data_1KLA
# 
_entry.id   1KLA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KLA         
WWPDB D_1000174451 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1KLC . 'representative structure' 
PDB 1KLD . ensemble                   
PDB 1KLA . split                      
PDB 1KLD . split                      
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KLA 
_pdbx_database_status.recvd_initial_deposition_date   1996-01-16 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hinck, A.P.'      1  
'Archer, S.J.'     2  
'Qian, S.W.'       3  
'Roberts, A.B.'    4  
'Sporn, M.B.'      5  
'Weatherbee, J.A.' 6  
'Tsang, M.L.-S.'   7  
'Lucas, R.'        8  
'Zhang, B.-L.'     9  
'Wenker, J.'       10 
'Torchia, D.A.'    11 
# 
_citation.id                        primary 
_citation.title                     
;Transforming growth factor beta 1: three-dimensional structure in solution and comparison with the X-ray structure of transforming growth factor beta 2.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            35 
_citation.page_first                8517 
_citation.page_last                 8534 
_citation.year                      1996 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8679613 
_citation.pdbx_database_id_DOI      10.1021/bi9604946 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hinck, A.P.'      1  
primary 'Archer, S.J.'     2  
primary 'Qian, S.W.'       3  
primary 'Roberts, A.B.'    4  
primary 'Sporn, M.B.'      5  
primary 'Weatherbee, J.A.' 6  
primary 'Tsang, M.L.'      7  
primary 'Lucas, R.'        8  
primary 'Zhang, B.L.'      9  
primary 'Wenker, J.'       10 
primary 'Torchia, D.A.'    11 
# 
_cell.entry_id           1KLA 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KLA 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'TRANSFORMING GROWTH FACTOR-BETA 1' 
_entity.formula_weight             12809.812 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    '1 MM (IN DIMER), PH 4.2' 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        TGF-B1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVP
QALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVP
QALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   LEU n 
1 3   ASP n 
1 4   THR n 
1 5   ASN n 
1 6   TYR n 
1 7   CYS n 
1 8   PHE n 
1 9   SER n 
1 10  SER n 
1 11  THR n 
1 12  GLU n 
1 13  LYS n 
1 14  ASN n 
1 15  CYS n 
1 16  CYS n 
1 17  VAL n 
1 18  ARG n 
1 19  GLN n 
1 20  LEU n 
1 21  TYR n 
1 22  ILE n 
1 23  ASP n 
1 24  PHE n 
1 25  ARG n 
1 26  LYS n 
1 27  ASP n 
1 28  LEU n 
1 29  GLY n 
1 30  TRP n 
1 31  LYS n 
1 32  TRP n 
1 33  ILE n 
1 34  HIS n 
1 35  GLU n 
1 36  PRO n 
1 37  LYS n 
1 38  GLY n 
1 39  TYR n 
1 40  HIS n 
1 41  ALA n 
1 42  ASN n 
1 43  PHE n 
1 44  CYS n 
1 45  LEU n 
1 46  GLY n 
1 47  PRO n 
1 48  CYS n 
1 49  PRO n 
1 50  TYR n 
1 51  ILE n 
1 52  TRP n 
1 53  SER n 
1 54  LEU n 
1 55  ASP n 
1 56  THR n 
1 57  GLN n 
1 58  TYR n 
1 59  SER n 
1 60  LYS n 
1 61  VAL n 
1 62  LEU n 
1 63  ALA n 
1 64  LEU n 
1 65  TYR n 
1 66  ASN n 
1 67  GLN n 
1 68  HIS n 
1 69  ASN n 
1 70  PRO n 
1 71  GLY n 
1 72  ALA n 
1 73  SER n 
1 74  ALA n 
1 75  ALA n 
1 76  PRO n 
1 77  CYS n 
1 78  CYS n 
1 79  VAL n 
1 80  PRO n 
1 81  GLN n 
1 82  ALA n 
1 83  LEU n 
1 84  GLU n 
1 85  PRO n 
1 86  LEU n 
1 87  PRO n 
1 88  ILE n 
1 89  VAL n 
1 90  TYR n 
1 91  TYR n 
1 92  VAL n 
1 93  GLY n 
1 94  ARG n 
1 95  LYS n 
1 96  PRO n 
1 97  LYS n 
1 98  VAL n 
1 99  GLU n 
1 100 GLN n 
1 101 LEU n 
1 102 SER n 
1 103 ASN n 
1 104 MET n 
1 105 ILE n 
1 106 VAL n 
1 107 ARG n 
1 108 SER n 
1 109 CYS n 
1 110 LYS n 
1 111 CYS n 
1 112 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                OVARY 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'Chinese hamster' 
_entity_src_gen.pdbx_host_org_scientific_name      'Cricetulus griseus' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     Cricetulus 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TGFB1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P01137 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLAL
YNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRL
KLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHAN
FCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KLA A 1 ? 112 ? P01137 279 ? 390 ? 1 112 
2 1 1KLA B 1 ? 112 ? P01137 279 ? 390 ? 1 112 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         ? 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  4.2 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_details.entry_id   1KLA 
_pdbx_nmr_details.text       'THIS ENTRY CONTAINS 1 - 17 OF 33 MODELS. 1 MM (IN DIMER).' 
# 
_pdbx_nmr_ensemble.entry_id                             1KLA 
_pdbx_nmr_ensemble.conformers_calculated_total_number   33 
_pdbx_nmr_ensemble.conformers_submitted_total_number    17 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           X-PLOR 3.1 BRUNGER 1 
'structure solution' XPLOR  3.1 ?       2 
# 
_exptl.entry_id          1KLA 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1KLA 
_struct.title                     'SOLUTION STRUCTURE OF TGF-B1, NMR, MODELS 1-17 OF 33 STRUCTURES' 
_struct.pdbx_descriptor           'TRANSFORMING GROWTH FACTOR-BETA 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KLA 
_struct_keywords.pdbx_keywords   'GROWTH FACTOR' 
_struct_keywords.text            'GROWTH FACTOR, MITOGEN, GLYCOPROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 57 ? HIS A 68 ? GLN A 57 HIS A 68 1 ? 12 
HELX_P HELX_P2 2 GLN B 57 ? HIS B 68 ? GLN B 57 HIS B 68 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 7  SG ? ? ? 1_555 A CYS 16  SG ? ? A CYS 7  A CYS 16  1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 78  SG ? ? A CYS 15 A CYS 78  1_555 ? ? ? ? ? ? ? 2.018 ? 
disulf3 disulf ? ? A CYS 44 SG ? ? ? 1_555 A CYS 109 SG ? ? A CYS 44 A CYS 109 1_555 ? ? ? ? ? ? ? 2.011 ? 
disulf4 disulf ? ? A CYS 48 SG ? ? ? 1_555 A CYS 111 SG ? ? A CYS 48 A CYS 111 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf5 disulf ? ? A CYS 77 SG ? ? ? 1_555 B CYS 77  SG ? ? A CYS 77 B CYS 77  1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf6 disulf ? ? B CYS 7  SG ? ? ? 1_555 B CYS 16  SG ? ? B CYS 7  B CYS 16  1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf7 disulf ? ? B CYS 15 SG ? ? ? 1_555 B CYS 78  SG ? ? B CYS 15 B CYS 78  1_555 ? ? ? ? ? ? ? 2.017 ? 
disulf8 disulf ? ? B CYS 44 SG ? ? ? 1_555 B CYS 109 SG ? ? B CYS 44 B CYS 109 1_555 ? ? ? ? ? ? ? 2.011 ? 
disulf9 disulf ? ? B CYS 48 SG ? ? ? 1_555 B CYS 111 SG ? ? B CYS 48 B CYS 111 1_555 ? ? ? ? ? ? ? 2.020 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 1  -0.21 
2  GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 1  -0.21 
3  GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 2  -0.07 
4  GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 2  -0.07 
5  GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 3  0.11  
6  GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 3  0.02  
7  GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 4  0.15  
8  GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 4  0.11  
9  GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 5  -0.04 
10 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 5  -0.13 
11 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 6  -0.21 
12 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 6  -0.20 
13 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 7  -0.05 
14 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 7  0.12  
15 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 8  -0.27 
16 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 8  -0.34 
17 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 9  -0.01 
18 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 9  -0.16 
19 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 10 -0.06 
20 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 10 0.00  
21 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 11 0.09  
22 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 11 0.00  
23 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 12 -0.32 
24 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 12 -0.32 
25 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 13 -0.23 
26 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 13 -0.16 
27 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 14 0.15  
28 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 14 -0.09 
29 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 15 0.04  
30 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 15 0.15  
31 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 16 0.44  
32 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 16 0.34  
33 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 17 -0.04 
34 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 17 -0.05 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 16  ? ARG A 18  ? CYS A 16  ARG A 18  
A 2 PHE A 43  ? LEU A 45  ? PHE A 43  LEU A 45  
B 1 TYR A 90  ? VAL A 92  ? TYR A 90  VAL A 92  
B 2 LYS A 95  ? LYS A 97  ? LYS A 95  LYS A 97  
C 1 CYS B 16  ? ARG B 18  ? CYS B 16  ARG B 18  
C 2 PHE B 43  ? LEU B 45  ? PHE B 43  LEU B 45  
D 1 TYR B 90  ? VAL B 92  ? TYR B 90  VAL B 92  
D 2 LYS B 95  ? LYS B 97  ? LYS B 95  LYS B 97  
E 1 CYS A 77  ? ALA A 82  ? CYS A 77  ALA A 82  
E 2 SER A 108 ? SER A 112 ? SER A 108 SER A 112 
F 1 CYS B 77  ? ALA B 82  ? CYS B 77  ALA B 82  
F 2 SER B 108 ? SER B 112 ? SER B 108 SER B 112 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O CYS A 16 ? O CYS A 16 N LEU A 45  ? N LEU A 45  
B 1 2 O TYR A 90 ? O TYR A 90 N LYS A 97  ? N LYS A 97  
C 1 2 O CYS B 16 ? O CYS B 16 N LEU B 45  ? N LEU B 45  
D 1 2 O TYR B 90 ? O TYR B 90 N LYS B 97  ? N LYS B 97  
E 1 2 O CYS A 77 ? O CYS A 77 N SER A 112 ? N SER A 112 
F 1 2 O CYS B 77 ? O CYS B 77 N SER B 112 ? N SER B 112 
# 
_database_PDB_matrix.entry_id          1KLA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KLA 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ALA A 1 1   ? 9.028   -1.949  -15.575 1.00 0.00 ? 1   ALA A N    1  
ATOM 2     C CA   . ALA A 1 1   ? 7.983   -2.064  -14.518 1.00 0.00 ? 1   ALA A CA   1  
ATOM 3     C C    . ALA A 1 1   ? 8.284   -1.076  -13.388 1.00 0.00 ? 1   ALA A C    1  
ATOM 4     O O    . ALA A 1 1   ? 9.163   -0.244  -13.495 1.00 0.00 ? 1   ALA A O    1  
ATOM 5     C CB   . ALA A 1 1   ? 7.976   -3.489  -13.961 1.00 0.00 ? 1   ALA A CB   1  
ATOM 6     H H1   . ALA A 1 1   ? 9.351   -0.964  -15.639 1.00 0.00 ? 1   ALA A H1   1  
ATOM 7     H H2   . ALA A 1 1   ? 9.834   -2.561  -15.334 1.00 0.00 ? 1   ALA A H2   1  
ATOM 8     H H3   . ALA A 1 1   ? 8.629   -2.245  -16.490 1.00 0.00 ? 1   ALA A H3   1  
ATOM 9     H HA   . ALA A 1 1   ? 7.016   -1.840  -14.944 1.00 0.00 ? 1   ALA A HA   1  
ATOM 10    H HB1  . ALA A 1 1   ? 8.543   -4.134  -14.616 1.00 0.00 ? 1   ALA A HB1  1  
ATOM 11    H HB2  . ALA A 1 1   ? 8.422   -3.494  -12.978 1.00 0.00 ? 1   ALA A HB2  1  
ATOM 12    H HB3  . ALA A 1 1   ? 6.959   -3.845  -13.897 1.00 0.00 ? 1   ALA A HB3  1  
ATOM 13    N N    . LEU A 1 2   ? 7.559   -1.162  -12.307 1.00 0.00 ? 2   LEU A N    1  
ATOM 14    C CA   . LEU A 1 2   ? 7.798   -0.229  -11.168 1.00 0.00 ? 2   LEU A CA   1  
ATOM 15    C C    . LEU A 1 2   ? 8.801   -0.848  -10.198 1.00 0.00 ? 2   LEU A C    1  
ATOM 16    O O    . LEU A 1 2   ? 8.546   -0.965  -9.016  1.00 0.00 ? 2   LEU A O    1  
ATOM 17    C CB   . LEU A 1 2   ? 6.486   0.017   -10.434 1.00 0.00 ? 2   LEU A CB   1  
ATOM 18    C CG   . LEU A 1 2   ? 5.657   1.049   -11.198 1.00 0.00 ? 2   LEU A CG   1  
ATOM 19    C CD1  . LEU A 1 2   ? 4.277   1.173   -10.552 1.00 0.00 ? 2   LEU A CD1  1  
ATOM 20    C CD2  . LEU A 1 2   ? 6.365   2.405   -11.153 1.00 0.00 ? 2   LEU A CD2  1  
ATOM 21    H H    . LEU A 1 2   ? 6.855   -1.840  -12.243 1.00 0.00 ? 2   LEU A H    1  
ATOM 22    H HA   . LEU A 1 2   ? 8.185   0.708   -11.540 1.00 0.00 ? 2   LEU A HA   1  
ATOM 23    H HB2  . LEU A 1 2   ? 5.939   -0.910  -10.365 1.00 0.00 ? 2   LEU A HB2  1  
ATOM 24    H HB3  . LEU A 1 2   ? 6.695   0.387   -9.442  1.00 0.00 ? 2   LEU A HB3  1  
ATOM 25    H HG   . LEU A 1 2   ? 5.547   0.732   -12.225 1.00 0.00 ? 2   LEU A HG   1  
ATOM 26    H HD11 . LEU A 1 2   ? 4.200   0.476   -9.730  1.00 0.00 ? 2   LEU A HD11 1  
ATOM 27    H HD12 . LEU A 1 2   ? 4.142   2.179   -10.184 1.00 0.00 ? 2   LEU A HD12 1  
ATOM 28    H HD13 . LEU A 1 2   ? 3.515   0.953   -11.284 1.00 0.00 ? 2   LEU A HD13 1  
ATOM 29    H HD21 . LEU A 1 2   ? 7.399   2.263   -10.877 1.00 0.00 ? 2   LEU A HD21 1  
ATOM 30    H HD22 . LEU A 1 2   ? 6.312   2.872   -12.125 1.00 0.00 ? 2   LEU A HD22 1  
ATOM 31    H HD23 . LEU A 1 2   ? 5.882   3.037   -10.422 1.00 0.00 ? 2   LEU A HD23 1  
ATOM 32    N N    . ASP A 1 3   ? 9.937   -1.242  -10.687 1.00 0.00 ? 3   ASP A N    1  
ATOM 33    C CA   . ASP A 1 3   ? 10.958  -1.852  -9.790  1.00 0.00 ? 3   ASP A CA   1  
ATOM 34    C C    . ASP A 1 3   ? 12.065  -0.839  -9.504  1.00 0.00 ? 3   ASP A C    1  
ATOM 35    O O    . ASP A 1 3   ? 12.110  0.233   -10.075 1.00 0.00 ? 3   ASP A O    1  
ATOM 36    C CB   . ASP A 1 3   ? 11.566  -3.092  -10.451 1.00 0.00 ? 3   ASP A CB   1  
ATOM 37    C CG   . ASP A 1 3   ? 11.545  -2.936  -11.973 1.00 0.00 ? 3   ASP A CG   1  
ATOM 38    O OD1  . ASP A 1 3   ? 10.521  -3.234  -12.566 1.00 0.00 ? 3   ASP A OD1  1  
ATOM 39    O OD2  . ASP A 1 3   ? 12.554  -2.522  -12.520 1.00 0.00 ? 3   ASP A OD2  1  
ATOM 40    H H    . ASP A 1 3   ? 10.117  -1.135  -11.641 1.00 0.00 ? 3   ASP A H    1  
ATOM 41    H HA   . ASP A 1 3   ? 10.489  -2.138  -8.860  1.00 0.00 ? 3   ASP A HA   1  
ATOM 42    H HB2  . ASP A 1 3   ? 12.586  -3.211  -10.117 1.00 0.00 ? 3   ASP A HB2  1  
ATOM 43    H HB3  . ASP A 1 3   ? 10.995  -3.962  -10.171 1.00 0.00 ? 3   ASP A HB3  1  
ATOM 44    N N    . THR A 1 4   ? 12.958  -1.176  -8.619  1.00 0.00 ? 4   THR A N    1  
ATOM 45    C CA   . THR A 1 4   ? 14.071  -0.247  -8.277  1.00 0.00 ? 4   THR A CA   1  
ATOM 46    C C    . THR A 1 4   ? 15.092  -0.216  -9.416  1.00 0.00 ? 4   THR A C    1  
ATOM 47    O O    . THR A 1 4   ? 16.073  0.499   -9.363  1.00 0.00 ? 4   THR A O    1  
ATOM 48    C CB   . THR A 1 4   ? 14.733  -0.723  -6.985  1.00 0.00 ? 4   THR A CB   1  
ATOM 49    O OG1  . THR A 1 4   ? 15.606  -1.807  -7.272  1.00 0.00 ? 4   THR A OG1  1  
ATOM 50    C CG2  . THR A 1 4   ? 13.647  -1.180  -6.006  1.00 0.00 ? 4   THR A CG2  1  
ATOM 51    H H    . THR A 1 4   ? 12.895  -2.047  -8.173  1.00 0.00 ? 4   THR A H    1  
ATOM 52    H HA   . THR A 1 4   ? 13.679  0.745   -8.131  1.00 0.00 ? 4   THR A HA   1  
ATOM 53    H HB   . THR A 1 4   ? 15.294  0.086   -6.544  1.00 0.00 ? 4   THR A HB   1  
ATOM 54    H HG1  . THR A 1 4   ? 15.283  -2.246  -8.063  1.00 0.00 ? 4   THR A HG1  1  
ATOM 55    H HG21 . THR A 1 4   ? 12.673  -0.978  -6.430  1.00 0.00 ? 4   THR A HG21 1  
ATOM 56    H HG22 . THR A 1 4   ? 13.747  -2.239  -5.824  1.00 0.00 ? 4   THR A HG22 1  
ATOM 57    H HG23 . THR A 1 4   ? 13.751  -0.642  -5.075  1.00 0.00 ? 4   THR A HG23 1  
ATOM 58    N N    . ASN A 1 5   ? 14.864  -0.974  -10.453 1.00 0.00 ? 5   ASN A N    1  
ATOM 59    C CA   . ASN A 1 5   ? 15.815  -0.973  -11.598 1.00 0.00 ? 5   ASN A CA   1  
ATOM 60    C C    . ASN A 1 5   ? 15.251  -0.094  -12.718 1.00 0.00 ? 5   ASN A C    1  
ATOM 61    O O    . ASN A 1 5   ? 15.981  0.545   -13.448 1.00 0.00 ? 5   ASN A O    1  
ATOM 62    C CB   . ASN A 1 5   ? 16.002  -2.403  -12.110 1.00 0.00 ? 5   ASN A CB   1  
ATOM 63    C CG   . ASN A 1 5   ? 17.331  -2.509  -12.859 1.00 0.00 ? 5   ASN A CG   1  
ATOM 64    O OD1  . ASN A 1 5   ? 17.357  -2.813  -14.035 1.00 0.00 ? 5   ASN A OD1  1  
ATOM 65    N ND2  . ASN A 1 5   ? 18.446  -2.271  -12.223 1.00 0.00 ? 5   ASN A ND2  1  
ATOM 66    H H    . ASN A 1 5   ? 14.063  -1.537  -10.483 1.00 0.00 ? 5   ASN A H    1  
ATOM 67    H HA   . ASN A 1 5   ? 16.766  -0.577  -11.276 1.00 0.00 ? 5   ASN A HA   1  
ATOM 68    H HB2  . ASN A 1 5   ? 16.003  -3.086  -11.273 1.00 0.00 ? 5   ASN A HB2  1  
ATOM 69    H HB3  . ASN A 1 5   ? 15.193  -2.654  -12.779 1.00 0.00 ? 5   ASN A HB3  1  
ATOM 70    H HD21 . ASN A 1 5   ? 18.426  -2.026  -11.274 1.00 0.00 ? 5   ASN A HD21 1  
ATOM 71    H HD22 . ASN A 1 5   ? 19.302  -2.336  -12.694 1.00 0.00 ? 5   ASN A HD22 1  
ATOM 72    N N    . TYR A 1 6   ? 13.952  -0.062  -12.858 1.00 0.00 ? 6   TYR A N    1  
ATOM 73    C CA   . TYR A 1 6   ? 13.333  0.767   -13.926 1.00 0.00 ? 6   TYR A CA   1  
ATOM 74    C C    . TYR A 1 6   ? 13.121  2.195   -13.417 1.00 0.00 ? 6   TYR A C    1  
ATOM 75    O O    . TYR A 1 6   ? 13.068  3.134   -14.187 1.00 0.00 ? 6   TYR A O    1  
ATOM 76    C CB   . TYR A 1 6   ? 11.985  0.152   -14.301 1.00 0.00 ? 6   TYR A CB   1  
ATOM 77    C CG   . TYR A 1 6   ? 11.192  1.124   -15.142 1.00 0.00 ? 6   TYR A CG   1  
ATOM 78    C CD1  . TYR A 1 6   ? 11.481  1.276   -16.503 1.00 0.00 ? 6   TYR A CD1  1  
ATOM 79    C CD2  . TYR A 1 6   ? 10.164  1.872   -14.556 1.00 0.00 ? 6   TYR A CD2  1  
ATOM 80    C CE1  . TYR A 1 6   ? 10.742  2.178   -17.279 1.00 0.00 ? 6   TYR A CE1  1  
ATOM 81    C CE2  . TYR A 1 6   ? 9.425   2.773   -15.330 1.00 0.00 ? 6   TYR A CE2  1  
ATOM 82    C CZ   . TYR A 1 6   ? 9.713   2.926   -16.692 1.00 0.00 ? 6   TYR A CZ   1  
ATOM 83    O OH   . TYR A 1 6   ? 8.983   3.814   -17.457 1.00 0.00 ? 6   TYR A OH   1  
ATOM 84    H H    . TYR A 1 6   ? 13.381  -0.588  -12.262 1.00 0.00 ? 6   TYR A H    1  
ATOM 85    H HA   . TYR A 1 6   ? 13.976  0.782   -14.793 1.00 0.00 ? 6   TYR A HA   1  
ATOM 86    H HB2  . TYR A 1 6   ? 12.150  -0.758  -14.855 1.00 0.00 ? 6   TYR A HB2  1  
ATOM 87    H HB3  . TYR A 1 6   ? 11.433  -0.074  -13.400 1.00 0.00 ? 6   TYR A HB3  1  
ATOM 88    H HD1  . TYR A 1 6   ? 12.275  0.699   -16.955 1.00 0.00 ? 6   TYR A HD1  1  
ATOM 89    H HD2  . TYR A 1 6   ? 9.942   1.754   -13.505 1.00 0.00 ? 6   TYR A HD2  1  
ATOM 90    H HE1  . TYR A 1 6   ? 10.964  2.295   -18.329 1.00 0.00 ? 6   TYR A HE1  1  
ATOM 91    H HE2  . TYR A 1 6   ? 8.631   3.350   -14.876 1.00 0.00 ? 6   TYR A HE2  1  
ATOM 92    H HH   . TYR A 1 6   ? 9.598   4.317   -17.996 1.00 0.00 ? 6   TYR A HH   1  
ATOM 93    N N    . CYS A 1 7   ? 12.996  2.370   -12.130 1.00 0.00 ? 7   CYS A N    1  
ATOM 94    C CA   . CYS A 1 7   ? 12.783  3.741   -11.586 1.00 0.00 ? 7   CYS A CA   1  
ATOM 95    C C    . CYS A 1 7   ? 14.074  4.551   -11.710 1.00 0.00 ? 7   CYS A C    1  
ATOM 96    O O    . CYS A 1 7   ? 14.058  5.705   -12.089 1.00 0.00 ? 7   CYS A O    1  
ATOM 97    C CB   . CYS A 1 7   ? 12.350  3.652   -10.119 1.00 0.00 ? 7   CYS A CB   1  
ATOM 98    S SG   . CYS A 1 7   ? 10.544  3.576   -10.048 1.00 0.00 ? 7   CYS A SG   1  
ATOM 99    H H    . CYS A 1 7   ? 13.040  1.601   -11.523 1.00 0.00 ? 7   CYS A H    1  
ATOM 100   H HA   . CYS A 1 7   ? 12.006  4.229   -12.156 1.00 0.00 ? 7   CYS A HA   1  
ATOM 101   H HB2  . CYS A 1 7   ? 12.767  2.760   -9.669  1.00 0.00 ? 7   CYS A HB2  1  
ATOM 102   H HB3  . CYS A 1 7   ? 12.697  4.522   -9.580  1.00 0.00 ? 7   CYS A HB3  1  
ATOM 103   N N    . PHE A 1 8   ? 15.194  3.958   -11.404 1.00 0.00 ? 8   PHE A N    1  
ATOM 104   C CA   . PHE A 1 8   ? 16.478  4.702   -11.519 1.00 0.00 ? 8   PHE A CA   1  
ATOM 105   C C    . PHE A 1 8   ? 17.062  4.501   -12.918 1.00 0.00 ? 8   PHE A C    1  
ATOM 106   O O    . PHE A 1 8   ? 18.247  4.296   -13.086 1.00 0.00 ? 8   PHE A O    1  
ATOM 107   C CB   . PHE A 1 8   ? 17.461  4.195   -10.466 1.00 0.00 ? 8   PHE A CB   1  
ATOM 108   C CG   . PHE A 1 8   ? 17.306  5.026   -9.217  1.00 0.00 ? 8   PHE A CG   1  
ATOM 109   C CD1  . PHE A 1 8   ? 17.873  6.304   -9.158  1.00 0.00 ? 8   PHE A CD1  1  
ATOM 110   C CD2  . PHE A 1 8   ? 16.589  4.525   -8.124  1.00 0.00 ? 8   PHE A CD2  1  
ATOM 111   C CE1  . PHE A 1 8   ? 17.725  7.082   -8.005  1.00 0.00 ? 8   PHE A CE1  1  
ATOM 112   C CE2  . PHE A 1 8   ? 16.439  5.305   -6.971  1.00 0.00 ? 8   PHE A CE2  1  
ATOM 113   C CZ   . PHE A 1 8   ? 17.008  6.584   -6.912  1.00 0.00 ? 8   PHE A CZ   1  
ATOM 114   H H    . PHE A 1 8   ? 15.191  3.024   -11.107 1.00 0.00 ? 8   PHE A H    1  
ATOM 115   H HA   . PHE A 1 8   ? 16.295  5.755   -11.359 1.00 0.00 ? 8   PHE A HA   1  
ATOM 116   H HB2  . PHE A 1 8   ? 17.247  3.160   -10.244 1.00 0.00 ? 8   PHE A HB2  1  
ATOM 117   H HB3  . PHE A 1 8   ? 18.470  4.286   -10.838 1.00 0.00 ? 8   PHE A HB3  1  
ATOM 118   H HD1  . PHE A 1 8   ? 18.426  6.689   -10.002 1.00 0.00 ? 8   PHE A HD1  1  
ATOM 119   H HD2  . PHE A 1 8   ? 16.152  3.539   -8.170  1.00 0.00 ? 8   PHE A HD2  1  
ATOM 120   H HE1  . PHE A 1 8   ? 18.163  8.068   -7.959  1.00 0.00 ? 8   PHE A HE1  1  
ATOM 121   H HE2  . PHE A 1 8   ? 15.886  4.920   -6.127  1.00 0.00 ? 8   PHE A HE2  1  
ATOM 122   H HZ   . PHE A 1 8   ? 16.891  7.186   -6.024  1.00 0.00 ? 8   PHE A HZ   1  
ATOM 123   N N    . SER A 1 9   ? 16.234  4.561   -13.924 1.00 0.00 ? 9   SER A N    1  
ATOM 124   C CA   . SER A 1 9   ? 16.733  4.378   -15.315 1.00 0.00 ? 9   SER A CA   1  
ATOM 125   C C    . SER A 1 9   ? 16.224  5.525   -16.192 1.00 0.00 ? 9   SER A C    1  
ATOM 126   O O    . SER A 1 9   ? 16.954  6.079   -16.990 1.00 0.00 ? 9   SER A O    1  
ATOM 127   C CB   . SER A 1 9   ? 16.223  3.048   -15.870 1.00 0.00 ? 9   SER A CB   1  
ATOM 128   O OG   . SER A 1 9   ? 16.865  2.780   -17.109 1.00 0.00 ? 9   SER A OG   1  
ATOM 129   H H    . SER A 1 9   ? 15.282  4.729   -13.763 1.00 0.00 ? 9   SER A H    1  
ATOM 130   H HA   . SER A 1 9   ? 17.813  4.378   -15.313 1.00 0.00 ? 9   SER A HA   1  
ATOM 131   H HB2  . SER A 1 9   ? 16.447  2.256   -15.176 1.00 0.00 ? 9   SER A HB2  1  
ATOM 132   H HB3  . SER A 1 9   ? 15.152  3.106   -16.013 1.00 0.00 ? 9   SER A HB3  1  
ATOM 133   H HG   . SER A 1 9   ? 17.687  2.320   -16.924 1.00 0.00 ? 9   SER A HG   1  
ATOM 134   N N    . SER A 1 10  ? 14.978  5.887   -16.049 1.00 0.00 ? 10  SER A N    1  
ATOM 135   C CA   . SER A 1 10  ? 14.424  6.997   -16.875 1.00 0.00 ? 10  SER A CA   1  
ATOM 136   C C    . SER A 1 10  ? 13.511  7.872   -16.011 1.00 0.00 ? 10  SER A C    1  
ATOM 137   O O    . SER A 1 10  ? 13.586  7.855   -14.799 1.00 0.00 ? 10  SER A O    1  
ATOM 138   C CB   . SER A 1 10  ? 13.621  6.415   -18.038 1.00 0.00 ? 10  SER A CB   1  
ATOM 139   O OG   . SER A 1 10  ? 14.144  6.910   -19.264 1.00 0.00 ? 10  SER A OG   1  
ATOM 140   H H    . SER A 1 10  ? 14.406  5.427   -15.399 1.00 0.00 ? 10  SER A H    1  
ATOM 141   H HA   . SER A 1 10  ? 15.235  7.597   -17.261 1.00 0.00 ? 10  SER A HA   1  
ATOM 142   H HB2  . SER A 1 10  ? 13.696  5.341   -18.029 1.00 0.00 ? 10  SER A HB2  1  
ATOM 143   H HB3  . SER A 1 10  ? 12.582  6.702   -17.936 1.00 0.00 ? 10  SER A HB3  1  
ATOM 144   H HG   . SER A 1 10  ? 14.672  6.215   -19.664 1.00 0.00 ? 10  SER A HG   1  
ATOM 145   N N    . THR A 1 11  ? 12.648  8.636   -16.627 1.00 0.00 ? 11  THR A N    1  
ATOM 146   C CA   . THR A 1 11  ? 11.731  9.510   -15.841 1.00 0.00 ? 11  THR A CA   1  
ATOM 147   C C    . THR A 1 11  ? 10.338  8.881   -15.800 1.00 0.00 ? 11  THR A C    1  
ATOM 148   O O    . THR A 1 11  ? 10.119  7.801   -16.312 1.00 0.00 ? 11  THR A O    1  
ATOM 149   C CB   . THR A 1 11  ? 11.647  10.888  -16.502 1.00 0.00 ? 11  THR A CB   1  
ATOM 150   O OG1  . THR A 1 11  ? 12.511  10.926  -17.629 1.00 0.00 ? 11  THR A OG1  1  
ATOM 151   C CG2  . THR A 1 11  ? 12.065  11.964  -15.499 1.00 0.00 ? 11  THR A CG2  1  
ATOM 152   H H    . THR A 1 11  ? 12.604  8.634   -17.606 1.00 0.00 ? 11  THR A H    1  
ATOM 153   H HA   . THR A 1 11  ? 12.109  9.616   -14.835 1.00 0.00 ? 11  THR A HA   1  
ATOM 154   H HB   . THR A 1 11  ? 10.632  11.074  -16.819 1.00 0.00 ? 11  THR A HB   1  
ATOM 155   H HG1  . THR A 1 11  ? 13.410  11.026  -17.309 1.00 0.00 ? 11  THR A HG1  1  
ATOM 156   H HG21 . THR A 1 11  ? 11.726  11.686  -14.511 1.00 0.00 ? 11  THR A HG21 1  
ATOM 157   H HG22 . THR A 1 11  ? 13.141  12.056  -15.497 1.00 0.00 ? 11  THR A HG22 1  
ATOM 158   H HG23 . THR A 1 11  ? 11.623  12.908  -15.778 1.00 0.00 ? 11  THR A HG23 1  
ATOM 159   N N    . GLU A 1 12  ? 9.393   9.549   -15.195 1.00 0.00 ? 12  GLU A N    1  
ATOM 160   C CA   . GLU A 1 12  ? 8.014   8.989   -15.121 1.00 0.00 ? 12  GLU A CA   1  
ATOM 161   C C    . GLU A 1 12  ? 7.131   9.910   -14.274 1.00 0.00 ? 12  GLU A C    1  
ATOM 162   O O    . GLU A 1 12  ? 7.616   10.757  -13.550 1.00 0.00 ? 12  GLU A O    1  
ATOM 163   C CB   . GLU A 1 12  ? 8.062   7.600   -14.480 1.00 0.00 ? 12  GLU A CB   1  
ATOM 164   C CG   . GLU A 1 12  ? 7.000   6.703   -15.118 1.00 0.00 ? 12  GLU A CG   1  
ATOM 165   C CD   . GLU A 1 12  ? 7.417   6.350   -16.547 1.00 0.00 ? 12  GLU A CD   1  
ATOM 166   O OE1  . GLU A 1 12  ? 8.580   6.037   -16.744 1.00 0.00 ? 12  GLU A OE1  1  
ATOM 167   O OE2  . GLU A 1 12  ? 6.566   6.399   -17.420 1.00 0.00 ? 12  GLU A OE2  1  
ATOM 168   H H    . GLU A 1 12  ? 9.591   10.419  -14.789 1.00 0.00 ? 12  GLU A H    1  
ATOM 169   H HA   . GLU A 1 12  ? 7.602   8.912   -16.117 1.00 0.00 ? 12  GLU A HA   1  
ATOM 170   H HB2  . GLU A 1 12  ? 9.040   7.167   -14.632 1.00 0.00 ? 12  GLU A HB2  1  
ATOM 171   H HB3  . GLU A 1 12  ? 7.869   7.686   -13.421 1.00 0.00 ? 12  GLU A HB3  1  
ATOM 172   H HG2  . GLU A 1 12  ? 6.900   5.797   -14.537 1.00 0.00 ? 12  GLU A HG2  1  
ATOM 173   H HG3  . GLU A 1 12  ? 6.055   7.223   -15.139 1.00 0.00 ? 12  GLU A HG3  1  
ATOM 174   N N    . LYS A 1 13  ? 5.838   9.750   -14.357 1.00 0.00 ? 13  LYS A N    1  
ATOM 175   C CA   . LYS A 1 13  ? 4.926   10.615  -13.556 1.00 0.00 ? 13  LYS A CA   1  
ATOM 176   C C    . LYS A 1 13  ? 4.090   9.744   -12.615 1.00 0.00 ? 13  LYS A C    1  
ATOM 177   O O    . LYS A 1 13  ? 3.521   10.222  -11.653 1.00 0.00 ? 13  LYS A O    1  
ATOM 178   C CB   . LYS A 1 13  ? 3.995   11.387  -14.495 1.00 0.00 ? 13  LYS A CB   1  
ATOM 179   C CG   . LYS A 1 13  ? 3.398   10.428  -15.528 1.00 0.00 ? 13  LYS A CG   1  
ATOM 180   C CD   . LYS A 1 13  ? 3.948   10.766  -16.915 1.00 0.00 ? 13  LYS A CD   1  
ATOM 181   C CE   . LYS A 1 13  ? 3.204   9.947   -17.971 1.00 0.00 ? 13  LYS A CE   1  
ATOM 182   N NZ   . LYS A 1 13  ? 3.933   8.670   -18.213 1.00 0.00 ? 13  LYS A NZ   1  
ATOM 183   H H    . LYS A 1 13  ? 5.467   9.061   -14.946 1.00 0.00 ? 13  LYS A H    1  
ATOM 184   H HA   . LYS A 1 13  ? 5.510   11.314  -12.975 1.00 0.00 ? 13  LYS A HA   1  
ATOM 185   H HB2  . LYS A 1 13  ? 3.199   11.838  -13.920 1.00 0.00 ? 13  LYS A HB2  1  
ATOM 186   H HB3  . LYS A 1 13  ? 4.554   12.157  -15.003 1.00 0.00 ? 13  LYS A HB3  1  
ATOM 187   H HG2  . LYS A 1 13  ? 3.662   9.413   -15.272 1.00 0.00 ? 13  LYS A HG2  1  
ATOM 188   H HG3  . LYS A 1 13  ? 2.323   10.530  -15.534 1.00 0.00 ? 13  LYS A HG3  1  
ATOM 189   H HD2  . LYS A 1 13  ? 3.808   11.820  -17.110 1.00 0.00 ? 13  LYS A HD2  1  
ATOM 190   H HD3  . LYS A 1 13  ? 5.000   10.529  -16.953 1.00 0.00 ? 13  LYS A HD3  1  
ATOM 191   H HE2  . LYS A 1 13  ? 2.205   9.732   -17.622 1.00 0.00 ? 13  LYS A HE2  1  
ATOM 192   H HE3  . LYS A 1 13  ? 3.151   10.510  -18.891 1.00 0.00 ? 13  LYS A HE3  1  
ATOM 193   H HZ1  . LYS A 1 13  ? 4.799   8.650   -17.638 1.00 0.00 ? 13  LYS A HZ1  1  
ATOM 194   H HZ2  . LYS A 1 13  ? 3.326   7.869   -17.949 1.00 0.00 ? 13  LYS A HZ2  1  
ATOM 195   H HZ3  . LYS A 1 13  ? 4.183   8.600   -19.220 1.00 0.00 ? 13  LYS A HZ3  1  
ATOM 196   N N    . ASN A 1 14  ? 4.011   8.470   -12.883 1.00 0.00 ? 14  ASN A N    1  
ATOM 197   C CA   . ASN A 1 14  ? 3.211   7.572   -12.003 1.00 0.00 ? 14  ASN A CA   1  
ATOM 198   C C    . ASN A 1 14  ? 4.092   7.060   -10.862 1.00 0.00 ? 14  ASN A C    1  
ATOM 199   O O    . ASN A 1 14  ? 5.223   7.474   -10.704 1.00 0.00 ? 14  ASN A O    1  
ATOM 200   C CB   . ASN A 1 14  ? 2.691   6.386   -12.819 1.00 0.00 ? 14  ASN A CB   1  
ATOM 201   C CG   . ASN A 1 14  ? 2.399   6.839   -14.250 1.00 0.00 ? 14  ASN A CG   1  
ATOM 202   O OD1  . ASN A 1 14  ? 3.237   6.720   -15.121 1.00 0.00 ? 14  ASN A OD1  1  
ATOM 203   N ND2  . ASN A 1 14  ? 1.234   7.357   -14.533 1.00 0.00 ? 14  ASN A ND2  1  
ATOM 204   H H    . ASN A 1 14  ? 4.476   8.103   -13.664 1.00 0.00 ? 14  ASN A H    1  
ATOM 205   H HA   . ASN A 1 14  ? 2.376   8.121   -11.594 1.00 0.00 ? 14  ASN A HA   1  
ATOM 206   H HB2  . ASN A 1 14  ? 3.438   5.605   -12.833 1.00 0.00 ? 14  ASN A HB2  1  
ATOM 207   H HB3  . ASN A 1 14  ? 1.784   6.010   -12.370 1.00 0.00 ? 14  ASN A HB3  1  
ATOM 208   H HD21 . ASN A 1 14  ? 0.557   7.453   -13.831 1.00 0.00 ? 14  ASN A HD21 1  
ATOM 209   H HD22 . ASN A 1 14  ? 1.038   7.651   -15.447 1.00 0.00 ? 14  ASN A HD22 1  
ATOM 210   N N    . CYS A 1 15  ? 3.583   6.161   -10.063 1.00 0.00 ? 15  CYS A N    1  
ATOM 211   C CA   . CYS A 1 15  ? 4.393   5.625   -8.933  1.00 0.00 ? 15  CYS A CA   1  
ATOM 212   C C    . CYS A 1 15  ? 5.803   5.300   -9.427  1.00 0.00 ? 15  CYS A C    1  
ATOM 213   O O    . CYS A 1 15  ? 6.035   5.115   -10.606 1.00 0.00 ? 15  CYS A O    1  
ATOM 214   C CB   . CYS A 1 15  ? 3.734   4.350   -8.390  1.00 0.00 ? 15  CYS A CB   1  
ATOM 215   S SG   . CYS A 1 15  ? 4.890   3.479   -7.296  1.00 0.00 ? 15  CYS A SG   1  
ATOM 216   H H    . CYS A 1 15  ? 2.668   5.840   -10.207 1.00 0.00 ? 15  CYS A H    1  
ATOM 217   H HA   . CYS A 1 15  ? 4.448   6.364   -8.148  1.00 0.00 ? 15  CYS A HA   1  
ATOM 218   H HB2  . CYS A 1 15  ? 2.846   4.613   -7.835  1.00 0.00 ? 15  CYS A HB2  1  
ATOM 219   H HB3  . CYS A 1 15  ? 3.466   3.705   -9.214  1.00 0.00 ? 15  CYS A HB3  1  
ATOM 220   N N    . CYS A 1 16  ? 6.744   5.218   -8.529  1.00 0.00 ? 16  CYS A N    1  
ATOM 221   C CA   . CYS A 1 16  ? 8.137   4.890   -8.933  1.00 0.00 ? 16  CYS A CA   1  
ATOM 222   C C    . CYS A 1 16  ? 9.019   4.804   -7.688  1.00 0.00 ? 16  CYS A C    1  
ATOM 223   O O    . CYS A 1 16  ? 9.228   5.779   -6.992  1.00 0.00 ? 16  CYS A O    1  
ATOM 224   C CB   . CYS A 1 16  ? 8.679   5.975   -9.868  1.00 0.00 ? 16  CYS A CB   1  
ATOM 225   S SG   . CYS A 1 16  ? 9.929   5.264   -10.976 1.00 0.00 ? 16  CYS A SG   1  
ATOM 226   H H    . CYS A 1 16  ? 6.531   5.362   -7.583  1.00 0.00 ? 16  CYS A H    1  
ATOM 227   H HA   . CYS A 1 16  ? 8.144   3.938   -9.443  1.00 0.00 ? 16  CYS A HA   1  
ATOM 228   H HB2  . CYS A 1 16  ? 7.869   6.381   -10.455 1.00 0.00 ? 16  CYS A HB2  1  
ATOM 229   H HB3  . CYS A 1 16  ? 9.127   6.763   -9.281  1.00 0.00 ? 16  CYS A HB3  1  
ATOM 230   N N    . VAL A 1 17  ? 9.536   3.642   -7.403  1.00 0.00 ? 17  VAL A N    1  
ATOM 231   C CA   . VAL A 1 17  ? 10.405  3.484   -6.207  1.00 0.00 ? 17  VAL A CA   1  
ATOM 232   C C    . VAL A 1 17  ? 11.608  4.429   -6.316  1.00 0.00 ? 17  VAL A C    1  
ATOM 233   O O    . VAL A 1 17  ? 12.362  4.380   -7.267  1.00 0.00 ? 17  VAL A O    1  
ATOM 234   C CB   . VAL A 1 17  ? 10.895  2.038   -6.133  1.00 0.00 ? 17  VAL A CB   1  
ATOM 235   C CG1  . VAL A 1 17  ? 11.766  1.735   -7.341  1.00 0.00 ? 17  VAL A CG1  1  
ATOM 236   C CG2  . VAL A 1 17  ? 11.727  1.833   -4.874  1.00 0.00 ? 17  VAL A CG2  1  
ATOM 237   H H    . VAL A 1 17  ? 9.349   2.869   -7.977  1.00 0.00 ? 17  VAL A H    1  
ATOM 238   H HA   . VAL A 1 17  ? 9.842   3.719   -5.321  1.00 0.00 ? 17  VAL A HA   1  
ATOM 239   H HB   . VAL A 1 17  ? 10.048  1.368   -6.123  1.00 0.00 ? 17  VAL A HB   1  
ATOM 240   H HG11 . VAL A 1 17  ? 11.239  2.002   -8.240  1.00 0.00 ? 17  VAL A HG11 1  
ATOM 241   H HG12 . VAL A 1 17  ? 12.681  2.306   -7.273  1.00 0.00 ? 17  VAL A HG12 1  
ATOM 242   H HG13 . VAL A 1 17  ? 11.999  0.682   -7.356  1.00 0.00 ? 17  VAL A HG13 1  
ATOM 243   H HG21 . VAL A 1 17  ? 12.243  2.750   -4.634  1.00 0.00 ? 17  VAL A HG21 1  
ATOM 244   H HG22 . VAL A 1 17  ? 11.080  1.556   -4.058  1.00 0.00 ? 17  VAL A HG22 1  
ATOM 245   H HG23 . VAL A 1 17  ? 12.448  1.048   -5.049  1.00 0.00 ? 17  VAL A HG23 1  
ATOM 246   N N    . ARG A 1 18  ? 11.793  5.289   -5.350  1.00 0.00 ? 18  ARG A N    1  
ATOM 247   C CA   . ARG A 1 18  ? 12.948  6.231   -5.401  1.00 0.00 ? 18  ARG A CA   1  
ATOM 248   C C    . ARG A 1 18  ? 13.991  5.813   -4.359  1.00 0.00 ? 18  ARG A C    1  
ATOM 249   O O    . ARG A 1 18  ? 13.759  4.932   -3.555  1.00 0.00 ? 18  ARG A O    1  
ATOM 250   C CB   . ARG A 1 18  ? 12.462  7.652   -5.100  1.00 0.00 ? 18  ARG A CB   1  
ATOM 251   C CG   . ARG A 1 18  ? 11.817  8.247   -6.353  1.00 0.00 ? 18  ARG A CG   1  
ATOM 252   C CD   . ARG A 1 18  ? 11.433  9.704   -6.090  1.00 0.00 ? 18  ARG A CD   1  
ATOM 253   N NE   . ARG A 1 18  ? 10.235  10.054  -6.903  1.00 0.00 ? 18  ARG A NE   1  
ATOM 254   C CZ   . ARG A 1 18  ? 10.358  10.834  -7.942  1.00 0.00 ? 18  ARG A CZ   1  
ATOM 255   N NH1  . ARG A 1 18  ? 11.003  11.964  -7.835  1.00 0.00 ? 18  ARG A NH1  1  
ATOM 256   N NH2  . ARG A 1 18  ? 9.839   10.484  -9.087  1.00 0.00 ? 18  ARG A NH2  1  
ATOM 257   H H    . ARG A 1 18  ? 11.175  5.314   -4.591  1.00 0.00 ? 18  ARG A H    1  
ATOM 258   H HA   . ARG A 1 18  ? 13.392  6.204   -6.385  1.00 0.00 ? 18  ARG A HA   1  
ATOM 259   H HB2  . ARG A 1 18  ? 11.736  7.622   -4.301  1.00 0.00 ? 18  ARG A HB2  1  
ATOM 260   H HB3  . ARG A 1 18  ? 13.300  8.265   -4.803  1.00 0.00 ? 18  ARG A HB3  1  
ATOM 261   H HG2  . ARG A 1 18  ? 12.517  8.202   -7.174  1.00 0.00 ? 18  ARG A HG2  1  
ATOM 262   H HG3  . ARG A 1 18  ? 10.931  7.683   -6.604  1.00 0.00 ? 18  ARG A HG3  1  
ATOM 263   H HD2  . ARG A 1 18  ? 11.207  9.833   -5.042  1.00 0.00 ? 18  ARG A HD2  1  
ATOM 264   H HD3  . ARG A 1 18  ? 12.255  10.348  -6.364  1.00 0.00 ? 18  ARG A HD3  1  
ATOM 265   H HE   . ARG A 1 18  ? 9.355   9.698   -6.659  1.00 0.00 ? 18  ARG A HE   1  
ATOM 266   H HH11 . ARG A 1 18  ? 11.401  12.231  -6.958  1.00 0.00 ? 18  ARG A HH11 1  
ATOM 267   H HH12 . ARG A 1 18  ? 11.098  12.562  -8.630  1.00 0.00 ? 18  ARG A HH12 1  
ATOM 268   H HH21 . ARG A 1 18  ? 9.347   9.618   -9.169  1.00 0.00 ? 18  ARG A HH21 1  
ATOM 269   H HH22 . ARG A 1 18  ? 9.935   11.082  -9.883  1.00 0.00 ? 18  ARG A HH22 1  
ATOM 270   N N    . GLN A 1 19  ? 15.140  6.435   -4.370  1.00 0.00 ? 19  GLN A N    1  
ATOM 271   C CA   . GLN A 1 19  ? 16.197  6.067   -3.383  1.00 0.00 ? 19  GLN A CA   1  
ATOM 272   C C    . GLN A 1 19  ? 15.761  6.480   -1.978  1.00 0.00 ? 19  GLN A C    1  
ATOM 273   O O    . GLN A 1 19  ? 15.102  7.484   -1.789  1.00 0.00 ? 19  GLN A O    1  
ATOM 274   C CB   . GLN A 1 19  ? 17.504  6.782   -3.736  1.00 0.00 ? 19  GLN A CB   1  
ATOM 275   C CG   . GLN A 1 19  ? 17.248  8.285   -3.866  1.00 0.00 ? 19  GLN A CG   1  
ATOM 276   C CD   . GLN A 1 19  ? 18.575  9.009   -4.105  1.00 0.00 ? 19  GLN A CD   1  
ATOM 277   O OE1  . GLN A 1 19  ? 19.281  9.332   -3.170  1.00 0.00 ? 19  GLN A OE1  1  
ATOM 278   N NE2  . GLN A 1 19  ? 18.946  9.279   -5.327  1.00 0.00 ? 19  GLN A NE2  1  
ATOM 279   H H    . GLN A 1 19  ? 15.309  7.140   -5.028  1.00 0.00 ? 19  GLN A H    1  
ATOM 280   H HA   . GLN A 1 19  ? 16.357  4.999   -3.406  1.00 0.00 ? 19  GLN A HA   1  
ATOM 281   H HB2  . GLN A 1 19  ? 18.230  6.607   -2.955  1.00 0.00 ? 19  GLN A HB2  1  
ATOM 282   H HB3  . GLN A 1 19  ? 17.882  6.400   -4.671  1.00 0.00 ? 19  GLN A HB3  1  
ATOM 283   H HG2  . GLN A 1 19  ? 16.583  8.467   -4.698  1.00 0.00 ? 19  GLN A HG2  1  
ATOM 284   H HG3  . GLN A 1 19  ? 16.798  8.655   -2.957  1.00 0.00 ? 19  GLN A HG3  1  
ATOM 285   H HE21 . GLN A 1 19  ? 18.377  9.018   -6.081  1.00 0.00 ? 19  GLN A HE21 1  
ATOM 286   H HE22 . GLN A 1 19  ? 19.794  9.741   -5.490  1.00 0.00 ? 19  GLN A HE22 1  
ATOM 287   N N    . LEU A 1 20  ? 16.128  5.713   -0.989  1.00 0.00 ? 20  LEU A N    1  
ATOM 288   C CA   . LEU A 1 20  ? 15.743  6.059   0.405   1.00 0.00 ? 20  LEU A CA   1  
ATOM 289   C C    . LEU A 1 20  ? 16.723  5.410   1.377   1.00 0.00 ? 20  LEU A C    1  
ATOM 290   O O    . LEU A 1 20  ? 16.330  4.812   2.357   1.00 0.00 ? 20  LEU A O    1  
ATOM 291   C CB   . LEU A 1 20  ? 14.334  5.542   0.693   1.00 0.00 ? 20  LEU A CB   1  
ATOM 292   C CG   . LEU A 1 20  ? 13.877  6.021   2.074   1.00 0.00 ? 20  LEU A CG   1  
ATOM 293   C CD1  . LEU A 1 20  ? 14.017  7.542   2.164   1.00 0.00 ? 20  LEU A CD1  1  
ATOM 294   C CD2  . LEU A 1 20  ? 12.415  5.630   2.284   1.00 0.00 ? 20  LEU A CD2  1  
ATOM 295   H H    . LEU A 1 20  ? 16.662  4.910   -1.165  1.00 0.00 ? 20  LEU A H    1  
ATOM 296   H HA   . LEU A 1 20  ? 15.764  7.130   0.529   1.00 0.00 ? 20  LEU A HA   1  
ATOM 297   H HB2  . LEU A 1 20  ? 13.658  5.916   -0.057  1.00 0.00 ? 20  LEU A HB2  1  
ATOM 298   H HB3  . LEU A 1 20  ? 14.334  4.463   0.672   1.00 0.00 ? 20  LEU A HB3  1  
ATOM 299   H HG   . LEU A 1 20  ? 14.485  5.560   2.838   1.00 0.00 ? 20  LEU A HG   1  
ATOM 300   H HD11 . LEU A 1 20  ? 13.753  7.985   1.216   1.00 0.00 ? 20  LEU A HD11 1  
ATOM 301   H HD12 . LEU A 1 20  ? 13.359  7.920   2.933   1.00 0.00 ? 20  LEU A HD12 1  
ATOM 302   H HD13 . LEU A 1 20  ? 15.038  7.796   2.409   1.00 0.00 ? 20  LEU A HD13 1  
ATOM 303   H HD21 . LEU A 1 20  ? 11.820  6.014   1.471   1.00 0.00 ? 20  LEU A HD21 1  
ATOM 304   H HD22 . LEU A 1 20  ? 12.332  4.553   2.313   1.00 0.00 ? 20  LEU A HD22 1  
ATOM 305   H HD23 . LEU A 1 20  ? 12.061  6.043   3.215   1.00 0.00 ? 20  LEU A HD23 1  
ATOM 306   N N    . TYR A 1 21  ? 17.997  5.514   1.127   1.00 0.00 ? 21  TYR A N    1  
ATOM 307   C CA   . TYR A 1 21  ? 18.962  4.891   2.070   1.00 0.00 ? 21  TYR A CA   1  
ATOM 308   C C    . TYR A 1 21  ? 18.583  5.303   3.488   1.00 0.00 ? 21  TYR A C    1  
ATOM 309   O O    . TYR A 1 21  ? 18.338  6.461   3.763   1.00 0.00 ? 21  TYR A O    1  
ATOM 310   C CB   . TYR A 1 21  ? 20.386  5.359   1.778   1.00 0.00 ? 21  TYR A CB   1  
ATOM 311   C CG   . TYR A 1 21  ? 21.306  4.782   2.828   1.00 0.00 ? 21  TYR A CG   1  
ATOM 312   C CD1  . TYR A 1 21  ? 21.306  5.309   4.128   1.00 0.00 ? 21  TYR A CD1  1  
ATOM 313   C CD2  . TYR A 1 21  ? 22.150  3.715   2.506   1.00 0.00 ? 21  TYR A CD2  1  
ATOM 314   C CE1  . TYR A 1 21  ? 22.153  4.768   5.104   1.00 0.00 ? 21  TYR A CE1  1  
ATOM 315   C CE2  . TYR A 1 21  ? 22.997  3.173   3.480   1.00 0.00 ? 21  TYR A CE2  1  
ATOM 316   C CZ   . TYR A 1 21  ? 22.998  3.699   4.780   1.00 0.00 ? 21  TYR A CZ   1  
ATOM 317   O OH   . TYR A 1 21  ? 23.833  3.165   5.740   1.00 0.00 ? 21  TYR A OH   1  
ATOM 318   H H    . TYR A 1 21  ? 18.313  5.996   0.333   1.00 0.00 ? 21  TYR A H    1  
ATOM 319   H HA   . TYR A 1 21  ? 18.909  3.815   1.981   1.00 0.00 ? 21  TYR A HA   1  
ATOM 320   H HB2  . TYR A 1 21  ? 20.688  5.015   0.799   1.00 0.00 ? 21  TYR A HB2  1  
ATOM 321   H HB3  . TYR A 1 21  ? 20.429  6.437   1.814   1.00 0.00 ? 21  TYR A HB3  1  
ATOM 322   H HD1  . TYR A 1 21  ? 20.653  6.132   4.376   1.00 0.00 ? 21  TYR A HD1  1  
ATOM 323   H HD2  . TYR A 1 21  ? 22.147  3.307   1.506   1.00 0.00 ? 21  TYR A HD2  1  
ATOM 324   H HE1  . TYR A 1 21  ? 22.151  5.173   6.108   1.00 0.00 ? 21  TYR A HE1  1  
ATOM 325   H HE2  . TYR A 1 21  ? 23.649  2.349   3.230   1.00 0.00 ? 21  TYR A HE2  1  
ATOM 326   H HH   . TYR A 1 21  ? 24.720  3.493   5.577   1.00 0.00 ? 21  TYR A HH   1  
ATOM 327   N N    . ILE A 1 22  ? 18.529  4.371   4.391   1.00 0.00 ? 22  ILE A N    1  
ATOM 328   C CA   . ILE A 1 22  ? 18.161  4.720   5.787   1.00 0.00 ? 22  ILE A CA   1  
ATOM 329   C C    . ILE A 1 22  ? 19.283  4.295   6.731   1.00 0.00 ? 22  ILE A C    1  
ATOM 330   O O    . ILE A 1 22  ? 19.592  3.127   6.857   1.00 0.00 ? 22  ILE A O    1  
ATOM 331   C CB   . ILE A 1 22  ? 16.870  3.994   6.170   1.00 0.00 ? 22  ILE A CB   1  
ATOM 332   C CG1  . ILE A 1 22  ? 15.740  4.443   5.241   1.00 0.00 ? 22  ILE A CG1  1  
ATOM 333   C CG2  . ILE A 1 22  ? 16.504  4.332   7.616   1.00 0.00 ? 22  ILE A CG2  1  
ATOM 334   C CD1  . ILE A 1 22  ? 14.401  3.940   5.782   1.00 0.00 ? 22  ILE A CD1  1  
ATOM 335   H H    . ILE A 1 22  ? 18.728  3.443   4.152   1.00 0.00 ? 22  ILE A H    1  
ATOM 336   H HA   . ILE A 1 22  ? 18.010  5.786   5.864   1.00 0.00 ? 22  ILE A HA   1  
ATOM 337   H HB   . ILE A 1 22  ? 17.015  2.928   6.076   1.00 0.00 ? 22  ILE A HB   1  
ATOM 338   H HG12 . ILE A 1 22  ? 15.725  5.522   5.186   1.00 0.00 ? 22  ILE A HG12 1  
ATOM 339   H HG13 . ILE A 1 22  ? 15.902  4.034   4.255   1.00 0.00 ? 22  ILE A HG13 1  
ATOM 340   H HG21 . ILE A 1 22  ? 16.409  5.402   7.722   1.00 0.00 ? 22  ILE A HG21 1  
ATOM 341   H HG22 . ILE A 1 22  ? 15.566  3.860   7.869   1.00 0.00 ? 22  ILE A HG22 1  
ATOM 342   H HG23 . ILE A 1 22  ? 17.278  3.972   8.277   1.00 0.00 ? 22  ILE A HG23 1  
ATOM 343   H HD11 . ILE A 1 22  ? 14.257  4.309   6.787   1.00 0.00 ? 22  ILE A HD11 1  
ATOM 344   H HD12 . ILE A 1 22  ? 13.600  4.295   5.150   1.00 0.00 ? 22  ILE A HD12 1  
ATOM 345   H HD13 . ILE A 1 22  ? 14.399  2.860   5.792   1.00 0.00 ? 22  ILE A HD13 1  
ATOM 346   N N    . ASP A 1 23  ? 19.890  5.231   7.406   1.00 0.00 ? 23  ASP A N    1  
ATOM 347   C CA   . ASP A 1 23  ? 20.980  4.868   8.349   1.00 0.00 ? 23  ASP A CA   1  
ATOM 348   C C    . ASP A 1 23  ? 20.344  4.458   9.674   1.00 0.00 ? 23  ASP A C    1  
ATOM 349   O O    . ASP A 1 23  ? 19.947  5.281   10.470  1.00 0.00 ? 23  ASP A O    1  
ATOM 350   C CB   . ASP A 1 23  ? 21.915  6.062   8.541   1.00 0.00 ? 23  ASP A CB   1  
ATOM 351   C CG   . ASP A 1 23  ? 22.973  5.735   9.600   1.00 0.00 ? 23  ASP A CG   1  
ATOM 352   O OD1  . ASP A 1 23  ? 22.620  5.140   10.604  1.00 0.00 ? 23  ASP A OD1  1  
ATOM 353   O OD2  . ASP A 1 23  ? 24.121  6.087   9.386   1.00 0.00 ? 23  ASP A OD2  1  
ATOM 354   H H    . ASP A 1 23  ? 19.622  6.168   7.300   1.00 0.00 ? 23  ASP A H    1  
ATOM 355   H HA   . ASP A 1 23  ? 21.537  4.035   7.951   1.00 0.00 ? 23  ASP A HA   1  
ATOM 356   H HB2  . ASP A 1 23  ? 22.405  6.286   7.604   1.00 0.00 ? 23  ASP A HB2  1  
ATOM 357   H HB3  . ASP A 1 23  ? 21.343  6.914   8.854   1.00 0.00 ? 23  ASP A HB3  1  
ATOM 358   N N    . PHE A 1 24  ? 20.232  3.173   9.874   1.00 0.00 ? 24  PHE A N    1  
ATOM 359   C CA   . PHE A 1 24  ? 19.607  2.597   11.107  1.00 0.00 ? 24  PHE A CA   1  
ATOM 360   C C    . PHE A 1 24  ? 19.470  3.618   12.243  1.00 0.00 ? 24  PHE A C    1  
ATOM 361   O O    . PHE A 1 24  ? 18.392  3.832   12.758  1.00 0.00 ? 24  PHE A O    1  
ATOM 362   C CB   . PHE A 1 24  ? 20.471  1.434   11.598  1.00 0.00 ? 24  PHE A CB   1  
ATOM 363   C CG   . PHE A 1 24  ? 20.000  0.155   10.954  1.00 0.00 ? 24  PHE A CG   1  
ATOM 364   C CD1  . PHE A 1 24  ? 18.737  -0.357  11.267  1.00 0.00 ? 24  PHE A CD1  1  
ATOM 365   C CD2  . PHE A 1 24  ? 20.821  -0.514  10.040  1.00 0.00 ? 24  PHE A CD2  1  
ATOM 366   C CE1  . PHE A 1 24  ? 18.293  -1.538  10.666  1.00 0.00 ? 24  PHE A CE1  1  
ATOM 367   C CE2  . PHE A 1 24  ? 20.377  -1.698  9.440   1.00 0.00 ? 24  PHE A CE2  1  
ATOM 368   C CZ   . PHE A 1 24  ? 19.114  -2.209  9.753   1.00 0.00 ? 24  PHE A CZ   1  
ATOM 369   H H    . PHE A 1 24  ? 20.554  2.561   9.179   1.00 0.00 ? 24  PHE A H    1  
ATOM 370   H HA   . PHE A 1 24  ? 18.629  2.217   10.859  1.00 0.00 ? 24  PHE A HA   1  
ATOM 371   H HB2  . PHE A 1 24  ? 21.503  1.614   11.332  1.00 0.00 ? 24  PHE A HB2  1  
ATOM 372   H HB3  . PHE A 1 24  ? 20.385  1.350   12.671  1.00 0.00 ? 24  PHE A HB3  1  
ATOM 373   H HD1  . PHE A 1 24  ? 18.107  0.158   11.974  1.00 0.00 ? 24  PHE A HD1  1  
ATOM 374   H HD2  . PHE A 1 24  ? 21.796  -0.118  9.799   1.00 0.00 ? 24  PHE A HD2  1  
ATOM 375   H HE1  . PHE A 1 24  ? 17.319  -1.934  10.908  1.00 0.00 ? 24  PHE A HE1  1  
ATOM 376   H HE2  . PHE A 1 24  ? 21.010  -2.217  8.736   1.00 0.00 ? 24  PHE A HE2  1  
ATOM 377   H HZ   . PHE A 1 24  ? 18.772  -3.120  9.288   1.00 0.00 ? 24  PHE A HZ   1  
ATOM 378   N N    . ARG A 1 25  ? 20.547  4.217   12.668  1.00 0.00 ? 25  ARG A N    1  
ATOM 379   C CA   . ARG A 1 25  ? 20.455  5.172   13.811  1.00 0.00 ? 25  ARG A CA   1  
ATOM 380   C C    . ARG A 1 25  ? 20.240  6.613   13.341  1.00 0.00 ? 25  ARG A C    1  
ATOM 381   O O    . ARG A 1 25  ? 19.621  7.403   14.026  1.00 0.00 ? 25  ARG A O    1  
ATOM 382   C CB   . ARG A 1 25  ? 21.746  5.100   14.629  1.00 0.00 ? 25  ARG A CB   1  
ATOM 383   C CG   . ARG A 1 25  ? 22.950  5.373   13.724  1.00 0.00 ? 25  ARG A CG   1  
ATOM 384   C CD   . ARG A 1 25  ? 23.823  6.466   14.344  1.00 0.00 ? 25  ARG A CD   1  
ATOM 385   N NE   . ARG A 1 25  ? 22.958  7.559   14.871  1.00 0.00 ? 25  ARG A NE   1  
ATOM 386   C CZ   . ARG A 1 25  ? 22.851  7.743   16.159  1.00 0.00 ? 25  ARG A CZ   1  
ATOM 387   N NH1  . ARG A 1 25  ? 23.027  6.743   16.979  1.00 0.00 ? 25  ARG A NH1  1  
ATOM 388   N NH2  . ARG A 1 25  ? 22.569  8.929   16.627  1.00 0.00 ? 25  ARG A NH2  1  
ATOM 389   H H    . ARG A 1 25  ? 21.414  4.016   12.262  1.00 0.00 ? 25  ARG A H    1  
ATOM 390   H HA   . ARG A 1 25  ? 19.630  4.881   14.441  1.00 0.00 ? 25  ARG A HA   1  
ATOM 391   H HB2  . ARG A 1 25  ? 21.712  5.839   15.415  1.00 0.00 ? 25  ARG A HB2  1  
ATOM 392   H HB3  . ARG A 1 25  ? 21.841  4.117   15.062  1.00 0.00 ? 25  ARG A HB3  1  
ATOM 393   H HG2  . ARG A 1 25  ? 23.529  4.467   13.615  1.00 0.00 ? 25  ARG A HG2  1  
ATOM 394   H HG3  . ARG A 1 25  ? 22.606  5.697   12.755  1.00 0.00 ? 25  ARG A HG3  1  
ATOM 395   H HD2  . ARG A 1 25  ? 24.405  6.046   15.152  1.00 0.00 ? 25  ARG A HD2  1  
ATOM 396   H HD3  . ARG A 1 25  ? 24.488  6.864   13.592  1.00 0.00 ? 25  ARG A HD3  1  
ATOM 397   H HE   . ARG A 1 25  ? 22.470  8.140   14.251  1.00 0.00 ? 25  ARG A HE   1  
ATOM 398   H HH11 . ARG A 1 25  ? 23.243  5.835   16.621  1.00 0.00 ? 25  ARG A HH11 1  
ATOM 399   H HH12 . ARG A 1 25  ? 22.945  6.885   17.966  1.00 0.00 ? 25  ARG A HH12 1  
ATOM 400   H HH21 . ARG A 1 25  ? 22.434  9.695   15.999  1.00 0.00 ? 25  ARG A HH21 1  
ATOM 401   H HH22 . ARG A 1 25  ? 22.487  9.070   17.613  1.00 0.00 ? 25  ARG A HH22 1  
ATOM 402   N N    . LYS A 1 26  ? 20.756  6.981   12.207  1.00 0.00 ? 26  LYS A N    1  
ATOM 403   C CA   . LYS A 1 26  ? 20.582  8.390   11.749  1.00 0.00 ? 26  LYS A CA   1  
ATOM 404   C C    . LYS A 1 26  ? 19.102  8.687   11.511  1.00 0.00 ? 26  LYS A C    1  
ATOM 405   O O    . LYS A 1 26  ? 18.577  9.684   11.965  1.00 0.00 ? 26  LYS A O    1  
ATOM 406   C CB   . LYS A 1 26  ? 21.335  8.603   10.441  1.00 0.00 ? 26  LYS A CB   1  
ATOM 407   C CG   . LYS A 1 26  ? 21.842  10.044  10.370  1.00 0.00 ? 26  LYS A CG   1  
ATOM 408   C CD   . LYS A 1 26  ? 22.559  10.268  9.036   1.00 0.00 ? 26  LYS A CD   1  
ATOM 409   C CE   . LYS A 1 26  ? 23.341  11.584  9.080   1.00 0.00 ? 26  LYS A CE   1  
ATOM 410   N NZ   . LYS A 1 26  ? 23.804  11.847  10.473  1.00 0.00 ? 26  LYS A NZ   1  
ATOM 411   H H    . LYS A 1 26  ? 21.271  6.343   11.667  1.00 0.00 ? 26  LYS A H    1  
ATOM 412   H HA   . LYS A 1 26  ? 20.969  9.063   12.500  1.00 0.00 ? 26  LYS A HA   1  
ATOM 413   H HB2  . LYS A 1 26  ? 22.164  7.917   10.386  1.00 0.00 ? 26  LYS A HB2  1  
ATOM 414   H HB3  . LYS A 1 26  ? 20.665  8.424   9.614   1.00 0.00 ? 26  LYS A HB3  1  
ATOM 415   H HG2  . LYS A 1 26  ? 21.006  10.724  10.450  1.00 0.00 ? 26  LYS A HG2  1  
ATOM 416   H HG3  . LYS A 1 26  ? 22.530  10.222  11.182  1.00 0.00 ? 26  LYS A HG3  1  
ATOM 417   H HD2  . LYS A 1 26  ? 23.241  9.450   8.854   1.00 0.00 ? 26  LYS A HD2  1  
ATOM 418   H HD3  . LYS A 1 26  ? 21.831  10.313  8.240   1.00 0.00 ? 26  LYS A HD3  1  
ATOM 419   H HE2  . LYS A 1 26  ? 24.197  11.515  8.425   1.00 0.00 ? 26  LYS A HE2  1  
ATOM 420   H HE3  . LYS A 1 26  ? 22.704  12.392  8.754   1.00 0.00 ? 26  LYS A HE3  1  
ATOM 421   H HZ1  . LYS A 1 26  ? 24.216  10.978  10.870  1.00 0.00 ? 26  LYS A HZ1  1  
ATOM 422   H HZ2  . LYS A 1 26  ? 24.522  12.599  10.464  1.00 0.00 ? 26  LYS A HZ2  1  
ATOM 423   H HZ3  . LYS A 1 26  ? 22.997  12.148  11.055  1.00 0.00 ? 26  LYS A HZ3  1  
ATOM 424   N N    . ASP A 1 27  ? 18.437  7.846   10.774  1.00 0.00 ? 27  ASP A N    1  
ATOM 425   C CA   . ASP A 1 27  ? 17.004  8.090   10.468  1.00 0.00 ? 27  ASP A CA   1  
ATOM 426   C C    . ASP A 1 27  ? 16.088  7.351   11.450  1.00 0.00 ? 27  ASP A C    1  
ATOM 427   O O    . ASP A 1 27  ? 15.179  7.930   12.012  1.00 0.00 ? 27  ASP A O    1  
ATOM 428   C CB   . ASP A 1 27  ? 16.725  7.598   9.054   1.00 0.00 ? 27  ASP A CB   1  
ATOM 429   C CG   . ASP A 1 27  ? 16.940  8.741   8.061   1.00 0.00 ? 27  ASP A CG   1  
ATOM 430   O OD1  . ASP A 1 27  ? 16.208  9.714   8.140   1.00 0.00 ? 27  ASP A OD1  1  
ATOM 431   O OD2  . ASP A 1 27  ? 17.834  8.624   7.238   1.00 0.00 ? 27  ASP A OD2  1  
ATOM 432   H H    . ASP A 1 27  ? 18.886  7.062   10.396  1.00 0.00 ? 27  ASP A H    1  
ATOM 433   H HA   . ASP A 1 27  ? 16.803  9.149   10.519  1.00 0.00 ? 27  ASP A HA   1  
ATOM 434   H HB2  . ASP A 1 27  ? 17.398  6.785   8.819   1.00 0.00 ? 27  ASP A HB2  1  
ATOM 435   H HB3  . ASP A 1 27  ? 15.714  7.252   8.994   1.00 0.00 ? 27  ASP A HB3  1  
ATOM 436   N N    . LEU A 1 28  ? 16.294  6.078   11.646  1.00 0.00 ? 28  LEU A N    1  
ATOM 437   C CA   . LEU A 1 28  ? 15.401  5.322   12.574  1.00 0.00 ? 28  LEU A CA   1  
ATOM 438   C C    . LEU A 1 28  ? 15.931  5.394   14.005  1.00 0.00 ? 28  LEU A C    1  
ATOM 439   O O    . LEU A 1 28  ? 15.206  5.163   14.952  1.00 0.00 ? 28  LEU A O    1  
ATOM 440   C CB   . LEU A 1 28  ? 15.341  3.857   12.139  1.00 0.00 ? 28  LEU A CB   1  
ATOM 441   C CG   . LEU A 1 28  ? 14.897  3.772   10.680  1.00 0.00 ? 28  LEU A CG   1  
ATOM 442   C CD1  . LEU A 1 28  ? 14.524  2.327   10.349  1.00 0.00 ? 28  LEU A CD1  1  
ATOM 443   C CD2  . LEU A 1 28  ? 13.679  4.674   10.462  1.00 0.00 ? 28  LEU A CD2  1  
ATOM 444   H H    . LEU A 1 28  ? 17.016  5.617   11.169  1.00 0.00 ? 28  LEU A H    1  
ATOM 445   H HA   . LEU A 1 28  ? 14.408  5.744   12.538  1.00 0.00 ? 28  LEU A HA   1  
ATOM 446   H HB2  . LEU A 1 28  ? 16.320  3.411   12.245  1.00 0.00 ? 28  LEU A HB2  1  
ATOM 447   H HB3  . LEU A 1 28  ? 14.635  3.326   12.760  1.00 0.00 ? 28  LEU A HB3  1  
ATOM 448   H HG   . LEU A 1 28  ? 15.707  4.093   10.040  1.00 0.00 ? 28  LEU A HG   1  
ATOM 449   H HD11 . LEU A 1 28  ? 14.879  1.675   11.133  1.00 0.00 ? 28  LEU A HD11 1  
ATOM 450   H HD12 . LEU A 1 28  ? 13.450  2.242   10.270  1.00 0.00 ? 28  LEU A HD12 1  
ATOM 451   H HD13 . LEU A 1 28  ? 14.977  2.044   9.411   1.00 0.00 ? 28  LEU A HD13 1  
ATOM 452   H HD21 . LEU A 1 28  ? 12.916  4.427   11.184  1.00 0.00 ? 28  LEU A HD21 1  
ATOM 453   H HD22 . LEU A 1 28  ? 13.969  5.707   10.585  1.00 0.00 ? 28  LEU A HD22 1  
ATOM 454   H HD23 . LEU A 1 28  ? 13.294  4.524   9.465   1.00 0.00 ? 28  LEU A HD23 1  
ATOM 455   N N    . GLY A 1 29  ? 17.182  5.706   14.180  1.00 0.00 ? 29  GLY A N    1  
ATOM 456   C CA   . GLY A 1 29  ? 17.730  5.780   15.564  1.00 0.00 ? 29  GLY A CA   1  
ATOM 457   C C    . GLY A 1 29  ? 17.592  4.409   16.231  1.00 0.00 ? 29  GLY A C    1  
ATOM 458   O O    . GLY A 1 29  ? 17.672  4.283   17.432  1.00 0.00 ? 29  GLY A O    1  
ATOM 459   H H    . GLY A 1 29  ? 17.758  5.886   13.408  1.00 0.00 ? 29  GLY A H    1  
ATOM 460   H HA2  . GLY A 1 29  ? 18.770  6.067   15.529  1.00 0.00 ? 29  GLY A HA2  1  
ATOM 461   H HA3  . GLY A 1 29  ? 17.173  6.509   16.133  1.00 0.00 ? 29  GLY A HA3  1  
ATOM 462   N N    . TRP A 1 30  ? 17.375  3.383   15.455  1.00 0.00 ? 30  TRP A N    1  
ATOM 463   C CA   . TRP A 1 30  ? 17.224  2.015   16.032  1.00 0.00 ? 30  TRP A CA   1  
ATOM 464   C C    . TRP A 1 30  ? 18.381  1.715   16.989  1.00 0.00 ? 30  TRP A C    1  
ATOM 465   O O    . TRP A 1 30  ? 19.538  1.776   16.623  1.00 0.00 ? 30  TRP A O    1  
ATOM 466   C CB   . TRP A 1 30  ? 17.227  0.990   14.897  1.00 0.00 ? 30  TRP A CB   1  
ATOM 467   C CG   . TRP A 1 30  ? 15.827  0.773   14.422  1.00 0.00 ? 30  TRP A CG   1  
ATOM 468   C CD1  . TRP A 1 30  ? 14.765  1.543   14.753  1.00 0.00 ? 30  TRP A CD1  1  
ATOM 469   C CD2  . TRP A 1 30  ? 15.319  -0.267  13.539  1.00 0.00 ? 30  TRP A CD2  1  
ATOM 470   N NE1  . TRP A 1 30  ? 13.637  1.041   14.130  1.00 0.00 ? 30  TRP A NE1  1  
ATOM 471   C CE2  . TRP A 1 30  ? 13.928  -0.076  13.370  1.00 0.00 ? 30  TRP A CE2  1  
ATOM 472   C CE3  . TRP A 1 30  ? 15.926  -1.349  12.876  1.00 0.00 ? 30  TRP A CE3  1  
ATOM 473   C CZ2  . TRP A 1 30  ? 13.164  -0.927  12.572  1.00 0.00 ? 30  TRP A CZ2  1  
ATOM 474   C CZ3  . TRP A 1 30  ? 15.160  -2.208  12.072  1.00 0.00 ? 30  TRP A CZ3  1  
ATOM 475   C CH2  . TRP A 1 30  ? 13.782  -1.998  11.920  1.00 0.00 ? 30  TRP A CH2  1  
ATOM 476   H H    . TRP A 1 30  ? 17.306  3.512   14.488  1.00 0.00 ? 30  TRP A H    1  
ATOM 477   H HA   . TRP A 1 30  ? 16.288  1.950   16.568  1.00 0.00 ? 30  TRP A HA   1  
ATOM 478   H HB2  . TRP A 1 30  ? 17.832  1.358   14.081  1.00 0.00 ? 30  TRP A HB2  1  
ATOM 479   H HB3  . TRP A 1 30  ? 17.634  0.057   15.256  1.00 0.00 ? 30  TRP A HB3  1  
ATOM 480   H HD1  . TRP A 1 30  ? 14.793  2.408   15.399  1.00 0.00 ? 30  TRP A HD1  1  
ATOM 481   H HE1  . TRP A 1 30  ? 12.735  1.415   14.205  1.00 0.00 ? 30  TRP A HE1  1  
ATOM 482   H HE3  . TRP A 1 30  ? 16.988  -1.518  12.986  1.00 0.00 ? 30  TRP A HE3  1  
ATOM 483   H HZ2  . TRP A 1 30  ? 12.103  -0.760  12.459  1.00 0.00 ? 30  TRP A HZ2  1  
ATOM 484   H HZ3  . TRP A 1 30  ? 15.634  -3.038  11.571  1.00 0.00 ? 30  TRP A HZ3  1  
ATOM 485   H HH2  . TRP A 1 30  ? 13.198  -2.663  11.301  1.00 0.00 ? 30  TRP A HH2  1  
ATOM 486   N N    . LYS A 1 31  ? 18.072  1.382   18.213  1.00 0.00 ? 31  LYS A N    1  
ATOM 487   C CA   . LYS A 1 31  ? 19.132  1.067   19.204  1.00 0.00 ? 31  LYS A CA   1  
ATOM 488   C C    . LYS A 1 31  ? 19.297  -0.448  19.332  1.00 0.00 ? 31  LYS A C    1  
ATOM 489   O O    . LYS A 1 31  ? 20.234  -0.927  19.939  1.00 0.00 ? 31  LYS A O    1  
ATOM 490   C CB   . LYS A 1 31  ? 18.715  1.623   20.562  1.00 0.00 ? 31  LYS A CB   1  
ATOM 491   C CG   . LYS A 1 31  ? 19.294  3.025   20.771  1.00 0.00 ? 31  LYS A CG   1  
ATOM 492   C CD   . LYS A 1 31  ? 19.064  3.882   19.530  1.00 0.00 ? 31  LYS A CD   1  
ATOM 493   C CE   . LYS A 1 31  ? 19.911  5.153   19.626  1.00 0.00 ? 31  LYS A CE   1  
ATOM 494   N NZ   . LYS A 1 31  ? 19.806  5.715   21.002  1.00 0.00 ? 31  LYS A NZ   1  
ATOM 495   H H    . LYS A 1 31  ? 17.134  1.335   18.486  1.00 0.00 ? 31  LYS A H    1  
ATOM 496   H HA   . LYS A 1 31  ? 20.065  1.514   18.900  1.00 0.00 ? 31  LYS A HA   1  
ATOM 497   H HB2  . LYS A 1 31  ? 17.637  1.669   20.603  1.00 0.00 ? 31  LYS A HB2  1  
ATOM 498   H HB3  . LYS A 1 31  ? 19.069  0.967   21.334  1.00 0.00 ? 31  LYS A HB3  1  
ATOM 499   H HG2  . LYS A 1 31  ? 18.812  3.488   21.620  1.00 0.00 ? 31  LYS A HG2  1  
ATOM 500   H HG3  . LYS A 1 31  ? 20.355  2.949   20.960  1.00 0.00 ? 31  LYS A HG3  1  
ATOM 501   H HD2  . LYS A 1 31  ? 19.344  3.326   18.648  1.00 0.00 ? 31  LYS A HD2  1  
ATOM 502   H HD3  . LYS A 1 31  ? 18.021  4.153   19.472  1.00 0.00 ? 31  LYS A HD3  1  
ATOM 503   H HE2  . LYS A 1 31  ? 20.942  4.915   19.411  1.00 0.00 ? 31  LYS A HE2  1  
ATOM 504   H HE3  . LYS A 1 31  ? 19.552  5.879   18.912  1.00 0.00 ? 31  LYS A HE3  1  
ATOM 505   H HZ1  . LYS A 1 31  ? 18.807  5.758   21.285  1.00 0.00 ? 31  LYS A HZ1  1  
ATOM 506   H HZ2  . LYS A 1 31  ? 20.326  5.107   21.666  1.00 0.00 ? 31  LYS A HZ2  1  
ATOM 507   H HZ3  . LYS A 1 31  ? 20.213  6.673   21.017  1.00 0.00 ? 31  LYS A HZ3  1  
ATOM 508   N N    . TRP A 1 32  ? 18.388  -1.210  18.789  1.00 0.00 ? 32  TRP A N    1  
ATOM 509   C CA   . TRP A 1 32  ? 18.503  -2.691  18.918  1.00 0.00 ? 32  TRP A CA   1  
ATOM 510   C C    . TRP A 1 32  ? 19.349  -3.264  17.782  1.00 0.00 ? 32  TRP A C    1  
ATOM 511   O O    . TRP A 1 32  ? 19.546  -4.458  17.695  1.00 0.00 ? 32  TRP A O    1  
ATOM 512   C CB   . TRP A 1 32  ? 17.110  -3.321  18.895  1.00 0.00 ? 32  TRP A CB   1  
ATOM 513   C CG   . TRP A 1 32  ? 16.576  -3.348  17.498  1.00 0.00 ? 32  TRP A CG   1  
ATOM 514   C CD1  . TRP A 1 32  ? 16.028  -2.294  16.855  1.00 0.00 ? 32  TRP A CD1  1  
ATOM 515   C CD2  . TRP A 1 32  ? 16.530  -4.465  16.564  1.00 0.00 ? 32  TRP A CD2  1  
ATOM 516   N NE1  . TRP A 1 32  ? 15.627  -2.697  15.598  1.00 0.00 ? 32  TRP A NE1  1  
ATOM 517   C CE2  . TRP A 1 32  ? 15.917  -4.026  15.368  1.00 0.00 ? 32  TRP A CE2  1  
ATOM 518   C CE3  . TRP A 1 32  ? 16.950  -5.803  16.638  1.00 0.00 ? 32  TRP A CE3  1  
ATOM 519   C CZ2  . TRP A 1 32  ? 15.725  -4.885  14.286  1.00 0.00 ? 32  TRP A CZ2  1  
ATOM 520   C CZ3  . TRP A 1 32  ? 16.763  -6.672  15.551  1.00 0.00 ? 32  TRP A CZ3  1  
ATOM 521   C CH2  . TRP A 1 32  ? 16.148  -6.212  14.377  1.00 0.00 ? 32  TRP A CH2  1  
ATOM 522   H H    . TRP A 1 32  ? 17.626  -0.811  18.316  1.00 0.00 ? 32  TRP A H    1  
ATOM 523   H HA   . TRP A 1 32  ? 18.977  -2.923  19.859  1.00 0.00 ? 32  TRP A HA   1  
ATOM 524   H HB2  . TRP A 1 32  ? 17.168  -4.330  19.275  1.00 0.00 ? 32  TRP A HB2  1  
ATOM 525   H HB3  . TRP A 1 32  ? 16.446  -2.742  19.521  1.00 0.00 ? 32  TRP A HB3  1  
ATOM 526   H HD1  . TRP A 1 32  ? 15.915  -1.303  17.257  1.00 0.00 ? 32  TRP A HD1  1  
ATOM 527   H HE1  . TRP A 1 32  ? 15.192  -2.124  14.939  1.00 0.00 ? 32  TRP A HE1  1  
ATOM 528   H HE3  . TRP A 1 32  ? 17.431  -6.162  17.532  1.00 0.00 ? 32  TRP A HE3  1  
ATOM 529   H HZ2  . TRP A 1 32  ? 15.251  -4.525  13.384  1.00 0.00 ? 32  TRP A HZ2  1  
ATOM 530   H HZ3  . TRP A 1 32  ? 17.091  -7.701  15.622  1.00 0.00 ? 32  TRP A HZ3  1  
ATOM 531   H HH2  . TRP A 1 32  ? 16.005  -6.881  13.542  1.00 0.00 ? 32  TRP A HH2  1  
ATOM 532   N N    . ILE A 1 33  ? 19.852  -2.433  16.915  1.00 0.00 ? 33  ILE A N    1  
ATOM 533   C CA   . ILE A 1 33  ? 20.685  -2.952  15.796  1.00 0.00 ? 33  ILE A CA   1  
ATOM 534   C C    . ILE A 1 33  ? 22.011  -2.187  15.759  1.00 0.00 ? 33  ILE A C    1  
ATOM 535   O O    . ILE A 1 33  ? 22.043  -0.972  15.774  1.00 0.00 ? 33  ILE A O    1  
ATOM 536   C CB   . ILE A 1 33  ? 19.926  -2.776  14.476  1.00 0.00 ? 33  ILE A CB   1  
ATOM 537   C CG1  . ILE A 1 33  ? 18.939  -3.931  14.319  1.00 0.00 ? 33  ILE A CG1  1  
ATOM 538   C CG2  . ILE A 1 33  ? 20.903  -2.786  13.297  1.00 0.00 ? 33  ILE A CG2  1  
ATOM 539   C CD1  . ILE A 1 33  ? 18.089  -3.717  13.069  1.00 0.00 ? 33  ILE A CD1  1  
ATOM 540   H H    . ILE A 1 33  ? 19.685  -1.472  17.000  1.00 0.00 ? 33  ILE A H    1  
ATOM 541   H HA   . ILE A 1 33  ? 20.881  -4.003  15.958  1.00 0.00 ? 33  ILE A HA   1  
ATOM 542   H HB   . ILE A 1 33  ? 19.387  -1.841  14.492  1.00 0.00 ? 33  ILE A HB   1  
ATOM 543   H HG12 . ILE A 1 33  ? 19.483  -4.857  14.228  1.00 0.00 ? 33  ILE A HG12 1  
ATOM 544   H HG13 . ILE A 1 33  ? 18.300  -3.972  15.183  1.00 0.00 ? 33  ILE A HG13 1  
ATOM 545   H HG21 . ILE A 1 33  ? 21.848  -3.199  13.617  1.00 0.00 ? 33  ILE A HG21 1  
ATOM 546   H HG22 . ILE A 1 33  ? 20.497  -3.390  12.500  1.00 0.00 ? 33  ILE A HG22 1  
ATOM 547   H HG23 . ILE A 1 33  ? 21.052  -1.777  12.945  1.00 0.00 ? 33  ILE A HG23 1  
ATOM 548   H HD11 . ILE A 1 33  ? 18.599  -3.040  12.402  1.00 0.00 ? 33  ILE A HD11 1  
ATOM 549   H HD12 . ILE A 1 33  ? 17.933  -4.663  12.574  1.00 0.00 ? 33  ILE A HD12 1  
ATOM 550   H HD13 . ILE A 1 33  ? 17.137  -3.297  13.351  1.00 0.00 ? 33  ILE A HD13 1  
ATOM 551   N N    . HIS A 1 34  ? 23.106  -2.894  15.720  1.00 0.00 ? 34  HIS A N    1  
ATOM 552   C CA   . HIS A 1 34  ? 24.435  -2.220  15.693  1.00 0.00 ? 34  HIS A CA   1  
ATOM 553   C C    . HIS A 1 34  ? 24.920  -2.079  14.245  1.00 0.00 ? 34  HIS A C    1  
ATOM 554   O O    . HIS A 1 34  ? 25.275  -1.005  13.804  1.00 0.00 ? 34  HIS A O    1  
ATOM 555   C CB   . HIS A 1 34  ? 25.436  -3.059  16.496  1.00 0.00 ? 34  HIS A CB   1  
ATOM 556   C CG   . HIS A 1 34  ? 26.841  -2.622  16.183  1.00 0.00 ? 34  HIS A CG   1  
ATOM 557   N ND1  . HIS A 1 34  ? 27.275  -1.322  16.386  1.00 0.00 ? 34  HIS A ND1  1  
ATOM 558   C CD2  . HIS A 1 34  ? 27.922  -3.305  15.681  1.00 0.00 ? 34  HIS A CD2  1  
ATOM 559   C CE1  . HIS A 1 34  ? 28.566  -1.262  16.012  1.00 0.00 ? 34  HIS A CE1  1  
ATOM 560   N NE2  . HIS A 1 34  ? 29.010  -2.444  15.574  1.00 0.00 ? 34  HIS A NE2  1  
ATOM 561   H H    . HIS A 1 34  ? 23.055  -3.872  15.716  1.00 0.00 ? 34  HIS A H    1  
ATOM 562   H HA   . HIS A 1 34  ? 24.350  -1.240  16.139  1.00 0.00 ? 34  HIS A HA   1  
ATOM 563   H HB2  . HIS A 1 34  ? 25.247  -2.927  17.552  1.00 0.00 ? 34  HIS A HB2  1  
ATOM 564   H HB3  . HIS A 1 34  ? 25.318  -4.101  16.238  1.00 0.00 ? 34  HIS A HB3  1  
ATOM 565   H HD1  . HIS A 1 34  ? 26.739  -0.581  16.738  1.00 0.00 ? 34  HIS A HD1  1  
ATOM 566   H HD2  . HIS A 1 34  ? 27.926  -4.351  15.410  1.00 0.00 ? 34  HIS A HD2  1  
ATOM 567   H HE1  . HIS A 1 34  ? 29.170  -0.368  16.060  1.00 0.00 ? 34  HIS A HE1  1  
ATOM 568   N N    . GLU A 1 35  ? 24.949  -3.154  13.506  1.00 0.00 ? 35  GLU A N    1  
ATOM 569   C CA   . GLU A 1 35  ? 25.424  -3.069  12.094  1.00 0.00 ? 35  GLU A CA   1  
ATOM 570   C C    . GLU A 1 35  ? 24.413  -3.746  11.163  1.00 0.00 ? 35  GLU A C    1  
ATOM 571   O O    . GLU A 1 35  ? 23.655  -4.595  11.584  1.00 0.00 ? 35  GLU A O    1  
ATOM 572   C CB   . GLU A 1 35  ? 26.778  -3.773  11.969  1.00 0.00 ? 35  GLU A CB   1  
ATOM 573   C CG   . GLU A 1 35  ? 27.902  -2.775  12.256  1.00 0.00 ? 35  GLU A CG   1  
ATOM 574   C CD   . GLU A 1 35  ? 28.954  -2.858  11.147  1.00 0.00 ? 35  GLU A CD   1  
ATOM 575   O OE1  . GLU A 1 35  ? 29.858  -3.666  11.274  1.00 0.00 ? 35  GLU A OE1  1  
ATOM 576   O OE2  . GLU A 1 35  ? 28.837  -2.110  10.190  1.00 0.00 ? 35  GLU A OE2  1  
ATOM 577   H H    . GLU A 1 35  ? 24.665  -4.015  13.879  1.00 0.00 ? 35  GLU A H    1  
ATOM 578   H HA   . GLU A 1 35  ? 25.531  -2.032  11.814  1.00 0.00 ? 35  GLU A HA   1  
ATOM 579   H HB2  . GLU A 1 35  ? 26.827  -4.586  12.678  1.00 0.00 ? 35  GLU A HB2  1  
ATOM 580   H HB3  . GLU A 1 35  ? 26.890  -4.161  10.967  1.00 0.00 ? 35  GLU A HB3  1  
ATOM 581   H HG2  . GLU A 1 35  ? 27.495  -1.775  12.294  1.00 0.00 ? 35  GLU A HG2  1  
ATOM 582   H HG3  . GLU A 1 35  ? 28.362  -3.014  13.203  1.00 0.00 ? 35  GLU A HG3  1  
ATOM 583   N N    . PRO A 1 36  ? 24.440  -3.345  9.917   1.00 0.00 ? 36  PRO A N    1  
ATOM 584   C CA   . PRO A 1 36  ? 25.368  -2.311  9.423   1.00 0.00 ? 36  PRO A CA   1  
ATOM 585   C C    . PRO A 1 36  ? 24.869  -0.920  9.817   1.00 0.00 ? 36  PRO A C    1  
ATOM 586   O O    . PRO A 1 36  ? 23.797  -0.767  10.367  1.00 0.00 ? 36  PRO A O    1  
ATOM 587   C CB   . PRO A 1 36  ? 25.331  -2.493  7.903   1.00 0.00 ? 36  PRO A CB   1  
ATOM 588   C CG   . PRO A 1 36  ? 23.995  -3.205  7.582   1.00 0.00 ? 36  PRO A CG   1  
ATOM 589   C CD   . PRO A 1 36  ? 23.540  -3.893  8.883   1.00 0.00 ? 36  PRO A CD   1  
ATOM 590   H HA   . PRO A 1 36  ? 26.365  -2.481  9.792   1.00 0.00 ? 36  PRO A HA   1  
ATOM 591   H HB2  . PRO A 1 36  ? 25.368  -1.528  7.414   1.00 0.00 ? 36  PRO A HB2  1  
ATOM 592   H HB3  . PRO A 1 36  ? 26.157  -3.106  7.580   1.00 0.00 ? 36  PRO A HB3  1  
ATOM 593   H HG2  . PRO A 1 36  ? 23.257  -2.480  7.266   1.00 0.00 ? 36  PRO A HG2  1  
ATOM 594   H HG3  . PRO A 1 36  ? 24.144  -3.945  6.812   1.00 0.00 ? 36  PRO A HG3  1  
ATOM 595   H HD2  . PRO A 1 36  ? 22.511  -3.644  9.102   1.00 0.00 ? 36  PRO A HD2  1  
ATOM 596   H HD3  . PRO A 1 36  ? 23.666  -4.962  8.808   1.00 0.00 ? 36  PRO A HD3  1  
ATOM 597   N N    . LYS A 1 37  ? 25.633  0.097   9.530   1.00 0.00 ? 37  LYS A N    1  
ATOM 598   C CA   . LYS A 1 37  ? 25.204  1.471   9.872   1.00 0.00 ? 37  LYS A CA   1  
ATOM 599   C C    . LYS A 1 37  ? 23.785  1.695   9.355   1.00 0.00 ? 37  LYS A C    1  
ATOM 600   O O    . LYS A 1 37  ? 22.981  2.365   9.972   1.00 0.00 ? 37  LYS A O    1  
ATOM 601   C CB   . LYS A 1 37  ? 26.155  2.449   9.196   1.00 0.00 ? 37  LYS A CB   1  
ATOM 602   C CG   . LYS A 1 37  ? 27.313  2.777   10.139  1.00 0.00 ? 37  LYS A CG   1  
ATOM 603   C CD   . LYS A 1 37  ? 27.199  4.232   10.600  1.00 0.00 ? 37  LYS A CD   1  
ATOM 604   C CE   . LYS A 1 37  ? 28.544  4.697   11.161  1.00 0.00 ? 37  LYS A CE   1  
ATOM 605   N NZ   . LYS A 1 37  ? 28.417  6.095   11.662  1.00 0.00 ? 37  LYS A NZ   1  
ATOM 606   H H    . LYS A 1 37  ? 26.487  -0.040  9.077   1.00 0.00 ? 37  LYS A H    1  
ATOM 607   H HA   . LYS A 1 37  ? 25.234  1.611   10.941  1.00 0.00 ? 37  LYS A HA   1  
ATOM 608   H HB2  . LYS A 1 37  ? 26.543  2.000   8.292   1.00 0.00 ? 37  LYS A HB2  1  
ATOM 609   H HB3  . LYS A 1 37  ? 25.625  3.344   8.948   1.00 0.00 ? 37  LYS A HB3  1  
ATOM 610   H HG2  . LYS A 1 37  ? 27.275  2.122   10.997  1.00 0.00 ? 37  LYS A HG2  1  
ATOM 611   H HG3  . LYS A 1 37  ? 28.251  2.639   9.621   1.00 0.00 ? 37  LYS A HG3  1  
ATOM 612   H HD2  . LYS A 1 37  ? 26.923  4.854   9.761   1.00 0.00 ? 37  LYS A HD2  1  
ATOM 613   H HD3  . LYS A 1 37  ? 26.445  4.307   11.369  1.00 0.00 ? 37  LYS A HD3  1  
ATOM 614   H HE2  . LYS A 1 37  ? 28.839  4.049   11.973  1.00 0.00 ? 37  LYS A HE2  1  
ATOM 615   H HE3  . LYS A 1 37  ? 29.291  4.660   10.381  1.00 0.00 ? 37  LYS A HE3  1  
ATOM 616   H HZ1  . LYS A 1 37  ? 27.506  6.492   11.352  1.00 0.00 ? 37  LYS A HZ1  1  
ATOM 617   H HZ2  . LYS A 1 37  ? 28.461  6.097   12.700  1.00 0.00 ? 37  LYS A HZ2  1  
ATOM 618   H HZ3  . LYS A 1 37  ? 29.194  6.671   11.283  1.00 0.00 ? 37  LYS A HZ3  1  
ATOM 619   N N    . GLY A 1 38  ? 23.478  1.134   8.221   1.00 0.00 ? 38  GLY A N    1  
ATOM 620   C CA   . GLY A 1 38  ? 22.116  1.301   7.645   1.00 0.00 ? 38  GLY A CA   1  
ATOM 621   C C    . GLY A 1 38  ? 21.969  0.380   6.434   1.00 0.00 ? 38  GLY A C    1  
ATOM 622   O O    . GLY A 1 38  ? 22.482  -0.720  6.414   1.00 0.00 ? 38  GLY A O    1  
ATOM 623   H H    . GLY A 1 38  ? 24.148  0.600   7.747   1.00 0.00 ? 38  GLY A H    1  
ATOM 624   H HA2  . GLY A 1 38  ? 21.375  1.044   8.388   1.00 0.00 ? 38  GLY A HA2  1  
ATOM 625   H HA3  . GLY A 1 38  ? 21.978  2.324   7.333   1.00 0.00 ? 38  GLY A HA3  1  
ATOM 626   N N    . TYR A 1 39  ? 21.277  0.822   5.422   1.00 0.00 ? 39  TYR A N    1  
ATOM 627   C CA   . TYR A 1 39  ? 21.102  -0.029  4.214   1.00 0.00 ? 39  TYR A CA   1  
ATOM 628   C C    . TYR A 1 39  ? 20.245  0.716   3.190   1.00 0.00 ? 39  TYR A C    1  
ATOM 629   O O    . TYR A 1 39  ? 19.842  1.840   3.408   1.00 0.00 ? 39  TYR A O    1  
ATOM 630   C CB   . TYR A 1 39  ? 20.425  -1.342  4.609   1.00 0.00 ? 39  TYR A CB   1  
ATOM 631   C CG   . TYR A 1 39  ? 18.967  -1.100  4.910   1.00 0.00 ? 39  TYR A CG   1  
ATOM 632   C CD1  . TYR A 1 39  ? 18.591  -0.278  5.980   1.00 0.00 ? 39  TYR A CD1  1  
ATOM 633   C CD2  . TYR A 1 39  ? 17.990  -1.710  4.121   1.00 0.00 ? 39  TYR A CD2  1  
ATOM 634   C CE1  . TYR A 1 39  ? 17.236  -0.068  6.258   1.00 0.00 ? 39  TYR A CE1  1  
ATOM 635   C CE2  . TYR A 1 39  ? 16.635  -1.500  4.397   1.00 0.00 ? 39  TYR A CE2  1  
ATOM 636   C CZ   . TYR A 1 39  ? 16.258  -0.679  5.467   1.00 0.00 ? 39  TYR A CZ   1  
ATOM 637   O OH   . TYR A 1 39  ? 14.921  -0.474  5.741   1.00 0.00 ? 39  TYR A OH   1  
ATOM 638   H H    . TYR A 1 39  ? 20.873  1.714   5.457   1.00 0.00 ? 39  TYR A H    1  
ATOM 639   H HA   . TYR A 1 39  ? 22.067  -0.242  3.782   1.00 0.00 ? 39  TYR A HA   1  
ATOM 640   H HB2  . TYR A 1 39  ? 20.510  -2.048  3.796   1.00 0.00 ? 39  TYR A HB2  1  
ATOM 641   H HB3  . TYR A 1 39  ? 20.909  -1.746  5.485   1.00 0.00 ? 39  TYR A HB3  1  
ATOM 642   H HD1  . TYR A 1 39  ? 19.344  0.195   6.589   1.00 0.00 ? 39  TYR A HD1  1  
ATOM 643   H HD2  . TYR A 1 39  ? 18.283  -2.341  3.295   1.00 0.00 ? 39  TYR A HD2  1  
ATOM 644   H HE1  . TYR A 1 39  ? 16.945  0.566   7.083   1.00 0.00 ? 39  TYR A HE1  1  
ATOM 645   H HE2  . TYR A 1 39  ? 15.882  -1.971  3.787   1.00 0.00 ? 39  TYR A HE2  1  
ATOM 646   H HH   . TYR A 1 39  ? 14.809  0.445   5.995   1.00 0.00 ? 39  TYR A HH   1  
ATOM 647   N N    . HIS A 1 40  ? 19.965  0.106   2.072   1.00 0.00 ? 40  HIS A N    1  
ATOM 648   C CA   . HIS A 1 40  ? 19.137  0.792   1.042   1.00 0.00 ? 40  HIS A CA   1  
ATOM 649   C C    . HIS A 1 40  ? 17.687  0.327   1.170   1.00 0.00 ? 40  HIS A C    1  
ATOM 650   O O    . HIS A 1 40  ? 17.204  -0.467  0.387   1.00 0.00 ? 40  HIS A O    1  
ATOM 651   C CB   . HIS A 1 40  ? 19.677  0.457   -0.349  1.00 0.00 ? 40  HIS A CB   1  
ATOM 652   C CG   . HIS A 1 40  ? 21.121  0.873   -0.425  1.00 0.00 ? 40  HIS A CG   1  
ATOM 653   N ND1  . HIS A 1 40  ? 21.506  2.141   -0.833  1.00 0.00 ? 40  HIS A ND1  1  
ATOM 654   C CD2  . HIS A 1 40  ? 22.284  0.205   -0.134  1.00 0.00 ? 40  HIS A CD2  1  
ATOM 655   C CE1  . HIS A 1 40  ? 22.849  2.196   -0.773  1.00 0.00 ? 40  HIS A CE1  1  
ATOM 656   N NE2  . HIS A 1 40  ? 23.374  1.042   -0.354  1.00 0.00 ? 40  HIS A NE2  1  
ATOM 657   H H    . HIS A 1 40  ? 20.300  -0.801  1.909   1.00 0.00 ? 40  HIS A H    1  
ATOM 658   H HA   . HIS A 1 40  ? 19.186  1.860   1.198   1.00 0.00 ? 40  HIS A HA   1  
ATOM 659   H HB2  . HIS A 1 40  ? 19.596  -0.607  -0.521  1.00 0.00 ? 40  HIS A HB2  1  
ATOM 660   H HB3  . HIS A 1 40  ? 19.108  0.989   -1.096  1.00 0.00 ? 40  HIS A HB3  1  
ATOM 661   H HD1  . HIS A 1 40  ? 20.908  2.865   -1.113  1.00 0.00 ? 40  HIS A HD1  1  
ATOM 662   H HD2  . HIS A 1 40  ? 22.345  -0.814  0.218   1.00 0.00 ? 40  HIS A HD2  1  
ATOM 663   H HE1  . HIS A 1 40  ? 23.432  3.069   -1.025  1.00 0.00 ? 40  HIS A HE1  1  
ATOM 664   N N    . ALA A 1 41  ? 16.995  0.813   2.163   1.00 0.00 ? 41  ALA A N    1  
ATOM 665   C CA   . ALA A 1 41  ? 15.577  0.404   2.364   1.00 0.00 ? 41  ALA A CA   1  
ATOM 666   C C    . ALA A 1 41  ? 14.750  0.754   1.127   1.00 0.00 ? 41  ALA A C    1  
ATOM 667   O O    . ALA A 1 41  ? 13.697  0.193   0.899   1.00 0.00 ? 41  ALA A O    1  
ATOM 668   C CB   . ALA A 1 41  ? 15.010  1.133   3.583   1.00 0.00 ? 41  ALA A CB   1  
ATOM 669   H H    . ALA A 1 41  ? 17.412  1.447   2.783   1.00 0.00 ? 41  ALA A H    1  
ATOM 670   H HA   . ALA A 1 41  ? 15.533  -0.660  2.531   1.00 0.00 ? 41  ALA A HA   1  
ATOM 671   H HB1  . ALA A 1 41  ? 15.798  1.295   4.305   1.00 0.00 ? 41  ALA A HB1  1  
ATOM 672   H HB2  . ALA A 1 41  ? 14.603  2.085   3.277   1.00 0.00 ? 41  ALA A HB2  1  
ATOM 673   H HB3  . ALA A 1 41  ? 14.230  0.535   4.030   1.00 0.00 ? 41  ALA A HB3  1  
ATOM 674   N N    . ASN A 1 42  ? 15.211  1.671   0.324   1.00 0.00 ? 42  ASN A N    1  
ATOM 675   C CA   . ASN A 1 42  ? 14.435  2.038   -0.892  1.00 0.00 ? 42  ASN A CA   1  
ATOM 676   C C    . ASN A 1 42  ? 13.003  2.387   -0.489  1.00 0.00 ? 42  ASN A C    1  
ATOM 677   O O    . ASN A 1 42  ? 12.618  2.249   0.655   1.00 0.00 ? 42  ASN A O    1  
ATOM 678   C CB   . ASN A 1 42  ? 14.410  0.850   -1.854  1.00 0.00 ? 42  ASN A CB   1  
ATOM 679   C CG   . ASN A 1 42  ? 15.585  0.955   -2.828  1.00 0.00 ? 42  ASN A CG   1  
ATOM 680   O OD1  . ASN A 1 42  ? 15.830  2.002   -3.392  1.00 0.00 ? 42  ASN A OD1  1  
ATOM 681   N ND2  . ASN A 1 42  ? 16.329  -0.095  -3.049  1.00 0.00 ? 42  ASN A ND2  1  
ATOM 682   H H    . ASN A 1 42  ? 16.063  2.116   0.519   1.00 0.00 ? 42  ASN A H    1  
ATOM 683   H HA   . ASN A 1 42  ? 14.895  2.888   -1.375  1.00 0.00 ? 42  ASN A HA   1  
ATOM 684   H HB2  . ASN A 1 42  ? 14.488  -0.070  -1.292  1.00 0.00 ? 42  ASN A HB2  1  
ATOM 685   H HB3  . ASN A 1 42  ? 13.483  0.854   -2.408  1.00 0.00 ? 42  ASN A HB3  1  
ATOM 686   H HD21 . ASN A 1 42  ? 16.131  -0.940  -2.593  1.00 0.00 ? 42  ASN A HD21 1  
ATOM 687   H HD22 . ASN A 1 42  ? 17.084  -0.038  -3.670  1.00 0.00 ? 42  ASN A HD22 1  
ATOM 688   N N    . PHE A 1 43  ? 12.205  2.827   -1.422  1.00 0.00 ? 43  PHE A N    1  
ATOM 689   C CA   . PHE A 1 43  ? 10.796  3.171   -1.092  1.00 0.00 ? 43  PHE A CA   1  
ATOM 690   C C    . PHE A 1 43  ? 10.097  3.656   -2.360  1.00 0.00 ? 43  PHE A C    1  
ATOM 691   O O    . PHE A 1 43  ? 10.678  3.656   -3.423  1.00 0.00 ? 43  PHE A O    1  
ATOM 692   C CB   . PHE A 1 43  ? 10.766  4.243   0.005   1.00 0.00 ? 43  PHE A CB   1  
ATOM 693   C CG   . PHE A 1 43  ? 10.829  5.631   -0.584  1.00 0.00 ? 43  PHE A CG   1  
ATOM 694   C CD1  . PHE A 1 43  ? 11.849  5.980   -1.475  1.00 0.00 ? 43  PHE A CD1  1  
ATOM 695   C CD2  . PHE A 1 43  ? 9.866   6.573   -0.218  1.00 0.00 ? 43  PHE A CD2  1  
ATOM 696   C CE1  . PHE A 1 43  ? 11.902  7.276   -2.000  1.00 0.00 ? 43  PHE A CE1  1  
ATOM 697   C CE2  . PHE A 1 43  ? 9.918   7.865   -0.743  1.00 0.00 ? 43  PHE A CE2  1  
ATOM 698   C CZ   . PHE A 1 43  ? 10.936  8.219   -1.634  1.00 0.00 ? 43  PHE A CZ   1  
ATOM 699   H H    . PHE A 1 43  ? 12.530  2.923   -2.345  1.00 0.00 ? 43  PHE A H    1  
ATOM 700   H HA   . PHE A 1 43  ? 10.294  2.283   -0.734  1.00 0.00 ? 43  PHE A HA   1  
ATOM 701   H HB2  . PHE A 1 43  ? 9.854   4.144   0.571   1.00 0.00 ? 43  PHE A HB2  1  
ATOM 702   H HB3  . PHE A 1 43  ? 11.609  4.098   0.664   1.00 0.00 ? 43  PHE A HB3  1  
ATOM 703   H HD1  . PHE A 1 43  ? 12.596  5.252   -1.756  1.00 0.00 ? 43  PHE A HD1  1  
ATOM 704   H HD2  . PHE A 1 43  ? 9.079   6.302   0.469   1.00 0.00 ? 43  PHE A HD2  1  
ATOM 705   H HE1  . PHE A 1 43  ? 12.688  7.549   -2.686  1.00 0.00 ? 43  PHE A HE1  1  
ATOM 706   H HE2  . PHE A 1 43  ? 9.173   8.587   -0.458  1.00 0.00 ? 43  PHE A HE2  1  
ATOM 707   H HZ   . PHE A 1 43  ? 10.976  9.220   -2.039  1.00 0.00 ? 43  PHE A HZ   1  
ATOM 708   N N    . CYS A 1 44  ? 8.856   4.043   -2.276  1.00 0.00 ? 44  CYS A N    1  
ATOM 709   C CA   . CYS A 1 44  ? 8.152   4.486   -3.511  1.00 0.00 ? 44  CYS A CA   1  
ATOM 710   C C    . CYS A 1 44  ? 7.172   5.617   -3.204  1.00 0.00 ? 44  CYS A C    1  
ATOM 711   O O    . CYS A 1 44  ? 6.603   5.693   -2.134  1.00 0.00 ? 44  CYS A O    1  
ATOM 712   C CB   . CYS A 1 44  ? 7.404   3.285   -4.086  1.00 0.00 ? 44  CYS A CB   1  
ATOM 713   S SG   . CYS A 1 44  ? 8.553   1.894   -4.189  1.00 0.00 ? 44  CYS A SG   1  
ATOM 714   H H    . CYS A 1 44  ? 8.385   4.021   -1.416  1.00 0.00 ? 44  CYS A H    1  
ATOM 715   H HA   . CYS A 1 44  ? 8.878   4.830   -4.230  1.00 0.00 ? 44  CYS A HA   1  
ATOM 716   H HB2  . CYS A 1 44  ? 6.581   3.026   -3.436  1.00 0.00 ? 44  CYS A HB2  1  
ATOM 717   H HB3  . CYS A 1 44  ? 7.029   3.515   -5.072  1.00 0.00 ? 44  CYS A HB3  1  
ATOM 718   N N    . LEU A 1 45  ? 6.973   6.496   -4.149  1.00 0.00 ? 45  LEU A N    1  
ATOM 719   C CA   . LEU A 1 45  ? 6.031   7.630   -3.935  1.00 0.00 ? 45  LEU A CA   1  
ATOM 720   C C    . LEU A 1 45  ? 5.183   7.824   -5.193  1.00 0.00 ? 45  LEU A C    1  
ATOM 721   O O    . LEU A 1 45  ? 5.135   6.972   -6.059  1.00 0.00 ? 45  LEU A O    1  
ATOM 722   C CB   . LEU A 1 45  ? 6.825   8.908   -3.658  1.00 0.00 ? 45  LEU A CB   1  
ATOM 723   C CG   . LEU A 1 45  ? 7.565   8.780   -2.329  1.00 0.00 ? 45  LEU A CG   1  
ATOM 724   C CD1  . LEU A 1 45  ? 8.350   10.066  -2.062  1.00 0.00 ? 45  LEU A CD1  1  
ATOM 725   C CD2  . LEU A 1 45  ? 6.553   8.553   -1.202  1.00 0.00 ? 45  LEU A CD2  1  
ATOM 726   H H    . LEU A 1 45  ? 7.446   6.408   -5.005  1.00 0.00 ? 45  LEU A H    1  
ATOM 727   H HA   . LEU A 1 45  ? 5.388   7.413   -3.095  1.00 0.00 ? 45  LEU A HA   1  
ATOM 728   H HB2  . LEU A 1 45  ? 7.541   9.065   -4.451  1.00 0.00 ? 45  LEU A HB2  1  
ATOM 729   H HB3  . LEU A 1 45  ? 6.150   9.749   -3.612  1.00 0.00 ? 45  LEU A HB3  1  
ATOM 730   H HG   . LEU A 1 45  ? 8.248   7.944   -2.377  1.00 0.00 ? 45  LEU A HG   1  
ATOM 731   H HD11 . LEU A 1 45  ? 7.824   10.905  -2.495  1.00 0.00 ? 45  LEU A HD11 1  
ATOM 732   H HD12 . LEU A 1 45  ? 8.449   10.215  -0.998  1.00 0.00 ? 45  LEU A HD12 1  
ATOM 733   H HD13 . LEU A 1 45  ? 9.331   9.988   -2.508  1.00 0.00 ? 45  LEU A HD13 1  
ATOM 734   H HD21 . LEU A 1 45  ? 5.836   9.361   -1.194  1.00 0.00 ? 45  LEU A HD21 1  
ATOM 735   H HD22 . LEU A 1 45  ? 6.040   7.617   -1.362  1.00 0.00 ? 45  LEU A HD22 1  
ATOM 736   H HD23 . LEU A 1 45  ? 7.070   8.522   -0.256  1.00 0.00 ? 45  LEU A HD23 1  
ATOM 737   N N    . GLY A 1 46  ? 4.516   8.940   -5.305  1.00 0.00 ? 46  GLY A N    1  
ATOM 738   C CA   . GLY A 1 46  ? 3.676   9.189   -6.511  1.00 0.00 ? 46  GLY A CA   1  
ATOM 739   C C    . GLY A 1 46  ? 2.396   8.352   -6.430  1.00 0.00 ? 46  GLY A C    1  
ATOM 740   O O    . GLY A 1 46  ? 2.335   7.383   -5.701  1.00 0.00 ? 46  GLY A O    1  
ATOM 741   H H    . GLY A 1 46  ? 4.570   9.616   -4.597  1.00 0.00 ? 46  GLY A H    1  
ATOM 742   H HA2  . GLY A 1 46  ? 3.419   10.238  -6.558  1.00 0.00 ? 46  GLY A HA2  1  
ATOM 743   H HA3  . GLY A 1 46  ? 4.227   8.912   -7.396  1.00 0.00 ? 46  GLY A HA3  1  
ATOM 744   N N    . PRO A 1 47  ? 1.408   8.758   -7.188  1.00 0.00 ? 47  PRO A N    1  
ATOM 745   C CA   . PRO A 1 47  ? 0.105   8.071   -7.232  1.00 0.00 ? 47  PRO A CA   1  
