data_1KKU
# 
_entry.id   1KKU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KKU         
RCSB  RCSB015061   
WWPDB D_1000015061 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1f9a '1f9a contains the same protein from Methanococcus jannaschii'              unspecified 
PDB 1ej2 '1ej2 contains the same protein from  METHANOBACTERIUM THERMOAUTOTROPHICUM' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KKU 
_pdbx_database_status.recvd_initial_deposition_date   2001-12-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Garavaglia, S.' 1 
;D'Angelo, I.
;
2 
'Emanuelli, M.'  3 
'Carnevali, F.'  4 
'Pierella, F.'   5 
'Magni, G.'      6 
'Rizzi, M.'      7 
# 
_citation.id                        primary 
_citation.title                     'Structure of human NMN adenylyltransferase. A key nuclear enzyme for NAD homeostasis.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            277 
_citation.page_first                8524 
_citation.page_last                 8530 
_citation.year                      2002 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11751893 
_citation.pdbx_database_id_DOI      10.1074/jbc.M111589200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Garavaglia, S.' 1 
primary 
;D'Angelo, I.
;
2 
primary 'Emanuelli, M.'  3 
primary 'Carnevali, F.'  4 
primary 'Pierella, F.'   5 
primary 'Magni, G.'      6 
primary 'Rizzi, M.'      7 
# 
_cell.entry_id           1KKU 
_cell.length_a           147.459 
_cell.length_b           147.459 
_cell.length_c           61.710 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KKU 
_symmetry.space_group_name_H-M             'P 63 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                182 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'NICOTINAMIDE MONONUCLEOTIDE ADENYLYLTRANSFERASE' 32016.518 1  2.7.7.1 ? ? ? 
2 water   nat water                                             18.015    56 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'NMN adenylyltransferase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWV
EVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLL
ESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWFANDISSTKIRRALRRGQSIRYLV
PDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWV
EVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLL
ESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWFANDISSTKIRRALRRGQSIRYLV
PDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   ASN n 
1 4   SER n 
1 5   GLU n 
1 6   LYS n 
1 7   THR n 
1 8   GLU n 
1 9   VAL n 
1 10  VAL n 
1 11  LEU n 
1 12  LEU n 
1 13  ALA n 
1 14  CYS n 
1 15  GLY n 
1 16  SER n 
1 17  PHE n 
1 18  ASN n 
1 19  PRO n 
1 20  ILE n 
1 21  THR n 
1 22  ASN n 
1 23  MET n 
1 24  HIS n 
1 25  LEU n 
1 26  ARG n 
1 27  LEU n 
1 28  PHE n 
1 29  GLU n 
1 30  LEU n 
1 31  ALA n 
1 32  LYS n 
1 33  ASP n 
1 34  TYR n 
1 35  MET n 
1 36  ASN n 
1 37  GLY n 
1 38  THR n 
1 39  GLY n 
1 40  ARG n 
1 41  TYR n 
1 42  THR n 
1 43  VAL n 
1 44  VAL n 
1 45  LYS n 
1 46  GLY n 
1 47  ILE n 
1 48  ILE n 
1 49  SER n 
1 50  PRO n 
1 51  VAL n 
1 52  GLY n 
1 53  ASP n 
1 54  ALA n 
1 55  TYR n 
1 56  LYS n 
1 57  LYS n 
1 58  LYS n 
1 59  GLY n 
1 60  LEU n 
1 61  ILE n 
1 62  PRO n 
1 63  ALA n 
1 64  TYR n 
1 65  HIS n 
1 66  ARG n 
1 67  VAL n 
1 68  ILE n 
1 69  MET n 
1 70  ALA n 
1 71  GLU n 
1 72  LEU n 
1 73  ALA n 
1 74  THR n 
1 75  LYS n 
1 76  ASN n 
1 77  SER n 
1 78  LYS n 
1 79  TRP n 
1 80  VAL n 
1 81  GLU n 
1 82  VAL n 
1 83  ASP n 
1 84  THR n 
1 85  TRP n 
1 86  GLU n 
1 87  SER n 
1 88  LEU n 
1 89  GLN n 
1 90  LYS n 
1 91  GLU n 
1 92  TRP n 
1 93  LYS n 
1 94  GLU n 
1 95  THR n 
1 96  LEU n 
1 97  LYS n 
1 98  VAL n 
1 99  LEU n 
1 100 ARG n 
1 101 HIS n 
1 102 HIS n 
1 103 GLN n 
1 104 GLU n 
1 105 LYS n 
1 106 LEU n 
1 107 GLU n 
1 108 ALA n 
1 109 SER n 
1 110 ASP n 
1 111 CYS n 
1 112 ASP n 
1 113 HIS n 
1 114 GLN n 
1 115 GLN n 
1 116 ASN n 
1 117 SER n 
1 118 PRO n 
1 119 THR n 
1 120 LEU n 
1 121 GLU n 
1 122 ARG n 
1 123 PRO n 
1 124 GLY n 
1 125 ARG n 
1 126 LYS n 
1 127 ARG n 
1 128 LYS n 
1 129 TRP n 
1 130 THR n 
1 131 GLU n 
1 132 THR n 
1 133 GLN n 
1 134 ASP n 
1 135 SER n 
1 136 SER n 
1 137 GLN n 
1 138 LYS n 
1 139 LYS n 
1 140 SER n 
1 141 LEU n 
1 142 GLU n 
1 143 PRO n 
1 144 LYS n 
1 145 THR n 
1 146 LYS n 
1 147 ALA n 
1 148 VAL n 
1 149 PRO n 
1 150 LYS n 
1 151 VAL n 
1 152 LYS n 
1 153 LEU n 
1 154 LEU n 
1 155 CYS n 
1 156 GLY n 
1 157 ALA n 
1 158 ASP n 
1 159 LEU n 
1 160 LEU n 
1 161 GLU n 
1 162 SER n 
1 163 PHE n 
1 164 ALA n 
1 165 VAL n 
1 166 PRO n 
1 167 ASN n 
1 168 LEU n 
1 169 TRP n 
1 170 LYS n 
1 171 SER n 
1 172 GLU n 
1 173 ASP n 
1 174 ILE n 
1 175 THR n 
1 176 GLN n 
1 177 ILE n 
1 178 VAL n 
1 179 ALA n 
1 180 ASN n 
1 181 TYR n 
1 182 GLY n 
1 183 LEU n 
1 184 ILE n 
1 185 CYS n 
1 186 VAL n 
1 187 THR n 
1 188 ARG n 
1 189 ALA n 
1 190 GLY n 
1 191 ASN n 
1 192 ASP n 
1 193 ALA n 
1 194 GLN n 
1 195 LYS n 
1 196 PHE n 
1 197 ILE n 
1 198 TYR n 
1 199 GLU n 
1 200 SER n 
1 201 ASP n 
1 202 VAL n 
1 203 LEU n 
1 204 TRP n 
1 205 LYS n 
1 206 HIS n 
1 207 ARG n 
1 208 SER n 
1 209 ASN n 
1 210 ILE n 
1 211 HIS n 
1 212 VAL n 
1 213 VAL n 
1 214 ASN n 
1 215 GLU n 
1 216 TRP n 
1 217 PHE n 
1 218 ALA n 
1 219 ASN n 
1 220 ASP n 
1 221 ILE n 
1 222 SER n 
1 223 SER n 
1 224 THR n 
1 225 LYS n 
1 226 ILE n 
1 227 ARG n 
1 228 ARG n 
1 229 ALA n 
1 230 LEU n 
1 231 ARG n 
1 232 ARG n 
1 233 GLY n 
1 234 GLN n 
1 235 SER n 
1 236 ILE n 
1 237 ARG n 
1 238 TYR n 
1 239 LEU n 
1 240 VAL n 
1 241 PRO n 
1 242 ASP n 
1 243 LEU n 
1 244 VAL n 
1 245 GLN n 
1 246 GLU n 
1 247 TYR n 
1 248 ILE n 
1 249 GLU n 
1 250 LYS n 
1 251 HIS n 
1 252 ASN n 
1 253 LEU n 
1 254 TYR n 
1 255 SER n 
1 256 SER n 
1 257 GLU n 
1 258 SER n 
1 259 GLU n 
1 260 ASP n 
1 261 ARG n 
1 262 ASN n 
1 263 ALA n 
1 264 GLY n 
1 265 VAL n 
1 266 ILE n 
1 267 LEU n 
1 268 ALA n 
1 269 PRO n 
1 270 LEU n 
1 271 GLN n 
1 272 ARG n 
1 273 ASN n 
1 274 THR n 
1 275 ALA n 
1 276 GLU n 
1 277 ALA n 
1 278 LYS n 
1 279 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pT7-7 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NMNA1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWV
EVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLL
ESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWFANDISSTKIRRALRRGQSIRYLV
PDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          Q9HAN9 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1KKU 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 279 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9HAN9 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  279 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       279 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1KKU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   60.0 
_exptl_crystal.density_Matthews      3.1 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.1 
_exptl_crystal_grow.pdbx_details    
'ammonium sulfate, Tris, isopropanol, pH 8.1, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-07-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    mirrors 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.934 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.934 
# 
_reflns.entry_id                     1KKU 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   14091 
_reflns.number_all                   14091 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.0750000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              8.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.5 
_reflns_shell.d_res_low              2.6 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1KKU 
_refine.ls_number_reflns_obs                     14091 
_refine.ls_number_reflns_all                     14091 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2470000 
_refine.ls_R_factor_all                          0.2500000 
_refine.ls_R_factor_R_work                       0.2360000 
_refine.ls_R_factor_R_free                       0.2840000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  965 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1750 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             56 
_refine_hist.number_atoms_total               1806 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d    0.018 ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg 2.0   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1KKU 
_struct.title                     'Crystal structure of nuclear human nicotinamide mononucleotide adenylyltransferase' 
_struct.pdbx_descriptor           'NICOTINAMIDE MONONUCLEOTIDE ADENYLYLTRANSFERASE (E.C.2.7.7.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KKU 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'alpha/beta structure - Rossmann fold, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 21  ? THR A 38  ? THR A 21  THR A 38  1 ? 18 
HELX_P HELX_P2  2  PRO A 62  ? LYS A 75  ? PRO A 62  LYS A 75  1 ? 14 
HELX_P HELX_P3  3  THR A 84  ? GLN A 89  ? THR A 84  GLN A 89  1 ? 6  
HELX_P HELX_P4  4  GLU A 94  ? ALA A 108 ? GLU A 94  ALA A 108 1 ? 15 
HELX_P HELX_P5  5  GLY A 156 ? VAL A 165 ? GLY A 156 VAL A 165 1 ? 10 
HELX_P HELX_P6  6  LYS A 170 ? TYR A 181 ? LYS A 170 TYR A 181 1 ? 12 
HELX_P HELX_P7  7  ALA A 189 ? SER A 200 ? ALA A 189 SER A 200 1 ? 12 
HELX_P HELX_P8  8  SER A 200 ? HIS A 206 ? SER A 200 HIS A 206 1 ? 7  
HELX_P HELX_P9  9  SER A 222 ? ARG A 232 ? SER A 222 ARG A 232 1 ? 11 
HELX_P HELX_P10 10 PRO A 241 ? HIS A 251 ? PRO A 241 HIS A 251 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASN 
_struct_mon_prot_cis.label_seq_id           18 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASN 
_struct_mon_prot_cis.auth_seq_id            18 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    19 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     19 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -7.58 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
A 5 6 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 80  ? VAL A 82  ? VAL A 80  VAL A 82  
A 2 TYR A 41  ? PRO A 50  ? TYR A 41  PRO A 50  
A 3 THR A 7   ? GLY A 15  ? THR A 7   GLY A 15  
A 4 LYS A 150 ? CYS A 155 ? LYS A 150 CYS A 155 
A 5 LEU A 183 ? THR A 187 ? LEU A 183 THR A 187 
A 6 ILE A 210 ? ASN A 214 ? ILE A 210 ASN A 214 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 81  ? O GLU A 81  N ILE A 48  ? N ILE A 48  
A 2 3 O ILE A 47  ? O ILE A 47  N LEU A 11  ? N LEU A 11  
A 3 4 N VAL A 10  ? N VAL A 10  O LYS A 150 ? O LYS A 150 
A 4 5 N LEU A 153 ? N LEU A 153 O ILE A 184 ? O ILE A 184 
A 5 6 N CYS A 185 ? N CYS A 185 O VAL A 213 ? O VAL A 213 
# 
_database_PDB_matrix.entry_id          1KKU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KKU 
_atom_sites.fract_transf_matrix[1][1]   0.006782 
_atom_sites.fract_transf_matrix[1][2]   0.003915 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007830 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016205 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 5   ? 34.287  114.757 48.138 1.00 101.06 ? 5   GLU A N   1 
ATOM   2    C CA  . GLU A 1 5   ? 34.891  113.980 46.998 1.00 101.06 ? 5   GLU A CA  1 
ATOM   3    C C   . GLU A 1 5   ? 33.821  113.212 46.222 1.00 101.06 ? 5   GLU A C   1 
ATOM   4    O O   . GLU A 1 5   ? 34.143  112.405 45.358 1.00 101.06 ? 5   GLU A O   1 
ATOM   5    C CB  . GLU A 1 5   ? 35.980  112.990 47.485 1.00 101.06 ? 5   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 5   ? 36.722  112.193 46.397 1.00 101.06 ? 5   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 5   ? 36.463  110.687 46.480 1.00 101.06 ? 5   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 5   ? 35.449  110.237 45.904 1.00 101.06 ? 5   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 5   ? 37.230  109.936 47.133 1.00 101.06 ? 5   GLU A OE2 1 
ATOM   10   N N   . LYS A 1 6   ? 32.554  113.448 46.540 1.00 101.06 ? 6   LYS A N   1 
ATOM   11   C CA  . LYS A 1 6   ? 31.458  112.658 45.975 1.00 97.60  ? 6   LYS A CA  1 
ATOM   12   C C   . LYS A 1 6   ? 31.318  112.971 44.477 1.00 88.42  ? 6   LYS A C   1 
ATOM   13   O O   . LYS A 1 6   ? 31.874  113.970 44.020 1.00 76.28  ? 6   LYS A O   1 
ATOM   14   C CB  . LYS A 1 6   ? 30.182  112.983 46.758 1.00 93.85  ? 6   LYS A CB  1 
ATOM   15   C CG  . LYS A 1 6   ? 30.438  113.095 48.276 1.00 100.57 ? 6   LYS A CG  1 
ATOM   16   C CD  . LYS A 1 6   ? 29.384  113.905 49.048 1.00 91.79  ? 6   LYS A CD  1 
ATOM   17   C CE  . LYS A 1 6   ? 29.037  113.230 50.382 1.00 76.42  ? 6   LYS A CE  1 
ATOM   18   N NZ  . LYS A 1 6   ? 28.050  114.007 51.183 1.00 90.60  ? 6   LYS A NZ  1 
ATOM   19   N N   . THR A 1 7   ? 30.624  112.141 43.697 1.00 83.43  ? 7   THR A N   1 
ATOM   20   C CA  . THR A 1 7   ? 30.419  112.483 42.281 1.00 72.45  ? 7   THR A CA  1 
ATOM   21   C C   . THR A 1 7   ? 29.170  113.353 42.119 1.00 73.58  ? 7   THR A C   1 
ATOM   22   O O   . THR A 1 7   ? 28.170  113.123 42.802 1.00 73.58  ? 7   THR A O   1 
ATOM   23   C CB  . THR A 1 7   ? 30.289  111.226 41.422 1.00 79.77  ? 7   THR A CB  1 
ATOM   24   O OG1 . THR A 1 7   ? 31.556  110.561 41.342 1.00 69.55  ? 7   THR A OG1 1 
ATOM   25   C CG2 . THR A 1 7   ? 30.012  111.618 39.980 1.00 76.86  ? 7   THR A CG2 1 
ATOM   26   N N   . GLU A 1 8   ? 29.244  114.368 41.258 1.00 67.49  ? 8   GLU A N   1 
ATOM   27   C CA  . GLU A 1 8   ? 28.107  115.245 40.967 1.00 59.90  ? 8   GLU A CA  1 
ATOM   28   C C   . GLU A 1 8   ? 27.237  114.619 39.867 1.00 63.62  ? 8   GLU A C   1 
ATOM   29   O O   . GLU A 1 8   ? 27.721  114.266 38.785 1.00 71.00  ? 8   GLU A O   1 
ATOM   30   C CB  . GLU A 1 8   ? 28.595  116.625 40.484 1.00 63.46  ? 8   GLU A CB  1 
ATOM   31   C CG  . GLU A 1 8   ? 29.100  117.557 41.580 1.00 86.35  ? 8   GLU A CG  1 
ATOM   32   C CD  . GLU A 1 8   ? 29.169  119.024 41.161 1.00 101.06 ? 8   GLU A CD  1 
ATOM   33   O OE1 . GLU A 1 8   ? 29.542  119.299 39.994 1.00 82.68  ? 8   GLU A OE1 1 
ATOM   34   O OE2 . GLU A 1 8   ? 28.870  119.907 42.012 1.00 93.48  ? 8   GLU A OE2 1 
ATOM   35   N N   . VAL A 1 9   ? 25.941  114.514 40.119 1.00 56.71  ? 9   VAL A N   1 
ATOM   36   C CA  . VAL A 1 9   ? 25.049  113.834 39.183 1.00 52.57  ? 9   VAL A CA  1 
ATOM   37   C C   . VAL A 1 9   ? 23.877  114.721 38.761 1.00 57.58  ? 9   VAL A C   1 
ATOM   38   O O   . VAL A 1 9   ? 23.298  115.449 39.586 1.00 52.66  ? 9   VAL A O   1 
ATOM   39   C CB  . VAL A 1 9   ? 24.409  112.636 39.862 1.00 61.88  ? 9   VAL A CB  1 
ATOM   40   C CG1 . VAL A 1 9   ? 23.235  112.167 39.014 1.00 63.86  ? 9   VAL A CG1 1 
ATOM   41   C CG2 . VAL A 1 9   ? 25.455  111.514 40.092 1.00 50.17  ? 9   VAL A CG2 1 
ATOM   42   N N   . VAL A 1 10  ? 23.486  114.628 37.494 1.00 49.12  ? 10  VAL A N   1 
ATOM   43   C CA  . VAL A 1 10  ? 22.244  115.244 37.073 1.00 50.96  ? 10  VAL A CA  1 
ATOM   44   C C   . VAL A 1 10  ? 21.209  114.167 36.736 1.00 46.71  ? 10  VAL A C   1 
ATOM   45   O O   . VAL A 1 10  ? 21.535  113.217 36.055 1.00 56.11  ? 10  VAL A O   1 
ATOM   46   C CB  . VAL A 1 10  ? 22.426  116.151 35.838 1.00 51.80  ? 10  VAL A CB  1 
ATOM   47   C CG1 . VAL A 1 10  ? 21.043  116.662 35.397 1.00 49.82  ? 10  VAL A CG1 1 
ATOM   48   C CG2 . VAL A 1 10  ? 23.327  117.329 36.156 1.00 52.44  ? 10  VAL A CG2 1 
ATOM   49   N N   . LEU A 1 11  ? 19.967  114.352 37.180 1.00 45.99  ? 11  LEU A N   1 
ATOM   50   C CA  . LEU A 1 11  ? 18.879  113.387 36.960 1.00 55.26  ? 11  LEU A CA  1 
ATOM   51   C C   . LEU A 1 11  ? 18.002  113.811 35.791 1.00 42.68  ? 11  LEU A C   1 
ATOM   52   O O   . LEU A 1 11  ? 17.419  114.877 35.823 1.00 54.85  ? 11  LEU A O   1 
ATOM   53   C CB  . LEU A 1 11  ? 17.982  113.312 38.198 1.00 43.16  ? 11  LEU A CB  1 
ATOM   54   C CG  . LEU A 1 11  ? 18.700  112.826 39.446 1.00 53.90  ? 11  LEU A CG  1 
ATOM   55   C CD1 . LEU A 1 11  ? 17.738  112.527 40.625 1.00 34.33  ? 11  LEU A CD1 1 
ATOM   56   C CD2 . LEU A 1 11  ? 19.461  111.588 39.028 1.00 51.38  ? 11  LEU A CD2 1 
ATOM   57   N N   . LEU A 1 12  ? 17.922  112.977 34.765 1.00 45.44  ? 12  LEU A N   1 
ATOM   58   C CA  . LEU A 1 12  ? 17.168  113.287 33.570 1.00 41.12  ? 12  LEU A CA  1 
ATOM   59   C C   . LEU A 1 12  ? 16.043  112.312 33.423 1.00 48.47  ? 12  LEU A C   1 
ATOM   60   O O   . LEU A 1 12  ? 16.282  111.110 33.301 1.00 43.94  ? 12  LEU A O   1 
ATOM   61   C CB  . LEU A 1 12  ? 18.055  113.128 32.345 1.00 34.10  ? 12  LEU A CB  1 
ATOM   62   C CG  . LEU A 1 12  ? 17.369  113.141 30.981 1.00 50.98  ? 12  LEU A CG  1 
ATOM   63   C CD1 . LEU A 1 12  ? 16.821  114.581 30.795 1.00 58.86  ? 12  LEU A CD1 1 
ATOM   64   C CD2 . LEU A 1 12  ? 18.507  112.878 29.969 1.00 46.89  ? 12  LEU A CD2 1 
ATOM   65   N N   . ALA A 1 13  ? 14.818  112.834 33.422 1.00 45.09  ? 13  ALA A N   1 
ATOM   66   C CA  . ALA A 1 13  ? 13.659  112.037 33.146 1.00 43.42  ? 13  ALA A CA  1 
ATOM   67   C C   . ALA A 1 13  ? 12.998  112.451 31.837 1.00 49.04  ? 13  ALA A C   1 
ATOM   68   O O   . ALA A 1 13  ? 12.492  113.570 31.702 1.00 54.10  ? 13  ALA A O   1 
ATOM   69   C CB  . ALA A 1 13  ? 12.683  112.040 34.334 1.00 38.10  ? 13  ALA A CB  1 
ATOM   70   N N   . CYS A 1 14  ? 13.057  111.527 30.873 1.00 48.03  ? 14  CYS A N   1 
ATOM   71   C CA  . CYS A 1 14  ? 12.276  111.574 29.636 1.00 50.77  ? 14  CYS A CA  1 
ATOM   72   C C   . CYS A 1 14  ? 10.904  110.955 29.849 1.00 53.65  ? 14  CYS A C   1 
ATOM   73   O O   . CYS A 1 14  ? 10.662  110.298 30.861 1.00 60.41  ? 14  CYS A O   1 
ATOM   74   C CB  . CYS A 1 14  ? 13.010  110.837 28.540 1.00 52.86  ? 14  CYS A CB  1 
ATOM   75   S SG  . CYS A 1 14  ? 14.567  111.629 28.025 1.00 54.86  ? 14  CYS A SG  1 
ATOM   76   N N   . GLY A 1 15  ? 10.014  111.159 28.892 1.00 46.89  ? 15  GLY A N   1 
ATOM   77   C CA  . GLY A 1 15  ? 8.670   110.633 28.988 1.00 39.77  ? 15  GLY A CA  1 
ATOM   78   C C   . GLY A 1 15  ? 7.671   111.568 28.318 1.00 49.89  ? 15  GLY A C   1 
ATOM   79   O O   . GLY A 1 15  ? 8.056   112.580 27.729 1.00 47.75  ? 15  GLY A O   1 
ATOM   80   N N   . SER A 1 16  ? 6.394   111.219 28.430 1.00 42.07  ? 16  SER A N   1 
ATOM   81   C CA  . SER A 1 16  ? 5.320   111.985 27.809 1.00 49.59  ? 16  SER A CA  1 
ATOM   82   C C   . SER A 1 16  ? 4.693   113.011 28.759 1.00 52.80  ? 16  SER A C   1 
ATOM   83   O O   . SER A 1 16  ? 4.120   114.009 28.306 1.00 58.22  ? 16  SER A O   1 
ATOM   84   C CB  . SER A 1 16  ? 4.225   111.043 27.293 1.00 39.96  ? 16  SER A CB  1 
ATOM   85   O OG  . SER A 1 16  ? 4.750   110.090 26.384 1.00 60.52  ? 16  SER A OG  1 
ATOM   86   N N   . PHE A 1 17  ? 4.801   112.773 30.076 1.00 41.13  ? 17  PHE A N   1 
ATOM   87   C CA  . PHE A 1 17  ? 4.186   113.672 31.066 1.00 38.08  ? 17  PHE A CA  1 
ATOM   88   C C   . PHE A 1 17  ? 2.813   114.049 30.588 1.00 41.42  ? 17  PHE A C   1 
ATOM   89   O O   . PHE A 1 17  ? 2.513   115.218 30.373 1.00 46.20  ? 17  PHE A O   1 
ATOM   90   C CB  . PHE A 1 17  ? 5.058   114.905 31.278 1.00 28.07  ? 17  PHE A CB  1 
ATOM   91   C CG  . PHE A 1 17  ? 6.422   114.549 31.747 1.00 32.79  ? 17  PHE A CG  1 
ATOM   92   C CD1 . PHE A 1 17  ? 7.456   114.404 30.844 1.00 31.29  ? 17  PHE A CD1 1 
ATOM   93   C CD2 . PHE A 1 17  ? 6.656   114.346 33.090 1.00 33.57  ? 17  PHE A CD2 1 
ATOM   94   C CE1 . PHE A 1 17  ? 8.715   114.046 31.276 1.00 42.68  ? 17  PHE A CE1 1 
ATOM   95   C CE2 . PHE A 1 17  ? 7.913   113.983 33.531 1.00 32.27  ? 17  PHE A CE2 1 
ATOM   96   C CZ  . PHE A 1 17  ? 8.944   113.831 32.621 1.00 34.81  ? 17  PHE A CZ  1 
ATOM   97   N N   . ASN A 1 18  ? 1.955   113.061 30.430 1.00 34.21  ? 18  ASN A N   1 
ATOM   98   C CA  . ASN A 1 18  ? 0.697   113.335 29.782 1.00 47.09  ? 18  ASN A CA  1 
ATOM   99   C C   . ASN A 1 18  ? -0.538  112.988 30.582 1.00 36.27  ? 18  ASN A C   1 
ATOM   100  O O   . ASN A 1 18  ? -1.282  112.078 30.234 1.00 41.16  ? 18  ASN A O   1 
ATOM   101  C CB  . ASN A 1 18  ? 0.666   112.600 28.442 1.00 36.67  ? 18  ASN A CB  1 
ATOM   102  C CG  . ASN A 1 18  ? -0.539  112.927 27.585 1.00 55.57  ? 18  ASN A CG  1 
ATOM   103  O OD1 . ASN A 1 18  ? -1.024  114.056 27.577 1.00 49.88  ? 18  ASN A OD1 1 
ATOM   104  N ND2 . ASN A 1 18  ? -1.022  111.930 26.850 1.00 41.61  ? 18  ASN A ND2 1 
ATOM   105  N N   . PRO A 1 19  ? -0.829  113.718 31.646 1.00 48.67  ? 19  PRO A N   1 
ATOM   106  C CA  . PRO A 1 19  ? 0.043   114.760 32.220 1.00 41.72  ? 19  PRO A CA  1 
ATOM   107  C C   . PRO A 1 19  ? 0.986   114.298 33.323 1.00 43.33  ? 19  PRO A C   1 
ATOM   108  O O   . PRO A 1 19  ? 0.988   113.139 33.699 1.00 42.57  ? 19  PRO A O   1 
ATOM   109  C CB  . PRO A 1 19  ? -0.869  115.513 33.181 1.00 38.97  ? 19  PRO A CB  1 
ATOM   110  C CG  . PRO A 1 19  ? -2.224  115.049 32.850 1.00 46.78  ? 19  PRO A CG  1 
ATOM   111  C CD  . PRO A 1 19  ? -2.093  113.636 32.362 1.00 37.94  ? 19  PRO A CD  1 
ATOM   112  N N   . ILE A 1 20  ? 1.755   115.243 33.853 1.00 35.37  ? 20  ILE A N   1 
ATOM   113  C CA  . ILE A 1 20  ? 2.632   115.048 35.010 1.00 42.97  ? 20  ILE A CA  1 
ATOM   114  C C   . ILE A 1 20  ? 1.743   114.932 36.235 1.00 40.30  ? 20  ILE A C   1 
ATOM   115  O O   . ILE A 1 20  ? 0.646   115.504 36.267 1.00 32.10  ? 20  ILE A O   1 
ATOM   116  C CB  . ILE A 1 20  ? 3.585   116.278 35.173 1.00 42.17  ? 20  ILE A CB  1 
ATOM   117  C CG1 . ILE A 1 20  ? 4.609   116.028 36.264 1.00 38.03  ? 20  ILE A CG1 1 
ATOM   118  C CG2 . ILE A 1 20  ? 2.803   117.634 35.502 1.00 23.41  ? 20  ILE A CG2 1 
ATOM   119  C CD1 . ILE A 1 20  ? 5.923   116.792 36.022 1.00 34.08  ? 20  ILE A CD1 1 
ATOM   120  N N   . THR A 1 21  ? 2.189   114.186 37.234 1.00 34.22  ? 21  THR A N   1 
ATOM   121  C CA  . THR A 1 21  ? 1.380   114.047 38.436 1.00 38.56  ? 21  THR A CA  1 
ATOM   122  C C   . THR A 1 21  ? 2.312   114.059 39.651 1.00 44.90  ? 21  THR A C   1 
ATOM   123  O O   . THR A 1 21  ? 3.547   114.063 39.487 1.00 35.72  ? 21  THR A O   1 
ATOM   124  C CB  . THR A 1 21  ? 0.693   112.676 38.433 1.00 48.21  ? 21  THR A CB  1 
ATOM   125  O OG1 . THR A 1 21  ? 1.709   111.692 38.679 1.00 34.70  ? 21  THR A OG1 1 
ATOM   126  C CG2 . THR A 1 21  ? 0.062   112.331 37.032 1.00 29.52  ? 21  THR A CG2 1 
ATOM   127  N N   . ASN A 1 22  ? 1.743   113.915 40.849 1.00 36.49  ? 22  ASN A N   1 
ATOM   128  C CA  . ASN A 1 22  ? 2.595   113.891 42.045 1.00 40.61  ? 22  ASN A CA  1 
ATOM   129  C C   . ASN A 1 22  ? 3.631   112.755 42.006 1.00 42.72  ? 22  ASN A C   1 
ATOM   130  O O   . ASN A 1 22  ? 4.783   112.883 42.503 1.00 38.90  ? 22  ASN A O   1 
ATOM   131  C CB  . ASN A 1 22  ? 1.759   113.837 43.333 1.00 38.15  ? 22  ASN A CB  1 
ATOM   132  C CG  . ASN A 1 22  ? 0.946   115.102 43.559 1.00 41.51  ? 22  ASN A CG  1 
ATOM   133  O OD1 . ASN A 1 22  ? 1.137   116.103 42.882 1.00 39.96  ? 22  ASN A OD1 1 
ATOM   134  N ND2 . ASN A 1 22  ? 0.032   115.054 44.517 1.00 37.78  ? 22  ASN A ND2 1 
ATOM   135  N N   . MET A 1 23  ? 3.232   111.635 41.410 1.00 37.17  ? 23  MET A N   1 
ATOM   136  C CA  . MET A 1 23  ? 4.128   110.468 41.319 1.00 32.40  ? 23  MET A CA  1 
ATOM   137  C C   . MET A 1 23  ? 5.457   110.813 40.618 1.00 34.62  ? 23  MET A C   1 
