.519 1.00 6.55   ? 421 PHE D CD2 1 
ATOM   8120 C CE1 . PHE D 1 222 ? 19.106  74.182 41.231 1.00 6.55   ? 421 PHE D CE1 1 
ATOM   8121 C CE2 . PHE D 1 222 ? 20.552  73.470 43.004 1.00 6.55   ? 421 PHE D CE2 1 
ATOM   8122 C CZ  . PHE D 1 222 ? 20.340  74.220 41.860 1.00 6.55   ? 421 PHE D CZ  1 
ATOM   8123 N N   . LEU D 1 223 ? 16.708  68.127 44.248 1.00 9.63   ? 422 LEU D N   1 
ATOM   8124 C CA  . LEU D 1 223 ? 15.705  67.242 44.826 1.00 8.50   ? 422 LEU D CA  1 
ATOM   8125 C C   . LEU D 1 223 ? 15.874  67.200 46.336 1.00 9.38   ? 422 LEU D C   1 
ATOM   8126 O O   . LEU D 1 223 ? 14.899  67.325 47.082 1.00 10.38  ? 422 LEU D O   1 
ATOM   8127 C CB  . LEU D 1 223 ? 15.826  65.826 44.247 1.00 7.23   ? 422 LEU D CB  1 
ATOM   8128 C CG  . LEU D 1 223 ? 14.889  64.734 44.772 1.00 6.55   ? 422 LEU D CG  1 
ATOM   8129 C CD1 . LEU D 1 223 ? 13.446  65.173 44.650 1.00 6.55   ? 422 LEU D CD1 1 
ATOM   8130 C CD2 . LEU D 1 223 ? 15.120  63.469 44.005 1.00 6.55   ? 422 LEU D CD2 1 
ATOM   8131 N N   . PHE D 1 224 ? 17.111  67.034 46.793 1.00 8.53   ? 423 PHE D N   1 
ATOM   8132 C CA  . PHE D 1 224 ? 17.353  66.985 48.225 1.00 7.85   ? 423 PHE D CA  1 
ATOM   8133 C C   . PHE D 1 224 ? 16.747  68.197 48.941 1.00 7.42   ? 423 PHE D C   1 
ATOM   8134 O O   . PHE D 1 224 ? 16.060  68.049 49.953 1.00 7.23   ? 423 PHE D O   1 
ATOM   8135 C CB  . PHE D 1 224 ? 18.846  66.914 48.520 1.00 8.21   ? 423 PHE D CB  1 
ATOM   8136 C CG  . PHE D 1 224 ? 19.153  66.873 49.975 1.00 9.48   ? 423 PHE D CG  1 
ATOM   8137 C CD1 . PHE D 1 224 ? 18.614  65.878 50.772 1.00 10.04  ? 423 PHE D CD1 1 
ATOM   8138 C CD2 . PHE D 1 224 ? 19.946  67.846 50.562 1.00 10.83  ? 423 PHE D CD2 1 
ATOM   8139 C CE1 . PHE D 1 224 ? 18.856  65.849 52.140 1.00 11.37  ? 423 PHE D CE1 1 
ATOM   8140 C CE2 . PHE D 1 224 ? 20.194  67.825 51.932 1.00 12.38  ? 423 PHE D CE2 1 
ATOM   8141 C CZ  . PHE D 1 224 ? 19.646  66.822 52.723 1.00 11.61  ? 423 PHE D CZ  1 
ATOM   8142 N N   . PRO D 1 225 ? 17.005  69.415 48.433 1.00 6.55   ? 424 PRO D N   1 
ATOM   8143 C CA  . PRO D 1 225 ? 16.432  70.578 49.101 1.00 6.55   ? 424 PRO D CA  1 
ATOM   8144 C C   . PRO D 1 225 ? 14.926  70.598 48.965 1.00 6.55   ? 424 PRO D C   1 
ATOM   8145 O O   . PRO D 1 225 ? 14.243  71.256 49.734 1.00 6.55   ? 424 PRO D O   1 
ATOM   8146 C CB  . PRO D 1 225 ? 17.099  71.743 48.387 1.00 6.55   ? 424 PRO D CB  1 
ATOM   8147 C CG  . PRO D 1 225 ? 18.429  71.180 48.009 1.00 6.55   ? 424 PRO D CG  1 
ATOM   8148 C CD  . PRO D 1 225 ? 18.038  69.835 47.471 1.00 6.55   ? 424 PRO D CD  1 
ATOM   8149 N N   . LYS D 1 226 ? 14.403  69.877 47.987 1.00 6.55   ? 425 LYS D N   1 
ATOM   8150 C CA  . LYS D 1 226 ? 12.963  69.833 47.803 1.00 6.55   ? 425 LYS D CA  1 
ATOM   8151 C C   . LYS D 1 226 ? 12.323  68.938 48.852 1.00 8.88   ? 425 LYS D C   1 
ATOM   8152 O O   . LYS D 1 226 ? 11.182  69.163 49.272 1.00 9.85   ? 425 LYS D O   1 
ATOM   8153 C CB  . LYS D 1 226 ? 12.612  69.303 46.422 1.00 7.30   ? 425 LYS D CB  1 
ATOM   8154 C CG  . LYS D 1 226 ? 12.651  70.325 45.305 1.00 7.74   ? 425 LYS D CG  1 
ATOM   8155 C CD  . LYS D 1 226 ? 12.296  69.639 44.001 1.00 7.50   ? 425 LYS D CD  1 
ATOM   8156 C CE  . LYS D 1 226 ? 12.275  70.592 42.827 1.00 7.49   ? 425 LYS D CE  1 
ATOM   8157 N NZ  . LYS D 1 226 ? 12.335  69.835 41.544 1.00 9.60   ? 425 LYS D NZ  1 
ATOM   8158 N N   . LEU D 1 227 ? 13.054  67.906 49.263 1.00 10.04  ? 426 LEU D N   1 
ATOM   8159 C CA  . LEU D 1 227 ? 12.553  66.983 50.278 1.00 10.52  ? 426 LEU D CA  1 
ATOM   8160 C C   . LEU D 1 227 ? 12.570  67.631 51.662 1.00 10.60  ? 426 LEU D C   1 
ATOM   8161 O O   . LEU D 1 227 ? 11.620  67.488 52.431 1.00 11.12  ? 426 LEU D O   1 
ATOM   8162 C CB  . LEU D 1 227 ? 13.378  65.692 50.284 1.00 8.90   ? 426 LEU D CB  1 
ATOM   8163 C CG  . LEU D 1 227 ? 12.915  64.611 49.308 1.00 7.48   ? 426 LEU D CG  1 
ATOM   8164 C CD1 . LEU D 1 227 ? 13.913  63.476 49.285 1.00 6.55   ? 426 LEU D CD1 1 
ATOM   8165 C CD2 . LEU D 1 227 ? 11.542  64.115 49.728 1.00 7.22   ? 426 LEU D CD2 1 
ATOM   8166 N N   . LEU D 1 228 ? 13.645  68.342 51.984 1.00 9.96   ? 427 LEU D N   1 
ATOM   8167 C CA  . LEU D 1 228 ? 13.707  69.002 53.275 1.00 8.98   ? 427 LEU D CA  1 
ATOM   8168 C C   . LEU D 1 228 ? 12.463  69.868 53.356 1.00 9.22   ? 427 LEU D C   1 
ATOM   8169 O O   . LEU D 1 228 ? 11.814  69.944 54.395 1.00 11.32  ? 427 LEU D O   1 
ATOM   8170 C CB  . LEU D 1 228 ? 14.958  69.871 53.383 1.00 6.92   ? 427 LEU D CB  1 
ATOM   8171 C CG  . LEU D 1 228 ? 16.246  69.117 53.081 1.00 6.55   ? 427 LEU D CG  1 
ATOM   8172 C CD1 . LEU D 1 228 ? 17.421  70.048 53.220 1.00 6.55   ? 427 LEU D CD1 1 
ATOM   8173 C CD2 . LEU D 1 228 ? 16.380  67.942 54.028 1.00 6.60   ? 427 LEU D CD2 1 
ATOM   8174 N N   . GLN D 1 229 ? 12.109  70.498 52.246 1.00 7.67   ? 428 GLN D N   1 
ATOM   8175 C CA  . GLN D 1 229 ? 10.941  71.346 52.250 1.00 9.18   ? 428 GLN D CA  1 
ATOM   8176 C C   . GLN D 1 229 ? 9.708   70.530 52.535 1.00 8.79   ? 428 GLN D C   1 
ATOM   8177 O O   . GLN D 1 229 ? 8.704   71.057 52.987 1.00 8.05   ? 428 GLN D O   1 
ATOM   8178 C CB  . GLN D 1 229 ? 10.784  72.052 50.912 1.00 13.70  ? 428 GLN D CB  1 
ATOM   8179 C CG  . GLN D 1 229 ? 9.638   73.049 50.890 1.00 19.82  ? 428 GLN D CG  1 
ATOM   8180 C CD  . GLN D 1 229 ? 9.705   74.024 52.050 1.00 24.31  ? 428 GLN D CD  1 
ATOM   8181 O OE1 . GLN D 1 229 ? 10.727  74.691 52.255 1.00 28.46  ? 428 GLN D OE1 1 
ATOM   8182 N NE2 . GLN D 1 229 ? 8.618   74.114 52.819 1.00 24.53  ? 428 GLN D NE2 1 
ATOM   8183 N N   . LYS D 1 230 ? 9.795   69.233 52.272 1.00 10.06  ? 429 LYS D N   1 
ATOM   8184 C CA  . LYS D 1 230 ? 8.670   68.326 52.481 1.00 11.75  ? 429 LYS D CA  1 
ATOM   8185 C C   . LYS D 1 230 ? 8.534   67.895 53.931 1.00 13.05  ? 429 LYS D C   1 
ATOM   8186 O O   . LYS D 1 230 ? 7.419   67.771 54.434 1.00 13.23  ? 429 LYS D O   1 
ATOM   8187 C CB  . LYS D 1 230 ? 8.819   67.090 51.589 1.00 10.69  ? 429 LYS D CB  1 
ATOM   8188 C CG  . LYS D 1 230 ? 8.783   67.398 50.108 1.00 7.62   ? 429 LYS D CG  1 
ATOM   8189 C CD  . LYS D 1 230 ? 7.394   67.856 49.707 1.00 8.33   ? 429 LYS D CD  1 
ATOM   8190 C CE  . LYS D 1 230 ? 7.353   68.310 48.258 1.00 8.86   ? 429 LYS D CE  1 
ATOM   8191 N NZ  . LYS D 1 230 ? 5.960   68.638 47.865 1.00 7.37   ? 429 LYS D NZ  1 
ATOM   8192 N N   . MET D 1 231 ? 9.665   67.642 54.590 1.00 14.53  ? 430 MET D N   1 
ATOM   8193 C CA  . MET D 1 231 ? 9.658   67.243 55.995 1.00 16.10  ? 430 MET D CA  1 
ATOM   8194 C C   . MET D 1 231 ? 8.942   68.342 56.761 1.00 16.37  ? 430 MET D C   1 
ATOM   8195 O O   . MET D 1 231 ? 8.227   68.076 57.719 1.00 18.50  ? 430 MET D O   1 
ATOM   8196 C CB  . MET D 1 231 ? 11.087  67.104 56.530 1.00 17.85  ? 430 MET D CB  1 
ATOM   8197 C CG  . MET D 1 231 ? 11.663  65.698 56.471 1.00 22.74  ? 430 MET D CG  1 
ATOM   8198 S SD  . MET D 1 231 ? 13.393  65.630 55.944 1.00 29.30  ? 430 MET D SD  1 
ATOM   8199 C CE  . MET D 1 231 ? 14.273  65.253 57.457 1.00 27.01  ? 430 MET D CE  1 
ATOM   8200 N N   . ALA D 1 232 ? 9.133   69.579 56.310 1.00 15.70  ? 431 ALA D N   1 
ATOM   8201 C CA  . ALA D 1 232 ? 8.531   70.749 56.934 1.00 14.82  ? 431 ALA D CA  1 
ATOM   8202 C C   . ALA D 1 232 ? 7.035   70.798 56.743 1.00 15.30  ? 431 ALA D C   1 
ATOM   8203 O O   . ALA D 1 232 ? 6.304   71.138 57.666 1.00 15.11  ? 431 ALA D O   1 
ATOM   8204 C CB  . ALA D 1 232 ? 9.145   71.998 56.368 1.00 15.48  ? 431 ALA D CB  1 
ATOM   8205 N N   . ASP D 1 233 ? 6.589   70.477 55.532 1.00 17.16  ? 432 ASP D N   1 
ATOM   8206 C CA  . ASP D 1 233 ? 5.165   70.477 55.196 1.00 17.81  ? 432 ASP D CA  1 
ATOM   8207 C C   . ASP D 1 233 ? 4.470   69.332 55.909 1.00 15.55  ? 432 ASP D C   1 
ATOM   8208 O O   . ASP D 1 233 ? 3.327   69.456 56.355 1.00 13.49  ? 432 ASP D O   1 
ATOM   8209 C CB  . ASP D 1 233 ? 4.957   70.319 53.684 1.00 22.50  ? 432 ASP D CB  1 
ATOM   8210 C CG  . ASP D 1 233 ? 5.642   71.408 52.876 1.00 28.01  ? 432 ASP D CG  1 
ATOM   8211 O OD1 . ASP D 1 233 ? 5.680   72.573 53.342 1.00 30.75  ? 432 ASP D OD1 1 
ATOM   8212 O OD2 . ASP D 1 233 ? 6.128   71.098 51.763 1.00 30.09  ? 432 ASP D OD2 1 
ATOM   8213 N N   . LEU D 1 234 ? 5.168   68.206 55.987 1.00 14.15  ? 433 LEU D N   1 
ATOM   8214 C CA  . LEU D 1 234 ? 4.638   67.031 56.652 1.00 13.17  ? 433 LEU D CA  1 
ATOM   8215 C C   . LEU D 1 234 ? 4.336   67.435 58.070 1.00 13.02  ? 433 LEU D C   1 
ATOM   8216 O O   . LEU D 1 234 ? 3.223   67.254 58.565 1.00 13.13  ? 433 LEU D O   1 
ATOM   8217 C CB  . LEU D 1 234 ? 5.669   65.907 56.635 1.00 11.14  ? 433 LEU D CB  1 
ATOM   8218 C CG  . LEU D 1 234 ? 5.441   64.925 55.495 1.00 9.15   ? 433 LEU D CG  1 
ATOM   8219 C CD1 . LEU D 1 234 ? 6.622   64.014 55.380 1.00 11.87  ? 433 LEU D CD1 1 
ATOM   8220 C CD2 . LEU D 1 234 ? 4.180   64.131 55.754 1.00 6.91   ? 433 LEU D CD2 1 
ATOM   8221 N N   . ARG D 1 235 ? 5.347   68.008 58.706 1.00 12.80  ? 434 ARG D N   1 
ATOM   8222 C CA  . ARG D 1 235 ? 5.252   68.474 60.072 1.00 12.57  ? 434 ARG D CA  1 
ATOM   8223 C C   . ARG D 1 235 ? 4.006   69.354 60.214 1.00 13.11  ? 434 ARG D C   1 
ATOM   8224 O O   . ARG D 1 235 ? 3.320   69.324 61.237 1.00 12.57  ? 434 ARG D O   1 
ATOM   8225 C CB  . ARG D 1 235 ? 6.525   69.244 60.408 1.00 11.36  ? 434 ARG D CB  1 
ATOM   8226 C CG  . ARG D 1 235 ? 6.921   69.144 61.862 1.00 15.27  ? 434 ARG D CG  1 
ATOM   8227 C CD  . ARG D 1 235 ? 8.377   69.508 62.095 1.00 17.93  ? 434 ARG D CD  1 
ATOM   8228 N NE  . ARG D 1 235 ? 9.269   68.388 61.815 1.00 20.87  ? 434 ARG D NE  1 
ATOM   8229 C CZ  . ARG D 1 235 ? 10.353  68.099 62.530 1.00 21.88  ? 434 ARG D CZ  1 
ATOM   8230 N NH1 . ARG D 1 235 ? 10.680  68.853 63.577 1.00 20.06  ? 434 ARG D NH1 1 
ATOM   8231 N NH2 . ARG D 1 235 ? 11.105  67.053 62.196 1.00 22.57  ? 434 ARG D NH2 1 
ATOM   8232 N N   . GLN D 1 236 ? 3.712   70.117 59.163 1.00 14.68  ? 435 GLN D N   1 
ATOM   8233 C CA  . GLN D 1 236 ? 2.552   71.007 59.121 1.00 15.10  ? 435 GLN D CA  1 
ATOM   8234 C C   . GLN D 1 236 ? 1.268   70.201 59.023 1.00 14.37  ? 435 GLN D C   1 
ATOM   8235 O O   . GLN D 1 236 ? 0.329   70.411 59.790 1.00 13.57  ? 435 GLN D O   1 
ATOM   8236 C CB  . GLN D 1 236 ? 2.652   71.934 57.908 1.00 18.95  ? 435 GLN D CB  1 
ATOM   8237 C CG  . GLN D 1 236 ? 1.502   72.921 57.739 1.00 24.99  ? 435 GLN D CG  1 
ATOM   8238 C CD  . GLN D 1 236 ? 1.381   73.922 58.892 1.00 28.37  ? 435 GLN D CD  1 
ATOM   8239 O OE1 . GLN D 1 236 ? 2.338   74.148 59.649 1.00 30.78  ? 435 GLN D OE1 1 
ATOM   8240 N NE2 . GLN D 1 236 ? 0.204   74.538 59.018 1.00 27.98  ? 435 GLN D NE2 1 
ATOM   8241 N N   . LEU D 1 237 ? 1.241   69.277 58.069 1.00 13.30  ? 436 LEU D N   1 
ATOM   8242 C CA  . LEU D 1 237 ? 0.087   68.426 57.841 1.00 11.83  ? 436 LEU D CA  1 
ATOM   8243 C C   . LEU D 1 237 ? -0.385  67.719 59.118 1.00 12.38  ? 436 LEU D C   1 
ATOM   8244 O O   . LEU D 1 237 ? -1.586  67.565 59.345 1.00 11.54  ? 436 LEU D O   1 
ATOM   8245 C CB  . LEU D 1 237 ? 0.425   67.407 56.755 1.00 9.28   ? 436 LEU D CB  1 
ATOM   8246 C CG  . LEU D 1 237 ? -0.769  66.693 56.128 1.00 9.03   ? 436 LEU D CG  1 
ATOM   8247 C CD1 . LEU D 1 237 ? -1.828  67.681 55.669 1.00 9.55   ? 436 LEU D CD1 1 
ATOM   8248 C CD2 . LEU D 1 237 ? -0.279  65.893 54.973 1.00 8.64   ? 436 LEU D CD2 1 
ATOM   8249 N N   . VAL D 1 238 ? 0.557   67.296 59.954 1.00 13.41  ? 437 VAL D N   1 
ATOM   8250 C CA  . VAL D 1 238 ? 0.219   66.616 61.202 1.00 15.20  ? 437 VAL D CA  1 
ATOM   8251 C C   . VAL D 1 238 ? -0.358  67.607 62.203 1.00 18.11  ? 437 VAL D C   1 
ATOM   8252 O O   . VAL D 1 238 ? -1.271  67.293 62.971 1.00 17.87  ? 437 VAL D O   1 
ATOM   8253 C CB  . VAL D 1 238 ? 1.447   65.988 61.836 1.00 14.57  ? 437 VAL D CB  1 
ATOM   8254 C CG1 . VAL D 1 238 ? 1.040   65.206 63.062 1.00 13.37  ? 437 VAL D CG1 1 
ATOM   8255 C CG2 . VAL D 1 238 ? 2.148   65.111 60.829 1.00 15.11  ? 437 VAL D CG2 1 
ATOM   8256 N N   . THR D 1 239 ? 0.206   68.807 62.206 1.00 20.57  ? 438 THR D N   1 
ATOM   8257 C CA  . THR D 1 239 ? -0.267  69.854 63.093 1.00 22.14  ? 438 THR D CA  1 
ATOM   8258 C C   . THR D 1 239 ? -1.752  70.050 62.797 1.00 21.59  ? 438 THR D C   1 
ATOM   8259 O O   . THR D 1 239 ? -2.598  69.889 63.667 1.00 22.28  ? 438 THR D O   1 
ATOM   8260 C CB  . THR D 1 239 ? 0.521   71.178 62.856 1.00 22.93  ? 438 THR D CB  1 
ATOM   8261 O OG1 . THR D 1 239 ? 1.744   71.154 63.611 1.00 21.12  ? 438 THR D OG1 1 
ATOM   8262 C CG2 . THR D 1 239 ? -0.310  72.388 63.255 1.00 23.71  ? 438 THR D CG2 1 
ATOM   8263 N N   . GLU D 1 240 ? -2.066  70.365 61.553 1.00 20.57  ? 439 GLU D N   1 
ATOM   8264 C CA  . GLU D 1 240 ? -3.446  70.574 61.173 1.00 22.05  ? 439 GLU D CA  1 
ATOM   8265 C C   . GLU D 1 240 ? -4.276  69.301 61.321 1.00 22.12  ? 439 GLU D C   1 
ATOM   8266 O O   . GLU D 1 240 ? -5.498  69.364 61.420 1.00 21.09  ? 439 GLU D O   1 
ATOM   8267 C CB  . GLU D 1 240 ? -3.504  71.068 59.732 1.00 23.99  ? 439 GLU D CB  1 
ATOM   8268 C CG  . GLU D 1 240 ? -2.390  72.046 59.397 1.00 28.16  ? 439 GLU D CG  1 
ATOM   8269 C CD  . GLU D 1 240 ? -2.340  72.399 57.923 1.00 30.73  ? 439 GLU D CD  1 
ATOM   8270 O OE1 . GLU D 1 240 ? -2.620  71.510 57.086 1.00 32.76  ? 439 GLU D OE1 1 
ATOM   8271 O OE2 . GLU D 1 240 ? -2.003  73.558 57.601 1.00 31.43  ? 439 GLU D OE2 1 
ATOM   8272 N N   . HIS D 1 241 ? -3.624  68.144 61.329 1.00 22.95  ? 440 HIS D N   1 
ATOM   8273 C CA  . HIS D 1 241 ? -4.371  66.902 61.459 1.00 24.78  ? 440 HIS D CA  1 
ATOM   8274 C C   . HIS D 1 241 ? -4.957  66.792 62.850 1.00 27.80  ? 440 HIS D C   1 
ATOM   8275 O O   . HIS D 1 241 ? -6.156  66.602 62.999 1.00 30.37  ? 440 HIS D O   1 
ATOM   8276 C CB  . HIS D 1 241 ? -3.496  65.673 61.188 1.00 22.76  ? 440 HIS D CB  1 
ATOM   8277 C CG  . HIS D 1 241 ? -4.221  64.366 61.356 1.00 19.96  ? 440 HIS D CG  1 
ATOM   8278 N ND1 . HIS D 1 241 ? -5.255  63.972 60.532 1.00 16.57  ? 440 HIS D ND1 1 
ATOM   8279 C CD2 . HIS D 1 241 ? -4.070  63.374 62.267 1.00 18.91  ? 440 HIS D CD2 1 
ATOM   8280 C CE1 . HIS D 1 241 ? -5.709  62.797 60.928 1.00 16.54  ? 440 HIS D CE1 1 
ATOM   8281 N NE2 . HIS D 1 241 ? -5.008  62.412 61.979 1.00 18.11  ? 440 HIS D NE2 1 
ATOM   8282 N N   . ALA D 1 242 ? -4.118  66.904 63.874 1.00 29.95  ? 441 ALA D N   1 
ATOM   8283 C CA  . ALA D 1 242 ? -4.603  66.804 65.249 1.00 31.96  ? 441 ALA D CA  1 
ATOM   8284 C C   . ALA D 1 242 ? -5.711  67.830 65.491 1.00 33.35  ? 441 ALA D C   1 
ATOM   8285 O O   . ALA D 1 242 ? -6.688  67.568 66.192 1.00 32.17  ? 441 ALA D O   1 
ATOM   8286 C CB  . ALA D 1 242 ? -3.450  67.027 66.224 1.00 32.56  ? 441 ALA D CB  1 
ATOM   8287 N N   . GLN D 1 243 ? -5.543  69.000 64.888 1.00 35.93  ? 442 GLN D N   1 
ATOM   8288 C CA  . GLN D 1 243 ? -6.493  70.093 64.996 1.00 38.81  ? 442 GLN D CA  1 
ATOM   8289 C C   . GLN D 1 243 ? -7.860  69.641 64.481 1.00 40.99  ? 442 GLN D C   1 
ATOM   8290 O O   . GLN D 1 243 ? -8.900  69.989 65.033 1.00 41.06  ? 442 GLN D O   1 
ATOM   8291 C CB  . GLN D 1 243 ? -5.980  71.271 64.166 1.00 39.18  ? 442 GLN D CB  1 
ATOM   8292 C CG  . GLN D 1 243 ? -5.943  72.610 64.882 1.00 40.70  ? 442 GLN D CG  1 
ATOM   8293 C CD  . GLN D 1 243 ? -5.042  73.613 64.179 1.00 41.25  ? 442 GLN D CD  1 
ATOM   8294 O OE1 . GLN D 1 243 ? -3.904  73.837 64.589 1.00 42.53  ? 442 GLN D OE1 1 
ATOM   8295 N NE2 . GLN D 1 243 ? -5.545  74.208 63.106 1.00 40.92  ? 442 GLN D NE2 1 
ATOM   8296 N N   . LEU D 1 244 ? -7.846  68.853 63.416 1.00 44.86  ? 443 LEU D N   1 
ATOM   8297 C CA  . LEU D 1 244 ? -9.076  68.355 62.811 1.00 48.24  ? 443 LEU D CA  1 
ATOM   8298 C C   . LEU D 1 244 ? -9.690  67.256 63.669 1.00 50.67  ? 443 LEU D C   1 
ATOM   8299 O O   . LEU D 1 244 ? -10.903 67.105 63.712 1.00 51.56  ? 443 LEU D O   1 
ATOM   8300 C CB  . LEU D 1 244 ? -8.786  67.807 61.407 1.00 47.25  ? 443 LEU D CB  1 
ATOM   8301 C CG  . LEU D 1 244 ? -9.903  67.685 60.364 1.00 47.06  ? 443 LEU D CG  1 
ATOM   8302 C CD1 . LEU D 1 244 ? -11.269 67.622 61.040 1.00 46.84  ? 443 LEU D CD1 1 
ATOM   8303 C CD2 . LEU D 1 244 ? -9.833  68.877 59.418 1.00 46.21  ? 443 LEU D CD2 1 
ATOM   8304 N N   . VAL D 1 245 ? -8.848  66.486 64.350 1.00 54.18  ? 444 VAL D N   1 
ATOM   8305 C CA  . VAL D 1 245 ? -9.327  65.400 65.196 1.00 58.33  ? 444 VAL D CA  1 
ATOM   8306 C C   . VAL D 1 245 ? -10.055 65.921 66.435 1.00 62.01  ? 444 VAL D C   1 
ATOM   8307 O O   . VAL D 1 245 ? -11.109 65.394 66.795 1.00 63.20  ? 444 VAL D O   1 
ATOM   8308 C CB  . VAL D 1 245 ? -8.157  64.464 65.623 1.00 57.69  ? 444 VAL D CB  1 
ATOM   8309 C CG1 . VAL D 1 245 ? -8.569  63.599 66.808 1.00 56.76  ? 444 VAL D CG1 1 
ATOM   8310 C CG2 . VAL D 1 245 ? -7.759  63.575 64.455 1.00 55.97  ? 444 VAL D CG2 1 
ATOM   8311 N N   . GLN D 1 246 ? -9.498  66.951 67.076 1.00 65.59  ? 445 GLN D N   1 
ATOM   8312 C CA  . GLN D 1 246 ? -10.091 67.559 68.277 1.00 68.29  ? 445 GLN D CA  1 
ATOM   8313 C C   . GLN D 1 246 ? -11.442 68.171 67.901 1.00 69.71  ? 445 GLN D C   1 
ATOM   8314 O O   . GLN D 1 246 ? -11.719 69.337 68.188 1.00 68.94  ? 445 GLN D O   1 
ATOM   8315 C CB  . GLN D 1 246 ? -9.169  68.658 68.815 1.00 69.09  ? 445 GLN D CB  1 
ATOM   8316 C CG  . GLN D 1 246 ? -9.250  68.902 70.313 1.00 70.46  ? 445 GLN D CG  1 
ATOM   8317 C CD  . GLN D 1 246 ? -8.472  67.873 71.111 1.00 71.66  ? 445 GLN D CD  1 
ATOM   8318 O OE1 . GLN D 1 246 ? -7.709  68.220 72.018 1.00 71.98  ? 445 GLN D OE1 1 
ATOM   8319 N NE2 . GLN D 1 246 ? -8.660  66.598 70.780 1.00 72.16  ? 445 GLN D NE2 1 
ATOM   8320 N N   . ILE D 1 247 ? -12.272 67.358 67.256 1.00 71.83  ? 446 ILE D N   1 
ATOM   8321 C CA  . ILE D 1 247 ? -13.588 67.752 66.782 1.00 73.88  ? 446 ILE D CA  1 
ATOM   8322 C C   . ILE D 1 247 ? -14.415 66.474 66.606 1.00 76.79  ? 446 ILE D C   1 
ATOM   8323 O O   . ILE D 1 247 ? -15.596 66.524 66.263 1.00 77.11  ? 446 ILE D O   1 
ATOM   8324 C CB  . ILE D 1 247 ? -13.457 68.499 65.422 1.00 72.34  ? 446 ILE D CB  1 
ATOM   8325 C CG1 . ILE D 1 247 ? -12.757 69.847 65.635 1.00 70.84  ? 446 ILE D CG1 1 
ATOM   8326 C CG2 . ILE D 1 247 ? -14.818 68.687 64.781 1.00 72.03  ? 446 ILE D CG2 1 
ATOM   8327 C CD1 . ILE D 1 247 ? -12.400 70.575 64.361 1.00 69.11  ? 446 ILE D CD1 1 
ATOM   8328 N N   . ILE D 1 248 ? -13.783 65.329 66.858 1.00 80.56  ? 447 ILE D N   1 
ATOM   8329 C CA  . ILE D 1 248 ? -14.439 64.029 66.720 1.00 85.04  ? 447 ILE D CA  1 
ATOM   8330 C C   . ILE D 1 248 ? -14.319 63.171 67.992 1.00 89.09  ? 447 ILE D C   1 
ATOM   8331 O O   . ILE D 1 248 ? -14.870 62.068 68.060 1.00 89.54  ? 447 ILE D O   1 
ATOM   8332 C CB  . ILE D 1 248 ? -13.849 63.228 65.517 1.00 83.73  ? 447 ILE D CB  1 
ATOM   8333 C CG1 . ILE D 1 248 ? -13.931 64.053 64.236 1.00 83.27  ? 447 ILE D CG1 1 
ATOM   8334 C CG2 . ILE D 1 248 ? -14.638 61.955 65.285 1.00 84.05  ? 447 ILE D CG2 1 
ATOM   8335 C CD1 . ILE D 1 248 ? -12.967 65.200 64.183 1.00 83.94  ? 447 ILE D CD1 1 
ATOM   8336 N N   . LYS D 1 249 ? -13.605 63.674 68.998 1.00 93.70  ? 448 LYS D N   1 
ATOM   8337 C CA  . LYS D 1 249 ? -13.431 62.934 70.253 1.00 98.05  ? 448 LYS D CA  1 
ATOM   8338 C C   . LYS D 1 249 ? -14.482 63.281 71.313 1.00 100.90 ? 448 LYS D C   1 
ATOM   8339 O O   . LYS D 1 249 ? -15.174 62.393 71.823 1.00 100.86 ? 448 LYS D O   1 
ATOM   8340 C CB  . LYS D 1 249 ? -12.040 63.183 70.850 1.00 98.08  ? 448 LYS D CB  1 
ATOM   8341 C CG  . LYS D 1 249 ? -11.861 62.534 72.218 1.00 98.52  ? 448 LYS D CG  1 
ATOM   8342 C CD  . LYS D 1 249 ? -10.872 63.289 73.090 1.00 97.62  ? 448 LYS D CD  1 
ATOM   8343 C CE  . LYS D 1 249 ? -10.974 62.846 74.542 1.00 97.37  ? 448 LYS D CE  1 
ATOM   8344 N NZ  . LYS D 1 249 ? -12.297 63.172 75.154 1.00 96.70  ? 448 LYS D NZ  1 
ATOM   8345 N N   . LYS D 1 250 ? -14.572 64.567 71.659 1.00 103.99 ? 449 LYS D N   1 
ATOM   8346 C CA  . LYS D 1 250 ? -15.531 65.038 72.660 1.00 106.71 ? 449 LYS D CA  1 
ATOM   8347 C C   . LYS D 1 250 ? -16.805 65.569 72.001 1.00 108.74 ? 449 LYS D C   1 
ATOM   8348 O O   . LYS D 1 250 ? -17.908 65.307 72.487 1.00 109.36 ? 449 LYS D O   1 
ATOM   8349 C CB  . LYS D 1 250 ? -14.906 66.122 73.551 1.00 106.32 ? 449 LYS D CB  1 
ATOM   8350 C CG  . LYS D 1 250 ? -13.681 65.667 74.332 1.00 105.95 ? 449 LYS D CG  1 
ATOM   8351 C CD  . LYS D 1 250 ? -13.220 66.735 75.312 1.00 105.17 ? 449 LYS D CD  1 
ATOM   8352 C CE  . LYS D 1 250 ? -11.839 66.434 75.875 1.00 104.89 ? 449 LYS D CE  1 
ATOM   8353 N NZ  . LYS D 1 250 ? -10.752 66.789 74.920 1.00 104.77 ? 449 LYS D NZ  1 
ATOM   8354 N N   . THR D 1 251 ? -16.659 66.326 70.912 1.00 110.61 ? 450 THR D N   1 
ATOM   8355 C CA  . THR D 1 251 ? -17.830 66.833 70.196 1.00 112.39 ? 450 THR D CA  1 
ATOM   8356 C C   . THR D 1 251 ? -18.570 65.554 69.839 1.00 114.03 ? 450 THR D C   1 
ATOM   8357 O O   . THR D 1 251 ? -19.720 65.343 70.233 1.00 114.22 ? 450 THR D O   1 
ATOM   8358 C CB  . THR D 1 251 ? -17.440 67.567 68.892 1.00 112.04 ? 450 THR D CB  1 
ATOM   8359 O OG1 . THR D 1 251 ? -16.728 68.768 69.209 1.00 111.99 ? 450 THR D OG1 1 
ATOM   8360 C CG2 . THR D 1 251 ? -18.679 67.920 68.086 1.00 111.69 ? 450 THR D CG2 1 
ATOM   8361 N N   . GLU D 1 252 ? -17.874 64.698 69.098 1.00 115.73 ? 451 GLU D N   1 
ATOM   8362 C CA  . GLU D 1 252 ? -18.397 63.403 68.700 1.00 117.55 ? 451 GLU D CA  1 
ATOM   8363 C C   . GLU D 1 252 ? -17.811 62.405 69.693 1.00 119.51 ? 451 GLU D C   1 
ATOM   8364 O O   . GLU D 1 252 ? -16.934 61.612 69.348 1.00 119.80 ? 451 GLU D O   1 
ATOM   8365 C CB  . GLU D 1 252 ? -17.940 63.045 67.282 1.00 116.58 ? 451 GLU D CB  1 
ATOM   8366 C CG  . GLU D 1 252 ? -18.476 63.959 66.193 1.00 115.14 ? 451 GLU D CG  1 
ATOM   8367 C CD  . GLU D 1 252 ? -19.972 63.830 66.009 1.00 114.49 ? 451 GLU D CD  1 
ATOM   8368 O OE1 . GLU D 1 252 ? -20.438 62.729 65.646 1.00 114.12 ? 451 GLU D OE1 1 
ATOM   8369 O OE2 . GLU D 1 252 ? -20.682 64.831 66.230 1.00 114.34 ? 451 GLU D OE2 1 
ATOM   8370 N N   . SER D 1 253 ? -18.272 62.476 70.939 1.00 121.82 ? 452 SER D N   1 
ATOM   8371 C CA  . SER D 1 253 ? -17.793 61.563 71.968 1.00 124.21 ? 452 SER D CA  1 
ATOM   8372 C C   . SER D 1 253 ? -18.483 60.232 71.773 1.00 126.09 ? 452 SER D C   1 
ATOM   8373 O O   . SER D 1 253 ? -19.674 60.088 72.050 1.00 126.32 ? 452 SER D O   1 
ATOM   8374 C CB  . SER D 1 253 ? -18.096 62.095 73.371 1.00 124.05 ? 452 SER D CB  1 
ATOM   8375 O OG  . SER D 1 253 ? -17.213 63.138 73.736 1.00 123.41 ? 452 SER D OG  1 
ATOM   8376 N N   . ASP D 1 254 ? -17.731 59.263 71.273 1.00 128.13 ? 453 ASP D N   1 
ATOM   8377 C CA  . ASP D 1 254 ? -18.273 57.940 71.038 1.00 130.23 ? 453 ASP D CA  1 
ATOM   8378 C C   . ASP D 1 254 ? -17.094 56.980 70.981 1.00 131.85 ? 453 ASP D C   1 
ATOM   8379 O O   . ASP D 1 254 ? -16.761 56.316 71.964 1.00 131.64 ? 453 ASP D O   1 
ATOM   8380 C CB  . ASP D 1 254 ? -19.035 57.894 69.701 1.00 130.30 ? 453 ASP D CB  1 
ATOM   8381 C CG  . ASP D 1 254 ? -19.366 59.281 69.150 1.00 130.23 ? 453 ASP D CG  1 
ATOM   8382 O OD1 . ASP D 1 254 ? -20.472 59.801 69.420 1.00 129.25 ? 453 ASP D OD1 1 
ATOM   8383 O OD2 . ASP D 1 254 ? -18.509 59.855 68.444 1.00 130.24 ? 453 ASP D OD2 1 
ATOM   8384 N N   . ALA D 1 255 ? -16.451 56.941 69.820 1.00 134.17 ? 454 ALA D N   1 
ATOM   8385 C CA  . ALA D 1 255 ? -15.315 56.059 69.591 1.00 136.40 ? 454 ALA D CA  1 
ATOM   8386 C C   . ALA D 1 255 ? -13.978 56.792 69.669 1.00 137.89 ? 454 ALA D C   1 
ATOM   8387 O O   . ALA D 1 255 ? -13.854 57.924 69.195 1.00 138.25 ? 454 ALA D O   1 
ATOM   8388 C CB  . ALA D 1 255 ? -15.464 55.391 68.231 1.00 136.02 ? 454 ALA D CB  1 
ATOM   8389 N N   . ALA D 1 256 ? -12.973 56.143 70.256 1.00 139.45 ? 455 ALA D N   1 
ATOM   8390 C CA  . ALA D 1 256 ? -11.650 56.760 70.374 1.00 141.19 ? 455 ALA D CA  1 
ATOM   8391 C C   . ALA D 1 256 ? -10.632 55.866 71.074 1.00 142.54 ? 455 ALA D C   1 
ATOM   8392 O O   . ALA D 1 256 ? -9.977  55.013 70.465 1.00 142.11 ? 455 ALA D O   1 
ATOM   8393 C CB  . ALA D 1 256 ? -11.770 58.081 71.131 1.00 140.94 ? 455 ALA D CB  1 
ATOM   8394 N N   . LEU D 1 257 ? -10.489 56.145 72.365 1.00 144.58 ? 456 LEU D N   1 
ATOM   8395 C CA  . LEU D 1 257 ? -9.626  55.439 73.301 1.00 146.34 ? 456 LEU D CA  1 
ATOM   8396 C C   . LEU D 1 257 ? -10.595 55.351 74.469 1.00 147.55 ? 456 LEU D C   1 
ATOM   8397 O O   . LEU D 1 257 ? -10.594 56.192 75.368 1.00 147.82 ? 456 LEU D O   1 
ATOM   8398 C CB  . LEU D 1 257 ? -8.420  56.281 73.733 1.00 146.21 ? 456 LEU D CB  1 
ATOM   8399 C CG  . LEU D 1 257 ? -7.391  56.888 72.776 1.00 146.18 ? 456 LEU D CG  1 
ATOM   8400 C CD1 . LEU D 1 257 ? -7.397  56.162 71.440 1.00 146.04 ? 456 LEU D CD1 1 
ATOM   8401 C CD2 . LEU D 1 257 ? -7.697  58.366 72.597 1.00 145.69 ? 456 LEU D CD2 1 
ATOM   8402 N N   . HIS D 1 258 ? -11.448 54.344 74.404 1.00 148.72 ? 457 HIS D N   1 
ATOM   8403 C CA  . HIS D 1 258 ? -12.487 54.081 75.386 1.00 149.64 ? 457 HIS D CA  1 
ATOM   8404 C C   . HIS D 1 258 ? -11.898 53.092 76.399 1.00 150.50 ? 457 HIS D C   1 
ATOM   8405 O O   . HIS D 1 258 ? -10.731 52.730 76.295 1.00 151.01 ? 457 HIS D O   1 