ATOM 746   C C    . PRO A 1 47  ? 0.193   6.810   -8.098  1.00 0.00 ? 47  PRO A C    1  
ATOM 747   O O    . PRO A 1 47  ? 1.241   6.464   -8.605  1.00 0.00 ? 47  PRO A O    1  
ATOM 748   C CB   . PRO A 1 47  ? -0.824  9.107   -7.870  1.00 0.00 ? 47  PRO A CB   1  
ATOM 749   C CG   . PRO A 1 47  ? 0.083   10.080  -8.661  1.00 0.00 ? 47  PRO A CG   1  
ATOM 750   C CD   . PRO A 1 47  ? 1.498   9.942   -8.068  1.00 0.00 ? 47  PRO A CD   1  
ATOM 751   H HA   . PRO A 1 47  ? -0.235  7.831   -6.239  1.00 0.00 ? 47  PRO A HA   1  
ATOM 752   H HB2  . PRO A 1 47  ? -1.521  8.618   -8.537  1.00 0.00 ? 47  PRO A HB2  1  
ATOM 753   H HB3  . PRO A 1 47  ? -1.358  9.649   -7.105  1.00 0.00 ? 47  PRO A HB3  1  
ATOM 754   H HG2  . PRO A 1 47  ? 0.089   9.810   -9.708  1.00 0.00 ? 47  PRO A HG2  1  
ATOM 755   H HG3  . PRO A 1 47  ? -0.265  11.094  -8.539  1.00 0.00 ? 47  PRO A HG3  1  
ATOM 756   H HD2  . PRO A 1 47  ? 2.222   9.778   -8.855  1.00 0.00 ? 47  PRO A HD2  1  
ATOM 757   H HD3  . PRO A 1 47  ? 1.754   10.817  -7.491  1.00 0.00 ? 47  PRO A HD3  1  
ATOM 758   N N    . CYS A 1 48  ? -0.903  6.123   -8.271  1.00 0.00 ? 48  CYS A N    1  
ATOM 759   C CA   . CYS A 1 48  ? -0.887  4.886   -9.103  1.00 0.00 ? 48  CYS A CA   1  
ATOM 760   C C    . CYS A 1 48  ? -2.216  4.768   -9.860  1.00 0.00 ? 48  CYS A C    1  
ATOM 761   O O    . CYS A 1 48  ? -3.260  4.646   -9.249  1.00 0.00 ? 48  CYS A O    1  
ATOM 762   C CB   . CYS A 1 48  ? -0.711  3.664   -8.190  1.00 0.00 ? 48  CYS A CB   1  
ATOM 763   S SG   . CYS A 1 48  ? -1.095  2.145   -9.104  1.00 0.00 ? 48  CYS A SG   1  
ATOM 764   H H    . CYS A 1 48  ? -1.739  6.420   -7.853  1.00 0.00 ? 48  CYS A H    1  
ATOM 765   H HA   . CYS A 1 48  ? -0.066  4.934   -9.800  1.00 0.00 ? 48  CYS A HA   1  
ATOM 766   H HB2  . CYS A 1 48  ? 0.308   3.622   -7.841  1.00 0.00 ? 48  CYS A HB2  1  
ATOM 767   H HB3  . CYS A 1 48  ? -1.376  3.750   -7.344  1.00 0.00 ? 48  CYS A HB3  1  
ATOM 768   N N    . PRO A 1 49  ? -2.144  4.794   -11.169 1.00 0.00 ? 49  PRO A N    1  
ATOM 769   C CA   . PRO A 1 49  ? -3.338  4.676   -12.019 1.00 0.00 ? 49  PRO A CA   1  
ATOM 770   C C    . PRO A 1 49  ? -3.801  3.210   -12.048 1.00 0.00 ? 49  PRO A C    1  
ATOM 771   O O    . PRO A 1 49  ? -3.686  2.507   -11.064 1.00 0.00 ? 49  PRO A O    1  
ATOM 772   C CB   . PRO A 1 49  ? -2.855  5.181   -13.387 1.00 0.00 ? 49  PRO A CB   1  
ATOM 773   C CG   . PRO A 1 49  ? -1.317  5.037   -13.392 1.00 0.00 ? 49  PRO A CG   1  
ATOM 774   C CD   . PRO A 1 49  ? -0.878  4.941   -11.918 1.00 0.00 ? 49  PRO A CD   1  
ATOM 775   H HA   . PRO A 1 49  ? -4.126  5.312   -11.649 1.00 0.00 ? 49  PRO A HA   1  
ATOM 776   H HB2  . PRO A 1 49  ? -3.284  4.590   -14.181 1.00 0.00 ? 49  PRO A HB2  1  
ATOM 777   H HB3  . PRO A 1 49  ? -3.120  6.218   -13.513 1.00 0.00 ? 49  PRO A HB3  1  
ATOM 778   H HG2  . PRO A 1 49  ? -1.033  4.146   -13.930 1.00 0.00 ? 49  PRO A HG2  1  
ATOM 779   H HG3  . PRO A 1 49  ? -0.867  5.905   -13.849 1.00 0.00 ? 49  PRO A HG3  1  
ATOM 780   H HD2  . PRO A 1 49  ? -0.245  4.077   -11.769 1.00 0.00 ? 49  PRO A HD2  1  
ATOM 781   H HD3  . PRO A 1 49  ? -0.369  5.842   -11.615 1.00 0.00 ? 49  PRO A HD3  1  
ATOM 782   N N    . TYR A 1 50  ? -4.332  2.737   -13.142 1.00 0.00 ? 50  TYR A N    1  
ATOM 783   C CA   . TYR A 1 50  ? -4.799  1.316   -13.172 1.00 0.00 ? 50  TYR A CA   1  
ATOM 784   C C    . TYR A 1 50  ? -3.675  0.396   -13.658 1.00 0.00 ? 50  TYR A C    1  
ATOM 785   O O    . TYR A 1 50  ? -2.932  -0.155  -12.873 1.00 0.00 ? 50  TYR A O    1  
ATOM 786   C CB   . TYR A 1 50  ? -6.020  1.153   -14.097 1.00 0.00 ? 50  TYR A CB   1  
ATOM 787   C CG   . TYR A 1 50  ? -6.252  2.405   -14.909 1.00 0.00 ? 50  TYR A CG   1  
ATOM 788   C CD1  . TYR A 1 50  ? -6.727  3.563   -14.284 1.00 0.00 ? 50  TYR A CD1  1  
ATOM 789   C CD2  . TYR A 1 50  ? -5.989  2.409   -16.284 1.00 0.00 ? 50  TYR A CD2  1  
ATOM 790   C CE1  . TYR A 1 50  ? -6.940  4.726   -15.032 1.00 0.00 ? 50  TYR A CE1  1  
ATOM 791   C CE2  . TYR A 1 50  ? -6.202  3.573   -17.034 1.00 0.00 ? 50  TYR A CE2  1  
ATOM 792   C CZ   . TYR A 1 50  ? -6.678  4.731   -16.407 1.00 0.00 ? 50  TYR A CZ   1  
ATOM 793   O OH   . TYR A 1 50  ? -6.888  5.878   -17.145 1.00 0.00 ? 50  TYR A OH   1  
ATOM 794   H H    . TYR A 1 50  ? -4.431  3.307   -13.927 1.00 0.00 ? 50  TYR A H    1  
ATOM 795   H HA   . TYR A 1 50  ? -5.078  1.024   -12.170 1.00 0.00 ? 50  TYR A HA   1  
ATOM 796   H HB2  . TYR A 1 50  ? -5.851  0.322   -14.766 1.00 0.00 ? 50  TYR A HB2  1  
ATOM 797   H HB3  . TYR A 1 50  ? -6.895  0.952   -13.496 1.00 0.00 ? 50  TYR A HB3  1  
ATOM 798   H HD1  . TYR A 1 50  ? -6.930  3.558   -13.222 1.00 0.00 ? 50  TYR A HD1  1  
ATOM 799   H HD2  . TYR A 1 50  ? -5.622  1.515   -16.767 1.00 0.00 ? 50  TYR A HD2  1  
ATOM 800   H HE1  . TYR A 1 50  ? -7.308  5.618   -14.548 1.00 0.00 ? 50  TYR A HE1  1  
ATOM 801   H HE2  . TYR A 1 50  ? -6.000  3.576   -18.094 1.00 0.00 ? 50  TYR A HE2  1  
ATOM 802   H HH   . TYR A 1 50  ? -6.421  5.784   -17.979 1.00 0.00 ? 50  TYR A HH   1  
ATOM 803   N N    . ILE A 1 51  ? -3.567  0.212   -14.946 1.00 0.00 ? 51  ILE A N    1  
ATOM 804   C CA   . ILE A 1 51  ? -2.517  -0.693  -15.506 1.00 0.00 ? 51  ILE A CA   1  
ATOM 805   C C    . ILE A 1 51  ? -1.212  -0.606  -14.702 1.00 0.00 ? 51  ILE A C    1  
ATOM 806   O O    . ILE A 1 51  ? -0.449  -1.549  -14.656 1.00 0.00 ? 51  ILE A O    1  
ATOM 807   C CB   . ILE A 1 51  ? -2.238  -0.302  -16.958 1.00 0.00 ? 51  ILE A CB   1  
ATOM 808   C CG1  . ILE A 1 51  ? -1.714  1.136   -17.005 1.00 0.00 ? 51  ILE A CG1  1  
ATOM 809   C CG2  . ILE A 1 51  ? -3.530  -0.401  -17.772 1.00 0.00 ? 51  ILE A CG2  1  
ATOM 810   C CD1  . ILE A 1 51  ? -1.099  1.412   -18.378 1.00 0.00 ? 51  ILE A CD1  1  
ATOM 811   H H    . ILE A 1 51  ? -4.194  0.658   -15.552 1.00 0.00 ? 51  ILE A H    1  
ATOM 812   H HA   . ILE A 1 51  ? -2.880  -1.710  -15.480 1.00 0.00 ? 51  ILE A HA   1  
ATOM 813   H HB   . ILE A 1 51  ? -1.499  -0.970  -17.375 1.00 0.00 ? 51  ILE A HB   1  
ATOM 814   H HG12 . ILE A 1 51  ? -2.530  1.822   -16.830 1.00 0.00 ? 51  ILE A HG12 1  
ATOM 815   H HG13 . ILE A 1 51  ? -0.961  1.270   -16.242 1.00 0.00 ? 51  ILE A HG13 1  
ATOM 816   H HG21 . ILE A 1 51  ? -4.369  -0.519  -17.102 1.00 0.00 ? 51  ILE A HG21 1  
ATOM 817   H HG22 . ILE A 1 51  ? -3.658  0.498   -18.356 1.00 0.00 ? 51  ILE A HG22 1  
ATOM 818   H HG23 . ILE A 1 51  ? -3.474  -1.254  -18.432 1.00 0.00 ? 51  ILE A HG23 1  
ATOM 819   H HD11 . ILE A 1 51  ? -0.559  0.538   -18.712 1.00 0.00 ? 51  ILE A HD11 1  
ATOM 820   H HD12 . ILE A 1 51  ? -1.883  1.642   -19.084 1.00 0.00 ? 51  ILE A HD12 1  
ATOM 821   H HD13 . ILE A 1 51  ? -0.421  2.249   -18.307 1.00 0.00 ? 51  ILE A HD13 1  
ATOM 822   N N    . TRP A 1 52  ? -0.938  0.509   -14.082 1.00 0.00 ? 52  TRP A N    1  
ATOM 823   C CA   . TRP A 1 52  ? 0.330   0.632   -13.302 1.00 0.00 ? 52  TRP A CA   1  
ATOM 824   C C    . TRP A 1 52  ? 0.383   -0.428  -12.199 1.00 0.00 ? 52  TRP A C    1  
ATOM 825   O O    . TRP A 1 52  ? -0.013  -0.184  -11.078 1.00 0.00 ? 52  TRP A O    1  
ATOM 826   C CB   . TRP A 1 52  ? 0.412   2.018   -12.669 1.00 0.00 ? 52  TRP A CB   1  
ATOM 827   C CG   . TRP A 1 52  ? 1.828   2.492   -12.701 1.00 0.00 ? 52  TRP A CG   1  
ATOM 828   C CD1  . TRP A 1 52  ? 2.488   3.029   -11.652 1.00 0.00 ? 52  TRP A CD1  1  
ATOM 829   C CD2  . TRP A 1 52  ? 2.769   2.480   -13.814 1.00 0.00 ? 52  TRP A CD2  1  
ATOM 830   N NE1  . TRP A 1 52  ? 3.775   3.348   -12.047 1.00 0.00 ? 52  TRP A NE1  1  
ATOM 831   C CE2  . TRP A 1 52  ? 3.997   3.029   -13.372 1.00 0.00 ? 52  TRP A CE2  1  
ATOM 832   C CE3  . TRP A 1 52  ? 2.678   2.051   -15.150 1.00 0.00 ? 52  TRP A CE3  1  
ATOM 833   C CZ2  . TRP A 1 52  ? 5.096   3.147   -14.226 1.00 0.00 ? 52  TRP A CZ2  1  
ATOM 834   C CZ3  . TRP A 1 52  ? 3.781   2.169   -16.012 1.00 0.00 ? 52  TRP A CZ3  1  
ATOM 835   C CH2  . TRP A 1 52  ? 4.987   2.715   -15.551 1.00 0.00 ? 52  TRP A CH2  1  
ATOM 836   H H    . TRP A 1 52  ? -1.557  1.266   -14.136 1.00 0.00 ? 52  TRP A H    1  
ATOM 837   H HA   . TRP A 1 52  ? 1.172   0.497   -13.964 1.00 0.00 ? 52  TRP A HA   1  
ATOM 838   H HB2  . TRP A 1 52  ? -0.210  2.701   -13.222 1.00 0.00 ? 52  TRP A HB2  1  
ATOM 839   H HB3  . TRP A 1 52  ? 0.072   1.967   -11.645 1.00 0.00 ? 52  TRP A HB3  1  
ATOM 840   H HD1  . TRP A 1 52  ? 2.077   3.181   -10.666 1.00 0.00 ? 52  TRP A HD1  1  
ATOM 841   H HE1  . TRP A 1 52  ? 4.460   3.751   -11.473 1.00 0.00 ? 52  TRP A HE1  1  
ATOM 842   H HE3  . TRP A 1 52  ? 1.753   1.628   -15.516 1.00 0.00 ? 52  TRP A HE3  1  
ATOM 843   H HZ2  . TRP A 1 52  ? 6.024   3.567   -13.865 1.00 0.00 ? 52  TRP A HZ2  1  
ATOM 844   H HZ3  . TRP A 1 52  ? 3.699   1.836   -17.036 1.00 0.00 ? 52  TRP A HZ3  1  
ATOM 845   H HH2  . TRP A 1 52  ? 5.831   2.803   -16.219 1.00 0.00 ? 52  TRP A HH2  1  
ATOM 846   N N    . SER A 1 53  ? 0.892   -1.593  -12.512 1.00 0.00 ? 53  SER A N    1  
ATOM 847   C CA   . SER A 1 53  ? 1.004   -2.685  -11.495 1.00 0.00 ? 53  SER A CA   1  
ATOM 848   C C    . SER A 1 53  ? -0.177  -2.646  -10.521 1.00 0.00 ? 53  SER A C    1  
ATOM 849   O O    . SER A 1 53  ? -0.169  -1.916  -9.549  1.00 0.00 ? 53  SER A O    1  
ATOM 850   C CB   . SER A 1 53  ? 2.307   -2.513  -10.715 1.00 0.00 ? 53  SER A CB   1  
ATOM 851   O OG   . SER A 1 53  ? 3.163   -1.626  -11.423 1.00 0.00 ? 53  SER A OG   1  
ATOM 852   H H    . SER A 1 53  ? 1.219   -1.748  -13.423 1.00 0.00 ? 53  SER A H    1  
ATOM 853   H HA   . SER A 1 53  ? 1.017   -3.640  -11.999 1.00 0.00 ? 53  SER A HA   1  
ATOM 854   H HB2  . SER A 1 53  ? 2.096   -2.102  -9.743  1.00 0.00 ? 53  SER A HB2  1  
ATOM 855   H HB3  . SER A 1 53  ? 2.786   -3.477  -10.600 1.00 0.00 ? 53  SER A HB3  1  
ATOM 856   H HG   . SER A 1 53  ? 4.045   -1.704  -11.051 1.00 0.00 ? 53  SER A HG   1  
ATOM 857   N N    . LEU A 1 54  ? -1.187  -3.436  -10.762 1.00 0.00 ? 54  LEU A N    1  
ATOM 858   C CA   . LEU A 1 54  ? -2.356  -3.449  -9.838  1.00 0.00 ? 54  LEU A CA   1  
ATOM 859   C C    . LEU A 1 54  ? -2.295  -4.706  -8.969  1.00 0.00 ? 54  LEU A C    1  
ATOM 860   O O    . LEU A 1 54  ? -2.124  -5.804  -9.460  1.00 0.00 ? 54  LEU A O    1  
ATOM 861   C CB   . LEU A 1 54  ? -3.651  -3.441  -10.652 1.00 0.00 ? 54  LEU A CB   1  
ATOM 862   C CG   . LEU A 1 54  ? -3.711  -2.156  -11.479 1.00 0.00 ? 54  LEU A CG   1  
ATOM 863   C CD1  . LEU A 1 54  ? -4.987  -2.137  -12.322 1.00 0.00 ? 54  LEU A CD1  1  
ATOM 864   C CD2  . LEU A 1 54  ? -3.704  -0.949  -10.540 1.00 0.00 ? 54  LEU A CD2  1  
ATOM 865   H H    . LEU A 1 54  ? -1.172  -4.027  -11.544 1.00 0.00 ? 54  LEU A H    1  
ATOM 866   H HA   . LEU A 1 54  ? -2.323  -2.574  -9.206  1.00 0.00 ? 54  LEU A HA   1  
ATOM 867   H HB2  . LEU A 1 54  ? -3.670  -4.298  -11.310 1.00 0.00 ? 54  LEU A HB2  1  
ATOM 868   H HB3  . LEU A 1 54  ? -4.497  -3.477  -9.983  1.00 0.00 ? 54  LEU A HB3  1  
ATOM 869   H HG   . LEU A 1 54  ? -2.850  -2.111  -12.131 1.00 0.00 ? 54  LEU A HG   1  
ATOM 870   H HD11 . LEU A 1 54  ? -5.470  -3.101  -12.267 1.00 0.00 ? 54  LEU A HD11 1  
ATOM 871   H HD12 . LEU A 1 54  ? -5.656  -1.377  -11.945 1.00 0.00 ? 54  LEU A HD12 1  
ATOM 872   H HD13 . LEU A 1 54  ? -4.736  -1.917  -13.350 1.00 0.00 ? 54  LEU A HD13 1  
ATOM 873   H HD21 . LEU A 1 54  ? -3.944  -1.272  -9.537  1.00 0.00 ? 54  LEU A HD21 1  
ATOM 874   H HD22 . LEU A 1 54  ? -2.725  -0.493  -10.546 1.00 0.00 ? 54  LEU A HD22 1  
ATOM 875   H HD23 . LEU A 1 54  ? -4.439  -0.230  -10.871 1.00 0.00 ? 54  LEU A HD23 1  
ATOM 876   N N    . ASP A 1 55  ? -2.420  -4.554  -7.679  1.00 0.00 ? 55  ASP A N    1  
ATOM 877   C CA   . ASP A 1 55  ? -2.354  -5.741  -6.779  1.00 0.00 ? 55  ASP A CA   1  
ATOM 878   C C    . ASP A 1 55  ? -3.765  -6.259  -6.489  1.00 0.00 ? 55  ASP A C    1  
ATOM 879   O O    . ASP A 1 55  ? -4.128  -7.349  -6.883  1.00 0.00 ? 55  ASP A O    1  
ATOM 880   C CB   . ASP A 1 55  ? -1.679  -5.346  -5.464  1.00 0.00 ? 55  ASP A CB   1  
ATOM 881   C CG   . ASP A 1 55  ? -0.982  -6.567  -4.860  1.00 0.00 ? 55  ASP A CG   1  
ATOM 882   O OD1  . ASP A 1 55  ? -0.179  -7.169  -5.553  1.00 0.00 ? 55  ASP A OD1  1  
ATOM 883   O OD2  . ASP A 1 55  ? -1.264  -6.879  -3.715  1.00 0.00 ? 55  ASP A OD2  1  
ATOM 884   H H    . ASP A 1 55  ? -2.548  -3.657  -7.302  1.00 0.00 ? 55  ASP A H    1  
ATOM 885   H HA   . ASP A 1 55  ? -1.778  -6.520  -7.255  1.00 0.00 ? 55  ASP A HA   1  
ATOM 886   H HB2  . ASP A 1 55  ? -0.951  -4.570  -5.652  1.00 0.00 ? 55  ASP A HB2  1  
ATOM 887   H HB3  . ASP A 1 55  ? -2.423  -4.981  -4.772  1.00 0.00 ? 55  ASP A HB3  1  
ATOM 888   N N    . THR A 1 56  ? -4.560  -5.491  -5.796  1.00 0.00 ? 56  THR A N    1  
ATOM 889   C CA   . THR A 1 56  ? -5.941  -5.949  -5.475  1.00 0.00 ? 56  THR A CA   1  
ATOM 890   C C    . THR A 1 56  ? -6.919  -5.408  -6.519  1.00 0.00 ? 56  THR A C    1  
ATOM 891   O O    . THR A 1 56  ? -6.610  -4.499  -7.264  1.00 0.00 ? 56  THR A O    1  
ATOM 892   C CB   . THR A 1 56  ? -6.341  -5.432  -4.092  1.00 0.00 ? 56  THR A CB   1  
ATOM 893   O OG1  . THR A 1 56  ? -6.893  -4.129  -4.217  1.00 0.00 ? 56  THR A OG1  1  
ATOM 894   C CG2  . THR A 1 56  ? -5.110  -5.383  -3.185  1.00 0.00 ? 56  THR A CG2  1  
ATOM 895   H H    . THR A 1 56  ? -4.247  -4.618  -5.480  1.00 0.00 ? 56  THR A H    1  
ATOM 896   H HA   . THR A 1 56  ? -5.973  -7.028  -5.478  1.00 0.00 ? 56  THR A HA   1  
ATOM 897   H HB   . THR A 1 56  ? -7.075  -6.094  -3.660  1.00 0.00 ? 56  THR A HB   1  
ATOM 898   H HG1  . THR A 1 56  ? -7.849  -4.211  -4.222  1.00 0.00 ? 56  THR A HG1  1  
ATOM 899   H HG21 . THR A 1 56  ? -4.648  -6.358  -3.152  1.00 0.00 ? 56  THR A HG21 1  
ATOM 900   H HG22 . THR A 1 56  ? -4.405  -4.663  -3.575  1.00 0.00 ? 56  THR A HG22 1  
ATOM 901   H HG23 . THR A 1 56  ? -5.409  -5.091  -2.189  1.00 0.00 ? 56  THR A HG23 1  
ATOM 902   N N    . GLN A 1 57  ? -8.101  -5.960  -6.578  1.00 0.00 ? 57  GLN A N    1  
ATOM 903   C CA   . GLN A 1 57  ? -9.100  -5.478  -7.571  1.00 0.00 ? 57  GLN A CA   1  
ATOM 904   C C    . GLN A 1 57  ? -9.479  -4.033  -7.244  1.00 0.00 ? 57  GLN A C    1  
ATOM 905   O O    . GLN A 1 57  ? -9.695  -3.223  -8.124  1.00 0.00 ? 57  GLN A O    1  
ATOM 906   C CB   . GLN A 1 57  ? -10.348 -6.361  -7.512  1.00 0.00 ? 57  GLN A CB   1  
ATOM 907   C CG   . GLN A 1 57  ? -10.298 -7.394  -8.641  1.00 0.00 ? 57  GLN A CG   1  
ATOM 908   C CD   . GLN A 1 57  ? -11.676 -8.035  -8.810  1.00 0.00 ? 57  GLN A CD   1  
ATOM 909   O OE1  . GLN A 1 57  ? -12.673 -7.479  -8.393  1.00 0.00 ? 57  GLN A OE1  1  
ATOM 910   N NE2  . GLN A 1 57  ? -11.777 -9.190  -9.409  1.00 0.00 ? 57  GLN A NE2  1  
ATOM 911   H H    . GLN A 1 57  ? -8.331  -6.691  -5.967  1.00 0.00 ? 57  GLN A H    1  
ATOM 912   H HA   . GLN A 1 57  ? -8.673  -5.523  -8.562  1.00 0.00 ? 57  GLN A HA   1  
ATOM 913   H HB2  . GLN A 1 57  ? -10.384 -6.869  -6.559  1.00 0.00 ? 57  GLN A HB2  1  
ATOM 914   H HB3  . GLN A 1 57  ? -11.229 -5.748  -7.627  1.00 0.00 ? 57  GLN A HB3  1  
ATOM 915   H HG2  . GLN A 1 57  ? -10.010 -6.907  -9.562  1.00 0.00 ? 57  GLN A HG2  1  
ATOM 916   H HG3  . GLN A 1 57  ? -9.576  -8.159  -8.397  1.00 0.00 ? 57  GLN A HG3  1  
ATOM 917   H HE21 . GLN A 1 57  ? -10.973 -9.639  -9.745  1.00 0.00 ? 57  GLN A HE21 1  
ATOM 918   H HE22 . GLN A 1 57  ? -12.655 -9.608  -9.522  1.00 0.00 ? 57  GLN A HE22 1  
ATOM 919   N N    . TYR A 1 58  ? -9.558  -3.701  -5.984  1.00 0.00 ? 58  TYR A N    1  
ATOM 920   C CA   . TYR A 1 58  ? -9.917  -2.306  -5.604  1.00 0.00 ? 58  TYR A CA   1  
ATOM 921   C C    . TYR A 1 58  ? -8.789  -1.365  -6.044  1.00 0.00 ? 58  TYR A C    1  
ATOM 922   O O    . TYR A 1 58  ? -8.963  -0.164  -6.115  1.00 0.00 ? 58  TYR A O    1  
ATOM 923   C CB   . TYR A 1 58  ? -10.124 -2.231  -4.080  1.00 0.00 ? 58  TYR A CB   1  
ATOM 924   C CG   . TYR A 1 58  ? -9.831  -0.835  -3.577  1.00 0.00 ? 58  TYR A CG   1  
ATOM 925   C CD1  . TYR A 1 58  ? -10.782 0.182   -3.724  1.00 0.00 ? 58  TYR A CD1  1  
ATOM 926   C CD2  . TYR A 1 58  ? -8.604  -0.562  -2.964  1.00 0.00 ? 58  TYR A CD2  1  
ATOM 927   C CE1  . TYR A 1 58  ? -10.503 1.472   -3.257  1.00 0.00 ? 58  TYR A CE1  1  
ATOM 928   C CE2  . TYR A 1 58  ? -8.326  0.726   -2.497  1.00 0.00 ? 58  TYR A CE2  1  
ATOM 929   C CZ   . TYR A 1 58  ? -9.274  1.742   -2.643  1.00 0.00 ? 58  TYR A CZ   1  
ATOM 930   O OH   . TYR A 1 58  ? -8.999  3.010   -2.182  1.00 0.00 ? 58  TYR A OH   1  
ATOM 931   H H    . TYR A 1 58  ? -9.376  -4.368  -5.289  1.00 0.00 ? 58  TYR A H    1  
ATOM 932   H HA   . TYR A 1 58  ? -10.832 -2.025  -6.105  1.00 0.00 ? 58  TYR A HA   1  
ATOM 933   H HB2  . TYR A 1 58  ? -11.146 -2.486  -3.846  1.00 0.00 ? 58  TYR A HB2  1  
ATOM 934   H HB3  . TYR A 1 58  ? -9.462  -2.930  -3.592  1.00 0.00 ? 58  TYR A HB3  1  
ATOM 935   H HD1  . TYR A 1 58  ? -11.730 -0.029  -4.198  1.00 0.00 ? 58  TYR A HD1  1  
ATOM 936   H HD2  . TYR A 1 58  ? -7.872  -1.347  -2.852  1.00 0.00 ? 58  TYR A HD2  1  
ATOM 937   H HE1  . TYR A 1 58  ? -11.233 2.259   -3.370  1.00 0.00 ? 58  TYR A HE1  1  
ATOM 938   H HE2  . TYR A 1 58  ? -7.378  0.935   -2.024  1.00 0.00 ? 58  TYR A HE2  1  
ATOM 939   H HH   . TYR A 1 58  ? -8.087  3.025   -1.880  1.00 0.00 ? 58  TYR A HH   1  
ATOM 940   N N    . SER A 1 59  ? -7.637  -1.900  -6.343  1.00 0.00 ? 59  SER A N    1  
ATOM 941   C CA   . SER A 1 59  ? -6.506  -1.035  -6.781  1.00 0.00 ? 59  SER A CA   1  
ATOM 942   C C    . SER A 1 59  ? -6.804  -0.485  -8.177  1.00 0.00 ? 59  SER A C    1  
ATOM 943   O O    . SER A 1 59  ? -6.301  0.549   -8.568  1.00 0.00 ? 59  SER A O    1  
ATOM 944   C CB   . SER A 1 59  ? -5.218  -1.858  -6.819  1.00 0.00 ? 59  SER A CB   1  
ATOM 945   O OG   . SER A 1 59  ? -4.959  -2.384  -5.524  1.00 0.00 ? 59  SER A OG   1  
ATOM 946   H H    . SER A 1 59  ? -7.517  -2.871  -6.282  1.00 0.00 ? 59  SER A H    1  
ATOM 947   H HA   . SER A 1 59  ? -6.390  -0.214  -6.088  1.00 0.00 ? 59  SER A HA   1  
ATOM 948   H HB2  . SER A 1 59  ? -5.329  -2.672  -7.516  1.00 0.00 ? 59  SER A HB2  1  
ATOM 949   H HB3  . SER A 1 59  ? -4.398  -1.227  -7.134  1.00 0.00 ? 59  SER A HB3  1  
ATOM 950   H HG   . SER A 1 59  ? -5.354  -1.793  -4.879  1.00 0.00 ? 59  SER A HG   1  
ATOM 951   N N    . LYS A 1 60  ? -7.622  -1.169  -8.931  1.00 0.00 ? 60  LYS A N    1  
ATOM 952   C CA   . LYS A 1 60  ? -7.955  -0.684  -10.300 1.00 0.00 ? 60  LYS A CA   1  
ATOM 953   C C    . LYS A 1 60  ? -9.264  0.107   -10.253 1.00 0.00 ? 60  LYS A C    1  
ATOM 954   O O    . LYS A 1 60  ? -9.488  1.003   -11.043 1.00 0.00 ? 60  LYS A O    1  
ATOM 955   C CB   . LYS A 1 60  ? -8.113  -1.878  -11.243 1.00 0.00 ? 60  LYS A CB   1  
ATOM 956   C CG   . LYS A 1 60  ? -9.104  -2.877  -10.644 1.00 0.00 ? 60  LYS A CG   1  
ATOM 957   C CD   . LYS A 1 60  ? -9.680  -3.755  -11.757 1.00 0.00 ? 60  LYS A CD   1  
ATOM 958   C CE   . LYS A 1 60  ? -8.997  -5.124  -11.732 1.00 0.00 ? 60  LYS A CE   1  
ATOM 959   N NZ   . LYS A 1 60  ? -9.765  -6.078  -12.582 1.00 0.00 ? 60  LYS A NZ   1  
ATOM 960   H H    . LYS A 1 60  ? -8.019  -2.000  -8.596  1.00 0.00 ? 60  LYS A H    1  
ATOM 961   H HA   . LYS A 1 60  ? -7.162  -0.045  -10.658 1.00 0.00 ? 60  LYS A HA   1  
ATOM 962   H HB2  . LYS A 1 60  ? -8.480  -1.535  -12.200 1.00 0.00 ? 60  LYS A HB2  1  
ATOM 963   H HB3  . LYS A 1 60  ? -7.156  -2.360  -11.377 1.00 0.00 ? 60  LYS A HB3  1  
ATOM 964   H HG2  . LYS A 1 60  ? -8.596  -3.498  -9.920  1.00 0.00 ? 60  LYS A HG2  1  
ATOM 965   H HG3  . LYS A 1 60  ? -9.907  -2.341  -10.159 1.00 0.00 ? 60  LYS A HG3  1  
ATOM 966   H HD2  . LYS A 1 60  ? -10.742 -3.878  -11.605 1.00 0.00 ? 60  LYS A HD2  1  
ATOM 967   H HD3  . LYS A 1 60  ? -9.504  -3.285  -12.713 1.00 0.00 ? 60  LYS A HD3  1  
ATOM 968   H HE2  . LYS A 1 60  ? -7.991  -5.031  -12.114 1.00 0.00 ? 60  LYS A HE2  1  
ATOM 969   H HE3  . LYS A 1 60  ? -8.965  -5.491  -10.717 1.00 0.00 ? 60  LYS A HE3  1  
ATOM 970   H HZ1  . LYS A 1 60  ? -9.819  -5.709  -13.554 1.00 0.00 ? 60  LYS A HZ1  1  
ATOM 971   H HZ2  . LYS A 1 60  ? -9.286  -7.000  -12.587 1.00 0.00 ? 60  LYS A HZ2  1  
ATOM 972   H HZ3  . LYS A 1 60  ? -10.724 -6.190  -12.198 1.00 0.00 ? 60  LYS A HZ3  1  
ATOM 973   N N    . VAL A 1 61  ? -10.130 -0.214  -9.330  1.00 0.00 ? 61  VAL A N    1  
ATOM 974   C CA   . VAL A 1 61  ? -11.419 0.521   -9.228  1.00 0.00 ? 61  VAL A CA   1  
ATOM 975   C C    . VAL A 1 61  ? -11.146 1.940   -8.722  1.00 0.00 ? 61  VAL A C    1  
ATOM 976   O O    . VAL A 1 61  ? -11.580 2.910   -9.308  1.00 0.00 ? 61  VAL A O    1  
ATOM 977   C CB   . VAL A 1 61  ? -12.343 -0.221  -8.255  1.00 0.00 ? 61  VAL A CB   1  
ATOM 978   C CG1  . VAL A 1 61  ? -13.451 0.714   -7.767  1.00 0.00 ? 61  VAL A CG1  1  
ATOM 979   C CG2  . VAL A 1 61  ? -12.969 -1.418  -8.971  1.00 0.00 ? 61  VAL A CG2  1  
ATOM 980   H H    . VAL A 1 61  ? -9.930  -0.937  -8.700  1.00 0.00 ? 61  VAL A H    1  
ATOM 981   H HA   . VAL A 1 61  ? -11.885 0.569   -10.202 1.00 0.00 ? 61  VAL A HA   1  
ATOM 982   H HB   . VAL A 1 61  ? -11.768 -0.568  -7.408  1.00 0.00 ? 61  VAL A HB   1  
ATOM 983   H HG11 . VAL A 1 61  ? -13.435 1.624   -8.347  1.00 0.00 ? 61  VAL A HG11 1  
ATOM 984   H HG12 . VAL A 1 61  ? -14.409 0.228   -7.885  1.00 0.00 ? 61  VAL A HG12 1  
ATOM 985   H HG13 . VAL A 1 61  ? -13.292 0.947   -6.725  1.00 0.00 ? 61  VAL A HG13 1  
ATOM 986   H HG21 . VAL A 1 61  ? -12.871 -1.288  -10.038 1.00 0.00 ? 61  VAL A HG21 1  
ATOM 987   H HG22 . VAL A 1 61  ? -12.463 -2.324  -8.672  1.00 0.00 ? 61  VAL A HG22 1  
ATOM 988   H HG23 . VAL A 1 61  ? -14.016 -1.488  -8.712  1.00 0.00 ? 61  VAL A HG23 1  
ATOM 989   N N    . LEU A 1 62  ? -10.422 2.066   -7.643  1.00 0.00 ? 62  LEU A N    1  
ATOM 990   C CA   . LEU A 1 62  ? -10.114 3.422   -7.107  1.00 0.00 ? 62  LEU A CA   1  
ATOM 991   C C    . LEU A 1 62  ? -9.116  4.111   -8.044  1.00 0.00 ? 62  LEU A C    1  
ATOM 992   O O    . LEU A 1 62  ? -9.230  5.286   -8.328  1.00 0.00 ? 62  LEU A O    1  
ATOM 993   C CB   . LEU A 1 62  ? -9.513  3.283   -5.702  1.00 0.00 ? 62  LEU A CB   1  
ATOM 994   C CG   . LEU A 1 62  ? -8.889  4.608   -5.243  1.00 0.00 ? 62  LEU A CG   1  
ATOM 995   C CD1  . LEU A 1 62  ? -9.925  5.448   -4.490  1.00 0.00 ? 62  LEU A CD1  1  
ATOM 996   C CD2  . LEU A 1 62  ? -7.715  4.302   -4.316  1.00 0.00 ? 62  LEU A CD2  1  
ATOM 997   H H    . LEU A 1 62  ? -10.077 1.270   -7.189  1.00 0.00 ? 62  LEU A H    1  
ATOM 998   H HA   . LEU A 1 62  ? -11.023 4.004   -7.057  1.00 0.00 ? 62  LEU A HA   1  
ATOM 999   H HB2  . LEU A 1 62  ? -10.292 2.999   -5.010  1.00 0.00 ? 62  LEU A HB2  1  
ATOM 1000  H HB3  . LEU A 1 62  ? -8.752  2.517   -5.714  1.00 0.00 ? 62  LEU A HB3  1  
ATOM 1001  H HG   . LEU A 1 62  ? -8.535  5.161   -6.099  1.00 0.00 ? 62  LEU A HG   1  
ATOM 1002  H HD11 . LEU A 1 62  ? -10.918 5.157   -4.795  1.00 0.00 ? 62  LEU A HD11 1  
ATOM 1003  H HD12 . LEU A 1 62  ? -9.814  5.289   -3.426  1.00 0.00 ? 62  LEU A HD12 1  
ATOM 1004  H HD13 . LEU A 1 62  ? -9.772  6.494   -4.713  1.00 0.00 ? 62  LEU A HD13 1  
ATOM 1005  H HD21 . LEU A 1 62  ? -7.845  3.323   -3.882  1.00 0.00 ? 62  LEU A HD21 1  
ATOM 1006  H HD22 . LEU A 1 62  ? -6.800  4.322   -4.884  1.00 0.00 ? 62  LEU A HD22 1  
ATOM 1007  H HD23 . LEU A 1 62  ? -7.671  5.043   -3.532  1.00 0.00 ? 62  LEU A HD23 1  
ATOM 1008  N N    . ALA A 1 63  ? -8.141  3.388   -8.532  1.00 0.00 ? 63  ALA A N    1  
ATOM 1009  C CA   . ALA A 1 63  ? -7.149  4.011   -9.455  1.00 0.00 ? 63  ALA A CA   1  
ATOM 1010  C C    . ALA A 1 63  ? -7.901  4.856   -10.486 1.00 0.00 ? 63  ALA A C    1  
ATOM 1011  O O    . ALA A 1 63  ? -7.532  5.977   -10.776 1.00 0.00 ? 63  ALA A O    1  
ATOM 1012  C CB   . ALA A 1 63  ? -6.347  2.915   -10.165 1.00 0.00 ? 63  ALA A CB   1  
ATOM 1013  H H    . ALA A 1 63  ? -8.066  2.440   -8.297  1.00 0.00 ? 63  ALA A H    1  
ATOM 1014  H HA   . ALA A 1 63  ? -6.479  4.643   -8.892  1.00 0.00 ? 63  ALA A HA   1  
ATOM 1015  H HB1  . ALA A 1 63  ? -6.991  2.073   -10.372 1.00 0.00 ? 63  ALA A HB1  1  
ATOM 1016  H HB2  . ALA A 1 63  ? -5.950  3.301   -11.093 1.00 0.00 ? 63  ALA A HB2  1  
ATOM 1017  H HB3  . ALA A 1 63  ? -5.532  2.597   -9.531  1.00 0.00 ? 63  ALA A HB3  1  
ATOM 1018  N N    . LEU A 1 64  ? -8.966  4.328   -11.027 1.00 0.00 ? 64  LEU A N    1  
ATOM 1019  C CA   . LEU A 1 64  ? -9.763  5.098   -12.024 1.00 0.00 ? 64  LEU A CA   1  
ATOM 1020  C C    . LEU A 1 64  ? -10.600 6.134   -11.280 1.00 0.00 ? 64  LEU A C    1  
ATOM 1021  O O    . LEU A 1 64  ? -10.757 7.254   -11.714 1.00 0.00 ? 64  LEU A O    1  
ATOM 1022  C CB   . LEU A 1 64  ? -10.696 4.144   -12.772 1.00 0.00 ? 64  LEU A CB   1  
ATOM 1023  C CG   . LEU A 1 64  ? -9.874  3.262   -13.704 1.00 0.00 ? 64  LEU A CG   1  
ATOM 1024  C CD1  . LEU A 1 64  ? -10.624 1.955   -13.966 1.00 0.00 ? 64  LEU A CD1  1  
ATOM 1025  C CD2  . LEU A 1 64  ? -9.647  3.994   -15.028 1.00 0.00 ? 64  LEU A CD2  1  
ATOM 1026  H H    . LEU A 1 64  ? -9.250  3.428   -10.766 1.00 0.00 ? 64  LEU A H    1  
ATOM 1027  H HA   . LEU A 1 64  ? -9.103  5.593   -12.724 1.00 0.00 ? 64  LEU A HA   1  
ATOM 1028  H HB2  . LEU A 1 64  ? -11.219 3.522   -12.060 1.00 0.00 ? 64  LEU A HB2  1  
ATOM 1029  H HB3  . LEU A 1 64  ? -11.410 4.711   -13.349 1.00 0.00 ? 64  LEU A HB3  1  
ATOM 1030  H HG   . LEU A 1 64  ? -8.925  3.047   -13.239 1.00 0.00 ? 64  LEU A HG   1  
ATOM 1031  H HD11 . LEU A 1 64  ? -11.608 2.176   -14.352 1.00 0.00 ? 64  LEU A HD11 1  
ATOM 1032  H HD12 . LEU A 1 64  ? -10.079 1.366   -14.688 1.00 0.00 ? 64  LEU A HD12 1  
ATOM 1033  H HD13 . LEU A 1 64  ? -10.714 1.402   -13.044 1.00 0.00 ? 64  LEU A HD13 1  
ATOM 1034  H HD21 . LEU A 1 64  ? -9.349  5.013   -14.829 1.00 0.00 ? 64  LEU A HD21 1  
ATOM 1035  H HD22 . LEU A 1 64  ? -8.870  3.495   -15.588 1.00 0.00 ? 64  LEU A HD22 1  
ATOM 1036  H HD23 . LEU A 1 64  ? -10.562 3.992   -15.603 1.00 0.00 ? 64  LEU A HD23 1  
ATOM 1037  N N    . TYR A 1 65  ? -11.135 5.757   -10.156 1.00 0.00 ? 65  TYR A N    1  
ATOM 1038  C CA   . TYR A 1 65  ? -11.965 6.706   -9.362  1.00 0.00 ? 65  TYR A CA   1  
ATOM 1039  C C    . TYR A 1 65  ? -11.247 8.055   -9.271  1.00 0.00 ? 65  TYR A C    1  
ATOM 1040  O O    . TYR A 1 65  ? -11.866 9.100   -9.239  1.00 0.00 ? 65  TYR A O    1  
ATOM 1041  C CB   . TYR A 1 65  ? -12.168 6.133   -7.958  1.00 0.00 ? 65  TYR A CB   1  
ATOM 1042  C CG   . TYR A 1 65  ? -12.939 7.115   -7.115  1.00 0.00 ? 65  TYR A CG   1  
ATOM 1043  C CD1  . TYR A 1 65  ? -14.340 7.117   -7.146  1.00 0.00 ? 65  TYR A CD1  1  
ATOM 1044  C CD2  . TYR A 1 65  ? -12.253 8.021   -6.297  1.00 0.00 ? 65  TYR A CD2  1  
ATOM 1045  C CE1  . TYR A 1 65  ? -15.053 8.028   -6.357  1.00 0.00 ? 65  TYR A CE1  1  
ATOM 1046  C CE2  . TYR A 1 65  ? -12.967 8.930   -5.509  1.00 0.00 ? 65  TYR A CE2  1  
ATOM 1047  C CZ   . TYR A 1 65  ? -14.367 8.933   -5.539  1.00 0.00 ? 65  TYR A CZ   1  
ATOM 1048  O OH   . TYR A 1 65  ? -15.070 9.830   -4.761  1.00 0.00 ? 65  TYR A OH   1  
ATOM 1049  H H    . TYR A 1 65  ? -10.988 4.845   -9.831  1.00 0.00 ? 65  TYR A H    1  
ATOM 1050  H HA   . TYR A 1 65  ? -12.923 6.837   -9.841  1.00 0.00 ? 65  TYR A HA   1  
ATOM 1051  H HB2  . TYR A 1 65  ? -12.719 5.206   -8.025  1.00 0.00 ? 65  TYR A HB2  1  
ATOM 1052  H HB3  . TYR A 1 65  ? -11.206 5.947   -7.504  1.00 0.00 ? 65  TYR A HB3  1  
ATOM 1053  H HD1  . TYR A 1 65  ? -14.870 6.417   -7.782  1.00 0.00 ? 65  TYR A HD1  1  
ATOM 1054  H HD2  . TYR A 1 65  ? -11.172 8.017   -6.273  1.00 0.00 ? 65  TYR A HD2  1  
ATOM 1055  H HE1  . TYR A 1 65  ? -16.132 8.031   -6.377  1.00 0.00 ? 65  TYR A HE1  1  
ATOM 1056  H HE2  . TYR A 1 65  ? -12.439 9.629   -4.878  1.00 0.00 ? 65  TYR A HE2  1  
ATOM 1057  H HH   . TYR A 1 65  ? -16.000 9.752   -4.986  1.00 0.00 ? 65  TYR A HH   1  
ATOM 1058  N N    . ASN A 1 66  ? -9.943  8.037   -9.234  1.00 0.00 ? 66  ASN A N    1  
ATOM 1059  C CA   . ASN A 1 66  ? -9.171  9.309   -9.152  1.00 0.00 ? 66  ASN A CA   1  
ATOM 1060  C C    . ASN A 1 66  ? -8.826  9.776   -10.562 1.00 0.00 ? 66  ASN A C    1  
ATOM 1061  O O    . ASN A 1 66  ? -9.016  10.921  -10.921 1.00 0.00 ? 66  ASN A O    1  
ATOM 1062  C CB   . ASN A 1 66  ? -7.873  9.048   -8.405  1.00 0.00 ? 66  ASN A CB   1  
ATOM 1063  C CG   . ASN A 1 66  ? -7.438  10.314  -7.663  1.00 0.00 ? 66  ASN A CG   1  
ATOM 1064  O OD1  . ASN A 1 66  ? -7.804  10.520  -6.523  1.00 0.00 ? 66  ASN A OD1  1  
ATOM 1065  N ND2  . ASN A 1 66  ? -6.667  11.176  -8.267  1.00 0.00 ? 66  ASN A ND2  1  
ATOM 1066  H H    . ASN A 1 66  ? -9.466  7.182   -9.265  1.00 0.00 ? 66  ASN A H    1  
ATOM 1067  H HA   . ASN A 1 66  ? -9.748  10.063  -8.639  1.00 0.00 ? 66  ASN A HA   1  
ATOM 1068  H HB2  . ASN A 1 66  ? -8.019  8.243   -7.701  1.00 0.00 ? 66  ASN A HB2  1  
ATOM 1069  H HB3  . ASN A 1 66  ? -7.115  8.770   -9.118  1.00 0.00 ? 66  ASN A HB3  1  
ATOM 1070  H HD21 . ASN A 1 66  ? -6.371  11.010  -9.186  1.00 0.00 ? 66  ASN A HD21 1  
ATOM 1071  H HD22 . ASN A 1 66  ? -6.382  11.990  -7.800  1.00 0.00 ? 66  ASN A HD22 1  
ATOM 1072  N N    . GLN A 1 67  ? -8.316  8.882   -11.362 1.00 0.00 ? 67  GLN A N    1  
ATOM 1073  C CA   . GLN A 1 67  ? -7.944  9.236   -12.761 1.00 0.00 ? 67  GLN A CA   1  
ATOM 1074  C C    . GLN A 1 67  ? -9.141  9.858   -13.481 1.00 0.00 ? 67  GLN A C    1  
ATOM 1075  O O    . GLN A 1 67  ? -9.007  10.452  -14.532 1.00 0.00 ? 67  GLN A O    1  
ATOM 1076  C CB   . GLN A 1 67  ? -7.509  7.968   -13.498 1.00 0.00 ? 67  GLN A CB   1  
ATOM 1077  C CG   . GLN A 1 67  ? -6.001  7.770   -13.335 1.00 0.00 ? 67  GLN A CG   1  
ATOM 1078  C CD   . GLN A 1 67  ? -5.257  8.905   -14.041 1.00 0.00 ? 67  GLN A CD   1  
ATOM 1079  O OE1  . GLN A 1 67  ? -4.582  9.692   -13.407 1.00 0.00 ? 67  GLN A OE1  1  
ATOM 1080  N NE2  . GLN A 1 67  ? -5.352  9.024   -15.337 1.00 0.00 ? 67  GLN A NE2  1  
ATOM 1081  H H    . GLN A 1 67  ? -8.175  7.967   -11.037 1.00 0.00 ? 67  GLN A H    1  
ATOM 1082  H HA   . GLN A 1 67  ? -7.131  9.941   -12.747 1.00 0.00 ? 67  GLN A HA   1  
ATOM 1083  H HB2  . GLN A 1 67  ? -8.031  7.118   -13.083 1.00 0.00 ? 67  GLN A HB2  1  
ATOM 1084  H HB3  . GLN A 1 67  ? -7.748  8.058   -14.546 1.00 0.00 ? 67  GLN A HB3  1  
ATOM 1085  H HG2  . GLN A 1 67  ? -5.749  7.773   -12.284 1.00 0.00 ? 67  GLN A HG2  1  
ATOM 1086  H HG3  . GLN A 1 67  ? -5.712  6.827   -13.772 1.00 0.00 ? 67  GLN A HG3  1  
ATOM 1087  H HE21 . GLN A 1 67  ? -5.896  8.390   -15.849 1.00 0.00 ? 67  GLN A HE21 1  
ATOM 1088  H HE22 . GLN A 1 67  ? -4.879  9.748   -15.799 1.00 0.00 ? 67  GLN A HE22 1  
ATOM 1089  N N    . HIS A 1 68  ? -10.307 9.723   -12.925 1.00 0.00 ? 68  HIS A N    1  
ATOM 1090  C CA   . HIS A 1 68  ? -11.516 10.303  -13.577 1.00 0.00 ? 68  HIS A CA   1  
ATOM 1091  C C    . HIS A 1 68  ? -11.756 11.721  -13.051 1.00 0.00 ? 68  HIS A C    1  
ATOM 1092  O O    . HIS A 1 68  ? -12.027 12.634  -13.806 1.00 0.00 ? 68  HIS A O    1  
ATOM 1093  C CB   . HIS A 1 68  ? -12.737 9.432   -13.267 1.00 0.00 ? 68  HIS A CB   1  
ATOM 1094  C CG   . HIS A 1 68  ? -12.887 8.378   -14.329 1.00 0.00 ? 68  HIS A CG   1  
ATOM 1095  N ND1  . HIS A 1 68  ? -12.347 7.108   -14.199 1.00 0.00 ? 68  HIS A ND1  1  
ATOM 1096  C CD2  . HIS A 1 68  ? -13.521 8.394   -15.544 1.00 0.00 ? 68  HIS A CD2  1  
ATOM 1097  C CE1  . HIS A 1 68  ? -12.664 6.418   -15.310 1.00 0.00 ? 68  HIS A CE1  1  
ATOM 1098  N NE2  . HIS A 1 68  ? -13.380 7.156   -16.164 1.00 0.00 ? 68  HIS A NE2  1  
ATOM 1099  H H    . HIS A 1 68  ? -10.388 9.240   -12.080 1.00 0.00 ? 68  HIS A H    1  
ATOM 1100  H HA   . HIS A 1 68  ? -11.364 10.339  -14.645 1.00 0.00 ? 68  HIS A HA   1  
ATOM 1101  H HB2  . HIS A 1 68  ? -12.608 8.959   -12.304 1.00 0.00 ? 68  HIS A HB2  1  
ATOM 1102  H HB3  . HIS A 1 68  ? -13.623 10.049  -13.251 1.00 0.00 ? 68  HIS A HB3  1  
ATOM 1103  H HD1  . HIS A 1 68  ? -11.830 6.773   -13.439 1.00 0.00 ? 68  HIS A HD1  1  
ATOM 1104  H HD2  . HIS A 1 68  ? -14.051 9.240   -15.953 1.00 0.00 ? 68  HIS A HD2  1  
ATOM 1105  H HE1  . HIS A 1 68  ? -12.376 5.392   -15.489 1.00 0.00 ? 68  HIS A HE1  1  
ATOM 1106  N N    . ASN A 1 69  ? -11.659 11.915  -11.764 1.00 0.00 ? 69  ASN A N    1  
ATOM 1107  C CA   . ASN A 1 69  ? -11.883 13.276  -11.198 1.00 0.00 ? 69  ASN A CA   1  
ATOM 1108  C C    . ASN A 1 69  ? -10.531 13.913  -10.847 1.00 0.00 ? 69  ASN A C    1  
ATOM 1109  O O    . ASN A 1 69  ? -9.783  13.366  -10.060 1.00 0.00 ? 69  ASN A O    1  
ATOM 1110  C CB   . ASN A 1 69  ? -12.732 13.165  -9.929  1.00 0.00 ? 69  ASN A CB   1  
ATOM 1111  C CG   . ASN A 1 69  ? -14.213 13.085  -10.307 1.00 0.00 ? 69  ASN A CG   1  
ATOM 1112  O OD1  . ASN A 1 69  ? -14.968 14.001  -10.047 1.00 0.00 ? 69  ASN A OD1  1  
ATOM 1113  N ND2  . ASN A 1 69  ? -14.663 12.021  -10.915 1.00 0.00 ? 69  ASN A ND2  1  
ATOM 1114  H H    . ASN A 1 69  ? -11.440 11.167  -11.170 1.00 0.00 ? 69  ASN A H    1  
ATOM 1115  H HA   . ASN A 1 69  ? -12.401 13.883  -11.922 1.00 0.00 ? 69  ASN A HA   1  
ATOM 1116  H HB2  . ASN A 1 69  ? -12.450 12.275  -9.384  1.00 0.00 ? 69  ASN A HB2  1  
ATOM 1117  H HB3  . ASN A 1 69  ? -12.568 14.033  -9.308  1.00 0.00 ? 69  ASN A HB3  1  
ATOM 1118  H HD21 . ASN A 1 69  ? -14.055 11.282  -11.124 1.00 0.00 ? 69  ASN A HD21 1  
ATOM 1119  H HD22 . ASN A 1 69  ? -15.610 11.962  -11.161 1.00 0.00 ? 69  ASN A HD22 1  
ATOM 1120  N N    . PRO A 1 70  ? -10.254 15.050  -11.438 1.00 0.00 ? 70  PRO A N    1  
ATOM 1121  C CA   . PRO A 1 70  ? -8.995  15.777  -11.198 1.00 0.00 ? 70  PRO A CA   1  
ATOM 1122  C C    . PRO A 1 70  ? -9.063  16.532  -9.867  1.00 0.00 ? 70  PRO A C    1  
ATOM 1123  O O    . PRO A 1 70  ? -9.791  17.494  -9.726  1.00 0.00 ? 70  PRO A O    1  
ATOM 1124  C CB   . PRO A 1 70  ? -8.914  16.754  -12.374 1.00 0.00 ? 70  PRO A CB   1  
ATOM 1125  C CG   . PRO A 1 70  ? -10.361 16.936  -12.890 1.00 0.00 ? 70  PRO A CG   1  
ATOM 1126  C CD   . PRO A 1 70  ? -11.161 15.716  -12.395 1.00 0.00 ? 70  PRO A CD   1  
ATOM 1127  H HA   . PRO A 1 70  ? -8.153  15.104  -11.217 1.00 0.00 ? 70  PRO A HA   1  
ATOM 1128  H HB2  . PRO A 1 70  ? -8.512  17.701  -12.041 1.00 0.00 ? 70  PRO A HB2  1  
ATOM 1129  H HB3  . PRO A 1 70  ? -8.298  16.342  -13.158 1.00 0.00 ? 70  PRO A HB3  1  
ATOM 1130  H HG2  . PRO A 1 70  ? -10.784 17.847  -12.488 1.00 0.00 ? 70  PRO A HG2  1  
ATOM 1131  H HG3  . PRO A 1 70  ? -10.371 16.965  -13.968 1.00 0.00 ? 70  PRO A HG3  1  
ATOM 1132  H HD2  . PRO A 1 70  ? -12.069 16.035  -11.901 1.00 0.00 ? 70  PRO A HD2  1  
ATOM 1133  H HD3  . PRO A 1 70  ? -11.388 15.054  -13.216 1.00 0.00 ? 70  PRO A HD3  1  
ATOM 1134  N N    . GLY A 1 71  ? -8.311  16.104  -8.891  1.00 0.00 ? 71  GLY A N    1  
ATOM 1135  C CA   . GLY A 1 71  ? -8.336  16.799  -7.573  1.00 0.00 ? 71  GLY A CA   1  
ATOM 1136  C C    . GLY A 1 71  ? -8.781  15.820  -6.485  1.00 0.00 ? 71  GLY A C    1  
ATOM 1137  O O    . GLY A 1 71  ? -8.846  16.160  -5.320  1.00 0.00 ? 71  GLY A O    1  
ATOM 1138  H H    . GLY A 1 71  ? -7.730  15.326  -9.024  1.00 0.00 ? 71  GLY A H    1  
ATOM 1139  H HA2  . GLY A 1 71  ? -7.347  17.170  -7.343  1.00 0.00 ? 71  GLY A HA2  1  
ATOM 1140  H HA3  . GLY A 1 71  ? -9.030  17.625  -7.614  1.00 0.00 ? 71  GLY A HA3  1  
ATOM 1141  N N    . ALA A 1 72  ? -9.083  14.604  -6.852  1.00 0.00 ? 72  ALA A N    1  
ATOM 1142  C CA   . ALA A 1 72  ? -9.517  13.608  -5.842  1.00 0.00 ? 72  ALA A CA   1  
ATOM 1143  C C    . ALA A 1 72  ? -8.301  13.129  -5.061  1.00 0.00 ? 72  ALA A C    1  
ATOM 1144  O O    . ALA A 1 72  ? -7.345  12.623  -5.614  1.00 0.00 ? 72  ALA A O    1  
ATOM 1145  C CB   . ALA A 1 72  ? -10.175 12.418  -6.535  1.00 0.00 ? 72  ALA A CB   1  
ATOM 1146  H H    . ALA A 1 72  ? -9.022  14.347  -7.788  1.00 0.00 ? 72  ALA A H    1  
ATOM 1147  H HA   . ALA A 1 72  ? -10.223 14.066  -5.164  1.00 0.00 ? 72  ALA A HA   1  
ATOM 1148  H HB1  . ALA A 1 72  ? -9.538  12.071  -7.334  1.00 0.00 ? 72  ALA A HB1  1  
ATOM 1149  H HB2  . ALA A 1 72  ? -10.321 11.623  -5.818  1.00 0.00 ? 72  ALA A HB2  1  
ATOM 1150  H HB3  . ALA A 1 72  ? -11.129 12.720  -6.938  1.00 0.00 ? 72  ALA A HB3  1  
ATOM 1151  N N    . SER A 1 73  ? -8.334  13.295  -3.778  1.00 0.00 ? 73  SER A N    1  
ATOM 1152  C CA   . SER A 1 73  ? -7.186  12.863  -2.934  1.00 0.00 ? 73  SER A CA   1  
ATOM 1153  C C    . SER A 1 73  ? -7.453  11.465  -2.370  1.00 0.00 ? 73  SER A C    1  
ATOM 1154  O O    . SER A 1 73  ? -6.947  11.103  -1.327  1.00 0.00 ? 73  SER A O    1  
ATOM 1155  C CB   . SER A 1 73  ? -7.006  13.848  -1.780  1.00 0.00 ? 73  SER A CB   1  
ATOM 1156  O OG   . SER A 1 73  ? -5.679  13.749  -1.280  1.00 0.00 ? 73  SER A OG   1  
ATOM 1157  H H    . SER A 1 73  ? -9.118  13.710  -3.372  1.00 0.00 ? 73  SER A H    1  
ATOM 1158  H HA   . SER A 1 73  ? -6.288  12.843  -3.532  1.00 0.00 ? 73  SER A HA   1  
ATOM 1159  H HB2  . SER A 1 73  ? -7.179  14.851  -2.131  1.00 0.00 ? 73  SER A HB2  1  
ATOM 1160  H HB3  . SER A 1 73  ? -7.716  13.615  -0.996  1.00 0.00 ? 73  SER A HB3  1  
ATOM 1161  H HG   . SER A 1 73  ? -5.716  13.313  -0.426  1.00 0.00 ? 73  SER A HG   1  
ATOM 1162  N N    . ALA A 1 74  ? -8.239  10.675  -3.049  1.00 0.00 ? 74  ALA A N    1  
ATOM 1163  C CA   . ALA A 1 74  ? -8.524  9.304   -2.539  1.00 0.00 ? 74  ALA A CA   1  
ATOM 1164  C C    . ALA A 1 74  ? -7.865  8.272   -3.457  1.00 0.00 ? 74  ALA A C    1  
ATOM 1165  O O    . ALA A 1 74  ? -8.218  7.110   -3.455  1.00 0.00 ? 74  ALA A O    1  
ATOM 1166  C CB   . ALA A 1 74  ? -10.037 9.072   -2.497  1.00 0.00 ? 74  ALA A CB   1  
ATOM 1167  H H    . ALA A 1 74  ? -8.638  10.981  -3.890  1.00 0.00 ? 74  ALA A H    1  
ATOM 1168  H HA   . ALA A 1 74  ? -8.117  9.204   -1.545  1.00 0.00 ? 74  ALA A HA   1  
ATOM 1169  H HB1  . ALA A 1 74  ? -10.494 9.510   -3.372  1.00 0.00 ? 74  ALA A HB1  1  
ATOM 1170  H HB2  . ALA A 1 74  ? -10.239 8.011   -2.479  1.00 0.00 ? 74  ALA A HB2  1  
ATOM 1171  H HB3  . ALA A 1 74  ? -10.447 9.531   -1.609  1.00 0.00 ? 74  ALA A HB3  1  
ATOM 1172  N N    . ALA A 1 75  ? -6.904  8.688   -4.234  1.00 0.00 ? 75  ALA A N    1  
ATOM 1173  C CA   . ALA A 1 75  ? -6.212  7.735   -5.148  1.00 0.00 ? 75  ALA A CA   1  
ATOM 1174  C C    . ALA A 1 75  ? -5.735  6.520   -4.342  1.00 0.00 ? 75  ALA A C    1  
ATOM 1175  O O    . ALA A 1 75  ? -6.000  6.428   -3.159  1.00 0.00 ? 75  ALA A O    1  
ATOM 1176  C CB   . ALA A 1 75  ? -5.015  8.441   -5.786  1.00 0.00 ? 75  ALA A CB   1  
ATOM 1177  H H    . ALA A 1 75  ? -6.633  9.628   -4.213  1.00 0.00 ? 75  ALA A H    1  
ATOM 1178  H HA   . ALA A 1 75  ? -6.898  7.413   -5.919  1.00 0.00 ? 75  ALA A HA   1  
ATOM 1179  H HB1  . ALA A 1 75  ? -5.057  9.496   -5.561  1.00 0.00 ? 75  ALA A HB1  1  
ATOM 1180  H HB2  . ALA A 1 75  ? -4.100  8.024   -5.392  1.00 0.00 ? 75  ALA A HB2  1  
ATOM 1181  H HB3  . ALA A 1 75  ? -5.043  8.299   -6.856  1.00 0.00 ? 75  ALA A HB3  1  
ATOM 1182  N N    . PRO A 1 76  ? -5.053  5.617   -5.003  1.00 0.00 ? 76  PRO A N    1  
ATOM 1183  C CA   . PRO A 1 76  ? -4.538  4.392   -4.363  1.00 0.00 ? 76  PRO A CA   1  
ATOM 1184  C C    . PRO A 1 76  ? -3.268  4.697   -3.567  1.00 0.00 ? 76  PRO A C    1  
ATOM 1185  O O    . PRO A 1 76  ? -2.984  5.833   -3.246  1.00 0.00 ? 76  PRO A O    1  
ATOM 1186  C CB   . PRO A 1 76  ? -4.238  3.469   -5.544  1.00 0.00 ? 76  PRO A CB   1  
ATOM 1187  C CG   . PRO A 1 76  ? -4.051  4.385   -6.776  1.00 0.00 ? 76  PRO A CG   1  
ATOM 1188  C CD   . PRO A 1 76  ? -4.733  5.725   -6.442  1.00 0.00 ? 76  PRO A CD   1  
ATOM 1189  H HA   . PRO A 1 76  ? -5.288  3.948   -3.729  1.00 0.00 ? 76  PRO A HA   1  
ATOM 1190  H HB2  . PRO A 1 76  ? -3.334  2.906   -5.354  1.00 0.00 ? 76  PRO A HB2  1  
ATOM 1191  H HB3  . PRO A 1 76  ? -5.066  2.799   -5.712  1.00 0.00 ? 76  PRO A HB3  1  
ATOM 1192  H HG2  . PRO A 1 76  ? -2.997  4.541   -6.961  1.00 0.00 ? 76  PRO A HG2  1  
ATOM 1193  H HG3  . PRO A 1 76  ? -4.518  3.943   -7.641  1.00 0.00 ? 76  PRO A HG3  1  
ATOM 1194  H HD2  . PRO A 1 76  ? -4.050  6.542   -6.623  1.00 0.00 ? 76  PRO A HD2  1  
ATOM 1195  H HD3  . PRO A 1 76  ? -5.637  5.847   -7.018  1.00 0.00 ? 76  PRO A HD3  1  
ATOM 1196  N N    . CYS A 1 77  ? -2.503  3.690   -3.241  1.00 0.00 ? 77  CYS A N    1  
ATOM 1197  C CA   . CYS A 1 77  ? -1.260  3.934   -2.460  1.00 0.00 ? 77  CYS A CA   1  
ATOM 1198  C C    . CYS A 1 77  ? -0.152  2.983   -2.920  1.00 0.00 ? 77  CYS A C    1  
ATOM 1199  O O    . CYS A 1 77  ? -0.052  1.862   -2.461  1.00 0.00 ? 77  CYS A O    1  
ATOM 1200  C CB   . CYS A 1 77  ? -1.542  3.704   -0.974  1.00 0.00 ? 77  CYS A CB   1  
ATOM 1201  S SG   . CYS A 1 77  ? -0.960  5.128   -0.021  1.00 0.00 ? 77  CYS A SG   1  
ATOM 1202  H H    . CYS A 1 77  ? -2.750  2.778   -3.503  1.00 0.00 ? 77  CYS A H    1  
ATOM 1203  H HA   . CYS A 1 77  ? -0.939  4.955   -2.608  1.00 0.00 ? 77  CYS A HA   1  
ATOM 1204  H HB2  . CYS A 1 77  ? -2.604  3.580   -0.824  1.00 0.00 ? 77  CYS A HB2  1  
ATOM 1205  H HB3  . CYS A 1 77  ? -1.026  2.814   -0.643  1.00 0.00 ? 77  CYS A HB3  1  
ATOM 1206  N N    . CYS A 1 78  ? 0.688   3.426   -3.816  1.00 0.00 ? 78  CYS A N    1  
ATOM 1207  C CA   . CYS A 1 78  ? 1.802   2.555   -4.292  1.00 0.00 ? 78  CYS A CA   1  
ATOM 1208  C C    . CYS A 1 78  ? 2.606   2.076   -3.080  1.00 0.00 ? 78  CYS A C    1  
ATOM 1209  O O    . CYS A 1 78  ? 2.833   2.820   -2.147  1.00 0.00 ? 78  CYS A O    1  
ATOM 1210  C CB   . CYS A 1 78  ? 2.706   3.365   -5.220  1.00 0.00 ? 78  CYS A CB   1  
ATOM 1211  S SG   . CYS A 1 78  ? 3.724   2.244   -6.207  1.00 0.00 ? 78  CYS A SG   1  
ATOM 1212  H H    . CYS A 1 78  ? 0.592   4.335   -4.169  1.00 0.00 ? 78  CYS A H    1  
ATOM 1213  H HA   . CYS A 1 78  ? 1.399   1.705   -4.824  1.00 0.00 ? 78  CYS A HA   1  
ATOM 1214  H HB2  . CYS A 1 78  ? 2.097   3.968   -5.876  1.00 0.00 ? 78  CYS A HB2  1  
ATOM 1215  H HB3  . CYS A 1 78  ? 3.343   4.006   -4.631  1.00 0.00 ? 78  CYS A HB3  1  
ATOM 1216  N N    . VAL A 1 79  ? 3.026   0.837   -3.068  1.00 0.00 ? 79  VAL A N    1  
ATOM 1217  C CA   . VAL A 1 79  ? 3.794   0.333   -1.893  1.00 0.00 ? 79  VAL A CA   1  
ATOM 1218  C C    . VAL A 1 79  ? 4.845   -0.694  -2.344  1.00 0.00 ? 79  VAL A C    1  
ATOM 1219  O O    . VAL A 1 79  ? 4.985   -0.949  -3.517  1.00 0.00 ? 79  VAL A O    1  
ATOM 1220  C CB   . VAL A 1 79  ? 2.809   -0.292  -0.889  1.00 0.00 ? 79  VAL A CB   1  
ATOM 1221  C CG1  . VAL A 1 79  ? 1.466   0.418   -0.996  1.00 0.00 ? 79  VAL A CG1  1  
ATOM 1222  C CG2  . VAL A 1 79  ? 2.598   -1.780  -1.189  1.00 0.00 ? 79  VAL A CG2  1  
ATOM 1223  H H    . VAL A 1 79  ? 2.829   0.244   -3.816  1.00 0.00 ? 79  VAL A H    1  
ATOM 1224  H HA   . VAL A 1 79  ? 4.294   1.163   -1.429  1.00 0.00 ? 79  VAL A HA   1  
ATOM 1225  H HB   . VAL A 1 79  ? 3.189   -0.171  0.113   1.00 0.00 ? 79  VAL A HB   1  
ATOM 1226  H HG11 . VAL A 1 79  ? 1.626   1.483   -1.056  1.00 0.00 ? 79  VAL A HG11 1  
ATOM 1227  H HG12 . VAL A 1 79  ? 0.952   0.080   -1.885  1.00 0.00 ? 79  VAL A HG12 1  
ATOM 1228  H HG13 . VAL A 1 79  ? 0.874   0.191   -0.127  1.00 0.00 ? 79  VAL A HG13 1  
ATOM 1229  H HG21 . VAL A 1 79  ? 2.694   -1.950  -2.251  1.00 0.00 ? 79  VAL A HG21 1  
ATOM 1230  H HG22 . VAL A 1 79  ? 3.336   -2.364  -0.661  1.00 0.00 ? 79  VAL A HG22 1  
ATOM 1231  H HG23 . VAL A 1 79  ? 1.608   -2.073  -0.867  1.00 0.00 ? 79  VAL A HG23 1  
ATOM 1232  N N    . PRO A 1 80  ? 5.557   -1.248  -1.392  1.00 0.00 ? 80  PRO A N    1  
ATOM 1233  C CA   . PRO A 1 80  ? 6.605   -2.247  -1.660  1.00 0.00 ? 80  PRO A CA   1  
ATOM 1234  C C    . PRO A 1 80  ? 5.985   -3.641  -1.809  1.00 0.00 ? 80  PRO A C    1  
ATOM 1235  O O    . PRO A 1 80  ? 5.675   -4.298  -0.836  1.00 0.00 ? 80  PRO A O    1  
ATOM 1236  C CB   . PRO A 1 80  ? 7.485   -2.181  -0.411  1.00 0.00 ? 80  PRO A CB   1  
ATOM 1237  C CG   . PRO A 1 80  ? 6.601   -1.596  0.717   1.00 0.00 ? 80  PRO A CG   1  
ATOM 1238  C CD   . PRO A 1 80  ? 5.392   -0.927  0.037   1.00 0.00 ? 80  PRO A CD   1  
ATOM 1239  H HA   . PRO A 1 80  ? 7.179   -1.984  -2.532  1.00 0.00 ? 80  PRO A HA   1  
ATOM 1240  H HB2  . PRO A 1 80  ? 7.824   -3.173  -0.145  1.00 0.00 ? 80  PRO A HB2  1  
ATOM 1241  H HB3  . PRO A 1 80  ? 8.329   -1.533  -0.585  1.00 0.00 ? 80  PRO A HB3  1  
ATOM 1242  H HG2  . PRO A 1 80  ? 6.268   -2.388  1.373   1.00 0.00 ? 80  PRO A HG2  1  
ATOM 1243  H HG3  . PRO A 1 80  ? 7.155   -0.861  1.274   1.00 0.00 ? 80  PRO A HG3  1  
ATOM 1244  H HD2  . PRO A 1 80  ? 4.476   -1.351  0.419   1.00 0.00 ? 80  PRO A HD2  1  
ATOM 1245  H HD3  . PRO A 1 80  ? 5.413   0.141   0.187   1.00 0.00 ? 80  PRO A HD3  1  
ATOM 1246  N N    . GLN A 1 81  ? 5.807   -4.100  -3.017  1.00 0.00 ? 81  GLN A N    1  
ATOM 1247  C CA   . GLN A 1 81  ? 5.213   -5.450  -3.220  1.00 0.00 ? 81  GLN A CA   1  
ATOM 1248  C C    . GLN A 1 81  ? 6.227   -6.510  -2.788  1.00 0.00 ? 81  GLN A C    1  
ATOM 1249  O O    . GLN A 1 81  ? 6.034   -7.208  -1.812  1.00 0.00 ? 81  GLN A O    1  
ATOM 1250  C CB   . GLN A 1 81  ? 4.870   -5.637  -4.699  1.00 0.00 ? 81  GLN A CB   1  
ATOM 1251  C CG   . GLN A 1 81  ? 4.573   -7.112  -4.972  1.00 0.00 ? 81  GLN A CG   1  
ATOM 1252  C CD   . GLN A 1 81  ? 4.314   -7.315  -6.465  1.00 0.00 ? 81  GLN A CD   1  
ATOM 1253  O OE1  . GLN A 1 81  ? 4.137   -6.361  -7.198  1.00 0.00 ? 81  GLN A OE1  1  
ATOM 1254  N NE2  . GLN A 1 81  ? 4.283   -8.525  -6.951  1.00 0.00 ? 81  GLN A NE2  1  
ATOM 1255  H H    . GLN A 1 81  ? 6.065   -3.561  -3.791  1.00 0.00 ? 81  GLN A H    1  
ATOM 1256  H HA   . GLN A 1 81  ? 4.317   -5.544  -2.625  1.00 0.00 ? 81  GLN A HA   1  
ATOM 1257  H HB2  . GLN A 1 81  ? 4.001   -5.043  -4.944  1.00 0.00 ? 81  GLN A HB2  1  
ATOM 1258  H HB3  . GLN A 1 81  ? 5.705   -5.322  -5.306  1.00 0.00 ? 81  GLN A HB3  1  
ATOM 1259  H HG2  . GLN A 1 81  ? 5.420   -7.709  -4.668  1.00 0.00 ? 81  GLN A HG2  1  
ATOM 1260  H HG3  . GLN A 1 81  ? 3.701   -7.412  -4.412  1.00 0.00 ? 81  GLN A HG3  1  
ATOM 1261  H HE21 . GLN A 1 81  ? 4.425   -9.294  -6.360  1.00 0.00 ? 81  GLN A HE21 1  
ATOM 1262  H HE22 . GLN A 1 81  ? 4.119   -8.666  -7.907  1.00 0.00 ? 81  GLN A HE22 1  
ATOM 1263  N N    . ALA A 1 82  ? 7.313   -6.629  -3.502  1.00 0.00 ? 82  ALA A N    1  
ATOM 1264  C CA   . ALA A 1 82  ? 8.344   -7.634  -3.126  1.00 0.00 ? 82  ALA A CA   1  
ATOM 1265  C C    . ALA A 1 82  ? 9.396   -6.954  -2.250  1.00 0.00 ? 82  ALA A C    1  
ATOM 1266  O O    . ALA A 1 82  ? 9.717   -5.798  -2.439  1.00 0.00 ? 82  ALA A O    1  
ATOM 1267  C CB   . ALA A 1 82  ? 9.007   -8.186  -4.390  1.00 0.00 ? 82  ALA A CB   1  
ATOM 1268  H H    . ALA A 1 82  ? 7.453   -6.050  -4.280  1.00 0.00 ? 82  ALA A H    1  
ATOM 1269  H HA   . ALA A 1 82  ? 7.881   -8.440  -2.576  1.00 0.00 ? 82  ALA A HA   1  
ATOM 1270  H HB1  . ALA A 1 82  ? 9.425   -7.372  -4.962  1.00 0.00 ? 82  ALA A HB1  1  
ATOM 1271  H HB2  . ALA A 1 82  ? 9.793   -8.873  -4.114  1.00 0.00 ? 82  ALA A HB2  1  
ATOM 1272  H HB3  . ALA A 1 82  ? 8.270   -8.704  -4.986  1.00 0.00 ? 82  ALA A HB3  1  
ATOM 1273  N N    . LEU A 1 83  ? 9.934   -7.653  -1.290  1.00 0.00 ? 83  LEU A N    1  
ATOM 1274  C CA   . LEU A 1 83  ? 10.956  -7.029  -0.409  1.00 0.00 ? 83  LEU A CA   1  
ATOM 1275  C C    . LEU A 1 83  ? 12.220  -7.878  -0.401  1.00 0.00 ? 83  LEU A C    1  
ATOM 1276  O O    . LEU A 1 83  ? 12.375  -8.808  -1.167  1.00 0.00 ? 83  LEU A O    1  
ATOM 1277  C CB   . LEU A 1 83  ? 10.417  -6.935  1.019   1.00 0.00 ? 83  LEU A CB   1  
ATOM 1278  C CG   . LEU A 1 83  ? 9.263   -5.939  1.061   1.00 0.00 ? 83  LEU A CG   1  
ATOM 1279  C CD1  . LEU A 1 83  ? 8.269   -6.350  2.149   1.00 0.00 ? 83  LEU A CD1  1  
ATOM 1280  C CD2  . LEU A 1 83  ? 9.809   -4.548  1.376   1.00 0.00 ? 83  LEU A CD2  1  
ATOM 1281  H H    . LEU A 1 83  ? 9.663   -8.583  -1.145  1.00 0.00 ? 83  LEU A H    1  
ATOM 1282  H HA   . LEU A 1 83  ? 11.189  -6.039  -0.771  1.00 0.00 ? 83  LEU A HA   1  
ATOM 1283  H HB2  . LEU A 1 83  ? 10.071  -7.905  1.340   1.00 0.00 ? 83  LEU A HB2  1  
ATOM 1284  H HB3  . LEU A 1 83  ? 11.202  -6.598  1.679   1.00 0.00 ? 83  LEU A HB3  1  
ATOM 1285  H HG   . LEU A 1 83  ? 8.769   -5.926  0.103   1.00 0.00 ? 83  LEU A HG   1  
ATOM 1286  H HD11 . LEU A 1 83  ? 8.436   -7.383  2.417   1.00 0.00 ? 83  LEU A HD11 1  
ATOM 1287  H HD12 . LEU A 1 83  ? 8.409   -5.725  3.018   1.00 0.00 ? 83  LEU A HD12 1  
ATOM 1288  H HD13 . LEU A 1 83  ? 7.262   -6.233  1.779   1.00 0.00 ? 83  LEU A HD13 1  
ATOM 1289  H HD21 . LEU A 1 83  ? 10.548  -4.622  2.160   1.00 0.00 ? 83  LEU A HD21 1  
ATOM 1290  H HD22 . LEU A 1 83  ? 10.265  -4.132  0.490   1.00 0.00 ? 83  LEU A HD22 1  
ATOM 1291  H HD23 . LEU A 1 83  ? 9.002   -3.909  1.701   1.00 0.00 ? 83  LEU A HD23 1  
ATOM 1292  N N    . GLU A 1 84  ? 13.116  -7.559  0.480   1.00 0.00 ? 84  GLU A N    1  
ATOM 1293  C CA   . GLU A 1 84  ? 14.382  -8.329  0.587   1.00 0.00 ? 84  GLU A CA   1  
ATOM 1294  C C    . GLU A 1 84  ? 14.795  -8.373  2.057   1.00 0.00 ? 84  GLU A C    1  
ATOM 1295  O O    . GLU A 1 84  ? 14.333  -7.576  2.845   1.00 0.00 ? 84  GLU A O    1  
ATOM 1296  C CB   . GLU A 1 84  ? 15.475  -7.644  -0.237  1.00 0.00 ? 84  GLU A CB   1  
ATOM 1297  C CG   . GLU A 1 84  ? 15.631  -8.367  -1.576  1.00 0.00 ? 84  GLU A CG   1  
ATOM 1298  C CD   . GLU A 1 84  ? 17.117  -8.523  -1.901  1.00 0.00 ? 84  GLU A CD   1  
ATOM 1299  O OE1  . GLU A 1 84  ? 17.765  -9.323  -1.247  1.00 0.00 ? 84  GLU A OE1  1  
ATOM 1300  O OE2  . GLU A 1 84  ? 17.582  -7.839  -2.797  1.00 0.00 ? 84  GLU A OE2  1  
ATOM 1301  H H    . GLU A 1 84  ? 12.947  -6.809  1.086   1.00 0.00 ? 84  GLU A H    1  
ATOM 1302  H HA   . GLU A 1 84  ? 14.228  -9.335  0.224   1.00 0.00 ? 84  GLU A HA   1  
ATOM 1303  H HB2  . GLU A 1 84  ? 15.201  -6.614  -0.412  1.00 0.00 ? 84  GLU A HB2  1  
ATOM 1304  H HB3  . GLU A 1 84  ? 16.409  -7.683  0.301   1.00 0.00 ? 84  GLU A HB3  1  
ATOM 1305  H HG2  . GLU A 1 84  ? 15.170  -9.342  -1.514  1.00 0.00 ? 84  GLU A HG2  1  
ATOM 1306  H HG3  . GLU A 1 84  ? 15.152  -7.791  -2.354  1.00 0.00 ? 84  GLU A HG3  1  
ATOM 1307  N N    . PRO A 1 85  ? 15.645  -9.305  2.385   1.00 0.00 ? 85  PRO A N    1  
ATOM 1308  C CA   . PRO A 1 85  ? 16.127  -9.480  3.764   1.00 0.00 ? 85  PRO A CA   1  
ATOM 1309  C C    . PRO A 1 85  ? 17.139  -8.390  4.132   1.00 0.00 ? 85  PRO A C    1  
ATOM 1310  O O    . PRO A 1 85  ? 17.261  -7.388  3.455   1.00 0.00 ? 85  PRO A O    1  
ATOM 1311  C CB   . PRO A 1 85  ? 16.770  -10.867 3.748   1.00 0.00 ? 85  PRO A CB   1  
ATOM 1312  C CG   . PRO A 1 85  ? 17.110  -11.172 2.271   1.00 0.00 ? 85  PRO A CG   1  
ATOM 1313  C CD   . PRO A 1 85  ? 16.209  -10.263 1.416   1.00 0.00 ? 85  PRO A CD   1  
ATOM 1314  H HA   . PRO A 1 85  ? 15.298  -9.471  4.452   1.00 0.00 ? 85  PRO A HA   1  
ATOM 1315  H HB2  . PRO A 1 85  ? 17.671  -10.864 4.348   1.00 0.00 ? 85  PRO A HB2  1  
ATOM 1316  H HB3  . PRO A 1 85  ? 16.076  -11.604 4.121   1.00 0.00 ? 85  PRO A HB3  1  
ATOM 1317  H HG2  . PRO A 1 85  ? 18.149  -10.952 2.080   1.00 0.00 ? 85  PRO A HG2  1  
ATOM 1318  H HG3  . PRO A 1 85  ? 16.898  -12.205 2.049   1.00 0.00 ? 85  PRO A HG3  1  
ATOM 1319  H HD2  . PRO A 1 85  ? 16.794  -9.749  0.666   1.00 0.00 ? 85  PRO A HD2  1  
ATOM 1320  H HD3  . PRO A 1 85  ? 15.419  -10.836 0.956   1.00 0.00 ? 85  PRO A HD3  1  
ATOM 1321  N N    . LEU A 1 86  ? 17.846  -8.566  5.216   1.00 0.00 ? 86  LEU A N    1  
ATOM 1322  C CA   . LEU A 1 86  ? 18.827  -7.529  5.645   1.00 0.00 ? 86  LEU A CA   1  
ATOM 1323  C C    . LEU A 1 86  ? 19.783  -8.136  6.686   1.00 0.00 ? 86  LEU A C    1  
ATOM 1324  O O    . LEU A 1 86  ? 19.385  -8.405  7.799   1.00 0.00 ? 86  LEU A O    1  
ATOM 1325  C CB   . LEU A 1 86  ? 18.026  -6.343  6.230   1.00 0.00 ? 86  LEU A CB   1  
ATOM 1326  C CG   . LEU A 1 86  ? 18.781  -5.626  7.362   1.00 0.00 ? 86  LEU A CG   1  
ATOM 1327  C CD1  . LEU A 1 86  ? 19.688  -4.539  6.795   1.00 0.00 ? 86  LEU A CD1  1  
ATOM 1328  C CD2  . LEU A 1 86  ? 17.765  -4.975  8.301   1.00 0.00 ? 86  LEU A CD2  1  
ATOM 1329  H H    . LEU A 1 86  ? 17.718  -9.372  5.760   1.00 0.00 ? 86  LEU A H    1  
ATOM 1330  H HA   . LEU A 1 86  ? 19.386  -7.191  4.787   1.00 0.00 ? 86  LEU A HA   1  
ATOM 1331  H HB2  . LEU A 1 86  ? 17.827  -5.633  5.441   1.00 0.00 ? 86  LEU A HB2  1  
ATOM 1332  H HB3  . LEU A 1 86  ? 17.086  -6.711  6.611   1.00 0.00 ? 86  LEU A HB3  1  
ATOM 1333  H HG   . LEU A 1 86  ? 19.371  -6.331  7.914   1.00 0.00 ? 86  LEU A HG   1  
ATOM 1334  H HD11 . LEU A 1 86  ? 19.336  -4.248  5.819   1.00 0.00 ? 86  LEU A HD11 1  
ATOM 1335  H HD12 . LEU A 1 86  ? 19.672  -3.682  7.455   1.00 0.00 ? 86  LEU A HD12 1  
ATOM 1336  H HD13 . LEU A 1 86  ? 20.697  -4.916  6.721   1.00 0.00 ? 86  LEU A HD13 1  
ATOM 1337  H HD21 . LEU A 1 86  ? 16.814  -5.477  8.206   1.00 0.00 ? 86  LEU A HD21 1  
ATOM 1338  H HD22 . LEU A 1 86  ? 18.113  -5.054  9.319   1.00 0.00 ? 86  LEU A HD22 1  
ATOM 1339  H HD23 . LEU A 1 86  ? 17.650  -3.934  8.039   1.00 0.00 ? 86  LEU A HD23 1  
ATOM 1340  N N    . PRO A 1 87  ? 21.023  -8.325  6.298   1.00 0.00 ? 87  PRO A N    1  
ATOM 1341  C CA   . PRO A 1 87  ? 22.055  -8.891  7.190   1.00 0.00 ? 87  PRO A CA   1  
ATOM 1342  C C    . PRO A 1 87  ? 22.496  -7.839  8.206   1.00 0.00 ? 87  PRO A C    1  
ATOM 1343  O O    . PRO A 1 87  ? 23.094  -6.839  7.861   1.00 0.00 ? 87  PRO A O    1  
ATOM 1344  C CB   . PRO A 1 87  ? 23.196  -9.259  6.238   1.00 0.00 ? 87  PRO A CB   1  
ATOM 1345  C CG   . PRO A 1 87  ? 22.999  -8.397  4.970   1.00 0.00 ? 87  PRO A CG   1  
ATOM 1346  C CD   . PRO A 1 87  ? 21.514  -7.987  4.946   1.00 0.00 ? 87  PRO A CD   1  
ATOM 1347  H HA   . PRO A 1 87  ? 21.692  -9.775  7.692   1.00 0.00 ? 87  PRO A HA   1  
ATOM 1348  H HB2  . PRO A 1 87  ? 24.149  -9.036  6.699   1.00 0.00 ? 87  PRO A HB2  1  
ATOM 1349  H HB3  . PRO A 1 87  ? 23.142  -10.304 5.979   1.00 0.00 ? 87  PRO A HB3  1  
ATOM 1350  H HG2  . PRO A 1 87  ? 23.629  -7.519  5.018   1.00 0.00 ? 87  PRO A HG2  1  
ATOM 1351  H HG3  . PRO A 1 87  ? 23.232  -8.973  4.088   1.00 0.00 ? 87  PRO A HG3  1  
ATOM 1352  H HD2  . PRO A 1 87  ? 21.418  -6.926  4.760   1.00 0.00 ? 87  PRO A HD2  1  
ATOM 1353  H HD3  . PRO A 1 87  ? 20.976  -8.554  4.202   1.00 0.00 ? 87  PRO A HD3  1  
ATOM 1354  N N    . ILE A 1 88  ? 22.189  -8.047  9.455   1.00 0.00 ? 88  ILE A N    1  
ATOM 1355  C CA   . ILE A 1 88  ? 22.574  -7.047  10.486  1.00 0.00 ? 88  ILE A CA   1  
ATOM 1356  C C    . ILE A 1 88  ? 23.382  -7.708  11.593  1.00 0.00 ? 88  ILE A C    1  
ATOM 1357  O O    . ILE A 1 88  ? 23.891  -8.801  11.452  1.00 0.00 ? 88  ILE A O    1  
ATOM 1358  C CB   . ILE A 1 88  ? 21.310  -6.440  11.100  1.00 0.00 ? 88  ILE A CB   1  
ATOM 1359  C CG1  . ILE A 1 88  ? 20.714  -7.411  12.123  1.00 0.00 ? 88  ILE A CG1  1  
ATOM 1360  C CG2  . ILE A 1 88  ? 20.287  -6.192  10.002  1.00 0.00 ? 88  ILE A CG2  1  
ATOM 1361  C CD1  . ILE A 1 88  ? 19.328  -6.933  12.539  1.00 0.00 ? 88  ILE A CD1  1  
ATOM 1362  H H    . ILE A 1 88  ? 21.694  -8.853  9.713   1.00 0.00 ? 88  ILE A H    1  
ATOM 1363  H HA   . ILE A 1 88  ? 23.160  -6.265  10.029  1.00 0.00 ? 88  ILE A HA   1  
ATOM 1364  H HB   . ILE A 1 88  ? 21.555  -5.506  11.584  1.00 0.00 ? 88  ILE A HB   1  
ATOM 1365  H HG12 . ILE A 1 88  ? 20.643  -8.390  11.685  1.00 0.00 ? 88  ILE A HG12 1  
ATOM 1366  H HG13 . ILE A 1 88  ? 21.346  -7.455  12.989  1.00 0.00 ? 88  ILE A HG13 1  
ATOM 1367  H HG21 . ILE A 1 88  ? 20.798  -6.005  9.071   1.00 0.00 ? 88  ILE A HG21 1  
ATOM 1368  H HG22 . ILE A 1 88  ? 19.655  -7.062  9.898   1.00 0.00 ? 88  ILE A HG22 1  
ATOM 1369  H HG23 . ILE A 1 88  ? 19.683  -5.337  10.262  1.00 0.00 ? 88  ILE A HG23 1  
ATOM 1370  H HD11 . ILE A 1 88  ? 19.094  -6.016  12.020  1.00 0.00 ? 88  ILE A HD11 1  
ATOM 1371  H HD12 . ILE A 1 88  ? 18.600  -7.687  12.289  1.00 0.00 ? 88  ILE A HD12 1  
ATOM 1372  H HD13 . ILE A 1 88  ? 19.315  -6.758  13.605  1.00 0.00 ? 88  ILE A HD13 1  
ATOM 1373  N N    . VAL A 1 89  ? 23.459  -7.042  12.707  1.00 0.00 ? 89  VAL A N    1  
ATOM 1374  C CA   . VAL A 1 89  ? 24.189  -7.581  13.880  1.00 0.00 ? 89  VAL A CA   1  
ATOM 1375  C C    . VAL A 1 89  ? 23.769  -6.787  15.112  1.00 0.00 ? 89  VAL A C    1  
ATOM 1376  O O    . VAL A 1 89  ? 24.094  -5.624  15.249  1.00 0.00 ? 89  VAL A O    1  
ATOM 1377  C CB   . VAL A 1 89  ? 25.701  -7.425  13.699  1.00 0.00 ? 89  VAL A CB   1  
ATOM 1378  C CG1  . VAL A 1 89  ? 26.415  -8.241  14.776  1.00 0.00 ? 89  VAL A CG1  1  
ATOM 1379  C CG2  . VAL A 1 89  ? 26.128  -7.920  12.315  1.00 0.00 ? 89  VAL A CG2  1  
ATOM 1380  H H    . VAL A 1 89  ? 23.002  -6.181  12.779  1.00 0.00 ? 89  VAL A H    1  
ATOM 1381  H HA   . VAL A 1 89  ? 23.935  -8.621  14.014  1.00 0.00 ? 89  VAL A HA   1  
ATOM 1382  H HB   . VAL A 1 89  ? 25.967  -6.383  13.807  1.00 0.00 ? 89  VAL A HB   1  
ATOM 1383  H HG11 . VAL A 1 89  ? 25.770  -9.043  15.104  1.00 0.00 ? 89  VAL A HG11 1  
ATOM 1384  H HG12 . VAL A 1 89  ? 27.326  -8.653  14.371  1.00 0.00 ? 89  VAL A HG12 1  
ATOM 1385  H HG13 . VAL A 1 89  ? 26.648  -7.602  15.615  1.00 0.00 ? 89  VAL A HG13 1  
ATOM 1386  H HG21 . VAL A 1 89  ? 25.808  -8.940  12.184  1.00 0.00 ? 89  VAL A HG21 1  
ATOM 1387  H HG22 . VAL A 1 89  ? 25.678  -7.300  11.555  1.00 0.00 ? 89  VAL A HG22 1  
ATOM 1388  H HG23 . VAL A 1 89  ? 27.203  -7.868  12.232  1.00 0.00 ? 89  VAL A HG23 1  
ATOM 1389  N N    . TYR A 1 90  ? 23.055  -7.394  16.012  1.00 0.00 ? 90  TYR A N    1  
ATOM 1390  C CA   . TYR A 1 90  ? 22.629  -6.654  17.226  1.00 0.00 ? 90  TYR A CA   1  
ATOM 1391  C C    . TYR A 1 90  ? 23.199  -7.341  18.465  1.00 0.00 ? 90  TYR A C    1  
ATOM 1392  O O    . TYR A 1 90  ? 24.029  -8.221  18.370  1.00 0.00 ? 90  TYR A O    1  
ATOM 1393  C CB   . TYR A 1 90  ? 21.104  -6.618  17.305  1.00 0.00 ? 90  TYR A CB   1  
ATOM 1394  C CG   . TYR A 1 90  ? 20.523  -7.917  16.804  1.00 0.00 ? 90  TYR A CG   1  
ATOM 1395  C CD1  . TYR A 1 90  ? 20.463  -8.167  15.431  1.00 0.00 ? 90  TYR A CD1  1  
ATOM 1396  C CD2  . TYR A 1 90  ? 20.031  -8.862  17.711  1.00 0.00 ? 90  TYR A CD2  1  
ATOM 1397  C CE1  . TYR A 1 90  ? 19.913  -9.364  14.958  1.00 0.00 ? 90  TYR A CE1  1  
ATOM 1398  C CE2  . TYR A 1 90  ? 19.482  -10.061 17.240  1.00 0.00 ? 90  TYR A CE2  1  
ATOM 1399  C CZ   . TYR A 1 90  ? 19.422  -10.311 15.863  1.00 0.00 ? 90  TYR A CZ   1  
ATOM 1400  O OH   . TYR A 1 90  ? 18.879  -11.492 15.400  1.00 0.00 ? 90  TYR A OH   1  
ATOM 1401  H H    . TYR A 1 90  ? 22.805  -8.331  15.892  1.00 0.00 ? 90  TYR A H    1  
ATOM 1402  H HA   . TYR A 1 90  ? 23.005  -5.641  17.172  1.00 0.00 ? 90  TYR A HA   1  
ATOM 1403  H HB2  . TYR A 1 90  ? 20.799  -6.457  18.328  1.00 0.00 ? 90  TYR A HB2  1  
ATOM 1404  H HB3  . TYR A 1 90  ? 20.742  -5.810  16.692  1.00 0.00 ? 90  TYR A HB3  1  
ATOM 1405  H HD1  . TYR A 1 90  ? 20.842  -7.435  14.736  1.00 0.00 ? 90  TYR A HD1  1  
ATOM 1406  H HD2  . TYR A 1 90  ? 20.079  -8.669  18.772  1.00 0.00 ? 90  TYR A HD2  1  
ATOM 1407  H HE1  . TYR A 1 90  ? 19.866  -9.556  13.896  1.00 0.00 ? 90  TYR A HE1  1  
ATOM 1408  H HE2  . TYR A 1 90  ? 19.100  -10.790 17.937  1.00 0.00 ? 90  TYR A HE2  1  
ATOM 1409  H HH   . TYR A 1 90  ? 19.307  -12.217 15.862  1.00 0.00 ? 90  TYR A HH   1  
ATOM 1410  N N    . TYR A 1 91  ? 22.775  -6.937  19.629  1.00 0.00 ? 91  TYR A N    1  
ATOM 1411  C CA   . TYR A 1 91  ? 23.314  -7.563  20.865  1.00 0.00 ? 91  TYR A CA   1  
ATOM 1412  C C    . TYR A 1 91  ? 22.197  -7.831  21.873  1.00 0.00 ? 91  TYR A C    1  
ATOM 1413  O O    . TYR A 1 91  ? 21.407  -6.964  22.190  1.00 0.00 ? 91  TYR A O    1  
ATOM 1414  C CB   . TYR A 1 91  ? 24.319  -6.613  21.507  1.00 0.00 ? 91  TYR A CB   1  
ATOM 1415  C CG   . TYR A 1 91  ? 25.701  -6.923  21.003  1.00 0.00 ? 91  TYR A CG   1  
ATOM 1416  C CD1  . TYR A 1 91  ? 26.127  -6.404  19.779  1.00 0.00 ? 91  TYR A CD1  1  
ATOM 1417  C CD2  . TYR A 1 91  ? 26.559  -7.718  21.767  1.00 0.00 ? 91  TYR A CD2  1  
ATOM 1418  C CE1  . TYR A 1 91  ? 27.419  -6.683  19.315  1.00 0.00 ? 91  TYR A CE1  1  
ATOM 1419  C CE2  . TYR A 1 91  ? 27.848  -7.996  21.311  1.00 0.00 ? 91  TYR A CE2  1  
ATOM 1420  C CZ   . TYR A 1 91  ? 28.282  -7.479  20.083  1.00 0.00 ? 91  TYR A CZ   1  
ATOM 1421  O OH   . TYR A 1 91  ? 29.556  -7.752  19.630  1.00 0.00 ? 91  TYR A OH   1  
ATOM 1422  H H    . TYR A 1 91  ? 22.118  -6.217  19.688  1.00 0.00 ? 91  TYR A H    1  
ATOM 1423  H HA   . TYR A 1 91  ? 23.807  -8.489  20.617  1.00 0.00 ? 91  TYR A HA   1  
ATOM 1424  H HB2  . TYR A 1 91  ? 24.064  -5.594  21.253  1.00 0.00 ? 91  TYR A HB2  1  
ATOM 1425  H HB3  . TYR A 1 91  ? 24.293  -6.733  22.580  1.00 0.00 ? 91  TYR A HB3  1  
ATOM 1426  H HD1  . TYR A 1 91  ? 25.455  -5.792  19.190  1.00 0.00 ? 91  TYR A HD1  1  
ATOM 1427  H HD2  . TYR A 1 91  ? 26.223  -8.121  22.709  1.00 0.00 ? 91  TYR A HD2  1  
ATOM 1428  H HE1  . TYR A 1 91  ? 27.752  -6.283  18.368  1.00 0.00 ? 91  TYR A HE1  1  
ATOM 1429  H HE2  . TYR A 1 91  ? 28.508  -8.609  21.907  1.00 0.00 ? 91  TYR A HE2  1  
ATOM 1430  H HH   . TYR A 1 91  ? 30.173  -7.227  20.144  1.00 0.00 ? 91  TYR A HH   1  
ATOM 1431  N N    . VAL A 1 92  ? 22.158  -9.017  22.412  1.00 0.00 ? 92  VAL A N    1  
ATOM 1432  C CA   . VAL A 1 92  ? 21.134  -9.337  23.438  1.00 0.00 ? 92  VAL A CA   1  
ATOM 1433  C C    . VAL A 1 92  ? 21.825  -9.300  24.794  1.00 0.00 ? 92  VAL A C    1  
ATOM 1434  O O    . VAL A 1 92  ? 22.410  -10.270 25.232  1.00 0.00 ? 92  VAL A O    1  
ATOM 1435  C CB   . VAL A 1 92  ? 20.556  -10.728 23.200  1.00 0.00 ? 92  VAL A CB   1  
ATOM 1436  C CG1  . VAL A 1 92  ? 19.112  -10.754 23.696  1.00 0.00 ? 92  VAL A CG1  1  
ATOM 1437  C CG2  . VAL A 1 92  ? 20.595  -11.053 21.705  1.00 0.00 ? 92  VAL A CG2  1  
ATOM 1438  H H    . VAL A 1 92  ? 22.827  -9.686  22.165  1.00 0.00 ? 92  VAL A H    1  
ATOM 1439  H HA   . VAL A 1 92  ? 20.344  -8.599  23.409  1.00 0.00 ? 92  VAL A HA   1  
ATOM 1440  H HB   . VAL A 1 92  ? 21.137  -11.458 23.746  1.00 0.00 ? 92  VAL A HB   1  
ATOM 1441  H HG11 . VAL A 1 92  ? 18.953  -9.928  24.376  1.00 0.00 ? 92  VAL A HG11 1  
ATOM 1442  H HG12 . VAL A 1 92  ? 18.441  -10.661 22.855  1.00 0.00 ? 92  VAL A HG12 1  
ATOM 1443  H HG13 . VAL A 1 92  ? 18.923  -11.684 24.209  1.00 0.00 ? 92  VAL A HG13 1  
ATOM 1444  H HG21 . VAL A 1 92  ? 21.612  -10.978 21.349  1.00 0.00 ? 92  VAL A HG21 1  
ATOM 1445  H HG22 . VAL A 1 92  ? 20.231  -12.056 21.546  1.00 0.00 ? 92  VAL A HG22 1  
ATOM 1446  H HG23 . VAL A 1 92  ? 19.973  -10.353 21.169  1.00 0.00 ? 92  VAL A HG23 1  
ATOM 1447  N N    . GLY A 1 93  ? 21.793  -8.178  25.446  1.00 0.00 ? 93  GLY A N    1  
ATOM 1448  C CA   . GLY A 1 93  ? 22.483  -8.065  26.758  1.00 0.00 ? 93  GLY A CA   1  
ATOM 1449  C C    . GLY A 1 93  ? 23.987  -7.915  26.502  1.00 0.00 ? 93  GLY A C    1  
ATOM 1450  O O    . GLY A 1 93  ? 24.527  -6.828  26.538  1.00 0.00 ? 93  GLY A O    1  
ATOM 1451  H H    . GLY A 1 93  ? 21.333  -7.404  25.062  1.00 0.00 ? 93  GLY A H    1  
ATOM 1452  H HA2  . GLY A 1 93  ? 22.114  -7.199  27.289  1.00 0.00 ? 93  GLY A HA2  1  
ATOM 1453  H HA3  . GLY A 1 93  ? 22.306  -8.955  27.341  1.00 0.00 ? 93  GLY A HA3  1  
ATOM 1454  N N    . ARG A 1 94  ? 24.667  -9.002  26.245  1.00 0.00 ? 94  ARG A N    1  
ATOM 1455  C CA   . ARG A 1 94  ? 26.138  -8.924  25.987  1.00 0.00 ? 94  ARG A CA   1  
ATOM 1456  C C    . ARG A 1 94  ? 26.550  -9.901  24.879  1.00 0.00 ? 94  ARG A C    1  
ATOM 1457  O O    . ARG A 1 94  ? 27.695  -9.939  24.476  1.00 0.00 ? 94  ARG A O    1  
ATOM 1458  C CB   . ARG A 1 94  ? 26.884  -9.295  27.264  1.00 0.00 ? 94  ARG A CB   1  
ATOM 1459  C CG   . ARG A 1 94  ? 26.519  -8.316  28.381  1.00 0.00 ? 94  ARG A CG   1  
ATOM 1460  C CD   . ARG A 1 94  ? 26.092  -9.096  29.625  1.00 0.00 ? 94  ARG A CD   1  
ATOM 1461  N NE   . ARG A 1 94  ? 25.074  -10.115 29.247  1.00 0.00 ? 94  ARG A NE   1  
ATOM 1462  C CZ   . ARG A 1 94  ? 25.281  -11.376 29.514  1.00 0.00 ? 94  ARG A CZ   1  
ATOM 1463  N NH1  . ARG A 1 94  ? 26.472  -11.888 29.360  1.00 0.00 ? 94  ARG A NH1  1  
ATOM 1464  N NH2  . ARG A 1 94  ? 24.298  -12.124 29.935  1.00 0.00 ? 94  ARG A NH2  1  
ATOM 1465  H H    . ARG A 1 94  ? 24.211  -9.867  26.230  1.00 0.00 ? 94  ARG A H    1  
ATOM 1466  H HA   . ARG A 1 94  ? 26.403  -7.922  25.692  1.00 0.00 ? 94  ARG A HA   1  
ATOM 1467  H HB2  . ARG A 1 94  ? 26.603  -10.297 27.554  1.00 0.00 ? 94  ARG A HB2  1  
ATOM 1468  H HB3  . ARG A 1 94  ? 27.948  -9.257  27.084  1.00 0.00 ? 94  ARG A HB3  1  
ATOM 1469  H HG2  . ARG A 1 94  ? 27.378  -7.704  28.616  1.00 0.00 ? 94  ARG A HG2  1  
ATOM 1470  H HG3  . ARG A 1 94  ? 25.706  -7.686  28.057  1.00 0.00 ? 94  ARG A HG3  1  
ATOM 1471  H HD2  . ARG A 1 94  ? 26.952  -9.589  30.054  1.00 0.00 ? 94  ARG A HD2  1  
ATOM 1472  H HD3  . ARG A 1 94  ? 25.669  -8.416  30.349  1.00 0.00 ? 94  ARG A HD3  1  
ATOM 1473  H HE   . ARG A 1 94  ? 24.247  -9.839  28.798  1.00 0.00 ? 94  ARG A HE   1  
ATOM 1474  H HH11 . ARG A 1 94  ? 27.225  -11.315 29.037  1.00 0.00 ? 94  ARG A HH11 1  
ATOM 1475  H HH12 . ARG A 1 94  ? 26.631  -12.854 29.564  1.00 0.00 ? 94  ARG A HH12 1  
ATOM 1476  H HH21 . ARG A 1 94  ? 23.386  -11.731 30.053  1.00 0.00 ? 94  ARG A HH21 1  
ATOM 1477  H HH22 . ARG A 1 94  ? 24.457  -13.089 30.139  1.00 0.00 ? 94  ARG A HH22 1  
ATOM 1478  N N    . LYS A 1 95  ? 25.643  -10.695 24.389  1.00 0.00 ? 95  LYS A N    1  
ATOM 1479  C CA   . LYS A 1 95  ? 26.009  -11.666 23.321  1.00 0.00 ? 95  LYS A CA   1  
ATOM 1480  C C    . LYS A 1 95  ? 25.734  -11.050 21.945  1.00 0.00 ? 95  LYS A C    1  
ATOM 1481  O O    . LYS A 1 95  ? 24.685  -10.481 21.726  1.00 0.00 ? 95  LYS A O    1  
ATOM 1482  C CB   . LYS A 1 95  ? 25.167  -12.933 23.483  1.00 0.00 ? 95  LYS A CB   1  
ATOM 1483  C CG   . LYS A 1 95  ? 26.001  -14.153 23.091  1.00 0.00 ? 95  LYS A CG   1  
ATOM 1484  C CD   . LYS A 1 95  ? 25.650  -14.575 21.663  1.00 0.00 ? 95  LYS A CD   1  
ATOM 1485  C CE   . LYS A 1 95  ? 26.042  -16.038 21.451  1.00 0.00 ? 95  LYS A CE   1  
ATOM 1486  N NZ   . LYS A 1 95  ? 25.085  -16.678 20.504  1.00 0.00 ? 95  LYS A NZ   1  
ATOM 1487  H H    . LYS A 1 95  ? 24.728  -10.661 24.725  1.00 0.00 ? 95  LYS A H    1  
ATOM 1488  H HA   . LYS A 1 95  ? 27.054  -11.916 23.410  1.00 0.00 ? 95  LYS A HA   1  
ATOM 1489  H HB2  . LYS A 1 95  ? 24.851  -13.026 24.512  1.00 0.00 ? 95  LYS A HB2  1  
ATOM 1490  H HB3  . LYS A 1 95  ? 24.299  -12.872 22.844  1.00 0.00 ? 95  LYS A HB3  1  
ATOM 1491  H HG2  . LYS A 1 95  ? 27.050  -13.902 23.146  1.00 0.00 ? 95  LYS A HG2  1  
ATOM 1492  H HG3  . LYS A 1 95  ? 25.787  -14.966 23.768  1.00 0.00 ? 95  LYS A HG3  1  
ATOM 1493  H HD2  . LYS A 1 95  ? 24.587  -14.460 21.504  1.00 0.00 ? 95  LYS A HD2  1  
ATOM 1494  H HD3  . LYS A 1 95  ? 26.188  -13.955 20.962  1.00 0.00 ? 95  LYS A HD3  1  
ATOM 1495  H HE2  . LYS A 1 95  ? 27.041  -16.088 21.042  1.00 0.00 ? 95  LYS A HE2  1  
ATOM 1496  H HE3  . LYS A 1 95  ? 26.014  -16.559 22.397  1.00 0.00 ? 95  LYS A HE3  1  
ATOM 1497  H HZ1  . LYS A 1 95  ? 24.914  -16.038 19.700  1.00 0.00 ? 95  LYS A HZ1  1  
ATOM 1498  H HZ2  . LYS A 1 95  ? 25.486  -17.572 20.156  1.00 0.00 ? 95  LYS A HZ2  1  
ATOM 1499  H HZ3  . LYS A 1 95  ? 24.188  -16.869 20.992  1.00 0.00 ? 95  LYS A HZ3  1  
ATOM 1500  N N    . PRO A 1 96  ? 26.680  -11.189 21.051  1.00 0.00 ? 96  PRO A N    1  
ATOM 1501  C CA   . PRO A 1 96  ? 26.551  -10.661 19.683  1.00 0.00 ? 96  PRO A CA   1  
ATOM 1502  C C    . PRO A 1 96  ? 25.676  -11.605 18.851  1.00 0.00 ? 96  PRO A C    1  
ATOM 1503  O O    . PRO A 1 96  ? 25.749  -12.809 18.996  1.00 0.00 ? 96  PRO A O    1  
ATOM 1504  C CB   . PRO A 1 96  ? 27.991  -10.650 19.164  1.00 0.00 ? 96  PRO A CB   1  
ATOM 1505  C CG   . PRO A 1 96  ? 28.769  -11.680 20.019  1.00 0.00 ? 96  PRO A CG   1  
ATOM 1506  C CD   . PRO A 1 96  ? 27.958  -11.881 21.313  1.00 0.00 ? 96  PRO A CD   1  
ATOM 1507  H HA   . PRO A 1 96  ? 26.147  -9.660  19.696  1.00 0.00 ? 96  PRO A HA   1  
ATOM 1508  H HB2  . PRO A 1 96  ? 28.010  -10.937 18.121  1.00 0.00 ? 96  PRO A HB2  1  
ATOM 1509  H HB3  . PRO A 1 96  ? 28.425  -9.671  19.289  1.00 0.00 ? 96  PRO A HB3  1  
ATOM 1510  H HG2  . PRO A 1 96  ? 28.854  -12.615 19.482  1.00 0.00 ? 96  PRO A HG2  1  
ATOM 1511  H HG3  . PRO A 1 96  ? 29.749  -11.298 20.259  1.00 0.00 ? 96  PRO A HG3  1  
ATOM 1512  H HD2  . PRO A 1 96  ? 27.791  -12.934 21.494  1.00 0.00 ? 96  PRO A HD2  1  
ATOM 1513  H HD3  . PRO A 1 96  ? 28.462  -11.426 22.152  1.00 0.00 ? 96  PRO A HD3  1  
ATOM 1514  N N    . LYS A 1 97  ? 24.845  -11.083 17.989  1.00 0.00 ? 97  LYS A N    1  
ATOM 1515  C CA   . LYS A 1 97  ? 23.976  -11.981 17.176  1.00 0.00 ? 97  LYS A CA   1  
ATOM 1516  C C    . LYS A 1 97  ? 23.772  -11.401 15.774  1.00 0.00 ? 97  LYS A C    1  
ATOM 1517  O O    . LYS A 1 97  ? 23.138  -10.379 15.601  1.00 0.00 ? 97  LYS A O    1  
ATOM 1518  C CB   . LYS A 1 97  ? 22.614  -12.123 17.861  1.00 0.00 ? 97  LYS A CB   1  
ATOM 1519  C CG   . LYS A 1 97  ? 22.702  -13.174 18.969  1.00 0.00 ? 97  LYS A CG   1  
ATOM 1520  C CD   . LYS A 1 97  ? 22.158  -14.508 18.453  1.00 0.00 ? 97  LYS A CD   1  
ATOM 1521  C CE   . LYS A 1 97  ? 23.162  -15.127 17.480  1.00 0.00 ? 97  LYS A CE   1  
ATOM 1522  N NZ   . LYS A 1 97  ? 22.661  -16.456 17.028  1.00 0.00 ? 97  LYS A NZ   1  
ATOM 1523  H H    . LYS A 1 97  ? 24.789  -10.110 17.882  1.00 0.00 ? 97  LYS A H    1  
ATOM 1524  H HA   . LYS A 1 97  ? 24.438  -12.953 17.098  1.00 0.00 ? 97  LYS A HA   1  
ATOM 1525  H HB2  . LYS A 1 97  ? 22.325  -11.173 18.287  1.00 0.00 ? 97  LYS A HB2  1  
ATOM 1526  H HB3  . LYS A 1 97  ? 21.877  -12.431 17.134  1.00 0.00 ? 97  LYS A HB3  1  
ATOM 1527  H HG2  . LYS A 1 97  ? 23.732  -13.296 19.269  1.00 0.00 ? 97  LYS A HG2  1  
ATOM 1528  H HG3  . LYS A 1 97  ? 22.116  -12.853 19.817  1.00 0.00 ? 97  LYS A HG3  1  
ATOM 1529  H HD2  . LYS A 1 97  ? 22.002  -15.179 19.286  1.00 0.00 ? 97  LYS A HD2  1  
ATOM 1530  H HD3  . LYS A 1 97  ? 21.221  -14.342 17.944  1.00 0.00 ? 97  LYS A HD3  1  
ATOM 1531  H HE2  . LYS A 1 97  ? 23.282  -14.478 16.625  1.00 0.00 ? 97  LYS A HE2  1  
ATOM 1532  H HE3  . LYS A 1 97  ? 24.114  -15.251 17.975  1.00 0.00 ? 97  LYS A HE3  1  
ATOM 1533  H HZ1  . LYS A 1 97  ? 21.798  -16.698 17.557  1.00 0.00 ? 97  LYS A HZ1  1  
ATOM 1534  H HZ2  . LYS A 1 97  ? 22.447  -16.419 16.012  1.00 0.00 ? 97  LYS A HZ2  1  
ATOM 1535  H HZ3  . LYS A 1 97  ? 23.388  -17.178 17.201  1.00 0.00 ? 97  LYS A HZ3  1  
ATOM 1536  N N    . VAL A 1 98  ? 24.285  -12.058 14.770  1.00 0.00 ? 98  VAL A N    1  
ATOM 1537  C CA   . VAL A 1 98  ? 24.098  -11.559 13.378  1.00 0.00 ? 98  VAL A CA   1  
ATOM 1538  C C    . VAL A 1 98  ? 22.876  -12.250 12.778  1.00 0.00 ? 98  VAL A C    1  
ATOM 1539  O O    . VAL A 1 98  ? 22.738  -13.455 12.860  1.00 0.00 ? 98  VAL A O    1  
ATOM 1540  C CB   . VAL A 1 98  ? 25.328  -11.898 12.532  1.00 0.00 ? 98  VAL A CB   1  
ATOM 1541  C CG1  . VAL A 1 98  ? 25.012  -11.654 11.054  1.00 0.00 ? 98  VAL A CG1  1  
ATOM 1542  C CG2  . VAL A 1 98  ? 26.499  -11.011 12.955  1.00 0.00 ? 98  VAL A CG2  1  
ATOM 1543  H H    . VAL A 1 98  ? 24.778  -12.890 14.930  1.00 0.00 ? 98  VAL A H    1  
ATOM 1544  H HA   . VAL A 1 98  ? 23.945  -10.490 13.390  1.00 0.00 ? 98  VAL A HA   1  
ATOM 1545  H HB   . VAL A 1 98  ? 25.589  -12.936 12.677  1.00 0.00 ? 98  VAL A HB   1  
ATOM 1546  H HG11 . VAL A 1 98  ? 24.260  -10.882 10.969  1.00 0.00 ? 98  VAL A HG11 1  
ATOM 1547  H HG12 . VAL A 1 98  ? 25.908  -11.341 10.540  1.00 0.00 ? 98  VAL A HG12 1  
ATOM 1548  H HG13 . VAL A 1 98  ? 24.641  -12.566 10.609  1.00 0.00 ? 98  VAL A HG13 1  
ATOM 1549  H HG21 . VAL A 1 98  ? 26.167  -10.309 13.704  1.00 0.00 ? 98  VAL A HG21 1  
ATOM 1550  H HG22 . VAL A 1 98  ? 27.288  -11.626 13.360  1.00 0.00 ? 98  VAL A HG22 1  
ATOM 1551  H HG23 . VAL A 1 98  ? 26.869  -10.472 12.095  1.00 0.00 ? 98  VAL A HG23 1  
ATOM 1552  N N    . GLU A 1 99  ? 21.982  -11.515 12.179  1.00 0.00 ? 99  GLU A N    1  
ATOM 1553  C CA   . GLU A 1 99  ? 20.784  -12.169 11.594  1.00 0.00 ? 99  GLU A CA   1  
ATOM 1554  C C    . GLU A 1 99  ? 20.529  -11.631 10.193  1.00 0.00 ? 99  GLU A C    1  
ATOM 1555  O O    . GLU A 1 99  ? 21.404  -11.093 9.544   1.00 0.00 ? 99  GLU A O    1  
ATOM 1556  C CB   . GLU A 1 99  ? 19.568  -11.881 12.467  1.00 0.00 ? 99  GLU A CB   1  
ATOM 1557  C CG   . GLU A 1 99  ? 18.925  -13.199 12.904  1.00 0.00 ? 99  GLU A CG   1  
ATOM 1558  C CD   . GLU A 1 99  ? 17.429  -13.168 12.585  1.00 0.00 ? 99  GLU A CD   1  
ATOM 1559  O OE1  . GLU A 1 99  ? 17.058  -12.483 11.647  1.00 0.00 ? 99  GLU A OE1  1  
ATOM 1560  O OE2  . GLU A 1 99  ? 16.680  -13.829 13.286  1.00 0.00 ? 99  GLU A OE2  1  
ATOM 1561  H H    . GLU A 1 99  ? 22.093  -10.539 12.116  1.00 0.00 ? 99  GLU A H    1  
ATOM 1562  H HA   . GLU A 1 99  ? 20.942  -13.234 11.546  1.00 0.00 ? 99  GLU A HA   1  
ATOM 1563  H HB2  . GLU A 1 99  ? 19.874  -11.325 13.334  1.00 0.00 ? 99  GLU A HB2  1  
ATOM 1564  H HB3  . GLU A 1 99  ? 18.855  -11.304 11.905  1.00 0.00 ? 99  GLU A HB3  1  
ATOM 1565  H HG2  . GLU A 1 99  ? 19.390  -14.018 12.376  1.00 0.00 ? 99  GLU A HG2  1  
ATOM 1566  H HG3  . GLU A 1 99  ? 19.062  -13.331 13.967  1.00 0.00 ? 99  GLU A HG3  1  
ATOM 1567  N N    . GLN A 1 100 ? 19.326  -11.777 9.731   1.00 0.00 ? 100 GLN A N    1  
ATOM 1568  C CA   . GLN A 1 100 ? 18.974  -11.287 8.376   1.00 0.00 ? 100 GLN A CA   1  
ATOM 1569  C C    . GLN A 1 100 ? 17.507  -10.876 8.375   1.00 0.00 ? 100 GLN A C    1  
ATOM 1570  O O    . GLN A 1 100 ? 16.639  -11.645 8.012   1.00 0.00 ? 100 GLN A O    1  
ATOM 1571  C CB   . GLN A 1 100 ? 19.176  -12.408 7.368   1.00 0.00 ? 100 GLN A CB   1  
ATOM 1572  C CG   . GLN A 1 100 ? 20.610  -12.934 7.462   1.00 0.00 ? 100 GLN A CG   1  
ATOM 1573  C CD   . GLN A 1 100 ? 20.952  -13.714 6.192   1.00 0.00 ? 100 GLN A CD   1  
ATOM 1574  O OE1  . GLN A 1 100 ? 20.887  -14.928 6.174   1.00 0.00 ? 100 GLN A OE1  1  
ATOM 1575  N NE2  . GLN A 1 100 ? 21.317  -13.064 5.121   1.00 0.00 ? 100 GLN A NE2  1  
ATOM 1576  H H    . GLN A 1 100 ? 18.645  -12.215 10.282  1.00 0.00 ? 100 GLN A H    1  
ATOM 1577  H HA   . GLN A 1 100 ? 19.596  -10.444 8.117   1.00 0.00 ? 100 GLN A HA   1  
ATOM 1578  H HB2  . GLN A 1 100 ? 18.483  -13.200 7.591   1.00 0.00 ? 100 GLN A HB2  1  
ATOM 1579  H HB3  . GLN A 1 100 ? 18.994  -12.036 6.371   1.00 0.00 ? 100 GLN A HB3  1  
ATOM 1580  H HG2  . GLN A 1 100 ? 21.291  -12.103 7.570   1.00 0.00 ? 100 GLN A HG2  1  
ATOM 1581  H HG3  . GLN A 1 100 ? 20.698  -13.587 8.318   1.00 0.00 ? 100 GLN A HG3  1  
ATOM 1582  H HE21 . GLN A 1 100 ? 21.369  -12.086 5.137   1.00 0.00 ? 100 GLN A HE21 1  
ATOM 1583  H HE22 . GLN A 1 100 ? 21.538  -13.554 4.302   1.00 0.00 ? 100 GLN A HE22 1  
ATOM 1584  N N    . LEU A 1 101 ? 17.220  -9.678  8.790   1.00 0.00 ? 101 LEU A N    1  
ATOM 1585  C CA   . LEU A 1 101 ? 15.805  -9.231  8.824   1.00 0.00 ? 101 LEU A CA   1  
ATOM 1586  C C    . LEU A 1 101 ? 15.119  -9.645  7.530   1.00 0.00 ? 101 LEU A C    1  
ATOM 1587  O O    . LEU A 1 101 ? 15.721  -9.679  6.476   1.00 0.00 ? 101 LEU A O    1  
ATOM 1588  C CB   . LEU A 1 101 ? 15.733  -7.713  8.988   1.00 0.00 ? 101 LEU A CB   1  
ATOM 1589  C CG   . LEU A 1 101 ? 16.475  -7.283  10.261  1.00 0.00 ? 101 LEU A CG   1  
ATOM 1590  C CD1  . LEU A 1 101 ? 15.925  -5.942  10.742  1.00 0.00 ? 101 LEU A CD1  1  
ATOM 1591  C CD2  . LEU A 1 101 ? 16.277  -8.326  11.363  1.00 0.00 ? 101 LEU A CD2  1  
ATOM 1592  H H    . LEU A 1 101 ? 17.931  -9.083  9.086   1.00 0.00 ? 101 LEU A H    1  
ATOM 1593  H HA   . LEU A 1 101 ? 15.304  -9.703  9.657   1.00 0.00 ? 101 LEU A HA   1  
ATOM 1594  H HB2  . LEU A 1 101 ? 16.189  -7.239  8.133   1.00 0.00 ? 101 LEU A HB2  1  
ATOM 1595  H HB3  . LEU A 1 101 ? 14.697  -7.416  9.058   1.00 0.00 ? 101 LEU A HB3  1  
ATOM 1596  H HG   . LEU A 1 101 ? 17.529  -7.182  10.045  1.00 0.00 ? 101 LEU A HG   1  
ATOM 1597  H HD11 . LEU A 1 101 ? 14.849  -5.941  10.653  1.00 0.00 ? 101 LEU A HD11 1  
ATOM 1598  H HD12 . LEU A 1 101 ? 16.202  -5.789  11.775  1.00 0.00 ? 101 LEU A HD12 1  
ATOM 1599  H HD13 . LEU A 1 101 ? 16.337  -5.150  10.139  1.00 0.00 ? 101 LEU A HD13 1  
ATOM 1600  H HD21 . LEU A 1 101 ? 15.222  -8.447  11.556  1.00 0.00 ? 101 LEU A HD21 1  
ATOM 1601  H HD22 . LEU A 1 101 ? 16.697  -9.268  11.044  1.00 0.00 ? 101 LEU A HD22 1  
ATOM 1602  H HD23 . LEU A 1 101 ? 16.773  -7.996  12.262  1.00 0.00 ? 101 LEU A HD23 1  
ATOM 1603  N N    . SER A 1 102 ? 13.872  -9.988  7.613   1.00 0.00 ? 102 SER A N    1  
ATOM 1604  C CA   . SER A 1 102 ? 13.138  -10.437 6.393   1.00 0.00 ? 102 SER A CA   1  