ATOM   138  O O   . MET A 1 23  ? 6.497   110.500 41.165 1.00 34.79  ? 23  MET A O   1 
ATOM   139  C CB  . MET A 1 23  ? 3.451   109.277 40.599 1.00 33.75  ? 23  MET A CB  1 
ATOM   140  C CG  . MET A 1 23  ? 4.426   108.116 40.306 1.00 43.80  ? 23  MET A CG  1 
ATOM   141  S SD  . MET A 1 23  ? 4.054   107.141 38.878 1.00 98.64  ? 23  MET A SD  1 
ATOM   142  C CE  . MET A 1 23  ? 4.771   108.209 37.522 1.00 54.27  ? 23  MET A CE  1 
ATOM   143  N N   . HIS A 1 24  ? 5.455   111.526 39.477 1.00 38.25  ? 24  HIS A N   1 
ATOM   144  C CA  . HIS A 1 24  ? 6.738   111.872 38.817 1.00 40.67  ? 24  HIS A CA  1 
ATOM   145  C C   . HIS A 1 24  ? 7.614   112.767 39.652 1.00 39.59  ? 24  HIS A C   1 
ATOM   146  O O   . HIS A 1 24  ? 8.854   112.670 39.603 1.00 44.16  ? 24  HIS A O   1 
ATOM   147  C CB  . HIS A 1 24  ? 6.598   112.561 37.460 1.00 36.06  ? 24  HIS A CB  1 
ATOM   148  C CG  . HIS A 1 24  ? 5.661   111.889 36.523 1.00 42.27  ? 24  HIS A CG  1 
ATOM   149  N ND1 . HIS A 1 24  ? 6.092   111.009 35.556 1.00 56.33  ? 24  HIS A ND1 1 
ATOM   150  C CD2 . HIS A 1 24  ? 4.321   112.004 36.366 1.00 42.84  ? 24  HIS A CD2 1 
ATOM   151  C CE1 . HIS A 1 24  ? 5.054   110.592 34.855 1.00 56.88  ? 24  HIS A CE1 1 
ATOM   152  N NE2 . HIS A 1 24  ? 3.966   111.162 35.336 1.00 47.03  ? 24  HIS A NE2 1 
ATOM   153  N N   . LEU A 1 25  ? 6.962   113.684 40.363 1.00 43.78  ? 25  LEU A N   1 
ATOM   154  C CA  . LEU A 1 25  ? 7.652   114.631 41.242 1.00 35.71  ? 25  LEU A CA  1 
ATOM   155  C C   . LEU A 1 25  ? 8.287   113.904 42.412 1.00 43.30  ? 25  LEU A C   1 
ATOM   156  O O   . LEU A 1 25  ? 9.439   114.176 42.748 1.00 32.76  ? 25  LEU A O   1 
ATOM   157  C CB  . LEU A 1 25  ? 6.675   115.705 41.773 1.00 33.77  ? 25  LEU A CB  1 
ATOM   158  C CG  . LEU A 1 25  ? 6.090   116.489 40.596 1.00 49.11  ? 25  LEU A CG  1 
ATOM   159  C CD1 . LEU A 1 25  ? 4.968   117.430 40.974 1.00 46.18  ? 25  LEU A CD1 1 
ATOM   160  C CD2 . LEU A 1 25  ? 7.196   117.267 39.923 1.00 42.33  ? 25  LEU A CD2 1 
ATOM   161  N N   . ARG A 1 26  ? 7.551   112.935 42.967 1.00 39.80  ? 26  ARG A N   1 
ATOM   162  C CA  . ARG A 1 26  ? 8.046   112.117 44.063 1.00 41.67  ? 26  ARG A CA  1 
ATOM   163  C C   . ARG A 1 26  ? 9.257   111.322 43.608 1.00 37.58  ? 26  ARG A C   1 
ATOM   164  O O   . ARG A 1 26  ? 10.217  111.208 44.370 1.00 47.91  ? 26  ARG A O   1 
ATOM   165  C CB  . ARG A 1 26  ? 7.021   111.058 44.542 1.00 44.57  ? 26  ARG A CB  1 
ATOM   166  C CG  . ARG A 1 26  ? 7.558   110.112 45.633 1.00 41.23  ? 26  ARG A CG  1 
ATOM   167  C CD  . ARG A 1 26  ? 7.784   110.745 47.030 1.00 44.56  ? 26  ARG A CD  1 
ATOM   168  N NE  . ARG A 1 26  ? 8.115   109.659 47.945 1.00 57.28  ? 26  ARG A NE  1 
ATOM   169  C CZ  . ARG A 1 26  ? 8.937   109.763 48.977 1.00 41.09  ? 26  ARG A CZ  1 
ATOM   170  N NH1 . ARG A 1 26  ? 9.471   110.934 49.257 1.00 37.29  ? 26  ARG A NH1 1 
ATOM   171  N NH2 . ARG A 1 26  ? 9.218   108.698 49.734 1.00 42.12  ? 26  ARG A NH2 1 
ATOM   172  N N   . LEU A 1 27  ? 9.228   110.739 42.402 1.00 41.39  ? 27  LEU A N   1 
ATOM   173  C CA  . LEU A 1 27  ? 10.414  110.013 41.908 1.00 44.09  ? 27  LEU A CA  1 
ATOM   174  C C   . LEU A 1 27  ? 11.702  110.806 42.007 1.00 48.23  ? 27  LEU A C   1 
ATOM   175  O O   . LEU A 1 27  ? 12.751  110.246 42.356 1.00 46.60  ? 27  LEU A O   1 
ATOM   176  C CB  . LEU A 1 27  ? 10.296  109.538 40.459 1.00 49.77  ? 27  LEU A CB  1 
ATOM   177  C CG  . LEU A 1 27  ? 9.331   108.436 40.031 1.00 76.34  ? 27  LEU A CG  1 
ATOM   178  C CD1 . LEU A 1 27  ? 9.646   108.006 38.607 1.00 83.14  ? 27  LEU A CD1 1 
ATOM   179  C CD2 . LEU A 1 27  ? 9.355   107.242 40.962 1.00 70.06  ? 27  LEU A CD2 1 
ATOM   180  N N   . PHE A 1 28  ? 11.667  112.096 41.663 1.00 44.29  ? 28  PHE A N   1 
ATOM   181  C CA  . PHE A 1 28  ? 12.900  112.866 41.825 1.00 34.73  ? 28  PHE A CA  1 
ATOM   182  C C   . PHE A 1 28  ? 13.387  112.957 43.249 1.00 32.41  ? 28  PHE A C   1 
ATOM   183  O O   . PHE A 1 28  ? 14.577  112.759 43.482 1.00 38.39  ? 28  PHE A O   1 
ATOM   184  C CB  . PHE A 1 28  ? 12.839  114.275 41.216 1.00 47.78  ? 28  PHE A CB  1 
ATOM   185  C CG  . PHE A 1 28  ? 12.922  114.310 39.699 1.00 34.86  ? 28  PHE A CG  1 
ATOM   186  C CD1 . PHE A 1 28  ? 11.787  114.210 38.928 1.00 35.84  ? 28  PHE A CD1 1 
ATOM   187  C CD2 . PHE A 1 28  ? 14.108  114.556 39.068 1.00 44.67  ? 28  PHE A CD2 1 
ATOM   188  C CE1 . PHE A 1 28  ? 11.857  114.297 37.553 1.00 44.44  ? 28  PHE A CE1 1 
ATOM   189  C CE2 . PHE A 1 28  ? 14.165  114.694 37.682 1.00 45.07  ? 28  PHE A CE2 1 
ATOM   190  C CZ  . PHE A 1 28  ? 13.045  114.572 36.946 1.00 42.22  ? 28  PHE A CZ  1 
ATOM   191  N N   . GLU A 1 29  ? 12.514  113.310 44.197 1.00 33.66  ? 29  GLU A N   1 
ATOM   192  C CA  . GLU A 1 29  ? 12.931  113.541 45.591 1.00 41.76  ? 29  GLU A CA  1 
ATOM   193  C C   . GLU A 1 29  ? 13.436  112.183 46.121 1.00 33.63  ? 29  GLU A C   1 
ATOM   194  O O   . GLU A 1 29  ? 14.477  112.116 46.764 1.00 40.08  ? 29  GLU A O   1 
ATOM   195  C CB  . GLU A 1 29  ? 11.760  113.987 46.468 1.00 37.12  ? 29  GLU A CB  1 
ATOM   196  C CG  . GLU A 1 29  ? 11.038  115.185 45.936 1.00 48.57  ? 29  GLU A CG  1 
ATOM   197  C CD  . GLU A 1 29  ? 11.935  116.413 45.936 1.00 50.19  ? 29  GLU A CD  1 
ATOM   198  O OE1 . GLU A 1 29  ? 12.636  116.666 46.934 1.00 59.98  ? 29  GLU A OE1 1 
ATOM   199  O OE2 . GLU A 1 29  ? 11.993  117.092 44.894 1.00 69.88  ? 29  GLU A OE2 1 
ATOM   200  N N   . LEU A 1 30  ? 12.719  111.113 45.795 1.00 42.47  ? 30  LEU A N   1 
ATOM   201  C CA  . LEU A 1 30  ? 13.146  109.792 46.189 1.00 34.43  ? 30  LEU A CA  1 
ATOM   202  C C   . LEU A 1 30  ? 14.590  109.571 45.699 1.00 46.07  ? 30  LEU A C   1 
ATOM   203  O O   . LEU A 1 30  ? 15.477  109.179 46.469 1.00 43.55  ? 30  LEU A O   1 
ATOM   204  C CB  . LEU A 1 30  ? 12.156  108.755 45.639 1.00 41.33  ? 30  LEU A CB  1 
ATOM   205  C CG  . LEU A 1 30  ? 11.771  107.458 46.362 1.00 51.21  ? 30  LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 30  ? 12.220  107.251 47.814 1.00 48.85  ? 30  LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 30  ? 10.342  106.988 46.131 1.00 81.64  ? 30  LEU A CD2 1 
ATOM   208  N N   . ALA A 1 31  ? 14.864  109.889 44.440 1.00 43.92  ? 31  ALA A N   1 
ATOM   209  C CA  . ALA A 1 31  ? 16.098  109.378 43.846 1.00 40.13  ? 31  ALA A CA  1 
ATOM   210  C C   . ALA A 1 31  ? 17.268  110.179 44.368 1.00 46.22  ? 31  ALA A C   1 
ATOM   211  O O   . ALA A 1 31  ? 18.353  109.638 44.584 1.00 46.20  ? 31  ALA A O   1 
ATOM   212  C CB  . ALA A 1 31  ? 16.028  109.433 42.348 1.00 39.55  ? 31  ALA A CB  1 
ATOM   213  N N   . LYS A 1 32  ? 17.025  111.455 44.617 1.00 40.90  ? 32  LYS A N   1 
ATOM   214  C CA  . LYS A 1 32  ? 18.069  112.298 45.159 1.00 47.29  ? 32  LYS A CA  1 
ATOM   215  C C   . LYS A 1 32  ? 18.381  111.928 46.595 1.00 45.14  ? 32  LYS A C   1 
ATOM   216  O O   . LYS A 1 32  ? 19.532  111.957 47.013 1.00 48.49  ? 32  LYS A O   1 
ATOM   217  C CB  . LYS A 1 32  ? 17.671  113.790 45.078 1.00 48.84  ? 32  LYS A CB  1 
ATOM   218  C CG  . LYS A 1 32  ? 18.460  114.740 46.006 1.00 53.02  ? 32  LYS A CG  1 
ATOM   219  C CD  . LYS A 1 32  ? 18.378  116.214 45.555 1.00 64.58  ? 32  LYS A CD  1 
ATOM   220  C CE  . LYS A 1 32  ? 18.541  117.210 46.717 1.00 59.51  ? 32  LYS A CE  1 
ATOM   221  N NZ  . LYS A 1 32  ? 18.631  118.642 46.242 1.00 59.46  ? 32  LYS A NZ  1 
ATOM   222  N N   . ASP A 1 33  ? 17.347  111.715 47.388 1.00 36.73  ? 33  ASP A N   1 
ATOM   223  C CA  . ASP A 1 33  ? 17.606  111.305 48.748 1.00 47.83  ? 33  ASP A CA  1 
ATOM   224  C C   . ASP A 1 33  ? 18.520  110.081 48.715 1.00 61.80  ? 33  ASP A C   1 
ATOM   225  O O   . ASP A 1 33  ? 19.438  109.969 49.542 1.00 52.59  ? 33  ASP A O   1 
ATOM   226  C CB  . ASP A 1 33  ? 16.294  110.961 49.465 1.00 55.94  ? 33  ASP A CB  1 
ATOM   227  C CG  . ASP A 1 33  ? 15.654  112.191 50.101 1.00 64.12  ? 33  ASP A CG  1 
ATOM   228  O OD1 . ASP A 1 33  ? 16.266  113.267 49.942 1.00 65.08  ? 33  ASP A OD1 1 
ATOM   229  O OD2 . ASP A 1 33  ? 14.551  112.195 50.710 1.00 51.97  ? 33  ASP A OD2 1 
ATOM   230  N N   . TYR A 1 34  ? 18.272  109.174 47.761 1.00 49.27  ? 34  TYR A N   1 
ATOM   231  C CA  . TYR A 1 34  ? 18.954  107.891 47.778 1.00 43.65  ? 34  TYR A CA  1 
ATOM   232  C C   . TYR A 1 34  ? 20.381  108.168 47.363 1.00 45.63  ? 34  TYR A C   1 
ATOM   233  O O   . TYR A 1 34  ? 21.341  107.762 48.006 1.00 51.35  ? 34  TYR A O   1 
ATOM   234  C CB  . TYR A 1 34  ? 18.303  106.896 46.803 1.00 42.56  ? 34  TYR A CB  1 
ATOM   235  C CG  . TYR A 1 34  ? 19.132  105.661 46.552 1.00 46.68  ? 34  TYR A CG  1 
ATOM   236  C CD1 . TYR A 1 34  ? 18.879  104.481 47.245 1.00 56.82  ? 34  TYR A CD1 1 
ATOM   237  C CD2 . TYR A 1 34  ? 20.179  105.674 45.638 1.00 45.31  ? 34  TYR A CD2 1 
ATOM   238  C CE1 . TYR A 1 34  ? 19.648  103.334 47.027 1.00 63.30  ? 34  TYR A CE1 1 
ATOM   239  C CE2 . TYR A 1 34  ? 20.950  104.533 45.411 1.00 56.77  ? 34  TYR A CE2 1 
ATOM   240  C CZ  . TYR A 1 34  ? 20.690  103.378 46.110 1.00 84.25  ? 34  TYR A CZ  1 
ATOM   241  O OH  . TYR A 1 34  ? 21.491  102.282 45.857 1.00 61.50  ? 34  TYR A OH  1 
ATOM   242  N N   . MET A 1 35  ? 20.524  108.785 46.212 1.00 49.34  ? 35  MET A N   1 
ATOM   243  C CA  . MET A 1 35  ? 21.855  108.995 45.691 1.00 56.42  ? 35  MET A CA  1 
ATOM   244  C C   . MET A 1 35  ? 22.686  109.664 46.778 1.00 54.74  ? 35  MET A C   1 
ATOM   245  O O   . MET A 1 35  ? 23.755  109.183 47.130 1.00 49.21  ? 35  MET A O   1 
ATOM   246  C CB  . MET A 1 35  ? 21.831  109.790 44.380 1.00 51.58  ? 35  MET A CB  1 
ATOM   247  C CG  . MET A 1 35  ? 21.309  109.014 43.156 1.00 47.36  ? 35  MET A CG  1 
ATOM   248  S SD  . MET A 1 35  ? 22.150  107.450 42.887 1.00 58.42  ? 35  MET A SD  1 
ATOM   249  C CE  . MET A 1 35  ? 23.644  108.018 42.118 1.00 58.77  ? 35  MET A CE  1 
ATOM   250  N N   . ASN A 1 36  ? 22.189  110.770 47.330 1.00 54.25  ? 36  ASN A N   1 
ATOM   251  C CA  . ASN A 1 36  ? 22.970  111.542 48.299 1.00 46.95  ? 36  ASN A CA  1 
ATOM   252  C C   . ASN A 1 36  ? 23.273  110.721 49.584 1.00 60.13  ? 36  ASN A C   1 
ATOM   253  O O   . ASN A 1 36  ? 24.218  111.006 50.326 1.00 53.49  ? 36  ASN A O   1 
ATOM   254  C CB  . ASN A 1 36  ? 22.210  112.801 48.711 1.00 60.97  ? 36  ASN A CB  1 
ATOM   255  C CG  . ASN A 1 36  ? 22.409  113.958 47.758 1.00 53.23  ? 36  ASN A CG  1 
ATOM   256  O OD1 . ASN A 1 36  ? 23.418  114.062 47.067 1.00 83.86  ? 36  ASN A OD1 1 
ATOM   257  N ND2 . ASN A 1 36  ? 21.467  114.871 47.769 1.00 49.42  ? 36  ASN A ND2 1 
ATOM   258  N N   . GLY A 1 37  ? 22.433  109.738 49.875 1.00 47.40  ? 37  GLY A N   1 
ATOM   259  C CA  . GLY A 1 37  ? 22.635  108.895 51.033 1.00 57.96  ? 37  GLY A CA  1 
ATOM   260  C C   . GLY A 1 37  ? 23.553  107.701 50.786 1.00 61.02  ? 37  GLY A C   1 
ATOM   261  O O   . GLY A 1 37  ? 23.794  106.925 51.692 1.00 53.17  ? 37  GLY A O   1 
ATOM   262  N N   . THR A 1 38  ? 24.074  107.550 49.575 1.00 61.55  ? 38  THR A N   1 
ATOM   263  C CA  . THR A 1 38  ? 25.104  106.550 49.310 1.00 58.19  ? 38  THR A CA  1 
ATOM   264  C C   . THR A 1 38  ? 26.382  106.954 50.018 1.00 61.67  ? 38  THR A C   1 
ATOM   265  O O   . THR A 1 38  ? 27.233  106.120 50.309 1.00 61.57  ? 38  THR A O   1 
ATOM   266  C CB  . THR A 1 38  ? 25.454  106.513 47.807 1.00 56.02  ? 38  THR A CB  1 
ATOM   267  O OG1 . THR A 1 38  ? 25.765  107.841 47.357 1.00 59.09  ? 38  THR A OG1 1 
ATOM   268  C CG2 . THR A 1 38  ? 24.275  106.069 46.969 1.00 62.81  ? 38  THR A CG2 1 
ATOM   269  N N   . GLY A 1 39  ? 26.567  108.256 50.154 1.00 54.50  ? 39  GLY A N   1 
ATOM   270  C CA  . GLY A 1 39  ? 27.830  108.808 50.603 1.00 59.37  ? 39  GLY A CA  1 
ATOM   271  C C   . GLY A 1 39  ? 28.772  108.970 49.426 1.00 71.37  ? 39  GLY A C   1 
ATOM   272  O O   . GLY A 1 39  ? 29.820  109.620 49.528 1.00 64.14  ? 39  GLY A O   1 
ATOM   273  N N   . ARG A 1 40  ? 28.365  108.423 48.284 1.00 68.26  ? 40  ARG A N   1 
ATOM   274  C CA  . ARG A 1 40  ? 29.216  108.458 47.109 1.00 67.40  ? 40  ARG A CA  1 
ATOM   275  C C   . ARG A 1 40  ? 28.873  109.541 46.076 1.00 67.66  ? 40  ARG A C   1 
ATOM   276  O O   . ARG A 1 40  ? 29.683  109.819 45.194 1.00 63.20  ? 40  ARG A O   1 
ATOM   277  C CB  . ARG A 1 40  ? 29.343  107.078 46.460 1.00 62.19  ? 40  ARG A CB  1 
ATOM   278  C CG  . ARG A 1 40  ? 29.118  105.877 47.427 1.00 97.49  ? 40  ARG A CG  1 
ATOM   279  C CD  . ARG A 1 40  ? 29.061  104.476 46.762 1.00 94.46  ? 40  ARG A CD  1 
ATOM   280  N NE  . ARG A 1 40  ? 27.781  103.783 46.908 1.00 98.22  ? 40  ARG A NE  1 
ATOM   281  C CZ  . ARG A 1 40  ? 27.145  103.199 45.906 1.00 101.06 ? 40  ARG A CZ  1 
ATOM   282  N NH1 . ARG A 1 40  ? 27.665  103.235 44.681 1.00 69.72  ? 40  ARG A NH1 1 
ATOM   283  N NH2 . ARG A 1 40  ? 25.989  102.587 46.130 1.00 101.06 ? 40  ARG A NH2 1 
ATOM   284  N N   . TYR A 1 41  ? 27.702  110.170 46.187 1.00 64.71  ? 41  TYR A N   1 
ATOM   285  C CA  . TYR A 1 41  ? 27.262  111.176 45.210 1.00 48.92  ? 41  TYR A CA  1 
ATOM   286  C C   . TYR A 1 41  ? 26.638  112.397 45.839 1.00 53.89  ? 41  TYR A C   1 
ATOM   287  O O   . TYR A 1 41  ? 26.248  112.411 47.002 1.00 58.70  ? 41  TYR A O   1 
ATOM   288  C CB  . TYR A 1 41  ? 26.198  110.631 44.257 1.00 54.00  ? 41  TYR A CB  1 
ATOM   289  C CG  . TYR A 1 41  ? 26.547  109.350 43.553 1.00 45.90  ? 41  TYR A CG  1 
ATOM   290  C CD1 . TYR A 1 41  ? 26.255  108.131 44.122 1.00 57.03  ? 41  TYR A CD1 1 
ATOM   291  C CD2 . TYR A 1 41  ? 27.163  109.367 42.315 1.00 62.19  ? 41  TYR A CD2 1 
ATOM   292  C CE1 . TYR A 1 41  ? 26.581  106.943 43.474 1.00 60.49  ? 41  TYR A CE1 1 
ATOM   293  C CE2 . TYR A 1 41  ? 27.492  108.211 41.655 1.00 52.15  ? 41  TYR A CE2 1 
ATOM   294  C CZ  . TYR A 1 41  ? 27.203  106.998 42.232 1.00 78.70  ? 41  TYR A CZ  1 
ATOM   295  O OH  . TYR A 1 41  ? 27.523  105.860 41.532 1.00 55.96  ? 41  TYR A OH  1 
ATOM   296  N N   . THR A 1 42  ? 26.483  113.409 45.000 1.00 54.19  ? 42  THR A N   1 
ATOM   297  C CA  . THR A 1 42  ? 25.771  114.628 45.348 1.00 65.75  ? 42  THR A CA  1 
ATOM   298  C C   . THR A 1 42  ? 24.943  115.026 44.144 1.00 61.36  ? 42  THR A C   1 
ATOM   299  O O   . THR A 1 42  ? 25.466  115.183 43.043 1.00 55.11  ? 42  THR A O   1 
ATOM   300  C CB  . THR A 1 42  ? 26.763  115.739 45.686 1.00 70.36  ? 42  THR A CB  1 
ATOM   301  O OG1 . THR A 1 42  ? 27.494  115.348 46.857 1.00 81.70  ? 42  THR A OG1 1 
ATOM   302  C CG2 . THR A 1 42  ? 26.014  117.001 46.096 1.00 64.41  ? 42  THR A CG2 1 
ATOM   303  N N   . VAL A 1 43  ? 23.638  115.132 44.339 1.00 59.67  ? 43  VAL A N   1 
ATOM   304  C CA  . VAL A 1 43  ? 22.755  115.329 43.210 1.00 54.43  ? 43  VAL A CA  1 
ATOM   305  C C   . VAL A 1 43  ? 22.641  116.810 42.973 1.00 63.19  ? 43  VAL A C   1 
ATOM   306  O O   . VAL A 1 43  ? 22.410  117.589 43.906 1.00 59.66  ? 43  VAL A O   1 
ATOM   307  C CB  . VAL A 1 43  ? 21.365  114.808 43.491 1.00 57.83  ? 43  VAL A CB  1 
ATOM   308  C CG1 . VAL A 1 43  ? 20.370  115.480 42.554 1.00 61.94  ? 43  VAL A CG1 1 
ATOM   309  C CG2 . VAL A 1 43  ? 21.358  113.325 43.287 1.00 48.79  ? 43  VAL A CG2 1 
ATOM   310  N N   . VAL A 1 44  ? 22.794  117.235 41.733 1.00 52.01  ? 44  VAL A N   1 
ATOM   311  C CA  . VAL A 1 44  ? 23.030  118.657 41.581 1.00 57.40  ? 44  VAL A CA  1 
ATOM   312  C C   . VAL A 1 44  ? 21.943  119.402 40.851 1.00 62.35  ? 44  VAL A C   1 
ATOM   313  O O   . VAL A 1 44  ? 21.752  120.602 41.053 1.00 55.81  ? 44  VAL A O   1 
ATOM   314  C CB  . VAL A 1 44  ? 24.423  118.913 41.005 1.00 67.85  ? 44  VAL A CB  1 
ATOM   315  C CG1 . VAL A 1 44  ? 24.375  119.885 39.845 1.00 69.36  ? 44  VAL A CG1 1 
ATOM   316  C CG2 . VAL A 1 44  ? 25.391  119.310 42.137 1.00 60.93  ? 44  VAL A CG2 1 
ATOM   317  N N   . LYS A 1 45  ? 21.197  118.674 40.029 1.00 54.54  ? 45  LYS A N   1 
ATOM   318  C CA  . LYS A 1 45  ? 20.083  119.266 39.307 1.00 52.37  ? 45  LYS A CA  1 
ATOM   319  C C   . LYS A 1 45  ? 19.233  118.105 38.782 1.00 55.53  ? 45  LYS A C   1 
ATOM   320  O O   . LYS A 1 45  ? 19.750  117.021 38.475 1.00 63.60  ? 45  LYS A O   1 
ATOM   321  C CB  . LYS A 1 45  ? 20.688  120.080 38.163 1.00 62.18  ? 45  LYS A CB  1 
ATOM   322  C CG  . LYS A 1 45  ? 19.777  120.441 37.008 1.00 67.87  ? 45  LYS A CG  1 
ATOM   323  C CD  . LYS A 1 45  ? 20.337  121.668 36.282 1.00 88.92  ? 45  LYS A CD  1 
ATOM   324  C CE  . LYS A 1 45  ? 20.440  121.468 34.777 1.00 92.53  ? 45  LYS A CE  1 
ATOM   325  N NZ  . LYS A 1 45  ? 21.050  122.650 34.095 1.00 69.21  ? 45  LYS A NZ  1 
ATOM   326  N N   . GLY A 1 46  ? 17.933  118.309 38.654 1.00 44.49  ? 46  GLY A N   1 
ATOM   327  C CA  . GLY A 1 46  ? 17.153  117.397 37.833 1.00 45.40  ? 46  GLY A CA  1 
ATOM   328  C C   . GLY A 1 46  ? 16.452  118.008 36.629 1.00 48.96  ? 46  GLY A C   1 
ATOM   329  O O   . GLY A 1 46  ? 16.135  119.177 36.621 1.00 49.50  ? 46  GLY A O   1 
ATOM   330  N N   . ILE A 1 47  ? 16.162  117.194 35.622 1.00 48.88  ? 47  ILE A N   1 
ATOM   331  C CA  . ILE A 1 47  ? 15.580  117.703 34.409 1.00 38.50  ? 47  ILE A CA  1 
ATOM   332  C C   . ILE A 1 47  ? 14.502  116.793 33.890 1.00 39.76  ? 47  ILE A C   1 
ATOM   333  O O   . ILE A 1 47  ? 14.744  115.607 33.656 1.00 44.01  ? 47  ILE A O   1 
ATOM   334  C CB  . ILE A 1 47  ? 16.662  117.831 33.343 1.00 55.01  ? 47  ILE A CB  1 
ATOM   335  C CG1 . ILE A 1 47  ? 17.792  118.726 33.843 1.00 53.32  ? 47  ILE A CG1 1 
ATOM   336  C CG2 . ILE A 1 47  ? 16.058  118.283 32.028 1.00 48.04  ? 47  ILE A CG2 1 
ATOM   337  C CD1 . ILE A 1 47  ? 19.124  118.383 33.228 1.00 49.87  ? 47  ILE A CD1 1 
ATOM   338  N N   . ILE A 1 48  ? 13.326  117.379 33.692 1.00 38.61  ? 48  ILE A N   1 
ATOM   339  C CA  . ILE A 1 48  ? 12.166  116.723 33.091 1.00 41.01  ? 48  ILE A CA  1 
ATOM   340  C C   . ILE A 1 48  ? 12.262  117.157 31.640 1.00 50.82  ? 48  ILE A C   1 
ATOM   341  O O   . ILE A 1 48  ? 12.595  118.326 31.385 1.00 56.60  ? 48  ILE A O   1 
ATOM   342  C CB  . ILE A 1 48  ? 10.855  117.303 33.716 1.00 45.39  ? 48  ILE A CB  1 
ATOM   343  C CG1 . ILE A 1 48  ? 10.635  116.770 35.143 1.00 36.60  ? 48  ILE A CG1 1 
ATOM   344  C CG2 . ILE A 1 48  ? 9.690   117.193 32.769 1.00 36.25  ? 48  ILE A CG2 1 
ATOM   345  C CD1 . ILE A 1 48  ? 9.525   117.450 35.935 1.00 48.42  ? 48  ILE A CD1 1 
ATOM   346  N N   . SER A 1 49  ? 12.077  116.241 30.697 1.00 45.64  ? 49  SER A N   1 
ATOM   347  C CA  . SER A 1 49  ? 12.154  116.579 29.285 1.00 42.88  ? 49  SER A CA  1 
ATOM   348  C C   . SER A 1 49  ? 11.064  115.837 28.550 1.00 44.79  ? 49  SER A C   1 
ATOM   349  O O   . SER A 1 49  ? 11.252  114.699 28.172 1.00 46.70  ? 49  SER A O   1 
ATOM   350  C CB  . SER A 1 49  ? 13.495  116.124 28.727 1.00 47.42  ? 49  SER A CB  1 
ATOM   351  O OG  . SER A 1 49  ? 13.575  116.293 27.317 1.00 47.32  ? 49  SER A OG  1 
ATOM   352  N N   . PRO A 1 50  ? 9.925   116.473 28.356 1.00 35.42  ? 50  PRO A N   1 
ATOM   353  C CA  . PRO A 1 50  ? 8.789   115.825 27.690 1.00 43.64  ? 50  PRO A CA  1 
ATOM   354  C C   . PRO A 1 50  ? 9.003   115.497 26.213 1.00 49.85  ? 50  PRO A C   1 
ATOM   355  O O   . PRO A 1 50  ? 9.805   116.158 25.569 1.00 48.99  ? 50  PRO A O   1 
ATOM   356  C CB  . PRO A 1 50  ? 7.633   116.804 27.886 1.00 40.04  ? 50  PRO A CB  1 
ATOM   357  C CG  . PRO A 1 50  ? 8.111   117.852 28.863 1.00 37.87  ? 50  PRO A CG  1 
ATOM   358  C CD  . PRO A 1 50  ? 9.613   117.824 28.840 1.00 42.07  ? 50  PRO A CD  1 
ATOM   359  N N   . VAL A 1 51  ? 8.357   114.439 25.709 1.00 48.38  ? 51  VAL A N   1 
ATOM   360  C CA  . VAL A 1 51  ? 8.569   114.021 24.335 1.00 46.23  ? 51  VAL A CA  1 
ATOM   361  C C   . VAL A 1 51  ? 7.903   115.052 23.393 1.00 61.84  ? 51  VAL A C   1 
ATOM   362  O O   . VAL A 1 51  ? 7.137   115.891 23.843 1.00 48.72  ? 51  VAL A O   1 
ATOM   363  C CB  . VAL A 1 51  ? 7.991   112.652 24.097 1.00 53.32  ? 51  VAL A CB  1 
ATOM   364  C CG1 . VAL A 1 51  ? 6.468   112.745 23.900 1.00 34.78  ? 51  VAL A CG1 1 
ATOM   365  C CG2 . VAL A 1 51  ? 8.661   112.000 22.906 1.00 42.74  ? 51  VAL A CG2 1 
ATOM   366  N N   . GLY A 1 52  ? 8.214   115.026 22.099 1.00 61.78  ? 52  GLY A N   1 
ATOM   367  C CA  . GLY A 1 52  ? 7.771   116.091 21.204 1.00 41.28  ? 52  GLY A CA  1 
ATOM   368  C C   . GLY A 1 52  ? 6.541   115.645 20.450 1.00 48.95  ? 52  GLY A C   1 
ATOM   369  O O   . GLY A 1 52  ? 6.018   114.550 20.694 1.00 47.54  ? 52  GLY A O   1 
ATOM   370  N N   . ASP A 1 53  ? 6.083   116.478 19.529 1.00 58.07  ? 53  ASP A N   1 
ATOM   371  C CA  . ASP A 1 53  ? 4.863   116.200 18.790 1.00 54.82  ? 53  ASP A CA  1 
ATOM   372  C C   . ASP A 1 53  ? 5.140   115.247 17.601 1.00 64.70  ? 53  ASP A C   1 
ATOM   373  O O   . ASP A 1 53  ? 4.208   114.762 16.968 1.00 59.55  ? 53  ASP A O   1 
ATOM   374  C CB  . ASP A 1 53  ? 4.294   117.513 18.255 1.00 66.86  ? 53  ASP A CB  1 
ATOM   375  C CG  . ASP A 1 53  ? 3.626   118.386 19.332 1.00 70.23  ? 53  ASP A CG  1 
ATOM   376  O OD1 . ASP A 1 53  ? 2.992   117.893 20.287 1.00 70.21  ? 53  ASP A OD1 1 
ATOM   377  O OD2 . ASP A 1 53  ? 3.640   119.627 19.249 1.00 101.06 ? 53  ASP A OD2 1 
ATOM   378  N N   . ALA A 1 54  ? 6.405   114.999 17.263 1.00 59.59  ? 54  ALA A N   1 
ATOM   379  C CA  . ALA A 1 54  ? 6.690   114.066 16.171 1.00 67.52  ? 54  ALA A CA  1 
ATOM   380  C C   . ALA A 1 54  ? 6.290   112.654 16.553 1.00 68.61  ? 54  ALA A C   1 
ATOM   381  O O   . ALA A 1 54  ? 5.950   111.840 15.693 1.00 67.73  ? 54  ALA A O   1 
ATOM   382  C CB  . ALA A 1 54  ? 8.163   114.097 15.758 1.00 60.24  ? 54  ALA A CB  1 
ATOM   383  N N   . TYR A 1 55  ? 6.367   112.361 17.844 1.00 69.24  ? 55  TYR A N   1 
ATOM   384  C CA  . TYR A 1 55  ? 6.018   111.038 18.340 1.00 73.73  ? 55  TYR A CA  1 
ATOM   385  C C   . TYR A 1 55  ? 4.549   111.156 18.144 1.00 68.83  ? 55  TYR A C   1 
ATOM   386  O O   . TYR A 1 55  ? 3.915   111.952 18.814 1.00 74.24  ? 55  TYR A O   1 
ATOM   387  C CB  . TYR A 1 55  ? 6.258   110.986 19.849 1.00 72.65  ? 55  TYR A CB  1 
ATOM   388  C CG  . TYR A 1 55  ? 6.045   109.654 20.522 1.00 82.85  ? 55  TYR A CG  1 
ATOM   389  C CD1 . TYR A 1 55  ? 6.475   108.472 19.933 1.00 101.06 ? 55  TYR A CD1 1 
ATOM   390  C CD2 . TYR A 1 55  ? 5.494   109.585 21.796 1.00 97.40  ? 55  TYR A CD2 1 
ATOM   391  C CE1 . TYR A 1 55  ? 6.324   107.248 20.582 1.00 101.06 ? 55  TYR A CE1 1 
ATOM   392  C CE2 . TYR A 1 55  ? 5.331   108.365 22.453 1.00 101.06 ? 55  TYR A CE2 1 
ATOM   393  C CZ  . TYR A 1 55  ? 5.750   107.199 21.842 1.00 101.06 ? 55  TYR A CZ  1 
ATOM   394  O OH  . TYR A 1 55  ? 5.587   105.986 22.488 1.00 83.18  ? 55  TYR A OH  1 
ATOM   395  N N   . LYS A 1 56  ? 3.974   110.452 17.200 1.00 54.39  ? 56  LYS A N   1 
ATOM   396  C CA  . LYS A 1 56  ? 2.574   110.730 17.049 1.00 75.30  ? 56  LYS A CA  1 
ATOM   397  C C   . LYS A 1 56  ? 1.768   109.668 17.762 1.00 78.53  ? 56  LYS A C   1 
ATOM   398  O O   . LYS A 1 56  ? 1.330   108.723 17.169 1.00 73.67  ? 56  LYS A O   1 
ATOM   399  C CB  . LYS A 1 56  ? 2.201   110.832 15.578 1.00 90.85  ? 56  LYS A CB  1 