ATOM   8406 C CB  . HIS D 1 258 ? -13.673 53.511 74.575 1.00 149.19 ? 457 HIS D CB  1 
ATOM   8407 C CG  . HIS D 1 258 ? -14.602 52.614 75.329 1.00 148.71 ? 457 HIS D CG  1 
ATOM   8408 N ND1 . HIS D 1 258 ? -15.809 53.043 75.835 1.00 148.59 ? 457 HIS D ND1 1 
ATOM   8409 C CD2 . HIS D 1 258 ? -14.550 51.285 75.573 1.00 148.55 ? 457 HIS D CD2 1 
ATOM   8410 C CE1 . HIS D 1 258 ? -16.459 52.016 76.352 1.00 148.49 ? 457 HIS D CE1 1 
ATOM   8411 N NE2 . HIS D 1 258 ? -15.715 50.935 76.205 1.00 148.38 ? 457 HIS D NE2 1 
ATOM   8412 N N   . PRO D 1 259 ? -12.634 52.775 77.473 1.00 151.03 ? 458 PRO D N   1 
ATOM   8413 C CA  . PRO D 1 259 ? -12.062 51.798 78.413 1.00 151.56 ? 458 PRO D CA  1 
ATOM   8414 C C   . PRO D 1 259 ? -12.219 50.422 77.738 1.00 152.19 ? 458 PRO D C   1 
ATOM   8415 O O   . PRO D 1 259 ? -12.484 49.408 78.392 1.00 152.47 ? 458 PRO D O   1 
ATOM   8416 C CB  . PRO D 1 259 ? -12.941 51.927 79.661 1.00 151.13 ? 458 PRO D CB  1 
ATOM   8417 C CG  . PRO D 1 259 ? -13.758 53.190 79.465 1.00 150.71 ? 458 PRO D CG  1 
ATOM   8418 C CD  . PRO D 1 259 ? -13.321 53.854 78.201 1.00 150.70 ? 458 PRO D CD  1 
ATOM   8419 N N   . LEU D 1 260 ? -12.061 50.421 76.413 1.00 152.48 ? 459 LEU D N   1 
ATOM   8420 C CA  . LEU D 1 260 ? -12.206 49.231 75.571 1.00 152.27 ? 459 LEU D CA  1 
ATOM   8421 C C   . LEU D 1 260 ? -10.882 48.587 75.299 1.00 152.13 ? 459 LEU D C   1 
ATOM   8422 O O   . LEU D 1 260 ? -10.772 47.384 75.068 1.00 152.29 ? 459 LEU D O   1 
ATOM   8423 C CB  . LEU D 1 260 ? -12.797 49.607 74.217 1.00 152.06 ? 459 LEU D CB  1 
ATOM   8424 C CG  . LEU D 1 260 ? -13.224 48.454 73.318 1.00 151.60 ? 459 LEU D CG  1 
ATOM   8425 C CD1 . LEU D 1 260 ? -13.224 47.126 74.069 1.00 151.46 ? 459 LEU D CD1 1 
ATOM   8426 C CD2 . LEU D 1 260 ? -14.610 48.769 72.817 1.00 151.18 ? 459 LEU D CD2 1 
ATOM   8427 N N   . LEU D 1 261 ? -9.871  49.424 75.290 1.00 151.70 ? 460 LEU D N   1 
ATOM   8428 C CA  . LEU D 1 261 ? -8.546  48.967 75.019 1.00 151.12 ? 460 LEU D CA  1 
ATOM   8429 C C   . LEU D 1 261 ? -8.020  48.376 76.331 1.00 151.11 ? 460 LEU D C   1 
ATOM   8430 O O   . LEU D 1 261 ? -6.840  48.469 76.659 1.00 151.19 ? 460 LEU D O   1 
ATOM   8431 C CB  . LEU D 1 261 ? -7.768  50.166 74.471 1.00 150.43 ? 460 LEU D CB  1 
ATOM   8432 C CG  . LEU D 1 261 ? -8.774  50.853 73.512 1.00 149.71 ? 460 LEU D CG  1 
ATOM   8433 C CD1 . LEU D 1 261 ? -9.491  51.954 74.249 1.00 149.58 ? 460 LEU D CD1 1 
ATOM   8434 C CD2 . LEU D 1 261 ? -8.108  51.431 72.292 1.00 149.26 ? 460 LEU D CD2 1 
ATOM   8435 N N   . GLN D 1 262 ? -8.944  47.756 77.069 1.00 150.94 ? 461 GLN D N   1 
ATOM   8436 C CA  . GLN D 1 262 ? -8.652  47.098 78.339 1.00 150.60 ? 461 GLN D CA  1 
ATOM   8437 C C   . GLN D 1 262 ? -8.841  45.597 78.123 1.00 149.91 ? 461 GLN D C   1 
ATOM   8438 O O   . GLN D 1 262 ? -7.895  44.868 77.848 1.00 149.35 ? 461 GLN D O   1 
ATOM   8439 C CB  . GLN D 1 262 ? -9.620  47.570 79.445 1.00 151.12 ? 461 GLN D CB  1 
ATOM   8440 C CG  . GLN D 1 262 ? -9.149  47.291 80.872 1.00 151.85 ? 461 GLN D CG  1 
ATOM   8441 C CD  . GLN D 1 262 ? -9.486  45.892 81.386 1.00 152.05 ? 461 GLN D CD  1 
ATOM   8442 O OE1 . GLN D 1 262 ? -10.554 45.669 81.963 1.00 152.26 ? 461 GLN D OE1 1 
ATOM   8443 N NE2 . GLN D 1 262 ? -8.572  44.947 81.179 1.00 152.00 ? 461 GLN D NE2 1 
ATOM   8444 N N   . GLU D 1 263 ? -10.101 45.181 78.205 1.00 149.58 ? 462 GLU D N   1 
ATOM   8445 C CA  . GLU D 1 263 ? -10.593 43.793 78.104 1.00 149.30 ? 462 GLU D CA  1 
ATOM   8446 C C   . GLU D 1 263 ? -10.456 42.819 76.931 1.00 149.60 ? 462 GLU D C   1 
ATOM   8447 O O   . GLU D 1 263 ? -11.411 42.089 76.645 1.00 149.76 ? 462 GLU D O   1 
ATOM   8448 C CB  . GLU D 1 263 ? -12.068 43.816 78.423 1.00 148.35 ? 462 GLU D CB  1 
ATOM   8449 C CG  . GLU D 1 263 ? -12.799 44.894 77.646 1.00 146.47 ? 462 GLU D CG  1 
ATOM   8450 C CD  . GLU D 1 263 ? -13.471 45.887 78.562 1.00 145.40 ? 462 GLU D CD  1 
ATOM   8451 O OE1 . GLU D 1 263 ? -12.792 46.447 79.449 1.00 144.71 ? 462 GLU D OE1 1 
ATOM   8452 O OE2 . GLU D 1 263 ? -14.685 46.107 78.391 1.00 144.59 ? 462 GLU D OE2 1 
ATOM   8453 N N   . ILE D 1 264 ? -9.284  42.745 76.321 1.00 149.95 ? 463 ILE D N   1 
ATOM   8454 C CA  . ILE D 1 264 ? -9.028  41.888 75.173 1.00 150.13 ? 463 ILE D CA  1 
ATOM   8455 C C   . ILE D 1 264 ? -7.496  41.798 75.220 1.00 150.28 ? 463 ILE D C   1 
ATOM   8456 O O   . ILE D 1 264 ? -6.898  40.713 75.249 1.00 150.25 ? 463 ILE D O   1 
ATOM   8457 C CB  . ILE D 1 264 ? -9.558  42.634 73.908 1.00 150.00 ? 463 ILE D CB  1 
ATOM   8458 C CG1 . ILE D 1 264 ? -11.031 42.292 73.675 1.00 149.68 ? 463 ILE D CG1 1 
ATOM   8459 C CG2 . ILE D 1 264 ? -8.732  42.331 72.698 1.00 149.95 ? 463 ILE D CG2 1 
ATOM   8460 C CD1 . ILE D 1 264 ? -11.718 43.212 72.673 1.00 149.14 ? 463 ILE D CD1 1 
ATOM   8461 N N   . TYR D 1 265 ? -6.886  42.979 75.282 1.00 150.41 ? 464 TYR D N   1 
ATOM   8462 C CA  . TYR D 1 265 ? -5.436  43.145 75.370 1.00 150.14 ? 464 TYR D CA  1 
ATOM   8463 C C   . TYR D 1 265 ? -4.861  42.284 76.490 1.00 149.76 ? 464 TYR D C   1 
ATOM   8464 O O   . TYR D 1 265 ? -3.905  41.530 76.282 1.00 149.70 ? 464 TYR D O   1 
ATOM   8465 C CB  . TYR D 1 265 ? -5.094  44.613 75.659 1.00 150.25 ? 464 TYR D CB  1 
ATOM   8466 C CG  . TYR D 1 265 ? -5.307  45.567 74.505 1.00 150.13 ? 464 TYR D CG  1 
ATOM   8467 C CD1 . TYR D 1 265 ? -6.325  45.357 73.574 1.00 150.36 ? 464 TYR D CD1 1 
ATOM   8468 C CD2 . TYR D 1 265 ? -4.505  46.698 74.359 1.00 149.87 ? 464 TYR D CD2 1 
ATOM   8469 C CE1 . TYR D 1 265 ? -6.539  46.248 72.527 1.00 150.33 ? 464 TYR D CE1 1 
ATOM   8470 C CE2 . TYR D 1 265 ? -4.712  47.597 73.317 1.00 150.13 ? 464 TYR D CE2 1 
ATOM   8471 C CZ  . TYR D 1 265 ? -5.730  47.366 72.405 1.00 150.32 ? 464 TYR D CZ  1 
ATOM   8472 O OH  . TYR D 1 265 ? -5.944  48.250 71.371 1.00 150.31 ? 464 TYR D OH  1 
ATOM   8473 N N   . ARG D 1 266 ? -5.439  42.422 77.684 1.00 148.86 ? 465 ARG D N   1 
ATOM   8474 C CA  . ARG D 1 266 ? -4.991  41.659 78.841 1.00 147.52 ? 465 ARG D CA  1 
ATOM   8475 C C   . ARG D 1 266 ? -5.225  40.184 78.538 1.00 147.35 ? 465 ARG D C   1 
ATOM   8476 O O   . ARG D 1 266 ? -6.239  39.816 77.939 1.00 147.53 ? 465 ARG D O   1 
ATOM   8477 C CB  . ARG D 1 266 ? -5.762  42.082 80.105 1.00 145.96 ? 465 ARG D CB  1 
ATOM   8478 C CG  . ARG D 1 266 ? -6.928  41.183 80.492 1.00 143.94 ? 465 ARG D CG  1 
ATOM   8479 C CD  . ARG D 1 266 ? -8.091  41.274 79.517 1.00 142.17 ? 465 ARG D CD  1 
ATOM   8480 N NE  . ARG D 1 266 ? -9.093  40.236 79.751 1.00 140.18 ? 465 ARG D NE  1 
ATOM   8481 C CZ  . ARG D 1 266 ? -9.659  39.988 80.928 1.00 139.45 ? 465 ARG D CZ  1 
ATOM   8482 N NH1 . ARG D 1 266 ? -9.322  40.701 81.995 1.00 139.13 ? 465 ARG D NH1 1 
ATOM   8483 N NH2 . ARG D 1 266 ? -10.570 39.032 81.038 1.00 138.75 ? 465 ARG D NH2 1 
ATOM   8484 N N   . ASP D 1 267 ? -4.276  39.344 78.935 1.00 146.60 ? 466 ASP D N   1 
ATOM   8485 C CA  . ASP D 1 267 ? -4.386  37.914 78.691 1.00 145.78 ? 466 ASP D CA  1 
ATOM   8486 C C   . ASP D 1 267 ? -4.450  37.624 77.188 1.00 144.91 ? 466 ASP D C   1 
ATOM   8487 O O   . ASP D 1 267 ? -5.160  36.714 76.751 1.00 145.03 ? 466 ASP D O   1 
ATOM   8488 C CB  . ASP D 1 267 ? -5.634  37.351 79.388 1.00 146.26 ? 466 ASP D CB  1 
ATOM   8489 C CG  . ASP D 1 267 ? -5.602  37.543 80.899 1.00 146.32 ? 466 ASP D CG  1 
ATOM   8490 O OD1 . ASP D 1 267 ? -5.977  38.635 81.379 1.00 146.37 ? 466 ASP D OD1 1 
ATOM   8491 O OD2 . ASP D 1 267 ? -5.190  36.598 81.606 1.00 146.21 ? 466 ASP D OD2 1 
ATOM   8492 N N   . MET D 1 268 ? -3.704  38.401 76.403 1.00 143.61 ? 467 MET D N   1 
ATOM   8493 C CA  . MET D 1 268 ? -3.674  38.225 74.952 1.00 142.28 ? 467 MET D CA  1 
ATOM   8494 C C   . MET D 1 268 ? -2.351  37.610 74.492 1.00 141.51 ? 467 MET D C   1 
ATOM   8495 O O   . MET D 1 268 ? -2.346  36.615 73.765 1.00 141.26 ? 467 MET D O   1 
ATOM   8496 C CB  . MET D 1 268 ? -3.886  39.569 74.243 1.00 141.76 ? 467 MET D CB  1 
ATOM   8497 C CG  . MET D 1 268 ? -3.979  39.482 72.724 1.00 140.80 ? 467 MET D CG  1 
ATOM   8498 S SD  . MET D 1 268 ? -5.537  38.811 72.111 1.00 138.99 ? 467 MET D SD  1 
ATOM   8499 C CE  . MET D 1 268 ? -6.466  40.321 71.866 1.00 138.54 ? 467 MET D CE  1 
ATOM   8500 N N   . TYR D 1 269 ? -1.234  38.200 74.913 1.00 140.46 ? 468 TYR D N   1 
ATOM   8501 C CA  . TYR D 1 269 ? 0.083   37.693 74.532 1.00 139.50 ? 468 TYR D CA  1 
ATOM   8502 C C   . TYR D 1 269 ? 0.747   36.882 75.640 1.00 139.47 ? 468 TYR D C   1 
ATOM   8503 O O   . TYR D 1 269 ? 1.989   36.742 75.597 1.00 139.17 ? 468 TYR D O   1 
ATOM   8504 C CB  . TYR D 1 269 ? 1.003   38.852 74.131 1.00 138.63 ? 468 TYR D CB  1 
ATOM   8505 C CG  . TYR D 1 269 ? 1.298   38.923 72.646 1.00 137.80 ? 468 TYR D CG  1 
ATOM   8506 C CD1 . TYR D 1 269 ? 1.948   40.029 72.094 1.00 137.29 ? 468 TYR D CD1 1 
ATOM   8507 C CD2 . TYR D 1 269 ? 0.920   37.890 71.790 1.00 137.41 ? 468 TYR D CD2 1 
ATOM   8508 C CE1 . TYR D 1 269 ? 2.211   40.104 70.724 1.00 136.40 ? 468 TYR D CE1 1 
ATOM   8509 C CE2 . TYR D 1 269 ? 1.177   37.956 70.422 1.00 137.03 ? 468 TYR D CE2 1 
ATOM   8510 C CZ  . TYR D 1 269 ? 1.820   39.065 69.896 1.00 136.35 ? 468 TYR D CZ  1 
ATOM   8511 O OH  . TYR D 1 269 ? 2.053   39.140 68.542 1.00 135.50 ? 468 TYR D OH  1 
ATOM   8512 O OXT . TYR D 1 269 ? 0.020   36.379 76.523 1.00 139.49 ? 468 TYR D OXT 1 
ATOM   8513 N N   . ASN E 2 1   ? 67.941  35.309 33.458 1.00 94.64  ? 682 ASN E N   1 
ATOM   8514 C CA  . ASN E 2 1   ? 67.305  33.994 33.375 1.00 94.71  ? 682 ASN E CA  1 
ATOM   8515 C C   . ASN E 2 1   ? 66.080  34.005 32.525 1.00 94.76  ? 682 ASN E C   1 
ATOM   8516 O O   . ASN E 2 1   ? 65.919  34.768 31.565 1.00 94.11  ? 682 ASN E O   1 
ATOM   8517 C CB  . ASN E 2 1   ? 66.957  33.459 34.764 1.00 94.56  ? 682 ASN E CB  1 
ATOM   8518 N N   . MET E 2 2   ? 65.162  33.194 32.982 1.00 95.08  ? 683 MET E N   1 
ATOM   8519 C CA  . MET E 2 2   ? 64.002  32.949 32.215 1.00 95.06  ? 683 MET E CA  1 
ATOM   8520 C C   . MET E 2 2   ? 63.594  31.597 32.792 1.00 93.79  ? 683 MET E C   1 
ATOM   8521 O O   . MET E 2 2   ? 64.228  31.109 33.743 1.00 94.12  ? 683 MET E O   1 
ATOM   8522 C CB  . MET E 2 2   ? 64.403  32.876 30.736 1.00 96.33  ? 683 MET E CB  1 
ATOM   8523 C CG  . MET E 2 2   ? 63.279  32.514 29.791 1.00 97.78  ? 683 MET E CG  1 
ATOM   8524 S SD  . MET E 2 2   ? 62.048  33.813 29.569 1.00 99.49  ? 683 MET E SD  1 
ATOM   8525 C CE  . MET E 2 2   ? 61.358  33.908 31.218 1.00 99.70  ? 683 MET E CE  1 
ATOM   8526 N N   . GLY E 2 3   ? 62.597  30.978 32.173 1.00 91.75  ? 684 GLY E N   1 
ATOM   8527 C CA  . GLY E 2 3   ? 61.988  29.799 32.753 1.00 88.85  ? 684 GLY E CA  1 
ATOM   8528 C C   . GLY E 2 3   ? 62.174  28.498 32.082 1.00 86.88  ? 684 GLY E C   1 
ATOM   8529 O O   . GLY E 2 3   ? 61.551  28.119 31.101 1.00 86.60  ? 684 GLY E O   1 
ATOM   8530 N N   . LEU E 2 4   ? 63.017  27.757 32.734 1.00 84.77  ? 685 LEU E N   1 
ATOM   8531 C CA  . LEU E 2 4   ? 63.431  26.512 32.220 1.00 81.61  ? 685 LEU E CA  1 
ATOM   8532 C C   . LEU E 2 4   ? 63.245  25.575 33.350 1.00 79.68  ? 685 LEU E C   1 
ATOM   8533 O O   . LEU E 2 4   ? 63.819  24.502 33.366 1.00 78.85  ? 685 LEU E O   1 
ATOM   8534 C CB  . LEU E 2 4   ? 64.889  26.644 31.915 1.00 80.52  ? 685 LEU E CB  1 
ATOM   8535 C CG  . LEU E 2 4   ? 65.470  27.195 33.231 1.00 79.30  ? 685 LEU E CG  1 
ATOM   8536 C CD1 . LEU E 2 4   ? 66.942  27.078 33.245 1.00 78.97  ? 685 LEU E CD1 1 
ATOM   8537 C CD2 . LEU E 2 4   ? 65.124  28.647 33.412 1.00 79.14  ? 685 LEU E CD2 1 
ATOM   8538 N N   . GLU E 2 5   ? 62.510  26.041 34.343 1.00 77.90  ? 686 GLU E N   1 
ATOM   8539 C CA  . GLU E 2 5   ? 62.196  25.240 35.501 1.00 76.71  ? 686 GLU E CA  1 
ATOM   8540 C C   . GLU E 2 5   ? 61.680  23.872 35.055 1.00 76.36  ? 686 GLU E C   1 
ATOM   8541 O O   . GLU E 2 5   ? 61.583  22.948 35.854 1.00 76.14  ? 686 GLU E O   1 
ATOM   8542 C CB  . GLU E 2 5   ? 61.105  25.932 36.291 1.00 75.71  ? 686 GLU E CB  1 
ATOM   8543 C CG  . GLU E 2 5   ? 59.792  26.001 35.532 1.00 74.20  ? 686 GLU E CG  1 
ATOM   8544 C CD  . GLU E 2 5   ? 58.705  26.666 36.332 1.00 73.37  ? 686 GLU E CD  1 
ATOM   8545 O OE1 . GLU E 2 5   ? 58.540  27.897 36.217 1.00 73.33  ? 686 GLU E OE1 1 
ATOM   8546 O OE2 . GLU E 2 5   ? 58.021  25.955 37.090 1.00 72.50  ? 686 GLU E OE2 1 
ATOM   8547 N N   . ALA E 2 6   ? 61.308  23.758 33.786 1.00 77.00  ? 687 ALA E N   1 
ATOM   8548 C CA  . ALA E 2 6   ? 60.809  22.495 33.258 1.00 77.21  ? 687 ALA E CA  1 
ATOM   8549 C C   . ALA E 2 6   ? 61.854  21.425 33.541 1.00 76.66  ? 687 ALA E C   1 
ATOM   8550 O O   . ALA E 2 6   ? 61.648  20.514 34.345 1.00 75.91  ? 687 ALA E O   1 
ATOM   8551 C CB  . ALA E 2 6   ? 60.579  22.617 31.748 1.00 77.93  ? 687 ALA E CB  1 
ATOM   8552 N N   . ILE E 2 7   ? 62.988  21.581 32.871 1.00 76.49  ? 688 ILE E N   1 
ATOM   8553 C CA  . ILE E 2 7   ? 64.125  20.679 32.967 1.00 76.07  ? 688 ILE E CA  1 
ATOM   8554 C C   . ILE E 2 7   ? 64.687  20.544 34.383 1.00 75.57  ? 688 ILE E C   1 
ATOM   8555 O O   . ILE E 2 7   ? 65.114  19.461 34.788 1.00 75.17  ? 688 ILE E O   1 
ATOM   8556 C CB  . ILE E 2 7   ? 65.259  21.171 32.040 1.00 76.44  ? 688 ILE E CB  1 
ATOM   8557 C CG1 . ILE E 2 7   ? 64.686  21.519 30.655 1.00 76.66  ? 688 ILE E CG1 1 
ATOM   8558 C CG2 . ILE E 2 7   ? 66.371  20.131 31.987 1.00 76.58  ? 688 ILE E CG2 1 
ATOM   8559 C CD1 . ILE E 2 7   ? 65.112  20.599 29.520 1.00 76.48  ? 688 ILE E CD1 1 
ATOM   8560 N N   . ILE E 2 8   ? 64.686  21.644 35.130 1.00 75.44  ? 689 ILE E N   1 
ATOM   8561 C CA  . ILE E 2 8   ? 65.228  21.648 36.486 1.00 75.35  ? 689 ILE E CA  1 
ATOM   8562 C C   . ILE E 2 8   ? 64.324  20.954 37.510 1.00 75.92  ? 689 ILE E C   1 
ATOM   8563 O O   . ILE E 2 8   ? 64.809  20.397 38.495 1.00 75.86  ? 689 ILE E O   1 
ATOM   8564 C CB  . ILE E 2 8   ? 65.525  23.107 36.963 1.00 74.46  ? 689 ILE E CB  1 
ATOM   8565 C CG1 . ILE E 2 8   ? 64.357  23.658 37.782 1.00 74.52  ? 689 ILE E CG1 1 
ATOM   8566 C CG2 . ILE E 2 8   ? 65.748  24.013 35.761 1.00 74.10  ? 689 ILE E CG2 1 
ATOM   8567 C CD1 . ILE E 2 8   ? 64.549  25.090 38.248 1.00 73.86  ? 689 ILE E CD1 1 
ATOM   8568 N N   . ARG E 2 9   ? 63.015  20.982 37.272 1.00 76.84  ? 690 ARG E N   1 
ATOM   8569 C CA  . ARG E 2 9   ? 62.057  20.369 38.191 1.00 77.52  ? 690 ARG E CA  1 
ATOM   8570 C C   . ARG E 2 9   ? 61.987  18.857 38.011 1.00 77.92  ? 690 ARG E C   1 
ATOM   8571 O O   . ARG E 2 9   ? 61.468  18.146 38.872 1.00 77.90  ? 690 ARG E O   1 
ATOM   8572 C CB  . ARG E 2 9   ? 60.661  20.980 37.993 1.00 78.07  ? 690 ARG E CB  1 
ATOM   8573 C CG  . ARG E 2 9   ? 59.664  20.628 39.091 1.00 78.52  ? 690 ARG E CG  1 
ATOM   8574 C CD  . ARG E 2 9   ? 58.240  21.049 38.749 1.00 79.00  ? 690 ARG E CD  1 
ATOM   8575 N NE  . ARG E 2 9   ? 57.835  22.327 39.338 1.00 79.34  ? 690 ARG E NE  1 
ATOM   8576 C CZ  . ARG E 2 9   ? 58.114  23.526 38.832 1.00 79.84  ? 690 ARG E CZ  1 
ATOM   8577 N NH1 . ARG E 2 9   ? 58.811  23.642 37.709 1.00 79.97  ? 690 ARG E NH1 1 
ATOM   8578 N NH2 . ARG E 2 9   ? 57.676  24.616 39.449 1.00 80.37  ? 690 ARG E NH2 1 
ATOM   8579 N N   . LYS E 2 10  ? 62.514  18.374 36.890 1.00 78.56  ? 691 LYS E N   1 
ATOM   8580 C CA  . LYS E 2 10  ? 62.525  16.947 36.588 1.00 79.72  ? 691 LYS E CA  1 
ATOM   8581 C C   . LYS E 2 10  ? 63.812  16.279 37.075 1.00 80.31  ? 691 LYS E C   1 
ATOM   8582 O O   . LYS E 2 10  ? 63.861  15.063 37.263 1.00 80.78  ? 691 LYS E O   1 
ATOM   8583 C CB  . LYS E 2 10  ? 62.373  16.737 35.083 1.00 80.24  ? 691 LYS E CB  1 
ATOM   8584 C CG  . LYS E 2 10  ? 62.840  15.380 34.582 1.00 81.53  ? 691 LYS E CG  1 
ATOM   8585 C CD  . LYS E 2 10  ? 63.350  15.504 33.155 1.00 83.21  ? 691 LYS E CD  1 
ATOM   8586 C CE  . LYS E 2 10  ? 64.498  16.503 33.075 1.00 84.08  ? 691 LYS E CE  1 
ATOM   8587 N NZ  . LYS E 2 10  ? 64.686  17.047 31.698 1.00 84.24  ? 691 LYS E NZ  1 
ATOM   8588 N N   . ALA E 2 11  ? 64.861  17.070 37.263 1.00 80.98  ? 692 ALA E N   1 
ATOM   8589 C CA  . ALA E 2 11  ? 66.126  16.536 37.751 1.00 81.74  ? 692 ALA E CA  1 
ATOM   8590 C C   . ALA E 2 11  ? 66.006  16.545 39.262 1.00 82.56  ? 692 ALA E C   1 
ATOM   8591 O O   . ALA E 2 11  ? 66.860  16.034 39.983 1.00 82.51  ? 692 ALA E O   1 
ATOM   8592 C CB  . ALA E 2 11  ? 67.270  17.422 37.314 1.00 81.63  ? 692 ALA E CB  1 
ATOM   8593 N N   . LEU E 2 12  ? 64.913  17.139 39.718 1.00 83.80  ? 693 LEU E N   1 
ATOM   8594 C CA  . LEU E 2 12  ? 64.607  17.269 41.127 1.00 85.46  ? 693 LEU E CA  1 
ATOM   8595 C C   . LEU E 2 12  ? 64.062  15.968 41.669 1.00 87.23  ? 693 LEU E C   1 
ATOM   8596 O O   . LEU E 2 12  ? 64.189  15.665 42.854 1.00 87.35  ? 693 LEU E O   1 
ATOM   8597 C CB  . LEU E 2 12  ? 63.566  18.361 41.301 1.00 84.65  ? 693 LEU E CB  1 
ATOM   8598 C CG  . LEU E 2 12  ? 63.855  19.363 42.403 1.00 84.31  ? 693 LEU E CG  1 
ATOM   8599 C CD1 . LEU E 2 12  ? 65.354  19.549 42.578 1.00 83.51  ? 693 LEU E CD1 1 
ATOM   8600 C CD2 . LEU E 2 12  ? 63.185  20.663 42.032 1.00 84.22  ? 693 LEU E CD2 1 
ATOM   8601 N N   . MET E 2 13  ? 63.445  15.204 40.782 1.00 89.59  ? 694 MET E N   1 
ATOM   8602 C CA  . MET E 2 13  ? 62.850  13.937 41.147 1.00 92.37  ? 694 MET E CA  1 
ATOM   8603 C C   . MET E 2 13  ? 63.219  12.921 40.098 1.00 94.94  ? 694 MET E C   1 
ATOM   8604 O O   . MET E 2 13  ? 62.809  13.030 38.949 1.00 95.15  ? 694 MET E O   1 
ATOM   8605 C CB  . MET E 2 13  ? 61.335  14.086 41.219 1.00 91.97  ? 694 MET E CB  1 
ATOM   8606 C CG  . MET E 2 13  ? 60.843  15.441 40.739 1.00 92.36  ? 694 MET E CG  1 
ATOM   8607 S SD  . MET E 2 13  ? 59.510  16.098 41.759 1.00 93.86  ? 694 MET E SD  1 
ATOM   8608 C CE  . MET E 2 13  ? 59.481  14.940 43.127 1.00 92.25  ? 694 MET E CE  1 
ATOM   8609 N N   . GLY E 2 14  ? 64.005  11.932 40.483 1.00 98.34  ? 695 GLY E N   1 
ATOM   8610 C CA  . GLY E 2 14  ? 64.383  10.931 39.513 1.00 103.45 ? 695 GLY E CA  1 
ATOM   8611 C C   . GLY E 2 14  ? 65.774  10.398 39.740 1.00 107.36 ? 695 GLY E C   1 
ATOM   8612 O O   . GLY E 2 14  ? 66.339  9.737  38.871 1.00 107.59 ? 695 GLY E O   1 
ATOM   8613 N N   . LYS E 2 15  ? 66.339  10.695 40.901 1.00 111.22 ? 696 LYS E N   1 
ATOM   8614 C CA  . LYS E 2 15  ? 67.663  10.201 41.218 1.00 115.40 ? 696 LYS E CA  1 
ATOM   8615 C C   . LYS E 2 15  ? 67.564  9.311  42.443 1.00 118.47 ? 696 LYS E C   1 
ATOM   8616 O O   . LYS E 2 15  ? 66.488  9.104  43.006 1.00 118.48 ? 696 LYS E O   1 
ATOM   8617 C CB  . LYS E 2 15  ? 68.618  11.362 41.490 1.00 114.99 ? 696 LYS E CB  1 
ATOM   8618 N N   . TYR E 2 16  ? 68.705  8.761  42.815 1.00 122.56 ? 697 TYR E N   1 
ATOM   8619 C CA  . TYR E 2 16  ? 68.850  7.928  43.989 1.00 126.77 ? 697 TYR E CA  1 
ATOM   8620 C C   . TYR E 2 16  ? 70.353  7.694  44.078 1.00 129.50 ? 697 TYR E C   1 
ATOM   8621 O O   . TYR E 2 16  ? 70.993  7.302  43.104 1.00 129.55 ? 697 TYR E O   1 
ATOM   8622 C CB  . TYR E 2 16  ? 68.013  6.615  43.913 1.00 127.19 ? 697 TYR E CB  1 
ATOM   8623 C CG  . TYR E 2 16  ? 68.216  5.676  42.733 1.00 127.93 ? 697 TYR E CG  1 
ATOM   8624 C CD1 . TYR E 2 16  ? 69.464  5.485  42.186 1.00 128.26 ? 697 TYR E CD1 1 
ATOM   8625 C CD2 . TYR E 2 16  ? 67.155  4.924  42.208 1.00 127.90 ? 697 TYR E CD2 1 
ATOM   8626 C CE1 . TYR E 2 16  ? 69.664  4.592  41.168 1.00 128.52 ? 697 TYR E CE1 1 
ATOM   8627 C CE2 . TYR E 2 16  ? 67.362  4.009  41.159 1.00 128.08 ? 697 TYR E CE2 1 
ATOM   8628 C CZ  . TYR E 2 16  ? 68.636  3.859  40.644 1.00 128.33 ? 697 TYR E CZ  1 
ATOM   8629 O OH  . TYR E 2 16  ? 68.914  3.014  39.588 1.00 128.33 ? 697 TYR E OH  1 
ATOM   8630 N N   . ASP E 2 17  ? 70.914  8.025  45.235 1.00 132.89 ? 698 ASP E N   1 
ATOM   8631 C CA  . ASP E 2 17  ? 72.344  7.893  45.500 1.00 136.17 ? 698 ASP E CA  1 
ATOM   8632 C C   . ASP E 2 17  ? 72.719  8.998  46.469 1.00 138.12 ? 698 ASP E C   1 
ATOM   8633 O O   . ASP E 2 17  ? 72.255  10.132 46.339 1.00 138.40 ? 698 ASP E O   1 
ATOM   8634 C CB  . ASP E 2 17  ? 73.175  8.069  44.225 1.00 136.75 ? 698 ASP E CB  1 
ATOM   8635 C CG  . ASP E 2 17  ? 74.564  7.477  44.352 1.00 137.60 ? 698 ASP E CG  1 
ATOM   8636 O OD1 . ASP E 2 17  ? 74.667  6.234  44.425 1.00 138.13 ? 698 ASP E OD1 1 
ATOM   8637 O OD2 . ASP E 2 17  ? 75.547  8.247  44.385 1.00 138.13 ? 698 ASP E OD2 1 
ATOM   8638 N N   . GLN E 2 18  ? 73.565  8.669  47.436 1.00 140.43 ? 699 GLN E N   1 
ATOM   8639 C CA  . GLN E 2 18  ? 73.993  9.650  48.417 1.00 142.53 ? 699 GLN E CA  1 
ATOM   8640 C C   . GLN E 2 18  ? 74.974  9.056  49.413 1.00 143.88 ? 699 GLN E C   1 
ATOM   8641 O O   . GLN E 2 18  ? 74.789  7.946  49.910 1.00 143.90 ? 699 GLN E O   1 
ATOM   8642 C CB  . GLN E 2 18  ? 72.777  10.213 49.159 1.00 142.41 ? 699 GLN E CB  1 
ATOM   8643 N N   . TRP E 2 19  ? 76.040  9.793  49.685 1.00 145.41 ? 700 TRP E N   1 
ATOM   8644 C CA  . TRP E 2 19  ? 77.011  9.349  50.665 1.00 146.91 ? 700 TRP E CA  1 
ATOM   8645 C C   . TRP E 2 19  ? 76.480  9.902  51.987 1.00 147.21 ? 700 TRP E C   1 
ATOM   8646 O O   . TRP E 2 19  ? 76.658  11.113 52.251 1.00 147.05 ? 700 TRP E O   1 
ATOM   8647 C CB  . TRP E 2 19  ? 78.403  9.909  50.347 1.00 148.30 ? 700 TRP E CB  1 
ATOM   8648 C CG  . TRP E 2 19  ? 79.132  10.403 51.557 1.00 149.77 ? 700 TRP E CG  1 
ATOM   8649 C CD1 . TRP E 2 19  ? 79.637  9.652  52.584 1.00 150.14 ? 700 TRP E CD1 1 
ATOM   8650 C CD2 . TRP E 2 19  ? 79.340  11.773 51.919 1.00 150.03 ? 700 TRP E CD2 1 
ATOM   8651 N NE1 . TRP E 2 19  ? 80.139  10.475 53.567 1.00 150.51 ? 700 TRP E NE1 1 
ATOM   8652 C CE2 . TRP E 2 19  ? 79.969  11.781 53.184 1.00 150.32 ? 700 TRP E CE2 1 
ATOM   8653 C CE3 . TRP E 2 19  ? 79.049  12.995 51.297 1.00 149.74 ? 700 TRP E CE3 1 
ATOM   8654 C CZ2 . TRP E 2 19  ? 80.314  12.968 53.840 1.00 150.21 ? 700 TRP E CZ2 1 
ATOM   8655 C CZ3 . TRP E 2 19  ? 79.389  14.172 51.948 1.00 149.60 ? 700 TRP E CZ3 1 
ATOM   8656 C CH2 . TRP E 2 19  ? 80.016  14.150 53.209 1.00 149.92 ? 700 TRP E CH2 1 
ATOM   8657 O OXT . TRP E 2 19  ? 75.842  9.122  52.723 1.00 147.72 ? 700 TRP E OXT 1 
ATOM   8658 N N   . ASN F 2 1   ? 17.751  34.167 37.438 1.00 81.65  ? 682 ASN F N   1 
ATOM   8659 C CA  . ASN F 2 1   ? 16.597  33.227 37.522 1.00 82.53  ? 682 ASN F CA  1 
ATOM   8660 C C   . ASN F 2 1   ? 16.768  32.215 38.660 1.00 82.74  ? 682 ASN F C   1 
ATOM   8661 O O   . ASN F 2 1   ? 15.811  31.531 39.038 1.00 83.36  ? 682 ASN F O   1 
ATOM   8662 C CB  . ASN F 2 1   ? 16.415  32.497 36.185 1.00 81.76  ? 682 ASN F CB  1 
ATOM   8663 N N   . MET F 2 2   ? 17.984  32.113 39.198 1.00 82.05  ? 683 MET F N   1 
ATOM   8664 C CA  . MET F 2 2   ? 18.256  31.189 40.300 1.00 80.80  ? 683 MET F CA  1 
ATOM   8665 C C   . MET F 2 2   ? 19.568  31.548 41.006 1.00 78.13  ? 683 MET F C   1 
ATOM   8666 O O   . MET F 2 2   ? 20.220  32.530 40.644 1.00 77.44  ? 683 MET F O   1 
ATOM   8667 C CB  . MET F 2 2   ? 18.289  29.735 39.793 1.00 83.36  ? 683 MET F CB  1 
ATOM   8668 C CG  . MET F 2 2   ? 18.016  28.685 40.871 1.00 86.40  ? 683 MET F CG  1 
ATOM   8669 S SD  . MET F 2 2   ? 16.414  28.846 41.699 1.00 89.48  ? 683 MET F SD  1 
ATOM   8670 C CE  . MET F 2 2   ? 16.000  27.145 42.081 1.00 87.44  ? 683 MET F CE  1 
ATOM   8671 N N   . GLY F 2 3   ? 19.941  30.748 42.008 1.00 75.05  ? 684 GLY F N   1 
ATOM   8672 C CA  . GLY F 2 3   ? 21.146  31.002 42.787 1.00 70.89  ? 684 GLY F CA  1 
ATOM   8673 C C   . GLY F 2 3   ? 22.465  30.403 42.318 1.00 67.82  ? 684 GLY F C   1 
ATOM   8674 O O   . GLY F 2 3   ? 22.627  29.181 42.247 1.00 67.88  ? 684 GLY F O   1 
ATOM   8675 N N   . LEU F 2 4   ? 23.417  31.287 42.022 1.00 63.60  ? 685 LEU F N   1 
ATOM   8676 C CA  . LEU F 2 4   ? 24.755  30.925 41.558 1.00 57.51  ? 685 LEU F CA  1 
ATOM   8677 C C   . LEU F 2 4   ? 25.667  32.073 41.960 1.00 54.63  ? 685 LEU F C   1 
ATOM   8678 O O   . LEU F 2 4   ? 26.834  32.131 41.575 1.00 53.87  ? 685 LEU F O   1 
ATOM   8679 C CB  . LEU F 2 4   ? 24.768  30.759 40.029 1.00 55.66  ? 685 LEU F CB  1 
ATOM   8680 C CG  . LEU F 2 4   ? 24.379  31.924 39.103 1.00 52.83  ? 685 LEU F CG  1 
ATOM   8681 C CD1 . LEU F 2 4   ? 24.484  31.459 37.668 1.00 53.27  ? 685 LEU F CD1 1 
ATOM   8682 C CD2 . LEU F 2 4   ? 22.965  32.391 39.371 1.00 52.49  ? 685 LEU F CD2 1 
ATOM   8683 N N   . GLU F 2 5   ? 25.112  32.971 42.767 1.00 51.00  ? 686 GLU F N   1 
ATOM   8684 C CA  . GLU F 2 5   ? 25.818  34.159 43.209 1.00 47.82  ? 686 GLU F CA  1 
ATOM   8685 C C   . GLU F 2 5   ? 27.110  33.922 43.962 1.00 45.82  ? 686 GLU F C   1 
ATOM   8686 O O   . GLU F 2 5   ? 27.770  34.866 44.388 1.00 45.81  ? 686 GLU F O   1 
ATOM   8687 C CB  . GLU F 2 5   ? 24.874  35.054 44.024 1.00 47.60  ? 686 GLU F CB  1 
ATOM   8688 C CG  . GLU F 2 5   ? 24.811  34.837 45.522 1.00 45.84  ? 686 GLU F CG  1 
ATOM   8689 C CD  . GLU F 2 5   ? 23.831  35.805 46.155 1.00 46.09  ? 686 GLU F CD  1 
ATOM   8690 O OE1 . GLU F 2 5   ? 22.631  35.715 45.832 1.00 46.72  ? 686 GLU F OE1 1 
ATOM   8691 O OE2 . GLU F 2 5   ? 24.250  36.665 46.954 1.00 45.88  ? 686 GLU F OE2 1 