ATOM 1605  C C    . SER A 1 102 ? 12.242  -9.321  5.848   1.00 0.00 ? 102 SER A C    1  
ATOM 1606  O O    . SER A 1 102 ? 11.517  -8.677  6.581   1.00 0.00 ? 102 SER A O    1  
ATOM 1607  C CB   . SER A 1 102 ? 12.277  -11.651 6.742   1.00 0.00 ? 102 SER A CB   1  
ATOM 1608  O OG   . SER A 1 102 ? 12.140  -12.474 5.591   1.00 0.00 ? 102 SER A OG   1  
ATOM 1609  H H    . SER A 1 102 ? 13.422  -9.964  8.486   1.00 0.00 ? 102 SER A H    1  
ATOM 1610  H HA   . SER A 1 102 ? 13.853  -10.719 5.634   1.00 0.00 ? 102 SER A HA   1  
ATOM 1611  H HB2  . SER A 1 102 ? 12.750  -12.216 7.527   1.00 0.00 ? 102 SER A HB2  1  
ATOM 1612  H HB3  . SER A 1 102 ? 11.304  -11.316 7.077   1.00 0.00 ? 102 SER A HB3  1  
ATOM 1613  H HG   . SER A 1 102 ? 13.006  -12.823 5.371   1.00 0.00 ? 102 SER A HG   1  
ATOM 1614  N N    . ASN A 1 103 ? 12.269  -9.107  4.558   1.00 0.00 ? 103 ASN A N    1  
ATOM 1615  C CA   . ASN A 1 103 ? 11.398  -8.053  3.954   1.00 0.00 ? 103 ASN A CA   1  
ATOM 1616  C C    . ASN A 1 103 ? 11.742  -6.680  4.528   1.00 0.00 ? 103 ASN A C    1  
ATOM 1617  O O    . ASN A 1 103 ? 10.890  -5.823  4.661   1.00 0.00 ? 103 ASN A O    1  
ATOM 1618  C CB   . ASN A 1 103 ? 9.935   -8.371  4.262   1.00 0.00 ? 103 ASN A CB   1  
ATOM 1619  C CG   . ASN A 1 103 ? 9.397   -9.361  3.227   1.00 0.00 ? 103 ASN A CG   1  
ATOM 1620  O OD1  . ASN A 1 103 ? 10.107  -9.765  2.328   1.00 0.00 ? 103 ASN A OD1  1  
ATOM 1621  N ND2  . ASN A 1 103 ? 8.162   -9.772  3.317   1.00 0.00 ? 103 ASN A ND2  1  
ATOM 1622  H H    . ASN A 1 103 ? 12.852  -9.653  3.982   1.00 0.00 ? 103 ASN A H    1  
ATOM 1623  H HA   . ASN A 1 103 ? 11.540  -8.035  2.883   1.00 0.00 ? 103 ASN A HA   1  
ATOM 1624  H HB2  . ASN A 1 103 ? 9.861   -8.804  5.249   1.00 0.00 ? 103 ASN A HB2  1  
ATOM 1625  H HB3  . ASN A 1 103 ? 9.356   -7.461  4.223   1.00 0.00 ? 103 ASN A HB3  1  
ATOM 1626  H HD21 . ASN A 1 103 ? 7.589   -9.447  4.043   1.00 0.00 ? 103 ASN A HD21 1  
ATOM 1627  H HD22 . ASN A 1 103 ? 7.808   -10.407 2.661   1.00 0.00 ? 103 ASN A HD22 1  
ATOM 1628  N N    . MET A 1 104 ? 12.979  -6.453  4.859   1.00 0.00 ? 104 MET A N    1  
ATOM 1629  C CA   . MET A 1 104 ? 13.362  -5.127  5.410   1.00 0.00 ? 104 MET A CA   1  
ATOM 1630  C C    . MET A 1 104 ? 13.861  -4.232  4.272   1.00 0.00 ? 104 MET A C    1  
ATOM 1631  O O    . MET A 1 104 ? 14.302  -3.123  4.494   1.00 0.00 ? 104 MET A O    1  
ATOM 1632  C CB   . MET A 1 104 ? 14.474  -5.300  6.445   1.00 0.00 ? 104 MET A CB   1  
ATOM 1633  C CG   . MET A 1 104 ? 14.828  -3.936  7.039   1.00 0.00 ? 104 MET A CG   1  
ATOM 1634  S SD   . MET A 1 104 ? 14.558  -3.968  8.827   1.00 0.00 ? 104 MET A SD   1  
ATOM 1635  C CE   . MET A 1 104 ? 15.903  -2.846  9.275   1.00 0.00 ? 104 MET A CE   1  
ATOM 1636  H H    . MET A 1 104 ? 13.654  -7.151  4.742   1.00 0.00 ? 104 MET A H    1  
ATOM 1637  H HA   . MET A 1 104 ? 12.502  -4.669  5.877   1.00 0.00 ? 104 MET A HA   1  
ATOM 1638  H HB2  . MET A 1 104 ? 14.135  -5.960  7.231   1.00 0.00 ? 104 MET A HB2  1  
ATOM 1639  H HB3  . MET A 1 104 ? 15.347  -5.722  5.970   1.00 0.00 ? 104 MET A HB3  1  
ATOM 1640  H HG2  . MET A 1 104 ? 15.865  -3.712  6.835   1.00 0.00 ? 104 MET A HG2  1  
ATOM 1641  H HG3  . MET A 1 104 ? 14.202  -3.176  6.594   1.00 0.00 ? 104 MET A HG3  1  
ATOM 1642  H HE1  . MET A 1 104 ? 16.433  -2.547  8.382   1.00 0.00 ? 104 MET A HE1  1  
ATOM 1643  H HE2  . MET A 1 104 ? 15.498  -1.973  9.760   1.00 0.00 ? 104 MET A HE2  1  
ATOM 1644  H HE3  . MET A 1 104 ? 16.581  -3.348  9.951   1.00 0.00 ? 104 MET A HE3  1  
ATOM 1645  N N    . ILE A 1 105 ? 13.784  -4.699  3.053   1.00 0.00 ? 105 ILE A N    1  
ATOM 1646  C CA   . ILE A 1 105 ? 14.245  -3.866  1.905   1.00 0.00 ? 105 ILE A CA   1  
ATOM 1647  C C    . ILE A 1 105 ? 13.180  -3.892  0.810   1.00 0.00 ? 105 ILE A C    1  
ATOM 1648  O O    . ILE A 1 105 ? 12.301  -4.729  0.809   1.00 0.00 ? 105 ILE A O    1  
ATOM 1649  C CB   . ILE A 1 105 ? 15.556  -4.421  1.345   1.00 0.00 ? 105 ILE A CB   1  
ATOM 1650  C CG1  . ILE A 1 105 ? 16.637  -4.380  2.428   1.00 0.00 ? 105 ILE A CG1  1  
ATOM 1651  C CG2  . ILE A 1 105 ? 15.998  -3.568  0.153   1.00 0.00 ? 105 ILE A CG2  1  
ATOM 1652  C CD1  . ILE A 1 105 ? 17.998  -4.693  1.802   1.00 0.00 ? 105 ILE A CD1  1  
ATOM 1653  H H    . ILE A 1 105 ? 13.415  -5.595  2.891   1.00 0.00 ? 105 ILE A H    1  
ATOM 1654  H HA   . ILE A 1 105 ? 14.396  -2.849  2.236   1.00 0.00 ? 105 ILE A HA   1  
ATOM 1655  H HB   . ILE A 1 105 ? 15.405  -5.441  1.021   1.00 0.00 ? 105 ILE A HB   1  
ATOM 1656  H HG12 . ILE A 1 105 ? 16.663  -3.397  2.874   1.00 0.00 ? 105 ILE A HG12 1  
ATOM 1657  H HG13 . ILE A 1 105 ? 16.415  -5.115  3.187   1.00 0.00 ? 105 ILE A HG13 1  
ATOM 1658  H HG21 . ILE A 1 105 ? 16.040  -2.530  0.448   1.00 0.00 ? 105 ILE A HG21 1  
ATOM 1659  H HG22 . ILE A 1 105 ? 16.975  -3.888  -0.177  1.00 0.00 ? 105 ILE A HG22 1  
ATOM 1660  H HG23 . ILE A 1 105 ? 15.290  -3.684  -0.655  1.00 0.00 ? 105 ILE A HG23 1  
ATOM 1661  H HD11 . ILE A 1 105 ? 18.194  -3.997  1.000   1.00 0.00 ? 105 ILE A HD11 1  
ATOM 1662  H HD12 . ILE A 1 105 ? 18.769  -4.604  2.553   1.00 0.00 ? 105 ILE A HD12 1  
ATOM 1663  H HD13 . ILE A 1 105 ? 17.991  -5.700  1.411   1.00 0.00 ? 105 ILE A HD13 1  
ATOM 1664  N N    . VAL A 1 106 ? 13.248  -2.982  -0.121  1.00 0.00 ? 106 VAL A N    1  
ATOM 1665  C CA   . VAL A 1 106 ? 12.235  -2.956  -1.207  1.00 0.00 ? 106 VAL A CA   1  
ATOM 1666  C C    . VAL A 1 106 ? 12.872  -3.427  -2.519  1.00 0.00 ? 106 VAL A C    1  
ATOM 1667  O O    . VAL A 1 106 ? 13.983  -3.064  -2.848  1.00 0.00 ? 106 VAL A O    1  
ATOM 1668  C CB   . VAL A 1 106 ? 11.721  -1.525  -1.363  1.00 0.00 ? 106 VAL A CB   1  
ATOM 1669  C CG1  . VAL A 1 106 ? 10.996  -1.382  -2.699  1.00 0.00 ? 106 VAL A CG1  1  
ATOM 1670  C CG2  . VAL A 1 106 ? 10.754  -1.208  -0.220  1.00 0.00 ? 106 VAL A CG2  1  
ATOM 1671  H H    . VAL A 1 106 ? 13.961  -2.312  -0.104  1.00 0.00 ? 106 VAL A H    1  
ATOM 1672  H HA   . VAL A 1 106 ? 11.414  -3.608  -0.949  1.00 0.00 ? 106 VAL A HA   1  
ATOM 1673  H HB   . VAL A 1 106 ? 12.554  -0.838  -1.332  1.00 0.00 ? 106 VAL A HB   1  
ATOM 1674  H HG11 . VAL A 1 106 ? 10.280  -2.183  -2.805  1.00 0.00 ? 106 VAL A HG11 1  
ATOM 1675  H HG12 . VAL A 1 106 ? 10.484  -0.433  -2.730  1.00 0.00 ? 106 VAL A HG12 1  
ATOM 1676  H HG13 . VAL A 1 106 ? 11.716  -1.432  -3.502  1.00 0.00 ? 106 VAL A HG13 1  
ATOM 1677  H HG21 . VAL A 1 106 ? 10.189  -2.094  0.031   1.00 0.00 ? 106 VAL A HG21 1  
ATOM 1678  H HG22 . VAL A 1 106 ? 11.313  -0.881  0.645   1.00 0.00 ? 106 VAL A HG22 1  
ATOM 1679  H HG23 . VAL A 1 106 ? 10.077  -0.425  -0.527  1.00 0.00 ? 106 VAL A HG23 1  
ATOM 1680  N N    . ARG A 1 107 ? 12.169  -4.229  -3.272  1.00 0.00 ? 107 ARG A N    1  
ATOM 1681  C CA   . ARG A 1 107 ? 12.724  -4.720  -4.566  1.00 0.00 ? 107 ARG A CA   1  
ATOM 1682  C C    . ARG A 1 107 ? 11.808  -4.277  -5.709  1.00 0.00 ? 107 ARG A C    1  
ATOM 1683  O O    . ARG A 1 107 ? 12.193  -4.271  -6.861  1.00 0.00 ? 107 ARG A O    1  
ATOM 1684  C CB   . ARG A 1 107 ? 12.807  -6.249  -4.542  1.00 0.00 ? 107 ARG A CB   1  
ATOM 1685  C CG   . ARG A 1 107 ? 14.115  -6.700  -5.198  1.00 0.00 ? 107 ARG A CG   1  
ATOM 1686  C CD   . ARG A 1 107 ? 13.828  -7.227  -6.606  1.00 0.00 ? 107 ARG A CD   1  
ATOM 1687  N NE   . ARG A 1 107 ? 13.621  -8.702  -6.553  1.00 0.00 ? 107 ARG A NE   1  
ATOM 1688  C CZ   . ARG A 1 107 ? 12.902  -9.293  -7.468  1.00 0.00 ? 107 ARG A CZ   1  
ATOM 1689  N NH1  . ARG A 1 107 ? 13.245  -9.208  -8.724  1.00 0.00 ? 107 ARG A NH1  1  
ATOM 1690  N NH2  . ARG A 1 107 ? 11.839  -9.969  -7.126  1.00 0.00 ? 107 ARG A NH2  1  
ATOM 1691  H H    . ARG A 1 107 ? 11.272  -4.506  -2.989  1.00 0.00 ? 107 ARG A H    1  
ATOM 1692  H HA   . ARG A 1 107 ? 13.711  -4.307  -4.714  1.00 0.00 ? 107 ARG A HA   1  
ATOM 1693  H HB2  . ARG A 1 107 ? 12.779  -6.595  -3.519  1.00 0.00 ? 107 ARG A HB2  1  
ATOM 1694  H HB3  . ARG A 1 107 ? 11.972  -6.664  -5.087  1.00 0.00 ? 107 ARG A HB3  1  
ATOM 1695  H HG2  . ARG A 1 107 ? 14.795  -5.862  -5.258  1.00 0.00 ? 107 ARG A HG2  1  
ATOM 1696  H HG3  . ARG A 1 107 ? 14.562  -7.484  -4.607  1.00 0.00 ? 107 ARG A HG3  1  
ATOM 1697  H HD2  . ARG A 1 107 ? 12.939  -6.752  -6.994  1.00 0.00 ? 107 ARG A HD2  1  
ATOM 1698  H HD3  . ARG A 1 107 ? 14.666  -7.004  -7.251  1.00 0.00 ? 107 ARG A HD3  1  
ATOM 1699  H HE   . ARG A 1 107 ? 14.025  -9.228  -5.832  1.00 0.00 ? 107 ARG A HE   1  
ATOM 1700  H HH11 . ARG A 1 107 ? 14.060  -8.690  -8.986  1.00 0.00 ? 107 ARG A HH11 1  
ATOM 1701  H HH12 . ARG A 1 107 ? 12.694  -9.661  -9.425  1.00 0.00 ? 107 ARG A HH12 1  
ATOM 1702  H HH21 . ARG A 1 107 ? 11.576  -10.035 -6.163  1.00 0.00 ? 107 ARG A HH21 1  
ATOM 1703  H HH22 . ARG A 1 107 ? 11.287  -10.422 -7.827  1.00 0.00 ? 107 ARG A HH22 1  
ATOM 1704  N N    . SER A 1 108 ? 10.596  -3.904  -5.397  1.00 0.00 ? 108 SER A N    1  
ATOM 1705  C CA   . SER A 1 108 ? 9.651   -3.457  -6.459  1.00 0.00 ? 108 SER A CA   1  
ATOM 1706  C C    . SER A 1 108 ? 8.332   -3.032  -5.811  1.00 0.00 ? 108 SER A C    1  
ATOM 1707  O O    . SER A 1 108 ? 7.856   -3.657  -4.884  1.00 0.00 ? 108 SER A O    1  
ATOM 1708  C CB   . SER A 1 108 ? 9.395   -4.606  -7.435  1.00 0.00 ? 108 SER A CB   1  
ATOM 1709  O OG   . SER A 1 108 ? 9.170   -5.803  -6.703  1.00 0.00 ? 108 SER A OG   1  
ATOM 1710  H H    . SER A 1 108 ? 10.307  -3.915  -4.461  1.00 0.00 ? 108 SER A H    1  
ATOM 1711  H HA   . SER A 1 108 ? 10.078  -2.617  -6.989  1.00 0.00 ? 108 SER A HA   1  
ATOM 1712  H HB2  . SER A 1 108 ? 8.526   -4.387  -8.032  1.00 0.00 ? 108 SER A HB2  1  
ATOM 1713  H HB3  . SER A 1 108 ? 10.254  -4.724  -8.083  1.00 0.00 ? 108 SER A HB3  1  
ATOM 1714  H HG   . SER A 1 108 ? 8.432   -6.264  -7.108  1.00 0.00 ? 108 SER A HG   1  
ATOM 1715  N N    . CYS A 1 109 ? 7.747   -1.964  -6.278  1.00 0.00 ? 109 CYS A N    1  
ATOM 1716  C CA   . CYS A 1 109 ? 6.467   -1.489  -5.672  1.00 0.00 ? 109 CYS A CA   1  
ATOM 1717  C C    . CYS A 1 109 ? 5.285   -1.778  -6.604  1.00 0.00 ? 109 CYS A C    1  
ATOM 1718  O O    . CYS A 1 109 ? 5.449   -1.983  -7.790  1.00 0.00 ? 109 CYS A O    1  
ATOM 1719  C CB   . CYS A 1 109 ? 6.570   0.014   -5.422  1.00 0.00 ? 109 CYS A CB   1  
ATOM 1720  S SG   . CYS A 1 109 ? 7.397   0.286   -3.840  1.00 0.00 ? 109 CYS A SG   1  
ATOM 1721  H H    . CYS A 1 109 ? 8.158   -1.466  -7.016  1.00 0.00 ? 109 CYS A H    1  
ATOM 1722  H HA   . CYS A 1 109 ? 6.312   -1.994  -4.733  1.00 0.00 ? 109 CYS A HA   1  
ATOM 1723  H HB2  . CYS A 1 109 ? 7.146   0.472   -6.214  1.00 0.00 ? 109 CYS A HB2  1  
ATOM 1724  H HB3  . CYS A 1 109 ? 5.585   0.455   -5.395  1.00 0.00 ? 109 CYS A HB3  1  
ATOM 1725  N N    . LYS A 1 110 ? 4.088   -1.786  -6.069  1.00 0.00 ? 110 LYS A N    1  
ATOM 1726  C CA   . LYS A 1 110 ? 2.888   -2.049  -6.906  1.00 0.00 ? 110 LYS A CA   1  
ATOM 1727  C C    . LYS A 1 110 ? 1.787   -1.064  -6.494  1.00 0.00 ? 110 LYS A C    1  
ATOM 1728  O O    . LYS A 1 110 ? 2.014   0.126   -6.429  1.00 0.00 ? 110 LYS A O    1  
ATOM 1729  C CB   . LYS A 1 110 ? 2.423   -3.493  -6.692  1.00 0.00 ? 110 LYS A CB   1  
ATOM 1730  C CG   . LYS A 1 110 ? 1.534   -3.923  -7.861  1.00 0.00 ? 110 LYS A CG   1  
ATOM 1731  C CD   . LYS A 1 110 ? 1.015   -5.341  -7.613  1.00 0.00 ? 110 LYS A CD   1  
ATOM 1732  C CE   . LYS A 1 110 ? 1.759   -6.326  -8.517  1.00 0.00 ? 110 LYS A CE   1  
ATOM 1733  N NZ   . LYS A 1 110 ? 0.782   -7.027  -9.398  1.00 0.00 ? 110 LYS A NZ   1  
ATOM 1734  H H    . LYS A 1 110 ? 3.976   -1.611  -5.111  1.00 0.00 ? 110 LYS A H    1  
ATOM 1735  H HA   . LYS A 1 110 ? 3.136   -1.897  -7.948  1.00 0.00 ? 110 LYS A HA   1  
ATOM 1736  H HB2  . LYS A 1 110 ? 3.284   -4.143  -6.636  1.00 0.00 ? 110 LYS A HB2  1  
ATOM 1737  H HB3  . LYS A 1 110 ? 1.862   -3.558  -5.772  1.00 0.00 ? 110 LYS A HB3  1  
ATOM 1738  H HG2  . LYS A 1 110 ? 0.698   -3.243  -7.948  1.00 0.00 ? 110 LYS A HG2  1  
ATOM 1739  H HG3  . LYS A 1 110 ? 2.108   -3.907  -8.775  1.00 0.00 ? 110 LYS A HG3  1  
ATOM 1740  H HD2  . LYS A 1 110 ? 1.177   -5.607  -6.579  1.00 0.00 ? 110 LYS A HD2  1  
ATOM 1741  H HD3  . LYS A 1 110 ? -0.041  -5.381  -7.833  1.00 0.00 ? 110 LYS A HD3  1  
ATOM 1742  H HE2  . LYS A 1 110 ? 2.472   -5.789  -9.125  1.00 0.00 ? 110 LYS A HE2  1  
ATOM 1743  H HE3  . LYS A 1 110 ? 2.279   -7.051  -7.908  1.00 0.00 ? 110 LYS A HE3  1  
ATOM 1744  H HZ1  . LYS A 1 110 ? 0.081   -6.345  -9.751  1.00 0.00 ? 110 LYS A HZ1  1  
ATOM 1745  H HZ2  . LYS A 1 110 ? 1.286   -7.454  -10.202 1.00 0.00 ? 110 LYS A HZ2  1  
ATOM 1746  H HZ3  . LYS A 1 110 ? 0.297   -7.770  -8.857  1.00 0.00 ? 110 LYS A HZ3  1  
ATOM 1747  N N    . CYS A 1 111 ? 0.599   -1.530  -6.209  1.00 0.00 ? 111 CYS A N    1  
ATOM 1748  C CA   . CYS A 1 111 ? -0.477  -0.582  -5.807  1.00 0.00 ? 111 CYS A CA   1  
ATOM 1749  C C    . CYS A 1 111 ? -1.467  -1.282  -4.874  1.00 0.00 ? 111 CYS A C    1  
ATOM 1750  O O    . CYS A 1 111 ? -2.437  -1.867  -5.313  1.00 0.00 ? 111 CYS A O    1  
ATOM 1751  C CB   . CYS A 1 111 ? -1.208  -0.096  -7.060  1.00 0.00 ? 111 CYS A CB   1  
ATOM 1752  S SG   . CYS A 1 111 ? -0.023  0.712   -8.166  1.00 0.00 ? 111 CYS A SG   1  
ATOM 1753  H H    . CYS A 1 111 ? 0.415   -2.490  -6.258  1.00 0.00 ? 111 CYS A H    1  
ATOM 1754  H HA   . CYS A 1 111 ? -0.039  0.263   -5.298  1.00 0.00 ? 111 CYS A HA   1  
ATOM 1755  H HB2  . CYS A 1 111 ? -1.656  -0.939  -7.565  1.00 0.00 ? 111 CYS A HB2  1  
ATOM 1756  H HB3  . CYS A 1 111 ? -1.978  0.606   -6.779  1.00 0.00 ? 111 CYS A HB3  1  
ATOM 1757  N N    . SER A 1 112 ? -1.239  -1.222  -3.588  1.00 0.00 ? 112 SER A N    1  
ATOM 1758  C CA   . SER A 1 112 ? -2.180  -1.880  -2.641  1.00 0.00 ? 112 SER A CA   1  
ATOM 1759  C C    . SER A 1 112 ? -3.327  -0.919  -2.323  1.00 0.00 ? 112 SER A C    1  
ATOM 1760  O O    . SER A 1 112 ? -3.049  0.244   -2.079  1.00 0.00 ? 112 SER A O    1  
ATOM 1761  C CB   . SER A 1 112 ? -1.443  -2.237  -1.351  1.00 0.00 ? 112 SER A CB   1  
ATOM 1762  O OG   . SER A 1 112 ? -2.204  -3.195  -0.627  1.00 0.00 ? 112 SER A OG   1  
ATOM 1763  O OXT  . SER A 1 112 ? -4.464  -1.361  -2.333  1.00 0.00 ? 112 SER A OXT  1  
ATOM 1764  H H    . SER A 1 112 ? -0.454  -0.740  -3.244  1.00 0.00 ? 112 SER A H    1  
ATOM 1765  H HA   . SER A 1 112 ? -2.576  -2.778  -3.091  1.00 0.00 ? 112 SER A HA   1  
ATOM 1766  H HB2  . SER A 1 112 ? -0.480  -2.655  -1.587  1.00 0.00 ? 112 SER A HB2  1  
ATOM 1767  H HB3  . SER A 1 112 ? -1.309  -1.344  -0.755  1.00 0.00 ? 112 SER A HB3  1  
ATOM 1768  H HG   . SER A 1 112 ? -1.857  -4.066  -0.832  1.00 0.00 ? 112 SER A HG   1  
ATOM 1769  N N    . ALA B 1 1   ? -9.094  -0.752  15.747  1.00 0.00 ? 1   ALA B N    1  
ATOM 1770  C CA   . ALA B 1 1   ? -8.052  -0.952  14.700  1.00 0.00 ? 1   ALA B CA   1  
ATOM 1771  C C    . ALA B 1 1   ? -8.340  -0.036  13.507  1.00 0.00 ? 1   ALA B C    1  
ATOM 1772  O O    . ALA B 1 1   ? -9.213  0.807   13.557  1.00 0.00 ? 1   ALA B O    1  
ATOM 1773  C CB   . ALA B 1 1   ? -8.068  -2.410  14.237  1.00 0.00 ? 1   ALA B CB   1  
ATOM 1774  H H1   . ALA B 1 1   ? -9.559  0.168   15.601  1.00 0.00 ? 1   ALA B H1   1  
ATOM 1775  H H2   . ALA B 1 1   ? -9.800  -1.512  15.683  1.00 0.00 ? 1   ALA B H2   1  
ATOM 1776  H H3   . ALA B 1 1   ? -8.650  -0.773  16.686  1.00 0.00 ? 1   ALA B H3   1  
ATOM 1777  H HA   . ALA B 1 1   ? -7.081  -0.715  15.109  1.00 0.00 ? 1   ALA B HA   1  
ATOM 1778  H HB1  . ALA B 1 1   ? -8.580  -3.016  14.970  1.00 0.00 ? 1   ALA B HB1  1  
ATOM 1779  H HB2  . ALA B 1 1   ? -8.581  -2.482  13.289  1.00 0.00 ? 1   ALA B HB2  1  
ATOM 1780  H HB3  . ALA B 1 1   ? -7.053  -2.763  14.124  1.00 0.00 ? 1   ALA B HB3  1  
ATOM 1781  N N    . LEU B 1 2   ? -7.612  -0.196  12.436  1.00 0.00 ? 2   LEU B N    1  
ATOM 1782  C CA   . LEU B 1 2   ? -7.840  0.665   11.240  1.00 0.00 ? 2   LEU B CA   1  
ATOM 1783  C C    . LEU B 1 2   ? -8.850  -0.004  10.312  1.00 0.00 ? 2   LEU B C    1  
ATOM 1784  O O    . LEU B 1 2   ? -8.592  -0.212  9.143   1.00 0.00 ? 2   LEU B O    1  
ATOM 1785  C CB   . LEU B 1 2   ? -6.527  0.848   10.490  1.00 0.00 ? 2   LEU B CB   1  
ATOM 1786  C CG   . LEU B 1 2   ? -5.678  1.910   11.188  1.00 0.00 ? 2   LEU B CG   1  
ATOM 1787  C CD1  . LEU B 1 2   ? -4.298  1.969   10.534  1.00 0.00 ? 2   LEU B CD1  1  
ATOM 1788  C CD2  . LEU B 1 2   ? -6.359  3.274   11.057  1.00 0.00 ? 2   LEU B CD2  1  
ATOM 1789  H H    . LEU B 1 2   ? -6.913  -0.882  12.418  1.00 0.00 ? 2   LEU B H    1  
ATOM 1790  H HA   . LEU B 1 2   ? -8.218  1.628   11.551  1.00 0.00 ? 2   LEU B HA   1  
ATOM 1791  H HB2  . LEU B 1 2   ? -5.995  -0.090  10.475  1.00 0.00 ? 2   LEU B HB2  1  
ATOM 1792  H HB3  . LEU B 1 2   ? -6.734  1.162   9.479   1.00 0.00 ? 2   LEU B HB3  1  
ATOM 1793  H HG   . LEU B 1 2   ? -5.572  1.657   12.233  1.00 0.00 ? 2   LEU B HG   1  
ATOM 1794  H HD11 . LEU B 1 2   ? -4.237  1.227   9.752   1.00 0.00 ? 2   LEU B HD11 1  
ATOM 1795  H HD12 . LEU B 1 2   ? -4.143  2.951   10.111  1.00 0.00 ? 2   LEU B HD12 1  
ATOM 1796  H HD13 . LEU B 1 2   ? -3.539  1.774   11.277  1.00 0.00 ? 2   LEU B HD13 1  
ATOM 1797  H HD21 . LEU B 1 2   ? -7.406  3.135   10.833  1.00 0.00 ? 2   LEU B HD21 1  
ATOM 1798  H HD22 . LEU B 1 2   ? -6.259  3.818   11.985  1.00 0.00 ? 2   LEU B HD22 1  
ATOM 1799  H HD23 . LEU B 1 2   ? -5.893  3.833   10.260  1.00 0.00 ? 2   LEU B HD23 1  
ATOM 1800  N N    . ASP B 1 3   ? -9.997  -0.341  10.820  1.00 0.00 ? 3   ASP B N    1  
ATOM 1801  C CA   . ASP B 1 3   ? -11.023 -0.995  9.961   1.00 0.00 ? 3   ASP B CA   1  
ATOM 1802  C C    . ASP B 1 3   ? -12.114 0.013   9.604   1.00 0.00 ? 3   ASP B C    1  
ATOM 1803  O O    . ASP B 1 3   ? -12.139 1.123   10.097  1.00 0.00 ? 3   ASP B O    1  
ATOM 1804  C CB   . ASP B 1 3   ? -11.652 -2.179  10.700  1.00 0.00 ? 3   ASP B CB   1  
ATOM 1805  C CG   . ASP B 1 3   ? -11.639 -1.919  12.208  1.00 0.00 ? 3   ASP B CG   1  
ATOM 1806  O OD1  . ASP B 1 3   ? -10.623 -2.189  12.827  1.00 0.00 ? 3   ASP B OD1  1  
ATOM 1807  O OD2  . ASP B 1 3   ? -12.647 -1.456  12.718  1.00 0.00 ? 3   ASP B OD2  1  
ATOM 1808  H H    . ASP B 1 3   ? -10.181 -0.161  11.762  1.00 0.00 ? 3   ASP B H    1  
ATOM 1809  H HA   . ASP B 1 3   ? -10.555 -1.349  9.055   1.00 0.00 ? 3   ASP B HA   1  
ATOM 1810  H HB2  . ASP B 1 3   ? -12.672 -2.307  10.367  1.00 0.00 ? 3   ASP B HB2  1  
ATOM 1811  H HB3  . ASP B 1 3   ? -11.090 -3.073  10.485  1.00 0.00 ? 3   ASP B HB3  1  
ATOM 1812  N N    . THR B 1 4   ? -13.013 -0.371  8.745   1.00 0.00 ? 4   THR B N    1  
ATOM 1813  C CA   . THR B 1 4   ? -14.109 0.553   8.341   1.00 0.00 ? 4   THR B CA   1  
ATOM 1814  C C    . THR B 1 4   ? -15.128 0.679   9.475   1.00 0.00 ? 4   THR B C    1  
ATOM 1815  O O    . THR B 1 4   ? -16.096 1.406   9.374   1.00 0.00 ? 4   THR B O    1  
ATOM 1816  C CB   . THR B 1 4   ? -14.783 0.001   7.084   1.00 0.00 ? 4   THR B CB   1  
ATOM 1817  O OG1  . THR B 1 4   ? -15.673 -1.045  7.446   1.00 0.00 ? 4   THR B OG1  1  
ATOM 1818  C CG2  . THR B 1 4   ? -13.708 -0.539  6.136   1.00 0.00 ? 4   THR B CG2  1  
ATOM 1819  H H    . THR B 1 4   ? -12.966 -1.271  8.361   1.00 0.00 ? 4   THR B H    1  
ATOM 1820  H HA   . THR B 1 4   ? -13.700 1.525   8.128   1.00 0.00 ? 4   THR B HA   1  
ATOM 1821  H HB   . THR B 1 4   ? -15.330 0.789   6.591   1.00 0.00 ? 4   THR B HB   1  
ATOM 1822  H HG1  . THR B 1 4   ? -15.349 -1.442  8.258   1.00 0.00 ? 4   THR B HG1  1  
ATOM 1823  H HG21 . THR B 1 4   ? -12.730 -0.366  6.564   1.00 0.00 ? 4   THR B HG21 1  
ATOM 1824  H HG22 . THR B 1 4   ? -13.853 -1.600  5.993   1.00 0.00 ? 4   THR B HG22 1  
ATOM 1825  H HG23 . THR B 1 4   ? -13.778 -0.034  5.184   1.00 0.00 ? 4   THR B HG23 1  
ATOM 1826  N N    . ASN B 1 5   ? -14.913 -0.013  10.561  1.00 0.00 ? 5   ASN B N    1  
ATOM 1827  C CA   . ASN B 1 5   ? -15.864 0.083   11.703  1.00 0.00 ? 5   ASN B CA   1  
ATOM 1828  C C    . ASN B 1 5   ? -15.286 1.027   12.761  1.00 0.00 ? 5   ASN B C    1  
ATOM 1829  O O    . ASN B 1 5   ? -16.007 1.726   13.444  1.00 0.00 ? 5   ASN B O    1  
ATOM 1830  C CB   . ASN B 1 5   ? -16.076 -1.304  12.313  1.00 0.00 ? 5   ASN B CB   1  
ATOM 1831  C CG   . ASN B 1 5   ? -17.405 -1.331  13.070  1.00 0.00 ? 5   ASN B CG   1  
ATOM 1832  O OD1  . ASN B 1 5   ? -17.432 -1.540  14.267  1.00 0.00 ? 5   ASN B OD1  1  
ATOM 1833  N ND2  . ASN B 1 5   ? -18.518 -1.127  12.419  1.00 0.00 ? 5   ASN B ND2  1  
ATOM 1834  H H    . ASN B 1 5   ? -14.123 -0.587  10.630  1.00 0.00 ? 5   ASN B H    1  
ATOM 1835  H HA   . ASN B 1 5   ? -16.808 0.472   11.352  1.00 0.00 ? 5   ASN B HA   1  
ATOM 1836  H HB2  . ASN B 1 5   ? -16.094 -2.044  11.526  1.00 0.00 ? 5   ASN B HB2  1  
ATOM 1837  H HB3  . ASN B 1 5   ? -15.270 -1.524  12.996  1.00 0.00 ? 5   ASN B HB3  1  
ATOM 1838  H HD21 . ASN B 1 5   ? -18.497 -0.959  11.454  1.00 0.00 ? 5   ASN B HD21 1  
ATOM 1839  H HD22 . ASN B 1 5   ? -19.374 -1.142  12.895  1.00 0.00 ? 5   ASN B HD22 1  
ATOM 1840  N N    . TYR B 1 6   ? -13.988 1.047   12.904  1.00 0.00 ? 6   TYR B N    1  
ATOM 1841  C CA   . TYR B 1 6   ? -13.357 1.935   13.915  1.00 0.00 ? 6   TYR B CA   1  
ATOM 1842  C C    . TYR B 1 6   ? -13.116 3.321   13.310  1.00 0.00 ? 6   TYR B C    1  
ATOM 1843  O O    . TYR B 1 6   ? -13.040 4.308   14.014  1.00 0.00 ? 6   TYR B O    1  
ATOM 1844  C CB   . TYR B 1 6   ? -12.024 1.320   14.339  1.00 0.00 ? 6   TYR B CB   1  
ATOM 1845  C CG   . TYR B 1 6   ? -11.217 2.332   15.116  1.00 0.00 ? 6   TYR B CG   1  
ATOM 1846  C CD1  . TYR B 1 6   ? -11.524 2.596   16.456  1.00 0.00 ? 6   TYR B CD1  1  
ATOM 1847  C CD2  . TYR B 1 6   ? -10.158 3.004   14.494  1.00 0.00 ? 6   TYR B CD2  1  
ATOM 1848  C CE1  . TYR B 1 6   ? -10.771 3.534   17.174  1.00 0.00 ? 6   TYR B CE1  1  
ATOM 1849  C CE2  . TYR B 1 6   ? -9.405  3.941   15.211  1.00 0.00 ? 6   TYR B CE2  1  
ATOM 1850  C CZ   . TYR B 1 6   ? -9.712  4.206   16.551  1.00 0.00 ? 6   TYR B CZ   1  
ATOM 1851  O OH   . TYR B 1 6   ? -8.970  5.129   17.259  1.00 0.00 ? 6   TYR B OH   1  
ATOM 1852  H H    . TYR B 1 6   ? -13.424 0.472   12.347  1.00 0.00 ? 6   TYR B H    1  
ATOM 1853  H HA   . TYR B 1 6   ? -14.004 2.022   14.775  1.00 0.00 ? 6   TYR B HA   1  
ATOM 1854  H HB2  . TYR B 1 6   ? -12.210 0.454   14.954  1.00 0.00 ? 6   TYR B HB2  1  
ATOM 1855  H HB3  . TYR B 1 6   ? -11.472 1.022   13.460  1.00 0.00 ? 6   TYR B HB3  1  
ATOM 1856  H HD1  . TYR B 1 6   ? -12.341 2.078   16.936  1.00 0.00 ? 6   TYR B HD1  1  
ATOM 1857  H HD2  . TYR B 1 6   ? -9.922  2.798   13.460  1.00 0.00 ? 6   TYR B HD2  1  
ATOM 1858  H HE1  . TYR B 1 6   ? -11.008 3.738   18.208  1.00 0.00 ? 6   TYR B HE1  1  
ATOM 1859  H HE2  . TYR B 1 6   ? -8.587  4.458   14.729  1.00 0.00 ? 6   TYR B HE2  1  
ATOM 1860  H HH   . TYR B 1 6   ? -8.369  4.649   17.834  1.00 0.00 ? 6   TYR B HH   1  
ATOM 1861  N N    . CYS B 1 7   ? -12.991 3.405   12.014  1.00 0.00 ? 7   CYS B N    1  
ATOM 1862  C CA   . CYS B 1 7   ? -12.751 4.732   11.380  1.00 0.00 ? 7   CYS B CA   1  
ATOM 1863  C C    . CYS B 1 7   ? -14.029 5.570   11.447  1.00 0.00 ? 7   CYS B C    1  
ATOM 1864  O O    . CYS B 1 7   ? -13.993 6.746   11.748  1.00 0.00 ? 7   CYS B O    1  
ATOM 1865  C CB   . CYS B 1 7   ? -12.317 4.539   9.924   1.00 0.00 ? 7   CYS B CB   1  
ATOM 1866  S SG   . CYS B 1 7   ? -10.512 4.429   9.863   1.00 0.00 ? 7   CYS B SG   1  
ATOM 1867  H H    . CYS B 1 7   ? -13.053 2.599   11.460  1.00 0.00 ? 7   CYS B H    1  
ATOM 1868  H HA   . CYS B 1 7   ? -11.967 5.244   11.919  1.00 0.00 ? 7   CYS B HA   1  
ATOM 1869  H HB2  . CYS B 1 7   ? -12.747 3.625   9.533   1.00 0.00 ? 7   CYS B HB2  1  
ATOM 1870  H HB3  . CYS B 1 7   ? -12.648 5.376   9.327   1.00 0.00 ? 7   CYS B HB3  1  
ATOM 1871  N N    . PHE B 1 8   ? -15.159 4.977   11.181  1.00 0.00 ? 8   PHE B N    1  
ATOM 1872  C CA   . PHE B 1 8   ? -16.430 5.749   11.245  1.00 0.00 ? 8   PHE B CA   1  
ATOM 1873  C C    . PHE B 1 8   ? -17.015 5.651   12.655  1.00 0.00 ? 8   PHE B C    1  
ATOM 1874  O O    . PHE B 1 8   ? -18.204 5.477   12.836  1.00 0.00 ? 8   PHE B O    1  
ATOM 1875  C CB   . PHE B 1 8   ? -17.423 5.191   10.226  1.00 0.00 ? 8   PHE B CB   1  
ATOM 1876  C CG   . PHE B 1 8   ? -17.250 5.932   8.923   1.00 0.00 ? 8   PHE B CG   1  
ATOM 1877  C CD1  . PHE B 1 8   ? -17.788 7.215   8.776   1.00 0.00 ? 8   PHE B CD1  1  
ATOM 1878  C CD2  . PHE B 1 8   ? -16.542 5.344   7.868   1.00 0.00 ? 8   PHE B CD2  1  
ATOM 1879  C CE1  . PHE B 1 8   ? -17.622 7.911   7.574   1.00 0.00 ? 8   PHE B CE1  1  
ATOM 1880  C CE2  . PHE B 1 8   ? -16.373 6.041   6.665   1.00 0.00 ? 8   PHE B CE2  1  
ATOM 1881  C CZ   . PHE B 1 8   ? -16.914 7.325   6.519   1.00 0.00 ? 8   PHE B CZ   1  
ATOM 1882  H H    . PHE B 1 8   ? -15.172 4.025   10.948  1.00 0.00 ? 8   PHE B H    1  
ATOM 1883  H HA   . PHE B 1 8   ? -16.228 6.785   11.017  1.00 0.00 ? 8   PHE B HA   1  
ATOM 1884  H HB2  . PHE B 1 8   ? -17.231 4.139   10.075  1.00 0.00 ? 8   PHE B HB2  1  
ATOM 1885  H HB3  . PHE B 1 8   ? -18.431 5.328   10.588  1.00 0.00 ? 8   PHE B HB3  1  
ATOM 1886  H HD1  . PHE B 1 8   ? -18.335 7.667   9.591   1.00 0.00 ? 8   PHE B HD1  1  
ATOM 1887  H HD2  . PHE B 1 8   ? -16.127 4.353   7.981   1.00 0.00 ? 8   PHE B HD2  1  
ATOM 1888  H HE1  . PHE B 1 8   ? -18.039 8.902   7.461   1.00 0.00 ? 8   PHE B HE1  1  
ATOM 1889  H HE2  . PHE B 1 8   ? -15.828 5.589   5.850   1.00 0.00 ? 8   PHE B HE2  1  
ATOM 1890  H HZ   . PHE B 1 8   ? -16.783 7.865   5.593   1.00 0.00 ? 8   PHE B HZ   1  
ATOM 1891  N N    . SER B 1 9   ? -16.185 5.765   13.655  1.00 0.00 ? 9   SER B N    1  
ATOM 1892  C CA   . SER B 1 9   ? -16.684 5.685   15.057  1.00 0.00 ? 9   SER B CA   1  
ATOM 1893  C C    . SER B 1 9   ? -16.154 6.879   15.855  1.00 0.00 ? 9   SER B C    1  
ATOM 1894  O O    . SER B 1 9   ? -16.869 7.488   16.626  1.00 0.00 ? 9   SER B O    1  
ATOM 1895  C CB   . SER B 1 9   ? -16.197 4.387   15.701  1.00 0.00 ? 9   SER B CB   1  
ATOM 1896  O OG   . SER B 1 9   ? -16.835 4.222   16.962  1.00 0.00 ? 9   SER B OG   1  
ATOM 1897  H H    . SER B 1 9   ? -15.231 5.907   13.482  1.00 0.00 ? 9   SER B H    1  
ATOM 1898  H HA   . SER B 1 9   ? -17.764 5.704   15.056  1.00 0.00 ? 9   SER B HA   1  
ATOM 1899  H HB2  . SER B 1 9   ? -16.444 3.552   15.067  1.00 0.00 ? 9   SER B HB2  1  
ATOM 1900  H HB3  . SER B 1 9   ? -15.124 4.432   15.832  1.00 0.00 ? 9   SER B HB3  1  
ATOM 1901  H HG   . SER B 1 9   ? -16.353 4.743   17.608  1.00 0.00 ? 9   SER B HG   1  
ATOM 1902  N N    . SER B 1 10  ? -14.905 7.218   15.679  1.00 0.00 ? 10  SER B N    1  
ATOM 1903  C CA   . SER B 1 10  ? -14.332 8.372   16.430  1.00 0.00 ? 10  SER B CA   1  
ATOM 1904  C C    . SER B 1 10  ? -13.400 9.168   15.512  1.00 0.00 ? 10  SER B C    1  
ATOM 1905  O O    . SER B 1 10  ? -13.469 9.068   14.303  1.00 0.00 ? 10  SER B O    1  
ATOM 1906  C CB   . SER B 1 10  ? -13.541 7.855   17.632  1.00 0.00 ? 10  SER B CB   1  
ATOM 1907  O OG   . SER B 1 10  ? -14.033 8.467   18.816  1.00 0.00 ? 10  SER B OG   1  
ATOM 1908  H H    . SER B 1 10  ? -14.344 6.714   15.053  1.00 0.00 ? 10  SER B H    1  
ATOM 1909  H HA   . SER B 1 10  ? -15.131 9.011   16.773  1.00 0.00 ? 10  SER B HA   1  
ATOM 1910  H HB2  . SER B 1 10  ? -13.658 6.787   17.710  1.00 0.00 ? 10  SER B HB2  1  
ATOM 1911  H HB3  . SER B 1 10  ? -12.493 8.091   17.500  1.00 0.00 ? 10  SER B HB3  1  
ATOM 1912  H HG   . SER B 1 10  ? -14.816 7.987   19.095  1.00 0.00 ? 10  SER B HG   1  
ATOM 1913  N N    . THR B 1 11  ? -12.527 9.959   16.077  1.00 0.00 ? 11  THR B N    1  
ATOM 1914  C CA   . THR B 1 11  ? -11.592 10.759  15.236  1.00 0.00 ? 11  THR B CA   1  
ATOM 1915  C C    . THR B 1 11  ? -10.211 10.102  15.240  1.00 0.00 ? 11  THR B C    1  
ATOM 1916  O O    . THR B 1 11  ? -10.012 9.055   15.823  1.00 0.00 ? 11  THR B O    1  
ATOM 1917  C CB   . THR B 1 11  ? -11.481 12.178  15.801  1.00 0.00 ? 11  THR B CB   1  
ATOM 1918  O OG1  . THR B 1 11  ? -12.349 12.312  16.917  1.00 0.00 ? 11  THR B OG1  1  
ATOM 1919  C CG2  . THR B 1 11  ? -11.870 13.192  14.724  1.00 0.00 ? 11  THR B CG2  1  
ATOM 1920  H H    . THR B 1 11  ? -12.487 10.026  17.054  1.00 0.00 ? 11  THR B H    1  
ATOM 1921  H HA   . THR B 1 11  ? -11.967 10.804  14.224  1.00 0.00 ? 11  THR B HA   1  
ATOM 1922  H HB   . THR B 1 11  ? -10.464 12.363  16.111  1.00 0.00 ? 11  THR B HB   1  
ATOM 1923  H HG1  . THR B 1 11  ? -12.050 13.062  17.436  1.00 0.00 ? 11  THR B HG1  1  
ATOM 1924  H HG21 . THR B 1 11  ? -11.305 12.997  13.825  1.00 0.00 ? 11  THR B HG21 1  
ATOM 1925  H HG22 . THR B 1 11  ? -12.926 13.105  14.512  1.00 0.00 ? 11  THR B HG22 1  
ATOM 1926  H HG23 . THR B 1 11  ? -11.655 14.190  15.075  1.00 0.00 ? 11  THR B HG23 1  
ATOM 1927  N N    . GLU B 1 12  ? -9.253  10.710  14.593  1.00 0.00 ? 12  GLU B N    1  
ATOM 1928  C CA   . GLU B 1 12  ? -7.884  10.123  14.560  1.00 0.00 ? 12  GLU B CA   1  
ATOM 1929  C C    . GLU B 1 12  ? -6.987  10.971  13.656  1.00 0.00 ? 12  GLU B C    1  
ATOM 1930  O O    . GLU B 1 12  ? -7.457  11.779  12.880  1.00 0.00 ? 12  GLU B O    1  
ATOM 1931  C CB   . GLU B 1 12  ? -7.953  8.696   14.012  1.00 0.00 ? 12  GLU B CB   1  
ATOM 1932  C CG   . GLU B 1 12  ? -6.909  7.827   14.716  1.00 0.00 ? 12  GLU B CG   1  
ATOM 1933  C CD   . GLU B 1 12  ? -7.346  7.573   16.160  1.00 0.00 ? 12  GLU B CD   1  
ATOM 1934  O OE1  . GLU B 1 12  ? -8.518  7.303   16.364  1.00 0.00 ? 12  GLU B OE1  1  
ATOM 1935  O OE2  . GLU B 1 12  ? -6.501  7.652   17.036  1.00 0.00 ? 12  GLU B OE2  1  
ATOM 1936  H H    . GLU B 1 12  ? -9.435  11.554  14.131  1.00 0.00 ? 12  GLU B H    1  
ATOM 1937  H HA   . GLU B 1 12  ? -7.474  10.105  15.559  1.00 0.00 ? 12  GLU B HA   1  
ATOM 1938  H HB2  . GLU B 1 12  ? -8.938  8.290   14.187  1.00 0.00 ? 12  GLU B HB2  1  
ATOM 1939  H HB3  . GLU B 1 12  ? -7.752  8.708   12.951  1.00 0.00 ? 12  GLU B HB3  1  
ATOM 1940  H HG2  . GLU B 1 12  ? -6.816  6.884   14.196  1.00 0.00 ? 12  GLU B HG2  1  
ATOM 1941  H HG3  . GLU B 1 12  ? -5.957  8.335   14.715  1.00 0.00 ? 12  GLU B HG3  1  
ATOM 1942  N N    . LYS B 1 13  ? -5.697  10.791  13.747  1.00 0.00 ? 13  LYS B N    1  
ATOM 1943  C CA   . LYS B 1 13  ? -4.773  11.586  12.890  1.00 0.00 ? 13  LYS B CA   1  
ATOM 1944  C C    . LYS B 1 13  ? -3.951  10.639  12.012  1.00 0.00 ? 13  LYS B C    1  
ATOM 1945  O O    . LYS B 1 13  ? -3.369  11.042  11.025  1.00 0.00 ? 13  LYS B O    1  
ATOM 1946  C CB   . LYS B 1 13  ? -3.831  12.406  13.774  1.00 0.00 ? 13  LYS B CB   1  
ATOM 1947  C CG   . LYS B 1 13  ? -3.244  11.509  14.866  1.00 0.00 ? 13  LYS B CG   1  
ATOM 1948  C CD   . LYS B 1 13  ? -3.793  11.937  16.228  1.00 0.00 ? 13  LYS B CD   1  
ATOM 1949  C CE   . LYS B 1 13  ? -3.062  11.177  17.335  1.00 0.00 ? 13  LYS B CE   1  
ATOM 1950  N NZ   . LYS B 1 13  ? -3.822  9.941   17.675  1.00 0.00 ? 13  LYS B NZ   1  
ATOM 1951  H H    . LYS B 1 13  ? -5.337  10.133  14.378  1.00 0.00 ? 13  LYS B H    1  
ATOM 1952  H HA   . LYS B 1 13  ? -5.346  12.251  12.262  1.00 0.00 ? 13  LYS B HA   1  
ATOM 1953  H HB2  . LYS B 1 13  ? -3.031  12.808  13.170  1.00 0.00 ? 13  LYS B HB2  1  
ATOM 1954  H HB3  . LYS B 1 13  ? -4.379  13.215  14.232  1.00 0.00 ? 13  LYS B HB3  1  
ATOM 1955  H HG2  . LYS B 1 13  ? -3.516  10.482  14.673  1.00 0.00 ? 13  LYS B HG2  1  
ATOM 1956  H HG3  . LYS B 1 13  ? -2.168  11.603  14.870  1.00 0.00 ? 13  LYS B HG3  1  
ATOM 1957  H HD2  . LYS B 1 13  ? -3.643  12.999  16.358  1.00 0.00 ? 13  LYS B HD2  1  
ATOM 1958  H HD3  . LYS B 1 13  ? -4.849  11.714  16.277  1.00 0.00 ? 13  LYS B HD3  1  
ATOM 1959  H HE2  . LYS B 1 13  ? -2.073  10.909  16.995  1.00 0.00 ? 13  LYS B HE2  1  
ATOM 1960  H HE3  . LYS B 1 13  ? -2.983  11.804  18.211  1.00 0.00 ? 13  LYS B HE3  1  
ATOM 1961  H HZ1  . LYS B 1 13  ? -4.831  10.089  17.476  1.00 0.00 ? 13  LYS B HZ1  1  
ATOM 1962  H HZ2  . LYS B 1 13  ? -3.470  9.149   17.102  1.00 0.00 ? 13  LYS B HZ2  1  
ATOM 1963  H HZ3  . LYS B 1 13  ? -3.695  9.723   18.685  1.00 0.00 ? 13  LYS B HZ3  1  
ATOM 1964  N N    . ASN B 1 14  ? -3.898  9.383   12.364  1.00 0.00 ? 14  ASN B N    1  
ATOM 1965  C CA   . ASN B 1 14  ? -3.112  8.413   11.549  1.00 0.00 ? 14  ASN B CA   1  
ATOM 1966  C C    . ASN B 1 14  ? -4.000  7.841   10.442  1.00 0.00 ? 14  ASN B C    1  
ATOM 1967  O O    . ASN B 1 14  ? -5.124  8.263   10.254  1.00 0.00 ? 14  ASN B O    1  
ATOM 1968  C CB   . ASN B 1 14  ? -2.617  7.275   12.444  1.00 0.00 ? 14  ASN B CB   1  
ATOM 1969  C CG   . ASN B 1 14  ? -2.319  7.817   13.843  1.00 0.00 ? 14  ASN B CG   1  
ATOM 1970  O OD1  . ASN B 1 14  ? -3.155  7.753   14.723  1.00 0.00 ? 14  ASN B OD1  1  
ATOM 1971  N ND2  . ASN B 1 14  ? -1.155  8.353   14.088  1.00 0.00 ? 14  ASN B ND2  1  
ATOM 1972  H H    . ASN B 1 14  ? -4.374  9.077   13.165  1.00 0.00 ? 14  ASN B H    1  
ATOM 1973  H HA   . ASN B 1 14  ? -2.266  8.917   11.107  1.00 0.00 ? 14  ASN B HA   1  
ATOM 1974  H HB2  . ASN B 1 14  ? -3.379  6.511   12.507  1.00 0.00 ? 14  ASN B HB2  1  
ATOM 1975  H HB3  . ASN B 1 14  ? -1.717  6.852   12.024  1.00 0.00 ? 14  ASN B HB3  1  
ATOM 1976  H HD21 . ASN B 1 14  ? -0.481  8.406   13.379  1.00 0.00 ? 14  ASN B HD21 1  
ATOM 1977  H HD22 . ASN B 1 14  ? -0.955  8.702   14.982  1.00 0.00 ? 14  ASN B HD22 1  
ATOM 1978  N N    . CYS B 1 15  ? -3.505  6.883   9.706   1.00 0.00 ? 15  CYS B N    1  
ATOM 1979  C CA   . CYS B 1 15  ? -4.324  6.287   8.613   1.00 0.00 ? 15  CYS B CA   1  
ATOM 1980  C C    . CYS B 1 15  ? -5.741  6.022   9.126   1.00 0.00 ? 15  CYS B C    1  
ATOM 1981  O O    . CYS B 1 15  ? -5.977  5.928   10.314  1.00 0.00 ? 15  CYS B O    1  
ATOM 1982  C CB   . CYS B 1 15  ? -3.686  4.966   8.158   1.00 0.00 ? 15  CYS B CB   1  
ATOM 1983  S SG   . CYS B 1 15  ? -4.859  4.038   7.131   1.00 0.00 ? 15  CYS B SG   1  
ATOM 1984  H H    . CYS B 1 15  ? -2.597  6.556   9.873   1.00 0.00 ? 15  CYS B H    1  
ATOM 1985  H HA   . CYS B 1 15  ? -4.364  6.972   7.779   1.00 0.00 ? 15  CYS B HA   1  
ATOM 1986  H HB2  . CYS B 1 15  ? -2.796  5.176   7.585   1.00 0.00 ? 15  CYS B HB2  1  
ATOM 1987  H HB3  . CYS B 1 15  ? -3.424  4.377   9.025   1.00 0.00 ? 15  CYS B HB3  1  
ATOM 1988  N N    . CYS B 1 16  ? -6.683  5.889   8.234   1.00 0.00 ? 16  CYS B N    1  
ATOM 1989  C CA   . CYS B 1 16  ? -8.081  5.616   8.659   1.00 0.00 ? 16  CYS B CA   1  
ATOM 1990  C C    . CYS B 1 16  ? -8.965  5.460   7.422   1.00 0.00 ? 16  CYS B C    1  
ATOM 1991  O O    . CYS B 1 16  ? -9.153  6.387   6.658   1.00 0.00 ? 16  CYS B O    1  
ATOM 1992  C CB   . CYS B 1 16  ? -8.600  6.774   9.514   1.00 0.00 ? 16  CYS B CB   1  
ATOM 1993  S SG   . CYS B 1 16  ? -9.872  6.173   10.661  1.00 0.00 ? 16  CYS B SG   1  
ATOM 1994  H H    . CYS B 1 16  ? -6.468  5.961   7.280   1.00 0.00 ? 16  CYS B H    1  
ATOM 1995  H HA   . CYS B 1 16  ? -8.106  4.702   9.234   1.00 0.00 ? 16  CYS B HA   1  
ATOM 1996  H HB2  . CYS B 1 16  ? -7.782  7.199   10.077  1.00 0.00 ? 16  CYS B HB2  1  
ATOM 1997  H HB3  . CYS B 1 16  ? -9.025  7.531   8.872   1.00 0.00 ? 16  CYS B HB3  1  
ATOM 1998  N N    . VAL B 1 17  ? -9.506  4.292   7.218   1.00 0.00 ? 17  VAL B N    1  
ATOM 1999  C CA   . VAL B 1 17  ? -10.379 4.071   6.034   1.00 0.00 ? 17  VAL B CA   1  
ATOM 2000  C C    . VAL B 1 17  ? -11.564 5.041   6.079   1.00 0.00 ? 17  VAL B C    1  
ATOM 2001  O O    . VAL B 1 17  ? -12.322 5.065   7.029   1.00 0.00 ? 17  VAL B O    1  
ATOM 2002  C CB   . VAL B 1 17  ? -10.896 2.633   6.055   1.00 0.00 ? 17  VAL B CB   1  
ATOM 2003  C CG1  . VAL B 1 17  ? -11.766 2.427   7.284   1.00 0.00 ? 17  VAL B CG1  1  
ATOM 2004  C CG2  . VAL B 1 17  ? -11.740 2.367   4.816   1.00 0.00 ? 17  VAL B CG2  1  
ATOM 2005  H H    . VAL B 1 17  ? -9.337  3.557   7.845   1.00 0.00 ? 17  VAL B H    1  
ATOM 2006  H HA   . VAL B 1 17  ? -9.811  4.236   5.134   1.00 0.00 ? 17  VAL B HA   1  
ATOM 2007  H HB   . VAL B 1 17  ? -10.063 1.946   6.084   1.00 0.00 ? 17  VAL B HB   1  
ATOM 2008  H HG11 . VAL B 1 17  ? -11.230 2.750   8.160   1.00 0.00 ? 17  VAL B HG11 1  
ATOM 2009  H HG12 . VAL B 1 17  ? -12.673 3.004   7.179   1.00 0.00 ? 17  VAL B HG12 1  
ATOM 2010  H HG13 . VAL B 1 17  ? -12.013 1.381   7.373   1.00 0.00 ? 17  VAL B HG13 1  
ATOM 2011  H HG21 . VAL B 1 17  ? -12.219 3.284   4.507   1.00 0.00 ? 17  VAL B HG21 1  
ATOM 2012  H HG22 . VAL B 1 17  ? -11.108 2.001   4.023   1.00 0.00 ? 17  VAL B HG22 1  
ATOM 2013  H HG23 . VAL B 1 17  ? -12.493 1.629   5.050   1.00 0.00 ? 17  VAL B HG23 1  
ATOM 2014  N N    . ARG B 1 18  ? -11.733 5.841   5.061   1.00 0.00 ? 18  ARG B N    1  
ATOM 2015  C CA   . ARG B 1 18  ? -12.872 6.803   5.049   1.00 0.00 ? 18  ARG B CA   1  
ATOM 2016  C C    . ARG B 1 18  ? -13.924 6.332   4.041   1.00 0.00 ? 18  ARG B C    1  
ATOM 2017  O O    . ARG B 1 18  ? -13.715 5.383   3.311   1.00 0.00 ? 18  ARG B O    1  
ATOM 2018  C CB   . ARG B 1 18  ? -12.364 8.192   4.653   1.00 0.00 ? 18  ARG B CB   1  
ATOM 2019  C CG   . ARG B 1 18  ? -11.693 8.856   5.858   1.00 0.00 ? 18  ARG B CG   1  
ATOM 2020  C CD   . ARG B 1 18  ? -11.316 10.296  5.505   1.00 0.00 ? 18  ARG B CD   1  
ATOM 2021  N NE   . ARG B 1 18  ? -10.104 10.696  6.276   1.00 0.00 ? 18  ARG B NE   1  
ATOM 2022  C CZ   . ARG B 1 18  ? -10.211 11.520  7.283   1.00 0.00 ? 18  ARG B CZ   1  
ATOM 2023  N NH1  . ARG B 1 18  ? -10.815 12.667  7.127   1.00 0.00 ? 18  ARG B NH1  1  
ATOM 2024  N NH2  . ARG B 1 18  ? -9.713  11.198  8.445   1.00 0.00 ? 18  ARG B NH2  1  
ATOM 2025  H H    . ARG B 1 18  ? -11.112 5.807   4.303   1.00 0.00 ? 18  ARG B H    1  
ATOM 2026  H HA   . ARG B 1 18  ? -13.313 6.849   6.034   1.00 0.00 ? 18  ARG B HA   1  
ATOM 2027  H HB2  . ARG B 1 18  ? -11.649 8.098   3.850   1.00 0.00 ? 18  ARG B HB2  1  
ATOM 2028  H HB3  . ARG B 1 18  ? -13.195 8.800   4.326   1.00 0.00 ? 18  ARG B HB3  1  
ATOM 2029  H HG2  . ARG B 1 18  ? -12.375 8.856   6.695   1.00 0.00 ? 18  ARG B HG2  1  
ATOM 2030  H HG3  . ARG B 1 18  ? -10.801 8.307   6.119   1.00 0.00 ? 18  ARG B HG3  1  
ATOM 2031  H HD2  . ARG B 1 18  ? -11.109 10.366  4.448   1.00 0.00 ? 18  ARG B HD2  1  
ATOM 2032  H HD3  . ARG B 1 18  ? -12.135 10.955  5.755   1.00 0.00 ? 18  ARG B HD3  1  
ATOM 2033  H HE   . ARG B 1 18  ? -9.226  10.339  6.027   1.00 0.00 ? 18  ARG B HE   1  
ATOM 2034  H HH11 . ARG B 1 18  ? -11.197 12.914  6.236   1.00 0.00 ? 18  ARG B HH11 1  
ATOM 2035  H HH12 . ARG B 1 18  ? -10.897 13.298  7.899   1.00 0.00 ? 18  ARG B HH12 1  
ATOM 2036  H HH21 . ARG B 1 18  ? -9.250  10.321  8.565   1.00 0.00 ? 18  ARG B HH21 1  
ATOM 2037  H HH22 . ARG B 1 18  ? -9.795  11.830  9.217   1.00 0.00 ? 18  ARG B HH22 1  
ATOM 2038  N N    . GLN B 1 19  ? -15.055 6.984   3.995   1.00 0.00 ? 19  GLN B N    1  
ATOM 2039  C CA   . GLN B 1 19  ? -16.120 6.567   3.035   1.00 0.00 ? 19  GLN B CA   1  
ATOM 2040  C C    . GLN B 1 19  ? -15.679 6.877   1.606   1.00 0.00 ? 19  GLN B C    1  
ATOM 2041  O O    . GLN B 1 19  ? -15.006 7.856   1.350   1.00 0.00 ? 19  GLN B O    1  
ATOM 2042  C CB   . GLN B 1 19  ? -17.414 7.325   3.339   1.00 0.00 ? 19  GLN B CB   1  
ATOM 2043  C CG   . GLN B 1 19  ? -17.135 8.829   3.364   1.00 0.00 ? 19  GLN B CG   1  
ATOM 2044  C CD   . GLN B 1 19  ? -18.449 9.590   3.546   1.00 0.00 ? 19  GLN B CD   1  
ATOM 2045  O OE1  . GLN B 1 19  ? -19.132 9.886   2.586   1.00 0.00 ? 19  GLN B OE1  1  
ATOM 2046  N NE2  . GLN B 1 19  ? -18.836 9.921   4.748   1.00 0.00 ? 19  GLN B NE2  1  
ATOM 2047  H H    . GLN B 1 19  ? -15.206 7.745   4.594   1.00 0.00 ? 19  GLN B H    1  
ATOM 2048  H HA   . GLN B 1 19  ? -16.296 5.506   3.131   1.00 0.00 ? 19  GLN B HA   1  
ATOM 2049  H HB2  . GLN B 1 19  ? -18.145 7.107   2.573   1.00 0.00 ? 19  GLN B HB2  1  
ATOM 2050  H HB3  . GLN B 1 19  ? -17.798 7.015   4.299   1.00 0.00 ? 19  GLN B HB3  1  
ATOM 2051  H HG2  . GLN B 1 19  ? -16.469 9.058   4.183   1.00 0.00 ? 19  GLN B HG2  1  
ATOM 2052  H HG3  . GLN B 1 19  ? -16.676 9.125   2.433   1.00 0.00 ? 19  GLN B HG3  1  
ATOM 2053  H HE21 . GLN B 1 19  ? -18.285 9.682   5.523   1.00 0.00 ? 19  GLN B HE21 1  
ATOM 2054  H HE22 . GLN B 1 19  ? -19.676 10.408  4.875   1.00 0.00 ? 19  GLN B HE22 1  
ATOM 2055  N N    . LEU B 1 20  ? -16.059 6.051   0.671   1.00 0.00 ? 20  LEU B N    1  
ATOM 2056  C CA   . LEU B 1 20  ? -15.669 6.297   -0.743  1.00 0.00 ? 20  LEU B CA   1  
ATOM 2057  C C    . LEU B 1 20  ? -16.660 5.602   -1.673  1.00 0.00 ? 20  LEU B C    1  
ATOM 2058  O O    . LEU B 1 20  ? -16.276 4.938   -2.613  1.00 0.00 ? 20  LEU B O    1  
ATOM 2059  C CB   . LEU B 1 20  ? -14.268 5.742   -0.993  1.00 0.00 ? 20  LEU B CB   1  
ATOM 2060  C CG   . LEU B 1 20  ? -13.806 6.117   -2.404  1.00 0.00 ? 20  LEU B CG   1  
ATOM 2061  C CD1  . LEU B 1 20  ? -13.924 7.629   -2.596  1.00 0.00 ? 20  LEU B CD1  1  
ATOM 2062  C CD2  . LEU B 1 20  ? -12.350 5.690   -2.586  1.00 0.00 ? 20  LEU B CD2  1  
ATOM 2063  H H    . LEU B 1 20  ? -16.605 5.269   0.899   1.00 0.00 ? 20  LEU B H    1  
ATOM 2064  H HA   . LEU B 1 20  ? -15.674 7.359   -0.937  1.00 0.00 ? 20  LEU B HA   1  
ATOM 2065  H HB2  . LEU B 1 20  ? -13.587 6.160   -0.271  1.00 0.00 ? 20  LEU B HB2  1  
ATOM 2066  H HB3  . LEU B 1 20  ? -14.282 4.667   -0.895  1.00 0.00 ? 20  LEU B HB3  1  
ATOM 2067  H HG   . LEU B 1 20  ? -14.421 5.614   -3.134  1.00 0.00 ? 20  LEU B HG   1  
ATOM 2068  H HD11 . LEU B 1 20  ? -13.591 8.133   -1.701  1.00 0.00 ? 20  LEU B HD11 1  
ATOM 2069  H HD12 . LEU B 1 20  ? -13.311 7.934   -3.430  1.00 0.00 ? 20  LEU B HD12 1  
ATOM 2070  H HD13 . LEU B 1 20  ? -14.954 7.888   -2.793  1.00 0.00 ? 20  LEU B HD13 1  
ATOM 2071  H HD21 . LEU B 1 20  ? -11.749 6.118   -1.799  1.00 0.00 ? 20  LEU B HD21 1  
ATOM 2072  H HD22 . LEU B 1 20  ? -12.283 4.612   -2.544  1.00 0.00 ? 20  LEU B HD22 1  
ATOM 2073  H HD23 . LEU B 1 20  ? -11.990 6.036   -3.542  1.00 0.00 ? 20  LEU B HD23 1  
ATOM 2074  N N    . TYR B 1 21  ? -17.932 5.741   -1.431  1.00 0.00 ? 21  TYR B N    1  
ATOM 2075  C CA   . TYR B 1 21  ? -18.907 5.074   -2.333  1.00 0.00 ? 21  TYR B CA   1  
ATOM 2076  C C    . TYR B 1 21  ? -18.520 5.384   -3.776  1.00 0.00 ? 21  TYR B C    1  
ATOM 2077  O O    . TYR B 1 21  ? -18.251 6.515   -4.127  1.00 0.00 ? 21  TYR B O    1  
ATOM 2078  C CB   . TYR B 1 21  ? -20.323 5.587   -2.076  1.00 0.00 ? 21  TYR B CB   1  
ATOM 2079  C CG   . TYR B 1 21  ? -21.254 4.954   -3.083  1.00 0.00 ? 21  TYR B CG   1  
ATOM 2080  C CD1  . TYR B 1 21  ? -21.248 5.390   -4.416  1.00 0.00 ? 21  TYR B CD1  1  
ATOM 2081  C CD2  . TYR B 1 21  ? -22.116 3.926   -2.688  1.00 0.00 ? 21  TYR B CD2  1  
ATOM 2082  C CE1  . TYR B 1 21  ? -22.105 4.798   -5.352  1.00 0.00 ? 21  TYR B CE1  1  
ATOM 2083  C CE2  . TYR B 1 21  ? -22.973 3.333   -3.622  1.00 0.00 ? 21  TYR B CE2  1  
ATOM 2084  C CZ   . TYR B 1 21  ? -22.968 3.768   -4.954  1.00 0.00 ? 21  TYR B CZ   1  
ATOM 2085  O OH   . TYR B 1 21  ? -23.814 3.183   -5.874  1.00 0.00 ? 21  TYR B OH   1  
ATOM 2086  H H    . TYR B 1 21  ? -18.240 6.277   -0.670  1.00 0.00 ? 21  TYR B H    1  
ATOM 2087  H HA   . TYR B 1 21  ? -18.874 4.006   -2.172  1.00 0.00 ? 21  TYR B HA   1  
ATOM 2088  H HB2  . TYR B 1 21  ? -20.630 5.317   -1.075  1.00 0.00 ? 21  TYR B HB2  1  
ATOM 2089  H HB3  . TYR B 1 21  ? -20.346 6.660   -2.187  1.00 0.00 ? 21  TYR B HB3  1  
ATOM 2090  H HD1  . TYR B 1 21  ? -20.581 6.183   -4.721  1.00 0.00 ? 21  TYR B HD1  1  
ATOM 2091  H HD2  . TYR B 1 21  ? -22.117 3.587   -1.662  1.00 0.00 ? 21  TYR B HD2  1  
ATOM 2092  H HE1  . TYR B 1 21  ? -22.097 5.133   -6.383  1.00 0.00 ? 21  TYR B HE1  1  
ATOM 2093  H HE2  . TYR B 1 21  ? -23.638 2.539   -3.315  1.00 0.00 ? 21  TYR B HE2  1  
ATOM 2094  H HH   . TYR B 1 21  ? -23.793 2.233   -5.733  1.00 0.00 ? 21  TYR B HH   1  
ATOM 2095  N N    . ILE B 1 22  ? -18.486 4.392   -4.615  1.00 0.00 ? 22  ILE B N    1  
ATOM 2096  C CA   . ILE B 1 22  ? -18.110 4.638   -6.031  1.00 0.00 ? 22  ILE B CA   1  
ATOM 2097  C C    . ILE B 1 22  ? -19.239 4.168   -6.946  1.00 0.00 ? 22  ILE B C    1  
ATOM 2098  O O    . ILE B 1 22  ? -19.567 2.999   -6.992  1.00 0.00 ? 22  ILE B O    1  
ATOM 2099  C CB   . ILE B 1 22  ? -16.831 3.865   -6.359  1.00 0.00 ? 22  ILE B CB   1  
ATOM 2100  C CG1  . ILE B 1 22  ? -15.695 4.356   -5.459  1.00 0.00 ? 22  ILE B CG1  1  
ATOM 2101  C CG2  . ILE B 1 22  ? -16.456 4.096   -7.824  1.00 0.00 ? 22  ILE B CG2  1  
ATOM 2102  C CD1  . ILE B 1 22  ? -14.363 3.803   -5.970  1.00 0.00 ? 22  ILE B CD1  1  
ATOM 2103  H H    . ILE B 1 22  ? -18.704 3.487   -4.313  1.00 0.00 ? 22  ILE B H    1  
ATOM 2104  H HA   . ILE B 1 22  ? -17.942 5.694   -6.181  1.00 0.00 ? 22  ILE B HA   1  
ATOM 2105  H HB   . ILE B 1 22  ? -16.996 2.811   -6.192  1.00 0.00 ? 22  ILE B HB   1  
ATOM 2106  H HG12 . ILE B 1 22  ? -15.666 5.436   -5.472  1.00 0.00 ? 22  ILE B HG12 1  
ATOM 2107  H HG13 . ILE B 1 22  ? -15.861 4.012   -4.450  1.00 0.00 ? 22  ILE B HG13 1  
ATOM 2108  H HG21 . ILE B 1 22  ? -16.384 5.156   -8.015  1.00 0.00 ? 22  ILE B HG21 1  
ATOM 2109  H HG22 . ILE B 1 22  ? -15.504 3.628   -8.029  1.00 0.00 ? 22  ILE B HG22 1  
ATOM 2110  H HG23 . ILE B 1 22  ? -17.213 3.665   -8.462  1.00 0.00 ? 22  ILE B HG23 1  
ATOM 2111  H HD11 . ILE B 1 22  ? -14.238 4.068   -7.010  1.00 0.00 ? 22  ILE B HD11 1  
ATOM 2112  H HD12 . ILE B 1 22  ? -13.553 4.224   -5.392  1.00 0.00 ? 22  ILE B HD12 1  
ATOM 2113  H HD13 . ILE B 1 22  ? -14.357 2.728   -5.870  1.00 0.00 ? 22  ILE B HD13 1  
ATOM 2114  N N    . ASP B 1 23  ? -19.829 5.066   -7.685  1.00 0.00 ? 23  ASP B N    1  
ATOM 2115  C CA   . ASP B 1 23  ? -20.924 4.659   -8.604  1.00 0.00 ? 23  ASP B CA   1  
ATOM 2116  C C    . ASP B 1 23  ? -20.297 4.150   -9.899  1.00 0.00 ? 23  ASP B C    1  
ATOM 2117  O O    . ASP B 1 23  ? -19.897 4.911   -10.753 1.00 0.00 ? 23  ASP B O    1  
ATOM 2118  C CB   . ASP B 1 23  ? -21.836 5.855   -8.880  1.00 0.00 ? 23  ASP B CB   1  
ATOM 2119  C CG   . ASP B 1 23  ? -22.905 5.471   -9.909  1.00 0.00 ? 23  ASP B CG   1  
ATOM 2120  O OD1  . ASP B 1 23  ? -22.565 4.805   -10.872 1.00 0.00 ? 23  ASP B OD1  1  
ATOM 2121  O OD2  . ASP B 1 23  ? -24.048 5.851   -9.713  1.00 0.00 ? 23  ASP B OD2  1  
ATOM 2122  H H    . ASP B 1 23  ? -19.545 6.002   -7.642  1.00 0.00 ? 23  ASP B H    1  
ATOM 2123  H HA   . ASP B 1 23  ? -21.498 3.866   -8.152  1.00 0.00 ? 23  ASP B HA   1  
ATOM 2124  H HB2  . ASP B 1 23  ? -22.317 6.158   -7.961  1.00 0.00 ? 23  ASP B HB2  1  
ATOM 2125  H HB3  . ASP B 1 23  ? -21.250 6.670   -9.259  1.00 0.00 ? 23  ASP B HB3  1  
ATOM 2126  N N    . PHE B 1 24  ? -20.196 2.852   -10.006 1.00 0.00 ? 24  PHE B N    1  
ATOM 2127  C CA   . PHE B 1 24  ? -19.582 2.184   -11.199 1.00 0.00 ? 24  PHE B CA   1  
ATOM 2128  C C    . PHE B 1 24  ? -19.430 3.124   -12.401 1.00 0.00 ? 24  PHE B C    1  
ATOM 2129  O O    . PHE B 1 24  ? -18.350 3.284   -12.935 1.00 0.00 ? 24  PHE B O    1  
ATOM 2130  C CB   . PHE B 1 24  ? -20.467 1.006   -11.612 1.00 0.00 ? 24  PHE B CB   1  
ATOM 2131  C CG   . PHE B 1 24  ? -20.026 -0.234  -10.877 1.00 0.00 ? 24  PHE B CG   1  
ATOM 2132  C CD1  . PHE B 1 24  ? -18.775 -0.796  -11.151 1.00 0.00 ? 24  PHE B CD1  1  
ATOM 2133  C CD2  . PHE B 1 24  ? -20.862 -0.818  -9.919  1.00 0.00 ? 24  PHE B CD2  1  
ATOM 2134  C CE1  . PHE B 1 24  ? -18.359 -1.942  -10.467 1.00 0.00 ? 24  PHE B CE1  1  
ATOM 2135  C CE2  . PHE B 1 24  ? -20.446 -1.967  -9.237  1.00 0.00 ? 24  PHE B CE2  1  
ATOM 2136  C CZ   . PHE B 1 24  ? -19.195 -2.528  -9.511  1.00 0.00 ? 24  PHE B CZ   1  
ATOM 2137  H H    . PHE B 1 24  ? -20.521 2.295   -9.268  1.00 0.00 ? 24  PHE B H    1  
ATOM 2138  H HA   . PHE B 1 24  ? -18.610 1.805   -10.926 1.00 0.00 ? 24  PHE B HA   1  
ATOM 2139  H HB2  . PHE B 1 24  ? -21.496 1.225   -11.367 1.00 0.00 ? 24  PHE B HB2  1  
ATOM 2140  H HB3  . PHE B 1 24  ? -20.376 0.844   -12.676 1.00 0.00 ? 24  PHE B HB3  1  
ATOM 2141  H HD1  . PHE B 1 24  ? -18.133 -0.348  -11.892 1.00 0.00 ? 24  PHE B HD1  1  
ATOM 2142  H HD2  . PHE B 1 24  ? -21.828 -0.384  -9.708  1.00 0.00 ? 24  PHE B HD2  1  
ATOM 2143  H HE1  . PHE B 1 24  ? -17.394 -2.375  -10.680 1.00 0.00 ? 24  PHE B HE1  1  
ATOM 2144  H HE2  . PHE B 1 24  ? -21.089 -2.422  -8.500  1.00 0.00 ? 24  PHE B HE2  1  
ATOM 2145  H HZ   . PHE B 1 24  ? -18.874 -3.411  -8.983  1.00 0.00 ? 24  PHE B HZ   1  
ATOM 2146  N N    . ARG B 1 25  ? -20.499 3.712   -12.861 1.00 0.00 ? 25  ARG B N    1  
ATOM 2147  C CA   . ARG B 1 25  ? -20.397 4.585   -14.066 1.00 0.00 ? 25  ARG B CA   1  
ATOM 2148  C C    . ARG B 1 25  ? -20.159 6.051   -13.696 1.00 0.00 ? 25  ARG B C    1  
ATOM 2149  O O    . ARG B 1 25  ? -19.526 6.782   -14.432 1.00 0.00 ? 25  ARG B O    1  
ATOM 2150  C CB   . ARG B 1 25  ? -21.690 4.474   -14.876 1.00 0.00 ? 25  ARG B CB   1  
ATOM 2151  C CG   . ARG B 1 25  ? -22.891 4.820   -13.992 1.00 0.00 ? 25  ARG B CG   1  
ATOM 2152  C CD   . ARG B 1 25  ? -23.747 5.885   -14.682 1.00 0.00 ? 25  ARG B CD   1  
ATOM 2153  N NE   . ARG B 1 25  ? -22.863 6.932   -15.269 1.00 0.00 ? 25  ARG B NE   1  
ATOM 2154  C CZ   . ARG B 1 25  ? -22.742 7.032   -16.564 1.00 0.00 ? 25  ARG B CZ   1  
ATOM 2155  N NH1  . ARG B 1 25  ? -22.929 5.984   -17.319 1.00 0.00 ? 25  ARG B NH1  1  
ATOM 2156  N NH2  . ARG B 1 25  ? -22.433 8.179   -17.104 1.00 0.00 ? 25  ARG B NH2  1  
ATOM 2157  H H    . ARG B 1 25  ? -21.368 3.553   -12.440 1.00 0.00 ? 25  ARG B H    1  
ATOM 2158  H HA   . ARG B 1 25  ? -19.577 4.240   -14.675 1.00 0.00 ? 25  ARG B HA   1  
ATOM 2159  H HB2  . ARG B 1 25  ? -21.649 5.157   -15.710 1.00 0.00 ? 25  ARG B HB2  1  
ATOM 2160  H HB3  . ARG B 1 25  ? -21.797 3.465   -15.242 1.00 0.00 ? 25  ARG B HB3  1  
ATOM 2161  H HG2  . ARG B 1 25  ? -23.485 3.932   -13.829 1.00 0.00 ? 25  ARG B HG2  1  
ATOM 2162  H HG3  . ARG B 1 25  ? -22.545 5.199   -13.044 1.00 0.00 ? 25  ARG B HG3  1  
ATOM 2163  H HD2  . ARG B 1 25  ? -24.330 5.426   -15.466 1.00 0.00 ? 25  ARG B HD2  1  
ATOM 2164  H HD3  . ARG B 1 25  ? -24.410 6.338   -13.959 1.00 0.00 ? 25  ARG B HD3  1  
ATOM 2165  H HE   . ARG B 1 25  ? -22.373 7.545   -14.682 1.00 0.00 ? 25  ARG B HE   1  
ATOM 2166  H HH11 . ARG B 1 25  ? -23.165 5.105   -16.905 1.00 0.00 ? 25  ARG B HH11 1  
ATOM 2167  H HH12 . ARG B 1 25  ? -22.836 6.060   -18.312 1.00 0.00 ? 25  ARG B HH12 1  
ATOM 2168  H HH21 . ARG B 1 25  ? -22.289 8.981   -16.525 1.00 0.00 ? 25  ARG B HH21 1  
ATOM 2169  H HH22 . ARG B 1 25  ? -22.339 8.255   -18.097 1.00 0.00 ? 25  ARG B HH22 1  
ATOM 2170  N N    . LYS B 1 26  ? -20.673 6.506   -12.593 1.00 0.00 ? 26  LYS B N    1  
ATOM 2171  C CA   . LYS B 1 26  ? -20.476 7.941   -12.237 1.00 0.00 ? 26  LYS B CA   1  
ATOM 2172  C C    . LYS B 1 26  ? -18.993 8.230   -12.010 1.00 0.00 ? 26  LYS B C    1  
ATOM 2173  O O    . LYS B 1 26  ? -18.450 9.185   -12.527 1.00 0.00 ? 26  LYS B O    1  
ATOM 2174  C CB   . LYS B 1 26  ? -21.236 8.264   -10.956 1.00 0.00 ? 26  LYS B CB   1  
ATOM 2175  C CG   . LYS B 1 26  ? -21.718 9.715   -11.010 1.00 0.00 ? 26  LYS B CG   1  
ATOM 2176  C CD   . LYS B 1 26  ? -22.102 10.185  -9.606  1.00 0.00 ? 26  LYS B CD   1  
ATOM 2177  C CE   . LYS B 1 26  ? -23.353 11.070  -9.674  1.00 0.00 ? 26  LYS B CE   1  
ATOM 2178  N NZ   . LYS B 1 26  ? -23.456 11.713  -11.017 1.00 0.00 ? 26  LYS B NZ   1  
ATOM 2179  H H    . LYS B 1 26  ? -21.201 5.918   -12.011 1.00 0.00 ? 26  LYS B H    1  
ATOM 2180  H HA   . LYS B 1 26  ? -20.845 8.563   -13.038 1.00 0.00 ? 26  LYS B HA   1  
ATOM 2181  H HB2  . LYS B 1 26  ? -22.077 7.598   -10.856 1.00 0.00 ? 26  LYS B HB2  1  
ATOM 2182  H HB3  . LYS B 1 26  ? -20.576 8.142   -10.110 1.00 0.00 ? 26  LYS B HB3  1  
ATOM 2183  H HG2  . LYS B 1 26  ? -20.926 10.342  -11.395 1.00 0.00 ? 26  LYS B HG2  1  
ATOM 2184  H HG3  . LYS B 1 26  ? -22.578 9.783   -11.658 1.00 0.00 ? 26  LYS B HG3  1  
ATOM 2185  H HD2  . LYS B 1 26  ? -22.303 9.325   -8.983  1.00 0.00 ? 26  LYS B HD2  1  
ATOM 2186  H HD3  . LYS B 1 26  ? -21.287 10.752  -9.182  1.00 0.00 ? 26  LYS B HD3  1  
ATOM 2187  H HE2  . LYS B 1 26  ? -24.230 10.465  -9.500  1.00 0.00 ? 26  LYS B HE2  1  
ATOM 2188  H HE3  . LYS B 1 26  ? -23.291 11.836  -8.914  1.00 0.00 ? 26  LYS B HE3  1  
ATOM 2189  H HZ1  . LYS B 1 26  ? -22.503 11.864  -11.406 1.00 0.00 ? 26  LYS B HZ1  1  
ATOM 2190  H HZ2  . LYS B 1 26  ? -23.999 11.096  -11.655 1.00 0.00 ? 26  LYS B HZ2  1  
ATOM 2191  H HZ3  . LYS B 1 26  ? -23.939 12.629  -10.927 1.00 0.00 ? 26  LYS B HZ3  1  
ATOM 2192  N N    . ASP B 1 27  ? -18.344 7.430   -11.214 1.00 0.00 ? 27  ASP B N    1  
ATOM 2193  C CA   . ASP B 1 27  ? -16.909 7.672   -10.920 1.00 0.00 ? 27  ASP B CA   1  
ATOM 2194  C C    . ASP B 1 27  ? -16.003 6.856   -11.849 1.00 0.00 ? 27  ASP B C    1  
ATOM 2195  O O    . ASP B 1 27  ? -15.086 7.382   -12.447 1.00 0.00 ? 27  ASP B O    1  
ATOM 2196  C CB   . ASP B 1 27  ? -16.643 7.270   -9.475  1.00 0.00 ? 27  ASP B CB   1  
ATOM 2197  C CG   . ASP B 1 27  ? -16.844 8.479   -8.559  1.00 0.00 ? 27  ASP B CG   1  
ATOM 2198  O OD1  . ASP B 1 27  ? -16.094 9.432   -8.695  1.00 0.00 ? 27  ASP B OD1  1  
ATOM 2199  O OD2  . ASP B 1 27  ? -17.744 8.431   -7.736  1.00 0.00 ? 27  ASP B OD2  1  
ATOM 2200  H H    . ASP B 1 27  ? -18.807 6.681   -10.787 1.00 0.00 ? 27  ASP B H    1  
ATOM 2201  H HA   . ASP B 1 27  ? -16.691 8.723   -11.040 1.00 0.00 ? 27  ASP B HA   1  
ATOM 2202  H HB2  . ASP B 1 27  ? -17.329 6.485   -9.190  1.00 0.00 ? 27  ASP B HB2  1  
ATOM 2203  H HB3  . ASP B 1 27  ? -15.637 6.914   -9.387  1.00 0.00 ? 27  ASP B HB3  1  
ATOM 2204  N N    . LEU B 1 28  ? -16.228 5.574   -11.959 1.00 0.00 ? 28  LEU B N    1  
ATOM 2205  C CA   . LEU B 1 28  ? -15.346 4.743   -12.833 1.00 0.00 ? 28  LEU B CA   1  
ATOM 2206  C C    . LEU B 1 28  ? -15.874 4.726   -14.269 1.00 0.00 ? 28  LEU B C    1  
ATOM 2207  O O    . LEU B 1 28  ? -15.148 4.430   -15.197 1.00 0.00 ? 28  LEU B O    1  
ATOM 2208  C CB   . LEU B 1 28  ? -15.307 3.309   -12.301 1.00 0.00 ? 28  LEU B CB   1  
ATOM 2209  C CG   . LEU B 1 28  ? -14.875 3.311   -10.835 1.00 0.00 ? 28  LEU B CG   1  
ATOM 2210  C CD1  . LEU B 1 28  ? -14.519 1.885   -10.410 1.00 0.00 ? 28  LEU B CD1  1  
ATOM 2211  C CD2  . LEU B 1 28  ? -13.650 4.213   -10.663 1.00 0.00 ? 28  LEU B CD2  1  
ATOM 2212  H H    . LEU B 1 28  ? -16.957 5.156   -11.453 1.00 0.00 ? 28  LEU B H    1  
ATOM 2213  H HA   . LEU B 1 28  ? -14.347 5.152   -12.824 1.00 0.00 ? 28  LEU B HA   1  
ATOM 2214  H HB2  . LEU B 1 28  ? -16.291 2.869   -12.385 1.00 0.00 ? 28  LEU B HB2  1  
ATOM 2215  H HB3  . LEU B 1 28  ? -14.604 2.730   -12.880 1.00 0.00 ? 28  LEU B HB3  1  
ATOM 2216  H HG   . LEU B 1 28  ? -15.686 3.680   -10.223 1.00 0.00 ? 28  LEU B HG   1  
ATOM 2217  H HD11 . LEU B 1 28  ? -14.812 1.195   -11.187 1.00 0.00 ? 28  LEU B HD11 1  
ATOM 2218  H HD12 . LEU B 1 28  ? -13.454 1.812   -10.247 1.00 0.00 ? 28  LEU B HD12 1  
ATOM 2219  H HD13 . LEU B 1 28  ? -15.041 1.640   -9.496  1.00 0.00 ? 28  LEU B HD13 1  
ATOM 2220  H HD21 . LEU B 1 28  ? -12.889 3.924   -11.373 1.00 0.00 ? 28  LEU B HD21 1  
ATOM 2221  H HD22 . LEU B 1 28  ? -13.931 5.241   -10.837 1.00 0.00 ? 28  LEU B HD22 1  
ATOM 2222  H HD23 . LEU B 1 28  ? -13.264 4.109   -9.660  1.00 0.00 ? 28  LEU B HD23 1  
ATOM 2223  N N    . GLY B 1 29  ? -17.125 5.032   -14.469 1.00 0.00 ? 29  GLY B N    1  
ATOM 2224  C CA   . GLY B 1 29  ? -17.671 5.019   -15.857 1.00 0.00 ? 29  GLY B CA   1  
ATOM 2225  C C    . GLY B 1 29  ? -17.574 3.600   -16.425 1.00 0.00 ? 29  GLY B C    1  
ATOM 2226  O O    . GLY B 1 29  ? -17.721 3.381   -17.611 1.00 0.00 ? 29  GLY B O    1  
ATOM 2227  H H    . GLY B 1 29  ? -17.702 5.265   -13.711 1.00 0.00 ? 29  GLY B H    1  
ATOM 2228  H HA2  . GLY B 1 29  ? -18.703 5.339   -15.845 1.00 0.00 ? 29  GLY B HA2  1  
ATOM 2229  H HA3  . GLY B 1 29  ? -17.095 5.689   -16.477 1.00 0.00 ? 29  GLY B HA3  1  
ATOM 2230  N N    . TRP B 1 30  ? -17.321 2.634   -15.582 1.00 0.00 ? 30  TRP B N    1  
ATOM 2231  C CA   . TRP B 1 30  ? -17.205 1.225   -16.058 1.00 0.00 ? 30  TRP B CA   1  
ATOM 2232  C C    . TRP B 1 30  ? -18.368 0.890   -16.992 1.00 0.00 ? 30  TRP B C    1  
ATOM 2233  O O    . TRP B 1 30  ? -19.523 1.020   -16.635 1.00 0.00 ? 30  TRP B O    1  
ATOM 2234  C CB   . TRP B 1 30  ? -17.231 0.285   -14.854 1.00 0.00 ? 30  TRP B CB   1  
ATOM 2235  C CG   . TRP B 1 30  ? -15.835 0.065   -14.370 1.00 0.00 ? 30  TRP B CG   1  
ATOM 2236  C CD1  . TRP B 1 30  ? -14.757 0.785   -14.755 1.00 0.00 ? 30  TRP B CD1  1  
ATOM 2237  C CD2  . TRP B 1 30  ? -15.349 -0.927  -13.423 1.00 0.00 ? 30  TRP B CD2  1  
ATOM 2238  N NE1  . TRP B 1 30  ? -13.638 0.296   -14.105 1.00 0.00 ? 30  TRP B NE1  1  
ATOM 2239  C CE2  . TRP B 1 30  ? -13.952 -0.760  -13.273 1.00 0.00 ? 30  TRP B CE2  1  
ATOM 2240  C CE3  . TRP B 1 30  ? -15.978 -1.946  -12.687 1.00 0.00 ? 30  TRP B CE3  1  
ATOM 2241  C CZ2  . TRP B 1 30  ? -13.205 -1.576  -12.423 1.00 0.00 ? 30  TRP B CZ2  1  
ATOM 2242  C CZ3  . TRP B 1 30  ? -15.229 -2.769  -11.831 1.00 0.00 ? 30  TRP B CZ3  1  
ATOM 2243  C CH2  . TRP B 1 30  ? -13.846 -2.585  -11.700 1.00 0.00 ? 30  TRP B CH2  1  
ATOM 2244  H H    . TRP B 1 30  ? -17.202 2.837   -14.631 1.00 0.00 ? 30  TRP B H    1  
ATOM 2245  H HA   . TRP B 1 30  ? -16.273 1.099   -16.589 1.00 0.00 ? 30  TRP B HA   1  
ATOM 2246  H HB2  . TRP B 1 30  ? -17.821 0.726   -14.065 1.00 0.00 ? 30  TRP B HB2  1  
ATOM 2247  H HB3  . TRP B 1 30  ? -17.665 -0.661  -15.144 1.00 0.00 ? 30  TRP B HB3  1  
ATOM 2248  H HD1  . TRP B 1 30  ? -14.767 1.606   -15.457 1.00 0.00 ? 30  TRP B HD1  1  
ATOM 2249  H HE1  . TRP B 1 30  ? -12.727 0.642   -14.210 1.00 0.00 ? 30  TRP B HE1  1  
ATOM 2250  H HE3  . TRP B 1 30  ? -17.045 -2.096  -12.781 1.00 0.00 ? 30  TRP B HE3  1  
ATOM 2251  H HZ2  . TRP B 1 30  ? -12.140 -1.429  -12.326 1.00 0.00 ? 30  TRP B HZ2  1  
ATOM 2252  H HZ3  . TRP B 1 30  ? -15.719 -3.549  -11.272 1.00 0.00 ? 30  TRP B HZ3  1  
ATOM 2253  H HH2  . TRP B 1 30  ? -13.276 -3.221  -11.040 1.00 0.00 ? 30  TRP B HH2  1  
ATOM 2254  N N    . LYS B 1 31  ? -18.071 0.464   -18.189 1.00 0.00 ? 31  LYS B N    1  
ATOM 2255  C CA   . LYS B 1 31  ? -19.137 0.127   -19.150 1.00 0.00 ? 31  LYS B CA   1  
ATOM 2256  C C    . LYS B 1 31  ? -19.323 -1.392  -19.209 1.00 0.00 ? 31  LYS B C    1  
ATOM 2257  O O    . LYS B 1 31  ? -20.243 -1.886  -19.830 1.00 0.00 ? 31  LYS B O    1  
ATOM 2258  C CB   . LYS B 1 31  ? -18.708 0.633   -20.522 1.00 0.00 ? 31  LYS B CB   1  
ATOM 2259  C CG   . LYS B 1 31  ? -18.657 2.166   -20.530 1.00 0.00 ? 31  LYS B CG   1  
ATOM 2260  C CD   . LYS B 1 31  ? -19.862 2.738   -19.780 1.00 0.00 ? 31  LYS B CD   1  
ATOM 2261  C CE   . LYS B 1 31  ? -19.854 4.264   -19.886 1.00 0.00 ? 31  LYS B CE   1  
ATOM 2262  N NZ   . LYS B 1 31  ? -19.730 4.662   -21.317 1.00 0.00 ? 31  LYS B NZ   1  
ATOM 2263  H H    . LYS B 1 31  ? -17.141 0.373   -18.464 1.00 0.00 ? 31  LYS B H    1  
ATOM 2264  H HA   . LYS B 1 31  ? -20.061 0.601   -18.859 1.00 0.00 ? 31  LYS B HA   1  
ATOM 2265  H HB2  . LYS B 1 31  ? -17.729 0.241   -20.754 1.00 0.00 ? 31  LYS B HB2  1  
ATOM 2266  H HB3  . LYS B 1 31  ? -19.406 0.294   -21.253 1.00 0.00 ? 31  LYS B HB3  1  
ATOM 2267  H HG2  . LYS B 1 31  ? -17.747 2.496   -20.051 1.00 0.00 ? 31  LYS B HG2  1  
ATOM 2268  H HG3  . LYS B 1 31  ? -18.672 2.519   -21.551 1.00 0.00 ? 31  LYS B HG3  1  
ATOM 2269  H HD2  . LYS B 1 31  ? -20.773 2.351   -20.214 1.00 0.00 ? 31  LYS B HD2  1  
ATOM 2270  H HD3  . LYS B 1 31  ? -19.808 2.451   -18.741 1.00 0.00 ? 31  LYS B HD3  1  
ATOM 2271  H HE2  . LYS B 1 31  ? -20.774 4.658   -19.481 1.00 0.00 ? 31  LYS B HE2  1  
ATOM 2272  H HE3  . LYS B 1 31  ? -19.017 4.659   -19.329 1.00 0.00 ? 31  LYS B HE3  1  
ATOM 2273  H HZ1  . LYS B 1 31  ? -20.427 4.139   -21.884 1.00 0.00 ? 31  LYS B HZ1  1  
ATOM 2274  H HZ2  . LYS B 1 31  ? -19.905 5.684   -21.408 1.00 0.00 ? 31  LYS B HZ2  1  
ATOM 2275  H HZ3  . LYS B 1 31  ? -18.774 4.441   -21.657 1.00 0.00 ? 31  LYS B HZ3  1  
ATOM 2276  N N    . TRP B 1 32  ? -18.454 -2.141  -18.582 1.00 0.00 ? 32  TRP B N    1  
ATOM 2277  C CA   . TRP B 1 32  ? -18.595 -3.624  -18.630 1.00 0.00 ? 32  TRP B CA   1  
ATOM 2278  C C    . TRP B 1 32  ? -19.455 -4.111  -17.465 1.00 0.00 ? 32  TRP B C    1  
ATOM 2279  O O    . TRP B 1 32  ? -19.700 -5.290  -17.322 1.00 0.00 ? 32  TRP B O    1  
ATOM 2280  C CB   . TRP B 1 32  ? -17.215 -4.281  -18.563 1.00 0.00 ? 32  TRP B CB   1  
ATOM 2281  C CG   . TRP B 1 32  ? -16.680 -4.230  -17.165 1.00 0.00 ? 32  TRP B CG   1  
ATOM 2282  C CD1  . TRP B 1 32  ? -16.107 -3.149  -16.592 1.00 0.00 ? 32  TRP B CD1  1  
ATOM 2283  C CD2  . TRP B 1 32  ? -16.653 -5.286  -16.160 1.00 0.00 ? 32  TRP B CD2  1  
ATOM 2284  N NE1  . TRP B 1 32  ? -15.711 -3.478  -15.312 1.00 0.00 ? 32  TRP B NE1  1  
ATOM 2285  C CE2  . TRP B 1 32  ? -16.029 -4.782  -14.996 1.00 0.00 ? 32  TRP B CE2  1  
ATOM 2286  C CE3  . TRP B 1 32  ? -17.100 -6.617  -16.146 1.00 0.00 ? 32  TRP B CE3  1  
ATOM 2287  C CZ2  . TRP B 1 32  ? -15.852 -5.571  -13.860 1.00 0.00 ? 32  TRP B CZ2  1  
ATOM 2288  C CZ3  . TRP B 1 32  ? -16.928 -7.416  -15.004 1.00 0.00 ? 32  TRP B CZ3  1  
ATOM 2289  C CH2  . TRP B 1 32  ? -16.302 -6.893  -13.863 1.00 0.00 ? 32  TRP B CH2  1  
ATOM 2290  H H    . TRP B 1 32  ? -17.710 -1.731  -18.092 1.00 0.00 ? 32  TRP B H    1  
ATOM 2291  H HA   . TRP B 1 32  ? -19.071 -3.901  -19.558 1.00 0.00 ? 32  TRP B HA   1  
ATOM 2292  H HB2  . TRP B 1 32  ? -17.294 -5.311  -18.876 1.00 0.00 ? 32  TRP B HB2  1  
ATOM 2293  H HB3  . TRP B 1 32  ? -16.539 -3.758  -19.224 1.00 0.00 ? 32  TRP B HB3  1  
ATOM 2294  H HD1  . TRP B 1 32  ? -15.974 -2.189  -17.058 1.00 0.00 ? 32  TRP B HD1  1  
ATOM 2295  H HE1  . TRP B 1 32  ? -15.262 -2.874  -14.691 1.00 0.00 ? 32  TRP B HE1  1  
ATOM 2296  H HE3  . TRP B 1 32  ? -17.589 -7.024  -17.014 1.00 0.00 ? 32  TRP B HE3  1  
ATOM 2297  H HZ2  . TRP B 1 32  ? -15.369 -5.163  -12.984 1.00 0.00 ? 32  TRP B HZ2  1  
ATOM 2298  H HZ3  . TRP B 1 32  ? -17.277 -8.440  -15.006 1.00 0.00 ? 32  TRP B HZ3  1  
ATOM 2299  H HH2  . TRP B 1 32  ? -16.171 -7.508  -12.987 1.00 0.00 ? 32  TRP B HH2  1  
ATOM 2300  N N    . ILE B 1 33  ? -19.919 -3.221  -16.635 1.00 0.00 ? 33  ILE B N    1  
ATOM 2301  C CA   . ILE B 1 33  ? -20.766 -3.650  -15.490 1.00 0.00 ? 33  ILE B CA   1  
ATOM 2302  C C    . ILE B 1 33  ? -22.077 -2.859  -15.509 1.00 0.00 ? 33  ILE B C    1  
ATOM 2303  O O    . ILE B 1 33  ? -22.084 -1.648  -15.606 1.00 0.00 ? 33  ILE B O    1  
ATOM 2304  C CB   . ILE B 1 33  ? -20.011 -3.407  -14.177 1.00 0.00 ? 33  ILE B CB   1  
ATOM 2305  C CG1  . ILE B 1 33  ? -19.050 -4.572  -13.939 1.00 0.00 ? 33  ILE B CG1  1  
ATOM 2306  C CG2  . ILE B 1 33  ? -20.995 -3.318  -13.008 1.00 0.00 ? 33  ILE B CG2  1  
ATOM 2307  C CD1  . ILE B 1 33  ? -18.187 -4.284  -12.714 1.00 0.00 ? 33  ILE B CD1  1  
ATOM 2308  H H    . ILE B 1 33  ? -19.713 -2.272  -16.767 1.00 0.00 ? 33  ILE B H    1  
ATOM 2309  H HA   . ILE B 1 33  ? -20.983 -4.705  -15.587 1.00 0.00 ? 33  ILE B HA   1  
ATOM 2310  H HB   . ILE B 1 33  ? -19.451 -2.487  -14.248 1.00 0.00 ? 33  ILE B HB   1  
ATOM 2311  H HG12 . ILE B 1 33  ? -19.616 -5.474  -13.774 1.00 0.00 ? 33  ILE B HG12 1  
ATOM 2312  H HG13 . ILE B 1 33  ? -18.418 -4.695  -14.801 1.00 0.00 ? 33  ILE B HG13 1  
ATOM 2313  H HG21 . ILE B 1 33  ? -21.711 -2.533  -13.199 1.00 0.00 ? 33  ILE B HG21 1  
ATOM 2314  H HG22 . ILE B 1 33  ? -21.513 -4.260  -12.901 1.00 0.00 ? 33  ILE B HG22 1  
ATOM 2315  H HG23 . ILE B 1 33  ? -20.455 -3.099  -12.099 1.00 0.00 ? 33  ILE B HG23 1  
ATOM 2316  H HD11 . ILE B 1 33  ? -18.684 -3.559  -12.090 1.00 0.00 ? 33  ILE B HD11 1  
ATOM 2317  H HD12 . ILE B 1 33  ? -18.036 -5.196  -12.158 1.00 0.00 ? 33  ILE B HD12 1  
ATOM 2318  H HD13 . ILE B 1 33  ? -17.233 -3.894  -13.031 1.00 0.00 ? 33  ILE B HD13 1  
ATOM 2319  N N    . HIS B 1 34  ? -23.185 -3.541  -15.427 1.00 0.00 ? 34  HIS B N    1  
ATOM 2320  C CA   . HIS B 1 34  ? -24.500 -2.841  -15.451 1.00 0.00 ? 34  HIS B CA   1  
ATOM 2321  C C    . HIS B 1 34  ? -24.984 -2.593  -14.019 1.00 0.00 ? 34  HIS B C    1  
ATOM 2322  O O    . HIS B 1 34  ? -25.318 -1.484  -13.652 1.00 0.00 ? 34  HIS B O    1  
ATOM 2323  C CB   . HIS B 1 34  ? -25.515 -3.713  -16.199 1.00 0.00 ? 34  HIS B CB   1  
ATOM 2324  C CG   . HIS B 1 34  ? -26.913 -3.232  -15.918 1.00 0.00 ? 34  HIS B CG   1  
ATOM 2325  N ND1  . HIS B 1 34  ? -27.324 -1.941  -16.208 1.00 0.00 ? 34  HIS B ND1  1  
ATOM 2326  C CD2  . HIS B 1 34  ? -28.005 -3.861  -15.373 1.00 0.00 ? 34  HIS B CD2  1  
ATOM 2327  C CE1  . HIS B 1 34  ? -28.614 -1.834  -15.839 1.00 0.00 ? 34  HIS B CE1  1  
ATOM 2328  N NE2  . HIS B 1 34  ? -29.078 -2.976  -15.324 1.00 0.00 ? 34  HIS B NE2  1  
ATOM 2329  H H    . HIS B 1 34  ? -23.152 -4.517  -15.358 1.00 0.00 ? 34  HIS B H    1  
ATOM 2330  H HA   . HIS B 1 34  ? -24.394 -1.896  -15.963 1.00 0.00 ? 34  HIS B HA   1  
ATOM 2331  H HB2  . HIS B 1 34  ? -25.322 -3.657  -17.260 1.00 0.00 ? 34  HIS B HB2  1  
ATOM 2332  H HB3  . HIS B 1 34  ? -25.416 -4.738  -15.871 1.00 0.00 ? 34  HIS B HB3  1  
ATOM 2333  H HD1  . HIS B 1 34  ? -26.776 -1.235  -16.609 1.00 0.00 ? 34  HIS B HD1  1  
ATOM 2334  H HD2  . HIS B 1 34  ? -28.027 -4.886  -15.033 1.00 0.00 ? 34  HIS B HD2  1  
ATOM 2335  H HE1  . HIS B 1 34  ? -29.202 -0.935  -15.945 1.00 0.00 ? 34  HIS B HE1  1  
ATOM 2336  N N    . GLU B 1 35  ? -25.034 -3.615  -13.209 1.00 0.00 ? 35  GLU B N    1  
ATOM 2337  C CA   . GLU B 1 35  ? -25.508 -3.427  -11.808 1.00 0.00 ? 35  GLU B CA   1  
ATOM 2338  C C    . GLU B 1 35  ? -24.512 -4.060  -10.831 1.00 0.00 ? 35  GLU B C    1  
ATOM 2339  O O    . GLU B 1 35  ? -23.770 -4.950  -11.193 1.00 0.00 ? 35  GLU B O    1  
ATOM 2340  C CB   . GLU B 1 35  ? -26.875 -4.094  -11.643 1.00 0.00 ? 35  GLU B CB   1  
ATOM 2341  C CG   . GLU B 1 35  ? -27.977 -3.092  -11.992 1.00 0.00 ? 35  GLU B CG   1  
ATOM 2342  C CD   . GLU B 1 35  ? -29.034 -3.088  -10.886 1.00 0.00 ? 35  GLU B CD   1  
ATOM 2343  O OE1  . GLU B 1 35  ? -29.941 -3.901  -10.958 1.00 0.00 ? 35  GLU B OE1  1  
ATOM 2344  O OE2  . GLU B 1 35  ? -28.919 -2.272  -9.987  1.00 0.00 ? 35  GLU B OE2  1  
ATOM 2345  H H    . GLU B 1 35  ? -24.766 -4.504  -13.523 1.00 0.00 ? 35  GLU B H    1  
ATOM 2346  H HA   . GLU B 1 35  ? -25.596 -2.372  -11.597 1.00 0.00 ? 35  GLU B HA   1  
ATOM 2347  H HB2  . GLU B 1 35  ? -26.941 -4.947  -12.302 1.00 0.00 ? 35  GLU B HB2  1  
ATOM 2348  H HB3  . GLU B 1 35  ? -26.997 -4.418  -10.620 1.00 0.00 ? 35  GLU B HB3  1  
ATOM 2349  H HG2  . GLU B 1 35  ? -27.549 -2.104  -12.085 1.00 0.00 ? 35  GLU B HG2  1  
ATOM 2350  H HG3  . GLU B 1 35  ? -28.438 -3.374  -12.927 1.00 0.00 ? 35  GLU B HG3  1  
ATOM 2351  N N    . PRO B 1 36  ? -24.533 -3.577  -9.614  1.00 0.00 ? 36  PRO B N    1  
ATOM 2352  C CA   . PRO B 1 36  ? -25.441 -2.495  -9.192  1.00 0.00 ? 36  PRO B CA   1  
ATOM 2353  C C    . PRO B 1 36  ? -24.918 -1.143  -9.679  1.00 0.00 ? 36  PRO B C    1  
ATOM 2354  O O    . PRO B 1 36  ? -23.843 -1.047  -10.238 1.00 0.00 ? 36  PRO B O    1  
ATOM 2355  C CB   . PRO B 1 36  ? -25.407 -2.575  -7.664  1.00 0.00 ? 36  PRO B CB   1  
ATOM 2356  C CG   . PRO B 1 36  ? -24.084 -3.288  -7.295  1.00 0.00 ? 36  PRO B CG   1  
ATOM 2357  C CD   . PRO B 1 36  ? -23.644 -4.072  -8.545  1.00 0.00 ? 36  PRO B CD   1  
ATOM 2358  H HA   . PRO B 1 36  ? -26.441 -2.671  -9.550  1.00 0.00 ? 36  PRO B HA   1  
ATOM 2359  H HB2  . PRO B 1 36  ? -25.427 -1.579  -7.241  1.00 0.00 ? 36  PRO B HB2  1  
ATOM 2360  H HB3  . PRO B 1 36  ? -26.244 -3.150  -7.302  1.00 0.00 ? 36  PRO B HB3  1  
ATOM 2361  H HG2  . PRO B 1 36  ? -23.333 -2.557  -7.028  1.00 0.00 ? 36  PRO B HG2  1  
ATOM 2362  H HG3  . PRO B 1 36  ? -24.247 -3.970  -6.475  1.00 0.00 ? 36  PRO B HG3  1  
ATOM 2363  H HD2  . PRO B 1 36  ? -22.610 -3.860  -8.779  1.00 0.00 ? 36  PRO B HD2  1  
ATOM 2364  H HD3  . PRO B 1 36  ? -23.792 -5.130  -8.398  1.00 0.00 ? 36  PRO B HD3  1  
ATOM 2365  N N    . LYS B 1 37  ? -25.663 -0.095  -9.461  1.00 0.00 ? 37  LYS B N    1  
ATOM 2366  C CA   . LYS B 1 37  ? -25.209 1.244   -9.895  1.00 0.00 ? 37  LYS B CA   1  
ATOM 2367  C C    . LYS B 1 37  ? -23.787 1.477   -9.392  1.00 0.00 ? 37  LYS B C    1  
ATOM 2368  O O    . LYS B 1 37  ? -22.969 2.084   -10.055 1.00 0.00 ? 37  LYS B O    1  
ATOM 2369  C CB   . LYS B 1 37  ? -26.143 2.284   -9.290  1.00 0.00 ? 37  LYS B CB   1  
ATOM 2370  C CG   . LYS B 1 37  ? -27.296 2.566   -10.256 1.00 0.00 ? 37  LYS B CG   1  
ATOM 2371  C CD   . LYS B 1 37  ? -27.138 3.969   -10.844 1.00 0.00 ? 37  LYS B CD   1  
ATOM 2372  C CE   . LYS B 1 37  ? -28.485 4.450   -11.385 1.00 0.00 ? 37  LYS B CE   1  
ATOM 2373  N NZ   . LYS B 1 37  ? -28.320 5.795   -12.006 1.00 0.00 ? 37  LYS B NZ   1  
ATOM 2374  H H    . LYS B 1 37  ? -26.520 -0.185  -9.001  1.00 0.00 ? 37  LYS B H    1  
ATOM 2375  H HA   . LYS B 1 37  ? -25.235 1.311   -10.972 1.00 0.00 ? 37  LYS B HA   1  
ATOM 2376  H HB2  . LYS B 1 37  ? -26.539 1.906   -8.358  1.00 0.00 ? 37  LYS B HB2  1  
ATOM 2377  H HB3  . LYS B 1 37  ? -25.597 3.184   -9.105  1.00 0.00 ? 37  LYS B HB3  1  
ATOM 2378  H HG2  . LYS B 1 37  ? -27.284 1.837   -11.053 1.00 0.00 ? 37  LYS B HG2  1  
ATOM 2379  H HG3  . LYS B 1 37  ? -28.234 2.505   -9.725  1.00 0.00 ? 37  LYS B HG3  1  
ATOM 2380  H HD2  . LYS B 1 37  ? -26.794 4.646   -10.075 1.00 0.00 ? 37  LYS B HD2  1  
ATOM 2381  H HD3  . LYS B 1 37  ? -26.417 3.943   -11.648 1.00 0.00 ? 37  LYS B HD3  1  
ATOM 2382  H HE2  . LYS B 1 37  ? -28.845 3.753   -12.127 1.00 0.00 ? 37  LYS B HE2  1  
ATOM 2383  H HE3  . LYS B 1 37  ? -29.197 4.513   -10.575 1.00 0.00 ? 37  LYS B HE3  1  
ATOM 2384  H HZ1  . LYS B 1 37  ? -27.614 6.340   -11.470 1.00 0.00 ? 37  LYS B HZ1  1  
ATOM 2385  H HZ2  . LYS B 1 37  ? -28.002 5.687   -12.990 1.00 0.00 ? 37  LYS B HZ2  1  
ATOM 2386  H HZ3  . LYS B 1 37  ? -29.230 6.298   -11.992 1.00 0.00 ? 37  LYS B HZ3  1  
ATOM 2387  N N    . GLY B 1 38  ? -23.491 0.995   -8.220  1.00 0.00 ? 38  GLY B N    1  
ATOM 2388  C CA   . GLY B 1 38  ? -22.126 1.177   -7.654  1.00 0.00 ? 38  GLY B CA   1  
ATOM 2389  C C    . GLY B 1 38  ? -21.991 0.333   -6.387  1.00 0.00 ? 38  GLY B C    1  
ATOM 2390  O O    . GLY B 1 38  ? -22.514 -0.760  -6.300  1.00 0.00 ? 38  GLY B O    1  
ATOM 2391  H H    . GLY B 1 38  ? -24.171 0.510   -7.709  1.00 0.00 ? 38  GLY B H    1  
ATOM 2392  H HA2  . GLY B 1 38  ? -21.389 0.863   -8.380  1.00 0.00 ? 38  GLY B HA2  1  
ATOM 2393  H HA3  . GLY B 1 38  ? -21.972 2.216   -7.408  1.00 0.00 ? 38  GLY B HA3  1  
ATOM 2394  N N    . TYR B 1 39  ? -21.296 0.832   -5.403  1.00 0.00 ? 39  TYR B N    1  
ATOM 2395  C CA   . TYR B 1 39  ? -21.132 0.060   -4.140  1.00 0.00 ? 39  TYR B CA   1  
ATOM 2396  C C    . TYR B 1 39  ? -20.259 0.857   -3.171  1.00 0.00 ? 39  TYR B C    1  
ATOM 2397  O O    . TYR B 1 39  ? -19.831 1.953   -3.467  1.00 0.00 ? 39  TYR B O    1  
ATOM 2398  C CB   . TYR B 1 39  ? -20.476 -1.288  -4.445  1.00 0.00 ? 39  TYR B CB   1  
ATOM 2399  C CG   . TYR B 1 39  ? -19.015 -1.091  -4.764  1.00 0.00 ? 39  TYR B CG   1  
ATOM 2400  C CD1  . TYR B 1 39  ? -18.628 -0.347  -5.885  1.00 0.00 ? 39  TYR B CD1  1  
ATOM 2401  C CD2  . TYR B 1 39  ? -18.047 -1.665  -3.938  1.00 0.00 ? 39  TYR B CD2  1  
ATOM 2402  C CE1  . TYR B 1 39  ? -17.270 -0.179  -6.179  1.00 0.00 ? 39  TYR B CE1  1  
ATOM 2403  C CE2  . TYR B 1 39  ? -16.689 -1.497  -4.230  1.00 0.00 ? 39  TYR B CE2  1  
ATOM 2404  C CZ   . TYR B 1 39  ? -16.300 -0.754  -5.351  1.00 0.00 ? 39  TYR B CZ   1  
ATOM 2405  O OH   . TYR B 1 39  ? -14.960 -0.590  -5.641  1.00 0.00 ? 39  TYR B OH   1  
ATOM 2406  H H    . TYR B 1 39  ? -20.885 1.717   -5.493  1.00 0.00 ? 39  TYR B H    1  
ATOM 2407  H HA   . TYR B 1 39  ? -22.099 -0.108  -3.693  1.00 0.00 ? 39  TYR B HA   1  
ATOM 2408  H HB2  . TYR B 1 39  ? -20.570 -1.933  -3.585  1.00 0.00 ? 39  TYR B HB2  1  
ATOM 2409  H HB3  . TYR B 1 39  ? -20.968 -1.744  -5.291  1.00 0.00 ? 39  TYR B HB3  1  
ATOM 2410  H HD1  . TYR B 1 39  ? -19.375 0.098   -6.523  1.00 0.00 ? 39  TYR B HD1  1  
ATOM 2411  H HD2  . TYR B 1 39  ? -18.349 -2.236  -3.073  1.00 0.00 ? 39  TYR B HD2  1  
ATOM 2412  H HE1  . TYR B 1 39  ? -16.971 0.394   -7.044  1.00 0.00 ? 39  TYR B HE1  1  
ATOM 2413  H HE2  . TYR B 1 39  ? -15.942 -1.940  -3.590  1.00 0.00 ? 39  TYR B HE2  1  
ATOM 2414  H HH   . TYR B 1 39  ? -14.459 -1.176  -5.069  1.00 0.00 ? 39  TYR B HH   1  
ATOM 2415  N N    . HIS B 1 40  ? -19.995 0.320   -2.013  1.00 0.00 ? 40  HIS B N    1  
ATOM 2416  C CA   . HIS B 1 40  ? -19.152 1.057   -1.032  1.00 0.00 ? 40  HIS B CA   1  
ATOM 2417  C C    . HIS B 1 40  ? -17.713 0.554   -1.130  1.00 0.00 ? 40  HIS B C    1  
ATOM 2418  O O    . HIS B 1 40  ? -17.247 -0.204  -0.302  1.00 0.00 ? 40  HIS B O    1  
ATOM 2419  C CB   . HIS B 1 40  ? -19.696 0.824   0.378   1.00 0.00 ? 40  HIS B CB   1  
ATOM 2420  C CG   . HIS B 1 40  ? -21.131 1.269   0.427   1.00 0.00 ? 40  HIS B CG   1  
ATOM 2421  N ND1  . HIS B 1 40  ? -21.491 2.568   0.748   1.00 0.00 ? 40  HIS B ND1  1  
ATOM 2422  C CD2  . HIS B 1 40  ? -22.307 0.604   0.184   1.00 0.00 ? 40  HIS B CD2  1  
ATOM 2423  C CE1  . HIS B 1 40  ? -22.833 2.644   0.687   1.00 0.00 ? 40  HIS B CE1  1  
ATOM 2424  N NE2  . HIS B 1 40  ? -23.380 1.473   0.349   1.00 0.00 ? 40  HIS B NE2  1  
ATOM 2425  H H    . HIS B 1 40  ? -20.350 -0.566  -1.788  1.00 0.00 ? 40  HIS B H    1  
ATOM 2426  H HA   . HIS B 1 40  ? -19.180 2.113   -1.258  1.00 0.00 ? 40  HIS B HA   1  
ATOM 2427  H HB2  . HIS B 1 40  ? -19.633 -0.227  0.620   1.00 0.00 ? 40  HIS B HB2  1  
ATOM 2428  H HB3  . HIS B 1 40  ? -19.116 1.394   1.088   1.00 0.00 ? 40  HIS B HB3  1  
ATOM 2429  H HD1  . HIS B 1 40  ? -20.879 3.299   0.977   1.00 0.00 ? 40  HIS B HD1  1  
ATOM 2430  H HD2  . HIS B 1 40  ? -22.386 -0.435  -0.099  1.00 0.00 ? 40  HIS B HD2  1  
ATOM 2431  H HE1  . HIS B 1 40  ? -23.399 3.542   0.882   1.00 0.00 ? 40  HIS B HE1  1  
ATOM 2432  N N    . ALA B 1 41  ? -17.008 0.969   -2.146  1.00 0.00 ? 41  ALA B N    1  
ATOM 2433  C CA   . ALA B 1 41  ? -15.600 0.517   -2.319  1.00 0.00 ? 41  ALA B CA   1  
ATOM 2434  C C    . ALA B 1 41  ? -14.768 0.934   -1.107  1.00 0.00 ? 41  ALA B C    1  
ATOM 2435  O O    . ALA B 1 41  ? -13.725 0.370   -0.839  1.00 0.00 ? 41  ALA B O    1  
ATOM 2436  C CB   . ALA B 1 41  ? -15.018 1.152   -3.584  1.00 0.00 ? 41  ALA B CB   1  
ATOM 2437  H H    . ALA B 1 41  ? -17.410 1.575   -2.803  1.00 0.00 ? 41  ALA B H    1  
ATOM 2438  H HA   . ALA B 1 41  ? -15.577 -0.557  -2.414  1.00 0.00 ? 41  ALA B HA   1  
ATOM 2439  H HB1  . ALA B 1 41  ? -15.804 1.289   -4.312  1.00 0.00 ? 41  ALA B HB1  1  
ATOM 2440  H HB2  . ALA B 1 41  ? -14.584 2.111   -3.339  1.00 0.00 ? 41  ALA B HB2  1  
ATOM 2441  H HB3  . ALA B 1 41  ? -14.256 0.506   -3.993  1.00 0.00 ? 41  ALA B HB3  1  
ATOM 2442  N N    . ASN B 1 42  ? -15.214 1.911   -0.369  1.00 0.00 ? 42  ASN B N    1  
ATOM 2443  C CA   . ASN B 1 42  ? -14.435 2.346   0.822   1.00 0.00 ? 42  ASN B CA   1  
ATOM 2444  C C    . ASN B 1 42  ? -12.997 2.643   0.400   1.00 0.00 ? 42  ASN B C    1  
ATOM 2445  O O    . ASN B 1 42  ? -12.615 2.424   -0.732  1.00 0.00 ? 42  ASN B O    1  
ATOM 2446  C CB   . ASN B 1 42  ? -14.433 1.224   1.862   1.00 0.00 ? 42  ASN B CB   1  
ATOM 2447  C CG   . ASN B 1 42  ? -15.608 1.415   2.823   1.00 0.00 ? 42  ASN B CG   1  
ATOM 2448  O OD1  . ASN B 1 42  ? -15.828 2.500   3.323   1.00 0.00 ? 42  ASN B OD1  1  
ATOM 2449  N ND2  . ASN B 1 42  ? -16.377 0.398   3.105   1.00 0.00 ? 42  ASN B ND2  1  
ATOM 2450  H H    . ASN B 1 42  ? -16.058 2.357   -0.596  1.00 0.00 ? 42  ASN B H    1  
ATOM 2451  H HA   . ASN B 1 42  ? -14.882 3.233   1.245   1.00 0.00 ? 42  ASN B HA   1  
ATOM 2452  H HB2  . ASN B 1 42  ? -14.528 0.271   1.361   1.00 0.00 ? 42  ASN B HB2  1  
ATOM 2453  H HB3  . ASN B 1 42  ? -13.507 1.248   2.416   1.00 0.00 ? 42  ASN B HB3  1  
ATOM 2454  H HD21 . ASN B 1 42  ? -16.199 -0.477  2.702   1.00 0.00 ? 42  ASN B HD21 1  
ATOM 2455  H HD22 . ASN B 1 42  ? -17.132 0.511   3.719   1.00 0.00 ? 42  ASN B HD22 1  
ATOM 2456  N N    . PHE B 1 43  ? -12.192 3.131   1.301   1.00 0.00 ? 43  PHE B N    1  
ATOM 2457  C CA   . PHE B 1 43  ? -10.778 3.428   0.949   1.00 0.00 ? 43  PHE B CA   1  
ATOM 2458  C C    . PHE B 1 43  ? -10.069 3.982   2.182   1.00 0.00 ? 43  PHE B C    1  
ATOM 2459  O O    . PHE B 1 43  ? -10.648 4.064   3.244   1.00 0.00 ? 43  PHE B O    1  
ATOM 2460  C CB   . PHE B 1 43  ? -10.731 4.425   -0.217  1.00 0.00 ? 43  PHE B CB   1  
ATOM 2461  C CG   . PHE B 1 43  ? -10.769 5.850   0.278   1.00 0.00 ? 43  PHE B CG   1  
ATOM 2462  C CD1  . PHE B 1 43  ? -11.783 6.276   1.144   1.00 0.00 ? 43  PHE B CD1  1  