ATOM   400  C CG  . LYS A 1 56  ? 2.008   112.268 15.063 1.00 96.19  ? 56  LYS A CG  1 
ATOM   401  C CD  . LYS A 1 56  ? 2.851   112.555 13.817 1.00 84.40  ? 56  LYS A CD  1 
ATOM   402  C CE  . LYS A 1 56  ? 1.999   113.127 12.677 1.00 99.96  ? 56  LYS A CE  1 
ATOM   403  N NZ  . LYS A 1 56  ? 2.827   113.132 11.405 1.00 86.40  ? 56  LYS A NZ  1 
ATOM   404  N N   . LYS A 1 57  ? 1.551   109.789 19.063 1.00 80.25  ? 57  LYS A N   1 
ATOM   405  C CA  . LYS A 1 57  ? 0.618   108.847 19.660 1.00 58.58  ? 57  LYS A CA  1 
ATOM   406  C C   . LYS A 1 57  ? -0.765  109.392 19.863 1.00 62.75  ? 57  LYS A C   1 
ATOM   407  O O   . LYS A 1 57  ? -0.946  110.593 19.963 1.00 70.33  ? 57  LYS A O   1 
ATOM   408  C CB  . LYS A 1 57  ? 1.129   108.320 20.974 1.00 52.93  ? 57  LYS A CB  1 
ATOM   409  C CG  . LYS A 1 57  ? 0.668   106.881 21.241 1.00 101.06 ? 57  LYS A CG  1 
ATOM   410  C CD  . LYS A 1 57  ? 0.693   106.506 22.739 1.00 101.06 ? 57  LYS A CD  1 
ATOM   411  C CE  . LYS A 1 57  ? 1.980   106.975 23.442 1.00 101.06 ? 57  LYS A CE  1 
ATOM   412  N NZ  . LYS A 1 57  ? 1.765   107.226 24.917 1.00 101.06 ? 57  LYS A NZ  1 
ATOM   413  N N   . LYS A 1 58  ? -1.735  108.491 19.973 1.00 63.50  ? 58  LYS A N   1 
ATOM   414  C CA  . LYS A 1 58  ? -3.116  108.868 20.231 1.00 59.59  ? 58  LYS A CA  1 
ATOM   415  C C   . LYS A 1 58  ? -3.268  109.174 21.722 1.00 65.04  ? 58  LYS A C   1 
ATOM   416  O O   . LYS A 1 58  ? -2.676  108.502 22.566 1.00 54.28  ? 58  LYS A O   1 
ATOM   417  C CB  . LYS A 1 58  ? -4.048  107.706 19.845 1.00 78.42  ? 58  LYS A CB  1 
ATOM   418  C CG  . LYS A 1 58  ? -5.556  108.046 19.846 1.00 73.48  ? 58  LYS A CG  1 
ATOM   419  C CD  . LYS A 1 58  ? -6.421  106.789 19.641 1.00 101.06 ? 58  LYS A CD  1 
ATOM   420  C CE  . LYS A 1 58  ? -7.926  107.085 19.791 1.00 101.06 ? 58  LYS A CE  1 
ATOM   421  N NZ  . LYS A 1 58  ? -8.708  105.903 20.275 1.00 99.35  ? 58  LYS A NZ  1 
ATOM   422  N N   . GLY A 1 59  ? -4.046  110.202 22.043 1.00 62.59  ? 59  GLY A N   1 
ATOM   423  C CA  . GLY A 1 59  ? -4.161  110.665 23.409 1.00 59.32  ? 59  GLY A CA  1 
ATOM   424  C C   . GLY A 1 59  ? -3.043  111.595 23.852 1.00 52.88  ? 59  GLY A C   1 
ATOM   425  O O   . GLY A 1 59  ? -3.164  112.288 24.849 1.00 55.75  ? 59  GLY A O   1 
ATOM   426  N N   . LEU A 1 60  ? -1.953  111.621 23.107 1.00 36.42  ? 60  LEU A N   1 
ATOM   427  C CA  . LEU A 1 60  ? -0.852  112.488 23.454 1.00 51.83  ? 60  LEU A CA  1 
ATOM   428  C C   . LEU A 1 60  ? -1.169  113.912 23.016 1.00 52.70  ? 60  LEU A C   1 
ATOM   429  O O   . LEU A 1 60  ? -1.302  114.152 21.836 1.00 50.41  ? 60  LEU A O   1 
ATOM   430  C CB  . LEU A 1 60  ? 0.374   111.994 22.723 1.00 44.03  ? 60  LEU A CB  1 
ATOM   431  C CG  . LEU A 1 60  ? 1.605   112.821 23.098 1.00 60.01  ? 60  LEU A CG  1 
ATOM   432  C CD1 . LEU A 1 60  ? 1.937   112.835 24.581 1.00 42.99  ? 60  LEU A CD1 1 
ATOM   433  C CD2 . LEU A 1 60  ? 2.821   112.344 22.348 1.00 57.81  ? 60  LEU A CD2 1 
ATOM   434  N N   . ILE A 1 61  ? -1.342  114.836 23.951 1.00 53.01  ? 61  ILE A N   1 
ATOM   435  C CA  . ILE A 1 61  ? -1.737  116.188 23.591 1.00 42.51  ? 61  ILE A CA  1 
ATOM   436  C C   . ILE A 1 61  ? -0.507  117.012 23.206 1.00 36.63  ? 61  ILE A C   1 
ATOM   437  O O   . ILE A 1 61  ? 0.648   116.573 23.435 1.00 39.72  ? 61  ILE A O   1 
ATOM   438  C CB  . ILE A 1 61  ? -2.594  116.782 24.732 1.00 50.38  ? 61  ILE A CB  1 
ATOM   439  C CG1 . ILE A 1 61  ? -1.747  117.099 25.984 1.00 37.64  ? 61  ILE A CG1 1 
ATOM   440  C CG2 . ILE A 1 61  ? -3.713  115.766 25.104 1.00 39.49  ? 61  ILE A CG2 1 
ATOM   441  C CD1 . ILE A 1 61  ? -2.530  117.596 27.134 1.00 35.13  ? 61  ILE A CD1 1 
ATOM   442  N N   . PRO A 1 62  ? -0.748  118.150 22.568 1.00 44.49  ? 62  PRO A N   1 
ATOM   443  C CA  . PRO A 1 62  ? 0.347   119.004 22.039 1.00 46.00  ? 62  PRO A CA  1 
ATOM   444  C C   . PRO A 1 62  ? 1.375   119.254 23.158 1.00 41.56  ? 62  PRO A C   1 
ATOM   445  O O   . PRO A 1 62  ? 1.030   119.421 24.333 1.00 43.53  ? 62  PRO A O   1 
ATOM   446  C CB  . PRO A 1 62  ? -0.388  120.287 21.564 1.00 44.07  ? 62  PRO A CB  1 
ATOM   447  C CG  . PRO A 1 62  ? -1.828  119.764 21.211 1.00 44.41  ? 62  PRO A CG  1 
ATOM   448  C CD  . PRO A 1 62  ? -2.095  118.688 22.285 1.00 35.61  ? 62  PRO A CD  1 
ATOM   449  N N   . ALA A 1 63  ? 2.637   119.083 22.823 1.00 42.29  ? 63  ALA A N   1 
ATOM   450  C CA  . ALA A 1 63  ? 3.739   119.382 23.699 1.00 44.20  ? 63  ALA A CA  1 
ATOM   451  C C   . ALA A 1 63  ? 3.565   120.655 24.562 1.00 57.11  ? 63  ALA A C   1 
ATOM   452  O O   . ALA A 1 63  ? 4.000   120.675 25.714 1.00 58.71  ? 63  ALA A O   1 
ATOM   453  C CB  . ALA A 1 63  ? 5.040   119.378 22.905 1.00 33.05  ? 63  ALA A CB  1 
ATOM   454  N N   . TYR A 1 64  ? 2.930   121.701 24.043 1.00 41.03  ? 64  TYR A N   1 
ATOM   455  C CA  . TYR A 1 64  ? 3.087   123.005 24.681 1.00 47.11  ? 64  TYR A CA  1 
ATOM   456  C C   . TYR A 1 64  ? 2.287   122.886 25.948 1.00 42.27  ? 64  TYR A C   1 
ATOM   457  O O   . TYR A 1 64  ? 2.619   123.441 26.989 1.00 40.60  ? 64  TYR A O   1 
ATOM   458  C CB  . TYR A 1 64  ? 2.571   124.212 23.845 1.00 41.32  ? 64  TYR A CB  1 
ATOM   459  C CG  . TYR A 1 64  ? 1.069   124.348 23.530 1.00 36.80  ? 64  TYR A CG  1 
ATOM   460  C CD1 . TYR A 1 64  ? 0.567   123.914 22.327 1.00 44.80  ? 64  TYR A CD1 1 
ATOM   461  C CD2 . TYR A 1 64  ? 0.191   125.016 24.367 1.00 40.79  ? 64  TYR A CD2 1 
ATOM   462  C CE1 . TYR A 1 64  ? -0.768  124.022 22.019 1.00 34.40  ? 64  TYR A CE1 1 
ATOM   463  C CE2 . TYR A 1 64  ? -1.180  125.134 24.053 1.00 34.37  ? 64  TYR A CE2 1 
ATOM   464  C CZ  . TYR A 1 64  ? -1.634  124.632 22.887 1.00 35.47  ? 64  TYR A CZ  1 
ATOM   465  O OH  . TYR A 1 64  ? -2.961  124.778 22.519 1.00 37.39  ? 64  TYR A OH  1 
ATOM   466  N N   . HIS A 1 65  ? 1.202   122.141 25.862 1.00 40.62  ? 65  HIS A N   1 
ATOM   467  C CA  . HIS A 1 65  ? 0.436   121.924 27.086 1.00 47.32  ? 65  HIS A CA  1 
ATOM   468  C C   . HIS A 1 65  ? 1.233   121.131 28.141 1.00 54.51  ? 65  HIS A C   1 
ATOM   469  O O   . HIS A 1 65  ? 1.153   121.377 29.371 1.00 42.99  ? 65  HIS A O   1 
ATOM   470  C CB  . HIS A 1 65  ? -0.867  121.194 26.833 1.00 36.30  ? 65  HIS A CB  1 
ATOM   471  C CG  . HIS A 1 65  ? -1.945  121.997 26.179 1.00 55.07  ? 65  HIS A CG  1 
ATOM   472  N ND1 . HIS A 1 65  ? -2.470  123.135 26.746 1.00 40.12  ? 65  HIS A ND1 1 
ATOM   473  C CD2 . HIS A 1 65  ? -2.674  121.757 25.056 1.00 38.98  ? 65  HIS A CD2 1 
ATOM   474  C CE1 . HIS A 1 65  ? -3.478  123.556 26.006 1.00 50.68  ? 65  HIS A CE1 1 
ATOM   475  N NE2 . HIS A 1 65  ? -3.592  122.764 24.952 1.00 44.61  ? 65  HIS A NE2 1 
ATOM   476  N N   . ARG A 1 66  ? 1.947   120.124 27.651 1.00 41.55  ? 66  ARG A N   1 
ATOM   477  C CA  . ARG A 1 66  ? 2.619   119.200 28.567 1.00 51.73  ? 66  ARG A CA  1 
ATOM   478  C C   . ARG A 1 66  ? 3.842   119.924 29.148 1.00 46.97  ? 66  ARG A C   1 
ATOM   479  O O   . ARG A 1 66  ? 4.188   119.775 30.317 1.00 46.42  ? 66  ARG A O   1 
ATOM   480  C CB  . ARG A 1 66  ? 2.966   117.839 27.908 1.00 21.97  ? 66  ARG A CB  1 
ATOM   481  C CG  . ARG A 1 66  ? 1.654   116.891 27.580 1.00 35.52  ? 66  ARG A CG  1 
ATOM   482  C CD  . ARG A 1 66  ? 1.809   115.992 26.253 1.00 48.69  ? 66  ARG A CD  1 
ATOM   483  N NE  . ARG A 1 66  ? 3.197   115.663 26.182 1.00 78.57  ? 66  ARG A NE  1 
ATOM   484  C CZ  . ARG A 1 66  ? 3.895   115.770 25.106 1.00 43.24  ? 66  ARG A CZ  1 
ATOM   485  N NH1 . ARG A 1 66  ? 3.296   116.036 23.965 1.00 59.88  ? 66  ARG A NH1 1 
ATOM   486  N NH2 . ARG A 1 66  ? 5.181   115.486 25.179 1.00 45.43  ? 66  ARG A NH2 1 
ATOM   487  N N   . VAL A 1 67  ? 4.479   120.754 28.343 1.00 42.52  ? 67  VAL A N   1 
ATOM   488  C CA  . VAL A 1 67  ? 5.521   121.613 28.855 1.00 32.94  ? 67  VAL A CA  1 
ATOM   489  C C   . VAL A 1 67  ? 4.960   122.558 29.928 1.00 39.47  ? 67  VAL A C   1 
ATOM   490  O O   . VAL A 1 67  ? 5.488   122.564 31.039 1.00 38.33  ? 67  VAL A O   1 
ATOM   491  C CB  . VAL A 1 67  ? 6.266   122.392 27.749 1.00 53.81  ? 67  VAL A CB  1 
ATOM   492  C CG1 . VAL A 1 67  ? 7.133   123.493 28.380 1.00 40.30  ? 67  VAL A CG1 1 
ATOM   493  C CG2 . VAL A 1 67  ? 7.161   121.459 26.925 1.00 33.72  ? 67  VAL A CG2 1 
ATOM   494  N N   . ILE A 1 68  ? 3.847   123.254 29.685 1.00 35.27  ? 68  ILE A N   1 
ATOM   495  C CA  . ILE A 1 68  ? 3.315   124.137 30.739 1.00 48.80  ? 68  ILE A CA  1 
ATOM   496  C C   . ILE A 1 68  ? 3.177   123.384 32.053 1.00 47.30  ? 68  ILE A C   1 
ATOM   497  O O   . ILE A 1 68  ? 3.730   123.798 33.078 1.00 41.18  ? 68  ILE A O   1 
ATOM   498  C CB  . ILE A 1 68  ? 1.931   124.808 30.415 1.00 49.56  ? 68  ILE A CB  1 
ATOM   499  C CG1 . ILE A 1 68  ? 1.960   125.495 29.055 1.00 66.37  ? 68  ILE A CG1 1 
ATOM   500  C CG2 . ILE A 1 68  ? 1.537   125.778 31.555 1.00 35.07  ? 68  ILE A CG2 1 
ATOM   501  C CD1 . ILE A 1 68  ? 3.017   126.546 28.972 1.00 59.20  ? 68  ILE A CD1 1 
ATOM   502  N N   . MET A 1 69  ? 2.400   122.309 32.020 1.00 47.74  ? 69  MET A N   1 
ATOM   503  C CA  . MET A 1 69  ? 1.992   121.632 33.231 1.00 44.33  ? 69  MET A CA  1 
ATOM   504  C C   . MET A 1 69  ? 3.207   121.133 33.966 1.00 39.76  ? 69  MET A C   1 
ATOM   505  O O   . MET A 1 69  ? 3.355   121.344 35.165 1.00 33.69  ? 69  MET A O   1 
ATOM   506  C CB  . MET A 1 69  ? 0.996   120.604 32.896 1.00 32.42  ? 69  MET A CB  1 
ATOM   507  C CG  . MET A 1 69  ? -0.392  121.116 33.383 1.00 45.65  ? 69  MET A CG  1 
ATOM   508  S SD  . MET A 1 69  ? -1.242  119.503 33.115 1.00 57.86  ? 69  MET A SD  1 
ATOM   509  C CE  . MET A 1 69  ? -0.566  119.201 31.080 1.00 34.71  ? 69  MET A CE  1 
ATOM   510  N N   . ALA A 1 70  ? 4.210   120.717 33.226 1.00 34.87  ? 70  ALA A N   1 
ATOM   511  C CA  . ALA A 1 70  ? 5.426   120.427 33.956 1.00 42.75  ? 70  ALA A CA  1 
ATOM   512  C C   . ALA A 1 70  ? 6.064   121.690 34.555 1.00 47.33  ? 70  ALA A C   1 
ATOM   513  O O   . ALA A 1 70  ? 6.707   121.635 35.615 1.00 41.39  ? 70  ALA A O   1 
ATOM   514  C CB  . ALA A 1 70  ? 6.413   119.663 33.068 1.00 33.66  ? 70  ALA A CB  1 
ATOM   515  N N   . GLU A 1 71  ? 5.939   122.827 33.876 1.00 37.69  ? 71  GLU A N   1 
ATOM   516  C CA  . GLU A 1 71  ? 6.597   124.010 34.455 1.00 41.99  ? 71  GLU A CA  1 
ATOM   517  C C   . GLU A 1 71  ? 5.757   124.428 35.679 1.00 40.98  ? 71  GLU A C   1 
ATOM   518  O O   . GLU A 1 71  ? 6.262   124.717 36.747 1.00 36.37  ? 71  GLU A O   1 
ATOM   519  C CB  . GLU A 1 71  ? 7.126   125.094 33.402 1.00 50.61  ? 71  GLU A CB  1 
ATOM   520  C CG  . GLU A 1 71  ? 8.684   125.143 33.259 1.00 59.96  ? 71  GLU A CG  1 
ATOM   521  C CD  . GLU A 1 71  ? 9.372   125.329 31.883 1.00 93.87  ? 71  GLU A CD  1 
ATOM   522  O OE1 . GLU A 1 71  ? 8.707   125.603 30.842 1.00 63.37  ? 71  GLU A OE1 1 
ATOM   523  O OE2 . GLU A 1 71  ? 10.648  125.223 31.862 1.00 93.59  ? 71  GLU A OE2 1 
ATOM   524  N N   . LEU A 1 72  ? 4.448   124.253 35.618 1.00 34.32  ? 72  LEU A N   1 
ATOM   525  C CA  . LEU A 1 72  ? 3.694   124.608 36.794 1.00 41.78  ? 72  LEU A CA  1 
ATOM   526  C C   . LEU A 1 72  ? 4.062   123.704 37.934 1.00 43.62  ? 72  LEU A C   1 
ATOM   527  O O   . LEU A 1 72  ? 4.081   124.137 39.084 1.00 44.77  ? 72  LEU A O   1 
ATOM   528  C CB  . LEU A 1 72  ? 2.189   124.613 36.560 1.00 32.95  ? 72  LEU A CB  1 
ATOM   529  C CG  . LEU A 1 72  ? 1.748   125.784 35.714 1.00 49.67  ? 72  LEU A CG  1 
ATOM   530  C CD1 . LEU A 1 72  ? 0.356   125.547 35.042 1.00 34.24  ? 72  LEU A CD1 1 
ATOM   531  C CD2 . LEU A 1 72  ? 1.776   127.073 36.534 1.00 44.45  ? 72  LEU A CD2 1 
ATOM   532  N N   . ALA A 1 73  ? 4.356   122.452 37.617 1.00 43.72  ? 73  ALA A N   1 
ATOM   533  C CA  . ALA A 1 73  ? 4.541   121.453 38.659 1.00 44.78  ? 73  ALA A CA  1 
ATOM   534  C C   . ALA A 1 73  ? 5.798   121.685 39.430 1.00 43.30  ? 73  ALA A C   1 
ATOM   535  O O   . ALA A 1 73  ? 5.855   121.342 40.625 1.00 42.66  ? 73  ALA A O   1 
ATOM   536  C CB  . ALA A 1 73  ? 4.512   120.004 38.109 1.00 31.48  ? 73  ALA A CB  1 
ATOM   537  N N   . THR A 1 74  ? 6.805   122.228 38.736 1.00 46.50  ? 74  THR A N   1 
ATOM   538  C CA  . THR A 1 74  ? 8.087   122.527 39.361 1.00 46.80  ? 74  THR A CA  1 
ATOM   539  C C   . THR A 1 74  ? 8.435   123.992 39.687 1.00 48.79  ? 74  THR A C   1 
ATOM   540  O O   . THR A 1 74  ? 9.593   124.281 39.949 1.00 40.43  ? 74  THR A O   1 
ATOM   541  C CB  . THR A 1 74  ? 9.191   121.943 38.524 1.00 48.15  ? 74  THR A CB  1 
ATOM   542  O OG1 . THR A 1 74  ? 9.081   122.476 37.194 1.00 36.88  ? 74  THR A OG1 1 
ATOM   543  C CG2 . THR A 1 74  ? 8.964   120.398 38.365 1.00 53.50  ? 74  THR A CG2 1 
ATOM   544  N N   . LYS A 1 75  ? 7.485   124.920 39.656 1.00 49.35  ? 75  LYS A N   1 
ATOM   545  C CA  . LYS A 1 75  ? 7.852   126.343 39.842 1.00 63.20  ? 75  LYS A CA  1 
ATOM   546  C C   . LYS A 1 75  ? 8.556   126.727 41.150 1.00 52.73  ? 75  LYS A C   1 
ATOM   547  O O   . LYS A 1 75  ? 9.378   127.633 41.177 1.00 63.33  ? 75  LYS A O   1 
ATOM   548  C CB  . LYS A 1 75  ? 6.696   127.316 39.547 1.00 49.88  ? 75  LYS A CB  1 
ATOM   549  C CG  . LYS A 1 75  ? 5.458   127.098 40.411 1.00 59.96  ? 75  LYS A CG  1 
ATOM   550  C CD  . LYS A 1 75  ? 4.533   128.332 40.448 1.00 75.75  ? 75  LYS A CD  1 
ATOM   551  C CE  . LYS A 1 75  ? 4.897   129.329 41.549 1.00 71.34  ? 75  LYS A CE  1 
ATOM   552  N NZ  . LYS A 1 75  ? 3.786   129.625 42.498 1.00 89.07  ? 75  LYS A NZ  1 
ATOM   553  N N   . ASN A 1 76  ? 8.294   125.960 42.182 1.00 50.31  ? 76  ASN A N   1 
ATOM   554  C CA  . ASN A 1 76  ? 8.765   126.251 43.519 1.00 59.65  ? 76  ASN A CA  1 
ATOM   555  C C   . ASN A 1 76  ? 9.940   125.353 43.885 1.00 64.02  ? 76  ASN A C   1 
ATOM   556  O O   . ASN A 1 76  ? 10.493  125.471 44.969 1.00 71.50  ? 76  ASN A O   1 
ATOM   557  C CB  . ASN A 1 76  ? 7.588   126.138 44.497 1.00 67.16  ? 76  ASN A CB  1 
ATOM   558  C CG  . ASN A 1 76  ? 6.653   127.316 44.373 1.00 77.60  ? 76  ASN A CG  1 
ATOM   559  O OD1 . ASN A 1 76  ? 7.060   128.409 43.964 1.00 68.47  ? 76  ASN A OD1 1 
ATOM   560  N ND2 . ASN A 1 76  ? 5.393   127.097 44.684 1.00 67.89  ? 76  ASN A ND2 1 
ATOM   561  N N   . SER A 1 77  ? 10.315  124.438 42.987 1.00 54.27  ? 77  SER A N   1 
ATOM   562  C CA  . SER A 1 77  ? 11.360  123.488 43.345 1.00 49.04  ? 77  SER A CA  1 
ATOM   563  C C   . SER A 1 77  ? 12.710  124.176 43.223 1.00 46.86  ? 77  SER A C   1 
ATOM   564  O O   . SER A 1 77  ? 13.003  124.825 42.225 1.00 47.01  ? 77  SER A O   1 
ATOM   565  C CB  . SER A 1 77  ? 11.334  122.258 42.451 1.00 45.98  ? 77  SER A CB  1 
ATOM   566  O OG  . SER A 1 77  ? 12.614  121.610 42.411 1.00 43.27  ? 77  SER A OG  1 
ATOM   567  N N   . LYS A 1 78  ? 13.540  124.011 44.233 1.00 46.23  ? 78  LYS A N   1 
ATOM   568  C CA  . LYS A 1 78  ? 14.869  124.567 44.155 1.00 76.33  ? 78  LYS A CA  1 
ATOM   569  C C   . LYS A 1 78  ? 15.716  123.911 43.066 1.00 67.78  ? 78  LYS A C   1 
ATOM   570  O O   . LYS A 1 78  ? 16.637  124.546 42.570 1.00 71.22  ? 78  LYS A O   1 
ATOM   571  C CB  . LYS A 1 78  ? 15.540  124.471 45.519 1.00 73.70  ? 78  LYS A CB  1 
ATOM   572  C CG  . LYS A 1 78  ? 14.576  124.014 46.611 1.00 99.51  ? 78  LYS A CG  1 
ATOM   573  C CD  . LYS A 1 78  ? 13.994  122.645 46.268 1.00 90.59  ? 78  LYS A CD  1 
ATOM   574  C CE  . LYS A 1 78  ? 12.541  122.505 46.711 1.00 101.06 ? 78  LYS A CE  1 
ATOM   575  N NZ  . LYS A 1 78  ? 12.075  121.083 46.732 1.00 101.06 ? 78  LYS A NZ  1 
ATOM   576  N N   . TRP A 1 79  ? 15.431  122.665 42.688 1.00 47.84  ? 79  TRP A N   1 
ATOM   577  C CA  . TRP A 1 79  ? 16.451  121.856 41.978 1.00 55.42  ? 79  TRP A CA  1 
ATOM   578  C C   . TRP A 1 79  ? 16.033  121.152 40.672 1.00 43.69  ? 79  TRP A C   1 
ATOM   579  O O   . TRP A 1 79  ? 16.868  120.694 39.929 1.00 42.11  ? 79  TRP A O   1 
ATOM   580  C CB  . TRP A 1 79  ? 17.146  120.843 42.929 1.00 50.42  ? 79  TRP A CB  1 
ATOM   581  C CG  . TRP A 1 79  ? 16.263  119.624 43.337 1.00 47.42  ? 79  TRP A CG  1 
ATOM   582  C CD1 . TRP A 1 79  ? 15.228  119.602 44.240 1.00 39.14  ? 79  TRP A CD1 1 
ATOM   583  C CD2 . TRP A 1 79  ? 16.343  118.316 42.824 1.00 36.83  ? 79  TRP A CD2 1 
ATOM   584  N NE1 . TRP A 1 79  ? 14.657  118.362 44.311 1.00 50.72  ? 79  TRP A NE1 1 
ATOM   585  C CE2 . TRP A 1 79  ? 15.350  117.538 43.472 1.00 53.79  ? 79  TRP A CE2 1 
ATOM   586  C CE3 . TRP A 1 79  ? 17.196  117.684 41.915 1.00 35.19  ? 79  TRP A CE3 1 
ATOM   587  C CZ2 . TRP A 1 79  ? 15.170  116.178 43.216 1.00 46.08  ? 79  TRP A CZ2 1 
ATOM   588  C CZ3 . TRP A 1 79  ? 16.990  116.344 41.628 1.00 41.49  ? 79  TRP A CZ3 1 
ATOM   589  C CH2 . TRP A 1 79  ? 15.985  115.604 42.279 1.00 44.32  ? 79  TRP A CH2 1 
ATOM   590  N N   . VAL A 1 80  ? 14.747  120.966 40.446 1.00 38.31  ? 80  VAL A N   1 
ATOM   591  C CA  . VAL A 1 80  ? 14.260  120.326 39.229 1.00 44.58  ? 80  VAL A CA  1 
ATOM   592  C C   . VAL A 1 80  ? 13.721  121.338 38.205 1.00 44.81  ? 80  VAL A C   1 
ATOM   593  O O   . VAL A 1 80  ? 12.921  122.166 38.580 1.00 44.35  ? 80  VAL A O   1 
ATOM   594  C CB  . VAL A 1 80  ? 13.048  119.423 39.588 1.00 41.91  ? 80  VAL A CB  1 
ATOM   595  C CG1 . VAL A 1 80  ? 12.492  118.798 38.340 1.00 43.48  ? 80  VAL A CG1 1 
ATOM   596  C CG2 . VAL A 1 80  ? 13.434  118.361 40.695 1.00 39.85  ? 80  VAL A CG2 1 
ATOM   597  N N   . GLU A 1 81  ? 14.023  121.173 36.913 1.00 47.66  ? 81  GLU A N   1 
ATOM   598  C CA  . GLU A 1 81  ? 13.596  122.101 35.849 1.00 48.10  ? 81  GLU A CA  1 
ATOM   599  C C   . GLU A 1 81  ? 13.146  121.336 34.604 1.00 54.28  ? 81  GLU A C   1 
ATOM   600  O O   . GLU A 1 81  ? 13.463  120.153 34.452 1.00 43.32  ? 81  GLU A O   1 
ATOM   601  C CB  . GLU A 1 81  ? 14.806  122.942 35.422 1.00 51.44  ? 81  GLU A CB  1 
ATOM   602  C CG  . GLU A 1 81  ? 15.892  122.912 36.473 1.00 92.00  ? 81  GLU A CG  1 
ATOM   603  C CD  . GLU A 1 81  ? 17.193  123.512 35.997 1.00 101.06 ? 81  GLU A CD  1 
ATOM   604  O OE1 . GLU A 1 81  ? 17.402  123.558 34.762 1.00 101.06 ? 81  GLU A OE1 1 
ATOM   605  O OE2 . GLU A 1 81  ? 17.999  123.916 36.870 1.00 101.06 ? 81  GLU A OE2 1 
ATOM   606  N N   . VAL A 1 82  ? 12.485  122.057 33.693 1.00 40.78  ? 82  VAL A N   1 
ATOM   607  C CA  . VAL A 1 82  ? 12.060  121.601 32.396 1.00 36.70  ? 82  VAL A CA  1 
ATOM   608  C C   . VAL A 1 82  ? 12.832  122.240 31.274 1.00 42.25  ? 82  VAL A C   1 
ATOM   609  O O   . VAL A 1 82  ? 12.906  123.445 31.177 1.00 55.56  ? 82  VAL A O   1 
ATOM   610  C CB  . VAL A 1 82  ? 10.622  121.995 32.185 1.00 37.57  ? 82  VAL A CB  1 
ATOM   611  C CG1 . VAL A 1 82  ? 10.077  121.417 30.934 1.00 34.89  ? 82  VAL A CG1 1 
ATOM   612  C CG2 . VAL A 1 82  ? 9.849   121.738 33.414 1.00 51.03  ? 82  VAL A CG2 1 
ATOM   613  N N   . ASP A 1 83  ? 13.293  121.365 30.396 1.00 53.87  ? 83  ASP A N   1 
ATOM   614  C CA  . ASP A 1 83  ? 14.035  121.676 29.194 1.00 52.52  ? 83  ASP A CA  1 
ATOM   615  C C   . ASP A 1 83  ? 13.250  121.175 28.011 1.00 57.38  ? 83  ASP A C   1 
ATOM   616  O O   . ASP A 1 83  ? 12.872  119.987 27.945 1.00 55.96  ? 83  ASP A O   1 
ATOM   617  C CB  . ASP A 1 83  ? 15.355  120.916 29.192 1.00 54.91  ? 83  ASP A CB  1 
ATOM   618  C CG  . ASP A 1 83  ? 16.243  121.337 28.063 1.00 49.80  ? 83  ASP A CG  1 
ATOM   619  O OD1 . ASP A 1 83  ? 17.316  121.866 28.385 1.00 49.61  ? 83  ASP A OD1 1 
ATOM   620  O OD2 . ASP A 1 83  ? 15.919  121.240 26.849 1.00 62.93  ? 83  ASP A OD2 1 
ATOM   621  N N   . THR A 1 84  ? 13.102  122.068 27.043 1.00 40.56  ? 84  THR A N   1 
ATOM   622  C CA  . THR A 1 84  ? 12.084  121.956 26.021 1.00 40.97  ? 84  THR A CA  1 
ATOM   623  C C   . THR A 1 84  ? 12.817  121.513 24.780 1.00 43.11  ? 84  THR A C   1 
ATOM   624  O O   . THR A 1 84  ? 12.194  121.248 23.731 1.00 40.25  ? 84  THR A O   1 
ATOM   625  C CB  . THR A 1 84  ? 11.493  123.341 25.793 1.00 59.65  ? 84  THR A CB  1 
ATOM   626  O OG1 . THR A 1 84  ? 12.575  124.301 25.656 1.00 49.74  ? 84  THR A OG1 1 
ATOM   627  C CG2 . THR A 1 84  ? 10.802  123.755 27.061 1.00 38.09  ? 84  THR A CG2 1 
ATOM   628  N N   . TRP A 1 85  ? 14.136  121.358 24.921 1.00 34.54  ? 85  TRP A N   1 
ATOM   629  C CA  . TRP A 1 85  ? 14.902  121.024 23.739 1.00 45.78  ? 85  TRP A CA  1 
ATOM   630  C C   . TRP A 1 85  ? 14.210  119.896 22.957 1.00 59.06  ? 85  TRP A C   1 
ATOM   631  O O   . TRP A 1 85  ? 13.737  120.106 21.851 1.00 61.79  ? 85  TRP A O   1 
ATOM   632  C CB  . TRP A 1 85  ? 16.340  120.672 24.089 1.00 38.47  ? 85  TRP A CB  1 
ATOM   633  C CG  . TRP A 1 85  ? 17.170  120.222 22.925 1.00 70.80  ? 85  TRP A CG  1 
ATOM   634  C CD1 . TRP A 1 85  ? 17.834  121.022 22.025 1.00 73.83  ? 85  TRP A CD1 1 
ATOM   635  C CD2 . TRP A 1 85  ? 17.445  118.874 22.530 1.00 62.47  ? 85  TRP A CD2 1 
ATOM   636  N NE1 . TRP A 1 85  ? 18.496  120.250 21.099 1.00 58.65  ? 85  TRP A NE1 1 
ATOM   637  C CE2 . TRP A 1 85  ? 18.275  118.930 21.382 1.00 84.30  ? 85  TRP A CE2 1 
ATOM   638  C CE3 . TRP A 1 85  ? 17.064  117.625 23.011 1.00 62.03  ? 85  TRP A CE3 1 
ATOM   639  C CZ2 . TRP A 1 85  ? 18.735  117.784 20.727 1.00 81.57  ? 85  TRP A CZ2 1 
ATOM   640  C CZ3 . TRP A 1 85  ? 17.530  116.487 22.367 1.00 54.47  ? 85  TRP A CZ3 1 
ATOM   641  C CH2 . TRP A 1 85  ? 18.351  116.574 21.235 1.00 86.69  ? 85  TRP A CH2 1 
ATOM   642  N N   . GLU A 1 86  ? 14.114  118.704 23.536 1.00 62.57  ? 86  GLU A N   1 
ATOM   643  C CA  . GLU A 1 86  ? 13.613  117.550 22.793 1.00 51.98  ? 86  GLU A CA  1 
ATOM   644  C C   . GLU A 1 86  ? 12.206  117.769 22.243 1.00 50.65  ? 86  GLU A C   1 
ATOM   645  O O   . GLU A 1 86  ? 11.890  117.328 21.137 1.00 49.76  ? 86  GLU A O   1 
ATOM   646  C CB  . GLU A 1 86  ? 13.704  116.282 23.645 1.00 48.38  ? 86  GLU A CB  1 
ATOM   647  C CG  . GLU A 1 86  ? 12.564  115.307 23.446 1.00 54.14  ? 86  GLU A CG  1 
ATOM   648  C CD  . GLU A 1 86  ? 12.788  113.994 24.195 1.00 87.84  ? 86  GLU A CD  1 
ATOM   649  O OE1 . GLU A 1 86  ? 12.679  112.913 23.557 1.00 59.80  ? 86  GLU A OE1 1 
ATOM   650  O OE2 . GLU A 1 86  ? 13.057  114.036 25.424 1.00 52.04  ? 86  GLU A OE2 1 
ATOM   651  N N   . SER A 1 87  ? 11.374  118.504 22.971 1.00 41.26  ? 87  SER A N   1 
ATOM   652  C CA  . SER A 1 87  ? 10.020  118.823 22.487 1.00 54.07  ? 87  SER A CA  1 
ATOM   653  C C   . SER A 1 87  ? 10.040  119.694 21.234 1.00 64.39  ? 87  SER A C   1 
ATOM   654  O O   . SER A 1 87  ? 9.070   119.728 20.466 1.00 52.12  ? 87  SER A O   1 
ATOM   655  C CB  . SER A 1 87  ? 9.201   119.553 23.569 1.00 54.80  ? 87  SER A CB  1 
ATOM   656  O OG  . SER A 1 87  ? 9.849   120.741 24.019 1.00 60.33  ? 87  SER A OG  1 
ATOM   657  N N   . LEU A 1 88  ? 11.132  120.430 21.056 1.00 53.45  ? 88  LEU A N   1 
ATOM   658  C CA  . LEU A 1 88  ? 11.227  121.355 19.938 1.00 73.67  ? 88  LEU A CA  1 
ATOM   659  C C   . LEU A 1 88  ? 11.670  120.731 18.605 1.00 76.74  ? 88  LEU A C   1 
ATOM   660  O O   . LEU A 1 88  ? 11.289  121.218 17.536 1.00 80.37  ? 88  LEU A O   1 
ATOM   661  C CB  . LEU A 1 88  ? 12.065  122.591 20.307 1.00 60.36  ? 88  LEU A CB  1 
ATOM   662  C CG  . LEU A 1 88  ? 11.411  123.431 21.417 1.00 67.95  ? 88  LEU A CG  1 