ATOM   8692 N N   . ALA F 2 6   ? 27.486  32.662 44.112 1.00 43.96  ? 687 ALA F N   1 
ATOM   8693 C CA  . ALA F 2 6   ? 28.720  32.345 44.805 1.00 41.63  ? 687 ALA F CA  1 
ATOM   8694 C C   . ALA F 2 6   ? 29.863  32.293 43.796 1.00 40.17  ? 687 ALA F C   1 
ATOM   8695 O O   . ALA F 2 6   ? 31.014  32.579 44.129 1.00 39.09  ? 687 ALA F O   1 
ATOM   8696 C CB  . ALA F 2 6   ? 28.584  31.020 45.518 1.00 42.23  ? 687 ALA F CB  1 
ATOM   8697 N N   . ILE F 2 7   ? 29.536  31.939 42.558 1.00 38.92  ? 688 ILE F N   1 
ATOM   8698 C CA  . ILE F 2 7   ? 30.543  31.853 41.507 1.00 37.76  ? 688 ILE F CA  1 
ATOM   8699 C C   . ILE F 2 7   ? 30.876  33.230 40.944 1.00 36.68  ? 688 ILE F C   1 
ATOM   8700 O O   . ILE F 2 7   ? 32.045  33.540 40.690 1.00 35.27  ? 688 ILE F O   1 
ATOM   8701 C CB  . ILE F 2 7   ? 30.068  30.952 40.350 1.00 38.34  ? 688 ILE F CB  1 
ATOM   8702 C CG1 . ILE F 2 7   ? 29.663  29.584 40.895 1.00 39.37  ? 688 ILE F CG1 1 
ATOM   8703 C CG2 . ILE F 2 7   ? 31.177  30.803 39.318 1.00 37.52  ? 688 ILE F CG2 1 
ATOM   8704 C CD1 . ILE F 2 7   ? 30.780  28.868 41.649 1.00 43.22  ? 688 ILE F CD1 1 
ATOM   8705 N N   . ILE F 2 8   ? 29.846  34.051 40.748 1.00 35.39  ? 689 ILE F N   1 
ATOM   8706 C CA  . ILE F 2 8   ? 30.047  35.393 40.213 1.00 34.49  ? 689 ILE F CA  1 
ATOM   8707 C C   . ILE F 2 8   ? 30.763  36.234 41.261 1.00 33.52  ? 689 ILE F C   1 
ATOM   8708 O O   . ILE F 2 8   ? 31.660  37.017 40.952 1.00 34.06  ? 689 ILE F O   1 
ATOM   8709 C CB  . ILE F 2 8   ? 28.683  36.080 39.806 1.00 34.21  ? 689 ILE F CB  1 
ATOM   8710 C CG1 . ILE F 2 8   ? 28.371  37.273 40.714 1.00 32.88  ? 689 ILE F CG1 1 
ATOM   8711 C CG2 . ILE F 2 8   ? 27.540  35.071 39.866 1.00 34.99  ? 689 ILE F CG2 1 
ATOM   8712 C CD1 . ILE F 2 8   ? 27.031  37.911 40.430 1.00 31.68  ? 689 ILE F CD1 1 
ATOM   8713 N N   . ARG F 2 9   ? 30.376  36.038 42.513 1.00 32.32  ? 690 ARG F N   1 
ATOM   8714 C CA  . ARG F 2 9   ? 30.954  36.784 43.611 1.00 30.15  ? 690 ARG F CA  1 
ATOM   8715 C C   . ARG F 2 9   ? 32.449  36.611 43.746 1.00 30.29  ? 690 ARG F C   1 
ATOM   8716 O O   . ARG F 2 9   ? 33.092  37.398 44.414 1.00 27.84  ? 690 ARG F O   1 
ATOM   8717 C CB  . ARG F 2 9   ? 30.279  36.388 44.906 1.00 29.09  ? 690 ARG F CB  1 
ATOM   8718 C CG  . ARG F 2 9   ? 30.122  37.540 45.866 1.00 28.37  ? 690 ARG F CG  1 
ATOM   8719 C CD  . ARG F 2 9   ? 28.926  37.280 46.756 1.00 29.38  ? 690 ARG F CD  1 
ATOM   8720 N NE  . ARG F 2 9   ? 28.398  38.501 47.355 1.00 30.33  ? 690 ARG F NE  1 
ATOM   8721 C CZ  . ARG F 2 9   ? 27.136  38.639 47.743 1.00 29.75  ? 690 ARG F CZ  1 
ATOM   8722 N NH1 . ARG F 2 9   ? 26.290  37.632 47.588 1.00 28.59  ? 690 ARG F NH1 1 
ATOM   8723 N NH2 . ARG F 2 9   ? 26.721  39.780 48.277 1.00 28.99  ? 690 ARG F NH2 1 
ATOM   8724 N N   . LYS F 2 10  ? 33.006  35.575 43.134 1.00 33.05  ? 691 LYS F N   1 
ATOM   8725 C CA  . LYS F 2 10  ? 34.446  35.365 43.210 1.00 36.23  ? 691 LYS F CA  1 
ATOM   8726 C C   . LYS F 2 10  ? 35.075  35.862 41.923 1.00 37.56  ? 691 LYS F C   1 
ATOM   8727 O O   . LYS F 2 10  ? 36.269  36.165 41.873 1.00 37.04  ? 691 LYS F O   1 
ATOM   8728 C CB  . LYS F 2 10  ? 34.765  33.884 43.444 1.00 36.67  ? 691 LYS F CB  1 
ATOM   8729 C CG  . LYS F 2 10  ? 36.179  33.461 43.077 1.00 38.78  ? 691 LYS F CG  1 
ATOM   8730 C CD  . LYS F 2 10  ? 36.353  31.970 43.321 1.00 40.64  ? 691 LYS F CD  1 
ATOM   8731 C CE  . LYS F 2 10  ? 37.681  31.452 42.781 1.00 40.59  ? 691 LYS F CE  1 
ATOM   8732 N NZ  . LYS F 2 10  ? 37.779  29.954 42.831 1.00 38.38  ? 691 LYS F NZ  1 
ATOM   8733 N N   . ALA F 2 11  ? 34.258  35.947 40.880 1.00 39.77  ? 692 ALA F N   1 
ATOM   8734 C CA  . ALA F 2 11  ? 34.727  36.448 39.602 1.00 43.10  ? 692 ALA F CA  1 
ATOM   8735 C C   . ALA F 2 11  ? 34.828  37.957 39.784 1.00 45.43  ? 692 ALA F C   1 
ATOM   8736 O O   . ALA F 2 11  ? 35.616  38.627 39.116 1.00 45.88  ? 692 ALA F O   1 
ATOM   8737 C CB  . ALA F 2 11  ? 33.731  36.109 38.502 1.00 42.80  ? 692 ALA F CB  1 
ATOM   8738 N N   . LEU F 2 12  ? 34.024  38.473 40.712 1.00 48.62  ? 693 LEU F N   1 
ATOM   8739 C CA  . LEU F 2 12  ? 33.984  39.897 41.034 1.00 52.35  ? 693 LEU F CA  1 
ATOM   8740 C C   . LEU F 2 12  ? 35.238  40.336 41.795 1.00 57.80  ? 693 LEU F C   1 
ATOM   8741 O O   . LEU F 2 12  ? 35.574  41.519 41.833 1.00 58.74  ? 693 LEU F O   1 
ATOM   8742 C CB  . LEU F 2 12  ? 32.740  40.206 41.876 1.00 48.15  ? 693 LEU F CB  1 
ATOM   8743 C CG  . LEU F 2 12  ? 31.533  40.919 41.261 1.00 44.67  ? 693 LEU F CG  1 
ATOM   8744 C CD1 . LEU F 2 12  ? 31.798  41.232 39.810 1.00 44.53  ? 693 LEU F CD1 1 
ATOM   8745 C CD2 . LEU F 2 12  ? 30.296  40.062 41.412 1.00 43.32  ? 693 LEU F CD2 1 
ATOM   8746 N N   . MET F 2 13  ? 35.916  39.371 42.406 1.00 64.09  ? 694 MET F N   1 
ATOM   8747 C CA  . MET F 2 13  ? 37.134  39.627 43.166 1.00 70.57  ? 694 MET F CA  1 
ATOM   8748 C C   . MET F 2 13  ? 38.307  39.144 42.329 1.00 74.67  ? 694 MET F C   1 
ATOM   8749 O O   . MET F 2 13  ? 38.162  38.879 41.141 1.00 75.21  ? 694 MET F O   1 
ATOM   8750 C CB  . MET F 2 13  ? 37.109  38.834 44.479 1.00 72.01  ? 694 MET F CB  1 
ATOM   8751 C CG  . MET F 2 13  ? 36.895  39.642 45.749 1.00 75.31  ? 694 MET F CG  1 
ATOM   8752 S SD  . MET F 2 13  ? 35.447  40.719 45.733 1.00 79.75  ? 694 MET F SD  1 
ATOM   8753 C CE  . MET F 2 13  ? 34.245  39.697 44.889 1.00 79.86  ? 694 MET F CE  1 
ATOM   8754 N N   . GLY F 2 14  ? 39.462  39.056 42.983 1.00 79.78  ? 695 GLY F N   1 
ATOM   8755 C CA  . GLY F 2 14  ? 40.711  38.563 42.412 1.00 86.04  ? 695 GLY F CA  1 
ATOM   8756 C C   . GLY F 2 14  ? 41.469  38.930 41.141 1.00 91.08  ? 695 GLY F C   1 
ATOM   8757 O O   . GLY F 2 14  ? 42.705  38.889 41.171 1.00 90.63  ? 695 GLY F O   1 
ATOM   8758 N N   . LYS F 2 15  ? 40.740  39.311 40.086 1.00 96.57  ? 696 LYS F N   1 
ATOM   8759 C CA  . LYS F 2 15  ? 41.224  39.577 38.718 1.00 101.53 ? 696 LYS F CA  1 
ATOM   8760 C C   . LYS F 2 15  ? 42.176  40.729 38.427 1.00 105.32 ? 696 LYS F C   1 
ATOM   8761 O O   . LYS F 2 15  ? 42.226  41.700 39.177 1.00 105.57 ? 696 LYS F O   1 
ATOM   8762 C CB  . LYS F 2 15  ? 39.993  39.650 37.806 1.00 101.05 ? 696 LYS F CB  1 
ATOM   8763 C CG  . LYS F 2 15  ? 39.077  40.809 38.149 1.00 100.65 ? 696 LYS F CG  1 
ATOM   8764 C CD  . LYS F 2 15  ? 39.782  42.142 37.952 1.00 99.83  ? 696 LYS F CD  1 
ATOM   8765 C CE  . LYS F 2 15  ? 38.966  43.325 38.437 1.00 99.12  ? 696 LYS F CE  1 
ATOM   8766 N NZ  . LYS F 2 15  ? 39.718  44.585 38.254 1.00 98.45  ? 696 LYS F NZ  1 
ATOM   8767 N N   . TYR F 2 16  ? 42.904  40.632 37.315 1.00 109.85 ? 697 TYR F N   1 
ATOM   8768 C CA  . TYR F 2 16  ? 43.896  41.648 36.992 1.00 114.19 ? 697 TYR F CA  1 
ATOM   8769 C C   . TYR F 2 16  ? 44.168  41.873 35.495 1.00 116.80 ? 697 TYR F C   1 
ATOM   8770 O O   . TYR F 2 16  ? 45.014  41.204 34.895 1.00 116.99 ? 697 TYR F O   1 
ATOM   8771 C CB  . TYR F 2 16  ? 45.202  41.263 37.682 1.00 114.99 ? 697 TYR F CB  1 
ATOM   8772 C CG  . TYR F 2 16  ? 45.872  40.107 36.989 1.00 115.82 ? 697 TYR F CG  1 
ATOM   8773 C CD1 . TYR F 2 16  ? 45.122  39.019 36.537 1.00 116.13 ? 697 TYR F CD1 1 
ATOM   8774 C CD2 . TYR F 2 16  ? 47.244  40.109 36.756 1.00 115.98 ? 697 TYR F CD2 1 
ATOM   8775 C CE1 . TYR F 2 16  ? 45.718  37.967 35.870 1.00 116.34 ? 697 TYR F CE1 1 
ATOM   8776 C CE2 . TYR F 2 16  ? 47.857  39.056 36.091 1.00 116.27 ? 697 TYR F CE2 1 
ATOM   8777 C CZ  . TYR F 2 16  ? 47.088  37.988 35.647 1.00 116.42 ? 697 TYR F CZ  1 
ATOM   8778 O OH  . TYR F 2 16  ? 47.687  36.952 34.966 1.00 115.87 ? 697 TYR F OH  1 
ATOM   8779 N N   . ASP F 2 17  ? 43.449  42.810 34.886 1.00 120.18 ? 698 ASP F N   1 
ATOM   8780 C CA  . ASP F 2 17  ? 43.687  43.135 33.477 1.00 123.09 ? 698 ASP F CA  1 
ATOM   8781 C C   . ASP F 2 17  ? 42.969  44.400 32.969 1.00 124.68 ? 698 ASP F C   1 
ATOM   8782 O O   . ASP F 2 17  ? 41.916  44.741 33.481 1.00 124.81 ? 698 ASP F O   1 
ATOM   8783 C CB  . ASP F 2 17  ? 43.286  41.972 32.579 1.00 123.59 ? 698 ASP F CB  1 
ATOM   8784 C CG  . ASP F 2 17  ? 43.814  42.147 31.190 1.00 124.27 ? 698 ASP F CG  1 
ATOM   8785 O OD1 . ASP F 2 17  ? 45.013  42.470 31.085 1.00 124.76 ? 698 ASP F OD1 1 
ATOM   8786 O OD2 . ASP F 2 17  ? 43.062  41.982 30.212 1.00 124.95 ? 698 ASP F OD2 1 
ATOM   8787 N N   . GLN F 2 18  ? 43.508  45.109 31.978 1.00 126.38 ? 699 GLN F N   1 
ATOM   8788 C CA  . GLN F 2 18  ? 42.774  46.276 31.473 1.00 128.07 ? 699 GLN F CA  1 
ATOM   8789 C C   . GLN F 2 18  ? 43.399  46.968 30.268 1.00 129.23 ? 699 GLN F C   1 
ATOM   8790 O O   . GLN F 2 18  ? 44.510  47.481 30.369 1.00 129.48 ? 699 GLN F O   1 
ATOM   8791 C CB  . GLN F 2 18  ? 42.565  47.302 32.598 1.00 127.60 ? 699 GLN F CB  1 
ATOM   8792 N N   . TRP F 2 19  ? 42.711  46.961 29.124 1.00 130.43 ? 700 TRP F N   1 
ATOM   8793 C CA  . TRP F 2 19  ? 43.232  47.678 27.961 1.00 131.49 ? 700 TRP F CA  1 
ATOM   8794 C C   . TRP F 2 19  ? 43.102  49.140 28.385 1.00 131.77 ? 700 TRP F C   1 
ATOM   8795 O O   . TRP F 2 19  ? 41.992  49.700 28.246 1.00 131.70 ? 700 TRP F O   1 
ATOM   8796 C CB  . TRP F 2 19  ? 42.394  47.430 26.693 1.00 132.39 ? 700 TRP F CB  1 
ATOM   8797 C CG  . TRP F 2 19  ? 42.353  48.638 25.754 1.00 133.58 ? 700 TRP F CG  1 
ATOM   8798 C CD1 . TRP F 2 19  ? 43.389  49.160 25.022 1.00 133.94 ? 700 TRP F CD1 1 
ATOM   8799 C CD2 . TRP F 2 19  ? 41.237  49.517 25.544 1.00 133.70 ? 700 TRP F CD2 1 
ATOM   8800 N NE1 . TRP F 2 19  ? 42.986  50.312 24.379 1.00 134.05 ? 700 TRP F NE1 1 
ATOM   8801 C CE2 . TRP F 2 19  ? 41.671  50.553 24.683 1.00 133.82 ? 700 TRP F CE2 1 
ATOM   8802 C CE3 . TRP F 2 19  ? 39.914  49.532 26.006 1.00 133.23 ? 700 TRP F CE3 1 
ATOM   8803 C CZ2 . TRP F 2 19  ? 40.825  51.594 24.275 1.00 133.45 ? 700 TRP F CZ2 1 
ATOM   8804 C CZ3 . TRP F 2 19  ? 39.076  50.565 25.603 1.00 132.94 ? 700 TRP F CZ3 1 
ATOM   8805 C CH2 . TRP F 2 19  ? 39.536  51.582 24.746 1.00 133.13 ? 700 TRP F CH2 1 
ATOM   8806 O OXT . TRP F 2 19  ? 44.093  49.697 28.901 1.00 132.16 ? 700 TRP F OXT 1 
ATOM   8807 N N   . ASN G 2 1   ? 60.625  47.418 56.132 1.00 93.85  ? 682 ASN G N   1 
ATOM   8808 C CA  . ASN G 2 1   ? 61.817  47.153 56.988 1.00 94.27  ? 682 ASN G CA  1 
ATOM   8809 C C   . ASN G 2 1   ? 61.510  46.133 58.094 1.00 94.83  ? 682 ASN G C   1 
ATOM   8810 O O   . ASN G 2 1   ? 62.313  45.939 59.012 1.00 94.89  ? 682 ASN G O   1 
ATOM   8811 C CB  . ASN G 2 1   ? 62.316  48.461 57.597 1.00 93.28  ? 682 ASN G CB  1 
ATOM   8812 N N   . MET G 2 2   ? 60.344  45.491 57.999 1.00 95.30  ? 683 MET G N   1 
ATOM   8813 C CA  . MET G 2 2   ? 59.904  44.475 58.967 1.00 94.75  ? 683 MET G CA  1 
ATOM   8814 C C   . MET G 2 2   ? 58.698  43.699 58.420 1.00 93.66  ? 683 MET G C   1 
ATOM   8815 O O   . MET G 2 2   ? 58.025  44.152 57.486 1.00 93.76  ? 683 MET G O   1 
ATOM   8816 C CB  . MET G 2 2   ? 59.553  45.119 60.322 1.00 95.43  ? 683 MET G CB  1 
ATOM   8817 C CG  . MET G 2 2   ? 59.085  44.135 61.390 1.00 95.62  ? 683 MET G CG  1 
ATOM   8818 S SD  . MET G 2 2   ? 60.269  42.827 61.777 1.00 96.10  ? 683 MET G SD  1 
ATOM   8819 C CE  . MET G 2 2   ? 60.819  43.315 63.411 1.00 94.88  ? 683 MET G CE  1 
ATOM   8820 N N   . GLY G 2 3   ? 58.430  42.539 59.019 1.00 91.84  ? 684 GLY G N   1 
ATOM   8821 C CA  . GLY G 2 3   ? 57.351  41.674 58.570 1.00 88.78  ? 684 GLY G CA  1 
ATOM   8822 C C   . GLY G 2 3   ? 55.940  41.861 59.085 1.00 86.69  ? 684 GLY G C   1 
ATOM   8823 O O   . GLY G 2 3   ? 55.502  41.188 60.024 1.00 86.16  ? 684 GLY G O   1 
ATOM   8824 N N   . LEU G 2 4   ? 55.221  42.777 58.454 1.00 84.70  ? 685 LEU G N   1 
ATOM   8825 C CA  . LEU G 2 4   ? 53.844  43.020 58.816 1.00 81.59  ? 685 LEU G CA  1 
ATOM   8826 C C   . LEU G 2 4   ? 52.966  42.649 57.647 1.00 79.86  ? 685 LEU G C   1 
ATOM   8827 O O   . LEU G 2 4   ? 51.865  43.038 57.645 1.00 79.79  ? 685 LEU G O   1 
ATOM   8828 C CB  . LEU G 2 4   ? 53.579  44.501 59.150 1.00 79.93  ? 685 LEU G CB  1 
ATOM   8829 C CG  . LEU G 2 4   ? 53.868  45.501 58.023 1.00 77.93  ? 685 LEU G CG  1 
ATOM   8830 C CD1 . LEU G 2 4   ? 53.088  46.795 58.194 1.00 76.99  ? 685 LEU G CD1 1 
ATOM   8831 C CD2 . LEU G 2 4   ? 55.356  45.765 58.010 1.00 76.99  ? 685 LEU G CD2 1 
ATOM   8832 N N   . GLU G 2 5   ? 53.413  41.898 56.653 1.00 77.67  ? 686 GLU G N   1 
ATOM   8833 C CA  . GLU G 2 5   ? 52.509  41.618 55.531 1.00 75.57  ? 686 GLU G CA  1 
ATOM   8834 C C   . GLU G 2 5   ? 51.167  40.965 55.914 1.00 74.68  ? 686 GLU G C   1 
ATOM   8835 O O   . GLU G 2 5   ? 50.203  41.020 55.147 1.00 74.64  ? 686 GLU G O   1 
ATOM   8836 C CB  . GLU G 2 5   ? 53.183  40.698 54.539 1.00 74.67  ? 686 GLU G CB  1 
ATOM   8837 C CG  . GLU G 2 5   ? 52.981  39.266 54.969 1.00 73.83  ? 686 GLU G CG  1 
ATOM   8838 C CD  . GLU G 2 5   ? 53.792  38.307 54.180 1.00 73.33  ? 686 GLU G CD  1 
ATOM   8839 O OE1 . GLU G 2 5   ? 54.978  38.606 53.943 1.00 72.74  ? 686 GLU G OE1 1 
ATOM   8840 O OE2 . GLU G 2 5   ? 53.250  37.248 53.817 1.00 73.19  ? 686 GLU G OE2 1 
ATOM   8841 N N   . ALA G 2 6   ? 51.118  40.328 57.081 1.00 73.30  ? 687 ALA G N   1 
ATOM   8842 C CA  . ALA G 2 6   ? 49.914  39.632 57.545 1.00 71.89  ? 687 ALA G CA  1 
ATOM   8843 C C   . ALA G 2 6   ? 48.701  40.542 57.713 1.00 71.13  ? 687 ALA G C   1 
ATOM   8844 O O   . ALA G 2 6   ? 47.567  40.142 57.463 1.00 70.57  ? 687 ALA G O   1 
ATOM   8845 C CB  . ALA G 2 6   ? 50.214  38.916 58.853 1.00 71.49  ? 687 ALA G CB  1 
ATOM   8846 N N   . ILE G 2 7   ? 48.969  41.764 58.152 1.00 71.08  ? 688 ILE G N   1 
ATOM   8847 C CA  . ILE G 2 7   ? 47.967  42.808 58.381 1.00 70.47  ? 688 ILE G CA  1 
ATOM   8848 C C   . ILE G 2 7   ? 47.453  43.474 57.082 1.00 69.34  ? 688 ILE G C   1 
ATOM   8849 O O   . ILE G 2 7   ? 46.284  43.821 56.983 1.00 69.29  ? 688 ILE G O   1 
ATOM   8850 C CB  . ILE G 2 7   ? 48.559  43.947 59.280 1.00 71.52  ? 688 ILE G CB  1 
ATOM   8851 C CG1 . ILE G 2 7   ? 49.830  44.503 58.646 1.00 72.79  ? 688 ILE G CG1 1 
ATOM   8852 C CG2 . ILE G 2 7   ? 48.939  43.424 60.654 1.00 71.65  ? 688 ILE G CG2 1 
ATOM   8853 C CD1 . ILE G 2 7   ? 50.160  43.872 57.389 1.00 73.99  ? 688 ILE G CD1 1 
ATOM   8854 N N   . ILE G 2 8   ? 48.343  43.670 56.106 1.00 68.14  ? 689 ILE G N   1 
ATOM   8855 C CA  . ILE G 2 8   ? 48.013  44.321 54.841 1.00 67.46  ? 689 ILE G CA  1 
ATOM   8856 C C   . ILE G 2 8   ? 47.477  43.301 53.871 1.00 67.33  ? 689 ILE G C   1 
ATOM   8857 O O   . ILE G 2 8   ? 46.693  43.628 52.979 1.00 67.51  ? 689 ILE G O   1 
ATOM   8858 C CB  . ILE G 2 8   ? 49.248  44.987 54.129 1.00 67.14  ? 689 ILE G CB  1 
ATOM   8859 C CG1 . ILE G 2 8   ? 49.731  44.103 52.980 1.00 66.62  ? 689 ILE G CG1 1 
ATOM   8860 C CG2 . ILE G 2 8   ? 50.409  45.173 55.061 1.00 67.44  ? 689 ILE G CG2 1 
ATOM   8861 C CD1 . ILE G 2 8   ? 51.012  44.572 52.349 1.00 66.56  ? 689 ILE G CD1 1 
ATOM   8862 N N   . ARG G 2 9   ? 47.936  42.068 54.027 1.00 66.80  ? 690 ARG G N   1 
ATOM   8863 C CA  . ARG G 2 9   ? 47.507  41.002 53.147 1.00 66.11  ? 690 ARG G CA  1 
ATOM   8864 C C   . ARG G 2 9   ? 45.995  40.879 53.237 1.00 65.77  ? 690 ARG G C   1 
ATOM   8865 O O   . ARG G 2 9   ? 45.313  40.596 52.251 1.00 65.45  ? 690 ARG G O   1 
ATOM   8866 C CB  . ARG G 2 9   ? 48.170  39.698 53.563 1.00 65.61  ? 690 ARG G CB  1 
ATOM   8867 C CG  . ARG G 2 9   ? 48.051  38.610 52.521 1.00 65.31  ? 690 ARG G CG  1 
ATOM   8868 C CD  . ARG G 2 9   ? 49.229  37.670 52.640 1.00 64.92  ? 690 ARG G CD  1 
ATOM   8869 N NE  . ARG G 2 9   ? 49.736  37.300 51.326 1.00 64.46  ? 690 ARG G NE  1 
ATOM   8870 C CZ  . ARG G 2 9   ? 51.025  37.159 51.048 1.00 64.04  ? 690 ARG G CZ  1 
ATOM   8871 N NH1 . ARG G 2 9   ? 51.926  37.362 51.993 1.00 64.26  ? 690 ARG G NH1 1 
ATOM   8872 N NH2 . ARG G 2 9   ? 51.417  36.814 49.830 1.00 62.93  ? 690 ARG G NH2 1 
ATOM   8873 N N   . LYS G 2 10  ? 45.485  41.124 54.436 1.00 65.49  ? 691 LYS G N   1 
ATOM   8874 C CA  . LYS G 2 10  ? 44.064  41.047 54.723 1.00 65.75  ? 691 LYS G CA  1 
ATOM   8875 C C   . LYS G 2 10  ? 43.287  42.283 54.293 1.00 66.41  ? 691 LYS G C   1 
ATOM   8876 O O   . LYS G 2 10  ? 42.064  42.245 54.220 1.00 66.33  ? 691 LYS G O   1 
ATOM   8877 C CB  . LYS G 2 10  ? 43.876  40.850 56.213 1.00 66.10  ? 691 LYS G CB  1 
ATOM   8878 C CG  . LYS G 2 10  ? 44.703  41.850 56.994 1.00 67.94  ? 691 LYS G CG  1 
ATOM   8879 C CD  . LYS G 2 10  ? 44.300  41.973 58.454 1.00 68.66  ? 691 LYS G CD  1 
ATOM   8880 C CE  . LYS G 2 10  ? 44.291  40.620 59.147 1.00 67.27  ? 691 LYS G CE  1 
ATOM   8881 N NZ  . LYS G 2 10  ? 45.106  40.610 60.391 1.00 64.20  ? 691 LYS G NZ  1 
ATOM   8882 N N   . ALA G 2 11  ? 43.980  43.386 54.033 1.00 67.79  ? 692 ALA G N   1 
ATOM   8883 C CA  . ALA G 2 11  ? 43.293  44.603 53.620 1.00 69.73  ? 692 ALA G CA  1 
ATOM   8884 C C   . ALA G 2 11  ? 43.046  44.547 52.130 1.00 72.08  ? 692 ALA G C   1 
ATOM   8885 O O   . ALA G 2 11  ? 42.130  45.180 51.614 1.00 71.38  ? 692 ALA G O   1 
ATOM   8886 C CB  . ALA G 2 11  ? 44.119  45.815 53.965 1.00 69.24  ? 692 ALA G CB  1 
ATOM   8887 N N   . LEU G 2 12  ? 43.884  43.784 51.443 1.00 76.31  ? 693 LEU G N   1 
ATOM   8888 C CA  . LEU G 2 12  ? 43.763  43.605 50.005 1.00 81.39  ? 693 LEU G CA  1 
ATOM   8889 C C   . LEU G 2 12  ? 42.474  42.857 49.701 1.00 85.79  ? 693 LEU G C   1 
ATOM   8890 O O   . LEU G 2 12  ? 41.876  43.013 48.631 1.00 86.62  ? 693 LEU G O   1 
ATOM   8891 C CB  . LEU G 2 12  ? 44.937  42.773 49.484 1.00 79.69  ? 693 LEU G CB  1 
ATOM   8892 C CG  . LEU G 2 12  ? 46.063  43.487 48.745 1.00 78.61  ? 693 LEU G CG  1 
ATOM   8893 C CD1 . LEU G 2 12  ? 45.816  44.975 48.754 1.00 78.33  ? 693 LEU G CD1 1 
ATOM   8894 C CD2 . LEU G 2 12  ? 47.390  43.152 49.391 1.00 78.18  ? 693 LEU G CD2 1 
ATOM   8895 N N   . MET G 2 13  ? 42.051  42.064 50.680 1.00 90.23  ? 694 MET G N   1 
ATOM   8896 C CA  . MET G 2 13  ? 40.885  41.202 50.561 1.00 93.84  ? 694 MET G CA  1 
ATOM   8897 C C   . MET G 2 13  ? 39.508  41.682 51.000 1.00 96.31  ? 694 MET G C   1 
ATOM   8898 O O   . MET G 2 13  ? 38.559  40.906 50.915 1.00 97.12  ? 694 MET G O   1 
ATOM   8899 C CB  . MET G 2 13  ? 41.162  39.897 51.314 1.00 94.22  ? 694 MET G CB  1 
ATOM   8900 C CG  . MET G 2 13  ? 42.501  39.252 51.003 1.00 94.90  ? 694 MET G CG  1 
ATOM   8901 S SD  . MET G 2 13  ? 42.730  38.975 49.235 1.00 96.27  ? 694 MET G SD  1 
ATOM   8902 C CE  . MET G 2 13  ? 41.141  38.276 48.795 1.00 95.74  ? 694 MET G CE  1 
ATOM   8903 N N   . GLY G 2 14  ? 39.334  42.921 51.435 1.00 98.67  ? 695 GLY G N   1 
ATOM   8904 C CA  . GLY G 2 14  ? 37.998  43.229 51.912 1.00 101.98 ? 695 GLY G CA  1 
ATOM   8905 C C   . GLY G 2 14  ? 36.983  44.233 51.400 1.00 104.49 ? 695 GLY G C   1 
ATOM   8906 O O   . GLY G 2 14  ? 35.828  44.142 51.815 1.00 104.38 ? 695 GLY G O   1 
ATOM   8907 N N   . LYS G 2 15  ? 37.323  45.131 50.485 1.00 106.87 ? 696 LYS G N   1 
ATOM   8908 C CA  . LYS G 2 15  ? 36.338  46.148 50.131 1.00 109.82 ? 696 LYS G CA  1 
ATOM   8909 C C   . LYS G 2 15  ? 35.376  46.147 48.947 1.00 112.11 ? 696 LYS G C   1 
ATOM   8910 O O   . LYS G 2 15  ? 35.510  45.414 47.961 1.00 111.74 ? 696 LYS G O   1 
ATOM   8911 C CB  . LYS G 2 15  ? 37.022  47.500 50.176 1.00 109.39 ? 696 LYS G CB  1 
ATOM   8912 N N   . TYR G 2 16  ? 34.392  47.034 49.119 1.00 115.26 ? 697 TYR G N   1 
ATOM   8913 C CA  . TYR G 2 16  ? 33.322  47.346 48.176 1.00 118.10 ? 697 TYR G CA  1 
ATOM   8914 C C   . TYR G 2 16  ? 33.372  48.869 48.024 1.00 120.38 ? 697 TYR G C   1 
ATOM   8915 O O   . TYR G 2 16  ? 32.942  49.602 48.920 1.00 120.88 ? 697 TYR G O   1 
ATOM   8916 C CB  . TYR G 2 16  ? 31.936  46.924 48.719 1.00 117.02 ? 697 TYR G CB  1 
ATOM   8917 C CG  . TYR G 2 16  ? 31.572  47.454 50.101 1.00 116.12 ? 697 TYR G CG  1 
ATOM   8918 C CD1 . TYR G 2 16  ? 32.314  47.090 51.226 1.00 115.89 ? 697 TYR G CD1 1 
ATOM   8919 C CD2 . TYR G 2 16  ? 30.485  48.312 50.283 1.00 115.19 ? 697 TYR G CD2 1 
ATOM   8920 C CE1 . TYR G 2 16  ? 31.987  47.564 52.497 1.00 115.10 ? 697 TYR G CE1 1 
ATOM   8921 C CE2 . TYR G 2 16  ? 30.150  48.791 51.555 1.00 114.72 ? 697 TYR G CE2 1 
ATOM   8922 C CZ  . TYR G 2 16  ? 30.908  48.413 52.655 1.00 114.66 ? 697 TYR G CZ  1 
ATOM   8923 O OH  . TYR G 2 16  ? 30.600  48.887 53.910 1.00 114.06 ? 697 TYR G OH  1 
ATOM   8924 N N   . ASP G 2 17  ? 33.935  49.339 46.909 1.00 123.04 ? 698 ASP G N   1 
ATOM   8925 C CA  . ASP G 2 17  ? 34.037  50.775 46.638 1.00 124.92 ? 698 ASP G CA  1 
ATOM   8926 C C   . ASP G 2 17  ? 34.934  51.137 45.453 1.00 125.74 ? 698 ASP G C   1 
ATOM   8927 O O   . ASP G 2 17  ? 35.985  50.531 45.229 1.00 125.83 ? 698 ASP G O   1 
ATOM   8928 C CB  . ASP G 2 17  ? 34.522  51.526 47.884 1.00 125.39 ? 698 ASP G CB  1 
ATOM   8929 C CG  . ASP G 2 17  ? 34.092  52.980 47.885 1.00 125.98 ? 698 ASP G CG  1 
ATOM   8930 O OD1 . ASP G 2 17  ? 33.129  53.313 47.162 1.00 126.30 ? 698 ASP G OD1 1 
ATOM   8931 O OD2 . ASP G 2 17  ? 34.698  53.787 48.618 1.00 126.41 ? 698 ASP G OD2 1 
ATOM   8932 N N   . GLN G 2 18  ? 34.498  52.142 44.703 1.00 126.59 ? 699 GLN G N   1 
ATOM   8933 C CA  . GLN G 2 18  ? 35.226  52.624 43.542 1.00 127.88 ? 699 GLN G CA  1 
ATOM   8934 C C   . GLN G 2 18  ? 34.395  53.687 42.837 1.00 129.14 ? 699 GLN G C   1 
ATOM   8935 O O   . GLN G 2 18  ? 33.169  53.602 42.803 1.00 129.24 ? 699 GLN G O   1 
ATOM   8936 C CB  . GLN G 2 18  ? 35.512  51.472 42.585 1.00 127.30 ? 699 GLN G CB  1 
ATOM   8937 N N   . TRP G 2 19  ? 35.067  54.701 42.302 1.00 130.75 ? 700 TRP G N   1 
ATOM   8938 C CA  . TRP G 2 19  ? 34.395  55.759 41.555 1.00 132.16 ? 700 TRP G CA  1 
ATOM   8939 C C   . TRP G 2 19  ? 35.010  55.769 40.154 1.00 132.60 ? 700 TRP G C   1 
ATOM   8940 O O   . TRP G 2 19  ? 36.249  55.622 40.058 1.00 132.83 ? 700 TRP G O   1 
ATOM   8941 C CB  . TRP G 2 19  ? 34.611  57.141 42.188 1.00 133.03 ? 700 TRP G CB  1 
ATOM   8942 C CG  . TRP G 2 19  ? 34.820  58.157 41.113 1.00 134.37 ? 700 TRP G CG  1 
ATOM   8943 C CD1 . TRP G 2 19  ? 33.870  58.648 40.255 1.00 134.37 ? 700 TRP G CD1 1 
ATOM   8944 C CD2 . TRP G 2 19  ? 36.085  58.610 40.608 1.00 135.00 ? 700 TRP G CD2 1 
ATOM   8945 N NE1 . TRP G 2 19  ? 34.469  59.357 39.241 1.00 134.79 ? 700 TRP G NE1 1 
ATOM   8946 C CE2 . TRP G 2 19  ? 35.827  59.350 39.432 1.00 135.13 ? 700 TRP G CE2 1 
ATOM   8947 C CE3 . TRP G 2 19  ? 37.415  58.451 41.030 1.00 134.93 ? 700 TRP G CE3 1 
ATOM   8948 C CZ2 . TRP G 2 19  ? 36.853  59.931 38.670 1.00 135.08 ? 700 TRP G CZ2 1 
ATOM   8949 C CZ3 . TRP G 2 19  ? 38.435  59.027 40.272 1.00 134.54 ? 700 TRP G CZ3 1 
ATOM   8950 C CH2 . TRP G 2 19  ? 38.145  59.758 39.105 1.00 134.71 ? 700 TRP G CH2 1 
ATOM   8951 O OXT . TRP G 2 19  ? 34.255  55.962 39.177 1.00 133.16 ? 700 TRP G OXT 1 
ATOM   8952 N N   . ASN H 2 1   ? 1.878   63.711 67.204 1.00 84.30  ? 682 ASN H N   1 
ATOM   8953 C CA  . ASN H 2 1   ? 0.817   64.735 67.414 1.00 84.77  ? 682 ASN H CA  1 
ATOM   8954 C C   . ASN H 2 1   ? -0.014  64.473 68.670 1.00 85.34  ? 682 ASN H C   1 
ATOM   8955 O O   . ASN H 2 1   ? -0.614  65.403 69.210 1.00 85.69  ? 682 ASN H O   1 
ATOM   8956 C CB  . ASN H 2 1   ? -0.096  64.803 66.190 1.00 83.98  ? 682 ASN H CB  1 
ATOM   8957 N N   . MET H 2 2   ? -0.055  63.221 69.135 1.00 85.56  ? 683 MET H N   1 
ATOM   8958 C CA  . MET H 2 2   ? -0.832  62.876 70.338 1.00 85.31  ? 683 MET H CA  1 
ATOM   8959 C C   . MET H 2 2   ? -0.223  61.727 71.161 1.00 84.19  ? 683 MET H C   1 
ATOM   8960 O O   . MET H 2 2   ? 0.843   61.211 70.818 1.00 84.44  ? 683 MET H O   1 
ATOM   8961 C CB  . MET H 2 2   ? -2.286  62.535 69.953 1.00 86.16  ? 683 MET H CB  1 
ATOM   8962 C CG  . MET H 2 2   ? -3.267  62.466 71.124 1.00 86.90  ? 683 MET H CG  1 
ATOM   8963 S SD  . MET H 2 2   ? -3.376  63.964 72.131 1.00 87.98  ? 683 MET H SD  1 
ATOM   8964 C CE  . MET H 2 2   ? -5.081  64.463 71.902 1.00 86.77  ? 683 MET H CE  1 
ATOM   8965 N N   . GLY H 2 3   ? -0.906  61.352 72.249 1.00 82.59  ? 684 GLY H N   1 
ATOM   8966 C CA  . GLY H 2 3   ? -0.447  60.285 73.134 1.00 79.62  ? 684 GLY H CA  1 
ATOM   8967 C C   . GLY H 2 3   ? -0.859  58.883 72.704 1.00 77.68  ? 684 GLY H C   1 
ATOM   8968 O O   . GLY H 2 3   ? -2.051  58.580 72.577 1.00 78.17  ? 684 GLY H O   1 
ATOM   8969 N N   . LEU H 2 4   ? 0.137   58.021 72.502 1.00 74.36  ? 685 LEU H N   1 
ATOM   8970 C CA  . LEU H 2 4   ? -0.081  56.646 72.051 1.00 69.94  ? 685 LEU H CA  1 
ATOM   8971 C C   . LEU H 2 4   ? 1.180   55.832 72.301 1.00 67.57  ? 685 LEU H C   1 
ATOM   8972 O O   . LEU H 2 4   ? 1.416   54.814 71.654 1.00 66.65  ? 685 LEU H O   1 
ATOM   8973 C CB  . LEU H 2 4   ? -0.353  56.638 70.554 1.00 68.44  ? 685 LEU H CB  1 
ATOM   8974 C CG  . LEU H 2 4   ? 0.856   57.216 69.808 1.00 66.06  ? 685 LEU H CG  1 
ATOM   8975 C CD1 . LEU H 2 4   ? 0.955   56.614 68.444 1.00 66.69  ? 685 LEU H CD1 1 
ATOM   8976 C CD2 . LEU H 2 4   ? 0.750   58.714 69.713 1.00 64.50  ? 685 LEU H CD2 1 
ATOM   8977 N N   . GLU H 2 5   ? 1.998   56.312 73.224 1.00 64.85  ? 686 GLU H N   1 
ATOM   8978 C CA  . GLU H 2 5   ? 3.249   55.661 73.567 1.00 62.28  ? 686 GLU H CA  1 