ATOM 2463  C CD2  . PHE B 1 43  ? -9.791  6.750   -0.149  1.00 0.00 ? 43  PHE B CD2  1  
ATOM 2464  C CE1  . PHE B 1 43  ? -11.814 7.605   1.581   1.00 0.00 ? 43  PHE B CE1  1  
ATOM 2465  C CE2  . PHE B 1 43  ? -9.821  8.075   0.288   1.00 0.00 ? 43  PHE B CE2  1  
ATOM 2466  C CZ   . PHE B 1 43  ? -10.833 8.505   1.153   1.00 0.00 ? 43  PHE B CZ   1  
ATOM 2467  H H    . PHE B 1 43  ? -12.515 3.295   2.216   1.00 0.00 ? 43  PHE B H    1  
ATOM 2468  H HA   . PHE B 1 43  ? -10.293 2.510   0.649   1.00 0.00 ? 43  PHE B HA   1  
ATOM 2469  H HB2  . PHE B 1 43  ? -9.821  4.273   -0.774  1.00 0.00 ? 43  PHE B HB2  1  
ATOM 2470  H HB3  . PHE B 1 43  ? -11.576 4.251   -0.865  1.00 0.00 ? 43  PHE B HB3  1  
ATOM 2471  H HD1  . PHE B 1 43  ? -12.541 5.580   1.473   1.00 0.00 ? 43  PHE B HD1  1  
ATOM 2472  H HD2  . PHE B 1 43  ? -9.009  6.420   -0.817  1.00 0.00 ? 43  PHE B HD2  1  
ATOM 2473  H HE1  . PHE B 1 43  ? -12.596 7.936   2.247   1.00 0.00 ? 43  PHE B HE1  1  
ATOM 2474  H HE2  . PHE B 1 43  ? -9.065  8.765   -0.045  1.00 0.00 ? 43  PHE B HE2  1  
ATOM 2475  H HZ   . PHE B 1 43  ? -10.857 9.531   1.489   1.00 0.00 ? 43  PHE B HZ   1  
ATOM 2476  N N    . CYS B 1 44  ? -8.821  4.339   2.071   1.00 0.00 ? 44  CYS B N    1  
ATOM 2477  C CA   . CYS B 1 44  ? -8.107  4.849   3.273   1.00 0.00 ? 44  CYS B CA   1  
ATOM 2478  C C    . CYS B 1 44  ? -7.104  5.937   2.892   1.00 0.00 ? 44  CYS B C    1  
ATOM 2479  O O    . CYS B 1 44  ? -6.523  5.922   1.825   1.00 0.00 ? 44  CYS B O    1  
ATOM 2480  C CB   . CYS B 1 44  ? -7.381  3.676   3.928   1.00 0.00 ? 44  CYS B CB   1  
ATOM 2481  S SG   . CYS B 1 44  ? -8.556  2.319   4.126   1.00 0.00 ? 44  CYS B SG   1  
ATOM 2482  H H    . CYS B 1 44  ? -8.352  4.251   1.215   1.00 0.00 ? 44  CYS B H    1  
ATOM 2483  H HA   . CYS B 1 44  ? -8.825  5.254   3.968   1.00 0.00 ? 44  CYS B HA   1  
ATOM 2484  H HB2  . CYS B 1 44  ? -6.564  3.358   3.296   1.00 0.00 ? 44  CYS B HB2  1  
ATOM 2485  H HB3  . CYS B 1 44  ? -6.998  3.967   4.895   1.00 0.00 ? 44  CYS B HB3  1  
ATOM 2486  N N    . LEU B 1 45  ? -6.899  6.882   3.770   1.00 0.00 ? 45  LEU B N    1  
ATOM 2487  C CA   . LEU B 1 45  ? -5.934  7.980   3.482   1.00 0.00 ? 45  LEU B CA   1  
ATOM 2488  C C    . LEU B 1 45  ? -5.084  8.238   4.729   1.00 0.00 ? 45  LEU B C    1  
ATOM 2489  O O    . LEU B 1 45  ? -5.058  7.444   5.648   1.00 0.00 ? 45  LEU B O    1  
ATOM 2490  C CB   . LEU B 1 45  ? -6.701  9.253   3.120   1.00 0.00 ? 45  LEU B CB   1  
ATOM 2491  C CG   . LEU B 1 45  ? -7.444  9.051   1.802   1.00 0.00 ? 45  LEU B CG   1  
ATOM 2492  C CD1  . LEU B 1 45  ? -8.204  10.331  1.449   1.00 0.00 ? 45  LEU B CD1  1  
ATOM 2493  C CD2  . LEU B 1 45  ? -6.439  8.730   0.693   1.00 0.00 ? 45  LEU B CD2  1  
ATOM 2494  H H    . LEU B 1 45  ? -7.380  6.866   4.625   1.00 0.00 ? 45  LEU B H    1  
ATOM 2495  H HA   . LEU B 1 45  ? -5.294  7.695   2.660   1.00 0.00 ? 45  LEU B HA   1  
ATOM 2496  H HB2  . LEU B 1 45  ? -7.413  9.478   3.900   1.00 0.00 ? 45  LEU B HB2  1  
ATOM 2497  H HB3  . LEU B 1 45  ? -6.008  10.075  3.018   1.00 0.00 ? 45  LEU B HB3  1  
ATOM 2498  H HG   . LEU B 1 45  ? -8.143  8.234   1.906   1.00 0.00 ? 45  LEU B HG   1  
ATOM 2499  H HD11 . LEU B 1 45  ? -7.666  11.186  1.830   1.00 0.00 ? 45  LEU B HD11 1  
ATOM 2500  H HD12 . LEU B 1 45  ? -8.295  10.412  0.376   1.00 0.00 ? 45  LEU B HD12 1  
ATOM 2501  H HD13 . LEU B 1 45  ? -9.188  10.299  1.892   1.00 0.00 ? 45  LEU B HD13 1  
ATOM 2502  H HD21 . LEU B 1 45  ? -5.435  8.867   1.066   1.00 0.00 ? 45  LEU B HD21 1  
ATOM 2503  H HD22 . LEU B 1 45  ? -6.568  7.706   0.376   1.00 0.00 ? 45  LEU B HD22 1  
ATOM 2504  H HD23 . LEU B 1 45  ? -6.605  9.390   -0.145  1.00 0.00 ? 45  LEU B HD23 1  
ATOM 2505  N N    . GLY B 1 46  ? -4.394  9.345   4.771   1.00 0.00 ? 46  GLY B N    1  
ATOM 2506  C CA   . GLY B 1 46  ? -3.553  9.653   5.963   1.00 0.00 ? 46  GLY B CA   1  
ATOM 2507  C C    . GLY B 1 46  ? -2.284  8.795   5.936   1.00 0.00 ? 46  GLY B C    1  
ATOM 2508  O O    . GLY B 1 46  ? -2.238  7.780   5.271   1.00 0.00 ? 46  GLY B O    1  
ATOM 2509  H H    . GLY B 1 46  ? -4.431  9.975   4.021   1.00 0.00 ? 46  GLY B H    1  
ATOM 2510  H HA2  . GLY B 1 46  ? -3.282  10.699  5.949   1.00 0.00 ? 46  GLY B HA2  1  
ATOM 2511  H HA3  . GLY B 1 46  ? -4.110  9.436   6.861   1.00 0.00 ? 46  GLY B HA3  1  
ATOM 2512  N N    . PRO B 1 47  ? -1.291  9.235   6.666   1.00 0.00 ? 47  PRO B N    1  
ATOM 2513  C CA   . PRO B 1 47  ? 0.002   8.534   6.756   1.00 0.00 ? 47  PRO B CA   1  
ATOM 2514  C C    . PRO B 1 47  ? -0.106  7.333   7.701   1.00 0.00 ? 47  PRO B C    1  
ATOM 2515  O O    . PRO B 1 47  ? -1.161  7.036   8.225   1.00 0.00 ? 47  PRO B O    1  
ATOM 2516  C CB   . PRO B 1 47  ? 0.946   9.595   7.329   1.00 0.00 ? 47  PRO B CB   1  
ATOM 2517  C CG   . PRO B 1 47  ? 0.051   10.627  8.056   1.00 0.00 ? 47  PRO B CG   1  
ATOM 2518  C CD   . PRO B 1 47  ? -1.364  10.474  7.469   1.00 0.00 ? 47  PRO B CD   1  
ATOM 2519  H HA   . PRO B 1 47  ? 0.339   8.226   5.780   1.00 0.00 ? 47  PRO B HA   1  
ATOM 2520  H HB2  . PRO B 1 47  ? 1.636   9.139   8.025   1.00 0.00 ? 47  PRO B HB2  1  
ATOM 2521  H HB3  . PRO B 1 47  ? 1.486   10.081  6.532   1.00 0.00 ? 47  PRO B HB3  1  
ATOM 2522  H HG2  . PRO B 1 47  ? 0.040   10.421  9.118   1.00 0.00 ? 47  PRO B HG2  1  
ATOM 2523  H HG3  . PRO B 1 47  ? 0.414   11.627  7.876   1.00 0.00 ? 47  PRO B HG3  1  
ATOM 2524  H HD2  . PRO B 1 47  ? -2.093  10.372  8.262   1.00 0.00 ? 47  PRO B HD2  1  
ATOM 2525  H HD3  . PRO B 1 47  ? -1.605  11.314  6.837   1.00 0.00 ? 47  PRO B HD3  1  
ATOM 2526  N N    . CYS B 1 48  ? 0.979   6.643   7.923   1.00 0.00 ? 48  CYS B N    1  
ATOM 2527  C CA   . CYS B 1 48  ? 0.941   5.464   8.834   1.00 0.00 ? 48  CYS B CA   1  
ATOM 2528  C C    . CYS B 1 48  ? 2.267   5.375   9.601   1.00 0.00 ? 48  CYS B C    1  
ATOM 2529  O O    . CYS B 1 48  ? 3.309   5.195   9.002   1.00 0.00 ? 48  CYS B O    1  
ATOM 2530  C CB   . CYS B 1 48  ? 0.745   4.188   8.005   1.00 0.00 ? 48  CYS B CB   1  
ATOM 2531  S SG   . CYS B 1 48  ? 1.098   2.729   9.021   1.00 0.00 ? 48  CYS B SG   1  
ATOM 2532  H H    . CYS B 1 48  ? 1.820   6.901   7.491   1.00 0.00 ? 48  CYS B H    1  
ATOM 2533  H HA   . CYS B 1 48  ? 0.121   5.572   9.525   1.00 0.00 ? 48  CYS B HA   1  
ATOM 2534  H HB2  . CYS B 1 48  ? -0.274  4.141   7.655   1.00 0.00 ? 48  CYS B HB2  1  
ATOM 2535  H HB3  . CYS B 1 48  ? 1.414   4.204   7.158   1.00 0.00 ? 48  CYS B HB3  1  
ATOM 2536  N N    . PRO B 1 49  ? 2.194   5.491   10.904  1.00 0.00 ? 49  PRO B N    1  
ATOM 2537  C CA   . PRO B 1 49  ? 3.384   5.409   11.764  1.00 0.00 ? 49  PRO B CA   1  
ATOM 2538  C C    . PRO B 1 49  ? 3.822   3.941   11.893  1.00 0.00 ? 49  PRO B C    1  
ATOM 2539  O O    . PRO B 1 49  ? 3.701   3.176   10.957  1.00 0.00 ? 49  PRO B O    1  
ATOM 2540  C CB   . PRO B 1 49  ? 2.907   6.014   13.094  1.00 0.00 ? 49  PRO B CB   1  
ATOM 2541  C CG   . PRO B 1 49  ? 1.367   5.897   13.104  1.00 0.00 ? 49  PRO B CG   1  
ATOM 2542  C CD   . PRO B 1 49  ? 0.929   5.709   11.638  1.00 0.00 ? 49  PRO B CD   1  
ATOM 2543  H HA   . PRO B 1 49  ? 4.184   6.006   11.354  1.00 0.00 ? 49  PRO B HA   1  
ATOM 2544  H HB2  . PRO B 1 49  ? 3.325   5.472   13.926  1.00 0.00 ? 49  PRO B HB2  1  
ATOM 2545  H HB3  . PRO B 1 49  ? 3.190   7.053   13.149  1.00 0.00 ? 49  PRO B HB3  1  
ATOM 2546  H HG2  . PRO B 1 49  ? 1.067   5.048   13.700  1.00 0.00 ? 49  PRO B HG2  1  
ATOM 2547  H HG3  . PRO B 1 49  ? 0.930   6.800   13.500  1.00 0.00 ? 49  PRO B HG3  1  
ATOM 2548  H HD2  . PRO B 1 49  ? 0.281   4.848   11.545  1.00 0.00 ? 49  PRO B HD2  1  
ATOM 2549  H HD3  . PRO B 1 49  ? 0.436   6.597   11.273  1.00 0.00 ? 49  PRO B HD3  1  
ATOM 2550  N N    . TYR B 1 50  ? 4.340   3.532   13.020  1.00 0.00 ? 50  TYR B N    1  
ATOM 2551  C CA   . TYR B 1 50  ? 4.783   2.108   13.146  1.00 0.00 ? 50  TYR B CA   1  
ATOM 2552  C C    . TYR B 1 50  ? 3.644   1.242   13.692  1.00 0.00 ? 50  TYR B C    1  
ATOM 2553  O O    . TYR B 1 50  ? 2.892   0.651   12.946  1.00 0.00 ? 50  TYR B O    1  
ATOM 2554  C CB   . TYR B 1 50  ? 6.001   1.986   14.083  1.00 0.00 ? 50  TYR B CB   1  
ATOM 2555  C CG   . TYR B 1 50  ? 6.255   3.287   14.808  1.00 0.00 ? 50  TYR B CG   1  
ATOM 2556  C CD1  . TYR B 1 50  ? 6.749   4.392   14.106  1.00 0.00 ? 50  TYR B CD1  1  
ATOM 2557  C CD2  . TYR B 1 50  ? 5.994   3.388   16.180  1.00 0.00 ? 50  TYR B CD2  1  
ATOM 2558  C CE1  . TYR B 1 50  ? 6.983   5.598   14.774  1.00 0.00 ? 50  TYR B CE1  1  
ATOM 2559  C CE2  . TYR B 1 50  ? 6.229   4.595   16.849  1.00 0.00 ? 50  TYR B CE2  1  
ATOM 2560  C CZ   . TYR B 1 50  ? 6.723   5.701   16.146  1.00 0.00 ? 50  TYR B CZ   1  
ATOM 2561  O OH   . TYR B 1 50  ? 6.954   6.891   16.806  1.00 0.00 ? 50  TYR B OH   1  
ATOM 2562  H H    . TYR B 1 50  ? 4.445   4.150   13.767  1.00 0.00 ? 50  TYR B H    1  
ATOM 2563  H HA   . TYR B 1 50  ? 5.058   1.743   12.168  1.00 0.00 ? 50  TYR B HA   1  
ATOM 2564  H HB2  . TYR B 1 50  ? 5.816   1.206   14.807  1.00 0.00 ? 50  TYR B HB2  1  
ATOM 2565  H HB3  . TYR B 1 50  ? 6.872   1.728   13.499  1.00 0.00 ? 50  TYR B HB3  1  
ATOM 2566  H HD1  . TYR B 1 50  ? 6.949   4.312   13.048  1.00 0.00 ? 50  TYR B HD1  1  
ATOM 2567  H HD2  . TYR B 1 50  ? 5.613   2.535   16.722  1.00 0.00 ? 50  TYR B HD2  1  
ATOM 2568  H HE1  . TYR B 1 50  ? 7.366   6.450   14.232  1.00 0.00 ? 50  TYR B HE1  1  
ATOM 2569  H HE2  . TYR B 1 50  ? 6.028   4.674   17.908  1.00 0.00 ? 50  TYR B HE2  1  
ATOM 2570  H HH   . TYR B 1 50  ? 7.832   7.197   16.568  1.00 0.00 ? 50  TYR B HH   1  
ATOM 2571  N N    . ILE B 1 51  ? 3.532   1.148   14.989  1.00 0.00 ? 51  ILE B N    1  
ATOM 2572  C CA   . ILE B 1 51  ? 2.467   0.301   15.608  1.00 0.00 ? 51  ILE B CA   1  
ATOM 2573  C C    . ILE B 1 51  ? 1.165   0.357   14.798  1.00 0.00 ? 51  ILE B C    1  
ATOM 2574  O O    . ILE B 1 51  ? 0.385   -0.573  14.813  1.00 0.00 ? 51  ILE B O    1  
ATOM 2575  C CB   . ILE B 1 51  ? 2.194   0.792   17.031  1.00 0.00 ? 51  ILE B CB   1  
ATOM 2576  C CG1  . ILE B 1 51  ? 1.702   2.240   16.983  1.00 0.00 ? 51  ILE B CG1  1  
ATOM 2577  C CG2  . ILE B 1 51  ? 3.482   0.719   17.853  1.00 0.00 ? 51  ILE B CG2  1  
ATOM 2578  C CD1  . ILE B 1 51  ? 1.088   2.617   18.332  1.00 0.00 ? 51  ILE B CD1  1  
ATOM 2579  H H    . ILE B 1 51  ? 4.166   1.624   15.566  1.00 0.00 ? 51  ILE B H    1  
ATOM 2580  H HA   . ILE B 1 51  ? 2.812   -0.722  15.649  1.00 0.00 ? 51  ILE B HA   1  
ATOM 2581  H HB   . ILE B 1 51  ? 1.440   0.168   17.488  1.00 0.00 ? 51  ILE B HB   1  
ATOM 2582  H HG12 . ILE B 1 51  ? 2.534   2.896   16.769  1.00 0.00 ? 51  ILE B HG12 1  
ATOM 2583  H HG13 . ILE B 1 51  ? 0.955   2.342   16.209  1.00 0.00 ? 51  ILE B HG13 1  
ATOM 2584  H HG21 . ILE B 1 51  ? 4.095   -0.093  17.490  1.00 0.00 ? 51  ILE B HG21 1  
ATOM 2585  H HG22 . ILE B 1 51  ? 4.023   1.649   17.758  1.00 0.00 ? 51  ILE B HG22 1  
ATOM 2586  H HG23 . ILE B 1 51  ? 3.238   0.549   18.891  1.00 0.00 ? 51  ILE B HG23 1  
ATOM 2587  H HD11 . ILE B 1 51  ? 0.987   1.731   18.942  1.00 0.00 ? 51  ILE B HD11 1  
ATOM 2588  H HD12 . ILE B 1 51  ? 1.729   3.327   18.833  1.00 0.00 ? 51  ILE B HD12 1  
ATOM 2589  H HD13 . ILE B 1 51  ? 0.115   3.058   18.175  1.00 0.00 ? 51  ILE B HD13 1  
ATOM 2590  N N    . TRP B 1 52  ? 0.911   1.433   14.104  1.00 0.00 ? 52  TRP B N    1  
ATOM 2591  C CA   . TRP B 1 52  ? -0.355  1.527   13.315  1.00 0.00 ? 52  TRP B CA   1  
ATOM 2592  C C    . TRP B 1 52  ? -0.426  0.397   12.285  1.00 0.00 ? 52  TRP B C    1  
ATOM 2593  O O    . TRP B 1 52  ? -0.026  0.558   11.150  1.00 0.00 ? 52  TRP B O    1  
ATOM 2594  C CB   . TRP B 1 52  ? -0.411  2.870   12.592  1.00 0.00 ? 52  TRP B CB   1  
ATOM 2595  C CG   . TRP B 1 52  ? -1.818  3.373   12.592  1.00 0.00 ? 52  TRP B CG   1  
ATOM 2596  C CD1  . TRP B 1 52  ? -2.467  3.854   11.510  1.00 0.00 ? 52  TRP B CD1  1  
ATOM 2597  C CD2  . TRP B 1 52  ? -2.758  3.452   13.703  1.00 0.00 ? 52  TRP B CD2  1  
ATOM 2598  N NE1  . TRP B 1 52  ? -3.747  4.225   11.884  1.00 0.00 ? 52  TRP B NE1  1  
ATOM 2599  C CE2  . TRP B 1 52  ? -3.974  3.997   13.226  1.00 0.00 ? 52  TRP B CE2  1  
ATOM 2600  C CE3  . TRP B 1 52  ? -2.673  3.108   15.063  1.00 0.00 ? 52  TRP B CE3  1  
ATOM 2601  C CZ2  . TRP B 1 52  ? -5.069  4.193   14.071  1.00 0.00 ? 52  TRP B CZ2  1  
ATOM 2602  C CZ3  . TRP B 1 52  ? -3.772  3.304   15.916  1.00 0.00 ? 52  TRP B CZ3  1  
ATOM 2603  C CH2  . TRP B 1 52  ? -4.967  3.845   15.421  1.00 0.00 ? 52  TRP B CH2  1  
ATOM 2604  H H    . TRP B 1 52  ? 1.544   2.181   14.108  1.00 0.00 ? 52  TRP B H    1  
ATOM 2605  H HA   . TRP B 1 52  ? -1.198  1.451   13.983  1.00 0.00 ? 52  TRP B HA   1  
ATOM 2606  H HB2  . TRP B 1 52  ? 0.225   3.575   13.098  1.00 0.00 ? 52  TRP B HB2  1  
ATOM 2607  H HB3  . TRP B 1 52  ? -0.073  2.746   11.574  1.00 0.00 ? 52  TRP B HB3  1  
ATOM 2608  H HD1  . TRP B 1 52  ? -2.054  3.934   10.518  1.00 0.00 ? 52  TRP B HD1  1  
ATOM 2609  H HE1  . TRP B 1 52  ? -4.423  4.606   11.284  1.00 0.00 ? 52  TRP B HE1  1  
ATOM 2610  H HE3  . TRP B 1 52  ? -1.758  2.689   15.454  1.00 0.00 ? 52  TRP B HE3  1  
ATOM 2611  H HZ2  . TRP B 1 52  ? -5.989  4.609   13.684  1.00 0.00 ? 52  TRP B HZ2  1  
ATOM 2612  H HZ3  . TRP B 1 52  ? -3.696  3.035   16.959  1.00 0.00 ? 52  TRP B HZ3  1  
ATOM 2613  H HH2  . TRP B 1 52  ? -5.808  3.993   16.082  1.00 0.00 ? 52  TRP B HH2  1  
ATOM 2614  N N    . SER B 1 53  ? -0.955  -0.735  12.676  1.00 0.00 ? 53  SER B N    1  
ATOM 2615  C CA   . SER B 1 53  ? -1.087  -1.891  11.736  1.00 0.00 ? 53  SER B CA   1  
ATOM 2616  C C    . SER B 1 53  ? 0.095   -1.941  10.762  1.00 0.00 ? 53  SER B C    1  
ATOM 2617  O O    . SER B 1 53  ? 0.100   -1.281  9.742   1.00 0.00 ? 53  SER B O    1  
ATOM 2618  C CB   . SER B 1 53  ? -2.387  -1.749  10.945  1.00 0.00 ? 53  SER B CB   1  
ATOM 2619  O OG   . SER B 1 53  ? -3.237  -0.818  11.604  1.00 0.00 ? 53  SER B OG   1  
ATOM 2620  H H    . SER B 1 53  ? -1.283  -0.823  13.595  1.00 0.00 ? 53  SER B H    1  
ATOM 2621  H HA   . SER B 1 53  ? -1.117  -2.809  12.304  1.00 0.00 ? 53  SER B HA   1  
ATOM 2622  H HB2  . SER B 1 53  ? -2.169  -1.390  9.953   1.00 0.00 ? 53  SER B HB2  1  
ATOM 2623  H HB3  . SER B 1 53  ? -2.874  -2.713  10.878  1.00 0.00 ? 53  SER B HB3  1  
ATOM 2624  H HG   . SER B 1 53  ? -3.384  -1.133  12.499  1.00 0.00 ? 53  SER B HG   1  
ATOM 2625  N N    . LEU B 1 54  ? 1.091   -2.730  11.059  1.00 0.00 ? 54  LEU B N    1  
ATOM 2626  C CA   . LEU B 1 54  ? 2.259   -2.827  10.139  1.00 0.00 ? 54  LEU B CA   1  
ATOM 2627  C C    . LEU B 1 54  ? 2.177   -4.140  9.359   1.00 0.00 ? 54  LEU B C    1  
ATOM 2628  O O    . LEU B 1 54  ? 1.991   -5.200  9.925   1.00 0.00 ? 54  LEU B O    1  
ATOM 2629  C CB   . LEU B 1 54  ? 3.555   -2.783  10.950  1.00 0.00 ? 54  LEU B CB   1  
ATOM 2630  C CG   . LEU B 1 54  ? 3.634   -1.448  11.692  1.00 0.00 ? 54  LEU B CG   1  
ATOM 2631  C CD1  . LEU B 1 54  ? 4.912   -1.393  12.531  1.00 0.00 ? 54  LEU B CD1  1  
ATOM 2632  C CD2  . LEU B 1 54  ? 3.644   -0.304  10.676  1.00 0.00 ? 54  LEU B CD2  1  
ATOM 2633  H H    . LEU B 1 54  ? 1.067   -3.264  11.880  1.00 0.00 ? 54  LEU B H    1  
ATOM 2634  H HA   . LEU B 1 54  ? 2.240   -1.998  9.447   1.00 0.00 ? 54  LEU B HA   1  
ATOM 2635  H HB2  . LEU B 1 54  ? 3.565   -3.596  11.662  1.00 0.00 ? 54  LEU B HB2  1  
ATOM 2636  H HB3  . LEU B 1 54  ? 4.400   -2.874  10.284  1.00 0.00 ? 54  LEU B HB3  1  
ATOM 2637  H HG   . LEU B 1 54  ? 2.775   -1.349  12.339  1.00 0.00 ? 54  LEU B HG   1  
ATOM 2638  H HD11 . LEU B 1 54  ? 5.441   -2.329  12.444  1.00 0.00 ? 54  LEU B HD11 1  
ATOM 2639  H HD12 . LEU B 1 54  ? 5.540   -0.589  12.176  1.00 0.00 ? 54  LEU B HD12 1  
ATOM 2640  H HD13 . LEU B 1 54  ? 4.655   -1.218  13.565  1.00 0.00 ? 54  LEU B HD13 1  
ATOM 2641  H HD21 . LEU B 1 54  ? 3.885   -0.692  9.698   1.00 0.00 ? 54  LEU B HD21 1  
ATOM 2642  H HD22 . LEU B 1 54  ? 2.670   0.162   10.649  1.00 0.00 ? 54  LEU B HD22 1  
ATOM 2643  H HD23 . LEU B 1 54  ? 4.385   0.428   10.966  1.00 0.00 ? 54  LEU B HD23 1  
ATOM 2644  N N    . ASP B 1 55  ? 2.300   -4.077  8.061   1.00 0.00 ? 55  ASP B N    1  
ATOM 2645  C CA   . ASP B 1 55  ? 2.214   -5.321  7.243   1.00 0.00 ? 55  ASP B CA   1  
ATOM 2646  C C    . ASP B 1 55  ? 3.615   -5.879  6.985   1.00 0.00 ? 55  ASP B C    1  
ATOM 2647  O O    . ASP B 1 55  ? 3.961   -6.949  7.446   1.00 0.00 ? 55  ASP B O    1  
ATOM 2648  C CB   . ASP B 1 55  ? 1.541   -5.002  5.906   1.00 0.00 ? 55  ASP B CB   1  
ATOM 2649  C CG   . ASP B 1 55  ? 0.831   -6.251  5.381   1.00 0.00 ? 55  ASP B CG   1  
ATOM 2650  O OD1  . ASP B 1 55  ? 0.016   -6.795  6.108   1.00 0.00 ? 55  ASP B OD1  1  
ATOM 2651  O OD2  . ASP B 1 55  ? 1.113   -6.642  4.260   1.00 0.00 ? 55  ASP B OD2  1  
ATOM 2652  H H    . ASP B 1 55  ? 2.440   -3.210  7.625   1.00 0.00 ? 55  ASP B H    1  
ATOM 2653  H HA   . ASP B 1 55  ? 1.627   -6.057  7.771   1.00 0.00 ? 55  ASP B HA   1  
ATOM 2654  H HB2  . ASP B 1 55  ? 0.821   -4.209  6.045   1.00 0.00 ? 55  ASP B HB2  1  
ATOM 2655  H HB3  . ASP B 1 55  ? 2.288   -4.689  5.192   1.00 0.00 ? 55  ASP B HB3  1  
ATOM 2656  N N    . THR B 1 56  ? 4.422   -5.170  6.245   1.00 0.00 ? 56  THR B N    1  
ATOM 2657  C CA   . THR B 1 56  ? 5.796   -5.670  5.952   1.00 0.00 ? 56  THR B CA   1  
ATOM 2658  C C    . THR B 1 56  ? 6.785   -5.080  6.958   1.00 0.00 ? 56  THR B C    1  
ATOM 2659  O O    . THR B 1 56  ? 6.494   -4.116  7.638   1.00 0.00 ? 56  THR B O    1  
ATOM 2660  C CB   . THR B 1 56  ? 6.201   -5.251  4.537   1.00 0.00 ? 56  THR B CB   1  
ATOM 2661  O OG1  . THR B 1 56  ? 6.777   -3.953  4.577   1.00 0.00 ? 56  THR B OG1  1  
ATOM 2662  C CG2  . THR B 1 56  ? 4.967   -5.235  3.634   1.00 0.00 ? 56  THR B CG2  1  
ATOM 2663  H H    . THR B 1 56  ? 4.124   -4.313  5.876   1.00 0.00 ? 56  THR B H    1  
ATOM 2664  H HA   . THR B 1 56  ? 5.809   -6.747  6.025   1.00 0.00 ? 56  THR B HA   1  
ATOM 2665  H HB   . THR B 1 56  ? 6.920   -5.953  4.145   1.00 0.00 ? 56  THR B HB   1  
ATOM 2666  H HG1  . THR B 1 56  ? 7.541   -3.949  3.995   1.00 0.00 ? 56  THR B HG1  1  
ATOM 2667  H HG21 . THR B 1 56  ? 4.422   -6.161  3.752   1.00 0.00 ? 56  THR B HG21 1  
ATOM 2668  H HG22 . THR B 1 56  ? 4.331   -4.406  3.907   1.00 0.00 ? 56  THR B HG22 1  
ATOM 2669  H HG23 . THR B 1 56  ? 5.275   -5.128  2.604   1.00 0.00 ? 56  THR B HG23 1  
ATOM 2670  N N    . GLN B 1 57  ? 7.954   -5.652  7.056   1.00 0.00 ? 57  GLN B N    1  
ATOM 2671  C CA   . GLN B 1 57  ? 8.963   -5.124  8.014   1.00 0.00 ? 57  GLN B CA   1  
ATOM 2672  C C    . GLN B 1 57  ? 9.372   -3.712  7.591   1.00 0.00 ? 57  GLN B C    1  
ATOM 2673  O O    . GLN B 1 57  ? 9.612   -2.852  8.416   1.00 0.00 ? 57  GLN B O    1  
ATOM 2674  C CB   . GLN B 1 57  ? 10.191  -6.036  8.014   1.00 0.00 ? 57  GLN B CB   1  
ATOM 2675  C CG   . GLN B 1 57  ? 10.155  -6.941  9.247   1.00 0.00 ? 57  GLN B CG   1  
ATOM 2676  C CD   . GLN B 1 57  ? 11.512  -7.627  9.416   1.00 0.00 ? 57  GLN B CD   1  
ATOM 2677  O OE1  . GLN B 1 57  ? 12.521  -7.123  8.964   1.00 0.00 ? 57  GLN B OE1  1  
ATOM 2678  N NE2  . GLN B 1 57  ? 11.579  -8.765  10.052  1.00 0.00 ? 57  GLN B NE2  1  
ATOM 2679  H H    . GLN B 1 57  ? 8.167   -6.428  6.497   1.00 0.00 ? 57  GLN B H    1  
ATOM 2680  H HA   . GLN B 1 57  ? 8.536   -5.094  9.006   1.00 0.00 ? 57  GLN B HA   1  
ATOM 2681  H HB2  . GLN B 1 57  ? 10.188  -6.643  7.120   1.00 0.00 ? 57  GLN B HB2  1  
ATOM 2682  H HB3  . GLN B 1 57  ? 11.087  -5.435  8.038   1.00 0.00 ? 57  GLN B HB3  1  
ATOM 2683  H HG2  . GLN B 1 57  ? 9.939   -6.347  10.123  1.00 0.00 ? 57  GLN B HG2  1  
ATOM 2684  H HG3  . GLN B 1 57  ? 9.388   -7.691  9.121   1.00 0.00 ? 57  GLN B HG3  1  
ATOM 2685  H HE21 . GLN B 1 57  ? 10.765  -9.171  10.416  1.00 0.00 ? 57  GLN B HE21 1  
ATOM 2686  H HE22 . GLN B 1 57  ? 12.444  -9.212  10.165  1.00 0.00 ? 57  GLN B HE22 1  
ATOM 2687  N N    . TYR B 1 58  ? 9.449   -3.463  6.312   1.00 0.00 ? 58  TYR B N    1  
ATOM 2688  C CA   . TYR B 1 58  ? 9.837   -2.104  5.841   1.00 0.00 ? 58  TYR B CA   1  
ATOM 2689  C C    . TYR B 1 58  ? 8.728   -1.112  6.218   1.00 0.00 ? 58  TYR B C    1  
ATOM 2690  O O    . TYR B 1 58  ? 8.925   0.087   6.210   1.00 0.00 ? 58  TYR B O    1  
ATOM 2691  C CB   . TYR B 1 58  ? 10.043  -2.133  4.314   1.00 0.00 ? 58  TYR B CB   1  
ATOM 2692  C CG   . TYR B 1 58  ? 9.776   -0.768  3.719   1.00 0.00 ? 58  TYR B CG   1  
ATOM 2693  C CD1  . TYR B 1 58  ? 10.744  0.239   3.801   1.00 0.00 ? 58  TYR B CD1  1  
ATOM 2694  C CD2  . TYR B 1 58  ? 8.555   -0.515  3.087   1.00 0.00 ? 58  TYR B CD2  1  
ATOM 2695  C CE1  . TYR B 1 58  ? 10.488  1.500   3.249   1.00 0.00 ? 58  TYR B CE1  1  
ATOM 2696  C CE2  . TYR B 1 58  ? 8.299   0.744   2.535   1.00 0.00 ? 58  TYR B CE2  1  
ATOM 2697  C CZ   . TYR B 1 58  ? 9.266   1.752   2.616   1.00 0.00 ? 58  TYR B CZ   1  
ATOM 2698  O OH   . TYR B 1 58  ? 9.014   2.993   2.072   1.00 0.00 ? 58  TYR B OH   1  
ATOM 2699  H H    . TYR B 1 58  ? 9.249   -4.169  5.662   1.00 0.00 ? 58  TYR B H    1  
ATOM 2700  H HA   . TYR B 1 58  ? 10.758  -1.809  6.322   1.00 0.00 ? 58  TYR B HA   1  
ATOM 2701  H HB2  . TYR B 1 58  ? 11.060  -2.422  4.098   1.00 0.00 ? 58  TYR B HB2  1  
ATOM 2702  H HB3  . TYR B 1 58  ? 9.368   -2.851  3.873   1.00 0.00 ? 58  TYR B HB3  1  
ATOM 2703  H HD1  . TYR B 1 58  ? 11.687  0.044   4.289   1.00 0.00 ? 58  TYR B HD1  1  
ATOM 2704  H HD2  . TYR B 1 58  ? 7.809   -1.293  3.024   1.00 0.00 ? 58  TYR B HD2  1  
ATOM 2705  H HE1  . TYR B 1 58  ? 11.233  2.280   3.312   1.00 0.00 ? 58  TYR B HE1  1  
ATOM 2706  H HE2  . TYR B 1 58  ? 7.356   0.939   2.047   1.00 0.00 ? 58  TYR B HE2  1  
ATOM 2707  H HH   . TYR B 1 58  ? 8.234   2.921   1.516   1.00 0.00 ? 58  TYR B HH   1  
ATOM 2708  N N    . SER B 1 59  ? 7.565   -1.605  6.550   1.00 0.00 ? 59  SER B N    1  
ATOM 2709  C CA   . SER B 1 59  ? 6.450   -0.692  6.929   1.00 0.00 ? 59  SER B CA   1  
ATOM 2710  C C    . SER B 1 59  ? 6.751   -0.063  8.290   1.00 0.00 ? 59  SER B C    1  
ATOM 2711  O O    . SER B 1 59  ? 6.257   0.997   8.619   1.00 0.00 ? 59  SER B O    1  
ATOM 2712  C CB   . SER B 1 59  ? 5.146   -1.488  7.009   1.00 0.00 ? 59  SER B CB   1  
ATOM 2713  O OG   . SER B 1 59  ? 4.900   -2.111  5.755   1.00 0.00 ? 59  SER B OG   1  
ATOM 2714  H H    . SER B 1 59  ? 7.427   -2.575  6.552   1.00 0.00 ? 59  SER B H    1  
ATOM 2715  H HA   . SER B 1 59  ? 6.351   0.087   6.187   1.00 0.00 ? 59  SER B HA   1  
ATOM 2716  H HB2  . SER B 1 59  ? 5.231   -2.245  7.771   1.00 0.00 ? 59  SER B HB2  1  
ATOM 2717  H HB3  . SER B 1 59  ? 4.332   -0.820  7.258   1.00 0.00 ? 59  SER B HB3  1  
ATOM 2718  H HG   . SER B 1 59  ? 5.745   -2.243  5.319   1.00 0.00 ? 59  SER B HG   1  
ATOM 2719  N N    . LYS B 1 60  ? 7.561   -0.708  9.084   1.00 0.00 ? 60  LYS B N    1  
ATOM 2720  C CA   . LYS B 1 60  ? 7.897   -0.147  10.422  1.00 0.00 ? 60  LYS B CA   1  
ATOM 2721  C C    . LYS B 1 60  ? 9.220   0.619   10.331  1.00 0.00 ? 60  LYS B C    1  
ATOM 2722  O O    . LYS B 1 60  ? 9.457   1.557   11.066  1.00 0.00 ? 60  LYS B O    1  
ATOM 2723  C CB   . LYS B 1 60  ? 8.031   -1.288  11.433  1.00 0.00 ? 60  LYS B CB   1  
ATOM 2724  C CG   . LYS B 1 60  ? 9.035   -2.318  10.914  1.00 0.00 ? 60  LYS B CG   1  
ATOM 2725  C CD   . LYS B 1 60  ? 9.596   -3.121  12.089  1.00 0.00 ? 60  LYS B CD   1  
ATOM 2726  C CE   . LYS B 1 60  ? 8.851   -4.452  12.199  1.00 0.00 ? 60  LYS B CE   1  
ATOM 2727  N NZ   . LYS B 1 60  ? 9.646   -5.399  13.031  1.00 0.00 ? 60  LYS B NZ   1  
ATOM 2728  H H    . LYS B 1 60  ? 7.950   -1.561  8.799   1.00 0.00 ? 60  LYS B H    1  
ATOM 2729  H HA   . LYS B 1 60  ? 7.113   0.525   10.738  1.00 0.00 ? 60  LYS B HA   1  
ATOM 2730  H HB2  . LYS B 1 60  ? 8.374   -0.893  12.379  1.00 0.00 ? 60  LYS B HB2  1  
ATOM 2731  H HB3  . LYS B 1 60  ? 7.070   -1.763  11.569  1.00 0.00 ? 60  LYS B HB3  1  
ATOM 2732  H HG2  . LYS B 1 60  ? 8.541   -2.987  10.224  1.00 0.00 ? 60  LYS B HG2  1  
ATOM 2733  H HG3  . LYS B 1 60  ? 9.843   -1.811  10.408  1.00 0.00 ? 60  LYS B HG3  1  
ATOM 2734  H HD2  . LYS B 1 60  ? 10.648  -3.308  11.927  1.00 0.00 ? 60  LYS B HD2  1  
ATOM 2735  H HD3  . LYS B 1 60  ? 9.466   -2.561  13.002  1.00 0.00 ? 60  LYS B HD3  1  
ATOM 2736  H HE2  . LYS B 1 60  ? 7.888   -4.288  12.660  1.00 0.00 ? 60  LYS B HE2  1  
ATOM 2737  H HE3  . LYS B 1 60  ? 8.711   -4.870  11.213  1.00 0.00 ? 60  LYS B HE3  1  
ATOM 2738  H HZ1  . LYS B 1 60  ? 10.647  -5.351  12.751  1.00 0.00 ? 60  LYS B HZ1  1  
ATOM 2739  H HZ2  . LYS B 1 60  ? 9.554   -5.141  14.034  1.00 0.00 ? 60  LYS B HZ2  1  
ATOM 2740  H HZ3  . LYS B 1 60  ? 9.292   -6.366  12.891  1.00 0.00 ? 60  LYS B HZ3  1  
ATOM 2741  N N    . VAL B 1 61  ? 10.080  0.229   9.429   1.00 0.00 ? 61  VAL B N    1  
ATOM 2742  C CA   . VAL B 1 61  ? 11.383  0.934   9.283   1.00 0.00 ? 61  VAL B CA   1  
ATOM 2743  C C    . VAL B 1 61  ? 11.137  2.321   8.678   1.00 0.00 ? 61  VAL B C    1  
ATOM 2744  O O    . VAL B 1 61  ? 11.587  3.322   9.197   1.00 0.00 ? 61  VAL B O    1  
ATOM 2745  C CB   . VAL B 1 61  ? 12.296  0.111   8.368   1.00 0.00 ? 61  VAL B CB   1  
ATOM 2746  C CG1  . VAL B 1 61  ? 13.419  0.992   7.820   1.00 0.00 ? 61  VAL B CG1  1  
ATOM 2747  C CG2  . VAL B 1 61  ? 12.904  -1.045  9.167   1.00 0.00 ? 61  VAL B CG2  1  
ATOM 2748  H H    . VAL B 1 61  ? 9.868   -0.527  8.845   1.00 0.00 ? 61  VAL B H    1  
ATOM 2749  H HA   . VAL B 1 61  ? 11.845  1.042   10.253  1.00 0.00 ? 61  VAL B HA   1  
ATOM 2750  H HB   . VAL B 1 61  ? 11.717  -0.284  7.546   1.00 0.00 ? 61  VAL B HB   1  
ATOM 2751  H HG11 . VAL B 1 61  ? 13.416  1.940   8.336   1.00 0.00 ? 61  VAL B HG11 1  
ATOM 2752  H HG12 . VAL B 1 61  ? 14.368  0.502   7.973   1.00 0.00 ? 61  VAL B HG12 1  
ATOM 2753  H HG13 . VAL B 1 61  ? 13.263  1.157   6.764   1.00 0.00 ? 61  VAL B HG13 1  
ATOM 2754  H HG21 . VAL B 1 61  ? 12.466  -1.071  10.153  1.00 0.00 ? 61  VAL B HG21 1  
ATOM 2755  H HG22 . VAL B 1 61  ? 12.705  -1.978  8.660   1.00 0.00 ? 61  VAL B HG22 1  
ATOM 2756  H HG23 . VAL B 1 61  ? 13.972  -0.903  9.251   1.00 0.00 ? 61  VAL B HG23 1  
ATOM 2757  N N    . LEU B 1 62  ? 10.420  2.387   7.589   1.00 0.00 ? 62  LEU B N    1  
ATOM 2758  C CA   . LEU B 1 62  ? 10.139  3.709   6.959   1.00 0.00 ? 62  LEU B CA   1  
ATOM 2759  C C    . LEU B 1 62  ? 9.155   4.478   7.845   1.00 0.00 ? 62  LEU B C    1  
ATOM 2760  O O    . LEU B 1 62  ? 9.292   5.667   8.052   1.00 0.00 ? 62  LEU B O    1  
ATOM 2761  C CB   . LEU B 1 62  ? 9.535   3.483   5.567   1.00 0.00 ? 62  LEU B CB   1  
ATOM 2762  C CG   . LEU B 1 62  ? 8.934   4.784   5.015   1.00 0.00 ? 62  LEU B CG   1  
ATOM 2763  C CD1  . LEU B 1 62  ? 9.981   5.548   4.199   1.00 0.00 ? 62  LEU B CD1  1  
ATOM 2764  C CD2  . LEU B 1 62  ? 7.750   4.436   4.116   1.00 0.00 ? 62  LEU B CD2  1  
ATOM 2765  H H    . LEU B 1 62  ? 10.062  1.568   7.188   1.00 0.00 ? 62  LEU B H    1  
ATOM 2766  H HA   . LEU B 1 62  ? 11.059  4.269   6.869   1.00 0.00 ? 62  LEU B HA   1  
ATOM 2767  H HB2  . LEU B 1 62  ? 10.308  3.139   4.897   1.00 0.00 ? 62  LEU B HB2  1  
ATOM 2768  H HB3  . LEU B 1 62  ? 8.760   2.734   5.632   1.00 0.00 ? 62  LEU B HB3  1  
ATOM 2769  H HG   . LEU B 1 62  ? 8.595   5.404   5.830   1.00 0.00 ? 62  LEU B HG   1  
ATOM 2770  H HD11 . LEU B 1 62  ? 10.971  5.247   4.507   1.00 0.00 ? 62  LEU B HD11 1  
ATOM 2771  H HD12 . LEU B 1 62  ? 9.849   5.330   3.148   1.00 0.00 ? 62  LEU B HD12 1  
ATOM 2772  H HD13 . LEU B 1 62  ? 9.860   6.610   4.362   1.00 0.00 ? 62  LEU B HD13 1  
ATOM 2773  H HD21 . LEU B 1 62  ? 7.862   3.427   3.749   1.00 0.00 ? 62  LEU B HD21 1  
ATOM 2774  H HD22 . LEU B 1 62  ? 6.839   4.510   4.685   1.00 0.00 ? 62  LEU B HD22 1  
ATOM 2775  H HD23 . LEU B 1 62  ? 7.716   5.121   3.283   1.00 0.00 ? 62  LEU B HD23 1  
ATOM 2776  N N    . ALA B 1 63  ? 8.166   3.807   8.378   1.00 0.00 ? 63  ALA B N    1  
ATOM 2777  C CA   . ALA B 1 63  ? 7.186   4.506   9.258   1.00 0.00 ? 63  ALA B CA   1  
ATOM 2778  C C    . ALA B 1 63  ? 7.953   5.402   10.232  1.00 0.00 ? 63  ALA B C    1  
ATOM 2779  O O    . ALA B 1 63  ? 7.605   6.546   10.447  1.00 0.00 ? 63  ALA B O    1  
ATOM 2780  C CB   . ALA B 1 63  ? 6.366   3.473   10.037  1.00 0.00 ? 63  ALA B CB   1  
ATOM 2781  H H    . ALA B 1 63  ? 8.074   2.847   8.206   1.00 0.00 ? 63  ALA B H    1  
ATOM 2782  H HA   . ALA B 1 63  ? 6.527   5.112   8.653   1.00 0.00 ? 63  ALA B HA   1  
ATOM 2783  H HB1  . ALA B 1 63  ? 6.866   2.517   10.006  1.00 0.00 ? 63  ALA B HB1  1  
ATOM 2784  H HB2  . ALA B 1 63  ? 6.264   3.793   11.063  1.00 0.00 ? 63  ALA B HB2  1  
ATOM 2785  H HB3  . ALA B 1 63  ? 5.386   3.381   9.591   1.00 0.00 ? 63  ALA B HB3  1  
ATOM 2786  N N    . LEU B 1 64  ? 9.007   4.892   10.809  1.00 0.00 ? 64  LEU B N    1  
ATOM 2787  C CA   . LEU B 1 64  ? 9.816   5.713   11.754  1.00 0.00 ? 64  LEU B CA   1  
ATOM 2788  C C    . LEU B 1 64  ? 10.671  6.682   10.945  1.00 0.00 ? 64  LEU B C    1  
ATOM 2789  O O    . LEU B 1 64  ? 10.848  7.826   11.304  1.00 0.00 ? 64  LEU B O    1  
ATOM 2790  C CB   . LEU B 1 64  ? 10.731  4.794   12.567  1.00 0.00 ? 64  LEU B CB   1  
ATOM 2791  C CG   . LEU B 1 64  ? 9.895   3.997   13.561  1.00 0.00 ? 64  LEU B CG   1  
ATOM 2792  C CD1  . LEU B 1 64  ? 10.624  2.702   13.920  1.00 0.00 ? 64  LEU B CD1  1  
ATOM 2793  C CD2  . LEU B 1 64  ? 9.679   4.828   14.827  1.00 0.00 ? 64  LEU B CD2  1  
ATOM 2794  H H    . LEU B 1 64  ? 9.276   3.971   10.609  1.00 0.00 ? 64  LEU B H    1  
ATOM 2795  H HA   . LEU B 1 64  ? 9.163   6.264   12.418  1.00 0.00 ? 64  LEU B HA   1  
ATOM 2796  H HB2  . LEU B 1 64  ? 11.239  4.114   11.900  1.00 0.00 ? 64  LEU B HB2  1  
ATOM 2797  H HB3  . LEU B 1 64  ? 11.458  5.386   13.101  1.00 0.00 ? 64  LEU B HB3  1  
ATOM 2798  H HG   . LEU B 1 64  ? 8.942   3.763   13.112  1.00 0.00 ? 64  LEU B HG   1  
ATOM 2799  H HD11 . LEU B 1 64  ? 11.575  2.672   13.409  1.00 0.00 ? 64  LEU B HD11 1  
ATOM 2800  H HD12 . LEU B 1 64  ? 10.788  2.666   14.987  1.00 0.00 ? 64  LEU B HD12 1  
ATOM 2801  H HD13 . LEU B 1 64  ? 10.025  1.856   13.619  1.00 0.00 ? 64  LEU B HD13 1  
ATOM 2802  H HD21 . LEU B 1 64  ? 9.408   5.837   14.554  1.00 0.00 ? 64  LEU B HD21 1  
ATOM 2803  H HD22 . LEU B 1 64  ? 8.887   4.389   15.415  1.00 0.00 ? 64  LEU B HD22 1  
ATOM 2804  H HD23 . LEU B 1 64  ? 10.591  4.844   15.406  1.00 0.00 ? 64  LEU B HD23 1  
ATOM 2805  N N    . TYR B 1 65  ? 11.199  6.223   9.850   1.00 0.00 ? 65  TYR B N    1  
ATOM 2806  C CA   . TYR B 1 65  ? 12.046  7.101   8.995   1.00 0.00 ? 65  TYR B CA   1  
ATOM 2807  C C    . TYR B 1 65  ? 11.353  8.454   8.813   1.00 0.00 ? 65  TYR B C    1  
ATOM 2808  O O    . TYR B 1 65  ? 11.992  9.484   8.717   1.00 0.00 ? 65  TYR B O    1  
ATOM 2809  C CB   . TYR B 1 65  ? 12.236  6.432   7.633   1.00 0.00 ? 65  TYR B CB   1  
ATOM 2810  C CG   . TYR B 1 65  ? 13.023  7.340   6.722   1.00 0.00 ? 65  TYR B CG   1  
ATOM 2811  C CD1  . TYR B 1 65  ? 14.424  7.318   6.750   1.00 0.00 ? 65  TYR B CD1  1  
ATOM 2812  C CD2  . TYR B 1 65  ? 12.351  8.199   5.844   1.00 0.00 ? 65  TYR B CD2  1  
ATOM 2813  C CE1  . TYR B 1 65  ? 15.151  8.159   5.897   1.00 0.00 ? 65  TYR B CE1  1  
ATOM 2814  C CE2  . TYR B 1 65  ? 13.079  9.038   4.993   1.00 0.00 ? 65  TYR B CE2  1  
ATOM 2815  C CZ   . TYR B 1 65  ? 14.478  9.018   5.018   1.00 0.00 ? 65  TYR B CZ   1  
ATOM 2816  O OH   . TYR B 1 65  ? 15.196  9.845   4.178   1.00 0.00 ? 65  TYR B OH   1  
ATOM 2817  H H    . TYR B 1 65  ? 11.035  5.294   9.587   1.00 0.00 ? 65  TYR B H    1  
ATOM 2818  H HA   . TYR B 1 65  ? 13.008  7.245   9.464   1.00 0.00 ? 65  TYR B HA   1  
ATOM 2819  H HB2  . TYR B 1 65  ? 12.770  5.502   7.761   1.00 0.00 ? 65  TYR B HB2  1  
ATOM 2820  H HB3  . TYR B 1 65  ? 11.270  6.233   7.193   1.00 0.00 ? 65  TYR B HB3  1  
ATOM 2821  H HD1  . TYR B 1 65  ? 14.943  6.655   7.431   1.00 0.00 ? 65  TYR B HD1  1  
ATOM 2822  H HD2  . TYR B 1 65  ? 11.270  8.214   5.824   1.00 0.00 ? 65  TYR B HD2  1  
ATOM 2823  H HE1  . TYR B 1 65  ? 16.230  8.143   5.914   1.00 0.00 ? 65  TYR B HE1  1  
ATOM 2824  H HE2  . TYR B 1 65  ? 12.561  9.700   4.315   1.00 0.00 ? 65  TYR B HE2  1  
ATOM 2825  H HH   . TYR B 1 65  ? 15.996  9.383   3.918   1.00 0.00 ? 65  TYR B HH   1  
ATOM 2826  N N    . ASN B 1 66  ? 10.050  8.457   8.771   1.00 0.00 ? 66  ASN B N    1  
ATOM 2827  C CA   . ASN B 1 66  ? 9.300   9.733   8.603   1.00 0.00 ? 66  ASN B CA   1  
ATOM 2828  C C    . ASN B 1 66  ? 8.965   10.300  9.978   1.00 0.00 ? 66  ASN B C    1  
ATOM 2829  O O    . ASN B 1 66  ? 9.179   11.462  10.260  1.00 0.00 ? 66  ASN B O    1  
ATOM 2830  C CB   . ASN B 1 66  ? 7.997   9.445   7.874   1.00 0.00 ? 66  ASN B CB   1  
ATOM 2831  C CG   . ASN B 1 66  ? 7.582   10.665  7.048   1.00 0.00 ? 66  ASN B CG   1  
ATOM 2832  O OD1  . ASN B 1 66  ? 7.934   10.776  5.891   1.00 0.00 ? 66  ASN B OD1  1  
ATOM 2833  N ND2  . ASN B 1 66  ? 6.842   11.589  7.597   1.00 0.00 ? 66  ASN B ND2  1  
ATOM 2834  H H    . ASN B 1 66  ? 9.557   7.613   8.855   1.00 0.00 ? 66  ASN B H    1  
ATOM 2835  H HA   . ASN B 1 66  ? 9.890   10.441  8.040   1.00 0.00 ? 66  ASN B HA   1  
ATOM 2836  H HB2  . ASN B 1 66  ? 8.128   8.592   7.225   1.00 0.00 ? 66  ASN B HB2  1  
ATOM 2837  H HB3  . ASN B 1 66  ? 7.235   9.229   8.604   1.00 0.00 ? 66  ASN B HB3  1  
ATOM 2838  H HD21 . ASN B 1 66  ? 6.557   11.499  8.531   1.00 0.00 ? 66  ASN B HD21 1  
ATOM 2839  H HD22 . ASN B 1 66  ? 6.572   12.374  7.076   1.00 0.00 ? 66  ASN B HD22 1  
ATOM 2840  N N    . GLN B 1 67  ? 8.437   9.471   10.834  1.00 0.00 ? 67  GLN B N    1  
ATOM 2841  C CA   . GLN B 1 67  ? 8.071   9.924   12.206  1.00 0.00 ? 67  GLN B CA   1  
ATOM 2842  C C    . GLN B 1 67  ? 9.279   10.572  12.884  1.00 0.00 ? 67  GLN B C    1  
ATOM 2843  O O    . GLN B 1 67  ? 9.156   11.238  13.892  1.00 0.00 ? 67  GLN B O    1  
ATOM 2844  C CB   . GLN B 1 67  ? 7.615   8.714   13.024  1.00 0.00 ? 67  GLN B CB   1  
ATOM 2845  C CG   . GLN B 1 67  ? 6.104   8.530   12.870  1.00 0.00 ? 67  GLN B CG   1  
ATOM 2846  C CD   . GLN B 1 67  ? 5.376   9.720   13.496  1.00 0.00 ? 67  GLN B CD   1  
ATOM 2847  O OE1  . GLN B 1 67  ? 4.732   10.486  12.806  1.00 0.00 ? 67  GLN B OE1  1  
ATOM 2848  N NE2  . GLN B 1 67  ? 5.449   9.910   14.785  1.00 0.00 ? 67  GLN B NE2  1  
ATOM 2849  H H    . GLN B 1 67  ? 8.277   8.540   10.571  1.00 0.00 ? 67  GLN B H    1  
ATOM 2850  H HA   . GLN B 1 67  ? 7.271   10.639  12.145  1.00 0.00 ? 67  GLN B HA   1  
ATOM 2851  H HB2  . GLN B 1 67  ? 8.124   7.830   12.665  1.00 0.00 ? 67  GLN B HB2  1  
ATOM 2852  H HB3  . GLN B 1 67  ? 7.855   8.867   14.064  1.00 0.00 ? 67  GLN B HB3  1  
ATOM 2853  H HG2  . GLN B 1 67  ? 5.854   8.466   11.820  1.00 0.00 ? 67  GLN B HG2  1  
ATOM 2854  H HG3  . GLN B 1 67  ? 5.799   7.622   13.368  1.00 0.00 ? 67  GLN B HG3  1  
ATOM 2855  H HE21 . GLN B 1 67  ? 5.967   9.292   15.343  1.00 0.00 ? 67  GLN B HE21 1  
ATOM 2856  H HE22 . GLN B 1 67  ? 4.986   10.670  15.196  1.00 0.00 ? 67  GLN B HE22 1  
ATOM 2857  N N    . HIS B 1 68  ? 10.444  10.380  12.339  1.00 0.00 ? 68  HIS B N    1  
ATOM 2858  C CA   . HIS B 1 68  ? 11.663  10.983  12.951  1.00 0.00 ? 68  HIS B CA   1  
ATOM 2859  C C    . HIS B 1 68  ? 11.925  12.358  12.333  1.00 0.00 ? 68  HIS B C    1  
ATOM 2860  O O    . HIS B 1 68  ? 12.207  13.316  13.025  1.00 0.00 ? 68  HIS B O    1  
ATOM 2861  C CB   . HIS B 1 68  ? 12.869  10.074  12.702  1.00 0.00 ? 68  HIS B CB   1  
ATOM 2862  C CG   . HIS B 1 68  ? 13.001  9.093   13.833  1.00 0.00 ? 68  HIS B CG   1  
ATOM 2863  N ND1  . HIS B 1 68  ? 12.439  7.827   13.791  1.00 0.00 ? 68  HIS B ND1  1  
ATOM 2864  C CD2  . HIS B 1 68  ? 13.635  9.182   15.045  1.00 0.00 ? 68  HIS B CD2  1  
ATOM 2865  C CE1  . HIS B 1 68  ? 12.743  7.210   14.947  1.00 0.00 ? 68  HIS B CE1  1  
ATOM 2866  N NE2  . HIS B 1 68  ? 13.471  7.992   15.749  1.00 0.00 ? 68  HIS B NE2  1  
ATOM 2867  H H    . HIS B 1 68  ? 10.516  9.840   11.529  1.00 0.00 ? 68  HIS B H    1  
ATOM 2868  H HA   . HIS B 1 68  ? 11.511  11.093  14.015  1.00 0.00 ? 68  HIS B HA   1  
ATOM 2869  H HB2  . HIS B 1 68  ? 12.733  9.538   11.774  1.00 0.00 ? 68  HIS B HB2  1  
ATOM 2870  H HB3  . HIS B 1 68  ? 13.765  10.674  12.645  1.00 0.00 ? 68  HIS B HB3  1  
ATOM 2871  H HD1  . HIS B 1 68  ? 11.918  7.449   13.054  1.00 0.00 ? 68  HIS B HD1  1  
ATOM 2872  H HD2  . HIS B 1 68  ? 14.180  10.044  15.397  1.00 0.00 ? 68  HIS B HD2  1  
ATOM 2873  H HE1  . HIS B 1 68  ? 12.437  6.204   15.196  1.00 0.00 ? 68  HIS B HE1  1  
ATOM 2874  N N    . ASN B 1 69  ? 11.836  12.467  11.035  1.00 0.00 ? 69  ASN B N    1  
ATOM 2875  C CA   . ASN B 1 69  ? 12.082  13.783  10.381  1.00 0.00 ? 69  ASN B CA   1  
ATOM 2876  C C    . ASN B 1 69  ? 10.742  14.417  9.983   1.00 0.00 ? 69  ASN B C    1  
ATOM 2877  O O    . ASN B 1 69  ? 9.989   13.835  9.229   1.00 0.00 ? 69  ASN B O    1  
ATOM 2878  C CB   . ASN B 1 69  ? 12.933  13.577  9.126   1.00 0.00 ? 69  ASN B CB   1  
ATOM 2879  C CG   . ASN B 1 69  ? 14.409  13.495  9.517   1.00 0.00 ? 69  ASN B CG   1  
ATOM 2880  O OD1  . ASN B 1 69  ? 15.192  14.355  9.165   1.00 0.00 ? 69  ASN B OD1  1  
ATOM 2881  N ND2  . ASN B 1 69  ? 14.825  12.489  10.236  1.00 0.00 ? 69  ASN B ND2  1  
ATOM 2882  H H    . ASN B 1 69  ? 11.608  11.684  10.491  1.00 0.00 ? 69  ASN B H    1  
ATOM 2883  H HA   . ASN B 1 69  ? 12.608  14.428  11.066  1.00 0.00 ? 69  ASN B HA   1  
ATOM 2884  H HB2  . ASN B 1 69  ? 12.637  12.659  8.637   1.00 0.00 ? 69  ASN B HB2  1  
ATOM 2885  H HB3  . ASN B 1 69  ? 12.787  14.407  8.451   1.00 0.00 ? 69  ASN B HB3  1  
ATOM 2886  H HD21 . ASN B 1 69  ? 14.194  11.795  10.520  1.00 0.00 ? 69  ASN B HD21 1  
ATOM 2887  H HD22 . ASN B 1 69  ? 15.769  12.427  10.492  1.00 0.00 ? 69  ASN B HD22 1  
ATOM 2888  N N    . PRO B 1 70  ? 10.483  15.595  10.498  1.00 0.00 ? 70  PRO B N    1  
ATOM 2889  C CA   . PRO B 1 70  ? 9.239   16.328  10.206  1.00 0.00 ? 70  PRO B CA   1  
ATOM 2890  C C    . PRO B 1 70  ? 9.324   16.986  8.826   1.00 0.00 ? 70  PRO B C    1  
ATOM 2891  O O    . PRO B 1 70  ? 10.079  17.915  8.617   1.00 0.00 ? 70  PRO B O    1  
ATOM 2892  C CB   . PRO B 1 70  ? 9.175   17.385  11.311  1.00 0.00 ? 70  PRO B CB   1  
ATOM 2893  C CG   . PRO B 1 70  ? 10.625  17.574  11.816  1.00 0.00 ? 70  PRO B CG   1  
ATOM 2894  C CD   . PRO B 1 70  ? 11.399  16.305  11.415  1.00 0.00 ? 70  PRO B CD   1  
ATOM 2895  H HA   . PRO B 1 70  ? 8.384   15.674  10.268  1.00 0.00 ? 70  PRO B HA   1  
ATOM 2896  H HB2  . PRO B 1 70  ? 8.793   18.315  10.911  1.00 0.00 ? 70  PRO B HB2  1  
ATOM 2897  H HB3  . PRO B 1 70  ? 8.550   17.042  12.120  1.00 0.00 ? 70  PRO B HB3  1  
ATOM 2898  H HG2  . PRO B 1 70  ? 11.068  18.444  11.350  1.00 0.00 ? 70  PRO B HG2  1  
ATOM 2899  H HG3  . PRO B 1 70  ? 10.633  17.682  12.889  1.00 0.00 ? 70  PRO B HG3  1  
ATOM 2900  H HD2  . PRO B 1 70  ? 12.317  16.567  10.909  1.00 0.00 ? 70  PRO B HD2  1  
ATOM 2901  H HD3  . PRO B 1 70  ? 11.603  15.696  12.282  1.00 0.00 ? 70  PRO B HD3  1  
ATOM 2902  N N    . GLY B 1 71  ? 8.558   16.512  7.882   1.00 0.00 ? 71  GLY B N    1  
ATOM 2903  C CA   . GLY B 1 71  ? 8.598   17.113  6.519   1.00 0.00 ? 71  GLY B CA   1  
ATOM 2904  C C    . GLY B 1 71  ? 9.024   16.053  5.502   1.00 0.00 ? 71  GLY B C    1  
ATOM 2905  O O    . GLY B 1 71  ? 9.086   16.308  4.315   1.00 0.00 ? 71  GLY B O    1  
ATOM 2906  H H    . GLY B 1 71  ? 7.956   15.762  8.070   1.00 0.00 ? 71  GLY B H    1  
ATOM 2907  H HA2  . GLY B 1 71  ? 7.618   17.488  6.263   1.00 0.00 ? 71  GLY B HA2  1  
ATOM 2908  H HA3  . GLY B 1 71  ? 9.310   17.925  6.505   1.00 0.00 ? 71  GLY B HA3  1  
ATOM 2909  N N    . ALA B 1 72  ? 9.314   14.863  5.954   1.00 0.00 ? 72  ALA B N    1  
ATOM 2910  C CA   . ALA B 1 72  ? 9.729   13.791  5.015   1.00 0.00 ? 72  ALA B CA   1  
ATOM 2911  C C    . ALA B 1 72  ? 8.505   13.282  4.266   1.00 0.00 ? 72  ALA B C    1  
ATOM 2912  O O    . ALA B 1 72  ? 7.543   12.825  4.851   1.00 0.00 ? 72  ALA B O    1  
ATOM 2913  C CB   . ALA B 1 72  ? 10.366  12.640  5.789   1.00 0.00 ? 72  ALA B CB   1  
ATOM 2914  H H    . ALA B 1 72  ? 9.255   14.674  6.906   1.00 0.00 ? 72  ALA B H    1  
ATOM 2915  H HA   . ALA B 1 72  ? 10.443  14.189  4.308   1.00 0.00 ? 72  ALA B HA   1  
ATOM 2916  H HB1  . ALA B 1 72  ? 10.158  12.756  6.841   1.00 0.00 ? 72  ALA B HB1  1  
ATOM 2917  H HB2  . ALA B 1 72  ? 9.956   11.704  5.440   1.00 0.00 ? 72  ALA B HB2  1  
ATOM 2918  H HB3  . ALA B 1 72  ? 11.434  12.647  5.629   1.00 0.00 ? 72  ALA B HB3  1  
ATOM 2919  N N    . SER B 1 73  ? 8.539   13.368  2.977   1.00 0.00 ? 73  SER B N    1  
ATOM 2920  C CA   . SER B 1 73  ? 7.383   12.901  2.161   1.00 0.00 ? 73  SER B CA   1  
ATOM 2921  C C    . SER B 1 73  ? 7.624   11.462  1.695   1.00 0.00 ? 73  SER B C    1  
ATOM 2922  O O    . SER B 1 73  ? 7.107   11.037  0.681   1.00 0.00 ? 73  SER B O    1  
ATOM 2923  C CB   . SER B 1 73  ? 7.224   13.811  0.942   1.00 0.00 ? 73  SER B CB   1  
ATOM 2924  O OG   . SER B 1 73  ? 5.896   13.705  0.448   1.00 0.00 ? 73  SER B OG   1  
ATOM 2925  H H    . SER B 1 73  ? 9.328   13.747  2.545   1.00 0.00 ? 73  SER B H    1  
ATOM 2926  H HA   . SER B 1 73  ? 6.484   12.940  2.757   1.00 0.00 ? 73  SER B HA   1  
ATOM 2927  H HB2  . SER B 1 73  ? 7.416   14.832  1.226   1.00 0.00 ? 73  SER B HB2  1  
ATOM 2928  H HB3  . SER B 1 73  ? 7.929   13.513  0.177   1.00 0.00 ? 73  SER B HB3  1  
ATOM 2929  H HG   . SER B 1 73  ? 5.868   14.121  -0.417  1.00 0.00 ? 73  SER B HG   1  
ATOM 2930  N N    . ALA B 1 74  ? 8.399   10.706  2.425   1.00 0.00 ? 74  ALA B N    1  
ATOM 2931  C CA   . ALA B 1 74  ? 8.659   9.297   2.011   1.00 0.00 ? 74  ALA B CA   1  
ATOM 2932  C C    . ALA B 1 74  ? 7.976   8.340   2.990   1.00 0.00 ? 74  ALA B C    1  
ATOM 2933  O O    . ALA B 1 74  ? 8.302   7.172   3.065   1.00 0.00 ? 74  ALA B O    1  
ATOM 2934  C CB   . ALA B 1 74  ? 10.167  9.031   1.995   1.00 0.00 ? 74  ALA B CB   1  
ATOM 2935  H H    . ALA B 1 74  ? 8.807   11.062  3.241   1.00 0.00 ? 74  ALA B H    1  
ATOM 2936  H HA   . ALA B 1 74  ? 8.257   9.139   1.024   1.00 0.00 ? 74  ALA B HA   1  
ATOM 2937  H HB1  . ALA B 1 74  ? 10.601  9.355   2.929   1.00 0.00 ? 74  ALA B HB1  1  
ATOM 2938  H HB2  . ALA B 1 74  ? 10.344  7.973   1.864   1.00 0.00 ? 74  ALA B HB2  1  
ATOM 2939  H HB3  . ALA B 1 74  ? 10.620  9.575   1.179   1.00 0.00 ? 74  ALA B HB3  1  
ATOM 2940  N N    . ALA B 1 75  ? 7.024   8.827   3.736   1.00 0.00 ? 75  ALA B N    1  
ATOM 2941  C CA   . ALA B 1 75  ? 6.309   7.952   4.707   1.00 0.00 ? 75  ALA B CA   1  
ATOM 2942  C C    . ALA B 1 75  ? 5.813   6.694   3.983   1.00 0.00 ? 75  ALA B C    1  
ATOM 2943  O O    . ALA B 1 75  ? 6.074   6.519   2.810   1.00 0.00 ? 75  ALA B O    1  
ATOM 2944  C CB   . ALA B 1 75  ? 5.120   8.721   5.287   1.00 0.00 ? 75  ALA B CB   1  
ATOM 2945  H H    . ALA B 1 75  ? 6.775   9.771   3.655   1.00 0.00 ? 75  ALA B H    1  
ATOM 2946  H HA   . ALA B 1 75  ? 6.983   7.671   5.504   1.00 0.00 ? 75  ALA B HA   1  
ATOM 2947  H HB1  . ALA B 1 75  ? 5.184   9.759   4.993   1.00 0.00 ? 75  ALA B HB1  1  
ATOM 2948  H HB2  . ALA B 1 75  ? 4.200   8.297   4.912   1.00 0.00 ? 75  ALA B HB2  1  
ATOM 2949  H HB3  . ALA B 1 75  ? 5.137   8.651   6.364   1.00 0.00 ? 75  ALA B HB3  1  
ATOM 2950  N N    . PRO B 1 76  ? 5.117   5.849   4.704   1.00 0.00 ? 76  PRO B N    1  
ATOM 2951  C CA   . PRO B 1 76  ? 4.581   4.592   4.149   1.00 0.00 ? 76  PRO B CA   1  
ATOM 2952  C C    . PRO B 1 76  ? 3.320   4.862   3.327   1.00 0.00 ? 76  PRO B C    1  
ATOM 2953  O O    . PRO B 1 76  ? 3.062   5.976   2.916   1.00 0.00 ? 76  PRO B O    1  
ATOM 2954  C CB   . PRO B 1 76  ? 4.258   3.759   5.390   1.00 0.00 ? 76  PRO B CB   1  
ATOM 2955  C CG   . PRO B 1 76  ? 4.087   4.762   6.555   1.00 0.00 ? 76  PRO B CG   1  
ATOM 2956  C CD   . PRO B 1 76  ? 4.799   6.060   6.132   1.00 0.00 ? 76  PRO B CD   1  
ATOM 2957  H HA   . PRO B 1 76  ? 5.325   4.091   3.552   1.00 0.00 ? 76  PRO B HA   1  
ATOM 2958  H HB2  . PRO B 1 76  ? 3.342   3.204   5.236   1.00 0.00 ? 76  PRO B HB2  1  
ATOM 2959  H HB3  . PRO B 1 76  ? 5.071   3.085   5.608   1.00 0.00 ? 76  PRO B HB3  1  
ATOM 2960  H HG2  . PRO B 1 76  ? 3.036   4.952   6.723   1.00 0.00 ? 76  PRO B HG2  1  
ATOM 2961  H HG3  . PRO B 1 76  ? 4.542   4.371   7.450   1.00 0.00 ? 76  PRO B HG3  1  
ATOM 2962  H HD2  . PRO B 1 76  ? 4.135   6.902   6.257   1.00 0.00 ? 76  PRO B HD2  1  
ATOM 2963  H HD3  . PRO B 1 76  ? 5.705   6.200   6.700   1.00 0.00 ? 76  PRO B HD3  1  
ATOM 2964  N N    . CYS B 1 77  ? 2.534   3.850   3.078   1.00 0.00 ? 77  CYS B N    1  
ATOM 2965  C CA   . CYS B 1 77  ? 1.298   4.057   2.276   1.00 0.00 ? 77  CYS B CA   1  
ATOM 2966  C C    . CYS B 1 77  ? 0.173   3.159   2.801   1.00 0.00 ? 77  CYS B C    1  
ATOM 2967  O O    . CYS B 1 77  ? 0.055   2.010   2.422   1.00 0.00 ? 77  CYS B O    1  
ATOM 2968  C CB   . CYS B 1 77  ? 1.580   3.714   0.812   1.00 0.00 ? 77  CYS B CB   1  
ATOM 2969  S SG   . CYS B 1 77  ? 1.047   5.086   -0.242  1.00 0.00 ? 77  CYS B SG   1  
ATOM 2970  H H    . CYS B 1 77  ? 2.761   2.956   3.412   1.00 0.00 ? 77  CYS B H    1  
ATOM 2971  H HA   . CYS B 1 77  ? 0.994   5.090   2.348   1.00 0.00 ? 77  CYS B HA   1  
ATOM 2972  H HB2  . CYS B 1 77  ? 2.639   3.549   0.679   1.00 0.00 ? 77  CYS B HB2  1  
ATOM 2973  H HB3  . CYS B 1 77  ? 1.039   2.820   0.540   1.00 0.00 ? 77  CYS B HB3  1  
ATOM 2974  N N    . CYS B 1 78  ? -0.661  3.679   3.661   1.00 0.00 ? 78  CYS B N    1  
ATOM 2975  C CA   . CYS B 1 78  ? -1.790  2.862   4.194   1.00 0.00 ? 78  CYS B CA   1  
ATOM 2976  C C    . CYS B 1 78  ? -2.603  2.316   3.016   1.00 0.00 ? 78  CYS B C    1  
ATOM 2977  O O    . CYS B 1 78  ? -2.814  3.000   2.034   1.00 0.00 ? 78  CYS B O    1  
ATOM 2978  C CB   . CYS B 1 78  ? -2.679  3.748   5.066   1.00 0.00 ? 78  CYS B CB   1  
ATOM 2979  S SG   . CYS B 1 78  ? -3.717  2.714   6.125   1.00 0.00 ? 78  CYS B SG   1  
ATOM 2980  H H    . CYS B 1 78  ? -0.550  4.609   3.949   1.00 0.00 ? 78  CYS B H    1  
ATOM 2981  H HA   . CYS B 1 78  ? -1.402  2.043   4.781   1.00 0.00 ? 78  CYS B HA   1  
ATOM 2982  H HB2  . CYS B 1 78  ? -2.059  4.382   5.681   1.00 0.00 ? 78  CYS B HB2  1  
ATOM 2983  H HB3  . CYS B 1 78  ? -3.306  4.360   4.435   1.00 0.00 ? 78  CYS B HB3  1  
ATOM 2984  N N    . VAL B 1 79  ? -3.046  1.088   3.086   1.00 0.00 ? 79  VAL B N    1  
ATOM 2985  C CA   . VAL B 1 79  ? -3.821  0.520   1.946   1.00 0.00 ? 79  VAL B CA   1  
ATOM 2986  C C    . VAL B 1 79  ? -4.893  -0.452  2.465   1.00 0.00 ? 79  VAL B C    1  
ATOM 2987  O O    . VAL B 1 79  ? -5.041  -0.621  3.652   1.00 0.00 ? 79  VAL B O    1  
ATOM 2988  C CB   . VAL B 1 79  ? -2.848  -0.191  0.989   1.00 0.00 ? 79  VAL B CB   1  
ATOM 2989  C CG1  . VAL B 1 79  ? -1.491  0.499   1.051   1.00 0.00 ? 79  VAL B CG1  1  
ATOM 2990  C CG2  . VAL B 1 79  ? -2.665  -1.659  1.390   1.00 0.00 ? 79  VAL B CG2  1  
ATOM 2991  H H    . VAL B 1 79  ? -2.861  0.543   3.873   1.00 0.00 ? 79  VAL B H    1  
ATOM 2992  H HA   . VAL B 1 79  ? -4.304  1.327   1.426   1.00 0.00 ? 79  VAL B HA   1  
ATOM 2993  H HB   . VAL B 1 79  ? -3.225  -0.131  -0.019  1.00 0.00 ? 79  VAL B HB   1  
ATOM 2994  H HG11 . VAL B 1 79  ? -1.630  1.569   1.040   1.00 0.00 ? 79  VAL B HG11 1  
ATOM 2995  H HG12 . VAL B 1 79  ? -0.984  0.211   1.961   1.00 0.00 ? 79  VAL B HG12 1  
ATOM 2996  H HG13 . VAL B 1 79  ? -0.903  0.203   0.201   1.00 0.00 ? 79  VAL B HG13 1  
ATOM 2997  H HG21 . VAL B 1 79  ? -2.736  -1.749  2.464   1.00 0.00 ? 79  VAL B HG21 1  
ATOM 2998  H HG22 . VAL B 1 79  ? -3.433  -2.259  0.926   1.00 0.00 ? 79  VAL B HG22 1  
ATOM 2999  H HG23 . VAL B 1 79  ? -1.693  -2.001  1.064   1.00 0.00 ? 79  VAL B HG23 1  
ATOM 3000  N N    . PRO B 1 80  ? -5.614  -1.058  1.552   1.00 0.00 ? 80  PRO B N    1  
ATOM 3001  C CA   . PRO B 1 80  ? -6.681  -2.017  1.886   1.00 0.00 ? 80  PRO B CA   1  
ATOM 3002  C C    . PRO B 1 80  ? -6.088  -3.409  2.128   1.00 0.00 ? 80  PRO B C    1  
ATOM 3003  O O    . PRO B 1 80  ? -5.790  -4.135  1.199   1.00 0.00 ? 80  PRO B O    1  
ATOM 3004  C CB   . PRO B 1 80  ? -7.562  -2.015  0.636   1.00 0.00 ? 80  PRO B CB   1  
ATOM 3005  C CG   . PRO B 1 80  ? -6.669  -1.522  -0.529  1.00 0.00 ? 80  PRO B CG   1  
ATOM 3006  C CD   . PRO B 1 80  ? -5.441  -0.841  0.105   1.00 0.00 ? 80  PRO B CD   1  
ATOM 3007  H HA   . PRO B 1 80  ? -7.249  -1.684  2.739   1.00 0.00 ? 80  PRO B HA   1  
ATOM 3008  H HB2  . PRO B 1 80  ? -7.922  -3.015  0.435   1.00 0.00 ? 80  PRO B HB2  1  
ATOM 3009  H HB3  . PRO B 1 80  ? -8.392  -1.339  0.767   1.00 0.00 ? 80  PRO B HB3  1  
ATOM 3010  H HG2  . PRO B 1 80  ? -6.358  -2.361  -1.136  1.00 0.00 ? 80  PRO B HG2  1  
ATOM 3011  H HG3  . PRO B 1 80  ? -7.208  -0.809  -1.130  1.00 0.00 ? 80  PRO B HG3  1  
ATOM 3012  H HD2  . PRO B 1 80  ? -4.536  -1.316  -0.244  1.00 0.00 ? 80  PRO B HD2  1  
ATOM 3013  H HD3  . PRO B 1 80  ? -5.431  0.214   -0.119  1.00 0.00 ? 80  PRO B HD3  1  
ATOM 3014  N N    . GLN B 1 81  ? -5.915  -3.791  3.364   1.00 0.00 ? 81  GLN B N    1  
ATOM 3015  C CA   . GLN B 1 81  ? -5.346  -5.135  3.654   1.00 0.00 ? 81  GLN B CA   1  
ATOM 3016  C C    . GLN B 1 81  ? -6.380  -6.204  3.296   1.00 0.00 ? 81  GLN B C    1  
ATOM 3017  O O    . GLN B 1 81  ? -6.202  -6.969  2.370   1.00 0.00 ? 81  GLN B O    1  
ATOM 3018  C CB   . GLN B 1 81  ? -4.999  -5.229  5.141   1.00 0.00 ? 81  GLN B CB   1  
ATOM 3019  C CG   . GLN B 1 81  ? -4.734  -6.687  5.514   1.00 0.00 ? 81  GLN B CG   1  
ATOM 3020  C CD   . GLN B 1 81  ? -4.488  -6.791  7.020   1.00 0.00 ? 81  GLN B CD   1  
ATOM 3021  O OE1  . GLN B 1 81  ? -4.295  -5.793  7.686   1.00 0.00 ? 81  GLN B OE1  1  
ATOM 3022  N NE2  . GLN B 1 81  ? -4.488  -7.965  7.589   1.00 0.00 ? 81  GLN B NE2  1  
ATOM 3023  H H    . GLN B 1 81  ? -6.163  -3.197  4.100   1.00 0.00 ? 81  GLN B H    1  
ATOM 3024  H HA   . GLN B 1 81  ? -4.453  -5.285  3.064   1.00 0.00 ? 81  GLN B HA   1  
ATOM 3025  H HB2  . GLN B 1 81  ? -4.116  -4.639  5.342   1.00 0.00 ? 81  GLN B HB2  1  
ATOM 3026  H HB3  . GLN B 1 81  ? -5.824  -4.853  5.728   1.00 0.00 ? 81  GLN B HB3  1  
ATOM 3027  H HG2  . GLN B 1 81  ? -5.591  -7.287  5.245   1.00 0.00 ? 81  GLN B HG2  1  
ATOM 3028  H HG3  . GLN B 1 81  ? -3.864  -7.041  4.983   1.00 0.00 ? 81  GLN B HG3  1  
ATOM 3029  H HE21 . GLN B 1 81  ? -4.644  -8.769  7.052   1.00 0.00 ? 81  GLN B HE21 1  
ATOM 3030  H HE22 . GLN B 1 81  ? -4.332  -8.042  8.553   1.00 0.00 ? 81  GLN B HE22 1  
ATOM 3031  N N    . ALA B 1 82  ? -7.466  -6.254  4.018   1.00 0.00 ? 82  ALA B N    1  
ATOM 3032  C CA   . ALA B 1 82  ? -8.516  -7.263  3.711   1.00 0.00 ? 82  ALA B CA   1  
ATOM 3033  C C    . ALA B 1 82  ? -9.555  -6.625  2.790   1.00 0.00 ? 82  ALA B C    1  
ATOM 3034  O O    . ALA B 1 82  ? -9.851  -5.452  2.897   1.00 0.00 ? 82  ALA B O    1  
ATOM 3035  C CB   . ALA B 1 82  ? -9.188  -7.713  5.010   1.00 0.00 ? 82  ALA B CB   1  
ATOM 3036  H H    . ALA B 1 82  ? -7.594  -5.622  4.755   1.00 0.00 ? 82  ALA B H    1  
ATOM 3037  H HA   . ALA B 1 82  ? -8.069  -8.114  3.219   1.00 0.00 ? 82  ALA B HA   1  
ATOM 3038  H HB1  . ALA B 1 82  ? -8.552  -7.470  5.848   1.00 0.00 ? 82  ALA B HB1  1  
ATOM 3039  H HB2  . ALA B 1 82  ? -10.136 -7.207  5.119   1.00 0.00 ? 82  ALA B HB2  1  
ATOM 3040  H HB3  . ALA B 1 82  ? -9.351  -8.780  4.980   1.00 0.00 ? 82  ALA B HB3  1  
ATOM 3041  N N    . LEU B 1 83  ? -10.107 -7.377  1.880   1.00 0.00 ? 83  LEU B N    1  
ATOM 3042  C CA   . LEU B 1 83  ? -11.117 -6.794  0.958   1.00 0.00 ? 83  LEU B CA   1  
ATOM 3043  C C    . LEU B 1 83  ? -12.396 -7.618  1.004   1.00 0.00 ? 83  LEU B C    1  
ATOM 3044  O O    . LEU B 1 83  ? -12.568 -8.491  1.831   1.00 0.00 ? 83  LEU B O    1  
ATOM 3045  C CB   . LEU B 1 83  ? -10.574 -6.803  -0.473  1.00 0.00 ? 83  LEU B CB   1  
ATOM 3046  C CG   . LEU B 1 83  ? -9.409  -5.824  -0.580  1.00 0.00 ? 83  LEU B CG   1  
ATOM 3047  C CD1  . LEU B 1 83  ? -8.419  -6.317  -1.635  1.00 0.00 ? 83  LEU B CD1  1  
ATOM 3048  C CD2  . LEU B 1 83  ? -9.940  -4.451  -0.988  1.00 0.00 ? 83  LEU B CD2  1  
ATOM 3049  H H    . LEU B 1 83  ? -9.857  -8.320  1.800   1.00 0.00 ? 83  LEU B H    1  
ATOM 3050  H HA   . LEU B 1 83  ? -11.332 -5.778  1.253   1.00 0.00 ? 83  LEU B HA   1  
ATOM 3051  H HB2  . LEU B 1 83  ? -10.237 -7.796  -0.725  1.00 0.00 ? 83  LEU B HB2  1  
ATOM 3052  H HB3  . LEU B 1 83  ? -11.354 -6.505  -1.156  1.00 0.00 ? 83  LEU B HB3  1  
ATOM 3053  H HG   . LEU B 1 83  ? -8.916  -5.751  0.376   1.00 0.00 ? 83  LEU B HG   1  
ATOM 3054  H HD11 . LEU B 1 83  ? -8.669  -7.329  -1.919  1.00 0.00 ? 83  LEU B HD11 1  
ATOM 3055  H HD12 . LEU B 1 83  ? -8.470  -5.677  -2.503  1.00 0.00 ? 83  LEU B HD12 1  
ATOM 3056  H HD13 . LEU B 1 83  ? -7.418  -6.294  -1.229  1.00 0.00 ? 83  LEU B HD13 1  
ATOM 3057  H HD21 . LEU B 1 83  ? -10.660 -4.567  -1.786  1.00 0.00 ? 83  LEU B HD21 1  
ATOM 3058  H HD22 . LEU B 1 83  ? -10.417 -3.983  -0.140  1.00 0.00 ? 83  LEU B HD22 1  
ATOM 3059  H HD23 . LEU B 1 83  ? -9.122  -3.835  -1.328  1.00 0.00 ? 83  LEU B HD23 1  
ATOM 3060  N N    . GLU B 1 84  ? -13.287 -7.344  0.103   1.00 0.00 ? 84  GLU B N    1  
ATOM 3061  C CA   . GLU B 1 84  ? -14.567 -8.097  0.049   1.00 0.00 ? 84  GLU B CA   1  
ATOM 3062  C C    . GLU B 1 84  ? -14.979 -8.233  -1.416  1.00 0.00 ? 84  GLU B C    1  
ATOM 3063  O O    . GLU B 1 84  ? -14.500 -7.501  -2.255  1.00 0.00 ? 84  GLU B O    1  
ATOM 3064  C CB   . GLU B 1 84  ? -15.647 -7.340  0.825   1.00 0.00 ? 84  GLU B CB   1  
ATOM 3065  C CG   . GLU B 1 84  ? -15.810 -7.962  2.213   1.00 0.00 ? 84  GLU B CG   1  
ATOM 3066  C CD   . GLU B 1 84  ? -17.297 -8.082  2.548   1.00 0.00 ? 84  GLU B CD   1  
ATOM 3067  O OE1  . GLU B 1 84  ? -17.952 -8.926  1.959   1.00 0.00 ? 84  GLU B OE1  1  
ATOM 3068  O OE2  . GLU B 1 84  ? -17.758 -7.326  3.389   1.00 0.00 ? 84  GLU B OE2  1  
ATOM 3069  H H    . GLU B 1 84  ? -13.106 -6.639  -0.552  1.00 0.00 ? 84  GLU B H    1  
ATOM 3070  H HA   . GLU B 1 84  ? -14.428 -9.079  0.479   1.00 0.00 ? 84  GLU B HA   1  
ATOM 3071  H HB2  . GLU B 1 84  ? -15.357 -6.304  0.926   1.00 0.00 ? 84  GLU B HB2  1  
ATOM 3072  H HB3  . GLU B 1 84  ? -16.583 -7.401  0.293   1.00 0.00 ? 84  GLU B HB3  1  
ATOM 3073  H HG2  . GLU B 1 84  ? -15.357 -8.943  2.223   1.00 0.00 ? 84  GLU B HG2  1  
ATOM 3074  H HG3  . GLU B 1 84  ? -15.327 -7.335  2.948   1.00 0.00 ? 84  GLU B HG3  1  
ATOM 3075  N N    . PRO B 1 85  ? -15.848 -9.168  -1.682  1.00 0.00 ? 85  PRO B N    1  
ATOM 3076  C CA   . PRO B 1 85  ? -16.333 -9.425  -3.048  1.00 0.00 ? 85  PRO B CA   1  
ATOM 3077  C C    . PRO B 1 85  ? -17.329 -8.347  -3.488  1.00 0.00 ? 85  PRO B C    1  
ATOM 3078  O O    . PRO B 1 85  ? -17.442 -7.305  -2.872  1.00 0.00 ? 85  PRO B O    1  
ATOM 3079  C CB   . PRO B 1 85  ? -16.995 -10.800 -2.942  1.00 0.00 ? 85  PRO B CB   1  
ATOM 3080  C CG   . PRO B 1 85  ? -17.338 -11.004 -1.449  1.00 0.00 ? 85  PRO B CG   1  
ATOM 3081  C CD   . PRO B 1 85  ? -16.433 -10.047 -0.652  1.00 0.00 ? 85  PRO B CD   1  
ATOM 3082  H HA   . PRO B 1 85  ? -15.504 -9.473  -3.734  1.00 0.00 ? 85  PRO B HA   1  
ATOM 3083  H HB2  . PRO B 1 85  ? -17.896 -10.823 -3.541  1.00 0.00 ? 85  PRO B HB2  1  
ATOM 3084  H HB3  . PRO B 1 85  ? -16.311 -11.568 -3.267  1.00 0.00 ? 85  PRO B HB3  1  
ATOM 3085  H HG2  . PRO B 1 85  ? -18.376 -10.767 -1.274  1.00 0.00 ? 85  PRO B HG2  1  
ATOM 3086  H HG3  . PRO B 1 85  ? -17.133 -12.022 -1.159  1.00 0.00 ? 85  PRO B HG3  1  
ATOM 3087  H HD2  . PRO B 1 85  ? -17.018 -9.473  0.053   1.00 0.00 ? 85  PRO B HD2  1  
ATOM 3088  H HD3  . PRO B 1 85  ? -15.654 -10.595 -0.145  1.00 0.00 ? 85  PRO B HD3  1  
ATOM 3089  N N    . LEU B 1 86  ? -18.033 -8.579  -4.563  1.00 0.00 ? 86  LEU B N    1  
ATOM 3090  C CA   . LEU B 1 86  ? -18.999 -7.558  -5.061  1.00 0.00 ? 86  LEU B CA   1  
ATOM 3091  C C    . LEU B 1 86  ? -19.964 -8.219  -6.059  1.00 0.00 ? 86  LEU B C    1  
ATOM 3092  O O    . LEU B 1 86  ? -19.568 -8.570  -7.150  1.00 0.00 ? 86  LEU B O    1  
ATOM 3093  C CB   . LEU B 1 86  ? -18.182 -6.427  -5.727  1.00 0.00 ? 86  LEU B CB   1  
ATOM 3094  C CG   . LEU B 1 86  ? -18.933 -5.773  -6.900  1.00 0.00 ? 86  LEU B CG   1  
ATOM 3095  C CD1  . LEU B 1 86  ? -19.805 -4.623  -6.404  1.00 0.00 ? 86  LEU B CD1  1  
ATOM 3096  C CD2  . LEU B 1 86  ? -17.912 -5.218  -7.894  1.00 0.00 ? 86  LEU B CD2  1  
ATOM 3097  H H    . LEU B 1 86  ? -17.912 -9.418  -5.058  1.00 0.00 ? 86  LEU B H    1  
ATOM 3098  H HA   . LEU B 1 86  ? -19.552 -7.154  -4.228  1.00 0.00 ? 86  LEU B HA   1  
ATOM 3099  H HB2  . LEU B 1 86  ? -17.965 -5.670  -4.989  1.00 0.00 ? 86  LEU B HB2  1  
ATOM 3100  H HB3  . LEU B 1 86  ? -17.251 -6.836  -6.090  1.00 0.00 ? 86  LEU B HB3  1  
ATOM 3101  H HG   . LEU B 1 86  ? -19.548 -6.499  -7.394  1.00 0.00 ? 86  LEU B HG   1  
ATOM 3102  H HD11 . LEU B 1 86  ? -20.088 -4.801  -5.379  1.00 0.00 ? 86  LEU B HD11 1  
ATOM 3103  H HD12 . LEU B 1 86  ? -19.251 -3.698  -6.473  1.00 0.00 ? 86  LEU B HD12 1  
ATOM 3104  H HD13 . LEU B 1 86  ? -20.692 -4.557  -7.019  1.00 0.00 ? 86  LEU B HD13 1  
ATOM 3105  H HD21 . LEU B 1 86  ? -16.994 -5.778  -7.818  1.00 0.00 ? 86  LEU B HD21 1  
ATOM 3106  H HD22 . LEU B 1 86  ? -18.303 -5.301  -8.896  1.00 0.00 ? 86  LEU B HD22 1  
ATOM 3107  H HD23 . LEU B 1 86  ? -17.720 -4.179  -7.669  1.00 0.00 ? 86  LEU B HD23 1  
ATOM 3108  N N    . PRO B 1 87  ? -21.207 -8.360  -5.662  1.00 0.00 ? 87  PRO B N    1  
ATOM 3109  C CA   . PRO B 1 87  ? -22.247 -8.969  -6.516  1.00 0.00 ? 87  PRO B CA   1  
ATOM 3110  C C    . PRO B 1 87  ? -22.668 -7.979  -7.601  1.00 0.00 ? 87  PRO B C    1  
ATOM 3111  O O    . PRO B 1 87  ? -23.258 -6.953  -7.326  1.00 0.00 ? 87  PRO B O    1  
ATOM 3112  C CB   . PRO B 1 87  ? -23.394 -9.256  -5.543  1.00 0.00 ? 87  PRO B CB   1  
ATOM 3113  C CG   . PRO B 1 87  ? -23.185 -8.313  -4.335  1.00 0.00 ? 87  PRO B CG   1  
ATOM 3114  C CD   . PRO B 1 87  ? -21.696 -7.921  -4.338  1.00 0.00 ? 87  PRO B CD   1  
ATOM 3115  H HA   . PRO B 1 87  ? -21.896 -9.889  -6.957  1.00 0.00 ? 87  PRO B HA   1  
ATOM 3116  H HB2  . PRO B 1 87  ? -24.343 -9.050  -6.020  1.00 0.00 ? 87  PRO B HB2  1  
ATOM 3117  H HB3  . PRO B 1 87  ? -23.356 -10.282 -5.215  1.00 0.00 ? 87  PRO B HB3  1  
ATOM 3118  H HG2  . PRO B 1 87  ? -23.805 -7.433  -4.441  1.00 0.00 ? 87  PRO B HG2  1  
ATOM 3119  H HG3  . PRO B 1 87  ? -23.424 -8.828  -3.417  1.00 0.00 ? 87  PRO B HG3  1  
ATOM 3120  H HD2  . PRO B 1 87  ? -21.588 -6.850  -4.228  1.00 0.00 ? 87  PRO B HD2  1  
ATOM 3121  H HD3  . PRO B 1 87  ? -21.165 -8.439  -3.555  1.00 0.00 ? 87  PRO B HD3  1  
ATOM 3122  N N    . ILE B 1 88  ? -22.352 -8.270  -8.832  1.00 0.00 ? 88  ILE B N    1  
ATOM 3123  C CA   . ILE B 1 88  ? -22.715 -7.336  -9.930  1.00 0.00 ? 88  ILE B CA   1  
ATOM 3124  C C    . ILE B 1 88  ? -23.540 -8.055  -10.989 1.00 0.00 ? 88  ILE B C    1  
ATOM 3125  O O    . ILE B 1 88  ? -24.070 -9.125  -10.773 1.00 0.00 ? 88  ILE B O    1  
ATOM 3126  C CB   . ILE B 1 88  ? -21.435 -6.804  -10.584 1.00 0.00 ? 88  ILE B CB   1  
ATOM 3127  C CG1  . ILE B 1 88  ? -20.869 -7.855  -11.544 1.00 0.00 ? 88  ILE B CG1  1  
ATOM 3128  C CG2  . ILE B 1 88  ? -20.401 -6.516  -9.506  1.00 0.00 ? 88  ILE B CG2  1  
ATOM 3129  C CD1  . ILE B 1 88  ? -19.470 -7.446  -11.990 1.00 0.00 ? 88  ILE B CD1  1  
ATOM 3130  H H    . ILE B 1 88  ? -21.863 -9.096  -9.031  1.00 0.00 ? 88  ILE B H    1  
ATOM 3131  H HA   . ILE B 1 88  ? -23.281 -6.510  -9.530  1.00 0.00 ? 88  ILE B HA   1  
ATOM 3132  H HB   . ILE B 1 88  ? -21.656 -5.896  -11.127 1.00 0.00 ? 88  ILE B HB   1  
ATOM 3133  H HG12 . ILE B 1 88  ? -20.826 -8.806  -11.043 1.00 0.00 ? 88  ILE B HG12 1  
ATOM 3134  H HG13 . ILE B 1 88  ? -21.504 -7.937  -12.404 1.00 0.00 ? 88  ILE B HG13 1  
ATOM 3135  H HG21 . ILE B 1 88  ? -20.284 -7.389  -8.881  1.00 0.00 ? 88  ILE B HG21 1  
ATOM 3136  H HG22 . ILE B 1 88  ? -19.456 -6.278  -9.970  1.00 0.00 ? 88  ILE B HG22 1  
ATOM 3137  H HG23 . ILE B 1 88  ? -20.730 -5.683  -8.904  1.00 0.00 ? 88  ILE B HG23 1  
ATOM 3138  H HD11 . ILE B 1 88  ? -19.202 -6.513  -11.519 1.00 0.00 ? 88  ILE B HD11 1  
ATOM 3139  H HD12 . ILE B 1 88  ? -18.766 -8.212  -11.706 1.00 0.00 ? 88  ILE B HD12 1  
ATOM 3140  H HD13 . ILE B 1 88  ? -19.459 -7.326  -13.064 1.00 0.00 ? 88  ILE B HD13 1  
ATOM 3141  N N    . VAL B 1 89  ? -23.608 -7.465  -12.146 1.00 0.00 ? 89  VAL B N    1  
ATOM 3142  C CA   . VAL B 1 89  ? -24.353 -8.068  -13.278 1.00 0.00 ? 89  VAL B CA   1  
ATOM 3143  C C    . VAL B 1 89  ? -23.919 -7.369  -14.562 1.00 0.00 ? 89  VAL B C    1  
ATOM 3144  O O    . VAL B 1 89  ? -24.220 -6.213  -14.777 1.00 0.00 ? 89  VAL B O    1  
ATOM 3145  C CB   . VAL B 1 89  ? -25.861 -7.869  -13.105 1.00 0.00 ? 89  VAL B CB   1  
ATOM 3146  C CG1  . VAL B 1 89  ? -26.595 -8.744  -14.119 1.00 0.00 ? 89  VAL B CG1  1  
ATOM 3147  C CG2  . VAL B 1 89  ? -26.292 -8.258  -11.689 1.00 0.00 ? 89  VAL B CG2  1  
ATOM 3148  H H    . VAL B 1 89  ? -23.135 -6.619  -12.277 1.00 0.00 ? 89  VAL B H    1  
ATOM 3149  H HA   . VAL B 1 89  ? -24.120 -9.120  -13.340 1.00 0.00 ? 89  VAL B HA   1  
ATOM 3150  H HB   . VAL B 1 89  ? -26.106 -6.832  -13.286 1.00 0.00 ? 89  VAL B HB   1  
ATOM 3151  H HG11 . VAL B 1 89  ? -25.922 -9.502  -14.492 1.00 0.00 ? 89  VAL B HG11 1  
ATOM 3152  H HG12 . VAL B 1 89  ? -27.441 -9.216  -13.644 1.00 0.00 ? 89  VAL B HG12 1  
ATOM 3153  H HG13 . VAL B 1 89  ? -26.937 -8.132  -14.940 1.00 0.00 ? 89  VAL B HG13 1  
ATOM 3154  H HG21 . VAL B 1 89  ? -25.994 -9.274  -11.488 1.00 0.00 ? 89  VAL B HG21 1  
ATOM 3155  H HG22 . VAL B 1 89  ? -25.825 -7.596  -10.975 1.00 0.00 ? 89  VAL B HG22 1  
ATOM 3156  H HG23 . VAL B 1 89  ? -27.366 -8.176  -11.606 1.00 0.00 ? 89  VAL B HG23 1  
ATOM 3157  N N    . TYR B 1 90  ? -23.219 -8.050  -15.419 1.00 0.00 ? 90  TYR B N    1  
ATOM 3158  C CA   . TYR B 1 90  ? -22.779 -7.401  -16.680 1.00 0.00 ? 90  TYR B CA   1  
ATOM 3159  C C    . TYR B 1 90  ? -23.361 -8.158  -17.872 1.00 0.00 ? 90  TYR B C    1  
ATOM 3160  O O    . TYR B 1 90  ? -24.205 -9.018  -17.720 1.00 0.00 ? 90  TYR B O    1  
ATOM 3161  C CB   . TYR B 1 90  ? -21.253 -7.398  -16.759 1.00 0.00 ? 90  TYR B CB   1  
ATOM 3162  C CG   . TYR B 1 90  ? -20.695 -8.671  -16.174 1.00 0.00 ? 90  TYR B CG   1  
ATOM 3163  C CD1  . TYR B 1 90  ? -20.637 -8.831  -14.786 1.00 0.00 ? 90  TYR B CD1  1  
ATOM 3164  C CD2  . TYR B 1 90  ? -20.221 -9.682  -17.016 1.00 0.00 ? 90  TYR B CD2  1  
ATOM 3165  C CE1  . TYR B 1 90  ? -20.107 -10.004 -14.236 1.00 0.00 ? 90  TYR B CE1  1  
ATOM 3166  C CE2  . TYR B 1 90  ? -19.691 -10.857 -16.467 1.00 0.00 ? 90  TYR B CE2  1  
ATOM 3167  C CZ   . TYR B 1 90  ? -19.634 -11.017 -15.078 1.00 0.00 ? 90  TYR B CZ   1  
ATOM 3168  O OH   . TYR B 1 90  ? -19.110 -12.174 -14.538 1.00 0.00 ? 90  TYR B OH   1  
ATOM 3169  H H    . TYR B 1 90  ? -22.987 -8.982  -15.236 1.00 0.00 ? 90  TYR B H    1  
ATOM 3170  H HA   . TYR B 1 90  ? -23.137 -6.381  -16.695 1.00 0.00 ? 90  TYR B HA   1  
ATOM 3171  H HB2  . TYR B 1 90  ? -20.946 -7.310  -17.790 1.00 0.00 ? 90  TYR B HB2  1  
ATOM 3172  H HB3  . TYR B 1 90  ? -20.878 -6.558  -16.200 1.00 0.00 ? 90  TYR B HB3  1  
ATOM 3173  H HD1  . TYR B 1 90  ? -21.002 -8.049  -14.141 1.00 0.00 ? 90  TYR B HD1  1  
ATOM 3174  H HD2  . TYR B 1 90  ? -20.267 -9.558  -18.088 1.00 0.00 ? 90  TYR B HD2  1  
ATOM 3175  H HE1  . TYR B 1 90  ? -20.062 -10.127 -13.163 1.00 0.00 ? 90  TYR B HE1  1  
ATOM 3176  H HE2  . TYR B 1 90  ? -19.324 -11.636 -17.116 1.00 0.00 ? 90  TYR B HE2  1  
ATOM 3177  H HH   . TYR B 1 90  ? -18.271 -11.956 -14.127 1.00 0.00 ? 90  TYR B HH   1  
ATOM 3178  N N    . TYR B 1 91  ? -22.932 -7.837  -19.058 1.00 0.00 ? 91  TYR B N    1  
ATOM 3179  C CA   . TYR B 1 91  ? -23.481 -8.533  -20.252 1.00 0.00 ? 91  TYR B CA   1  
ATOM 3180  C C    . TYR B 1 91  ? -22.369 -8.891  -21.235 1.00 0.00 ? 91  TYR B C    1  
ATOM 3181  O O    . TYR B 1 91  ? -21.560 -8.064  -21.608 1.00 0.00 ? 91  TYR B O    1  
ATOM 3182  C CB   . TYR B 1 91  ? -24.466 -7.609  -20.958 1.00 0.00 ? 91  TYR B CB   1  
ATOM 3183  C CG   . TYR B 1 91  ? -25.854 -7.861  -20.438 1.00 0.00 ? 91  TYR B CG   1  
ATOM 3184  C CD1  . TYR B 1 91  ? -26.273 -7.253  -19.254 1.00 0.00 ? 91  TYR B CD1  1  
ATOM 3185  C CD2  . TYR B 1 91  ? -26.724 -8.693  -21.149 1.00 0.00 ? 91  TYR B CD2  1  
ATOM 3186  C CE1  . TYR B 1 91  ? -27.570 -7.479  -18.774 1.00 0.00 ? 91  TYR B CE1  1  
ATOM 3187  C CE2  . TYR B 1 91  ? -28.018 -8.918  -20.677 1.00 0.00 ? 91  TYR B CE2  1  
ATOM 3188  C CZ   . TYR B 1 91  ? -28.444 -8.312  -19.488 1.00 0.00 ? 91  TYR B CZ   1  
ATOM 3189  O OH   . TYR B 1 91  ? -29.723 -8.534  -19.019 1.00 0.00 ? 91  TYR B OH   1  
ATOM 3190  H H    . TYR B 1 91  ? -22.264 -7.132  -19.164 1.00 0.00 ? 91  TYR B H    1  
ATOM 3191  H HA   . TYR B 1 91  ? -23.993 -9.431  -19.943 1.00 0.00 ? 91  TYR B HA   1  
ATOM 3192  H HB2  . TYR B 1 91  ? -24.193 -6.581  -20.770 1.00 0.00 ? 91  TYR B HB2  1  
ATOM 3193  H HB3  . TYR B 1 91  ? -24.441 -7.799  -22.021 1.00 0.00 ? 91  TYR B HB3  1  
ATOM 3194  H HD1  . TYR B 1 91  ? -25.592 -6.614  -18.707 1.00 0.00 ? 91  TYR B HD1  1  
ATOM 3195  H HD2  . TYR B 1 91  ? -26.394 -9.164  -22.059 1.00 0.00 ? 91  TYR B HD2  1  
ATOM 3196  H HE1  . TYR B 1 91  ? -27.897 -7.011  -17.858 1.00 0.00 ? 91  TYR B HE1  1  
ATOM 3197  H HE2  . TYR B 1 91  ? -28.688 -9.560  -21.231 1.00 0.00 ? 91  TYR B HE2  1  
ATOM 3198  H HH   . TYR B 1 91  ? -30.200 -7.702  -19.051 1.00 0.00 ? 91  TYR B HH   1  
ATOM 3199  N N    . VAL B 1 92  ? -22.354 -10.110 -21.693 1.00 0.00 ? 92  VAL B N    1  
ATOM 3200  C CA   . VAL B 1 92  ? -21.335 -10.521 -22.691 1.00 0.00 ? 92  VAL B CA   1  
ATOM 3201  C C    . VAL B 1 92  ? -22.025 -10.566 -24.047 1.00 0.00 ? 92  VAL B C    1  
ATOM 3202  O O    . VAL B 1 92  ? -22.632 -11.552 -24.415 1.00 0.00 ? 92  VAL B O    1  
ATOM 3203  C CB   . VAL B 1 92  ? -20.783 -11.903 -22.354 1.00 0.00 ? 92  VAL B CB   1  
ATOM 3204  C CG1  . VAL B 1 92  ? -19.339 -11.989 -22.842 1.00 0.00 ? 92  VAL B CG1  1  
ATOM 3205  C CG2  . VAL B 1 92  ? -20.832 -12.122 -20.841 1.00 0.00 ? 92  VAL B CG2  1  
ATOM 3206  H H    . VAL B 1 92  ? -23.036 -10.748 -21.403 1.00 0.00 ? 92  VAL B H    1  
ATOM 3207  H HA   . VAL B 1 92  ? -20.532 -9.798  -22.713 1.00 0.00 ? 92  VAL B HA   1  
ATOM 3208  H HB   . VAL B 1 92  ? -21.376 -12.658 -22.851 1.00 0.00 ? 92  VAL B HB   1  
ATOM 3209  H HG11 . VAL B 1 92  ? -19.270 -11.563 -23.833 1.00 0.00 ? 92  VAL B HG11 1  
ATOM 3210  H HG12 . VAL B 1 92  ? -18.699 -11.437 -22.169 1.00 0.00 ? 92  VAL B HG12 1  
ATOM 3211  H HG13 . VAL B 1 92  ? -19.029 -13.022 -22.871 1.00 0.00 ? 92  VAL B HG13 1  
ATOM 3212  H HG21 . VAL B 1 92  ? -20.356 -11.292 -20.342 1.00 0.00 ? 92  VAL B HG21 1  
ATOM 3213  H HG22 . VAL B 1 92  ? -21.862 -12.192 -20.522 1.00 0.00 ? 92  VAL B HG22 1  
ATOM 3214  H HG23 . VAL B 1 92  ? -20.315 -13.037 -20.593 1.00 0.00 ? 92  VAL B HG23 1  
ATOM 3215  N N    . GLY B 1 93  ? -21.969 -9.494  -24.778 1.00 0.00 ? 93  GLY B N    1  
ATOM 3216  C CA   . GLY B 1 93  ? -22.658 -9.461  -26.095 1.00 0.00 ? 93  GLY B CA   1  
ATOM 3217  C C    . GLY B 1 93  ? -24.157 -9.264  -25.852 1.00 0.00 ? 93  GLY B C    1  
ATOM 3218  O O    . GLY B 1 93  ? -24.675 -8.170  -25.959 1.00 0.00 ? 93  GLY B O    1  
ATOM 3219  H H    . GLY B 1 93  ? -21.492 -8.704  -24.449 1.00 0.00 ? 93  GLY B H    1  
ATOM 3220  H HA2  . GLY B 1 93  ? -22.271 -8.642  -26.686 1.00 0.00 ? 93  GLY B HA2  1  
ATOM 3221  H HA3  . GLY B 1 93  ? -22.498 -10.393 -26.613 1.00 0.00 ? 93  GLY B HA3  1  
ATOM 3222  N N    . ARG B 1 94  ? -24.859 -10.318 -25.524 1.00 0.00 ? 94  ARG B N    1  
ATOM 3223  C CA   . ARG B 1 94  ? -26.329 -10.194 -25.274 1.00 0.00 ? 94  ARG B CA   1  
ATOM 3224  C C    . ARG B 1 94  ? -26.759 -11.085 -24.103 1.00 0.00 ? 94  ARG B C    1  
ATOM 3225  O O    . ARG B 1 94  ? -27.906 -11.075 -23.700 1.00 0.00 ? 94  ARG B O    1  
ATOM 3226  C CB   . ARG B 1 94  ? -27.083 -10.638 -26.524 1.00 0.00 ? 94  ARG B CB   1  
ATOM 3227  C CG   . ARG B 1 94  ? -26.695 -9.747  -27.707 1.00 0.00 ? 94  ARG B CG   1  
ATOM 3228  C CD   . ARG B 1 94  ? -26.301 -10.623 -28.898 1.00 0.00 ? 94  ARG B CD   1  
ATOM 3229  N NE   . ARG B 1 94  ? -25.297 -11.633 -28.460 1.00 0.00 ? 94  ARG B NE   1  
ATOM 3230  C CZ   . ARG B 1 94  ? -25.535 -12.905 -28.631 1.00 0.00 ? 94  ARG B CZ   1  
ATOM 3231  N NH1  . ARG B 1 94  ? -26.738 -13.375 -28.441 1.00 0.00 ? 94  ARG B NH1  1  
ATOM 3232  N NH2  . ARG B 1 94  ? -24.571 -13.706 -28.992 1.00 0.00 ? 94  ARG B NH2  1  
ATOM 3233  H H    . ARG B 1 94  ? -24.421 -11.188 -25.452 1.00 0.00 ? 94  ARG B H    1  
ATOM 3234  H HA   . ARG B 1 94  ? -26.575 -9.169  -25.049 1.00 0.00 ? 94  ARG B HA   1  
ATOM 3235  H HB2  . ARG B 1 94  ? -26.824 -11.664 -26.742 1.00 0.00 ? 94  ARG B HB2  1  
ATOM 3236  H HB3  . ARG B 1 94  ? -28.146 -10.563 -26.351 1.00 0.00 ? 94  ARG B HB3  1  
ATOM 3237  H HG2  . ARG B 1 94  ? -27.535 -9.125  -27.979 1.00 0.00 ? 94  ARG B HG2  1  
ATOM 3238  H HG3  . ARG B 1 94  ? -25.860 -9.123  -27.430 1.00 0.00 ? 94  ARG B HG3  1  
ATOM 3239  H HD2  . ARG B 1 94  ? -27.176 -11.127 -29.279 1.00 0.00 ? 94  ARG B HD2  1  
ATOM 3240  H HD3  . ARG B 1 94  ? -25.874 -10.004 -29.674 1.00 0.00 ? 94  ARG B HD3  1  
ATOM 3241  H HE   . ARG B 1 94  ? -24.458 -11.343 -28.045 1.00 0.00 ? 94  ARG B HE   1  
ATOM 3242  H HH11 . ARG B 1 94  ? -27.477 -12.760 -28.164 1.00 0.00 ? 94  ARG B HH11 1  
ATOM 3243  H HH12 . ARG B 1 94  ? -26.920 -14.349 -28.571 1.00 0.00 ? 94  ARG B HH12 1  
ATOM 3244  H HH21 . ARG B 1 94  ? -23.649 -13.345 -29.137 1.00 0.00 ? 94  ARG B HH21 1  
ATOM 3245  H HH22 . ARG B 1 94  ? -24.753 -14.680 -29.123 1.00 0.00 ? 94  ARG B HH22 1  
ATOM 3246  N N    . LYS B 1 95  ? -25.867 -11.862 -23.558 1.00 0.00 ? 95  LYS B N    1  
ATOM 3247  C CA   . LYS B 1 95  ? -26.249 -12.751 -22.427 1.00 0.00 ? 95  LYS B CA   1  
ATOM 3248  C C    . LYS B 1 95  ? -25.962 -12.049 -21.095 1.00 0.00 ? 95  LYS B C    1  
ATOM 3249  O O    . LYS B 1 95  ? -24.902 -11.489 -20.914 1.00 0.00 ? 95  LYS B O    1  
ATOM 3250  C CB   . LYS B 1 95  ? -25.429 -14.040 -22.503 1.00 0.00 ? 95  LYS B CB   1  
ATOM 3251  C CG   . LYS B 1 95  ? -26.279 -15.217 -22.025 1.00 0.00 ? 95  LYS B CG   1  
ATOM 3252  C CD   . LYS B 1 95  ? -25.917 -15.553 -20.576 1.00 0.00 ? 95  LYS B CD   1  
ATOM 3253  C CE   . LYS B 1 95  ? -26.376 -16.976 -20.250 1.00 0.00 ? 95  LYS B CE   1  
ATOM 3254  N NZ   . LYS B 1 95  ? -25.439 -17.586 -19.265 1.00 0.00 ? 95  LYS B NZ   1  
ATOM 3255  H H    . LYS B 1 95  ? -24.951 -11.867 -23.895 1.00 0.00 ? 95  LYS B H    1  
ATOM 3256  H HA   . LYS B 1 95  ? -27.299 -12.989 -22.499 1.00 0.00 ? 95  LYS B HA   1  
ATOM 3257  H HB2  . LYS B 1 95  ? -25.120 -14.210 -23.524 1.00 0.00 ? 95  LYS B HB2  1  
ATOM 3258  H HB3  . LYS B 1 95  ? -24.557 -13.950 -21.873 1.00 0.00 ? 95  LYS B HB3  1  
ATOM 3259  H HG2  . LYS B 1 95  ? -27.325 -14.952 -22.084 1.00 0.00 ? 95  LYS B HG2  1  
ATOM 3260  H HG3  . LYS B 1 95  ? -26.089 -16.076 -22.650 1.00 0.00 ? 95  LYS B HG3  1  
ATOM 3261  H HD2  . LYS B 1 95  ? -24.847 -15.480 -20.448 1.00 0.00 ? 95  LYS B HD2  1  
ATOM 3262  H HD3  . LYS B 1 95  ? -26.408 -14.858 -19.912 1.00 0.00 ? 95  LYS B HD3  1  
ATOM 3263  H HE2  . LYS B 1 95  ? -27.370 -16.946 -19.831 1.00 0.00 ? 95  LYS B HE2  1  
ATOM 3264  H HE3  . LYS B 1 95  ? -26.383 -17.567 -21.154 1.00 0.00 ? 95  LYS B HE3  1  
ATOM 3265  H HZ1  . LYS B 1 95  ? -24.756 -16.869 -18.946 1.00 0.00 ? 95  LYS B HZ1  1  
ATOM 3266  H HZ2  . LYS B 1 95  ? -25.978 -17.940 -18.448 1.00 0.00 ? 95  LYS B HZ2  1  
ATOM 3267  H HZ3  . LYS B 1 95  ? -24.928 -18.372 -19.712 1.00 0.00 ? 95  LYS B HZ3  1  
ATOM 3268  N N    . PRO B 1 96  ? -26.911 -12.107 -20.195 1.00 0.00 ? 96  PRO B N    1  
ATOM 3269  C CA   . PRO B 1 96  ? -26.770 -11.490 -18.866 1.00 0.00 ? 96  PRO B CA   1  
ATOM 3270  C C    . PRO B 1 96  ? -25.916 -12.394 -17.971 1.00 0.00 ? 96  PRO B C    1  
ATOM 3271  O O    . PRO B 1 96  ? -26.017 -13.603 -18.032 1.00 0.00 ? 96  PRO B O    1  
ATOM 3272  C CB   . PRO B 1 96  ? -28.210 -11.414 -18.351 1.00 0.00 ? 96  PRO B CB   1  
ATOM 3273  C CG   . PRO B 1 96  ? -29.009 -12.483 -19.135 1.00 0.00 ? 96  PRO B CG   1  
ATOM 3274  C CD   . PRO B 1 96  ? -28.203 -12.788 -20.412 1.00 0.00 ? 96  PRO B CD   1  
ATOM 3275  H HA   . PRO B 1 96  ? -26.346 -10.500 -18.947 1.00 0.00 ? 96  PRO B HA   1  
ATOM 3276  H HB2  . PRO B 1 96  ? -28.235 -11.629 -17.291 1.00 0.00 ? 96  PRO B HB2  1  
ATOM 3277  H HB3  . PRO B 1 96  ? -28.624 -10.437 -18.544 1.00 0.00 ? 96  PRO B HB3  1  
ATOM 3278  H HG2  . PRO B 1 96  ? -29.113 -13.378 -18.536 1.00 0.00 ? 96  PRO B HG2  1  
ATOM 3279  H HG3  . PRO B 1 96  ? -29.981 -12.098 -19.401 1.00 0.00 ? 96  PRO B HG3  1  
ATOM 3280  H HD2  . PRO B 1 96  ? -28.059 -13.854 -20.521 1.00 0.00 ? 96  PRO B HD2  1  
ATOM 3281  H HD3  . PRO B 1 96  ? -28.698 -12.380 -21.279 1.00 0.00 ? 96  PRO B HD3  1  
ATOM 3282  N N    . LYS B 1 97  ? -25.070 -11.833 -17.149 1.00 0.00 ? 97  LYS B N    1  
ATOM 3283  C CA   . LYS B 1 97  ? -24.219 -12.692 -16.276 1.00 0.00 ? 97  LYS B CA   1  
ATOM 3284  C C    . LYS B 1 97  ? -24.000 -12.023 -14.916 1.00 0.00 ? 97  LYS B C    1  
ATOM 3285  O O    . LYS B 1 97  ? -23.339 -11.009 -14.811 1.00 0.00 ? 97  LYS B O    1  
ATOM 3286  C CB   . LYS B 1 97  ? -22.862 -12.911 -16.951 1.00 0.00 ? 97  LYS B CB   1  
ATOM 3287  C CG   . LYS B 1 97  ? -22.977 -14.023 -17.997 1.00 0.00 ? 97  LYS B CG   1  
ATOM 3288  C CD   . LYS B 1 97  ? -22.464 -15.337 -17.405 1.00 0.00 ? 97  LYS B CD   1  
ATOM 3289  C CE   . LYS B 1 97  ? -23.455 -15.848 -16.357 1.00 0.00 ? 97  LYS B CE   1  
ATOM 3290  N NZ   . LYS B 1 97  ? -22.977 -17.152 -15.817 1.00 0.00 ? 97  LYS B NZ   1  
ATOM 3291  H H    . LYS B 1 97  ? -24.990 -10.857 -17.110 1.00 0.00 ? 97  LYS B H    1  
ATOM 3292  H HA   . LYS B 1 97  ? -24.703 -13.646 -16.132 1.00 0.00 ? 97  LYS B HA   1  
ATOM 3293  H HB2  . LYS B 1 97  ? -22.548 -11.996 -17.432 1.00 0.00 ? 97  LYS B HB2  1  
ATOM 3294  H HB3  . LYS B 1 97  ? -22.132 -13.195 -16.208 1.00 0.00 ? 97  LYS B HB3  1  
ATOM 3295  H HG2  . LYS B 1 97  ? -24.011 -14.137 -18.289 1.00 0.00 ? 97  LYS B HG2  1  
ATOM 3296  H HG3  . LYS B 1 97  ? -22.385 -13.765 -18.862 1.00 0.00 ? 97  LYS B HG3  1  
ATOM 3297  H HD2  . LYS B 1 97  ? -22.361 -16.070 -18.192 1.00 0.00 ? 97  LYS B HD2  1  
ATOM 3298  H HD3  . LYS B 1 97  ? -21.505 -15.171 -16.939 1.00 0.00 ? 97  LYS B HD3  1  
ATOM 3299  H HE2  . LYS B 1 97  ? -23.530 -15.131 -15.553 1.00 0.00 ? 97  LYS B HE2  1  
ATOM 3300  H HE3  . LYS B 1 97  ? -24.425 -15.980 -16.814 1.00 0.00 ? 97  LYS B HE3  1  
ATOM 3301  H HZ1  . LYS B 1 97  ? -22.224 -17.525 -16.428 1.00 0.00 ? 97  LYS B HZ1  1  
ATOM 3302  H HZ2  . LYS B 1 97  ? -22.608 -17.013 -14.854 1.00 0.00 ? 97  LYS B HZ2  1  
ATOM 3303  H HZ3  . LYS B 1 97  ? -23.767 -17.827 -15.792 1.00 0.00 ? 97  LYS B HZ3  1  
ATOM 3304  N N    . VAL B 1 98  ? -24.533 -12.597 -13.871 1.00 0.00 ? 98  VAL B N    1  
ATOM 3305  C CA   . VAL B 1 98  ? -24.336 -12.012 -12.514 1.00 0.00 ? 98  VAL B CA   1  
ATOM 3306  C C    . VAL B 1 98  ? -23.126 -12.684 -11.869 1.00 0.00 ? 98  VAL B C    1  
ATOM 3307  O O    . VAL B 1 98  ? -23.012 -13.894 -11.868 1.00 0.00 ? 98  VAL B O    1  
ATOM 3308  C CB   . VAL B 1 98  ? -25.573 -12.274 -11.651 1.00 0.00 ? 98  VAL B CB   1  
ATOM 3309  C CG1  . VAL B 1 98  ? -25.251 -11.953 -10.188 1.00 0.00 ? 98  VAL B CG1  1  
ATOM 3310  C CG2  . VAL B 1 98  ? -26.727 -11.390 -12.124 1.00 0.00 ? 98  VAL B CG2  1  
ATOM 3311  H H    . VAL B 1 98  ? -25.048 -13.424 -13.977 1.00 0.00 ? 98  VAL B H    1  
ATOM 3312  H HA   . VAL B 1 98  ? -24.164 -10.949 -12.596 1.00 0.00 ? 98  VAL B HA   1  
ATOM 3313  H HB   . VAL B 1 98  ? -25.855 -13.314 -11.735 1.00 0.00 ? 98  VAL B HB   1  
ATOM 3314  H HG11 . VAL B 1 98  ? -24.891 -10.938 -10.112 1.00 0.00 ? 98  VAL B HG11 1  
ATOM 3315  H HG12 . VAL B 1 98  ? -26.144 -12.063 -9.590  1.00 0.00 ? 98  VAL B HG12 1  
ATOM 3316  H HG13 . VAL B 1 98  ? -24.491 -12.631 -9.829  1.00 0.00 ? 98  VAL B HG13 1  
ATOM 3317  H HG21 . VAL B 1 98  ? -26.386 -10.751 -12.926 1.00 0.00 ? 98  VAL B HG21 1  
ATOM 3318  H HG22 . VAL B 1 98  ? -27.535 -12.012 -12.478 1.00 0.00 ? 98  VAL B HG22 1  
ATOM 3319  H HG23 . VAL B 1 98  ? -27.075 -10.782 -11.302 1.00 0.00 ? 98  VAL B HG23 1  
ATOM 3320  N N    . GLU B 1 99  ? -22.217 -11.927 -11.322 1.00 0.00 ? 99  GLU B N    1  