ATOM   663  C CD1 . LEU A 1 88  ? 12.314  124.519 22.016 1.00 72.96  ? 88  LEU A CD1 1 
ATOM   664  C CD2 . LEU A 1 88  ? 10.082  123.991 21.017 1.00 58.59  ? 88  LEU A CD2 1 
ATOM   665  N N   . GLN A 1 89  ? 12.460  119.661 18.653 1.00 70.03  ? 89  GLN A N   1 
ATOM   666  C CA  . GLN A 1 89  ? 13.044  119.120 17.423 1.00 67.23  ? 89  GLN A CA  1 
ATOM   667  C C   . GLN A 1 89  ? 11.937  118.631 16.481 1.00 64.85  ? 89  GLN A C   1 
ATOM   668  O O   . GLN A 1 89  ? 10.900  118.162 16.930 1.00 63.76  ? 89  GLN A O   1 
ATOM   669  C CB  . GLN A 1 89  ? 13.986  117.947 17.703 1.00 59.03  ? 89  GLN A CB  1 
ATOM   670  C CG  . GLN A 1 89  ? 15.201  118.172 18.597 1.00 45.34  ? 89  GLN A CG  1 
ATOM   671  C CD  . GLN A 1 89  ? 15.982  119.445 18.309 1.00 87.27  ? 89  GLN A CD  1 
ATOM   672  O OE1 . GLN A 1 89  ? 15.895  120.420 19.063 1.00 83.17  ? 89  GLN A OE1 1 
ATOM   673  N NE2 . GLN A 1 89  ? 16.798  119.415 17.261 1.00 82.46  ? 89  GLN A NE2 1 
ATOM   674  N N   . LYS A 1 90  ? 12.201  118.710 15.178 1.00 62.66  ? 90  LYS A N   1 
ATOM   675  C CA  . LYS A 1 90  ? 11.227  118.520 14.106 1.00 79.55  ? 90  LYS A CA  1 
ATOM   676  C C   . LYS A 1 90  ? 11.045  117.022 13.818 1.00 70.76  ? 90  LYS A C   1 
ATOM   677  O O   . LYS A 1 90  ? 9.950   116.569 13.441 1.00 68.52  ? 90  LYS A O   1 
ATOM   678  C CB  . LYS A 1 90  ? 11.744  119.243 12.845 1.00 83.96  ? 90  LYS A CB  1 
ATOM   679  C CG  . LYS A 1 90  ? 11.221  120.677 12.657 1.00 101.06 ? 90  LYS A CG  1 
ATOM   680  C CD  . LYS A 1 90  ? 11.890  121.388 11.458 1.00 101.06 ? 90  LYS A CD  1 
ATOM   681  C CE  . LYS A 1 90  ? 13.078  122.266 11.882 1.00 101.06 ? 90  LYS A CE  1 
ATOM   682  N NZ  . LYS A 1 90  ? 13.348  123.336 10.875 1.00 101.06 ? 90  LYS A NZ  1 
ATOM   683  N N   . GLU A 1 91  ? 12.130  116.266 14.006 1.00 53.60  ? 91  GLU A N   1 
ATOM   684  C CA  . GLU A 1 91  ? 12.073  114.800 14.056 1.00 73.61  ? 91  GLU A CA  1 
ATOM   685  C C   . GLU A 1 91  ? 12.239  114.165 15.468 1.00 70.19  ? 91  GLU A C   1 
ATOM   686  O O   . GLU A 1 91  ? 13.031  114.617 16.298 1.00 67.92  ? 91  GLU A O   1 
ATOM   687  C CB  . GLU A 1 91  ? 13.026  114.170 13.010 1.00 75.40  ? 91  GLU A CB  1 
ATOM   688  C CG  . GLU A 1 91  ? 13.215  114.973 11.712 1.00 101.06 ? 91  GLU A CG  1 
ATOM   689  C CD  . GLU A 1 91  ? 14.382  114.503 10.823 1.00 101.06 ? 91  GLU A CD  1 
ATOM   690  O OE1 . GLU A 1 91  ? 15.294  113.780 11.310 1.00 101.06 ? 91  GLU A OE1 1 
ATOM   691  O OE2 . GLU A 1 91  ? 14.389  114.869 9.617  1.00 101.06 ? 91  GLU A OE2 1 
ATOM   692  N N   . TRP A 1 92  ? 11.485  113.105 15.745 1.00 66.83  ? 92  TRP A N   1 
ATOM   693  C CA  . TRP A 1 92  ? 11.564  112.449 17.050 1.00 56.47  ? 92  TRP A CA  1 
ATOM   694  C C   . TRP A 1 92  ? 12.954  111.918 17.360 1.00 62.01  ? 92  TRP A C   1 
ATOM   695  O O   . TRP A 1 92  ? 13.634  111.395 16.478 1.00 65.85  ? 92  TRP A O   1 
ATOM   696  C CB  . TRP A 1 92  ? 10.563  111.315 17.109 1.00 65.78  ? 92  TRP A CB  1 
ATOM   697  C CG  . TRP A 1 92  ? 10.631  110.491 18.331 1.00 80.72  ? 92  TRP A CG  1 
ATOM   698  C CD1 . TRP A 1 92  ? 9.846   110.613 19.438 1.00 85.78  ? 92  TRP A CD1 1 
ATOM   699  C CD2 . TRP A 1 92  ? 11.474  109.357 18.560 1.00 88.32  ? 92  TRP A CD2 1 
ATOM   700  N NE1 . TRP A 1 92  ? 10.159  109.636 20.351 1.00 65.78  ? 92  TRP A NE1 1 
ATOM   701  C CE2 . TRP A 1 92  ? 11.173  108.865 19.849 1.00 69.67  ? 92  TRP A CE2 1 
ATOM   702  C CE3 . TRP A 1 92  ? 12.465  108.711 17.811 1.00 89.81  ? 92  TRP A CE3 1 
ATOM   703  C CZ2 . TRP A 1 92  ? 11.814  107.759 20.399 1.00 79.09  ? 92  TRP A CZ2 1 
ATOM   704  C CZ3 . TRP A 1 92  ? 13.105  107.613 18.361 1.00 101.06 ? 92  TRP A CZ3 1 
ATOM   705  C CH2 . TRP A 1 92  ? 12.777  107.148 19.642 1.00 101.06 ? 92  TRP A CH2 1 
ATOM   706  N N   . LYS A 1 93  ? 13.358  112.076 18.616 1.00 57.02  ? 93  LYS A N   1 
ATOM   707  C CA  . LYS A 1 93  ? 14.708  111.819 19.100 1.00 64.63  ? 93  LYS A CA  1 
ATOM   708  C C   . LYS A 1 93  ? 14.684  110.625 20.037 1.00 73.66  ? 93  LYS A C   1 
ATOM   709  O O   . LYS A 1 93  ? 13.789  110.481 20.864 1.00 74.88  ? 93  LYS A O   1 
ATOM   710  C CB  . LYS A 1 93  ? 15.217  113.003 19.909 1.00 61.63  ? 93  LYS A CB  1 
ATOM   711  C CG  . LYS A 1 93  ? 15.671  114.171 19.074 1.00 73.31  ? 93  LYS A CG  1 
ATOM   712  C CD  . LYS A 1 93  ? 16.949  113.880 18.338 1.00 70.00  ? 93  LYS A CD  1 
ATOM   713  C CE  . LYS A 1 93  ? 16.851  114.364 16.905 1.00 90.23  ? 93  LYS A CE  1 
ATOM   714  N NZ  . LYS A 1 93  ? 18.055  115.157 16.529 1.00 92.85  ? 93  LYS A NZ  1 
ATOM   715  N N   . GLU A 1 94  ? 15.701  109.788 19.925 1.00 58.27  ? 94  GLU A N   1 
ATOM   716  C CA  . GLU A 1 94  ? 15.830  108.640 20.782 1.00 57.15  ? 94  GLU A CA  1 
ATOM   717  C C   . GLU A 1 94  ? 16.501  109.030 22.080 1.00 50.57  ? 94  GLU A C   1 
ATOM   718  O O   . GLU A 1 94  ? 17.364  109.911 22.121 1.00 57.03  ? 94  GLU A O   1 
ATOM   719  C CB  . GLU A 1 94  ? 16.660  107.597 20.039 1.00 59.88  ? 94  GLU A CB  1 
ATOM   720  C CG  . GLU A 1 94  ? 17.056  108.080 18.659 1.00 91.77  ? 94  GLU A CG  1 
ATOM   721  C CD  . GLU A 1 94  ? 17.469  106.935 17.776 1.00 101.06 ? 94  GLU A CD  1 
ATOM   722  O OE1 . GLU A 1 94  ? 17.351  105.779 18.257 1.00 101.06 ? 94  GLU A OE1 1 
ATOM   723  O OE2 . GLU A 1 94  ? 17.926  107.198 16.634 1.00 101.06 ? 94  GLU A OE2 1 
ATOM   724  N N   . THR A 1 95  ? 16.149  108.338 23.150 1.00 54.31  ? 95  THR A N   1 
ATOM   725  C CA  . THR A 1 95  ? 16.627  108.719 24.478 1.00 55.85  ? 95  THR A CA  1 
ATOM   726  C C   . THR A 1 95  ? 18.140  108.811 24.515 1.00 57.34  ? 95  THR A C   1 
ATOM   727  O O   . THR A 1 95  ? 18.724  109.638 25.223 1.00 63.60  ? 95  THR A O   1 
ATOM   728  C CB  . THR A 1 95  ? 16.120  107.689 25.500 1.00 64.75  ? 95  THR A CB  1 
ATOM   729  O OG1 . THR A 1 95  ? 14.704  107.584 25.355 1.00 53.10  ? 95  THR A OG1 1 
ATOM   730  C CG2 . THR A 1 95  ? 16.235  108.216 26.929 1.00 49.74  ? 95  THR A CG2 1 
ATOM   731  N N   . LEU A 1 96  ? 18.800  107.967 23.743 1.00 58.01  ? 96  LEU A N   1 
ATOM   732  C CA  . LEU A 1 96  ? 20.254  108.001 23.781 1.00 67.43  ? 96  LEU A CA  1 
ATOM   733  C C   . LEU A 1 96  ? 20.774  109.337 23.233 1.00 57.86  ? 96  LEU A C   1 
ATOM   734  O O   . LEU A 1 96  ? 21.780  109.886 23.689 1.00 67.96  ? 96  LEU A O   1 
ATOM   735  C CB  . LEU A 1 96  ? 20.834  106.821 23.003 1.00 61.21  ? 96  LEU A CB  1 
ATOM   736  C CG  . LEU A 1 96  ? 22.354  106.778 22.891 1.00 66.83  ? 96  LEU A CG  1 
ATOM   737  C CD1 . LEU A 1 96  ? 22.970  106.710 24.279 1.00 61.86  ? 96  LEU A CD1 1 
ATOM   738  C CD2 . LEU A 1 96  ? 22.805  105.582 22.029 1.00 66.47  ? 96  LEU A CD2 1 
ATOM   739  N N   . LYS A 1 97  ? 20.064  109.880 22.266 1.00 46.44  ? 97  LYS A N   1 
ATOM   740  C CA  . LYS A 1 97  ? 20.441  111.186 21.759 1.00 62.06  ? 97  LYS A CA  1 
ATOM   741  C C   . LYS A 1 97  ? 20.075  112.270 22.758 1.00 55.53  ? 97  LYS A C   1 
ATOM   742  O O   . LYS A 1 97  ? 20.860  113.185 23.006 1.00 46.52  ? 97  LYS A O   1 
ATOM   743  C CB  . LYS A 1 97  ? 19.817  111.441 20.383 1.00 65.66  ? 97  LYS A CB  1 
ATOM   744  C CG  . LYS A 1 97  ? 20.267  110.407 19.322 1.00 67.48  ? 97  LYS A CG  1 
ATOM   745  C CD  . LYS A 1 97  ? 20.057  110.890 17.893 1.00 94.55  ? 97  LYS A CD  1 
ATOM   746  C CE  . LYS A 1 97  ? 21.266  110.570 17.020 1.00 101.06 ? 97  LYS A CE  1 
ATOM   747  N NZ  . LYS A 1 97  ? 21.356  109.114 16.689 1.00 92.26  ? 97  LYS A NZ  1 
ATOM   748  N N   . VAL A 1 98  ? 18.906  112.158 23.378 1.00 50.20  ? 98  VAL A N   1 
ATOM   749  C CA  . VAL A 1 98  ? 18.559  113.162 24.369 1.00 39.36  ? 98  VAL A CA  1 
ATOM   750  C C   . VAL A 1 98  ? 19.627  113.159 25.425 1.00 47.18  ? 98  VAL A C   1 
ATOM   751  O O   . VAL A 1 98  ? 20.084  114.212 25.849 1.00 53.23  ? 98  VAL A O   1 
ATOM   752  C CB  . VAL A 1 98  ? 17.196  112.894 24.984 1.00 47.70  ? 98  VAL A CB  1 
ATOM   753  C CG1 . VAL A 1 98  ? 16.829  113.921 26.062 1.00 44.82  ? 98  VAL A CG1 1 
ATOM   754  C CG2 . VAL A 1 98  ? 16.184  112.884 23.898 1.00 44.44  ? 98  VAL A CG2 1 
ATOM   755  N N   . LEU A 1 99  ? 20.064  111.969 25.822 1.00 46.60  ? 99  LEU A N   1 
ATOM   756  C CA  . LEU A 1 99  ? 21.130  111.875 26.818 1.00 53.82  ? 99  LEU A CA  1 
ATOM   757  C C   . LEU A 1 99  ? 22.449  112.541 26.395 1.00 49.15  ? 99  LEU A C   1 
ATOM   758  O O   . LEU A 1 99  ? 23.128  113.187 27.187 1.00 59.36  ? 99  LEU A O   1 
ATOM   759  C CB  . LEU A 1 99  ? 21.369  110.410 27.243 1.00 49.92  ? 99  LEU A CB  1 
ATOM   760  C CG  . LEU A 1 99  ? 20.311  109.774 28.155 1.00 57.35  ? 99  LEU A CG  1 
ATOM   761  C CD1 . LEU A 1 99  ? 20.349  108.249 28.122 1.00 45.66  ? 99  LEU A CD1 1 
ATOM   762  C CD2 . LEU A 1 99  ? 20.440  110.284 29.583 1.00 52.74  ? 99  LEU A CD2 1 
ATOM   763  N N   . ARG A 1 100 ? 22.856  112.312 25.164 1.00 59.75  ? 100 ARG A N   1 
ATOM   764  C CA  . ARG A 1 100 ? 24.142  112.822 24.710 1.00 68.04  ? 100 ARG A CA  1 
ATOM   765  C C   . ARG A 1 100 ? 23.979  114.331 24.665 1.00 54.02  ? 100 ARG A C   1 
ATOM   766  O O   . ARG A 1 100 ? 24.813  115.102 25.149 1.00 51.24  ? 100 ARG A O   1 
ATOM   767  C CB  . ARG A 1 100 ? 24.434  112.269 23.309 1.00 67.36  ? 100 ARG A CB  1 
ATOM   768  C CG  . ARG A 1 100 ? 25.846  112.488 22.779 1.00 78.71  ? 100 ARG A CG  1 
ATOM   769  C CD  . ARG A 1 100 ? 25.856  112.713 21.254 1.00 101.06 ? 100 ARG A CD  1 
ATOM   770  N NE  . ARG A 1 100 ? 27.141  113.180 20.719 1.00 101.06 ? 100 ARG A NE  1 
ATOM   771  C CZ  . ARG A 1 100 ? 27.493  113.102 19.433 1.00 101.06 ? 100 ARG A CZ  1 
ATOM   772  N NH1 . ARG A 1 100 ? 26.654  112.588 18.537 1.00 101.06 ? 100 ARG A NH1 1 
ATOM   773  N NH2 . ARG A 1 100 ? 28.685  113.535 19.041 1.00 101.06 ? 100 ARG A NH2 1 
ATOM   774  N N   . HIS A 1 101 ? 22.836  114.751 24.157 1.00 49.12  ? 101 HIS A N   1 
ATOM   775  C CA  . HIS A 1 101 ? 22.575  116.172 24.112 1.00 55.74  ? 101 HIS A CA  1 
ATOM   776  C C   . HIS A 1 101 ? 22.793  116.797 25.470 1.00 60.34  ? 101 HIS A C   1 
ATOM   777  O O   . HIS A 1 101 ? 23.536  117.767 25.579 1.00 66.57  ? 101 HIS A O   1 
ATOM   778  C CB  . HIS A 1 101 ? 21.184  116.468 23.580 1.00 52.01  ? 101 HIS A CB  1 
ATOM   779  C CG  . HIS A 1 101 ? 20.869  117.925 23.547 1.00 80.68  ? 101 HIS A CG  1 
ATOM   780  N ND1 . HIS A 1 101 ? 20.535  118.639 24.679 1.00 66.92  ? 101 HIS A ND1 1 
ATOM   781  C CD2 . HIS A 1 101 ? 20.883  118.813 22.526 1.00 84.21  ? 101 HIS A CD2 1 
ATOM   782  C CE1 . HIS A 1 101 ? 20.325  119.898 24.347 1.00 88.61  ? 101 HIS A CE1 1 
ATOM   783  N NE2 . HIS A 1 101 ? 20.517  120.028 23.047 1.00 72.37  ? 101 HIS A NE2 1 
ATOM   784  N N   . HIS A 1 102 ? 22.203  116.229 26.523 1.00 58.84  ? 102 HIS A N   1 
ATOM   785  C CA  . HIS A 1 102 ? 22.324  116.877 27.833 1.00 59.31  ? 102 HIS A CA  1 
ATOM   786  C C   . HIS A 1 102 ? 23.680  116.735 28.512 1.00 47.01  ? 102 HIS A C   1 
ATOM   787  O O   . HIS A 1 102 ? 24.119  117.614 29.232 1.00 52.32  ? 102 HIS A O   1 
ATOM   788  C CB  . HIS A 1 102 ? 21.186  116.491 28.779 1.00 61.90  ? 102 HIS A CB  1 
ATOM   789  C CG  . HIS A 1 102 ? 19.897  117.197 28.490 1.00 52.91  ? 102 HIS A CG  1 
ATOM   790  N ND1 . HIS A 1 102 ? 19.617  118.463 28.964 1.00 41.43  ? 102 HIS A ND1 1 
ATOM   791  C CD2 . HIS A 1 102 ? 18.828  116.827 27.743 1.00 45.01  ? 102 HIS A CD2 1 
ATOM   792  C CE1 . HIS A 1 102 ? 18.415  118.829 28.552 1.00 56.32  ? 102 HIS A CE1 1 
ATOM   793  N NE2 . HIS A 1 102 ? 17.907  117.850 27.818 1.00 54.18  ? 102 HIS A NE2 1 
ATOM   794  N N   . GLN A 1 103 ? 24.388  115.645 28.252 1.00 55.86  ? 103 GLN A N   1 
ATOM   795  C CA  . GLN A 1 103 ? 25.756  115.528 28.771 1.00 51.97  ? 103 GLN A CA  1 
ATOM   796  C C   . GLN A 1 103 ? 26.717  116.532 28.115 1.00 60.19  ? 103 GLN A C   1 
ATOM   797  O O   . GLN A 1 103 ? 27.540  117.149 28.789 1.00 64.17  ? 103 GLN A O   1 
ATOM   798  C CB  . GLN A 1 103 ? 26.274  114.098 28.536 1.00 48.45  ? 103 GLN A CB  1 
ATOM   799  C CG  . GLN A 1 103 ? 27.568  113.785 29.243 1.00 44.10  ? 103 GLN A CG  1 
ATOM   800  C CD  . GLN A 1 103 ? 27.438  113.906 30.761 1.00 63.36  ? 103 GLN A CD  1 
ATOM   801  O OE1 . GLN A 1 103 ? 27.144  112.932 31.440 1.00 78.60  ? 103 GLN A OE1 1 
ATOM   802  N NE2 . GLN A 1 103 ? 27.652  115.102 31.288 1.00 62.90  ? 103 GLN A NE2 1 
ATOM   803  N N   . GLU A 1 104 ? 26.642  116.655 26.792 1.00 59.82  ? 104 GLU A N   1 
ATOM   804  C CA  . GLU A 1 104 ? 27.522  117.570 26.076 1.00 72.25  ? 104 GLU A CA  1 
ATOM   805  C C   . GLU A 1 104 ? 27.256  118.998 26.551 1.00 76.96  ? 104 GLU A C   1 
ATOM   806  O O   . GLU A 1 104 ? 28.173  119.806 26.611 1.00 84.15  ? 104 GLU A O   1 
ATOM   807  C CB  . GLU A 1 104 ? 27.341  117.461 24.554 1.00 62.29  ? 104 GLU A CB  1 
ATOM   808  C CG  . GLU A 1 104 ? 27.721  116.110 23.957 1.00 85.13  ? 104 GLU A CG  1 
ATOM   809  C CD  . GLU A 1 104 ? 27.515  116.026 22.446 1.00 100.34 ? 104 GLU A CD  1 
ATOM   810  O OE1 . GLU A 1 104 ? 26.564  116.642 21.924 1.00 94.61  ? 104 GLU A OE1 1 
ATOM   811  O OE2 . GLU A 1 104 ? 28.302  115.336 21.765 1.00 88.16  ? 104 GLU A OE2 1 
ATOM   812  N N   . LYS A 1 105 ? 26.015  119.297 26.930 1.00 74.61  ? 105 LYS A N   1 
ATOM   813  C CA  . LYS A 1 105 ? 25.657  120.655 27.344 1.00 71.98  ? 105 LYS A CA  1 
ATOM   814  C C   . LYS A 1 105 ? 26.355  121.009 28.657 1.00 80.42  ? 105 LYS A C   1 
ATOM   815  O O   . LYS A 1 105 ? 26.627  122.174 28.945 1.00 79.59  ? 105 LYS A O   1 
ATOM   816  C CB  . LYS A 1 105 ? 24.142  120.775 27.511 1.00 71.74  ? 105 LYS A CB  1 
ATOM   817  C CG  . LYS A 1 105 ? 23.565  122.166 27.287 1.00 93.62  ? 105 LYS A CG  1 
ATOM   818  C CD  . LYS A 1 105 ? 22.430  122.450 28.272 1.00 101.06 ? 105 LYS A CD  1 
ATOM   819  C CE  . LYS A 1 105 ? 21.408  123.427 27.704 1.00 101.06 ? 105 LYS A CE  1 
ATOM   820  N NZ  . LYS A 1 105 ? 20.110  123.339 28.437 1.00 82.22  ? 105 LYS A NZ  1 
ATOM   821  N N   . LEU A 1 106 ? 26.656  120.003 29.466 1.00 83.63  ? 106 LEU A N   1 
ATOM   822  C CA  . LEU A 1 106 ? 27.235  120.286 30.768 1.00 85.63  ? 106 LEU A CA  1 
ATOM   823  C C   . LEU A 1 106 ? 28.739  120.464 30.624 1.00 86.10  ? 106 LEU A C   1 
ATOM   824  O O   . LEU A 1 106 ? 29.380  121.225 31.353 1.00 88.94  ? 106 LEU A O   1 
ATOM   825  C CB  . LEU A 1 106 ? 26.907  119.158 31.742 1.00 90.10  ? 106 LEU A CB  1 
ATOM   826  C CG  . LEU A 1 106 ? 25.797  119.541 32.720 1.00 89.98  ? 106 LEU A CG  1 
ATOM   827  C CD1 . LEU A 1 106 ? 24.541  119.971 31.974 1.00 101.06 ? 106 LEU A CD1 1 
ATOM   828  C CD2 . LEU A 1 106 ? 25.506  118.400 33.670 1.00 101.06 ? 106 LEU A CD2 1 
ATOM   829  N N   . GLU A 1 107 ? 29.280  119.754 29.647 1.00 83.97  ? 107 GLU A N   1 
ATOM   830  C CA  . GLU A 1 107 ? 30.704  119.744 29.382 1.00 91.76  ? 107 GLU A CA  1 
ATOM   831  C C   . GLU A 1 107 ? 31.068  121.103 28.785 1.00 96.93  ? 107 GLU A C   1 
ATOM   832  O O   . GLU A 1 107 ? 32.222  121.523 28.830 1.00 91.01  ? 107 GLU A O   1 
ATOM   833  C CB  . GLU A 1 107 ? 31.036  118.574 28.444 1.00 89.80  ? 107 GLU A CB  1 
ATOM   834  C CG  . GLU A 1 107 ? 30.396  117.271 28.922 1.00 100.66 ? 107 GLU A CG  1 
ATOM   835  C CD  . GLU A 1 107 ? 30.835  116.026 28.160 1.00 101.06 ? 107 GLU A CD  1 
ATOM   836  O OE1 . GLU A 1 107 ? 30.667  115.988 26.922 1.00 101.06 ? 107 GLU A OE1 1 
ATOM   837  O OE2 . GLU A 1 107 ? 31.290  115.052 28.809 1.00 89.97  ? 107 GLU A OE2 1 
ATOM   838  N N   . ALA A 1 108 ? 30.056  121.811 28.290 1.00 97.95  ? 108 ALA A N   1 
ATOM   839  C CA  . ALA A 1 108 ? 30.265  123.088 27.616 1.00 101.06 ? 108 ALA A CA  1 
ATOM   840  C C   . ALA A 1 108 ? 30.310  124.257 28.600 1.00 101.06 ? 108 ALA A C   1 
ATOM   841  O O   . ALA A 1 108 ? 30.884  125.309 28.308 1.00 101.06 ? 108 ALA A O   1 
ATOM   842  C CB  . ALA A 1 108 ? 29.207  123.313 26.548 1.00 101.06 ? 108 ALA A CB  1 
ATOM   843  N N   . SER A 1 109 ? 29.751  124.051 29.784 1.00 101.06 ? 109 SER A N   1 
ATOM   844  C CA  . SER A 1 109 ? 30.055  124.923 30.902 1.00 101.06 ? 109 SER A CA  1 
ATOM   845  C C   . SER A 1 109 ? 31.418  124.595 31.511 1.00 101.06 ? 109 SER A C   1 
ATOM   846  O O   . SER A 1 109 ? 31.555  124.460 32.727 1.00 101.06 ? 109 SER A O   1 
ATOM   847  C CB  . SER A 1 109 ? 28.933  124.826 31.930 1.00 101.06 ? 109 SER A CB  1 
ATOM   848  O OG  . SER A 1 109 ? 27.707  124.477 31.295 1.00 101.06 ? 109 SER A OG  1 
ATOM   849  N N   . ASP A 1 110 ? 32.418  124.503 30.636 1.00 101.06 ? 110 ASP A N   1 
ATOM   850  C CA  . ASP A 1 110 ? 33.746  123.950 30.924 1.00 101.06 ? 110 ASP A CA  1 
ATOM   851  C C   . ASP A 1 110 ? 33.759  122.474 31.306 1.00 101.06 ? 110 ASP A C   1 
ATOM   852  O O   . ASP A 1 110 ? 34.486  121.683 30.703 1.00 99.54  ? 110 ASP A O   1 
ATOM   853  C CB  . ASP A 1 110 ? 34.484  124.791 31.949 1.00 101.06 ? 110 ASP A CB  1 
ATOM   854  N N   . VAL A 1 148 ? 32.879  118.255 36.449 1.00 64.31  ? 148 VAL A N   1 
ATOM   855  C CA  . VAL A 1 148 ? 32.038  117.721 35.372 1.00 86.56  ? 148 VAL A CA  1 
ATOM   856  C C   . VAL A 1 148 ? 30.956  116.768 35.869 1.00 84.05  ? 148 VAL A C   1 
ATOM   857  O O   . VAL A 1 148 ? 31.240  115.609 36.143 1.00 92.90  ? 148 VAL A O   1 
ATOM   858  C CB  . VAL A 1 148 ? 32.881  116.890 34.401 1.00 93.87  ? 148 VAL A CB  1 
ATOM   859  C CG1 . VAL A 1 148 ? 32.621  117.308 32.962 1.00 101.06 ? 148 VAL A CG1 1 
ATOM   860  C CG2 . VAL A 1 148 ? 34.365  116.979 34.765 1.00 101.06 ? 148 VAL A CG2 1 
ATOM   861  N N   . PRO A 1 149 ? 29.713  117.221 35.945 1.00 75.78  ? 149 PRO A N   1 
ATOM   862  C CA  . PRO A 1 149 ? 28.614  116.366 36.411 1.00 74.78  ? 149 PRO A CA  1 
ATOM   863  C C   . PRO A 1 149 ? 28.112  115.331 35.392 1.00 67.78  ? 149 PRO A C   1 
ATOM   864  O O   . PRO A 1 149 ? 28.047  115.591 34.188 1.00 61.85  ? 149 PRO A O   1 
ATOM   865  C CB  . PRO A 1 149 ? 27.520  117.370 36.760 1.00 82.94  ? 149 PRO A CB  1 
ATOM   866  C CG  . PRO A 1 149 ? 28.206  118.731 36.693 1.00 87.13  ? 149 PRO A CG  1 
ATOM   867  C CD  . PRO A 1 149 ? 29.259  118.584 35.637 1.00 83.43  ? 149 PRO A CD  1 
ATOM   868  N N   . LYS A 1 150 ? 27.773  114.142 35.882 1.00 55.34  ? 150 LYS A N   1 
ATOM   869  C CA  . LYS A 1 150 ? 27.332  113.045 35.018 1.00 51.92  ? 150 LYS A CA  1 
ATOM   870  C C   . LYS A 1 150 ? 25.791  112.969 34.985 1.00 50.86  ? 150 LYS A C   1 
ATOM   871  O O   . LYS A 1 150 ? 25.123  112.902 36.024 1.00 63.79  ? 150 LYS A O   1 
ATOM   872  C CB  . LYS A 1 150 ? 27.887  111.736 35.587 1.00 52.36  ? 150 LYS A CB  1 
ATOM   873  C CG  . LYS A 1 150 ? 29.360  111.485 35.257 1.00 89.11  ? 150 LYS A CG  1 
ATOM   874  C CD  . LYS A 1 150 ? 29.597  110.049 34.751 1.00 101.06 ? 150 LYS A CD  1 
ATOM   875  C CE  . LYS A 1 150 ? 31.095  109.764 34.511 1.00 101.06 ? 150 LYS A CE  1 
ATOM   876  N NZ  . LYS A 1 150 ? 31.477  108.343 34.825 1.00 101.06 ? 150 LYS A NZ  1 
ATOM   877  N N   . VAL A 1 151 ? 25.218  112.964 33.802 1.00 42.26  ? 151 VAL A N   1 
ATOM   878  C CA  . VAL A 1 151 ? 23.792  112.760 33.704 1.00 52.50  ? 151 VAL A CA  1 
ATOM   879  C C   . VAL A 1 151 ? 23.470  111.299 33.915 1.00 61.42  ? 151 VAL A C   1 
ATOM   880  O O   . VAL A 1 151 ? 24.261  110.441 33.531 1.00 57.41  ? 151 VAL A O   1 
ATOM   881  C CB  . VAL A 1 151 ? 23.271  113.121 32.317 1.00 54.64  ? 151 VAL A CB  1 
ATOM   882  C CG1 . VAL A 1 151 ? 23.505  111.943 31.376 1.00 79.13  ? 151 VAL A CG1 1 
ATOM   883  C CG2 . VAL A 1 151 ? 21.785  113.448 32.392 1.00 61.25  ? 151 VAL A CG2 1 
ATOM   884  N N   . LYS A 1 152 ? 22.299  111.006 34.478 1.00 44.55  ? 152 LYS A N   1 
ATOM   885  C CA  . LYS A 1 152 ? 21.899  109.623 34.614 1.00 50.08  ? 152 LYS A CA  1 
ATOM   886  C C   . LYS A 1 152 ? 20.426  109.566 34.309 1.00 55.18  ? 152 LYS A C   1 
ATOM   887  O O   . LYS A 1 152 ? 19.724  110.536 34.556 1.00 53.54  ? 152 LYS A O   1 
ATOM   888  C CB  . LYS A 1 152 ? 22.212  109.177 36.034 1.00 57.05  ? 152 LYS A CB  1 
ATOM   889  C CG  . LYS A 1 152 ? 23.649  109.495 36.399 1.00 50.05  ? 152 LYS A CG  1 
ATOM   890  C CD  . LYS A 1 152 ? 24.265  108.463 37.280 1.00 55.24  ? 152 LYS A CD  1 
ATOM   891  C CE  . LYS A 1 152 ? 25.516  107.915 36.628 1.00 78.73  ? 152 LYS A CE  1 
ATOM   892  N NZ  . LYS A 1 152 ? 26.381  107.230 37.607 1.00 62.22  ? 152 LYS A NZ  1 
ATOM   893  N N   . LEU A 1 153 ? 19.984  108.493 33.661 1.00 47.04  ? 153 LEU A N   1 
ATOM   894  C CA  . LEU A 1 153 ? 18.577  108.348 33.304 1.00 41.26  ? 153 LEU A CA  1 
ATOM   895  C C   . LEU A 1 153 ? 17.792  107.814 34.512 1.00 51.39  ? 153 LEU A C   1 
ATOM   896  O O   . LEU A 1 153 ? 18.172  106.812 35.117 1.00 40.50  ? 153 LEU A O   1 
ATOM   897  C CB  . LEU A 1 153 ? 18.392  107.375 32.143 1.00 45.63  ? 153 LEU A CB  1 
ATOM   898  C CG  . LEU A 1 153 ? 17.013  107.523 31.502 1.00 61.02  ? 153 LEU A CG  1 
ATOM   899  C CD1 . LEU A 1 153 ? 16.953  108.987 30.939 1.00 45.00  ? 153 LEU A CD1 1 
ATOM   900  C CD2 . LEU A 1 153 ? 16.885  106.470 30.424 1.00 42.78  ? 153 LEU A CD2 1 
ATOM   901  N N   . LEU A 1 154 ? 16.729  108.534 34.840 1.00 41.08  ? 154 LEU A N   1 
ATOM   902  C CA  . LEU A 1 154 ? 15.801  108.272 35.910 1.00 46.86  ? 154 LEU A CA  1 
ATOM   903  C C   . LEU A 1 154 ? 14.593  107.628 35.283 1.00 46.42  ? 154 LEU A C   1 
ATOM   904  O O   . LEU A 1 154 ? 13.996  108.204 34.390 1.00 67.31  ? 154 LEU A O   1 
ATOM   905  C CB  . LEU A 1 154 ? 15.328  109.600 36.503 1.00 44.75  ? 154 LEU A CB  1 
ATOM   906  C CG  . LEU A 1 154 ? 14.523  109.488 37.805 1.00 63.43  ? 154 LEU A CG  1 
ATOM   907  C CD1 . LEU A 1 154 ? 15.254  108.614 38.836 1.00 43.96  ? 154 LEU A CD1 1 
ATOM   908  C CD2 . LEU A 1 154 ? 14.199  110.866 38.418 1.00 52.55  ? 154 LEU A CD2 1 
ATOM   909  N N   . CYS A 1 155 ? 14.238  106.435 35.730 1.00 44.93  ? 155 CYS A N   1 
ATOM   910  C CA  . CYS A 1 155 ? 13.181  105.674 35.088 1.00 46.64  ? 155 CYS A CA  1 
ATOM   911  C C   . CYS A 1 155 ? 12.548  104.818 36.171 1.00 54.71  ? 155 CYS A C   1 
ATOM   912  O O   . CYS A 1 155 ? 12.949  104.892 37.326 1.00 53.33  ? 155 CYS A O   1 
ATOM   913  C CB  . CYS A 1 155 ? 13.784  104.750 34.057 1.00 63.27  ? 155 CYS A CB  1 
ATOM   914  S SG  . CYS A 1 155 ? 15.038  103.658 34.774 1.00 55.59  ? 155 CYS A SG  1 
ATOM   915  N N   . GLY A 1 156 ? 11.558  104.020 35.783 1.00 60.79  ? 156 GLY A N   1 
ATOM   916  C CA  . GLY A 1 156 ? 11.029  102.964 36.618 1.00 56.45  ? 156 GLY A CA  1 
ATOM   917  C C   . GLY A 1 156 ? 11.293  101.591 36.024 1.00 63.79  ? 156 GLY A C   1 
ATOM   918  O O   . GLY A 1 156 ? 12.090  101.452 35.098 1.00 54.72  ? 156 GLY A O   1 
ATOM   919  N N   . ALA A 1 157 ? 10.597  100.570 36.524 1.00 61.05  ? 157 ALA A N   1 
ATOM   920  C CA  . ALA A 1 157 ? 10.916  99.209  36.131 1.00 59.07  ? 157 ALA A CA  1 
ATOM   921  C C   . ALA A 1 157 ? 10.487  99.025  34.695 1.00 56.54  ? 157 ALA A C   1 
ATOM   922  O O   . ALA A 1 157 ? 11.224  98.534  33.855 1.00 70.74  ? 157 ALA A O   1 
ATOM   923  C CB  . ALA A 1 157 ? 10.192  98.227  37.009 1.00 64.15  ? 157 ALA A CB  1 
ATOM   924  N N   . ASP A 1 158 ? 9.245   99.379  34.454 1.00 60.70  ? 158 ASP A N   1 
ATOM   925  C CA  . ASP A 1 158 ? 8.749   99.623  33.121 1.00 74.29  ? 158 ASP A CA  1 