ATOM   8979 C C   . GLU H 2 5   ? 2.951   54.301 74.131 1.00 60.16  ? 686 GLU H C   1 
ATOM   8980 O O   . GLU H 2 5   ? 3.716   53.360 73.963 1.00 59.66  ? 686 GLU H O   1 
ATOM   8981 C CB  . GLU H 2 5   ? 3.971   56.497 74.607 1.00 62.59  ? 686 GLU H CB  1 
ATOM   8982 C CG  . GLU H 2 5   ? 3.180   57.735 74.974 1.00 63.78  ? 686 GLU H CG  1 
ATOM   8983 C CD  . GLU H 2 5   ? 3.932   58.641 75.907 1.00 64.88  ? 686 GLU H CD  1 
ATOM   8984 O OE1 . GLU H 2 5   ? 3.457   59.774 76.133 1.00 66.04  ? 686 GLU H OE1 1 
ATOM   8985 O OE2 . GLU H 2 5   ? 4.994   58.221 76.413 1.00 63.69  ? 686 GLU H OE2 1 
ATOM   8986 N N   . ALA H 2 6   ? 1.816   54.218 74.807 1.00 58.62  ? 687 ALA H N   1 
ATOM   8987 C CA  . ALA H 2 6   ? 1.374   52.986 75.430 1.00 57.53  ? 687 ALA H CA  1 
ATOM   8988 C C   . ALA H 2 6   ? 1.493   51.827 74.450 1.00 56.49  ? 687 ALA H C   1 
ATOM   8989 O O   . ALA H 2 6   ? 1.730   50.680 74.836 1.00 57.33  ? 687 ALA H O   1 
ATOM   8990 C CB  . ALA H 2 6   ? -0.067  53.142 75.885 1.00 58.03  ? 687 ALA H CB  1 
ATOM   8991 N N   . ILE H 2 7   ? 1.345   52.154 73.174 1.00 54.03  ? 688 ILE H N   1 
ATOM   8992 C CA  . ILE H 2 7   ? 1.383   51.182 72.090 1.00 51.46  ? 688 ILE H CA  1 
ATOM   8993 C C   . ILE H 2 7   ? 2.783   50.880 71.639 1.00 49.83  ? 688 ILE H C   1 
ATOM   8994 O O   . ILE H 2 7   ? 3.213   49.733 71.535 1.00 49.00  ? 688 ILE H O   1 
ATOM   8995 C CB  . ILE H 2 7   ? 0.669   51.740 70.862 1.00 51.71  ? 688 ILE H CB  1 
ATOM   8996 C CG1 . ILE H 2 7   ? -0.712  52.251 71.260 1.00 52.88  ? 688 ILE H CG1 1 
ATOM   8997 C CG2 . ILE H 2 7   ? 0.616   50.691 69.769 1.00 50.09  ? 688 ILE H CG2 1 
ATOM   8998 C CD1 . ILE H 2 7   ? -1.593  51.189 71.889 1.00 54.42  ? 688 ILE H CD1 1 
ATOM   8999 N N   . ILE H 2 8   ? 3.460   51.968 71.328 1.00 48.86  ? 689 ILE H N   1 
ATOM   9000 C CA  . ILE H 2 8   ? 4.807   51.958 70.823 1.00 48.00  ? 689 ILE H CA  1 
ATOM   9001 C C   . ILE H 2 8   ? 5.781   51.541 71.895 1.00 48.72  ? 689 ILE H C   1 
ATOM   9002 O O   . ILE H 2 8   ? 6.889   51.109 71.609 1.00 48.94  ? 689 ILE H O   1 
ATOM   9003 C CB  . ILE H 2 8   ? 5.162   53.358 70.308 1.00 46.25  ? 689 ILE H CB  1 
ATOM   9004 C CG1 . ILE H 2 8   ? 6.275   53.958 71.140 1.00 44.65  ? 689 ILE H CG1 1 
ATOM   9005 C CG2 . ILE H 2 8   ? 3.958   54.282 70.434 1.00 44.82  ? 689 ILE H CG2 1 
ATOM   9006 C CD1 . ILE H 2 8   ? 6.885   55.116 70.474 1.00 46.67  ? 689 ILE H CD1 1 
ATOM   9007 N N   . ARG H 2 9   ? 5.348   51.663 73.138 1.00 49.93  ? 690 ARG H N   1 
ATOM   9008 C CA  . ARG H 2 9   ? 6.186   51.326 74.275 1.00 50.34  ? 690 ARG H CA  1 
ATOM   9009 C C   . ARG H 2 9   ? 6.496   49.849 74.356 1.00 51.83  ? 690 ARG H C   1 
ATOM   9010 O O   . ARG H 2 9   ? 7.625   49.449 74.625 1.00 51.83  ? 690 ARG H O   1 
ATOM   9011 C CB  . ARG H 2 9   ? 5.493   51.748 75.558 1.00 48.43  ? 690 ARG H CB  1 
ATOM   9012 C CG  . ARG H 2 9   ? 6.435   51.917 76.725 1.00 46.13  ? 690 ARG H CG  1 
ATOM   9013 C CD  . ARG H 2 9   ? 6.059   53.182 77.466 1.00 44.10  ? 690 ARG H CD  1 
ATOM   9014 N NE  . ARG H 2 9   ? 7.238   53.903 77.911 1.00 42.12  ? 690 ARG H NE  1 
ATOM   9015 C CZ  . ARG H 2 9   ? 7.241   55.189 78.223 1.00 41.61  ? 690 ARG H CZ  1 
ATOM   9016 N NH1 . ARG H 2 9   ? 6.119   55.889 78.133 1.00 41.99  ? 690 ARG H NH1 1 
ATOM   9017 N NH2 . ARG H 2 9   ? 8.365   55.773 78.612 1.00 42.71  ? 690 ARG H NH2 1 
ATOM   9018 N N   . LYS H 2 10  ? 5.469   49.049 74.119 1.00 54.46  ? 691 LYS H N   1 
ATOM   9019 C CA  . LYS H 2 10  ? 5.564   47.601 74.188 1.00 57.55  ? 691 LYS H CA  1 
ATOM   9020 C C   . LYS H 2 10  ? 5.953   46.951 72.870 1.00 58.73  ? 691 LYS H C   1 
ATOM   9021 O O   . LYS H 2 10  ? 6.029   45.727 72.783 1.00 58.72  ? 691 LYS H O   1 
ATOM   9022 C CB  . LYS H 2 10  ? 4.222   47.051 74.607 1.00 59.32  ? 691 LYS H CB  1 
ATOM   9023 C CG  . LYS H 2 10  ? 3.186   47.346 73.548 1.00 60.90  ? 691 LYS H CG  1 
ATOM   9024 C CD  . LYS H 2 10  ? 1.831   46.781 73.899 1.00 62.83  ? 691 LYS H CD  1 
ATOM   9025 C CE  . LYS H 2 10  ? 0.948   46.837 72.670 1.00 64.88  ? 691 LYS H CE  1 
ATOM   9026 N NZ  . LYS H 2 10  ? -0.486  46.748 73.034 1.00 65.21  ? 691 LYS H NZ  1 
ATOM   9027 N N   . ALA H 2 11  ? 6.148   47.759 71.834 1.00 60.07  ? 692 ALA H N   1 
ATOM   9028 C CA  . ALA H 2 11  ? 6.548   47.222 70.545 1.00 61.03  ? 692 ALA H CA  1 
ATOM   9029 C C   . ALA H 2 11  ? 8.060   47.208 70.644 1.00 62.36  ? 692 ALA H C   1 
ATOM   9030 O O   . ALA H 2 11  ? 8.757   46.447 69.968 1.00 61.65  ? 692 ALA H O   1 
ATOM   9031 C CB  . ALA H 2 11  ? 6.094   48.143 69.438 1.00 60.43  ? 692 ALA H CB  1 
ATOM   9032 N N   . LEU H 2 12  ? 8.543   48.067 71.532 1.00 63.99  ? 693 LEU H N   1 
ATOM   9033 C CA  . LEU H 2 12  ? 9.957   48.213 71.786 1.00 66.08  ? 693 LEU H CA  1 
ATOM   9034 C C   . LEU H 2 12  ? 10.520  47.025 72.531 1.00 69.94  ? 693 LEU H C   1 
ATOM   9035 O O   . LEU H 2 12  ? 11.723  46.765 72.482 1.00 69.35  ? 693 LEU H O   1 
ATOM   9036 C CB  . LEU H 2 12  ? 10.207  49.474 72.609 1.00 62.66  ? 693 LEU H CB  1 
ATOM   9037 C CG  . LEU H 2 12  ? 10.616  50.725 71.840 1.00 60.59  ? 693 LEU H CG  1 
ATOM   9038 C CD1 . LEU H 2 12  ? 11.072  50.334 70.449 1.00 59.34  ? 693 LEU H CD1 1 
ATOM   9039 C CD2 . LEU H 2 12  ? 9.468   51.689 71.768 1.00 60.16  ? 693 LEU H CD2 1 
ATOM   9040 N N   . MET H 2 13  ? 9.646   46.287 73.204 1.00 75.90  ? 694 MET H N   1 
ATOM   9041 C CA  . MET H 2 13  ? 10.091  45.162 74.005 1.00 82.07  ? 694 MET H CA  1 
ATOM   9042 C C   . MET H 2 13  ? 10.141  43.776 73.363 1.00 86.45  ? 694 MET H C   1 
ATOM   9043 O O   . MET H 2 13  ? 11.211  43.321 72.977 1.00 87.42  ? 694 MET H O   1 
ATOM   9044 C CB  . MET H 2 13  ? 9.264   45.099 75.287 1.00 82.23  ? 694 MET H CB  1 
ATOM   9045 C CG  . MET H 2 13  ? 8.893   46.455 75.877 1.00 83.69  ? 694 MET H CG  1 
ATOM   9046 S SD  . MET H 2 13  ? 10.203  47.696 76.000 1.00 86.98  ? 694 MET H SD  1 
ATOM   9047 C CE  . MET H 2 13  ? 11.543  46.807 76.788 1.00 84.91  ? 694 MET H CE  1 
ATOM   9048 N N   . GLY H 2 14  ? 9.000   43.103 73.243 1.00 90.93  ? 695 GLY H N   1 
ATOM   9049 C CA  . GLY H 2 14  ? 9.008   41.753 72.694 1.00 97.61  ? 695 GLY H CA  1 
ATOM   9050 C C   . GLY H 2 14  ? 9.036   41.501 71.194 1.00 102.67 ? 695 GLY H C   1 
ATOM   9051 O O   . GLY H 2 14  ? 8.028   41.682 70.513 1.00 102.83 ? 695 GLY H O   1 
ATOM   9052 N N   . LYS H 2 15  ? 10.175  41.058 70.667 1.00 107.56 ? 696 LYS H N   1 
ATOM   9053 C CA  . LYS H 2 15  ? 10.265  40.771 69.237 1.00 112.83 ? 696 LYS H CA  1 
ATOM   9054 C C   . LYS H 2 15  ? 11.542  40.044 68.860 1.00 116.53 ? 696 LYS H C   1 
ATOM   9055 O O   . LYS H 2 15  ? 12.452  39.896 69.682 1.00 117.03 ? 696 LYS H O   1 
ATOM   9056 C CB  . LYS H 2 15  ? 10.130  42.048 68.429 1.00 112.37 ? 696 LYS H CB  1 
ATOM   9057 N N   . TYR H 2 16  ? 11.626  39.618 67.601 1.00 120.94 ? 697 TYR H N   1 
ATOM   9058 C CA  . TYR H 2 16  ? 12.787  38.851 67.197 1.00 124.95 ? 697 TYR H CA  1 
ATOM   9059 C C   . TYR H 2 16  ? 13.242  38.789 65.738 1.00 126.99 ? 697 TYR H C   1 
ATOM   9060 O O   . TYR H 2 16  ? 12.491  38.378 64.850 1.00 127.28 ? 697 TYR H O   1 
ATOM   9061 C CB  . TYR H 2 16  ? 12.597  37.427 67.719 1.00 125.96 ? 697 TYR H CB  1 
ATOM   9062 C CG  . TYR H 2 16  ? 11.481  36.619 67.076 1.00 127.09 ? 697 TYR H CG  1 
ATOM   9063 C CD1 . TYR H 2 16  ? 11.719  35.848 65.934 1.00 127.15 ? 697 TYR H CD1 1 
ATOM   9064 C CD2 . TYR H 2 16  ? 10.197  36.593 67.631 1.00 127.33 ? 697 TYR H CD2 1 
ATOM   9065 C CE1 . TYR H 2 16  ? 10.715  35.068 65.364 1.00 127.13 ? 697 TYR H CE1 1 
ATOM   9066 C CE2 . TYR H 2 16  ? 9.183   35.815 67.065 1.00 127.31 ? 697 TYR H CE2 1 
ATOM   9067 C CZ  . TYR H 2 16  ? 9.452   35.055 65.934 1.00 127.25 ? 697 TYR H CZ  1 
ATOM   9068 O OH  . TYR H 2 16  ? 8.468   34.269 65.380 1.00 127.49 ? 697 TYR H OH  1 
ATOM   9069 N N   . ASP H 2 17  ? 14.496  39.190 65.526 1.00 129.12 ? 698 ASP H N   1 
ATOM   9070 C CA  . ASP H 2 17  ? 15.167  39.152 64.229 1.00 131.34 ? 698 ASP H CA  1 
ATOM   9071 C C   . ASP H 2 17  ? 16.223  40.224 64.018 1.00 132.75 ? 698 ASP H C   1 
ATOM   9072 O O   . ASP H 2 17  ? 16.081  41.372 64.445 1.00 132.76 ? 698 ASP H O   1 
ATOM   9073 C CB  . ASP H 2 17  ? 14.182  39.192 63.055 1.00 131.74 ? 698 ASP H CB  1 
ATOM   9074 C CG  . ASP H 2 17  ? 14.450  38.084 62.046 1.00 132.39 ? 698 ASP H CG  1 
ATOM   9075 O OD1 . ASP H 2 17  ? 15.638  37.755 61.833 1.00 133.19 ? 698 ASP H OD1 1 
ATOM   9076 O OD2 . ASP H 2 17  ? 13.483  37.546 61.466 1.00 132.64 ? 698 ASP H OD2 1 
ATOM   9077 N N   . GLN H 2 18  ? 17.291  39.815 63.349 1.00 134.51 ? 699 GLN H N   1 
ATOM   9078 C CA  . GLN H 2 18  ? 18.404  40.689 63.038 1.00 136.44 ? 699 GLN H CA  1 
ATOM   9079 C C   . GLN H 2 18  ? 19.086  40.170 61.781 1.00 138.00 ? 699 GLN H C   1 
ATOM   9080 O O   . GLN H 2 18  ? 19.795  39.162 61.829 1.00 138.54 ? 699 GLN H O   1 
ATOM   9081 C CB  . GLN H 2 18  ? 19.397  40.710 64.197 1.00 135.58 ? 699 GLN H CB  1 
ATOM   9082 N N   . TRP H 2 19  ? 18.839  40.825 60.649 1.00 139.60 ? 700 TRP H N   1 
ATOM   9083 C CA  . TRP H 2 19  ? 19.495  40.423 59.411 1.00 141.06 ? 700 TRP H CA  1 
ATOM   9084 C C   . TRP H 2 19  ? 20.824  41.182 59.402 1.00 141.57 ? 700 TRP H C   1 
ATOM   9085 O O   . TRP H 2 19  ? 20.835  42.324 59.915 1.00 141.77 ? 700 TRP H O   1 
ATOM   9086 C CB  . TRP H 2 19  ? 18.674  40.816 58.168 1.00 141.62 ? 700 TRP H CB  1 
ATOM   9087 C CG  . TRP H 2 19  ? 19.568  41.003 56.968 1.00 142.23 ? 700 TRP H CG  1 
ATOM   9088 C CD1 . TRP H 2 19  ? 19.995  40.040 56.093 1.00 142.23 ? 700 TRP H CD1 1 
ATOM   9089 C CD2 . TRP H 2 19  ? 20.315  42.183 56.654 1.00 142.29 ? 700 TRP H CD2 1 
ATOM   9090 N NE1 . TRP H 2 19  ? 20.974  40.548 55.268 1.00 142.34 ? 700 TRP H NE1 1 
ATOM   9091 C CE2 . TRP H 2 19  ? 21.189  41.862 55.593 1.00 142.35 ? 700 TRP H CE2 1 
ATOM   9092 C CE3 . TRP H 2 19  ? 20.337  43.481 57.176 1.00 141.92 ? 700 TRP H CE3 1 
ATOM   9093 C CZ2 . TRP H 2 19  ? 22.077  42.796 55.047 1.00 142.18 ? 700 TRP H CZ2 1 
ATOM   9094 C CZ3 . TRP H 2 19  ? 21.216  44.399 56.634 1.00 141.41 ? 700 TRP H CZ3 1 
ATOM   9095 C CH2 . TRP H 2 19  ? 22.075  44.056 55.584 1.00 141.56 ? 700 TRP H CH2 1 
ATOM   9096 O OXT . TRP H 2 19  ? 21.825  40.647 58.873 1.00 141.97 ? 700 TRP H OXT 1 
HETATM 9097 N N   . 471 I 3 .   ? 73.301  29.338 26.395 1.00 83.53  ? 775 471 A N   1 
HETATM 9098 C CA  . 471 I 3 .   ? 72.748  29.063 27.719 1.00 82.91  ? 775 471 A CA  1 
HETATM 9099 C CB  . 471 I 3 .   ? 73.859  28.918 28.758 1.00 82.37  ? 775 471 A CB  1 
HETATM 9100 C CG  . 471 I 3 .   ? 75.181  28.301 28.364 1.00 82.11  ? 775 471 A CG  1 
HETATM 9101 C CD1 . 471 I 3 .   ? 76.116  29.033 27.740 1.00 81.78  ? 775 471 A CD1 1 
HETATM 9102 C CD2 . 471 I 3 .   ? 75.456  27.013 28.619 1.00 82.27  ? 775 471 A CD2 1 
HETATM 9103 C CE1 . 471 I 3 .   ? 77.291  28.499 27.375 1.00 81.60  ? 775 471 A CE1 1 
HETATM 9104 C CE2 . 471 I 3 .   ? 76.631  26.479 28.255 1.00 82.16  ? 775 471 A CE2 1 
HETATM 9105 C CZ  . 471 I 3 .   ? 77.564  27.210 27.625 1.00 82.15  ? 775 471 A CZ  1 
HETATM 9106 O OH  . 471 I 3 .   ? 78.766  26.674 27.241 1.00 83.21  ? 775 471 A OH  1 
HETATM 9107 C C1A . 471 I 3 .   ? 72.991  28.786 25.155 1.00 84.17  ? 775 471 A C1A 1 
HETATM 9108 C C1F . 471 I 3 .   ? 73.652  29.194 24.074 1.00 84.40  ? 775 471 A C1F 1 
HETATM 9109 C C1B . 471 I 3 .   ? 71.944  27.731 24.948 1.00 84.63  ? 775 471 A C1B 1 
HETATM 9110 C C1H . 471 I 3 .   ? 75.375  30.541 22.722 1.00 85.92  ? 775 471 A C1H 1 
HETATM 9111 C C1I . 471 I 3 .   ? 74.737  30.714 21.555 1.00 86.37  ? 775 471 A C1I 1 
HETATM 9112 C C1J . 471 I 3 .   ? 75.415  31.031 20.442 1.00 86.43  ? 775 471 A C1J 1 
HETATM 9113 C C1K . 471 I 3 .   ? 76.748  31.186 20.449 1.00 87.34  ? 775 471 A C1K 1 
HETATM 9114 C C1N . 471 I 3 .   ? 77.539  31.545 19.212 1.00 88.43  ? 775 471 A C1N 1 
HETATM 9115 F F1Q . 471 I 3 .   ? 76.787  31.567 18.075 1.00 89.95  ? 775 471 A F1Q 1 
HETATM 9116 F F1P . 471 I 3 .   ? 78.085  32.787 19.341 1.00 89.84  ? 775 471 A F1P 1 
HETATM 9117 F F1O . 471 I 3 .   ? 78.564  30.676 18.985 1.00 89.37  ? 775 471 A F1O 1 
HETATM 9118 C C1L . 471 I 3 .   ? 77.383  31.010 21.617 1.00 86.60  ? 775 471 A C1L 1 
HETATM 9119 C C1M . 471 I 3 .   ? 76.707  30.693 22.732 1.00 86.40  ? 775 471 A C1M 1 
HETATM 9120 C C1G . 471 I 3 .   ? 74.745  30.212 23.930 1.00 84.95  ? 775 471 A C1G 1 
HETATM 9121 O O1G . 471 I 3 .   ? 75.121  30.806 24.939 1.00 83.88  ? 775 471 A O1G 1 
HETATM 9122 O O3F . 471 I 3 .   ? 80.476  25.608 21.745 1.00 90.16  ? 775 471 A O3F 1 
HETATM 9123 C C3G . 471 I 3 .   ? 80.368  24.281 22.070 1.00 90.61  ? 775 471 A C3G 1 
HETATM 9124 N N3H . 471 I 3 .   ? 80.249  24.164 23.441 1.00 90.28  ? 775 471 A N3H 1 
HETATM 9125 C C3C . 471 I 3 .   ? 80.286  25.440 23.966 1.00 89.60  ? 775 471 A C3C 1 
HETATM 9126 C C3D . 471 I 3 .   ? 80.428  26.332 22.907 1.00 89.98  ? 775 471 A C3D 1 
HETATM 9127 C C3E . 471 I 3 .   ? 80.522  27.839 22.919 1.00 89.65  ? 775 471 A C3E 1 
HETATM 9128 C C3I . 471 I 3 .   ? 80.382  23.300 21.156 1.00 90.97  ? 775 471 A C3I 1 
HETATM 9129 C C3N . 471 I 3 .   ? 80.279  22.001 21.477 1.00 91.56  ? 775 471 A C3N 1 
HETATM 9130 C C3M . 471 I 3 .   ? 80.299  21.043 20.537 1.00 91.84  ? 775 471 A C3M 1 
HETATM 9131 C C3L . 471 I 3 .   ? 80.424  21.373 19.244 1.00 91.66  ? 775 471 A C3L 1 
HETATM 9132 C C3K . 471 I 3 .   ? 80.527  22.666 18.903 1.00 91.30  ? 775 471 A C3K 1 
HETATM 9133 C C3J . 471 I 3 .   ? 80.506  23.609 19.856 1.00 90.99  ? 775 471 A C3J 1 
HETATM 9134 C C3A . 471 I 3 .   ? 78.784  26.010 25.979 1.00 85.51  ? 775 471 A C3A 1 
HETATM 9135 C C3B . 471 I 3 .   ? 80.187  25.731 25.445 1.00 87.83  ? 775 471 A C3B 1 
HETATM 9136 C C4A . 471 I 3 .   ? 71.793  30.184 28.121 1.00 82.88  ? 775 471 A C4A 1 
HETATM 9137 N N4B . 471 I 3 .   ? 70.387  29.884 27.863 1.00 82.88  ? 775 471 A N4B 1 
HETATM 9138 C C4C . 471 I 3 .   ? 69.647  30.498 26.957 1.00 82.76  ? 775 471 A C4C 1 
HETATM 9139 O O4C . 471 I 3 .   ? 70.064  31.396 26.227 1.00 81.94  ? 775 471 A O4C 1 
HETATM 9140 C C4D . 471 I 3 .   ? 68.201  30.044 26.841 1.00 82.96  ? 775 471 A C4D 1 
HETATM 9141 C C4E . 471 I 3 .   ? 67.999  28.827 25.941 1.00 83.39  ? 775 471 A C4E 1 
HETATM 9142 N N   . 471 J 3 .   ? 22.343  25.273 32.334 1.00 99.36  ? 776 471 B N   1 
HETATM 9143 C CA  . 471 J 3 .   ? 23.007  26.537 32.644 1.00 100.04 ? 776 471 B CA  1 
HETATM 9144 C CB  . 471 J 3 .   ? 22.963  27.494 31.455 1.00 99.93  ? 776 471 B CB  1 
HETATM 9145 C CG  . 471 J 3 .   ? 23.539  26.972 30.159 1.00 99.40  ? 776 471 B CG  1 
HETATM 9146 C CD1 . 471 J 3 .   ? 22.776  26.277 29.300 1.00 98.65  ? 776 471 B CD1 1 
HETATM 9147 C CD2 . 471 J 3 .   ? 24.823  27.180 29.831 1.00 99.06  ? 776 471 B CD2 1 
HETATM 9148 C CE1 . 471 J 3 .   ? 23.285  25.799 28.156 1.00 98.36  ? 776 471 B CE1 1 
HETATM 9149 C CE2 . 471 J 3 .   ? 25.330  26.701 28.685 1.00 98.77  ? 776 471 B CE2 1 
HETATM 9150 C CZ  . 471 J 3 .   ? 24.571  25.999 27.830 1.00 98.72  ? 776 471 B CZ  1 
HETATM 9151 O OH  . 471 J 3 .   ? 25.079  25.495 26.659 1.00 99.08  ? 776 471 B OH  1 
HETATM 9152 C C1A . 471 J 3 .   ? 21.393  24.410 32.875 1.00 98.87  ? 776 471 B C1A 1 
HETATM 9153 C C1F . 471 J 3 .   ? 21.093  23.317 32.177 1.00 98.38  ? 776 471 B C1F 1 
HETATM 9154 C C1B . 471 J 3 .   ? 20.677  24.615 34.178 1.00 98.41  ? 776 471 B C1B 1 
HETATM 9155 C C1H . 471 J 3 .   ? 21.264  21.691 30.177 1.00 98.02  ? 776 471 B C1H 1 
HETATM 9156 C C1I . 471 J 3 .   ? 21.268  20.475 30.745 1.00 98.41  ? 776 471 B C1I 1 
HETATM 9157 C C1J . 471 J 3 .   ? 20.906  19.393 30.039 1.00 98.47  ? 776 471 B C1J 1 
HETATM 9158 C C1K . 471 J 3 .   ? 20.532  19.489 28.754 1.00 98.51  ? 776 471 B C1K 1 
HETATM 9159 C C1N . 471 J 3 .   ? 20.126  18.276 27.949 1.00 98.52  ? 776 471 B C1N 1 
HETATM 9160 F F1Q . 471 J 3 .   ? 19.013  18.515 27.198 1.00 98.81  ? 776 471 B F1Q 1 
HETATM 9161 F F1P . 471 J 3 .   ? 21.141  17.934 27.107 1.00 98.91  ? 776 471 B F1P 1 
HETATM 9162 F F1O . 471 J 3 .   ? 19.855  17.189 28.726 1.00 98.06  ? 776 471 B F1O 1 
HETATM 9163 C C1L . 471 J 3 .   ? 20.529  20.706 28.191 1.00 98.58  ? 776 471 B C1L 1 
HETATM 9164 C C1M . 471 J 3 .   ? 20.891  21.791 28.892 1.00 98.34  ? 776 471 B C1M 1 
HETATM 9165 C C1G . 471 J 3 .   ? 21.636  22.854 30.856 1.00 97.75  ? 776 471 B C1G 1 
HETATM 9166 O O1G . 471 J 3 .   ? 22.493  23.537 30.298 1.00 97.05  ? 776 471 B O1G 1 
HETATM 9167 O O3F . 471 J 3 .   ? 26.188  19.864 25.298 1.00 100.50 ? 776 471 B O3F 1 
HETATM 9168 C C3G . 471 J 3 .   ? 27.489  20.223 25.533 1.00 100.74 ? 776 471 B C3G 1 
HETATM 9169 N N3H . 471 J 3 .   ? 27.566  21.600 25.593 1.00 100.71 ? 776 471 B N3H 1 
HETATM 9170 C C3C . 471 J 3 .   ? 26.293  22.095 25.390 1.00 100.43 ? 776 471 B C3C 1 
HETATM 9171 C C3D . 471 J 3 .   ? 25.443  21.010 25.207 1.00 100.14 ? 776 471 B C3D 1 
HETATM 9172 C C3E . 471 J 3 .   ? 23.955  20.987 24.949 1.00 99.51  ? 776 471 B C3E 1 
HETATM 9173 C C3I . 471 J 3 .   ? 28.494  19.346 25.676 1.00 100.67 ? 776 471 B C3I 1 
HETATM 9174 C C3N . 471 J 3 .   ? 29.758  19.731 25.905 1.00 100.87 ? 776 471 B C3N 1 
HETATM 9175 C C3M . 471 J 3 .   ? 30.749  18.838 26.045 1.00 100.25 ? 776 471 B C3M 1 
HETATM 9176 C C3L . 471 J 3 .   ? 30.487  17.525 25.955 1.00 99.38  ? 776 471 B C3L 1 
HETATM 9177 C C3K . 471 J 3 .   ? 29.229  17.121 25.728 1.00 99.30  ? 776 471 B C3K 1 
HETATM 9178 C C3J . 471 J 3 .   ? 28.252  18.029 25.591 1.00 100.02 ? 776 471 B C3J 1 
HETATM 9179 C C3A . 471 J 3 .   ? 25.742  24.235 26.737 1.00 99.76  ? 776 471 B C3A 1 
HETATM 9180 C C3B . 471 J 3 .   ? 25.970  23.571 25.381 1.00 100.43 ? 776 471 B C3B 1 
HETATM 9181 C C4A . 471 J 3 .   ? 23.001  27.125 34.053 1.00 100.27 ? 776 471 B C4A 1 
HETATM 9182 N N4B . 471 J 3 .   ? 24.332  27.338 34.617 1.00 100.59 ? 776 471 B N4B 1 
HETATM 9183 C C4C . 471 J 3 .   ? 24.711  27.026 35.843 1.00 101.26 ? 776 471 B C4C 1 
HETATM 9184 O O4C . 471 J 3 .   ? 23.970  26.506 36.677 1.00 101.81 ? 776 471 B O4C 1 
HETATM 9185 C C4D . 471 J 3 .   ? 26.161  27.360 36.160 1.00 101.29 ? 776 471 B C4D 1 
HETATM 9186 C C4E . 471 J 3 .   ? 26.412  27.918 37.557 1.00 100.94 ? 776 471 B C4E 1 
HETATM 9187 N N   . 471 K 3 .   ? 55.353  52.805 65.084 1.00 79.43  ? 777 471 C N   1 
HETATM 9188 C CA  . 471 K 3 .   ? 54.925  52.246 63.804 1.00 79.97  ? 777 471 C CA  1 
HETATM 9189 C CB  . 471 K 3 .   ? 54.913  53.384 62.784 1.00 78.91  ? 777 471 C CB  1 
HETATM 9190 C CG  . 471 K 3 .   ? 54.195  54.635 63.236 1.00 78.65  ? 777 471 C CG  1 
HETATM 9191 C CD1 . 471 K 3 .   ? 54.829  55.590 63.932 1.00 77.41  ? 777 471 C CD1 1 
HETATM 9192 C CD2 . 471 K 3 .   ? 52.894  54.826 62.968 1.00 79.32  ? 777 471 C CD2 1 
HETATM 9193 C CE1 . 471 K 3 .   ? 54.194  56.693 64.356 1.00 76.81  ? 777 471 C CE1 1 
HETATM 9194 C CE2 . 471 K 3 .   ? 52.256  55.928 63.390 1.00 78.74  ? 777 471 C CE2 1 
HETATM 9195 C CZ  . 471 K 3 .   ? 52.891  56.878 64.093 1.00 77.65  ? 777 471 C CZ  1 
HETATM 9196 O OH  . 471 K 3 .   ? 52.242  58.001 64.538 1.00 77.47  ? 777 471 C OH  1 
HETATM 9197 C C1A . 471 K 3 .   ? 54.641  52.818 66.281 1.00 79.46  ? 777 471 C C1A 1 
HETATM 9198 C C1F . 471 K 3 .   ? 55.152  53.418 67.353 1.00 78.74  ? 777 471 C C1F 1 
HETATM 9199 C C1B . 471 K 3 .   ? 53.283  52.203 66.457 1.00 79.19  ? 777 471 C C1B 1 
HETATM 9200 C C1H . 471 K 3 .   ? 56.811  54.767 68.730 1.00 76.68  ? 777 471 C C1H 1 
HETATM 9201 C C1I . 471 K 3 .   ? 57.714  54.278 69.594 1.00 76.13  ? 777 471 C C1I 1 
HETATM 9202 C C1J . 471 K 3 .   ? 58.001  54.955 70.715 1.00 76.47  ? 777 471 C C1J 1 
HETATM 9203 C C1K . 471 K 3 .   ? 57.410  56.123 71.008 1.00 75.88  ? 777 471 C C1K 1 
HETATM 9204 C C1N . 471 K 3 .   ? 57.728  56.898 72.266 1.00 75.18  ? 777 471 C C1N 1 
HETATM 9205 F F1Q . 471 K 3 .   ? 58.585  56.250 73.105 1.00 75.26  ? 777 471 C F1Q 1 
HETATM 9206 F F1P . 471 K 3 .   ? 58.332  58.075 71.937 1.00 75.46  ? 777 471 C F1P 1 
HETATM 9207 F F1O . 471 K 3 .   ? 56.600  57.168 72.981 1.00 73.84  ? 777 471 C F1O 1 
HETATM 9208 C C1L . 471 K 3 .   ? 56.507  56.604 70.140 1.00 76.20  ? 777 471 C C1L 1 
HETATM 9209 C C1M . 471 K 3 .   ? 56.214  55.933 69.016 1.00 76.30  ? 777 471 C C1M 1 
HETATM 9210 C C1G . 471 K 3 .   ? 56.457  54.136 67.537 1.00 77.47  ? 777 471 C C1G 1 
HETATM 9211 O O1G . 471 K 3 .   ? 57.265  54.180 66.611 1.00 77.87  ? 777 471 C O1G 1 
HETATM 9212 O O3F . 471 K 3 .   ? 51.752  59.402 70.105 1.00 75.97  ? 777 471 C O3F 1 
HETATM 9213 C C3G . 471 K 3 .   ? 50.392  59.255 70.018 1.00 75.49  ? 777 471 C C3G 1 
HETATM 9214 N N3H . 471 K 3 .   ? 50.045  59.175 68.683 1.00 76.24  ? 777 471 C N3H 1 
HETATM 9215 C C3C . 471 K 3 .   ? 51.207  59.276 67.944 1.00 76.19  ? 777 471 C C3C 1 
HETATM 9216 C C3D . 471 K 3 .   ? 52.265  59.418 68.835 1.00 75.75  ? 777 471 C C3D 1 
HETATM 9217 C C3E . 471 K 3 .   ? 53.744  59.569 68.565 1.00 75.29  ? 777 471 C C3E 1 
HETATM 9218 C C3I . 471 K 3 .   ? 49.586  59.203 71.088 1.00 74.41  ? 777 471 C C3I 1 
HETATM 9219 C C3N . 471 K 3 .   ? 48.254  59.060 71.006 1.00 73.50  ? 777 471 C C3N 1 
HETATM 9220 C C3M . 471 K 3 .   ? 47.476  59.012 72.098 1.00 72.24  ? 777 471 C C3M 1 
HETATM 9221 C C3L . 471 K 3 .   ? 48.027  59.110 73.316 1.00 72.12  ? 777 471 C C3L 1 
HETATM 9222 C C3K . 471 K 3 .   ? 49.356  59.253 73.425 1.00 73.18  ? 777 471 C C3K 1 
HETATM 9223 C C3J . 471 K 3 .   ? 50.113  59.298 72.318 1.00 74.16  ? 777 471 C C3J 1 
HETATM 9224 C C3A . 471 K 3 .   ? 51.551  57.892 65.782 1.00 77.13  ? 777 471 C C3A 1 
HETATM 9225 C C3B . 471 K 3 .   ? 51.237  59.236 66.434 1.00 76.48  ? 777 471 C C3B 1 
HETATM 9226 C C4A . 471 K 3 .   ? 55.539  50.901 63.424 1.00 81.66  ? 777 471 C C4A 1 
HETATM 9227 N N4B . 471 K 3 .   ? 54.590  49.953 62.844 1.00 84.58  ? 777 471 C N4B 1 
HETATM 9228 C C4C . 471 K 3 .   ? 54.138  48.842 63.396 1.00 85.46  ? 777 471 C C4C 1 
HETATM 9229 O O4C . 471 K 3 .   ? 54.459  48.443 64.515 1.00 86.25  ? 777 471 C O4C 1 
HETATM 9230 C C4D . 471 K 3 .   ? 53.160  48.055 62.537 1.00 85.21  ? 777 471 C C4D 1 
HETATM 9231 C C4E . 471 K 3 .   ? 51.863  47.643 63.228 1.00 84.30  ? 777 471 C C4E 1 
HETATM 9232 N N   . 471 L 3 .   ? -5.782  57.873 61.963 1.00 112.65 ? 778 471 D N   1 
HETATM 9233 C CA  . 471 L 3 .   ? -4.455  57.590 62.506 1.00 112.39 ? 778 471 D CA  1 
HETATM 9234 C CB  . 471 L 3 .   ? -3.394  57.701 61.412 1.00 110.72 ? 778 471 D CB  1 
HETATM 9235 C CG  . 471 L 3 .   ? -3.766  57.025 60.112 1.00 108.53 ? 778 471 D CG  1 
HETATM 9236 C CD1 . 471 L 3 .   ? -4.466  57.689 59.181 1.00 107.40 ? 778 471 D CD1 1 
HETATM 9237 C CD2 . 471 L 3 .   ? -3.421  55.751 59.867 1.00 107.06 ? 778 471 D CD2 1 
HETATM 9238 C CE1 . 471 L 3 .   ? -4.822  57.099 58.030 1.00 106.18 ? 778 471 D CE1 1 
HETATM 9239 C CE2 . 471 L 3 .   ? -3.777  55.162 58.715 1.00 105.91 ? 778 471 D CE2 1 
HETATM 9240 C CZ  . 471 L 3 .   ? -4.482  55.824 57.786 1.00 105.31 ? 778 471 D CZ  1 
HETATM 9241 O OH  . 471 L 3 .   ? -4.858  55.224 56.612 1.00 103.81 ? 778 471 D OH  1 
HETATM 9242 C C1A . 471 L 3 .   ? -7.055  57.430 62.310 1.00 113.22 ? 778 471 D C1A 1 
HETATM 9243 C C1F . 471 L 3 .   ? -8.114  57.820 61.604 1.00 113.58 ? 778 471 D C1F 1 
HETATM 9244 C C1B . 471 L 3 .   ? -7.344  56.495 63.447 1.00 113.61 ? 778 471 D C1B 1 
HETATM 9245 C C1H . 471 L 3 .   ? -9.537  58.909 59.814 1.00 115.19 ? 778 471 D C1H 1 
HETATM 9246 C C1I . 471 L 3 .   ? -9.558  59.068 58.481 1.00 116.13 ? 778 471 D C1I 1 
HETATM 9247 C C1J . 471 L 3 .   ? -10.708 59.240 57.813 1.00 116.91 ? 778 471 D C1J 1 
HETATM 9248 C C1K . 471 L 3 .   ? -11.884 59.259 58.458 1.00 117.19 ? 778 471 D C1K 1 
HETATM 9249 C C1N . 471 L 3 .   ? -13.170 59.447 57.687 1.00 117.69 ? 778 471 D C1N 1 
HETATM 9250 F F1Q . 471 L 3 .   ? -13.479 60.772 57.599 1.00 118.83 ? 778 471 D F1Q 1 
HETATM 9251 F F1P . 471 L 3 .   ? -13.092 58.962 56.416 1.00 118.10 ? 778 471 D F1P 1 
HETATM 9252 F F1O . 471 L 3 .   ? -14.210 58.789 58.274 1.00 118.03 ? 778 471 D F1O 1 
HETATM 9253 C C1L . 471 L 3 .   ? -11.864 59.107 59.791 1.00 116.08 ? 778 471 D C1L 1 
HETATM 9254 C C1M . 471 L 3 .   ? -10.713 58.935 60.458 1.00 115.48 ? 778 471 D C1M 1 
HETATM 9255 C C1G . 471 L 3 .   ? -8.285  58.720 60.415 1.00 114.10 ? 778 471 D C1G 1 
HETATM 9256 O O1G . 471 L 3 .   ? -7.298  59.302 59.966 1.00 112.85 ? 778 471 D O1G 1 
HETATM 9257 O O3F . 471 L 3 .   ? -10.383 53.942 55.177 1.00 100.21 ? 778 471 D O3F 1 
HETATM 9258 C C3G . 471 L 3 .   ? -9.996  52.645 55.391 1.00 100.08 ? 778 471 D C3G 1 
HETATM 9259 N N3H . 471 L 3 .   ? -8.618  52.592 55.465 1.00 101.21 ? 778 471 D N3H 1 
HETATM 9260 C C3C . 471 L 3 .   ? -8.154  53.880 55.290 1.00 100.73 ? 778 471 D C3C 1 
HETATM 9261 C C3D . 471 L 3 .   ? -9.253  54.715 55.112 1.00 100.05 ? 778 471 D C3D 1 
HETATM 9262 C C3E . 471 L 3 .   ? -9.303  56.207 54.881 1.00 99.26  ? 778 471 D C3E 1 
HETATM 9263 C C3I . 471 L 3 .   ? -10.858 51.623 55.503 1.00 98.74  ? 778 471 D C3I 1 
HETATM 9264 C C3N . 471 L 3 .   ? -10.461 50.359 55.712 1.00 97.98  ? 778 471 D C3N 1 