ATOM 3321  C CA   . GLU B 1 99  ? -21.031 -12.562 -10.693 1.00 0.00 ? 99  GLU B CA   1  
ATOM 3322  C C    . GLU B 1 99  ? -20.767 -11.936 -9.330  1.00 0.00 ? 99  GLU B C    1  
ATOM 3323  O O    . GLU B 1 99  ? -21.635 -11.345 -8.718  1.00 0.00 ? 99  GLU B O    1  
ATOM 3324  C CB   . GLU B 1 99  ? -19.808 -12.356 -11.581 1.00 0.00 ? 99  GLU B CB   1  
ATOM 3325  C CG   . GLU B 1 99  ? -19.183 -13.711 -11.920 1.00 0.00 ? 99  GLU B CG   1  
ATOM 3326  C CD   . GLU B 1 99  ? -17.687 -13.676 -11.605 1.00 0.00 ? 99  GLU B CD   1  
ATOM 3327  O OE1  . GLU B 1 99  ? -17.308 -12.940 -10.710 1.00 0.00 ? 99  GLU B OE1  1  
ATOM 3328  O OE2  . GLU B 1 99  ? -16.946 -14.386 -12.265 1.00 0.00 ? 99  GLU B OE2  1  
ATOM 3329  H H    . GLU B 1 99  ? -22.309 -10.948 -11.326 1.00 0.00 ? 99  GLU B H    1  
ATOM 3330  H HA   . GLU B 1 99  ? -21.209 -13.618 -10.573 1.00 0.00 ? 99  GLU B HA   1  
ATOM 3331  H HB2  . GLU B 1 99  ? -20.104 -11.859 -12.487 1.00 0.00 ? 99  GLU B HB2  1  
ATOM 3332  H HB3  . GLU B 1 99  ? -19.088 -11.751 -11.059 1.00 0.00 ? 99  GLU B HB3  1  
ATOM 3333  H HG2  . GLU B 1 99  ? -19.658 -14.483 -11.333 1.00 0.00 ? 99  GLU B HG2  1  
ATOM 3334  H HG3  . GLU B 1 99  ? -19.323 -13.919 -12.970 1.00 0.00 ? 99  GLU B HG3  1  
ATOM 3335  N N    . GLN B 1 100 ? -19.566 -12.066 -8.857  1.00 0.00 ? 100 GLN B N    1  
ATOM 3336  C CA   . GLN B 1 100 ? -19.209 -11.489 -7.538  1.00 0.00 ? 100 GLN B CA   1  
ATOM 3337  C C    . GLN B 1 100 ? -17.733 -11.109 -7.559  1.00 0.00 ? 100 GLN B C    1  
ATOM 3338  O O    . GLN B 1 100 ? -16.882 -11.870 -7.145  1.00 0.00 ? 100 GLN B O    1  
ATOM 3339  C CB   . GLN B 1 100 ? -19.435 -12.532 -6.453  1.00 0.00 ? 100 GLN B CB   1  
ATOM 3340  C CG   . GLN B 1 100 ? -20.878 -13.038 -6.517  1.00 0.00 ? 100 GLN B CG   1  
ATOM 3341  C CD   . GLN B 1 100 ? -21.236 -13.728 -5.200  1.00 0.00 ? 100 GLN B CD   1  
ATOM 3342  O OE1  . GLN B 1 100 ? -21.175 -14.937 -5.097  1.00 0.00 ? 100 GLN B OE1  1  
ATOM 3343  N NE2  . GLN B 1 100 ? -21.611 -13.005 -4.179  1.00 0.00 ? 100 GLN B NE2  1  
ATOM 3344  H H    . GLN B 1 100 ? -18.891 -12.547 -9.377  1.00 0.00 ? 100 GLN B H    1  
ATOM 3345  H HA   . GLN B 1 100 ? -19.813 -10.618 -7.341  1.00 0.00 ? 100 GLN B HA   1  
ATOM 3346  H HB2  . GLN B 1 100 ? -18.756 -13.351 -6.616  1.00 0.00 ? 100 GLN B HB2  1  
ATOM 3347  H HB3  . GLN B 1 100 ? -19.250 -12.094 -5.484  1.00 0.00 ? 100 GLN B HB3  1  
ATOM 3348  H HG2  . GLN B 1 100 ? -21.544 -12.204 -6.681  1.00 0.00 ? 100 GLN B HG2  1  
ATOM 3349  H HG3  . GLN B 1 100 ? -20.977 -13.743 -7.329  1.00 0.00 ? 100 GLN B HG3  1  
ATOM 3350  H HE21 . GLN B 1 100 ? -21.660 -12.030 -4.261  1.00 0.00 ? 100 GLN B HE21 1  
ATOM 3351  H HE22 . GLN B 1 100 ? -21.843 -13.438 -3.331  1.00 0.00 ? 100 GLN B HE22 1  
ATOM 3352  N N    . LEU B 1 101 ? -17.421 -9.948  -8.052  1.00 0.00 ? 101 LEU B N    1  
ATOM 3353  C CA   . LEU B 1 101 ? -15.996 -9.534  -8.112  1.00 0.00 ? 101 LEU B CA   1  
ATOM 3354  C C    . LEU B 1 101 ? -15.320 -9.875  -6.792  1.00 0.00 ? 101 LEU B C    1  
ATOM 3355  O O    . LEU B 1 101 ? -15.922 -9.826  -5.740  1.00 0.00 ? 101 LEU B O    1  
ATOM 3356  C CB   . LEU B 1 101 ? -15.892 -8.033  -8.375  1.00 0.00 ? 101 LEU B CB   1  
ATOM 3357  C CG   . LEU B 1 101 ? -16.628 -7.672  -9.672  1.00 0.00 ? 101 LEU B CG   1  
ATOM 3358  C CD1  . LEU B 1 101 ? -16.051 -6.377  -10.240 1.00 0.00 ? 101 LEU B CD1  1  
ATOM 3359  C CD2  . LEU B 1 101 ? -16.455 -8.791  -10.702 1.00 0.00 ? 101 LEU B CD2  1  
ATOM 3360  H H    . LEU B 1 101 ? -18.120 -9.359  -8.390  1.00 0.00 ? 101 LEU B H    1  
ATOM 3361  H HA   . LEU B 1 101 ? -15.504 -10.071 -8.910  1.00 0.00 ? 101 LEU B HA   1  
ATOM 3362  H HB2  . LEU B 1 101 ? -16.334 -7.494  -7.553  1.00 0.00 ? 101 LEU B HB2  1  
ATOM 3363  H HB3  . LEU B 1 101 ? -14.850 -7.763  -8.466  1.00 0.00 ? 101 LEU B HB3  1  
ATOM 3364  H HG   . LEU B 1 101 ? -17.678 -7.534  -9.461  1.00 0.00 ? 101 LEU B HG   1  
ATOM 3365  H HD11 . LEU B 1 101 ? -14.976 -6.383  -10.132 1.00 0.00 ? 101 LEU B HD11 1  
ATOM 3366  H HD12 . LEU B 1 101 ? -16.308 -6.295  -11.286 1.00 0.00 ? 101 LEU B HD12 1  
ATOM 3367  H HD13 . LEU B 1 101 ? -16.461 -5.538  -9.702  1.00 0.00 ? 101 LEU B HD13 1  
ATOM 3368  H HD21 . LEU B 1 101 ? -15.403 -8.955  -10.880 1.00 0.00 ? 101 LEU B HD21 1  
ATOM 3369  H HD22 . LEU B 1 101 ? -16.903 -9.698  -10.323 1.00 0.00 ? 101 LEU B HD22 1  
ATOM 3370  H HD23 . LEU B 1 101 ? -16.938 -8.508  -11.624 1.00 0.00 ? 101 LEU B HD23 1  
ATOM 3371  N N    . SER B 1 102 ? -14.079 -10.244 -6.850  1.00 0.00 ? 102 SER B N    1  
ATOM 3372  C CA   . SER B 1 102 ? -13.353 -10.622 -5.602  1.00 0.00 ? 102 SER B CA   1  
ATOM 3373  C C    . SER B 1 102 ? -12.438 -9.486  -5.135  1.00 0.00 ? 102 SER B C    1  
ATOM 3374  O O    . SER B 1 102 ? -11.701 -8.910  -5.909  1.00 0.00 ? 102 SER B O    1  
ATOM 3375  C CB   . SER B 1 102 ? -12.512 -11.872 -5.865  1.00 0.00 ? 102 SER B CB   1  
ATOM 3376  O OG   . SER B 1 102 ? -12.402 -12.625 -4.665  1.00 0.00 ? 102 SER B OG   1  
ATOM 3377  H H    . SER B 1 102 ? -13.628 -10.286 -7.722  1.00 0.00 ? 102 SER B H    1  
ATOM 3378  H HA   . SER B 1 102 ? -14.072 -10.839 -4.826  1.00 0.00 ? 102 SER B HA   1  
ATOM 3379  H HB2  . SER B 1 102 ? -12.988 -12.476 -6.620  1.00 0.00 ? 102 SER B HB2  1  
ATOM 3380  H HB3  . SER B 1 102 ? -11.530 -11.577 -6.210  1.00 0.00 ? 102 SER B HB3  1  
ATOM 3381  H HG   . SER B 1 102 ? -13.072 -13.312 -4.682  1.00 0.00 ? 102 SER B HG   1  
ATOM 3382  N N    . ASN B 1 103 ? -12.464 -9.180  -3.863  1.00 0.00 ? 103 ASN B N    1  
ATOM 3383  C CA   . ASN B 1 103 ? -11.575 -8.102  -3.333  1.00 0.00 ? 103 ASN B CA   1  
ATOM 3384  C C    . ASN B 1 103 ? -11.894 -6.766  -4.002  1.00 0.00 ? 103 ASN B C    1  
ATOM 3385  O O    . ASN B 1 103 ? -11.027 -5.937  -4.197  1.00 0.00 ? 103 ASN B O    1  
ATOM 3386  C CB   . ASN B 1 103 ? -10.118 -8.470  -3.614  1.00 0.00 ? 103 ASN B CB   1  
ATOM 3387  C CG   . ASN B 1 103 ? -9.602  -9.393  -2.508  1.00 0.00 ? 103 ASN B CG   1  
ATOM 3388  O OD1  . ASN B 1 103 ? -10.322 -9.713  -1.583  1.00 0.00 ? 103 ASN B OD1  1  
ATOM 3389  N ND2  . ASN B 1 103 ? -8.376  -9.838  -2.565  1.00 0.00 ? 103 ASN B ND2  1  
ATOM 3390  H H    . ASN B 1 103 ? -13.058 -9.673  -3.252  1.00 0.00 ? 103 ASN B H    1  
ATOM 3391  H HA   . ASN B 1 103 ? -11.717 -8.006  -2.266  1.00 0.00 ? 103 ASN B HA   1  
ATOM 3392  H HB2  . ASN B 1 103 ? -10.052 -8.975  -4.567  1.00 0.00 ? 103 ASN B HB2  1  
ATOM 3393  H HB3  . ASN B 1 103 ? -9.521  -7.571  -3.640  1.00 0.00 ? 103 ASN B HB3  1  
ATOM 3394  H HD21 . ASN B 1 103 ? -7.795  -9.582  -3.311  1.00 0.00 ? 103 ASN B HD21 1  
ATOM 3395  H HD22 . ASN B 1 103 ? -8.036  -10.429 -1.860  1.00 0.00 ? 103 ASN B HD22 1  
ATOM 3396  N N    . MET B 1 104 ? -13.128 -6.540  -4.344  1.00 0.00 ? 104 MET B N    1  
ATOM 3397  C CA   . MET B 1 104 ? -13.491 -5.249  -4.985  1.00 0.00 ? 104 MET B CA   1  
ATOM 3398  C C    . MET B 1 104 ? -13.967 -4.270  -3.909  1.00 0.00 ? 104 MET B C    1  
ATOM 3399  O O    . MET B 1 104 ? -14.385 -3.169  -4.202  1.00 0.00 ? 104 MET B O    1  
ATOM 3400  C CB   . MET B 1 104 ? -14.612 -5.476  -5.999  1.00 0.00 ? 104 MET B CB   1  
ATOM 3401  C CG   . MET B 1 104 ? -14.951 -4.153  -6.687  1.00 0.00 ? 104 MET B CG   1  
ATOM 3402  S SD   . MET B 1 104 ? -14.658 -4.303  -8.465  1.00 0.00 ? 104 MET B SD   1  
ATOM 3403  C CE   . MET B 1 104 ? -15.981 -3.190  -8.997  1.00 0.00 ? 104 MET B CE   1  
ATOM 3404  H H    . MET B 1 104 ? -13.814 -7.215  -4.176  1.00 0.00 ? 104 MET B H    1  
ATOM 3405  H HA   . MET B 1 104 ? -12.626 -4.840  -5.488  1.00 0.00 ? 104 MET B HA   1  
ATOM 3406  H HB2  . MET B 1 104 ? -14.290 -6.195  -6.738  1.00 0.00 ? 104 MET B HB2  1  
ATOM 3407  H HB3  . MET B 1 104 ? -15.488 -5.849  -5.491  1.00 0.00 ? 104 MET B HB3  1  
ATOM 3408  H HG2  . MET B 1 104 ? -15.989 -3.912  -6.512  1.00 0.00 ? 104 MET B HG2  1  
ATOM 3409  H HG3  . MET B 1 104 ? -14.327 -3.369  -6.285  1.00 0.00 ? 104 MET B HG3  1  
ATOM 3410  H HE1  . MET B 1 104 ? -16.511 -2.823  -8.129  1.00 0.00 ? 104 MET B HE1  1  
ATOM 3411  H HE2  . MET B 1 104 ? -15.558 -2.359  -9.536  1.00 0.00 ? 104 MET B HE2  1  
ATOM 3412  H HE3  . MET B 1 104 ? -16.663 -3.725  -9.642  1.00 0.00 ? 104 MET B HE3  1  
ATOM 3413  N N    . ILE B 1 105 ? -13.899 -4.658  -2.661  1.00 0.00 ? 105 ILE B N    1  
ATOM 3414  C CA   . ILE B 1 105 ? -14.342 -3.741  -1.572  1.00 0.00 ? 105 ILE B CA   1  
ATOM 3415  C C    . ILE B 1 105 ? -13.282 -3.716  -0.472  1.00 0.00 ? 105 ILE B C    1  
ATOM 3416  O O    . ILE B 1 105 ? -12.427 -4.575  -0.403  1.00 0.00 ? 105 ILE B O    1  
ATOM 3417  C CB   . ILE B 1 105 ? -15.666 -4.228  -0.982  1.00 0.00 ? 105 ILE B CB   1  
ATOM 3418  C CG1  . ILE B 1 105 ? -16.741 -4.239  -2.070  1.00 0.00 ? 105 ILE B CG1  1  
ATOM 3419  C CG2  . ILE B 1 105 ? -16.094 -3.286  0.146   1.00 0.00 ? 105 ILE B CG2  1  
ATOM 3420  C CD1  . ILE B 1 105 ? -18.108 -4.486  -1.431  1.00 0.00 ? 105 ILE B CD1  1  
ATOM 3421  H H    . ILE B 1 105 ? -13.548 -5.548  -2.439  1.00 0.00 ? 105 ILE B H    1  
ATOM 3422  H HA   . ILE B 1 105 ? -14.470 -2.744  -1.970  1.00 0.00 ? 105 ILE B HA   1  
ATOM 3423  H HB   . ILE B 1 105 ? -15.538 -5.226  -0.588  1.00 0.00 ? 105 ILE B HB   1  
ATOM 3424  H HG12 . ILE B 1 105 ? -16.747 -3.287  -2.580  1.00 0.00 ? 105 ILE B HG12 1  
ATOM 3425  H HG13 . ILE B 1 105 ? -16.530 -5.026  -2.778  1.00 0.00 ? 105 ILE B HG13 1  
ATOM 3426  H HG21 . ILE B 1 105 ? -16.114 -2.270  -0.222  1.00 0.00 ? 105 ILE B HG21 1  
ATOM 3427  H HG22 . ILE B 1 105 ? -17.078 -3.563  0.493   1.00 0.00 ? 105 ILE B HG22 1  
ATOM 3428  H HG23 . ILE B 1 105 ? -15.391 -3.359  0.963   1.00 0.00 ? 105 ILE B HG23 1  
ATOM 3429  H HD11 . ILE B 1 105 ? -18.044 -5.328  -0.757  1.00 0.00 ? 105 ILE B HD11 1  
ATOM 3430  H HD12 . ILE B 1 105 ? -18.413 -3.608  -0.881  1.00 0.00 ? 105 ILE B HD12 1  
ATOM 3431  H HD13 . ILE B 1 105 ? -18.834 -4.697  -2.202  1.00 0.00 ? 105 ILE B HD13 1  
ATOM 3432  N N    . VAL B 1 106 ? -13.328 -2.738  0.387   1.00 0.00 ? 106 VAL B N    1  
ATOM 3433  C CA   . VAL B 1 106 ? -12.319 -2.656  1.473   1.00 0.00 ? 106 VAL B CA   1  
ATOM 3434  C C    . VAL B 1 106 ? -12.967 -3.030  2.810   1.00 0.00 ? 106 VAL B C    1  
ATOM 3435  O O    . VAL B 1 106 ? -14.077 -2.637  3.107   1.00 0.00 ? 106 VAL B O    1  
ATOM 3436  C CB   . VAL B 1 106 ? -11.784 -1.226  1.538   1.00 0.00 ? 106 VAL B CB   1  
ATOM 3437  C CG1  . VAL B 1 106 ? -11.057 -1.007  2.862   1.00 0.00 ? 106 VAL B CG1  1  
ATOM 3438  C CG2  . VAL B 1 106 ? -10.812 -0.998  0.378   1.00 0.00 ? 106 VAL B CG2  1  
ATOM 3439  H H    . VAL B 1 106 ? -14.022 -2.052  0.315   1.00 0.00 ? 106 VAL B H    1  
ATOM 3440  H HA   . VAL B 1 106 ? -11.507 -3.335  1.263   1.00 0.00 ? 106 VAL B HA   1  
ATOM 3441  H HB   . VAL B 1 106 ? -12.607 -0.531  1.461   1.00 0.00 ? 106 VAL B HB   1  
ATOM 3442  H HG11 . VAL B 1 106 ? -10.675 -1.951  3.221   1.00 0.00 ? 106 VAL B HG11 1  
ATOM 3443  H HG12 . VAL B 1 106 ? -10.240 -0.319  2.714   1.00 0.00 ? 106 VAL B HG12 1  
ATOM 3444  H HG13 . VAL B 1 106 ? -11.748 -0.599  3.585   1.00 0.00 ? 106 VAL B HG13 1  
ATOM 3445  H HG21 . VAL B 1 106 ? -10.141 -1.841  0.300   1.00 0.00 ? 106 VAL B HG21 1  
ATOM 3446  H HG22 . VAL B 1 106 ? -11.368 -0.894  -0.542  1.00 0.00 ? 106 VAL B HG22 1  
ATOM 3447  H HG23 . VAL B 1 106 ? -10.242 -0.099  0.558   1.00 0.00 ? 106 VAL B HG23 1  
ATOM 3448  N N    . ARG B 1 107 ? -12.274 -3.784  3.620   1.00 0.00 ? 107 ARG B N    1  
ATOM 3449  C CA   . ARG B 1 107 ? -12.838 -4.182  4.940   1.00 0.00 ? 107 ARG B CA   1  
ATOM 3450  C C    . ARG B 1 107 ? -11.918 -3.679  6.055   1.00 0.00 ? 107 ARG B C    1  
ATOM 3451  O O    . ARG B 1 107 ? -12.307 -3.588  7.203   1.00 0.00 ? 107 ARG B O    1  
ATOM 3452  C CB   . ARG B 1 107 ? -12.943 -5.707  5.012   1.00 0.00 ? 107 ARG B CB   1  
ATOM 3453  C CG   . ARG B 1 107 ? -14.254 -6.098  5.696   1.00 0.00 ? 107 ARG B CG   1  
ATOM 3454  C CD   . ARG B 1 107 ? -13.973 -6.514  7.141   1.00 0.00 ? 107 ARG B CD   1  
ATOM 3455  N NE   . ARG B 1 107 ? -13.825 -7.995  7.211   1.00 0.00 ? 107 ARG B NE   1  
ATOM 3456  C CZ   . ARG B 1 107 ? -13.115 -8.535  8.163   1.00 0.00 ? 107 ARG B CZ   1  
ATOM 3457  N NH1  . ARG B 1 107 ? -13.460 -8.365  9.410   1.00 0.00 ? 107 ARG B NH1  1  
ATOM 3458  N NH2  . ARG B 1 107 ? -12.059 -9.243  7.869   1.00 0.00 ? 107 ARG B NH2  1  
ATOM 3459  H H    . ARG B 1 107 ? -11.378 -4.087  3.359   1.00 0.00 ? 107 ARG B H    1  
ATOM 3460  H HA   . ARG B 1 107 ? -13.820 -3.747  5.058   1.00 0.00 ? 107 ARG B HA   1  
ATOM 3461  H HB2  . ARG B 1 107 ? -12.921 -6.116  4.012   1.00 0.00 ? 107 ARG B HB2  1  
ATOM 3462  H HB3  . ARG B 1 107 ? -12.112 -6.098  5.580   1.00 0.00 ? 107 ARG B HB3  1  
ATOM 3463  H HG2  . ARG B 1 107 ? -14.930 -5.255  5.687   1.00 0.00 ? 107 ARG B HG2  1  
ATOM 3464  H HG3  . ARG B 1 107 ? -14.703 -6.925  5.166   1.00 0.00 ? 107 ARG B HG3  1  
ATOM 3465  H HD2  . ARG B 1 107 ? -13.061 -6.045  7.480   1.00 0.00 ? 107 ARG B HD2  1  
ATOM 3466  H HD3  . ARG B 1 107 ? -14.793 -6.204  7.771   1.00 0.00 ? 107 ARG B HD3  1  
ATOM 3467  H HE   . ARG B 1 107 ? -14.261 -8.563  6.543   1.00 0.00 ? 107 ARG B HE   1  
ATOM 3468  H HH11 . ARG B 1 107 ? -14.268 -7.821  9.636   1.00 0.00 ? 107 ARG B HH11 1  
ATOM 3469  H HH12 . ARG B 1 107 ? -12.916 -8.779  10.140  1.00 0.00 ? 107 ARG B HH12 1  
ATOM 3470  H HH21 . ARG B 1 107 ? -11.794 -9.372  6.913   1.00 0.00 ? 107 ARG B HH21 1  
ATOM 3471  H HH22 . ARG B 1 107 ? -11.515 -9.657  8.598   1.00 0.00 ? 107 ARG B HH22 1  
ATOM 3472  N N    . SER B 1 108 ? -10.699 -3.348  5.723   1.00 0.00 ? 108 SER B N    1  
ATOM 3473  C CA   . SER B 1 108 ? -9.749  -2.848  6.756   1.00 0.00 ? 108 SER B CA   1  
ATOM 3474  C C    . SER B 1 108 ? -8.420  -2.494  6.083   1.00 0.00 ? 108 SER B C    1  
ATOM 3475  O O    . SER B 1 108 ? -7.953  -3.193  5.206   1.00 0.00 ? 108 SER B O    1  
ATOM 3476  C CB   . SER B 1 108 ? -9.519  -3.932  7.810   1.00 0.00 ? 108 SER B CB   1  
ATOM 3477  O OG   . SER B 1 108 ? -9.277  -5.174  7.162   1.00 0.00 ? 108 SER B OG   1  
ATOM 3478  H H    . SER B 1 108 ? -10.408 -3.427  4.792   1.00 0.00 ? 108 SER B H    1  
ATOM 3479  H HA   . SER B 1 108 ? -10.161 -1.965  7.225   1.00 0.00 ? 108 SER B HA   1  
ATOM 3480  H HB2  . SER B 1 108 ? -8.665  -3.675  8.414   1.00 0.00 ? 108 SER B HB2  1  
ATOM 3481  H HB3  . SER B 1 108 ? -10.394 -4.008  8.443   1.00 0.00 ? 108 SER B HB3  1  
ATOM 3482  H HG   . SER B 1 108 ? -10.097 -5.674  7.164   1.00 0.00 ? 108 SER B HG   1  
ATOM 3483  N N    . CYS B 1 109 ? -7.819  -1.404  6.472   1.00 0.00 ? 109 CYS B N    1  
ATOM 3484  C CA   . CYS B 1 109 ? -6.530  -0.995  5.837   1.00 0.00 ? 109 CYS B CA   1  
ATOM 3485  C C    . CYS B 1 109 ? -5.352  -1.243  6.785   1.00 0.00 ? 109 CYS B C    1  
ATOM 3486  O O    . CYS B 1 109 ? -5.518  -1.367  7.982   1.00 0.00 ? 109 CYS B O    1  
ATOM 3487  C CB   . CYS B 1 109 ? -6.607  0.490   5.487   1.00 0.00 ? 109 CYS B CB   1  
ATOM 3488  S SG   . CYS B 1 109 ? -7.431  0.669   3.890   1.00 0.00 ? 109 CYS B SG   1  
ATOM 3489  H H    . CYS B 1 109 ? -8.224  -0.845  7.169   1.00 0.00 ? 109 CYS B H    1  
ATOM 3490  H HA   . CYS B 1 109 ? -6.385  -1.564  4.933   1.00 0.00 ? 109 CYS B HA   1  
ATOM 3491  H HB2  . CYS B 1 109 ? -7.173  1.011   6.247   1.00 0.00 ? 109 CYS B HB2  1  
ATOM 3492  H HB3  . CYS B 1 109 ? -5.614  0.910   5.429   1.00 0.00 ? 109 CYS B HB3  1  
ATOM 3493  N N    . LYS B 1 110 ? -4.156  -1.307  6.251   1.00 0.00 ? 110 LYS B N    1  
ATOM 3494  C CA   . LYS B 1 110 ? -2.961  -1.535  7.104   1.00 0.00 ? 110 LYS B CA   1  
ATOM 3495  C C    . LYS B 1 110 ? -1.842  -0.599  6.630   1.00 0.00 ? 110 LYS B C    1  
ATOM 3496  O O    . LYS B 1 110 ? -2.049  0.587   6.485   1.00 0.00 ? 110 LYS B O    1  
ATOM 3497  C CB   . LYS B 1 110 ? -2.521  -2.997  6.985   1.00 0.00 ? 110 LYS B CB   1  
ATOM 3498  C CG   . LYS B 1 110 ? -1.641  -3.364  8.182   1.00 0.00 ? 110 LYS B CG   1  
ATOM 3499  C CD   . LYS B 1 110 ? -1.150  -4.805  8.034   1.00 0.00 ? 110 LYS B CD   1  
ATOM 3500  C CE   . LYS B 1 110 ? -1.917  -5.706  9.004   1.00 0.00 ? 110 LYS B CE   1  
ATOM 3501  N NZ   . LYS B 1 110 ? -0.961  -6.341  9.954   1.00 0.00 ? 110 LYS B NZ   1  
ATOM 3502  H H    . LYS B 1 110 ? -4.043  -1.197  5.284   1.00 0.00 ? 110 LYS B H    1  
ATOM 3503  H HA   . LYS B 1 110 ? -3.205  -1.313  8.133   1.00 0.00 ? 110 LYS B HA   1  
ATOM 3504  H HB2  . LYS B 1 110 ? -3.393  -3.635  6.969   1.00 0.00 ? 110 LYS B HB2  1  
ATOM 3505  H HB3  . LYS B 1 110 ? -1.960  -3.132  6.073   1.00 0.00 ? 110 LYS B HB3  1  
ATOM 3506  H HG2  . LYS B 1 110 ? -0.792  -2.696  8.223   1.00 0.00 ? 110 LYS B HG2  1  
ATOM 3507  H HG3  . LYS B 1 110 ? -2.215  -3.272  9.092   1.00 0.00 ? 110 LYS B HG3  1  
ATOM 3508  H HD2  . LYS B 1 110 ? -1.317  -5.140  7.021   1.00 0.00 ? 110 LYS B HD2  1  
ATOM 3509  H HD3  . LYS B 1 110 ? -0.096  -4.852  8.260   1.00 0.00 ? 110 LYS B HD3  1  
ATOM 3510  H HE2  . LYS B 1 110 ? -2.633  -5.114  9.555   1.00 0.00 ? 110 LYS B HE2  1  
ATOM 3511  H HE3  . LYS B 1 110 ? -2.436  -6.472  8.448   1.00 0.00 ? 110 LYS B HE3  1  
ATOM 3512  H HZ1  . LYS B 1 110 ? -0.405  -5.603  10.432  1.00 0.00 ? 110 LYS B HZ1  1  
ATOM 3513  H HZ2  . LYS B 1 110 ? -1.488  -6.891  10.661  1.00 0.00 ? 110 LYS B HZ2  1  
ATOM 3514  H HZ3  . LYS B 1 110 ? -0.322  -6.974  9.432   1.00 0.00 ? 110 LYS B HZ3  1  
ATOM 3515  N N    . CYS B 1 111 ? -0.663  -1.103  6.381   1.00 0.00 ? 111 CYS B N    1  
ATOM 3516  C CA   . CYS B 1 111 ? 0.430   -0.203  5.919   1.00 0.00 ? 111 CYS B CA   1  
ATOM 3517  C C    . CYS B 1 111 ? 1.409   -0.979  5.036   1.00 0.00 ? 111 CYS B C    1  
ATOM 3518  O O    . CYS B 1 111 ? 2.373   -1.544  5.513   1.00 0.00 ? 111 CYS B O    1  
ATOM 3519  C CB   . CYS B 1 111 ? 1.167   0.353   7.139   1.00 0.00 ? 111 CYS B CB   1  
ATOM 3520  S SG   . CYS B 1 111 ? -0.004  1.259   8.182   1.00 0.00 ? 111 CYS B SG   1  
ATOM 3521  H H    . CYS B 1 111 ? -0.494  -2.060  6.495   1.00 0.00 ? 111 CYS B H    1  
ATOM 3522  H HA   . CYS B 1 111 ? 0.007   0.614   5.354   1.00 0.00 ? 111 CYS B HA   1  
ATOM 3523  H HB2  . CYS B 1 111 ? 1.596   -0.462  7.703   1.00 0.00 ? 111 CYS B HB2  1  
ATOM 3524  H HB3  . CYS B 1 111 ? 1.952   1.019   6.814   1.00 0.00 ? 111 CYS B HB3  1  
ATOM 3525  N N    . SER B 1 112 ? 1.178   -1.005  3.749   1.00 0.00 ? 112 SER B N    1  
ATOM 3526  C CA   . SER B 1 112 ? 2.107   -1.739  2.846   1.00 0.00 ? 112 SER B CA   1  
ATOM 3527  C C    . SER B 1 112 ? 3.273   -0.822  2.471   1.00 0.00 ? 112 SER B C    1  
ATOM 3528  O O    . SER B 1 112 ? 3.017   0.327   2.149   1.00 0.00 ? 112 SER B O    1  
ATOM 3529  C CB   . SER B 1 112 ? 1.360   -2.159  1.580   1.00 0.00 ? 112 SER B CB   1  
ATOM 3530  O OG   . SER B 1 112 ? 2.096   -3.178  0.916   1.00 0.00 ? 112 SER B OG   1  
ATOM 3531  O OXT  . SER B 1 112 ? 4.402   -1.282  2.516   1.00 0.00 ? 112 SER B OXT  1  
ATOM 3532  H H    . SER B 1 112 ? 0.398   -0.539  3.375   1.00 0.00 ? 112 SER B H    1  
ATOM 3533  H HA   . SER B 1 112 ? 2.484   -2.616  3.351   1.00 0.00 ? 112 SER B HA   1  
ATOM 3534  H HB2  . SER B 1 112 ? 0.387   -2.538  1.843   1.00 0.00 ? 112 SER B HB2  1  
ATOM 3535  H HB3  . SER B 1 112 ? 1.246   -1.302  0.931   1.00 0.00 ? 112 SER B HB3  1  
ATOM 3536  H HG   . SER B 1 112 ? 3.021   -3.079  1.153   1.00 0.00 ? 112 SER B HG   1  
ATOM 3537  N N    . ALA A 1 1   ? 7.545   -2.948  -15.200 1.00 0.00 ? 1   ALA A N    2  
ATOM 3538  C CA   . ALA A 1 1   ? 7.894   -3.605  -13.908 1.00 0.00 ? 1   ALA A CA   2  
ATOM 3539  C C    . ALA A 1 1   ? 8.207   -2.534  -12.861 1.00 0.00 ? 1   ALA A C    2  
ATOM 3540  O O    . ALA A 1 1   ? 9.127   -1.755  -13.014 1.00 0.00 ? 1   ALA A O    2  
ATOM 3541  C CB   . ALA A 1 1   ? 9.120   -4.499  -14.104 1.00 0.00 ? 1   ALA A CB   2  
ATOM 3542  H H1   . ALA A 1 1   ? 6.741   -2.307  -15.058 1.00 0.00 ? 1   ALA A H1   2  
ATOM 3543  H H2   . ALA A 1 1   ? 8.362   -2.406  -15.544 1.00 0.00 ? 1   ALA A H2   2  
ATOM 3544  H H3   . ALA A 1 1   ? 7.292   -3.676  -15.900 1.00 0.00 ? 1   ALA A H3   2  
ATOM 3545  H HA   . ALA A 1 1   ? 7.060   -4.203  -13.572 1.00 0.00 ? 1   ALA A HA   2  
ATOM 3546  H HB1  . ALA A 1 1   ? 9.059   -4.988  -15.065 1.00 0.00 ? 1   ALA A HB1  2  
ATOM 3547  H HB2  . ALA A 1 1   ? 10.015  -3.896  -14.062 1.00 0.00 ? 1   ALA A HB2  2  
ATOM 3548  H HB3  . ALA A 1 1   ? 9.150   -5.244  -13.323 1.00 0.00 ? 1   ALA A HB3  2  
ATOM 3549  N N    . LEU A 1 2   ? 7.453   -2.489  -11.798 1.00 0.00 ? 2   LEU A N    2  
ATOM 3550  C CA   . LEU A 1 2   ? 7.713   -1.467  -10.745 1.00 0.00 ? 2   LEU A CA   2  
ATOM 3551  C C    . LEU A 1 2   ? 8.689   -2.027  -9.718  1.00 0.00 ? 2   LEU A C    2  
ATOM 3552  O O    . LEU A 1 2   ? 8.366   -2.192  -8.561  1.00 0.00 ? 2   LEU A O    2  
ATOM 3553  C CB   . LEU A 1 2   ? 6.412   -1.105  -10.041 1.00 0.00 ? 2   LEU A CB   2  
ATOM 3554  C CG   . LEU A 1 2   ? 5.318   -0.856  -11.075 1.00 0.00 ? 2   LEU A CG   2  
ATOM 3555  C CD1  . LEU A 1 2   ? 4.092   -0.262  -10.380 1.00 0.00 ? 2   LEU A CD1  2  
ATOM 3556  C CD2  . LEU A 1 2   ? 5.827   0.126   -12.134 1.00 0.00 ? 2   LEU A CD2  2  
ATOM 3557  H H    . LEU A 1 2   ? 6.715   -3.126  -11.691 1.00 0.00 ? 2   LEU A H    2  
ATOM 3558  H HA   . LEU A 1 2   ? 8.136   -0.582  -11.196 1.00 0.00 ? 2   LEU A HA   2  
ATOM 3559  H HB2  . LEU A 1 2   ? 6.121   -1.918  -9.392  1.00 0.00 ? 2   LEU A HB2  2  
ATOM 3560  H HB3  . LEU A 1 2   ? 6.563   -0.213  -9.455  1.00 0.00 ? 2   LEU A HB3  2  
ATOM 3561  H HG   . LEU A 1 2   ? 5.047   -1.790  -11.546 1.00 0.00 ? 2   LEU A HG   2  
ATOM 3562  H HD11 . LEU A 1 2   ? 4.054   -0.611  -9.357  1.00 0.00 ? 2   LEU A HD11 2  
ATOM 3563  H HD12 . LEU A 1 2   ? 4.160   0.816   -10.390 1.00 0.00 ? 2   LEU A HD12 2  
ATOM 3564  H HD13 . LEU A 1 2   ? 3.198   -0.572  -10.898 1.00 0.00 ? 2   LEU A HD13 2  
ATOM 3565  H HD21 . LEU A 1 2   ? 6.824   -0.154  -12.439 1.00 0.00 ? 2   LEU A HD21 2  
ATOM 3566  H HD22 . LEU A 1 2   ? 5.171   0.099   -12.990 1.00 0.00 ? 2   LEU A HD22 2  
ATOM 3567  H HD23 . LEU A 1 2   ? 5.843   1.124   -11.722 1.00 0.00 ? 2   LEU A HD23 2  
ATOM 3568  N N    . ASP A 1 3   ? 9.882   -2.318  -10.135 1.00 0.00 ? 3   ASP A N    2  
ATOM 3569  C CA   . ASP A 1 3   ? 10.885  -2.866  -9.187  1.00 0.00 ? 3   ASP A CA   2  
ATOM 3570  C C    . ASP A 1 3   ? 11.996  -1.842  -8.971  1.00 0.00 ? 3   ASP A C    2  
ATOM 3571  O O    . ASP A 1 3   ? 12.003  -0.778  -9.558  1.00 0.00 ? 3   ASP A O    2  
ATOM 3572  C CB   . ASP A 1 3   ? 11.487  -4.149  -9.762  1.00 0.00 ? 3   ASP A CB   2  
ATOM 3573  C CG   . ASP A 1 3   ? 11.523  -4.062  -11.290 1.00 0.00 ? 3   ASP A CG   2  
ATOM 3574  O OD1  . ASP A 1 3   ? 10.503  -4.331  -11.903 1.00 0.00 ? 3   ASP A OD1  2  
ATOM 3575  O OD2  . ASP A 1 3   ? 12.570  -3.729  -11.820 1.00 0.00 ? 3   ASP A OD2  2  
ATOM 3576  H H    . ASP A 1 3   ? 10.118  -2.174  -11.071 1.00 0.00 ? 3   ASP A H    2  
ATOM 3577  H HA   . ASP A 1 3   ? 10.407  -3.085  -8.243  1.00 0.00 ? 3   ASP A HA   2  
ATOM 3578  H HB2  . ASP A 1 3   ? 12.492  -4.276  -9.384  1.00 0.00 ? 3   ASP A HB2  2  
ATOM 3579  H HB3  . ASP A 1 3   ? 10.884  -4.991  -9.466  1.00 0.00 ? 3   ASP A HB3  2  
ATOM 3580  N N    . THR A 1 4   ? 12.935  -2.163  -8.130  1.00 0.00 ? 4   THR A N    2  
ATOM 3581  C CA   . THR A 1 4   ? 14.058  -1.225  -7.860  1.00 0.00 ? 4   THR A CA   2  
ATOM 3582  C C    . THR A 1 4   ? 15.072  -1.287  -9.007  1.00 0.00 ? 4   THR A C    2  
ATOM 3583  O O    . THR A 1 4   ? 16.122  -0.679  -8.952  1.00 0.00 ? 4   THR A O    2  
ATOM 3584  C CB   . THR A 1 4   ? 14.728  -1.621  -6.543  1.00 0.00 ? 4   THR A CB   2  
ATOM 3585  O OG1  . THR A 1 4   ? 15.708  -2.620  -6.793  1.00 0.00 ? 4   THR A OG1  2  
ATOM 3586  C CG2  . THR A 1 4   ? 13.668  -2.168  -5.583  1.00 0.00 ? 4   THR A CG2  2  
ATOM 3587  H H    . THR A 1 4   ? 12.902  -3.026  -7.670  1.00 0.00 ? 4   THR A H    2  
ATOM 3588  H HA   . THR A 1 4   ? 13.677  -0.220  -7.779  1.00 0.00 ? 4   THR A HA   2  
ATOM 3589  H HB   . THR A 1 4   ? 15.197  -0.757  -6.100  1.00 0.00 ? 4   THR A HB   2  
ATOM 3590  H HG1  . THR A 1 4   ? 16.182  -2.782  -5.973  1.00 0.00 ? 4   THR A HG1  2  
ATOM 3591  H HG21 . THR A 1 4   ? 12.683  -1.896  -5.940  1.00 0.00 ? 4   THR A HG21 2  
ATOM 3592  H HG22 . THR A 1 4   ? 13.745  -3.244  -5.534  1.00 0.00 ? 4   THR A HG22 2  
ATOM 3593  H HG23 . THR A 1 4   ? 13.820  -1.751  -4.599  1.00 0.00 ? 4   THR A HG23 2  
ATOM 3594  N N    . ASN A 1 5   ? 14.761  -2.009  -10.051 1.00 0.00 ? 5   ASN A N    2  
ATOM 3595  C CA   . ASN A 1 5   ? 15.701  -2.100  -11.201 1.00 0.00 ? 5   ASN A CA   2  
ATOM 3596  C C    . ASN A 1 5   ? 15.237  -1.154  -12.313 1.00 0.00 ? 5   ASN A C    2  
ATOM 3597  O O    . ASN A 1 5   ? 16.035  -0.502  -12.958 1.00 0.00 ? 5   ASN A O    2  
ATOM 3598  C CB   . ASN A 1 5   ? 15.724  -3.536  -11.729 1.00 0.00 ? 5   ASN A CB   2  
ATOM 3599  C CG   . ASN A 1 5   ? 16.622  -3.613  -12.965 1.00 0.00 ? 5   ASN A CG   2  
ATOM 3600  O OD1  . ASN A 1 5   ? 16.178  -3.365  -14.069 1.00 0.00 ? 5   ASN A OD1  2  
ATOM 3601  N ND2  . ASN A 1 5   ? 17.875  -3.948  -12.826 1.00 0.00 ? 5   ASN A ND2  2  
ATOM 3602  H H    . ASN A 1 5   ? 13.909  -2.487  -10.080 1.00 0.00 ? 5   ASN A H    2  
ATOM 3603  H HA   . ASN A 1 5   ? 16.693  -1.818  -10.880 1.00 0.00 ? 5   ASN A HA   2  
ATOM 3604  H HB2  . ASN A 1 5   ? 16.109  -4.194  -10.962 1.00 0.00 ? 5   ASN A HB2  2  
ATOM 3605  H HB3  . ASN A 1 5   ? 14.722  -3.838  -11.994 1.00 0.00 ? 5   ASN A HB3  2  
ATOM 3606  H HD21 . ASN A 1 5   ? 18.234  -4.149  -11.937 1.00 0.00 ? 5   ASN A HD21 2  
ATOM 3607  H HD22 . ASN A 1 5   ? 18.459  -4.000  -13.612 1.00 0.00 ? 5   ASN A HD22 2  
ATOM 3608  N N    . TYR A 1 6   ? 13.952  -1.075  -12.547 1.00 0.00 ? 6   TYR A N    2  
ATOM 3609  C CA   . TYR A 1 6   ? 13.441  -0.179  -13.615 1.00 0.00 ? 6   TYR A CA   2  
ATOM 3610  C C    . TYR A 1 6   ? 13.232  1.228   -13.050 1.00 0.00 ? 6   TYR A C    2  
ATOM 3611  O O    . TYR A 1 6   ? 13.090  2.188   -13.782 1.00 0.00 ? 6   TYR A O    2  
ATOM 3612  C CB   . TYR A 1 6   ? 12.111  -0.734  -14.121 1.00 0.00 ? 6   TYR A CB   2  
ATOM 3613  C CG   . TYR A 1 6   ? 11.421  0.296   -14.978 1.00 0.00 ? 6   TYR A CG   2  
ATOM 3614  C CD1  . TYR A 1 6   ? 11.948  0.638   -16.230 1.00 0.00 ? 6   TYR A CD1  2  
ATOM 3615  C CD2  . TYR A 1 6   ? 10.252  0.908   -14.519 1.00 0.00 ? 6   TYR A CD2  2  
ATOM 3616  C CE1  . TYR A 1 6   ? 11.303  1.595   -17.021 1.00 0.00 ? 6   TYR A CE1  2  
ATOM 3617  C CE2  . TYR A 1 6   ? 9.605   1.865   -15.310 1.00 0.00 ? 6   TYR A CE2  2  
ATOM 3618  C CZ   . TYR A 1 6   ? 10.131  2.209   -16.562 1.00 0.00 ? 6   TYR A CZ   2  
ATOM 3619  O OH   . TYR A 1 6   ? 9.494   3.152   -17.342 1.00 0.00 ? 6   TYR A OH   2  
ATOM 3620  H H    . TYR A 1 6   ? 13.320  -1.609  -12.023 1.00 0.00 ? 6   TYR A H    2  
ATOM 3621  H HA   . TYR A 1 6   ? 14.149  -0.142  -14.429 1.00 0.00 ? 6   TYR A HA   2  
ATOM 3622  H HB2  . TYR A 1 6   ? 12.294  -1.626  -14.699 1.00 0.00 ? 6   TYR A HB2  2  
ATOM 3623  H HB3  . TYR A 1 6   ? 11.482  -0.978  -13.278 1.00 0.00 ? 6   TYR A HB3  2  
ATOM 3624  H HD1  . TYR A 1 6   ? 12.852  0.165   -16.583 1.00 0.00 ? 6   TYR A HD1  2  
ATOM 3625  H HD2  . TYR A 1 6   ? 9.848   0.640   -13.553 1.00 0.00 ? 6   TYR A HD2  2  
ATOM 3626  H HE1  . TYR A 1 6   ? 11.708  1.860   -17.987 1.00 0.00 ? 6   TYR A HE1  2  
ATOM 3627  H HE2  . TYR A 1 6   ? 8.701   2.338   -14.955 1.00 0.00 ? 6   TYR A HE2  2  
ATOM 3628  H HH   . TYR A 1 6   ? 9.251   2.734   -18.172 1.00 0.00 ? 6   TYR A HH   2  
ATOM 3629  N N    . CYS A 1 7   ? 13.212  1.361   -11.751 1.00 0.00 ? 7   CYS A N    2  
ATOM 3630  C CA   . CYS A 1 7   ? 13.012  2.707   -11.144 1.00 0.00 ? 7   CYS A CA   2  
ATOM 3631  C C    . CYS A 1 7   ? 14.369  3.368   -10.901 1.00 0.00 ? 7   CYS A C    2  
ATOM 3632  O O    . CYS A 1 7   ? 14.473  4.575   -10.801 1.00 0.00 ? 7   CYS A O    2  
ATOM 3633  C CB   . CYS A 1 7   ? 12.261  2.564   -9.818  1.00 0.00 ? 7   CYS A CB   2  
ATOM 3634  S SG   . CYS A 1 7   ? 10.482  2.680   -10.128 1.00 0.00 ? 7   CYS A SG   2  
ATOM 3635  H H    . CYS A 1 7   ? 13.328  0.575   -11.177 1.00 0.00 ? 7   CYS A H    2  
ATOM 3636  H HA   . CYS A 1 7   ? 12.432  3.321   -11.818 1.00 0.00 ? 7   CYS A HA   2  
ATOM 3637  H HB2  . CYS A 1 7   ? 12.488  1.604   -9.377  1.00 0.00 ? 7   CYS A HB2  2  
ATOM 3638  H HB3  . CYS A 1 7   ? 12.562  3.350   -9.143  1.00 0.00 ? 7   CYS A HB3  2  
ATOM 3639  N N    . PHE A 1 8   ? 15.411  2.590   -10.810 1.00 0.00 ? 8   PHE A N    2  
ATOM 3640  C CA   . PHE A 1 8   ? 16.760  3.178   -10.582 1.00 0.00 ? 8   PHE A CA   2  
ATOM 3641  C C    . PHE A 1 8   ? 17.420  3.474   -11.929 1.00 0.00 ? 8   PHE A C    2  
ATOM 3642  O O    . PHE A 1 8   ? 18.628  3.449   -12.057 1.00 0.00 ? 8   PHE A O    2  
ATOM 3643  C CB   . PHE A 1 8   ? 17.623  2.190   -9.796  1.00 0.00 ? 8   PHE A CB   2  
ATOM 3644  C CG   . PHE A 1 8   ? 17.458  2.444   -8.317  1.00 0.00 ? 8   PHE A CG   2  
ATOM 3645  C CD1  . PHE A 1 8   ? 16.256  2.964   -7.824  1.00 0.00 ? 8   PHE A CD1  2  
ATOM 3646  C CD2  . PHE A 1 8   ? 18.511  2.159   -7.438  1.00 0.00 ? 8   PHE A CD2  2  
ATOM 3647  C CE1  . PHE A 1 8   ? 16.106  3.200   -6.452  1.00 0.00 ? 8   PHE A CE1  2  
ATOM 3648  C CE2  . PHE A 1 8   ? 18.361  2.395   -6.067  1.00 0.00 ? 8   PHE A CE2  2  
ATOM 3649  C CZ   . PHE A 1 8   ? 17.158  2.916   -5.574  1.00 0.00 ? 8   PHE A CZ   2  
ATOM 3650  H H    . PHE A 1 8   ? 15.308  1.620   -10.898 1.00 0.00 ? 8   PHE A H    2  
ATOM 3651  H HA   . PHE A 1 8   ? 16.662  4.096   -10.020 1.00 0.00 ? 8   PHE A HA   2  
ATOM 3652  H HB2  . PHE A 1 8   ? 17.312  1.181   -10.025 1.00 0.00 ? 8   PHE A HB2  2  
ATOM 3653  H HB3  . PHE A 1 8   ? 18.659  2.319   -10.069 1.00 0.00 ? 8   PHE A HB3  2  
ATOM 3654  H HD1  . PHE A 1 8   ? 15.444  3.183   -8.501  1.00 0.00 ? 8   PHE A HD1  2  
ATOM 3655  H HD2  . PHE A 1 8   ? 19.438  1.758   -7.819  1.00 0.00 ? 8   PHE A HD2  2  
ATOM 3656  H HE1  . PHE A 1 8   ? 15.179  3.602   -6.071  1.00 0.00 ? 8   PHE A HE1  2  
ATOM 3657  H HE2  . PHE A 1 8   ? 19.172  2.177   -5.389  1.00 0.00 ? 8   PHE A HE2  2  
ATOM 3658  H HZ   . PHE A 1 8   ? 17.043  3.098   -4.516  1.00 0.00 ? 8   PHE A HZ   2  
ATOM 3659  N N    . SER A 1 9   ? 16.637  3.750   -12.936 1.00 0.00 ? 9   SER A N    2  
ATOM 3660  C CA   . SER A 1 9   ? 17.221  4.045   -14.273 1.00 0.00 ? 9   SER A CA   2  
ATOM 3661  C C    . SER A 1 9   ? 16.406  5.146   -14.958 1.00 0.00 ? 9   SER A C    2  
ATOM 3662  O O    . SER A 1 9   ? 16.888  6.237   -15.184 1.00 0.00 ? 9   SER A O    2  
ATOM 3663  C CB   . SER A 1 9   ? 17.190  2.779   -15.131 1.00 0.00 ? 9   SER A CB   2  
ATOM 3664  O OG   . SER A 1 9   ? 18.484  2.189   -15.144 1.00 0.00 ? 9   SER A OG   2  
ATOM 3665  H H    . SER A 1 9   ? 15.665  3.764   -12.811 1.00 0.00 ? 9   SER A H    2  
ATOM 3666  H HA   . SER A 1 9   ? 18.243  4.375   -14.155 1.00 0.00 ? 9   SER A HA   2  
ATOM 3667  H HB2  . SER A 1 9   ? 16.486  2.078   -14.715 1.00 0.00 ? 9   SER A HB2  2  
ATOM 3668  H HB3  . SER A 1 9   ? 16.889  3.034   -16.138 1.00 0.00 ? 9   SER A HB3  2  
ATOM 3669  H HG   . SER A 1 9   ? 18.956  2.526   -15.909 1.00 0.00 ? 9   SER A HG   2  
ATOM 3670  N N    . SER A 1 10  ? 15.175  4.867   -15.291 1.00 0.00 ? 10  SER A N    2  
ATOM 3671  C CA   . SER A 1 10  ? 14.334  5.898   -15.962 1.00 0.00 ? 10  SER A CA   2  
ATOM 3672  C C    . SER A 1 10  ? 13.645  6.765   -14.906 1.00 0.00 ? 10  SER A C    2  
ATOM 3673  O O    . SER A 1 10  ? 14.046  6.803   -13.760 1.00 0.00 ? 10  SER A O    2  
ATOM 3674  C CB   . SER A 1 10  ? 13.276  5.210   -16.823 1.00 0.00 ? 10  SER A CB   2  
ATOM 3675  O OG   . SER A 1 10  ? 12.918  6.066   -17.902 1.00 0.00 ? 10  SER A OG   2  
ATOM 3676  H H    . SER A 1 10  ? 14.805  3.980   -15.100 1.00 0.00 ? 10  SER A H    2  
ATOM 3677  H HA   . SER A 1 10  ? 14.958  6.520   -16.586 1.00 0.00 ? 10  SER A HA   2  
ATOM 3678  H HB2  . SER A 1 10  ? 13.672  4.289   -17.218 1.00 0.00 ? 10  SER A HB2  2  
ATOM 3679  H HB3  . SER A 1 10  ? 12.405  4.994   -16.219 1.00 0.00 ? 10  SER A HB3  2  
ATOM 3680  H HG   . SER A 1 10  ? 13.713  6.515   -18.199 1.00 0.00 ? 10  SER A HG   2  
ATOM 3681  N N    . THR A 1 11  ? 12.609  7.462   -15.285 1.00 0.00 ? 11  THR A N    2  
ATOM 3682  C CA   . THR A 1 11  ? 11.892  8.327   -14.307 1.00 0.00 ? 11  THR A CA   2  
ATOM 3683  C C    . THR A 1 11  ? 10.554  7.682   -13.940 1.00 0.00 ? 11  THR A C    2  
ATOM 3684  O O    . THR A 1 11  ? 10.480  6.835   -13.072 1.00 0.00 ? 11  THR A O    2  
ATOM 3685  C CB   . THR A 1 11  ? 11.658  9.711   -14.924 1.00 0.00 ? 11  THR A CB   2  
ATOM 3686  O OG1  . THR A 1 11  ? 10.531  10.322  -14.314 1.00 0.00 ? 11  THR A OG1  2  
ATOM 3687  C CG2  . THR A 1 11  ? 11.420  9.571   -16.431 1.00 0.00 ? 11  THR A CG2  2  
ATOM 3688  H H    . THR A 1 11  ? 12.303  7.416   -16.215 1.00 0.00 ? 11  THR A H    2  
ATOM 3689  H HA   . THR A 1 11  ? 12.485  8.431   -13.419 1.00 0.00 ? 11  THR A HA   2  
ATOM 3690  H HB   . THR A 1 11  ? 12.527  10.325  -14.761 1.00 0.00 ? 11  THR A HB   2  
ATOM 3691  H HG1  . THR A 1 11  ? 10.737  11.248  -14.170 1.00 0.00 ? 11  THR A HG1  2  
ATOM 3692  H HG21 . THR A 1 11  ? 10.900  8.646   -16.628 1.00 0.00 ? 11  THR A HG21 2  
ATOM 3693  H HG22 . THR A 1 11  ? 10.823  10.402  -16.779 1.00 0.00 ? 11  THR A HG22 2  
ATOM 3694  H HG23 . THR A 1 11  ? 12.368  9.568   -16.947 1.00 0.00 ? 11  THR A HG23 2  
ATOM 3695  N N    . GLU A 1 12  ? 9.500   8.076   -14.591 1.00 0.00 ? 12  GLU A N    2  
ATOM 3696  C CA   . GLU A 1 12  ? 8.166   7.489   -14.283 1.00 0.00 ? 12  GLU A CA   2  
ATOM 3697  C C    . GLU A 1 12  ? 7.683   8.003   -12.925 1.00 0.00 ? 12  GLU A C    2  
ATOM 3698  O O    . GLU A 1 12  ? 8.450   8.134   -11.992 1.00 0.00 ? 12  GLU A O    2  
ATOM 3699  C CB   . GLU A 1 12  ? 8.276   5.963   -14.241 1.00 0.00 ? 12  GLU A CB   2  
ATOM 3700  C CG   . GLU A 1 12  ? 6.935   5.343   -14.639 1.00 0.00 ? 12  GLU A CG   2  
ATOM 3701  C CD   . GLU A 1 12  ? 6.800   5.348   -16.164 1.00 0.00 ? 12  GLU A CD   2  
ATOM 3702  O OE1  . GLU A 1 12  ? 7.818   5.250   -16.828 1.00 0.00 ? 12  GLU A OE1  2  
ATOM 3703  O OE2  . GLU A 1 12  ? 5.682   5.452   -16.639 1.00 0.00 ? 12  GLU A OE2  2  
ATOM 3704  H H    . GLU A 1 12  ? 9.588   8.758   -15.282 1.00 0.00 ? 12  GLU A H    2  
ATOM 3705  H HA   . GLU A 1 12  ? 7.461   7.777   -15.049 1.00 0.00 ? 12  GLU A HA   2  
ATOM 3706  H HB2  . GLU A 1 12  ? 9.043   5.639   -14.930 1.00 0.00 ? 12  GLU A HB2  2  
ATOM 3707  H HB3  . GLU A 1 12  ? 8.533   5.648   -13.241 1.00 0.00 ? 12  GLU A HB3  2  
ATOM 3708  H HG2  . GLU A 1 12  ? 6.887   4.326   -14.276 1.00 0.00 ? 12  GLU A HG2  2  
ATOM 3709  H HG3  . GLU A 1 12  ? 6.129   5.918   -14.207 1.00 0.00 ? 12  GLU A HG3  2  
ATOM 3710  N N    . LYS A 1 13  ? 6.416   8.296   -12.806 1.00 0.00 ? 13  LYS A N    2  
ATOM 3711  C CA   . LYS A 1 13  ? 5.887   8.802   -11.508 1.00 0.00 ? 13  LYS A CA   2  
ATOM 3712  C C    . LYS A 1 13  ? 4.903   7.787   -10.925 1.00 0.00 ? 13  LYS A C    2  
ATOM 3713  O O    . LYS A 1 13  ? 4.680   7.742   -9.731  1.00 0.00 ? 13  LYS A O    2  
ATOM 3714  C CB   . LYS A 1 13  ? 5.172   10.137  -11.734 1.00 0.00 ? 13  LYS A CB   2  
ATOM 3715  C CG   . LYS A 1 13  ? 6.154   11.146  -12.333 1.00 0.00 ? 13  LYS A CG   2  
ATOM 3716  C CD   . LYS A 1 13  ? 5.730   12.564  -11.945 1.00 0.00 ? 13  LYS A CD   2  
ATOM 3717  C CE   . LYS A 1 13  ? 6.276   13.558  -12.972 1.00 0.00 ? 13  LYS A CE   2  
ATOM 3718  N NZ   . LYS A 1 13  ? 7.718   13.814  -12.696 1.00 0.00 ? 13  LYS A NZ   2  
ATOM 3719  H H    . LYS A 1 13  ? 5.813   8.184   -13.570 1.00 0.00 ? 13  LYS A H    2  
ATOM 3720  H HA   . LYS A 1 13  ? 6.706   8.947   -10.818 1.00 0.00 ? 13  LYS A HA   2  
ATOM 3721  H HB2  . LYS A 1 13  ? 4.344   9.990   -12.413 1.00 0.00 ? 13  LYS A HB2  2  
ATOM 3722  H HB3  . LYS A 1 13  ? 4.804   10.512  -10.792 1.00 0.00 ? 13  LYS A HB3  2  
ATOM 3723  H HG2  . LYS A 1 13  ? 7.147   10.948  -11.956 1.00 0.00 ? 13  LYS A HG2  2  
ATOM 3724  H HG3  . LYS A 1 13  ? 6.153   11.054  -13.409 1.00 0.00 ? 13  LYS A HG3  2  
ATOM 3725  H HD2  . LYS A 1 13  ? 4.652   12.624  -11.921 1.00 0.00 ? 13  LYS A HD2  2  
ATOM 3726  H HD3  . LYS A 1 13  ? 6.126   12.803  -10.969 1.00 0.00 ? 13  LYS A HD3  2  
ATOM 3727  H HE2  . LYS A 1 13  ? 6.166   13.149  -13.964 1.00 0.00 ? 13  LYS A HE2  2  
ATOM 3728  H HE3  . LYS A 1 13  ? 5.727   14.486  -12.902 1.00 0.00 ? 13  LYS A HE3  2  
ATOM 3729  H HZ1  . LYS A 1 13  ? 7.837   14.090  -11.699 1.00 0.00 ? 13  LYS A HZ1  2  
ATOM 3730  H HZ2  . LYS A 1 13  ? 8.266   12.951  -12.885 1.00 0.00 ? 13  LYS A HZ2  2  
ATOM 3731  H HZ3  . LYS A 1 13  ? 8.059   14.580  -13.312 1.00 0.00 ? 13  LYS A HZ3  2  
ATOM 3732  N N    . ASN A 1 14  ? 4.312   6.972   -11.755 1.00 0.00 ? 14  ASN A N    2  
ATOM 3733  C CA   . ASN A 1 14  ? 3.345   5.960   -11.244 1.00 0.00 ? 14  ASN A CA   2  
ATOM 3734  C C    . ASN A 1 14  ? 3.995   5.166   -10.108 1.00 0.00 ? 14  ASN A C    2  
ATOM 3735  O O    . ASN A 1 14  ? 5.104   5.448   -9.701  1.00 0.00 ? 14  ASN A O    2  
ATOM 3736  C CB   . ASN A 1 14  ? 2.958   5.004   -12.375 1.00 0.00 ? 14  ASN A CB   2  
ATOM 3737  C CG   . ASN A 1 14  ? 2.613   5.808   -13.630 1.00 0.00 ? 14  ASN A CG   2  
ATOM 3738  O OD1  . ASN A 1 14  ? 1.654   6.555   -13.644 1.00 0.00 ? 14  ASN A OD1  2  
ATOM 3739  N ND2  . ASN A 1 14  ? 3.360   5.686   -14.693 1.00 0.00 ? 14  ASN A ND2  2  
ATOM 3740  H H    . ASN A 1 14  ? 4.506   7.023   -12.715 1.00 0.00 ? 14  ASN A H    2  
ATOM 3741  H HA   . ASN A 1 14  ? 2.461   6.460   -10.876 1.00 0.00 ? 14  ASN A HA   2  
ATOM 3742  H HB2  . ASN A 1 14  ? 3.785   4.343   -12.586 1.00 0.00 ? 14  ASN A HB2  2  
ATOM 3743  H HB3  . ASN A 1 14  ? 2.098   4.422   -12.076 1.00 0.00 ? 14  ASN A HB3  2  
ATOM 3744  H HD21 . ASN A 1 14  ? 4.133   5.084   -14.682 1.00 0.00 ? 14  ASN A HD21 2  
ATOM 3745  H HD22 . ASN A 1 14  ? 3.147   6.196   -15.502 1.00 0.00 ? 14  ASN A HD22 2  
ATOM 3746  N N    . CYS A 1 15  ? 3.318   4.173   -9.598  1.00 0.00 ? 15  CYS A N    2  
ATOM 3747  C CA   . CYS A 1 15  ? 3.905   3.363   -8.493  1.00 0.00 ? 15  CYS A CA   2  
ATOM 3748  C C    . CYS A 1 15  ? 5.352   3.028   -8.844  1.00 0.00 ? 15  CYS A C    2  
ATOM 3749  O O    . CYS A 1 15  ? 5.628   2.080   -9.552  1.00 0.00 ? 15  CYS A O    2  
ATOM 3750  C CB   . CYS A 1 15  ? 3.095   2.073   -8.324  1.00 0.00 ? 15  CYS A CB   2  
ATOM 3751  S SG   . CYS A 1 15  ? 4.017   0.871   -7.326  1.00 0.00 ? 15  CYS A SG   2  
ATOM 3752  H H    . CYS A 1 15  ? 2.426   3.959   -9.942  1.00 0.00 ? 15  CYS A H    2  
ATOM 3753  H HA   . CYS A 1 15  ? 3.878   3.931   -7.574  1.00 0.00 ? 15  CYS A HA   2  
ATOM 3754  H HB2  . CYS A 1 15  ? 2.163   2.301   -7.838  1.00 0.00 ? 15  CYS A HB2  2  
ATOM 3755  H HB3  . CYS A 1 15  ? 2.894   1.650   -9.296  1.00 0.00 ? 15  CYS A HB3  2  
ATOM 3756  N N    . CYS A 1 16  ? 6.279   3.806   -8.363  1.00 0.00 ? 16  CYS A N    2  
ATOM 3757  C CA   . CYS A 1 16  ? 7.704   3.540   -8.679  1.00 0.00 ? 16  CYS A CA   2  
ATOM 3758  C C    . CYS A 1 16  ? 8.521   3.525   -7.386  1.00 0.00 ? 16  CYS A C    2  
ATOM 3759  O O    . CYS A 1 16  ? 8.362   4.368   -6.521  1.00 0.00 ? 16  CYS A O    2  
ATOM 3760  C CB   . CYS A 1 16  ? 8.225   4.641   -9.612  1.00 0.00 ? 16  CYS A CB   2  
ATOM 3761  S SG   . CYS A 1 16  ? 10.035  4.600   -9.683  1.00 0.00 ? 16  CYS A SG   2  
ATOM 3762  H H    . CYS A 1 16  ? 6.034   4.571   -7.801  1.00 0.00 ? 16  CYS A H    2  
ATOM 3763  H HA   . CYS A 1 16  ? 7.791   2.582   -9.171  1.00 0.00 ? 16  CYS A HA   2  
ATOM 3764  H HB2  . CYS A 1 16  ? 7.825   4.488   -10.604 1.00 0.00 ? 16  CYS A HB2  2  
ATOM 3765  H HB3  . CYS A 1 16  ? 7.903   5.604   -9.243  1.00 0.00 ? 16  CYS A HB3  2  
ATOM 3766  N N    . VAL A 1 17  ? 9.403   2.574   -7.256  1.00 0.00 ? 17  VAL A N    2  
ATOM 3767  C CA   . VAL A 1 17  ? 10.248  2.500   -6.039  1.00 0.00 ? 17  VAL A CA   2  
ATOM 3768  C C    . VAL A 1 17  ? 11.419  3.470   -6.207  1.00 0.00 ? 17  VAL A C    2  
ATOM 3769  O O    . VAL A 1 17  ? 12.414  3.166   -6.835  1.00 0.00 ? 17  VAL A O    2  
ATOM 3770  C CB   . VAL A 1 17  ? 10.763  1.069   -5.873  1.00 0.00 ? 17  VAL A CB   2  
ATOM 3771  C CG1  . VAL A 1 17  ? 11.737  0.736   -6.995  1.00 0.00 ? 17  VAL A CG1  2  
ATOM 3772  C CG2  . VAL A 1 17  ? 11.476  0.928   -4.530  1.00 0.00 ? 17  VAL A CG2  2  
ATOM 3773  H H    . VAL A 1 17  ? 9.515   1.911   -7.968  1.00 0.00 ? 17  VAL A H    2  
ATOM 3774  H HA   . VAL A 1 17  ? 9.665   2.780   -5.174  1.00 0.00 ? 17  VAL A HA   2  
ATOM 3775  H HB   . VAL A 1 17  ? 9.933   0.385   -5.916  1.00 0.00 ? 17  VAL A HB   2  
ATOM 3776  H HG11 . VAL A 1 17  ? 11.418  1.222   -7.903  1.00 0.00 ? 17  VAL A HG11 2  
ATOM 3777  H HG12 . VAL A 1 17  ? 12.724  1.082   -6.726  1.00 0.00 ? 17  VAL A HG12 2  
ATOM 3778  H HG13 . VAL A 1 17  ? 11.759  -0.333  -7.146  1.00 0.00 ? 17  VAL A HG13 2  
ATOM 3779  H HG21 . VAL A 1 17  ? 10.811  1.235   -3.737  1.00 0.00 ? 17  VAL A HG21 2  
ATOM 3780  H HG22 . VAL A 1 17  ? 11.763  -0.103  -4.383  1.00 0.00 ? 17  VAL A HG22 2  
ATOM 3781  H HG23 . VAL A 1 17  ? 12.357  1.552   -4.525  1.00 0.00 ? 17  VAL A HG23 2  
ATOM 3782  N N    . ARG A 1 18  ? 11.302  4.652   -5.672  1.00 0.00 ? 18  ARG A N    2  
ATOM 3783  C CA   . ARG A 1 18  ? 12.402  5.645   -5.829  1.00 0.00 ? 18  ARG A CA   2  
ATOM 3784  C C    . ARG A 1 18  ? 13.470  5.427   -4.754  1.00 0.00 ? 18  ARG A C    2  
ATOM 3785  O O    . ARG A 1 18  ? 13.219  4.841   -3.718  1.00 0.00 ? 18  ARG A O    2  
ATOM 3786  C CB   . ARG A 1 18  ? 11.829  7.059   -5.715  1.00 0.00 ? 18  ARG A CB   2  
ATOM 3787  C CG   . ARG A 1 18  ? 10.944  7.350   -6.927  1.00 0.00 ? 18  ARG A CG   2  
ATOM 3788  C CD   . ARG A 1 18  ? 10.274  8.714   -6.755  1.00 0.00 ? 18  ARG A CD   2  
ATOM 3789  N NE   . ARG A 1 18  ? 8.803   8.572   -6.937  1.00 0.00 ? 18  ARG A NE   2  
ATOM 3790  C CZ   . ARG A 1 18  ? 8.234   9.018   -8.024  1.00 0.00 ? 18  ARG A CZ   2  
ATOM 3791  N NH1  . ARG A 1 18  ? 8.926   9.122   -9.125  1.00 0.00 ? 18  ARG A NH1  2  
ATOM 3792  N NH2  . ARG A 1 18  ? 6.974   9.358   -8.009  1.00 0.00 ? 18  ARG A NH2  2  
ATOM 3793  H H    . ARG A 1 18  ? 10.486  4.891   -5.181  1.00 0.00 ? 18  ARG A H    2  
ATOM 3794  H HA   . ARG A 1 18  ? 12.852  5.522   -6.803  1.00 0.00 ? 18  ARG A HA   2  
ATOM 3795  H HB2  . ARG A 1 18  ? 11.240  7.138   -4.815  1.00 0.00 ? 18  ARG A HB2  2  
ATOM 3796  H HB3  . ARG A 1 18  ? 12.638  7.775   -5.682  1.00 0.00 ? 18  ARG A HB3  2  
ATOM 3797  H HG2  . ARG A 1 18  ? 11.548  7.354   -7.822  1.00 0.00 ? 18  ARG A HG2  2  
ATOM 3798  H HG3  . ARG A 1 18  ? 10.185  6.586   -7.008  1.00 0.00 ? 18  ARG A HG3  2  
ATOM 3799  H HD2  . ARG A 1 18  ? 10.479  9.094   -5.764  1.00 0.00 ? 18  ARG A HD2  2  
ATOM 3800  H HD3  . ARG A 1 18  ? 10.663  9.401   -7.491  1.00 0.00 ? 18  ARG A HD3  2  
ATOM 3801  H HE   . ARG A 1 18  ? 8.261   8.143   -6.241  1.00 0.00 ? 18  ARG A HE   2  
ATOM 3802  H HH11 . ARG A 1 18  ? 9.892   8.860   -9.135  1.00 0.00 ? 18  ARG A HH11 2  
ATOM 3803  H HH12 . ARG A 1 18  ? 8.492   9.466   -9.958  1.00 0.00 ? 18  ARG A HH12 2  
ATOM 3804  H HH21 . ARG A 1 18  ? 6.444   9.277   -7.165  1.00 0.00 ? 18  ARG A HH21 2  
ATOM 3805  H HH22 . ARG A 1 18  ? 6.539   9.701   -8.842  1.00 0.00 ? 18  ARG A HH22 2  
ATOM 3806  N N    . GLN A 1 19  ? 14.665  5.898   -5.001  1.00 0.00 ? 19  GLN A N    2  
ATOM 3807  C CA   . GLN A 1 19  ? 15.764  5.727   -4.007  1.00 0.00 ? 19  GLN A CA   2  
ATOM 3808  C C    . GLN A 1 19  ? 15.350  6.350   -2.677  1.00 0.00 ? 19  GLN A C    2  
ATOM 3809  O O    . GLN A 1 19  ? 14.501  7.219   -2.622  1.00 0.00 ? 19  GLN A O    2  
ATOM 3810  C CB   . GLN A 1 19  ? 17.027  6.422   -4.523  1.00 0.00 ? 19  GLN A CB   2  
ATOM 3811  C CG   . GLN A 1 19  ? 16.820  7.937   -4.505  1.00 0.00 ? 19  GLN A CG   2  
ATOM 3812  C CD   . GLN A 1 19  ? 17.851  8.603   -5.419  1.00 0.00 ? 19  GLN A CD   2  
ATOM 3813  O OE1  . GLN A 1 19  ? 18.816  9.174   -4.950  1.00 0.00 ? 19  GLN A OE1  2  
ATOM 3814  N NE2  . GLN A 1 19  ? 17.686  8.556   -6.712  1.00 0.00 ? 19  GLN A NE2  2  
ATOM 3815  H H    . GLN A 1 19  ? 14.839  6.363   -5.845  1.00 0.00 ? 19  GLN A H    2  
ATOM 3816  H HA   . GLN A 1 19  ? 15.966  4.678   -3.861  1.00 0.00 ? 19  GLN A HA   2  
ATOM 3817  H HB2  . GLN A 1 19  ? 17.863  6.164   -3.888  1.00 0.00 ? 19  GLN A HB2  2  
ATOM 3818  H HB3  . GLN A 1 19  ? 17.228  6.099   -5.533  1.00 0.00 ? 19  GLN A HB3  2  
ATOM 3819  H HG2  . GLN A 1 19  ? 15.824  8.168   -4.854  1.00 0.00 ? 19  GLN A HG2  2  
ATOM 3820  H HG3  . GLN A 1 19  ? 16.943  8.306   -3.498  1.00 0.00 ? 19  GLN A HG3  2  
ATOM 3821  H HE21 . GLN A 1 19  ? 16.907  8.096   -7.090  1.00 0.00 ? 19  GLN A HE21 2  
ATOM 3822  H HE22 . GLN A 1 19  ? 18.340  8.980   -7.306  1.00 0.00 ? 19  GLN A HE22 2  
ATOM 3823  N N    . LEU A 1 20  ? 15.942  5.913   -1.604  1.00 0.00 ? 20  LEU A N    2  
ATOM 3824  C CA   . LEU A 1 20  ? 15.581  6.476   -0.276  1.00 0.00 ? 20  LEU A CA   2  
ATOM 3825  C C    . LEU A 1 20  ? 16.589  6.010   0.764   1.00 0.00 ? 20  LEU A C    2  
ATOM 3826  O O    . LEU A 1 20  ? 16.229  5.617   1.854   1.00 0.00 ? 20  LEU A O    2  
ATOM 3827  C CB   . LEU A 1 20  ? 14.188  5.992   0.114   1.00 0.00 ? 20  LEU A CB   2  
ATOM 3828  C CG   . LEU A 1 20  ? 13.708  6.730   1.364   1.00 0.00 ? 20  LEU A CG   2  
ATOM 3829  C CD1  . LEU A 1 20  ? 13.538  8.216   1.048   1.00 0.00 ? 20  LEU A CD1  2  
ATOM 3830  C CD2  . LEU A 1 20  ? 12.365  6.145   1.806   1.00 0.00 ? 20  LEU A CD2  2  
ATOM 3831  H H    . LEU A 1 20  ? 16.622  5.210   -1.669  1.00 0.00 ? 20  LEU A H    2  
ATOM 3832  H HA   . LEU A 1 20  ? 15.587  7.554   -0.328  1.00 0.00 ? 20  LEU A HA   2  
ATOM 3833  H HB2  . LEU A 1 20  ? 13.511  6.188   -0.697  1.00 0.00 ? 20  LEU A HB2  2  
ATOM 3834  H HB3  . LEU A 1 20  ? 14.217  4.931   0.313   1.00 0.00 ? 20  LEU A HB3  2  
ATOM 3835  H HG   . LEU A 1 20  ? 14.430  6.612   2.157   1.00 0.00 ? 20  LEU A HG   2  
ATOM 3836  H HD11 . LEU A 1 20  ? 13.394  8.344   -0.015  1.00 0.00 ? 20  LEU A HD11 2  
ATOM 3837  H HD12 . LEU A 1 20  ? 12.678  8.601   1.576   1.00 0.00 ? 20  LEU A HD12 2  
ATOM 3838  H HD13 . LEU A 1 20  ? 14.422  8.753   1.359   1.00 0.00 ? 20  LEU A HD13 2  
ATOM 3839  H HD21 . LEU A 1 20  ? 11.644  6.257   1.008   1.00 0.00 ? 20  LEU A HD21 2  
ATOM 3840  H HD22 . LEU A 1 20  ? 12.486  5.097   2.037   1.00 0.00 ? 20  LEU A HD22 2  
ATOM 3841  H HD23 . LEU A 1 20  ? 12.015  6.670   2.682   1.00 0.00 ? 20  LEU A HD23 2  
ATOM 3842  N N    . TYR A 1 21  ? 17.852  6.046   0.442   1.00 0.00 ? 21  TYR A N    2  
ATOM 3843  C CA   . TYR A 1 21  ? 18.867  5.602   1.434   1.00 0.00 ? 21  TYR A CA   2  
ATOM 3844  C C    . TYR A 1 21  ? 18.520  6.206   2.793   1.00 0.00 ? 21  TYR A C    2  
ATOM 3845  O O    . TYR A 1 21  ? 18.226  7.379   2.903   1.00 0.00 ? 21  TYR A O    2  
ATOM 3846  C CB   . TYR A 1 21  ? 20.260  6.074   1.019   1.00 0.00 ? 21  TYR A CB   2  
ATOM 3847  C CG   . TYR A 1 21  ? 21.241  5.692   2.100   1.00 0.00 ? 21  TYR A CG   2  
ATOM 3848  C CD1  . TYR A 1 21  ? 21.270  6.406   3.305   1.00 0.00 ? 21  TYR A CD1  2  
ATOM 3849  C CD2  . TYR A 1 21  ? 22.119  4.621   1.900   1.00 0.00 ? 21  TYR A CD2  2  
ATOM 3850  C CE1  . TYR A 1 21  ? 22.176  6.047   4.311   1.00 0.00 ? 21  TYR A CE1  2  
ATOM 3851  C CE2  . TYR A 1 21  ? 23.025  4.261   2.904   1.00 0.00 ? 21  TYR A CE2  2  
ATOM 3852  C CZ   . TYR A 1 21  ? 23.055  4.975   4.110   1.00 0.00 ? 21  TYR A CZ   2  
ATOM 3853  O OH   . TYR A 1 21  ? 23.948  4.621   5.100   1.00 0.00 ? 21  TYR A OH   2  
ATOM 3854  H H    . TYR A 1 21  ? 18.126  6.362   -0.446  1.00 0.00 ? 21  TYR A H    2  
ATOM 3855  H HA   . TYR A 1 21  ? 18.857  4.524   1.505   1.00 0.00 ? 21  TYR A HA   2  
ATOM 3856  H HB2  . TYR A 1 21  ? 20.541  5.602   0.089   1.00 0.00 ? 21  TYR A HB2  2  
ATOM 3857  H HB3  . TYR A 1 21  ? 20.257  7.146   0.896   1.00 0.00 ? 21  TYR A HB3  2  
ATOM 3858  H HD1  . TYR A 1 21  ? 20.591  7.232   3.459   1.00 0.00 ? 21  TYR A HD1  2  
ATOM 3859  H HD2  . TYR A 1 21  ? 22.093  4.069   0.972   1.00 0.00 ? 21  TYR A HD2  2  
ATOM 3860  H HE1  . TYR A 1 21  ? 22.197  6.598   5.244   1.00 0.00 ? 21  TYR A HE1  2  
ATOM 3861  H HE2  . TYR A 1 21  ? 23.702  3.435   2.747   1.00 0.00 ? 21  TYR A HE2  2  
ATOM 3862  H HH   . TYR A 1 21  ? 24.732  4.261   4.677   1.00 0.00 ? 21  TYR A HH   2  
ATOM 3863  N N    . ILE A 1 22  ? 18.540  5.417   3.825   1.00 0.00 ? 22  ILE A N    2  
ATOM 3864  C CA   . ILE A 1 22  ? 18.196  5.953   5.167   1.00 0.00 ? 22  ILE A CA   2  
ATOM 3865  C C    . ILE A 1 22  ? 19.376  5.769   6.116   1.00 0.00 ? 22  ILE A C    2  
ATOM 3866  O O    . ILE A 1 22  ? 19.756  4.662   6.444   1.00 0.00 ? 22  ILE A O    2  
ATOM 3867  C CB   . ILE A 1 22  ? 16.986  5.201   5.724   1.00 0.00 ? 22  ILE A CB   2  
ATOM 3868  C CG1  . ILE A 1 22  ? 15.758  5.490   4.858   1.00 0.00 ? 22  ILE A CG1  2  
ATOM 3869  C CG2  . ILE A 1 22  ? 16.714  5.660   7.157   1.00 0.00 ? 22  ILE A CG2  2  
ATOM 3870  C CD1  . ILE A 1 22  ? 14.534  4.798   5.462   1.00 0.00 ? 22  ILE A CD1  2  
ATOM 3871  H H    . ILE A 1 22  ? 18.772  4.473   3.717   1.00 0.00 ? 22  ILE A H    2  
ATOM 3872  H HA   . ILE A 1 22  ? 17.959  7.003   5.086   1.00 0.00 ? 22  ILE A HA   2  
ATOM 3873  H HB   . ILE A 1 22  ? 17.189  4.140   5.720   1.00 0.00 ? 22  ILE A HB   2  
ATOM 3874  H HG12 . ILE A 1 22  ? 15.588  6.556   4.818   1.00 0.00 ? 22  ILE A HG12 2  
ATOM 3875  H HG13 . ILE A 1 22  ? 15.925  5.114   3.861   1.00 0.00 ? 22  ILE A HG13 2  
ATOM 3876  H HG21 . ILE A 1 22  ? 17.553  6.240   7.515   1.00 0.00 ? 22  ILE A HG21 2  
ATOM 3877  H HG22 . ILE A 1 22  ? 15.822  6.268   7.179   1.00 0.00 ? 22  ILE A HG22 2  
ATOM 3878  H HG23 . ILE A 1 22  ? 16.577  4.798   7.792   1.00 0.00 ? 22  ILE A HG23 2  
ATOM 3879  H HD11 . ILE A 1 22  ? 14.652  4.728   6.532   1.00 0.00 ? 22  ILE A HD11 2  
ATOM 3880  H HD12 . ILE A 1 22  ? 13.648  5.371   5.234   1.00 0.00 ? 22  ILE A HD12 2  
ATOM 3881  H HD13 . ILE A 1 22  ? 14.439  3.806   5.044   1.00 0.00 ? 22  ILE A HD13 2  
ATOM 3882  N N    . ASP A 1 23  ? 19.945  6.844   6.584   1.00 0.00 ? 23  ASP A N    2  
ATOM 3883  C CA   . ASP A 1 23  ? 21.078  6.721   7.535   1.00 0.00 ? 23  ASP A CA   2  
ATOM 3884  C C    . ASP A 1 23  ? 20.491  6.535   8.928   1.00 0.00 ? 23  ASP A C    2  
ATOM 3885  O O    . ASP A 1 23  ? 20.164  7.485   9.601   1.00 0.00 ? 23  ASP A O    2  
ATOM 3886  C CB   . ASP A 1 23  ? 21.944  7.980   7.480   1.00 0.00 ? 23  ASP A CB   2  
ATOM 3887  C CG   . ASP A 1 23  ? 22.946  7.970   8.637   1.00 0.00 ? 23  ASP A CG   2  
ATOM 3888  O OD1  . ASP A 1 23  ? 22.970  6.993   9.368   1.00 0.00 ? 23  ASP A OD1  2  
ATOM 3889  O OD2  . ASP A 1 23  ? 23.675  8.940   8.771   1.00 0.00 ? 23  ASP A OD2  2  
ATOM 3890  H H    . ASP A 1 23  ? 19.613  7.730   6.326   1.00 0.00 ? 23  ASP A H    2  
ATOM 3891  H HA   . ASP A 1 23  ? 21.674  5.860   7.283   1.00 0.00 ? 23  ASP A HA   2  
ATOM 3892  H HB2  . ASP A 1 23  ? 22.480  8.004   6.542   1.00 0.00 ? 23  ASP A HB2  2  
ATOM 3893  H HB3  . ASP A 1 23  ? 21.316  8.848   7.555   1.00 0.00 ? 23  ASP A HB3  2  
ATOM 3894  N N    . PHE A 1 24  ? 20.337  5.298   9.326   1.00 0.00 ? 24  PHE A N    2  
ATOM 3895  C CA   . PHE A 1 24  ? 19.747  4.948   10.659  1.00 0.00 ? 24  PHE A CA   2  
ATOM 3896  C C    . PHE A 1 24  ? 19.584  6.168   11.572  1.00 0.00 ? 24  PHE A C    2  
ATOM 3897  O O    . PHE A 1 24  ? 18.495  6.480   12.009  1.00 0.00 ? 24  PHE A O    2  
ATOM 3898  C CB   . PHE A 1 24  ? 20.657  3.930   11.350  1.00 0.00 ? 24  PHE A CB   2  
ATOM 3899  C CG   . PHE A 1 24  ? 20.273  2.539   10.908  1.00 0.00 ? 24  PHE A CG   2  
ATOM 3900  C CD1  . PHE A 1 24  ? 19.035  2.006   11.283  1.00 0.00 ? 24  PHE A CD1  2  
ATOM 3901  C CD2  . PHE A 1 24  ? 21.150  1.786   10.120  1.00 0.00 ? 24  PHE A CD2  2  
ATOM 3902  C CE1  . PHE A 1 24  ? 18.673  0.719   10.870  1.00 0.00 ? 24  PHE A CE1  2  
ATOM 3903  C CE2  . PHE A 1 24  ? 20.788  0.497   9.708   1.00 0.00 ? 24  PHE A CE2  2  
ATOM 3904  C CZ   . PHE A 1 24  ? 19.550  -0.035  10.082  1.00 0.00 ? 24  PHE A CZ   2  
ATOM 3905  H H    . PHE A 1 24  ? 20.602  4.574   8.722   1.00 0.00 ? 24  PHE A H    2  
ATOM 3906  H HA   . PHE A 1 24  ? 18.780  4.495   10.505  1.00 0.00 ? 24  PHE A HA   2  
ATOM 3907  H HB2  . PHE A 1 24  ? 21.685  4.123   11.080  1.00 0.00 ? 24  PHE A HB2  2  
ATOM 3908  H HB3  . PHE A 1 24  ? 20.543  4.012   12.421  1.00 0.00 ? 24  PHE A HB3  2  
ATOM 3909  H HD1  . PHE A 1 24  ? 18.360  2.586   11.892  1.00 0.00 ? 24  PHE A HD1  2  
ATOM 3910  H HD2  . PHE A 1 24  ? 22.106  2.197   9.830   1.00 0.00 ? 24  PHE A HD2  2  
ATOM 3911  H HE1  . PHE A 1 24  ? 17.718  0.308   11.158  1.00 0.00 ? 24  PHE A HE1  2  
ATOM 3912  H HE2  . PHE A 1 24  ? 21.463  -0.086  9.102   1.00 0.00 ? 24  PHE A HE2  2  
ATOM 3913  H HZ   . PHE A 1 24  ? 19.271  -1.026  9.762   1.00 0.00 ? 24  PHE A HZ   2  
ATOM 3914  N N    . ARG A 1 25  ? 20.654  6.845   11.883  1.00 0.00 ? 25  ARG A N    2  
ATOM 3915  C CA   . ARG A 1 25  ? 20.555  8.016   12.801  1.00 0.00 ? 25  ARG A CA   2  
ATOM 3916  C C    . ARG A 1 25  ? 20.164  9.298   12.053  1.00 0.00 ? 25  ARG A C    2  
ATOM 3917  O O    . ARG A 1 25  ? 19.400  10.101  12.550  1.00 0.00 ? 25  ARG A O    2  
ATOM 3918  C CB   . ARG A 1 25  ? 21.908  8.230   13.483  1.00 0.00 ? 25  ARG A CB   2  
ATOM 3919  C CG   . ARG A 1 25  ? 21.877  9.527   14.294  1.00 0.00 ? 25  ARG A CG   2  
ATOM 3920  C CD   . ARG A 1 25  ? 23.297  9.890   14.727  1.00 0.00 ? 25  ARG A CD   2  
ATOM 3921  N NE   . ARG A 1 25  ? 24.250  9.547   13.633  1.00 0.00 ? 25  ARG A NE   2  
ATOM 3922  C CZ   . ARG A 1 25  ? 24.770  10.493  12.900  1.00 0.00 ? 25  ARG A CZ   2  
ATOM 3923  N NH1  . ARG A 1 25  ? 25.399  11.486  13.467  1.00 0.00 ? 25  ARG A NH1  2  
ATOM 3924  N NH2  . ARG A 1 25  ? 24.661  10.446  11.601  1.00 0.00 ? 25  ARG A NH2  2  
ATOM 3925  H H    . ARG A 1 25  ? 21.527  6.567   11.535  1.00 0.00 ? 25  ARG A H    2  
ATOM 3926  H HA   . ARG A 1 25  ? 19.814  7.807   13.556  1.00 0.00 ? 25  ARG A HA   2  
ATOM 3927  H HB2  . ARG A 1 25  ? 22.113  7.399   14.142  1.00 0.00 ? 25  ARG A HB2  2  
ATOM 3928  H HB3  . ARG A 1 25  ? 22.681  8.295   12.733  1.00 0.00 ? 25  ARG A HB3  2  
ATOM 3929  H HG2  . ARG A 1 25  ? 21.470  10.323  13.687  1.00 0.00 ? 25  ARG A HG2  2  
ATOM 3930  H HG3  . ARG A 1 25  ? 21.260  9.391   15.169  1.00 0.00 ? 25  ARG A HG3  2  
ATOM 3931  H HD2  . ARG A 1 25  ? 23.352  10.949  14.933  1.00 0.00 ? 25  ARG A HD2  2  
ATOM 3932  H HD3  . ARG A 1 25  ? 23.556  9.334   15.616  1.00 0.00 ? 25  ARG A HD3  2  
ATOM 3933  H HE   . ARG A 1 25  ? 24.485  8.611   13.463  1.00 0.00 ? 25  ARG A HE   2  
ATOM 3934  H HH11 . ARG A 1 25  ? 25.483  11.521  14.463  1.00 0.00 ? 25  ARG A HH11 2  
ATOM 3935  H HH12 . ARG A 1 25  ? 25.798  12.211  12.906  1.00 0.00 ? 25  ARG A HH12 2  
ATOM 3936  H HH21 . ARG A 1 25  ? 24.178  9.686   11.166  1.00 0.00 ? 25  ARG A HH21 2  
ATOM 3937  H HH22 . ARG A 1 25  ? 25.059  11.172  11.040  1.00 0.00 ? 25  ARG A HH22 2  
ATOM 3938  N N    . LYS A 1 26  ? 20.700  9.524   10.887  1.00 0.00 ? 26  LYS A N    2  
ATOM 3939  C CA   . LYS A 1 26  ? 20.370  10.784  10.155  1.00 0.00 ? 26  LYS A CA   2  
ATOM 3940  C C    . LYS A 1 26  ? 18.875  10.858  9.845   1.00 0.00 ? 26  LYS A C    2  
ATOM 3941  O O    . LYS A 1 26  ? 18.239  11.877  10.033  1.00 0.00 ? 26  LYS A O    2  
ATOM 3942  C CB   . LYS A 1 26  ? 21.135  10.819  8.837   1.00 0.00 ? 26  LYS A CB   2  
ATOM 3943  C CG   . LYS A 1 26  ? 21.476  12.267  8.479   1.00 0.00 ? 26  LYS A CG   2  
ATOM 3944  C CD   . LYS A 1 26  ? 22.992  12.462  8.531   1.00 0.00 ? 26  LYS A CD   2  
ATOM 3945  C CE   . LYS A 1 26  ? 23.432  13.368  7.379   1.00 0.00 ? 26  LYS A CE   2  
ATOM 3946  N NZ   . LYS A 1 26  ? 24.222  14.510  7.918   1.00 0.00 ? 26  LYS A NZ   2  
ATOM 3947  H H    . LYS A 1 26  ? 21.339  8.884   10.501  1.00 0.00 ? 26  LYS A H    2  
ATOM 3948  H HA   . LYS A 1 26  ? 20.655  11.635  10.755  1.00 0.00 ? 26  LYS A HA   2  
ATOM 3949  H HB2  . LYS A 1 26  ? 22.036  10.239  8.929   1.00 0.00 ? 26  LYS A HB2  2  
ATOM 3950  H HB3  . LYS A 1 26  ? 20.516  10.400  8.058   1.00 0.00 ? 26  LYS A HB3  2  
ATOM 3951  H HG2  . LYS A 1 26  ? 21.117  12.486  7.483   1.00 0.00 ? 26  LYS A HG2  2  
ATOM 3952  H HG3  . LYS A 1 26  ? 21.005  12.932  9.187   1.00 0.00 ? 26  LYS A HG3  2  
ATOM 3953  H HD2  . LYS A 1 26  ? 23.265  12.918  9.473   1.00 0.00 ? 26  LYS A HD2  2  
ATOM 3954  H HD3  . LYS A 1 26  ? 23.482  11.504  8.440   1.00 0.00 ? 26  LYS A HD3  2  
ATOM 3955  H HE2  . LYS A 1 26  ? 24.042  12.802  6.690   1.00 0.00 ? 26  LYS A HE2  2  
ATOM 3956  H HE3  . LYS A 1 26  ? 22.560  13.743  6.864   1.00 0.00 ? 26  LYS A HE3  2  
ATOM 3957  H HZ1  . LYS A 1 26  ? 25.015  14.148  8.484   1.00 0.00 ? 26  LYS A HZ1  2  
ATOM 3958  H HZ2  . LYS A 1 26  ? 24.590  15.080  7.129   1.00 0.00 ? 26  LYS A HZ2  2  
ATOM 3959  H HZ3  . LYS A 1 26  ? 23.613  15.102  8.518   1.00 0.00 ? 26  LYS A HZ3  2  
ATOM 3960  N N    . ASP A 1 27  ? 18.322  9.803   9.324   1.00 0.00 ? 27  ASP A N    2  
ATOM 3961  C CA   . ASP A 1 27  ? 16.886  9.821   8.944   1.00 0.00 ? 27  ASP A CA   2  
ATOM 3962  C C    . ASP A 1 27  ? 15.980  9.384   10.101  1.00 0.00 ? 27  ASP A C    2  
ATOM 3963  O O    . ASP A 1 27  ? 15.149  10.142  10.562  1.00 0.00 ? 27  ASP A O    2  
ATOM 3964  C CB   . ASP A 1 27  ? 16.701  8.874   7.766   1.00 0.00 ? 27  ASP A CB   2  
ATOM 3965  C CG   . ASP A 1 27  ? 16.890  9.649   6.463   1.00 0.00 ? 27  ASP A CG   2  
ATOM 3966  O OD1  . ASP A 1 27  ? 16.088  10.531  6.200   1.00 0.00 ? 27  ASP A OD1  2  
ATOM 3967  O OD2  . ASP A 1 27  ? 17.834  9.350   5.751   1.00 0.00 ? 27  ASP A OD2  2  
ATOM 3968  H H    . ASP A 1 27  ? 18.862  9.009   9.143   1.00 0.00 ? 27  ASP A H    2  
ATOM 3969  H HA   . ASP A 1 27  ? 16.613  10.818  8.637   1.00 0.00 ? 27  ASP A HA   2  
ATOM 3970  H HB2  . ASP A 1 27  ? 17.433  8.081   7.825   1.00 0.00 ? 27  ASP A HB2  2  
ATOM 3971  H HB3  . ASP A 1 27  ? 15.715  8.453   7.798   1.00 0.00 ? 27  ASP A HB3  2  
ATOM 3972  N N    . LEU A 1 28  ? 16.100  8.168   10.560  1.00 0.00 ? 28  LEU A N    2  
ATOM 3973  C CA   . LEU A 1 28  ? 15.202  7.708   11.664  1.00 0.00 ? 28  LEU A CA   2  
ATOM 3974  C C    . LEU A 1 28  ? 15.809  8.044   13.023  1.00 0.00 ? 28  LEU A C    2  
ATOM 3975  O O    . LEU A 1 28  ? 15.158  7.930   14.043  1.00 0.00 ? 28  LEU A O    2  
ATOM 3976  C CB   . LEU A 1 28  ? 15.012  6.192   11.577  1.00 0.00 ? 28  LEU A CB   2  
ATOM 3977  C CG   . LEU A 1 28  ? 14.509  5.809   10.188  1.00 0.00 ? 28  LEU A CG   2  
ATOM 3978  C CD1  . LEU A 1 28  ? 14.417  4.286   10.085  1.00 0.00 ? 28  LEU A CD1  2  
ATOM 3979  C CD2  . LEU A 1 28  ? 13.122  6.410   9.963   1.00 0.00 ? 28  LEU A CD2  2  
ATOM 3980  H H    . LEU A 1 28  ? 16.754  7.553   10.166  1.00 0.00 ? 28  LEU A H    2  
ATOM 3981  H HA   . LEU A 1 28  ? 14.243  8.193   11.571  1.00 0.00 ? 28  LEU A HA   2  
ATOM 3982  H HB2  . LEU A 1 28  ? 15.957  5.702   11.766  1.00 0.00 ? 28  LEU A HB2  2  
ATOM 3983  H HB3  . LEU A 1 28  ? 14.292  5.878   12.318  1.00 0.00 ? 28  LEU A HB3  2  
ATOM 3984  H HG   . LEU A 1 28  ? 15.195  6.184   9.441   1.00 0.00 ? 28  LEU A HG   2  
ATOM 3985  H HD11 . LEU A 1 28  ? 14.751  3.841   11.011  1.00 0.00 ? 28  LEU A HD11 2  
ATOM 3986  H HD12 . LEU A 1 28  ? 13.392  4.000   9.897   1.00 0.00 ? 28  LEU A HD12 2  
ATOM 3987  H HD13 . LEU A 1 28  ? 15.041  3.940   9.274   1.00 0.00 ? 28  LEU A HD13 2  
ATOM 3988  H HD21 . LEU A 1 28  ? 12.943  7.185   10.692  1.00 0.00 ? 28  LEU A HD21 2  
ATOM 3989  H HD22 . LEU A 1 28  ? 13.070  6.829   8.970   1.00 0.00 ? 28  LEU A HD22 2  
ATOM 3990  H HD23 . LEU A 1 28  ? 12.375  5.637   10.069  1.00 0.00 ? 28  LEU A HD23 2  
ATOM 3991  N N    . GLY A 1 29  ? 17.047  8.441   13.062  1.00 0.00 ? 29  GLY A N    2  
ATOM 3992  C CA   . GLY A 1 29  ? 17.667  8.757   14.378  1.00 0.00 ? 29  GLY A CA   2  
ATOM 3993  C C    . GLY A 1 29  ? 17.629  7.498   15.247  1.00 0.00 ? 29  GLY A C    2  
ATOM 3994  O O    . GLY A 1 29  ? 17.796  7.550   16.449  1.00 0.00 ? 29  GLY A O    2  
ATOM 3995  H H    . GLY A 1 29  ? 17.568  8.518   12.235  1.00 0.00 ? 29  GLY A H    2  
ATOM 3996  H HA2  . GLY A 1 29  ? 18.689  9.075   14.235  1.00 0.00 ? 29  GLY A HA2  2  
ATOM 3997  H HA3  . GLY A 1 29  ? 17.108  9.542   14.864  1.00 0.00 ? 29  GLY A HA3  2  
ATOM 3998  N N    . TRP A 1 30  ? 17.399  6.363   14.638  1.00 0.00 ? 30  TRP A N    2  
ATOM 3999  C CA   . TRP A 1 30  ? 17.336  5.090   15.406  1.00 0.00 ? 30  TRP A CA   2  
ATOM 4000  C C    . TRP A 1 30  ? 18.488  5.032   16.406  1.00 0.00 ? 30  TRP A C    2  
ATOM 4001  O O    . TRP A 1 30  ? 19.643  5.150   16.050  1.00 0.00 ? 30  TRP A O    2  
ATOM 4002  C CB   . TRP A 1 30  ? 17.444  3.911   14.438  1.00 0.00 ? 30  TRP A CB   2  
ATOM 4003  C CG   . TRP A 1 30  ? 16.084  3.560   13.927  1.00 0.00 ? 30  TRP A CG   2  
ATOM 4004  C CD1  . TRP A 1 30  ? 14.989  4.349   14.025  1.00 0.00 ? 30  TRP A CD1  2  
ATOM 4005  C CD2  . TRP A 1 30  ? 15.656  2.348   13.243  1.00 0.00 ? 30  TRP A CD2  2  
ATOM 4006  N NE1  . TRP A 1 30  ? 13.916  3.696   13.446  1.00 0.00 ? 30  TRP A NE1  2  
ATOM 4007  C CE2  . TRP A 1 30  ? 14.276  2.459   12.950  1.00 0.00 ? 30  TRP A CE2  2  
ATOM 4008  C CE3  . TRP A 1 30  ? 16.325  1.175   12.853  1.00 0.00 ? 30  TRP A CE3  2  
ATOM 4009  C CZ2  . TRP A 1 30  ? 13.584  1.441   12.293  1.00 0.00 ? 30  TRP A CZ2  2  
ATOM 4010  C CZ3  . TRP A 1 30  ? 15.631  0.147   12.193  1.00 0.00 ? 30  TRP A CZ3  2  
ATOM 4011  C CH2  . TRP A 1 30  ? 14.263  0.280   11.914  1.00 0.00 ? 30  TRP A CH2  2  
ATOM 4012  H H    . TRP A 1 30  ? 17.262  6.350   13.670  1.00 0.00 ? 30  TRP A H    2  
ATOM 4013  H HA   . TRP A 1 30  ? 16.397  5.035   15.935  1.00 0.00 ? 30  TRP A HA   2  
ATOM 4014  H HB2  . TRP A 1 30  ? 18.081  4.182   13.610  1.00 0.00 ? 30  TRP A HB2  2  
ATOM 4015  H HB3  . TRP A 1 30  ? 17.865  3.060   14.953  1.00 0.00 ? 30  TRP A HB3  2  
ATOM 4016  H HD1  . TRP A 1 30  ? 14.958  5.326   14.482  1.00 0.00 ? 30  TRP A HD1  2  
ATOM 4017  H HE1  . TRP A 1 30  ? 13.005  4.049   13.385  1.00 0.00 ? 30  TRP A HE1  2  
ATOM 4018  H HE3  . TRP A 1 30  ? 17.380  1.064   13.063  1.00 0.00 ? 30  TRP A HE3  2  
ATOM 4019  H HZ2  . TRP A 1 30  ? 12.531  1.549   12.082  1.00 0.00 ? 30  TRP A HZ2  2  
ATOM 4020  H HZ3  . TRP A 1 30  ? 16.153  -0.751  11.900  1.00 0.00 ? 30  TRP A HZ3  2  
ATOM 4021  H HH2  . TRP A 1 30  ? 13.736  -0.513  11.406  1.00 0.00 ? 30  TRP A HH2  2  
ATOM 4022  N N    . LYS A 1 31  ? 18.177  4.854   17.658  1.00 0.00 ? 31  LYS A N    2  
ATOM 4023  C CA   . LYS A 1 31  ? 19.234  4.790   18.690  1.00 0.00 ? 31  LYS A CA   2  
ATOM 4024  C C    . LYS A 1 31  ? 19.432  3.341   19.132  1.00 0.00 ? 31  LYS A C    2  
ATOM 4025  O O    . LYS A 1 31  ? 20.377  3.019   19.825  1.00 0.00 ? 31  LYS A O    2  
ATOM 4026  C CB   . LYS A 1 31  ? 18.784  5.623   19.882  1.00 0.00 ? 31  LYS A CB   2  
ATOM 4027  C CG   . LYS A 1 31  ? 19.283  7.060   19.725  1.00 0.00 ? 31  LYS A CG   2  
ATOM 4028  C CD   . LYS A 1 31  ? 18.320  8.014   20.435  1.00 0.00 ? 31  LYS A CD   2  
ATOM 4029  C CE   . LYS A 1 31  ? 18.954  9.404   20.525  1.00 0.00 ? 31  LYS A CE   2  
ATOM 4030  N NZ   . LYS A 1 31  ? 18.346  10.295  19.497  1.00 0.00 ? 31  LYS A NZ   2  
ATOM 4031  H H    . LYS A 1 31  ? 17.242  4.766   17.925  1.00 0.00 ? 31  LYS A H    2  
ATOM 4032  H HA   . LYS A 1 31  ? 20.158  5.186   18.297  1.00 0.00 ? 31  LYS A HA   2  
ATOM 4033  H HB2  . LYS A 1 31  ? 17.705  5.617   19.928  1.00 0.00 ? 31  LYS A HB2  2  
ATOM 4034  H HB3  . LYS A 1 31  ? 19.181  5.197   20.782  1.00 0.00 ? 31  LYS A HB3  2  
ATOM 4035  H HG2  . LYS A 1 31  ? 20.267  7.149   20.163  1.00 0.00 ? 31  LYS A HG2  2  
ATOM 4036  H HG3  . LYS A 1 31  ? 19.330  7.313   18.677  1.00 0.00 ? 31  LYS A HG3  2  
ATOM 4037  H HD2  . LYS A 1 31  ? 17.397  8.075   19.876  1.00 0.00 ? 31  LYS A HD2  2  
ATOM 4038  H HD3  . LYS A 1 31  ? 18.118  7.648   21.429  1.00 0.00 ? 31  LYS A HD3  2  
ATOM 4039  H HE2  . LYS A 1 31  ? 18.777  9.816   21.508  1.00 0.00 ? 31  LYS A HE2  2  
ATOM 4040  H HE3  . LYS A 1 31  ? 20.017  9.328   20.353  1.00 0.00 ? 31  LYS A HE3  2  
ATOM 4041  H HZ1  . LYS A 1 31  ? 17.372  9.988   19.303  1.00 0.00 ? 31  LYS A HZ1  2  
ATOM 4042  H HZ2  . LYS A 1 31  ? 18.335  11.274  19.847  1.00 0.00 ? 31  LYS A HZ2  2  
ATOM 4043  H HZ3  . LYS A 1 31  ? 18.907  10.246  18.622  1.00 0.00 ? 31  LYS A HZ3  2  
ATOM 4044  N N    . TRP A 1 32  ? 18.548  2.462   18.746  1.00 0.00 ? 32  TRP A N    2  
ATOM 4045  C CA   . TRP A 1 32  ? 18.695  1.040   19.162  1.00 0.00 ? 32  TRP A CA   2  
ATOM 4046  C C    . TRP A 1 32  ? 19.608  0.303   18.184  1.00 0.00 ? 32  TRP A C    2  
ATOM 4047  O O    . TRP A 1 32  ? 19.899  -0.860  18.358  1.00 0.00 ? 32  TRP A O    2  
ATOM 4048  C CB   . TRP A 1 32  ? 17.323  0.364   19.198  1.00 0.00 ? 32  TRP A CB   2  
ATOM 4049  C CG   . TRP A 1 32  ? 16.853  0.061   17.809  1.00 0.00 ? 32  TRP A CG   2  
ATOM 4050  C CD1  . TRP A 1 32  ? 16.311  0.962   16.961  1.00 0.00 ? 32  TRP A CD1  2  
ATOM 4051  C CD2  . TRP A 1 32  ? 16.869  -1.210  17.096  1.00 0.00 ? 32  TRP A CD2  2  
ATOM 4052  N NE1  . TRP A 1 32  ? 15.976  0.325   15.784  1.00 0.00 ? 32  TRP A NE1  2  
ATOM 4053  C CE2  . TRP A 1 32  ? 16.303  -1.015  15.815  1.00 0.00 ? 32  TRP A CE2  2  
ATOM 4054  C CE3  . TRP A 1 32  ? 17.313  -2.498  17.434  1.00 0.00 ? 32  TRP A CE3  2  
ATOM 4055  C CZ2  . TRP A 1 32  ? 16.176  -2.063  14.904  1.00 0.00 ? 32  TRP A CZ2  2  
ATOM 4056  C CZ3  . TRP A 1 32  ? 17.190  -3.557  16.519  1.00 0.00 ? 32  TRP A CZ3  2  
ATOM 4057  C CH2  . TRP A 1 32  ? 16.621  -3.339  15.257  1.00 0.00 ? 32  TRP A CH2  2  
ATOM 4058  H H    . TRP A 1 32  ? 17.786  2.739   18.191  1.00 0.00 ? 32  TRP A H    2  
ATOM 4059  H HA   . TRP A 1 32  ? 19.132  1.005   20.146  1.00 0.00 ? 32  TRP A HA   2  
ATOM 4060  H HB2  . TRP A 1 32  ? 17.393  -0.557  19.759  1.00 0.00 ? 32  TRP A HB2  2  
ATOM 4061  H HB3  . TRP A 1 32  ? 16.614  1.021   19.681  1.00 0.00 ? 32  TRP A HB3  2  
ATOM 4062  H HD1  . TRP A 1 32  ? 16.160  2.005   17.168  1.00 0.00 ? 32  TRP A HD1  2  
ATOM 4063  H HE1  . TRP A 1 32  ? 15.561  0.756   15.011  1.00 0.00 ? 32  TRP A HE1  2  
ATOM 4064  H HE3  . TRP A 1 32  ? 17.761  -2.673  18.396  1.00 0.00 ? 32  TRP A HE3  2  
ATOM 4065  H HZ2  . TRP A 1 32  ? 15.736  -1.889  13.933  1.00 0.00 ? 32  TRP A HZ2  2  
ATOM 4066  H HZ3  . TRP A 1 32  ? 17.535  -4.546  16.792  1.00 0.00 ? 32  TRP A HZ3  2  
ATOM 4067  H HH2  . TRP A 1 32  ? 16.527  -4.153  14.555  1.00 0.00 ? 32  TRP A HH2  2  
ATOM 4068  N N    . ILE A 1 33  ? 20.061  0.967   17.159  1.00 0.00 ? 33  ILE A N    2  
ATOM 4069  C CA   . ILE A 1 33  ? 20.953  0.291   16.180  1.00 0.00 ? 33  ILE A CA   2  
ATOM 4070  C C    . ILE A 1 33  ? 22.254  1.090   16.039  1.00 0.00 ? 33  ILE A C    2  
ATOM 4071  O O    . ILE A 1 33  ? 22.243  2.288   15.837  1.00 0.00 ? 33  ILE A O    2  
ATOM 4072  C CB   . ILE A 1 33  ? 20.237  0.190   14.826  1.00 0.00 ? 33  ILE A CB   2  
ATOM 4073  C CG1  . ILE A 1 33  ? 19.331  -1.039  14.842  1.00 0.00 ? 33  ILE A CG1  2  
ATOM 4074  C CG2  . ILE A 1 33  ? 21.254  0.049   13.690  1.00 0.00 ? 33  ILE A CG2  2  
ATOM 4075  C CD1  . ILE A 1 33  ? 18.509  -1.094  13.558  1.00 0.00 ? 33  ILE A CD1  2  
ATOM 4076  H H    . ILE A 1 33  ? 19.815  1.907   17.033  1.00 0.00 ? 33  ILE A H    2  
ATOM 4077  H HA   . ILE A 1 33  ? 21.180  -0.704  16.538  1.00 0.00 ? 33  ILE A HA   2  
ATOM 4078  H HB   . ILE A 1 33  ? 19.638  1.075   14.668  1.00 0.00 ? 33  ILE A HB   2  
ATOM 4079  H HG12 . ILE A 1 33  ? 19.936  -1.928  14.919  1.00 0.00 ? 33  ILE A HG12 2  
ATOM 4080  H HG13 . ILE A 1 33  ? 18.669  -0.983  15.689  1.00 0.00 ? 33  ILE A HG13 2  
ATOM 4081  H HG21 . ILE A 1 33  ? 22.153  -0.416  14.067  1.00 0.00 ? 33  ILE A HG21 2  
ATOM 4082  H HG22 . ILE A 1 33  ? 20.834  -0.562  12.906  1.00 0.00 ? 33  ILE A HG22 2  
ATOM 4083  H HG23 . ILE A 1 33  ? 21.492  1.026   13.297  1.00 0.00 ? 33  ILE A HG23 2  
ATOM 4084  H HD11 . ILE A 1 33  ? 19.037  -0.578  12.771  1.00 0.00 ? 33  ILE A HD11 2  
ATOM 4085  H HD12 . ILE A 1 33  ? 18.355  -2.124  13.274  1.00 0.00 ? 33  ILE A HD12 2  
ATOM 4086  H HD13 . ILE A 1 33  ? 17.555  -0.620  13.723  1.00 0.00 ? 33  ILE A HD13 2  
ATOM 4087  N N    . HIS A 1 34  ? 23.372  0.428   16.145  1.00 0.00 ? 34  HIS A N    2  
ATOM 4088  C CA   . HIS A 1 34  ? 24.679  1.134   16.021  1.00 0.00 ? 34  HIS A CA   2  
ATOM 4089  C C    . HIS A 1 34  ? 25.176  1.033   14.575  1.00 0.00 ? 34  HIS A C    2  
ATOM 4090  O O    . HIS A 1 34  ? 25.566  2.014   13.973  1.00 0.00 ? 34  HIS A O    2  
ATOM 4091  C CB   . HIS A 1 34  ? 25.694  0.481   16.965  1.00 0.00 ? 34  HIS A CB   2  
ATOM 4092  C CG   . HIS A 1 34  ? 27.090  0.904   16.593  1.00 0.00 ? 34  HIS A CG   2  
ATOM 4093  N ND1  . HIS A 1 34  ? 27.464  2.237   16.518  1.00 0.00 ? 34  HIS A ND1  2  
ATOM 4094  C CD2  . HIS A 1 34  ? 28.211  0.180   16.270  1.00 0.00 ? 34  HIS A CD2  2  
ATOM 4095  C CE1  . HIS A 1 34  ? 28.762  2.273   16.163  1.00 0.00 ? 34  HIS A CE1  2  
ATOM 4096  N NE2  . HIS A 1 34  ? 29.266  1.047   15.999  1.00 0.00 ? 34  HIS A NE2  2  
ATOM 4097  H H    . HIS A 1 34  ? 23.352  -0.536  16.310  1.00 0.00 ? 34  HIS A H    2  
ATOM 4098  H HA   . HIS A 1 34  ? 24.554  2.173   16.288  1.00 0.00 ? 34  HIS A HA   2  
ATOM 4099  H HB2  . HIS A 1 34  ? 25.486  0.784   17.980  1.00 0.00 ? 34  HIS A HB2  2  
ATOM 4100  H HB3  . HIS A 1 34  ? 25.614  -0.594  16.890  1.00 0.00 ? 34  HIS A HB3  2  
ATOM 4101  H HD1  . HIS A 1 34  ? 26.888  3.010   16.691  1.00 0.00 ? 34  HIS A HD1  2  
ATOM 4102  H HD2  . HIS A 1 34  ? 28.266  -0.898  16.233  1.00 0.00 ? 34  HIS A HD2  2  
ATOM 4103  H HE1  . HIS A 1 34  ? 29.327  3.183   16.027  1.00 0.00 ? 34  HIS A HE1  2  
ATOM 4104  N N    . GLU A 1 35  ? 25.165  -0.146  14.014  1.00 0.00 ? 35  GLU A N    2  
ATOM 4105  C CA   . GLU A 1 35  ? 25.637  -0.308  12.610  1.00 0.00 ? 35  GLU A CA   2  
ATOM 4106  C C    . GLU A 1 35  ? 24.624  -1.142  11.821  1.00 0.00 ? 35  GLU A C    2  
ATOM 4107  O O    . GLU A 1 35  ? 23.867  -1.900  12.395  1.00 0.00 ? 35  GLU A O    2  
ATOM 4108  C CB   . GLU A 1 35  ? 26.993  -1.017  12.604  1.00 0.00 ? 35  GLU A CB   2  
ATOM 4109  C CG   . GLU A 1 35  ? 28.113  0.015   12.767  1.00 0.00 ? 35  GLU A CG   2  
ATOM 4110  C CD   . GLU A 1 35  ? 29.452  -0.622  12.388  1.00 0.00 ? 35  GLU A CD   2  
ATOM 4111  O OE1  . GLU A 1 35  ? 29.869  -1.534  13.081  1.00 0.00 ? 35  GLU A OE1  2  
ATOM 4112  O OE2  . GLU A 1 35  ? 30.036  -0.185  11.411  1.00 0.00 ? 35  GLU A OE2  2  
ATOM 4113  H H    . GLU A 1 35  ? 24.847  -0.924  14.516  1.00 0.00 ? 35  GLU A H    2  
ATOM 4114  H HA   . GLU A 1 35  ? 25.738  0.665   12.150  1.00 0.00 ? 35  GLU A HA   2  
ATOM 4115  H HB2  . GLU A 1 35  ? 27.032  -1.723  13.420  1.00 0.00 ? 35  GLU A HB2  2  
ATOM 4116  H HB3  . GLU A 1 35  ? 27.122  -1.540  11.669  1.00 0.00 ? 35  GLU A HB3  2  
ATOM 4117  H HG2  . GLU A 1 35  ? 27.919  0.860   12.123  1.00 0.00 ? 35  GLU A HG2  2  
ATOM 4118  H HG3  . GLU A 1 35  ? 28.151  0.345   13.794  1.00 0.00 ? 35  GLU A HG3  2  
ATOM 4119  N N    . PRO A 1 36  ? 24.644  -0.977  10.523  1.00 0.00 ? 36  PRO A N    2  
ATOM 4120  C CA   . PRO A 1 36  ? 25.570  -0.054  9.841   1.00 0.00 ? 36  PRO A CA   2  
ATOM 4121  C C    . PRO A 1 36  ? 25.080  1.388   9.978   1.00 0.00 ? 36  PRO A C    2  
ATOM 4122  O O    . PRO A 1 36  ? 24.017  1.646   10.507  1.00 0.00 ? 36  PRO A O    2  
ATOM 4123  C CB   . PRO A 1 36  ? 25.520  -0.510  8.381   1.00 0.00 ? 36  PRO A CB   2  
ATOM 4124  C CG   . PRO A 1 36  ? 24.183  -1.267  8.205   1.00 0.00 ? 36  PRO A CG   2  
ATOM 4125  C CD   . PRO A 1 36  ? 23.736  -1.703  9.613   1.00 0.00 ? 36  PRO A CD   2  
ATOM 4126  H HA   . PRO A 1 36  ? 26.569  -0.156  10.227  1.00 0.00 ? 36  PRO A HA   2  
ATOM 4127  H HB2  . PRO A 1 36  ? 25.555  0.350   7.724   1.00 0.00 ? 36  PRO A HB2  2  
ATOM 4128  H HB3  . PRO A 1 36  ? 26.344  -1.173  8.170   1.00 0.00 ? 36  PRO A HB3  2  
ATOM 4129  H HG2  . PRO A 1 36  ? 23.443  -0.612  7.764   1.00 0.00 ? 36  PRO A HG2  2  
ATOM 4130  H HG3  . PRO A 1 36  ? 24.328  -2.136  7.583   1.00 0.00 ? 36  PRO A HG3  2  
ATOM 4131  H HD2  . PRO A 1 36  ? 22.708  -1.416  9.789   1.00 0.00 ? 36  PRO A HD2  2  
ATOM 4132  H HD3  . PRO A 1 36  ? 23.859  -2.768  9.735   1.00 0.00 ? 36  PRO A HD3  2  
ATOM 4133  N N    . LYS A 1 37  ? 25.843  2.330   9.500   1.00 0.00 ? 37  LYS A N    2  
ATOM 4134  C CA   . LYS A 1 37  ? 25.423  3.745   9.592   1.00 0.00 ? 37  LYS A CA   2  
ATOM 4135  C C    . LYS A 1 37  ? 24.046  3.898   8.951   1.00 0.00 ? 37  LYS A C    2  
ATOM 4136  O O    . LYS A 1 37  ? 23.217  4.662   9.402   1.00 0.00 ? 37  LYS A O    2  
ATOM 4137  C CB   . LYS A 1 37  ? 26.439  4.593   8.838   1.00 0.00 ? 37  LYS A CB   2  
ATOM 4138  C CG   . LYS A 1 37  ? 27.543  5.042   9.796   1.00 0.00 ? 37  LYS A CG   2  
ATOM 4139  C CD   . LYS A 1 37  ? 28.366  6.156   9.145   1.00 0.00 ? 37  LYS A CD   2  
ATOM 4140  C CE   . LYS A 1 37  ? 29.810  5.686   8.967   1.00 0.00 ? 37  LYS A CE   2  
ATOM 4141  N NZ   . LYS A 1 37  ? 30.337  5.185   10.267  1.00 0.00 ? 37  LYS A NZ   2  
ATOM 4142  H H    . LYS A 1 37  ? 26.691  2.108   9.069   1.00 0.00 ? 37  LYS A H    2  
ATOM 4143  H HA   . LYS A 1 37  ? 25.385  4.052   10.626  1.00 0.00 ? 37  LYS A HA   2  
ATOM 4144  H HB2  . LYS A 1 37  ? 26.869  4.007   8.040   1.00 0.00 ? 37  LYS A HB2  2  
ATOM 4145  H HB3  . LYS A 1 37  ? 25.946  5.449   8.425   1.00 0.00 ? 37  LYS A HB3  2  
ATOM 4146  H HG2  . LYS A 1 37  ? 27.100  5.408   10.711  1.00 0.00 ? 37  LYS A HG2  2  
ATOM 4147  H HG3  . LYS A 1 37  ? 28.188  4.206   10.019  1.00 0.00 ? 37  LYS A HG3  2  
ATOM 4148  H HD2  . LYS A 1 37  ? 27.942  6.399   8.181   1.00 0.00 ? 37  LYS A HD2  2  
ATOM 4149  H HD3  . LYS A 1 37  ? 28.349  7.031   9.777   1.00 0.00 ? 37  LYS A HD3  2  
ATOM 4150  H HE2  . LYS A 1 37  ? 29.842  4.892   8.235   1.00 0.00 ? 37  LYS A HE2  2  
ATOM 4151  H HE3  . LYS A 1 37  ? 30.418  6.512   8.626   1.00 0.00 ? 37  LYS A HE3  2  
ATOM 4152  H HZ1  . LYS A 1 37  ? 29.990  5.790   11.039  1.00 0.00 ? 37  LYS A HZ1  2  
ATOM 4153  H HZ2  . LYS A 1 37  ? 30.012  4.210   10.421  1.00 0.00 ? 37  LYS A HZ2  2  
ATOM 4154  H HZ3  . LYS A 1 37  ? 31.377  5.205   10.250  1.00 0.00 ? 37  LYS A HZ3  2  
ATOM 4155  N N    . GLY A 1 38  ? 23.803  3.170   7.899   1.00 0.00 ? 38  GLY A N    2  
ATOM 4156  C CA   . GLY A 1 38  ? 22.482  3.258   7.215   1.00 0.00 ? 38  GLY A CA   2  
ATOM 4157  C C    . GLY A 1 38  ? 22.375  2.148   6.167   1.00 0.00 ? 38  GLY A C    2  
ATOM 4158  O O    . GLY A 1 38  ? 22.970  1.097   6.299   1.00 0.00 ? 38  GLY A O    2  
ATOM 4159  H H    . GLY A 1 38  ? 24.492  2.561   7.559   1.00 0.00 ? 38  GLY A H    2  
ATOM 4160  H HA2  . GLY A 1 38  ? 21.691  3.147   7.944   1.00 0.00 ? 38  GLY A HA2  2  
ATOM 4161  H HA3  . GLY A 1 38  ? 22.391  4.217   6.728   1.00 0.00 ? 38  GLY A HA3  2  
ATOM 4162  N N    . TYR A 1 39  ? 21.620  2.374   5.127   1.00 0.00 ? 39  TYR A N    2  
ATOM 4163  C CA   . TYR A 1 39  ? 21.475  1.335   4.069   1.00 0.00 ? 39  TYR A CA   2  
ATOM 4164  C C    . TYR A 1 39  ? 20.523  1.844   2.987   1.00 0.00 ? 39  TYR A C    2  
ATOM 4165  O O    . TYR A 1 39  ? 20.023  2.948   3.060   1.00 0.00 ? 39  TYR A O    2  
ATOM 4166  C CB   . TYR A 1 39  ? 20.917  0.050   4.686   1.00 0.00 ? 39  TYR A CB   2  
ATOM 4167  C CG   . TYR A 1 39  ? 19.455  0.228   5.012   1.00 0.00 ? 39  TYR A CG   2  
ATOM 4168  C CD1  . TYR A 1 39  ? 19.057  1.153   5.984   1.00 0.00 ? 39  TYR A CD1  2  
ATOM 4169  C CD2  . TYR A 1 39  ? 18.495  -0.541  4.347   1.00 0.00 ? 39  TYR A CD2  2  
ATOM 4170  C CE1  . TYR A 1 39  ? 17.700  1.308   6.291   1.00 0.00 ? 39  TYR A CE1  2  
ATOM 4171  C CE2  . TYR A 1 39  ? 17.139  -0.386  4.651   1.00 0.00 ? 39  TYR A CE2  2  
ATOM 4172  C CZ   . TYR A 1 39  ? 16.741  0.539   5.624   1.00 0.00 ? 39  TYR A CZ   2  
ATOM 4173  O OH   . TYR A 1 39  ? 15.405  0.691   5.929   1.00 0.00 ? 39  TYR A OH   2  
ATOM 4174  H H    . TYR A 1 39  ? 21.151  3.230   5.040   1.00 0.00 ? 39  TYR A H    2  
ATOM 4175  H HA   . TYR A 1 39  ? 22.438  1.130   3.630   1.00 0.00 ? 39  TYR A HA   2  
ATOM 4176  H HB2  . TYR A 1 39  ? 21.031  -0.763  3.985   1.00 0.00 ? 39  TYR A HB2  2  
ATOM 4177  H HB3  . TYR A 1 39  ? 21.460  -0.178  5.591   1.00 0.00 ? 39  TYR A HB3  2  
ATOM 4178  H HD1  . TYR A 1 39  ? 19.794  1.748   6.498   1.00 0.00 ? 39  TYR A HD1  2  
ATOM 4179  H HD2  . TYR A 1 39  ? 18.804  -1.253  3.595   1.00 0.00 ? 39  TYR A HD2  2  