ATOM   926  C C   . ASP A 1 158 ? 9.876   99.797  32.090 1.00 56.26  ? 158 ASP A C   1 
ATOM   927  O O   . ASP A 1 158 ? 9.940   99.029  31.148 1.00 58.39  ? 158 ASP A O   1 
ATOM   928  C CB  . ASP A 1 158 ? 7.643   100.696 33.188 1.00 88.07  ? 158 ASP A CB  1 
ATOM   929  C CG  . ASP A 1 158 ? 7.394   101.429 31.881 1.00 101.06 ? 158 ASP A CG  1 
ATOM   930  O OD1 . ASP A 1 158 ? 6.203   101.643 31.560 1.00 101.06 ? 158 ASP A OD1 1 
ATOM   931  O OD2 . ASP A 1 158 ? 8.293   101.931 31.172 1.00 101.06 ? 158 ASP A OD2 1 
ATOM   932  N N   . LEU A 1 159 ? 10.849  100.677 32.300 1.00 58.46  ? 159 LEU A N   1 
ATOM   933  C CA  . LEU A 1 159 ? 11.987  100.693 31.369 1.00 48.97  ? 159 LEU A CA  1 
ATOM   934  C C   . LEU A 1 159 ? 12.706  99.339  31.209 1.00 58.94  ? 159 LEU A C   1 
ATOM   935  O O   . LEU A 1 159 ? 12.965  98.842  30.101 1.00 64.29  ? 159 LEU A O   1 
ATOM   936  C CB  . LEU A 1 159 ? 12.990  101.805 31.725 1.00 62.07  ? 159 LEU A CB  1 
ATOM   937  C CG  . LEU A 1 159 ? 13.670  102.568 30.576 1.00 69.98  ? 159 LEU A CG  1 
ATOM   938  C CD1 . LEU A 1 159 ? 15.155  102.306 30.551 1.00 64.24  ? 159 LEU A CD1 1 
ATOM   939  C CD2 . LEU A 1 159 ? 13.061  102.317 29.192 1.00 94.87  ? 159 LEU A CD2 1 
ATOM   940  N N   . LEU A 1 160 ? 13.138  98.801  32.333 1.00 54.08  ? 160 LEU A N   1 
ATOM   941  C CA  . LEU A 1 160 ? 13.642  97.442  32.317 1.00 67.15  ? 160 LEU A CA  1 
ATOM   942  C C   . LEU A 1 160 ? 12.682  96.440  31.646 1.00 70.08  ? 160 LEU A C   1 
ATOM   943  O O   . LEU A 1 160 ? 13.031  95.767  30.676 1.00 70.21  ? 160 LEU A O   1 
ATOM   944  C CB  . LEU A 1 160 ? 14.038  97.017  33.728 1.00 53.19  ? 160 LEU A CB  1 
ATOM   945  C CG  . LEU A 1 160 ? 15.025  97.989  34.384 1.00 55.81  ? 160 LEU A CG  1 
ATOM   946  C CD1 . LEU A 1 160 ? 15.291  97.624  35.784 1.00 46.38  ? 160 LEU A CD1 1 
ATOM   947  C CD2 . LEU A 1 160 ? 16.347  98.091  33.658 1.00 48.31  ? 160 LEU A CD2 1 
ATOM   948  N N   . GLU A 1 161 ? 11.439  96.372  32.080 1.00 72.11  ? 161 GLU A N   1 
ATOM   949  C CA  . GLU A 1 161 ? 10.605  95.485  31.301 1.00 79.93  ? 161 GLU A CA  1 
ATOM   950  C C   . GLU A 1 161 ? 10.845  95.797  29.809 1.00 85.34  ? 161 GLU A C   1 
ATOM   951  O O   . GLU A 1 161 ? 11.102  94.904  29.003 1.00 90.60  ? 161 GLU A O   1 
ATOM   952  C CB  . GLU A 1 161 ? 9.127   95.504  31.709 1.00 80.71  ? 161 GLU A CB  1 
ATOM   953  C CG  . GLU A 1 161 ? 8.430   94.179  31.385 1.00 101.06 ? 161 GLU A CG  1 
ATOM   954  C CD  . GLU A 1 161 ? 7.320   93.810  32.362 1.00 101.06 ? 161 GLU A CD  1 
ATOM   955  O OE1 . GLU A 1 161 ? 7.009   94.646  33.237 1.00 101.06 ? 161 GLU A OE1 1 
ATOM   956  O OE2 . GLU A 1 161 ? 6.749   92.697  32.252 1.00 93.77  ? 161 GLU A OE2 1 
ATOM   957  N N   . SER A 1 162 ? 10.816  97.067  29.440 1.00 80.13  ? 162 SER A N   1 
ATOM   958  C CA  . SER A 1 162 ? 10.748  97.385  28.026 1.00 73.34  ? 162 SER A CA  1 
ATOM   959  C C   . SER A 1 162 ? 11.970  96.864  27.307 1.00 71.24  ? 162 SER A C   1 
ATOM   960  O O   . SER A 1 162 ? 11.889  96.539  26.133 1.00 59.17  ? 162 SER A O   1 
ATOM   961  C CB  . SER A 1 162 ? 10.648  98.886  27.801 1.00 70.71  ? 162 SER A CB  1 
ATOM   962  O OG  . SER A 1 162 ? 10.938  99.187  26.446 1.00 85.47  ? 162 SER A OG  1 
ATOM   963  N N   . PHE A 1 163 ? 13.093  96.804  28.021 1.00 74.44  ? 163 PHE A N   1 
ATOM   964  C CA  . PHE A 1 163 ? 14.403  96.595  27.431 1.00 65.74  ? 163 PHE A CA  1 
ATOM   965  C C   . PHE A 1 163 ? 14.535  95.184  26.914 1.00 76.01  ? 163 PHE A C   1 
ATOM   966  O O   . PHE A 1 163 ? 15.472  94.885  26.189 1.00 86.66  ? 163 PHE A O   1 
ATOM   967  C CB  . PHE A 1 163 ? 15.503  96.828  28.472 1.00 65.81  ? 163 PHE A CB  1 
ATOM   968  C CG  . PHE A 1 163 ? 16.062  98.228  28.485 1.00 57.78  ? 163 PHE A CG  1 
ATOM   969  C CD1 . PHE A 1 163 ? 16.917  98.631  29.486 1.00 52.33  ? 163 PHE A CD1 1 
ATOM   970  C CD2 . PHE A 1 163 ? 15.777  99.127  27.459 1.00 64.21  ? 163 PHE A CD2 1 
ATOM   971  C CE1 . PHE A 1 163 ? 17.452  99.930  29.490 1.00 58.17  ? 163 PHE A CE1 1 
ATOM   972  C CE2 . PHE A 1 163 ? 16.318  100.406 27.448 1.00 58.12  ? 163 PHE A CE2 1 
ATOM   973  C CZ  . PHE A 1 163 ? 17.152  100.811 28.467 1.00 58.43  ? 163 PHE A CZ  1 
ATOM   974  N N   . ALA A 1 164 ? 13.628  94.302  27.313 1.00 79.85  ? 164 ALA A N   1 
ATOM   975  C CA  . ALA A 1 164 ? 13.805  92.875  27.044 1.00 85.20  ? 164 ALA A CA  1 
ATOM   976  C C   . ALA A 1 164 ? 12.766  92.305  26.075 1.00 89.69  ? 164 ALA A C   1 
ATOM   977  O O   . ALA A 1 164 ? 12.932  91.191  25.557 1.00 90.08  ? 164 ALA A O   1 
ATOM   978  C CB  . ALA A 1 164 ? 13.823  92.074  28.340 1.00 92.54  ? 164 ALA A CB  1 
ATOM   979  N N   . VAL A 1 165 ? 11.701  93.067  25.835 1.00 79.72  ? 165 VAL A N   1 
ATOM   980  C CA  . VAL A 1 165 ? 10.778  92.778  24.742 1.00 86.20  ? 165 VAL A CA  1 
ATOM   981  C C   . VAL A 1 165 ? 11.523  92.450  23.446 1.00 83.76  ? 165 VAL A C   1 
ATOM   982  O O   . VAL A 1 165 ? 12.374  93.210  22.985 1.00 80.41  ? 165 VAL A O   1 
ATOM   983  C CB  . VAL A 1 165 ? 9.779   93.927  24.517 1.00 86.83  ? 165 VAL A CB  1 
ATOM   984  C CG1 . VAL A 1 165 ? 9.722   94.316  23.040 1.00 80.22  ? 165 VAL A CG1 1 
ATOM   985  C CG2 . VAL A 1 165 ? 8.401   93.551  25.040 1.00 89.86  ? 165 VAL A CG2 1 
ATOM   986  N N   . PRO A 1 166 ? 11.210  91.288  22.891 1.00 90.70  ? 166 PRO A N   1 
ATOM   987  C CA  . PRO A 1 166 ? 12.080  90.571  21.949 1.00 99.24  ? 166 PRO A CA  1 
ATOM   988  C C   . PRO A 1 166 ? 12.901  91.416  20.967 1.00 100.76 ? 166 PRO A C   1 
ATOM   989  O O   . PRO A 1 166 ? 14.135  91.355  21.012 1.00 96.89  ? 166 PRO A O   1 
ATOM   990  C CB  . PRO A 1 166 ? 11.098  89.662  21.208 1.00 101.06 ? 166 PRO A CB  1 
ATOM   991  C CG  . PRO A 1 166 ? 9.718   90.052  21.768 1.00 101.06 ? 166 PRO A CG  1 
ATOM   992  C CD  . PRO A 1 166 ? 9.974   90.541  23.165 1.00 94.55  ? 166 PRO A CD  1 
ATOM   993  N N   . ASN A 1 167 ? 12.241  92.148  20.071 1.00 101.06 ? 167 ASN A N   1 
ATOM   994  C CA  . ASN A 1 167 ? 12.945  92.834  18.984 1.00 101.06 ? 167 ASN A CA  1 
ATOM   995  C C   . ASN A 1 167 ? 13.038  94.345  19.238 1.00 101.06 ? 167 ASN A C   1 
ATOM   996  O O   . ASN A 1 167 ? 13.623  95.077  18.435 1.00 101.06 ? 167 ASN A O   1 
ATOM   997  C CB  . ASN A 1 167 ? 12.269  92.562  17.620 1.00 101.06 ? 167 ASN A CB  1 
ATOM   998  C CG  . ASN A 1 167 ? 12.618  91.182  17.030 1.00 101.06 ? 167 ASN A CG  1 
ATOM   999  O OD1 . ASN A 1 167 ? 13.757  90.943  16.595 1.00 101.06 ? 167 ASN A OD1 1 
ATOM   1000 N ND2 . ASN A 1 167 ? 11.622  90.280  16.984 1.00 59.85  ? 167 ASN A ND2 1 
ATOM   1001 N N   . LEU A 1 168 ? 12.467  94.795  20.358 1.00 99.05  ? 168 LEU A N   1 
ATOM   1002 C CA  . LEU A 1 168 ? 12.123  96.205  20.581 1.00 92.11  ? 168 LEU A CA  1 
ATOM   1003 C C   . LEU A 1 168 ? 13.321  97.155  20.654 1.00 92.18  ? 168 LEU A C   1 
ATOM   1004 O O   . LEU A 1 168 ? 13.296  98.239  20.068 1.00 89.84  ? 168 LEU A O   1 
ATOM   1005 C CB  . LEU A 1 168 ? 11.216  96.370  21.809 1.00 89.63  ? 168 LEU A CB  1 
ATOM   1006 C CG  . LEU A 1 168 ? 10.461  97.697  21.955 1.00 94.06  ? 168 LEU A CG  1 
ATOM   1007 C CD1 . LEU A 1 168 ? 9.544   97.917  20.757 1.00 101.06 ? 168 LEU A CD1 1 
ATOM   1008 C CD2 . LEU A 1 168 ? 9.650   97.777  23.254 1.00 101.06 ? 168 LEU A CD2 1 
ATOM   1009 N N   . TRP A 1 169 ? 14.362  96.765  21.384 1.00 93.75  ? 169 TRP A N   1 
ATOM   1010 C CA  . TRP A 1 169 ? 15.544  97.610  21.506 1.00 85.35  ? 169 TRP A CA  1 
ATOM   1011 C C   . TRP A 1 169 ? 16.716  96.940  20.834 1.00 86.99  ? 169 TRP A C   1 
ATOM   1012 O O   . TRP A 1 169 ? 16.806  95.712  20.807 1.00 79.62  ? 169 TRP A O   1 
ATOM   1013 C CB  . TRP A 1 169 ? 15.916  97.853  22.970 1.00 89.46  ? 169 TRP A CB  1 
ATOM   1014 C CG  . TRP A 1 169 ? 14.963  98.721  23.698 1.00 66.65  ? 169 TRP A CG  1 
ATOM   1015 C CD1 . TRP A 1 169 ? 13.769  98.349  24.239 1.00 56.93  ? 169 TRP A CD1 1 
ATOM   1016 C CD2 . TRP A 1 169 ? 15.134  100.101 24.009 1.00 41.57  ? 169 TRP A CD2 1 
ATOM   1017 N NE1 . TRP A 1 169 ? 13.169  99.429  24.837 1.00 67.81  ? 169 TRP A NE1 1 
ATOM   1018 C CE2 . TRP A 1 169 ? 13.983  100.523 24.694 1.00 43.26  ? 169 TRP A CE2 1 
ATOM   1019 C CE3 . TRP A 1 169 ? 16.129  101.050 23.725 1.00 77.04  ? 169 TRP A CE3 1 
ATOM   1020 C CZ2 . TRP A 1 169 ? 13.815  101.841 25.154 1.00 75.01  ? 169 TRP A CZ2 1 
ATOM   1021 C CZ3 . TRP A 1 169 ? 15.961  102.360 24.168 1.00 66.31  ? 169 TRP A CZ3 1 
ATOM   1022 C CH2 . TRP A 1 169 ? 14.816  102.739 24.889 1.00 66.74  ? 169 TRP A CH2 1 
ATOM   1023 N N   . LYS A 1 170 ? 17.615  97.772  20.319 1.00 84.89  ? 170 LYS A N   1 
ATOM   1024 C CA  . LYS A 1 170 ? 18.913  97.346  19.829 1.00 83.86  ? 170 LYS A CA  1 
ATOM   1025 C C   . LYS A 1 170 ? 19.882  97.164  20.982 1.00 79.59  ? 170 LYS A C   1 
ATOM   1026 O O   . LYS A 1 170 ? 20.180  98.118  21.705 1.00 81.02  ? 170 LYS A O   1 
ATOM   1027 C CB  . LYS A 1 170 ? 19.477  98.400  18.873 1.00 82.92  ? 170 LYS A CB  1 
ATOM   1028 C CG  . LYS A 1 170 ? 18.451  99.030  17.951 1.00 101.06 ? 170 LYS A CG  1 
ATOM   1029 C CD  . LYS A 1 170 ? 19.118  99.975  16.951 1.00 101.06 ? 170 LYS A CD  1 
ATOM   1030 C CE  . LYS A 1 170 ? 18.081  100.631 16.027 1.00 101.06 ? 170 LYS A CE  1 
ATOM   1031 N NZ  . LYS A 1 170 ? 18.492  101.997 15.514 1.00 101.06 ? 170 LYS A NZ  1 
ATOM   1032 N N   . SER A 1 171 ? 20.419  95.956  21.119 1.00 79.53  ? 171 SER A N   1 
ATOM   1033 C CA  . SER A 1 171 ? 21.276  95.646  22.258 1.00 82.79  ? 171 SER A CA  1 
ATOM   1034 C C   . SER A 1 171 ? 22.350  96.717  22.490 1.00 73.46  ? 171 SER A C   1 
ATOM   1035 O O   . SER A 1 171 ? 22.725  97.016  23.629 1.00 76.02  ? 171 SER A O   1 
ATOM   1036 C CB  . SER A 1 171 ? 21.884  94.242  22.125 1.00 88.46  ? 171 SER A CB  1 
ATOM   1037 O OG  . SER A 1 171 ? 23.305  94.283  21.995 1.00 101.06 ? 171 SER A OG  1 
ATOM   1038 N N   . GLU A 1 172 ? 22.827  97.307  21.402 1.00 73.92  ? 172 GLU A N   1 
ATOM   1039 C CA  . GLU A 1 172 ? 23.949  98.227  21.465 1.00 75.80  ? 172 GLU A CA  1 
ATOM   1040 C C   . GLU A 1 172 ? 23.496  99.580  22.006 1.00 62.76  ? 172 GLU A C   1 
ATOM   1041 O O   . GLU A 1 172 ? 24.263  100.281 22.664 1.00 67.96  ? 172 GLU A O   1 
ATOM   1042 C CB  . GLU A 1 172 ? 24.626  98.370  20.085 1.00 86.05  ? 172 GLU A CB  1 
ATOM   1043 C CG  . GLU A 1 172 ? 24.937  97.038  19.393 1.00 101.06 ? 172 GLU A CG  1 
ATOM   1044 C CD  . GLU A 1 172 ? 26.315  96.981  18.715 1.00 101.06 ? 172 GLU A CD  1 
ATOM   1045 O OE1 . GLU A 1 172 ? 26.395  97.260  17.488 1.00 101.06 ? 172 GLU A OE1 1 
ATOM   1046 O OE2 . GLU A 1 172 ? 27.318  96.613  19.387 1.00 101.06 ? 172 GLU A OE2 1 
ATOM   1047 N N   . ASP A 1 173 ? 22.236  99.924  21.770 1.00 62.48  ? 173 ASP A N   1 
ATOM   1048 C CA  . ASP A 1 173 ? 21.666  101.151 22.330 1.00 65.60  ? 173 ASP A CA  1 
ATOM   1049 C C   . ASP A 1 173 ? 21.449  100.979 23.844 1.00 58.22  ? 173 ASP A C   1 
ATOM   1050 O O   . ASP A 1 173 ? 21.825  101.841 24.651 1.00 52.77  ? 173 ASP A O   1 
ATOM   1051 C CB  . ASP A 1 173 ? 20.346  101.530 21.616 1.00 68.05  ? 173 ASP A CB  1 
ATOM   1052 C CG  . ASP A 1 173 ? 20.569  102.350 20.334 1.00 90.61  ? 173 ASP A CG  1 
ATOM   1053 O OD1 . ASP A 1 173 ? 21.744  102.608 19.990 1.00 94.09  ? 173 ASP A OD1 1 
ATOM   1054 O OD2 . ASP A 1 173 ? 19.639  102.778 19.602 1.00 83.58  ? 173 ASP A OD2 1 
ATOM   1055 N N   . ILE A 1 174 ? 20.894  99.838  24.232 1.00 58.04  ? 174 ILE A N   1 
ATOM   1056 C CA  . ILE A 1 174 ? 20.803  99.533  25.651 1.00 59.75  ? 174 ILE A CA  1 
ATOM   1057 C C   . ILE A 1 174 ? 22.177  99.632  26.277 1.00 51.58  ? 174 ILE A C   1 
ATOM   1058 O O   . ILE A 1 174 ? 22.333  100.114 27.380 1.00 51.87  ? 174 ILE A O   1 
ATOM   1059 C CB  . ILE A 1 174 ? 20.290  98.135  25.881 1.00 60.49  ? 174 ILE A CB  1 
ATOM   1060 C CG1 . ILE A 1 174 ? 18.802  98.057  25.589 1.00 65.03  ? 174 ILE A CG1 1 
ATOM   1061 C CG2 . ILE A 1 174 ? 20.486  97.779  27.313 1.00 68.31  ? 174 ILE A CG2 1 
ATOM   1062 C CD1 . ILE A 1 174 ? 18.314  96.663  25.547 1.00 70.17  ? 174 ILE A CD1 1 
ATOM   1063 N N   . THR A 1 175 ? 23.194  99.241  25.537 1.00 51.02  ? 175 THR A N   1 
ATOM   1064 C CA  . THR A 1 175 ? 24.506  99.113  26.141 1.00 55.83  ? 175 THR A CA  1 
ATOM   1065 C C   . THR A 1 175 ? 25.003  100.530 26.345 1.00 48.62  ? 175 THR A C   1 
ATOM   1066 O O   . THR A 1 175 ? 25.599  100.869 27.367 1.00 58.74  ? 175 THR A O   1 
ATOM   1067 C CB  . THR A 1 175 ? 25.461  98.350  25.182 1.00 71.82  ? 175 THR A CB  1 
ATOM   1068 O OG1 . THR A 1 175 ? 25.049  96.984  25.033 1.00 60.38  ? 175 THR A OG1 1 
ATOM   1069 C CG2 . THR A 1 175 ? 26.835  98.234  25.781 1.00 56.16  ? 175 THR A CG2 1 
ATOM   1070 N N   . GLN A 1 176 ? 24.775  101.389 25.371 1.00 59.88  ? 176 GLN A N   1 
ATOM   1071 C CA  . GLN A 1 176 ? 25.355  102.724 25.515 1.00 68.71  ? 176 GLN A CA  1 
ATOM   1072 C C   . GLN A 1 176 ? 24.711  103.510 26.666 1.00 58.48  ? 176 GLN A C   1 
ATOM   1073 O O   . GLN A 1 176 ? 25.397  104.143 27.474 1.00 51.33  ? 176 GLN A O   1 
ATOM   1074 C CB  . GLN A 1 176 ? 25.297  103.504 24.206 1.00 69.87  ? 176 GLN A CB  1 
ATOM   1075 C CG  . GLN A 1 176 ? 26.245  102.950 23.131 1.00 87.08  ? 176 GLN A CG  1 
ATOM   1076 C CD  . GLN A 1 176 ? 25.790  103.311 21.727 1.00 101.06 ? 176 GLN A CD  1 
ATOM   1077 O OE1 . GLN A 1 176 ? 26.151  104.373 21.203 1.00 79.32  ? 176 GLN A OE1 1 
ATOM   1078 N NE2 . GLN A 1 176 ? 24.966  102.449 21.128 1.00 96.98  ? 176 GLN A NE2 1 
ATOM   1079 N N   . ILE A 1 177 ? 23.392  103.408 26.770 1.00 55.33  ? 177 ILE A N   1 
ATOM   1080 C CA  . ILE A 1 177 ? 22.696  104.067 27.851 1.00 44.05  ? 177 ILE A CA  1 
ATOM   1081 C C   . ILE A 1 177 ? 23.237  103.557 29.152 1.00 54.93  ? 177 ILE A C   1 
ATOM   1082 O O   . ILE A 1 177 ? 23.668  104.320 30.019 1.00 56.22  ? 177 ILE A O   1 
ATOM   1083 C CB  . ILE A 1 177 ? 21.238  103.759 27.793 1.00 48.15  ? 177 ILE A CB  1 
ATOM   1084 C CG1 . ILE A 1 177 ? 20.629  104.421 26.551 1.00 44.00  ? 177 ILE A CG1 1 
ATOM   1085 C CG2 . ILE A 1 177 ? 20.579  104.278 29.074 1.00 46.01  ? 177 ILE A CG2 1 
ATOM   1086 C CD1 . ILE A 1 177 ? 19.216  103.934 26.216 1.00 52.84  ? 177 ILE A CD1 1 
ATOM   1087 N N   . VAL A 1 178 ? 23.246  102.250 29.313 1.00 50.36  ? 178 VAL A N   1 
ATOM   1088 C CA  . VAL A 1 178 ? 23.493  101.802 30.657 1.00 64.43  ? 178 VAL A CA  1 
ATOM   1089 C C   . VAL A 1 178 ? 24.864  102.186 30.967 1.00 61.21  ? 178 VAL A C   1 
ATOM   1090 O O   . VAL A 1 178 ? 25.150  102.458 32.113 1.00 64.92  ? 178 VAL A O   1 
ATOM   1091 C CB  . VAL A 1 178 ? 23.889  100.409 30.765 1.00 61.06  ? 178 VAL A CB  1 
ATOM   1092 C CG1 . VAL A 1 178 ? 25.388  100.351 31.236 1.00 96.28  ? 178 VAL A CG1 1 
ATOM   1093 C CG2 . VAL A 1 178 ? 23.053  99.898  31.779 1.00 51.20  ? 178 VAL A CG2 1 
ATOM   1094 N N   . ALA A 1 179 ? 25.738  101.891 30.005 1.00 56.02  ? 179 ALA A N   1 
ATOM   1095 C CA  . ALA A 1 179 ? 27.170  101.924 30.258 1.00 67.04  ? 179 ALA A CA  1 
ATOM   1096 C C   . ALA A 1 179 ? 27.732  103.338 30.247 1.00 67.44  ? 179 ALA A C   1 
ATOM   1097 O O   . ALA A 1 179 ? 28.594  103.638 31.049 1.00 55.33  ? 179 ALA A O   1 
ATOM   1098 C CB  . ALA A 1 179 ? 27.923  101.047 29.284 1.00 68.48  ? 179 ALA A CB  1 
ATOM   1099 N N   . ASN A 1 180 ? 27.265  104.211 29.354 1.00 64.47  ? 180 ASN A N   1 
ATOM   1100 C CA  . ASN A 1 180 ? 27.872  105.527 29.241 1.00 68.53  ? 180 ASN A CA  1 
ATOM   1101 C C   . ASN A 1 180 ? 27.290  106.543 30.225 1.00 69.81  ? 180 ASN A C   1 
ATOM   1102 O O   . ASN A 1 180 ? 27.988  107.460 30.648 1.00 64.81  ? 180 ASN A O   1 
ATOM   1103 C CB  . ASN A 1 180 ? 27.772  106.025 27.804 1.00 73.43  ? 180 ASN A CB  1 
ATOM   1104 C CG  . ASN A 1 180 ? 28.731  105.300 26.866 1.00 89.75  ? 180 ASN A CG  1 
ATOM   1105 O OD1 . ASN A 1 180 ? 29.832  104.903 27.266 1.00 74.37  ? 180 ASN A OD1 1 
ATOM   1106 N ND2 . ASN A 1 180 ? 28.313  105.125 25.609 1.00 79.13  ? 180 ASN A ND2 1 
ATOM   1107 N N   . TYR A 1 181 ? 26.026  106.330 30.602 1.00 63.73  ? 181 TYR A N   1 
ATOM   1108 C CA  . TYR A 1 181 ? 25.252  107.201 31.500 1.00 60.43  ? 181 TYR A CA  1 
ATOM   1109 C C   . TYR A 1 181 ? 24.941  106.603 32.879 1.00 60.78  ? 181 TYR A C   1 
ATOM   1110 O O   . TYR A 1 181 ? 25.486  107.101 33.881 1.00 59.42  ? 181 TYR A O   1 
ATOM   1111 C CB  . TYR A 1 181 ? 23.994  107.718 30.784 1.00 54.70  ? 181 TYR A CB  1 
ATOM   1112 C CG  . TYR A 1 181 ? 24.443  108.379 29.514 1.00 49.04  ? 181 TYR A CG  1 
ATOM   1113 C CD1 . TYR A 1 181 ? 24.592  107.630 28.384 1.00 44.29  ? 181 TYR A CD1 1 
ATOM   1114 C CD2 . TYR A 1 181 ? 24.886  109.702 29.492 1.00 46.35  ? 181 TYR A CD2 1 
ATOM   1115 C CE1 . TYR A 1 181 ? 25.087  108.169 27.226 1.00 67.03  ? 181 TYR A CE1 1 
ATOM   1116 C CE2 . TYR A 1 181 ? 25.406  110.255 28.323 1.00 62.46  ? 181 TYR A CE2 1 
ATOM   1117 C CZ  . TYR A 1 181 ? 25.500  109.471 27.188 1.00 58.31  ? 181 TYR A CZ  1 
ATOM   1118 O OH  . TYR A 1 181 ? 25.994  109.946 25.981 1.00 65.22  ? 181 TYR A OH  1 
ATOM   1119 N N   . GLY A 1 182 ? 24.114  105.537 32.917 1.00 55.89  ? 182 GLY A N   1 
ATOM   1120 C CA  . GLY A 1 182 ? 23.653  104.923 34.157 1.00 55.38  ? 182 GLY A CA  1 
ATOM   1121 C C   . GLY A 1 182 ? 22.136  104.973 34.316 1.00 64.64  ? 182 GLY A C   1 
ATOM   1122 O O   . GLY A 1 182 ? 21.467  105.841 33.755 1.00 50.03  ? 182 GLY A O   1 
ATOM   1123 N N   . LEU A 1 183 ? 21.563  103.998 35.008 1.00 54.74  ? 183 LEU A N   1 
ATOM   1124 C CA  . LEU A 1 183 ? 20.153  104.094 35.327 1.00 51.21  ? 183 LEU A CA  1 
ATOM   1125 C C   . LEU A 1 183 ? 19.926  104.252 36.824 1.00 49.79  ? 183 LEU A C   1 
ATOM   1126 O O   . LEU A 1 183 ? 20.655  103.677 37.648 1.00 49.16  ? 183 LEU A O   1 
ATOM   1127 C CB  . LEU A 1 183 ? 19.381  102.905 34.798 1.00 46.07  ? 183 LEU A CB  1 
ATOM   1128 C CG  . LEU A 1 183 ? 19.371  102.671 33.290 1.00 59.91  ? 183 LEU A CG  1 
ATOM   1129 C CD1 . LEU A 1 183 ? 18.516  101.386 33.039 1.00 51.57  ? 183 LEU A CD1 1 
ATOM   1130 C CD2 . LEU A 1 183 ? 18.769  103.848 32.558 1.00 54.53  ? 183 LEU A CD2 1 
ATOM   1131 N N   . ILE A 1 184 ? 18.926  105.062 37.149 1.00 43.31  ? 184 ILE A N   1 
ATOM   1132 C CA  . ILE A 1 184 ? 18.339  105.132 38.480 1.00 42.45  ? 184 ILE A CA  1 
ATOM   1133 C C   . ILE A 1 184 ? 16.883  104.776 38.367 1.00 39.50  ? 184 ILE A C   1 
ATOM   1134 O O   . ILE A 1 184 ? 16.055  105.561 37.919 1.00 50.74  ? 184 ILE A O   1 
ATOM   1135 C CB  . ILE A 1 184 ? 18.523  106.537 39.078 1.00 50.27  ? 184 ILE A CB  1 
ATOM   1136 C CG1 . ILE A 1 184 ? 19.997  106.900 39.018 1.00 53.58  ? 184 ILE A CG1 1 
ATOM   1137 C CG2 . ILE A 1 184 ? 18.117  106.582 40.542 1.00 44.36  ? 184 ILE A CG2 1 
ATOM   1138 C CD1 . ILE A 1 184 ? 20.244  108.236 39.541 1.00 55.93  ? 184 ILE A CD1 1 
ATOM   1139 N N   . CYS A 1 185 ? 16.594  103.562 38.806 1.00 47.21  ? 185 CYS A N   1 
ATOM   1140 C CA  . CYS A 1 185 ? 15.286  102.934 38.723 1.00 45.69  ? 185 CYS A CA  1 
ATOM   1141 C C   . CYS A 1 185 ? 14.570  103.044 40.077 1.00 41.87  ? 185 CYS A C   1 
ATOM   1142 O O   . CYS A 1 185 ? 14.906  102.341 41.020 1.00 46.63  ? 185 CYS A O   1 
ATOM   1143 C CB  . CYS A 1 185 ? 15.490  101.455 38.382 1.00 43.47  ? 185 CYS A CB  1 
ATOM   1144 S SG  . CYS A 1 185 ? 13.965  100.631 37.895 1.00 56.45  ? 185 CYS A SG  1 
ATOM   1145 N N   . VAL A 1 186 ? 13.632  103.973 40.185 1.00 51.50  ? 186 VAL A N   1 
ATOM   1146 C CA  . VAL A 1 186 ? 12.846  104.096 41.395 1.00 39.84  ? 186 VAL A CA  1 
ATOM   1147 C C   . VAL A 1 186 ? 11.609  103.284 41.196 1.00 44.00  ? 186 VAL A C   1 
ATOM   1148 O O   . VAL A 1 186 ? 10.922  103.491 40.212 1.00 50.97  ? 186 VAL A O   1 
ATOM   1149 C CB  . VAL A 1 186 ? 12.381  105.529 41.650 1.00 43.43  ? 186 VAL A CB  1 
ATOM   1150 C CG1 . VAL A 1 186 ? 11.468  105.553 42.853 1.00 40.70  ? 186 VAL A CG1 1 
ATOM   1151 C CG2 . VAL A 1 186 ? 13.576  106.472 41.934 1.00 41.75  ? 186 VAL A CG2 1 
ATOM   1152 N N   . THR A 1 187 ? 11.275  102.411 42.151 1.00 40.79  ? 187 THR A N   1 
ATOM   1153 C CA  . THR A 1 187 ? 10.077  101.591 41.990 1.00 36.63  ? 187 THR A CA  1 
ATOM   1154 C C   . THR A 1 187 ? 9.590   100.983 43.308 1.00 37.10  ? 187 THR A C   1 
ATOM   1155 O O   . THR A 1 187 ? 10.338  100.875 44.282 1.00 38.34  ? 187 THR A O   1 
ATOM   1156 C CB  . THR A 1 187 ? 10.350  100.447 40.921 1.00 52.70  ? 187 THR A CB  1 
ATOM   1157 O OG1 . THR A 1 187 ? 9.397   99.378  41.060 1.00 60.58  ? 187 THR A OG1 1 
ATOM   1158 C CG2 . THR A 1 187 ? 11.639  99.723  41.268 1.00 53.10  ? 187 THR A CG2 1 
ATOM   1159 N N   . ARG A 1 188 ? 8.330   100.566 43.274 1.00 42.17  ? 188 ARG A N   1 
ATOM   1160 C CA  . ARG A 1 188 ? 7.635   99.906  44.373 1.00 68.48  ? 188 ARG A CA  1 
ATOM   1161 C C   . ARG A 1 188 ? 7.751   98.381  44.271 1.00 64.35  ? 188 ARG A C   1 
ATOM   1162 O O   . ARG A 1 188 ? 7.097   97.670  45.029 1.00 68.64  ? 188 ARG A O   1 
ATOM   1163 C CB  . ARG A 1 188 ? 6.148   100.281 44.306 1.00 61.91  ? 188 ARG A CB  1 
ATOM   1164 C CG  . ARG A 1 188 ? 5.535   100.838 45.585 1.00 60.94  ? 188 ARG A CG  1 
ATOM   1165 C CD  . ARG A 1 188 ? 4.035   100.586 45.699 1.00 71.64  ? 188 ARG A CD  1 
ATOM   1166 N NE  . ARG A 1 188 ? 3.707   99.240  46.178 1.00 92.19  ? 188 ARG A NE  1 
ATOM   1167 C CZ  . ARG A 1 188 ? 2.517   98.656  46.016 1.00 101.06 ? 188 ARG A CZ  1 
ATOM   1168 N NH1 . ARG A 1 188 ? 1.552   99.307  45.373 1.00 68.71  ? 188 ARG A NH1 1 
ATOM   1169 N NH2 . ARG A 1 188 ? 2.291   97.422  46.478 1.00 101.06 ? 188 ARG A NH2 1 
ATOM   1170 N N   . ALA A 1 189 ? 8.559   97.900  43.325 1.00 63.54  ? 189 ALA A N   1 
ATOM   1171 C CA  . ALA A 1 189 ? 8.661   96.464  42.982 1.00 65.36  ? 189 ALA A CA  1 
ATOM   1172 C C   . ALA A 1 189 ? 10.113  96.020  42.671 1.00 65.84  ? 189 ALA A C   1 
ATOM   1173 O O   . ALA A 1 189 ? 10.407  95.440  41.619 1.00 66.97  ? 189 ALA A O   1 
ATOM   1174 C CB  . ALA A 1 189 ? 7.746   96.138  41.780 1.00 62.16  ? 189 ALA A CB  1 
ATOM   1175 N N   . GLY A 1 190 ? 11.042  96.325  43.563 1.00 57.90  ? 190 GLY A N   1 
ATOM   1176 C CA  . GLY A 1 190 ? 12.403  96.544  43.111 1.00 77.23  ? 190 GLY A CA  1 
ATOM   1177 C C   . GLY A 1 190 ? 12.866  95.125  42.962 1.00 71.24  ? 190 GLY A C   1 
ATOM   1178 O O   . GLY A 1 190 ? 13.769  94.721  42.237 1.00 61.12  ? 190 GLY A O   1 
ATOM   1179 N N   . ASN A 1 191 ? 12.127  94.319  43.666 1.00 68.72  ? 191 ASN A N   1 
ATOM   1180 C CA  . ASN A 1 191 ? 12.216  92.913  43.501 1.00 82.56  ? 191 ASN A CA  1 
ATOM   1181 C C   . ASN A 1 191 ? 12.037  92.400  42.064 1.00 74.45  ? 191 ASN A C   1 
ATOM   1182 O O   . ASN A 1 191 ? 12.947  91.723  41.594 1.00 63.17  ? 191 ASN A O   1 
ATOM   1183 C CB  . ASN A 1 191 ? 11.405  92.376  44.664 1.00 86.28  ? 191 ASN A CB  1 
ATOM   1184 C CG  . ASN A 1 191 ? 11.600  93.306  45.892 1.00 101.06 ? 191 ASN A CG  1 
ATOM   1185 O OD1 . ASN A 1 191 ? 10.713  93.500  46.717 1.00 101.06 ? 191 ASN A OD1 1 
ATOM   1186 N ND2 . ASN A 1 191 ? 12.778  93.959  45.946 1.00 101.06 ? 191 ASN A ND2 1 
ATOM   1187 N N   . ASP A 1 192 ? 11.001  92.843  41.329 1.00 72.71  ? 192 ASP A N   1 
ATOM   1188 C CA  . ASP A 1 192 ? 10.935  92.713  39.848 1.00 52.54  ? 192 ASP A CA  1 