HETATM 9265 C C3M . 471 L 3 .   ? -11.345 49.356 55.818 1.00 97.51  ? 778 471 D C3M 1 
HETATM 9266 C C3L . 471 L 3 .   ? -12.658 49.607 55.715 1.00 96.98  ? 778 471 D C3L 1 
HETATM 9267 C C3K . 471 L 3 .   ? -13.075 50.864 55.507 1.00 97.01  ? 778 471 D C3K 1 
HETATM 9268 C C3J . 471 L 3 .   ? -12.176 51.854 55.403 1.00 97.71  ? 778 471 D C3J 1 
HETATM 9269 C C3A . 471 L 3 .   ? -6.060  54.458 56.675 1.00 101.82 ? 778 471 D C3A 1 
HETATM 9270 C C3B . 471 L 3 .   ? -6.687  54.237 55.300 1.00 101.31 ? 778 471 D C3B 1 
HETATM 9271 C C4A . 471 L 3 .   ? -4.067  57.978 63.930 1.00 113.07 ? 778 471 D C4A 1 
HETATM 9272 N N4B . 471 L 3 .   ? -3.537  56.891 64.750 1.00 113.35 ? 778 471 D N4B 1 
HETATM 9273 C C4C . 471 L 3 .   ? -3.957  56.572 65.961 1.00 112.90 ? 778 471 D C4C 1 
HETATM 9274 O O4C . 471 L 3 .   ? -4.864  57.163 66.545 1.00 113.37 ? 778 471 D O4C 1 
HETATM 9275 C C4D . 471 L 3 .   ? -3.232  55.402 66.605 1.00 112.23 ? 778 471 D C4D 1 
HETATM 9276 C C4E . 471 L 3 .   ? -4.076  54.537 67.537 1.00 111.97 ? 778 471 D C4E 1 
HETATM 9277 O O   . HOH M 4 .   ? 95.416  26.913 46.847 1.00 11.53  ? 776 HOH A O   1 
HETATM 9278 O O   . HOH M 4 .   ? 69.322  18.782 53.454 1.00 7.55   ? 777 HOH A O   1 
HETATM 9279 O O   . HOH M 4 .   ? 61.381  32.792 55.986 1.00 28.04  ? 778 HOH A O   1 
HETATM 9280 O O   . HOH M 4 .   ? 86.778  29.241 38.003 1.00 6.55   ? 779 HOH A O   1 
HETATM 9281 O O   . HOH M 4 .   ? 98.293  27.383 41.590 1.00 42.62  ? 780 HOH A O   1 
HETATM 9282 O O   . HOH M 4 .   ? 76.709  36.759 55.798 1.00 18.14  ? 781 HOH A O   1 
HETATM 9283 O O   . HOH M 4 .   ? 97.208  29.321 47.344 1.00 9.26   ? 782 HOH A O   1 
HETATM 9284 O O   . HOH M 4 .   ? 92.355  32.147 19.818 1.00 28.82  ? 783 HOH A O   1 
HETATM 9285 O O   . HOH M 4 .   ? 70.591  38.331 37.066 1.00 6.55   ? 784 HOH A O   1 
HETATM 9286 O O   . HOH M 4 .   ? 80.370  9.885  41.524 1.00 22.47  ? 785 HOH A O   1 
HETATM 9287 O O   . HOH M 4 .   ? 84.876  41.451 36.108 1.00 6.55   ? 786 HOH A O   1 
HETATM 9288 O O   . HOH M 4 .   ? 61.971  22.170 27.221 1.00 70.60  ? 787 HOH A O   1 
HETATM 9289 O O   . HOH M 4 .   ? 83.468  21.096 29.049 1.00 57.44  ? 788 HOH A O   1 
HETATM 9290 O O   . HOH M 4 .   ? 79.303  24.967 34.364 1.00 77.71  ? 789 HOH A O   1 
HETATM 9291 O O   . HOH M 4 .   ? 82.185  23.908 27.963 1.00 11.47  ? 790 HOH A O   1 
HETATM 9292 O O   . HOH M 4 .   ? 88.620  43.548 37.809 1.00 26.68  ? 791 HOH A O   1 
HETATM 9293 O O   . HOH M 4 .   ? 72.656  14.836 45.237 1.00 16.67  ? 792 HOH A O   1 
HETATM 9294 O O   . HOH M 4 .   ? 86.989  14.874 32.030 1.00 52.90  ? 793 HOH A O   1 
HETATM 9295 O O   . HOH M 4 .   ? 91.677  35.598 51.454 1.00 6.55   ? 794 HOH A O   1 
HETATM 9296 O O   . HOH M 4 .   ? 91.949  15.211 25.933 1.00 31.84  ? 795 HOH A O   1 
HETATM 9297 O O   . HOH M 4 .   ? 79.383  18.018 31.201 1.00 62.75  ? 796 HOH A O   1 
HETATM 9298 O O   . HOH M 4 .   ? 97.832  33.247 48.449 1.00 49.74  ? 797 HOH A O   1 
HETATM 9299 O O   . HOH M 4 .   ? 80.126  21.981 25.472 1.00 23.67  ? 798 HOH A O   1 
HETATM 9300 O O   . HOH M 4 .   ? 96.263  25.451 31.635 1.00 15.87  ? 799 HOH A O   1 
HETATM 9301 O O   . HOH M 4 .   ? 91.898  23.561 40.766 1.00 41.92  ? 800 HOH A O   1 
HETATM 9302 O O   . HOH M 4 .   ? 88.634  14.192 28.417 1.00 33.60  ? 801 HOH A O   1 
HETATM 9303 O O   . HOH M 4 .   ? 94.965  31.947 30.139 1.00 20.64  ? 802 HOH A O   1 
HETATM 9304 O O   . HOH M 4 .   ? 83.529  12.686 46.860 1.00 16.56  ? 803 HOH A O   1 
HETATM 9305 O O   . HOH M 4 .   ? 84.393  42.418 27.214 1.00 9.15   ? 804 HOH A O   1 
HETATM 9306 O O   . HOH M 4 .   ? 86.270  30.205 9.418  1.00 51.12  ? 805 HOH A O   1 
HETATM 9307 O O   . HOH M 4 .   ? 89.612  31.774 40.110 1.00 32.41  ? 806 HOH A O   1 
HETATM 9308 O O   . HOH M 4 .   ? 81.301  23.144 31.517 1.00 15.86  ? 807 HOH A O   1 
HETATM 9309 O O   . HOH M 4 .   ? 89.316  36.909 52.401 1.00 38.89  ? 808 HOH A O   1 
HETATM 9310 O O   . HOH M 4 .   ? 93.586  22.310 14.130 1.00 50.11  ? 809 HOH A O   1 
HETATM 9311 O O   . HOH M 4 .   ? 86.016  12.403 44.665 1.00 30.38  ? 810 HOH A O   1 
HETATM 9312 O O   . HOH M 4 .   ? 96.524  32.521 36.856 1.00 28.36  ? 811 HOH A O   1 
HETATM 9313 O O   . HOH M 4 .   ? 78.014  23.707 29.071 1.00 52.03  ? 812 HOH A O   1 
HETATM 9314 O O   . HOH M 4 .   ? 96.081  15.348 29.611 1.00 30.23  ? 813 HOH A O   1 
HETATM 9315 O O   . HOH M 4 .   ? 85.784  35.096 22.286 1.00 7.24   ? 814 HOH A O   1 
HETATM 9316 O O   . HOH M 4 .   ? 93.493  36.992 23.571 1.00 58.43  ? 815 HOH A O   1 
HETATM 9317 O O   . HOH M 4 .   ? 91.482  38.995 28.172 1.00 49.82  ? 816 HOH A O   1 
HETATM 9318 O O   . HOH M 4 .   ? 74.821  40.330 44.124 1.00 52.42  ? 817 HOH A O   1 
HETATM 9319 O O   . HOH M 4 .   ? 93.867  37.995 27.874 1.00 35.21  ? 818 HOH A O   1 
HETATM 9320 O O   . HOH M 4 .   ? 83.015  23.155 34.961 1.00 40.26  ? 819 HOH A O   1 
HETATM 9321 O O   . HOH M 4 .   ? 80.460  41.932 34.538 1.00 14.99  ? 820 HOH A O   1 
HETATM 9322 O O   . HOH M 4 .   ? 74.036  14.754 37.831 1.00 31.43  ? 821 HOH A O   1 
HETATM 9323 O O   . HOH M 4 .   ? 96.024  35.695 22.859 1.00 72.87  ? 822 HOH A O   1 
HETATM 9324 O O   . HOH M 4 .   ? 93.564  19.039 16.789 1.00 61.65  ? 823 HOH A O   1 
HETATM 9325 O O   . HOH M 4 .   ? 76.459  42.155 45.516 1.00 27.19  ? 824 HOH A O   1 
HETATM 9326 O O   . HOH M 4 .   ? 72.420  43.800 37.038 1.00 21.64  ? 825 HOH A O   1 
HETATM 9327 O O   . HOH M 4 .   ? 86.116  26.630 56.937 1.00 13.55  ? 826 HOH A O   1 
HETATM 9328 O O   . HOH M 4 .   ? 96.452  28.386 39.753 1.00 39.76  ? 827 HOH A O   1 
HETATM 9329 O O   . HOH M 4 .   ? 100.643 33.167 38.795 1.00 19.17  ? 828 HOH A O   1 
HETATM 9330 O O   . HOH M 4 .   ? 80.600  42.700 30.294 1.00 30.86  ? 829 HOH A O   1 
HETATM 9331 O O   . HOH M 4 .   ? 88.873  45.627 42.121 1.00 22.88  ? 830 HOH A O   1 
HETATM 9332 O O   . HOH M 4 .   ? 95.425  22.245 23.685 1.00 12.66  ? 831 HOH A O   1 
HETATM 9333 O O   . HOH M 4 .   ? 82.511  12.423 35.796 1.00 46.86  ? 832 HOH A O   1 
HETATM 9334 O O   . HOH M 4 .   ? 71.892  15.875 53.902 1.00 6.55   ? 833 HOH A O   1 
HETATM 9335 O O   . HOH M 4 .   ? 99.146  26.426 45.774 1.00 7.76   ? 834 HOH A O   1 
HETATM 9336 O O   . HOH M 4 .   ? 84.608  11.719 27.413 1.00 23.99  ? 835 HOH A O   1 
HETATM 9337 O O   . HOH M 4 .   ? 94.174  27.026 41.052 1.00 43.75  ? 836 HOH A O   1 
HETATM 9338 O O   . HOH N 4 .   ? 26.447  54.614 30.445 1.00 6.55   ? 777 HOH B O   1 
HETATM 9339 O O   . HOH N 4 .   ? 23.493  36.050 18.569 1.00 18.20  ? 778 HOH B O   1 
HETATM 9340 O O   . HOH N 4 .   ? 39.195  46.020 26.928 1.00 7.70   ? 779 HOH B O   1 
HETATM 9341 O O   . HOH N 4 .   ? 28.498  3.681  36.111 1.00 62.36  ? 780 HOH B O   1 
HETATM 9342 O O   . HOH N 4 .   ? 16.327  45.249 29.540 1.00 11.51  ? 781 HOH B O   1 
HETATM 9343 O O   . HOH N 4 .   ? 13.893  39.991 46.023 1.00 53.88  ? 782 HOH B O   1 
HETATM 9344 O O   . HOH N 4 .   ? 33.760  25.459 34.716 1.00 18.27  ? 783 HOH B O   1 
HETATM 9345 O O   . HOH N 4 .   ? 35.131  29.461 26.930 1.00 48.35  ? 784 HOH B O   1 
HETATM 9346 O O   . HOH N 4 .   ? 7.710   43.655 18.908 1.00 19.30  ? 785 HOH B O   1 
HETATM 9347 O O   . HOH N 4 .   ? 43.012  20.650 46.046 1.00 17.65  ? 786 HOH B O   1 
HETATM 9348 O O   . HOH N 4 .   ? 20.193  33.891 8.701  1.00 6.55   ? 787 HOH B O   1 
HETATM 9349 O O   . HOH N 4 .   ? 17.588  49.922 12.821 1.00 21.33  ? 788 HOH B O   1 
HETATM 9350 O O   . HOH N 4 .   ? 41.873  22.492 13.915 1.00 14.65  ? 789 HOH B O   1 
HETATM 9351 O O   . HOH N 4 .   ? 23.286  35.585 11.520 1.00 27.09  ? 790 HOH B O   1 
HETATM 9352 O O   . HOH N 4 .   ? 28.152  53.220 17.248 1.00 6.55   ? 791 HOH B O   1 
HETATM 9353 O O   . HOH N 4 .   ? 37.109  42.873 33.572 1.00 31.40  ? 792 HOH B O   1 
HETATM 9354 O O   . HOH N 4 .   ? 24.552  61.987 21.045 1.00 59.53  ? 793 HOH B O   1 
HETATM 9355 O O   . HOH N 4 .   ? 29.707  23.211 25.700 1.00 30.18  ? 794 HOH B O   1 
HETATM 9356 O O   . HOH N 4 .   ? 15.771  42.356 48.110 1.00 18.04  ? 795 HOH B O   1 
HETATM 9357 O O   . HOH N 4 .   ? 16.108  21.382 11.362 1.00 56.26  ? 796 HOH B O   1 
HETATM 9358 O O   . HOH N 4 .   ? 39.374  22.778 28.290 1.00 15.12  ? 797 HOH B O   1 
HETATM 9359 O O   . HOH N 4 .   ? 39.432  44.206 22.889 1.00 28.09  ? 798 HOH B O   1 
HETATM 9360 O O   . HOH N 4 .   ? 29.534  11.827 12.889 1.00 34.69  ? 799 HOH B O   1 
HETATM 9361 O O   . HOH N 4 .   ? 28.055  36.015 20.855 1.00 54.35  ? 800 HOH B O   1 
HETATM 9362 O O   . HOH N 4 .   ? 29.479  33.760 21.807 1.00 9.78   ? 801 HOH B O   1 
HETATM 9363 O O   . HOH N 4 .   ? 11.142  29.153 21.951 1.00 42.62  ? 802 HOH B O   1 
HETATM 9364 O O   . HOH N 4 .   ? 21.000  37.740 15.053 1.00 21.53  ? 803 HOH B O   1 
HETATM 9365 O O   . HOH N 4 .   ? 25.216  41.390 9.680  1.00 30.13  ? 804 HOH B O   1 
HETATM 9366 O O   . HOH N 4 .   ? 16.654  42.786 30.208 1.00 43.88  ? 805 HOH B O   1 
HETATM 9367 O O   . HOH N 4 .   ? 11.796  53.846 37.487 1.00 7.16   ? 806 HOH B O   1 
HETATM 9368 O O   . HOH N 4 .   ? 11.195  48.303 37.516 1.00 24.22  ? 807 HOH B O   1 
HETATM 9369 O O   . HOH N 4 .   ? 15.363  52.854 31.635 1.00 14.19  ? 808 HOH B O   1 
HETATM 9370 O O   . HOH N 4 .   ? 15.284  56.254 32.343 1.00 24.58  ? 809 HOH B O   1 
HETATM 9371 O O   . HOH N 4 .   ? 16.021  53.311 27.921 1.00 42.72  ? 810 HOH B O   1 
HETATM 9372 O O   . HOH N 4 .   ? 17.081  55.410 26.337 1.00 53.35  ? 811 HOH B O   1 
HETATM 9373 O O   . HOH N 4 .   ? 16.969  58.082 25.844 1.00 31.15  ? 812 HOH B O   1 
HETATM 9374 O O   . HOH N 4 .   ? 20.802  59.192 26.268 1.00 21.95  ? 813 HOH B O   1 
HETATM 9375 O O   . HOH N 4 .   ? 13.786  53.894 23.570 1.00 27.54  ? 814 HOH B O   1 
HETATM 9376 O O   . HOH N 4 .   ? 29.941  38.819 13.259 1.00 16.18  ? 815 HOH B O   1 
HETATM 9377 O O   . HOH N 4 .   ? 31.229  32.345 24.809 1.00 6.55   ? 816 HOH B O   1 
HETATM 9378 O O   . HOH N 4 .   ? 35.950  39.831 15.501 1.00 46.26  ? 817 HOH B O   1 
HETATM 9379 O O   . HOH N 4 .   ? 33.746  55.499 28.084 1.00 41.24  ? 818 HOH B O   1 
HETATM 9380 O O   . HOH N 4 .   ? 29.549  21.556 10.900 1.00 8.58   ? 819 HOH B O   1 
HETATM 9381 O O   . HOH N 4 .   ? 36.361  50.466 33.393 1.00 20.09  ? 820 HOH B O   1 
HETATM 9382 O O   . HOH N 4 .   ? 12.271  43.375 28.865 1.00 31.07  ? 821 HOH B O   1 
HETATM 9383 O O   . HOH N 4 .   ? 20.241  30.622 22.493 1.00 40.28  ? 822 HOH B O   1 
HETATM 9384 O O   . HOH N 4 .   ? 19.057  41.877 47.927 1.00 38.07  ? 823 HOH B O   1 
HETATM 9385 O O   . HOH N 4 .   ? 25.198  20.861 9.794  1.00 22.77  ? 824 HOH B O   1 
HETATM 9386 O O   . HOH N 4 .   ? 42.976  39.433 25.586 1.00 40.31  ? 825 HOH B O   1 
HETATM 9387 O O   . HOH N 4 .   ? 30.504  55.959 30.789 1.00 10.59  ? 826 HOH B O   1 
HETATM 9388 O O   . HOH N 4 .   ? 25.501  56.245 46.499 1.00 71.13  ? 827 HOH B O   1 
HETATM 9389 O O   . HOH N 4 .   ? 32.584  56.454 32.650 1.00 15.50  ? 828 HOH B O   1 
HETATM 9390 O O   . HOH N 4 .   ? 33.662  49.163 34.855 1.00 6.55   ? 829 HOH B O   1 
HETATM 9391 O O   . HOH N 4 .   ? 27.170  30.996 8.081  1.00 26.82  ? 830 HOH B O   1 
HETATM 9392 O O   . HOH N 4 .   ? 25.826  57.596 33.260 1.00 39.34  ? 831 HOH B O   1 
HETATM 9393 O O   . HOH N 4 .   ? 29.104  26.331 23.887 1.00 36.19  ? 832 HOH B O   1 
HETATM 9394 O O   . HOH N 4 .   ? 29.024  37.072 11.906 1.00 41.25  ? 833 HOH B O   1 
HETATM 9395 O O   . HOH N 4 .   ? 33.831  41.352 11.984 1.00 105.42 ? 834 HOH B O   1 
HETATM 9396 O O   . HOH N 4 .   ? 21.243  59.804 14.583 1.00 6.55   ? 835 HOH B O   1 
HETATM 9397 O O   . HOH N 4 .   ? 38.438  48.350 31.960 1.00 26.09  ? 836 HOH B O   1 
HETATM 9398 O O   . HOH N 4 .   ? 35.724  31.661 6.363  1.00 58.08  ? 837 HOH B O   1 
HETATM 9399 O O   . HOH N 4 .   ? 27.282  40.024 10.038 1.00 25.23  ? 838 HOH B O   1 
HETATM 9400 O O   . HOH N 4 .   ? 20.788  39.158 44.829 1.00 23.79  ? 839 HOH B O   1 
HETATM 9401 O O   . HOH N 4 .   ? 34.129  29.429 24.730 1.00 59.01  ? 840 HOH B O   1 
HETATM 9402 O O   . HOH N 4 .   ? 12.699  50.095 34.184 1.00 66.21  ? 841 HOH B O   1 
HETATM 9403 O O   . HOH N 4 .   ? 28.813  30.084 24.051 1.00 12.55  ? 842 HOH B O   1 
HETATM 9404 O O   . HOH N 4 .   ? 32.431  56.381 35.577 1.00 43.32  ? 843 HOH B O   1 
HETATM 9405 O O   . HOH N 4 .   ? 20.912  31.313 11.257 1.00 41.65  ? 844 HOH B O   1 
HETATM 9406 O O   . HOH N 4 .   ? 13.581  47.084 26.990 1.00 38.20  ? 845 HOH B O   1 
HETATM 9407 O O   . HOH N 4 .   ? 38.623  38.122 18.875 1.00 44.27  ? 846 HOH B O   1 
HETATM 9408 O O   . HOH N 4 .   ? 41.058  40.815 20.482 1.00 10.29  ? 847 HOH B O   1 
HETATM 9409 O O   . HOH N 4 .   ? 21.463  7.364  20.436 1.00 38.80  ? 848 HOH B O   1 
HETATM 9410 O O   . HOH N 4 .   ? 20.796  46.289 6.634  1.00 45.57  ? 849 HOH B O   1 
HETATM 9411 O O   . HOH N 4 .   ? 24.946  40.625 6.667  1.00 21.66  ? 850 HOH B O   1 
HETATM 9412 O O   . HOH N 4 .   ? 36.147  39.859 12.165 1.00 32.19  ? 851 HOH B O   1 
HETATM 9413 O O   . HOH N 4 .   ? 31.003  22.098 8.955  1.00 20.20  ? 852 HOH B O   1 
HETATM 9414 O O   . HOH N 4 .   ? 37.543  48.782 36.904 1.00 14.76  ? 853 HOH B O   1 
HETATM 9415 O O   . HOH N 4 .   ? 12.029  29.377 15.199 1.00 48.66  ? 854 HOH B O   1 
HETATM 9416 O O   . HOH N 4 .   ? 41.204  28.536 25.414 1.00 37.64  ? 855 HOH B O   1 
HETATM 9417 O O   . HOH N 4 .   ? 32.931  27.959 3.319  1.00 18.12  ? 856 HOH B O   1 
HETATM 9418 O O   . HOH N 4 .   ? 30.569  55.951 37.409 1.00 41.76  ? 857 HOH B O   1 
HETATM 9419 O O   . HOH N 4 .   ? 12.355  47.621 40.110 1.00 13.20  ? 858 HOH B O   1 
HETATM 9420 O O   . HOH N 4 .   ? 34.469  8.031  41.680 1.00 26.61  ? 859 HOH B O   1 
HETATM 9421 O O   . HOH N 4 .   ? 42.953  35.036 47.686 1.00 41.22  ? 860 HOH B O   1 
HETATM 9422 O O   . HOH N 4 .   ? 18.357  57.989 18.657 1.00 30.96  ? 861 HOH B O   1 
HETATM 9423 O O   . HOH N 4 .   ? 19.328  11.051 16.065 1.00 7.46   ? 862 HOH B O   1 
HETATM 9424 O O   . HOH N 4 .   ? 35.183  31.828 39.316 1.00 23.43  ? 863 HOH B O   1 
HETATM 9425 O O   . HOH N 4 .   ? 3.083   30.807 27.955 1.00 20.21  ? 864 HOH B O   1 
HETATM 9426 O O   . HOH N 4 .   ? 7.466   27.409 15.931 1.00 59.47  ? 865 HOH B O   1 
HETATM 9427 O O   . HOH N 4 .   ? 35.126  14.142 39.881 1.00 35.00  ? 866 HOH B O   1 
HETATM 9428 O O   . HOH N 4 .   ? 18.066  62.101 26.953 1.00 10.87  ? 867 HOH B O   1 
HETATM 9429 O O   . HOH N 4 .   ? 35.615  47.411 42.596 1.00 71.01  ? 868 HOH B O   1 
HETATM 9430 O O   . HOH N 4 .   ? 18.417  60.191 22.257 1.00 29.75  ? 869 HOH B O   1 
HETATM 9431 O O   . HOH N 4 .   ? 41.052  25.952 27.379 1.00 34.01  ? 870 HOH B O   1 
HETATM 9432 O O   . HOH N 4 .   ? 38.918  40.001 16.119 1.00 28.86  ? 871 HOH B O   1 
HETATM 9433 O O   . HOH N 4 .   ? 11.933  53.569 32.872 1.00 32.60  ? 872 HOH B O   1 
HETATM 9434 O O   . HOH N 4 .   ? 9.863   22.693 25.952 1.00 29.27  ? 873 HOH B O   1 
HETATM 9435 O O   . HOH N 4 .   ? 10.406  50.601 33.831 1.00 36.49  ? 874 HOH B O   1 
HETATM 9436 O O   . HOH N 4 .   ? 25.058  4.385  19.762 1.00 37.43  ? 875 HOH B O   1 
HETATM 9437 O O   . HOH N 4 .   ? 16.301  53.552 10.726 1.00 19.42  ? 876 HOH B O   1 
HETATM 9438 O O   . HOH N 4 .   ? 37.322  23.133 26.601 1.00 26.66  ? 877 HOH B O   1 
HETATM 9439 O O   . HOH N 4 .   ? 31.448  33.203 7.887  1.00 35.69  ? 878 HOH B O   1 
HETATM 9440 O O   . HOH N 4 .   ? 42.494  29.946 28.417 1.00 62.92  ? 879 HOH B O   1 
HETATM 9441 O O   . HOH N 4 .   ? 37.069  19.734 3.845  1.00 56.25  ? 880 HOH B O   1 
HETATM 9442 O O   . HOH N 4 .   ? 27.477  13.485 11.098 1.00 27.85  ? 881 HOH B O   1 
HETATM 9443 O O   . HOH N 4 .   ? 12.189  43.995 45.836 1.00 24.56  ? 882 HOH B O   1 
HETATM 9444 O O   . HOH N 4 .   ? 9.585   38.073 18.403 1.00 16.38  ? 883 HOH B O   1 
HETATM 9445 O O   . HOH N 4 .   ? 21.645  31.165 5.851  1.00 71.96  ? 884 HOH B O   1 
HETATM 9446 O O   . HOH O 4 .   ? 33.141  74.899 65.263 1.00 26.09  ? 778 HOH C O   1 
HETATM 9447 O O   . HOH O 4 .   ? 56.393  72.419 60.002 1.00 20.42  ? 779 HOH C O   1 
HETATM 9448 O O   . HOH O 4 .   ? 59.037  72.395 40.590 1.00 29.22  ? 780 HOH C O   1 
HETATM 9449 O O   . HOH O 4 .   ? 67.635  48.511 60.056 1.00 12.45  ? 781 HOH C O   1 
HETATM 9450 O O   . HOH O 4 .   ? 56.264  40.093 50.697 1.00 7.27   ? 782 HOH C O   1 
HETATM 9451 O O   . HOH O 4 .   ? 50.292  75.386 61.115 1.00 31.75  ? 783 HOH C O   1 
HETATM 9452 O O   . HOH O 4 .   ? 47.460  71.355 51.022 1.00 6.55   ? 784 HOH C O   1 
HETATM 9453 O O   . HOH O 4 .   ? 57.872  42.232 34.227 1.00 13.17  ? 785 HOH C O   1 
HETATM 9454 O O   . HOH O 4 .   ? 56.558  75.210 62.199 1.00 15.23  ? 786 HOH C O   1 
HETATM 9455 O O   . HOH O 4 .   ? 60.100  40.336 49.632 1.00 13.85  ? 787 HOH C O   1 
HETATM 9456 O O   . HOH O 4 .   ? 40.450  81.522 70.289 1.00 54.36  ? 788 HOH C O   1 
HETATM 9457 O O   . HOH O 4 .   ? 38.597  65.631 51.473 1.00 50.97  ? 789 HOH C O   1 
HETATM 9458 O O   . HOH O 4 .   ? 65.097  78.619 46.384 1.00 20.99  ? 790 HOH C O   1 
HETATM 9459 O O   . HOH O 4 .   ? 36.450  53.604 72.546 1.00 36.64  ? 791 HOH C O   1 
HETATM 9460 O O   . HOH O 4 .   ? 46.659  60.001 57.386 1.00 24.02  ? 792 HOH C O   1 
HETATM 9461 O O   . HOH O 4 .   ? 49.460  64.255 54.021 1.00 9.17   ? 793 HOH C O   1 
HETATM 9462 O O   . HOH O 4 .   ? 50.370  58.605 57.566 1.00 85.60  ? 794 HOH C O   1 
HETATM 9463 O O   . HOH O 4 .   ? 47.380  74.098 69.425 1.00 6.55   ? 795 HOH C O   1 
HETATM 9464 O O   . HOH O 4 .   ? 54.114  76.903 67.263 1.00 71.03  ? 796 HOH C O   1 
HETATM 9465 O O   . HOH O 4 .   ? 49.099  62.566 57.694 1.00 68.56  ? 797 HOH C O   1 
HETATM 9466 O O   . HOH O 4 .   ? 43.416  60.387 60.874 1.00 19.22  ? 798 HOH C O   1 
HETATM 9467 O O   . HOH O 4 .   ? 47.805  60.451 63.876 1.00 43.81  ? 799 HOH C O   1 
HETATM 9468 O O   . HOH O 4 .   ? 61.441  55.030 46.913 1.00 71.98  ? 800 HOH C O   1 
HETATM 9469 O O   . HOH O 4 .   ? 38.483  82.691 73.426 1.00 15.55  ? 801 HOH C O   1 
HETATM 9470 O O   . HOH O 4 .   ? 38.656  67.103 64.264 1.00 10.20  ? 802 HOH C O   1 
HETATM 9471 O O   . HOH O 4 .   ? 55.490  78.985 43.574 1.00 35.44  ? 803 HOH C O   1 
HETATM 9472 O O   . HOH O 4 .   ? 54.445  73.355 54.743 1.00 65.42  ? 804 HOH C O   1 
HETATM 9473 O O   . HOH O 4 .   ? 45.816  67.119 40.493 1.00 58.95  ? 805 HOH C O   1 
HETATM 9474 O O   . HOH O 4 .   ? 60.664  60.239 70.334 1.00 84.09  ? 806 HOH C O   1 
HETATM 9475 O O   . HOH O 4 .   ? 57.997  71.829 71.693 1.00 64.96  ? 807 HOH C O   1 
HETATM 9476 O O   . HOH O 4 .   ? 57.679  64.414 81.339 1.00 20.19  ? 808 HOH C O   1 
HETATM 9477 O O   . HOH O 4 .   ? 66.502  62.791 57.429 1.00 34.01  ? 809 HOH C O   1 
HETATM 9478 O O   . HOH O 4 .   ? 46.297  62.123 63.132 1.00 50.81  ? 810 HOH C O   1 
HETATM 9479 O O   . HOH O 4 .   ? 39.075  64.351 60.381 1.00 46.69  ? 811 HOH C O   1 
HETATM 9480 O O   . HOH O 4 .   ? 47.671  72.451 78.152 1.00 22.48  ? 812 HOH C O   1 
HETATM 9481 O O   . HOH O 4 .   ? 43.521  72.093 75.245 1.00 6.55   ? 813 HOH C O   1 
HETATM 9482 O O   . HOH O 4 .   ? 44.220  49.600 40.831 1.00 37.86  ? 814 HOH C O   1 
HETATM 9483 O O   . HOH O 4 .   ? 66.179  56.391 46.911 1.00 62.44  ? 815 HOH C O   1 
HETATM 9484 O O   . HOH O 4 .   ? 48.068  58.893 66.630 1.00 45.13  ? 816 HOH C O   1 
HETATM 9485 O O   . HOH O 4 .   ? 48.398  73.000 53.011 1.00 30.95  ? 817 HOH C O   1 
HETATM 9486 O O   . HOH O 4 .   ? 64.410  51.378 53.550 1.00 14.05  ? 818 HOH C O   1 
HETATM 9487 O O   . HOH O 4 .   ? 63.865  70.913 64.231 1.00 37.63  ? 819 HOH C O   1 
HETATM 9488 O O   . HOH O 4 .   ? 49.175  75.581 45.320 1.00 33.53  ? 820 HOH C O   1 
HETATM 9489 O O   . HOH O 4 .   ? 60.722  47.420 83.592 1.00 23.72  ? 821 HOH C O   1 
HETATM 9490 O O   . HOH O 4 .   ? 36.638  68.290 67.516 1.00 25.54  ? 822 HOH C O   1 
HETATM 9491 O O   . HOH O 4 .   ? 55.376  66.256 28.439 1.00 23.27  ? 823 HOH C O   1 
HETATM 9492 O O   . HOH O 4 .   ? 56.397  79.313 70.285 1.00 36.19  ? 824 HOH C O   1 
HETATM 9493 O O   . HOH O 4 .   ? 54.055  77.650 47.153 1.00 37.36  ? 825 HOH C O   1 
HETATM 9494 O O   . HOH O 4 .   ? 68.427  71.384 49.208 1.00 31.41  ? 826 HOH C O   1 
HETATM 9495 O O   . HOH O 4 .   ? 48.404  65.672 89.176 1.00 39.52  ? 827 HOH C O   1 
HETATM 9496 O O   . HOH O 4 .   ? 68.404  60.623 43.827 1.00 48.95  ? 828 HOH C O   1 
HETATM 9497 O O   . HOH O 4 .   ? 68.611  44.380 69.687 1.00 25.51  ? 829 HOH C O   1 
HETATM 9498 O O   . HOH O 4 .   ? 67.578  66.919 52.067 1.00 27.12  ? 830 HOH C O   1 
HETATM 9499 O O   . HOH O 4 .   ? 64.246  81.702 45.356 1.00 18.93  ? 831 HOH C O   1 
HETATM 9500 O O   . HOH O 4 .   ? 57.797  74.012 58.605 1.00 72.68  ? 832 HOH C O   1 
HETATM 9501 O O   . HOH P 4 .   ? -5.199  60.316 64.837 1.00 10.84  ? 779 HOH D O   1 
HETATM 9502 O O   . HOH P 4 .   ? 24.452  57.448 61.239 1.00 6.55   ? 780 HOH D O   1 
HETATM 9503 O O   . HOH P 4 .   ? 16.435  43.961 60.947 1.00 6.75   ? 781 HOH D O   1 
HETATM 9504 O O   . HOH P 4 .   ? 26.700  54.845 72.443 1.00 47.23  ? 782 HOH D O   1 
HETATM 9505 O O   . HOH P 4 .   ? 10.257  39.588 56.556 1.00 26.73  ? 783 HOH D O   1 
HETATM 9506 O O   . HOH P 4 .   ? 9.409   51.934 43.958 1.00 25.72  ? 784 HOH D O   1 
HETATM 9507 O O   . HOH P 4 .   ? 17.142  44.819 64.381 1.00 12.98  ? 785 HOH D O   1 
HETATM 9508 O O   . HOH P 4 .   ? 27.032  65.865 66.937 1.00 10.52  ? 786 HOH D O   1 
HETATM 9509 O O   . HOH P 4 .   ? -2.005  71.131 66.848 1.00 49.22  ? 787 HOH D O   1 
HETATM 9510 O O   . HOH P 4 .   ? -8.047  46.111 36.732 1.00 43.93  ? 788 HOH D O   1 
HETATM 9511 O O   . HOH P 4 .   ? 7.276   64.772 37.662 1.00 24.22  ? 789 HOH D O   1 
HETATM 9512 O O   . HOH P 4 .   ? -17.506 50.588 41.509 1.00 19.86  ? 790 HOH D O   1 
HETATM 9513 O O   . HOH P 4 .   ? 6.124   53.549 51.282 1.00 6.55   ? 791 HOH D O   1 
HETATM 9514 O O   . HOH P 4 .   ? 21.835  65.572 40.957 1.00 26.37  ? 792 HOH D O   1 
HETATM 9515 O O   . HOH P 4 .   ? 28.336  55.863 75.864 1.00 26.75  ? 793 HOH D O   1 
HETATM 9516 O O   . HOH P 4 .   ? 15.985  62.068 37.562 1.00 6.55   ? 794 HOH D O   1 
HETATM 9517 O O   . HOH P 4 .   ? 18.307  64.933 43.385 1.00 38.17  ? 795 HOH D O   1 
HETATM 9518 O O   . HOH P 4 .   ? 11.834  64.856 37.076 1.00 14.99  ? 796 HOH D O   1 
HETATM 9519 O O   . HOH P 4 .   ? 4.752   57.359 41.664 1.00 41.85  ? 797 HOH D O   1 
HETATM 9520 O O   . HOH P 4 .   ? 5.933   43.535 43.884 1.00 35.21  ? 798 HOH D O   1 
HETATM 9521 O O   . HOH P 4 .   ? 8.674   55.888 40.871 1.00 28.47  ? 799 HOH D O   1 
HETATM 9522 O O   . HOH P 4 .   ? -6.211  57.972 38.410 1.00 50.10  ? 800 HOH D O   1 
HETATM 9523 O O   . HOH P 4 .   ? -8.927  50.840 40.830 1.00 21.50  ? 801 HOH D O   1 
HETATM 9524 O O   . HOH P 4 .   ? 3.404   52.661 52.657 1.00 15.57  ? 802 HOH D O   1 
HETATM 9525 O O   . HOH P 4 .   ? -7.947  54.775 39.265 1.00 17.01  ? 803 HOH D O   1 
HETATM 9526 O O   . HOH P 4 .   ? 15.187  68.652 71.700 1.00 14.05  ? 804 HOH D O   1 
HETATM 9527 O O   . HOH P 4 .   ? 29.251  62.883 57.726 1.00 32.71  ? 805 HOH D O   1 
HETATM 9528 O O   . HOH P 4 .   ? 2.220   48.866 54.975 1.00 61.22  ? 806 HOH D O   1 
HETATM 9529 O O   . HOH P 4 .   ? 11.634  70.173 59.580 1.00 13.86  ? 807 HOH D O   1 
HETATM 9530 O O   . HOH P 4 .   ? 24.231  67.825 63.111 1.00 6.55   ? 808 HOH D O   1 
HETATM 9531 O O   . HOH P 4 .   ? 3.673   42.863 44.082 1.00 36.72  ? 809 HOH D O   1 
HETATM 9532 O O   . HOH P 4 .   ? 16.048  60.296 78.473 1.00 9.44   ? 810 HOH D O   1 
HETATM 9533 O O   . HOH P 4 .   ? -0.036  61.279 52.873 1.00 21.88  ? 811 HOH D O   1 
HETATM 9534 O O   . HOH P 4 .   ? 0.091   45.972 56.999 1.00 51.16  ? 812 HOH D O   1 
HETATM 9535 O O   . HOH P 4 .   ? 4.102   72.952 62.759 1.00 7.33   ? 813 HOH D O   1 
HETATM 9536 O O   . HOH P 4 .   ? 8.986   72.789 63.587 1.00 21.47  ? 814 HOH D O   1 
HETATM 9537 O O   . HOH P 4 .   ? 27.932  65.616 57.403 1.00 36.74  ? 815 HOH D O   1 
HETATM 9538 O O   . HOH P 4 .   ? 8.241   73.040 60.246 1.00 33.55  ? 816 HOH D O   1 
HETATM 9539 O O   . HOH P 4 .   ? 26.310  54.234 60.368 1.00 65.54  ? 817 HOH D O   1 
HETATM 9540 O O   . HOH P 4 .   ? 26.758  54.142 64.393 1.00 21.54  ? 818 HOH D O   1 
HETATM 9541 O O   . HOH P 4 .   ? 0.215   47.409 54.904 1.00 75.32  ? 819 HOH D O   1 
HETATM 9542 O O   . HOH P 4 .   ? 9.488   50.876 40.239 1.00 28.80  ? 820 HOH D O   1 
HETATM 9543 O O   . HOH P 4 .   ? 13.774  45.104 63.937 1.00 25.14  ? 821 HOH D O   1 
HETATM 9544 O O   . HOH P 4 .   ? -5.681  50.510 55.602 1.00 68.08  ? 822 HOH D O   1 
HETATM 9545 O O   . HOH P 4 .   ? 14.280  47.657 44.362 1.00 15.59  ? 823 HOH D O   1 
HETATM 9546 O O   . HOH P 4 .   ? 18.164  69.465 65.125 1.00 22.24  ? 824 HOH D O   1 
HETATM 9547 O O   . HOH P 4 .   ? 12.429  71.561 71.312 1.00 12.43  ? 825 HOH D O   1 
HETATM 9548 O O   . HOH P 4 .   ? 8.275   68.398 66.830 1.00 16.81  ? 826 HOH D O   1 
HETATM 9549 O O   . HOH P 4 .   ? 18.814  45.528 68.395 1.00 68.40  ? 827 HOH D O   1 
HETATM 9550 O O   . HOH P 4 .   ? -7.311  48.936 38.654 1.00 51.24  ? 828 HOH D O   1 
HETATM 9551 O O   . HOH P 4 .   ? 13.762  69.240 75.198 1.00 25.66  ? 829 HOH D O   1 