ATOM 4180  H HE1  . TYR A 1 39  ? 17.395  2.022   7.041   1.00 0.00 ? 39  TYR A HE1  2  
ATOM 4181  H HE2  . TYR A 1 39  ? 16.400  -0.979  4.138   1.00 0.00 ? 39  TYR A HE2  2  
ATOM 4182  H HH   . TYR A 1 39  ? 15.218  1.631   5.987   1.00 0.00 ? 39  TYR A HH   2  
ATOM 4183  N N    . HIS A 1 40  ? 20.267  1.054   1.983   1.00 0.00 ? 40  HIS A N    2  
ATOM 4184  C CA   . HIS A 1 40  ? 19.345  1.504   0.903   1.00 0.00 ? 40  HIS A CA   2  
ATOM 4185  C C    . HIS A 1 40  ? 17.948  0.951   1.182   1.00 0.00 ? 40  HIS A C    2  
ATOM 4186  O O    . HIS A 1 40  ? 17.537  -0.046  0.622   1.00 0.00 ? 40  HIS A O    2  
ATOM 4187  C CB   . HIS A 1 40  ? 19.854  0.992   -0.444  1.00 0.00 ? 40  HIS A CB   2  
ATOM 4188  C CG   . HIS A 1 40  ? 21.312  1.334   -0.577  1.00 0.00 ? 40  HIS A CG   2  
ATOM 4189  N ND1  . HIS A 1 40  ? 21.747  2.473   -1.236  1.00 0.00 ? 40  HIS A ND1  2  
ATOM 4190  C CD2  . HIS A 1 40  ? 22.446  0.708   -0.123  1.00 0.00 ? 40  HIS A CD2  2  
ATOM 4191  C CE1  . HIS A 1 40  ? 23.092  2.496   -1.160  1.00 0.00 ? 40  HIS A CE1  2  
ATOM 4192  N NE2  . HIS A 1 40  ? 23.568  1.442   -0.493  1.00 0.00 ? 40  HIS A NE2  2  
ATOM 4193  H H    . HIS A 1 40  ? 20.678  0.165   1.939   1.00 0.00 ? 40  HIS A H    2  
ATOM 4194  H HA   . HIS A 1 40  ? 19.308  2.583   0.889   1.00 0.00 ? 40  HIS A HA   2  
ATOM 4195  H HB2  . HIS A 1 40  ? 19.727  -0.080  -0.494  1.00 0.00 ? 40  HIS A HB2  2  
ATOM 4196  H HB3  . HIS A 1 40  ? 19.299  1.461   -1.242  1.00 0.00 ? 40  HIS A HB3  2  
ATOM 4197  H HD1  . HIS A 1 40  ? 21.181  3.139   -1.678  1.00 0.00 ? 40  HIS A HD1  2  
ATOM 4198  H HD2  . HIS A 1 40  ? 22.463  -0.212  0.440   1.00 0.00 ? 40  HIS A HD2  2  
ATOM 4199  H HE1  . HIS A 1 40  ? 23.709  3.276   -1.580  1.00 0.00 ? 40  HIS A HE1  2  
ATOM 4200  N N    . ALA A 1 41  ? 17.223  1.589   2.057   1.00 0.00 ? 41  ALA A N    2  
ATOM 4201  C CA   . ALA A 1 41  ? 15.857  1.106   2.398   1.00 0.00 ? 41  ALA A CA   2  
ATOM 4202  C C    . ALA A 1 41  ? 14.934  1.223   1.183   1.00 0.00 ? 41  ALA A C    2  
ATOM 4203  O O    . ALA A 1 41  ? 13.943  0.528   1.085   1.00 0.00 ? 41  ALA A O    2  
ATOM 4204  C CB   . ALA A 1 41  ? 15.295  1.947   3.546   1.00 0.00 ? 41  ALA A CB   2  
ATOM 4205  H H    . ALA A 1 41  ? 17.583  2.384   2.503   1.00 0.00 ? 41  ALA A H    2  
ATOM 4206  H HA   . ALA A 1 41  ? 15.910  0.074   2.706   1.00 0.00 ? 41  ALA A HA   2  
ATOM 4207  H HB1  . ALA A 1 41  ? 16.104  2.268   4.186   1.00 0.00 ? 41  ALA A HB1  2  
ATOM 4208  H HB2  . ALA A 1 41  ? 14.790  2.813   3.144   1.00 0.00 ? 41  ALA A HB2  2  
ATOM 4209  H HB3  . ALA A 1 41  ? 14.597  1.356   4.118   1.00 0.00 ? 41  ALA A HB3  2  
ATOM 4210  N N    . ASN A 1 42  ? 15.237  2.095   0.262   1.00 0.00 ? 42  ASN A N    2  
ATOM 4211  C CA   . ASN A 1 42  ? 14.350  2.239   -0.926  1.00 0.00 ? 42  ASN A CA   2  
ATOM 4212  C C    . ASN A 1 42  ? 12.921  2.473   -0.440  1.00 0.00 ? 42  ASN A C    2  
ATOM 4213  O O    . ASN A 1 42  ? 12.650  2.433   0.744   1.00 0.00 ? 42  ASN A O    2  
ATOM 4214  C CB   . ASN A 1 42  ? 14.393  0.952   -1.754  1.00 0.00 ? 42  ASN A CB   2  
ATOM 4215  C CG   . ASN A 1 42  ? 15.512  1.046   -2.793  1.00 0.00 ? 42  ASN A CG   2  
ATOM 4216  O OD1  . ASN A 1 42  ? 16.675  1.103   -2.446  1.00 0.00 ? 42  ASN A OD1  2  
ATOM 4217  N ND2  . ASN A 1 42  ? 15.206  1.065   -4.062  1.00 0.00 ? 42  ASN A ND2  2  
ATOM 4218  H H    . ASN A 1 42  ? 16.035  2.657   0.353   1.00 0.00 ? 42  ASN A H    2  
ATOM 4219  H HA   . ASN A 1 42  ? 14.674  3.074   -1.529  1.00 0.00 ? 42  ASN A HA   2  
ATOM 4220  H HB2  . ASN A 1 42  ? 14.575  0.111   -1.100  1.00 0.00 ? 42  ASN A HB2  2  
ATOM 4221  H HB3  . ASN A 1 42  ? 13.447  0.816   -2.256  1.00 0.00 ? 42  ASN A HB3  2  
ATOM 4222  H HD21 . ASN A 1 42  ? 14.269  1.020   -4.340  1.00 0.00 ? 42  ASN A HD21 2  
ATOM 4223  H HD22 . ASN A 1 42  ? 15.915  1.121   -4.734  1.00 0.00 ? 42  ASN A HD22 2  
ATOM 4224  N N    . PHE A 1 43  ? 11.998  2.704   -1.330  1.00 0.00 ? 43  PHE A N    2  
ATOM 4225  C CA   . PHE A 1 43  ? 10.597  2.921   -0.878  1.00 0.00 ? 43  PHE A CA   2  
ATOM 4226  C C    . PHE A 1 43  ? 9.667   3.030   -2.080  1.00 0.00 ? 43  PHE A C    2  
ATOM 4227  O O    . PHE A 1 43  ? 10.085  3.309   -3.186  1.00 0.00 ? 43  PHE A O    2  
ATOM 4228  C CB   . PHE A 1 43  ? 10.511  4.198   -0.035  1.00 0.00 ? 43  PHE A CB   2  
ATOM 4229  C CG   . PHE A 1 43  ? 10.511  5.415   -0.922  1.00 0.00 ? 43  PHE A CG   2  
ATOM 4230  C CD1  . PHE A 1 43  ? 11.598  5.668   -1.760  1.00 0.00 ? 43  PHE A CD1  2  
ATOM 4231  C CD2  . PHE A 1 43  ? 9.426   6.296   -0.898  1.00 0.00 ? 43  PHE A CD2  2  
ATOM 4232  C CE1  . PHE A 1 43  ? 11.604  6.805   -2.572  1.00 0.00 ? 43  PHE A CE1  2  
ATOM 4233  C CE2  . PHE A 1 43  ? 9.430   7.428   -1.711  1.00 0.00 ? 43  PHE A CE2  2  
ATOM 4234  C CZ   . PHE A 1 43  ? 10.518  7.686   -2.549  1.00 0.00 ? 43  PHE A CZ   2  
ATOM 4235  H H    . PHE A 1 43  ? 12.222  2.727   -2.287  1.00 0.00 ? 43  PHE A H    2  
ATOM 4236  H HA   . PHE A 1 43  ? 10.291  2.079   -0.275  1.00 0.00 ? 43  PHE A HA   2  
ATOM 4237  H HB2  . PHE A 1 43  ? 9.600   4.187   0.539   1.00 0.00 ? 43  PHE A HB2  2  
ATOM 4238  H HB3  . PHE A 1 43  ? 11.356  4.244   0.637   1.00 0.00 ? 43  PHE A HB3  2  
ATOM 4239  H HD1  . PHE A 1 43  ? 12.437  4.988   -1.777  1.00 0.00 ? 43  PHE A HD1  2  
ATOM 4240  H HD2  . PHE A 1 43  ? 8.583   6.101   -0.252  1.00 0.00 ? 43  PHE A HD2  2  
ATOM 4241  H HE1  . PHE A 1 43  ? 12.444  7.003   -3.218  1.00 0.00 ? 43  PHE A HE1  2  
ATOM 4242  H HE2  . PHE A 1 43  ? 8.594   8.103   -1.689  1.00 0.00 ? 43  PHE A HE2  2  
ATOM 4243  H HZ   . PHE A 1 43  ? 10.522  8.565   -3.176  1.00 0.00 ? 43  PHE A HZ   2  
ATOM 4244  N N    . CYS A 1 44  ? 8.404   2.807   -1.864  1.00 0.00 ? 44  CYS A N    2  
ATOM 4245  C CA   . CYS A 1 44  ? 7.426   2.892   -2.978  1.00 0.00 ? 44  CYS A CA   2  
ATOM 4246  C C    . CYS A 1 44  ? 6.442   4.013   -2.660  1.00 0.00 ? 44  CYS A C    2  
ATOM 4247  O O    . CYS A 1 44  ? 5.692   3.932   -1.708  1.00 0.00 ? 44  CYS A O    2  
ATOM 4248  C CB   . CYS A 1 44  ? 6.652   1.571   -3.089  1.00 0.00 ? 44  CYS A CB   2  
ATOM 4249  S SG   . CYS A 1 44  ? 7.670   0.196   -2.488  1.00 0.00 ? 44  CYS A SG   2  
ATOM 4250  H H    . CYS A 1 44  ? 8.096   2.584   -0.962  1.00 0.00 ? 44  CYS A H    2  
ATOM 4251  H HA   . CYS A 1 44  ? 7.942   3.101   -3.907  1.00 0.00 ? 44  CYS A HA   2  
ATOM 4252  H HB2  . CYS A 1 44  ? 5.751   1.633   -2.499  1.00 0.00 ? 44  CYS A HB2  2  
ATOM 4253  H HB3  . CYS A 1 44  ? 6.391   1.398   -4.122  1.00 0.00 ? 44  CYS A HB3  2  
ATOM 4254  N N    . LEU A 1 45  ? 6.435   5.065   -3.427  1.00 0.00 ? 45  LEU A N    2  
ATOM 4255  C CA   . LEU A 1 45  ? 5.487   6.172   -3.120  1.00 0.00 ? 45  LEU A CA   2  
ATOM 4256  C C    . LEU A 1 45  ? 4.054   5.640   -3.189  1.00 0.00 ? 45  LEU A C    2  
ATOM 4257  O O    . LEU A 1 45  ? 3.832   4.460   -3.022  1.00 0.00 ? 45  LEU A O    2  
ATOM 4258  C CB   . LEU A 1 45  ? 5.718   7.329   -4.100  1.00 0.00 ? 45  LEU A CB   2  
ATOM 4259  C CG   . LEU A 1 45  ? 6.808   8.249   -3.549  1.00 0.00 ? 45  LEU A CG   2  
ATOM 4260  C CD1  . LEU A 1 45  ? 6.959   9.467   -4.461  1.00 0.00 ? 45  LEU A CD1  2  
ATOM 4261  C CD2  . LEU A 1 45  ? 6.419   8.711   -2.143  1.00 0.00 ? 45  LEU A CD2  2  
ATOM 4262  H H    . LEU A 1 45  ? 7.050   5.129   -4.194  1.00 0.00 ? 45  LEU A H    2  
ATOM 4263  H HA   . LEU A 1 45  ? 5.668   6.509   -2.120  1.00 0.00 ? 45  LEU A HA   2  
ATOM 4264  H HB2  . LEU A 1 45  ? 6.033   6.936   -5.053  1.00 0.00 ? 45  LEU A HB2  2  
ATOM 4265  H HB3  . LEU A 1 45  ? 4.811   7.894   -4.223  1.00 0.00 ? 45  LEU A HB3  2  
ATOM 4266  H HG   . LEU A 1 45  ? 7.745   7.712   -3.507  1.00 0.00 ? 45  LEU A HG   2  
ATOM 4267  H HD11 . LEU A 1 45  ? 6.270   9.384   -5.289  1.00 0.00 ? 45  LEU A HD11 2  
ATOM 4268  H HD12 . LEU A 1 45  ? 6.741   10.365  -3.900  1.00 0.00 ? 45  LEU A HD12 2  
ATOM 4269  H HD13 . LEU A 1 45  ? 7.969   9.513   -4.837  1.00 0.00 ? 45  LEU A HD13 2  
ATOM 4270  H HD21 . LEU A 1 45  ? 5.361   8.923   -2.113  1.00 0.00 ? 45  LEU A HD21 2  
ATOM 4271  H HD22 . LEU A 1 45  ? 6.649   7.930   -1.432  1.00 0.00 ? 45  LEU A HD22 2  
ATOM 4272  H HD23 . LEU A 1 45  ? 6.974   9.602   -1.890  1.00 0.00 ? 45  LEU A HD23 2  
ATOM 4273  N N    . GLY A 1 46  ? 3.073   6.481   -3.388  1.00 0.00 ? 46  GLY A N    2  
ATOM 4274  C CA   . GLY A 1 46  ? 1.677   5.966   -3.425  1.00 0.00 ? 46  GLY A CA   2  
ATOM 4275  C C    . GLY A 1 46  ? 0.984   6.160   -4.801  1.00 0.00 ? 46  GLY A C    2  
ATOM 4276  O O    . GLY A 1 46  ? -0.229  6.111   -4.852  1.00 0.00 ? 46  GLY A O    2  
ATOM 4277  H H    . GLY A 1 46  ? 3.247   7.438   -3.486  1.00 0.00 ? 46  GLY A H    2  
ATOM 4278  H HA2  . GLY A 1 46  ? 1.691   4.916   -3.186  1.00 0.00 ? 46  GLY A HA2  2  
ATOM 4279  H HA3  . GLY A 1 46  ? 1.100   6.484   -2.672  1.00 0.00 ? 46  GLY A HA3  2  
ATOM 4280  N N    . PRO A 1 47  ? 1.722   6.363   -5.883  1.00 0.00 ? 47  PRO A N    2  
ATOM 4281  C CA   . PRO A 1 47  ? 1.100   6.540   -7.210  1.00 0.00 ? 47  PRO A CA   2  
ATOM 4282  C C    . PRO A 1 47  ? 0.698   5.187   -7.797  1.00 0.00 ? 47  PRO A C    2  
ATOM 4283  O O    . PRO A 1 47  ? 1.521   4.316   -7.994  1.00 0.00 ? 47  PRO A O    2  
ATOM 4284  C CB   . PRO A 1 47  ? 2.205   7.153   -8.060  1.00 0.00 ? 47  PRO A CB   2  
ATOM 4285  C CG   . PRO A 1 47  ? 3.531   6.755   -7.384  1.00 0.00 ? 47  PRO A CG   2  
ATOM 4286  C CD   . PRO A 1 47  ? 3.198   6.447   -5.914  1.00 0.00 ? 47  PRO A CD   2  
ATOM 4287  H HA   . PRO A 1 47  ? 0.255   7.207   -7.157  1.00 0.00 ? 47  PRO A HA   2  
ATOM 4288  H HB2  . PRO A 1 47  ? 2.161   6.758   -9.065  1.00 0.00 ? 47  PRO A HB2  2  
ATOM 4289  H HB3  . PRO A 1 47  ? 2.111   8.228   -8.076  1.00 0.00 ? 47  PRO A HB3  2  
ATOM 4290  H HG2  . PRO A 1 47  ? 3.940   5.878   -7.865  1.00 0.00 ? 47  PRO A HG2  2  
ATOM 4291  H HG3  . PRO A 1 47  ? 4.233   7.571   -7.434  1.00 0.00 ? 47  PRO A HG3  2  
ATOM 4292  H HD2  . PRO A 1 47  ? 3.644   5.509   -5.609  1.00 0.00 ? 47  PRO A HD2  2  
ATOM 4293  H HD3  . PRO A 1 47  ? 3.534   7.252   -5.292  1.00 0.00 ? 47  PRO A HD3  2  
ATOM 4294  N N    . CYS A 1 48  ? -0.552  5.007   -8.090  1.00 0.00 ? 48  CYS A N    2  
ATOM 4295  C CA   . CYS A 1 48  ? -0.996  3.716   -8.685  1.00 0.00 ? 48  CYS A CA   2  
ATOM 4296  C C    . CYS A 1 48  ? -2.158  3.969   -9.647  1.00 0.00 ? 48  CYS A C    2  
ATOM 4297  O O    . CYS A 1 48  ? -3.300  3.993   -9.237  1.00 0.00 ? 48  CYS A O    2  
ATOM 4298  C CB   . CYS A 1 48  ? -1.453  2.758   -7.581  1.00 0.00 ? 48  CYS A CB   2  
ATOM 4299  S SG   . CYS A 1 48  ? -0.019  2.155   -6.660  1.00 0.00 ? 48  CYS A SG   2  
ATOM 4300  H H    . CYS A 1 48  ? -1.196  5.726   -7.936  1.00 0.00 ? 48  CYS A H    2  
ATOM 4301  H HA   . CYS A 1 48  ? -0.175  3.272   -9.227  1.00 0.00 ? 48  CYS A HA   2  
ATOM 4302  H HB2  . CYS A 1 48  ? -2.115  3.274   -6.910  1.00 0.00 ? 48  CYS A HB2  2  
ATOM 4303  H HB3  . CYS A 1 48  ? -1.972  1.921   -8.025  1.00 0.00 ? 48  CYS A HB3  2  
ATOM 4304  N N    . PRO A 1 49  ? -1.842  4.135   -10.902 1.00 0.00 ? 49  PRO A N    2  
ATOM 4305  C CA   . PRO A 1 49  ? -2.858  4.370   -11.936 1.00 0.00 ? 49  PRO A CA   2  
ATOM 4306  C C    . PRO A 1 49  ? -3.607  3.060   -12.217 1.00 0.00 ? 49  PRO A C    2  
ATOM 4307  O O    . PRO A 1 49  ? -3.791  2.256   -11.324 1.00 0.00 ? 49  PRO A O    2  
ATOM 4308  C CB   . PRO A 1 49  ? -2.047  4.882   -13.134 1.00 0.00 ? 49  PRO A CB   2  
ATOM 4309  C CG   . PRO A 1 49  ? -0.590  4.416   -12.911 1.00 0.00 ? 49  PRO A CG   2  
ATOM 4310  C CD   . PRO A 1 49  ? -0.454  4.097   -11.408 1.00 0.00 ? 49  PRO A CD   2  
ATOM 4311  H HA   . PRO A 1 49  ? -3.550  5.131   -11.610 1.00 0.00 ? 49  PRO A HA   2  
ATOM 4312  H HB2  . PRO A 1 49  ? -2.434  4.468   -14.052 1.00 0.00 ? 49  PRO A HB2  2  
ATOM 4313  H HB3  . PRO A 1 49  ? -2.080  5.959   -13.170 1.00 0.00 ? 49  PRO A HB3  2  
ATOM 4314  H HG2  . PRO A 1 49  ? -0.389  3.539   -13.504 1.00 0.00 ? 49  PRO A HG2  2  
ATOM 4315  H HG3  . PRO A 1 49  ? 0.095   5.206   -13.177 1.00 0.00 ? 49  PRO A HG3  2  
ATOM 4316  H HD2  . PRO A 1 49  ? -0.024  3.114   -11.268 1.00 0.00 ? 49  PRO A HD2  2  
ATOM 4317  H HD3  . PRO A 1 49  ? 0.144   4.847   -10.913 1.00 0.00 ? 49  PRO A HD3  2  
ATOM 4318  N N    . TYR A 1 50  ? -4.066  2.828   -13.415 1.00 0.00 ? 50  TYR A N    2  
ATOM 4319  C CA   . TYR A 1 50  ? -4.817  1.560   -13.661 1.00 0.00 ? 50  TYR A CA   2  
ATOM 4320  C C    . TYR A 1 50  ? -3.894  0.472   -14.226 1.00 0.00 ? 50  TYR A C    2  
ATOM 4321  O O    . TYR A 1 50  ? -3.313  -0.296  -13.490 1.00 0.00 ? 50  TYR A O    2  
ATOM 4322  C CB   . TYR A 1 50  ? -5.996  1.792   -14.627 1.00 0.00 ? 50  TYR A CB   2  
ATOM 4323  C CG   . TYR A 1 50  ? -5.961  3.194   -15.190 1.00 0.00 ? 50  TYR A CG   2  
ATOM 4324  C CD1  . TYR A 1 50  ? -6.360  4.273   -14.395 1.00 0.00 ? 50  TYR A CD1  2  
ATOM 4325  C CD2  . TYR A 1 50  ? -5.536  3.412   -16.506 1.00 0.00 ? 50  TYR A CD2  2  
ATOM 4326  C CE1  . TYR A 1 50  ? -6.334  5.572   -14.912 1.00 0.00 ? 50  TYR A CE1  2  
ATOM 4327  C CE2  . TYR A 1 50  ? -5.509  4.713   -17.024 1.00 0.00 ? 50  TYR A CE2  2  
ATOM 4328  C CZ   . TYR A 1 50  ? -5.909  5.793   -16.227 1.00 0.00 ? 50  TYR A CZ   2  
ATOM 4329  O OH   . TYR A 1 50  ? -5.883  7.075   -16.739 1.00 0.00 ? 50  TYR A OH   2  
ATOM 4330  H H    . TYR A 1 50  ? -3.938  3.480   -14.133 1.00 0.00 ? 50  TYR A H    2  
ATOM 4331  H HA   . TYR A 1 50  ? -5.212  1.213   -12.717 1.00 0.00 ? 50  TYR A HA   2  
ATOM 4332  H HB2  . TYR A 1 50  ? -5.946  1.080   -15.434 1.00 0.00 ? 50  TYR A HB2  2  
ATOM 4333  H HB3  . TYR A 1 50  ? -6.923  1.650   -14.089 1.00 0.00 ? 50  TYR A HB3  2  
ATOM 4334  H HD1  . TYR A 1 50  ? -6.687  4.102   -13.379 1.00 0.00 ? 50  TYR A HD1  2  
ATOM 4335  H HD2  . TYR A 1 50  ? -5.228  2.579   -17.120 1.00 0.00 ? 50  TYR A HD2  2  
ATOM 4336  H HE1  . TYR A 1 50  ? -6.644  6.404   -14.296 1.00 0.00 ? 50  TYR A HE1  2  
ATOM 4337  H HE2  . TYR A 1 50  ? -5.181  4.883   -18.040 1.00 0.00 ? 50  TYR A HE2  2  
ATOM 4338  H HH   . TYR A 1 50  ? -6.610  7.565   -16.347 1.00 0.00 ? 50  TYR A HH   2  
ATOM 4339  N N    . ILE A 1 51  ? -3.781  0.384   -15.524 1.00 0.00 ? 51  ILE A N    2  
ATOM 4340  C CA   . ILE A 1 51  ? -2.932  -0.678  -16.147 1.00 0.00 ? 51  ILE A CA   2  
ATOM 4341  C C    . ILE A 1 51  ? -1.674  -0.959  -15.316 1.00 0.00 ? 51  ILE A C    2  
ATOM 4342  O O    . ILE A 1 51  ? -1.151  -2.055  -15.334 1.00 0.00 ? 51  ILE A O    2  
ATOM 4343  C CB   . ILE A 1 51  ? -2.523  -0.237  -17.553 1.00 0.00 ? 51  ILE A CB   2  
ATOM 4344  C CG1  . ILE A 1 51  ? -1.844  1.132   -17.477 1.00 0.00 ? 51  ILE A CG1  2  
ATOM 4345  C CG2  . ILE A 1 51  ? -3.766  -0.139  -18.440 1.00 0.00 ? 51  ILE A CG2  2  
ATOM 4346  C CD1  . ILE A 1 51  ? -1.091  1.401   -18.781 1.00 0.00 ? 51  ILE A CD1  2  
ATOM 4347  H H    . ILE A 1 51  ? -4.275  1.003   -16.099 1.00 0.00 ? 51  ILE A H    2  
ATOM 4348  H HA   . ILE A 1 51  ? -3.515  -1.585  -16.218 1.00 0.00 ? 51  ILE A HA   2  
ATOM 4349  H HB   . ILE A 1 51  ? -1.838  -0.959  -17.972 1.00 0.00 ? 51  ILE A HB   2  
ATOM 4350  H HG12 . ILE A 1 51  ? -2.592  1.897   -17.329 1.00 0.00 ? 51  ILE A HG12 2  
ATOM 4351  H HG13 . ILE A 1 51  ? -1.147  1.143   -16.653 1.00 0.00 ? 51  ILE A HG13 2  
ATOM 4352  H HG21 . ILE A 1 51  ? -4.641  -0.016  -17.819 1.00 0.00 ? 51  ILE A HG21 2  
ATOM 4353  H HG22 . ILE A 1 51  ? -3.670  0.709   -19.100 1.00 0.00 ? 51  ILE A HG22 2  
ATOM 4354  H HG23 . ILE A 1 51  ? -3.863  -1.042  -19.025 1.00 0.00 ? 51  ILE A HG23 2  
ATOM 4355  H HD11 . ILE A 1 51  ? -0.416  0.581   -18.983 1.00 0.00 ? 51  ILE A HD11 2  
ATOM 4356  H HD12 . ILE A 1 51  ? -1.797  1.493   -19.594 1.00 0.00 ? 51  ILE A HD12 2  
ATOM 4357  H HD13 . ILE A 1 51  ? -0.527  2.318   -18.690 1.00 0.00 ? 51  ILE A HD13 2  
ATOM 4358  N N    . TRP A 1 52  ? -1.176  0.007   -14.596 1.00 0.00 ? 52  TRP A N    2  
ATOM 4359  C CA   . TRP A 1 52  ? 0.055   -0.226  -13.780 1.00 0.00 ? 52  TRP A CA   2  
ATOM 4360  C C    . TRP A 1 52  ? -0.122  -1.454  -12.883 1.00 0.00 ? 52  TRP A C    2  
ATOM 4361  O O    . TRP A 1 52  ? -0.531  -1.334  -11.746 1.00 0.00 ? 52  TRP A O    2  
ATOM 4362  C CB   . TRP A 1 52  ? 0.318   0.992   -12.905 1.00 0.00 ? 52  TRP A CB   2  
ATOM 4363  C CG   . TRP A 1 52  ? 1.754   1.390   -13.025 1.00 0.00 ? 52  TRP A CG   2  
ATOM 4364  C CD1  . TRP A 1 52  ? 2.518   1.828   -12.003 1.00 0.00 ? 52  TRP A CD1  2  
ATOM 4365  C CD2  . TRP A 1 52  ? 2.609   1.389   -14.206 1.00 0.00 ? 52  TRP A CD2  2  
ATOM 4366  N NE1  . TRP A 1 52  ? 3.790   2.099   -12.477 1.00 0.00 ? 52  TRP A NE1  2  
ATOM 4367  C CE2  . TRP A 1 52  ? 3.896   1.844   -13.830 1.00 0.00 ? 52  TRP A CE2  2  
ATOM 4368  C CE3  . TRP A 1 52  ? 2.397   1.043   -15.552 1.00 0.00 ? 52  TRP A CE3  2  
ATOM 4369  C CZ2  . TRP A 1 52  ? 4.936   1.949   -14.755 1.00 0.00 ? 52  TRP A CZ2  2  
ATOM 4370  C CZ3  . TRP A 1 52  ? 3.440   1.148   -16.487 1.00 0.00 ? 52  TRP A CZ3  2  
ATOM 4371  C CH2  . TRP A 1 52  ? 4.708   1.600   -16.088 1.00 0.00 ? 52  TRP A CH2  2  
ATOM 4372  H H    . TRP A 1 52  ? -1.606  0.889   -14.596 1.00 0.00 ? 52  TRP A H    2  
ATOM 4373  H HA   . TRP A 1 52  ? 0.899   -0.380  -14.435 1.00 0.00 ? 52  TRP A HA   2  
ATOM 4374  H HB2  . TRP A 1 52  ? -0.312  1.803   -13.225 1.00 0.00 ? 52  TRP A HB2  2  
ATOM 4375  H HB3  . TRP A 1 52  ? 0.098   0.750   -11.876 1.00 0.00 ? 52  TRP A HB3  2  
ATOM 4376  H HD1  . TRP A 1 52  ? 2.190   1.947   -10.984 1.00 0.00 ? 52  TRP A HD1  2  
ATOM 4377  H HE1  . TRP A 1 52  ? 4.535   2.432   -11.935 1.00 0.00 ? 52  TRP A HE1  2  
ATOM 4378  H HE3  . TRP A 1 52  ? 1.426   0.694   -15.870 1.00 0.00 ? 52  TRP A HE3  2  
ATOM 4379  H HZ2  . TRP A 1 52  ? 5.913   2.295   -14.441 1.00 0.00 ? 52  TRP A HZ2  2  
ATOM 4380  H HZ3  . TRP A 1 52  ? 3.267   0.878   -17.518 1.00 0.00 ? 52  TRP A HZ3  2  
ATOM 4381  H HH2  . TRP A 1 52  ? 5.505   1.678   -16.812 1.00 0.00 ? 52  TRP A HH2  2  
ATOM 4382  N N    . SER A 1 53  ? 0.206   -2.621  -13.392 1.00 0.00 ? 53  SER A N    2  
ATOM 4383  C CA   . SER A 1 53  ? 0.092   -3.893  -12.600 1.00 0.00 ? 53  SER A CA   2  
ATOM 4384  C C    . SER A 1 53  ? -0.876  -3.734  -11.424 1.00 0.00 ? 53  SER A C    2  
ATOM 4385  O O    . SER A 1 53  ? -0.467  -3.523  -10.299 1.00 0.00 ? 53  SER A O    2  
ATOM 4386  C CB   . SER A 1 53  ? 1.471   -4.275  -12.062 1.00 0.00 ? 53  SER A CB   2  
ATOM 4387  O OG   . SER A 1 53  ? 2.057   -5.242  -12.923 1.00 0.00 ? 53  SER A OG   2  
ATOM 4388  H H    . SER A 1 53  ? 0.550   -2.662  -14.310 1.00 0.00 ? 53  SER A H    2  
ATOM 4389  H HA   . SER A 1 53  ? -0.264  -4.680  -13.247 1.00 0.00 ? 53  SER A HA   2  
ATOM 4390  H HB2  . SER A 1 53  ? 2.102   -3.402  -12.029 1.00 0.00 ? 53  SER A HB2  2  
ATOM 4391  H HB3  . SER A 1 53  ? 1.367   -4.680  -11.065 1.00 0.00 ? 53  SER A HB3  2  
ATOM 4392  H HG   . SER A 1 53  ? 2.799   -4.829  -13.371 1.00 0.00 ? 53  SER A HG   2  
ATOM 4393  N N    . LEU A 1 54  ? -2.154  -3.838  -11.666 1.00 0.00 ? 54  LEU A N    2  
ATOM 4394  C CA   . LEU A 1 54  ? -3.129  -3.697  -10.548 1.00 0.00 ? 54  LEU A CA   2  
ATOM 4395  C C    . LEU A 1 54  ? -3.263  -5.039  -9.828  1.00 0.00 ? 54  LEU A C    2  
ATOM 4396  O O    . LEU A 1 54  ? -3.464  -6.067  -10.442 1.00 0.00 ? 54  LEU A O    2  
ATOM 4397  C CB   . LEU A 1 54  ? -4.489  -3.267  -11.101 1.00 0.00 ? 54  LEU A CB   2  
ATOM 4398  C CG   . LEU A 1 54  ? -4.425  -1.797  -11.519 1.00 0.00 ? 54  LEU A CG   2  
ATOM 4399  C CD1  . LEU A 1 54  ? -5.402  -1.545  -12.671 1.00 0.00 ? 54  LEU A CD1  2  
ATOM 4400  C CD2  . LEU A 1 54  ? -4.802  -0.913  -10.328 1.00 0.00 ? 54  LEU A CD2  2  
ATOM 4401  H H    . LEU A 1 54  ? -2.470  -4.012  -12.577 1.00 0.00 ? 54  LEU A H    2  
ATOM 4402  H HA   . LEU A 1 54  ? -2.771  -2.951  -9.853  1.00 0.00 ? 54  LEU A HA   2  
ATOM 4403  H HB2  . LEU A 1 54  ? -4.741  -3.877  -11.957 1.00 0.00 ? 54  LEU A HB2  2  
ATOM 4404  H HB3  . LEU A 1 54  ? -5.244  -3.389  -10.337 1.00 0.00 ? 54  LEU A HB3  2  
ATOM 4405  H HG   . LEU A 1 54  ? -3.421  -1.562  -11.840 1.00 0.00 ? 54  LEU A HG   2  
ATOM 4406  H HD11 . LEU A 1 54  ? -6.206  -2.262  -12.624 1.00 0.00 ? 54  LEU A HD11 2  
ATOM 4407  H HD12 . LEU A 1 54  ? -5.806  -0.546  -12.588 1.00 0.00 ? 54  LEU A HD12 2  
ATOM 4408  H HD13 . LEU A 1 54  ? -4.885  -1.647  -13.613 1.00 0.00 ? 54  LEU A HD13 2  
ATOM 4409  H HD21 . LEU A 1 54  ? -4.508  -1.400  -9.411  1.00 0.00 ? 54  LEU A HD21 2  
ATOM 4410  H HD22 . LEU A 1 54  ? -4.294  0.038   -10.410 1.00 0.00 ? 54  LEU A HD22 2  
ATOM 4411  H HD23 . LEU A 1 54  ? -5.870  -0.751  -10.323 1.00 0.00 ? 54  LEU A HD23 2  
ATOM 4412  N N    . ASP A 1 55  ? -3.146  -5.039  -8.528  1.00 0.00 ? 55  ASP A N    2  
ATOM 4413  C CA   . ASP A 1 55  ? -3.259  -6.316  -7.770  1.00 0.00 ? 55  ASP A CA   2  
ATOM 4414  C C    . ASP A 1 55  ? -4.703  -6.510  -7.304  1.00 0.00 ? 55  ASP A C    2  
ATOM 4415  O O    . ASP A 1 55  ? -5.333  -7.505  -7.601  1.00 0.00 ? 55  ASP A O    2  
ATOM 4416  C CB   . ASP A 1 55  ? -2.332  -6.270  -6.553  1.00 0.00 ? 55  ASP A CB   2  
ATOM 4417  C CG   . ASP A 1 55  ? -0.916  -6.667  -6.974  1.00 0.00 ? 55  ASP A CG   2  
ATOM 4418  O OD1  . ASP A 1 55  ? -0.698  -6.838  -8.163  1.00 0.00 ? 55  ASP A OD1  2  
ATOM 4419  O OD2  . ASP A 1 55  ? -0.073  -6.793  -6.102  1.00 0.00 ? 55  ASP A OD2  2  
ATOM 4420  H H    . ASP A 1 55  ? -2.979  -4.199  -8.053  1.00 0.00 ? 55  ASP A H    2  
ATOM 4421  H HA   . ASP A 1 55  ? -2.974  -7.140  -8.407  1.00 0.00 ? 55  ASP A HA   2  
ATOM 4422  H HB2  . ASP A 1 55  ? -2.320  -5.269  -6.147  1.00 0.00 ? 55  ASP A HB2  2  
ATOM 4423  H HB3  . ASP A 1 55  ? -2.688  -6.959  -5.803  1.00 0.00 ? 55  ASP A HB3  2  
ATOM 4424  N N    . THR A 1 56  ? -5.234  -5.566  -6.578  1.00 0.00 ? 56  THR A N    2  
ATOM 4425  C CA   . THR A 1 56  ? -6.638  -5.699  -6.097  1.00 0.00 ? 56  THR A CA   2  
ATOM 4426  C C    . THR A 1 56  ? -7.575  -4.980  -7.068  1.00 0.00 ? 56  THR A C    2  
ATOM 4427  O O    . THR A 1 56  ? -7.302  -3.883  -7.512  1.00 0.00 ? 56  THR A O    2  
ATOM 4428  C CB   . THR A 1 56  ? -6.768  -5.071  -4.708  1.00 0.00 ? 56  THR A CB   2  
ATOM 4429  O OG1  . THR A 1 56  ? -7.055  -3.686  -4.840  1.00 0.00 ? 56  THR A OG1  2  
ATOM 4430  C CG2  . THR A 1 56  ? -5.459  -5.251  -3.936  1.00 0.00 ? 56  THR A CG2  2  
ATOM 4431  H H    . THR A 1 56  ? -4.711  -4.769  -6.349  1.00 0.00 ? 56  THR A H    2  
ATOM 4432  H HA   . THR A 1 56  ? -6.904  -6.744  -6.047  1.00 0.00 ? 56  THR A HA   2  
ATOM 4433  H HB   . THR A 1 56  ? -7.568  -5.555  -4.170  1.00 0.00 ? 56  THR A HB   2  
ATOM 4434  H HG1  . THR A 1 56  ? -6.223  -3.208  -4.821  1.00 0.00 ? 56  THR A HG1  2  
ATOM 4435  H HG21 . THR A 1 56  ? -5.185  -6.296  -3.928  1.00 0.00 ? 56  THR A HG21 2  
ATOM 4436  H HG22 . THR A 1 56  ? -4.678  -4.677  -4.411  1.00 0.00 ? 56  THR A HG22 2  
ATOM 4437  H HG23 . THR A 1 56  ? -5.590  -4.908  -2.920  1.00 0.00 ? 56  THR A HG23 2  
ATOM 4438  N N    . GLN A 1 57  ? -8.679  -5.587  -7.404  1.00 0.00 ? 57  GLN A N    2  
ATOM 4439  C CA   . GLN A 1 57  ? -9.626  -4.933  -8.347  1.00 0.00 ? 57  GLN A CA   2  
ATOM 4440  C C    . GLN A 1 57  ? -10.032 -3.564  -7.796  1.00 0.00 ? 57  GLN A C    2  
ATOM 4441  O O    . GLN A 1 57  ? -10.384 -2.668  -8.537  1.00 0.00 ? 57  GLN A O    2  
ATOM 4442  C CB   . GLN A 1 57  ? -10.868 -5.806  -8.515  1.00 0.00 ? 57  GLN A CB   2  
ATOM 4443  C CG   . GLN A 1 57  ? -11.279 -5.831  -9.988  1.00 0.00 ? 57  GLN A CG   2  
ATOM 4444  C CD   . GLN A 1 57  ? -10.719 -7.090  -10.652 1.00 0.00 ? 57  GLN A CD   2  
ATOM 4445  O OE1  . GLN A 1 57  ? -9.603  -7.488  -10.383 1.00 0.00 ? 57  GLN A OE1  2  
ATOM 4446  N NE2  . GLN A 1 57  ? -11.452 -7.738  -11.516 1.00 0.00 ? 57  GLN A NE2  2  
ATOM 4447  H H    . GLN A 1 57  ? -8.884  -6.473  -7.037  1.00 0.00 ? 57  GLN A H    2  
ATOM 4448  H HA   . GLN A 1 57  ? -9.146  -4.804  -9.306  1.00 0.00 ? 57  GLN A HA   2  
ATOM 4449  H HB2  . GLN A 1 57  ? -10.645 -6.811  -8.184  1.00 0.00 ? 57  GLN A HB2  2  
ATOM 4450  H HB3  . GLN A 1 57  ? -11.676 -5.403  -7.923  1.00 0.00 ? 57  GLN A HB3  2  
ATOM 4451  H HG2  . GLN A 1 57  ? -12.357 -5.833  -10.061 1.00 0.00 ? 57  GLN A HG2  2  
ATOM 4452  H HG3  . GLN A 1 57  ? -10.885 -4.958  -10.486 1.00 0.00 ? 57  GLN A HG3  2  
ATOM 4453  H HE21 . GLN A 1 57  ? -12.352 -7.417  -11.733 1.00 0.00 ? 57  GLN A HE21 2  
ATOM 4454  H HE22 . GLN A 1 57  ? -11.103 -8.545  -11.946 1.00 0.00 ? 57  GLN A HE22 2  
ATOM 4455  N N    . TYR A 1 58  ? -9.981  -3.390  -6.504  1.00 0.00 ? 58  TYR A N    2  
ATOM 4456  C CA   . TYR A 1 58  ? -10.359 -2.072  -5.923  1.00 0.00 ? 58  TYR A CA   2  
ATOM 4457  C C    . TYR A 1 58  ? -9.369  -1.011  -6.424  1.00 0.00 ? 58  TYR A C    2  
ATOM 4458  O O    . TYR A 1 58  ? -9.751  0.086   -6.785  1.00 0.00 ? 58  TYR A O    2  
ATOM 4459  C CB   . TYR A 1 58  ? -10.332 -2.161  -4.384  1.00 0.00 ? 58  TYR A CB   2  
ATOM 4460  C CG   . TYR A 1 58  ? -10.022 -0.809  -3.788  1.00 0.00 ? 58  TYR A CG   2  
ATOM 4461  C CD1  . TYR A 1 58  ? -10.954 0.231   -3.885  1.00 0.00 ? 58  TYR A CD1  2  
ATOM 4462  C CD2  . TYR A 1 58  ? -8.798  -0.594  -3.146  1.00 0.00 ? 58  TYR A CD2  2  
ATOM 4463  C CE1  . TYR A 1 58  ? -10.659 1.484   -3.338  1.00 0.00 ? 58  TYR A CE1  2  
ATOM 4464  C CE2  . TYR A 1 58  ? -8.505  0.660   -2.601  1.00 0.00 ? 58  TYR A CE2  2  
ATOM 4465  C CZ   . TYR A 1 58  ? -9.435  1.697   -2.698  1.00 0.00 ? 58  TYR A CZ   2  
ATOM 4466  O OH   . TYR A 1 58  ? -9.146  2.928   -2.162  1.00 0.00 ? 58  TYR A OH   2  
ATOM 4467  H H    . TYR A 1 58  ? -9.691  -4.121  -5.920  1.00 0.00 ? 58  TYR A H    2  
ATOM 4468  H HA   . TYR A 1 58  ? -11.356 -1.812  -6.249  1.00 0.00 ? 58  TYR A HA   2  
ATOM 4469  H HB2  . TYR A 1 58  ? -11.296 -2.494  -4.029  1.00 0.00 ? 58  TYR A HB2  2  
ATOM 4470  H HB3  . TYR A 1 58  ? -9.576  -2.867  -4.075  1.00 0.00 ? 58  TYR A HB3  2  
ATOM 4471  H HD1  . TYR A 1 58  ? -11.899 0.065   -4.380  1.00 0.00 ? 58  TYR A HD1  2  
ATOM 4472  H HD2  . TYR A 1 58  ? -8.079  -1.397  -3.070  1.00 0.00 ? 58  TYR A HD2  2  
ATOM 4473  H HE1  . TYR A 1 58  ? -11.375 2.290   -3.413  1.00 0.00 ? 58  TYR A HE1  2  
ATOM 4474  H HE2  . TYR A 1 58  ? -7.560  0.828   -2.106  1.00 0.00 ? 58  TYR A HE2  2  
ATOM 4475  H HH   . TYR A 1 58  ? -8.351  2.840   -1.629  1.00 0.00 ? 58  TYR A HH   2  
ATOM 4476  N N    . SER A 1 59  ? -8.103  -1.330  -6.455  1.00 0.00 ? 59  SER A N    2  
ATOM 4477  C CA   . SER A 1 59  ? -7.097  -0.341  -6.937  1.00 0.00 ? 59  SER A CA   2  
ATOM 4478  C C    . SER A 1 59  ? -7.486  0.135   -8.337  1.00 0.00 ? 59  SER A C    2  
ATOM 4479  O O    . SER A 1 59  ? -7.035  1.163   -8.800  1.00 0.00 ? 59  SER A O    2  
ATOM 4480  C CB   . SER A 1 59  ? -5.715  -0.997  -6.986  1.00 0.00 ? 59  SER A CB   2  
ATOM 4481  O OG   . SER A 1 59  ? -5.773  -2.158  -7.803  1.00 0.00 ? 59  SER A OG   2  
ATOM 4482  H H    . SER A 1 59  ? -7.815  -2.220  -6.163  1.00 0.00 ? 59  SER A H    2  
ATOM 4483  H HA   . SER A 1 59  ? -7.071  0.505   -6.265  1.00 0.00 ? 59  SER A HA   2  
ATOM 4484  H HB2  . SER A 1 59  ? -5.001  -0.307  -7.403  1.00 0.00 ? 59  SER A HB2  2  
ATOM 4485  H HB3  . SER A 1 59  ? -5.410  -1.264  -5.983  1.00 0.00 ? 59  SER A HB3  2  
ATOM 4486  H HG   . SER A 1 59  ? -4.992  -2.686  -7.623  1.00 0.00 ? 59  SER A HG   2  
ATOM 4487  N N    . LYS A 1 60  ? -8.325  -0.601  -9.014  1.00 0.00 ? 60  LYS A N    2  
ATOM 4488  C CA   . LYS A 1 60  ? -8.747  -0.183  -10.379 1.00 0.00 ? 60  LYS A CA   2  
ATOM 4489  C C    . LYS A 1 60  ? -9.802  0.916   -10.255 1.00 0.00 ? 60  LYS A C    2  
ATOM 4490  O O    . LYS A 1 60  ? -9.804  1.879   -10.997 1.00 0.00 ? 60  LYS A O    2  
ATOM 4491  C CB   . LYS A 1 60  ? -9.336  -1.389  -11.121 1.00 0.00 ? 60  LYS A CB   2  
ATOM 4492  C CG   . LYS A 1 60  ? -10.143 -0.915  -12.330 1.00 0.00 ? 60  LYS A CG   2  
ATOM 4493  C CD   . LYS A 1 60  ? -10.710 -2.128  -13.070 1.00 0.00 ? 60  LYS A CD   2  
ATOM 4494  C CE   . LYS A 1 60  ? -10.246 -2.100  -14.528 1.00 0.00 ? 60  LYS A CE   2  
ATOM 4495  N NZ   . LYS A 1 60  ? -9.618  -3.406  -14.873 1.00 0.00 ? 60  LYS A NZ   2  
ATOM 4496  H H    . LYS A 1 60  ? -8.682  -1.426  -8.623  1.00 0.00 ? 60  LYS A H    2  
ATOM 4497  H HA   . LYS A 1 60  ? -7.893  0.195   -10.922 1.00 0.00 ? 60  LYS A HA   2  
ATOM 4498  H HB2  . LYS A 1 60  ? -8.532  -2.031  -11.453 1.00 0.00 ? 60  LYS A HB2  2  
ATOM 4499  H HB3  . LYS A 1 60  ? -9.982  -1.938  -10.454 1.00 0.00 ? 60  LYS A HB3  2  
ATOM 4500  H HG2  . LYS A 1 60  ? -10.953 -0.283  -11.997 1.00 0.00 ? 60  LYS A HG2  2  
ATOM 4501  H HG3  . LYS A 1 60  ? -9.501  -0.356  -12.995 1.00 0.00 ? 60  LYS A HG3  2  
ATOM 4502  H HD2  . LYS A 1 60  ? -10.357 -3.033  -12.597 1.00 0.00 ? 60  LYS A HD2  2  
ATOM 4503  H HD3  . LYS A 1 60  ? -11.788 -2.099  -13.036 1.00 0.00 ? 60  LYS A HD3  2  
ATOM 4504  H HE2  . LYS A 1 60  ? -11.096 -1.927  -15.172 1.00 0.00 ? 60  LYS A HE2  2  
ATOM 4505  H HE3  . LYS A 1 60  ? -9.526  -1.307  -14.661 1.00 0.00 ? 60  LYS A HE3  2  
ATOM 4506  H HZ1  . LYS A 1 60  ? -9.608  -4.019  -14.034 1.00 0.00 ? 60  LYS A HZ1  2  
ATOM 4507  H HZ2  . LYS A 1 60  ? -10.165 -3.865  -15.629 1.00 0.00 ? 60  LYS A HZ2  2  
ATOM 4508  H HZ3  . LYS A 1 60  ? -8.643  -3.245  -15.198 1.00 0.00 ? 60  LYS A HZ3  2  
ATOM 4509  N N    . VAL A 1 61  ? -10.698 0.782   -9.317  1.00 0.00 ? 61  VAL A N    2  
ATOM 4510  C CA   . VAL A 1 61  ? -11.750 1.815   -9.136  1.00 0.00 ? 61  VAL A CA   2  
ATOM 4511  C C    . VAL A 1 61  ? -11.131 3.059   -8.502  1.00 0.00 ? 61  VAL A C    2  
ATOM 4512  O O    . VAL A 1 61  ? -10.914 4.055   -9.159  1.00 0.00 ? 61  VAL A O    2  
ATOM 4513  C CB   . VAL A 1 61  ? -12.840 1.260   -8.222  1.00 0.00 ? 61  VAL A CB   2  
ATOM 4514  C CG1  . VAL A 1 61  ? -13.782 2.387   -7.801  1.00 0.00 ? 61  VAL A CG1  2  
ATOM 4515  C CG2  . VAL A 1 61  ? -13.627 0.191   -8.977  1.00 0.00 ? 61  VAL A CG2  2  
ATOM 4516  H H    . VAL A 1 61  ? -10.678 0.002   -8.727  1.00 0.00 ? 61  VAL A H    2  
ATOM 4517  H HA   . VAL A 1 61  ? -12.177 2.070   -10.094 1.00 0.00 ? 61  VAL A HA   2  
ATOM 4518  H HB   . VAL A 1 61  ? -12.387 0.824   -7.344  1.00 0.00 ? 61  VAL A HB   2  
ATOM 4519  H HG11 . VAL A 1 61  ? -13.429 3.321   -8.208  1.00 0.00 ? 61  VAL A HG11 2  
ATOM 4520  H HG12 . VAL A 1 61  ? -14.774 2.183   -8.173  1.00 0.00 ? 61  VAL A HG12 2  
ATOM 4521  H HG13 . VAL A 1 61  ? -13.805 2.450   -6.723  1.00 0.00 ? 61  VAL A HG13 2  
ATOM 4522  H HG21 . VAL A 1 61  ? -13.026 -0.187  -9.791  1.00 0.00 ? 61  VAL A HG21 2  
ATOM 4523  H HG22 . VAL A 1 61  ? -13.871 -0.617  -8.304  1.00 0.00 ? 61  VAL A HG22 2  
ATOM 4524  H HG23 . VAL A 1 61  ? -14.536 0.623   -9.369  1.00 0.00 ? 61  VAL A HG23 2  
ATOM 4525  N N    . LEU A 1 62  ? -10.839 3.006   -7.231  1.00 0.00 ? 62  LEU A N    2  
ATOM 4526  C CA   . LEU A 1 62  ? -10.228 4.184   -6.554  1.00 0.00 ? 62  LEU A CA   2  
ATOM 4527  C C    . LEU A 1 62  ? -9.128  4.761   -7.451  1.00 0.00 ? 62  LEU A C    2  
ATOM 4528  O O    . LEU A 1 62  ? -8.827  5.937   -7.402  1.00 0.00 ? 62  LEU A O    2  
ATOM 4529  C CB   . LEU A 1 62  ? -9.634  3.735   -5.215  1.00 0.00 ? 62  LEU A CB   2  
ATOM 4530  C CG   . LEU A 1 62  ? -8.822  4.868   -4.581  1.00 0.00 ? 62  LEU A CG   2  
ATOM 4531  C CD1  . LEU A 1 62  ? -9.717  5.701   -3.656  1.00 0.00 ? 62  LEU A CD1  2  
ATOM 4532  C CD2  . LEU A 1 62  ? -7.679  4.262   -3.769  1.00 0.00 ? 62  LEU A CD2  2  
ATOM 4533  H H    . LEU A 1 62  ? -11.019 2.188   -6.721  1.00 0.00 ? 62  LEU A H    2  
ATOM 4534  H HA   . LEU A 1 62  ? -10.986 4.934   -6.383  1.00 0.00 ? 62  LEU A HA   2  
ATOM 4535  H HB2  . LEU A 1 62  ? -10.436 3.457   -4.548  1.00 0.00 ? 62  LEU A HB2  2  
ATOM 4536  H HB3  . LEU A 1 62  ? -8.991  2.883   -5.377  1.00 0.00 ? 62  LEU A HB3  2  
ATOM 4537  H HG   . LEU A 1 62  ? -8.419  5.502   -5.356  1.00 0.00 ? 62  LEU A HG   2  
ATOM 4538  H HD11 . LEU A 1 62  ? -10.754 5.509   -3.883  1.00 0.00 ? 62  LEU A HD11 2  
ATOM 4539  H HD12 . LEU A 1 62  ? -9.519  5.433   -2.627  1.00 0.00 ? 62  LEU A HD12 2  
ATOM 4540  H HD13 . LEU A 1 62  ? -9.505  6.752   -3.797  1.00 0.00 ? 62  LEU A HD13 2  
ATOM 4541  H HD21 . LEU A 1 62  ? -7.789  3.187   -3.743  1.00 0.00 ? 62  LEU A HD21 2  
ATOM 4542  H HD22 . LEU A 1 62  ? -6.737  4.516   -4.228  1.00 0.00 ? 62  LEU A HD22 2  
ATOM 4543  H HD23 . LEU A 1 62  ? -7.707  4.650   -2.762  1.00 0.00 ? 62  LEU A HD23 2  
ATOM 4544  N N    . ALA A 1 63  ? -8.532  3.942   -8.280  1.00 0.00 ? 63  ALA A N    2  
ATOM 4545  C CA   . ALA A 1 63  ? -7.461  4.446   -9.188  1.00 0.00 ? 63  ALA A CA   2  
ATOM 4546  C C    . ALA A 1 63  ? -7.996  5.645   -9.973  1.00 0.00 ? 63  ALA A C    2  
ATOM 4547  O O    . ALA A 1 63  ? -7.476  6.739   -9.887  1.00 0.00 ? 63  ALA A O    2  
ATOM 4548  C CB   . ALA A 1 63  ? -7.053  3.334   -10.162 1.00 0.00 ? 63  ALA A CB   2  
ATOM 4549  H H    . ALA A 1 63  ? -8.796  2.999   -8.309  1.00 0.00 ? 63  ALA A H    2  
ATOM 4550  H HA   . ALA A 1 63  ? -6.605  4.749   -8.605  1.00 0.00 ? 63  ALA A HA   2  
ATOM 4551  H HB1  . ALA A 1 63  ? -7.844  2.601   -10.227 1.00 0.00 ? 63  ALA A HB1  2  
ATOM 4552  H HB2  . ALA A 1 63  ? -6.875  3.756   -11.141 1.00 0.00 ? 63  ALA A HB2  2  
ATOM 4553  H HB3  . ALA A 1 63  ? -6.150  2.856   -9.808  1.00 0.00 ? 63  ALA A HB3  2  
ATOM 4554  N N    . LEU A 1 64  ? -9.039  5.445   -10.731 1.00 0.00 ? 64  LEU A N    2  
ATOM 4555  C CA   . LEU A 1 64  ? -9.621  6.568   -11.518 1.00 0.00 ? 64  LEU A CA   2  
ATOM 4556  C C    . LEU A 1 64  ? -10.289 7.551   -10.562 1.00 0.00 ? 64  LEU A C    2  
ATOM 4557  O O    . LEU A 1 64  ? -10.350 8.735   -10.809 1.00 0.00 ? 64  LEU A O    2  
ATOM 4558  C CB   . LEU A 1 64  ? -10.659 6.009   -12.486 1.00 0.00 ? 64  LEU A CB   2  
ATOM 4559  C CG   . LEU A 1 64  ? -9.943  5.196   -13.560 1.00 0.00 ? 64  LEU A CG   2  
ATOM 4560  C CD1  . LEU A 1 64  ? -10.944 4.283   -14.268 1.00 0.00 ? 64  LEU A CD1  2  
ATOM 4561  C CD2  . LEU A 1 64  ? -9.308  6.145   -14.578 1.00 0.00 ? 64  LEU A CD2  2  
ATOM 4562  H H    . LEU A 1 64  ? -9.444  4.554   -10.778 1.00 0.00 ? 64  LEU A H    2  
ATOM 4563  H HA   . LEU A 1 64  ? -8.839  7.072   -12.071 1.00 0.00 ? 64  LEU A HA   2  
ATOM 4564  H HB2  . LEU A 1 64  ? -11.346 5.373   -11.945 1.00 0.00 ? 64  LEU A HB2  2  
ATOM 4565  H HB3  . LEU A 1 64  ? -11.203 6.818   -12.947 1.00 0.00 ? 64  LEU A HB3  2  
ATOM 4566  H HG   . LEU A 1 64  ? -9.173  4.597   -13.096 1.00 0.00 ? 64  LEU A HG   2  
ATOM 4567  H HD11 . LEU A 1 64  ? -11.917 4.753   -14.274 1.00 0.00 ? 64  LEU A HD11 2  
ATOM 4568  H HD12 . LEU A 1 64  ? -10.621 4.113   -15.284 1.00 0.00 ? 64  LEU A HD12 2  
ATOM 4569  H HD13 . LEU A 1 64  ? -11.004 3.340   -13.746 1.00 0.00 ? 64  LEU A HD13 2  
ATOM 4570  H HD21 . LEU A 1 64  ? -8.640  6.824   -14.069 1.00 0.00 ? 64  LEU A HD21 2  
ATOM 4571  H HD22 . LEU A 1 64  ? -8.753  5.573   -15.307 1.00 0.00 ? 64  LEU A HD22 2  
ATOM 4572  H HD23 . LEU A 1 64  ? -10.083 6.708   -15.077 1.00 0.00 ? 64  LEU A HD23 2  
ATOM 4573  N N    . TYR A 1 65  ? -10.784 7.063   -9.466  1.00 0.00 ? 65  TYR A N    2  
ATOM 4574  C CA   . TYR A 1 65  ? -11.440 7.961   -8.477  1.00 0.00 ? 65  TYR A CA   2  
ATOM 4575  C C    . TYR A 1 65  ? -10.504 9.135   -8.182  1.00 0.00 ? 65  TYR A C    2  
ATOM 4576  O O    . TYR A 1 65  ? -10.935 10.232  -7.883  1.00 0.00 ? 65  TYR A O    2  
ATOM 4577  C CB   . TYR A 1 65  ? -11.708 7.173   -7.193  1.00 0.00 ? 65  TYR A CB   2  
ATOM 4578  C CG   . TYR A 1 65  ? -12.459 8.030   -6.205  1.00 0.00 ? 65  TYR A CG   2  
ATOM 4579  C CD1  . TYR A 1 65  ? -11.756 8.873   -5.338  1.00 0.00 ? 65  TYR A CD1  2  
ATOM 4580  C CD2  . TYR A 1 65  ? -13.858 7.973   -6.146  1.00 0.00 ? 65  TYR A CD2  2  
ATOM 4581  C CE1  . TYR A 1 65  ? -12.447 9.659   -4.410  1.00 0.00 ? 65  TYR A CE1  2  
ATOM 4582  C CE2  . TYR A 1 65  ? -14.550 8.762   -5.218  1.00 0.00 ? 65  TYR A CE2  2  
ATOM 4583  C CZ   . TYR A 1 65  ? -13.844 9.603   -4.349  1.00 0.00 ? 65  TYR A CZ   2  
ATOM 4584  O OH   . TYR A 1 65  ? -14.526 10.380  -3.435  1.00 0.00 ? 65  TYR A OH   2  
ATOM 4585  H H    . TYR A 1 65  ? -10.717 6.103   -9.289  1.00 0.00 ? 65  TYR A H    2  
ATOM 4586  H HA   . TYR A 1 65  ? -12.373 8.329   -8.879  1.00 0.00 ? 65  TYR A HA   2  
ATOM 4587  H HB2  . TYR A 1 65  ? -12.294 6.297   -7.427  1.00 0.00 ? 65  TYR A HB2  2  
ATOM 4588  H HB3  . TYR A 1 65  ? -10.767 6.868   -6.760  1.00 0.00 ? 65  TYR A HB3  2  
ATOM 4589  H HD1  . TYR A 1 65  ? -10.677 8.915   -5.384  1.00 0.00 ? 65  TYR A HD1  2  
ATOM 4590  H HD2  . TYR A 1 65  ? -14.405 7.325   -6.822  1.00 0.00 ? 65  TYR A HD2  2  
ATOM 4591  H HE1  . TYR A 1 65  ? -11.903 10.309  -3.741  1.00 0.00 ? 65  TYR A HE1  2  
ATOM 4592  H HE2  . TYR A 1 65  ? -15.626 8.717   -5.166  1.00 0.00 ? 65  TYR A HE2  2  
ATOM 4593  H HH   . TYR A 1 65  ? -13.904 10.659  -2.759  1.00 0.00 ? 65  TYR A HH   2  
ATOM 4594  N N    . ASN A 1 66  ? -9.223  8.907   -8.280  1.00 0.00 ? 66  ASN A N    2  
ATOM 4595  C CA   . ASN A 1 66  ? -8.236  9.994   -8.023  1.00 0.00 ? 66  ASN A CA   2  
ATOM 4596  C C    . ASN A 1 66  ? -7.799  10.587  -9.356  1.00 0.00 ? 66  ASN A C    2  
ATOM 4597  O O    . ASN A 1 66  ? -7.957  11.763  -9.615  1.00 0.00 ? 66  ASN A O    2  
ATOM 4598  C CB   . ASN A 1 66  ? -7.009  9.404   -7.342  1.00 0.00 ? 66  ASN A CB   2  
ATOM 4599  C CG   . ASN A 1 66  ? -6.131  10.530  -6.795  1.00 0.00 ? 66  ASN A CG   2  
ATOM 4600  O OD1  . ASN A 1 66  ? -4.924  10.492  -6.926  1.00 0.00 ? 66  ASN A OD1  2  
ATOM 4601  N ND2  . ASN A 1 66  ? -6.687  11.540  -6.182  1.00 0.00 ? 66  ASN A ND2  2  
ATOM 4602  H H    . ASN A 1 66  ? -8.908  8.013   -8.530  1.00 0.00 ? 66  ASN A H    2  
ATOM 4603  H HA   . ASN A 1 66  ? -8.675  10.759  -7.400  1.00 0.00 ? 66  ASN A HA   2  
ATOM 4604  H HB2  . ASN A 1 66  ? -7.319  8.756   -6.541  1.00 0.00 ? 66  ASN A HB2  2  
ATOM 4605  H HB3  . ASN A 1 66  ? -6.448  8.836   -8.069  1.00 0.00 ? 66  ASN A HB3  2  
ATOM 4606  H HD21 . ASN A 1 66  ? -7.659  11.573  -6.074  1.00 0.00 ? 66  ASN A HD21 2  
ATOM 4607  H HD22 . ASN A 1 66  ? -6.131  12.268  -5.836  1.00 0.00 ? 66  ASN A HD22 2  
ATOM 4608  N N    . GLN A 1 67  ? -7.248  9.760   -10.201 1.00 0.00 ? 67  GLN A N    2  
ATOM 4609  C CA   . GLN A 1 67  ? -6.785  10.233  -11.538 1.00 0.00 ? 67  GLN A CA   2  
ATOM 4610  C C    . GLN A 1 67  ? -7.789  11.228  -12.117 1.00 0.00 ? 67  GLN A C    2  
ATOM 4611  O O    . GLN A 1 67  ? -7.452  12.079  -12.916 1.00 0.00 ? 67  GLN A O    2  
ATOM 4612  C CB   . GLN A 1 67  ? -6.653  9.031   -12.478 1.00 0.00 ? 67  GLN A CB   2  
ATOM 4613  C CG   . GLN A 1 67  ? -5.233  8.466   -12.390 1.00 0.00 ? 67  GLN A CG   2  
ATOM 4614  C CD   . GLN A 1 67  ? -4.472  8.794   -13.675 1.00 0.00 ? 67  GLN A CD   2  
ATOM 4615  O OE1  . GLN A 1 67  ? -4.052  7.905   -14.390 1.00 0.00 ? 67  GLN A OE1  2  
ATOM 4616  N NE2  . GLN A 1 67  ? -4.274  10.042  -14.003 1.00 0.00 ? 67  GLN A NE2  2  
ATOM 4617  H H    . GLN A 1 67  ? -7.138  8.817   -9.949  1.00 0.00 ? 67  GLN A H    2  
ATOM 4618  H HA   . GLN A 1 67  ? -5.832  10.714  -11.434 1.00 0.00 ? 67  GLN A HA   2  
ATOM 4619  H HB2  . GLN A 1 67  ? -7.362  8.270   -12.187 1.00 0.00 ? 67  GLN A HB2  2  
ATOM 4620  H HB3  . GLN A 1 67  ? -6.854  9.341   -13.491 1.00 0.00 ? 67  GLN A HB3  2  
ATOM 4621  H HG2  . GLN A 1 67  ? -4.723  8.906   -11.546 1.00 0.00 ? 67  GLN A HG2  2  
ATOM 4622  H HG3  . GLN A 1 67  ? -5.280  7.394   -12.264 1.00 0.00 ? 67  GLN A HG3  2  
ATOM 4623  H HE21 . GLN A 1 67  ? -4.612  10.759  -13.426 1.00 0.00 ? 67  GLN A HE21 2  
ATOM 4624  H HE22 . GLN A 1 67  ? -3.788  10.262  -14.825 1.00 0.00 ? 67  GLN A HE22 2  
ATOM 4625  N N    . HIS A 1 68  ? -9.017  11.129  -11.710 1.00 0.00 ? 68  HIS A N    2  
ATOM 4626  C CA   . HIS A 1 68  ? -10.057 12.067  -12.221 1.00 0.00 ? 68  HIS A CA   2  
ATOM 4627  C C    . HIS A 1 68  ? -10.059 13.330  -11.356 1.00 0.00 ? 68  HIS A C    2  
ATOM 4628  O O    . HIS A 1 68  ? -10.084 14.437  -11.855 1.00 0.00 ? 68  HIS A O    2  
ATOM 4629  C CB   . HIS A 1 68  ? -11.432 11.401  -12.147 1.00 0.00 ? 68  HIS A CB   2  
ATOM 4630  C CG   . HIS A 1 68  ? -11.682 10.609  -13.400 1.00 0.00 ? 68  HIS A CG   2  
ATOM 4631  N ND1  . HIS A 1 68  ? -11.326 9.275   -13.518 1.00 0.00 ? 68  HIS A ND1  2  
ATOM 4632  C CD2  . HIS A 1 68  ? -12.263 10.950  -14.595 1.00 0.00 ? 68  HIS A CD2  2  
ATOM 4633  C CE1  . HIS A 1 68  ? -11.696 8.865   -14.745 1.00 0.00 ? 68  HIS A CE1  2  
ATOM 4634  N NE2  . HIS A 1 68  ? -12.273 9.847   -15.443 1.00 0.00 ? 68  HIS A NE2  2  
ATOM 4635  H H    . HIS A 1 68  ? -9.254  10.439  -11.065 1.00 0.00 ? 68  HIS A H    2  
ATOM 4636  H HA   . HIS A 1 68  ? -9.836  12.329  -13.245 1.00 0.00 ? 68  HIS A HA   2  
ATOM 4637  H HB2  . HIS A 1 68  ? -11.470 10.743  -11.292 1.00 0.00 ? 68  HIS A HB2  2  
ATOM 4638  H HB3  . HIS A 1 68  ? -12.194 12.161  -12.049 1.00 0.00 ? 68  HIS A HB3  2  
ATOM 4639  H HD1  . HIS A 1 68  ? -10.885 8.730   -12.834 1.00 0.00 ? 68  HIS A HD1  2  
ATOM 4640  H HD2  . HIS A 1 68  ? -12.657 11.925  -14.837 1.00 0.00 ? 68  HIS A HD2  2  
ATOM 4641  H HE1  . HIS A 1 68  ? -11.549 7.861   -15.117 1.00 0.00 ? 68  HIS A HE1  2  
ATOM 4642  N N    . ASN A 1 69  ? -10.032 13.168  -10.061 1.00 0.00 ? 69  ASN A N    2  
ATOM 4643  C CA   . ASN A 1 69  ? -10.031 14.353  -9.159  1.00 0.00 ? 69  ASN A CA   2  
ATOM 4644  C C    . ASN A 1 69  ? -8.613  14.587  -8.623  1.00 0.00 ? 69  ASN A C    2  
ATOM 4645  O O    . ASN A 1 69  ? -8.155  13.862  -7.763  1.00 0.00 ? 69  ASN A O    2  
ATOM 4646  C CB   . ASN A 1 69  ? -10.975 14.095  -7.982  1.00 0.00 ? 69  ASN A CB   2  
ATOM 4647  C CG   . ASN A 1 69  ? -12.400 13.899  -8.501  1.00 0.00 ? 69  ASN A CG   2  
ATOM 4648  O OD1  . ASN A 1 69  ? -12.874 12.785  -8.604  1.00 0.00 ? 69  ASN A OD1  2  
ATOM 4649  N ND2  . ASN A 1 69  ? -13.109 14.943  -8.834  1.00 0.00 ? 69  ASN A ND2  2  
ATOM 4650  H H    . ASN A 1 69  ? -10.012 12.265  -9.682  1.00 0.00 ? 69  ASN A H    2  
ATOM 4651  H HA   . ASN A 1 69  ? -10.368 15.221  -9.703  1.00 0.00 ? 69  ASN A HA   2  
ATOM 4652  H HB2  . ASN A 1 69  ? -10.656 13.206  -7.455  1.00 0.00 ? 69  ASN A HB2  2  
ATOM 4653  H HB3  . ASN A 1 69  ? -10.950 14.939  -7.310  1.00 0.00 ? 69  ASN A HB3  2  
ATOM 4654  H HD21 . ASN A 1 69  ? -12.727 15.842  -8.751  1.00 0.00 ? 69  ASN A HD21 2  
ATOM 4655  H HD22 . ASN A 1 69  ? -14.024 14.829  -9.167  1.00 0.00 ? 69  ASN A HD22 2  
ATOM 4656  N N    . PRO A 1 70  ? -7.960  15.597  -9.142  1.00 0.00 ? 70  PRO A N    2  
ATOM 4657  C CA   . PRO A 1 70  ? -6.592  15.951  -8.725  1.00 0.00 ? 70  PRO A CA   2  
ATOM 4658  C C    . PRO A 1 70  ? -6.623  16.689  -7.383  1.00 0.00 ? 70  PRO A C    2  
ATOM 4659  O O    . PRO A 1 70  ? -7.209  17.746  -7.260  1.00 0.00 ? 70  PRO A O    2  
ATOM 4660  C CB   . PRO A 1 70  ? -6.101  16.870  -9.845  1.00 0.00 ? 70  PRO A CB   2  
ATOM 4661  C CG   . PRO A 1 70  ? -7.366  17.440  -10.527 1.00 0.00 ? 70  PRO A CG   2  
ATOM 4662  C CD   . PRO A 1 70  ? -8.520  16.479  -10.187 1.00 0.00 ? 70  PRO A CD   2  
ATOM 4663  H HA   . PRO A 1 70  ? -5.971  15.072  -8.666  1.00 0.00 ? 70  PRO A HA   2  
ATOM 4664  H HB2  . PRO A 1 70  ? -5.504  17.671  -9.431  1.00 0.00 ? 70  PRO A HB2  2  
ATOM 4665  H HB3  . PRO A 1 70  ? -5.523  16.308  -10.562 1.00 0.00 ? 70  PRO A HB3  2  
ATOM 4666  H HG2  . PRO A 1 70  ? -7.578  18.429  -10.143 1.00 0.00 ? 70  PRO A HG2  2  
ATOM 4667  H HG3  . PRO A 1 70  ? -7.227  17.479  -11.596 1.00 0.00 ? 70  PRO A HG3  2  
ATOM 4668  H HD2  . PRO A 1 70  ? -9.370  17.029  -9.807  1.00 0.00 ? 70  PRO A HD2  2  
ATOM 4669  H HD3  . PRO A 1 70  ? -8.798  15.899  -11.053 1.00 0.00 ? 70  PRO A HD3  2  
ATOM 4670  N N    . GLY A 1 71  ? -5.997  16.141  -6.378  1.00 0.00 ? 71  GLY A N    2  
ATOM 4671  C CA   . GLY A 1 71  ? -5.994  16.813  -5.048  1.00 0.00 ? 71  GLY A CA   2  
ATOM 4672  C C    . GLY A 1 71  ? -6.629  15.893  -4.004  1.00 0.00 ? 71  GLY A C    2  
ATOM 4673  O O    . GLY A 1 71  ? -6.642  16.193  -2.826  1.00 0.00 ? 71  GLY A O    2  
ATOM 4674  H H    . GLY A 1 71  ? -5.531  15.287  -6.496  1.00 0.00 ? 71  GLY A H    2  
ATOM 4675  H HA2  . GLY A 1 71  ? -4.976  17.037  -4.762  1.00 0.00 ? 71  GLY A HA2  2  
ATOM 4676  H HA3  . GLY A 1 71  ? -6.561  17.731  -5.107  1.00 0.00 ? 71  GLY A HA3  2  
ATOM 4677  N N    . ALA A 1 72  ? -7.151  14.771  -4.421  1.00 0.00 ? 72  ALA A N    2  
ATOM 4678  C CA   . ALA A 1 72  ? -7.774  13.836  -3.449  1.00 0.00 ? 72  ALA A CA   2  
ATOM 4679  C C    . ALA A 1 72  ? -6.726  12.835  -2.978  1.00 0.00 ? 72  ALA A C    2  
ATOM 4680  O O    . ALA A 1 72  ? -6.137  12.113  -3.756  1.00 0.00 ? 72  ALA A O    2  
ATOM 4681  C CB   . ALA A 1 72  ? -8.928  13.090  -4.112  1.00 0.00 ? 72  ALA A CB   2  
ATOM 4682  H H    . ALA A 1 72  ? -7.127  14.542  -5.368  1.00 0.00 ? 72  ALA A H    2  
ATOM 4683  H HA   . ALA A 1 72  ? -8.145  14.394  -2.602  1.00 0.00 ? 72  ALA A HA   2  
ATOM 4684  H HB1  . ALA A 1 72  ? -8.789  13.089  -5.182  1.00 0.00 ? 72  ALA A HB1  2  
ATOM 4685  H HB2  . ALA A 1 72  ? -8.951  12.072  -3.750  1.00 0.00 ? 72  ALA A HB2  2  
ATOM 4686  H HB3  . ALA A 1 72  ? -9.858  13.579  -3.869  1.00 0.00 ? 72  ALA A HB3  2  
ATOM 4687  N N    . SER A 1 73  ? -6.490  12.794  -1.705  1.00 0.00 ? 73  SER A N    2  
ATOM 4688  C CA   . SER A 1 73  ? -5.475  11.850  -1.160  1.00 0.00 ? 73  SER A CA   2  
ATOM 4689  C C    . SER A 1 73  ? -6.070  10.443  -1.079  1.00 0.00 ? 73  SER A C    2  
ATOM 4690  O O    . SER A 1 73  ? -5.406  9.503   -0.690  1.00 0.00 ? 73  SER A O    2  
ATOM 4691  C CB   . SER A 1 73  ? -5.054  12.307  0.237   1.00 0.00 ? 73  SER A CB   2  
ATOM 4692  O OG   . SER A 1 73  ? -4.606  11.183  0.983   1.00 0.00 ? 73  SER A OG   2  
ATOM 4693  H H    . SER A 1 73  ? -6.978  13.393  -1.108  1.00 0.00 ? 73  SER A H    2  
ATOM 4694  H HA   . SER A 1 73  ? -4.612  11.837  -1.809  1.00 0.00 ? 73  SER A HA   2  
ATOM 4695  H HB2  . SER A 1 73  ? -4.253  13.023  0.157   1.00 0.00 ? 73  SER A HB2  2  
ATOM 4696  H HB3  . SER A 1 73  ? -5.898  12.768  0.733   1.00 0.00 ? 73  SER A HB3  2  
ATOM 4697  H HG   . SER A 1 73  ? -4.724  11.379  1.914   1.00 0.00 ? 73  SER A HG   2  
ATOM 4698  N N    . ALA A 1 74  ? -7.314  10.286  -1.444  1.00 0.00 ? 74  ALA A N    2  
ATOM 4699  C CA   . ALA A 1 74  ? -7.941  8.935   -1.383  1.00 0.00 ? 74  ALA A CA   2  
ATOM 4700  C C    . ALA A 1 74  ? -7.378  8.050   -2.496  1.00 0.00 ? 74  ALA A C    2  
ATOM 4701  O O    . ALA A 1 74  ? -7.724  6.894   -2.611  1.00 0.00 ? 74  ALA A O    2  
ATOM 4702  C CB   . ALA A 1 74  ? -9.459  9.062   -1.540  1.00 0.00 ? 74  ALA A CB   2  
ATOM 4703  H H    . ALA A 1 74  ? -7.835  11.055  -1.757  1.00 0.00 ? 74  ALA A H    2  
ATOM 4704  H HA   . ALA A 1 74  ? -7.719  8.485   -0.429  1.00 0.00 ? 74  ALA A HA   2  
ATOM 4705  H HB1  . ALA A 1 74  ? -9.684  9.594   -2.452  1.00 0.00 ? 74  ALA A HB1  2  
ATOM 4706  H HB2  . ALA A 1 74  ? -9.901  8.076   -1.579  1.00 0.00 ? 74  ALA A HB2  2  
ATOM 4707  H HB3  . ALA A 1 74  ? -9.863  9.605   -0.698  1.00 0.00 ? 74  ALA A HB3  2  
ATOM 4708  N N    . ALA A 1 75  ? -6.508  8.580   -3.312  1.00 0.00 ? 75  ALA A N    2  
ATOM 4709  C CA   . ALA A 1 75  ? -5.916  7.763   -4.409  1.00 0.00 ? 75  ALA A CA   2  
ATOM 4710  C C    . ALA A 1 75  ? -5.423  6.429   -3.834  1.00 0.00 ? 75  ALA A C    2  
ATOM 4711  O O    . ALA A 1 75  ? -5.531  6.194   -2.647  1.00 0.00 ? 75  ALA A O    2  
ATOM 4712  C CB   . ALA A 1 75  ? -4.742  8.530   -5.019  1.00 0.00 ? 75  ALA A CB   2  
ATOM 4713  H H    . ALA A 1 75  ? -6.237  9.514   -3.200  1.00 0.00 ? 75  ALA A H    2  
ATOM 4714  H HA   . ALA A 1 75  ? -6.662  7.578   -5.168  1.00 0.00 ? 75  ALA A HA   2  
ATOM 4715  H HB1  . ALA A 1 75  ? -4.729  9.538   -4.628  1.00 0.00 ? 75  ALA A HB1  2  
ATOM 4716  H HB2  . ALA A 1 75  ? -3.817  8.035   -4.764  1.00 0.00 ? 75  ALA A HB2  2  
ATOM 4717  H HB3  . ALA A 1 75  ? -4.851  8.561   -6.092  1.00 0.00 ? 75  ALA A HB3  2  
ATOM 4718  N N    . PRO A 1 76  ? -4.887  5.592   -4.687  1.00 0.00 ? 76  PRO A N    2  
ATOM 4719  C CA   . PRO A 1 76  ? -4.371  4.275   -4.274  1.00 0.00 ? 76  PRO A CA   2  
ATOM 4720  C C    . PRO A 1 76  ? -3.049  4.457   -3.534  1.00 0.00 ? 76  PRO A C    2  
ATOM 4721  O O    . PRO A 1 76  ? -2.681  5.560   -3.185  1.00 0.00 ? 76  PRO A O    2  
ATOM 4722  C CB   . PRO A 1 76  ? -4.170  3.531   -5.591  1.00 0.00 ? 76  PRO A CB   2  
ATOM 4723  C CG   . PRO A 1 76  ? -4.037  4.619   -6.679  1.00 0.00 ? 76  PRO A CG   2  
ATOM 4724  C CD   . PRO A 1 76  ? -4.736  5.876   -6.129  1.00 0.00 ? 76  PRO A CD   2  
ATOM 4725  H HA   . PRO A 1 76  ? -5.088  3.758   -3.658  1.00 0.00 ? 76  PRO A HA   2  
ATOM 4726  H HB2  . PRO A 1 76  ? -3.272  2.931   -5.542  1.00 0.00 ? 76  PRO A HB2  2  
ATOM 4727  H HB3  . PRO A 1 76  ? -5.025  2.908   -5.801  1.00 0.00 ? 76  PRO A HB3  2  
ATOM 4728  H HG2  . PRO A 1 76  ? -2.993  4.831   -6.865  1.00 0.00 ? 76  PRO A HG2  2  
ATOM 4729  H HG3  . PRO A 1 76  ? -4.522  4.298   -7.584  1.00 0.00 ? 76  PRO A HG3  2  
ATOM 4730  H HD2  . PRO A 1 76  ? -4.114  6.744   -6.288  1.00 0.00 ? 76  PRO A HD2  2  
ATOM 4731  H HD3  . PRO A 1 76  ? -5.702  6.008   -6.589  1.00 0.00 ? 76  PRO A HD3  2  
ATOM 4732  N N    . CYS A 1 77  ? -2.332  3.401   -3.266  1.00 0.00 ? 77  CYS A N    2  
ATOM 4733  C CA   . CYS A 1 77  ? -1.061  3.587   -2.525  1.00 0.00 ? 77  CYS A CA   2  
ATOM 4734  C C    . CYS A 1 77  ? 0.017   2.582   -2.956  1.00 0.00 ? 77  CYS A C    2  
ATOM 4735  O O    . CYS A 1 77  ? 0.116   1.497   -2.418  1.00 0.00 ? 77  CYS A O    2  
ATOM 4736  C CB   . CYS A 1 77  ? -1.342  3.432   -1.034  1.00 0.00 ? 77  CYS A CB   2  
ATOM 4737  S SG   . CYS A 1 77  ? -0.983  4.995   -0.204  1.00 0.00 ? 77  CYS A SG   2  
ATOM 4738  H H    . CYS A 1 77  ? -2.633  2.505   -3.528  1.00 0.00 ? 77  CYS A H    2  
ATOM 4739  H HA   . CYS A 1 77  ? -0.697  4.586   -2.706  1.00 0.00 ? 77  CYS A HA   2  
ATOM 4740  H HB2  . CYS A 1 77  ? -2.380  3.173   -0.887  1.00 0.00 ? 77  CYS A HB2  2  
ATOM 4741  H HB3  . CYS A 1 77  ? -0.714  2.654   -0.627  1.00 0.00 ? 77  CYS A HB3  2  
ATOM 4742  N N    . CYS A 1 78  ? 0.850   2.952   -3.895  1.00 0.00 ? 78  CYS A N    2  
ATOM 4743  C CA   . CYS A 1 78  ? 1.957   2.037   -4.318  1.00 0.00 ? 78  CYS A CA   2  
ATOM 4744  C C    . CYS A 1 78  ? 2.701   1.576   -3.050  1.00 0.00 ? 78  CYS A C    2  
ATOM 4745  O O    . CYS A 1 78  ? 2.832   2.328   -2.105  1.00 0.00 ? 78  CYS A O    2  
ATOM 4746  C CB   . CYS A 1 78  ? 2.919   2.804   -5.239  1.00 0.00 ? 78  CYS A CB   2  
ATOM 4747  S SG   . CYS A 1 78  ? 4.389   1.801   -5.569  1.00 0.00 ? 78  CYS A SG   2  
ATOM 4748  H H    . CYS A 1 78  ? 0.762   3.840   -4.306  1.00 0.00 ? 78  CYS A H    2  
ATOM 4749  H HA   . CYS A 1 78  ? 1.549   1.181   -4.837  1.00 0.00 ? 78  CYS A HA   2  
ATOM 4750  H HB2  . CYS A 1 78  ? 2.421   3.029   -6.169  1.00 0.00 ? 78  CYS A HB2  2  
ATOM 4751  H HB3  . CYS A 1 78  ? 3.219   3.732   -4.761  1.00 0.00 ? 78  CYS A HB3  2  
ATOM 4752  N N    . VAL A 1 79  ? 3.172   0.351   -3.000  1.00 0.00 ? 79  VAL A N    2  
ATOM 4753  C CA   . VAL A 1 79  ? 3.871   -0.115  -1.762  1.00 0.00 ? 79  VAL A CA   2  
ATOM 4754  C C    . VAL A 1 79  ? 5.013   -1.091  -2.110  1.00 0.00 ? 79  VAL A C    2  
ATOM 4755  O O    . VAL A 1 79  ? 5.254   -1.367  -3.262  1.00 0.00 ? 79  VAL A O    2  
ATOM 4756  C CB   . VAL A 1 79  ? 2.841   -0.798  -0.849  1.00 0.00 ? 79  VAL A CB   2  
ATOM 4757  C CG1  . VAL A 1 79  ? 1.505   -0.086  -0.989  1.00 0.00 ? 79  VAL A CG1  2  
ATOM 4758  C CG2  . VAL A 1 79  ? 2.659   -2.265  -1.250  1.00 0.00 ? 79  VAL A CG2  2  
ATOM 4759  H H    . VAL A 1 79  ? 3.053   -0.254  -3.751  1.00 0.00 ? 79  VAL A H    2  
ATOM 4760  H HA   . VAL A 1 79  ? 4.281   0.738   -1.256  1.00 0.00 ? 79  VAL A HA   2  
ATOM 4761  H HB   . VAL A 1 79  ? 3.163   -0.734  0.174   1.00 0.00 ? 79  VAL A HB   2  
ATOM 4762  H HG11 . VAL A 1 79  ? 1.666   0.979   -1.003  1.00 0.00 ? 79  VAL A HG11 2  
ATOM 4763  H HG12 . VAL A 1 79  ? 1.032   -0.393  -1.912  1.00 0.00 ? 79  VAL A HG12 2  
ATOM 4764  H HG13 . VAL A 1 79  ? 0.874   -0.346  -0.156  1.00 0.00 ? 79  VAL A HG13 2  
ATOM 4765  H HG21 . VAL A 1 79  ? 2.706   -2.352  -2.326  1.00 0.00 ? 79  VAL A HG21 2  
ATOM 4766  H HG22 . VAL A 1 79  ? 3.441   -2.859  -0.805  1.00 0.00 ? 79  VAL A HG22 2  
ATOM 4767  H HG23 . VAL A 1 79  ? 1.697   -2.614  -0.902  1.00 0.00 ? 79  VAL A HG23 2  
ATOM 4768  N N    . PRO A 1 80  ? 5.686   -1.577  -1.087  1.00 0.00 ? 80  PRO A N    2  
ATOM 4769  C CA   . PRO A 1 80  ? 6.807   -2.525  -1.237  1.00 0.00 ? 80  PRO A CA   2  
ATOM 4770  C C    . PRO A 1 80  ? 6.285   -3.969  -1.271  1.00 0.00 ? 80  PRO A C    2  
ATOM 4771  O O    . PRO A 1 80  ? 5.778   -4.472  -0.288  1.00 0.00 ? 80  PRO A O    2  
ATOM 4772  C CB   . PRO A 1 80  ? 7.624   -2.303  0.038   1.00 0.00 ? 80  PRO A CB   2  
ATOM 4773  C CG   . PRO A 1 80  ? 6.648   -1.711  1.084   1.00 0.00 ? 80  PRO A CG   2  
ATOM 4774  C CD   . PRO A 1 80  ? 5.412   -1.211  0.313   1.00 0.00 ? 80  PRO A CD   2  
ATOM 4775  H HA   . PRO A 1 80  ? 7.404   -2.299  -2.104  1.00 0.00 ? 80  PRO A HA   2  
ATOM 4776  H HB2  . PRO A 1 80  ? 8.024   -3.245  0.389   1.00 0.00 ? 80  PRO A HB2  2  
ATOM 4777  H HB3  . PRO A 1 80  ? 8.423   -1.604  -0.151  1.00 0.00 ? 80  PRO A HB3  2  
ATOM 4778  H HG2  . PRO A 1 80  ? 6.360   -2.476  1.792   1.00 0.00 ? 80  PRO A HG2  2  
ATOM 4779  H HG3  . PRO A 1 80  ? 7.114   -0.887  1.597   1.00 0.00 ? 80  PRO A HG3  2  
ATOM 4780  H HD2  . PRO A 1 80  ? 4.528   -1.717  0.670   1.00 0.00 ? 80  PRO A HD2  2  
ATOM 4781  H HD3  . PRO A 1 80  ? 5.307   -0.142  0.409   1.00 0.00 ? 80  PRO A HD3  2  
ATOM 4782  N N    . GLN A 1 81  ? 6.412   -4.645  -2.380  1.00 0.00 ? 81  GLN A N    2  
ATOM 4783  C CA   . GLN A 1 81  ? 5.932   -6.053  -2.450  1.00 0.00 ? 81  GLN A CA   2  
ATOM 4784  C C    . GLN A 1 81  ? 6.983   -6.969  -1.822  1.00 0.00 ? 81  GLN A C    2  
ATOM 4785  O O    . GLN A 1 81  ? 6.788   -7.513  -0.754  1.00 0.00 ? 81  GLN A O    2  
ATOM 4786  C CB   . GLN A 1 81  ? 5.717   -6.448  -3.914  1.00 0.00 ? 81  GLN A CB   2  
ATOM 4787  C CG   . GLN A 1 81  ? 4.625   -7.516  -3.999  1.00 0.00 ? 81  GLN A CG   2  
ATOM 4788  C CD   . GLN A 1 81  ? 5.201   -8.788  -4.623  1.00 0.00 ? 81  GLN A CD   2  
ATOM 4789  O OE1  . GLN A 1 81  ? 5.909   -8.728  -5.608  1.00 0.00 ? 81  GLN A OE1  2  
ATOM 4790  N NE2  . GLN A 1 81  ? 4.921   -9.946  -4.090  1.00 0.00 ? 81  GLN A NE2  2  
ATOM 4791  H H    . GLN A 1 81  ? 6.829   -4.233  -3.159  1.00 0.00 ? 81  GLN A H    2  
ATOM 4792  H HA   . GLN A 1 81  ? 5.001   -6.145  -1.910  1.00 0.00 ? 81  GLN A HA   2  
ATOM 4793  H HB2  . GLN A 1 81  ? 5.417   -5.579  -4.480  1.00 0.00 ? 81  GLN A HB2  2  
ATOM 4794  H HB3  . GLN A 1 81  ? 6.636   -6.842  -4.319  1.00 0.00 ? 81  GLN A HB3  2  
ATOM 4795  H HG2  . GLN A 1 81  ? 4.259   -7.735  -3.006  1.00 0.00 ? 81  GLN A HG2  2  
ATOM 4796  H HG3  . GLN A 1 81  ? 3.813   -7.152  -4.610  1.00 0.00 ? 81  GLN A HG3  2  
ATOM 4797  H HE21 . GLN A 1 81  ? 4.349   -9.994  -3.296  1.00 0.00 ? 81  GLN A HE21 2  
ATOM 4798  H HE22 . GLN A 1 81  ? 5.284   -10.767 -4.484  1.00 0.00 ? 81  GLN A HE22 2  
ATOM 4799  N N    . ALA A 1 82  ? 8.103   -7.132  -2.472  1.00 0.00 ? 82  ALA A N    2  
ATOM 4800  C CA   . ALA A 1 82  ? 9.173   -8.001  -1.907  1.00 0.00 ? 82  ALA A CA   2  
ATOM 4801  C C    . ALA A 1 82  ? 10.112  -7.143  -1.058  1.00 0.00 ? 82  ALA A C    2  
ATOM 4802  O O    . ALA A 1 82  ? 10.175  -5.940  -1.213  1.00 0.00 ? 82  ALA A O    2  
ATOM 4803  C CB   . ALA A 1 82  ? 9.962   -8.649  -3.047  1.00 0.00 ? 82  ALA A CB   2  
ATOM 4804  H H    . ALA A 1 82  ? 8.243   -6.675  -3.328  1.00 0.00 ? 82  ALA A H    2  
ATOM 4805  H HA   . ALA A 1 82  ? 8.728   -8.768  -1.291  1.00 0.00 ? 82  ALA A HA   2  
ATOM 4806  H HB1  . ALA A 1 82  ? 9.518   -8.375  -3.993  1.00 0.00 ? 82  ALA A HB1  2  
ATOM 4807  H HB2  . ALA A 1 82  ? 10.985  -8.308  -3.017  1.00 0.00 ? 82  ALA A HB2  2  
ATOM 4808  H HB3  . ALA A 1 82  ? 9.937   -9.723  -2.936  1.00 0.00 ? 82  ALA A HB3  2  
ATOM 4809  N N    . LEU A 1 83  ? 10.841  -7.745  -0.159  1.00 0.00 ? 83  LEU A N    2  
ATOM 4810  C CA   . LEU A 1 83  ? 11.765  -6.947  0.693   1.00 0.00 ? 83  LEU A CA   2  
ATOM 4811  C C    . LEU A 1 83  ? 13.079  -7.691  0.877   1.00 0.00 ? 83  LEU A C    2  
ATOM 4812  O O    . LEU A 1 83  ? 13.363  -8.670  0.214   1.00 0.00 ? 83  LEU A O    2  
ATOM 4813  C CB   . LEU A 1 83  ? 11.130  -6.722  2.068   1.00 0.00 ? 83  LEU A CB   2  
ATOM 4814  C CG   . LEU A 1 83  ? 9.852   -5.910  1.907   1.00 0.00 ? 83  LEU A CG   2  
ATOM 4815  C CD1  . LEU A 1 83  ? 8.856   -6.298  3.001   1.00 0.00 ? 83  LEU A CD1  2  
ATOM 4816  C CD2  . LEU A 1 83  ? 10.181  -4.422  2.024   1.00 0.00 ? 83  LEU A CD2  2  
ATOM 4817  H H    . LEU A 1 83  ? 10.779  -8.715  -0.042  1.00 0.00 ? 83  LEU A H    2  
ATOM 4818  H HA   . LEU A 1 83  ? 11.953  -5.991  0.227   1.00 0.00 ? 83  LEU A HA   2  
ATOM 4819  H HB2  . LEU A 1 83  ? 10.900  -7.675  2.521   1.00 0.00 ? 83  LEU A HB2  2  
ATOM 4820  H HB3  . LEU A 1 83  ? 11.819  -6.182  2.699   1.00 0.00 ? 83  LEU A HB3  2  
ATOM 4821  H HG   . LEU A 1 83  ? 9.425   -6.111  0.939   1.00 0.00 ? 83  LEU A HG   2  
ATOM 4822  H HD11 . LEU A 1 83  ? 8.876   -7.368  3.142   1.00 0.00 ? 83  LEU A HD11 2  
ATOM 4823  H HD12 . LEU A 1 83  ? 9.127   -5.807  3.924   1.00 0.00 ? 83  LEU A HD12 2  
ATOM 4824  H HD13 . LEU A 1 83  ? 7.863   -5.992  2.708   1.00 0.00 ? 83  LEU A HD13 2  
ATOM 4825  H HD21 . LEU A 1 83  ? 10.887  -4.273  2.827   1.00 0.00 ? 83  LEU A HD21 2  
ATOM 4826  H HD22 . LEU A 1 83  ? 10.612  -4.075  1.097   1.00 0.00 ? 83  LEU A HD22 2  
ATOM 4827  H HD23 . LEU A 1 83  ? 9.277   -3.868  2.231   1.00 0.00 ? 83  LEU A HD23 2  
ATOM 4828  N N    . GLU A 1 84  ? 13.877  -7.227  1.788   1.00 0.00 ? 84  GLU A N    2  
ATOM 4829  C CA   . GLU A 1 84  ? 15.184  -7.878  2.062   1.00 0.00 ? 84  GLU A CA   2  
ATOM 4830  C C    . GLU A 1 84  ? 15.543  -7.637  3.528   1.00 0.00 ? 84  GLU A C    2  
ATOM 4831  O O    . GLU A 1 84  ? 15.055  -6.705  4.131   1.00 0.00 ? 84  GLU A O    2  
ATOM 4832  C CB   . GLU A 1 84  ? 16.260  -7.273  1.158   1.00 0.00 ? 84  GLU A CB   2  
ATOM 4833  C CG   . GLU A 1 84  ? 16.479  -8.180  -0.054  1.00 0.00 ? 84  GLU A CG   2  
ATOM 4834  C CD   . GLU A 1 84  ? 17.847  -8.855  0.054   1.00 0.00 ? 84  GLU A CD   2  
ATOM 4835  O OE1  . GLU A 1 84  ? 18.788  -8.184  0.447   1.00 0.00 ? 84  GLU A OE1  2  
ATOM 4836  O OE2  . GLU A 1 84  ? 17.932  -10.031 -0.259  1.00 0.00 ? 84  GLU A OE2  2  
ATOM 4837  H H    . GLU A 1 84  ? 13.606  -6.439  2.305   1.00 0.00 ? 84  GLU A H    2  
ATOM 4838  H HA   . GLU A 1 84  ? 15.106  -8.940  1.876   1.00 0.00 ? 84  GLU A HA   2  
ATOM 4839  H HB2  . GLU A 1 84  ? 15.941  -6.296  0.824   1.00 0.00 ? 84  GLU A HB2  2  
ATOM 4840  H HB3  . GLU A 1 84  ? 17.184  -7.181  1.708   1.00 0.00 ? 84  GLU A HB3  2  
ATOM 4841  H HG2  . GLU A 1 84  ? 15.706  -8.934  -0.084  1.00 0.00 ? 84  GLU A HG2  2  
ATOM 4842  H HG3  . GLU A 1 84  ? 16.441  -7.590  -0.957  1.00 0.00 ? 84  GLU A HG3  2  
ATOM 4843  N N    . PRO A 1 85  ? 16.379  -8.485  4.060   1.00 0.00 ? 85  PRO A N    2  
ATOM 4844  C CA   . PRO A 1 85  ? 16.810  -8.390  5.464   1.00 0.00 ? 85  PRO A CA   2  
ATOM 4845  C C    . PRO A 1 85  ? 17.805  -7.239  5.651   1.00 0.00 ? 85  PRO A C    2  
ATOM 4846  O O    . PRO A 1 85  ? 17.913  -6.360  4.819   1.00 0.00 ? 85  PRO A O    2  
ATOM 4847  C CB   . PRO A 1 85  ? 17.451  -9.752  5.739   1.00 0.00 ? 85  PRO A CB   2  
ATOM 4848  C CG   . PRO A 1 85  ? 17.841  -10.335 4.363   1.00 0.00 ? 85  PRO A CG   2  
ATOM 4849  C CD   . PRO A 1 85  ? 16.976  -9.610  3.315   1.00 0.00 ? 85  PRO A CD   2  
ATOM 4850  H HA   . PRO A 1 85  ? 15.956  -8.254  6.107   1.00 0.00 ? 85  PRO A HA   2  
ATOM 4851  H HB2  . PRO A 1 85  ? 18.330  -9.628  6.358   1.00 0.00 ? 85  PRO A HB2  2  
ATOM 4852  H HB3  . PRO A 1 85  ? 16.742  -10.404 6.225   1.00 0.00 ? 85  PRO A HB3  2  
ATOM 4853  H HG2  . PRO A 1 85  ? 18.888  -10.158 4.170   1.00 0.00 ? 85  PRO A HG2  2  
ATOM 4854  H HG3  . PRO A 1 85  ? 17.628  -11.393 4.338   1.00 0.00 ? 85  PRO A HG3  2  
ATOM 4855  H HD2  . PRO A 1 85  ? 17.591  -9.247  2.504   1.00 0.00 ? 85  PRO A HD2  2  
ATOM 4856  H HD3  . PRO A 1 85  ? 16.202  -10.264 2.943   1.00 0.00 ? 85  PRO A HD3  2  
ATOM 4857  N N    . LEU A 1 86  ? 18.510  -7.221  6.750   1.00 0.00 ? 86  LEU A N    2  
ATOM 4858  C CA   . LEU A 1 86  ? 19.468  -6.107  6.997   1.00 0.00 ? 86  LEU A CA   2  
ATOM 4859  C C    . LEU A 1 86  ? 20.426  -6.494  8.140   1.00 0.00 ? 86  LEU A C    2  
ATOM 4860  O O    . LEU A 1 86  ? 20.011  -6.612  9.272   1.00 0.00 ? 86  LEU A O    2  
ATOM 4861  C CB   . LEU A 1 86  ? 18.640  -4.852  7.353   1.00 0.00 ? 86  LEU A CB   2  
ATOM 4862  C CG   . LEU A 1 86  ? 19.369  -3.941  8.352   1.00 0.00 ? 86  LEU A CG   2  
ATOM 4863  C CD1  . LEU A 1 86  ? 20.388  -3.063  7.633   1.00 0.00 ? 86  LEU A CD1  2  
ATOM 4864  C CD2  . LEU A 1 86  ? 18.348  -3.042  9.049   1.00 0.00 ? 86  LEU A CD2  2  
ATOM 4865  H H    . LEU A 1 86  ? 18.395  -7.927  7.421   1.00 0.00 ? 86  LEU A H    2  
ATOM 4866  H HA   . LEU A 1 86  ? 20.031  -5.917  6.097   1.00 0.00 ? 86  LEU A HA   2  
ATOM 4867  H HB2  . LEU A 1 86  ? 18.446  -4.294  6.450   1.00 0.00 ? 86  LEU A HB2  2  
ATOM 4868  H HB3  . LEU A 1 86  ? 17.699  -5.163  7.779   1.00 0.00 ? 86  LEU A HB3  2  
ATOM 4869  H HG   . LEU A 1 86  ? 19.869  -4.541  9.087   1.00 0.00 ? 86  LEU A HG   2  
ATOM 4870  H HD11 . LEU A 1 86  ? 20.360  -3.269  6.576   1.00 0.00 ? 86  LEU A HD11 2  
ATOM 4871  H HD12 . LEU A 1 86  ? 20.147  -2.024  7.806   1.00 0.00 ? 86  LEU A HD12 2  
ATOM 4872  H HD13 . LEU A 1 86  ? 21.375  -3.271  8.018   1.00 0.00 ? 86  LEU A HD13 2  
ATOM 4873  H HD21 . LEU A 1 86  ? 17.374  -3.506  9.012   1.00 0.00 ? 86  LEU A HD21 2  
ATOM 4874  H HD22 . LEU A 1 86  ? 18.640  -2.897  10.078  1.00 0.00 ? 86  LEU A HD22 2  
ATOM 4875  H HD23 . LEU A 1 86  ? 18.311  -2.086  8.547   1.00 0.00 ? 86  LEU A HD23 2  
ATOM 4876  N N    . PRO A 1 87  ? 21.686  -6.662  7.812   1.00 0.00 ? 87  PRO A N    2  
ATOM 4877  C CA   . PRO A 1 87  ? 22.723  -7.019  8.802   1.00 0.00 ? 87  PRO A CA   2  
ATOM 4878  C C    . PRO A 1 87  ? 23.084  -5.787  9.632   1.00 0.00 ? 87  PRO A C    2  
ATOM 4879  O O    . PRO A 1 87  ? 23.586  -4.807  9.119   1.00 0.00 ? 87  PRO A O    2  
ATOM 4880  C CB   . PRO A 1 87  ? 23.904  -7.475  7.941   1.00 0.00 ? 87  PRO A CB   2  
ATOM 4881  C CG   . PRO A 1 87  ? 23.696  -6.840  6.545   1.00 0.00 ? 87  PRO A CG   2  
ATOM 4882  C CD   . PRO A 1 87  ? 22.197  -6.508  6.434   1.00 0.00 ? 87  PRO A CD   2  
ATOM 4883  H HA   . PRO A 1 87  ? 22.393  -7.825  9.440   1.00 0.00 ? 87  PRO A HA   2  
ATOM 4884  H HB2  . PRO A 1 87  ? 24.833  -7.132  8.375   1.00 0.00 ? 87  PRO A HB2  2  
ATOM 4885  H HB3  . PRO A 1 87  ? 23.908  -8.550  7.854   1.00 0.00 ? 87  PRO A HB3  2  
ATOM 4886  H HG2  . PRO A 1 87  ? 24.287  -5.938  6.459   1.00 0.00 ? 87  PRO A HG2  2  
ATOM 4887  H HG3  . PRO A 1 87  ? 23.973  -7.541  5.773   1.00 0.00 ? 87  PRO A HG3  2  
ATOM 4888  H HD2  . PRO A 1 87  ? 22.059  -5.493  6.089   1.00 0.00 ? 87  PRO A HD2  2  
ATOM 4889  H HD3  . PRO A 1 87  ? 21.702  -7.205  5.775   1.00 0.00 ? 87  PRO A HD3  2  
ATOM 4890  N N    . ILE A 1 88  ? 22.817  -5.819  10.908  1.00 0.00 ? 88  ILE A N    2  
ATOM 4891  C CA   . ILE A 1 88  ? 23.129  -4.637  11.756  1.00 0.00 ? 88  ILE A CA   2  
ATOM 4892  C C    . ILE A 1 88  ? 23.918  -5.056  12.991  1.00 0.00 ? 88  ILE A C    2  
ATOM 4893  O O    . ILE A 1 88  ? 24.465  -6.137  13.070  1.00 0.00 ? 88  ILE A O    2  
ATOM 4894  C CB   . ILE A 1 88  ? 21.821  -3.980  12.211  1.00 0.00 ? 88  ILE A CB   2  
ATOM 4895  C CG1  . ILE A 1 88  ? 21.225  -4.768  13.383  1.00 0.00 ? 88  ILE A CG1  2  
ATOM 4896  C CG2  . ILE A 1 88  ? 20.828  -3.985  11.058  1.00 0.00 ? 88  ILE A CG2  2  
ATOM 4897  C CD1  . ILE A 1 88  ? 19.812  -4.277  13.674  1.00 0.00 ? 88  ILE A CD1  2  
ATOM 4898  H H    . ILE A 1 88  ? 22.399  -6.612  11.304  1.00 0.00 ? 88  ILE A H    2  
ATOM 4899  H HA   . ILE A 1 88  ? 23.705  -3.926  11.185  1.00 0.00 ? 88  ILE A HA   2  
ATOM 4900  H HB   . ILE A 1 88  ? 22.014  -2.962  12.518  1.00 0.00 ? 88  ILE A HB   2  
ATOM 4901  H HG12 . ILE A 1 88  ? 21.200  -5.814  13.131  1.00 0.00 ? 88  ILE A HG12 2  
ATOM 4902  H HG13 . ILE A 1 88  ? 21.833  -4.631  14.255  1.00 0.00 ? 88  ILE A HG13 2  
ATOM 4903  H HG21 . ILE A 1 88  ? 21.359  -4.130  10.129  1.00 0.00 ? 88  ILE A HG21 2  
ATOM 4904  H HG22 . ILE A 1 88  ? 20.121  -4.791  11.197  1.00 0.00 ? 88  ILE A HG22 2  
ATOM 4905  H HG23 . ILE A 1 88  ? 20.301  -3.044  11.031  1.00 0.00 ? 88  ILE A HG23 2  
ATOM 4906  H HD11 . ILE A 1 88  ? 19.525  -3.545  12.937  1.00 0.00 ? 88  ILE A HD11 2  
ATOM 4907  H HD12 . ILE A 1 88  ? 19.130  -5.112  13.639  1.00 0.00 ? 88  ILE A HD12 2  
ATOM 4908  H HD13 . ILE A 1 88  ? 19.785  -3.831  14.657  1.00 0.00 ? 88  ILE A HD13 2  
ATOM 4909  N N    . VAL A 1 89  ? 23.935  -4.194  13.964  1.00 0.00 ? 89  VAL A N    2  
ATOM 4910  C CA   . VAL A 1 89  ? 24.637  -4.479  15.240  1.00 0.00 ? 89  VAL A CA   2  
ATOM 4911  C C    . VAL A 1 89  ? 24.140  -3.487  16.287  1.00 0.00 ? 89  VAL A C    2  
ATOM 4912  O O    . VAL A 1 89  ? 24.423  -2.309  16.215  1.00 0.00 ? 89  VAL A O    2  
ATOM 4913  C CB   . VAL A 1 89  ? 26.148  -4.300  15.080  1.00 0.00 ? 89  VAL A CB   2  
ATOM 4914  C CG1  . VAL A 1 89  ? 26.847  -4.879  16.309  1.00 0.00 ? 89  VAL A CG1  2  
ATOM 4915  C CG2  . VAL A 1 89  ? 26.641  -5.021  13.823  1.00 0.00 ? 89  VAL A CG2  2  
ATOM 4916  H H    . VAL A 1 89  ? 23.450  -3.350  13.860  1.00 0.00 ? 89  VAL A H    2  
ATOM 4917  H HA   . VAL A 1 89  ? 24.413  -5.485  15.556  1.00 0.00 ? 89  VAL A HA   2  
ATOM 4918  H HB   . VAL A 1 89  ? 26.376  -3.245  15.004  1.00 0.00 ? 89  VAL A HB   2  
ATOM 4919  H HG11 . VAL A 1 89  ? 26.156  -5.509  16.851  1.00 0.00 ? 89  VAL A HG11 2  
ATOM 4920  H HG12 . VAL A 1 89  ? 27.699  -5.463  15.998  1.00 0.00 ? 89  VAL A HG12 2  
ATOM 4921  H HG13 . VAL A 1 89  ? 27.175  -4.073  16.948  1.00 0.00 ? 89  VAL A HG13 2  
ATOM 4922  H HG21 . VAL A 1 89  ? 26.367  -6.062  13.874  1.00 0.00 ? 89  VAL A HG21 2  
ATOM 4923  H HG22 . VAL A 1 89  ? 26.193  -4.571  12.950  1.00 0.00 ? 89  VAL A HG22 2  
ATOM 4924  H HG23 . VAL A 1 89  ? 27.716  -4.935  13.758  1.00 0.00 ? 89  VAL A HG23 2  
ATOM 4925  N N    . TYR A 1 90  ? 23.405  -3.943  17.256  1.00 0.00 ? 90  TYR A N    2  
ATOM 4926  C CA   . TYR A 1 90  ? 22.898  -3.006  18.293  1.00 0.00 ? 90  TYR A CA   2  
ATOM 4927  C C    . TYR A 1 90  ? 23.428  -3.421  19.663  1.00 0.00 ? 90  TYR A C    2  
ATOM 4928  O O    . TYR A 1 90  ? 24.276  -4.282  19.775  1.00 0.00 ? 90  TYR A O    2  
ATOM 4929  C CB   . TYR A 1 90  ? 21.370  -3.021  18.303  1.00 0.00 ? 90  TYR A CB   2  
ATOM 4930  C CG   . TYR A 1 90  ? 20.858  -4.422  18.074  1.00 0.00 ? 90  TYR A CG   2  
ATOM 4931  C CD1  . TYR A 1 90  ? 20.863  -4.964  16.784  1.00 0.00 ? 90  TYR A CD1  2  
ATOM 4932  C CD2  . TYR A 1 90  ? 20.365  -5.175  19.147  1.00 0.00 ? 90  TYR A CD2  2  
ATOM 4933  C CE1  . TYR A 1 90  ? 20.377  -6.259  16.564  1.00 0.00 ? 90  TYR A CE1  2  
ATOM 4934  C CE2  . TYR A 1 90  ? 19.880  -6.469  18.927  1.00 0.00 ? 90  TYR A CE2  2  
ATOM 4935  C CZ   . TYR A 1 90  ? 19.885  -7.012  17.636  1.00 0.00 ? 90  TYR A CZ   2  
ATOM 4936  O OH   . TYR A 1 90  ? 19.405  -8.287  17.422  1.00 0.00 ? 90  TYR A OH   2  
ATOM 4937  H H    . TYR A 1 90  ? 23.188  -4.896  17.302  1.00 0.00 ? 90  TYR A H    2  
ATOM 4938  H HA   . TYR A 1 90  ? 23.242  -2.006  18.064  1.00 0.00 ? 90  TYR A HA   2  
ATOM 4939  H HB2  . TYR A 1 90  ? 21.013  -2.659  19.255  1.00 0.00 ? 90  TYR A HB2  2  
ATOM 4940  H HB3  . TYR A 1 90  ? 21.009  -2.380  17.517  1.00 0.00 ? 90  TYR A HB3  2  
ATOM 4941  H HD1  . TYR A 1 90  ? 21.243  -4.383  15.960  1.00 0.00 ? 90  TYR A HD1  2  
ATOM 4942  H HD2  . TYR A 1 90  ? 20.361  -4.757  20.143  1.00 0.00 ? 90  TYR A HD2  2  
ATOM 4943  H HE1  . TYR A 1 90  ? 20.381  -6.677  15.567  1.00 0.00 ? 90  TYR A HE1  2  
ATOM 4944  H HE2  . TYR A 1 90  ? 19.498  -7.049  19.753  1.00 0.00 ? 90  TYR A HE2  2  
ATOM 4945  H HH   . TYR A 1 90  ? 18.552  -8.360  17.856  1.00 0.00 ? 90  TYR A HH   2  
ATOM 4946  N N    . TYR A 1 91  ? 22.949  -2.805  20.706  1.00 0.00 ? 91  TYR A N    2  
ATOM 4947  C CA   . TYR A 1 91  ? 23.445  -3.161  22.062  1.00 0.00 ? 91  TYR A CA   2  
ATOM 4948  C C    . TYR A 1 91  ? 22.283  -3.412  23.019  1.00 0.00 ? 91  TYR A C    2  
ATOM 4949  O O    . TYR A 1 91  ? 21.382  -2.606  23.150  1.00 0.00 ? 91  TYR A O    2  
ATOM 4950  C CB   . TYR A 1 91  ? 24.280  -2.008  22.607  1.00 0.00 ? 91  TYR A CB   2  
ATOM 4951  C CG   . TYR A 1 91  ? 25.727  -2.232  22.268  1.00 0.00 ? 91  TYR A CG   2  
ATOM 4952  C CD1  . TYR A 1 91  ? 26.229  -1.793  21.042  1.00 0.00 ? 91  TYR A CD1  2  
ATOM 4953  C CD2  . TYR A 1 91  ? 26.567  -2.867  23.186  1.00 0.00 ? 91  TYR A CD2  2  
ATOM 4954  C CE1  . TYR A 1 91  ? 27.579  -1.993  20.730  1.00 0.00 ? 91  TYR A CE1  2  
ATOM 4955  C CE2  . TYR A 1 91  ? 27.914  -3.065  22.881  1.00 0.00 ? 91  TYR A CE2  2  
ATOM 4956  C CZ   . TYR A 1 91  ? 28.423  -2.629  21.651  1.00 0.00 ? 91  TYR A CZ   2  
ATOM 4957  O OH   . TYR A 1 91  ? 29.755  -2.823  21.347  1.00 0.00 ? 91  TYR A OH   2  
ATOM 4958  H H    . TYR A 1 91  ? 22.279  -2.104  20.596  1.00 0.00 ? 91  TYR A H    2  
ATOM 4959  H HA   . TYR A 1 91  ? 24.059  -4.047  22.000  1.00 0.00 ? 91  TYR A HA   2  
ATOM 4960  H HB2  . TYR A 1 91  ? 23.945  -1.081  22.166  1.00 0.00 ? 91  TYR A HB2  2  
ATOM 4961  H HB3  . TYR A 1 91  ? 24.166  -1.958  23.681  1.00 0.00 ? 91  TYR A HB3  2  
ATOM 4962  H HD1  . TYR A 1 91  ? 25.571  -1.306  20.334  1.00 0.00 ? 91  TYR A HD1  2  
ATOM 4963  H HD2  . TYR A 1 91  ? 26.173  -3.209  24.130  1.00 0.00 ? 91  TYR A HD2  2  
ATOM 4964  H HE1  . TYR A 1 91  ? 27.971  -1.656  19.780  1.00 0.00 ? 91  TYR A HE1  2  
ATOM 4965  H HE2  . TYR A 1 91  ? 28.560  -3.554  23.595  1.00 0.00 ? 91  TYR A HE2  2  
ATOM 4966  H HH   . TYR A 1 91  ? 30.000  -2.190  20.668  1.00 0.00 ? 91  TYR A HH   2  
ATOM 4967  N N    . VAL A 1 92  ? 22.321  -4.510  23.717  1.00 0.00 ? 92  VAL A N    2  
ATOM 4968  C CA   . VAL A 1 92  ? 21.252  -4.807  24.704  1.00 0.00 ? 92  VAL A CA   2  
ATOM 4969  C C    . VAL A 1 92  ? 21.810  -4.508  26.088  1.00 0.00 ? 92  VAL A C    2  
ATOM 4970  O O    . VAL A 1 92  ? 22.444  -5.341  26.706  1.00 0.00 ? 92  VAL A O    2  
ATOM 4971  C CB   . VAL A 1 92  ? 20.850  -6.275  24.627  1.00 0.00 ? 92  VAL A CB   2  
ATOM 4972  C CG1  . VAL A 1 92  ? 19.377  -6.402  25.009  1.00 0.00 ? 92  VAL A CG1  2  
ATOM 4973  C CG2  . VAL A 1 92  ? 21.063  -6.795  23.205  1.00 0.00 ? 92  VAL A CG2  2  
ATOM 4974  H H    . VAL A 1 92  ? 23.072  -5.126  23.613  1.00 0.00 ? 92  VAL A H    2  
ATOM 4975  H HA   . VAL A 1 92  ? 20.392  -4.178  24.513  1.00 0.00 ? 92  VAL A HA   2  
ATOM 4976  H HB   . VAL A 1 92  ? 21.451  -6.848  25.318  1.00 0.00 ? 92  VAL A HB   2  
ATOM 4977  H HG11 . VAL A 1 92  ? 18.789  -5.737  24.395  1.00 0.00 ? 92  VAL A HG11 2  
ATOM 4978  H HG12 . VAL A 1 92  ? 19.050  -7.419  24.856  1.00 0.00 ? 92  VAL A HG12 2  
ATOM 4979  H HG13 . VAL A 1 92  ? 19.252  -6.135  26.049  1.00 0.00 ? 92  VAL A HG13 2  
ATOM 4980  H HG21 . VAL A 1 92  ? 21.090  -5.962  22.518  1.00 0.00 ? 92  VAL A HG21 2  
ATOM 4981  H HG22 . VAL A 1 92  ? 21.999  -7.332  23.155  1.00 0.00 ? 92  VAL A HG22 2  
ATOM 4982  H HG23 . VAL A 1 92  ? 20.253  -7.457  22.937  1.00 0.00 ? 92  VAL A HG23 2  
ATOM 4983  N N    . GLY A 1 93  ? 21.607  -3.320  26.567  1.00 0.00 ? 93  GLY A N    2  
ATOM 4984  C CA   . GLY A 1 93  ? 22.158  -2.954  27.899  1.00 0.00 ? 93  GLY A CA   2  
ATOM 4985  C C    . GLY A 1 93  ? 23.649  -2.643  27.741  1.00 0.00 ? 93  GLY A C    2  
ATOM 4986  O O    . GLY A 1 93  ? 24.055  -1.497  27.708  1.00 0.00 ? 93  GLY A O    2  
ATOM 4987  H H    . GLY A 1 93  ? 21.107  -2.661  26.041  1.00 0.00 ? 93  GLY A H    2  
ATOM 4988  H HA2  . GLY A 1 93  ? 21.640  -2.085  28.280  1.00 0.00 ? 93  GLY A HA2  2  
ATOM 4989  H HA3  . GLY A 1 93  ? 22.035  -3.781  28.583  1.00 0.00 ? 93  GLY A HA3  2  
ATOM 4990  N N    . ARG A 1 94  ? 24.471  -3.655  27.644  1.00 0.00 ? 94  ARG A N    2  
ATOM 4991  C CA   . ARG A 1 94  ? 25.940  -3.417  27.490  1.00 0.00 ? 94  ARG A CA   2  
ATOM 4992  C C    . ARG A 1 94  ? 26.580  -4.480  26.589  1.00 0.00 ? 94  ARG A C    2  
ATOM 4993  O O    . ARG A 1 94  ? 27.759  -4.424  26.304  1.00 0.00 ? 94  ARG A O    2  
ATOM 4994  C CB   . ARG A 1 94  ? 26.591  -3.487  28.865  1.00 0.00 ? 94  ARG A CB   2  
ATOM 4995  C CG   . ARG A 1 94  ? 25.938  -2.464  29.798  1.00 0.00 ? 94  ARG A CG   2  
ATOM 4996  C CD   . ARG A 1 94  ? 26.629  -2.501  31.163  1.00 0.00 ? 94  ARG A CD   2  
ATOM 4997  N NE   . ARG A 1 94  ? 25.607  -2.663  32.236  1.00 0.00 ? 94  ARG A NE   2  
ATOM 4998  C CZ   . ARG A 1 94  ? 24.632  -1.801  32.346  1.00 0.00 ? 94  ARG A CZ   2  
ATOM 4999  N NH1  . ARG A 1 94  ? 24.891  -0.557  32.645  1.00 0.00 ? 94  ARG A NH1  2  
ATOM 5000  N NH2  . ARG A 1 94  ? 23.400  -2.184  32.157  1.00 0.00 ? 94  ARG A NH2  2  
ATOM 5001  H H    . ARG A 1 94  ? 24.124  -4.568  27.684  1.00 0.00 ? 94  ARG A H    2  
ATOM 5002  H HA   . ARG A 1 94  ? 26.107  -2.442  27.062  1.00 0.00 ? 94  ARG A HA   2  
ATOM 5003  H HB2  . ARG A 1 94  ? 26.454  -4.482  29.264  1.00 0.00 ? 94  ARG A HB2  2  
ATOM 5004  H HB3  . ARG A 1 94  ? 27.646  -3.273  28.778  1.00 0.00 ? 94  ARG A HB3  2  
ATOM 5005  H HG2  . ARG A 1 94  ? 26.034  -1.476  29.372  1.00 0.00 ? 94  ARG A HG2  2  
ATOM 5006  H HG3  . ARG A 1 94  ? 24.892  -2.704  29.920  1.00 0.00 ? 94  ARG A HG3  2  
ATOM 5007  H HD2  . ARG A 1 94  ? 27.318  -3.332  31.195  1.00 0.00 ? 94  ARG A HD2  2  
ATOM 5008  H HD3  . ARG A 1 94  ? 27.170  -1.580  31.318  1.00 0.00 ? 94  ARG A HD3  2  
ATOM 5009  H HE   . ARG A 1 94  ? 25.666  -3.416  32.859  1.00 0.00 ? 94  ARG A HE   2  
ATOM 5010  H HH11 . ARG A 1 94  ? 25.836  -0.264  32.791  1.00 0.00 ? 94  ARG A HH11 2  
ATOM 5011  H HH12 . ARG A 1 94  ? 24.145  0.103   32.729  1.00 0.00 ? 94  ARG A HH12 2  
ATOM 5012  H HH21 . ARG A 1 94  ? 23.202  -3.137  31.928  1.00 0.00 ? 94  ARG A HH21 2  
ATOM 5013  H HH22 . ARG A 1 94  ? 22.653  -1.524  32.241  1.00 0.00 ? 94  ARG A HH22 2  
ATOM 5014  N N    . LYS A 1 95  ? 25.831  -5.448  26.144  1.00 0.00 ? 95  LYS A N    2  
ATOM 5015  C CA   . LYS A 1 95  ? 26.427  -6.501  25.273  1.00 0.00 ? 95  LYS A CA   2  
ATOM 5016  C C    . LYS A 1 95  ? 26.126  -6.183  23.804  1.00 0.00 ? 95  LYS A C    2  
ATOM 5017  O O    . LYS A 1 95  ? 25.013  -5.837  23.468  1.00 0.00 ? 95  LYS A O    2  
ATOM 5018  C CB   . LYS A 1 95  ? 25.818  -7.858  25.632  1.00 0.00 ? 95  LYS A CB   2  
ATOM 5019  C CG   . LYS A 1 95  ? 26.424  -8.358  26.944  1.00 0.00 ? 95  LYS A CG   2  
ATOM 5020  C CD   . LYS A 1 95  ? 25.333  -9.008  27.797  1.00 0.00 ? 95  LYS A CD   2  
ATOM 5021  C CE   . LYS A 1 95  ? 24.981  -8.086  28.965  1.00 0.00 ? 95  LYS A CE   2  
ATOM 5022  N NZ   . LYS A 1 95  ? 24.926  -8.880  30.225  1.00 0.00 ? 95  LYS A NZ   2  
ATOM 5023  H H    . LYS A 1 95  ? 24.886  -5.487  26.382  1.00 0.00 ? 95  LYS A H    2  
ATOM 5024  H HA   . LYS A 1 95  ? 27.493  -6.532  25.431  1.00 0.00 ? 95  LYS A HA   2  
ATOM 5025  H HB2  . LYS A 1 95  ? 24.749  -7.754  25.746  1.00 0.00 ? 95  LYS A HB2  2  
ATOM 5026  H HB3  . LYS A 1 95  ? 26.031  -8.567  24.846  1.00 0.00 ? 95  LYS A HB3  2  
ATOM 5027  H HG2  . LYS A 1 95  ? 27.195  -9.085  26.730  1.00 0.00 ? 95  LYS A HG2  2  
ATOM 5028  H HG3  . LYS A 1 95  ? 26.852  -7.526  27.484  1.00 0.00 ? 95  LYS A HG3  2  
ATOM 5029  H HD2  . LYS A 1 95  ? 24.454  -9.174  27.190  1.00 0.00 ? 95  LYS A HD2  2  
ATOM 5030  H HD3  . LYS A 1 95  ? 25.690  -9.952  28.181  1.00 0.00 ? 95  LYS A HD3  2  
ATOM 5031  H HE2  . LYS A 1 95  ? 25.735  -7.317  29.056  1.00 0.00 ? 95  LYS A HE2  2  
ATOM 5032  H HE3  . LYS A 1 95  ? 24.020  -7.627  28.786  1.00 0.00 ? 95  LYS A HE3  2  
ATOM 5033  H HZ1  . LYS A 1 95  ? 25.502  -9.740  30.117  1.00 0.00 ? 95  LYS A HZ1  2  
ATOM 5034  H HZ2  . LYS A 1 95  ? 25.295  -8.309  31.012  1.00 0.00 ? 95  LYS A HZ2  2  
ATOM 5035  H HZ3  . LYS A 1 95  ? 23.940  -9.145  30.425  1.00 0.00 ? 95  LYS A HZ3  2  
ATOM 5036  N N    . PRO A 1 96  ? 27.126  -6.315  22.969  1.00 0.00 ? 96  PRO A N    2  
ATOM 5037  C CA   . PRO A 1 96  ? 26.985  -6.050  21.527  1.00 0.00 ? 96  PRO A CA   2  