ATOM   1189 C C   . ASP A 1 192 ? 12.169  93.417  39.236 1.00 57.55  ? 192 ASP A C   1 
ATOM   1190 O O   . ASP A 1 192 ? 12.867  92.847  38.411 1.00 58.30  ? 192 ASP A O   1 
ATOM   1191 C CB  . ASP A 1 192 ? 9.621   93.272  39.255 1.00 66.06  ? 192 ASP A CB  1 
ATOM   1192 C CG  . ASP A 1 192 ? 8.384   92.533  39.735 1.00 75.47  ? 192 ASP A CG  1 
ATOM   1193 O OD1 . ASP A 1 192 ? 8.535   91.388  40.212 1.00 78.41  ? 192 ASP A OD1 1 
ATOM   1194 O OD2 . ASP A 1 192 ? 7.231   93.036  39.691 1.00 69.60  ? 192 ASP A OD2 1 
ATOM   1195 N N   . ALA A 1 193 ? 12.492  94.638  39.651 1.00 44.05  ? 193 ALA A N   1 
ATOM   1196 C CA  . ALA A 1 193 ? 13.618  95.334  39.031 1.00 44.62  ? 193 ALA A CA  1 
ATOM   1197 C C   . ALA A 1 193 ? 14.841  94.418  39.035 1.00 45.71  ? 193 ALA A C   1 
ATOM   1198 O O   . ALA A 1 193 ? 15.437  94.159  37.983 1.00 43.22  ? 193 ALA A O   1 
ATOM   1199 C CB  . ALA A 1 193 ? 13.907  96.636  39.706 1.00 39.75  ? 193 ALA A CB  1 
ATOM   1200 N N   . GLN A 1 194 ? 15.239  93.929  40.195 1.00 47.21  ? 194 GLN A N   1 
ATOM   1201 C CA  . GLN A 1 194 ? 16.479  93.139  40.277 1.00 47.30  ? 194 GLN A CA  1 
ATOM   1202 C C   . GLN A 1 194 ? 16.435  91.909  39.392 1.00 50.43  ? 194 GLN A C   1 
ATOM   1203 O O   . GLN A 1 194 ? 17.440  91.476  38.869 1.00 47.21  ? 194 GLN A O   1 
ATOM   1204 C CB  . GLN A 1 194 ? 16.749  92.624  41.686 1.00 50.81  ? 194 GLN A CB  1 
ATOM   1205 C CG  . GLN A 1 194 ? 16.577  93.596  42.816 1.00 66.26  ? 194 GLN A CG  1 
ATOM   1206 C CD  . GLN A 1 194 ? 17.765  94.452  43.005 1.00 73.07  ? 194 GLN A CD  1 
ATOM   1207 O OE1 . GLN A 1 194 ? 18.684  94.423  42.186 1.00 75.87  ? 194 GLN A OE1 1 
ATOM   1208 N NE2 . GLN A 1 194 ? 17.753  95.256  44.062 1.00 90.00  ? 194 GLN A NE2 1 
ATOM   1209 N N   . LYS A 1 195 ? 15.263  91.312  39.276 1.00 44.24  ? 195 LYS A N   1 
ATOM   1210 C CA  . LYS A 1 195 ? 15.112  90.152  38.443 1.00 50.88  ? 195 LYS A CA  1 
ATOM   1211 C C   . LYS A 1 195 ? 15.365  90.502  36.967 1.00 56.87  ? 195 LYS A C   1 
ATOM   1212 O O   . LYS A 1 195 ? 16.084  89.772  36.285 1.00 48.13  ? 195 LYS A O   1 
ATOM   1213 C CB  . LYS A 1 195 ? 13.722  89.568  38.652 1.00 54.15  ? 195 LYS A CB  1 
ATOM   1214 C CG  . LYS A 1 195 ? 13.383  88.436  37.730 1.00 48.87  ? 195 LYS A CG  1 
ATOM   1215 C CD  . LYS A 1 195 ? 12.213  87.636  38.229 1.00 81.87  ? 195 LYS A CD  1 
ATOM   1216 C CE  . LYS A 1 195 ? 12.610  86.164  38.397 1.00 101.06 ? 195 LYS A CE  1 
ATOM   1217 N NZ  . LYS A 1 195 ? 12.488  85.386  37.129 1.00 95.06  ? 195 LYS A NZ  1 
ATOM   1218 N N   . PHE A 1 196 ? 14.814  91.609  36.456 1.00 51.11  ? 196 PHE A N   1 
ATOM   1219 C CA  . PHE A 1 196 ? 15.105  91.900  35.062 1.00 47.76  ? 196 PHE A CA  1 
ATOM   1220 C C   . PHE A 1 196 ? 16.584  92.093  34.883 1.00 48.17  ? 196 PHE A C   1 
ATOM   1221 O O   . PHE A 1 196 ? 17.135  91.721  33.855 1.00 54.57  ? 196 PHE A O   1 
ATOM   1222 C CB  . PHE A 1 196 ? 14.426  93.139  34.514 1.00 52.82  ? 196 PHE A CB  1 
ATOM   1223 C CG  . PHE A 1 196 ? 12.950  93.095  34.566 1.00 51.21  ? 196 PHE A CG  1 
ATOM   1224 C CD1 . PHE A 1 196 ? 12.330  94.069  35.319 1.00 56.17  ? 196 PHE A CD1 1 
ATOM   1225 C CD2 . PHE A 1 196 ? 12.168  92.154  33.895 1.00 63.70  ? 196 PHE A CD2 1 
ATOM   1226 C CE1 . PHE A 1 196 ? 10.971  94.144  35.431 1.00 50.14  ? 196 PHE A CE1 1 
ATOM   1227 C CE2 . PHE A 1 196 ? 10.774  92.214  34.026 1.00 86.43  ? 196 PHE A CE2 1 
ATOM   1228 C CZ  . PHE A 1 196 ? 10.186  93.218  34.789 1.00 68.76  ? 196 PHE A CZ  1 
ATOM   1229 N N   . ILE A 1 197 ? 17.229  92.717  35.856 1.00 33.39  ? 197 ILE A N   1 
ATOM   1230 C CA  . ILE A 1 197 ? 18.656  92.872  35.723 1.00 45.03  ? 197 ILE A CA  1 
ATOM   1231 C C   . ILE A 1 197 ? 19.352  91.509  35.630 1.00 48.41  ? 197 ILE A C   1 
ATOM   1232 O O   . ILE A 1 197 ? 20.199  91.278  34.780 1.00 49.11  ? 197 ILE A O   1 
ATOM   1233 C CB  . ILE A 1 197 ? 19.210  93.794  36.791 1.00 41.51  ? 197 ILE A CB  1 
ATOM   1234 C CG1 . ILE A 1 197 ? 18.691  95.202  36.489 1.00 56.70  ? 197 ILE A CG1 1 
ATOM   1235 C CG2 . ILE A 1 197 ? 20.778  93.837  36.751 1.00 40.63  ? 197 ILE A CG2 1 
ATOM   1236 C CD1 . ILE A 1 197 ? 18.858  96.206  37.623 1.00 40.15  ? 197 ILE A CD1 1 
ATOM   1237 N N   . TYR A 1 198 ? 18.894  90.552  36.415 1.00 46.19  ? 198 TYR A N   1 
ATOM   1238 C CA  . TYR A 1 198 ? 19.596  89.292  36.460 1.00 50.36  ? 198 TYR A CA  1 
ATOM   1239 C C   . TYR A 1 198 ? 19.344  88.498  35.173 1.00 53.25  ? 198 TYR A C   1 
ATOM   1240 O O   . TYR A 1 198 ? 20.206  87.760  34.704 1.00 49.04  ? 198 TYR A O   1 
ATOM   1241 C CB  . TYR A 1 198 ? 19.211  88.523  37.724 1.00 45.99  ? 198 TYR A CB  1 
ATOM   1242 C CG  . TYR A 1 198 ? 19.358  87.038  37.573 1.00 42.99  ? 198 TYR A CG  1 
ATOM   1243 C CD1 . TYR A 1 198 ? 20.588  86.430  37.750 1.00 45.77  ? 198 TYR A CD1 1 
ATOM   1244 C CD2 . TYR A 1 198 ? 18.284  86.254  37.202 1.00 44.00  ? 198 TYR A CD2 1 
ATOM   1245 C CE1 . TYR A 1 198 ? 20.759  85.075  37.574 1.00 36.10  ? 198 TYR A CE1 1 
ATOM   1246 C CE2 . TYR A 1 198 ? 18.451  84.883  37.011 1.00 61.71  ? 198 TYR A CE2 1 
ATOM   1247 C CZ  . TYR A 1 198 ? 19.709  84.326  37.181 1.00 46.81  ? 198 TYR A CZ  1 
ATOM   1248 O OH  . TYR A 1 198 ? 19.897  82.982  37.038 1.00 59.63  ? 198 TYR A OH  1 
ATOM   1249 N N   . GLU A 1 199 ? 18.163  88.676  34.597 1.00 46.81  ? 199 GLU A N   1 
ATOM   1250 C CA  . GLU A 1 199 ? 17.777  88.015  33.359 1.00 51.42  ? 199 GLU A CA  1 
ATOM   1251 C C   . GLU A 1 199 ? 18.362  88.547  32.049 1.00 52.13  ? 199 GLU A C   1 
ATOM   1252 O O   . GLU A 1 199 ? 18.220  87.894  31.022 1.00 50.30  ? 199 GLU A O   1 
ATOM   1253 C CB  . GLU A 1 199 ? 16.247  87.932  33.259 1.00 46.73  ? 199 GLU A CB  1 
ATOM   1254 C CG  . GLU A 1 199 ? 15.626  86.998  34.283 1.00 72.56  ? 199 GLU A CG  1 
ATOM   1255 C CD  . GLU A 1 199 ? 14.108  86.966  34.206 1.00 93.28  ? 199 GLU A CD  1 
ATOM   1256 O OE1 . GLU A 1 199 ? 13.543  85.890  34.486 1.00 77.38  ? 199 GLU A OE1 1 
ATOM   1257 O OE2 . GLU A 1 199 ? 13.483  88.007  33.888 1.00 88.48  ? 199 GLU A OE2 1 
ATOM   1258 N N   . SER A 1 200 ? 19.079  89.673  32.069 1.00 49.14  ? 200 SER A N   1 
ATOM   1259 C CA  . SER A 1 200 ? 19.605  90.232  30.822 1.00 44.66  ? 200 SER A CA  1 
ATOM   1260 C C   . SER A 1 200 ? 21.095  90.372  30.937 1.00 47.80  ? 200 SER A C   1 
ATOM   1261 O O   . SER A 1 200 ? 21.579  91.035  31.858 1.00 49.60  ? 200 SER A O   1 
ATOM   1262 C CB  . SER A 1 200 ? 19.007  91.624  30.499 1.00 36.77  ? 200 SER A CB  1 
ATOM   1263 O OG  . SER A 1 200 ? 20.082  92.448  29.996 1.00 53.15  ? 200 SER A OG  1 
ATOM   1264 N N   . ASP A 1 201 ? 21.834  89.800  29.992 1.00 41.02  ? 201 ASP A N   1 
ATOM   1265 C CA  . ASP A 1 201 ? 23.297  89.870  30.062 1.00 48.59  ? 201 ASP A CA  1 
ATOM   1266 C C   . ASP A 1 201 ? 23.792  91.280  29.952 1.00 48.84  ? 201 ASP A C   1 
ATOM   1267 O O   . ASP A 1 201 ? 24.770  91.667  30.596 1.00 50.53  ? 201 ASP A O   1 
ATOM   1268 C CB  . ASP A 1 201 ? 23.890  89.002  28.970 1.00 48.27  ? 201 ASP A CB  1 
ATOM   1269 C CG  . ASP A 1 201 ? 23.226  87.657  28.955 1.00 88.89  ? 201 ASP A CG  1 
ATOM   1270 O OD1 . ASP A 1 201 ? 22.002  87.667  28.707 1.00 101.06 ? 201 ASP A OD1 1 
ATOM   1271 O OD2 . ASP A 1 201 ? 23.767  86.589  29.310 1.00 86.43  ? 201 ASP A OD2 1 
ATOM   1272 N N   . VAL A 1 202 ? 23.097  92.061  29.136 1.00 52.84  ? 202 VAL A N   1 
ATOM   1273 C CA  . VAL A 1 202 ? 23.563  93.403  28.902 1.00 53.29  ? 202 VAL A CA  1 
ATOM   1274 C C   . VAL A 1 202 ? 23.333  94.133  30.190 1.00 46.84  ? 202 VAL A C   1 
ATOM   1275 O O   . VAL A 1 202 ? 24.230  94.764  30.688 1.00 41.67  ? 202 VAL A O   1 
ATOM   1276 C CB  . VAL A 1 202 ? 22.803  94.130  27.787 1.00 68.86  ? 202 VAL A CB  1 
ATOM   1277 C CG1 . VAL A 1 202 ? 23.440  95.489  27.570 1.00 73.00  ? 202 VAL A CG1 1 
ATOM   1278 C CG2 . VAL A 1 202 ? 22.821  93.315  26.496 1.00 76.99  ? 202 VAL A CG2 1 
ATOM   1279 N N   . LEU A 1 203 ? 22.152  94.033  30.778 1.00 46.72  ? 203 LEU A N   1 
ATOM   1280 C CA  . LEU A 1 203 ? 22.033  94.709  32.062 1.00 37.92  ? 203 LEU A CA  1 
ATOM   1281 C C   . LEU A 1 203 ? 22.942  94.203  33.169 1.00 52.45  ? 203 LEU A C   1 
ATOM   1282 O O   . LEU A 1 203 ? 23.587  95.039  33.871 1.00 39.75  ? 203 LEU A O   1 
ATOM   1283 C CB  . LEU A 1 203 ? 20.568  94.688  32.537 1.00 39.08  ? 203 LEU A CB  1 
ATOM   1284 C CG  . LEU A 1 203 ? 19.472  95.367  31.698 1.00 49.22  ? 203 LEU A CG  1 
ATOM   1285 C CD1 . LEU A 1 203 ? 18.148  95.380  32.482 1.00 58.19  ? 203 LEU A CD1 1 
ATOM   1286 C CD2 . LEU A 1 203 ? 19.997  96.788  31.307 1.00 36.54  ? 203 LEU A CD2 1 
ATOM   1287 N N   . TRP A 1 204 ? 23.011  92.868  33.315 1.00 45.48  ? 204 TRP A N   1 
ATOM   1288 C CA  . TRP A 1 204 ? 23.845  92.314  34.367 1.00 47.55  ? 204 TRP A CA  1 
ATOM   1289 C C   . TRP A 1 204 ? 25.253  92.826  34.136 1.00 47.46  ? 204 TRP A C   1 
ATOM   1290 O O   . TRP A 1 204 ? 25.925  93.248  35.063 1.00 48.30  ? 204 TRP A O   1 
ATOM   1291 C CB  . TRP A 1 204 ? 23.809  90.775  34.413 1.00 59.46  ? 204 TRP A CB  1 
ATOM   1292 C CG  . TRP A 1 204 ? 24.696  90.197  35.491 1.00 60.80  ? 204 TRP A CG  1 
ATOM   1293 C CD1 . TRP A 1 204 ? 25.997  89.837  35.367 1.00 56.93  ? 204 TRP A CD1 1 
ATOM   1294 C CD2 . TRP A 1 204 ? 24.351  89.983  36.866 1.00 45.72  ? 204 TRP A CD2 1 
ATOM   1295 N NE1 . TRP A 1 204 ? 26.483  89.394  36.572 1.00 53.00  ? 204 TRP A NE1 1 
ATOM   1296 C CE2 . TRP A 1 204 ? 25.493  89.485  37.514 1.00 51.18  ? 204 TRP A CE2 1 
ATOM   1297 C CE3 . TRP A 1 204 ? 23.183  90.180  37.626 1.00 79.37  ? 204 TRP A CE3 1 
ATOM   1298 C CZ2 . TRP A 1 204 ? 25.504  89.151  38.886 1.00 66.22  ? 204 TRP A CZ2 1 
ATOM   1299 C CZ3 . TRP A 1 204 ? 23.193  89.871  39.013 1.00 55.27  ? 204 TRP A CZ3 1 
ATOM   1300 C CH2 . TRP A 1 204 ? 24.343  89.342  39.615 1.00 59.64  ? 204 TRP A CH2 1 
ATOM   1301 N N   . LYS A 1 205 ? 25.707  92.835  32.892 1.00 50.63  ? 205 LYS A N   1 
ATOM   1302 C CA  . LYS A 1 205 ? 27.105  93.220  32.708 1.00 57.37  ? 205 LYS A CA  1 
ATOM   1303 C C   . LYS A 1 205 ? 27.300  94.606  33.318 1.00 56.24  ? 205 LYS A C   1 
ATOM   1304 O O   . LYS A 1 205 ? 28.382  94.933  33.838 1.00 54.78  ? 205 LYS A O   1 
ATOM   1305 C CB  . LYS A 1 205 ? 27.545  93.187  31.238 1.00 66.09  ? 205 LYS A CB  1 
ATOM   1306 C CG  . LYS A 1 205 ? 29.057  93.175  31.020 1.00 65.82  ? 205 LYS A CG  1 
ATOM   1307 C CD  . LYS A 1 205 ? 29.450  92.972  29.538 1.00 100.29 ? 205 LYS A CD  1 
ATOM   1308 C CE  . LYS A 1 205 ? 30.850  93.543  29.223 1.00 101.06 ? 205 LYS A CE  1 
ATOM   1309 N NZ  . LYS A 1 205 ? 31.102  93.835  27.773 1.00 90.72  ? 205 LYS A NZ  1 
ATOM   1310 N N   . HIS A 1 206 ? 26.273  95.451  33.270 1.00 48.18  ? 206 HIS A N   1 
ATOM   1311 C CA  . HIS A 1 206 ? 26.644  96.822  33.570 1.00 51.84  ? 206 HIS A CA  1 
ATOM   1312 C C   . HIS A 1 206 ? 25.982  97.226  34.866 1.00 49.92  ? 206 HIS A C   1 
ATOM   1313 O O   . HIS A 1 206 ? 25.876  98.423  35.184 1.00 53.41  ? 206 HIS A O   1 
ATOM   1314 C CB  . HIS A 1 206 ? 26.293  97.740  32.395 1.00 61.03  ? 206 HIS A CB  1 
ATOM   1315 C CG  . HIS A 1 206 ? 27.212  97.593  31.214 1.00 73.10  ? 206 HIS A CG  1 
ATOM   1316 N ND1 . HIS A 1 206 ? 26.838  96.953  30.049 1.00 56.82  ? 206 HIS A ND1 1 
ATOM   1317 C CD2 . HIS A 1 206 ? 28.494  97.999  31.024 1.00 57.42  ? 206 HIS A CD2 1 
ATOM   1318 C CE1 . HIS A 1 206 ? 27.834  97.009  29.182 1.00 56.12  ? 206 HIS A CE1 1 
ATOM   1319 N NE2 . HIS A 1 206 ? 28.857  97.621  29.755 1.00 51.75  ? 206 HIS A NE2 1 
ATOM   1320 N N   . ARG A 1 207 ? 25.524  96.208  35.597 1.00 45.29  ? 207 ARG A N   1 
ATOM   1321 C CA  . ARG A 1 207 ? 24.783  96.395  36.849 1.00 54.22  ? 207 ARG A CA  1 
ATOM   1322 C C   . ARG A 1 207 ? 25.406  97.392  37.827 1.00 61.25  ? 207 ARG A C   1 
ATOM   1323 O O   . ARG A 1 207 ? 24.693  98.044  38.586 1.00 51.62  ? 207 ARG A O   1 
ATOM   1324 C CB  . ARG A 1 207 ? 24.408  95.057  37.532 1.00 53.95  ? 207 ARG A CB  1 
ATOM   1325 C CG  . ARG A 1 207 ? 25.478  94.434  38.448 1.00 57.72  ? 207 ARG A CG  1 
ATOM   1326 C CD  . ARG A 1 207 ? 25.477  92.880  38.490 1.00 55.23  ? 207 ARG A CD  1 
ATOM   1327 N NE  . ARG A 1 207 ? 26.676  92.357  39.161 1.00 48.27  ? 207 ARG A NE  1 
ATOM   1328 C CZ  . ARG A 1 207 ? 27.857  92.117  38.574 1.00 63.99  ? 207 ARG A CZ  1 
ATOM   1329 N NH1 . ARG A 1 207 ? 28.020  92.263  37.252 1.00 51.50  ? 207 ARG A NH1 1 
ATOM   1330 N NH2 . ARG A 1 207 ? 28.857  91.624  39.305 1.00 60.99  ? 207 ARG A NH2 1 
ATOM   1331 N N   . SER A 1 208 ? 26.724  97.536  37.821 1.00 53.09  ? 208 SER A N   1 
ATOM   1332 C CA  . SER A 1 208 ? 27.300  98.338  38.875 1.00 60.38  ? 208 SER A CA  1 
ATOM   1333 C C   . SER A 1 208 ? 26.875  99.765  38.592 1.00 61.79  ? 208 SER A C   1 
ATOM   1334 O O   . SER A 1 208 ? 27.010  100.655 39.426 1.00 60.20  ? 208 SER A O   1 
ATOM   1335 C CB  . SER A 1 208 ? 28.829  98.212  38.933 1.00 74.77  ? 208 SER A CB  1 
ATOM   1336 O OG  . SER A 1 208 ? 29.451  98.768  37.783 1.00 79.13  ? 208 SER A OG  1 
ATOM   1337 N N   . ASN A 1 209 ? 26.309  99.969  37.420 1.00 49.64  ? 209 ASN A N   1 
ATOM   1338 C CA  . ASN A 1 209 ? 25.869  101.299 36.978 1.00 50.91  ? 209 ASN A CA  1 
ATOM   1339 C C   . ASN A 1 209 ? 24.336  101.487 36.976 1.00 55.63  ? 209 ASN A C   1 
ATOM   1340 O O   . ASN A 1 209 ? 23.855  102.468 36.425 1.00 55.20  ? 209 ASN A O   1 
ATOM   1341 C CB  . ASN A 1 209 ? 26.328  101.521 35.533 1.00 58.10  ? 209 ASN A CB  1 
ATOM   1342 C CG  . ASN A 1 209 ? 26.803  102.936 35.231 1.00 76.84  ? 209 ASN A CG  1 
ATOM   1343 O OD1 . ASN A 1 209 ? 27.263  103.672 36.087 1.00 69.22  ? 209 ASN A OD1 1 
ATOM   1344 N ND2 . ASN A 1 209 ? 26.757  103.287 33.952 1.00 76.73  ? 209 ASN A ND2 1 
ATOM   1345 N N   . ILE A 1 210 ? 23.562  100.584 37.576 1.00 49.64  ? 210 ILE A N   1 
ATOM   1346 C CA  . ILE A 1 210 ? 22.096  100.721 37.628 1.00 48.98  ? 210 ILE A CA  1 
ATOM   1347 C C   . ILE A 1 210 ? 21.813  100.811 39.134 1.00 50.75  ? 210 ILE A C   1 
ATOM   1348 O O   . ILE A 1 210 ? 22.467  100.105 39.868 1.00 52.72  ? 210 ILE A O   1 
ATOM   1349 C CB  . ILE A 1 210 ? 21.584  99.418  37.141 1.00 42.73  ? 210 ILE A CB  1 
ATOM   1350 C CG1 . ILE A 1 210 ? 21.963  99.185  35.672 1.00 49.95  ? 210 ILE A CG1 1 
ATOM   1351 C CG2 . ILE A 1 210 ? 20.080  99.298  37.331 1.00 42.04  ? 210 ILE A CG2 1 
ATOM   1352 C CD1 . ILE A 1 210 ? 21.055  98.119  34.951 1.00 51.59  ? 210 ILE A CD1 1 
ATOM   1353 N N   . HIS A 1 211 ? 21.010  101.752 39.613 1.00 56.74  ? 211 HIS A N   1 
ATOM   1354 C CA  . HIS A 1 211 ? 20.703  101.804 41.042 1.00 49.61  ? 211 HIS A CA  1 
ATOM   1355 C C   . HIS A 1 211 ? 19.210  101.572 41.191 1.00 47.60  ? 211 HIS A C   1 
ATOM   1356 O O   . HIS A 1 211 ? 18.397  102.268 40.613 1.00 54.57  ? 211 HIS A O   1 
ATOM   1357 C CB  . HIS A 1 211 ? 21.057  103.162 41.598 1.00 55.03  ? 211 HIS A CB  1 
ATOM   1358 C CG  . HIS A 1 211 ? 22.521  103.433 41.617 1.00 46.65  ? 211 HIS A CG  1 
ATOM   1359 N ND1 . HIS A 1 211 ? 23.317  103.108 42.694 1.00 73.56  ? 211 HIS A ND1 1 
ATOM   1360 C CD2 . HIS A 1 211 ? 23.341  103.971 40.687 1.00 68.95  ? 211 HIS A CD2 1 
ATOM   1361 C CE1 . HIS A 1 211 ? 24.566  103.444 42.429 1.00 71.71  ? 211 HIS A CE1 1 
ATOM   1362 N NE2 . HIS A 1 211 ? 24.605  103.989 41.225 1.00 60.43  ? 211 HIS A NE2 1 
ATOM   1363 N N   . VAL A 1 212 ? 18.849  100.522 41.889 1.00 43.28  ? 212 VAL A N   1 
ATOM   1364 C CA  . VAL A 1 212 ? 17.462  100.238 42.106 1.00 46.82  ? 212 VAL A CA  1 
ATOM   1365 C C   . VAL A 1 212 ? 17.018  100.878 43.402 1.00 50.68  ? 212 VAL A C   1 
ATOM   1366 O O   . VAL A 1 212 ? 17.596  100.641 44.460 1.00 47.98  ? 212 VAL A O   1 
ATOM   1367 C CB  . VAL A 1 212 ? 17.302  98.761  42.214 1.00 46.38  ? 212 VAL A CB  1 
ATOM   1368 C CG1 . VAL A 1 212 ? 15.845  98.422  42.438 1.00 41.67  ? 212 VAL A CG1 1 
ATOM   1369 C CG2 . VAL A 1 212 ? 17.854  98.171  40.949 1.00 44.16  ? 212 VAL A CG2 1 
ATOM   1370 N N   . VAL A 1 213 ? 16.014  101.729 43.316 1.00 50.06  ? 213 VAL A N   1 
ATOM   1371 C CA  . VAL A 1 213 ? 15.597  102.477 44.492 1.00 38.15  ? 213 VAL A CA  1 
ATOM   1372 C C   . VAL A 1 213 ? 14.205  102.071 44.952 1.00 39.45  ? 213 VAL A C   1 
ATOM   1373 O O   . VAL A 1 213 ? 13.240  102.229 44.201 1.00 45.95  ? 213 VAL A O   1 
ATOM   1374 C CB  . VAL A 1 213 ? 15.629  104.002 44.230 1.00 58.58  ? 213 VAL A CB  1 
ATOM   1375 C CG1 . VAL A 1 213 ? 15.199  104.739 45.465 1.00 42.28  ? 213 VAL A CG1 1 
ATOM   1376 C CG2 . VAL A 1 213 ? 17.020  104.423 43.817 1.00 41.64  ? 213 VAL A CG2 1 
ATOM   1377 N N   . ASN A 1 214 ? 14.083  101.649 46.209 1.00 40.48  ? 214 ASN A N   1 
ATOM   1378 C CA  . ASN A 1 214 ? 12.766  101.289 46.715 1.00 46.70  ? 214 ASN A CA  1 
ATOM   1379 C C   . ASN A 1 214 ? 11.872  102.462 47.116 1.00 37.42  ? 214 ASN A C   1 
ATOM   1380 O O   . ASN A 1 214 ? 12.304  103.326 47.855 1.00 43.78  ? 214 ASN A O   1 
ATOM   1381 C CB  . ASN A 1 214 ? 12.871  100.257 47.861 1.00 38.59  ? 214 ASN A CB  1 
ATOM   1382 C CG  . ASN A 1 214 ? 13.470  98.921  47.400 1.00 60.65  ? 214 ASN A CG  1 
ATOM   1383 O OD1 . ASN A 1 214 ? 12.854  98.214  46.619 1.00 46.79  ? 214 ASN A OD1 1 
ATOM   1384 N ND2 . ASN A 1 214 ? 14.700  98.615  47.838 1.00 43.49  ? 214 ASN A ND2 1 
ATOM   1385 N N   . GLU A 1 215 ? 10.607  102.421 46.724 1.00 43.86  ? 215 GLU A N   1 
ATOM   1386 C CA  . GLU A 1 215 ? 9.626   103.341 47.277 1.00 50.97  ? 215 GLU A CA  1 
ATOM   1387 C C   . GLU A 1 215 ? 8.773   102.613 48.301 1.00 30.05  ? 215 GLU A C   1 
ATOM   1388 O O   . GLU A 1 215 ? 7.972   101.775 47.936 1.00 42.70  ? 215 GLU A O   1 
ATOM   1389 C CB  . GLU A 1 215 ? 8.695   103.895 46.173 1.00 30.12  ? 215 GLU A CB  1 
ATOM   1390 C CG  . GLU A 1 215 ? 7.440   104.584 46.733 1.00 39.67  ? 215 GLU A CG  1 
ATOM   1391 C CD  . GLU A 1 215 ? 7.740   105.967 47.343 1.00 89.04  ? 215 GLU A CD  1 
ATOM   1392 O OE1 . GLU A 1 215 ? 7.564   106.975 46.613 1.00 64.78  ? 215 GLU A OE1 1 
ATOM   1393 O OE2 . GLU A 1 215 ? 8.148   106.069 48.544 1.00 54.61  ? 215 GLU A OE2 1 
ATOM   1394 N N   . TRP A 1 216 ? 8.888   103.003 49.557 1.00 43.48  ? 216 TRP A N   1 
ATOM   1395 C CA  . TRP A 1 216 ? 8.172   102.366 50.653 1.00 35.77  ? 216 TRP A CA  1 
ATOM   1396 C C   . TRP A 1 216 ? 6.829   103.022 50.831 1.00 44.39  ? 216 TRP A C   1 
ATOM   1397 O O   . TRP A 1 216 ? 5.970   102.476 51.514 1.00 49.57  ? 216 TRP A O   1 
ATOM   1398 C CB  . TRP A 1 216 ? 9.005   102.429 51.937 1.00 37.40  ? 216 TRP A CB  1 
ATOM   1399 C CG  . TRP A 1 216 ? 10.258  101.712 51.711 1.00 39.18  ? 216 TRP A CG  1 
ATOM   1400 C CD1 . TRP A 1 216 ? 11.493  102.250 51.466 1.00 47.33  ? 216 TRP A CD1 1 
ATOM   1401 C CD2 . TRP A 1 216 ? 10.383  100.319 51.520 1.00 29.26  ? 216 TRP A CD2 1 
ATOM   1402 N NE1 . TRP A 1 216 ? 12.392  101.249 51.211 1.00 43.37  ? 216 TRP A NE1 1 
ATOM   1403 C CE2 . TRP A 1 216 ? 11.730  100.051 51.240 1.00 28.60  ? 216 TRP A CE2 1 
ATOM   1404 C CE3 . TRP A 1 216 ? 9.487   99.244  51.614 1.00 49.48  ? 216 TRP A CE3 1 
ATOM   1405 C CZ2 . TRP A 1 216 ? 12.204  98.764  51.031 1.00 43.96  ? 216 TRP A CZ2 1 
ATOM   1406 C CZ3 . TRP A 1 216 ? 9.949   97.966  51.377 1.00 56.32  ? 216 TRP A CZ3 1 
ATOM   1407 C CH2 . TRP A 1 216 ? 11.285  97.740  51.052 1.00 48.14  ? 216 TRP A CH2 1 
ATOM   1408 N N   . PHE A 1 217 ? 6.605   104.149 50.151 1.00 40.08  ? 217 PHE A N   1 
ATOM   1409 C CA  . PHE A 1 217 ? 5.286   104.774 50.202 1.00 44.45  ? 217 PHE A CA  1 
ATOM   1410 C C   . PHE A 1 217 ? 4.584   104.644 48.895 1.00 50.73  ? 217 PHE A C   1 
ATOM   1411 O O   . PHE A 1 217 ? 4.823   105.464 48.033 1.00 54.84  ? 217 PHE A O   1 
ATOM   1412 C CB  . PHE A 1 217 ? 5.446   106.269 50.239 1.00 60.26  ? 217 PHE A CB  1 
ATOM   1413 C CG  . PHE A 1 217 ? 5.707   106.819 51.560 1.00 63.94  ? 217 PHE A CG  1 
ATOM   1414 C CD1 . PHE A 1 217 ? 6.972   106.771 52.095 1.00 68.85  ? 217 PHE A CD1 1 
ATOM   1415 C CD2 . PHE A 1 217 ? 4.725   107.507 52.222 1.00 101.06 ? 217 PHE A CD2 1 
ATOM   1416 C CE1 . PHE A 1 217 ? 7.252   107.367 53.282 1.00 83.26  ? 217 PHE A CE1 1 
ATOM   1417 C CE2 . PHE A 1 217 ? 4.996   108.090 53.444 1.00 101.06 ? 217 PHE A CE2 1 
ATOM   1418 C CZ  . PHE A 1 217 ? 6.261   108.013 53.973 1.00 96.12  ? 217 PHE A CZ  1 
ATOM   1419 N N   . ALA A 1 218 ? 3.650   103.728 48.773 1.00 41.35  ? 218 ALA A N   1 
ATOM   1420 C CA  . ALA A 1 218 ? 2.961   103.550 47.521 1.00 51.33  ? 218 ALA A CA  1 
ATOM   1421 C C   . ALA A 1 218 ? 2.313   104.872 47.077 1.00 52.34  ? 218 ALA A C   1 
ATOM   1422 O O   . ALA A 1 218 ? 1.518   105.480 47.797 1.00 60.58  ? 218 ALA A O   1 
ATOM   1423 C CB  . ALA A 1 218 ? 1.864   102.449 47.705 1.00 51.34  ? 218 ALA A CB  1 
ATOM   1424 N N   . ASN A 1 219 ? 2.586   105.309 45.862 1.00 56.19  ? 219 ASN A N   1 
ATOM   1425 C CA  . ASN A 1 219 ? 1.817   106.421 45.312 1.00 66.41  ? 219 ASN A CA  1 
ATOM   1426 C C   . ASN A 1 219 ? 1.844   106.274 43.804 1.00 58.02  ? 219 ASN A C   1 
ATOM   1427 O O   . ASN A 1 219 ? 2.595   106.967 43.146 1.00 57.30  ? 219 ASN A O   1 
ATOM   1428 C CB  . ASN A 1 219 ? 2.363   107.776 45.795 1.00 53.96  ? 219 ASN A CB  1 
ATOM   1429 C CG  . ASN A 1 219 ? 3.747   108.089 45.247 1.00 69.44  ? 219 ASN A CG  1 
ATOM   1430 O OD1 . ASN A 1 219 ? 3.900   108.998 44.429 1.00 61.12  ? 219 ASN A OD1 1 
ATOM   1431 N ND2 . ASN A 1 219 ? 4.767   107.393 45.743 1.00 59.68  ? 219 ASN A ND2 1 
ATOM   1432 N N   . ASP A 1 220 ? 1.110   105.269 43.311 1.00 56.70  ? 220 ASP A N   1 
ATOM   1433 C CA  . ASP A 1 220 ? 1.039   104.865 41.905 1.00 50.17  ? 220 ASP A CA  1 
ATOM   1434 C C   . ASP A 1 220 ? 0.056   105.713 41.112 1.00 49.86  ? 220 ASP A C   1 
ATOM   1435 O O   . ASP A 1 220 ? -1.002  105.250 40.671 1.00 43.77  ? 220 ASP A O   1 
ATOM   1436 C CB  . ASP A 1 220 ? 0.570   103.409 41.809 1.00 55.36  ? 220 ASP A CB  1 
ATOM   1437 C CG  . ASP A 1 220 ? 1.466   102.454 42.604 1.00 89.98  ? 220 ASP A CG  1 
ATOM   1438 O OD1 . ASP A 1 220 ? 2.696   102.455 42.359 1.00 80.88  ? 220 ASP A OD1 1 
ATOM   1439 O OD2 . ASP A 1 220 ? 1.036   101.690 43.505 1.00 75.70  ? 220 ASP A OD2 1 
ATOM   1440 N N   . ILE A 1 221 ? 0.394   106.974 40.920 1.00 48.16  ? 221 ILE A N   1 
ATOM   1441 C CA  . ILE A 1 221 ? -0.522  107.850 40.230 1.00 45.15  ? 221 ILE A CA  1 
ATOM   1442 C C   . ILE A 1 221 ? -0.121  107.976 38.762 1.00 41.49  ? 221 ILE A C   1 
ATOM   1443 O O   . ILE A 1 221 ? 0.620   108.873 38.413 1.00 46.55  ? 221 ILE A O   1 
ATOM   1444 C CB  . ILE A 1 221 ? -0.536  109.168 40.985 1.00 43.03  ? 221 ILE A CB  1 
ATOM   1445 C CG1 . ILE A 1 221 ? -0.877  108.899 42.464 1.00 38.45  ? 221 ILE A CG1 1 
ATOM   1446 C CG2 . ILE A 1 221 ? -1.467  110.163 40.331 1.00 40.19  ? 221 ILE A CG2 1 
ATOM   1447 C CD1 . ILE A 1 221 ? -0.432  110.111 43.418 1.00 33.50  ? 221 ILE A CD1 1 
ATOM   1448 N N   . SER A 1 222 ? -0.574  107.052 37.912 1.00 42.94  ? 222 SER A N   1 
ATOM   1449 C CA  . SER A 1 222 ? -0.072  106.968 36.524 1.00 45.69  ? 222 SER A CA  1 
ATOM   1450 C C   . SER A 1 222 ? -0.853  107.962 35.682 1.00 32.57  ? 222 SER A C   1 
ATOM   1451 O O   . SER A 1 222 ? -2.030  108.259 35.974 1.00 38.30  ? 222 SER A O   1 