HETATM 9552 O O   . HOH P 4 .   ? 0.265   52.459 54.093 1.00 21.67  ? 830 HOH D O   1 
HETATM 9553 O O   . HOH P 4 .   ? 21.505  53.601 76.493 1.00 17.88  ? 831 HOH D O   1 
HETATM 9554 O O   . HOH P 4 .   ? 17.864  48.183 72.590 1.00 18.15  ? 832 HOH D O   1 
HETATM 9555 O O   . HOH P 4 .   ? -12.367 71.276 58.757 1.00 17.06  ? 833 HOH D O   1 
HETATM 9556 O O   . HOH P 4 .   ? 25.824  54.853 67.406 1.00 66.39  ? 834 HOH D O   1 
HETATM 9557 O O   . HOH P 4 .   ? -1.882  68.845 45.170 1.00 35.02  ? 835 HOH D O   1 
HETATM 9558 O O   . HOH P 4 .   ? 18.258  40.851 51.959 1.00 55.03  ? 836 HOH D O   1 
HETATM 9559 O O   . HOH P 4 .   ? -5.627  43.050 45.391 1.00 63.43  ? 837 HOH D O   1 
HETATM 9560 O O   . HOH P 4 .   ? 24.187  57.618 69.408 1.00 6.55   ? 838 HOH D O   1 
HETATM 9561 O O   . HOH P 4 .   ? -2.450  41.873 46.887 1.00 11.26  ? 839 HOH D O   1 
HETATM 9562 O O   . HOH P 4 .   ? -2.695  49.379 52.221 1.00 58.87  ? 840 HOH D O   1 
HETATM 9563 O O   . HOH P 4 .   ? 14.832  72.904 69.079 1.00 20.36  ? 841 HOH D O   1 
HETATM 9564 O O   . HOH P 4 .   ? -21.773 62.809 71.095 1.00 41.58  ? 842 HOH D O   1 
HETATM 9565 O O   . HOH P 4 .   ? -2.291  60.160 40.037 1.00 21.53  ? 843 HOH D O   1 
HETATM 9566 O O   . HOH P 4 .   ? -6.929  55.999 35.090 1.00 7.12   ? 844 HOH D O   1 
HETATM 9567 O O   . HOH P 4 .   ? 29.108  55.320 72.136 1.00 31.41  ? 845 HOH D O   1 
HETATM 9568 O O   . HOH P 4 .   ? -4.840  45.386 40.004 1.00 33.00  ? 846 HOH D O   1 
HETATM 9569 O O   . HOH P 4 .   ? 24.856  52.183 74.772 1.00 32.42  ? 847 HOH D O   1 
HETATM 9570 O O   . HOH P 4 .   ? 25.089  68.371 40.996 1.00 22.94  ? 848 HOH D O   1 
HETATM 9571 O O   . HOH P 4 .   ? 2.950   59.183 38.881 1.00 25.52  ? 849 HOH D O   1 
HETATM 9572 O O   . HOH P 4 .   ? 8.875   68.984 76.735 1.00 8.11   ? 850 HOH D O   1 
HETATM 9573 O O   . HOH P 4 .   ? -0.850  67.731 41.435 1.00 41.09  ? 851 HOH D O   1 
HETATM 9574 O O   . HOH P 4 .   ? 1.970   55.859 38.084 1.00 29.46  ? 852 HOH D O   1 
HETATM 9575 O O   . HOH P 4 .   ? 15.350  69.683 57.682 1.00 51.76  ? 853 HOH D O   1 
HETATM 9576 O O   . HOH P 4 .   ? 17.656  74.847 70.400 1.00 23.88  ? 854 HOH D O   1 
HETATM 9577 O O   . HOH P 4 .   ? -10.094 70.000 52.163 1.00 20.37  ? 855 HOH D O   1 
HETATM 9578 O O   . HOH P 4 .   ? -8.815  51.936 36.476 1.00 39.70  ? 856 HOH D O   1 
HETATM 9579 O O   . HOH P 4 .   ? 4.804   69.257 66.935 1.00 43.39  ? 857 HOH D O   1 
HETATM 9580 O O   . HOH P 4 .   ? 5.349   66.027 77.123 1.00 7.03   ? 858 HOH D O   1 
HETATM 9581 O O   . HOH P 4 .   ? 31.069  64.491 60.440 1.00 56.30  ? 859 HOH D O   1 
HETATM 9582 O O   . HOH P 4 .   ? 7.492   61.288 75.581 1.00 27.18  ? 860 HOH D O   1 
HETATM 9583 O O   . HOH P 4 .   ? -6.084  43.518 38.254 1.00 19.89  ? 861 HOH D O   1 
HETATM 9584 O O   . HOH P 4 .   ? 26.707  50.359 62.295 1.00 26.89  ? 862 HOH D O   1 
HETATM 9585 O O   . HOH P 4 .   ? 28.250  54.399 68.530 1.00 59.59  ? 863 HOH D O   1 
HETATM 9586 O O   . HOH P 4 .   ? 5.579   54.033 39.244 1.00 43.96  ? 864 HOH D O   1 
HETATM 9587 O O   . HOH P 4 .   ? -4.850  67.022 43.804 1.00 47.04  ? 865 HOH D O   1 
HETATM 9588 O O   . HOH Q 4 .   ? 64.387  16.960 46.587 1.00 26.45  ? 161 HOH E O   1 
HETATM 9589 O O   . HOH Q 4 .   ? 62.090  24.957 30.678 1.00 94.75  ? 169 HOH E O   1 
HETATM 9590 O O   . HOH Q 4 .   ? 72.684  10.063 52.409 1.00 15.32  ? 257 HOH E O   1 
HETATM 9591 O O   . HOH Q 4 .   ? 73.140  6.541  49.333 1.00 67.28  ? 258 HOH E O   1 
HETATM 9592 O O   . HOH R 4 .   ? 28.160  33.782 48.488 1.00 21.86  ? 113 HOH F O   1 
HETATM 9593 O O   . HOH R 4 .   ? 33.607  29.342 42.693 1.00 51.23  ? 133 HOH F O   1 
HETATM 9594 O O   . HOH R 4 .   ? 23.914  40.184 50.806 1.00 51.96  ? 227 HOH F O   1 
HETATM 9595 O O   . HOH R 4 .   ? 26.382  29.007 42.678 1.00 6.55   ? 240 HOH F O   1 
HETATM 9596 O O   . HOH R 4 .   ? 41.974  38.496 45.102 1.00 22.50  ? 242 HOH F O   1 
HETATM 9597 O O   . HOH R 4 .   ? 38.756  45.397 34.815 1.00 27.26  ? 244 HOH F O   1 
HETATM 9598 O O   . HOH R 4 .   ? 39.131  43.335 41.848 1.00 14.85  ? 255 HOH F O   1 
HETATM 9599 O O   . HOH R 4 .   ? 25.064  32.387 48.321 1.00 56.46  ? 264 HOH F O   1 
HETATM 9600 O O   . HOH R 4 .   ? 31.182  39.651 47.206 1.00 25.42  ? 270 HOH F O   1 
HETATM 9601 O O   . HOH R 4 .   ? 35.724  43.756 43.615 1.00 19.80  ? 298 HOH F O   1 
HETATM 9602 O O   . HOH S 4 .   ? 52.043  42.214 60.642 1.00 10.96  ? 260 HOH G O   1 
HETATM 9603 O O   . HOH T 4 .   ? 16.139  41.291 71.348 1.00 53.94  ? 40  HOH H O   1 
HETATM 9604 O O   . HOH T 4 .   ? -2.395  55.026 72.730 1.00 14.98  ? 243 HOH H O   1 
HETATM 9605 O O   . HOH T 4 .   ? 13.369  42.847 73.266 1.00 41.72  ? 254 HOH H O   1 
HETATM 9606 O O   . HOH T 4 .   ? 9.010   51.994 78.070 1.00 37.49  ? 271 HOH H O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   200 200 THR ALA A . n 
A 1 2   ALA 2   201 201 ALA ALA A . n 
A 1 3   ASP 3   202 202 ASP ASP A . n 
A 1 4   LEU 4   203 203 LEU LEU A . n 
A 1 5   LYS 5   204 204 LYS LYS A . n 
A 1 6   SER 6   205 205 SER SER A . n 
A 1 7   LEU 7   206 206 LEU LEU A . n 
A 1 8   ALA 8   207 207 ALA ALA A . n 
A 1 9   LYS 9   208 208 LYS LYS A . n 
A 1 10  ARG 10  209 209 ARG ARG A . n 
A 1 11  ILE 11  210 210 ILE ILE A . n 
A 1 12  TYR 12  211 211 TYR TYR A . n 
A 1 13  GLU 13  212 212 GLU GLU A . n 
A 1 14  ALA 14  213 213 ALA ALA A . n 
A 1 15  TYR 15  214 214 TYR TYR A . n 
A 1 16  LEU 16  215 215 LEU LEU A . n 
A 1 17  LYS 17  216 216 LYS LYS A . n 
A 1 18  ASN 18  217 217 ASN ASN A . n 
A 1 19  PHE 19  218 218 PHE PHE A . n 
A 1 20  ASN 20  219 219 ASN ASN A . n 
A 1 21  MET 21  220 220 MET MET A . n 
A 1 22  ASN 22  221 221 ASN ASN A . n 
A 1 23  LYS 23  222 222 LYS LYS A . n 
A 1 24  VAL 24  223 223 VAL VAL A . n 
A 1 25  LYS 25  224 224 LYS LYS A . n 
A 1 26  ALA 26  225 225 ALA ALA A . n 
A 1 27  ARG 27  226 226 ARG ARG A . n 
A 1 28  VAL 28  227 227 VAL VAL A . n 
A 1 29  ILE 29  228 228 ILE ILE A . n 
A 1 30  LEU 30  229 229 LEU LEU A . n 
A 1 31  SER 31  230 230 SER SER A . n 
A 1 32  GLY 32  231 231 GLY GLY A . n 
A 1 33  LYS 33  232 232 LYS LYS A . n 
A 1 34  ALA 34  233 233 ALA ALA A . n 
A 1 35  SER 35  234 234 SER SER A . n 
A 1 36  ASN 36  235 235 ASN ASN A . n 
A 1 37  ASN 37  236 236 ASN ASN A . n 
A 1 38  PRO 38  237 237 PRO PRO A . n 
A 1 39  PRO 39  238 238 PRO PRO A . n 
A 1 40  PHE 40  239 239 PHE PHE A . n 
A 1 41  VAL 41  240 240 VAL VAL A . n 
A 1 42  ILE 42  241 241 ILE ILE A . n 
A 1 43  HIS 43  242 242 HIS HIS A . n 
A 1 44  ASP 44  243 243 ASP ASP A . n 
A 1 45  MET 45  244 244 MET MET A . n 
A 1 46  GLU 46  245 245 GLU GLU A . n 
A 1 47  THR 47  246 246 THR THR A . n 
A 1 48  LEU 48  247 247 LEU LEU A . n 
A 1 49  CYS 49  248 248 CYS CYS A . n 
A 1 50  MET 50  249 249 MET MET A . n 
A 1 51  ALA 51  250 250 ALA ALA A . n 
A 1 52  GLU 52  251 251 GLU GLU A . n 
A 1 53  LYS 53  252 252 LYS LYS A . n 
A 1 54  THR 54  253 253 THR THR A . n 
A 1 55  LEU 55  254 254 LEU LEU A . n 
A 1 56  VAL 56  255 255 VAL VAL A . n 
A 1 57  ALA 57  256 256 ALA ALA A . n 
A 1 58  LYS 58  257 257 LYS LYS A . n 
A 1 59  LEU 59  258 258 LEU LEU A . n 
A 1 60  VAL 60  259 259 VAL VAL A . n 
A 1 61  ALA 61  260 260 ALA ALA A . n 
A 1 62  ASN 62  261 261 ASN ASN A . n 
A 1 63  GLY 63  262 262 GLY GLY A . n 
A 1 64  ILE 64  263 263 ILE ILE A . n 
A 1 65  GLN 65  264 264 GLN GLN A . n 
A 1 66  ASN 66  265 265 ASN ASN A . n 
A 1 67  LYS 67  266 266 LYS LYS A . n 
A 1 68  GLU 68  267 267 GLU GLU A . n 
A 1 69  ALA 69  268 268 ALA ALA A . n 
A 1 70  GLU 70  269 269 GLU GLU A . n 
A 1 71  VAL 71  270 270 VAL VAL A . n 
A 1 72  ARG 72  271 271 ARG ARG A . n 
A 1 73  ILE 73  272 272 ILE ILE A . n 
A 1 74  PHE 74  273 273 PHE PHE A . n 
A 1 75  HIS 75  274 274 HIS HIS A . n 
A 1 76  CYS 76  275 275 CYS CYS A . n 
A 1 77  CYS 77  276 276 CYS CYS A . n 
A 1 78  GLN 78  277 277 GLN GLN A . n 
A 1 79  CYS 79  278 278 CYS CYS A . n 
A 1 80  THR 80  279 279 THR THR A . n 
A 1 81  SER 81  280 280 SER SER A . n 
A 1 82  VAL 82  281 281 VAL VAL A . n 
A 1 83  GLU 83  282 282 GLU GLU A . n 
A 1 84  THR 84  283 283 THR THR A . n 
A 1 85  VAL 85  284 284 VAL VAL A . n 
A 1 86  THR 86  285 285 THR THR A . n 
A 1 87  GLU 87  286 286 GLU GLU A . n 
A 1 88  LEU 88  287 287 LEU LEU A . n 
A 1 89  THR 89  288 288 THR THR A . n 
A 1 90  GLU 90  289 289 GLU GLU A . n 
A 1 91  PHE 91  290 290 PHE PHE A . n 
A 1 92  ALA 92  291 291 ALA ALA A . n 
A 1 93  LYS 93  292 292 LYS LYS A . n 
A 1 94  ALA 94  293 293 ALA ALA A . n 
A 1 95  ILE 95  294 294 ILE ILE A . n 
A 1 96  PRO 96  295 295 PRO PRO A . n 
A 1 97  GLY 97  296 296 GLY GLY A . n 
A 1 98  PHE 98  297 297 PHE PHE A . n 
A 1 99  ALA 99  298 298 ALA ALA A . n 
A 1 100 ASN 100 299 299 ASN ASN A . n 
A 1 101 LEU 101 300 300 LEU LEU A . n 
A 1 102 ASP 102 301 301 ASP ASP A . n 
A 1 103 LEU 103 302 302 LEU LEU A . n 
A 1 104 ASN 104 303 303 ASN ASN A . n 
A 1 105 ASP 105 304 304 ASP ASP A . n 
A 1 106 GLN 106 305 305 GLN GLN A . n 
A 1 107 VAL 107 306 306 VAL VAL A . n 
A 1 108 THR 108 307 307 THR THR A . n 
A 1 109 LEU 109 308 308 LEU LEU A . n 
A 1 110 LEU 110 309 309 LEU LEU A . n 
A 1 111 LYS 111 310 310 LYS LYS A . n 
A 1 112 TYR 112 311 311 TYR TYR A . n 
A 1 113 GLY 113 312 312 GLY GLY A . n 
A 1 114 VAL 114 313 313 VAL VAL A . n 
A 1 115 TYR 115 314 314 TYR TYR A . n 
A 1 116 GLU 116 315 315 GLU GLU A . n 
A 1 117 ALA 117 316 316 ALA ALA A . n 
A 1 118 ILE 118 317 317 ILE ILE A . n 
A 1 119 PHE 119 318 318 PHE PHE A . n 
A 1 120 ALA 120 319 319 ALA ALA A . n 
A 1 121 MET 121 320 320 MET MET A . n 
A 1 122 LEU 122 321 321 LEU LEU A . n 
A 1 123 SER 123 322 322 SER SER A . n 
A 1 124 SER 124 323 323 SER SER A . n 
A 1 125 VAL 125 324 324 VAL VAL A . n 
A 1 126 MET 126 325 325 MET MET A . n 
A 1 127 ASN 127 326 326 ASN ASN A . n 
A 1 128 LYS 128 327 327 LYS LYS A . n 
A 1 129 ASP 129 328 328 ASP ASP A . n 
A 1 130 GLY 130 329 329 GLY GLY A . n 
A 1 131 MET 131 330 330 MET MET A . n 
A 1 132 LEU 132 331 331 LEU LEU A . n 
A 1 133 VAL 133 332 332 VAL VAL A . n 
A 1 134 ALA 134 333 333 ALA ALA A . n 
A 1 135 TYR 135 334 334 TYR TYR A . n 
A 1 136 GLY 136 335 335 GLY GLY A . n 
A 1 137 ASN 137 336 336 ASN ASN A . n 
A 1 138 GLY 138 337 337 GLY GLY A . n 
A 1 139 PHE 139 338 338 PHE PHE A . n 
A 1 140 ILE 140 339 339 ILE ILE A . n 
A 1 141 THR 141 340 340 THR THR A . n 
A 1 142 ARG 142 341 341 ARG ARG A . n 
A 1 143 GLU 143 342 342 GLU GLU A . n 
A 1 144 PHE 144 343 343 PHE PHE A . n 
A 1 145 LEU 145 344 344 LEU LEU A . n 
A 1 146 LYS 146 345 345 LYS LYS A . n 
A 1 147 SER 147 346 346 SER SER A . n 
A 1 148 LEU 148 347 347 LEU LEU A . n 
A 1 149 ARG 149 348 348 ARG ARG A . n 
A 1 150 LYS 150 349 349 LYS LYS A . n 
A 1 151 PRO 151 350 350 PRO PRO A . n 
A 1 152 PHE 152 351 351 PHE PHE A . n 
A 1 153 CYS 153 352 352 CYS CYS A . n 
A 1 154 ASP 154 353 353 ASP ASP A . n 
A 1 155 ILE 155 354 354 ILE ILE A . n 
A 1 156 MET 156 355 355 MET MET A . n 
A 1 157 GLU 157 356 356 GLU GLU A . n 
A 1 158 PRO 158 357 357 PRO PRO A . n 
A 1 159 LYS 159 358 358 LYS LYS A . n 
A 1 160 PHE 160 359 359 PHE PHE A . n 
A 1 161 ASP 161 360 360 ASP ASP A . n 
A 1 162 PHE 162 361 361 PHE PHE A . n 
A 1 163 ALA 163 362 362 ALA ALA A . n 
A 1 164 MET 164 363 363 MET MET A . n 
A 1 165 LYS 165 364 364 LYS LYS A . n 
A 1 166 PHE 166 365 365 PHE PHE A . n 
A 1 167 ASN 167 366 366 ASN ASN A . n 
A 1 168 ALA 168 367 367 ALA ALA A . n 
A 1 169 LEU 169 368 368 LEU LEU A . n 
A 1 170 GLU 170 369 369 GLU GLU A . n 
A 1 171 LEU 171 370 370 LEU LEU A . n 
A 1 172 ASP 172 371 371 ASP ASP A . n 
A 1 173 ASP 173 372 372 ASP ASP A . n 
A 1 174 SER 174 373 373 SER SER A . n 
A 1 175 ASP 175 374 374 ASP ASP A . n 
A 1 176 ILE 176 375 375 ILE ILE A . n 
A 1 177 SER 177 376 376 SER SER A . n 
A 1 178 LEU 178 377 377 LEU LEU A . n 
A 1 179 PHE 179 378 378 PHE PHE A . n 
A 1 180 VAL 180 379 379 VAL VAL A . n 
A 1 181 ALA 181 380 380 ALA ALA A . n 
A 1 182 ALA 182 381 381 ALA ALA A . n 
A 1 183 ILE 183 382 382 ILE ILE A . n 
A 1 184 ILE 184 383 383 ILE ILE A . n 
A 1 185 CYS 185 384 384 CYS CYS A . n 
A 1 186 CYS 186 385 385 CYS CYS A . n 
A 1 187 GLY 187 386 386 GLY GLY A . n 
A 1 188 ASP 188 387 387 ASP ASP A . n 
A 1 189 ARG 189 388 388 ARG ARG A . n 
A 1 190 PRO 190 389 389 PRO PRO A . n 
A 1 191 GLY 191 390 390 GLY GLY A . n 
A 1 192 LEU 192 391 391 LEU LEU A . n 
A 1 193 LEU 193 392 392 LEU LEU A . n 
A 1 194 ASN 194 393 393 ASN ASN A . n 
A 1 195 VAL 195 394 394 VAL VAL A . n 
A 1 196 GLY 196 395 395 GLY GLY A . n 
A 1 197 HIS 197 396 396 HIS HIS A . n 
A 1 198 ILE 198 397 397 ILE ILE A . n 
A 1 199 GLU 199 398 398 GLU GLU A . n 
A 1 200 LYS 200 399 399 LYS LYS A . n 
A 1 201 MET 201 400 400 MET MET A . n 
A 1 202 GLN 202 401 401 GLN GLN A . n 
A 1 203 GLU 203 402 402 GLU GLU A . n 
A 1 204 GLY 204 403 403 GLY GLY A . n 
A 1 205 ILE 205 404 404 ILE ILE A . n 
A 1 206 VAL 206 405 405 VAL VAL A . n 
A 1 207 HIS 207 406 406 HIS HIS A . n 
A 1 208 VAL 208 407 407 VAL VAL A . n 
A 1 209 LEU 209 408 408 LEU LEU A . n 
A 1 210 ARG 210 409 409 ARG ARG A . n 
A 1 211 LEU 211 410 410 LEU LEU A . n 
A 1 212 HIS 212 411 411 HIS HIS A . n 
A 1 213 LEU 213 412 412 LEU LEU A . n 
A 1 214 GLN 214 413 413 GLN GLN A . n 
A 1 215 SER 215 414 414 SER SER A . n 
A 1 216 ASN 216 415 415 ASN ASN A . n 
A 1 217 HIS 217 416 416 HIS HIS A . n 
A 1 218 PRO 218 417 417 PRO PRO A . n 
A 1 219 ASP 219 418 418 ASP ASP A . n 
A 1 220 ASP 220 419 419 ASP ASP A . n 
A 1 221 ILE 221 420 420 ILE ILE A . n 
A 1 222 PHE 222 421 421 PHE PHE A . n 
A 1 223 LEU 223 422 422 LEU LEU A . n 
A 1 224 PHE 224 423 423 PHE PHE A . n 
A 1 225 PRO 225 424 424 PRO PRO A . n 
A 1 226 LYS 226 425 425 LYS LYS A . n 
A 1 227 LEU 227 426 426 LEU LEU A . n 
A 1 228 LEU 228 427 427 LEU LEU A . n 
A 1 229 GLN 229 428 428 GLN GLN A . n 
A 1 230 LYS 230 429 429 LYS LYS A . n 
A 1 231 MET 231 430 430 MET MET A . n 
A 1 232 ALA 232 431 431 ALA ALA A . n 
A 1 233 ASP 233 432 432 ASP ASP A . n 
A 1 234 LEU 234 433 433 LEU LEU A . n 
A 1 235 ARG 235 434 434 ARG ARG A . n 
A 1 236 GLN 236 435 435 GLN GLN A . n 
A 1 237 LEU 237 436 436 LEU LEU A . n 
A 1 238 VAL 238 437 437 VAL VAL A . n 
A 1 239 THR 239 438 438 THR THR A . n 
A 1 240 GLU 240 439 439 GLU GLU A . n 
A 1 241 HIS 241 440 440 HIS HIS A . n 
A 1 242 ALA 242 441 441 ALA ALA A . n 
A 1 243 GLN 243 442 442 GLN GLN A . n 
A 1 244 LEU 244 443 443 LEU LEU A . n 
A 1 245 VAL 245 444 444 VAL VAL A . n 
A 1 246 GLN 246 445 445 GLN GLN A . n 
A 1 247 ILE 247 446 446 ILE ILE A . n 
A 1 248 ILE 248 447 447 ILE ILE A . n 
A 1 249 LYS 249 448 448 LYS LYS A . n 
A 1 250 LYS 250 449 449 LYS LYS A . n 
A 1 251 THR 251 450 450 THR THR A . n 
A 1 252 GLU 252 451 451 GLU GLU A . n 
A 1 253 SER 253 452 452 SER SER A . n 
A 1 254 ASP 254 453 453 ASP ASP A . n 
A 1 255 ALA 255 454 454 ALA ALA A . n 
A 1 256 ALA 256 455 455 ALA ALA A . n 
A 1 257 LEU 257 456 456 LEU LEU A . n 
A 1 258 HIS 258 457 457 HIS HIS A . n 
A 1 259 PRO 259 458 458 PRO PRO A . n 
A 1 260 LEU 260 459 459 LEU LEU A . n 
A 1 261 LEU 261 460 460 LEU LEU A . n 
A 1 262 GLN 262 461 461 GLN GLN A . n 
A 1 263 GLU 263 462 462 GLU GLU A . n 
A 1 264 ILE 264 463 463 ILE ILE A . n 
A 1 265 TYR 265 464 464 TYR TYR A . n 
A 1 266 ARG 266 465 465 ARG ARG A . n 
A 1 267 ASP 267 466 466 ASP ASP A . n 
A 1 268 MET 268 467 467 MET MET A . n 
A 1 269 TYR 269 468 468 TYR TYR A . n 
B 1 1   THR 1   200 200 THR ALA B . n 
B 1 2   ALA 2   201 201 ALA ALA B . n 
B 1 3   ASP 3   202 202 ASP ASP B . n 
B 1 4   LEU 4   203 203 LEU LEU B . n 
B 1 5   LYS 5   204 204 LYS LYS B . n 
B 1 6   SER 6   205 205 SER SER B . n 
B 1 7   LEU 7   206 206 LEU LEU B . n 
B 1 8   ALA 8   207 207 ALA ALA B . n 
B 1 9   LYS 9   208 208 LYS LYS B . n 
B 1 10  ARG 10  209 209 ARG ARG B . n 
B 1 11  ILE 11  210 210 ILE ILE B . n 
B 1 12  TYR 12  211 211 TYR TYR B . n 
B 1 13  GLU 13  212 212 GLU GLU B . n 
B 1 14  ALA 14  213 213 ALA ALA B . n 
B 1 15  TYR 15  214 214 TYR TYR B . n 
B 1 16  LEU 16  215 215 LEU LEU B . n 
B 1 17  LYS 17  216 216 LYS LYS B . n 
B 1 18  ASN 18  217 217 ASN ASN B . n 
B 1 19  PHE 19  218 218 PHE PHE B . n 
B 1 20  ASN 20  219 219 ASN ASN B . n 
B 1 21  MET 21  220 220 MET MET B . n 
B 1 22  ASN 22  221 221 ASN ASN B . n 
B 1 23  LYS 23  222 222 LYS LYS B . n 
B 1 24  VAL 24  223 223 VAL VAL B . n 
B 1 25  LYS 25  224 224 LYS LYS B . n 
B 1 26  ALA 26  225 225 ALA ALA B . n 
B 1 27  ARG 27  226 226 ARG ARG B . n 
B 1 28  VAL 28  227 227 VAL VAL B . n 
B 1 29  ILE 29  228 228 ILE ILE B . n 
B 1 30  LEU 30  229 229 LEU LEU B . n 
B 1 31  SER 31  230 230 SER SER B . n 
B 1 32  GLY 32  231 231 GLY GLY B . n 
B 1 33  LYS 33  232 232 LYS LYS B . n 
B 1 34  ALA 34  233 233 ALA ALA B . n 
B 1 35  SER 35  234 234 SER SER B . n 
B 1 36  ASN 36  235 235 ASN ASN B . n 
B 1 37  ASN 37  236 236 ASN ASN B . n 
B 1 38  PRO 38  237 237 PRO PRO B . n 
B 1 39  PRO 39  238 238 PRO PRO B . n 
B 1 40  PHE 40  239 239 PHE PHE B . n 
B 1 41  VAL 41  240 240 VAL VAL B . n 
B 1 42  ILE 42  241 241 ILE ILE B . n 
B 1 43  HIS 43  242 242 HIS HIS B . n 
B 1 44  ASP 44  243 243 ASP ASP B . n 
B 1 45  MET 45  244 244 MET MET B . n 
B 1 46  GLU 46  245 245 GLU GLU B . n 
B 1 47  THR 47  246 246 THR THR B . n 
B 1 48  LEU 48  247 247 LEU LEU B . n 
B 1 49  CYS 49  248 248 CYS CYS B . n 
B 1 50  MET 50  249 249 MET MET B . n 
B 1 51  ALA 51  250 250 ALA ALA B . n 
B 1 52  GLU 52  251 251 GLU GLU B . n 
B 1 53  LYS 53  252 252 LYS LYS B . n 
B 1 54  THR 54  253 253 THR THR B . n 
B 1 55  LEU 55  254 254 LEU LEU B . n 
B 1 56  VAL 56  255 255 VAL VAL B . n 
B 1 57  ALA 57  256 256 ALA ALA B . n 
B 1 58  LYS 58  257 257 LYS LYS B . n 
B 1 59  LEU 59  258 258 LEU LEU B . n 
B 1 60  VAL 60  259 259 VAL VAL B . n 
B 1 61  ALA 61  260 260 ALA ALA B . n 
B 1 62  ASN 62  261 261 ASN ASN B . n 
B 1 63  GLY 63  262 262 GLY GLY B . n 
B 1 64  ILE 64  263 263 ILE ILE B . n 
B 1 65  GLN 65  264 264 GLN GLN B . n 
B 1 66  ASN 66  265 265 ASN ASN B . n 
B 1 67  LYS 67  266 266 LYS LYS B . n 
B 1 68  GLU 68  267 267 GLU GLU B . n 
B 1 69  ALA 69  268 268 ALA ALA B . n 
B 1 70  GLU 70  269 269 GLU GLU B . n 
B 1 71  VAL 71  270 270 VAL VAL B . n 
B 1 72  ARG 72  271 271 ARG ARG B . n 
B 1 73  ILE 73  272 272 ILE ILE B . n 
B 1 74  PHE 74  273 273 PHE PHE B . n 
B 1 75  HIS 75  274 274 HIS HIS B . n 
B 1 76  CYS 76  275 275 CYS CYS B . n 
B 1 77  CYS 77  276 276 CYS CYS B . n 
B 1 78  GLN 78  277 277 GLN GLN B . n 
B 1 79  CYS 79  278 278 CYS CYS B . n 
B 1 80  THR 80  279 279 THR THR B . n 
B 1 81  SER 81  280 280 SER SER B . n 
B 1 82  VAL 82  281 281 VAL VAL B . n 
B 1 83  GLU 83  282 282 GLU GLU B . n 
B 1 84  THR 84  283 283 THR THR B . n 
B 1 85  VAL 85  284 284 VAL VAL B . n 
B 1 86  THR 86  285 285 THR THR B . n 
B 1 87  GLU 87  286 286 GLU GLU B . n 
B 1 88  LEU 88  287 287 LEU LEU B . n 
B 1 89  THR 89  288 288 THR THR B . n 
B 1 90  GLU 90  289 289 GLU GLU B . n 
B 1 91  PHE 91  290 290 PHE PHE B . n 
B 1 92  ALA 92  291 291 ALA ALA B . n 
B 1 93  LYS 93  292 292 LYS LYS B . n 
B 1 94  ALA 94  293 293 ALA ALA B . n 
B 1 95  ILE 95  294 294 ILE ILE B . n 
B 1 96  PRO 96  295 295 PRO PRO B . n 
B 1 97  GLY 97  296 296 GLY GLY B . n 
B 1 98  PHE 98  297 297 PHE PHE B . n 
B 1 99  ALA 99  298 298 ALA ALA B . n 
B 1 100 ASN 100 299 299 ASN ASN B . n 
B 1 101 LEU 101 300 300 LEU LEU B . n 
B 1 102 ASP 102 301 301 ASP ASP B . n 
B 1 103 LEU 103 302 302 LEU LEU B . n 
B 1 104 ASN 104 303 303 ASN ASN B . n 
B 1 105 ASP 105 304 304 ASP ASP B . n 
B 1 106 GLN 106 305 305 GLN GLN B . n 
B 1 107 VAL 107 306 306 VAL VAL B . n 
B 1 108 THR 108 307 307 THR THR B . n 
B 1 109 LEU 109 308 308 LEU LEU B . n 
B 1 110 LEU 110 309 309 LEU LEU B . n 
B 1 111 LYS 111 310 310 LYS LYS B . n 
B 1 112 TYR 112 311 311 TYR TYR B . n 
B 1 113 GLY 113 312 312 GLY GLY B . n 
B 1 114 VAL 114 313 313 VAL VAL B . n 
B 1 115 TYR 115 314 314 TYR TYR B . n 
B 1 116 GLU 116 315 315 GLU GLU B . n 
B 1 117 ALA 117 316 316 ALA ALA B . n 
B 1 118 ILE 118 317 317 ILE ILE B . n 
B 1 119 PHE 119 318 318 PHE PHE B . n 
B 1 120 ALA 120 319 319 ALA ALA B . n 
B 1 121 MET 121 320 320 MET MET B . n 
B 1 122 LEU 122 321 321 LEU LEU B . n 
B 1 123 SER 123 322 322 SER SER B . n 
B 1 124 SER 124 323 323 SER SER B . n 
B 1 125 VAL 125 324 324 VAL VAL B . n 
B 1 126 MET 126 325 325 MET MET B . n 
B 1 127 ASN 127 326 326 ASN ASN B . n 
B 1 128 LYS 128 327 327 LYS LYS B . n 
B 1 129 ASP 129 328 328 ASP ASP B . n 
B 1 130 GLY 130 329 329 GLY GLY B . n 
B 1 131 MET 131 330 330 MET MET B . n 
B 1 132 LEU 132 331 331 LEU LEU B . n 
B 1 133 VAL 133 332 332 VAL VAL B . n 
B 1 134 ALA 134 333 333 ALA ALA B . n 
B 1 135 TYR 135 334 334 TYR TYR B . n 
B 1 136 GLY 136 335 335 GLY GLY B . n 
B 1 137 ASN 137 336 336 ASN ASN B . n 
B 1 138 GLY 138 337 337 GLY GLY B . n 
B 1 139 PHE 139 338 338 PHE PHE B . n 
B 1 140 ILE 140 339 339 ILE ILE B . n 
B 1 141 THR 141 340 340 THR THR B . n 
B 1 142 ARG 142 341 341 ARG ARG B . n 
B 1 143 GLU 143 342 342 GLU GLU B . n 
B 1 144 PHE 144 343 343 PHE PHE B . n 
B 1 145 LEU 145 344 344 LEU LEU B . n 
B 1 146 LYS 146 345 345 LYS LYS B . n 
B 1 147 SER 147 346 346 SER SER B . n 
B 1 148 LEU 148 347 347 LEU LEU B . n 
B 1 149 ARG 149 348 348 ARG ARG B . n 
B 1 150 LYS 150 349 349 LYS LYS B . n 
B 1 151 PRO 151 350 350 PRO PRO B . n 
B 1 152 PHE 152 351 351 PHE PHE B . n 
B 1 153 CYS 153 352 352 CYS CYS B . n 
B 1 154 ASP 154 353 353 ASP ASP B . n 
B 1 155 ILE 155 354 354 ILE ILE B . n 
B 1 156 MET 156 355 355 MET MET B . n 
B 1 157 GLU 157 356 356 GLU GLU B . n 
B 1 158 PRO 158 357 357 PRO PRO B . n 
B 1 159 LYS 159 358 358 LYS LYS B . n 
B 1 160 PHE 160 359 359 PHE PHE B . n 
B 1 161 ASP 161 360 360 ASP ASP B . n 
B 1 162 PHE 162 361 361 PHE PHE B . n 
B 1 163 ALA 163 362 362 ALA ALA B . n 
B 1 164 MET 164 363 363 MET MET B . n 
B 1 165 LYS 165 364 364 LYS LYS B . n 
B 1 166 PHE 166 365 365 PHE PHE B . n 
B 1 167 ASN 167 366 366 ASN ASN B . n 
B 1 168 ALA 168 367 367 ALA ALA B . n 
B 1 169 LEU 169 368 368 LEU LEU B . n 
B 1 170 GLU 170 369 369 GLU GLU B . n 
B 1 171 LEU 171 370 370 LEU LEU B . n 
B 1 172 ASP 172 371 371 ASP ASP B . n 
B 1 173 ASP 173 372 372 ASP ASP B . n 
B 1 174 SER 174 373 373 SER SER B . n 
B 1 175 ASP 175 374 374 ASP ASP B . n 
B 1 176 ILE 176 375 375 ILE ILE B . n 
B 1 177 SER 177 376 376 SER SER B . n 
B 1 178 LEU 178 377 377 LEU LEU B . n 
B 1 179 PHE 179 378 378 PHE PHE B . n 
B 1 180 VAL 180 379 379 VAL VAL B . n 
B 1 181 ALA 181 380 380 ALA ALA B . n 
B 1 182 ALA 182 381 381 ALA ALA B . n 
B 1 183 ILE 183 382 382 ILE ILE B . n 
B 1 184 ILE 184 383 383 ILE ILE B . n 
B 1 185 CYS 185 384 384 CYS CYS B . n 
B 1 186 CYS 186 385 385 CYS CYS B . n 
B 1 187 GLY 187 386 386 GLY GLY B . n 
B 1 188 ASP 188 387 387 ASP ASP B . n 
B 1 189 ARG 189 388 388 ARG ARG B . n 
B 1 190 PRO 190 389 389 PRO PRO B . n 
B 1 191 GLY 191 390 390 GLY GLY B . n 
B 1 192 LEU 192 391 391 LEU LEU B . n 
B 1 193 LEU 193 392 392 LEU LEU B . n 
B 1 194 ASN 194 393 393 ASN ASN B . n 
B 1 195 VAL 195 394 394 VAL VAL B . n 
B 1 196 GLY 196 395 395 GLY GLY B . n 
B 1 197 HIS 197 396 396 HIS HIS B . n 
B 1 198 ILE 198 397 397 ILE ILE B . n 
B 1 199 GLU 199 398 398 GLU GLU B . n 
B 1 200 LYS 200 399 399 LYS LYS B . n 
B 1 201 MET 201 400 400 MET MET B . n 
B 1 202 GLN 202 401 401 GLN GLN B . n 
B 1 203 GLU 203 402 402 GLU GLU B . n 
B 1 204 GLY 204 403 403 GLY GLY B . n 
B 1 205 ILE 205 404 404 ILE ILE B . n 
B 1 206 VAL 206 405 405 VAL VAL B . n 
B 1 207 HIS 207 406 406 HIS HIS B . n 
B 1 208 VAL 208 407 407 VAL VAL B . n 
B 1 209 LEU 209 408 408 LEU LEU B . n 
B 1 210 ARG 210 409 409 ARG ARG B . n 
B 1 211 LEU 211 410 410 LEU LEU B . n 
B 1 212 HIS 212 411 411 HIS HIS B . n 
B 1 213 LEU 213 412 412 LEU LEU B . n 
B 1 214 GLN 214 413 413 GLN GLN B . n 
B 1 215 SER 215 414 414 SER SER B . n 
B 1 216 ASN 216 415 415 ASN ASN B . n 
B 1 217 HIS 217 416 416 HIS HIS B . n 
B 1 218 PRO 218 417 417 PRO PRO B . n 
B 1 219 ASP 219 418 418 ASP ASP B . n 
B 1 220 ASP 220 419 419 ASP ASP B . n 
B 1 221 ILE 221 420 420 ILE ILE B . n 
B 1 222 PHE 222 421 421 PHE PHE B . n 
B 1 223 LEU 223 422 422 LEU LEU B . n 
B 1 224 PHE 224 423 423 PHE PHE B . n 
B 1 225 PRO 225 424 424 PRO PRO B . n 
B 1 226 LYS 226 425 425 LYS LYS B . n 
B 1 227 LEU 227 426 426 LEU LEU B . n 
B 1 228 LEU 228 427 427 LEU LEU B . n 
B 1 229 GLN 229 428 428 GLN GLN B . n 
B 1 230 LYS 230 429 429 LYS LYS B . n 
B 1 231 MET 231 430 430 MET MET B . n 
B 1 232 ALA 232 431 431 ALA ALA B . n 
B 1 233 ASP 233 432 432 ASP ASP B . n 
B 1 234 LEU 234 433 433 LEU LEU B . n 
B 1 235 ARG 235 434 434 ARG ARG B . n 
B 1 236 GLN 236 435 435 GLN GLN B . n 
B 1 237 LEU 237 436 436 LEU LEU B . n 
B 1 238 VAL 238 437 437 VAL VAL B . n 
B 1 239 THR 239 438 438 THR THR B . n 
B 1 240 GLU 240 439 439 GLU GLU B . n 
B 1 241 HIS 241 440 440 HIS HIS B . n 
B 1 242 ALA 242 441 441 ALA ALA B . n 
B 1 243 GLN 243 442 442 GLN GLN B . n 
B 1 244 LEU 244 443 443 LEU LEU B . n 
B 1 245 VAL 245 444 444 VAL VAL B . n 
B 1 246 GLN 246 445 445 GLN GLN B . n 