ATOM 5038  C C    . PRO A 1 96  ? 26.303  -7.239  20.843  1.00 0.00 ? 96  PRO A C    2  
ATOM 5039  O O    . PRO A 1 96  ? 26.519  -8.378  21.206  1.00 0.00 ? 96  PRO A O    2  
ATOM 5040  C CB   . PRO A 1 96  ? 28.431  -5.897  21.048  1.00 0.00 ? 96  PRO A CB   2  
ATOM 5041  C CG   . PRO A 1 96  ? 29.315  -6.629  22.086  1.00 0.00 ? 96  PRO A CG   2  
ATOM 5042  C CD   . PRO A 1 96  ? 28.481  -6.738  23.377  1.00 0.00 ? 96  PRO A CD   2  
ATOM 5043  H HA   . PRO A 1 96  ? 26.437  -5.136  21.361  1.00 0.00 ? 96  PRO A HA   2  
ATOM 5044  H HB2  . PRO A 1 96  ? 28.547  -6.349  20.071  1.00 0.00 ? 96  PRO A HB2  2  
ATOM 5045  H HB3  . PRO A 1 96  ? 28.703  -4.854  21.009  1.00 0.00 ? 96  PRO A HB3  2  
ATOM 5046  H HG2  . PRO A 1 96  ? 29.571  -7.615  21.723  1.00 0.00 ? 96  PRO A HG2  2  
ATOM 5047  H HG3  . PRO A 1 96  ? 30.210  -6.060  22.278  1.00 0.00 ? 96  PRO A HG3  2  
ATOM 5048  H HD2  . PRO A 1 96  ? 28.471  -7.757  23.735  1.00 0.00 ? 96  PRO A HD2  2  
ATOM 5049  H HD3  . PRO A 1 96  ? 28.866  -6.073  24.134  1.00 0.00 ? 96  PRO A HD3  2  
ATOM 5050  N N    . LYS A 1 97  ? 25.476  -6.991  19.861  1.00 0.00 ? 97  LYS A N    2  
ATOM 5051  C CA   . LYS A 1 97  ? 24.783  -8.118  19.175  1.00 0.00 ? 97  LYS A CA   2  
ATOM 5052  C C    . LYS A 1 97  ? 24.610  -7.803  17.686  1.00 0.00 ? 97  LYS A C    2  
ATOM 5053  O O    . LYS A 1 97  ? 24.202  -6.722  17.313  1.00 0.00 ? 97  LYS A O    2  
ATOM 5054  C CB   . LYS A 1 97  ? 23.401  -8.320  19.801  1.00 0.00 ? 97  LYS A CB   2  
ATOM 5055  C CG   . LYS A 1 97  ? 23.545  -8.956  21.185  1.00 0.00 ? 97  LYS A CG   2  
ATOM 5056  C CD   . LYS A 1 97  ? 23.485  -10.480 21.056  1.00 0.00 ? 97  LYS A CD   2  
ATOM 5057  C CE   . LYS A 1 97  ? 24.823  -11.083 21.482  1.00 0.00 ? 97  LYS A CE   2  
ATOM 5058  N NZ   . LYS A 1 97  ? 25.404  -11.854 20.347  1.00 0.00 ? 97  LYS A NZ   2  
ATOM 5059  H H    . LYS A 1 97  ? 25.309  -6.068  19.581  1.00 0.00 ? 97  LYS A H    2  
ATOM 5060  H HA   . LYS A 1 97  ? 25.364  -9.022  19.287  1.00 0.00 ? 97  LYS A HA   2  
ATOM 5061  H HB2  . LYS A 1 97  ? 22.907  -7.364  19.895  1.00 0.00 ? 97  LYS A HB2  2  
ATOM 5062  H HB3  . LYS A 1 97  ? 22.812  -8.969  19.170  1.00 0.00 ? 97  LYS A HB3  2  
ATOM 5063  H HG2  . LYS A 1 97  ? 24.492  -8.668  21.617  1.00 0.00 ? 97  LYS A HG2  2  
ATOM 5064  H HG3  . LYS A 1 97  ? 22.742  -8.619  21.822  1.00 0.00 ? 97  LYS A HG3  2  
ATOM 5065  H HD2  . LYS A 1 97  ? 22.698  -10.862 21.691  1.00 0.00 ? 97  LYS A HD2  2  
ATOM 5066  H HD3  . LYS A 1 97  ? 23.281  -10.746 20.030  1.00 0.00 ? 97  LYS A HD3  2  
ATOM 5067  H HE2  . LYS A 1 97  ? 25.502  -10.292 21.764  1.00 0.00 ? 97  LYS A HE2  2  
ATOM 5068  H HE3  . LYS A 1 97  ? 24.670  -11.743 22.324  1.00 0.00 ? 97  LYS A HE3  2  
ATOM 5069  H HZ1  . LYS A 1 97  ? 24.997  -11.514 19.452  1.00 0.00 ? 97  LYS A HZ1  2  
ATOM 5070  H HZ2  . LYS A 1 97  ? 26.434  -11.722 20.328  1.00 0.00 ? 97  LYS A HZ2  2  
ATOM 5071  H HZ3  . LYS A 1 97  ? 25.185  -12.865 20.467  1.00 0.00 ? 97  LYS A HZ3  2  
ATOM 5072  N N    . VAL A 1 98  ? 24.898  -8.749  16.833  1.00 0.00 ? 98  VAL A N    2  
ATOM 5073  C CA   . VAL A 1 98  ? 24.727  -8.516  15.371  1.00 0.00 ? 98  VAL A CA   2  
ATOM 5074  C C    . VAL A 1 98  ? 23.549  -9.355  14.882  1.00 0.00 ? 98  VAL A C    2  
ATOM 5075  O O    . VAL A 1 98  ? 23.473  -10.537 15.149  1.00 0.00 ? 98  VAL A O    2  
ATOM 5076  C CB   . VAL A 1 98  ? 25.988  -8.944  14.620  1.00 0.00 ? 98  VAL A CB   2  
ATOM 5077  C CG1  . VAL A 1 98  ? 25.709  -8.930  13.114  1.00 0.00 ? 98  VAL A CG1  2  
ATOM 5078  C CG2  . VAL A 1 98  ? 27.127  -7.973  14.935  1.00 0.00 ? 98  VAL A CG2  2  
ATOM 5079  H H    . VAL A 1 98  ? 25.210  -9.620  17.156  1.00 0.00 ? 98  VAL A H    2  
ATOM 5080  H HA   . VAL A 1 98  ? 24.529  -7.469  15.189  1.00 0.00 ? 98  VAL A HA   2  
ATOM 5081  H HB   . VAL A 1 98  ? 26.267  -9.941  14.925  1.00 0.00 ? 98  VAL A HB   2  
ATOM 5082  H HG11 . VAL A 1 98  ? 24.930  -8.215  12.898  1.00 0.00 ? 98  VAL A HG11 2  
ATOM 5083  H HG12 . VAL A 1 98  ? 26.608  -8.654  12.583  1.00 0.00 ? 98  VAL A HG12 2  
ATOM 5084  H HG13 . VAL A 1 98  ? 25.392  -9.913  12.797  1.00 0.00 ? 98  VAL A HG13 2  
ATOM 5085  H HG21 . VAL A 1 98  ? 26.749  -7.159  15.535  1.00 0.00 ? 98  VAL A HG21 2  
ATOM 5086  H HG22 . VAL A 1 98  ? 27.903  -8.491  15.478  1.00 0.00 ? 98  VAL A HG22 2  
ATOM 5087  H HG23 . VAL A 1 98  ? 27.531  -7.582  14.013  1.00 0.00 ? 98  VAL A HG23 2  
ATOM 5088  N N    . GLU A 1 99  ? 22.625  -8.769  14.173  1.00 0.00 ? 99  GLU A N    2  
ATOM 5089  C CA   . GLU A 1 99  ? 21.469  -9.569  13.694  1.00 0.00 ? 99  GLU A CA   2  
ATOM 5090  C C    . GLU A 1 99  ? 21.225  -9.302  12.216  1.00 0.00 ? 99  GLU A C    2  
ATOM 5091  O O    . GLU A 1 99  ? 22.094  -8.854  11.493  1.00 0.00 ? 99  GLU A O    2  
ATOM 5092  C CB   . GLU A 1 99  ? 20.217  -9.191  14.479  1.00 0.00 ? 99  GLU A CB   2  
ATOM 5093  C CG   . GLU A 1 99  ? 19.596  -10.447 15.090  1.00 0.00 ? 99  GLU A CG   2  
ATOM 5094  C CD   . GLU A 1 99  ? 18.076  -10.283 15.163  1.00 0.00 ? 99  GLU A CD   2  
ATOM 5095  O OE1  . GLU A 1 99  ? 17.569  -9.372  14.530  1.00 0.00 ? 99  GLU A OE1  2  
ATOM 5096  O OE2  . GLU A 1 99  ? 17.448  -11.071 15.850  1.00 0.00 ? 99  GLU A OE2  2  
ATOM 5097  H H    . GLU A 1 99  ? 22.688  -7.810  13.960  1.00 0.00 ? 99  GLU A H    2  
ATOM 5098  H HA   . GLU A 1 99  ? 21.673  -10.617 13.837  1.00 0.00 ? 99  GLU A HA   2  
ATOM 5099  H HB2  . GLU A 1 99  ? 20.480  -8.502  15.260  1.00 0.00 ? 99  GLU A HB2  2  
ATOM 5100  H HB3  . GLU A 1 99  ? 19.508  -8.729  13.816  1.00 0.00 ? 99  GLU A HB3  2  
ATOM 5101  H HG2  . GLU A 1 99  ? 19.838  -11.303 14.476  1.00 0.00 ? 99  GLU A HG2  2  
ATOM 5102  H HG3  . GLU A 1 99  ? 19.987  -10.595 16.085  1.00 0.00 ? 99  GLU A HG3  2  
ATOM 5103  N N    . GLN A 1 100 ? 20.038  -9.580  11.770  1.00 0.00 ? 100 GLN A N    2  
ATOM 5104  C CA   . GLN A 1 100 ? 19.699  -9.358  10.345  1.00 0.00 ? 100 GLN A CA   2  
ATOM 5105  C C    . GLN A 1 100 ? 18.220  -9.002  10.248  1.00 0.00 ? 100 GLN A C    2  
ATOM 5106  O O    . GLN A 1 100 ? 17.382  -9.849  10.008  1.00 0.00 ? 100 GLN A O    2  
ATOM 5107  C CB   . GLN A 1 100 ? 19.953  -10.640 9.568   1.00 0.00 ? 100 GLN A CB   2  
ATOM 5108  C CG   . GLN A 1 100 ? 21.366  -11.146 9.862   1.00 0.00 ? 100 GLN A CG   2  
ATOM 5109  C CD   . GLN A 1 100 ? 21.631  -12.418 9.055   1.00 0.00 ? 100 GLN A CD   2  
ATOM 5110  O OE1  . GLN A 1 100 ? 21.532  -13.513 9.575   1.00 0.00 ? 100 GLN A OE1  2  
ATOM 5111  N NE2  . GLN A 1 100 ? 21.965  -12.321 7.798   1.00 0.00 ? 100 GLN A NE2  2  
ATOM 5112  H H    . GLN A 1 100 ? 19.365  -9.941  12.381  1.00 0.00 ? 100 GLN A H    2  
ATOM 5113  H HA   . GLN A 1 100 ? 20.300  -8.559  9.941   1.00 0.00 ? 100 GLN A HA   2  
ATOM 5114  H HB2  . GLN A 1 100 ? 19.232  -11.379 9.879   1.00 0.00 ? 100 GLN A HB2  2  
ATOM 5115  H HB3  . GLN A 1 100 ? 19.848  -10.452 8.510   1.00 0.00 ? 100 GLN A HB3  2  
ATOM 5116  H HG2  . GLN A 1 100 ? 22.085  -10.387 9.585   1.00 0.00 ? 100 GLN A HG2  2  
ATOM 5117  H HG3  . GLN A 1 100 ? 21.461  -11.363 10.915  1.00 0.00 ? 100 GLN A HG3  2  
ATOM 5118  H HE21 . GLN A 1 100 ? 22.044  -11.439 7.379   1.00 0.00 ? 100 GLN A HE21 2  
ATOM 5119  H HE22 . GLN A 1 100 ? 22.137  -13.130 7.272   1.00 0.00 ? 100 GLN A HE22 2  
ATOM 5120  N N    . LEU A 1 101 ? 17.888  -7.761  10.446  1.00 0.00 ? 101 LEU A N    2  
ATOM 5121  C CA   . LEU A 1 101 ? 16.460  -7.359  10.380  1.00 0.00 ? 101 LEU A CA   2  
ATOM 5122  C C    . LEU A 1 101 ? 15.807  -8.015  9.170   1.00 0.00 ? 101 LEU A C    2  
ATOM 5123  O O    . LEU A 1 101 ? 16.424  -8.216  8.144   1.00 0.00 ? 101 LEU A O    2  
ATOM 5124  C CB   . LEU A 1 101 ? 16.345  -5.839  10.268  1.00 0.00 ? 101 LEU A CB   2  
ATOM 5125  C CG   . LEU A 1 101 ? 17.057  -5.166  11.447  1.00 0.00 ? 101 LEU A CG   2  
ATOM 5126  C CD1  . LEU A 1 101 ? 16.488  -3.761  11.651  1.00 0.00 ? 101 LEU A CD1  2  
ATOM 5127  C CD2  . LEU A 1 101 ? 16.845  -5.987  12.723  1.00 0.00 ? 101 LEU A CD2  2  
ATOM 5128  H H    . LEU A 1 101 ? 18.575  -7.100  10.650  1.00 0.00 ? 101 LEU A H    2  
ATOM 5129  H HA   . LEU A 1 101 ? 15.957  -7.690  11.277  1.00 0.00 ? 101 LEU A HA   2  
ATOM 5130  H HB2  . LEU A 1 101 ? 16.799  -5.513  9.345   1.00 0.00 ? 101 LEU A HB2  2  
ATOM 5131  H HB3  . LEU A 1 101 ? 15.301  -5.563  10.273  1.00 0.00 ? 101 LEU A HB3  2  
ATOM 5132  H HG   . LEU A 1 101 ? 18.114  -5.095  11.235  1.00 0.00 ? 101 LEU A HG   2  
ATOM 5133  H HD11 . LEU A 1 101 ? 15.470  -3.728  11.288  1.00 0.00 ? 101 LEU A HD11 2  
ATOM 5134  H HD12 . LEU A 1 101 ? 16.503  -3.514  12.702  1.00 0.00 ? 101 LEU A HD12 2  
ATOM 5135  H HD13 . LEU A 1 101 ? 17.087  -3.046  11.105  1.00 0.00 ? 101 LEU A HD13 2  
ATOM 5136  H HD21 . LEU A 1 101 ? 15.787  -6.083  12.917  1.00 0.00 ? 101 LEU A HD21 2  
ATOM 5137  H HD22 . LEU A 1 101 ? 17.278  -6.968  12.593  1.00 0.00 ? 101 LEU A HD22 2  
ATOM 5138  H HD23 . LEU A 1 101 ? 17.320  -5.491  13.553  1.00 0.00 ? 101 LEU A HD23 2  
ATOM 5139  N N    . SER A 1 102 ? 14.563  -8.365  9.297   1.00 0.00 ? 102 SER A N    2  
ATOM 5140  C CA   . SER A 1 102 ? 13.853  -9.031  8.165   1.00 0.00 ? 102 SER A CA   2  
ATOM 5141  C C    . SER A 1 102 ? 12.965  -8.023  7.433   1.00 0.00 ? 102 SER A C    2  
ATOM 5142  O O    . SER A 1 102 ? 12.320  -7.196  8.043   1.00 0.00 ? 102 SER A O    2  
ATOM 5143  C CB   . SER A 1 102 ? 12.987  -10.167 8.709   1.00 0.00 ? 102 SER A CB   2  
ATOM 5144  O OG   . SER A 1 102 ? 13.441  -11.402 8.169   1.00 0.00 ? 102 SER A OG   2  
ATOM 5145  H H    . SER A 1 102 ? 14.098  -8.193  10.145  1.00 0.00 ? 102 SER A H    2  
ATOM 5146  H HA   . SER A 1 102 ? 14.579  -9.434  7.475   1.00 0.00 ? 102 SER A HA   2  
ATOM 5147  H HB2  . SER A 1 102 ? 13.064  -10.201 9.782   1.00 0.00 ? 102 SER A HB2  2  
ATOM 5148  H HB3  . SER A 1 102 ? 11.955  -9.998  8.430   1.00 0.00 ? 102 SER A HB3  2  
ATOM 5149  H HG   . SER A 1 102 ? 12.814  -11.680 7.496   1.00 0.00 ? 102 SER A HG   2  
ATOM 5150  N N    . ASN A 1 103 ? 12.919  -8.089  6.128   1.00 0.00 ? 103 ASN A N    2  
ATOM 5151  C CA   . ASN A 1 103 ? 12.058  -7.133  5.369   1.00 0.00 ? 103 ASN A CA   2  
ATOM 5152  C C    . ASN A 1 103 ? 12.431  -5.701  5.741   1.00 0.00 ? 103 ASN A C    2  
ATOM 5153  O O    . ASN A 1 103 ? 11.599  -4.817  5.768   1.00 0.00 ? 103 ASN A O    2  
ATOM 5154  C CB   . ASN A 1 103 ? 10.590  -7.373  5.721   1.00 0.00 ? 103 ASN A CB   2  
ATOM 5155  C CG   . ASN A 1 103 ? 10.078  -8.607  4.977   1.00 0.00 ? 103 ASN A CG   2  
ATOM 5156  O OD1  . ASN A 1 103 ? 10.735  -9.115  4.092   1.00 0.00 ? 103 ASN A OD1  2  
ATOM 5157  N ND2  . ASN A 1 103 ? 8.921   -9.116  5.304   1.00 0.00 ? 103 ASN A ND2  2  
ATOM 5158  H H    . ASN A 1 103 ? 13.446  -8.768  5.649   1.00 0.00 ? 103 ASN A H    2  
ATOM 5159  H HA   . ASN A 1 103 ? 12.201  -7.275  4.307   1.00 0.00 ? 103 ASN A HA   2  
ATOM 5160  H HB2  . ASN A 1 103 ? 10.495  -7.525  6.785   1.00 0.00 ? 103 ASN A HB2  2  
ATOM 5161  H HB3  . ASN A 1 103 ? 10.011  -6.512  5.428   1.00 0.00 ? 103 ASN A HB3  2  
ATOM 5162  H HD21 . ASN A 1 103 ? 8.390   -8.707  6.020   1.00 0.00 ? 103 ASN A HD21 2  
ATOM 5163  H HD22 . ASN A 1 103 ? 8.584   -9.908  4.836   1.00 0.00 ? 103 ASN A HD22 2  
ATOM 5164  N N    . MET A 1 104 ? 13.677  -5.465  6.026   1.00 0.00 ? 104 MET A N    2  
ATOM 5165  C CA   . MET A 1 104 ? 14.107  -4.090  6.392   1.00 0.00 ? 104 MET A CA   2  
ATOM 5166  C C    . MET A 1 104 ? 14.592  -3.371  5.135   1.00 0.00 ? 104 MET A C    2  
ATOM 5167  O O    . MET A 1 104 ? 15.240  -2.347  5.203   1.00 0.00 ? 104 MET A O    2  
ATOM 5168  C CB   . MET A 1 104 ? 15.248  -4.166  7.411   1.00 0.00 ? 104 MET A CB   2  
ATOM 5169  C CG   . MET A 1 104 ? 15.068  -3.068  8.460   1.00 0.00 ? 104 MET A CG   2  
ATOM 5170  S SD   . MET A 1 104 ? 15.933  -1.573  7.920   1.00 0.00 ? 104 MET A SD   2  
ATOM 5171  C CE   . MET A 1 104 ? 16.205  -0.867  9.563   1.00 0.00 ? 104 MET A CE   2  
ATOM 5172  H H    . MET A 1 104 ? 14.329  -6.191  5.998   1.00 0.00 ? 104 MET A H    2  
ATOM 5173  H HA   . MET A 1 104 ? 13.274  -3.552  6.821   1.00 0.00 ? 104 MET A HA   2  
ATOM 5174  H HB2  . MET A 1 104 ? 15.236  -5.133  7.894   1.00 0.00 ? 104 MET A HB2  2  
ATOM 5175  H HB3  . MET A 1 104 ? 16.192  -4.027  6.906   1.00 0.00 ? 104 MET A HB3  2  
ATOM 5176  H HG2  . MET A 1 104 ? 14.016  -2.852  8.579   1.00 0.00 ? 104 MET A HG2  2  
ATOM 5177  H HG3  . MET A 1 104 ? 15.476  -3.401  9.402   1.00 0.00 ? 104 MET A HG3  2  
ATOM 5178  H HE1  . MET A 1 104 ? 15.328  -1.021  10.173  1.00 0.00 ? 104 MET A HE1  2  
ATOM 5179  H HE2  . MET A 1 104 ? 17.052  -1.353  10.028  1.00 0.00 ? 104 MET A HE2  2  
ATOM 5180  H HE3  . MET A 1 104 ? 16.395  0.193   9.472   1.00 0.00 ? 104 MET A HE3  2  
ATOM 5181  N N    . ILE A 1 105 ? 14.272  -3.899  3.983   1.00 0.00 ? 105 ILE A N    2  
ATOM 5182  C CA   . ILE A 1 105 ? 14.702  -3.247  2.715   1.00 0.00 ? 105 ILE A CA   2  
ATOM 5183  C C    . ILE A 1 105 ? 13.635  -3.482  1.647   1.00 0.00 ? 105 ILE A C    2  
ATOM 5184  O O    . ILE A 1 105 ? 12.741  -4.286  1.819   1.00 0.00 ? 105 ILE A O    2  
ATOM 5185  C CB   . ILE A 1 105 ? 16.030  -3.848  2.249   1.00 0.00 ? 105 ILE A CB   2  
ATOM 5186  C CG1  . ILE A 1 105 ? 17.090  -3.652  3.336   1.00 0.00 ? 105 ILE A CG1  2  
ATOM 5187  C CG2  . ILE A 1 105 ? 16.479  -3.149  0.965   1.00 0.00 ? 105 ILE A CG2  2  
ATOM 5188  C CD1  . ILE A 1 105 ? 18.453  -4.095  2.803   1.00 0.00 ? 105 ILE A CD1  2  
ATOM 5189  H H    . ILE A 1 105 ? 13.740  -4.724  3.951   1.00 0.00 ? 105 ILE A H    2  
ATOM 5190  H HA   . ILE A 1 105 ? 14.823  -2.187  2.877   1.00 0.00 ? 105 ILE A HA   2  
ATOM 5191  H HB   . ILE A 1 105 ? 15.897  -4.903  2.058   1.00 0.00 ? 105 ILE A HB   2  
ATOM 5192  H HG12 . ILE A 1 105 ? 17.133  -2.608  3.612   1.00 0.00 ? 105 ILE A HG12 2  
ATOM 5193  H HG13 . ILE A 1 105 ? 16.834  -4.243  4.201   1.00 0.00 ? 105 ILE A HG13 2  
ATOM 5194  H HG21 . ILE A 1 105 ? 16.368  -2.081  1.078   1.00 0.00 ? 105 ILE A HG21 2  
ATOM 5195  H HG22 . ILE A 1 105 ? 17.515  -3.384  0.769   1.00 0.00 ? 105 ILE A HG22 2  
ATOM 5196  H HG23 . ILE A 1 105 ? 15.870  -3.488  0.139   1.00 0.00 ? 105 ILE A HG23 2  
ATOM 5197  H HD11 . ILE A 1 105 ? 18.331  -4.974  2.186   1.00 0.00 ? 105 ILE A HD11 2  
ATOM 5198  H HD12 . ILE A 1 105 ? 18.886  -3.300  2.216   1.00 0.00 ? 105 ILE A HD12 2  
ATOM 5199  H HD13 . ILE A 1 105 ? 19.105  -4.327  3.633   1.00 0.00 ? 105 ILE A HD13 2  
ATOM 5200  N N    . VAL A 1 106 ? 13.714  -2.786  0.548   1.00 0.00 ? 106 VAL A N    2  
ATOM 5201  C CA   . VAL A 1 106 ? 12.698  -2.971  -0.519  1.00 0.00 ? 106 VAL A CA   2  
ATOM 5202  C C    . VAL A 1 106 ? 13.363  -3.561  -1.767  1.00 0.00 ? 106 VAL A C    2  
ATOM 5203  O O    . VAL A 1 106 ? 14.401  -3.107  -2.206  1.00 0.00 ? 106 VAL A O    2  
ATOM 5204  C CB   . VAL A 1 106 ? 12.070  -1.612  -0.847  1.00 0.00 ? 106 VAL A CB   2  
ATOM 5205  C CG1  . VAL A 1 106 ? 11.430  -1.651  -2.235  1.00 0.00 ? 106 VAL A CG1  2  
ATOM 5206  C CG2  . VAL A 1 106 ? 11.000  -1.289  0.198   1.00 0.00 ? 106 VAL A CG2  2  
ATOM 5207  H H    . VAL A 1 106 ? 14.437  -2.137  0.426   1.00 0.00 ? 106 VAL A H    2  
ATOM 5208  H HA   . VAL A 1 106 ? 11.930  -3.645  -0.170  1.00 0.00 ? 106 VAL A HA   2  
ATOM 5209  H HB   . VAL A 1 106 ? 12.835  -0.849  -0.826  1.00 0.00 ? 106 VAL A HB   2  
ATOM 5210  H HG11 . VAL A 1 106 ? 10.938  -2.603  -2.377  1.00 0.00 ? 106 VAL A HG11 2  
ATOM 5211  H HG12 . VAL A 1 106 ? 10.707  -0.855  -2.321  1.00 0.00 ? 106 VAL A HG12 2  
ATOM 5212  H HG13 . VAL A 1 106 ? 12.196  -1.526  -2.986  1.00 0.00 ? 106 VAL A HG13 2  
ATOM 5213  H HG21 . VAL A 1 106 ? 10.465  -2.192  0.456   1.00 0.00 ? 106 VAL A HG21 2  
ATOM 5214  H HG22 . VAL A 1 106 ? 11.470  -0.885  1.082   1.00 0.00 ? 106 VAL A HG22 2  
ATOM 5215  H HG23 . VAL A 1 106 ? 10.309  -0.565  -0.206  1.00 0.00 ? 106 VAL A HG23 2  
ATOM 5216  N N    . ARG A 1 107 ? 12.761  -4.564  -2.345  1.00 0.00 ? 107 ARG A N    2  
ATOM 5217  C CA   . ARG A 1 107 ? 13.341  -5.183  -3.570  1.00 0.00 ? 107 ARG A CA   2  
ATOM 5218  C C    . ARG A 1 107 ? 12.377  -4.968  -4.738  1.00 0.00 ? 107 ARG A C    2  
ATOM 5219  O O    . ARG A 1 107 ? 12.733  -5.118  -5.889  1.00 0.00 ? 107 ARG A O    2  
ATOM 5220  C CB   . ARG A 1 107 ? 13.540  -6.683  -3.340  1.00 0.00 ? 107 ARG A CB   2  
ATOM 5221  C CG   . ARG A 1 107 ? 14.840  -7.137  -4.006  1.00 0.00 ? 107 ARG A CG   2  
ATOM 5222  C CD   . ARG A 1 107 ? 14.597  -7.356  -5.501  1.00 0.00 ? 107 ARG A CD   2  
ATOM 5223  N NE   . ARG A 1 107 ? 15.024  -8.733  -5.876  1.00 0.00 ? 107 ARG A NE   2  
ATOM 5224  C CZ   . ARG A 1 107 ? 16.172  -9.197  -5.461  1.00 0.00 ? 107 ARG A CZ   2  
ATOM 5225  N NH1  . ARG A 1 107 ? 17.251  -8.476  -5.591  1.00 0.00 ? 107 ARG A NH1  2  
ATOM 5226  N NH2  . ARG A 1 107 ? 16.240  -10.382 -4.919  1.00 0.00 ? 107 ARG A NH2  2  
ATOM 5227  H H    . ARG A 1 107 ? 11.920  -4.907  -1.977  1.00 0.00 ? 107 ARG A H    2  
ATOM 5228  H HA   . ARG A 1 107 ? 14.291  -4.721  -3.794  1.00 0.00 ? 107 ARG A HA   2  
ATOM 5229  H HB2  . ARG A 1 107 ? 13.591  -6.879  -2.278  1.00 0.00 ? 107 ARG A HB2  2  
ATOM 5230  H HB3  . ARG A 1 107 ? 12.710  -7.226  -3.766  1.00 0.00 ? 107 ARG A HB3  2  
ATOM 5231  H HG2  . ARG A 1 107 ? 15.597  -6.378  -3.871  1.00 0.00 ? 107 ARG A HG2  2  
ATOM 5232  H HG3  . ARG A 1 107 ? 15.171  -8.061  -3.558  1.00 0.00 ? 107 ARG A HG3  2  
ATOM 5233  H HD2  . ARG A 1 107 ? 13.546  -7.233  -5.718  1.00 0.00 ? 107 ARG A HD2  2  
ATOM 5234  H HD3  . ARG A 1 107 ? 15.168  -6.635  -6.068  1.00 0.00 ? 107 ARG A HD3  2  
ATOM 5235  H HE   . ARG A 1 107 ? 14.443  -9.292  -6.434  1.00 0.00 ? 107 ARG A HE   2  
ATOM 5236  H HH11 . ARG A 1 107 ? 17.200  -7.568  -6.008  1.00 0.00 ? 107 ARG A HH11 2  
ATOM 5237  H HH12 . ARG A 1 107 ? 18.131  -8.831  -5.273  1.00 0.00 ? 107 ARG A HH12 2  
ATOM 5238  H HH21 . ARG A 1 107 ? 15.412  -10.935 -4.819  1.00 0.00 ? 107 ARG A HH21 2  
ATOM 5239  H HH22 . ARG A 1 107 ? 17.119  -10.736 -4.600  1.00 0.00 ? 107 ARG A HH22 2  
ATOM 5240  N N    . SER A 1 108 ? 11.155  -4.611  -4.442  1.00 0.00 ? 108 SER A N    2  
ATOM 5241  C CA   . SER A 1 108 ? 10.155  -4.378  -5.522  1.00 0.00 ? 108 SER A CA   2  
ATOM 5242  C C    . SER A 1 108 ? 8.920   -3.701  -4.922  1.00 0.00 ? 108 SER A C    2  
ATOM 5243  O O    . SER A 1 108 ? 8.734   -3.687  -3.724  1.00 0.00 ? 108 SER A O    2  
ATOM 5244  C CB   . SER A 1 108 ? 9.752   -5.714  -6.147  1.00 0.00 ? 108 SER A CB   2  
ATOM 5245  O OG   . SER A 1 108 ? 10.916  -6.389  -6.606  1.00 0.00 ? 108 SER A OG   2  
ATOM 5246  H H    . SER A 1 108 ? 10.894  -4.494  -3.506  1.00 0.00 ? 108 SER A H    2  
ATOM 5247  H HA   . SER A 1 108 ? 10.585  -3.739  -6.280  1.00 0.00 ? 108 SER A HA   2  
ATOM 5248  H HB2  . SER A 1 108 ? 9.257   -6.324  -5.409  1.00 0.00 ? 108 SER A HB2  2  
ATOM 5249  H HB3  . SER A 1 108 ? 9.078   -5.535  -6.974  1.00 0.00 ? 108 SER A HB3  2  
ATOM 5250  H HG   . SER A 1 108 ? 10.988  -6.247  -7.552  1.00 0.00 ? 108 SER A HG   2  
ATOM 5251  N N    . CYS A 1 109 ? 8.084   -3.128  -5.745  1.00 0.00 ? 109 CYS A N    2  
ATOM 5252  C CA   . CYS A 1 109 ? 6.865   -2.442  -5.217  1.00 0.00 ? 109 CYS A CA   2  
ATOM 5253  C C    . CYS A 1 109 ? 5.640   -2.768  -6.082  1.00 0.00 ? 109 CYS A C    2  
ATOM 5254  O O    . CYS A 1 109 ? 5.747   -2.960  -7.278  1.00 0.00 ? 109 CYS A O    2  
ATOM 5255  C CB   . CYS A 1 109 ? 7.104   -0.935  -5.227  1.00 0.00 ? 109 CYS A CB   2  
ATOM 5256  S SG   . CYS A 1 109 ? 8.510   -0.561  -4.156  1.00 0.00 ? 109 CYS A SG   2  
ATOM 5257  H H    . CYS A 1 109 ? 8.266   -3.139  -6.706  1.00 0.00 ? 109 CYS A H    2  
ATOM 5258  H HA   . CYS A 1 109 ? 6.681   -2.764  -4.205  1.00 0.00 ? 109 CYS A HA   2  
ATOM 5259  H HB2  . CYS A 1 109 ? 7.316   -0.609  -6.235  1.00 0.00 ? 109 CYS A HB2  2  
ATOM 5260  H HB3  . CYS A 1 109 ? 6.225   -0.426  -4.861  1.00 0.00 ? 109 CYS A HB3  2  
ATOM 5261  N N    . LYS A 1 110 ? 4.473   -2.817  -5.486  1.00 0.00 ? 110 LYS A N    2  
ATOM 5262  C CA   . LYS A 1 110 ? 3.242   -3.112  -6.265  1.00 0.00 ? 110 LYS A CA   2  
ATOM 5263  C C    . LYS A 1 110 ? 2.211   -2.022  -5.971  1.00 0.00 ? 110 LYS A C    2  
ATOM 5264  O O    . LYS A 1 110 ? 2.552   -0.867  -5.809  1.00 0.00 ? 110 LYS A O    2  
ATOM 5265  C CB   . LYS A 1 110 ? 2.688   -4.477  -5.850  1.00 0.00 ? 110 LYS A CB   2  
ATOM 5266  C CG   . LYS A 1 110 ? 2.070   -5.170  -7.066  1.00 0.00 ? 110 LYS A CG   2  
ATOM 5267  C CD   . LYS A 1 110 ? 2.595   -6.604  -7.155  1.00 0.00 ? 110 LYS A CD   2  
ATOM 5268  C CE   . LYS A 1 110 ? 2.357   -7.147  -8.565  1.00 0.00 ? 110 LYS A CE   2  
ATOM 5269  N NZ   . LYS A 1 110 ? 2.841   -8.555  -8.642  1.00 0.00 ? 110 LYS A NZ   2  
ATOM 5270  H H    . LYS A 1 110 ? 4.403   -2.649  -4.521  1.00 0.00 ? 110 LYS A H    2  
ATOM 5271  H HA   . LYS A 1 110 ? 3.474   -3.119  -7.320  1.00 0.00 ? 110 LYS A HA   2  
ATOM 5272  H HB2  . LYS A 1 110 ? 3.489   -5.086  -5.456  1.00 0.00 ? 110 LYS A HB2  2  
ATOM 5273  H HB3  . LYS A 1 110 ? 1.931   -4.343  -5.091  1.00 0.00 ? 110 LYS A HB3  2  
ATOM 5274  H HG2  . LYS A 1 110 ? 0.994   -5.185  -6.964  1.00 0.00 ? 110 LYS A HG2  2  
ATOM 5275  H HG3  . LYS A 1 110 ? 2.340   -4.633  -7.962  1.00 0.00 ? 110 LYS A HG3  2  
ATOM 5276  H HD2  . LYS A 1 110 ? 3.653   -6.613  -6.939  1.00 0.00 ? 110 LYS A HD2  2  
ATOM 5277  H HD3  . LYS A 1 110 ? 2.074   -7.223  -6.440  1.00 0.00 ? 110 LYS A HD3  2  
ATOM 5278  H HE2  . LYS A 1 110 ? 1.301   -7.116  -8.789  1.00 0.00 ? 110 LYS A HE2  2  
ATOM 5279  H HE3  . LYS A 1 110 ? 2.895   -6.542  -9.280  1.00 0.00 ? 110 LYS A HE3  2  
ATOM 5280  H HZ1  . LYS A 1 110 ? 3.806   -8.610  -8.259  1.00 0.00 ? 110 LYS A HZ1  2  
ATOM 5281  H HZ2  . LYS A 1 110 ? 2.214   -9.167  -8.085  1.00 0.00 ? 110 LYS A HZ2  2  
ATOM 5282  H HZ3  . LYS A 1 110 ? 2.842   -8.866  -9.635  1.00 0.00 ? 110 LYS A HZ3  2  
ATOM 5283  N N    . CYS A 1 111 ? 0.955   -2.364  -5.894  1.00 0.00 ? 111 CYS A N    2  
ATOM 5284  C CA   . CYS A 1 111 ? -0.071  -1.325  -5.604  1.00 0.00 ? 111 CYS A CA   2  
ATOM 5285  C C    . CYS A 1 111 ? -1.199  -1.931  -4.770  1.00 0.00 ? 111 CYS A C    2  
ATOM 5286  O O    . CYS A 1 111 ? -2.064  -2.612  -5.284  1.00 0.00 ? 111 CYS A O    2  
ATOM 5287  C CB   . CYS A 1 111 ? -0.640  -0.793  -6.920  1.00 0.00 ? 111 CYS A CB   2  
ATOM 5288  S SG   . CYS A 1 111 ? 0.489   0.444   -7.606  1.00 0.00 ? 111 CYS A SG   2  
ATOM 5289  H H    . CYS A 1 111 ? 0.689   -3.297  -6.023  1.00 0.00 ? 111 CYS A H    2  
ATOM 5290  H HA   . CYS A 1 111 ? 0.385   -0.513  -5.057  1.00 0.00 ? 111 CYS A HA   2  
ATOM 5291  H HB2  . CYS A 1 111 ? -0.751  -1.608  -7.621  1.00 0.00 ? 111 CYS A HB2  2  
ATOM 5292  H HB3  . CYS A 1 111 ? -1.604  -0.340  -6.740  1.00 0.00 ? 111 CYS A HB3  2  
ATOM 5293  N N    . SER A 1 112 ? -1.205  -1.688  -3.486  1.00 0.00 ? 112 SER A N    2  
ATOM 5294  C CA   . SER A 1 112 ? -2.288  -2.253  -2.637  1.00 0.00 ? 112 SER A CA   2  
ATOM 5295  C C    . SER A 1 112 ? -3.349  -1.180  -2.391  1.00 0.00 ? 112 SER A C    2  
ATOM 5296  O O    . SER A 1 112 ? -2.974  -0.074  -2.037  1.00 0.00 ? 112 SER A O    2  
ATOM 5297  C CB   . SER A 1 112 ? -1.705  -2.714  -1.301  1.00 0.00 ? 112 SER A CB   2  
ATOM 5298  O OG   . SER A 1 112 ? -2.644  -3.557  -0.646  1.00 0.00 ? 112 SER A OG   2  
ATOM 5299  O OXT  . SER A 1 112 ? -4.519  -1.480  -2.565  1.00 0.00 ? 112 SER A OXT  2  
ATOM 5300  H H    . SER A 1 112 ? -0.500  -1.131  -3.083  1.00 0.00 ? 112 SER A H    2  
ATOM 5301  H HA   . SER A 1 112 ? -2.738  -3.095  -3.142  1.00 0.00 ? 112 SER A HA   2  
ATOM 5302  H HB2  . SER A 1 112 ? -0.796  -3.263  -1.474  1.00 0.00 ? 112 SER A HB2  2  
ATOM 5303  H HB3  . SER A 1 112 ? -1.490  -1.850  -0.685  1.00 0.00 ? 112 SER A HB3  2  
ATOM 5304  H HG   . SER A 1 112 ? -2.383  -4.468  -0.800  1.00 0.00 ? 112 SER A HG   2  
ATOM 5305  N N    . ALA B 1 1   ? -7.639  -1.785  15.442  1.00 0.00 ? 1   ALA B N    2  
ATOM 5306  C CA   . ALA B 1 1   ? -7.986  -2.520  14.193  1.00 0.00 ? 1   ALA B CA   2  
ATOM 5307  C C    . ALA B 1 1   ? -8.279  -1.517  13.076  1.00 0.00 ? 1   ALA B C    2  
ATOM 5308  O O    . ALA B 1 1   ? -9.179  -0.706  13.177  1.00 0.00 ? 1   ALA B O    2  
ATOM 5309  C CB   . ALA B 1 1   ? -9.226  -3.382  14.438  1.00 0.00 ? 1   ALA B CB   2  
ATOM 5310  H H1   . ALA B 1 1   ? -7.886  -0.780  15.333  1.00 0.00 ? 1   ALA B H1   2  
ATOM 5311  H H2   . ALA B 1 1   ? -8.169  -2.187  16.241  1.00 0.00 ? 1   ALA B H2   2  
ATOM 5312  H H3   . ALA B 1 1   ? -6.620  -1.874  15.626  1.00 0.00 ? 1   ALA B H3   2  
ATOM 5313  H HA   . ALA B 1 1   ? -7.160  -3.151  13.904  1.00 0.00 ? 1   ALA B HA   2  
ATOM 5314  H HB1  . ALA B 1 1   ? -9.246  -3.700  15.470  1.00 0.00 ? 1   ALA B HB1  2  
ATOM 5315  H HB2  . ALA B 1 1   ? -10.113 -2.806  14.223  1.00 0.00 ? 1   ALA B HB2  2  
ATOM 5316  H HB3  . ALA B 1 1   ? -9.194  -4.249  13.795  1.00 0.00 ? 1   ALA B HB3  2  
ATOM 5317  N N    . LEU B 1 2   ? -7.528  -1.562  12.009  1.00 0.00 ? 2   LEU B N    2  
ATOM 5318  C CA   . LEU B 1 2   ? -7.770  -0.609  10.890  1.00 0.00 ? 2   LEU B CA   2  
ATOM 5319  C C    . LEU B 1 2   ? -8.757  -1.217  9.903   1.00 0.00 ? 2   LEU B C    2  
ATOM 5320  O O    . LEU B 1 2   ? -8.438  -1.458  8.756   1.00 0.00 ? 2   LEU B O    2  
ATOM 5321  C CB   . LEU B 1 2   ? -6.463  -0.319  10.165  1.00 0.00 ? 2   LEU B CB   2  
ATOM 5322  C CG   . LEU B 1 2   ? -5.361  -0.020  11.181  1.00 0.00 ? 2   LEU B CG   2  
ATOM 5323  C CD1  . LEU B 1 2   ? -4.129  0.508   10.448  1.00 0.00 ? 2   LEU B CD1  2  
ATOM 5324  C CD2  . LEU B 1 2   ? -5.852  1.035   12.176  1.00 0.00 ? 2   LEU B CD2  2  
ATOM 5325  H H    . LEU B 1 2   ? -6.806  -2.223  11.944  1.00 0.00 ? 2   LEU B H    2  
ATOM 5326  H HA   . LEU B 1 2   ? -8.176  0.312   11.281  1.00 0.00 ? 2   LEU B HA   2  
ATOM 5327  H HB2  . LEU B 1 2   ? -6.185  -1.178  9.573   1.00 0.00 ? 2   LEU B HB2  2  
ATOM 5328  H HB3  . LEU B 1 2   ? -6.597  0.534   9.521   1.00 0.00 ? 2   LEU B HB3  2  
ATOM 5329  H HG   . LEU B 1 2   ? -5.105  -0.927  11.711  1.00 0.00 ? 2   LEU B HG   2  
ATOM 5330  H HD11 . LEU B 1 2   ? -4.104  0.101   9.448   1.00 0.00 ? 2   LEU B HD11 2  
ATOM 5331  H HD12 . LEU B 1 2   ? -4.176  1.586   10.398  1.00 0.00 ? 2   LEU B HD12 2  
ATOM 5332  H HD13 . LEU B 1 2   ? -3.238  0.211   10.981  1.00 0.00 ? 2   LEU B HD13 2  
ATOM 5333  H HD21 . LEU B 1 2   ? -6.856  0.797   12.492  1.00 0.00 ? 2   LEU B HD21 2  
ATOM 5334  H HD22 . LEU B 1 2   ? -5.199  1.048   13.034  1.00 0.00 ? 2   LEU B HD22 2  
ATOM 5335  H HD23 . LEU B 1 2   ? -5.847  2.005   11.702  1.00 0.00 ? 2   LEU B HD23 2  
ATOM 5336  N N    . ASP B 1 3   ? -9.952  -1.465  10.339  1.00 0.00 ? 3   ASP B N    2  
ATOM 5337  C CA   . ASP B 1 3   ? -10.967 -2.057  9.429   1.00 0.00 ? 3   ASP B CA   2  
ATOM 5338  C C    . ASP B 1 3   ? -12.058 -1.028  9.143   1.00 0.00 ? 3   ASP B C    2  
ATOM 5339  O O    . ASP B 1 3   ? -12.042 0.074   9.655   1.00 0.00 ? 3   ASP B O    2  
ATOM 5340  C CB   . ASP B 1 3   ? -11.593 -3.287  10.087  1.00 0.00 ? 3   ASP B CB   2  
ATOM 5341  C CG   . ASP B 1 3   ? -11.624 -3.102  11.606  1.00 0.00 ? 3   ASP B CG   2  
ATOM 5342  O OD1  . ASP B 1 3   ? -10.608 -3.350  12.233  1.00 0.00 ? 3   ASP B OD1  2  
ATOM 5343  O OD2  . ASP B 1 3   ? -12.663 -2.714  12.114  1.00 0.00 ? 3   ASP B OD2  2  
ATOM 5344  H H    . ASP B 1 3   ? -10.183 -1.260  11.265  1.00 0.00 ? 3   ASP B H    2  
ATOM 5345  H HA   . ASP B 1 3   ? -10.494 -2.346  8.502   1.00 0.00 ? 3   ASP B HA   2  
ATOM 5346  H HB2  . ASP B 1 3   ? -12.601 -3.416  9.720   1.00 0.00 ? 3   ASP B HB2  2  
ATOM 5347  H HB3  . ASP B 1 3   ? -11.008 -4.158  9.845   1.00 0.00 ? 3   ASP B HB3  2  
ATOM 5348  N N    . THR B 1 4   ? -13.005 -1.387  8.327   1.00 0.00 ? 4   THR B N    2  
ATOM 5349  C CA   . THR B 1 4   ? -14.110 -0.446  7.995   1.00 0.00 ? 4   THR B CA   2  
ATOM 5350  C C    . THR B 1 4   ? -15.124 -0.414  9.142   1.00 0.00 ? 4   THR B C    2  
ATOM 5351  O O    . THR B 1 4   ? -16.164 0.207   9.046   1.00 0.00 ? 4   THR B O    2  
ATOM 5352  C CB   . THR B 1 4   ? -14.788 -0.913  6.706   1.00 0.00 ? 4   THR B CB   2  
ATOM 5353  O OG1  . THR B 1 4   ? -15.786 -1.876  7.018   1.00 0.00 ? 4   THR B OG1  2  
ATOM 5354  C CG2  . THR B 1 4   ? -13.738 -1.539  5.781   1.00 0.00 ? 4   THR B CG2  2  
ATOM 5355  H H    . THR B 1 4   ? -12.991 -2.280  7.927   1.00 0.00 ? 4   THR B H    2  
ATOM 5356  H HA   . THR B 1 4   ? -13.709 0.544   7.851   1.00 0.00 ? 4   THR B HA   2  
ATOM 5357  H HB   . THR B 1 4   ? -15.241 -0.070  6.209   1.00 0.00 ? 4   THR B HB   2  
ATOM 5358  H HG1  . THR B 1 4   ? -16.335 -1.997  6.240   1.00 0.00 ? 4   THR B HG1  2  
ATOM 5359  H HG21 . THR B 1 4   ? -12.748 -1.284  6.135   1.00 0.00 ? 4   THR B HG21 2  
ATOM 5360  H HG22 . THR B 1 4   ? -13.851 -2.613  5.781   1.00 0.00 ? 4   THR B HG22 2  
ATOM 5361  H HG23 . THR B 1 4   ? -13.868 -1.163  4.778   1.00 0.00 ? 4   THR B HG23 2  
ATOM 5362  N N    . ASN B 1 5   ? -14.827 -1.072  10.233  1.00 0.00 ? 5   ASN B N    2  
ATOM 5363  C CA   . ASN B 1 5   ? -15.769 -1.070  11.385  1.00 0.00 ? 5   ASN B CA   2  
ATOM 5364  C C    . ASN B 1 5   ? -15.289 -0.060  12.432  1.00 0.00 ? 5   ASN B C    2  
ATOM 5365  O O    . ASN B 1 5   ? -16.075 0.648   13.028  1.00 0.00 ? 5   ASN B O    2  
ATOM 5366  C CB   . ASN B 1 5   ? -15.816 -2.466  12.010  1.00 0.00 ? 5   ASN B CB   2  
ATOM 5367  C CG   . ASN B 1 5   ? -16.718 -2.443  13.246  1.00 0.00 ? 5   ASN B CG   2  
ATOM 5368  O OD1  . ASN B 1 5   ? -16.272 -2.134  14.332  1.00 0.00 ? 5   ASN B OD1  2  
ATOM 5369  N ND2  . ASN B 1 5   ? -17.978 -2.759  13.123  1.00 0.00 ? 5   ASN B ND2  2  
ATOM 5370  H H    . ASN B 1 5   ? -13.983 -1.562  10.294  1.00 0.00 ? 5   ASN B H    2  
ATOM 5371  H HA   . ASN B 1 5   ? -16.756 -0.794  11.044  1.00 0.00 ? 5   ASN B HA   2  
ATOM 5372  H HB2  . ASN B 1 5   ? -16.207 -3.170  11.290  1.00 0.00 ? 5   ASN B HB2  2  
ATOM 5373  H HB3  . ASN B 1 5   ? -14.820 -2.765  12.300  1.00 0.00 ? 5   ASN B HB3  2  
ATOM 5374  H HD21 . ASN B 1 5   ? -18.338 -3.008  12.247  1.00 0.00 ? 5   ASN B HD21 2  
ATOM 5375  H HD22 . ASN B 1 5   ? -18.565 -2.747  13.908  1.00 0.00 ? 5   ASN B HD22 2  
ATOM 5376  N N    . TYR B 1 6   ? -14.005 0.008   12.666  1.00 0.00 ? 6   TYR B N    2  
ATOM 5377  C CA   . TYR B 1 6   ? -13.479 0.963   13.673  1.00 0.00 ? 6   TYR B CA   2  
ATOM 5378  C C    . TYR B 1 6   ? -13.247 2.327   13.017  1.00 0.00 ? 6   TYR B C    2  
ATOM 5379  O O    . TYR B 1 6   ? -13.096 3.330   13.685  1.00 0.00 ? 6   TYR B O    2  
ATOM 5380  C CB   . TYR B 1 6   ? -12.159 0.419   14.215  1.00 0.00 ? 6   TYR B CB   2  
ATOM 5381  C CG   . TYR B 1 6   ? -11.451 1.492   15.003  1.00 0.00 ? 6   TYR B CG   2  
ATOM 5382  C CD1  . TYR B 1 6   ? -11.965 1.917   16.233  1.00 0.00 ? 6   TYR B CD1  2  
ATOM 5383  C CD2  . TYR B 1 6   ? -10.278 2.062   14.499  1.00 0.00 ? 6   TYR B CD2  2  
ATOM 5384  C CE1  . TYR B 1 6   ? -11.305 2.913   16.960  1.00 0.00 ? 6   TYR B CE1  2  
ATOM 5385  C CE2  . TYR B 1 6   ? -9.616  3.059   15.225  1.00 0.00 ? 6   TYR B CE2  2  
ATOM 5386  C CZ   . TYR B 1 6   ? -10.130 3.484   16.456  1.00 0.00 ? 6   TYR B CZ   2  
ATOM 5387  O OH   . TYR B 1 6   ? -9.478  4.467   17.173  1.00 0.00 ? 6   TYR B OH   2  
ATOM 5388  H H    . TYR B 1 6   ? -13.383 -0.573  12.181  1.00 0.00 ? 6   TYR B H    2  
ATOM 5389  H HA   . TYR B 1 6   ? -14.187 1.064   14.481  1.00 0.00 ? 6   TYR B HA   2  
ATOM 5390  H HB2  . TYR B 1 6   ? -12.357 -0.428  14.852  1.00 0.00 ? 6   TYR B HB2  2  
ATOM 5391  H HB3  . TYR B 1 6   ? -11.534 0.110   13.390  1.00 0.00 ? 6   TYR B HB3  2  
ATOM 5392  H HD1  . TYR B 1 6   ? -12.872 1.475   16.621  1.00 0.00 ? 6   TYR B HD1  2  
ATOM 5393  H HD2  . TYR B 1 6   ? -9.883  1.731   13.548  1.00 0.00 ? 6   TYR B HD2  2  
ATOM 5394  H HE1  . TYR B 1 6   ? -11.701 3.242   17.909  1.00 0.00 ? 6   TYR B HE1  2  
ATOM 5395  H HE2  . TYR B 1 6   ? -8.708  3.499   14.837  1.00 0.00 ? 6   TYR B HE2  2  
ATOM 5396  H HH   . TYR B 1 6   ? -9.263  4.110   18.038  1.00 0.00 ? 6   TYR B HH   2  
ATOM 5397  N N    . CYS B 1 7   ? -13.218 2.373   11.712  1.00 0.00 ? 7   CYS B N    2  
ATOM 5398  C CA   . CYS B 1 7   ? -12.997 3.673   11.018  1.00 0.00 ? 7   CYS B CA   2  
ATOM 5399  C C    . CYS B 1 7   ? -14.343 4.339   10.729  1.00 0.00 ? 7   CYS B C    2  
ATOM 5400  O O    . CYS B 1 7   ? -14.428 5.537   10.551  1.00 0.00 ? 7   CYS B O    2  
ATOM 5401  C CB   . CYS B 1 7   ? -12.246 3.431   9.705   1.00 0.00 ? 7   CYS B CB   2  
ATOM 5402  S SG   . CYS B 1 7   ? -10.465 3.538   10.009  1.00 0.00 ? 7   CYS B SG   2  
ATOM 5403  H H    . CYS B 1 7   ? -13.342 1.553   11.190  1.00 0.00 ? 7   CYS B H    2  
ATOM 5404  H HA   . CYS B 1 7   ? -12.408 4.320   11.651  1.00 0.00 ? 7   CYS B HA   2  
ATOM 5405  H HB2  . CYS B 1 7   ? -12.489 2.448   9.326   1.00 0.00 ? 7   CYS B HB2  2  
ATOM 5406  H HB3  . CYS B 1 7   ? -12.533 4.178   8.980   1.00 0.00 ? 7   CYS B HB3  2  
ATOM 5407  N N    . PHE B 1 8   ? -15.399 3.573   10.688  1.00 0.00 ? 8   PHE B N    2  
ATOM 5408  C CA   . PHE B 1 8   ? -16.738 4.167   10.418  1.00 0.00 ? 8   PHE B CA   2  
ATOM 5409  C C    . PHE B 1 8   ? -17.392 4.566   11.743  1.00 0.00 ? 8   PHE B C    2  
ATOM 5410  O O    . PHE B 1 8   ? -18.600 4.575   11.872  1.00 0.00 ? 8   PHE B O    2  
ATOM 5411  C CB   . PHE B 1 8   ? -17.620 3.142   9.701   1.00 0.00 ? 8   PHE B CB   2  
ATOM 5412  C CG   . PHE B 1 8   ? -17.450 3.286   8.207   1.00 0.00 ? 8   PHE B CG   2  
ATOM 5413  C CD1  . PHE B 1 8   ? -16.239 3.754   7.682   1.00 0.00 ? 8   PHE B CD1  2  
ATOM 5414  C CD2  . PHE B 1 8   ? -18.504 2.953   7.348   1.00 0.00 ? 8   PHE B CD2  2  
ATOM 5415  C CE1  . PHE B 1 8   ? -16.084 3.891   6.297   1.00 0.00 ? 8   PHE B CE1  2  
ATOM 5416  C CE2  . PHE B 1 8   ? -18.349 3.089   5.963   1.00 0.00 ? 8   PHE B CE2  2  
ATOM 5417  C CZ   . PHE B 1 8   ? -17.138 3.558   5.438   1.00 0.00 ? 8   PHE B CZ   2  
ATOM 5418  H H    . PHE B 1 8   ? -15.312 2.609   10.838  1.00 0.00 ? 8   PHE B H    2  
ATOM 5419  H HA   . PHE B 1 8   ? -16.624 5.043   9.795   1.00 0.00 ? 8   PHE B HA   2  
ATOM 5420  H HB2  . PHE B 1 8   ? -17.330 2.146   10.003  1.00 0.00 ? 8   PHE B HB2  2  
ATOM 5421  H HB3  . PHE B 1 8   ? -18.653 3.311   9.963   1.00 0.00 ? 8   PHE B HB3  2  
ATOM 5422  H HD1  . PHE B 1 8   ? -15.426 4.012   8.345   1.00 0.00 ? 8   PHE B HD1  2  
ATOM 5423  H HD2  . PHE B 1 8   ? -19.437 2.591   7.754   1.00 0.00 ? 8   PHE B HD2  2  
ATOM 5424  H HE1  . PHE B 1 8   ? -15.150 4.252   5.892   1.00 0.00 ? 8   PHE B HE1  2  
ATOM 5425  H HE2  . PHE B 1 8   ? -19.162 2.833   5.301   1.00 0.00 ? 8   PHE B HE2  2  
ATOM 5426  H HZ   . PHE B 1 8   ? -17.018 3.663   4.370   1.00 0.00 ? 8   PHE B HZ   2  
ATOM 5427  N N    . SER B 1 9   ? -16.603 4.895   12.729  1.00 0.00 ? 9   SER B N    2  
ATOM 5428  C CA   . SER B 1 9   ? -17.179 5.291   14.044  1.00 0.00 ? 9   SER B CA   2  
ATOM 5429  C C    . SER B 1 9   ? -16.344 6.421   14.651  1.00 0.00 ? 9   SER B C    2  
ATOM 5430  O O    . SER B 1 9   ? -16.804 7.536   14.797  1.00 0.00 ? 9   SER B O    2  
ATOM 5431  C CB   . SER B 1 9   ? -17.167 4.087   14.988  1.00 0.00 ? 9   SER B CB   2  
ATOM 5432  O OG   . SER B 1 9   ? -18.470 3.521   15.044  1.00 0.00 ? 9   SER B OG   2  
ATOM 5433  H H    . SER B 1 9   ? -15.631 4.880   12.605  1.00 0.00 ? 9   SER B H    2  
ATOM 5434  H HA   . SER B 1 9   ? -18.195 5.629   13.906  1.00 0.00 ? 9   SER B HA   2  
ATOM 5435  H HB2  . SER B 1 9   ? -16.475 3.346   14.621  1.00 0.00 ? 9   SER B HB2  2  
ATOM 5436  H HB3  . SER B 1 9   ? -16.859 4.407   15.974  1.00 0.00 ? 9   SER B HB3  2  
ATOM 5437  H HG   . SER B 1 9   ? -18.771 3.559   15.955  1.00 0.00 ? 9   SER B HG   2  
ATOM 5438  N N    . SER B 1 10  ? -15.120 6.142   15.008  1.00 0.00 ? 10  SER B N    2  
ATOM 5439  C CA   . SER B 1 10  ? -14.258 7.200   15.607  1.00 0.00 ? 10  SER B CA   2  
ATOM 5440  C C    . SER B 1 10  ? -13.552 7.980   14.495  1.00 0.00 ? 10  SER B C    2  
ATOM 5441  O O    . SER B 1 10  ? -13.948 7.941   13.348  1.00 0.00 ? 10  SER B O    2  
ATOM 5442  C CB   . SER B 1 10  ? -13.211 6.552   16.514  1.00 0.00 ? 10  SER B CB   2  
ATOM 5443  O OG   . SER B 1 10  ? -12.842 7.470   17.534  1.00 0.00 ? 10  SER B OG   2  
ATOM 5444  H H    . SER B 1 10  ? -14.768 5.236   14.883  1.00 0.00 ? 10  SER B H    2  
ATOM 5445  H HA   . SER B 1 10  ? -14.869 7.875   16.188  1.00 0.00 ? 10  SER B HA   2  
ATOM 5446  H HB2  . SER B 1 10  ? -13.625 5.666   16.967  1.00 0.00 ? 10  SER B HB2  2  
ATOM 5447  H HB3  . SER B 1 10  ? -12.344 6.282   15.925  1.00 0.00 ? 10  SER B HB3  2  
ATOM 5448  H HG   . SER B 1 10  ? -13.635 7.924   17.826  1.00 0.00 ? 10  SER B HG   2  
ATOM 5449  N N    . THR B 1 11  ? -12.508 8.690   14.829  1.00 0.00 ? 11  THR B N    2  
ATOM 5450  C CA   . THR B 1 11  ? -11.776 9.473   13.793  1.00 0.00 ? 11  THR B CA   2  
ATOM 5451  C C    . THR B 1 11  ? -10.450 8.781   13.471  1.00 0.00 ? 11  THR B C    2  
ATOM 5452  O O    . THR B 1 11  ? -10.390 7.878   12.660  1.00 0.00 ? 11  THR B O    2  
ATOM 5453  C CB   . THR B 1 11  ? -11.516 10.892  14.311  1.00 0.00 ? 11  THR B CB   2  
ATOM 5454  O OG1  . THR B 1 11  ? -10.374 11.434  13.663  1.00 0.00 ? 11  THR B OG1  2  
ATOM 5455  C CG2  . THR B 1 11  ? -11.287 10.858  15.823  1.00 0.00 ? 11  THR B CG2  2  
ATOM 5456  H H    . THR B 1 11  ? -12.206 8.708   15.760  1.00 0.00 ? 11  THR B H    2  
ATOM 5457  H HA   . THR B 1 11  ? -12.368 9.525   12.900  1.00 0.00 ? 11  THR B HA   2  
ATOM 5458  H HB   . THR B 1 11  ? -12.371 11.511  14.100  1.00 0.00 ? 11  THR B HB   2  
ATOM 5459  H HG1  . THR B 1 11  ? -10.642 11.737  12.792  1.00 0.00 ? 11  THR B HG1  2  
ATOM 5460  H HG21 . THR B 1 11  ? -10.810 9.928   16.094  1.00 0.00 ? 11  THR B HG21 2  
ATOM 5461  H HG22 . THR B 1 11  ? -10.652 11.685  16.110  1.00 0.00 ? 11  THR B HG22 2  
ATOM 5462  H HG23 . THR B 1 11  ? -12.235 10.939  16.335  1.00 0.00 ? 11  THR B HG23 2  
ATOM 5463  N N    . GLU B 1 12  ? -9.391  9.197   14.097  1.00 0.00 ? 12  GLU B N    2  
ATOM 5464  C CA   . GLU B 1 12  ? -8.067  8.568   13.830  1.00 0.00 ? 12  GLU B CA   2  
ATOM 5465  C C    . GLU B 1 12  ? -7.577  8.980   12.440  1.00 0.00 ? 12  GLU B C    2  
ATOM 5466  O O    . GLU B 1 12  ? -8.342  9.058   11.500  1.00 0.00 ? 12  GLU B O    2  
ATOM 5467  C CB   . GLU B 1 12  ? -8.204  7.045   13.892  1.00 0.00 ? 12  GLU B CB   2  
ATOM 5468  C CG   . GLU B 1 12  ? -6.876  6.430   14.336  1.00 0.00 ? 12  GLU B CG   2  
ATOM 5469  C CD   . GLU B 1 12  ? -6.744  6.539   15.856  1.00 0.00 ? 12  GLU B CD   2  
ATOM 5470  O OE1  . GLU B 1 12  ? -7.766  6.516   16.523  1.00 0.00 ? 12  GLU B OE1  2  
ATOM 5471  O OE2  . GLU B 1 12  ? -5.624  6.646   16.328  1.00 0.00 ? 12  GLU B OE2  2  
ATOM 5472  H H    . GLU B 1 12  ? -9.467  9.924   14.743  1.00 0.00 ? 12  GLU B H    2  
ATOM 5473  H HA   . GLU B 1 12  ? -7.355  8.895   14.575  1.00 0.00 ? 12  GLU B HA   2  
ATOM 5474  H HB2  . GLU B 1 12  ? -8.978  6.782   14.598  1.00 0.00 ? 12  GLU B HB2  2  
ATOM 5475  H HB3  . GLU B 1 12  ? -8.464  6.667   12.915  1.00 0.00 ? 12  GLU B HB3  2  
ATOM 5476  H HG2  . GLU B 1 12  ? -6.847  5.389   14.046  1.00 0.00 ? 12  GLU B HG2  2  
ATOM 5477  H HG3  . GLU B 1 12  ? -6.059  6.957   13.867  1.00 0.00 ? 12  GLU B HG3  2  
ATOM 5478  N N    . LYS B 1 13  ? -6.305  9.245   12.303  1.00 0.00 ? 13  LYS B N    2  
ATOM 5479  C CA   . LYS B 1 13  ? -5.770  9.651   10.973  1.00 0.00 ? 13  LYS B CA   2  
ATOM 5480  C C    . LYS B 1 13  ? -4.802  8.582   10.461  1.00 0.00 ? 13  LYS B C    2  
ATOM 5481  O O    . LYS B 1 13  ? -4.582  8.448   9.274   1.00 0.00 ? 13  LYS B O    2  
ATOM 5482  C CB   . LYS B 1 13  ? -5.035  10.987  11.104  1.00 0.00 ? 13  LYS B CB   2  
ATOM 5483  C CG   . LYS B 1 13  ? -5.982  12.035  11.692  1.00 0.00 ? 13  LYS B CG   2  
ATOM 5484  C CD   . LYS B 1 13  ? -5.580  13.425  11.194  1.00 0.00 ? 13  LYS B CD   2  
ATOM 5485  C CE   . LYS B 1 13  ? -6.106  14.486  12.164  1.00 0.00 ? 13  LYS B CE   2  
ATOM 5486  N NZ   . LYS B 1 13  ? -7.494  14.870  11.778  1.00 0.00 ? 13  LYS B NZ   2  
ATOM 5487  H H    . LYS B 1 13  ? -5.704  9.176   13.073  1.00 0.00 ? 13  LYS B H    2  
ATOM 5488  H HA   . LYS B 1 13  ? -6.587  9.759   10.274  1.00 0.00 ? 13  LYS B HA   2  
ATOM 5489  H HB2  . LYS B 1 13  ? -4.181  10.865  11.755  1.00 0.00 ? 13  LYS B HB2  2  
ATOM 5490  H HB3  . LYS B 1 13  ? -4.702  11.312  10.130  1.00 0.00 ? 13  LYS B HB3  2  
ATOM 5491  H HG2  . LYS B 1 13  ? -6.994  11.819  11.381  1.00 0.00 ? 13  LYS B HG2  2  
ATOM 5492  H HG3  . LYS B 1 13  ? -5.922  12.009  12.769  1.00 0.00 ? 13  LYS B HG3  2  
ATOM 5493  H HD2  . LYS B 1 13  ? -4.503  13.490  11.138  1.00 0.00 ? 13  LYS B HD2  2  
ATOM 5494  H HD3  . LYS B 1 13  ? -6.002  13.594  10.216  1.00 0.00 ? 13  LYS B HD3  2  
ATOM 5495  H HE2  . LYS B 1 13  ? -6.110  14.086  13.167  1.00 0.00 ? 13  LYS B HE2  2  
ATOM 5496  H HE3  . LYS B 1 13  ? -5.468  15.357  12.126  1.00 0.00 ? 13  LYS B HE3  2  
ATOM 5497  H HZ1  . LYS B 1 13  ? -7.662  14.605  10.785  1.00 0.00 ? 13  LYS B HZ1  2  
ATOM 5498  H HZ2  . LYS B 1 13  ? -8.174  14.377  12.390  1.00 0.00 ? 13  LYS B HZ2  2  
ATOM 5499  H HZ3  . LYS B 1 13  ? -7.613  15.897  11.888  1.00 0.00 ? 13  LYS B HZ3  2  
ATOM 5500  N N    . ASN B 1 14  ? -4.224  7.816   11.347  1.00 0.00 ? 14  ASN B N    2  
ATOM 5501  C CA   . ASN B 1 14  ? -3.275  6.754   10.907  1.00 0.00 ? 14  ASN B CA   2  
ATOM 5502  C C    . ASN B 1 14  ? -3.939  5.898   9.827   1.00 0.00 ? 14  ASN B C    2  
ATOM 5503  O O    . ASN B 1 14  ? -5.046  6.165   9.407   1.00 0.00 ? 14  ASN B O    2  
ATOM 5504  C CB   . ASN B 1 14  ? -2.906  5.874   12.104  1.00 0.00 ? 14  ASN B CB   2  
ATOM 5505  C CG   . ASN B 1 14  ? -2.560  6.760   13.301  1.00 0.00 ? 14  ASN B CG   2  
ATOM 5506  O OD1  . ASN B 1 14  ? -1.587  7.488   13.271  1.00 0.00 ? 14  ASN B OD1  2  
ATOM 5507  N ND2  . ASN B 1 14  ? -3.319  6.730   14.361  1.00 0.00 ? 14  ASN B ND2  2  
ATOM 5508  H H    . ASN B 1 14  ? -4.417  7.938   12.300  1.00 0.00 ? 14  ASN B H    2  
ATOM 5509  H HA   . ASN B 1 14  ? -2.382  7.211   10.508  1.00 0.00 ? 14  ASN B HA   2  
ATOM 5510  H HB2  . ASN B 1 14  ? -3.744  5.239   12.354  1.00 0.00 ? 14  ASN B HB2  2  
ATOM 5511  H HB3  . ASN B 1 14  ? -2.053  5.263   11.852  1.00 0.00 ? 14  ASN B HB3  2  
ATOM 5512  H HD21 . ASN B 1 14  ? -4.105  6.144   14.386  1.00 0.00 ? 14  ASN B HD21 2  
ATOM 5513  H HD22 . ASN B 1 14  ? -3.105  7.295   15.133  1.00 0.00 ? 14  ASN B HD22 2  
ATOM 5514  N N    . CYS B 1 15  ? -3.275  4.866   9.377   1.00 0.00 ? 15  CYS B N    2  
ATOM 5515  C CA   . CYS B 1 15  ? -3.876  3.993   8.328   1.00 0.00 ? 15  CYS B CA   2  
ATOM 5516  C C    . CYS B 1 15  ? -5.329  3.708   8.700   1.00 0.00 ? 15  CYS B C    2  
ATOM 5517  O O    . CYS B 1 15  ? -5.620  2.815   9.471   1.00 0.00 ? 15  CYS B O    2  
ATOM 5518  C CB   . CYS B 1 15  ? -3.091  2.680   8.246   1.00 0.00 ? 15  CYS B CB   2  
ATOM 5519  S SG   . CYS B 1 15  ? -4.035  1.435   7.324   1.00 0.00 ? 15  CYS B SG   2  
ATOM 5520  H H    . CYS B 1 15  ? -2.384  4.664   9.731   1.00 0.00 ? 15  CYS B H    2  
ATOM 5521  H HA   . CYS B 1 15  ? -3.839  4.497   7.373   1.00 0.00 ? 15  CYS B HA   2  
ATOM 5522  H HB2  . CYS B 1 15  ? -2.152  2.857   7.751   1.00 0.00 ? 15  CYS B HB2  2  
ATOM 5523  H HB3  . CYS B 1 15  ? -2.902  2.316   9.245   1.00 0.00 ? 15  CYS B HB3  2  
ATOM 5524  N N    . CYS B 1 16  ? -6.242  4.467   8.167   1.00 0.00 ? 16  CYS B N    2  
ATOM 5525  C CA   . CYS B 1 16  ? -7.672  4.247   8.500   1.00 0.00 ? 16  CYS B CA   2  
ATOM 5526  C C    . CYS B 1 16  ? -8.491  4.162   7.211   1.00 0.00 ? 16  CYS B C    2  
ATOM 5527  O O    . CYS B 1 16  ? -8.317  4.944   6.293   1.00 0.00 ? 16  CYS B O    2  
ATOM 5528  C CB   . CYS B 1 16  ? -8.171  5.416   9.359   1.00 0.00 ? 16  CYS B CB   2  
ATOM 5529  S SG   . CYS B 1 16  ? -9.983  5.412   9.431   1.00 0.00 ? 16  CYS B SG   2  
ATOM 5530  H H    . CYS B 1 16  ? -5.985  5.187   7.554   1.00 0.00 ? 16  CYS B H    2  
ATOM 5531  H HA   . CYS B 1 16  ? -7.774  3.325   9.054   1.00 0.00 ? 16  CYS B HA   2  
ATOM 5532  H HB2  . CYS B 1 16  ? -7.775  5.319   10.359  1.00 0.00 ? 16  CYS B HB2  2  
ATOM 5533  H HB3  . CYS B 1 16  ? -7.832  6.346   8.929   1.00 0.00 ? 16  CYS B HB3  2  
ATOM 5534  N N    . VAL B 1 17  ? -9.389  3.221   7.145   1.00 0.00 ? 17  VAL B N    2  
ATOM 5535  C CA   . VAL B 1 17  ? -10.238 3.082   5.934   1.00 0.00 ? 17  VAL B CA   2  
ATOM 5536  C C    . VAL B 1 17  ? -11.391 4.082   6.036   1.00 0.00 ? 17  VAL B C    2  
ATOM 5537  O O    . VAL B 1 17  ? -12.388 3.840   6.687   1.00 0.00 ? 17  VAL B O    2  
ATOM 5538  C CB   . VAL B 1 17  ? -10.779 1.652   5.864   1.00 0.00 ? 17  VAL B CB   2  
ATOM 5539  C CG1  . VAL B 1 17  ? -11.755 1.411   7.007   1.00 0.00 ? 17  VAL B CG1  2  
ATOM 5540  C CG2  . VAL B 1 17  ? -11.496 1.435   4.534   1.00 0.00 ? 17  VAL B CG2  2  
ATOM 5541  H H    . VAL B 1 17  ? -9.512  2.609   7.899   1.00 0.00 ? 17  VAL B H    2  
ATOM 5542  H HA   . VAL B 1 17  ? -9.650  3.293   5.052   1.00 0.00 ? 17  VAL B HA   2  
ATOM 5543  H HB   . VAL B 1 17  ? -9.960  0.957   5.951   1.00 0.00 ? 17  VAL B HB   2  
ATOM 5544  H HG11 . VAL B 1 17  ? -11.418 1.940   7.885   1.00 0.00 ? 17  VAL B HG11 2  
ATOM 5545  H HG12 . VAL B 1 17  ? -12.734 1.769   6.724   1.00 0.00 ? 17  VAL B HG12 2  
ATOM 5546  H HG13 . VAL B 1 17  ? -11.807 0.353   7.218   1.00 0.00 ? 17  VAL B HG13 2  
ATOM 5547  H HG21 . VAL B 1 17  ? -12.268 2.181   4.416   1.00 0.00 ? 17  VAL B HG21 2  
ATOM 5548  H HG22 . VAL B 1 17  ? -10.788 1.518   3.724   1.00 0.00 ? 17  VAL B HG22 2  
ATOM 5549  H HG23 . VAL B 1 17  ? -11.943 0.451   4.522   1.00 0.00 ? 17  VAL B HG23 2  
ATOM 5550  N N    . ARG B 1 18  ? -11.255 5.219   5.420   1.00 0.00 ? 18  ARG B N    2  
ATOM 5551  C CA   . ARG B 1 18  ? -12.337 6.240   5.512   1.00 0.00 ? 18  ARG B CA   2  
ATOM 5552  C C    . ARG B 1 18  ? -13.411 5.966   4.455   1.00 0.00 ? 18  ARG B C    2  
ATOM 5553  O O    . ARG B 1 18  ? -13.172 5.306   3.462   1.00 0.00 ? 18  ARG B O    2  
ATOM 5554  C CB   . ARG B 1 18  ? -11.739 7.632   5.299   1.00 0.00 ? 18  ARG B CB   2  
ATOM 5555  C CG   . ARG B 1 18  ? -10.855 7.993   6.493   1.00 0.00 ? 18  ARG B CG   2  
ATOM 5556  C CD   . ARG B 1 18  ? -10.168 9.335   6.232   1.00 0.00 ? 18  ARG B CD   2  
ATOM 5557  N NE   . ARG B 1 18  ? -8.696  9.185   6.405   1.00 0.00 ? 18  ARG B NE   2  
ATOM 5558  C CZ   . ARG B 1 18  ? -8.109  9.679   7.460   1.00 0.00 ? 18  ARG B CZ   2  
ATOM 5559  N NH1  . ARG B 1 18  ? -8.783  9.837   8.567   1.00 0.00 ? 18  ARG B NH1  2  
ATOM 5560  N NH2  . ARG B 1 18  ? -6.849  10.013  7.410   1.00 0.00 ? 18  ARG B NH2  2  
ATOM 5561  H H    . ARG B 1 18  ? -10.436 5.410   4.913   1.00 0.00 ? 18  ARG B H    2  
ATOM 5562  H HA   . ARG B 1 18  ? -12.786 6.193   6.493   1.00 0.00 ? 18  ARG B HA   2  
ATOM 5563  H HB2  . ARG B 1 18  ? -11.144 7.634   4.400   1.00 0.00 ? 18  ARG B HB2  2  
ATOM 5564  H HB3  . ARG B 1 18  ? -12.533 8.357   5.209   1.00 0.00 ? 18  ARG B HB3  2  
ATOM 5565  H HG2  . ARG B 1 18  ? -11.463 8.064   7.382   1.00 0.00 ? 18  ARG B HG2  2  
ATOM 5566  H HG3  . ARG B 1 18  ? -10.103 7.229   6.628   1.00 0.00 ? 18  ARG B HG3  2  
ATOM 5567  H HD2  . ARG B 1 18  ? -10.381 9.658   5.222   1.00 0.00 ? 18  ARG B HD2  2  
ATOM 5568  H HD3  . ARG B 1 18  ? -10.540 10.071  6.930   1.00 0.00 ? 18  ARG B HD3  2  
ATOM 5569  H HE   . ARG B 1 18  ? -8.169  8.714   5.727   1.00 0.00 ? 18  ARG B HE   2  
ATOM 5570  H HH11 . ARG B 1 18  ? -9.747  9.577   8.607   1.00 0.00 ? 18  ARG B HH11 2  
ATOM 5571  H HH12 . ARG B 1 18  ? -8.333  10.217  9.375   1.00 0.00 ? 18  ARG B HH12 2  
ATOM 5572  H HH21 . ARG B 1 18  ? -6.332  9.889   6.563   1.00 0.00 ? 18  ARG B HH21 2  
ATOM 5573  H HH22 . ARG B 1 18  ? -6.400  10.394  8.219   1.00 0.00 ? 18  ARG B HH22 2  
ATOM 5574  N N    . GLN B 1 19  ? -14.597 6.473   4.671   1.00 0.00 ? 19  GLN B N    2  
ATOM 5575  C CA   . GLN B 1 19  ? -15.701 6.255   3.693   1.00 0.00 ? 19  GLN B CA   2  
ATOM 5576  C C    . GLN B 1 19  ? -15.283 6.785   2.326   1.00 0.00 ? 19  GLN B C    2  
ATOM 5577  O O    . GLN B 1 19  ? -14.420 7.634   2.214   1.00 0.00 ? 19  GLN B O    2  
ATOM 5578  C CB   . GLN B 1 19  ? -16.952 7.000   4.165   1.00 0.00 ? 19  GLN B CB   2  
ATOM 5579  C CG   . GLN B 1 19  ? -16.728 8.508   4.027   1.00 0.00 ? 19  GLN B CG   2  
ATOM 5580  C CD   . GLN B 1 19  ? -17.747 9.255   4.890   1.00 0.00 ? 19  GLN B CD   2  
ATOM 5581  O OE1  . GLN B 1 19  ? -18.690 9.826   4.379   1.00 0.00 ? 19  GLN B OE1  2  
ATOM 5582  N NE2  . GLN B 1 19  ? -17.595 9.278   6.185   1.00 0.00 ? 19  GLN B NE2  2  
ATOM 5583  H H    . GLN B 1 19  ? -14.761 6.999   5.481   1.00 0.00 ? 19  GLN B H    2  
ATOM 5584  H HA   . GLN B 1 19  ? -15.920 5.202   3.615   1.00 0.00 ? 19  GLN B HA   2  
ATOM 5585  H HB2  . GLN B 1 19  ? -17.797 6.703   3.562   1.00 0.00 ? 19  GLN B HB2  2  
ATOM 5586  H HB3  . GLN B 1 19  ? -17.144 6.761   5.200   1.00 0.00 ? 19  GLN B HB3  2  
ATOM 5587  H HG2  . GLN B 1 19  ? -15.729 8.755   4.355   1.00 0.00 ? 19  GLN B HG2  2  
ATOM 5588  H HG3  . GLN B 1 19  ? -16.852 8.797   2.995   1.00 0.00 ? 19  GLN B HG3  2  
ATOM 5589  H HE21 . GLN B 1 19  ? -16.835 8.817   6.598   1.00 0.00 ? 19  GLN B HE21 2  
ATOM 5590  H HE22 . GLN B 1 19  ? -18.243 9.754   6.747   1.00 0.00 ? 19  GLN B HE22 2  
ATOM 5591  N N    . LEU B 1 20  ? -15.883 6.288   1.283   1.00 0.00 ? 20  LEU B N    2  
ATOM 5592  C CA   . LEU B 1 20  ? -15.517 6.760   -0.076  1.00 0.00 ? 20  LEU B CA   2  
ATOM 5593  C C    . LEU B 1 20  ? -16.532 6.241   -1.085  1.00 0.00 ? 20  LEU B C    2  
ATOM 5594  O O    . LEU B 1 20  ? -16.178 5.769   -2.145  1.00 0.00 ? 20  LEU B O    2  
ATOM 5595  C CB   . LEU B 1 20  ? -14.132 6.232   -0.434  1.00 0.00 ? 20  LEU B CB   2  
ATOM 5596  C CG   . LEU B 1 20  ? -13.643 6.874   -1.732  1.00 0.00 ? 20  LEU B CG   2  
ATOM 5597  C CD1  . LEU B 1 20  ? -13.450 8.375   -1.518  1.00 0.00 ? 20  LEU B CD1  2  
ATOM 5598  C CD2  . LEU B 1 20  ? -12.311 6.240   -2.131  1.00 0.00 ? 20  LEU B CD2  2  
ATOM 5599  H H    . LEU B 1 20  ? -16.574 5.601   1.395   1.00 0.00 ? 20  LEU B H    2  
ATOM 5600  H HA   . LEU B 1 20  ? -15.507 7.839   -0.095  1.00 0.00 ? 20  LEU B HA   2  
ATOM 5601  H HB2  . LEU B 1 20  ? -13.452 6.475   0.361   1.00 0.00 ? 20  LEU B HB2  2  
ATOM 5602  H HB3  . LEU B 1 20  ? -14.176 5.160   -0.557  1.00 0.00 ? 20  LEU B HB3  2  
ATOM 5603  H HG   . LEU B 1 20  ? -14.370 6.712   -2.513  1.00 0.00 ? 20  LEU B HG   2  
ATOM 5604  H HD11 . LEU B 1 20  ? -13.333 8.576   -0.463  1.00 0.00 ? 20  LEU B HD11 2  
ATOM 5605  H HD12 . LEU B 1 20  ? -12.569 8.705   -2.047  1.00 0.00 ? 20  LEU B HD12 2  
ATOM 5606  H HD13 . LEU B 1 20  ? -14.315 8.906   -1.891  1.00 0.00 ? 20  LEU B HD13 2  
ATOM 5607  H HD21 . LEU B 1 20  ? -12.439 5.173   -2.244  1.00 0.00 ? 20  LEU B HD21 2  
ATOM 5608  H HD22 . LEU B 1 20  ? -11.976 6.662   -3.067  1.00 0.00 ? 20  LEU B HD22 2  
ATOM 5609  H HD23 . LEU B 1 20  ? -11.574 6.434   -1.366  1.00 0.00 ? 20  LEU B HD23 2  
ATOM 5610  N N    . TYR B 1 21  ? -17.794 6.320   -0.769  1.00 0.00 ? 21  TYR B N    2  
ATOM 5611  C CA   . TYR B 1 21  ? -18.816 5.827   -1.731  1.00 0.00 ? 21  TYR B CA   2  
ATOM 5612  C C    . TYR B 1 21  ? -18.456 6.332   -3.127  1.00 0.00 ? 21  TYR B C    2  
ATOM 5613  O O    . TYR B 1 21  ? -18.139 7.490   -3.315  1.00 0.00 ? 21  TYR B O    2  
ATOM 5614  C CB   . TYR B 1 21  ? -20.199 6.351   -1.353  1.00 0.00 ? 21  TYR B CB   2  
ATOM 5615  C CG   . TYR B 1 21  ? -21.188 5.914   -2.407  1.00 0.00 ? 21  TYR B CG   2  
ATOM 5616  C CD1  . TYR B 1 21  ? -21.203 6.543   -3.659  1.00 0.00 ? 21  TYR B CD1  2  
ATOM 5617  C CD2  . TYR B 1 21  ? -22.086 4.876   -2.135  1.00 0.00 ? 21  TYR B CD2  2  
ATOM 5618  C CE1  . TYR B 1 21  ? -22.116 6.134   -4.638  1.00 0.00 ? 21  TYR B CE1  2  
ATOM 5619  C CE2  . TYR B 1 21  ? -22.999 4.467   -3.112  1.00 0.00 ? 21  TYR B CE2  2  
ATOM 5620  C CZ   . TYR B 1 21  ? -23.015 5.095   -4.365  1.00 0.00 ? 21  TYR B CZ   2  
ATOM 5621  O OH   . TYR B 1 21  ? -23.916 4.689   -5.328  1.00 0.00 ? 21  TYR B OH   2  
ATOM 5622  H H    . TYR B 1 21  ? -18.064 6.701   0.095   1.00 0.00 ? 21  TYR B H    2  
ATOM 5623  H HA   . TYR B 1 21  ? -18.825 4.747   -1.729  1.00 0.00 ? 21  TYR B HA   2  
ATOM 5624  H HB2  . TYR B 1 21  ? -20.488 5.949   -0.392  1.00 0.00 ? 21  TYR B HB2  2  
ATOM 5625  H HB3  . TYR B 1 21  ? -20.178 7.429   -1.303  1.00 0.00 ? 21  TYR B HB3  2  
ATOM 5626  H HD1  . TYR B 1 21  ? -20.509 7.343   -3.868  1.00 0.00 ? 21  TYR B HD1  2  
ATOM 5627  H HD2  . TYR B 1 21  ? -22.071 4.389   -1.171  1.00 0.00 ? 21  TYR B HD2  2  
ATOM 5628  H HE1  . TYR B 1 21  ? -22.126 6.619   -5.607  1.00 0.00 ? 21  TYR B HE1  2  
ATOM 5629  H HE2  . TYR B 1 21  ? -23.692 3.666   -2.900  1.00 0.00 ? 21  TYR B HE2  2  
ATOM 5630  H HH   . TYR B 1 21  ? -23.989 3.733   -5.282  1.00 0.00 ? 21  TYR B HH   2  
ATOM 5631  N N    . ILE B 1 22  ? -18.490 5.475   -4.103  1.00 0.00 ? 22  ILE B N    2  
ATOM 5632  C CA   . ILE B 1 22  ? -18.135 5.913   -5.478  1.00 0.00 ? 22  ILE B CA   2  
ATOM 5633  C C    . ILE B 1 22  ? -19.319 5.690   -6.416  1.00 0.00 ? 22  ILE B C    2  
ATOM 5634  O O    . ILE B 1 22  ? -19.722 4.572   -6.668  1.00 0.00 ? 22  ILE B O    2  
ATOM 5635  C CB   . ILE B 1 22  ? -16.941 5.099   -5.979  1.00 0.00 ? 22  ILE B CB   2  
ATOM 5636  C CG1  . ILE B 1 22  ? -15.696 5.462   -5.168  1.00 0.00 ? 22  ILE B CG1  2  
ATOM 5637  C CG2  . ILE B 1 22  ? -16.693 5.413   -7.456  1.00 0.00 ? 22  ILE B CG2  2  
ATOM 5638  C CD1  . ILE B 1 22  ? -14.498 4.674   -5.698  1.00 0.00 ? 22  ILE B CD1  2  
ATOM 5639  H H    . ILE B 1 22  ? -18.740 4.545   -3.932  1.00 0.00 ? 22  ILE B H    2  
ATOM 5640  H HA   . ILE B 1 22  ? -17.876 6.960   -5.467  1.00 0.00 ? 22  ILE B HA   2  
ATOM 5641  H HB   . ILE B 1 22  ? -17.153 4.045   -5.867  1.00 0.00 ? 22  ILE B HB   2  
ATOM 5642  H HG12 . ILE B 1 22  ? -15.503 6.521   -5.259  1.00 0.00 ? 22  ILE B HG12 2  
ATOM 5643  H HG13 . ILE B 1 22  ? -15.858 5.211   -4.132  1.00 0.00 ? 22  ILE B HG13 2  
ATOM 5644  H HG21 . ILE B 1 22  ? -17.484 6.047   -7.828  1.00 0.00 ? 22  ILE B HG21 2  
ATOM 5645  H HG22 . ILE B 1 22  ? -15.745 5.920   -7.561  1.00 0.00 ? 22  ILE B HG22 2  
ATOM 5646  H HG23 . ILE B 1 22  ? -16.673 4.492   -8.020  1.00 0.00 ? 22  ILE B HG23 2  
ATOM 5647  H HD11 . ILE B 1 22  ? -14.796 4.105   -6.566  1.00 0.00 ? 22  ILE B HD11 2  
ATOM 5648  H HD12 . ILE B 1 22  ? -13.709 5.360   -5.970  1.00 0.00 ? 22  ILE B HD12 2  
ATOM 5649  H HD13 . ILE B 1 22  ? -14.141 4.001   -4.932  1.00 0.00 ? 22  ILE B HD13 2  
ATOM 5650  N N    . ASP B 1 23  ? -19.865 6.742   -6.958  1.00 0.00 ? 23  ASP B N    2  
ATOM 5651  C CA   . ASP B 1 23  ? -20.999 6.576   -7.902  1.00 0.00 ? 23  ASP B CA   2  
ATOM 5652  C C    . ASP B 1 23  ? -20.414 6.287   -9.278  1.00 0.00 ? 23  ASP B C    2  
ATOM 5653  O O    . ASP B 1 23  ? -20.066 7.184   -10.011 1.00 0.00 ? 23  ASP B O    2  
ATOM 5654  C CB   . ASP B 1 23  ? -21.845 7.849   -7.934  1.00 0.00 ? 23  ASP B CB   2  
ATOM 5655  C CG   . ASP B 1 23  ? -22.843 7.775   -9.093  1.00 0.00 ? 23  ASP B CG   2  
ATOM 5656  O OD1  . ASP B 1 23  ? -22.891 6.745   -9.744  1.00 0.00 ? 23  ASP B OD1  2  
ATOM 5657  O OD2  . ASP B 1 23  ? -23.547 8.749   -9.307  1.00 0.00 ? 23  ASP B OD2  2  
ATOM 5658  H H    . ASP B 1 23  ? -19.515 7.636   -6.759  1.00 0.00 ? 23  ASP B H    2  
ATOM 5659  H HA   . ASP B 1 23  ? -21.610 5.744   -7.594  1.00 0.00 ? 23  ASP B HA   2  
ATOM 5660  H HB2  . ASP B 1 23  ? -22.385 7.945   -7.002  1.00 0.00 ? 23  ASP B HB2  2  
ATOM 5661  H HB3  . ASP B 1 23  ? -21.205 8.702   -8.066  1.00 0.00 ? 23  ASP B HB3  2  
ATOM 5662  N N    . PHE B 1 24  ? -20.283 5.024   -9.592  1.00 0.00 ? 24  PHE B N    2  
ATOM 5663  C CA   . PHE B 1 24  ? -19.697 4.574   -10.898 1.00 0.00 ? 24  PHE B CA   2  
ATOM 5664  C C    . PHE B 1 24  ? -19.513 5.729   -11.888 1.00 0.00 ? 24  PHE B C    2  
ATOM 5665  O O    . PHE B 1 24  ? -18.419 5.991   -12.345 1.00 0.00 ? 24  PHE B O    2  
ATOM 5666  C CB   . PHE B 1 24  ? -20.622 3.526   -11.522 1.00 0.00 ? 24  PHE B CB   2  
ATOM 5667  C CG   . PHE B 1 24  ? -20.263 2.162   -10.986 1.00 0.00 ? 24  PHE B CG   2  
ATOM 5668  C CD1  . PHE B 1 24  ? -19.036 1.581   -11.320 1.00 0.00 ? 24  PHE B CD1  2  
ATOM 5669  C CD2  . PHE B 1 24  ? -21.155 1.479   -10.150 1.00 0.00 ? 24  PHE B CD2  2  
ATOM 5670  C CE1  . PHE B 1 24  ? -18.698 0.320   -10.820 1.00 0.00 ? 24  PHE B CE1  2  
ATOM 5671  C CE2  . PHE B 1 24  ? -20.816 0.215   -9.652  1.00 0.00 ? 24  PHE B CE2  2  
ATOM 5672  C CZ   . PHE B 1 24  ? -19.589 -0.363  -9.986  1.00 0.00 ? 24  PHE B CZ   2  
ATOM 5673  H H    . PHE B 1 24  ? -20.563 4.346   -8.942  1.00 0.00 ? 24  PHE B H    2  
ATOM 5674  H HA   . PHE B 1 24  ? -18.738 4.118   -10.710 1.00 0.00 ? 24  PHE B HA   2  
ATOM 5675  H HB2  . PHE B 1 24  ? -21.647 3.754   -11.271 1.00 0.00 ? 24  PHE B HB2  2  
ATOM 5676  H HB3  . PHE B 1 24  ? -20.502 3.533   -12.595 1.00 0.00 ? 24  PHE B HB3  2  
ATOM 5677  H HD1  . PHE B 1 24  ? -18.349 2.106   -11.967 1.00 0.00 ? 24  PHE B HD1  2  
ATOM 5678  H HD2  . PHE B 1 24  ? -22.103 1.926   -9.892  1.00 0.00 ? 24  PHE B HD2  2  
ATOM 5679  H HE1  . PHE B 1 24  ? -17.751 -0.128  -11.078 1.00 0.00 ? 24  PHE B HE1  2  
ATOM 5680  H HE2  . PHE B 1 24  ? -21.502 -0.315  -9.010  1.00 0.00 ? 24  PHE B HE2  2  
ATOM 5681  H HZ   . PHE B 1 24  ? -19.328 -1.335  -9.599  1.00 0.00 ? 24  PHE B HZ   2  
ATOM 5682  N N    . ARG B 1 25  ? -20.571 6.402   -12.245 1.00 0.00 ? 25  ARG B N    2  
ATOM 5683  C CA   . ARG B 1 25  ? -20.449 7.509   -13.238 1.00 0.00 ? 25  ARG B CA   2  
ATOM 5684  C C    . ARG B 1 25  ? -20.038 8.831   -12.576 1.00 0.00 ? 25  ARG B C    2  
ATOM 5685  O O    . ARG B 1 25  ? -19.259 9.586   -13.124 1.00 0.00 ? 25  ARG B O    2  
ATOM 5686  C CB   . ARG B 1 25  ? -21.797 7.699   -13.938 1.00 0.00 ? 25  ARG B CB   2  
ATOM 5687  C CG   . ARG B 1 25  ? -21.746 8.946   -14.824 1.00 0.00 ? 25  ARG B CG   2  
ATOM 5688  C CD   . ARG B 1 25  ? -23.160 9.294   -15.296 1.00 0.00 ? 25  ARG B CD   2  
ATOM 5689  N NE   . ARG B 1 25  ? -24.128 9.046   -14.190 1.00 0.00 ? 25  ARG B NE   2  
ATOM 5690  C CZ   . ARG B 1 25  ? -24.623 10.049  -13.517 1.00 0.00 ? 25  ARG B CZ   2  
ATOM 5691  N NH1  . ARG B 1 25  ? -25.238 11.015  -14.144 1.00 0.00 ? 25  ARG B NH1  2  
ATOM 5692  N NH2  . ARG B 1 25  ? -24.505 10.085  -12.218 1.00 0.00 ? 25  ARG B NH2  2  
ATOM 5693  H H    . ARG B 1 25  ? -21.447 6.165   -11.880 1.00 0.00 ? 25  ARG B H    2  
ATOM 5694  H HA   . ARG B 1 25  ? -19.710 7.237   -13.975 1.00 0.00 ? 25  ARG B HA   2  
ATOM 5695  H HB2  . ARG B 1 25  ? -22.010 6.833   -14.548 1.00 0.00 ? 25  ARG B HB2  2  
ATOM 5696  H HB3  . ARG B 1 25  ? -22.573 7.817   -13.197 1.00 0.00 ? 25  ARG B HB3  2  
ATOM 5697  H HG2  . ARG B 1 25  ? -21.342 9.775   -14.259 1.00 0.00 ? 25  ARG B HG2  2  
ATOM 5698  H HG3  . ARG B 1 25  ? -21.120 8.755   -15.682 1.00 0.00 ? 25  ARG B HG3  2  
ATOM 5699  H HD2  . ARG B 1 25  ? -23.198 10.336  -15.580 1.00 0.00 ? 25  ARG B HD2  2  
ATOM 5700  H HD3  . ARG B 1 25  ? -23.417 8.679   -16.145 1.00 0.00 ? 25  ARG B HD3  2  
ATOM 5701  H HE   . ARG B 1 25  ? -24.392 8.128   -13.967 1.00 0.00 ? 25  ARG B HE   2  
ATOM 5702  H HH11 . ARG B 1 25  ? -25.329 10.987  -15.139 1.00 0.00 ? 25  ARG B HH11 2  
ATOM 5703  H HH12 . ARG B 1 25  ? -25.617 11.783  -13.628 1.00 0.00 ? 25  ARG B HH12 2  
ATOM 5704  H HH21 . ARG B 1 25  ? -24.036 9.343   -11.738 1.00 0.00 ? 25  ARG B HH21 2  
ATOM 5705  H HH22 . ARG B 1 25  ? -24.883 10.853  -11.702 1.00 0.00 ? 25  ARG B HH22 2  
ATOM 5706  N N    . LYS B 1 26  ? -20.571 9.143   -11.429 1.00 0.00 ? 26  LYS B N    2  
ATOM 5707  C CA   . LYS B 1 26  ? -20.221 10.444  -10.783 1.00 0.00 ? 26  LYS B CA   2  
ATOM 5708  C C    . LYS B 1 26  ? -18.725 10.514  -10.480 1.00 0.00 ? 26  LYS B C    2  
ATOM 5709  O O    . LYS B 1 26  ? -18.073 11.506  -10.742 1.00 0.00 ? 26  LYS B O    2  
ATOM 5710  C CB   . LYS B 1 26  ? -20.980 10.576  -9.468  1.00 0.00 ? 26  LYS B CB   2  
ATOM 5711  C CG   . LYS B 1 26  ? -21.297 12.050  -9.205  1.00 0.00 ? 26  LYS B CG   2  
ATOM 5712  C CD   . LYS B 1 26  ? -22.808 12.272  -9.298  1.00 0.00 ? 26  LYS B CD   2  
ATOM 5713  C CE   . LYS B 1 26  ? -23.252 13.234  -8.195  1.00 0.00 ? 26  LYS B CE   2  
ATOM 5714  N NZ   . LYS B 1 26  ? -23.990 14.379  -8.801  1.00 0.00 ? 26  LYS B NZ   2  
ATOM 5715  H H    . LYS B 1 26  ? -21.221 8.540   -11.003 1.00 0.00 ? 26  LYS B H    2  
ATOM 5716  H HA   . LYS B 1 26  ? -20.495 11.257  -11.438 1.00 0.00 ? 26  LYS B HA   2  
ATOM 5717  H HB2  . LYS B 1 26  ? -21.893 10.008  -9.521  1.00 0.00 ? 26  LYS B HB2  2  
ATOM 5718  H HB3  . LYS B 1 26  ? -20.368 10.198  -8.665  1.00 0.00 ? 26  LYS B HB3  2  
ATOM 5719  H HG2  . LYS B 1 26  ? -20.952 12.321  -8.216  1.00 0.00 ? 26  LYS B HG2  2  
ATOM 5720  H HG3  . LYS B 1 26  ? -20.798 12.663  -9.940  1.00 0.00 ? 26  LYS B HG3  2  
ATOM 5721  H HD2  . LYS B 1 26  ? -23.050 12.693  -10.263 1.00 0.00 ? 26  LYS B HD2  2  
ATOM 5722  H HD3  . LYS B 1 26  ? -23.319 11.329  -9.176  1.00 0.00 ? 26  LYS B HD3  2  
ATOM 5723  H HE2  . LYS B 1 26  ? -23.899 12.715  -7.503  1.00 0.00 ? 26  LYS B HE2  2  
ATOM 5724  H HE3  . LYS B 1 26  ? -22.384 13.604  -7.668  1.00 0.00 ? 26  LYS B HE3  2  
ATOM 5725  H HZ1  . LYS B 1 26  ? -24.069 14.236  -9.828  1.00 0.00 ? 26  LYS B HZ1  2  
ATOM 5726  H HZ2  . LYS B 1 26  ? -24.942 14.436  -8.387  1.00 0.00 ? 26  LYS B HZ2  2  
ATOM 5727  H HZ3  . LYS B 1 26  ? -23.474 15.262  -8.610  1.00 0.00 ? 26  LYS B HZ3  2  
ATOM 5728  N N    . ASP B 1 27  ? -18.188 9.489   -9.888  1.00 0.00 ? 27  ASP B N    2  
ATOM 5729  C CA   . ASP B 1 27  ? -16.751 9.511   -9.513  1.00 0.00 ? 27  ASP B CA   2  
ATOM 5730  C C    . ASP B 1 27  ? -15.855 8.977   -10.637 1.00 0.00 ? 27  ASP B C    2  
ATOM 5731  O O    . ASP B 1 27  ? -15.009 9.685   -11.148 1.00 0.00 ? 27  ASP B O    2  
ATOM 5732  C CB   . ASP B 1 27  ? -16.574 8.650   -8.270  1.00 0.00 ? 27  ASP B CB   2  
ATOM 5733  C CG   . ASP B 1 27  ? -16.740 9.520   -7.025  1.00 0.00 ? 27  ASP B CG   2  
ATOM 5734  O OD1  . ASP B 1 27  ? -15.919 10.401  -6.829  1.00 0.00 ? 27  ASP B OD1  2  
ATOM 5735  O OD2  . ASP B 1 27  ? -17.685 9.291   -6.287  1.00 0.00 ? 27  ASP B OD2  2  
ATOM 5736  H H    . ASP B 1 27  ? -18.740 8.718   -9.652  1.00 0.00 ? 27  ASP B H    2  
ATOM 5737  H HA   . ASP B 1 27  ? -16.460 10.524  -9.280  1.00 0.00 ? 27  ASP B HA   2  
ATOM 5738  H HB2  . ASP B 1 27  ? -17.321 7.868   -8.266  1.00 0.00 ? 27  ASP B HB2  2  
ATOM 5739  H HB3  . ASP B 1 27  ? -15.597 8.210   -8.276  1.00 0.00 ? 27  ASP B HB3  2  
ATOM 5740  N N    . LEU B 1 28  ? -16.002 7.736   -11.011 1.00 0.00 ? 28  LEU B N    2  
ATOM 5741  C CA   . LEU B 1 28  ? -15.115 7.184   -12.079 1.00 0.00 ? 28  LEU B CA   2  
ATOM 5742  C C    . LEU B 1 28  ? -15.717 7.438   -13.459 1.00 0.00 ? 28  LEU B C    2  
ATOM 5743  O O    . LEU B 1 28  ? -15.069 7.240   -14.468 1.00 0.00 ? 28  LEU B O    2  
ATOM 5744  C CB   . LEU B 1 28  ? -14.959 5.673   -11.888 1.00 0.00 ? 28  LEU B CB   2  
ATOM 5745  C CG   . LEU B 1 28  ? -14.465 5.378   -10.474 1.00 0.00 ? 28  LEU B CG   2  
ATOM 5746  C CD1  . LEU B 1 28  ? -14.406 3.865   -10.265 1.00 0.00 ? 28  LEU B CD1  2  
ATOM 5747  C CD2  . LEU B 1 28  ? -13.066 5.963   -10.289 1.00 0.00 ? 28  LEU B CD2  2  
ATOM 5748  H H    . LEU B 1 28  ? -16.670 7.164   -10.575 1.00 0.00 ? 28  LEU B H    2  
ATOM 5749  H HA   . LEU B 1 28  ? -14.146 7.652   -12.018 1.00 0.00 ? 28  LEU B HA   2  
ATOM 5750  H HB2  . LEU B 1 28  ? -15.915 5.192   -12.043 1.00 0.00 ? 28  LEU B HB2  2  
ATOM 5751  H HB3  . LEU B 1 28  ? -14.246 5.293   -12.603 1.00 0.00 ? 28  LEU B HB3  2  
ATOM 5752  H HG   . LEU B 1 28  ? -15.143 5.819   -9.757  1.00 0.00 ? 28  LEU B HG   2  
ATOM 5753  H HD11 . LEU B 1 28  ? -14.750 3.365   -11.157 1.00 0.00 ? 28  LEU B HD11 2  
ATOM 5754  H HD12 . LEU B 1 28  ? -13.386 3.572   -10.059 1.00 0.00 ? 28  LEU B HD12 2  
ATOM 5755  H HD13 . LEU B 1 28  ? -15.034 3.592   -9.430  1.00 0.00 ? 28  LEU B HD13 2  
ATOM 5756  H HD21 . LEU B 1 28  ? -12.864 6.670   -11.078 1.00 0.00 ? 28  LEU B HD21 2  
ATOM 5757  H HD22 . LEU B 1 28  ? -13.009 6.461   -9.334  1.00 0.00 ? 28  LEU B HD22 2  
ATOM 5758  H HD23 . LEU B 1 28  ? -12.337 5.166   -10.324 1.00 0.00 ? 28  LEU B HD23 2  
ATOM 5759  N N    . GLY B 1 29  ? -16.947 7.857   -13.526 1.00 0.00 ? 29  GLY B N    2  
ATOM 5760  C CA   . GLY B 1 29  ? -17.560 8.096   -14.863 1.00 0.00 ? 29  GLY B CA   2  
ATOM 5761  C C    . GLY B 1 29  ? -17.540 6.781   -15.646 1.00 0.00 ? 29  GLY B C    2  
ATOM 5762  O O    . GLY B 1 29  ? -17.704 6.757   -16.849 1.00 0.00 ? 29  GLY B O    2  
ATOM 5763  H H    . GLY B 1 29  ? -17.466 8.002   -12.707 1.00 0.00 ? 29  GLY B H    2  
ATOM 5764  H HA2  . GLY B 1 29  ? -18.577 8.438   -14.742 1.00 0.00 ? 29  GLY B HA2  2  
ATOM 5765  H HA3  . GLY B 1 29  ? -16.987 8.837   -15.397 1.00 0.00 ? 29  GLY B HA3  2  
ATOM 5766  N N    . TRP B 1 30  ? -17.329 5.687   -14.962 1.00 0.00 ? 30  TRP B N    2  
ATOM 5767  C CA   . TRP B 1 30  ? -17.287 4.365   -15.642 1.00 0.00 ? 30  TRP B CA   2  
ATOM 5768  C C    . TRP B 1 30  ? -18.438 4.260   -16.639 1.00 0.00 ? 30  TRP B C    2  
ATOM 5769  O O    . TRP B 1 30  ? -19.591 4.426   -16.294 1.00 0.00 ? 30  TRP B O    2  
ATOM 5770  C CB   . TRP B 1 30  ? -17.414 3.257   -14.597 1.00 0.00 ? 30  TRP B CB   2  
ATOM 5771  C CG   . TRP B 1 30  ? -16.061 2.914   -14.063 1.00 0.00 ? 30  TRP B CG   2  
ATOM 5772  C CD1  . TRP B 1 30  ? -14.950 3.671   -14.214 1.00 0.00 ? 30  TRP B CD1  2  
ATOM 5773  C CD2  . TRP B 1 30  ? -15.657 1.743   -13.298 1.00 0.00 ? 30  TRP B CD2  2  
ATOM 5774  N NE1  . TRP B 1 30  ? -13.890 3.037   -13.589 1.00 0.00 ? 30  TRP B NE1  2  
ATOM 5775  C CE2  . TRP B 1 30  ? -14.276 1.844   -13.011 1.00 0.00 ? 30  TRP B CE2  2  
ATOM 5776  C CE3  . TRP B 1 30  ? -16.350 0.612   -12.831 1.00 0.00 ? 30  TRP B CE3  2  
ATOM 5777  C CZ2  . TRP B 1 30  ? -13.604 0.858   -12.286 1.00 0.00 ? 30  TRP B CZ2  2  
ATOM 5778  C CZ3  . TRP B 1 30  ? -15.677 -0.383  -12.102 1.00 0.00 ? 30  TRP B CZ3  2  
ATOM 5779  C CH2  . TRP B 1 30  ? -14.308 -0.259  -11.831 1.00 0.00 ? 30  TRP B CH2  2  
ATOM 5780  H H    . TRP B 1 30  ? -17.196 5.736   -13.995 1.00 0.00 ? 30  TRP B H    2  
ATOM 5781  H HA   . TRP B 1 30  ? -16.347 4.259   -16.164 1.00 0.00 ? 30  TRP B HA   2  
ATOM 5782  H HB2  . TRP B 1 30  ? -18.044 3.597   -13.787 1.00 0.00 ? 30  TRP B HB2  2  
ATOM 5783  H HB3  . TRP B 1 30  ? -17.854 2.382   -15.051 1.00 0.00 ? 30  TRP B HB3  2  
ATOM 5784  H HD1  . TRP B 1 30  ? -14.899 4.615   -14.735 1.00 0.00 ? 30  TRP B HD1  2  
ATOM 5785  H HE1  . TRP B 1 30  ? -12.972 3.376   -13.551 1.00 0.00 ? 30  TRP B HE1  2  
ATOM 5786  H HE3  . TRP B 1 30  ? -17.407 0.509   -13.035 1.00 0.00 ? 30  TRP B HE3  2  
ATOM 5787  H HZ2  . TRP B 1 30  ? -12.549 0.959   -12.079 1.00 0.00 ? 30  TRP B HZ2  2  
ATOM 5788  H HZ3  . TRP B 1 30  ? -16.219 -1.248  -11.750 1.00 0.00 ? 30  TRP B HZ3  2  
ATOM 5789  H HH2  . TRP B 1 30  ? -13.797 -1.029  -11.270 1.00 0.00 ? 30  TRP B HH2  2  
ATOM 5790  N N    . LYS B 1 31  ? -18.131 3.989   -17.875 1.00 0.00 ? 31  LYS B N    2  
ATOM 5791  C CA   . LYS B 1 31  ? -19.190 3.875   -18.901 1.00 0.00 ? 31  LYS B CA   2  
ATOM 5792  C C    . LYS B 1 31  ? -19.416 2.403   -19.245 1.00 0.00 ? 31  LYS B C    2  
ATOM 5793  O O    . LYS B 1 31  ? -20.365 2.054   -19.918 1.00 0.00 ? 31  LYS B O    2  
ATOM 5794  C CB   . LYS B 1 31  ? -18.727 4.617   -20.147 1.00 0.00 ? 31  LYS B CB   2  
ATOM 5795  C CG   . LYS B 1 31  ? -19.198 6.071   -20.088 1.00 0.00 ? 31  LYS B CG   2  
ATOM 5796  C CD   . LYS B 1 31  ? -18.237 6.954   -20.889 1.00 0.00 ? 31  LYS B CD   2  
ATOM 5797  C CE   . LYS B 1 31  ? -18.836 8.354   -21.041 1.00 0.00 ? 31  LYS B CE   2  
ATOM 5798  N NZ   . LYS B 1 31  ? -18.252 9.258   -20.009 1.00 0.00 ? 31  LYS B NZ   2  
ATOM 5799  H H    . LYS B 1 31  ? -17.198 3.864   -18.135 1.00 0.00 ? 31  LYS B H    2  
ATOM 5800  H HA   . LYS B 1 31  ? -20.106 4.314   -18.535 1.00 0.00 ? 31  LYS B HA   2  
ATOM 5801  H HB2  . LYS B 1 31  ? -17.647 4.587   -20.194 1.00 0.00 ? 31  LYS B HB2  2  
ATOM 5802  H HB3  . LYS B 1 31  ? -19.133 4.139   -21.016 1.00 0.00 ? 31  LYS B HB3  2  
ATOM 5803  H HG2  . LYS B 1 31  ? -20.191 6.145   -20.508 1.00 0.00 ? 31  LYS B HG2  2  
ATOM 5804  H HG3  . LYS B 1 31  ? -19.216 6.403   -19.061 1.00 0.00 ? 31  LYS B HG3  2  
ATOM 5805  H HD2  . LYS B 1 31  ? -17.292 7.019   -20.372 1.00 0.00 ? 31  LYS B HD2  2  
ATOM 5806  H HD3  . LYS B 1 31  ? -18.084 6.523   -21.867 1.00 0.00 ? 31  LYS B HD3  2  
ATOM 5807  H HE2  . LYS B 1 31  ? -18.608 8.738   -22.025 1.00 0.00 ? 31  LYS B HE2  2  
ATOM 5808  H HE3  . LYS B 1 31  ? -19.907 8.304   -20.913 1.00 0.00 ? 31  LYS B HE3  2  
ATOM 5809  H HZ1  . LYS B 1 31  ? -17.362 8.855   -19.658 1.00 0.00 ? 31  LYS B HZ1  2  
ATOM 5810  H HZ2  . LYS B 1 31  ? -18.067 10.190  -20.429 1.00 0.00 ? 31  LYS B HZ2  2  
ATOM 5811  H HZ3  . LYS B 1 31  ? -18.924 9.359   -19.220 1.00 0.00 ? 31  LYS B HZ3  2  
ATOM 5812  N N    . TRP B 1 32  ? -18.548 1.536   -18.798 1.00 0.00 ? 32  TRP B N    2  
ATOM 5813  C CA   . TRP B 1 32  ? -18.722 0.092   -19.119 1.00 0.00 ? 32  TRP B CA   2  
ATOM 5814  C C    . TRP B 1 32  ? -19.646 -0.561  -18.094 1.00 0.00 ? 32  TRP B C    2  
ATOM 5815  O O    . TRP B 1 32  ? -19.958 -1.729  -18.191 1.00 0.00 ? 32  TRP B O    2  
ATOM 5816  C CB   . TRP B 1 32  ? -17.363 -0.610  -19.111 1.00 0.00 ? 32  TRP B CB   2  
ATOM 5817  C CG   . TRP B 1 32  ? -16.897 -0.828  -17.704 1.00 0.00 ? 32  TRP B CG   2  
ATOM 5818  C CD1  . TRP B 1 32  ? -16.335 0.115   -16.918 1.00 0.00 ? 32  TRP B CD1  2  
ATOM 5819  C CD2  . TRP B 1 32  ? -16.943 -2.047  -16.908 1.00 0.00 ? 32  TRP B CD2  2  
ATOM 5820  N NE1  . TRP B 1 32  ? -16.015 -0.448  -15.700 1.00 0.00 ? 32  TRP B NE1  2  
ATOM 5821  C CE2  . TRP B 1 32  ? -16.372 -1.779  -15.642 1.00 0.00 ? 32  TRP B CE2  2  
ATOM 5822  C CE3  . TRP B 1 32  ? -17.415 -3.347  -17.157 1.00 0.00 ? 32  TRP B CE3  2  
ATOM 5823  C CZ2  . TRP B 1 32  ? -16.271 -2.767  -14.660 1.00 0.00 ? 32  TRP B CZ2  2  
ATOM 5824  C CZ3  . TRP B 1 32  ? -17.319 -4.344  -16.172 1.00 0.00 ? 32  TRP B CZ3  2  
ATOM 5825  C CH2  . TRP B 1 32  ? -16.745 -4.053  -14.926 1.00 0.00 ? 32  TRP B CH2  2  
ATOM 5826  H H    . TRP B 1 32  ? -17.782 1.835   -18.262 1.00 0.00 ? 32  TRP B H    2  
ATOM 5827  H HA   . TRP B 1 32  ? -19.162 0.000   -20.099 1.00 0.00 ? 32  TRP B HA   2  
ATOM 5828  H HB2  . TRP B 1 32  ? -17.451 -1.565  -19.609 1.00 0.00 ? 32  TRP B HB2  2  
ATOM 5829  H HB3  . TRP B 1 32  ? -16.642 0.000   -19.635 1.00 0.00 ? 32  TRP B HB3  2  
ATOM 5830  H HD1  . TRP B 1 32  ? -16.159 1.138   -17.197 1.00 0.00 ? 32  TRP B HD1  2  
ATOM 5831  H HE1  . TRP B 1 32  ? -15.591 0.024   -14.957 1.00 0.00 ? 32  TRP B HE1  2  
ATOM 5832  H HE3  . TRP B 1 32  ? -17.865 -3.576  -18.107 1.00 0.00 ? 32  TRP B HE3  2  
ATOM 5833  H HZ2  . TRP B 1 32  ? -15.828 -2.537  -13.702 1.00 0.00 ? 32  TRP B HZ2  2  
ATOM 5834  H HZ3  . TRP B 1 32  ? -17.687 -5.340  -16.379 1.00 0.00 ? 32  TRP B HZ3  2  
ATOM 5835  H HH2  . TRP B 1 32  ? -16.673 -4.821  -14.170 1.00 0.00 ? 32  TRP B HH2  2  
ATOM 5836  N N    . ILE B 1 33  ? -20.088 0.178   -17.116 1.00 0.00 ? 33  ILE B N    2  
ATOM 5837  C CA   . ILE B 1 33  ? -20.992 -0.416  -16.095 1.00 0.00 ? 33  ILE B CA   2  
ATOM 5838  C C    . ILE B 1 33  ? -22.278 0.414   -16.008 1.00 0.00 ? 33  ILE B C    2  
ATOM 5839  O O    . ILE B 1 33  ? -22.245 1.622   -15.883 1.00 0.00 ? 33  ILE B O    2  
ATOM 5840  C CB   . ILE B 1 33  ? -20.278 -0.441  -14.736 1.00 0.00 ? 33  ILE B CB   2  
ATOM 5841  C CG1  . ILE B 1 33  ? -19.389 -1.681  -14.672 1.00 0.00 ? 33  ILE B CG1  2  
ATOM 5842  C CG2  . ILE B 1 33  ? -21.299 -0.496  -13.596 1.00 0.00 ? 33  ILE B CG2  2  
ATOM 5843  C CD1  . ILE B 1 33  ? -18.563 -1.658  -13.389 1.00 0.00 ? 33  ILE B CD1  2  
ATOM 5844  H H    . ILE B 1 33  ? -19.826 1.120   -17.054 1.00 0.00 ? 33  ILE B H    2  
ATOM 5845  H HA   . ILE B 1 33  ? -21.238 -1.428  -16.387 1.00 0.00 ? 33  ILE B HA   2  
ATOM 5846  H HB   . ILE B 1 33  ? -19.669 0.443   -14.633 1.00 0.00 ? 33  ILE B HB   2  
ATOM 5847  H HG12 . ILE B 1 33  ? -20.006 -2.565  -14.686 1.00 0.00 ? 33  ILE B HG12 2  
ATOM 5848  H HG13 . ILE B 1 33  ? -18.730 -1.690  -15.522 1.00 0.00 ? 33  ILE B HG13 2  
ATOM 5849  H HG21 . ILE B 1 33  ? -21.956 0.359   -13.658 1.00 0.00 ? 33  ILE B HG21 2  
ATOM 5850  H HG22 . ILE B 1 33  ? -21.882 -1.402  -13.677 1.00 0.00 ? 33  ILE B HG22 2  
ATOM 5851  H HG23 . ILE B 1 33  ? -20.782 -0.485  -12.648 1.00 0.00 ? 33  ILE B HG23 2  
ATOM 5852  H HD11 . ILE B 1 33  ? -19.085 -1.086  -12.637 1.00 0.00 ? 33  ILE B HD11 2  
ATOM 5853  H HD12 . ILE B 1 33  ? -18.413 -2.666  -13.036 1.00 0.00 ? 33  ILE B HD12 2  
ATOM 5854  H HD13 . ILE B 1 33  ? -17.606 -1.204  -13.587 1.00 0.00 ? 33  ILE B HD13 2  
ATOM 5855  N N    . HIS B 1 34  ? -23.408 -0.233  -16.073 1.00 0.00 ? 34  HIS B N    2  
ATOM 5856  C CA   . HIS B 1 34  ? -24.702 0.502   -15.997 1.00 0.00 ? 34  HIS B CA   2  
ATOM 5857  C C    . HIS B 1 34  ? -25.199 0.503   -14.548 1.00 0.00 ? 34  HIS B C    2  
ATOM 5858  O O    . HIS B 1 34  ? -25.570 1.528   -14.011 1.00 0.00 ? 34  HIS B O    2  
ATOM 5859  C CB   . HIS B 1 34  ? -25.728 -0.194  -16.897 1.00 0.00 ? 34  HIS B CB   2  
ATOM 5860  C CG   . HIS B 1 34  ? -27.118 0.268   -16.550 1.00 0.00 ? 34  HIS B CG   2  
ATOM 5861  N ND1  . HIS B 1 34  ? -27.479 1.607   -16.563 1.00 0.00 ? 34  HIS B ND1  2  
ATOM 5862  C CD2  . HIS B 1 34  ? -28.246 -0.420  -16.179 1.00 0.00 ? 34  HIS B CD2  2  
ATOM 5863  C CE1  . HIS B 1 34  ? -28.775 1.680   -16.209 1.00 0.00 ? 34  HIS B CE1  2  
ATOM 5864  N NE2  . HIS B 1 34  ? -29.291 0.473   -15.965 1.00 0.00 ? 34  HIS B NE2  2  
ATOM 5865  H H    . HIS B 1 34  ? -23.404 -1.207  -16.175 1.00 0.00 ? 34  HIS B H    2  
ATOM 5866  H HA   . HIS B 1 34  ? -24.559 1.519   -16.330 1.00 0.00 ? 34  HIS B HA   2  
ATOM 5867  H HB2  . HIS B 1 34  ? -25.519 0.045   -17.930 1.00 0.00 ? 34  HIS B HB2  2  
ATOM 5868  H HB3  . HIS B 1 34  ? -25.661 -1.263  -16.757 1.00 0.00 ? 34  HIS B HB3  2  
ATOM 5869  H HD1  . HIS B 1 34  ? -26.896 2.361   -16.788 1.00 0.00 ? 34  HIS B HD1  2  
ATOM 5870  H HD2  . HIS B 1 34  ? -28.312 -1.494  -16.070 1.00 0.00 ? 34  HIS B HD2  2  
ATOM 5871  H HE1  . HIS B 1 34  ? -29.331 2.603   -16.133 1.00 0.00 ? 34  HIS B HE1  2  
ATOM 5872  N N    . GLU B 1 35  ? -25.208 -0.635  -13.911 1.00 0.00 ? 35  GLU B N    2  
ATOM 5873  C CA   . GLU B 1 35  ? -25.681 -0.693  -12.499 1.00 0.00 ? 35  GLU B CA   2  
ATOM 5874  C C    . GLU B 1 35  ? -24.679 -1.489  -11.658 1.00 0.00 ? 35  GLU B C    2  
ATOM 5875  O O    . GLU B 1 35  ? -23.933 -2.292  -12.182 1.00 0.00 ? 35  GLU B O    2  
ATOM 5876  C CB   . GLU B 1 35  ? -27.047 -1.378  -12.443 1.00 0.00 ? 35  GLU B CB   2  
ATOM 5877  C CG   . GLU B 1 35  ? -28.148 -0.344  -12.685 1.00 0.00 ? 35  GLU B CG   2  
ATOM 5878  C CD   . GLU B 1 35  ? -29.499 -0.931  -12.268 1.00 0.00 ? 35  GLU B CD   2  
ATOM 5879  O OE1  . GLU B 1 35  ? -29.931 -1.878  -12.903 1.00 0.00 ? 35  GLU B OE1  2  
ATOM 5880  O OE2  . GLU B 1 35  ? -30.076 -0.422  -11.322 1.00 0.00 ? 35  GLU B OE2  2  
ATOM 5881  H H    . GLU B 1 35  ? -24.904 -1.451  -14.360 1.00 0.00 ? 35  GLU B H    2  
ATOM 5882  H HA   . GLU B 1 35  ? -25.764 0.309   -12.105 1.00 0.00 ? 35  GLU B HA   2  
ATOM 5883  H HB2  . GLU B 1 35  ? -27.097 -2.144  -13.204 1.00 0.00 ? 35  GLU B HB2  2  
ATOM 5884  H HB3  . GLU B 1 35  ? -27.186 -1.827  -11.470 1.00 0.00 ? 35  GLU B HB3  2  
ATOM 5885  H HG2  . GLU B 1 35  ? -27.944 0.543   -12.102 1.00 0.00 ? 35  GLU B HG2  2  
ATOM 5886  H HG3  . GLU B 1 35  ? -28.177 -0.088  -13.733 1.00 0.00 ? 35  GLU B HG3  2  
ATOM 5887  N N    . PRO B 1 36  ? -24.698 -1.240  -10.374 1.00 0.00 ? 36  PRO B N    2  
ATOM 5888  C CA   . PRO B 1 36  ? -25.611 -0.263  -9.753  1.00 0.00 ? 36  PRO B CA   2  
ATOM 5889  C C    . PRO B 1 36  ? -25.104 1.163   -9.982  1.00 0.00 ? 36  PRO B C    2  
ATOM 5890  O O    . PRO B 1 36  ? -24.040 1.373   -10.531 1.00 0.00 ? 36  PRO B O    2  
ATOM 5891  C CB   . PRO B 1 36  ? -25.565 -0.624  -8.266  1.00 0.00 ? 36  PRO B CB   2  
ATOM 5892  C CG   . PRO B 1 36  ? -24.236 -1.384  -8.044  1.00 0.00 ? 36  PRO B CG   2  
ATOM 5893  C CD   . PRO B 1 36  ? -23.797 -1.918  -9.420  1.00 0.00 ? 36  PRO B CD   2  
ATOM 5894  H HA   . PRO B 1 36  ? -26.612 -0.378  -10.131 1.00 0.00 ? 36  PRO B HA   2  
ATOM 5895  H HB2  . PRO B 1 36  ? -25.588 0.276   -7.665  1.00 0.00 ? 36  PRO B HB2  2  