ATOM   1452 C CB  . SER A 1 222 ? -0.209  105.538 35.930 1.00 37.67  ? 222 SER A CB  1 
ATOM   1453 O OG  . SER A 1 222 ? -1.570  105.269 35.626 1.00 41.22  ? 222 SER A OG  1 
ATOM   1454 N N   . SER A 1 223 ? -0.224  108.432 34.614 1.00 40.69  ? 223 SER A N   1 
ATOM   1455 C CA  . SER A 1 223 ? -0.926  109.340 33.668 1.00 54.41  ? 223 SER A CA  1 
ATOM   1456 C C   . SER A 1 223 ? -2.203  108.723 33.136 1.00 38.19  ? 223 SER A C   1 
ATOM   1457 O O   . SER A 1 223 ? -3.250  109.388 33.006 1.00 37.90  ? 223 SER A O   1 
ATOM   1458 C CB  . SER A 1 223 ? -0.045  109.727 32.477 1.00 48.67  ? 223 SER A CB  1 
ATOM   1459 O OG  . SER A 1 223 ? 1.089   110.359 33.011 1.00 44.53  ? 223 SER A OG  1 
ATOM   1460 N N   . THR A 1 224 ? -2.072  107.473 32.749 1.00 39.28  ? 224 THR A N   1 
ATOM   1461 C CA  . THR A 1 224 ? -3.174  106.671 32.278 1.00 37.68  ? 224 THR A CA  1 
ATOM   1462 C C   . THR A 1 224 ? -4.312  106.686 33.256 1.00 43.15  ? 224 THR A C   1 
ATOM   1463 O O   . THR A 1 224 ? -5.436  107.007 32.868 1.00 44.84  ? 224 THR A O   1 
ATOM   1464 C CB  . THR A 1 224 ? -2.658  105.231 32.046 1.00 56.06  ? 224 THR A CB  1 
ATOM   1465 O OG1 . THR A 1 224 ? -1.680  105.280 31.003 1.00 65.29  ? 224 THR A OG1 1 
ATOM   1466 C CG2 . THR A 1 224 ? -3.734  104.342 31.456 1.00 42.49  ? 224 THR A CG2 1 
ATOM   1467 N N   . LYS A 1 225 ? -4.068  106.474 34.550 1.00 41.59  ? 225 LYS A N   1 
ATOM   1468 C CA  . LYS A 1 225 ? -5.231  106.613 35.477 1.00 36.27  ? 225 LYS A CA  1 
ATOM   1469 C C   . LYS A 1 225 ? -5.764  108.041 35.592 1.00 37.35  ? 225 LYS A C   1 
ATOM   1470 O O   . LYS A 1 225 ? -6.952  108.293 35.812 1.00 35.37  ? 225 LYS A O   1 
ATOM   1471 C CB  . LYS A 1 225 ? -4.931  106.055 36.867 1.00 44.10  ? 225 LYS A CB  1 
ATOM   1472 C CG  . LYS A 1 225 ? -4.569  104.562 36.846 1.00 46.42  ? 225 LYS A CG  1 
ATOM   1473 C CD  . LYS A 1 225 ? -4.594  103.996 38.258 1.00 65.94  ? 225 LYS A CD  1 
ATOM   1474 C CE  . LYS A 1 225 ? -3.711  102.762 38.367 1.00 88.92  ? 225 LYS A CE  1 
ATOM   1475 N NZ  . LYS A 1 225 ? -4.474  101.578 37.960 1.00 67.13  ? 225 LYS A NZ  1 
ATOM   1476 N N   . ILE A 1 226 ? -4.882  109.012 35.468 1.00 35.29  ? 226 ILE A N   1 
ATOM   1477 C CA  . ILE A 1 226 ? -5.399  110.356 35.607 1.00 37.58  ? 226 ILE A CA  1 
ATOM   1478 C C   . ILE A 1 226 ? -6.302  110.630 34.413 1.00 30.09  ? 226 ILE A C   1 
ATOM   1479 O O   . ILE A 1 226 ? -7.434  111.109 34.565 1.00 34.02  ? 226 ILE A O   1 
ATOM   1480 C CB  . ILE A 1 226 ? -4.235  111.390 35.643 1.00 46.87  ? 226 ILE A CB  1 
ATOM   1481 C CG1 . ILE A 1 226 ? -3.509  111.288 36.995 1.00 36.35  ? 226 ILE A CG1 1 
ATOM   1482 C CG2 . ILE A 1 226 ? -4.839  112.780 35.426 1.00 34.94  ? 226 ILE A CG2 1 
ATOM   1483 C CD1 . ILE A 1 226 ? -4.455  111.530 38.181 1.00 30.31  ? 226 ILE A CD1 1 
ATOM   1484 N N   . ARG A 1 227 ? -5.835  110.276 33.217 1.00 37.08  ? 227 ARG A N   1 
ATOM   1485 C CA  . ARG A 1 227 ? -6.650  110.581 32.034 1.00 43.28  ? 227 ARG A CA  1 
ATOM   1486 C C   . ARG A 1 227 ? -7.974  109.836 32.153 1.00 43.24  ? 227 ARG A C   1 
ATOM   1487 O O   . ARG A 1 227 ? -9.032  110.422 31.929 1.00 43.39  ? 227 ARG A O   1 
ATOM   1488 C CB  . ARG A 1 227 ? -5.962  110.194 30.712 1.00 44.55  ? 227 ARG A CB  1 
ATOM   1489 C CG  . ARG A 1 227 ? -4.737  111.033 30.327 1.00 39.75  ? 227 ARG A CG  1 
ATOM   1490 C CD  . ARG A 1 227 ? -4.127  110.681 28.968 1.00 41.39  ? 227 ARG A CD  1 
ATOM   1491 N NE  . ARG A 1 227 ? -3.815  109.267 28.777 1.00 45.64  ? 227 ARG A NE  1 
ATOM   1492 C CZ  . ARG A 1 227 ? -2.678  108.681 29.095 1.00 45.70  ? 227 ARG A CZ  1 
ATOM   1493 N NH1 . ARG A 1 227 ? -1.713  109.382 29.692 1.00 44.78  ? 227 ARG A NH1 1 
ATOM   1494 N NH2 . ARG A 1 227 ? -2.495  107.378 28.816 1.00 39.17  ? 227 ARG A NH2 1 
ATOM   1495 N N   . ARG A 1 228 ? -7.931  108.564 32.532 1.00 50.32  ? 228 ARG A N   1 
ATOM   1496 C CA  . ARG A 1 228 ? -9.159  107.798 32.717 1.00 40.40  ? 228 ARG A CA  1 
ATOM   1497 C C   . ARG A 1 228 ? -10.106 108.527 33.697 1.00 37.64  ? 228 ARG A C   1 
ATOM   1498 O O   . ARG A 1 228 ? -11.310 108.728 33.435 1.00 35.72  ? 228 ARG A O   1 
ATOM   1499 C CB  . ARG A 1 228 ? -8.842  106.331 33.124 1.00 36.13  ? 228 ARG A CB  1 
ATOM   1500 C CG  . ARG A 1 228 ? -10.094 105.518 33.409 1.00 56.96  ? 228 ARG A CG  1 
ATOM   1501 C CD  . ARG A 1 228 ? -9.855  104.071 33.743 1.00 45.39  ? 228 ARG A CD  1 
ATOM   1502 N NE  . ARG A 1 228 ? -8.990  103.420 32.766 1.00 51.78  ? 228 ARG A NE  1 
ATOM   1503 C CZ  . ARG A 1 228 ? -7.817  102.886 33.059 1.00 60.74  ? 228 ARG A CZ  1 
ATOM   1504 N NH1 . ARG A 1 228 ? -7.360  102.931 34.302 1.00 53.01  ? 228 ARG A NH1 1 
ATOM   1505 N NH2 . ARG A 1 228 ? -7.094  102.343 32.097 1.00 53.60  ? 228 ARG A NH2 1 
ATOM   1506 N N   . ALA A 1 229 ? -9.562  109.011 34.814 1.00 36.73  ? 229 ALA A N   1 
ATOM   1507 C CA  . ALA A 1 229 ? -10.444 109.651 35.782 1.00 41.89  ? 229 ALA A CA  1 
ATOM   1508 C C   . ALA A 1 229 ? -11.043 110.882 35.121 1.00 48.20  ? 229 ALA A C   1 
ATOM   1509 O O   . ALA A 1 229 ? -12.223 111.212 35.352 1.00 40.39  ? 229 ALA A O   1 
ATOM   1510 C CB  . ALA A 1 229 ? -9.681  110.039 37.050 1.00 46.87  ? 229 ALA A CB  1 
ATOM   1511 N N   . LEU A 1 230 ? -10.204 111.608 34.364 1.00 39.90  ? 230 LEU A N   1 
ATOM   1512 C CA  . LEU A 1 230 ? -10.666 112.881 33.835 1.00 40.95  ? 230 LEU A CA  1 
ATOM   1513 C C   . LEU A 1 230 ? -11.788 112.692 32.833 1.00 40.86  ? 230 LEU A C   1 
ATOM   1514 O O   . LEU A 1 230 ? -12.796 113.367 32.925 1.00 38.99  ? 230 LEU A O   1 
ATOM   1515 C CB  . LEU A 1 230 ? -9.545  113.761 33.257 1.00 47.28  ? 230 LEU A CB  1 
ATOM   1516 C CG  . LEU A 1 230 ? -8.564  114.451 34.215 1.00 50.11  ? 230 LEU A CG  1 
ATOM   1517 C CD1 . LEU A 1 230 ? -7.219  114.714 33.601 1.00 38.36  ? 230 LEU A CD1 1 
ATOM   1518 C CD2 . LEU A 1 230 ? -9.100  115.685 34.941 1.00 34.64  ? 230 LEU A CD2 1 
ATOM   1519 N N   . ARG A 1 231 ? -11.643 111.817 31.859 1.00 44.99  ? 231 ARG A N   1 
ATOM   1520 C CA  . ARG A 1 231 ? -12.755 111.558 30.956 1.00 55.20  ? 231 ARG A CA  1 
ATOM   1521 C C   . ARG A 1 231 ? -14.016 110.935 31.575 1.00 52.10  ? 231 ARG A C   1 
ATOM   1522 O O   . ARG A 1 231 ? -15.057 110.919 30.932 1.00 56.53  ? 231 ARG A O   1 
ATOM   1523 C CB  . ARG A 1 231 ? -12.292 110.860 29.671 1.00 59.29  ? 231 ARG A CB  1 
ATOM   1524 C CG  . ARG A 1 231 ? -12.291 109.332 29.739 1.00 59.43  ? 231 ARG A CG  1 
ATOM   1525 C CD  . ARG A 1 231 ? -11.441 108.640 28.661 1.00 55.26  ? 231 ARG A CD  1 
ATOM   1526 N NE  . ARG A 1 231 ? -10.979 107.320 29.094 1.00 53.03  ? 231 ARG A NE  1 
ATOM   1527 C CZ  . ARG A 1 231 ? -9.710  106.968 29.168 1.00 58.91  ? 231 ARG A CZ  1 
ATOM   1528 N NH1 . ARG A 1 231 ? -8.760  107.853 28.879 1.00 43.66  ? 231 ARG A NH1 1 
ATOM   1529 N NH2 . ARG A 1 231 ? -9.386  105.751 29.567 1.00 66.35  ? 231 ARG A NH2 1 
ATOM   1530 N N   . ARG A 1 232 ? -13.974 110.549 32.850 1.00 47.43  ? 232 ARG A N   1 
ATOM   1531 C CA  . ARG A 1 232 ? -15.203 110.217 33.595 1.00 51.79  ? 232 ARG A CA  1 
ATOM   1532 C C   . ARG A 1 232 ? -15.674 111.314 34.510 1.00 49.08  ? 232 ARG A C   1 
ATOM   1533 O O   . ARG A 1 232 ? -16.542 111.081 35.341 1.00 48.85  ? 232 ARG A O   1 
ATOM   1534 C CB  . ARG A 1 232 ? -15.033 108.930 34.420 1.00 39.15  ? 232 ARG A CB  1 
ATOM   1535 C CG  . ARG A 1 232 ? -14.386 107.797 33.635 1.00 40.16  ? 232 ARG A CG  1 
ATOM   1536 C CD  . ARG A 1 232 ? -14.374 106.467 34.311 1.00 55.67  ? 232 ARG A CD  1 
ATOM   1537 N NE  . ARG A 1 232 ? -13.968 105.408 33.399 1.00 52.04  ? 232 ARG A NE  1 
ATOM   1538 C CZ  . ARG A 1 232 ? -13.517 104.239 33.805 1.00 60.47  ? 232 ARG A CZ  1 
ATOM   1539 N NH1 . ARG A 1 232 ? -13.415 104.003 35.108 1.00 45.49  ? 232 ARG A NH1 1 
ATOM   1540 N NH2 . ARG A 1 232 ? -13.153 103.318 32.925 1.00 44.59  ? 232 ARG A NH2 1 
ATOM   1541 N N   . GLY A 1 233 ? -15.080 112.503 34.413 1.00 60.96  ? 233 GLY A N   1 
ATOM   1542 C CA  . GLY A 1 233 ? -15.536 113.624 35.230 1.00 50.36  ? 233 GLY A CA  1 
ATOM   1543 C C   . GLY A 1 233 ? -15.175 113.525 36.714 1.00 50.38  ? 233 GLY A C   1 
ATOM   1544 O O   . GLY A 1 233 ? -15.801 114.156 37.570 1.00 40.78  ? 233 GLY A O   1 
ATOM   1545 N N   . GLN A 1 234 ? -14.178 112.706 37.045 1.00 46.01  ? 234 GLN A N   1 
ATOM   1546 C CA  . GLN A 1 234 ? -13.860 112.519 38.473 1.00 50.50  ? 234 GLN A CA  1 
ATOM   1547 C C   . GLN A 1 234 ? -12.850 113.530 38.974 1.00 46.31  ? 234 GLN A C   1 
ATOM   1548 O O   . GLN A 1 234 ? -12.028 114.032 38.207 1.00 51.69  ? 234 GLN A O   1 
ATOM   1549 C CB  . GLN A 1 234 ? -13.282 111.136 38.733 1.00 48.98  ? 234 GLN A CB  1 
ATOM   1550 C CG  . GLN A 1 234 ? -14.127 110.002 38.274 1.00 44.37  ? 234 GLN A CG  1 
ATOM   1551 C CD  . GLN A 1 234 ? -13.466 108.657 38.432 1.00 52.56  ? 234 GLN A CD  1 
ATOM   1552 O OE1 . GLN A 1 234 ? -12.247 108.549 38.650 1.00 55.64  ? 234 GLN A OE1 1 
ATOM   1553 N NE2 . GLN A 1 234 ? -14.265 107.605 38.267 1.00 63.81  ? 234 GLN A NE2 1 
ATOM   1554 N N   . SER A 1 235 ? -12.829 113.765 40.271 1.00 48.35  ? 235 SER A N   1 
ATOM   1555 C CA  . SER A 1 235 ? -11.774 114.615 40.816 1.00 47.24  ? 235 SER A CA  1 
ATOM   1556 C C   . SER A 1 235 ? -10.390 114.005 40.690 1.00 44.08  ? 235 SER A C   1 
ATOM   1557 O O   . SER A 1 235 ? -10.225 112.793 40.764 1.00 40.65  ? 235 SER A O   1 
ATOM   1558 C CB  . SER A 1 235 ? -12.063 114.988 42.277 1.00 56.80  ? 235 SER A CB  1 
ATOM   1559 O OG  . SER A 1 235 ? -10.899 115.533 42.861 1.00 53.89  ? 235 SER A OG  1 
ATOM   1560 N N   . ILE A 1 236 ? -9.392  114.840 40.461 1.00 44.12  ? 236 ILE A N   1 
ATOM   1561 C CA  . ILE A 1 236 ? -8.003  114.375 40.505 1.00 33.80  ? 236 ILE A CA  1 
ATOM   1562 C C   . ILE A 1 236 ? -7.252  115.241 41.458 1.00 36.80  ? 236 ILE A C   1 
ATOM   1563 O O   . ILE A 1 236 ? -6.032  115.150 41.540 1.00 38.73  ? 236 ILE A O   1 
ATOM   1564 C CB  . ILE A 1 236 ? -7.297  114.474 39.150 1.00 37.96  ? 236 ILE A CB  1 
ATOM   1565 C CG1 . ILE A 1 236 ? -7.226  115.941 38.642 1.00 40.44  ? 236 ILE A CG1 1 
ATOM   1566 C CG2 . ILE A 1 236 ? -7.990  113.553 38.107 1.00 49.08  ? 236 ILE A CG2 1 
ATOM   1567 C CD1 . ILE A 1 236 ? -6.252  116.099 37.397 1.00 30.32  ? 236 ILE A CD1 1 
ATOM   1568 N N   . ARG A 1 237 ? -7.979  116.144 42.122 1.00 39.22  ? 237 ARG A N   1 
ATOM   1569 C CA  . ARG A 1 237 ? -7.406  116.910 43.234 1.00 41.22  ? 237 ARG A CA  1 
ATOM   1570 C C   . ARG A 1 237 ? -6.580  116.012 44.159 1.00 35.18  ? 237 ARG A C   1 
ATOM   1571 O O   . ARG A 1 237 ? -7.083  115.043 44.648 1.00 39.13  ? 237 ARG A O   1 
ATOM   1572 C CB  . ARG A 1 237 ? -8.526  117.516 44.062 1.00 35.25  ? 237 ARG A CB  1 
ATOM   1573 C CG  . ARG A 1 237 ? -8.063  118.723 44.958 1.00 59.03  ? 237 ARG A CG  1 
ATOM   1574 C CD  . ARG A 1 237 ? -7.926  120.149 44.306 1.00 58.86  ? 237 ARG A CD  1 
ATOM   1575 N NE  . ARG A 1 237 ? -7.672  121.193 45.304 1.00 93.96  ? 237 ARG A NE  1 
ATOM   1576 C CZ  . ARG A 1 237 ? -7.083  122.362 45.037 1.00 101.06 ? 237 ARG A CZ  1 
ATOM   1577 N NH1 . ARG A 1 237 ? -6.668  122.631 43.805 1.00 65.20  ? 237 ARG A NH1 1 
ATOM   1578 N NH2 . ARG A 1 237 ? -6.913  123.281 45.990 1.00 101.06 ? 237 ARG A NH2 1 
ATOM   1579 N N   . TYR A 1 238 ? -5.353  116.422 44.453 1.00 36.92  ? 238 TYR A N   1 
ATOM   1580 C CA  . TYR A 1 238 ? -4.471  115.927 45.509 1.00 42.36  ? 238 TYR A CA  1 
ATOM   1581 C C   . TYR A 1 238 ? -3.739  114.691 44.966 1.00 44.52  ? 238 TYR A C   1 
ATOM   1582 O O   . TYR A 1 238 ? -2.977  114.129 45.695 1.00 41.69  ? 238 TYR A O   1 
ATOM   1583 C CB  . TYR A 1 238 ? -5.171  115.562 46.843 1.00 38.54  ? 238 TYR A CB  1 
ATOM   1584 C CG  . TYR A 1 238 ? -6.076  116.654 47.419 1.00 44.56  ? 238 TYR A CG  1 
ATOM   1585 C CD1 . TYR A 1 238 ? -7.447  116.467 47.511 1.00 38.10  ? 238 TYR A CD1 1 
ATOM   1586 C CD2 . TYR A 1 238 ? -5.553  117.875 47.838 1.00 44.19  ? 238 TYR A CD2 1 
ATOM   1587 C CE1 . TYR A 1 238 ? -8.305  117.484 47.948 1.00 38.78  ? 238 TYR A CE1 1 
ATOM   1588 C CE2 . TYR A 1 238 ? -6.371  118.865 48.295 1.00 44.21  ? 238 TYR A CE2 1 
ATOM   1589 C CZ  . TYR A 1 238 ? -7.747  118.663 48.349 1.00 45.48  ? 238 TYR A CZ  1 
ATOM   1590 O OH  . TYR A 1 238 ? -8.552  119.629 48.859 1.00 54.14  ? 238 TYR A OH  1 
ATOM   1591 N N   . LEU A 1 239 ? -3.867  114.401 43.670 1.00 41.79  ? 239 LEU A N   1 
ATOM   1592 C CA  . LEU A 1 239 ? -2.969  113.494 42.948 1.00 39.22  ? 239 LEU A CA  1 
ATOM   1593 C C   . LEU A 1 239 ? -1.971  114.207 42.028 1.00 43.99  ? 239 LEU A C   1 
ATOM   1594 O O   . LEU A 1 239 ? -1.004  113.609 41.555 1.00 38.77  ? 239 LEU A O   1 
ATOM   1595 C CB  . LEU A 1 239 ? -3.810  112.524 42.099 1.00 31.64  ? 239 LEU A CB  1 
ATOM   1596 C CG  . LEU A 1 239 ? -4.975  111.806 42.789 1.00 49.26  ? 239 LEU A CG  1 
ATOM   1597 C CD1 . LEU A 1 239 ? -5.847  110.993 41.825 1.00 49.69  ? 239 LEU A CD1 1 
ATOM   1598 C CD2 . LEU A 1 239 ? -4.421  110.905 43.880 1.00 32.12  ? 239 LEU A CD2 1 
ATOM   1599 N N   . VAL A 1 240 ? -2.215  115.488 41.771 1.00 42.14  ? 240 VAL A N   1 
ATOM   1600 C CA  . VAL A 1 240 ? -1.311  116.309 40.962 1.00 48.18  ? 240 VAL A CA  1 
ATOM   1601 C C   . VAL A 1 240 ? -1.283  117.684 41.651 1.00 36.69  ? 240 VAL A C   1 
ATOM   1602 O O   . VAL A 1 240 ? -2.210  118.043 42.333 1.00 36.80  ? 240 VAL A O   1 
ATOM   1603 C CB  . VAL A 1 240 ? -1.882  116.466 39.487 1.00 45.38  ? 240 VAL A CB  1 
ATOM   1604 C CG1 . VAL A 1 240 ? -2.368  115.131 38.916 1.00 42.77  ? 240 VAL A CG1 1 
ATOM   1605 C CG2 . VAL A 1 240 ? -3.042  117.471 39.422 1.00 33.63  ? 240 VAL A CG2 1 
ATOM   1606 N N   . PRO A 1 241 ? -0.273  118.483 41.420 1.00 35.05  ? 241 PRO A N   1 
ATOM   1607 C CA  . PRO A 1 241 ? -0.232  119.831 42.022 1.00 36.31  ? 241 PRO A CA  1 
ATOM   1608 C C   . PRO A 1 241 ? -1.455  120.696 41.662 1.00 33.69  ? 241 PRO A C   1 
ATOM   1609 O O   . PRO A 1 241 ? -2.117  120.536 40.617 1.00 41.41  ? 241 PRO A O   1 
ATOM   1610 C CB  . PRO A 1 241 ? 1.071   120.436 41.506 1.00 37.31  ? 241 PRO A CB  1 
ATOM   1611 C CG  . PRO A 1 241 ? 1.947   119.146 41.072 1.00 33.23  ? 241 PRO A CG  1 
ATOM   1612 C CD  . PRO A 1 241 ? 0.859   118.190 40.515 1.00 33.26  ? 241 PRO A CD  1 
ATOM   1613 N N   . ASP A 1 242 ? -1.881  121.461 42.660 1.00 33.46  ? 242 ASP A N   1 
ATOM   1614 C CA  . ASP A 1 242 ? -3.080  122.276 42.584 1.00 35.86  ? 242 ASP A CA  1 
ATOM   1615 C C   . ASP A 1 242 ? -3.047  123.049 41.251 1.00 39.87  ? 242 ASP A C   1 
ATOM   1616 O O   . ASP A 1 242 ? -4.034  123.076 40.521 1.00 39.09  ? 242 ASP A O   1 
ATOM   1617 C CB  . ASP A 1 242 ? -3.121  123.252 43.753 1.00 40.53  ? 242 ASP A CB  1 
ATOM   1618 C CG  . ASP A 1 242 ? -3.391  122.597 45.098 1.00 61.77  ? 242 ASP A CG  1 
ATOM   1619 O OD1 . ASP A 1 242 ? -3.478  121.382 45.175 1.00 54.69  ? 242 ASP A OD1 1 
ATOM   1620 O OD2 . ASP A 1 242 ? -3.530  123.248 46.162 1.00 93.99  ? 242 ASP A OD2 1 
ATOM   1621 N N   . LEU A 1 243 ? -1.913  123.647 40.899 1.00 35.96  ? 243 LEU A N   1 
ATOM   1622 C CA  . LEU A 1 243 ? -1.893  124.445 39.666 1.00 39.25  ? 243 LEU A CA  1 
ATOM   1623 C C   . LEU A 1 243 ? -2.034  123.628 38.371 1.00 41.11  ? 243 LEU A C   1 
ATOM   1624 O O   . LEU A 1 243 ? -2.630  124.077 37.406 1.00 39.18  ? 243 LEU A O   1 
ATOM   1625 C CB  . LEU A 1 243 ? -0.657  125.320 39.622 1.00 36.50  ? 243 LEU A CB  1 
ATOM   1626 C CG  . LEU A 1 243 ? -0.650  126.495 40.600 1.00 40.20  ? 243 LEU A CG  1 
ATOM   1627 C CD1 . LEU A 1 243 ? 0.597   127.238 40.212 1.00 41.14  ? 243 LEU A CD1 1 
ATOM   1628 C CD2 . LEU A 1 243 ? -1.807  127.447 40.357 1.00 45.41  ? 243 LEU A CD2 1 
ATOM   1629 N N   . VAL A 1 244 ? -1.474  122.420 38.349 1.00 42.73  ? 244 VAL A N   1 
ATOM   1630 C CA  . VAL A 1 244 ? -1.623  121.519 37.244 1.00 29.09  ? 244 VAL A CA  1 
ATOM   1631 C C   . VAL A 1 244 ? -3.101  121.071 37.104 1.00 39.36  ? 244 VAL A C   1 
ATOM   1632 O O   . VAL A 1 244 ? -3.707  121.040 36.031 1.00 40.69  ? 244 VAL A O   1 
ATOM   1633 C CB  . VAL A 1 244 ? -0.755  120.266 37.464 1.00 48.04  ? 244 VAL A CB  1 
ATOM   1634 C CG1 . VAL A 1 244 ? -1.118  119.247 36.423 1.00 34.31  ? 244 VAL A CG1 1 
ATOM   1635 C CG2 . VAL A 1 244 ? 0.769   120.629 37.346 1.00 30.22  ? 244 VAL A CG2 1 
ATOM   1636 N N   . GLN A 1 245 ? -3.726  120.829 38.221 1.00 39.40  ? 245 GLN A N   1 
ATOM   1637 C CA  . GLN A 1 245 ? -5.156  120.544 38.229 1.00 44.93  ? 245 GLN A CA  1 
ATOM   1638 C C   . GLN A 1 245 ? -6.026  121.719 37.717 1.00 36.11  ? 245 GLN A C   1 
ATOM   1639 O O   . GLN A 1 245 ? -7.037  121.551 36.981 1.00 40.14  ? 245 GLN A O   1 
ATOM   1640 C CB  . GLN A 1 245 ? -5.566  120.178 39.674 1.00 34.17  ? 245 GLN A CB  1 
ATOM   1641 C CG  . GLN A 1 245 ? -6.993  119.689 39.782 1.00 35.35  ? 245 GLN A CG  1 
ATOM   1642 C CD  . GLN A 1 245 ? -8.012  120.834 39.985 1.00 48.09  ? 245 GLN A CD  1 
ATOM   1643 O OE1 . GLN A 1 245 ? -9.135  120.733 39.536 1.00 43.41  ? 245 GLN A OE1 1 
ATOM   1644 N NE2 . GLN A 1 245 ? -7.621  121.890 40.661 1.00 41.43  ? 245 GLN A NE2 1 
ATOM   1645 N N   . GLU A 1 246 ? -5.643  122.923 38.100 1.00 46.81  ? 246 GLU A N   1 
ATOM   1646 C CA  . GLU A 1 246 ? -6.341  124.101 37.592 1.00 54.77  ? 246 GLU A CA  1 
ATOM   1647 C C   . GLU A 1 246 ? -6.217  124.315 36.080 1.00 35.32  ? 246 GLU A C   1 
ATOM   1648 O O   . GLU A 1 246 ? -7.219  124.527 35.397 1.00 39.85  ? 246 GLU A O   1 
ATOM   1649 C CB  . GLU A 1 246 ? -6.101  125.332 38.484 1.00 46.71  ? 246 GLU A CB  1 
ATOM   1650 C CG  . GLU A 1 246 ? -6.724  125.034 39.863 1.00 75.86  ? 246 GLU A CG  1 
ATOM   1651 C CD  . GLU A 1 246 ? -6.080  125.715 41.072 1.00 91.29  ? 246 GLU A CD  1 
ATOM   1652 O OE1 . GLU A 1 246 ? -5.402  126.737 40.850 1.00 75.40  ? 246 GLU A OE1 1 
ATOM   1653 O OE2 . GLU A 1 246 ? -6.283  125.268 42.246 1.00 90.50  ? 246 GLU A OE2 1 
ATOM   1654 N N   . TYR A 1 247 ? -5.015  124.065 35.555 1.00 34.13  ? 247 TYR A N   1 
ATOM   1655 C CA  . TYR A 1 247 ? -4.746  124.213 34.136 1.00 44.92  ? 247 TYR A CA  1 
ATOM   1656 C C   . TYR A 1 247 ? -5.556  123.206 33.361 1.00 40.93  ? 247 TYR A C   1 
ATOM   1657 O O   . TYR A 1 247 ? -6.161  123.540 32.340 1.00 43.33  ? 247 TYR A O   1 
ATOM   1658 C CB  . TYR A 1 247 ? -3.265  123.936 33.861 1.00 34.01  ? 247 TYR A CB  1 
ATOM   1659 C CG  . TYR A 1 247 ? -2.836  124.167 32.448 1.00 36.81  ? 247 TYR A CG  1 
ATOM   1660 C CD1 . TYR A 1 247 ? -2.576  125.465 31.985 1.00 39.71  ? 247 TYR A CD1 1 
ATOM   1661 C CD2 . TYR A 1 247 ? -2.785  123.122 31.561 1.00 36.46  ? 247 TYR A CD2 1 
ATOM   1662 C CE1 . TYR A 1 247 ? -2.192  125.702 30.676 1.00 37.61  ? 247 TYR A CE1 1 
ATOM   1663 C CE2 . TYR A 1 247 ? -2.387  123.310 30.293 1.00 43.23  ? 247 TYR A CE2 1 
ATOM   1664 C CZ  . TYR A 1 247 ? -2.090  124.599 29.855 1.00 55.36  ? 247 TYR A CZ  1 
ATOM   1665 O OH  . TYR A 1 247 ? -1.704  124.710 28.549 1.00 41.12  ? 247 TYR A OH  1 
ATOM   1666 N N   . ILE A 1 248 ? -5.554  121.962 33.854 1.00 42.69  ? 248 ILE A N   1 
ATOM   1667 C CA  . ILE A 1 248 ? -6.281  120.908 33.157 1.00 40.89  ? 248 ILE A CA  1 
ATOM   1668 C C   . ILE A 1 248 ? -7.761  121.275 33.159 1.00 33.80  ? 248 ILE A C   1 
ATOM   1669 O O   . ILE A 1 248 ? -8.463  121.132 32.152 1.00 42.93  ? 248 ILE A O   1 
ATOM   1670 C CB  . ILE A 1 248 ? -6.055  119.561 33.841 1.00 36.45  ? 248 ILE A CB  1 
ATOM   1671 C CG1 . ILE A 1 248 ? -4.680  118.994 33.470 1.00 36.52  ? 248 ILE A CG1 1 
ATOM   1672 C CG2 . ILE A 1 248 ? -7.246  118.604 33.632 1.00 31.91  ? 248 ILE A CG2 1 
ATOM   1673 C CD1 . ILE A 1 248 ? -4.203  117.902 34.396 1.00 39.46  ? 248 ILE A CD1 1 
ATOM   1674 N N   . GLU A 1 249 ? -8.244  121.807 34.269 1.00 38.35  ? 249 GLU A N   1 
ATOM   1675 C CA  . GLU A 1 249 ? -9.663  122.098 34.313 1.00 41.60  ? 249 GLU A CA  1 
ATOM   1676 C C   . GLU A 1 249 ? -10.080 123.250 33.435 1.00 48.77  ? 249 GLU A C   1 
ATOM   1677 O O   . GLU A 1 249 ? -11.150 123.231 32.817 1.00 44.46  ? 249 GLU A O   1 
ATOM   1678 C CB  . GLU A 1 249 ? -10.143 122.375 35.727 1.00 41.40  ? 249 GLU A CB  1 
ATOM   1679 C CG  . GLU A 1 249 ? -11.543 122.969 35.771 1.00 59.97  ? 249 GLU A CG  1 
ATOM   1680 C CD  . GLU A 1 249 ? -12.110 123.006 37.185 1.00 101.06 ? 249 GLU A CD  1 
ATOM   1681 O OE1 . GLU A 1 249 ? -11.864 124.008 37.896 1.00 101.06 ? 249 GLU A OE1 1 
ATOM   1682 O OE2 . GLU A 1 249 ? -12.780 122.024 37.600 1.00 101.06 ? 249 GLU A OE2 1 
ATOM   1683 N N   . LYS A 1 250 ? -9.270  124.300 33.409 1.00 46.67  ? 250 LYS A N   1 
ATOM   1684 C CA  . LYS A 1 250 ? -9.704  125.451 32.601 1.00 54.02  ? 250 LYS A CA  1 
ATOM   1685 C C   . LYS A 1 250 ? -9.646  125.199 31.083 1.00 45.51  ? 250 LYS A C   1 
ATOM   1686 O O   . LYS A 1 250 ? -10.445 125.718 30.293 1.00 47.89  ? 250 LYS A O   1 
ATOM   1687 C CB  . LYS A 1 250 ? -8.814  126.633 32.940 1.00 51.20  ? 250 LYS A CB  1 
ATOM   1688 C CG  . LYS A 1 250 ? -8.955  127.054 34.372 1.00 56.00  ? 250 LYS A CG  1 
ATOM   1689 C CD  . LYS A 1 250 ? -9.862  128.201 34.399 1.00 50.80  ? 250 LYS A CD  1 
ATOM   1690 C CE  . LYS A 1 250 ? -10.883 128.111 35.475 1.00 72.94  ? 250 LYS A CE  1 
ATOM   1691 N NZ  . LYS A 1 250 ? -10.785 129.360 36.300 1.00 62.50  ? 250 LYS A NZ  1 
ATOM   1692 N N   . HIS A 1 251 ? -8.689  124.380 30.682 1.00 42.20  ? 251 HIS A N   1 
ATOM   1693 C CA  . HIS A 1 251 ? -8.564  123.963 29.294 1.00 43.64  ? 251 HIS A CA  1 
ATOM   1694 C C   . HIS A 1 251 ? -9.323  122.714 28.933 1.00 42.36  ? 251 HIS A C   1 
ATOM   1695 O O   . HIS A 1 251 ? -9.231  122.258 27.812 1.00 46.77  ? 251 HIS A O   1 
ATOM   1696 C CB  . HIS A 1 251 ? -7.115  123.719 28.940 1.00 50.50  ? 251 HIS A CB  1 
ATOM   1697 C CG  . HIS A 1 251 ? -6.285  124.960 28.864 1.00 59.31  ? 251 HIS A CG  1 
ATOM   1698 N ND1 . HIS A 1 251 ? -6.011  125.599 27.672 1.00 51.03  ? 251 HIS A ND1 1 
ATOM   1699 C CD2 . HIS A 1 251 ? -5.627  125.649 29.826 1.00 48.06  ? 251 HIS A CD2 1 
ATOM   1700 C CE1 . HIS A 1 251 ? -5.183  126.601 27.901 1.00 46.92  ? 251 HIS A CE1 1 
ATOM   1701 N NE2 . HIS A 1 251 ? -4.949  126.665 29.202 1.00 51.38  ? 251 HIS A NE2 1 
ATOM   1702 N N   . ASN A 1 252 ? -10.102 122.177 29.861 1.00 53.30  ? 252 ASN A N   1 
ATOM   1703 C CA  . ASN A 1 252 ? -10.875 120.972 29.582 1.00 54.01  ? 252 ASN A CA  1 
ATOM   1704 C C   . ASN A 1 252 ? -10.088 119.848 28.933 1.00 51.24  ? 252 ASN A C   1 
ATOM   1705 O O   . ASN A 1 252 ? -10.582 119.165 28.064 1.00 58.50  ? 252 ASN A O   1 
ATOM   1706 C CB  . ASN A 1 252 ? -12.083 121.275 28.716 1.00 55.80  ? 252 ASN A CB  1 
ATOM   1707 C CG  . ASN A 1 252 ? -13.257 120.338 28.999 1.00 82.81  ? 252 ASN A CG  1 
ATOM   1708 O OD1 . ASN A 1 252 ? -13.407 119.798 30.109 1.00 59.62  ? 252 ASN A OD1 1 
ATOM   1709 N ND2 . ASN A 1 252 ? -14.122 120.173 28.002 1.00 69.53  ? 252 ASN A ND2 1 
ATOM   1710 N N   . LEU A 1 253 ? -8.873  119.622 29.390 1.00 47.19  ? 253 LEU A N   1 
ATOM   1711 C CA  . LEU A 1 253 ? -8.081  118.574 28.817 1.00 42.58  ? 253 LEU A CA  1 
ATOM   1712 C C   . LEU A 1 253 ? -8.465  117.152 29.254 1.00 51.70  ? 253 LEU A C   1 
ATOM   1713 O O   . LEU A 1 253 ? -8.895  116.932 30.378 1.00 47.93  ? 253 LEU A O   1 