B 1 247 ILE 247 446 446 ILE ILE B . n 
B 1 248 ILE 248 447 447 ILE ILE B . n 
B 1 249 LYS 249 448 448 LYS LYS B . n 
B 1 250 LYS 250 449 449 LYS LYS B . n 
B 1 251 THR 251 450 450 THR THR B . n 
B 1 252 GLU 252 451 451 GLU GLU B . n 
B 1 253 SER 253 452 452 SER SER B . n 
B 1 254 ASP 254 453 453 ASP ASP B . n 
B 1 255 ALA 255 454 454 ALA ALA B . n 
B 1 256 ALA 256 455 455 ALA ALA B . n 
B 1 257 LEU 257 456 456 LEU LEU B . n 
B 1 258 HIS 258 457 457 HIS HIS B . n 
B 1 259 PRO 259 458 458 PRO PRO B . n 
B 1 260 LEU 260 459 459 LEU LEU B . n 
B 1 261 LEU 261 460 460 LEU LEU B . n 
B 1 262 GLN 262 461 461 GLN GLN B . n 
B 1 263 GLU 263 462 462 GLU GLU B . n 
B 1 264 ILE 264 463 463 ILE ILE B . n 
B 1 265 TYR 265 464 464 TYR TYR B . n 
B 1 266 ARG 266 465 465 ARG ARG B . n 
B 1 267 ASP 267 466 466 ASP ASP B . n 
B 1 268 MET 268 467 467 MET MET B . n 
B 1 269 TYR 269 468 468 TYR TYR B . n 
C 1 1   THR 1   200 200 THR ALA C . n 
C 1 2   ALA 2   201 201 ALA ALA C . n 
C 1 3   ASP 3   202 202 ASP ASP C . n 
C 1 4   LEU 4   203 203 LEU LEU C . n 
C 1 5   LYS 5   204 204 LYS LYS C . n 
C 1 6   SER 6   205 205 SER SER C . n 
C 1 7   LEU 7   206 206 LEU LEU C . n 
C 1 8   ALA 8   207 207 ALA ALA C . n 
C 1 9   LYS 9   208 208 LYS LYS C . n 
C 1 10  ARG 10  209 209 ARG ARG C . n 
C 1 11  ILE 11  210 210 ILE ILE C . n 
C 1 12  TYR 12  211 211 TYR TYR C . n 
C 1 13  GLU 13  212 212 GLU GLU C . n 
C 1 14  ALA 14  213 213 ALA ALA C . n 
C 1 15  TYR 15  214 214 TYR TYR C . n 
C 1 16  LEU 16  215 215 LEU LEU C . n 
C 1 17  LYS 17  216 216 LYS LYS C . n 
C 1 18  ASN 18  217 217 ASN ASN C . n 
C 1 19  PHE 19  218 218 PHE PHE C . n 
C 1 20  ASN 20  219 219 ASN ASN C . n 
C 1 21  MET 21  220 220 MET MET C . n 
C 1 22  ASN 22  221 221 ASN ASN C . n 
C 1 23  LYS 23  222 222 LYS LYS C . n 
C 1 24  VAL 24  223 223 VAL VAL C . n 
C 1 25  LYS 25  224 224 LYS LYS C . n 
C 1 26  ALA 26  225 225 ALA ALA C . n 
C 1 27  ARG 27  226 226 ARG ARG C . n 
C 1 28  VAL 28  227 227 VAL VAL C . n 
C 1 29  ILE 29  228 228 ILE ILE C . n 
C 1 30  LEU 30  229 229 LEU LEU C . n 
C 1 31  SER 31  230 230 SER SER C . n 
C 1 32  GLY 32  231 231 GLY GLY C . n 
C 1 33  LYS 33  232 232 LYS LYS C . n 
C 1 34  ALA 34  233 233 ALA ALA C . n 
C 1 35  SER 35  234 234 SER SER C . n 
C 1 36  ASN 36  235 235 ASN ASN C . n 
C 1 37  ASN 37  236 236 ASN ASN C . n 
C 1 38  PRO 38  237 237 PRO PRO C . n 
C 1 39  PRO 39  238 238 PRO PRO C . n 
C 1 40  PHE 40  239 239 PHE PHE C . n 
C 1 41  VAL 41  240 240 VAL VAL C . n 
C 1 42  ILE 42  241 241 ILE ILE C . n 
C 1 43  HIS 43  242 242 HIS HIS C . n 
C 1 44  ASP 44  243 243 ASP ASP C . n 
C 1 45  MET 45  244 244 MET MET C . n 
C 1 46  GLU 46  245 245 GLU GLU C . n 
C 1 47  THR 47  246 246 THR THR C . n 
C 1 48  LEU 48  247 247 LEU LEU C . n 
C 1 49  CYS 49  248 248 CYS CYS C . n 
C 1 50  MET 50  249 249 MET MET C . n 
C 1 51  ALA 51  250 250 ALA ALA C . n 
C 1 52  GLU 52  251 251 GLU GLU C . n 
C 1 53  LYS 53  252 252 LYS LYS C . n 
C 1 54  THR 54  253 253 THR THR C . n 
C 1 55  LEU 55  254 254 LEU LEU C . n 
C 1 56  VAL 56  255 255 VAL VAL C . n 
C 1 57  ALA 57  256 256 ALA ALA C . n 
C 1 58  LYS 58  257 257 LYS LYS C . n 
C 1 59  LEU 59  258 258 LEU LEU C . n 
C 1 60  VAL 60  259 259 VAL VAL C . n 
C 1 61  ALA 61  260 260 ALA ALA C . n 
C 1 62  ASN 62  261 261 ASN ASN C . n 
C 1 63  GLY 63  262 262 GLY GLY C . n 
C 1 64  ILE 64  263 263 ILE ILE C . n 
C 1 65  GLN 65  264 264 GLN GLN C . n 
C 1 66  ASN 66  265 265 ASN ASN C . n 
C 1 67  LYS 67  266 266 LYS LYS C . n 
C 1 68  GLU 68  267 267 GLU GLU C . n 
C 1 69  ALA 69  268 268 ALA ALA C . n 
C 1 70  GLU 70  269 269 GLU GLU C . n 
C 1 71  VAL 71  270 270 VAL VAL C . n 
C 1 72  ARG 72  271 271 ARG ARG C . n 
C 1 73  ILE 73  272 272 ILE ILE C . n 
C 1 74  PHE 74  273 273 PHE PHE C . n 
C 1 75  HIS 75  274 274 HIS HIS C . n 
C 1 76  CYS 76  275 275 CYS CYS C . n 
C 1 77  CYS 77  276 276 CYS CYS C . n 
C 1 78  GLN 78  277 277 GLN GLN C . n 
C 1 79  CYS 79  278 278 CYS CYS C . n 
C 1 80  THR 80  279 279 THR THR C . n 
C 1 81  SER 81  280 280 SER SER C . n 
C 1 82  VAL 82  281 281 VAL VAL C . n 
C 1 83  GLU 83  282 282 GLU GLU C . n 
C 1 84  THR 84  283 283 THR THR C . n 
C 1 85  VAL 85  284 284 VAL VAL C . n 
C 1 86  THR 86  285 285 THR THR C . n 
C 1 87  GLU 87  286 286 GLU GLU C . n 
C 1 88  LEU 88  287 287 LEU LEU C . n 
C 1 89  THR 89  288 288 THR THR C . n 
C 1 90  GLU 90  289 289 GLU GLU C . n 
C 1 91  PHE 91  290 290 PHE PHE C . n 
C 1 92  ALA 92  291 291 ALA ALA C . n 
C 1 93  LYS 93  292 292 LYS LYS C . n 
C 1 94  ALA 94  293 293 ALA ALA C . n 
C 1 95  ILE 95  294 294 ILE ILE C . n 
C 1 96  PRO 96  295 295 PRO PRO C . n 
C 1 97  GLY 97  296 296 GLY GLY C . n 
C 1 98  PHE 98  297 297 PHE PHE C . n 
C 1 99  ALA 99  298 298 ALA ALA C . n 
C 1 100 ASN 100 299 299 ASN ASN C . n 
C 1 101 LEU 101 300 300 LEU LEU C . n 
C 1 102 ASP 102 301 301 ASP ASP C . n 
C 1 103 LEU 103 302 302 LEU LEU C . n 
C 1 104 ASN 104 303 303 ASN ASN C . n 
C 1 105 ASP 105 304 304 ASP ASP C . n 
C 1 106 GLN 106 305 305 GLN GLN C . n 
C 1 107 VAL 107 306 306 VAL VAL C . n 
C 1 108 THR 108 307 307 THR THR C . n 
C 1 109 LEU 109 308 308 LEU LEU C . n 
C 1 110 LEU 110 309 309 LEU LEU C . n 
C 1 111 LYS 111 310 310 LYS LYS C . n 
C 1 112 TYR 112 311 311 TYR TYR C . n 
C 1 113 GLY 113 312 312 GLY GLY C . n 
C 1 114 VAL 114 313 313 VAL VAL C . n 
C 1 115 TYR 115 314 314 TYR TYR C . n 
C 1 116 GLU 116 315 315 GLU GLU C . n 
C 1 117 ALA 117 316 316 ALA ALA C . n 
C 1 118 ILE 118 317 317 ILE ILE C . n 
C 1 119 PHE 119 318 318 PHE PHE C . n 
C 1 120 ALA 120 319 319 ALA ALA C . n 
C 1 121 MET 121 320 320 MET MET C . n 
C 1 122 LEU 122 321 321 LEU LEU C . n 
C 1 123 SER 123 322 322 SER SER C . n 
C 1 124 SER 124 323 323 SER SER C . n 
C 1 125 VAL 125 324 324 VAL VAL C . n 
C 1 126 MET 126 325 325 MET MET C . n 
C 1 127 ASN 127 326 326 ASN ASN C . n 
C 1 128 LYS 128 327 327 LYS LYS C . n 
C 1 129 ASP 129 328 328 ASP ASP C . n 
C 1 130 GLY 130 329 329 GLY GLY C . n 
C 1 131 MET 131 330 330 MET MET C . n 
C 1 132 LEU 132 331 331 LEU LEU C . n 
C 1 133 VAL 133 332 332 VAL VAL C . n 
C 1 134 ALA 134 333 333 ALA ALA C . n 
C 1 135 TYR 135 334 334 TYR TYR C . n 
C 1 136 GLY 136 335 335 GLY GLY C . n 
C 1 137 ASN 137 336 336 ASN ASN C . n 
C 1 138 GLY 138 337 337 GLY GLY C . n 
C 1 139 PHE 139 338 338 PHE PHE C . n 
C 1 140 ILE 140 339 339 ILE ILE C . n 
C 1 141 THR 141 340 340 THR THR C . n 
C 1 142 ARG 142 341 341 ARG ARG C . n 
C 1 143 GLU 143 342 342 GLU GLU C . n 
C 1 144 PHE 144 343 343 PHE PHE C . n 
C 1 145 LEU 145 344 344 LEU LEU C . n 
C 1 146 LYS 146 345 345 LYS LYS C . n 
C 1 147 SER 147 346 346 SER SER C . n 
C 1 148 LEU 148 347 347 LEU LEU C . n 
C 1 149 ARG 149 348 348 ARG ARG C . n 
C 1 150 LYS 150 349 349 LYS LYS C . n 
C 1 151 PRO 151 350 350 PRO PRO C . n 
C 1 152 PHE 152 351 351 PHE PHE C . n 
C 1 153 CYS 153 352 352 CYS CYS C . n 
C 1 154 ASP 154 353 353 ASP ASP C . n 
C 1 155 ILE 155 354 354 ILE ILE C . n 
C 1 156 MET 156 355 355 MET MET C . n 
C 1 157 GLU 157 356 356 GLU GLU C . n 
C 1 158 PRO 158 357 357 PRO PRO C . n 
C 1 159 LYS 159 358 358 LYS LYS C . n 
C 1 160 PHE 160 359 359 PHE PHE C . n 
C 1 161 ASP 161 360 360 ASP ASP C . n 
C 1 162 PHE 162 361 361 PHE PHE C . n 
C 1 163 ALA 163 362 362 ALA ALA C . n 
C 1 164 MET 164 363 363 MET MET C . n 
C 1 165 LYS 165 364 364 LYS LYS C . n 
C 1 166 PHE 166 365 365 PHE PHE C . n 
C 1 167 ASN 167 366 366 ASN ASN C . n 
C 1 168 ALA 168 367 367 ALA ALA C . n 
C 1 169 LEU 169 368 368 LEU LEU C . n 
C 1 170 GLU 170 369 369 GLU GLU C . n 
C 1 171 LEU 171 370 370 LEU LEU C . n 
C 1 172 ASP 172 371 371 ASP ASP C . n 
C 1 173 ASP 173 372 372 ASP ASP C . n 
C 1 174 SER 174 373 373 SER SER C . n 
C 1 175 ASP 175 374 374 ASP ASP C . n 
C 1 176 ILE 176 375 375 ILE ILE C . n 
C 1 177 SER 177 376 376 SER SER C . n 
C 1 178 LEU 178 377 377 LEU LEU C . n 
C 1 179 PHE 179 378 378 PHE PHE C . n 
C 1 180 VAL 180 379 379 VAL VAL C . n 
C 1 181 ALA 181 380 380 ALA ALA C . n 
C 1 182 ALA 182 381 381 ALA ALA C . n 
C 1 183 ILE 183 382 382 ILE ILE C . n 
C 1 184 ILE 184 383 383 ILE ILE C . n 
C 1 185 CYS 185 384 384 CYS CYS C . n 
C 1 186 CYS 186 385 385 CYS CYS C . n 
C 1 187 GLY 187 386 386 GLY GLY C . n 
C 1 188 ASP 188 387 387 ASP ASP C . n 
C 1 189 ARG 189 388 388 ARG ARG C . n 
C 1 190 PRO 190 389 389 PRO PRO C . n 
C 1 191 GLY 191 390 390 GLY GLY C . n 
C 1 192 LEU 192 391 391 LEU LEU C . n 
C 1 193 LEU 193 392 392 LEU LEU C . n 
C 1 194 ASN 194 393 393 ASN ASN C . n 
C 1 195 VAL 195 394 394 VAL VAL C . n 
C 1 196 GLY 196 395 395 GLY GLY C . n 
C 1 197 HIS 197 396 396 HIS HIS C . n 
C 1 198 ILE 198 397 397 ILE ILE C . n 
C 1 199 GLU 199 398 398 GLU GLU C . n 
C 1 200 LYS 200 399 399 LYS LYS C . n 
C 1 201 MET 201 400 400 MET MET C . n 
C 1 202 GLN 202 401 401 GLN GLN C . n 
C 1 203 GLU 203 402 402 GLU GLU C . n 
C 1 204 GLY 204 403 403 GLY GLY C . n 
C 1 205 ILE 205 404 404 ILE ILE C . n 
C 1 206 VAL 206 405 405 VAL VAL C . n 
C 1 207 HIS 207 406 406 HIS HIS C . n 
C 1 208 VAL 208 407 407 VAL VAL C . n 
C 1 209 LEU 209 408 408 LEU LEU C . n 
C 1 210 ARG 210 409 409 ARG ARG C . n 
C 1 211 LEU 211 410 410 LEU LEU C . n 
C 1 212 HIS 212 411 411 HIS HIS C . n 
C 1 213 LEU 213 412 412 LEU LEU C . n 
C 1 214 GLN 214 413 413 GLN GLN C . n 
C 1 215 SER 215 414 414 SER SER C . n 
C 1 216 ASN 216 415 415 ASN ASN C . n 
C 1 217 HIS 217 416 416 HIS HIS C . n 
C 1 218 PRO 218 417 417 PRO PRO C . n 
C 1 219 ASP 219 418 418 ASP ASP C . n 
C 1 220 ASP 220 419 419 ASP ASP C . n 
C 1 221 ILE 221 420 420 ILE ILE C . n 
C 1 222 PHE 222 421 421 PHE PHE C . n 
C 1 223 LEU 223 422 422 LEU LEU C . n 
C 1 224 PHE 224 423 423 PHE PHE C . n 
C 1 225 PRO 225 424 424 PRO PRO C . n 
C 1 226 LYS 226 425 425 LYS LYS C . n 
C 1 227 LEU 227 426 426 LEU LEU C . n 
C 1 228 LEU 228 427 427 LEU LEU C . n 
C 1 229 GLN 229 428 428 GLN GLN C . n 
C 1 230 LYS 230 429 429 LYS LYS C . n 
C 1 231 MET 231 430 430 MET MET C . n 
C 1 232 ALA 232 431 431 ALA ALA C . n 
C 1 233 ASP 233 432 432 ASP ASP C . n 
C 1 234 LEU 234 433 433 LEU LEU C . n 
C 1 235 ARG 235 434 434 ARG ARG C . n 
C 1 236 GLN 236 435 435 GLN GLN C . n 
C 1 237 LEU 237 436 436 LEU LEU C . n 
C 1 238 VAL 238 437 437 VAL VAL C . n 
C 1 239 THR 239 438 438 THR THR C . n 
C 1 240 GLU 240 439 439 GLU GLU C . n 
C 1 241 HIS 241 440 440 HIS HIS C . n 
C 1 242 ALA 242 441 441 ALA ALA C . n 
C 1 243 GLN 243 442 442 GLN GLN C . n 
C 1 244 LEU 244 443 443 LEU LEU C . n 
C 1 245 VAL 245 444 444 VAL VAL C . n 
C 1 246 GLN 246 445 445 GLN GLN C . n 
C 1 247 ILE 247 446 446 ILE ILE C . n 
C 1 248 ILE 248 447 447 ILE ILE C . n 
C 1 249 LYS 249 448 448 LYS LYS C . n 
C 1 250 LYS 250 449 449 LYS LYS C . n 
C 1 251 THR 251 450 450 THR THR C . n 
C 1 252 GLU 252 451 451 GLU GLU C . n 
C 1 253 SER 253 452 452 SER SER C . n 
C 1 254 ASP 254 453 453 ASP ASP C . n 
C 1 255 ALA 255 454 454 ALA ALA C . n 
C 1 256 ALA 256 455 455 ALA ALA C . n 
C 1 257 LEU 257 456 456 LEU LEU C . n 
C 1 258 HIS 258 457 457 HIS HIS C . n 
C 1 259 PRO 259 458 458 PRO PRO C . n 
C 1 260 LEU 260 459 459 LEU LEU C . n 
C 1 261 LEU 261 460 460 LEU LEU C . n 
C 1 262 GLN 262 461 461 GLN GLN C . n 
C 1 263 GLU 263 462 462 GLU GLU C . n 
C 1 264 ILE 264 463 463 ILE ILE C . n 
C 1 265 TYR 265 464 464 TYR TYR C . n 
C 1 266 ARG 266 465 465 ARG ARG C . n 
C 1 267 ASP 267 466 466 ASP ASP C . n 
C 1 268 MET 268 467 467 MET MET C . n 
C 1 269 TYR 269 468 468 TYR TYR C . n 
D 1 1   THR 1   200 200 THR ALA D . n 
D 1 2   ALA 2   201 201 ALA ALA D . n 
D 1 3   ASP 3   202 202 ASP ASP D . n 
D 1 4   LEU 4   203 203 LEU LEU D . n 
D 1 5   LYS 5   204 204 LYS LYS D . n 
D 1 6   SER 6   205 205 SER SER D . n 
D 1 7   LEU 7   206 206 LEU LEU D . n 
D 1 8   ALA 8   207 207 ALA ALA D . n 
D 1 9   LYS 9   208 208 LYS LYS D . n 
D 1 10  ARG 10  209 209 ARG ARG D . n 
D 1 11  ILE 11  210 210 ILE ILE D . n 
D 1 12  TYR 12  211 211 TYR TYR D . n 
D 1 13  GLU 13  212 212 GLU GLU D . n 
D 1 14  ALA 14  213 213 ALA ALA D . n 
D 1 15  TYR 15  214 214 TYR TYR D . n 
D 1 16  LEU 16  215 215 LEU LEU D . n 
D 1 17  LYS 17  216 216 LYS LYS D . n 
D 1 18  ASN 18  217 217 ASN ASN D . n 
D 1 19  PHE 19  218 218 PHE PHE D . n 
D 1 20  ASN 20  219 219 ASN ASN D . n 
D 1 21  MET 21  220 220 MET MET D . n 
D 1 22  ASN 22  221 221 ASN ASN D . n 
D 1 23  LYS 23  222 222 LYS LYS D . n 
D 1 24  VAL 24  223 223 VAL VAL D . n 
D 1 25  LYS 25  224 224 LYS LYS D . n 
D 1 26  ALA 26  225 225 ALA ALA D . n 
D 1 27  ARG 27  226 226 ARG ARG D . n 
D 1 28  VAL 28  227 227 VAL VAL D . n 
D 1 29  ILE 29  228 228 ILE ILE D . n 
D 1 30  LEU 30  229 229 LEU LEU D . n 
D 1 31  SER 31  230 230 SER SER D . n 
D 1 32  GLY 32  231 231 GLY GLY D . n 
D 1 33  LYS 33  232 232 LYS LYS D . n 
D 1 34  ALA 34  233 233 ALA ALA D . n 
D 1 35  SER 35  234 234 SER SER D . n 
D 1 36  ASN 36  235 235 ASN ASN D . n 
D 1 37  ASN 37  236 236 ASN ASN D . n 
D 1 38  PRO 38  237 237 PRO PRO D . n 
D 1 39  PRO 39  238 238 PRO PRO D . n 
D 1 40  PHE 40  239 239 PHE PHE D . n 
D 1 41  VAL 41  240 240 VAL VAL D . n 
D 1 42  ILE 42  241 241 ILE ILE D . n 
D 1 43  HIS 43  242 242 HIS HIS D . n 
D 1 44  ASP 44  243 243 ASP ASP D . n 
D 1 45  MET 45  244 244 MET MET D . n 
D 1 46  GLU 46  245 245 GLU GLU D . n 
D 1 47  THR 47  246 246 THR THR D . n 
D 1 48  LEU 48  247 247 LEU LEU D . n 
D 1 49  CYS 49  248 248 CYS CYS D . n 
D 1 50  MET 50  249 249 MET MET D . n 
D 1 51  ALA 51  250 250 ALA ALA D . n 
D 1 52  GLU 52  251 251 GLU GLU D . n 
D 1 53  LYS 53  252 252 LYS LYS D . n 
D 1 54  THR 54  253 253 THR THR D . n 
D 1 55  LEU 55  254 254 LEU LEU D . n 
D 1 56  VAL 56  255 255 VAL VAL D . n 
D 1 57  ALA 57  256 256 ALA ALA D . n 
D 1 58  LYS 58  257 257 LYS LYS D . n 
D 1 59  LEU 59  258 258 LEU LEU D . n 
D 1 60  VAL 60  259 259 VAL VAL D . n 
D 1 61  ALA 61  260 260 ALA ALA D . n 
D 1 62  ASN 62  261 261 ASN ASN D . n 
D 1 63  GLY 63  262 262 GLY GLY D . n 
D 1 64  ILE 64  263 263 ILE ILE D . n 
D 1 65  GLN 65  264 264 GLN GLN D . n 
D 1 66  ASN 66  265 265 ASN ASN D . n 
D 1 67  LYS 67  266 266 LYS LYS D . n 
D 1 68  GLU 68  267 267 GLU GLU D . n 
D 1 69  ALA 69  268 268 ALA ALA D . n 
D 1 70  GLU 70  269 269 GLU GLU D . n 
D 1 71  VAL 71  270 270 VAL VAL D . n 
D 1 72  ARG 72  271 271 ARG ARG D . n 
D 1 73  ILE 73  272 272 ILE ILE D . n 
D 1 74  PHE 74  273 273 PHE PHE D . n 
D 1 75  HIS 75  274 274 HIS HIS D . n 
D 1 76  CYS 76  275 275 CYS CYS D . n 
D 1 77  CYS 77  276 276 CYS CYS D . n 
D 1 78  GLN 78  277 277 GLN GLN D . n 
D 1 79  CYS 79  278 278 CYS CYS D . n 
D 1 80  THR 80  279 279 THR THR D . n 
D 1 81  SER 81  280 280 SER SER D . n 
D 1 82  VAL 82  281 281 VAL VAL D . n 
D 1 83  GLU 83  282 282 GLU GLU D . n 
D 1 84  THR 84  283 283 THR THR D . n 
D 1 85  VAL 85  284 284 VAL VAL D . n 
D 1 86  THR 86  285 285 THR THR D . n 
D 1 87  GLU 87  286 286 GLU GLU D . n 
D 1 88  LEU 88  287 287 LEU LEU D . n 
D 1 89  THR 89  288 288 THR THR D . n 
D 1 90  GLU 90  289 289 GLU GLU D . n 
D 1 91  PHE 91  290 290 PHE PHE D . n 
D 1 92  ALA 92  291 291 ALA ALA D . n 
D 1 93  LYS 93  292 292 LYS LYS D . n 
D 1 94  ALA 94  293 293 ALA ALA D . n 
D 1 95  ILE 95  294 294 ILE ILE D . n 
D 1 96  PRO 96  295 295 PRO PRO D . n 
D 1 97  GLY 97  296 296 GLY GLY D . n 
D 1 98  PHE 98  297 297 PHE PHE D . n 
D 1 99  ALA 99  298 298 ALA ALA D . n 
D 1 100 ASN 100 299 299 ASN ASN D . n 
D 1 101 LEU 101 300 300 LEU LEU D . n 
D 1 102 ASP 102 301 301 ASP ASP D . n 
D 1 103 LEU 103 302 302 LEU LEU D . n 
D 1 104 ASN 104 303 303 ASN ASN D . n 
D 1 105 ASP 105 304 304 ASP ASP D . n 
D 1 106 GLN 106 305 305 GLN GLN D . n 
D 1 107 VAL 107 306 306 VAL VAL D . n 
D 1 108 THR 108 307 307 THR THR D . n 
D 1 109 LEU 109 308 308 LEU LEU D . n 
D 1 110 LEU 110 309 309 LEU LEU D . n 
D 1 111 LYS 111 310 310 LYS LYS D . n 
D 1 112 TYR 112 311 311 TYR TYR D . n 
D 1 113 GLY 113 312 312 GLY GLY D . n 
D 1 114 VAL 114 313 313 VAL VAL D . n 
D 1 115 TYR 115 314 314 TYR TYR D . n 
D 1 116 GLU 116 315 315 GLU GLU D . n 
D 1 117 ALA 117 316 316 ALA ALA D . n 
D 1 118 ILE 118 317 317 ILE ILE D . n 
D 1 119 PHE 119 318 318 PHE PHE D . n 
D 1 120 ALA 120 319 319 ALA ALA D . n 
D 1 121 MET 121 320 320 MET MET D . n 
D 1 122 LEU 122 321 321 LEU LEU D . n 
D 1 123 SER 123 322 322 SER SER D . n 
D 1 124 SER 124 323 323 SER SER D . n 
D 1 125 VAL 125 324 324 VAL VAL D . n 
D 1 126 MET 126 325 325 MET MET D . n 
D 1 127 ASN 127 326 326 ASN ASN D . n 
D 1 128 LYS 128 327 327 LYS LYS D . n 
D 1 129 ASP 129 328 328 ASP ASP D . n 
D 1 130 GLY 130 329 329 GLY GLY D . n 
D 1 131 MET 131 330 330 MET MET D . n 
D 1 132 LEU 132 331 331 LEU LEU D . n 
D 1 133 VAL 133 332 332 VAL VAL D . n 
D 1 134 ALA 134 333 333 ALA ALA D . n 
D 1 135 TYR 135 334 334 TYR TYR D . n 
D 1 136 GLY 136 335 335 GLY GLY D . n 
D 1 137 ASN 137 336 336 ASN ASN D . n 
D 1 138 GLY 138 337 337 GLY GLY D . n 
D 1 139 PHE 139 338 338 PHE PHE D . n 
D 1 140 ILE 140 339 339 ILE ILE D . n 
D 1 141 THR 141 340 340 THR THR D . n 
D 1 142 ARG 142 341 341 ARG ARG D . n 
D 1 143 GLU 143 342 342 GLU GLU D . n 
D 1 144 PHE 144 343 343 PHE PHE D . n 
D 1 145 LEU 145 344 344 LEU LEU D . n 
D 1 146 LYS 146 345 345 LYS LYS D . n 
D 1 147 SER 147 346 346 SER SER D . n 
D 1 148 LEU 148 347 347 LEU LEU D . n 
D 1 149 ARG 149 348 348 ARG ARG D . n 
D 1 150 LYS 150 349 349 LYS LYS D . n 
D 1 151 PRO 151 350 350 PRO PRO D . n 
D 1 152 PHE 152 351 351 PHE PHE D . n 
D 1 153 CYS 153 352 352 CYS CYS D . n 
D 1 154 ASP 154 353 353 ASP ASP D . n 
D 1 155 ILE 155 354 354 ILE ILE D . n 
D 1 156 MET 156 355 355 MET MET D . n 
D 1 157 GLU 157 356 356 GLU GLU D . n 
D 1 158 PRO 158 357 357 PRO PRO D . n 
D 1 159 LYS 159 358 358 LYS LYS D . n 
D 1 160 PHE 160 359 359 PHE PHE D . n 
D 1 161 ASP 161 360 360 ASP ASP D . n 
D 1 162 PHE 162 361 361 PHE PHE D . n 
D 1 163 ALA 163 362 362 ALA ALA D . n 
D 1 164 MET 164 363 363 MET MET D . n 
D 1 165 LYS 165 364 364 LYS LYS D . n 
D 1 166 PHE 166 365 365 PHE PHE D . n 
D 1 167 ASN 167 366 366 ASN ASN D . n 
D 1 168 ALA 168 367 367 ALA ALA D . n 
D 1 169 LEU 169 368 368 LEU LEU D . n 
D 1 170 GLU 170 369 369 GLU GLU D . n 
D 1 171 LEU 171 370 370 LEU LEU D . n 
D 1 172 ASP 172 371 371 ASP ASP D . n 
D 1 173 ASP 173 372 372 ASP ASP D . n 
D 1 174 SER 174 373 373 SER SER D . n 
D 1 175 ASP 175 374 374 ASP ASP D . n 
D 1 176 ILE 176 375 375 ILE ILE D . n 
D 1 177 SER 177 376 376 SER SER D . n 
D 1 178 LEU 178 377 377 LEU LEU D . n 
D 1 179 PHE 179 378 378 PHE PHE D . n 
D 1 180 VAL 180 379 379 VAL VAL D . n 
D 1 181 ALA 181 380 380 ALA ALA D . n 
D 1 182 ALA 182 381 381 ALA ALA D . n 
D 1 183 ILE 183 382 382 ILE ILE D . n 
D 1 184 ILE 184 383 383 ILE ILE D . n 
D 1 185 CYS 185 384 384 CYS CYS D . n 
D 1 186 CYS 186 385 385 CYS CYS D . n 
D 1 187 GLY 187 386 386 GLY GLY D . n 
D 1 188 ASP 188 387 387 ASP ASP D . n 
D 1 189 ARG 189 388 388 ARG ARG D . n 
D 1 190 PRO 190 389 389 PRO PRO D . n 
D 1 191 GLY 191 390 390 GLY GLY D . n 
D 1 192 LEU 192 391 391 LEU LEU D . n 
D 1 193 LEU 193 392 392 LEU LEU D . n 
D 1 194 ASN 194 393 393 ASN ASN D . n 
D 1 195 VAL 195 394 394 VAL VAL D . n 
D 1 196 GLY 196 395 395 GLY GLY D . n 
D 1 197 HIS 197 396 396 HIS HIS D . n 
D 1 198 ILE 198 397 397 ILE ILE D . n 
D 1 199 GLU 199 398 398 GLU GLU D . n 
D 1 200 LYS 200 399 399 LYS LYS D . n 
D 1 201 MET 201 400 400 MET MET D . n 
D 1 202 GLN 202 401 401 GLN GLN D . n 
D 1 203 GLU 203 402 402 GLU GLU D . n 
D 1 204 GLY 204 403 403 GLY GLY D . n 
D 1 205 ILE 205 404 404 ILE ILE D . n 
D 1 206 VAL 206 405 405 VAL VAL D . n 
D 1 207 HIS 207 406 406 HIS HIS D . n 
D 1 208 VAL 208 407 407 VAL VAL D . n 
D 1 209 LEU 209 408 408 LEU LEU D . n 
D 1 210 ARG 210 409 409 ARG ARG D . n 
D 1 211 LEU 211 410 410 LEU LEU D . n 
D 1 212 HIS 212 411 411 HIS HIS D . n 
D 1 213 LEU 213 412 412 LEU LEU D . n 
D 1 214 GLN 214 413 413 GLN GLN D . n 
D 1 215 SER 215 414 414 SER SER D . n 
D 1 216 ASN 216 415 415 ASN ASN D . n 
D 1 217 HIS 217 416 416 HIS HIS D . n 
D 1 218 PRO 218 417 417 PRO PRO D . n 
D 1 219 ASP 219 418 418 ASP ASP D . n 
D 1 220 ASP 220 419 419 ASP ASP D . n 
D 1 221 ILE 221 420 420 ILE ILE D . n 
D 1 222 PHE 222 421 421 PHE PHE D . n 
D 1 223 LEU 223 422 422 LEU LEU D . n 
D 1 224 PHE 224 423 423 PHE PHE D . n 
D 1 225 PRO 225 424 424 PRO PRO D . n 
D 1 226 LYS 226 425 425 LYS LYS D . n 
D 1 227 LEU 227 426 426 LEU LEU D . n 
D 1 228 LEU 228 427 427 LEU LEU D . n 
D 1 229 GLN 229 428 428 GLN GLN D . n 
D 1 230 LYS 230 429 429 LYS LYS D . n 
D 1 231 MET 231 430 430 MET MET D . n 
D 1 232 ALA 232 431 431 ALA ALA D . n 
D 1 233 ASP 233 432 432 ASP ASP D . n 
D 1 234 LEU 234 433 433 LEU LEU D . n 
D 1 235 ARG 235 434 434 ARG ARG D . n 
D 1 236 GLN 236 435 435 GLN GLN D . n 
D 1 237 LEU 237 436 436 LEU LEU D . n 
D 1 238 VAL 238 437 437 VAL VAL D . n 
D 1 239 THR 239 438 438 THR THR D . n 
D 1 240 GLU 240 439 439 GLU GLU D . n 
D 1 241 HIS 241 440 440 HIS HIS D . n 
D 1 242 ALA 242 441 441 ALA ALA D . n 
D 1 243 GLN 243 442 442 GLN GLN D . n 
D 1 244 LEU 244 443 443 LEU LEU D . n 
D 1 245 VAL 245 444 444 VAL VAL D . n 
D 1 246 GLN 246 445 445 GLN GLN D . n 
D 1 247 ILE 247 446 446 ILE ILE D . n 
D 1 248 ILE 248 447 447 ILE ILE D . n 
D 1 249 LYS 249 448 448 LYS LYS D . n 
D 1 250 LYS 250 449 449 LYS LYS D . n 
D 1 251 THR 251 450 450 THR THR D . n 
D 1 252 GLU 252 451 451 GLU GLU D . n 
D 1 253 SER 253 452 452 SER SER D . n 
D 1 254 ASP 254 453 453 ASP ASP D . n 
D 1 255 ALA 255 454 454 ALA ALA D . n 
D 1 256 ALA 256 455 455 ALA ALA D . n 
D 1 257 LEU 257 456 456 LEU LEU D . n 
D 1 258 HIS 258 457 457 HIS HIS D . n 
D 1 259 PRO 259 458 458 PRO PRO D . n 
D 1 260 LEU 260 459 459 LEU LEU D . n 
D 1 261 LEU 261 460 460 LEU LEU D . n 
D 1 262 GLN 262 461 461 GLN GLN D . n 
D 1 263 GLU 263 462 462 GLU GLU D . n 
D 1 264 ILE 264 463 463 ILE ILE D . n 
D 1 265 TYR 265 464 464 TYR TYR D . n 
D 1 266 ARG 266 465 465 ARG ARG D . n 
D 1 267 ASP 267 466 466 ASP ASP D . n 
D 1 268 MET 268 467 467 MET MET D . n 
D 1 269 TYR 269 468 468 TYR TYR D . n 
E 2 1   ASN 1   682 682 ASN ALA E . n 
E 2 2   MET 2   683 683 MET MET E . n 
E 2 3   GLY 3   684 684 GLY GLY E . n 
E 2 4   LEU 4   685 685 LEU LEU E . n 
E 2 5   GLU 5   686 686 GLU GLU E . n 
E 2 6   ALA 6   687 687 ALA ALA E . n 
E 2 7   ILE 7   688 688 ILE ILE E . n 
E 2 8   ILE 8   689 689 ILE ILE E . n 
E 2 9   ARG 9   690 690 ARG ARG E . n 
E 2 10  LYS 10  691 691 LYS LYS E . n 
E 2 11  ALA 11  692 692 ALA ALA E . n 
E 2 12  LEU 12  693 693 LEU LEU E . n 
E 2 13  MET 13  694 694 MET MET E . n 
E 2 14  GLY 14  695 695 GLY GLY E . n 
E 2 15  LYS 15  696 696 LYS ALA E . n 
E 2 16  TYR 16  697 697 TYR TYR E . n 
E 2 17  ASP 17  698 698 ASP ASP E . n 
E 2 18  GLN 18  699 699 GLN ALA E . n 
E 2 19  TRP 19  700 700 TRP TRP E . n 
F 2 1   ASN 1   682 682 ASN ALA F . n 
F 2 2   MET 2   683 683 MET MET F . n 
F 2 3   GLY 3   684 684 GLY GLY F . n 
F 2 4   LEU 4   685 685 LEU LEU F . n 
F 2 5   GLU 5   686 686 GLU GLU F . n 
F 2 6   ALA 6   687 687 ALA ALA F . n 
F 2 7   ILE 7   688 688 ILE ILE F . n 
F 2 8   ILE 8   689 689 ILE ILE F . n 
F 2 9   ARG 9   690 690 ARG ARG F . n 
F 2 10  LYS 10  691 691 LYS LYS F . n 
F 2 11  ALA 11  692 692 ALA ALA F . n 
F 2 12  LEU 12  693 693 LEU LEU F . n 
F 2 13  MET 13  694 694 MET MET F . n 
F 2 14  GLY 14  695 695 GLY GLY F . n 
F 2 15  LYS 15  696 696 LYS LYS F . n 
F 2 16  TYR 16  697 697 TYR TYR F . n 
F 2 17  ASP 17  698 698 ASP ASP F . n 
F 2 18  GLN 18  699 699 GLN ALA F . n 
F 2 19  TRP 19  700 700 TRP TRP F . n 
G 2 1   ASN 1   682 682 ASN ALA G . n 
G 2 2   MET 2   683 683 MET MET G . n 
G 2 3   GLY 3   684 684 GLY GLY G . n 
G 2 4   LEU 4   685 685 LEU LEU G . n 
G 2 5   GLU 5   686 686 GLU GLU G . n 
G 2 6   ALA 6   687 687 ALA ALA G . n 
G 2 7   ILE 7   688 688 ILE ILE G . n 
G 2 8   ILE 8   689 689 ILE ILE G . n 
G 2 9   ARG 9   690 690 ARG ARG G . n 
G 2 10  LYS 10  691 691 LYS LYS G . n 
G 2 11  ALA 11  692 692 ALA ALA G . n 
G 2 12  LEU 12  693 693 LEU LEU G . n 
G 2 13  MET 13  694 694 MET MET G . n 
G 2 14  GLY 14  695 695 GLY GLY G . n 
G 2 15  LYS 15  696 696 LYS ALA G . n 
G 2 16  TYR 16  697 697 TYR TYR G . n 
G 2 17  ASP 17  698 698 ASP ASP G . n 
G 2 18  GLN 18  699 699 GLN ALA G . n 
G 2 19  TRP 19  700 700 TRP TRP G . n 
H 2 1   ASN 1   682 682 ASN ALA H . n 
H 2 2   MET 2   683 683 MET MET H . n 
H 2 3   GLY 3   684 684 GLY GLY H . n 
H 2 4   LEU 4   685 685 LEU LEU H . n 
H 2 5   GLU 5   686 686 GLU GLU H . n 
H 2 6   ALA 6   687 687 ALA ALA H . n 
H 2 7   ILE 7   688 688 ILE ILE H . n 
H 2 8   ILE 8   689 689 ILE ILE H . n 
H 2 9   ARG 9   690 690 ARG ARG H . n 
H 2 10  LYS 10  691 691 LYS LYS H . n 
H 2 11  ALA 11  692 692 ALA ALA H . n 
H 2 12  LEU 12  693 693 LEU LEU H . n 
H 2 13  MET 13  694 694 MET MET H . n 
H 2 14  GLY 14  695 695 GLY GLY H . n 
H 2 15  LYS 15  696 696 LYS ALA H . n 
H 2 16  TYR 16  697 697 TYR TYR H . n 
H 2 17  ASP 17  698 698 ASP ASP H . n 
H 2 18  GLN 18  699 699 GLN ALA H . n 
H 2 19  TRP 19  700 700 TRP TRP H . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 3 471 1   775 1   471 471 A . 
J 3 471 1   776 2   471 471 B . 
K 3 471 1   777 3   471 471 C . 
L 3 471 1   778 4   471 471 D . 
M 4 HOH 1   776 7   HOH HOH A . 
M 4 HOH 2   777 10  HOH HOH A . 
M 4 HOH 3   778 22  HOH HOH A . 
M 4 HOH 4   779 23  HOH HOH A . 
M 4 HOH 5   780 29  HOH HOH A . 
M 4 HOH 6   781 30  HOH HOH A . 
M 4 HOH 7   782 33  HOH HOH A . 
M 4 HOH 8   783 36  HOH HOH A . 
M 4 HOH 9   784 41  HOH HOH A . 
M 4 HOH 10  785 43  HOH HOH A . 
M 4 HOH 11  786 51  HOH HOH A . 
M 4 HOH 12  787 61  HOH HOH A . 
M 4 HOH 13  788 91  HOH HOH A . 
M 4 HOH 14  789 97  HOH HOH A . 
M 4 HOH 15  790 103 HOH HOH A . 
M 4 HOH 16  791 105 HOH HOH A . 
M 4 HOH 17  792 109 HOH HOH A . 
M 4 HOH 18  793 110 HOH HOH A . 
M 4 HOH 19  794 114 HOH HOH A . 
M 4 HOH 20  795 117 HOH HOH A . 
M 4 HOH 21  796 122 HOH HOH A . 
M 4 HOH 22  797 124 HOH HOH A . 
M 4 HOH 23  798 125 HOH HOH A . 
M 4 HOH 24  799 137 HOH HOH A . 
M 4 HOH 25  800 142 HOH HOH A . 
M 4 HOH 26  801 146 HOH HOH A . 
M 4 HOH 27  802 147 HOH HOH A . 
M 4 HOH 28  803 149 HOH HOH A . 
M 4 HOH 29  804 155 HOH HOH A . 
M 4 HOH 30  805 159 HOH HOH A . 
M 4 HOH 31  806 164 HOH HOH A . 
M 4 HOH 32  807 170 HOH HOH A . 
M 4 HOH 33  808 174 HOH HOH A . 
M 4 HOH 34  809 176 HOH HOH A . 
M 4 HOH 35  810 181 HOH HOH A . 
M 4 HOH 36  811 182 HOH HOH A . 
M 4 HOH 37  812 187 HOH HOH A . 
M 4 HOH 38  813 189 HOH HOH A . 
M 4 HOH 39  814 191 HOH HOH A . 
M 4 HOH 40  815 192 HOH HOH A . 
M 4 HOH 41  816 201 HOH HOH A . 
M 4 HOH 42  817 204 HOH HOH A . 
M 4 HOH 43  818 208 HOH HOH A . 
M 4 HOH 44  819 209 HOH HOH A . 
M 4 HOH 45  820 218 HOH HOH A . 
M 4 HOH 46  821 223 HOH HOH A . 
M 4 HOH 47  822 228 HOH HOH A . 
M 4 HOH 48  823 229 HOH HOH A . 
M 4 HOH 49  824 232 HOH HOH A . 
M 4 HOH 50  825 235 HOH HOH A . 
M 4 HOH 51  826 263 HOH HOH A . 
M 4 HOH 52  827 275 HOH HOH A . 
M 4 HOH 53  828 287 HOH HOH A . 
M 4 HOH 54  829 288 HOH HOH A . 
M 4 HOH 55  830 290 HOH HOH A . 
M 4 HOH 56  831 291 HOH HOH A . 
M 4 HOH 57  832 294 HOH HOH A . 
M 4 HOH 58  833 303 HOH HOH A . 
M 4 HOH 59  834 304 HOH HOH A . 
M 4 HOH 60  835 305 HOH HOH A . 
M 4 HOH 61  836 310 HOH HOH A . 
N 4 HOH 1   777 1   HOH HOH B . 
N 4 HOH 2   778 5   HOH HOH B . 
N 4 HOH 3   779 6   HOH HOH B . 
N 4 HOH 4   780 9   HOH HOH B . 
N 4 HOH 5   781 14  HOH HOH B . 
N 4 HOH 6   782 16  HOH HOH B . 
N 4 HOH 7   783 20  HOH HOH B . 
N 4 HOH 8   784 26  HOH HOH B . 
N 4 HOH 9   785 31  HOH HOH B . 
N 4 HOH 10  786 34  HOH HOH B . 
N 4 HOH 11  787 35  HOH HOH B . 
N 4 HOH 12  788 39  HOH HOH B . 
N 4 HOH 13  789 44  HOH HOH B . 
N 4 HOH 14  790 46  HOH HOH B . 
N 4 HOH 15  791 48  HOH HOH B . 
N 4 HOH 16  792 50  HOH HOH B . 
N 4 HOH 17  793 55  HOH HOH B . 
N 4 HOH 18  794 56  HOH HOH B . 
N 4 HOH 19  795 57  HOH HOH B . 
N 4 HOH 20  796 58  HOH HOH B . 
N 4 HOH 21  797 59  HOH HOH B . 
N 4 HOH 22  798 63  HOH HOH B . 
N 4 HOH 23  799 64  HOH HOH B . 
N 4 HOH 24  800 65  HOH HOH B . 
N 4 HOH 25  801 66  HOH HOH B . 
N 4 HOH 26  802 67  HOH HOH B . 
N 4 HOH 27  803 68  HOH HOH B . 
N 4 HOH 28  804 69  HOH HOH B . 
N 4 HOH 29  805 70  HOH HOH B . 
N 4 HOH 30  806 71  HOH HOH B . 
N 4 HOH 31  807 72  HOH HOH B . 
N 4 HOH 32  808 73  HOH HOH B . 
N 4 HOH 33  809 74  HOH HOH B . 
N 4 HOH 34  810 75  HOH HOH B . 
N 4 HOH 35  811 76  HOH HOH B . 
N 4 HOH 36  812 77  HOH HOH B . 
N 4 HOH 37  813 78  HOH HOH B . 
N 4 HOH 38  814 79  HOH HOH B . 
N 4 HOH 39  815 81  HOH HOH B . 
N 4 HOH 40  816 83  HOH HOH B . 
N 4 HOH 41  817 86  HOH HOH B . 
N 4 HOH 42  818 88  HOH HOH B . 
N 4 HOH 43  819 89  HOH HOH B . 
N 4 HOH 44  820 92  HOH HOH B . 
N 4 HOH 45  821 99  HOH HOH B . 
N 4 HOH 46  822 100 HOH HOH B . 
N 4 HOH 47  823 101 HOH HOH B . 
N 4 HOH 48  824 104 HOH HOH B . 
N 4 HOH 49  825 106 HOH HOH B . 
N 4 HOH 50  826 108 HOH HOH B . 
N 4 HOH 51  827 111 HOH HOH B . 
N 4 HOH 52  828 112 HOH HOH B . 
N 4 HOH 53  829 116 HOH HOH B . 
N 4 HOH 54  830 118 HOH HOH B . 
N 4 HOH 55  831 123 HOH HOH B . 
N 4 HOH 56  832 128 HOH HOH B . 
N 4 HOH 57  833 135 HOH HOH B . 
N 4 HOH 58  834 138 HOH HOH B . 
N 4 HOH 59  835 140 HOH HOH B . 
N 4 HOH 60  836 148 HOH HOH B . 
N 4 HOH 61  837 152 HOH HOH B . 
N 4 HOH 62  838 154 HOH HOH B . 
N 4 HOH 63  839 158 HOH HOH B . 
N 4 HOH 64  840 162 HOH HOH B . 
N 4 HOH 65  841 172 HOH HOH B . 
N 4 HOH 66  842 173 HOH HOH B . 
N 4 HOH 67  843 175 HOH HOH B . 
N 4 HOH 68  844 179 HOH HOH B . 
N 4 HOH 69  845 183 HOH HOH B . 
N 4 HOH 70  846 186 HOH HOH B . 
N 4 HOH 71  847 199 HOH HOH B . 
N 4 HOH 72  848 203 HOH HOH B . 
N 4 HOH 73  849 206 HOH HOH B . 
N 4 HOH 74  850 211 HOH HOH B . 
N 4 HOH 75  851 212 HOH HOH B . 
N 4 HOH 76  852 213 HOH HOH B . 
N 4 HOH 77  853 215 HOH HOH B . 
N 4 HOH 78  854 219 HOH HOH B . 
N 4 HOH 79  855 224 HOH HOH B . 
N 4 HOH 80  856 225 HOH HOH B . 
N 4 HOH 81  857 233 HOH HOH B . 
N 4 HOH 82  858 238 HOH HOH B . 
N 4 HOH 83  859 241 HOH HOH B . 
N 4 HOH 84  860 248 HOH HOH B . 
N 4 HOH 85  861 249 HOH HOH B . 
N 4 HOH 86  862 251 HOH HOH B . 
N 4 HOH 87  863 253 HOH HOH B . 
N 4 HOH 88  864 259 HOH HOH B . 
N 4 HOH 89  865 266 HOH HOH B . 
N 4 HOH 90  866 268 HOH HOH B . 
N 4 HOH 91  867 272 HOH HOH B . 
N 4 HOH 92  868 273 HOH HOH B . 
N 4 HOH 93  869 274 HOH HOH B . 
N 4 HOH 94  870 277 HOH HOH B . 
N 4 HOH 95  871 284 HOH HOH B . 
N 4 HOH 96  872 285 HOH HOH B . 
N 4 HOH 97  873 286 HOH HOH B . 
N 4 HOH 98  874 292 HOH HOH B . 
N 4 HOH 99  875 296 HOH HOH B . 
N 4 HOH 100 876 297 HOH HOH B . 
N 4 HOH 101 877 299 HOH HOH B . 
N 4 HOH 102 878 300 HOH HOH B . 
N 4 HOH 103 879 311 HOH HOH B . 
N 4 HOH 104 880 313 HOH HOH B . 
N 4 HOH 105 881 317 HOH HOH B . 
N 4 HOH 106 882 322 HOH HOH B . 
N 4 HOH 107 883 325 HOH HOH B . 
N 4 HOH 108 884 330 HOH HOH B . 
O 4 HOH 1   778 2   HOH HOH C . 
O 4 HOH 2   779 3   HOH HOH C . 
O 4 HOH 3   780 11  HOH HOH C . 
O 4 HOH 4   781 17  HOH HOH C . 
O 4 HOH 5   782 19  HOH HOH C . 
O 4 HOH 6   783 28  HOH HOH C . 
O 4 HOH 7   784 32  HOH HOH C . 
O 4 HOH 8   785 37  HOH HOH C . 
O 4 HOH 9   786 38  HOH HOH C . 
O 4 HOH 10  787 47  HOH HOH C . 
O 4 HOH 11  788 52  HOH HOH C . 
O 4 HOH 12  789 54  HOH HOH C . 
O 4 HOH 13  790 60  HOH HOH C . 
O 4 HOH 14  791 62  HOH HOH C . 
O 4 HOH 15  792 80  HOH HOH C . 
O 4 HOH 16  793 82  HOH HOH C . 
O 4 HOH 17  794 87  HOH HOH C . 
O 4 HOH 18  795 95  HOH HOH C . 
O 4 HOH 19  796 120 HOH HOH C . 
O 4 HOH 20  797 127 HOH HOH C . 
O 4 HOH 21  798 131 HOH HOH C . 
O 4 HOH 22  799 145 HOH HOH C . 
O 4 HOH 23  800 150 HOH HOH C . 
O 4 HOH 24  801 151 HOH HOH C . 
O 4 HOH 25  802 157 HOH HOH C . 
O 4 HOH 26  803 160 HOH HOH C . 
O 4 HOH 27  804 163 HOH HOH C . 
O 4 HOH 28  805 167 HOH HOH C . 
O 4 HOH 29  806 168 HOH HOH C . 
O 4 HOH 30  807 171 HOH HOH C . 
O 4 HOH 31  808 178 HOH HOH C . 
O 4 HOH 32  809 180 HOH HOH C . 
O 4 HOH 33  810 184 HOH HOH C . 
O 4 HOH 34  811 185 HOH HOH C . 
O 4 HOH 35  812 194 HOH HOH C . 
O 4 HOH 36  813 198 HOH HOH C . 
O 4 HOH 37  814 205 HOH HOH C . 
O 4 HOH 38  815 220 HOH HOH C . 
O 4 HOH 39  816 226 HOH HOH C . 
O 4 HOH 40  817 231 HOH HOH C . 
O 4 HOH 41  818 237 HOH HOH C . 
O 4 HOH 42  819 250 HOH HOH C . 
O 4 HOH 43  820 256 HOH HOH C . 
O 4 HOH 44  821 267 HOH HOH C . 
O 4 HOH 45  822 279 HOH HOH C . 
O 4 HOH 46  823 281 HOH HOH C . 
O 4 HOH 47  824 282 HOH HOH C . 
O 4 HOH 48  825 293 HOH HOH C . 
O 4 HOH 49  826 306 HOH HOH C . 
O 4 HOH 50  827 314 HOH HOH C . 
O 4 HOH 51  828 315 HOH HOH C . 
O 4 HOH 52  829 316 HOH HOH C . 
O 4 HOH 53  830 324 HOH HOH C . 
O 4 HOH 54  831 328 HOH HOH C . 
O 4 HOH 55  832 329 HOH HOH C . 
P 4 HOH 1   779 4   HOH HOH D . 
P 4 HOH 2   780 8   HOH HOH D . 
P 4 HOH 3   781 12  HOH HOH D . 
P 4 HOH 4   782 13  HOH HOH D . 
P 4 HOH 5   783 15  HOH HOH D . 
P 4 HOH 6   784 18  HOH HOH D . 
P 4 HOH 7   785 21  HOH HOH D . 
P 4 HOH 8   786 24  HOH HOH D . 
P 4 HOH 9   787 25  HOH HOH D . 
P 4 HOH 10  788 27  HOH HOH D . 
P 4 HOH 11  789 42  HOH HOH D . 
P 4 HOH 12  790 45  HOH HOH D . 
P 4 HOH 13  791 49  HOH HOH D . 
P 4 HOH 14  792 53  HOH HOH D . 
P 4 HOH 15  793 84  HOH HOH D . 
P 4 HOH 16  794 85  HOH HOH D . 
P 4 HOH 17  795 90  HOH HOH D . 
P 4 HOH 18  796 93  HOH HOH D . 
P 4 HOH 19  797 94  HOH HOH D . 
P 4 HOH 20  798 96  HOH HOH D . 
P 4 HOH 21  799 98  HOH HOH D . 
P 4 HOH 22  800 102 HOH HOH D . 
P 4 HOH 23  801 107 HOH HOH D . 
P 4 HOH 24  802 115 HOH HOH D . 
P 4 HOH 25  803 119 HOH HOH D . 
P 4 HOH 26  804 121 HOH HOH D . 
P 4 HOH 27  805 126 HOH HOH D . 
P 4 HOH 28  806 129 HOH HOH D . 
P 4 HOH 29  807 130 HOH HOH D . 
P 4 HOH 30  808 132 HOH HOH D . 
P 4 HOH 31  809 134 HOH HOH D . 
P 4 HOH 32  810 136 HOH HOH D . 
P 4 HOH 33  811 139 HOH HOH D . 
P 4 HOH 34  812 141 HOH HOH D . 
P 4 HOH 35  813 143 HOH HOH D . 
P 4 HOH 36  814 144 HOH HOH D . 
P 4 HOH 37  815 153 HOH HOH D . 
P 4 HOH 38  816 156 HOH HOH D . 
P 4 HOH 39  817 165 HOH HOH D . 
P 4 HOH 40  818 166 HOH HOH D . 
P 4 HOH 41  819 177 HOH HOH D . 
P 4 HOH 42  820 188 HOH HOH D . 
P 4 HOH 43  821 190 HOH HOH D . 
P 4 HOH 44  822 193 HOH HOH D . 
P 4 HOH 45  823 195 HOH HOH D . 
P 4 HOH 46  824 196 HOH HOH D . 
P 4 HOH 47  825 197 HOH HOH D . 
P 4 HOH 48  826 200 HOH HOH D . 
P 4 HOH 49  827 202 HOH HOH D . 
P 4 HOH 50  828 207 HOH HOH D . 
P 4 HOH 51  829 210 HOH HOH D . 
P 4 HOH 52  830 214 HOH HOH D . 
P 4 HOH 53  831 216 HOH HOH D . 
P 4 HOH 54  832 217 HOH HOH D . 
P 4 HOH 55  833 221 HOH HOH D . 
P 4 HOH 56  834 222 HOH HOH D . 
P 4 HOH 57  835 230 HOH HOH D . 
P 4 HOH 58  836 234 HOH HOH D . 
P 4 HOH 59  837 236 HOH HOH D . 
P 4 HOH 60  838 239 HOH HOH D . 
P 4 HOH 61  839 245 HOH HOH D . 
P 4 HOH 62  840 246 HOH HOH D . 
P 4 HOH 63  841 247 HOH HOH D . 
P 4 HOH 64  842 252 HOH HOH D . 
P 4 HOH 65  843 261 HOH HOH D . 
P 4 HOH 66  844 262 HOH HOH D . 
P 4 HOH 67  845 265 HOH HOH D . 
P 4 HOH 68  846 269 HOH HOH D . 
P 4 HOH 69  847 276 HOH HOH D . 
P 4 HOH 70  848 278 HOH HOH D . 
P 4 HOH 71  849 280 HOH HOH D . 
P 4 HOH 72  850 283 HOH HOH D . 
P 4 HOH 73  851 289 HOH HOH D . 
P 4 HOH 74  852 295 HOH HOH D . 
P 4 HOH 75  853 301 HOH HOH D . 
P 4 HOH 76  854 302 HOH HOH D . 
P 4 HOH 77  855 307 HOH HOH D . 
P 4 HOH 78  856 308 HOH HOH D . 
P 4 HOH 79  857 309 HOH HOH D . 
P 4 HOH 80  858 312 HOH HOH D . 
P 4 HOH 81  859 318 HOH HOH D . 
P 4 HOH 82  860 319 HOH HOH D . 
P 4 HOH 83  861 320 HOH HOH D . 
P 4 HOH 84  862 321 HOH HOH D . 
P 4 HOH 85  863 323 HOH HOH D . 
P 4 HOH 86  864 326 HOH HOH D . 
P 4 HOH 87  865 327 HOH HOH D . 
Q 4 HOH 1   161 161 HOH HOH E . 
Q 4 HOH 2   169 169 HOH HOH E . 
Q 4 HOH 3   257 257 HOH HOH E . 
Q 4 HOH 4   258 258 HOH HOH E . 
R 4 HOH 1   113 113 HOH HOH F . 
R 4 HOH 2   133 133 HOH HOH F . 
R 4 HOH 3   227 227 HOH HOH F . 
R 4 HOH 4   240 240 HOH HOH F . 
R 4 HOH 5   242 242 HOH HOH F . 
R 4 HOH 6   244 244 HOH HOH F . 
R 4 HOH 7   255 255 HOH HOH F . 
R 4 HOH 8   264 264 HOH HOH F . 
R 4 HOH 9   270 270 HOH HOH F . 
R 4 HOH 10  298 298 HOH HOH F . 
S 4 HOH 1   260 260 HOH HOH G . 
T 4 HOH 1   40  40  HOH HOH H . 
T 4 HOH 2   243 243 HOH HOH H . 
T 4 HOH 3   254 254 HOH HOH H . 
T 4 HOH 4   271 271 HOH HOH H . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
3 author_and_software_defined_assembly PISA dimeric 2 
4 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E,I,M,Q 
2 1 B,F,J,N,R 
3 1 C,G,K,O,S 
4 1 D,H,L,P,T 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3390  ? 
1 MORE         -31   ? 
1 'SSA (A^2)'  14870 ? 
2 'ABSA (A^2)' 3360  ? 
2 MORE         -29   ? 
2 'SSA (A^2)'  15550 ? 
3 'ABSA (A^2)' 3120  ? 
3 MORE         -24   ? 
3 'SSA (A^2)'  15230 ? 
4 'ABSA (A^2)' 3280  ? 
4 MORE         -27   ? 
4 'SSA (A^2)'  15020 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-02-20 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2013-09-18 
5 'Structure model' 1 4 2017-02-01 
6 'Structure model' 1 5 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 5 'Structure model' 'Structure summary'         
5 6 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    6 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 6 'Structure model' '_software.classification' 
2 6 'Structure model' '_software.name'           
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing           .    ? 1 
CNX       refinement        2000 ? 2 
MAR345    'data collection' .    ? 3 
SCALEPACK 'data scaling'    .    ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O D ARG 348 ? ? CG  D LYS 349 ? ? 1.74 
2 1 O C GLY 231 ? ? N   C ALA 233 ? ? 1.90 
3 1 O G LEU 685 ? ? CD1 G ILE 688 ? ? 1.92 
4 1 O B GLU 451 ? ? OD1 B ASP 453 ? ? 1.92 
5 1 O C SER 230 ? ? N   C LYS 232 ? ? 2.07 
6 1 O A ASN 219 ? ? NZ  A LYS 224 ? ? 2.10 
7 1 O A LYS 448 ? ? OG  A SER 452 ? ? 2.19 
8 1 O D PHE 343 ? ? OG  D SER 346 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 N B GLU 267 ? ? CA B GLU 267 ? ? C B GLU 267 ? ? 91.18  111.00 -19.82 2.70 N 
2  1 N C ASN 236 ? ? CA C ASN 236 ? ? C C ASN 236 ? ? 93.76  111.00 -17.24 2.70 N 
3  1 N C LYS 266 ? ? CA C LYS 266 ? ? C C LYS 266 ? ? 93.62  111.00 -17.38 2.70 N 
4  1 N C GLU 451 ? ? CA C GLU 451 ? ? C C GLU 451 ? ? 90.04  111.00 -20.96 2.70 N 
5  1 N C LEU 456 ? ? CA C LEU 456 ? ? C C LEU 456 ? ? 94.32  111.00 -16.68 2.70 N 
6  1 N C GLN 461 ? ? CA C GLN 461 ? ? C C GLN 461 ? ? 90.69  111.00 -20.31 2.70 N 
7  1 N D ASN 236 ? ? CA D ASN 236 ? ? C D ASN 236 ? ? 91.66  111.00 -19.34 2.70 N 
8  1 N D GLU 462 ? ? CA D GLU 462 ? ? C D GLU 462 ? ? 128.38 111.00 17.38  2.70 N 
9  1 N F GLY 695 ? ? CA F GLY 695 ? ? C F GLY 695 ? ? 132.10 113.10 19.00  2.50 N 
10 1 N G GLY 695 ? ? CA G GLY 695 ? ? C G GLY 695 ? ? 130.20 113.10 17.10  2.50 N 
11 1 N G LYS 696 ? ? CA G LYS 696 ? ? C G LYS 696 ? ? 127.84 111.00 16.84  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 ALA A 201 ? ? -169.28 -58.78  
2   1 ARG A 209 ? ? -46.94  -19.25  
3   1 LEU A 215 ? ? -75.66  30.97   
4   1 LYS A 216 ? ? -154.32 -7.71   
5   1 LEU A 229 ? ? -55.87  -83.01  
6   1 LYS A 232 ? ? -162.01 -167.88 
7   1 ALA A 233 ? ? 72.77   54.73   
8   1 SER A 234 ? ? 162.56  116.57  
9   1 ASN A 235 ? ? -113.56 52.09   
10  1 ASN A 236 ? ? -161.60 74.23   
11  1 PRO A 238 ? ? -45.26  158.55  
12  1 ALA A 250 ? ? -37.77  -72.82  
13  1 ALA A 256 ? ? 34.41   25.51   
14  1 VAL A 259 ? ? -144.36 30.98   
15  1 ALA A 260 ? ? -165.37 -37.15  
16  1 GLN A 264 ? ? -147.53 11.21   
17  1 ASN A 265 ? ? -169.71 14.71   
18  1 GLU A 267 ? ? -39.04  139.36  
19  1 CYS A 276 ? ? -39.60  -17.11  
20  1 CYS A 278 ? ? -75.81  21.68   
21  1 VAL A 281 ? ? -147.85 -34.17  
22  1 PRO A 295 ? ? -33.80  124.56  
23  1 LEU A 300 ? ? -22.77  132.32  
24  1 LYS A 327 ? ? -54.96  -4.90   
25  1 SER A 346 ? ? 178.10  -18.49  
26  1 CYS A 352 ? ? -44.16  -9.21   
27  1 VAL A 394 ? ? -59.50  11.05   
28  1 SER A 414 ? ? -99.49  32.58   
29  1 ASN A 415 ? ? -139.29 -32.36  
30  1 PRO A 417 ? ? -58.55  -0.84   
31  1 ASP A 419 ? ? -115.41 60.01   
32  1 GLN A 442 ? ? -65.04  -70.07  
33  1 SER A 452 ? ? 30.99   40.80   
34  1 ALA A 454 ? ? -108.61 79.22   
35  1 ALA A 455 ? ? -110.48 -166.00 
36  1 PRO A 458 ? ? -79.93  45.67   
37  1 GLU A 462 ? ? -170.85 -16.34  
38  1 ILE A 463 ? ? -136.31 -33.22  
39  1 ARG A 465 ? ? -70.14  -93.80  
40  1 ASP A 466 ? ? -57.29  79.35   
41  1 MET A 467 ? ? -157.82 -36.03  
42  1 LEU B 229 ? ? -65.34  -74.23  
43  1 LYS B 232 ? ? 19.36   65.70   
44  1 ALA B 233 ? ? -102.86 53.99   
45  1 SER B 234 ? ? 166.27  133.66  
46  1 ASN B 236 ? ? 72.96   67.22   
47  1 MET B 244 ? ? -45.66  -14.74  
48  1 ALA B 250 ? ? -60.19  -86.53  
49  1 ALA B 260 ? ? -177.77 51.02   
50  1 ASN B 261 ? ? -122.35 -67.12  
51  1 GLN B 264 ? ? -161.94 -7.21   
52  1 ASN B 265 ? ? -158.75 16.93   
53  1 GLU B 267 ? ? -173.08 99.99   
54  1 THR B 279 ? ? -69.98  23.29   
55  1 PRO B 295 ? ? -31.46  118.83  
56  1 PRO B 350 ? ? -82.00  45.38   
57  1 ASN B 393 ? ? -111.10 56.65   
58  1 ILE B 446 ? ? -64.98  28.67   
59  1 ILE B 447 ? ? -144.85 -8.71   
60  1 LYS B 448 ? ? -56.67  -103.62 
61  1 ASP B 453 ? ? -139.42 -75.65  
62  1 ALA B 455 ? ? 157.84  -167.13 
63  1 LEU B 456 ? ? -47.78  82.59   
64  1 PRO B 458 ? ? -66.72  27.12   
65  1 ILE B 463 ? ? 62.93   -5.62   
66  1 TYR B 464 ? ? -151.23 43.53   
67  1 ASP B 466 ? ? 66.55   67.84   
68  1 ASP C 202 ? ? -148.79 -18.44  
69  1 LEU C 215 ? ? -66.37  4.70    
70  1 SER C 230 ? ? -79.40  -81.88  
71  1 LYS C 232 ? ? -39.71  54.60   
72  1 SER C 234 ? ? 158.66  122.97  
73  1 ASN C 236 ? ? 64.88   77.35   
74  1 ALA C 250 ? ? -79.42  -92.16  
75  1 GLU C 251 ? ? -48.72  -11.73  
76  1 LEU C 254 ? ? -59.85  -77.31  
77  1 LYS C 257 ? ? -178.87 -0.51   
78  1 ALA C 260 ? ? -91.54  44.92   
79  1 ASN C 261 ? ? -144.66 -60.04  
80  1 ASN C 265 ? ? 174.39  125.40  
81  1 GLU C 267 ? ? -34.38  120.58  
82  1 GLU C 269 ? ? -40.75  -3.40   
83  1 ILE C 272 ? ? -92.93  34.67   
84  1 PHE C 273 ? ? -150.87 2.21    
85  1 THR C 279 ? ? -140.25 46.20   
86  1 SER C 280 ? ? -147.02 -81.02  
87  1 VAL C 281 ? ? -44.61  -17.88  
88  1 ILE C 294 ? ? -38.33  120.91  
89  1 LEU C 300 ? ? -27.74  144.84  
90  1 LEU C 302 ? ? -35.47  -35.13  
91  1 VAL C 306 ? ? -38.60  -34.69  
92  1 ALA C 333 ? ? 40.29   73.07   
93  1 TYR C 334 ? ? 58.74   11.83   
94  1 GLU C 342 ? ? -50.73  -70.96  
95  1 PHE C 343 ? ? -43.39  -12.56  
96  1 SER C 346 ? ? -118.77 74.96   
97  1 LYS C 349 ? ? -45.09  150.85  
98  1 PRO C 350 ? ? -99.73  38.35   
99  1 LEU C 368 ? ? -67.82  2.02    
100 1 ASN C 393 ? ? -90.05  42.20   
101 1 VAL C 394 ? ? -40.48  -3.45   
102 1 ARG C 409 ? ? -38.91  -39.30  
103 1 HIS C 416 ? ? -142.57 57.92   
104 1 GLN C 442 ? ? -97.95  33.06   
105 1 LEU C 443 ? ? -146.38 10.06   
106 1 ILE C 446 ? ? -158.59 32.61   
107 1 ILE C 447 ? ? -159.72 63.21   
108 1 LYS C 448 ? ? -154.64 -38.99  
109 1 SER C 452 ? ? -167.78 50.36   
110 1 ASP C 453 ? ? -123.85 -79.05  
111 1 ALA C 455 ? ? -178.09 -176.27 
112 1 TYR C 464 ? ? -151.59 -32.76  
113 1 ASP C 466 ? ? 43.21   22.07   
114 1 MET C 467 ? ? -101.91 41.08   
115 1 VAL D 223 ? ? -44.52  -73.73  
116 1 LEU D 229 ? ? -62.55  -78.24  
117 1 SER D 230 ? ? -74.29  -76.91  
118 1 LYS D 232 ? ? 39.68   68.72   
119 1 ALA D 233 ? ? -77.08  -72.21  
120 1 ASN D 236 ? ? -158.29 78.86   
121 1 LYS D 257 ? ? -167.17 -9.98   
122 1 ALA D 260 ? ? 167.19  -37.89  
123 1 GLU D 267 ? ? 45.21   86.82   
124 1 ALA D 268 ? ? -64.96  65.62   
125 1 GLU D 269 ? ? -168.13 -14.21  
126 1 ILE D 272 ? ? -66.03  1.87    
127 1 HIS D 274 ? ? -60.68  -75.69  
128 1 PRO D 295 ? ? -43.85  68.45   
129 1 LYS D 327 ? ? -39.42  -34.02  
130 1 ALA D 333 ? ? 26.59   65.21   
131 1 PHE D 338 ? ? -164.33 101.51  
132 1 LYS D 349 ? ? 141.96  146.45  
133 1 CYS D 352 ? ? -30.26  -25.27  
134 1 CYS D 384 ? ? -68.78  49.24   
135 1 ASP D 387 ? ? -148.98 32.02   
136 1 ASN D 393 ? ? -93.55  50.11   
137 1 VAL D 394 ? ? -67.24  29.37   
138 1 ASP D 419 ? ? -159.52 85.84   
139 1 PHE D 421 ? ? -97.95  42.27   
140 1 GLN D 445 ? ? -63.75  51.45   
141 1 ILE D 446 ? ? -158.33 -2.35   
142 1 ASP D 453 ? ? -159.05 -80.87  
143 1 ALA D 455 ? ? 180.00  -97.40  
144 1 PRO D 458 ? ? -75.91  36.14   
145 1 LEU D 460 ? ? -80.89  35.12   
146 1 GLN D 461 ? ? -112.17 -82.23  
147 1 GLU D 462 ? ? -60.27  43.59   
148 1 ILE D 463 ? ? -160.11 -51.86  
149 1 MET E 683 ? ? 156.66  -172.24 
150 1 GLU E 686 ? ? -48.93  -15.52  
151 1 TYR E 697 ? ? -173.13 125.13  
152 1 ASP E 698 ? ? 148.62  139.29  
153 1 GLN E 699 ? ? -179.18 134.97  
154 1 LEU F 685 ? ? -153.98 9.58    
155 1 GLU F 686 ? ? -58.66  1.73    
156 1 MET F 694 ? ? -105.08 -167.02 
157 1 GLN F 699 ? ? -175.29 115.90  
158 1 ASP G 698 ? ? 169.14  141.81  
159 1 GLN G 699 ? ? 174.73  143.75  
160 1 LEU H 685 ? ? -163.94 21.90   
161 1 MET H 694 ? ? -91.88  -79.12  
162 1 ASP H 698 ? ? 150.16  142.18  
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             LYS 
_pdbx_validate_main_chain_plane.auth_asym_id             D 
_pdbx_validate_main_chain_plane.auth_seq_id              349 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -10.92 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A THR 200 ? OG1 ? A THR 1  OG1 
2  1 Y 1 A THR 200 ? CG2 ? A THR 1  CG2 
3  1 Y 1 B THR 200 ? OG1 ? B THR 1  OG1 
4  1 Y 1 B THR 200 ? CG2 ? B THR 1  CG2 
5  1 Y 1 C THR 200 ? OG1 ? C THR 1  OG1 
6  1 Y 1 C THR 200 ? CG2 ? C THR 1  CG2 
7  1 Y 1 D THR 200 ? OG1 ? D THR 1  OG1 
8  1 Y 1 D THR 200 ? CG2 ? D THR 1  CG2 
9  1 Y 1 E ASN 682 ? CG  ? E ASN 1  CG  
10 1 Y 1 E ASN 682 ? OD1 ? E ASN 1  OD1 
11 1 Y 1 E ASN 682 ? ND2 ? E ASN 1  ND2 
12 1 Y 1 E LYS 696 ? CG  ? E LYS 15 CG  
13 1 Y 1 E LYS 696 ? CD  ? E LYS 15 CD  
14 1 Y 1 E LYS 696 ? CE  ? E LYS 15 CE  
15 1 Y 1 E LYS 696 ? NZ  ? E LYS 15 NZ  
16 1 Y 1 E GLN 699 ? CG  ? E GLN 18 CG  
17 1 Y 1 E GLN 699 ? CD  ? E GLN 18 CD  
18 1 Y 1 E GLN 699 ? OE1 ? E GLN 18 OE1 
19 1 Y 1 E GLN 699 ? NE2 ? E GLN 18 NE2 
20 1 Y 1 F ASN 682 ? CG  ? F ASN 1  CG  
21 1 Y 1 F ASN 682 ? OD1 ? F ASN 1  OD1 
22 1 Y 1 F ASN 682 ? ND2 ? F ASN 1  ND2 
23 1 Y 1 F GLN 699 ? CG  ? F GLN 18 CG  
24 1 Y 1 F GLN 699 ? CD  ? F GLN 18 CD  
25 1 Y 1 F GLN 699 ? OE1 ? F GLN 18 OE1 
26 1 Y 1 F GLN 699 ? NE2 ? F GLN 18 NE2 
27 1 Y 1 G ASN 682 ? CG  ? G ASN 1  CG  
28 1 Y 1 G ASN 682 ? OD1 ? G ASN 1  OD1 
29 1 Y 1 G ASN 682 ? ND2 ? G ASN 1  ND2 
30 1 Y 1 G LYS 696 ? CG  ? G LYS 15 CG  
31 1 Y 1 G LYS 696 ? CD  ? G LYS 15 CD  
32 1 Y 1 G LYS 696 ? CE  ? G LYS 15 CE  
33 1 Y 1 G LYS 696 ? NZ  ? G LYS 15 NZ  
34 1 Y 1 G GLN 699 ? CG  ? G GLN 18 CG  
35 1 Y 1 G GLN 699 ? CD  ? G GLN 18 CD  
36 1 Y 1 G GLN 699 ? OE1 ? G GLN 18 OE1 
37 1 Y 1 G GLN 699 ? NE2 ? G GLN 18 NE2 
38 1 Y 1 H ASN 682 ? CG  ? H ASN 1  CG  
39 1 Y 1 H ASN 682 ? OD1 ? H ASN 1  OD1 
40 1 Y 1 H ASN 682 ? ND2 ? H ASN 1  ND2 
41 1 Y 1 H LYS 696 ? CG  ? H LYS 15 CG  
42 1 Y 1 H LYS 696 ? CD  ? H LYS 15 CD  
43 1 Y 1 H LYS 696 ? CE  ? H LYS 15 CE  
44 1 Y 1 H LYS 696 ? NZ  ? H LYS 15 NZ  
45 1 Y 1 H GLN 699 ? CG  ? H GLN 18 CG  
46 1 Y 1 H GLN 699 ? CD  ? H GLN 18 CD  
47 1 Y 1 H GLN 699 ? OE1 ? H GLN 18 OE1 
48 1 Y 1 H GLN 699 ? NE2 ? H GLN 18 NE2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 
;N-((2S)-2-({(1Z)-1-METHYL-3-OXO-3-[4-(TRIFLUOROMETHYL) PHENYL]PROP-1-ENYL}AMINO)-3-{4-[2-(5-METHYL-2-PHENYL-1,3-OXAZOL-4-YL)ETHOXY]PHENYL}PROPYL)PROPANAMIDE
;
471 
4 water HOH 
#