ATOM   1714 C CB  . LEU A 1 253 ? -6.653  118.848 29.173 1.00 34.72  ? 253 LEU A CB  1 
ATOM   1715 C CG  . LEU A 1 253 ? -5.966  120.137 28.698 1.00 41.95  ? 253 LEU A CG  1 
ATOM   1716 C CD1 . LEU A 1 253 ? -4.515  120.196 29.330 1.00 35.68  ? 253 LEU A CD1 1 
ATOM   1717 C CD2 . LEU A 1 253 ? -5.867  120.170 27.167 1.00 40.83  ? 253 LEU A CD2 1 
ATOM   1718 N N   . TYR A 1 254 ? -8.266  116.188 28.363 1.00 43.31  ? 254 TYR A N   1 
ATOM   1719 C CA  . TYR A 1 254 ? -8.499  114.791 28.652 1.00 44.80  ? 254 TYR A CA  1 
ATOM   1720 C C   . TYR A 1 254 ? -9.973  114.519 28.962 1.00 43.42  ? 254 TYR A C   1 
ATOM   1721 O O   . TYR A 1 254 ? -10.336 113.452 29.427 1.00 50.52  ? 254 TYR A O   1 
ATOM   1722 C CB  . TYR A 1 254 ? -7.639  114.364 29.853 1.00 47.84  ? 254 TYR A CB  1 
ATOM   1723 C CG  . TYR A 1 254 ? -6.170  114.654 29.735 1.00 44.61  ? 254 TYR A CG  1 
ATOM   1724 C CD1 . TYR A 1 254 ? -5.538  115.551 30.602 1.00 37.73  ? 254 TYR A CD1 1 
ATOM   1725 C CD2 . TYR A 1 254 ? -5.402  114.054 28.736 1.00 32.47  ? 254 TYR A CD2 1 
ATOM   1726 C CE1 . TYR A 1 254 ? -4.144  115.818 30.485 1.00 32.75  ? 254 TYR A CE1 1 
ATOM   1727 C CE2 . TYR A 1 254 ? -4.044  114.310 28.625 1.00 37.73  ? 254 TYR A CE2 1 
ATOM   1728 C CZ  . TYR A 1 254 ? -3.413  115.185 29.504 1.00 39.93  ? 254 TYR A CZ  1 
ATOM   1729 O OH  . TYR A 1 254 ? -2.054  115.406 29.379 1.00 39.08  ? 254 TYR A OH  1 
ATOM   1730 N N   . SER A 1 255 ? -10.822 115.514 28.801 1.00 43.24  ? 255 SER A N   1 
ATOM   1731 C CA  . SER A 1 255 ? -12.218 115.333 29.159 1.00 57.33  ? 255 SER A CA  1 
ATOM   1732 C C   . SER A 1 255 ? -12.893 114.462 28.081 1.00 70.86  ? 255 SER A C   1 
ATOM   1733 O O   . SER A 1 255 ? -13.822 113.718 28.366 1.00 66.72  ? 255 SER A O   1 
ATOM   1734 C CB  . SER A 1 255 ? -12.916 116.693 29.205 1.00 59.66  ? 255 SER A CB  1 
ATOM   1735 O OG  . SER A 1 255 ? -13.204 117.099 27.871 1.00 77.42  ? 255 SER A OG  1 
ATOM   1736 N N   . SER A 1 256 ? -12.451 114.608 26.834 1.00 79.82  ? 256 SER A N   1 
ATOM   1737 C CA  . SER A 1 256 ? -13.232 114.202 25.669 1.00 98.62  ? 256 SER A CA  1 
ATOM   1738 C C   . SER A 1 256 ? -13.544 112.724 25.754 1.00 101.06 ? 256 SER A C   1 
ATOM   1739 O O   . SER A 1 256 ? -14.528 112.317 26.381 1.00 100.44 ? 256 SER A O   1 
ATOM   1740 C CB  . SER A 1 256 ? -12.403 114.409 24.405 1.00 101.06 ? 256 SER A CB  1 
ATOM   1741 O OG  . SER A 1 256 ? -11.364 113.444 24.357 1.00 101.06 ? 256 SER A OG  1 
ATOM   1742 N N   . GLU A 1 257 ? -12.643 111.936 25.167 1.00 101.06 ? 257 GLU A N   1 
ATOM   1743 C CA  . GLU A 1 257 ? -12.980 110.835 24.266 1.00 101.06 ? 257 GLU A CA  1 
ATOM   1744 C C   . GLU A 1 257 ? -14.046 109.889 24.821 1.00 101.06 ? 257 GLU A C   1 
ATOM   1745 O O   . GLU A 1 257 ? -13.823 108.675 24.898 1.00 101.06 ? 257 GLU A O   1 
ATOM   1746 C CB  . GLU A 1 257 ? -11.719 110.026 23.943 1.00 101.06 ? 257 GLU A CB  1 
ATOM   1747 C CG  . GLU A 1 257 ? -11.174 110.244 22.542 1.00 101.06 ? 257 GLU A CG  1 
ATOM   1748 C CD  . GLU A 1 257 ? -9.663  110.123 22.486 1.00 101.06 ? 257 GLU A CD  1 
ATOM   1749 O OE1 . GLU A 1 257 ? -9.030  109.997 23.566 1.00 101.06 ? 257 GLU A OE1 1 
ATOM   1750 O OE2 . GLU A 1 257 ? -9.111  110.171 21.358 1.00 101.06 ? 257 GLU A OE2 1 
HETATM 1751 O O   . HOH B 2 .   ? -6.775  106.522 29.950 1.00 49.59  ? 280 HOH A O   1 
HETATM 1752 O O   . HOH B 2 .   ? 2.825   107.631 34.057 1.00 40.74  ? 281 HOH A O   1 
HETATM 1753 O O   . HOH B 2 .   ? 7.763   101.112 38.788 1.00 55.06  ? 282 HOH A O   1 
HETATM 1754 O O   . HOH B 2 .   ? -8.950  113.563 44.274 1.00 51.57  ? 283 HOH A O   1 
HETATM 1755 O O   . HOH B 2 .   ? 15.409  118.254 26.415 1.00 51.67  ? 284 HOH A O   1 
HETATM 1756 O O   . HOH B 2 .   ? -1.472  102.306 34.835 1.00 53.88  ? 285 HOH A O   1 
HETATM 1757 O O   . HOH B 2 .   ? 16.010  101.045 49.570 1.00 62.38  ? 286 HOH A O   1 
HETATM 1758 O O   . HOH B 2 .   ? 0.403   123.947 42.658 1.00 45.61  ? 287 HOH A O   1 
HETATM 1759 O O   . HOH B 2 .   ? 31.678  91.108  37.535 1.00 49.67  ? 288 HOH A O   1 
HETATM 1760 O O   . HOH B 2 .   ? 0.683   113.263 18.862 1.00 64.54  ? 289 HOH A O   1 
HETATM 1761 O O   . HOH B 2 .   ? 20.354  123.965 24.397 1.00 60.40  ? 290 HOH A O   1 
HETATM 1762 O O   . HOH B 2 .   ? 21.048  98.402  42.980 1.00 48.99  ? 291 HOH A O   1 
HETATM 1763 O O   . HOH B 2 .   ? -10.950 105.689 41.739 1.00 64.69  ? 292 HOH A O   1 
HETATM 1764 O O   . HOH B 2 .   ? 15.076  114.961 48.115 1.00 52.39  ? 293 HOH A O   1 
HETATM 1765 O O   . HOH B 2 .   ? 27.677  107.491 24.331 1.00 56.87  ? 294 HOH A O   1 
HETATM 1766 O O   . HOH B 2 .   ? -13.211 124.532 28.610 1.00 76.30  ? 295 HOH A O   1 
HETATM 1767 O O   . HOH B 2 .   ? -1.667  117.348 45.642 1.00 46.63  ? 296 HOH A O   1 
HETATM 1768 O O   . HOH B 2 .   ? 25.525  108.588 20.696 1.00 66.01  ? 297 HOH A O   1 
HETATM 1769 O O   . HOH B 2 .   ? 5.871   132.861 40.791 1.00 64.40  ? 298 HOH A O   1 
HETATM 1770 O O   . HOH B 2 .   ? 29.414  106.891 38.128 1.00 53.46  ? 299 HOH A O   1 
HETATM 1771 O O   . HOH B 2 .   ? -0.927  104.857 25.641 1.00 63.68  ? 300 HOH A O   1 
HETATM 1772 O O   . HOH B 2 .   ? -4.133  101.213 34.223 1.00 52.97  ? 301 HOH A O   1 
HETATM 1773 O O   . HOH B 2 .   ? 20.872  120.146 48.066 1.00 62.70  ? 302 HOH A O   1 
HETATM 1774 O O   . HOH B 2 .   ? 20.015  89.249  27.263 1.00 69.07  ? 303 HOH A O   1 
HETATM 1775 O O   . HOH B 2 .   ? 5.455   108.032 28.753 1.00 63.09  ? 304 HOH A O   1 
HETATM 1776 O O   . HOH B 2 .   ? -4.038  105.075 22.281 1.00 72.92  ? 305 HOH A O   1 
HETATM 1777 O O   . HOH B 2 .   ? -8.564  111.377 28.109 1.00 58.80  ? 306 HOH A O   1 
HETATM 1778 O O   . HOH B 2 .   ? -11.025 118.945 34.840 1.00 54.46  ? 307 HOH A O   1 
HETATM 1779 O O   . HOH B 2 .   ? 9.346   109.952 34.672 1.00 65.57  ? 308 HOH A O   1 
HETATM 1780 O O   . HOH B 2 .   ? -12.995 105.353 37.694 1.00 48.38  ? 309 HOH A O   1 
HETATM 1781 O O   . HOH B 2 .   ? 7.847   103.194 34.562 1.00 67.61  ? 310 HOH A O   1 
HETATM 1782 O O   . HOH B 2 .   ? 1.873   107.594 29.252 1.00 44.67  ? 311 HOH A O   1 
HETATM 1783 O O   . HOH B 2 .   ? 28.820  96.153  36.494 1.00 51.47  ? 312 HOH A O   1 
HETATM 1784 O O   . HOH B 2 .   ? 13.201  110.180 50.412 1.00 52.31  ? 313 HOH A O   1 
HETATM 1785 O O   . HOH B 2 .   ? 3.107   126.062 46.496 1.00 65.54  ? 314 HOH A O   1 
HETATM 1786 O O   . HOH B 2 .   ? -2.890  126.955 36.678 1.00 34.67  ? 315 HOH A O   1 
HETATM 1787 O O   . HOH B 2 .   ? -2.291  127.538 27.530 1.00 41.49  ? 316 HOH A O   1 
HETATM 1788 O O   . HOH B 2 .   ? 4.300   121.482 42.706 1.00 44.37  ? 317 HOH A O   1 
HETATM 1789 O O   . HOH B 2 .   ? -2.803  120.689 47.962 1.00 38.09  ? 318 HOH A O   1 
HETATM 1790 O O   . HOH B 2 .   ? 14.264  105.574 22.671 1.00 60.94  ? 319 HOH A O   1 
HETATM 1791 O O   . HOH B 2 .   ? 29.443  88.281  39.300 1.00 67.05  ? 320 HOH A O   1 
HETATM 1792 O O   . HOH B 2 .   ? 0.710   108.899 26.566 1.00 46.80  ? 321 HOH A O   1 
HETATM 1793 O O   . HOH B 2 .   ? -10.088 117.840 39.430 1.00 53.93  ? 322 HOH A O   1 
HETATM 1794 O O   . HOH B 2 .   ? 2.771   117.499 32.012 1.00 39.70  ? 323 HOH A O   1 
HETATM 1795 O O   . HOH B 2 .   ? 5.241   110.238 31.706 1.00 55.56  ? 324 HOH A O   1 
HETATM 1796 O O   . HOH B 2 .   ? 13.455  108.532 31.690 1.00 57.33  ? 325 HOH A O   1 
HETATM 1797 O O   . HOH B 2 .   ? -12.853 115.904 33.308 1.00 48.90  ? 326 HOH A O   1 
HETATM 1798 O O   . HOH B 2 .   ? -4.300  126.550 23.680 1.00 49.25  ? 327 HOH A O   1 
HETATM 1799 O O   . HOH B 2 .   ? -7.357  116.724 25.558 1.00 47.37  ? 328 HOH A O   1 
HETATM 1800 O O   . HOH B 2 .   ? 0.998   106.112 33.631 1.00 63.35  ? 329 HOH A O   1 
HETATM 1801 O O   . HOH B 2 .   ? 20.564  121.106 18.260 1.00 56.26  ? 330 HOH A O   1 
HETATM 1802 O O   . HOH B 2 .   ? 8.917   122.807 16.538 1.00 60.84  ? 331 HOH A O   1 
HETATM 1803 O O   . HOH B 2 .   ? 6.655   121.943 17.575 1.00 67.94  ? 332 HOH A O   1 
HETATM 1804 O O   . HOH B 2 .   ? -5.236  106.258 26.828 1.00 53.96  ? 333 HOH A O   1 
HETATM 1805 O O   . HOH B 2 .   ? -7.718  123.899 24.700 1.00 68.08  ? 334 HOH A O   1 
HETATM 1806 O O   . HOH B 2 .   ? 9.990   107.534 34.528 1.00 74.43  ? 335 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   ?   ?   ?   A . n 
A 1 3   ASN 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   ?   ?   ?   A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  CYS 14  14  14  CYS CYS A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  PHE 17  17  17  PHE PHE A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  THR 21  21  21  THR THR A . n 
A 1 22  ASN 22  22  22  ASN ASN A . n 
A 1 23  MET 23  23  23  MET MET A . n 
A 1 24  HIS 24  24  24  HIS HIS A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  MET 35  35  35  MET MET A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  GLY 39  39  39  GLY GLY A . n 
A 1 40  ARG 40  40  40  ARG ARG A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  SER 49  49  49  SER SER A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  ALA 54  54  54  ALA ALA A . n 
A 1 55  TYR 55  55  55  TYR TYR A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  LYS 57  57  57  LYS LYS A . n 
A 1 58  LYS 58  58  58  LYS LYS A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  TYR 64  64  64  TYR TYR A . n 
A 1 65  HIS 65  65  65  HIS HIS A . n 
A 1 66  ARG 66  66  66  ARG ARG A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  MET 69  69  69  MET MET A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  TRP 79  79  79  TRP TRP A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  TRP 85  85  85  TRP TRP A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  SER 87  87  87  SER SER A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  TRP 92  92  92  TRP TRP A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ARG 100 100 100 ARG ARG A . n 
A 1 101 HIS 101 101 101 HIS HIS A . n 
A 1 102 HIS 102 102 102 HIS HIS A . n 
A 1 103 GLN 103 103 103 GLN GLN A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 LYS 105 105 105 LYS LYS A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 ASP 110 110 110 ASP ALA A . n 
A 1 111 CYS 111 111 ?   ?   ?   A . n 
A 1 112 ASP 112 112 ?   ?   ?   A . n 
A 1 113 HIS 113 113 ?   ?   ?   A . n 
A 1 114 GLN 114 114 ?   ?   ?   A . n 
A 1 115 GLN 115 115 ?   ?   ?   A . n 
A 1 116 ASN 116 116 ?   ?   ?   A . n 
A 1 117 SER 117 117 ?   ?   ?   A . n 
A 1 118 PRO 118 118 ?   ?   ?   A . n 
A 1 119 THR 119 119 ?   ?   ?   A . n 
A 1 120 LEU 120 120 ?   ?   ?   A . n 
A 1 121 GLU 121 121 ?   ?   ?   A . n 
A 1 122 ARG 122 122 ?   ?   ?   A . n 
A 1 123 PRO 123 123 ?   ?   ?   A . n 
A 1 124 GLY 124 124 ?   ?   ?   A . n 
A 1 125 ARG 125 125 ?   ?   ?   A . n 
A 1 126 LYS 126 126 ?   ?   ?   A . n 
A 1 127 ARG 127 127 ?   ?   ?   A . n 
A 1 128 LYS 128 128 ?   ?   ?   A . n 
A 1 129 TRP 129 129 ?   ?   ?   A . n 
A 1 130 THR 130 130 ?   ?   ?   A . n 
A 1 131 GLU 131 131 ?   ?   ?   A . n 
A 1 132 THR 132 132 ?   ?   ?   A . n 
A 1 133 GLN 133 133 ?   ?   ?   A . n 
A 1 134 ASP 134 134 ?   ?   ?   A . n 
A 1 135 SER 135 135 ?   ?   ?   A . n 
A 1 136 SER 136 136 ?   ?   ?   A . n 
A 1 137 GLN 137 137 ?   ?   ?   A . n 
A 1 138 LYS 138 138 ?   ?   ?   A . n 
A 1 139 LYS 139 139 ?   ?   ?   A . n 
A 1 140 SER 140 140 ?   ?   ?   A . n 
A 1 141 LEU 141 141 ?   ?   ?   A . n 
A 1 142 GLU 142 142 ?   ?   ?   A . n 
A 1 143 PRO 143 143 ?   ?   ?   A . n 
A 1 144 LYS 144 144 ?   ?   ?   A . n 
A 1 145 THR 145 145 ?   ?   ?   A . n 
A 1 146 LYS 146 146 ?   ?   ?   A . n 
A 1 147 ALA 147 147 ?   ?   ?   A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 LYS 152 152 152 LYS LYS A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 LEU 154 154 154 LEU LEU A . n 
A 1 155 CYS 155 155 155 CYS CYS A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 PHE 163 163 163 PHE PHE A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 PRO 166 166 166 PRO PRO A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 TRP 169 169 169 TRP TRP A . n 
A 1 170 LYS 170 170 170 LYS LYS A . n 
A 1 171 SER 171 171 171 SER SER A . n 
A 1 172 GLU 172 172 172 GLU GLU A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 ASN 180 180 180 ASN ASN A . n 
A 1 181 TYR 181 181 181 TYR TYR A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 LEU 183 183 183 LEU LEU A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 CYS 185 185 185 CYS CYS A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 THR 187 187 187 THR THR A . n 
A 1 188 ARG 188 188 188 ARG ARG A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 ASN 191 191 191 ASN ASN A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 GLN 194 194 194 GLN GLN A . n 
A 1 195 LYS 195 195 195 LYS LYS A . n 
A 1 196 PHE 196 196 196 PHE PHE A . n 
A 1 197 ILE 197 197 197 ILE ILE A . n 
A 1 198 TYR 198 198 198 TYR TYR A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ASP 201 201 201 ASP ASP A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 TRP 204 204 204 TRP TRP A . n 
A 1 205 LYS 205 205 205 LYS LYS A . n 
A 1 206 HIS 206 206 206 HIS HIS A . n 
A 1 207 ARG 207 207 207 ARG ARG A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 ASN 209 209 209 ASN ASN A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 HIS 211 211 211 HIS HIS A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 ASN 214 214 214 ASN ASN A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 TRP 216 216 216 TRP TRP A . n 
A 1 217 PHE 217 217 217 PHE PHE A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 ASN 219 219 219 ASN ASN A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 ILE 221 221 221 ILE ILE A . n 
A 1 222 SER 222 222 222 SER SER A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 THR 224 224 224 THR THR A . n 
A 1 225 LYS 225 225 225 LYS LYS A . n 
A 1 226 ILE 226 226 226 ILE ILE A . n 
A 1 227 ARG 227 227 227 ARG ARG A . n 
A 1 228 ARG 228 228 228 ARG ARG A . n 
A 1 229 ALA 229 229 229 ALA ALA A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 ARG 231 231 231 ARG ARG A . n 
A 1 232 ARG 232 232 232 ARG ARG A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 GLN 234 234 234 GLN GLN A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 ILE 236 236 236 ILE ILE A . n 
A 1 237 ARG 237 237 237 ARG ARG A . n 
A 1 238 TYR 238 238 238 TYR TYR A . n 
A 1 239 LEU 239 239 239 LEU LEU A . n 
A 1 240 VAL 240 240 240 VAL VAL A . n 
A 1 241 PRO 241 241 241 PRO PRO A . n 
A 1 242 ASP 242 242 242 ASP ASP A . n 
A 1 243 LEU 243 243 243 LEU LEU A . n 
A 1 244 VAL 244 244 244 VAL VAL A . n 
A 1 245 GLN 245 245 245 GLN GLN A . n 
A 1 246 GLU 246 246 246 GLU GLU A . n 
A 1 247 TYR 247 247 247 TYR TYR A . n 
A 1 248 ILE 248 248 248 ILE ILE A . n 
A 1 249 GLU 249 249 249 GLU GLU A . n 
A 1 250 LYS 250 250 250 LYS LYS A . n 
A 1 251 HIS 251 251 251 HIS HIS A . n 
A 1 252 ASN 252 252 252 ASN ASN A . n 
A 1 253 LEU 253 253 253 LEU LEU A . n 
A 1 254 TYR 254 254 254 TYR TYR A . n 
A 1 255 SER 255 255 255 SER SER A . n 
A 1 256 SER 256 256 256 SER SER A . n 
A 1 257 GLU 257 257 257 GLU GLU A . n 
A 1 258 SER 258 258 ?   ?   ?   A . n 
A 1 259 GLU 259 259 ?   ?   ?   A . n 
A 1 260 ASP 260 260 ?   ?   ?   A . n 
A 1 261 ARG 261 261 ?   ?   ?   A . n 
A 1 262 ASN 262 262 ?   ?   ?   A . n 
A 1 263 ALA 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 VAL 265 265 ?   ?   ?   A . n 
A 1 266 ILE 266 266 ?   ?   ?   A . n 
A 1 267 LEU 267 267 ?   ?   ?   A . n 
A 1 268 ALA 268 268 ?   ?   ?   A . n 
A 1 269 PRO 269 269 ?   ?   ?   A . n 
A 1 270 LEU 270 270 ?   ?   ?   A . n 
A 1 271 GLN 271 271 ?   ?   ?   A . n 
A 1 272 ARG 272 272 ?   ?   ?   A . n 
A 1 273 ASN 273 273 ?   ?   ?   A . n 
A 1 274 THR 274 274 ?   ?   ?   A . n 
A 1 275 ALA 275 275 ?   ?   ?   A . n 
A 1 276 GLU 276 276 ?   ?   ?   A . n 
A 1 277 ALA 277 277 ?   ?   ?   A . n 
A 1 278 LYS 278 278 ?   ?   ?   A . n 
A 1 279 THR 279 279 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4,5,6 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z            1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_665  -y+1,x-y+1,z     -0.5000000000 -0.8660254038 0.0000000000 73.7295000000  0.8660254038  
-0.5000000000 0.0000000000 127.7032400166 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
3 'crystal symmetry operation' 3_565  -x+y,-x+1,z      -0.5000000000 0.8660254038  0.0000000000 -73.7295000000 -0.8660254038 
-0.5000000000 0.0000000000 127.7032400166 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
4 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+1/2 0.5000000000  -0.8660254038 0.0000000000 73.7295000000  -0.8660254038 
-0.5000000000 0.0000000000 127.7032400166 0.0000000000 0.0000000000 -1.0000000000 30.8550000000 
5 'crystal symmetry operation' 12_565 x,x-y+1,-z+1/2   0.5000000000  0.8660254038  0.0000000000 -73.7295000000 0.8660254038  
-0.5000000000 0.0000000000 127.7032400166 0.0000000000 0.0000000000 -1.0000000000 30.8550000000 
6 'crystal symmetry operation' 11_555 -x+y,y,-z+1/2    -1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 -1.0000000000 30.8550000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-06-10 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELXS phasing          .         ? 1 
REFMAC refinement       .         ? 2 
MOSFLM 'data reduction' .         ? 3 
CCP4   'data scaling'   '(SCALA)' ? 4 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            SD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            MET 
_pdbx_validate_rmsd_bond.auth_seq_id_1             69 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CE 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            MET 
_pdbx_validate_rmsd_bond.auth_seq_id_2             69 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                2.166 
_pdbx_validate_rmsd_bond.bond_target_value         1.774 
_pdbx_validate_rmsd_bond.bond_deviation            0.392 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.056 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A PRO 19  ? ? CA A PRO 19  ? ? C   A PRO 19  ? ? 93.65  112.00 -18.35 2.50 N 
2 1 CB A ASP 33  ? ? CG A ASP 33  ? ? OD2 A ASP 33  ? ? 124.85 118.30 6.55   0.90 N 
3 1 CB A ASP 158 ? ? CG A ASP 158 ? ? OD2 A ASP 158 ? ? 124.32 118.30 6.02   0.90 N 
4 1 CB A ASP 173 ? ? CG A ASP 173 ? ? OD2 A ASP 173 ? ? 123.98 118.30 5.68   0.90 N 
5 1 CB A VAL 178 ? ? CA A VAL 178 ? ? C   A VAL 178 ? ? 88.88  111.40 -22.52 1.90 N 
6 1 CB A ASN 191 ? ? CA A ASN 191 ? ? C   A ASN 191 ? ? 122.47 110.40 12.07  2.00 N 
7 1 CB A PHE 196 ? ? CG A PHE 196 ? ? CD1 A PHE 196 ? ? 116.58 120.80 -4.22  0.70 N 
8 1 CB A ASP 201 ? ? CG A ASP 201 ? ? OD2 A ASP 201 ? ? 124.91 118.30 6.61   0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 63  ? ? -38.55  -35.56 
2 1 SER A 109 ? ? -77.63  49.77  
3 1 ASP A 158 ? ? -15.42  -52.77 
4 1 ALA A 189 ? ? -141.21 51.62  
5 1 ASN A 219 ? ? -153.29 71.81  
6 1 TYR A 238 ? ? 84.43   8.66   
7 1 SER A 256 ? ? -58.85  -90.99 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   SER 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    256 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   GLU 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    257 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -133.27 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ASP 110 ? CG  ? A ASP 110 CG  
2 1 Y 1 A ASP 110 ? OD1 ? A ASP 110 OD1 
3 1 Y 1 A ASP 110 ? OD2 ? A ASP 110 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLU 2   ? A GLU 2   
3  1 Y 1 A ASN 3   ? A ASN 3   
4  1 Y 1 A SER 4   ? A SER 4   
5  1 Y 1 A CYS 111 ? A CYS 111 
6  1 Y 1 A ASP 112 ? A ASP 112 
7  1 Y 1 A HIS 113 ? A HIS 113 
8  1 Y 1 A GLN 114 ? A GLN 114 
9  1 Y 1 A GLN 115 ? A GLN 115 
10 1 Y 1 A ASN 116 ? A ASN 116 
11 1 Y 1 A SER 117 ? A SER 117 
12 1 Y 1 A PRO 118 ? A PRO 118 
13 1 Y 1 A THR 119 ? A THR 119 
14 1 Y 1 A LEU 120 ? A LEU 120 
15 1 Y 1 A GLU 121 ? A GLU 121 
16 1 Y 1 A ARG 122 ? A ARG 122 
17 1 Y 1 A PRO 123 ? A PRO 123 
18 1 Y 1 A GLY 124 ? A GLY 124 
19 1 Y 1 A ARG 125 ? A ARG 125 
20 1 Y 1 A LYS 126 ? A LYS 126 
21 1 Y 1 A ARG 127 ? A ARG 127 
22 1 Y 1 A LYS 128 ? A LYS 128 
23 1 Y 1 A TRP 129 ? A TRP 129 
24 1 Y 1 A THR 130 ? A THR 130 
25 1 Y 1 A GLU 131 ? A GLU 131 
26 1 Y 1 A THR 132 ? A THR 132 
27 1 Y 1 A GLN 133 ? A GLN 133 
28 1 Y 1 A ASP 134 ? A ASP 134 
29 1 Y 1 A SER 135 ? A SER 135 
30 1 Y 1 A SER 136 ? A SER 136 
31 1 Y 1 A GLN 137 ? A GLN 137 
32 1 Y 1 A LYS 138 ? A LYS 138 
33 1 Y 1 A LYS 139 ? A LYS 139 
34 1 Y 1 A SER 140 ? A SER 140 
35 1 Y 1 A LEU 141 ? A LEU 141 
36 1 Y 1 A GLU 142 ? A GLU 142 
37 1 Y 1 A PRO 143 ? A PRO 143 
38 1 Y 1 A LYS 144 ? A LYS 144 
39 1 Y 1 A THR 145 ? A THR 145 
40 1 Y 1 A LYS 146 ? A LYS 146 
41 1 Y 1 A ALA 147 ? A ALA 147 
42 1 Y 1 A SER 258 ? A SER 258 
43 1 Y 1 A GLU 259 ? A GLU 259 
44 1 Y 1 A ASP 260 ? A ASP 260 
45 1 Y 1 A ARG 261 ? A ARG 261 
46 1 Y 1 A ASN 262 ? A ASN 262 
47 1 Y 1 A ALA 263 ? A ALA 263 
48 1 Y 1 A GLY 264 ? A GLY 264 
49 1 Y 1 A VAL 265 ? A VAL 265 
50 1 Y 1 A ILE 266 ? A ILE 266 
51 1 Y 1 A LEU 267 ? A LEU 267 
52 1 Y 1 A ALA 268 ? A ALA 268 
53 1 Y 1 A PRO 269 ? A PRO 269 
54 1 Y 1 A LEU 270 ? A LEU 270 
55 1 Y 1 A GLN 271 ? A GLN 271 
56 1 Y 1 A ARG 272 ? A ARG 272 
57 1 Y 1 A ASN 273 ? A ASN 273 
58 1 Y 1 A THR 274 ? A THR 274 
59 1 Y 1 A ALA 275 ? A ALA 275 
60 1 Y 1 A GLU 276 ? A GLU 276 
61 1 Y 1 A ALA 277 ? A ALA 277 
62 1 Y 1 A LYS 278 ? A LYS 278 
63 1 Y 1 A THR 279 ? A THR 279 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  280 1  HOH HOH A . 
B 2 HOH 2  281 2  HOH HOH A . 
B 2 HOH 3  282 3  HOH HOH A . 
B 2 HOH 4  283 4  HOH HOH A . 
B 2 HOH 5  284 5  HOH HOH A . 
B 2 HOH 6  285 6  HOH HOH A . 
B 2 HOH 7  286 7  HOH HOH A . 
B 2 HOH 8  287 8  HOH HOH A . 
B 2 HOH 9  288 9  HOH HOH A . 
B 2 HOH 10 289 11 HOH HOH A . 
B 2 HOH 11 290 12 HOH HOH A . 
B 2 HOH 12 291 14 HOH HOH A . 
B 2 HOH 13 292 15 HOH HOH A . 
B 2 HOH 14 293 18 HOH HOH A . 
B 2 HOH 15 294 19 HOH HOH A . 
B 2 HOH 16 295 20 HOH HOH A . 
B 2 HOH 17 296 21 HOH HOH A . 
B 2 HOH 18 297 22 HOH HOH A . 
B 2 HOH 19 298 23 HOH HOH A . 
B 2 HOH 20 299 24 HOH HOH A . 
B 2 HOH 21 300 25 HOH HOH A . 
B 2 HOH 22 301 26 HOH HOH A . 
B 2 HOH 23 302 27 HOH HOH A . 
B 2 HOH 24 303 29 HOH HOH A . 
B 2 HOH 25 304 30 HOH HOH A . 
B 2 HOH 26 305 31 HOH HOH A . 
B 2 HOH 27 306 33 HOH HOH A . 
B 2 HOH 28 307 34 HOH HOH A . 
B 2 HOH 29 308 35 HOH HOH A . 
B 2 HOH 30 309 36 HOH HOH A . 
B 2 HOH 31 310 38 HOH HOH A . 
B 2 HOH 32 311 39 HOH HOH A . 
B 2 HOH 33 312 40 HOH HOH A . 
B 2 HOH 34 313 41 HOH HOH A . 
B 2 HOH 35 314 42 HOH HOH A . 
B 2 HOH 36 315 43 HOH HOH A . 
B 2 HOH 37 316 44 HOH HOH A . 
B 2 HOH 38 317 47 HOH HOH A . 
B 2 HOH 39 318 48 HOH HOH A . 
B 2 HOH 40 319 49 HOH HOH A . 
B 2 HOH 41 320 52 HOH HOH A . 
B 2 HOH 42 321 53 HOH HOH A . 
B 2 HOH 43 322 54 HOH HOH A . 
B 2 HOH 44 323 58 HOH HOH A . 
B 2 HOH 45 324 59 HOH HOH A . 
B 2 HOH 46 325 63 HOH HOH A . 
B 2 HOH 47 326 64 HOH HOH A . 
B 2 HOH 48 327 71 HOH HOH A . 
B 2 HOH 49 328 72 HOH HOH A . 
B 2 HOH 50 329 73 HOH HOH A . 
B 2 HOH 51 330 74 HOH HOH A . 
B 2 HOH 52 331 75 HOH HOH A . 
B 2 HOH 53 332 76 HOH HOH A . 
B 2 HOH 54 333 78 HOH HOH A . 
B 2 HOH 55 334 79 HOH HOH A . 
B 2 HOH 56 335 80 HOH HOH A . 
#