ATOM 5896  H HB3  . PRO B 1 36  ? -26.396 -1.263  -8.013  1.00 0.00 ? 36  PRO B HB3  2  
ATOM 5897  H HG2  . PRO B 1 36  ? -23.487 -0.710  -7.648  1.00 0.00 ? 36  PRO B HG2  2  
ATOM 5898  H HG3  . PRO B 1 36  ? -24.389 -2.209  -7.365  1.00 0.00 ? 36  PRO B HG3  2  
ATOM 5899  H HD2  . PRO B 1 36  ? -22.767 -1.656  -9.616  1.00 0.00 ? 36  PRO B HD2  2  
ATOM 5900  H HD3  . PRO B 1 36  ? -23.936 -2.986  -9.473  1.00 0.00 ? 36  PRO B HD3  2  
ATOM 5901  N N    . LYS B 1 37  ? -25.852 2.143   -9.558  1.00 0.00 ? 37  LYS B N    2  
ATOM 5902  C CA   . LYS B 1 37  ? -25.415 3.545   -9.735  1.00 0.00 ? 37  LYS B CA   2  
ATOM 5903  C C    . LYS B 1 37  ? -24.029 3.713   -9.117  1.00 0.00 ? 37  LYS B C    2  
ATOM 5904  O O    . LYS B 1 37  ? -23.193 4.437   -9.620  1.00 0.00 ? 37  LYS B O    2  
ATOM 5905  C CB   . LYS B 1 37  ? -26.406 4.452   -9.016  1.00 0.00 ? 37  LYS B CB   2  
ATOM 5906  C CG   . LYS B 1 37  ? -27.521 4.871   -9.976  1.00 0.00 ? 37  LYS B CG   2  
ATOM 5907  C CD   . LYS B 1 37  ? -28.413 5.908   -9.293  1.00 0.00 ? 37  LYS B CD   2  
ATOM 5908  C CE   . LYS B 1 37  ? -29.743 6.015   -10.042 1.00 0.00 ? 37  LYS B CE   2  
ATOM 5909  N NZ   . LYS B 1 37  ? -30.276 4.650   -10.305 1.00 0.00 ? 37  LYS B NZ   2  
ATOM 5910  H H    . LYS B 1 37  ? -26.701 1.958   -9.108  1.00 0.00 ? 37  LYS B H    2  
ATOM 5911  H HA   . LYS B 1 37  ? -25.385 3.793   -10.785 1.00 0.00 ? 37  LYS B HA   2  
ATOM 5912  H HB2  . LYS B 1 37  ? -26.834 3.917   -8.180  1.00 0.00 ? 37  LYS B HB2  2  
ATOM 5913  H HB3  . LYS B 1 37  ? -25.894 5.320   -8.656  1.00 0.00 ? 37  LYS B HB3  2  
ATOM 5914  H HG2  . LYS B 1 37  ? -27.087 5.297   -10.868 1.00 0.00 ? 37  LYS B HG2  2  
ATOM 5915  H HG3  . LYS B 1 37  ? -28.114 4.007   -10.239 1.00 0.00 ? 37  LYS B HG3  2  
ATOM 5916  H HD2  . LYS B 1 37  ? -28.599 5.608   -8.272  1.00 0.00 ? 37  LYS B HD2  2  
ATOM 5917  H HD3  . LYS B 1 37  ? -27.920 6.869   -9.301  1.00 0.00 ? 37  LYS B HD3  2  
ATOM 5918  H HE2  . LYS B 1 37  ? -30.451 6.569   -9.442  1.00 0.00 ? 37  LYS B HE2  2  
ATOM 5919  H HE3  . LYS B 1 37  ? -29.587 6.528   -10.980 1.00 0.00 ? 37  LYS B HE3  2  
ATOM 5920  H HZ1  . LYS B 1 37  ? -29.919 3.993   -9.581  1.00 0.00 ? 37  LYS B HZ1  2  
ATOM 5921  H HZ2  . LYS B 1 37  ? -31.315 4.671   -10.274 1.00 0.00 ? 37  LYS B HZ2  2  
ATOM 5922  H HZ3  . LYS B 1 37  ? -29.967 4.332   -11.246 1.00 0.00 ? 37  LYS B HZ3  2  
ATOM 5923  N N    . GLY B 1 38  ? -23.786 3.045   -8.027  1.00 0.00 ? 38  GLY B N    2  
ATOM 5924  C CA   . GLY B 1 38  ? -22.459 3.151   -7.360  1.00 0.00 ? 38  GLY B CA   2  
ATOM 5925  C C    . GLY B 1 38  ? -22.375 2.120   -6.234  1.00 0.00 ? 38  GLY B C    2  
ATOM 5926  O O    . GLY B 1 38  ? -22.996 1.076   -6.286  1.00 0.00 ? 38  GLY B O    2  
ATOM 5927  H H    . GLY B 1 38  ? -24.482 2.468   -7.646  1.00 0.00 ? 38  GLY B H    2  
ATOM 5928  H HA2  . GLY B 1 38  ? -21.677 2.964   -8.082  1.00 0.00 ? 38  GLY B HA2  2  
ATOM 5929  H HA3  . GLY B 1 38  ? -22.342 4.141   -6.946  1.00 0.00 ? 38  GLY B HA3  2  
ATOM 5930  N N    . TYR B 1 39  ? -21.611 2.402   -5.214  1.00 0.00 ? 39  TYR B N    2  
ATOM 5931  C CA   . TYR B 1 39  ? -21.488 1.438   -4.085  1.00 0.00 ? 39  TYR B CA   2  
ATOM 5932  C C    . TYR B 1 39  ? -20.530 2.003   -3.036  1.00 0.00 ? 39  TYR B C    2  
ATOM 5933  O O    . TYR B 1 39  ? -20.019 3.094   -3.176  1.00 0.00 ? 39  TYR B O    2  
ATOM 5934  C CB   . TYR B 1 39  ? -20.953 0.103   -4.611  1.00 0.00 ? 39  TYR B CB   2  
ATOM 5935  C CG   . TYR B 1 39  ? -19.487 0.233   -4.949  1.00 0.00 ? 39  TYR B CG   2  
ATOM 5936  C CD1  . TYR B 1 39  ? -19.075 1.085   -5.982  1.00 0.00 ? 39  TYR B CD1  2  
ATOM 5937  C CD2  . TYR B 1 39  ? -18.542 -0.506  -4.234  1.00 0.00 ? 39  TYR B CD2  2  
ATOM 5938  C CE1  . TYR B 1 39  ? -17.715 1.195   -6.297  1.00 0.00 ? 39  TYR B CE1  2  
ATOM 5939  C CE2  . TYR B 1 39  ? -17.182 -0.394  -4.548  1.00 0.00 ? 39  TYR B CE2  2  
ATOM 5940  C CZ   . TYR B 1 39  ? -16.769 0.456   -5.580  1.00 0.00 ? 39  TYR B CZ   2  
ATOM 5941  O OH   . TYR B 1 39  ? -15.429 0.563   -5.893  1.00 0.00 ? 39  TYR B OH   2  
ATOM 5942  H H    . TYR B 1 39  ? -21.119 3.249   -5.191  1.00 0.00 ? 39  TYR B H    2  
ATOM 5943  H HA   . TYR B 1 39  ? -22.457 1.282   -3.637  1.00 0.00 ? 39  TYR B HA   2  
ATOM 5944  H HB2  . TYR B 1 39  ? -21.081 -0.657  -3.853  1.00 0.00 ? 39  TYR B HB2  2  
ATOM 5945  H HB3  . TYR B 1 39  ? -21.502 -0.179  -5.498  1.00 0.00 ? 39  TYR B HB3  2  
ATOM 5946  H HD1  . TYR B 1 39  ? -19.803 1.656   -6.533  1.00 0.00 ? 39  TYR B HD1  2  
ATOM 5947  H HD2  . TYR B 1 39  ? -18.861 -1.160  -3.436  1.00 0.00 ? 39  TYR B HD2  2  
ATOM 5948  H HE1  . TYR B 1 39  ? -17.398 1.852   -7.093  1.00 0.00 ? 39  TYR B HE1  2  
ATOM 5949  H HE2  . TYR B 1 39  ? -16.452 -0.964  -3.995  1.00 0.00 ? 39  TYR B HE2  2  
ATOM 5950  H HH   . TYR B 1 39  ? -15.204 1.496   -5.922  1.00 0.00 ? 39  TYR B HH   2  
ATOM 5951  N N    . HIS B 1 40  ? -20.280 1.271   -1.988  1.00 0.00 ? 40  HIS B N    2  
ATOM 5952  C CA   . HIS B 1 40  ? -19.353 1.775   -0.938  1.00 0.00 ? 40  HIS B CA   2  
ATOM 5953  C C    . HIS B 1 40  ? -17.966 1.181   -1.177  1.00 0.00 ? 40  HIS B C    2  
ATOM 5954  O O    . HIS B 1 40  ? -17.574 0.212   -0.558  1.00 0.00 ? 40  HIS B O    2  
ATOM 5955  C CB   . HIS B 1 40  ? -19.872 1.361   0.439   1.00 0.00 ? 40  HIS B CB   2  
ATOM 5956  C CG   . HIS B 1 40  ? -21.324 1.739   0.547   1.00 0.00 ? 40  HIS B CG   2  
ATOM 5957  N ND1  . HIS B 1 40  ? -21.738 2.927   1.128   1.00 0.00 ? 40  HIS B ND1  2  
ATOM 5958  C CD2  . HIS B 1 40  ? -22.469 1.103   0.138   1.00 0.00 ? 40  HIS B CD2  2  
ATOM 5959  C CE1  . HIS B 1 40  ? -23.081 2.968   1.052   1.00 0.00 ? 40  HIS B CE1  2  
ATOM 5960  N NE2  . HIS B 1 40  ? -23.577 1.880   0.458   1.00 0.00 ? 40  HIS B NE2  2  
ATOM 5961  H H    . HIS B 1 40  ? -20.700 0.391   -1.890  1.00 0.00 ? 40  HIS B H    2  
ATOM 5962  H HA   . HIS B 1 40  ? -19.298 2.852   -0.994  1.00 0.00 ? 40  HIS B HA   2  
ATOM 5963  H HB2  . HIS B 1 40  ? -19.766 0.292   0.559   1.00 0.00 ? 40  HIS B HB2  2  
ATOM 5964  H HB3  . HIS B 1 40  ? -19.309 1.870   1.207   1.00 0.00 ? 40  HIS B HB3  2  
ATOM 5965  H HD1  . HIS B 1 40  ? -21.158 3.613   1.521   1.00 0.00 ? 40  HIS B HD1  2  
ATOM 5966  H HD2  . HIS B 1 40  ? -22.503 0.149   -0.365  1.00 0.00 ? 40  HIS B HD2  2  
ATOM 5967  H HE1  . HIS B 1 40  ? -23.684 3.784   1.421   1.00 0.00 ? 40  HIS B HE1  2  
ATOM 5968  N N    . ALA B 1 41  ? -17.228 1.753   -2.088  1.00 0.00 ? 41  ALA B N    2  
ATOM 5969  C CA   . ALA B 1 41  ? -15.872 1.225   -2.395  1.00 0.00 ? 41  ALA B CA   2  
ATOM 5970  C C    . ALA B 1 41  ? -14.948 1.407   -1.190  1.00 0.00 ? 41  ALA B C    2  
ATOM 5971  O O    . ALA B 1 41  ? -13.968 0.703   -1.042  1.00 0.00 ? 41  ALA B O    2  
ATOM 5972  C CB   . ALA B 1 41  ? -15.298 1.980   -3.597  1.00 0.00 ? 41  ALA B CB   2  
ATOM 5973  H H    . ALA B 1 41  ? -17.574 2.526   -2.580  1.00 0.00 ? 41  ALA B H    2  
ATOM 5974  H HA   . ALA B 1 41  ? -15.943 0.176   -2.634  1.00 0.00 ? 41  ALA B HA   2  
ATOM 5975  H HB1  . ALA B 1 41  ? -16.102 2.270   -4.257  1.00 0.00 ? 41  ALA B HB1  2  
ATOM 5976  H HB2  . ALA B 1 41  ? -14.779 2.862   -3.253  1.00 0.00 ? 41  ALA B HB2  2  
ATOM 5977  H HB3  . ALA B 1 41  ? -14.609 1.341   -4.129  1.00 0.00 ? 41  ALA B HB3  2  
ATOM 5978  N N    . ASN B 1 42  ? -15.237 2.345   -0.329  1.00 0.00 ? 42  ASN B N    2  
ATOM 5979  C CA   . ASN B 1 42  ? -14.349 2.552   0.848   1.00 0.00 ? 42  ASN B CA   2  
ATOM 5980  C C    . ASN B 1 42  ? -12.917 2.730   0.350   1.00 0.00 ? 42  ASN B C    2  
ATOM 5981  O O    . ASN B 1 42  ? -12.648 2.610   -0.829  1.00 0.00 ? 42  ASN B O    2  
ATOM 5982  C CB   . ASN B 1 42  ? -14.414 1.322   1.758   1.00 0.00 ? 42  ASN B CB   2  
ATOM 5983  C CG   . ASN B 1 42  ? -15.530 1.504   2.788   1.00 0.00 ? 42  ASN B CG   2  
ATOM 5984  O OD1  . ASN B 1 42  ? -16.691 1.586   2.436   1.00 0.00 ? 42  ASN B OD1  2  
ATOM 5985  N ND2  . ASN B 1 42  ? -15.228 1.570   4.055   1.00 0.00 ? 42  ASN B ND2  2  
ATOM 5986  H H    . ASN B 1 42  ? -16.026 2.912   -0.460  1.00 0.00 ? 42  ASN B H    2  
ATOM 5987  H HA   . ASN B 1 42  ? -14.661 3.430   1.394   1.00 0.00 ? 42  ASN B HA   2  
ATOM 5988  H HB2  . ASN B 1 42  ? -14.611 0.443   1.161   1.00 0.00 ? 42  ASN B HB2  2  
ATOM 5989  H HB3  . ASN B 1 42  ? -13.471 1.204   2.270   1.00 0.00 ? 42  ASN B HB3  2  
ATOM 5990  H HD21 . ASN B 1 42  ? -14.292 1.503   4.339   1.00 0.00 ? 42  ASN B HD21 2  
ATOM 5991  H HD22 . ASN B 1 42  ? -15.935 1.685   4.723   1.00 0.00 ? 42  ASN B HD22 2  
ATOM 5992  N N    . PHE B 1 43  ? -11.989 3.003   1.223   1.00 0.00 ? 43  PHE B N    2  
ATOM 5993  C CA   . PHE B 1 43  ? -10.586 3.165   0.757   1.00 0.00 ? 43  PHE B CA   2  
ATOM 5994  C C    . PHE B 1 43  ? -9.652  3.340   1.949   1.00 0.00 ? 43  PHE B C    2  
ATOM 5995  O O    . PHE B 1 43  ? -10.062 3.706   3.033   1.00 0.00 ? 43  PHE B O    2  
ATOM 5996  C CB   . PHE B 1 43  ? -10.482 4.381   -0.171  1.00 0.00 ? 43  PHE B CB   2  
ATOM 5997  C CG   . PHE B 1 43  ? -10.462 5.654   0.634   1.00 0.00 ? 43  PHE B CG   2  
ATOM 5998  C CD1  . PHE B 1 43  ? -11.545 5.983   1.450   1.00 0.00 ? 43  PHE B CD1  2  
ATOM 5999  C CD2  . PHE B 1 43  ? -9.361  6.513   0.553   1.00 0.00 ? 43  PHE B CD2  2  
ATOM 6000  C CE1  . PHE B 1 43  ? -11.532 7.171   2.184   1.00 0.00 ? 43  PHE B CE1  2  
ATOM 6001  C CE2  . PHE B 1 43  ? -9.346  7.696   1.289   1.00 0.00 ? 43  PHE B CE2  2  
ATOM 6002  C CZ   . PHE B 1 43  ? -10.431 8.029   2.104   1.00 0.00 ? 43  PHE B CZ   2  
ATOM 6003  H H    . PHE B 1 43  ? -12.212 3.091   2.177   1.00 0.00 ? 43  PHE B H    2  
ATOM 6004  H HA   . PHE B 1 43  ? -10.295 2.280   0.212   1.00 0.00 ? 43  PHE B HA   2  
ATOM 6005  H HB2  . PHE B 1 43  ? -9.573  4.316   -0.744  1.00 0.00 ? 43  PHE B HB2  2  
ATOM 6006  H HB3  . PHE B 1 43  ? -11.329 4.395   -0.840  1.00 0.00 ? 43  PHE B HB3  2  
ATOM 6007  H HD1  . PHE B 1 43  ? -12.396 5.319   1.510   1.00 0.00 ? 43  PHE B HD1  2  
ATOM 6008  H HD2  . PHE B 1 43  ? -8.520  6.259   -0.075  1.00 0.00 ? 43  PHE B HD2  2  
ATOM 6009  H HE1  . PHE B 1 43  ? -12.370 7.426   2.813   1.00 0.00 ? 43  PHE B HE1  2  
ATOM 6010  H HE2  . PHE B 1 43  ? -8.498  8.353   1.224   1.00 0.00 ? 43  PHE B HE2  2  
ATOM 6011  H HZ   . PHE B 1 43  ? -10.420 8.948   2.671   1.00 0.00 ? 43  PHE B HZ   2  
ATOM 6012  N N    . CYS B 1 44  ? -8.394  3.077   1.749   1.00 0.00 ? 44  CYS B N    2  
ATOM 6013  C CA   . CYS B 1 44  ? -7.413  3.218   2.855   1.00 0.00 ? 44  CYS B CA   2  
ATOM 6014  C C    . CYS B 1 44  ? -6.410  4.302   2.465   1.00 0.00 ? 44  CYS B C    2  
ATOM 6015  O O    . CYS B 1 44  ? -5.658  4.144   1.523   1.00 0.00 ? 44  CYS B O    2  
ATOM 6016  C CB   . CYS B 1 44  ? -6.661  1.895   3.051   1.00 0.00 ? 44  CYS B CB   2  
ATOM 6017  S SG   . CYS B 1 44  ? -7.702  0.501   2.542   1.00 0.00 ? 44  CYS B SG   2  
ATOM 6018  H H    . CYS B 1 44  ? -8.092  2.783   0.864   1.00 0.00 ? 44  CYS B H    2  
ATOM 6019  H HA   . CYS B 1 44  ? -7.924  3.496   3.768   1.00 0.00 ? 44  CYS B HA   2  
ATOM 6020  H HB2  . CYS B 1 44  ? -5.760  1.904   2.458   1.00 0.00 ? 44  CYS B HB2  2  
ATOM 6021  H HB3  . CYS B 1 44  ? -6.401  1.784   4.094   1.00 0.00 ? 44  CYS B HB3  2  
ATOM 6022  N N    . LEU B 1 45  ? -6.386  5.403   3.159   1.00 0.00 ? 45  LEU B N    2  
ATOM 6023  C CA   . LEU B 1 45  ? -5.420  6.471   2.782   1.00 0.00 ? 45  LEU B CA   2  
ATOM 6024  C C    . LEU B 1 45  ? -3.996  5.920   2.888   1.00 0.00 ? 45  LEU B C    2  
ATOM 6025  O O    . LEU B 1 45  ? -3.792  4.728   2.798   1.00 0.00 ? 45  LEU B O    2  
ATOM 6026  C CB   . LEU B 1 45  ? -5.629  7.693   3.684   1.00 0.00 ? 45  LEU B CB   2  
ATOM 6027  C CG   . LEU B 1 45  ? -6.707  8.591   3.074   1.00 0.00 ? 45  LEU B CG   2  
ATOM 6028  C CD1  . LEU B 1 45  ? -6.839  9.868   3.905   1.00 0.00 ? 45  LEU B CD1  2  
ATOM 6029  C CD2  . LEU B 1 45  ? -6.313  8.955   1.643   1.00 0.00 ? 45  LEU B CD2  2  
ATOM 6030  H H    . LEU B 1 45  ? -7.001  5.529   3.918   1.00 0.00 ? 45  LEU B H    2  
ATOM 6031  H HA   . LEU B 1 45  ? -5.594  6.746   1.763   1.00 0.00 ? 45  LEU B HA   2  
ATOM 6032  H HB2  . LEU B 1 45  ? -5.948  7.368   4.661   1.00 0.00 ? 45  LEU B HB2  2  
ATOM 6033  H HB3  . LEU B 1 45  ? -4.713  8.250   3.767   1.00 0.00 ? 45  LEU B HB3  2  
ATOM 6034  H HG   . LEU B 1 45  ? -7.651  8.066   3.068   1.00 0.00 ? 45  LEU B HG   2  
ATOM 6035  H HD11 . LEU B 1 45  ? -6.123  9.848   4.712   1.00 0.00 ? 45  LEU B HD11 2  
ATOM 6036  H HD12 . LEU B 1 45  ? -6.650  10.727  3.277   1.00 0.00 ? 45  LEU B HD12 2  
ATOM 6037  H HD13 . LEU B 1 45  ? -7.838  9.932   4.311   1.00 0.00 ? 45  LEU B HD13 2  
ATOM 6038  H HD21 . LEU B 1 45  ? -5.252  9.146   1.599   1.00 0.00 ? 45  LEU B HD21 2  
ATOM 6039  H HD22 . LEU B 1 45  ? -6.560  8.136   0.983   1.00 0.00 ? 45  LEU B HD22 2  
ATOM 6040  H HD23 . LEU B 1 45  ? -6.852  9.840   1.335   1.00 0.00 ? 45  LEU B HD23 2  
ATOM 6041  N N    . GLY B 1 46  ? -3.000  6.755   3.034   1.00 0.00 ? 46  GLY B N    2  
ATOM 6042  C CA   . GLY B 1 46  ? -1.614  6.219   3.106   1.00 0.00 ? 46  GLY B CA   2  
ATOM 6043  C C    . GLY B 1 46  ? -0.916  6.496   4.465   1.00 0.00 ? 46  GLY B C    2  
ATOM 6044  O O    . GLY B 1 46  ? 0.297   6.433   4.520   1.00 0.00 ? 46  GLY B O    2  
ATOM 6045  H H    . GLY B 1 46  ? -3.157  7.720   3.068   1.00 0.00 ? 46  GLY B H    2  
ATOM 6046  H HA2  . GLY B 1 46  ? -1.649  5.155   2.942   1.00 0.00 ? 46  GLY B HA2  2  
ATOM 6047  H HA3  . GLY B 1 46  ? -1.028  6.671   2.319   1.00 0.00 ? 46  GLY B HA3  2  
ATOM 6048  N N    . PRO B 1 47  ? -1.650  6.782   5.531   1.00 0.00 ? 47  PRO B N    2  
ATOM 6049  C CA   . PRO B 1 47  ? -1.023  7.038   6.843   1.00 0.00 ? 47  PRO B CA   2  
ATOM 6050  C C    . PRO B 1 47  ? -0.642  5.719   7.517   1.00 0.00 ? 47  PRO B C    2  
ATOM 6051  O O    . PRO B 1 47  ? -1.479  4.876   7.768   1.00 0.00 ? 47  PRO B O    2  
ATOM 6052  C CB   . PRO B 1 47  ? -2.118  7.726   7.650   1.00 0.00 ? 47  PRO B CB   2  
ATOM 6053  C CG   . PRO B 1 47  ? -3.451  7.303   7.002   1.00 0.00 ? 47  PRO B CG   2  
ATOM 6054  C CD   . PRO B 1 47  ? -3.124  6.891   5.557   1.00 0.00 ? 47  PRO B CD   2  
ATOM 6055  H HA   . PRO B 1 47  ? -0.168  7.686   6.745   1.00 0.00 ? 47  PRO B HA   2  
ATOM 6056  H HB2  . PRO B 1 47  ? -2.078  7.400   8.680   1.00 0.00 ? 47  PRO B HB2  2  
ATOM 6057  H HB3  . PRO B 1 47  ? -2.007  8.796   7.591   1.00 0.00 ? 47  PRO B HB3  2  
ATOM 6058  H HG2  . PRO B 1 47  ? -3.872  6.466   7.543   1.00 0.00 ? 47  PRO B HG2  2  
ATOM 6059  H HG3  . PRO B 1 47  ? -4.140  8.131   6.999   1.00 0.00 ? 47  PRO B HG3  2  
ATOM 6060  H HD2  . PRO B 1 47  ? -3.586  5.943   5.316   1.00 0.00 ? 47  PRO B HD2  2  
ATOM 6061  H HD3  . PRO B 1 47  ? -3.449  7.658   4.881   1.00 0.00 ? 47  PRO B HD3  2  
ATOM 6062  N N    . CYS B 1 48  ? 0.606   5.539   7.823   1.00 0.00 ? 48  CYS B N    2  
ATOM 6063  C CA   . CYS B 1 48  ? 1.029   4.279   8.498   1.00 0.00 ? 48  CYS B CA   2  
ATOM 6064  C C    . CYS B 1 48  ? 2.194   4.573   9.445   1.00 0.00 ? 48  CYS B C    2  
ATOM 6065  O O    . CYS B 1 48  ? 3.338   4.544   9.037   1.00 0.00 ? 48  CYS B O    2  
ATOM 6066  C CB   . CYS B 1 48  ? 1.469   3.248   7.457   1.00 0.00 ? 48  CYS B CB   2  
ATOM 6067  S SG   . CYS B 1 48  ? 0.023   2.599   6.586   1.00 0.00 ? 48  CYS B SG   2  
ATOM 6068  H H    . CYS B 1 48  ? 1.261   6.235   7.622   1.00 0.00 ? 48  CYS B H    2  
ATOM 6069  H HA   . CYS B 1 48  ? 0.199   3.883   9.067   1.00 0.00 ? 48  CYS B HA   2  
ATOM 6070  H HB2  . CYS B 1 48  ? 2.130   3.713   6.749   1.00 0.00 ? 48  CYS B HB2  2  
ATOM 6071  H HB3  . CYS B 1 48  ? 1.984   2.437   7.950   1.00 0.00 ? 48  CYS B HB3  2  
ATOM 6072  N N    . PRO B 1 49  ? 1.879   4.832   10.685  1.00 0.00 ? 49  PRO B N    2  
ATOM 6073  C CA   . PRO B 1 49  ? 2.899   5.115   11.703  1.00 0.00 ? 49  PRO B CA   2  
ATOM 6074  C C    . PRO B 1 49  ? 3.627   3.814   12.069  1.00 0.00 ? 49  PRO B C    2  
ATOM 6075  O O    . PRO B 1 49  ? 3.801   2.952   11.231  1.00 0.00 ? 49  PRO B O    2  
ATOM 6076  C CB   . PRO B 1 49  ? 2.095   5.717   12.865  1.00 0.00 ? 49  PRO B CB   2  
ATOM 6077  C CG   . PRO B 1 49  ? 0.630   5.262   12.668  1.00 0.00 ? 49  PRO B CG   2  
ATOM 6078  C CD   . PRO B 1 49  ? 0.490   4.857   11.186  1.00 0.00 ? 49  PRO B CD   2  
ATOM 6079  H HA   . PRO B 1 49  ? 3.603   5.843   11.330  1.00 0.00 ? 49  PRO B HA   2  
ATOM 6080  H HB2  . PRO B 1 49  ? 2.473   5.355   13.809  1.00 0.00 ? 49  PRO B HB2  2  
ATOM 6081  H HB3  . PRO B 1 49  ? 2.146   6.794   12.833  1.00 0.00 ? 49  PRO B HB3  2  
ATOM 6082  H HG2  . PRO B 1 49  ? 0.416   4.425   13.312  1.00 0.00 ? 49  PRO B HG2  2  
ATOM 6083  H HG3  . PRO B 1 49  ? -0.041  6.077   12.886  1.00 0.00 ? 49  PRO B HG3  2  
ATOM 6084  H HD2  . PRO B 1 49  ? 0.037   3.878   11.103  1.00 0.00 ? 49  PRO B HD2  2  
ATOM 6085  H HD3  . PRO B 1 49  ? -0.088  5.591   10.646  1.00 0.00 ? 49  PRO B HD3  2  
ATOM 6086  N N    . TYR B 1 50  ? 4.079   3.653   13.283  1.00 0.00 ? 50  TYR B N    2  
ATOM 6087  C CA   . TYR B 1 50  ? 4.810   2.392   13.612  1.00 0.00 ? 50  TYR B CA   2  
ATOM 6088  C C    . TYR B 1 50  ? 3.870   1.360   14.250  1.00 0.00 ? 50  TYR B C    2  
ATOM 6089  O O    . TYR B 1 50  ? 3.275   0.554   13.568  1.00 0.00 ? 50  TYR B O    2  
ATOM 6090  C CB   . TYR B 1 50  ? 5.995   2.668   14.560  1.00 0.00 ? 50  TYR B CB   2  
ATOM 6091  C CG   . TYR B 1 50  ? 5.985   4.104   15.031  1.00 0.00 ? 50  TYR B CG   2  
ATOM 6092  C CD1  . TYR B 1 50  ? 6.412   5.120   14.171  1.00 0.00 ? 50  TYR B CD1  2  
ATOM 6093  C CD2  . TYR B 1 50  ? 5.555   4.416   16.327  1.00 0.00 ? 50  TYR B CD2  2  
ATOM 6094  C CE1  . TYR B 1 50  ? 6.412   6.451   14.604  1.00 0.00 ? 50  TYR B CE1  2  
ATOM 6095  C CE2  . TYR B 1 50  ? 5.553   5.748   16.761  1.00 0.00 ? 50  TYR B CE2  2  
ATOM 6096  C CZ   . TYR B 1 50  ? 5.981   6.765   15.899  1.00 0.00 ? 50  TYR B CZ   2  
ATOM 6097  O OH   . TYR B 1 50  ? 5.981   8.077   16.327  1.00 0.00 ? 50  TYR B OH   2  
ATOM 6098  H H    . TYR B 1 50  ? 3.959   4.349   13.958  1.00 0.00 ? 50  TYR B H    2  
ATOM 6099  H HA   . TYR B 1 50  ? 5.199   1.977   12.694  1.00 0.00 ? 50  TYR B HA   2  
ATOM 6100  H HB2  . TYR B 1 50  ? 5.934   2.011   15.413  1.00 0.00 ? 50  TYR B HB2  2  
ATOM 6101  H HB3  . TYR B 1 50  ? 6.919   2.476   14.033  1.00 0.00 ? 50  TYR B HB3  2  
ATOM 6102  H HD1  . TYR B 1 50  ? 6.743   4.878   13.171  1.00 0.00 ? 50  TYR B HD1  2  
ATOM 6103  H HD2  . TYR B 1 50  ? 5.226   3.631   16.991  1.00 0.00 ? 50  TYR B HD2  2  
ATOM 6104  H HE1  . TYR B 1 50  ? 6.744   7.235   13.939  1.00 0.00 ? 50  TYR B HE1  2  
ATOM 6105  H HE2  . TYR B 1 50  ? 5.222   5.990   17.760  1.00 0.00 ? 50  TYR B HE2  2  
ATOM 6106  H HH   . TYR B 1 50  ? 6.689   8.537   15.872  1.00 0.00 ? 50  TYR B HH   2  
ATOM 6107  N N    . ILE B 1 51  ? 3.758   1.360   15.551  1.00 0.00 ? 51  ILE B N    2  
ATOM 6108  C CA   . ILE B 1 51  ? 2.891   0.357   16.245  1.00 0.00 ? 51  ILE B CA   2  
ATOM 6109  C C    . ILE B 1 51  ? 1.627   0.042   15.435  1.00 0.00 ? 51  ILE B C    2  
ATOM 6110  O O    . ILE B 1 51  ? 1.081   -1.037  15.534  1.00 0.00 ? 51  ILE B O    2  
ATOM 6111  C CB   . ILE B 1 51  ? 2.489   0.898   17.617  1.00 0.00 ? 51  ILE B CB   2  
ATOM 6112  C CG1  . ILE B 1 51  ? 1.851   2.278   17.453  1.00 0.00 ? 51  ILE B CG1  2  
ATOM 6113  C CG2  . ILE B 1 51  ? 3.729   1.015   18.506  1.00 0.00 ? 51  ILE B CG2  2  
ATOM 6114  C CD1  . ILE B 1 51  ? 1.090   2.645   18.728  1.00 0.00 ? 51  ILE B CD1  2  
ATOM 6115  H H    . ILE B 1 51  ? 4.263   2.008   16.082  1.00 0.00 ? 51  ILE B H    2  
ATOM 6116  H HA   . ILE B 1 51  ? 3.458   -0.554  16.377  1.00 0.00 ? 51  ILE B HA   2  
ATOM 6117  H HB   . ILE B 1 51  ? 1.781   0.224   18.076  1.00 0.00 ? 51  ILE B HB   2  
ATOM 6118  H HG12 . ILE B 1 51  ? 2.624   3.011   17.269  1.00 0.00 ? 51  ILE B HG12 2  
ATOM 6119  H HG13 . ILE B 1 51  ? 1.166   2.261   16.619  1.00 0.00 ? 51  ILE B HG13 2  
ATOM 6120  H HG21 . ILE B 1 51  ? 4.578   1.296   17.902  1.00 0.00 ? 51  ILE B HG21 2  
ATOM 6121  H HG22 . ILE B 1 51  ? 3.560   1.768   19.261  1.00 0.00 ? 51  ILE B HG22 2  
ATOM 6122  H HG23 . ILE B 1 51  ? 3.922   0.065   18.981  1.00 0.00 ? 51  ILE B HG23 2  
ATOM 6123  H HD11 . ILE B 1 51  ? 1.453   2.045   19.549  1.00 0.00 ? 51  ILE B HD11 2  
ATOM 6124  H HD12 . ILE B 1 51  ? 1.245   3.691   18.951  1.00 0.00 ? 51  ILE B HD12 2  
ATOM 6125  H HD13 . ILE B 1 51  ? 0.036   2.460   18.584  1.00 0.00 ? 51  ILE B HD13 2  
ATOM 6126  N N    . TRP B 1 52  ? 1.151   0.965   14.647  1.00 0.00 ? 52  TRP B N    2  
ATOM 6127  C CA   . TRP B 1 52  ? -0.086  0.700   13.849  1.00 0.00 ? 52  TRP B CA   2  
ATOM 6128  C C    . TRP B 1 52  ? 0.068   -0.587  13.035  1.00 0.00 ? 52  TRP B C    2  
ATOM 6129  O O    . TRP B 1 52  ? 0.469   -0.550  11.891  1.00 0.00 ? 52  TRP B O    2  
ATOM 6130  C CB   . TRP B 1 52  ? -0.329  1.862   12.896  1.00 0.00 ? 52  TRP B CB   2  
ATOM 6131  C CG   . TRP B 1 52  ? -1.759  2.290   12.983  1.00 0.00 ? 52  TRP B CG   2  
ATOM 6132  C CD1  . TRP B 1 52  ? -2.514  2.675   11.933  1.00 0.00 ? 52  TRP B CD1  2  
ATOM 6133  C CD2  . TRP B 1 52  ? -2.619  2.379   14.159  1.00 0.00 ? 52  TRP B CD2  2  
ATOM 6134  N NE1  . TRP B 1 52  ? -3.782  2.996   12.382  1.00 0.00 ? 52  TRP B NE1  2  
ATOM 6135  C CE2  . TRP B 1 52  ? -3.897  2.830   13.747  1.00 0.00 ? 52  TRP B CE2  2  
ATOM 6136  C CE3  . TRP B 1 52  ? -2.418  2.117   15.525  1.00 0.00 ? 52  TRP B CE3  2  
ATOM 6137  C CZ2  . TRP B 1 52  ? -4.939  3.011   14.659  1.00 0.00 ? 52  TRP B CZ2  2  
ATOM 6138  C CZ3  . TRP B 1 52  ? -3.463  2.298   16.446  1.00 0.00 ? 52  TRP B CZ3  2  
ATOM 6139  C CH2  . TRP B 1 52  ? -4.721  2.745   16.014  1.00 0.00 ? 52  TRP B CH2  2  
ATOM 6140  H H    . TRP B 1 52  ? 1.599   1.834   14.583  1.00 0.00 ? 52  TRP B H    2  
ATOM 6141  H HA   . TRP B 1 52  ? -0.930  0.605   14.513  1.00 0.00 ? 52  TRP B HA   2  
ATOM 6142  H HB2  . TRP B 1 52  ? 0.312   2.682   13.164  1.00 0.00 ? 52  TRP B HB2  2  
ATOM 6143  H HB3  . TRP B 1 52  ? -0.110  1.551   11.885  1.00 0.00 ? 52  TRP B HB3  2  
ATOM 6144  H HD1  . TRP B 1 52  ? -2.179  2.722   10.909  1.00 0.00 ? 52  TRP B HD1  2  
ATOM 6145  H HE1  . TRP B 1 52  ? -4.520  3.306   11.817  1.00 0.00 ? 52  TRP B HE1  2  
ATOM 6146  H HE3  . TRP B 1 52  ? -1.454  1.773   15.870  1.00 0.00 ? 52  TRP B HE3  2  
ATOM 6147  H HZ2  . TRP B 1 52  ? -5.909  3.352   14.320  1.00 0.00 ? 52  TRP B HZ2  2  
ATOM 6148  H HZ3  . TRP B 1 52  ? -3.297  2.093   17.494  1.00 0.00 ? 52  TRP B HZ3  2  
ATOM 6149  H HH2  . TRP B 1 52  ? -5.520  2.882   16.728  1.00 0.00 ? 52  TRP B HH2  2  
ATOM 6150  N N    . SER B 1 53  ? -0.275  -1.713  13.623  1.00 0.00 ? 53  SER B N    2  
ATOM 6151  C CA   . SER B 1 53  ? -0.185  -3.034  12.916  1.00 0.00 ? 53  SER B CA   2  
ATOM 6152  C C    . SER B 1 53  ? 0.784   -2.974  11.731  1.00 0.00 ? 53  SER B C    2  
ATOM 6153  O O    . SER B 1 53  ? 0.375   -2.839  10.594  1.00 0.00 ? 53  SER B O    2  
ATOM 6154  C CB   . SER B 1 53  ? -1.573  -3.423  12.406  1.00 0.00 ? 53  SER B CB   2  
ATOM 6155  O OG   . SER B 1 53  ? -2.185  -4.304  13.337  1.00 0.00 ? 53  SER B OG   2  
ATOM 6156  H H    . SER B 1 53  ? -0.613  -1.687  14.542  1.00 0.00 ? 53  SER B H    2  
ATOM 6157  H HA   . SER B 1 53  ? 0.155   -3.785  13.613  1.00 0.00 ? 53  SER B HA   2  
ATOM 6158  H HB2  . SER B 1 53  ? -2.180  -2.539  12.301  1.00 0.00 ? 53  SER B HB2  2  
ATOM 6159  H HB3  . SER B 1 53  ? -1.477  -3.908  11.444  1.00 0.00 ? 53  SER B HB3  2  
ATOM 6160  H HG   . SER B 1 53  ? -2.539  -5.052  12.850  1.00 0.00 ? 53  SER B HG   2  
ATOM 6161  N N    . LEU B 1 54  ? 2.061   -3.076  11.978  1.00 0.00 ? 54  LEU B N    2  
ATOM 6162  C CA   . LEU B 1 54  ? 3.035   -3.029  10.852  1.00 0.00 ? 54  LEU B CA   2  
ATOM 6163  C C    . LEU B 1 54  ? 3.150   -4.420  10.227  1.00 0.00 ? 54  LEU B C    2  
ATOM 6164  O O    . LEU B 1 54  ? 3.339   -5.405  10.913  1.00 0.00 ? 54  LEU B O    2  
ATOM 6165  C CB   . LEU B 1 54  ? 4.403   -2.579  11.373  1.00 0.00 ? 54  LEU B CB   2  
ATOM 6166  C CG   . LEU B 1 54  ? 4.337   -1.093  11.729  1.00 0.00 ? 54  LEU B CG   2  
ATOM 6167  C CD1  . LEU B 1 54  ? 5.337   -0.781  12.846  1.00 0.00 ? 54  LEU B CD1  2  
ATOM 6168  C CD2  . LEU B 1 54  ? 4.679   -0.258  10.494  1.00 0.00 ? 54  LEU B CD2  2  
ATOM 6169  H H    . LEU B 1 54  ? 2.376   -3.189  12.899  1.00 0.00 ? 54  LEU B H    2  
ATOM 6170  H HA   . LEU B 1 54  ? 2.687   -2.330  10.106  1.00 0.00 ? 54  LEU B HA   2  
ATOM 6171  H HB2  . LEU B 1 54  ? 4.662   -3.152  12.251  1.00 0.00 ? 54  LEU B HB2  2  
ATOM 6172  H HB3  . LEU B 1 54  ? 5.147   -2.731  10.606  1.00 0.00 ? 54  LEU B HB3  2  
ATOM 6173  H HG   . LEU B 1 54  ? 3.338   -0.852  12.060  1.00 0.00 ? 54  LEU B HG   2  
ATOM 6174  H HD11 . LEU B 1 54  ? 6.128   -1.514  12.838  1.00 0.00 ? 54  LEU B HD11 2  
ATOM 6175  H HD12 . LEU B 1 54  ? 5.756   0.202   12.689  1.00 0.00 ? 54  LEU B HD12 2  
ATOM 6176  H HD13 . LEU B 1 54  ? 4.831   -0.807  13.801  1.00 0.00 ? 54  LEU B HD13 2  
ATOM 6177  H HD21 . LEU B 1 54  ? 4.712   -0.898  9.625   1.00 0.00 ? 54  LEU B HD21 2  
ATOM 6178  H HD22 . LEU B 1 54  ? 3.925   0.502   10.353  1.00 0.00 ? 54  LEU B HD22 2  
ATOM 6179  H HD23 . LEU B 1 54  ? 5.642   0.212   10.632  1.00 0.00 ? 54  LEU B HD23 2  
ATOM 6180  N N    . ASP B 1 55  ? 3.031   -4.509  8.931   1.00 0.00 ? 55  ASP B N    2  
ATOM 6181  C CA   . ASP B 1 55  ? 3.125   -5.839  8.263   1.00 0.00 ? 55  ASP B CA   2  
ATOM 6182  C C    . ASP B 1 55  ? 4.564   -6.084  7.809   1.00 0.00 ? 55  ASP B C    2  
ATOM 6183  O O    . ASP B 1 55  ? 5.180   -7.066  8.171   1.00 0.00 ? 55  ASP B O    2  
ATOM 6184  C CB   . ASP B 1 55  ? 2.196   -5.868  7.048   1.00 0.00 ? 55  ASP B CB   2  
ATOM 6185  C CG   . ASP B 1 55  ? 0.774   -6.210  7.499   1.00 0.00 ? 55  ASP B CG   2  
ATOM 6186  O OD1  . ASP B 1 55  ? 0.556   -6.287  8.696   1.00 0.00 ? 55  ASP B OD1  2  
ATOM 6187  O OD2  . ASP B 1 55  ? -0.071  -6.389  6.638   1.00 0.00 ? 55  ASP B OD2  2  
ATOM 6188  H H    . ASP B 1 55  ? 2.875   -3.702  8.397   1.00 0.00 ? 55  ASP B H    2  
ATOM 6189  H HA   . ASP B 1 55  ? 2.832   -6.612  8.958   1.00 0.00 ? 55  ASP B HA   2  
ATOM 6190  H HB2  . ASP B 1 55  ? 2.199   -4.899  6.569   1.00 0.00 ? 55  ASP B HB2  2  
ATOM 6191  H HB3  . ASP B 1 55  ? 2.540   -6.616  6.350   1.00 0.00 ? 55  ASP B HB3  2  
ATOM 6192  N N    . THR B 1 56  ? 5.106   -5.199  7.019   1.00 0.00 ? 56  THR B N    2  
ATOM 6193  C CA   . THR B 1 56  ? 6.505   -5.386  6.546   1.00 0.00 ? 56  THR B CA   2  
ATOM 6194  C C    . THR B 1 56  ? 7.457   -4.623  7.467   1.00 0.00 ? 56  THR B C    2  
ATOM 6195  O O    . THR B 1 56  ? 7.204   -3.495  7.836   1.00 0.00 ? 56  THR B O    2  
ATOM 6196  C CB   . THR B 1 56  ? 6.642   -4.852  5.119   1.00 0.00 ? 56  THR B CB   2  
ATOM 6197  O OG1  . THR B 1 56  ? 6.955   -3.467  5.162   1.00 0.00 ? 56  THR B OG1  2  
ATOM 6198  C CG2  . THR B 1 56  ? 5.327   -5.058  4.363   1.00 0.00 ? 56  THR B CG2  2  
ATOM 6199  H H    . THR B 1 56  ? 4.594   -4.412  6.738   1.00 0.00 ? 56  THR B H    2  
ATOM 6200  H HA   . THR B 1 56  ? 6.753   -6.437  6.563   1.00 0.00 ? 56  THR B HA   2  
ATOM 6201  H HB   . THR B 1 56  ? 7.433   -5.384  4.612   1.00 0.00 ? 56  THR B HB   2  
ATOM 6202  H HG1  . THR B 1 56  ? 7.731   -3.321  4.617   1.00 0.00 ? 56  THR B HG1  2  
ATOM 6203  H HG21 . THR B 1 56  ? 4.888   -6.000  4.654   1.00 0.00 ? 56  THR B HG21 2  
ATOM 6204  H HG22 . THR B 1 56  ? 4.645   -4.255  4.602   1.00 0.00 ? 56  THR B HG22 2  
ATOM 6205  H HG23 . THR B 1 56  ? 5.519   -5.062  3.300   1.00 0.00 ? 56  THR B HG23 2  
ATOM 6206  N N    . GLN B 1 57  ? 8.547   -5.228  7.844   1.00 0.00 ? 57  GLN B N    2  
ATOM 6207  C CA   . GLN B 1 57  ? 9.505   -4.528  8.743   1.00 0.00 ? 57  GLN B CA   2  
ATOM 6208  C C    . GLN B 1 57  ? 9.932   -3.207  8.104   1.00 0.00 ? 57  GLN B C    2  
ATOM 6209  O O    . GLN B 1 57  ? 10.299  -2.270  8.783   1.00 0.00 ? 57  GLN B O    2  
ATOM 6210  C CB   . GLN B 1 57  ? 10.731  -5.411  8.968   1.00 0.00 ? 57  GLN B CB   2  
ATOM 6211  C CG   . GLN B 1 57  ? 11.150  -5.338  10.438  1.00 0.00 ? 57  GLN B CG   2  
ATOM 6212  C CD   . GLN B 1 57  ? 10.559  -6.528  11.197  1.00 0.00 ? 57  GLN B CD   2  
ATOM 6213  O OE1  . GLN B 1 57  ? 9.426   -6.903  10.973  1.00 0.00 ? 57  GLN B OE1  2  
ATOM 6214  N NE2  . GLN B 1 57  ? 11.284  -7.141  12.092  1.00 0.00 ? 57  GLN B NE2  2  
ATOM 6215  H H    . GLN B 1 57  ? 8.735   -6.140  7.538   1.00 0.00 ? 57  GLN B H    2  
ATOM 6216  H HA   . GLN B 1 57  ? 9.027   -4.330  9.691   1.00 0.00 ? 57  GLN B HA   2  
ATOM 6217  H HB2  . GLN B 1 57  ? 10.488  -6.432  8.711   1.00 0.00 ? 57  GLN B HB2  2  
ATOM 6218  H HB3  . GLN B 1 57  ? 11.542  -5.065  8.345   1.00 0.00 ? 57  GLN B HB3  2  
ATOM 6219  H HG2  . GLN B 1 57  ? 12.228  -5.365  10.506  1.00 0.00 ? 57  GLN B HG2  2  
ATOM 6220  H HG3  . GLN B 1 57  ? 10.785  -4.419  10.872  1.00 0.00 ? 57  GLN B HG3  2  
ATOM 6221  H HE21 . GLN B 1 57  ? 12.198  -6.838  12.272  1.00 0.00 ? 57  GLN B HE21 2  
ATOM 6222  H HE22 . GLN B 1 57  ? 10.915  -7.904  12.582  1.00 0.00 ? 57  GLN B HE22 2  
ATOM 6223  N N    . TYR B 1 58  ? 9.887   -3.118  6.801   1.00 0.00 ? 58  TYR B N    2  
ATOM 6224  C CA   . TYR B 1 58  ? 10.288  -1.847  6.135   1.00 0.00 ? 58  TYR B CA   2  
ATOM 6225  C C    . TYR B 1 58  ? 9.318   -0.738  6.563   1.00 0.00 ? 58  TYR B C    2  
ATOM 6226  O O    . TYR B 1 58  ? 9.720   0.375   6.842   1.00 0.00 ? 58  TYR B O    2  
ATOM 6227  C CB   . TYR B 1 58  ? 10.262  -2.034  4.606   1.00 0.00 ? 58  TYR B CB   2  
ATOM 6228  C CG   . TYR B 1 58  ? 9.972   -0.719  3.919   1.00 0.00 ? 58  TYR B CG   2  
ATOM 6229  C CD1  . TYR B 1 58  ? 10.921  0.310   3.942   1.00 0.00 ? 58  TYR B CD1  2  
ATOM 6230  C CD2  . TYR B 1 58  ? 8.748   -0.528  3.269   1.00 0.00 ? 58  TYR B CD2  2  
ATOM 6231  C CE1  . TYR B 1 58  ? 10.644  1.529   3.312   1.00 0.00 ? 58  TYR B CE1  2  
ATOM 6232  C CE2  . TYR B 1 58  ? 8.473   0.689   2.642   1.00 0.00 ? 58  TYR B CE2  2  
ATOM 6233  C CZ   . TYR B 1 58  ? 9.420   1.715   2.663   1.00 0.00 ? 58  TYR B CZ   2  
ATOM 6234  O OH   . TYR B 1 58  ? 9.147   2.913   2.045   1.00 0.00 ? 58  TYR B OH   2  
ATOM 6235  H H    . TYR B 1 58  ? 9.585   -3.882  6.265   1.00 0.00 ? 58  TYR B H    2  
ATOM 6236  H HA   . TYR B 1 58  ? 11.288  -1.585  6.447   1.00 0.00 ? 58  TYR B HA   2  
ATOM 6237  H HB2  . TYR B 1 58  ? 11.222  -2.403  4.276   1.00 0.00 ? 58  TYR B HB2  2  
ATOM 6238  H HB3  . TYR B 1 58  ? 9.498   -2.750  4.340   1.00 0.00 ? 58  TYR B HB3  2  
ATOM 6239  H HD1  . TYR B 1 58  ? 11.867  0.164   4.445   1.00 0.00 ? 58  TYR B HD1  2  
ATOM 6240  H HD2  . TYR B 1 58  ? 8.016   -1.322  3.252   1.00 0.00 ? 58  TYR B HD2  2  
ATOM 6241  H HE1  . TYR B 1 58  ? 11.372  2.326   3.329   1.00 0.00 ? 58  TYR B HE1  2  
ATOM 6242  H HE2  . TYR B 1 58  ? 7.529   0.838   2.139   1.00 0.00 ? 58  TYR B HE2  2  
ATOM 6243  H HH   . TYR B 1 58  ? 8.471   2.758   1.383   1.00 0.00 ? 58  TYR B HH   2  
ATOM 6244  N N    . SER B 1 59  ? 8.047   -1.032  6.619   1.00 0.00 ? 59  SER B N    2  
ATOM 6245  C CA   . SER B 1 59  ? 7.061   0.007   7.031   1.00 0.00 ? 59  SER B CA   2  
ATOM 6246  C C    . SER B 1 59  ? 7.456   0.565   8.400   1.00 0.00 ? 59  SER B C    2  
ATOM 6247  O O    . SER B 1 59  ? 7.020   1.626   8.796   1.00 0.00 ? 59  SER B O    2  
ATOM 6248  C CB   . SER B 1 59  ? 5.664   -0.613  7.115   1.00 0.00 ? 59  SER B CB   2  
ATOM 6249  O OG   . SER B 1 59  ? 5.701   -1.739  7.981   1.00 0.00 ? 59  SER B OG   2  
ATOM 6250  H H    . SER B 1 59  ? 7.741   -1.935  6.391   1.00 0.00 ? 59  SER B H    2  
ATOM 6251  H HA   . SER B 1 59  ? 7.055   0.809   6.306   1.00 0.00 ? 59  SER B HA   2  
ATOM 6252  H HB2  . SER B 1 59  ? 4.969   0.111   7.505   1.00 0.00 ? 59  SER B HB2  2  
ATOM 6253  H HB3  . SER B 1 59  ? 5.348   -0.917  6.126   1.00 0.00 ? 59  SER B HB3  2  
ATOM 6254  H HG   . SER B 1 59  ? 6.315   -1.546  8.693   1.00 0.00 ? 59  SER B HG   2  
ATOM 6255  N N    . LYS B 1 60  ? 8.286   -0.138  9.123   1.00 0.00 ? 60  LYS B N    2  
ATOM 6256  C CA   . LYS B 1 60  ? 8.715   0.361   10.459  1.00 0.00 ? 60  LYS B CA   2  
ATOM 6257  C C    . LYS B 1 60  ? 9.785   1.436   10.264  1.00 0.00 ? 60  LYS B C    2  
ATOM 6258  O O    . LYS B 1 60  ? 9.804   2.443   10.943  1.00 0.00 ? 60  LYS B O    2  
ATOM 6259  C CB   . LYS B 1 60  ? 9.292   -0.800  11.277  1.00 0.00 ? 60  LYS B CB   2  
ATOM 6260  C CG   . LYS B 1 60  ? 10.095  -0.253  12.460  1.00 0.00 ? 60  LYS B CG   2  
ATOM 6261  C CD   . LYS B 1 60  ? 10.639  -1.416  13.291  1.00 0.00 ? 60  LYS B CD   2  
ATOM 6262  C CE   . LYS B 1 60  ? 10.163  -1.277  14.738  1.00 0.00 ? 60  LYS B CE   2  
ATOM 6263  N NZ   . LYS B 1 60  ? 9.515   -2.546  15.171  1.00 0.00 ? 60  LYS B NZ   2  
ATOM 6264  H H    . LYS B 1 60  ? 8.633   -0.990  8.784   1.00 0.00 ? 60  LYS B H    2  
ATOM 6265  H HA   . LYS B 1 60  ? 7.867   0.784   10.977  1.00 0.00 ? 60  LYS B HA   2  
ATOM 6266  H HB2  . LYS B 1 60  ? 8.484   -1.417  11.645  1.00 0.00 ? 60  LYS B HB2  2  
ATOM 6267  H HB3  . LYS B 1 60  ? 9.939   -1.395  10.650  1.00 0.00 ? 60  LYS B HB3  2  
ATOM 6268  H HG2  . LYS B 1 60  ? 10.918  0.342   12.089  1.00 0.00 ? 60  LYS B HG2  2  
ATOM 6269  H HG3  . LYS B 1 60  ? 9.456   0.361   13.076  1.00 0.00 ? 60  LYS B HG3  2  
ATOM 6270  H HD2  . LYS B 1 60  ? 10.281  -2.350  12.882  1.00 0.00 ? 60  LYS B HD2  2  
ATOM 6271  H HD3  . LYS B 1 60  ? 11.718  -1.403  13.266  1.00 0.00 ? 60  LYS B HD3  2  
ATOM 6272  H HE2  . LYS B 1 60  ? 11.008  -1.066  15.377  1.00 0.00 ? 60  LYS B HE2  2  
ATOM 6273  H HE3  . LYS B 1 60  ? 9.450   -0.467  14.805  1.00 0.00 ? 60  LYS B HE3  2  
ATOM 6274  H HZ1  . LYS B 1 60  ? 10.078  -3.354  14.839  1.00 0.00 ? 60  LYS B HZ1  2  
ATOM 6275  H HZ2  . LYS B 1 60  ? 9.456   -2.567  16.209  1.00 0.00 ? 60  LYS B HZ2  2  
ATOM 6276  H HZ3  . LYS B 1 60  ? 8.559   -2.603  14.767  1.00 0.00 ? 60  LYS B HZ3  2  
ATOM 6277  N N    . VAL B 1 61  ? 10.675  1.226   9.335   1.00 0.00 ? 61  VAL B N    2  
ATOM 6278  C CA   . VAL B 1 61  ? 11.743  2.226   9.083   1.00 0.00 ? 61  VAL B CA   2  
ATOM 6279  C C    . VAL B 1 61  ? 11.142  3.434   8.366   1.00 0.00 ? 61  VAL B C    2  
ATOM 6280  O O    . VAL B 1 61  ? 10.933  4.471   8.958   1.00 0.00 ? 61  VAL B O    2  
ATOM 6281  C CB   . VAL B 1 61  ? 12.820  1.590   8.207   1.00 0.00 ? 61  VAL B CB   2  
ATOM 6282  C CG1  . VAL B 1 61  ? 13.777  2.668   7.707   1.00 0.00 ? 61  VAL B CG1  2  
ATOM 6283  C CG2  . VAL B 1 61  ? 13.595  0.562   9.031   1.00 0.00 ? 61  VAL B CG2  2  
ATOM 6284  H H    . VAL B 1 61  ? 10.640  0.409   8.798   1.00 0.00 ? 61  VAL B H    2  
ATOM 6285  H HA   . VAL B 1 61  ? 12.177  2.538   10.021  1.00 0.00 ? 61  VAL B HA   2  
ATOM 6286  H HB   . VAL B 1 61  ? 12.355  1.102   7.364   1.00 0.00 ? 61  VAL B HB   2  
ATOM 6287  H HG11 . VAL B 1 61  ? 13.447  3.633   8.059   1.00 0.00 ? 61  VAL B HG11 2  
ATOM 6288  H HG12 . VAL B 1 61  ? 14.770  2.468   8.081   1.00 0.00 ? 61  VAL B HG12 2  
ATOM 6289  H HG13 . VAL B 1 61  ? 13.790  2.663   6.628   1.00 0.00 ? 61  VAL B HG13 2  
ATOM 6290  H HG21 . VAL B 1 61  ? 12.987  0.240   9.865   1.00 0.00 ? 61  VAL B HG21 2  
ATOM 6291  H HG22 . VAL B 1 61  ? 13.834  -0.288  8.410   1.00 0.00 ? 61  VAL B HG22 2  
ATOM 6292  H HG23 . VAL B 1 61  ? 14.505  1.009   9.399   1.00 0.00 ? 61  VAL B HG23 2  
ATOM 6293  N N    . LEU B 1 62  ? 10.857  3.303   7.098   1.00 0.00 ? 62  LEU B N    2  
ATOM 6294  C CA   . LEU B 1 62  ? 10.262  4.443   6.345   1.00 0.00 ? 62  LEU B CA   2  
ATOM 6295  C C    . LEU B 1 62  ? 9.170   5.096   7.201   1.00 0.00 ? 62  LEU B C    2  
ATOM 6296  O O    . LEU B 1 62  ? 8.885   6.270   7.071   1.00 0.00 ? 62  LEU B O    2  
ATOM 6297  C CB   . LEU B 1 62  ? 9.658   3.918   5.037   1.00 0.00 ? 62  LEU B CB   2  
ATOM 6298  C CG   . LEU B 1 62  ? 8.869   5.023   4.330   1.00 0.00 ? 62  LEU B CG   2  
ATOM 6299  C CD1  . LEU B 1 62  ? 9.779   5.779   3.354   1.00 0.00 ? 62  LEU B CD1  2  
ATOM 6300  C CD2  . LEU B 1 62  ? 7.714   4.389   3.553   1.00 0.00 ? 62  LEU B CD2  2  
ATOM 6301  H H    . LEU B 1 62  ? 11.029  2.452   6.643   1.00 0.00 ? 62  LEU B H    2  
ATOM 6302  H HA   . LEU B 1 62  ? 11.031  5.169   6.124   1.00 0.00 ? 62  LEU B HA   2  
ATOM 6303  H HB2  . LEU B 1 62  ? 10.454  3.581   4.390   1.00 0.00 ? 62  LEU B HB2  2  
ATOM 6304  H HB3  . LEU B 1 62  ? 8.999   3.091   5.253   1.00 0.00 ? 62  LEU B HB3  2  
ATOM 6305  H HG   . LEU B 1 62  ? 8.475   5.712   5.062   1.00 0.00 ? 62  LEU B HG   2  
ATOM 6306  H HD11 . LEU B 1 62  ? 10.811  5.577   3.589   1.00 0.00 ? 62  LEU B HD11 2  
ATOM 6307  H HD12 . LEU B 1 62  ? 9.570   5.456   2.343   1.00 0.00 ? 62  LEU B HD12 2  
ATOM 6308  H HD13 . LEU B 1 62  ? 9.591   6.841   3.434   1.00 0.00 ? 62  LEU B HD13 2  
ATOM 6309  H HD21 . LEU B 1 62  ? 7.800   3.313   3.603   1.00 0.00 ? 62  LEU B HD21 2  
ATOM 6310  H HD22 . LEU B 1 62  ? 6.778   4.695   3.989   1.00 0.00 ? 62  LEU B HD22 2  
ATOM 6311  H HD23 . LEU B 1 62  ? 7.757   4.707   2.522   1.00 0.00 ? 62  LEU B HD23 2  
ATOM 6312  N N    . ALA B 1 63  ? 8.564   4.344   8.084   1.00 0.00 ? 63  ALA B N    2  
ATOM 6313  C CA   . ALA B 1 63  ? 7.500   4.924   8.957   1.00 0.00 ? 63  ALA B CA   2  
ATOM 6314  C C    . ALA B 1 63  ? 8.054   6.161   9.667   1.00 0.00 ? 63  ALA B C    2  
ATOM 6315  O O    . ALA B 1 63  ? 7.546   7.254   9.520   1.00 0.00 ? 63  ALA B O    2  
ATOM 6316  C CB   . ALA B 1 63  ? 7.067   3.884   9.998   1.00 0.00 ? 63  ALA B CB   2  
ATOM 6317  H H    . ALA B 1 63  ? 8.813   3.401   8.178   1.00 0.00 ? 63  ALA B H    2  
ATOM 6318  H HA   . ALA B 1 63  ? 6.651   5.206   8.352   1.00 0.00 ? 63  ALA B HA   2  
ATOM 6319  H HB1  . ALA B 1 63  ? 7.834   3.127   10.094  1.00 0.00 ? 63  ALA B HB1  2  
ATOM 6320  H HB2  . ALA B 1 63  ? 6.920   4.368   10.953  1.00 0.00 ? 63  ALA B HB2  2  
ATOM 6321  H HB3  . ALA B 1 63  ? 6.143   3.420   9.684   1.00 0.00 ? 63  ALA B HB3  2  
ATOM 6322  N N    . LEU B 1 64  ? 9.099   5.995   10.429  1.00 0.00 ? 64  LEU B N    2  
ATOM 6323  C CA   . LEU B 1 64  ? 9.698   7.159   11.143  1.00 0.00 ? 64  LEU B CA   2  
ATOM 6324  C C    . LEU B 1 64  ? 10.384  8.065   10.125  1.00 0.00 ? 64  LEU B C    2  
ATOM 6325  O O    . LEU B 1 64  ? 10.470  9.261   10.298  1.00 0.00 ? 64  LEU B O    2  
ATOM 6326  C CB   . LEU B 1 64  ? 10.725  6.648   12.151  1.00 0.00 ? 64  LEU B CB   2  
ATOM 6327  C CG   . LEU B 1 64  ? 9.995   5.908   13.269  1.00 0.00 ? 64  LEU B CG   2  
ATOM 6328  C CD1  . LEU B 1 64  ? 10.983  5.022   14.029  1.00 0.00 ? 64  LEU B CD1  2  
ATOM 6329  C CD2  . LEU B 1 64  ? 9.375   6.922   14.234  1.00 0.00 ? 64  LEU B CD2  2  
ATOM 6330  H H    . LEU B 1 64  ? 9.495   5.104   10.528  1.00 0.00 ? 64  LEU B H    2  
ATOM 6331  H HA   . LEU B 1 64  ? 8.923   7.711   11.659  1.00 0.00 ? 64  LEU B HA   2  
ATOM 6332  H HB2  . LEU B 1 64  ? 11.407  5.972   11.653  1.00 0.00 ? 64  LEU B HB2  2  
ATOM 6333  H HB3  . LEU B 1 64  ? 11.275  7.477   12.564  1.00 0.00 ? 64  LEU B HB3  2  
ATOM 6334  H HG   . LEU B 1 64  ? 9.217   5.295   12.839  1.00 0.00 ? 64  LEU B HG   2  
ATOM 6335  H HD11 . LEU B 1 64  ? 11.959  5.483   14.023  1.00 0.00 ? 64  LEU B HD11 2  
ATOM 6336  H HD12 . LEU B 1 64  ? 10.648  4.902   15.049  1.00 0.00 ? 64  LEU B HD12 2  
ATOM 6337  H HD13 . LEU B 1 64  ? 11.039  4.055   13.552  1.00 0.00 ? 64  LEU B HD13 2  
ATOM 6338  H HD21 . LEU B 1 64  ? 10.136  7.607   14.575  1.00 0.00 ? 64  LEU B HD21 2  
ATOM 6339  H HD22 . LEU B 1 64  ? 8.597   7.473   13.725  1.00 0.00 ? 64  LEU B HD22 2  
ATOM 6340  H HD23 . LEU B 1 64  ? 8.953   6.401   15.081  1.00 0.00 ? 64  LEU B HD23 2  
ATOM 6341  N N    . TYR B 1 65  ? 10.867  7.498   9.061   1.00 0.00 ? 65  TYR B N    2  
ATOM 6342  C CA   . TYR B 1 65  ? 11.540  8.319   8.015   1.00 0.00 ? 65  TYR B CA   2  
ATOM 6343  C C    . TYR B 1 65  ? 10.622  9.483   7.640   1.00 0.00 ? 65  TYR B C    2  
ATOM 6344  O O    . TYR B 1 65  ? 11.066  10.549  7.263   1.00 0.00 ? 65  TYR B O    2  
ATOM 6345  C CB   . TYR B 1 65  ? 11.797  7.442   6.789   1.00 0.00 ? 65  TYR B CB   2  
ATOM 6346  C CG   . TYR B 1 65  ? 12.555  8.224   5.743   1.00 0.00 ? 65  TYR B CG   2  
ATOM 6347  C CD1  . TYR B 1 65  ? 11.856  9.010   4.818   1.00 0.00 ? 65  TYR B CD1  2  
ATOM 6348  C CD2  . TYR B 1 65  ? 13.953  8.151   5.687   1.00 0.00 ? 65  TYR B CD2  2  
ATOM 6349  C CE1  . TYR B 1 65  ? 12.553  9.723   3.837   1.00 0.00 ? 65  TYR B CE1  2  
ATOM 6350  C CE2  . TYR B 1 65  ? 14.649  8.867   4.705   1.00 0.00 ? 65  TYR B CE2  2  
ATOM 6351  C CZ   . TYR B 1 65  ? 13.949  9.651   3.780   1.00 0.00 ? 65  TYR B CZ   2  
ATOM 6352  O OH   . TYR B 1 65  ? 14.638  10.354  2.813   1.00 0.00 ? 65  TYR B OH   2  
ATOM 6353  H H    . TYR B 1 65  ? 10.779  6.531   8.946   1.00 0.00 ? 65  TYR B H    2  
ATOM 6354  H HA   . TYR B 1 65  ? 12.476  8.699   8.396   1.00 0.00 ? 65  TYR B HA   2  
ATOM 6355  H HB2  . TYR B 1 65  ? 12.377  6.580   7.080   1.00 0.00 ? 65  TYR B HB2  2  
ATOM 6356  H HB3  . TYR B 1 65  ? 10.853  7.117   6.379   1.00 0.00 ? 65  TYR B HB3  2  
ATOM 6357  H HD1  . TYR B 1 65  ? 10.778  9.065   4.862   1.00 0.00 ? 65  TYR B HD1  2  
ATOM 6358  H HD2  . TYR B 1 65  ? 14.495  7.548   6.407   1.00 0.00 ? 65  TYR B HD2  2  
ATOM 6359  H HE1  . TYR B 1 65  ? 12.014  10.329  3.124   1.00 0.00 ? 65  TYR B HE1  2  
ATOM 6360  H HE2  . TYR B 1 65  ? 15.725  8.810   4.655   1.00 0.00 ? 65  TYR B HE2  2  
ATOM 6361  H HH   . TYR B 1 65  ? 13.999  10.690  2.178   1.00 0.00 ? 65  TYR B HH   2  
ATOM 6362  N N    . ASN B 1 66  ? 9.338   9.282   7.758   1.00 0.00 ? 66  ASN B N    2  
ATOM 6363  C CA   . ASN B 1 66  ? 8.364   10.362  7.427   1.00 0.00 ? 66  ASN B CA   2  
ATOM 6364  C C    . ASN B 1 66  ? 7.939   11.054  8.716   1.00 0.00 ? 66  ASN B C    2  
ATOM 6365  O O    . ASN B 1 66  ? 8.112   12.244  8.892   1.00 0.00 ? 66  ASN B O    2  
ATOM 6366  C CB   . ASN B 1 66  ? 7.125   9.743   6.795   1.00 0.00 ? 66  ASN B CB   2  
ATOM 6367  C CG   . ASN B 1 66  ? 6.260   10.839  6.168   1.00 0.00 ? 66  ASN B CG   2  
ATOM 6368  O OD1  . ASN B 1 66  ? 5.053   10.817  6.291   1.00 0.00 ? 66  ASN B OD1  2  
ATOM 6369  N ND2  . ASN B 1 66  ? 6.829   11.805  5.500   1.00 0.00 ? 66  ASN B ND2  2  
ATOM 6370  H H    . ASN B 1 66  ? 9.010   8.413   8.071   1.00 0.00 ? 66  ASN B H    2  
ATOM 6371  H HA   . ASN B 1 66  ? 8.811   11.074  6.751   1.00 0.00 ? 66  ASN B HA   2  
ATOM 6372  H HB2  . ASN B 1 66  ? 7.423   9.033   6.041   1.00 0.00 ? 66  ASN B HB2  2  
ATOM 6373  H HB3  . ASN B 1 66  ? 6.560   9.237   7.561   1.00 0.00 ? 66  ASN B HB3  2  
ATOM 6374  H HD21 . ASN B 1 66  ? 7.803   11.825  5.398   1.00 0.00 ? 66  ASN B HD21 2  
ATOM 6375  H HD22 . ASN B 1 66  ? 6.280   12.512  5.101   1.00 0.00 ? 66  ASN B HD22 2  
ATOM 6376  N N    . GLN B 1 67  ? 7.379   10.297  9.618   1.00 0.00 ? 67  GLN B N    2  
ATOM 6377  C CA   . GLN B 1 67  ? 6.925   10.869  10.919  1.00 0.00 ? 67  GLN B CA   2  
ATOM 6378  C C    . GLN B 1 67  ? 7.945   11.885  11.428  1.00 0.00 ? 67  GLN B C    2  
ATOM 6379  O O    . GLN B 1 67  ? 7.623   12.794  12.167  1.00 0.00 ? 67  GLN B O    2  
ATOM 6380  C CB   . GLN B 1 67  ? 6.772   9.739   11.940  1.00 0.00 ? 67  GLN B CB   2  
ATOM 6381  C CG   . GLN B 1 67  ? 5.344   9.192   11.887  1.00 0.00 ? 67  GLN B CG   2  
ATOM 6382  C CD   . GLN B 1 67  ? 4.587   9.617   13.146  1.00 0.00 ? 67  GLN B CD   2  
ATOM 6383  O OE1  . GLN B 1 67  ? 4.160   8.784   13.921  1.00 0.00 ? 67  GLN B OE1  2  
ATOM 6384  N NE2  . GLN B 1 67  ? 4.401   10.886  13.386  1.00 0.00 ? 67  GLN B NE2  2  
ATOM 6385  H H    . GLN B 1 67  ? 7.255   9.341   9.435   1.00 0.00 ? 67  GLN B H    2  
ATOM 6386  H HA   . GLN B 1 67  ? 5.980   11.358  10.780  1.00 0.00 ? 67  GLN B HA   2  
ATOM 6387  H HB2  . GLN B 1 67  ? 7.470   8.948   11.705  1.00 0.00 ? 67  GLN B HB2  2  
ATOM 6388  H HB3  . GLN B 1 67  ? 6.977   10.115  12.930  1.00 0.00 ? 67  GLN B HB3  2  
ATOM 6389  H HG2  . GLN B 1 67  ? 4.842   9.584   11.015  1.00 0.00 ? 67  GLN B HG2  2  
ATOM 6390  H HG3  . GLN B 1 67  ? 5.373   8.114   11.832  1.00 0.00 ? 67  GLN B HG3  2  
ATOM 6391  H HE21 . GLN B 1 67  ? 4.745   11.557  12.761  1.00 0.00 ? 67  GLN B HE21 2  
ATOM 6392  H HE22 . GLN B 1 67  ? 3.917   11.167  14.190  1.00 0.00 ? 67  GLN B HE22 2  
ATOM 6393  N N    . HIS B 1 68  ? 9.171   11.738  11.028  1.00 0.00 ? 68  HIS B N    2  
ATOM 6394  C CA   . HIS B 1 68  ? 10.227  12.690  11.473  1.00 0.00 ? 68  HIS B CA   2  
ATOM 6395  C C    . HIS B 1 68  ? 10.252  13.890  10.524  1.00 0.00 ? 68  HIS B C    2  
ATOM 6396  O O    . HIS B 1 68  ? 10.306  15.029  10.946  1.00 0.00 ? 68  HIS B O    2  
ATOM 6397  C CB   . HIS B 1 68  ? 11.589  11.993  11.442  1.00 0.00 ? 68  HIS B CB   2  
ATOM 6398  C CG   . HIS B 1 68  ? 11.829  11.291  12.748  1.00 0.00 ? 68  HIS B CG   2  
ATOM 6399  N ND1  . HIS B 1 68  ? 11.463  9.971   12.959  1.00 0.00 ? 68  HIS B ND1  2  
ATOM 6400  C CD2  . HIS B 1 68  ? 12.410  11.710  13.916  1.00 0.00 ? 68  HIS B CD2  2  
ATOM 6401  C CE1  . HIS B 1 68  ? 11.826  9.645   14.213  1.00 0.00 ? 68  HIS B CE1  2  
ATOM 6402  N NE2  . HIS B 1 68  ? 12.408  10.670  14.842  1.00 0.00 ? 68  HIS B NE2  2  
ATOM 6403  H H    . HIS B 1 68  ? 9.394   11.000  10.432  1.00 0.00 ? 68  HIS B H    2  
ATOM 6404  H HA   . HIS B 1 68  ? 10.014  13.026  12.477  1.00 0.00 ? 68  HIS B HA   2  
ATOM 6405  H HB2  . HIS B 1 68  ? 11.608  11.273  10.637  1.00 0.00 ? 68  HIS B HB2  2  
ATOM 6406  H HB3  . HIS B 1 68  ? 12.364  12.728  11.286  1.00 0.00 ? 68  HIS B HB3  2  
ATOM 6407  H HD1  . HIS B 1 68  ? 11.019  9.383   12.315  1.00 0.00 ? 68  HIS B HD1  2  
ATOM 6408  H HD2  . HIS B 1 68  ? 12.810  12.698  14.090  1.00 0.00 ? 68  HIS B HD2  2  
ATOM 6409  H HE1  . HIS B 1 68  ? 11.671  8.672   14.654  1.00 0.00 ? 68  HIS B HE1  2  
ATOM 6410  N N    . ASN B 1 69  ? 10.213  13.641  9.243   1.00 0.00 ? 69  ASN B N    2  
ATOM 6411  C CA   . ASN B 1 69  ? 10.235  14.761  8.262   1.00 0.00 ? 69  ASN B CA   2  
ATOM 6412  C C    . ASN B 1 69  ? 8.822   14.984  7.711   1.00 0.00 ? 69  ASN B C    2  
ATOM 6413  O O    . ASN B 1 69  ? 8.350   14.212  6.900   1.00 0.00 ? 69  ASN B O    2  
ATOM 6414  C CB   . ASN B 1 69  ? 11.174  14.407  7.107   1.00 0.00 ? 69  ASN B CB   2  
ATOM 6415  C CG   . ASN B 1 69  ? 12.595  14.226  7.642   1.00 0.00 ? 69  ASN B CG   2  
ATOM 6416  O OD1  . ASN B 1 69  ? 13.053  13.114  7.819   1.00 0.00 ? 69  ASN B OD1  2  
ATOM 6417  N ND2  . ASN B 1 69  ? 13.319  15.278  7.908   1.00 0.00 ? 69  ASN B ND2  2  
ATOM 6418  H H    . ASN B 1 69  ? 10.170  12.715  8.927   1.00 0.00 ? 69  ASN B H    2  
ATOM 6419  H HA   . ASN B 1 69  ? 10.587  15.658  8.747   1.00 0.00 ? 69  ASN B HA   2  
ATOM 6420  H HB2  . ASN B 1 69  ? 10.842  13.490  6.642   1.00 0.00 ? 69  ASN B HB2  2  
ATOM 6421  H HB3  . ASN B 1 69  ? 11.165  15.204  6.379   1.00 0.00 ? 69  ASN B HB3  2  
ATOM 6422  H HD21 . ASN B 1 69  ? 12.950  16.175  7.765   1.00 0.00 ? 69  ASN B HD21 2  
ATOM 6423  H HD22 . ASN B 1 69  ? 14.230  15.174  8.252   1.00 0.00 ? 69  ASN B HD22 2  
ATOM 6424  N N    . PRO B 1 70  ? 8.186   16.036  8.164   1.00 0.00 ? 70  PRO B N    2  
ATOM 6425  C CA   . PRO B 1 70  ? 6.824   16.384  7.726   1.00 0.00 ? 70  PRO B CA   2  
ATOM 6426  C C    . PRO B 1 70  ? 6.868   17.035  6.342   1.00 0.00 ? 70  PRO B C    2  
ATOM 6427  O O    . PRO B 1 70  ? 7.472   18.072  6.152   1.00 0.00 ? 70  PRO B O    2  
ATOM 6428  C CB   . PRO B 1 70  ? 6.349   17.379  8.788   1.00 0.00 ? 70  PRO B CB   2  
ATOM 6429  C CG   . PRO B 1 70  ? 7.624   17.972  9.432   1.00 0.00 ? 70  PRO B CG   2  
ATOM 6430  C CD   . PRO B 1 70  ? 8.763   16.974  9.149   1.00 0.00 ? 70  PRO B CD   2  
ATOM 6431  H HA   . PRO B 1 70  ? 6.188   15.513  7.723   1.00 0.00 ? 70  PRO B HA   2  
ATOM 6432  H HB2  . PRO B 1 70  ? 5.762   18.161  8.326   1.00 0.00 ? 70  PRO B HB2  2  
ATOM 6433  H HB3  . PRO B 1 70  ? 5.765   16.870  9.540   1.00 0.00 ? 70  PRO B HB3  2  
ATOM 6434  H HG2  . PRO B 1 70  ? 7.850   18.931  8.987   1.00 0.00 ? 70  PRO B HG2  2  
ATOM 6435  H HG3  . PRO B 1 70  ? 7.489   18.077  10.496  1.00 0.00 ? 70  PRO B HG3  2  
ATOM 6436  H HD2  . PRO B 1 70  ? 9.618   17.487  8.731   1.00 0.00 ? 70  PRO B HD2  2  
ATOM 6437  H HD3  . PRO B 1 70  ? 9.037   16.447  10.049  1.00 0.00 ? 70  PRO B HD3  2  
ATOM 6438  N N    . GLY B 1 71  ? 6.233   16.434  5.373   1.00 0.00 ? 71  GLY B N    2  
ATOM 6439  C CA   . GLY B 1 71  ? 6.244   17.018  4.003   1.00 0.00 ? 71  GLY B CA   2  
ATOM 6440  C C    . GLY B 1 71  ? 6.865   16.019  3.024   1.00 0.00 ? 71  GLY B C    2  
ATOM 6441  O O    . GLY B 1 71  ? 6.891   16.242  1.829   1.00 0.00 ? 71  GLY B O    2  
ATOM 6442  H H    . GLY B 1 71  ? 5.754   15.597  5.546   1.00 0.00 ? 71  GLY B H    2  
ATOM 6443  H HA2  . GLY B 1 71  ? 5.231   17.239  3.699   1.00 0.00 ? 71  GLY B HA2  2  
ATOM 6444  H HA3  . GLY B 1 71  ? 6.826   17.926  4.003   1.00 0.00 ? 71  GLY B HA3  2  
ATOM 6445  N N    . ALA B 1 72  ? 7.361   14.916  3.516   1.00 0.00 ? 72  ALA B N    2  
ATOM 6446  C CA   . ALA B 1 72  ? 7.970   13.906  2.613   1.00 0.00 ? 72  ALA B CA   2  
ATOM 6447  C C    . ALA B 1 72  ? 6.904   12.897  2.203   1.00 0.00 ? 72  ALA B C    2  
ATOM 6448  O O    . ALA B 1 72  ? 6.296   12.241  3.026   1.00 0.00 ? 72  ALA B O    2  
ATOM 6449  C CB   . ALA B 1 72  ? 9.105   13.181  3.329   1.00 0.00 ? 72  ALA B CB   2  
ATOM 6450  H H    . ALA B 1 72  ? 7.326   14.748  4.477   1.00 0.00 ? 72  ALA B H    2  
ATOM 6451  H HA   . ALA B 1 72  ? 8.355   14.398  1.731   1.00 0.00 ? 72  ALA B HA   2  
ATOM 6452  H HB1  . ALA B 1 72  ? 9.044   13.377  4.389   1.00 0.00 ? 72  ALA B HB1  2  
ATOM 6453  H HB2  . ALA B 1 72  ? 9.021   12.119  3.153   1.00 0.00 ? 72  ALA B HB2  2  
ATOM 6454  H HB3  . ALA B 1 72  ? 10.052  13.535  2.950   1.00 0.00 ? 72  ALA B HB3  2  
ATOM 6455  N N    . SER B 1 73  ? 6.673   12.775  0.934   1.00 0.00 ? 73  SER B N    2  
ATOM 6456  C CA   . SER B 1 73  ? 5.643   11.815  0.448   1.00 0.00 ? 73  SER B CA   2  
ATOM 6457  C C    . SER B 1 73  ? 6.210   10.394  0.465   1.00 0.00 ? 73  SER B C    2  
ATOM 6458  O O    . SER B 1 73  ? 5.528   9.442   0.145   1.00 0.00 ? 73  SER B O    2  
ATOM 6459  C CB   . SER B 1 73  ? 5.239   12.182  -0.980  1.00 0.00 ? 73  SER B CB   2  
ATOM 6460  O OG   . SER B 1 73  ? 4.724   11.030  -1.632  1.00 0.00 ? 73  SER B OG   2  
ATOM 6461  H H    . SER B 1 73  ? 7.178   13.320  0.301   1.00 0.00 ? 73  SER B H    2  
ATOM 6462  H HA   . SER B 1 73  ? 4.776   11.863  1.090   1.00 0.00 ? 73  SER B HA   2  
ATOM 6463  H HB2  . SER B 1 73  ? 4.480   12.947  -0.956  1.00 0.00 ? 73  SER B HB2  2  
ATOM 6464  H HB3  . SER B 1 73  ? 6.105   12.554  -1.512  1.00 0.00 ? 73  SER B HB3  2  
ATOM 6465  H HG   . SER B 1 73  ? 4.577   11.251  -2.554  1.00 0.00 ? 73  SER B HG   2  
ATOM 6466  N N    . ALA B 1 74  ? 7.453   10.241  0.837   1.00 0.00 ? 74  ALA B N    2  
ATOM 6467  C CA   . ALA B 1 74  ? 8.055   8.877   0.867   1.00 0.00 ? 74  ALA B CA   2  
ATOM 6468  C C    . ALA B 1 74  ? 7.476   8.079   2.039   1.00 0.00 ? 74  ALA B C    2  
ATOM 6469  O O    . ALA B 1 74  ? 7.798   6.925   2.229   1.00 0.00 ? 74  ALA B O    2  
ATOM 6470  C CB   . ALA B 1 74  ? 9.574   8.987   1.015   1.00 0.00 ? 74  ALA B CB   2  
ATOM 6471  H H    . ALA B 1 74  ? 7.989   11.020  1.092   1.00 0.00 ? 74  ALA B H    2  
ATOM 6472  H HA   . ALA B 1 74  ? 7.822   8.368   -0.053  1.00 0.00 ? 74  ALA B HA   2  
ATOM 6473  H HB1  . ALA B 1 74  ? 9.925   9.858   0.481   1.00 0.00 ? 74  ALA B HB1  2  
ATOM 6474  H HB2  . ALA B 1 74  ? 9.831   9.076   2.059   1.00 0.00 ? 74  ALA B HB2  2  
ATOM 6475  H HB3  . ALA B 1 74  ? 10.040  8.103   0.603   1.00 0.00 ? 74  ALA B HB3  2  
ATOM 6476  N N    . ALA B 1 75  ? 6.618   8.680   2.818   1.00 0.00 ? 75  ALA B N    2  
ATOM 6477  C CA   . ALA B 1 75  ? 6.012   7.950   3.968   1.00 0.00 ? 75  ALA B CA   2  
ATOM 6478  C C    . ALA B 1 75  ? 5.492   6.589   3.483   1.00 0.00 ? 75  ALA B C    2  
ATOM 6479  O O    . ALA B 1 75  ? 5.590   6.275   2.313   1.00 0.00 ? 75  ALA B O    2  
ATOM 6480  C CB   . ALA B 1 75  ? 4.853   8.780   4.522   1.00 0.00 ? 75  ALA B CB   2  
ATOM 6481  H H    . ALA B 1 75  ? 6.367   9.610   2.644   1.00 0.00 ? 75  ALA B H    2  
ATOM 6482  H HA   . ALA B 1 75  ? 6.754   7.802   4.738   1.00 0.00 ? 75  ALA B HA   2  
ATOM 6483  H HB1  . ALA B 1 75  ? 4.891   9.774   4.104   1.00 0.00 ? 75  ALA B HB1  2  
ATOM 6484  H HB2  . ALA B 1 75  ? 3.916   8.312   4.257   1.00 0.00 ? 75  ALA B HB2  2  
ATOM 6485  H HB3  . ALA B 1 75  ? 4.935   8.837   5.598   1.00 0.00 ? 75  ALA B HB3  2  
ATOM 6486  N N    . PRO B 1 76  ? 4.948   5.818   4.391   1.00 0.00 ? 76  PRO B N    2  
ATOM 6487  C CA   . PRO B 1 76  ? 4.407   4.486   4.067   1.00 0.00 ? 76  PRO B CA   2  
ATOM 6488  C C    . PRO B 1 76  ? 3.087   4.640   3.316   1.00 0.00 ? 76  PRO B C    2  
ATOM 6489  O O    . PRO B 1 76  ? 2.735   5.726   2.900   1.00 0.00 ? 76  PRO B O    2  
ATOM 6490  C CB   . PRO B 1 76  ? 4.197   3.835   5.431   1.00 0.00 ? 76  PRO B CB   2  
ATOM 6491  C CG   . PRO B 1 76  ? 4.087   4.996   6.444   1.00 0.00 ? 76  PRO B CG   2  
ATOM 6492  C CD   . PRO B 1 76  ? 4.808   6.199   5.811   1.00 0.00 ? 76  PRO B CD   2  
ATOM 6493  H HA   . PRO B 1 76  ? 5.114   3.916   3.486   1.00 0.00 ? 76  PRO B HA   2  
ATOM 6494  H HB2  . PRO B 1 76  ? 3.289   3.249   5.424   1.00 0.00 ? 76  PRO B HB2  2  
ATOM 6495  H HB3  . PRO B 1 76  ? 5.041   3.213   5.681   1.00 0.00 ? 76  PRO B HB3  2  
ATOM 6496  H HG2  . PRO B 1 76  ? 3.046   5.240   6.617   1.00 0.00 ? 76  PRO B HG2  2  
ATOM 6497  H HG3  . PRO B 1 76  ? 4.566   4.727   7.369   1.00 0.00 ? 76  PRO B HG3  2  
ATOM 6498  H HD2  . PRO B 1 76  ? 4.206   7.089   5.915   1.00 0.00 ? 76  PRO B HD2  2  
ATOM 6499  H HD3  . PRO B 1 76  ? 5.780   6.339   6.259   1.00 0.00 ? 76  PRO B HD3  2  
ATOM 6500  N N    . CYS B 1 77  ? 2.355   3.580   3.112   1.00 0.00 ? 77  CYS B N    2  
ATOM 6501  C CA   . CYS B 1 77  ? 1.087   3.738   2.361   1.00 0.00 ? 77  CYS B CA   2  
ATOM 6502  C C    . CYS B 1 77  ? -0.007  2.782   2.855   1.00 0.00 ? 77  CYS B C    2  
ATOM 6503  O O    . CYS B 1 77  ? -0.127  1.667   2.387   1.00 0.00 ? 77  CYS B O    2  
ATOM 6504  C CB   . CYS B 1 77  ? 1.367   3.479   0.883   1.00 0.00 ? 77  CYS B CB   2  
ATOM 6505  S SG   . CYS B 1 77  ? 1.027   4.988   -0.052  1.00 0.00 ? 77  CYS B SG   2  
ATOM 6506  H H    . CYS B 1 77  ? 2.643   2.698   3.430   1.00 0.00 ? 77  CYS B H    2  
ATOM 6507  H HA   . CYS B 1 77  ? 0.740   4.754   2.472   1.00 0.00 ? 77  CYS B HA   2  
ATOM 6508  H HB2  . CYS B 1 77  ? 2.401   3.199   0.755   1.00 0.00 ? 77  CYS B HB2  2  
ATOM 6509  H HB3  . CYS B 1 77  ? 0.730   2.683   0.530   1.00 0.00 ? 77  CYS B HB3  2  
ATOM 6510  N N    . CYS B 1 78  ? -0.832  3.228   3.769   1.00 0.00 ? 78  CYS B N    2  
ATOM 6511  C CA   . CYS B 1 78  ? -1.955  2.363   4.251   1.00 0.00 ? 78  CYS B CA   2  
ATOM 6512  C C    . CYS B 1 78  ? -2.709  1.832   3.015   1.00 0.00 ? 78  CYS B C    2  
ATOM 6513  O O    . CYS B 1 78  ? -2.825  2.520   2.021   1.00 0.00 ? 78  CYS B O    2  
ATOM 6514  C CB   . CYS B 1 78  ? -2.902  3.209   5.118   1.00 0.00 ? 78  CYS B CB   2  
ATOM 6515  S SG   . CYS B 1 78  ? -4.393  2.261   5.511   1.00 0.00 ? 78  CYS B SG   2  
ATOM 6516  H H    . CYS B 1 78  ? -0.727  4.138   4.121   1.00 0.00 ? 78  CYS B H    2  
ATOM 6517  H HA   . CYS B 1 78  ? -1.563  1.537   4.826   1.00 0.00 ? 78  CYS B HA   2  
ATOM 6518  H HB2  . CYS B 1 78  ? -2.400  3.483   6.033   1.00 0.00 ? 78  CYS B HB2  2  
ATOM 6519  H HB3  . CYS B 1 78  ? -3.182  4.109   4.581   1.00 0.00 ? 78  CYS B HB3  2  
ATOM 6520  N N    . VAL B 1 79  ? -3.201  0.614   3.046   1.00 0.00 ? 79  VAL B N    2  
ATOM 6521  C CA   . VAL B 1 79  ? -3.908  0.076   1.842   1.00 0.00 ? 79  VAL B CA   2  
ATOM 6522  C C    . VAL B 1 79  ? -5.067  -0.855  2.254   1.00 0.00 ? 79  VAL B C    2  
ATOM 6523  O O    . VAL B 1 79  ? -5.311  -1.051  3.421   1.00 0.00 ? 79  VAL B O    2  
ATOM 6524  C CB   . VAL B 1 79  ? -2.889  -0.684  0.979   1.00 0.00 ? 79  VAL B CB   2  
ATOM 6525  C CG1  . VAL B 1 79  ? -1.541  0.011   1.069   1.00 0.00 ? 79  VAL B CG1  2  
ATOM 6526  C CG2  . VAL B 1 79  ? -2.733  -2.123  1.480   1.00 0.00 ? 79  VAL B CG2  2  
ATOM 6527  H H    . VAL B 1 79  ? -3.093  0.058   3.837   1.00 0.00 ? 79  VAL B H    2  
ATOM 6528  H HA   . VAL B 1 79  ? -4.303  0.900   1.279   1.00 0.00 ? 79  VAL B HA   2  
ATOM 6529  H HB   . VAL B 1 79  ? -3.211  -0.686  -0.048  1.00 0.00 ? 79  VAL B HB   2  
ATOM 6530  H HG11 . VAL B 1 79  ? -1.683  1.080   1.019   1.00 0.00 ? 79  VAL B HG11 2  
ATOM 6531  H HG12 . VAL B 1 79  ? -1.068  -0.246  2.006   1.00 0.00 ? 79  VAL B HG12 2  
ATOM 6532  H HG13 . VAL B 1 79  ? -0.920  -0.309  0.251   1.00 0.00 ? 79  VAL B HG13 2  
ATOM 6533  H HG21 . VAL B 1 79  ? -2.784  -2.135  2.559   1.00 0.00 ? 79  VAL B HG21 2  
ATOM 6534  H HG22 . VAL B 1 79  ? -3.524  -2.734  1.074   1.00 0.00 ? 79  VAL B HG22 2  
ATOM 6535  H HG23 . VAL B 1 79  ? -1.776  -2.511  1.161   1.00 0.00 ? 79  VAL B HG23 2  
ATOM 6536  N N    . PRO B 1 80  ? -5.752  -1.395  1.266   1.00 0.00 ? 80  PRO B N    2  
ATOM 6537  C CA   . PRO B 1 80  ? -6.889  -2.311  1.477   1.00 0.00 ? 80  PRO B CA   2  
ATOM 6538  C C    . PRO B 1 80  ? -6.394  -3.759  1.609   1.00 0.00 ? 80  PRO B C    2  
ATOM 6539  O O    . PRO B 1 80  ? -5.900  -4.338  0.662   1.00 0.00 ? 80  PRO B O    2  
ATOM 6540  C CB   . PRO B 1 80  ? -7.703  -2.162  0.191   1.00 0.00 ? 80  PRO B CB   2  
ATOM 6541  C CG   . PRO B 1 80  ? -6.717  -1.660  -0.892  1.00 0.00 ? 80  PRO B CG   2  
ATOM 6542  C CD   . PRO B 1 80  ? -5.473  -1.126  -0.155  1.00 0.00 ? 80  PRO B CD   2  
ATOM 6543  H HA   . PRO B 1 80  ? -7.483  -2.018  2.327   1.00 0.00 ? 80  PRO B HA   2  
ATOM 6544  H HB2  . PRO B 1 80  ? -8.119  -3.119  -0.096  1.00 0.00 ? 80  PRO B HB2  2  
ATOM 6545  H HB3  . PRO B 1 80  ? -8.490  -1.439  0.330   1.00 0.00 ? 80  PRO B HB3  2  
ATOM 6546  H HG2  . PRO B 1 80  ? -6.440  -2.475  -1.545  1.00 0.00 ? 80  PRO B HG2  2  
ATOM 6547  H HG3  . PRO B 1 80  ? -7.169  -0.866  -1.463  1.00 0.00 ? 80  PRO B HG3  2  
ATOM 6548  H HD2  . PRO B 1 80  ? -4.597  -1.668  -0.478  1.00 0.00 ? 80  PRO B HD2  2  
ATOM 6549  H HD3  . PRO B 1 80  ? -5.353  -0.068  -0.322  1.00 0.00 ? 80  PRO B HD3  2  
ATOM 6550  N N    . GLN B 1 81  ? -6.527  -4.354  2.762   1.00 0.00 ? 81  GLN B N    2  
ATOM 6551  C CA   . GLN B 1 81  ? -6.071  -5.762  2.929   1.00 0.00 ? 81  GLN B CA   2  
ATOM 6552  C C    . GLN B 1 81  ? -7.137  -6.702  2.363   1.00 0.00 ? 81  GLN B C    2  
ATOM 6553  O O    . GLN B 1 81  ? -6.950  -7.324  1.337   1.00 0.00 ? 81  GLN B O    2  
ATOM 6554  C CB   . GLN B 1 81  ? -5.867  -6.059  4.416   1.00 0.00 ? 81  GLN B CB   2  
ATOM 6555  C CG   . GLN B 1 81  ? -4.787  -7.131  4.578   1.00 0.00 ? 81  GLN B CG   2  
ATOM 6556  C CD   . GLN B 1 81  ? -5.381  -8.354  5.281   1.00 0.00 ? 81  GLN B CD   2  
ATOM 6557  O OE1  . GLN B 1 81  ? -6.106  -8.221  6.248   1.00 0.00 ? 81  GLN B OE1  2  
ATOM 6558  N NE2  . GLN B 1 81  ? -5.102  -9.547  4.833   1.00 0.00 ? 81  GLN B NE2  2  
ATOM 6559  H H    . GLN B 1 81  ? -6.932  -3.882  3.513   1.00 0.00 ? 81  GLN B H    2  
ATOM 6560  H HA   . GLN B 1 81  ? -5.142  -5.908  2.398   1.00 0.00 ? 81  GLN B HA   2  
ATOM 6561  H HB2  . GLN B 1 81  ? -5.557  -5.157  4.924   1.00 0.00 ? 81  GLN B HB2  2  
ATOM 6562  H HB3  . GLN B 1 81  ? -6.791  -6.415  4.843   1.00 0.00 ? 81  GLN B HB3  2  
ATOM 6563  H HG2  . GLN B 1 81  ? -4.418  -7.419  3.604   1.00 0.00 ? 81  GLN B HG2  2  
ATOM 6564  H HG3  . GLN B 1 81  ? -3.975  -6.738  5.169   1.00 0.00 ? 81  GLN B HG3  2  
ATOM 6565  H HE21 . GLN B 1 81  ? -4.517  -9.654  4.055   1.00 0.00 ? 81  GLN B HE21 2  
ATOM 6566  H HE22 . GLN B 1 81  ? -5.477  -10.337 5.277   1.00 0.00 ? 81  GLN B HE22 2  
ATOM 6567  N N    . ALA B 1 82  ? -8.262  -6.798  3.018   1.00 0.00 ? 82  ALA B N    2  
ATOM 6568  C CA   . ALA B 1 82  ? -9.347  -7.686  2.514   1.00 0.00 ? 82  ALA B CA   2  
ATOM 6569  C C    . ALA B 1 82  ? -10.269 -6.874  1.603   1.00 0.00 ? 82  ALA B C    2  
ATOM 6570  O O    . ALA B 1 82  ? -10.306 -5.661  1.669   1.00 0.00 ? 82  ALA B O    2  
ATOM 6571  C CB   . ALA B 1 82  ? -10.149 -8.235  3.696   1.00 0.00 ? 82  ALA B CB   2  
ATOM 6572  H H    . ALA B 1 82  ? -8.395  -6.280  3.840   1.00 0.00 ? 82  ALA B H    2  
ATOM 6573  H HA   . ALA B 1 82  ? -8.915  -8.504  1.955   1.00 0.00 ? 82  ALA B HA   2  
ATOM 6574  H HB1  . ALA B 1 82  ? -10.363 -7.435  4.388   1.00 0.00 ? 82  ALA B HB1  2  
ATOM 6575  H HB2  . ALA B 1 82  ? -11.074 -8.659  3.336   1.00 0.00 ? 82  ALA B HB2  2  
ATOM 6576  H HB3  . ALA B 1 82  ? -9.573  -9.000  4.196   1.00 0.00 ? 82  ALA B HB3  2  
ATOM 6577  N N    . LEU B 1 83  ? -11.012 -7.523  0.750   1.00 0.00 ? 83  LEU B N    2  
ATOM 6578  C CA   . LEU B 1 83  ? -11.920 -6.769  -0.157  1.00 0.00 ? 83  LEU B CA   2  
ATOM 6579  C C    . LEU B 1 83  ? -13.250 -7.501  -0.294  1.00 0.00 ? 83  LEU B C    2  
ATOM 6580  O O    . LEU B 1 83  ? -13.551 -8.428  0.433   1.00 0.00 ? 83  LEU B O    2  
ATOM 6581  C CB   . LEU B 1 83  ? -11.281 -6.648  -1.543  1.00 0.00 ? 83  LEU B CB   2  
ATOM 6582  C CG   . LEU B 1 83  ? -9.990  -5.846  -1.433  1.00 0.00 ? 83  LEU B CG   2  
ATOM 6583  C CD1  . LEU B 1 83  ? -8.999  -6.323  -2.495  1.00 0.00 ? 83  LEU B CD1  2  
ATOM 6584  C CD2  . LEU B 1 83  ? -10.295 -4.365  -1.653  1.00 0.00 ? 83  LEU B CD2  2  
ATOM 6585  H H    . LEU B 1 83  ? -10.972 -8.501  0.705   1.00 0.00 ? 83  LEU B H    2  
ATOM 6586  H HA   . LEU B 1 83  ? -12.094 -5.783  0.243   1.00 0.00 ? 83  LEU B HA   2  
ATOM 6587  H HB2  . LEU B 1 83  ? -11.065 -7.632  -1.930  1.00 0.00 ? 83  LEU B HB2  2  
ATOM 6588  H HB3  . LEU B 1 83  ? -11.960 -6.140  -2.211  1.00 0.00 ? 83  LEU B HB3  2  
ATOM 6589  H HG   . LEU B 1 83  ? -9.568  -5.987  -0.453  1.00 0.00 ? 83  LEU B HG   2  
ATOM 6590  H HD11 . LEU B 1 83  ? -9.031  -7.400  -2.561  1.00 0.00 ? 83  LEU B HD11 2  
ATOM 6591  H HD12 . LEU B 1 83  ? -9.263  -5.896  -3.451  1.00 0.00 ? 83  LEU B HD12 2  
ATOM 6592  H HD13 . LEU B 1 83  ? -8.002  -6.009  -2.224  1.00 0.00 ? 83  LEU B HD13 2  
ATOM 6593  H HD21 . LEU B 1 83  ? -10.996 -4.259  -2.467  1.00 0.00 ? 83  LEU B HD21 2  
ATOM 6594  H HD22 . LEU B 1 83  ? -10.721 -3.948  -0.753  1.00 0.00 ? 83  LEU B HD22 2  
ATOM 6595  H HD23 . LEU B 1 83  ? -9.381  -3.842  -1.895  1.00 0.00 ? 83  LEU B HD23 2  
ATOM 6596  N N    . GLU B 1 84  ? -14.038 -7.083  -1.235  1.00 0.00 ? 84  GLU B N    2  
ATOM 6597  C CA   . GLU B 1 84  ? -15.357 -7.730  -1.465  1.00 0.00 ? 84  GLU B CA   2  
ATOM 6598  C C    . GLU B 1 84  ? -15.716 -7.576  -2.943  1.00 0.00 ? 84  GLU B C    2  
ATOM 6599  O O    . GLU B 1 84  ? -15.217 -6.689  -3.604  1.00 0.00 ? 84  GLU B O    2  
ATOM 6600  C CB   . GLU B 1 84  ? -16.420 -7.051  -0.598  1.00 0.00 ? 84  GLU B CB   2  
ATOM 6601  C CG   . GLU B 1 84  ? -16.653 -7.880  0.667   1.00 0.00 ? 84  GLU B CG   2  
ATOM 6602  C CD   . GLU B 1 84  ? -18.034 -8.534  0.604   1.00 0.00 ? 84  GLU B CD   2  
ATOM 6603  O OE1  . GLU B 1 84  ? -18.963 -7.871  0.171   1.00 0.00 ? 84  GLU B OE1  2  
ATOM 6604  O OE2  . GLU B 1 84  ? -18.140 -9.686  0.992   1.00 0.00 ? 84  GLU B OE2  2  
ATOM 6605  H H    . GLU B 1 84  ? -13.753 -6.337  -1.802  1.00 0.00 ? 84  GLU B H    2  
ATOM 6606  H HA   . GLU B 1 84  ? -15.297 -8.779  -1.214  1.00 0.00 ? 84  GLU B HA   2  
ATOM 6607  H HB2  . GLU B 1 84  ? -16.082 -6.062  -0.324  1.00 0.00 ? 84  GLU B HB2  2  
ATOM 6608  H HB3  . GLU B 1 84  ? -17.344 -6.976  -1.153  1.00 0.00 ? 84  GLU B HB3  2  
ATOM 6609  H HG2  . GLU B 1 84  ? -15.895 -8.646  0.738   1.00 0.00 ? 84  GLU B HG2  2  
ATOM 6610  H HG3  . GLU B 1 84  ? -16.598 -7.237  1.533   1.00 0.00 ? 84  GLU B HG3  2  
ATOM 6611  N N    . PRO B 1 85  ? -16.562 -8.446  -3.422  1.00 0.00 ? 85  PRO B N    2  
ATOM 6612  C CA   . PRO B 1 85  ? -16.993 -8.432  -4.829  1.00 0.00 ? 85  PRO B CA   2  
ATOM 6613  C C    . PRO B 1 85  ? -17.972 -7.282  -5.089  1.00 0.00 ? 85  PRO B C    2  
ATOM 6614  O O    . PRO B 1 85  ? -18.069 -6.350  -4.315  1.00 0.00 ? 85  PRO B O    2  
ATOM 6615  C CB   . PRO B 1 85  ? -17.653 -9.800  -5.018  1.00 0.00 ? 85  PRO B CB   2  
ATOM 6616  C CG   . PRO B 1 85  ? -18.049 -10.292 -3.607  1.00 0.00 ? 85  PRO B CG   2  
ATOM 6617  C CD   . PRO B 1 85  ? -17.173 -9.515  -2.608  1.00 0.00 ? 85  PRO B CD   2  
ATOM 6618  H HA   . PRO B 1 85  ? -16.139 -8.349  -5.479  1.00 0.00 ? 85  PRO B HA   2  
ATOM 6619  H HB2  . PRO B 1 85  ? -18.532 -9.704  -5.642  1.00 0.00 ? 85  PRO B HB2  2  
ATOM 6620  H HB3  . PRO B 1 85  ? -16.954 -10.492 -5.461  1.00 0.00 ? 85  PRO B HB3  2  
ATOM 6621  H HG2  . PRO B 1 85  ? -19.094 -10.088 -3.425  1.00 0.00 ? 85  PRO B HG2  2  
ATOM 6622  H HG3  . PRO B 1 85  ? -17.852 -11.349 -3.516  1.00 0.00 ? 85  PRO B HG3  2  
ATOM 6623  H HD2  . PRO B 1 85  ? -17.782 -9.095  -1.820  1.00 0.00 ? 85  PRO B HD2  2  
ATOM 6624  H HD3  . PRO B 1 85  ? -16.406 -10.155 -2.198  1.00 0.00 ? 85  PRO B HD3  2  
ATOM 6625  N N    . LEU B 1 86  ? -18.677 -7.323  -6.188  1.00 0.00 ? 86  LEU B N    2  
ATOM 6626  C CA   . LEU B 1 86  ? -19.619 -6.213  -6.510  1.00 0.00 ? 86  LEU B CA   2  
ATOM 6627  C C    . LEU B 1 86  ? -20.582 -6.661  -7.626  1.00 0.00 ? 86  LEU B C    2  
ATOM 6628  O O    . LEU B 1 86  ? -20.166 -6.861  -8.745  1.00 0.00 ? 86  LEU B O    2  
ATOM 6629  C CB   . LEU B 1 86  ? -18.773 -4.995  -6.949  1.00 0.00 ? 86  LEU B CB   2  
ATOM 6630  C CG   . LEU B 1 86  ? -19.490 -4.139  -8.007  1.00 0.00 ? 86  LEU B CG   2  
ATOM 6631  C CD1  . LEU B 1 86  ? -20.463 -3.169  -7.343  1.00 0.00 ? 86  LEU B CD1  2  
ATOM 6632  C CD2  . LEU B 1 86  ? -18.451 -3.334  -8.787  1.00 0.00 ? 86  LEU B CD2  2  
ATOM 6633  H H    . LEU B 1 86  ? -18.569 -8.071  -6.814  1.00 0.00 ? 86  LEU B H    2  
ATOM 6634  H HA   . LEU B 1 86  ? -20.179 -5.955  -5.626  1.00 0.00 ? 86  LEU B HA   2  
ATOM 6635  H HB2  . LEU B 1 86  ? -18.570 -4.382  -6.084  1.00 0.00 ? 86  LEU B HB2  2  
ATOM 6636  H HB3  . LEU B 1 86  ? -17.839 -5.347  -7.355  1.00 0.00 ? 86  LEU B HB3  2  
ATOM 6637  H HG   . LEU B 1 86  ? -20.026 -4.774  -8.685  1.00 0.00 ? 86  LEU B HG   2  
ATOM 6638  H HD11 . LEU B 1 86  ? -20.161 -2.997  -6.323  1.00 0.00 ? 86  LEU B HD11 2  
ATOM 6639  H HD12 . LEU B 1 86  ? -20.454 -2.232  -7.885  1.00 0.00 ? 86  LEU B HD12 2  
ATOM 6640  H HD13 . LEU B 1 86  ? -21.457 -3.586  -7.364  1.00 0.00 ? 86  LEU B HD13 2  
ATOM 6641  H HD21 . LEU B 1 86  ? -17.495 -3.835  -8.737  1.00 0.00 ? 86  LEU B HD21 2  
ATOM 6642  H HD22 . LEU B 1 86  ? -18.760 -3.250  -9.818  1.00 0.00 ? 86  LEU B HD22 2  
ATOM 6643  H HD23 . LEU B 1 86  ? -18.365 -2.347  -8.356  1.00 0.00 ? 86  LEU B HD23 2  
ATOM 6644  N N    . PRO B 1 87  ? -21.844 -6.788  -7.289  1.00 0.00 ? 87  PRO B N    2  
ATOM 6645  C CA   . PRO B 1 87  ? -22.883 -7.195  -8.256  1.00 0.00 ? 87  PRO B CA   2  
ATOM 6646  C C    . PRO B 1 87  ? -23.225 -6.016  -9.166  1.00 0.00 ? 87  PRO B C    2  
ATOM 6647  O O    . PRO B 1 87  ? -23.711 -4.996  -8.719  1.00 0.00 ? 87  PRO B O    2  
ATOM 6648  C CB   . PRO B 1 87  ? -24.072 -7.574  -7.368  1.00 0.00 ? 87  PRO B CB   2  
ATOM 6649  C CG   . PRO B 1 87  ? -23.858 -6.849  -6.020  1.00 0.00 ? 87  PRO B CG   2  
ATOM 6650  C CD   . PRO B 1 87  ? -22.353 -6.533  -5.926  1.00 0.00 ? 87  PRO B CD   2  
ATOM 6651  H HA   . PRO B 1 87  ? -22.566 -8.046  -8.837  1.00 0.00 ? 87  PRO B HA   2  
ATOM 6652  H HB2  . PRO B 1 87  ? -24.996 -7.248  -7.828  1.00 0.00 ? 87  PRO B HB2  2  
ATOM 6653  H HB3  . PRO B 1 87  ? -24.092 -8.641  -7.209  1.00 0.00 ? 87  PRO B HB3  2  
ATOM 6654  H HG2  . PRO B 1 87  ? -24.434 -5.933  -5.998  1.00 0.00 ? 87  PRO B HG2  2  
ATOM 6655  H HG3  . PRO B 1 87  ? -24.148 -7.490  -5.203  1.00 0.00 ? 87  PRO B HG3  2  
ATOM 6656  H HD2  . PRO B 1 87  ? -22.201 -5.498  -5.650  1.00 0.00 ? 87  PRO B HD2  2  
ATOM 6657  H HD3  . PRO B 1 87  ? -21.872 -7.191  -5.220  1.00 0.00 ? 87  PRO B HD3  2  
ATOM 6658  N N    . ILE B 1 88  ? -22.957 -6.137  -10.435 1.00 0.00 ? 88  ILE B N    2  
ATOM 6659  C CA   . ILE B 1 88  ? -23.250 -5.008  -11.359 1.00 0.00 ? 88  ILE B CA   2  
ATOM 6660  C C    . ILE B 1 88  ? -24.048 -5.494  -12.562 1.00 0.00 ? 88  ILE B C    2  
ATOM 6661  O O    . ILE B 1 88  ? -24.613 -6.568  -12.570 1.00 0.00 ? 88  ILE B O    2  
ATOM 6662  C CB   . ILE B 1 88  ? -21.932 -4.408  -11.860 1.00 0.00 ? 88  ILE B CB   2  
ATOM 6663  C CG1  . ILE B 1 88  ? -21.354 -5.283  -12.977 1.00 0.00 ? 88  ILE B CG1  2  
ATOM 6664  C CG2  . ILE B 1 88  ? -20.931 -4.353  -10.715 1.00 0.00 ? 88  ILE B CG2  2  
ATOM 6665  C CD1  . ILE B 1 88  ? -19.931 -4.837  -13.294 1.00 0.00 ? 88  ILE B CD1  2  
ATOM 6666  H H    . ILE B 1 88  ? -22.551 -6.961  -10.778 1.00 0.00 ? 88  ILE B H    2  
ATOM 6667  H HA   . ILE B 1 88  ? -23.811 -4.250  -10.836 1.00 0.00 ? 88  ILE B HA   2  
ATOM 6668  H HB   . ILE B 1 88  ? -22.108 -3.411  -12.235 1.00 0.00 ? 88  ILE B HB   2  
ATOM 6669  H HG12 . ILE B 1 88  ? -21.350 -6.310  -12.660 1.00 0.00 ? 88  ILE B HG12 2  
ATOM 6670  H HG13 . ILE B 1 88  ? -21.958 -5.187  -13.860 1.00 0.00 ? 88  ILE B HG13 2  
ATOM 6671  H HG21 . ILE B 1 88  ? -21.373 -3.843  -9.874  1.00 0.00 ? 88  ILE B HG21 2  
ATOM 6672  H HG22 . ILE B 1 88  ? -20.662 -5.359  -10.426 1.00 0.00 ? 88  ILE B HG22 2  
ATOM 6673  H HG23 . ILE B 1 88  ? -20.047 -3.823  -11.037 1.00 0.00 ? 88  ILE B HG23 2  
ATOM 6674  H HD11 . ILE B 1 88  ? -19.882 -3.761  -13.263 1.00 0.00 ? 88  ILE B HD11 2  
ATOM 6675  H HD12 . ILE B 1 88  ? -19.254 -5.253  -12.565 1.00 0.00 ? 88  ILE B HD12 2  
ATOM 6676  H HD13 . ILE B 1 88  ? -19.658 -5.183  -14.281 1.00 0.00 ? 88  ILE B HD13 2  
ATOM 6677  N N    . VAL B 1 89  ? -24.049 -4.696  -13.590 1.00 0.00 ? 89  VAL B N    2  
ATOM 6678  C CA   . VAL B 1 89  ? -24.756 -5.052  -14.844 1.00 0.00 ? 89  VAL B CA   2  
ATOM 6679  C C    . VAL B 1 89  ? -24.242 -4.140  -15.954 1.00 0.00 ? 89  VAL B C    2  
ATOM 6680  O O    . VAL B 1 89  ? -24.503 -2.955  -15.959 1.00 0.00 ? 89  VAL B O    2  
ATOM 6681  C CB   . VAL B 1 89  ? -26.264 -4.838  -14.701 1.00 0.00 ? 89  VAL B CB   2  
ATOM 6682  C CG1  . VAL B 1 89  ? -26.969 -5.490  -15.889 1.00 0.00 ? 89  VAL B CG1  2  
ATOM 6683  C CG2  . VAL B 1 89  ? -26.770 -5.464  -13.399 1.00 0.00 ? 89  VAL B CG2  2  
ATOM 6684  H H    . VAL B 1 89  ? -23.549 -3.857  -13.541 1.00 0.00 ? 89  VAL B H    2  
ATOM 6685  H HA   . VAL B 1 89  ? -24.548 -6.081  -15.094 1.00 0.00 ? 89  VAL B HA   2  
ATOM 6686  H HB   . VAL B 1 89  ? -26.474 -3.777  -14.699 1.00 0.00 ? 89  VAL B HB   2  
ATOM 6687  H HG11 . VAL B 1 89  ? -26.281 -6.155  -16.393 1.00 0.00 ? 89  VAL B HG11 2  
ATOM 6688  H HG12 . VAL B 1 89  ? -27.821 -6.051  -15.540 1.00 0.00 ? 89  VAL B HG12 2  
ATOM 6689  H HG13 . VAL B 1 89  ? -27.295 -4.724  -16.577 1.00 0.00 ? 89  VAL B HG13 2  
ATOM 6690  H HG21 . VAL B 1 89  ? -26.509 -6.509  -13.377 1.00 0.00 ? 89  VAL B HG21 2  
ATOM 6691  H HG22 . VAL B 1 89  ? -26.316 -4.961  -12.557 1.00 0.00 ? 89  VAL B HG22 2  
ATOM 6692  H HG23 . VAL B 1 89  ? -27.842 -5.360  -13.344 1.00 0.00 ? 89  VAL B HG23 2  
ATOM 6693  N N    . TYR B 1 90  ? -23.514 -4.672  -16.891 1.00 0.00 ? 90  TYR B N    2  
ATOM 6694  C CA   . TYR B 1 90  ? -22.992 -3.814  -17.986 1.00 0.00 ? 90  TYR B CA   2  
ATOM 6695  C C    . TYR B 1 90  ? -23.530 -4.310  -19.326 1.00 0.00 ? 90  TYR B C    2  
ATOM 6696  O O    . TYR B 1 90  ? -24.396 -5.158  -19.380 1.00 0.00 ? 90  TYR B O    2  
ATOM 6697  C CB   . TYR B 1 90  ? -21.464 -3.858  -17.995 1.00 0.00 ? 90  TYR B CB   2  
ATOM 6698  C CG   . TYR B 1 90  ? -20.980 -5.251  -17.673 1.00 0.00 ? 90  TYR B CG   2  
ATOM 6699  C CD1  . TYR B 1 90  ? -20.994 -5.704  -16.349 1.00 0.00 ? 90  TYR B CD1  2  
ATOM 6700  C CD2  . TYR B 1 90  ? -20.505 -6.083  -18.692 1.00 0.00 ? 90  TYR B CD2  2  
ATOM 6701  C CE1  . TYR B 1 90  ? -20.536 -6.991  -16.043 1.00 0.00 ? 90  TYR B CE1  2  
ATOM 6702  C CE2  . TYR B 1 90  ? -20.046 -7.371  -18.386 1.00 0.00 ? 90  TYR B CE2  2  
ATOM 6703  C CZ   . TYR B 1 90  ? -20.061 -7.825  -17.062 1.00 0.00 ? 90  TYR B CZ   2  
ATOM 6704  O OH   . TYR B 1 90  ? -19.610 -9.094  -16.763 1.00 0.00 ? 90  TYR B OH   2  
ATOM 6705  H H    . TYR B 1 90  ? -23.314 -5.629  -16.874 1.00 0.00 ? 90  TYR B H    2  
ATOM 6706  H HA   . TYR B 1 90  ? -23.317 -2.796  -17.824 1.00 0.00 ? 90  TYR B HA   2  
ATOM 6707  H HB2  . TYR B 1 90  ? -21.102 -3.566  -18.968 1.00 0.00 ? 90  TYR B HB2  2  
ATOM 6708  H HB3  . TYR B 1 90  ? -21.090 -3.173  -17.253 1.00 0.00 ? 90  TYR B HB3  2  
ATOM 6709  H HD1  . TYR B 1 90  ? -21.359 -5.060  -15.567 1.00 0.00 ? 90  TYR B HD1  2  
ATOM 6710  H HD2  . TYR B 1 90  ? -20.493 -5.734  -19.713 1.00 0.00 ? 90  TYR B HD2  2  
ATOM 6711  H HE1  . TYR B 1 90  ? -20.547 -7.340  -15.020 1.00 0.00 ? 90  TYR B HE1  2  
ATOM 6712  H HE2  . TYR B 1 90  ? -19.678 -8.012  -19.171 1.00 0.00 ? 90  TYR B HE2  2  
ATOM 6713  H HH   . TYR B 1 90  ? -18.967 -9.021  -16.052 1.00 0.00 ? 90  TYR B HH   2  
ATOM 6714  N N    . TYR B 1 91  ? -23.040 -3.776  -20.407 1.00 0.00 ? 91  TYR B N    2  
ATOM 6715  C CA   . TYR B 1 91  ? -23.544 -4.211  -21.737 1.00 0.00 ? 91  TYR B CA   2  
ATOM 6716  C C    . TYR B 1 91  ? -22.387 -4.547  -22.676 1.00 0.00 ? 91  TYR B C    2  
ATOM 6717  O O    . TYR B 1 91  ? -21.475 -3.766  -22.864 1.00 0.00 ? 91  TYR B O    2  
ATOM 6718  C CB   . TYR B 1 91  ? -24.358 -3.081  -22.356 1.00 0.00 ? 91  TYR B CB   2  
ATOM 6719  C CG   . TYR B 1 91  ? -25.809 -3.259  -22.006 1.00 0.00 ? 91  TYR B CG   2  
ATOM 6720  C CD1  . TYR B 1 91  ? -26.305 -2.733  -20.813 1.00 0.00 ? 91  TYR B CD1  2  
ATOM 6721  C CD2  . TYR B 1 91  ? -26.658 -3.940  -22.882 1.00 0.00 ? 91  TYR B CD2  2  
ATOM 6722  C CE1  . TYR B 1 91  ? -27.659 -2.889  -20.490 1.00 0.00 ? 91  TYR B CE1  2  
ATOM 6723  C CE2  . TYR B 1 91  ? -28.009 -4.097  -22.566 1.00 0.00 ? 91  TYR B CE2  2  
ATOM 6724  C CZ   . TYR B 1 91  ? -28.512 -3.572  -21.369 1.00 0.00 ? 91  TYR B CZ   2  
ATOM 6725  O OH   . TYR B 1 91  ? -29.848 -3.726  -21.055 1.00 0.00 ? 91  TYR B OH   2  
ATOM 6726  H H    . TYR B 1 91  ? -22.356 -3.082  -20.345 1.00 0.00 ? 91  TYR B H    2  
ATOM 6727  H HA   . TYR B 1 91  ? -24.174 -5.079  -21.618 1.00 0.00 ? 91  TYR B HA   2  
ATOM 6728  H HB2  . TYR B 1 91  ? -24.008 -2.134  -21.974 1.00 0.00 ? 91  TYR B HB2  2  
ATOM 6729  H HB3  . TYR B 1 91  ? -24.243 -3.101  -23.430 1.00 0.00 ? 91  TYR B HB3  2  
ATOM 6730  H HD1  . TYR B 1 91  ? -25.639 -2.210  -20.137 1.00 0.00 ? 91  TYR B HD1  2  
ATOM 6731  H HD2  . TYR B 1 91  ? -26.268 -4.351  -23.800 1.00 0.00 ? 91  TYR B HD2  2  
ATOM 6732  H HE1  . TYR B 1 91  ? -28.046 -2.484  -19.566 1.00 0.00 ? 91  TYR B HE1  2  
ATOM 6733  H HE2  . TYR B 1 91  ? -28.661 -4.623  -23.248 1.00 0.00 ? 91  TYR B HE2  2  
ATOM 6734  H HH   . TYR B 1 91  ? -30.163 -2.897  -20.688 1.00 0.00 ? 91  TYR B HH   2  
ATOM 6735  N N    . VAL B 1 92  ? -22.443 -5.690  -23.297 1.00 0.00 ? 92  VAL B N    2  
ATOM 6736  C CA   . VAL B 1 92  ? -21.379 -6.069  -24.263 1.00 0.00 ? 92  VAL B CA   2  
ATOM 6737  C C    . VAL B 1 92  ? -21.933 -5.852  -25.665 1.00 0.00 ? 92  VAL B C    2  
ATOM 6738  O O    . VAL B 1 92  ? -22.577 -6.713  -26.229 1.00 0.00 ? 92  VAL B O    2  
ATOM 6739  C CB   . VAL B 1 92  ? -21.002 -7.537  -24.092 1.00 0.00 ? 92  VAL B CB   2  
ATOM 6740  C CG1  . VAL B 1 92  ? -19.534 -7.714  -24.470 1.00 0.00 ? 92  VAL B CG1  2  
ATOM 6741  C CG2  . VAL B 1 92  ? -21.218 -7.957  -22.637 1.00 0.00 ? 92  VAL B CG2  2  
ATOM 6742  H H    . VAL B 1 92  ? -23.203 -6.286  -23.151 1.00 0.00 ? 92  VAL B H    2  
ATOM 6743  H HA   . VAL B 1 92  ? -20.510 -5.445  -24.113 1.00 0.00 ? 92  VAL B HA   2  
ATOM 6744  H HB   . VAL B 1 92  ? -21.616 -8.144  -24.741 1.00 0.00 ? 92  VAL B HB   2  
ATOM 6745  H HG11 . VAL B 1 92  ? -19.029 -6.760  -24.401 1.00 0.00 ? 92  VAL B HG11 2  
ATOM 6746  H HG12 . VAL B 1 92  ? -19.070 -8.417  -23.796 1.00 0.00 ? 92  VAL B HG12 2  
ATOM 6747  H HG13 . VAL B 1 92  ? -19.466 -8.083  -25.482 1.00 0.00 ? 92  VAL B HG13 2  
ATOM 6748  H HG21 . VAL B 1 92  ? -22.248 -7.781  -22.362 1.00 0.00 ? 92  VAL B HG21 2  
ATOM 6749  H HG22 . VAL B 1 92  ? -20.991 -9.007  -22.528 1.00 0.00 ? 92  VAL B HG22 2  
ATOM 6750  H HG23 . VAL B 1 92  ? -20.570 -7.379  -21.995 1.00 0.00 ? 92  VAL B HG23 2  
ATOM 6751  N N    . GLY B 1 93  ? -21.712 -4.699  -26.218 1.00 0.00 ? 93  GLY B N    2  
ATOM 6752  C CA   . GLY B 1 93  ? -22.255 -4.413  -27.573 1.00 0.00 ? 93  GLY B CA   2  
ATOM 6753  C C    . GLY B 1 93  ? -23.742 -4.069  -27.439 1.00 0.00 ? 93  GLY B C    2  
ATOM 6754  O O    . GLY B 1 93  ? -24.131 -2.918  -27.487 1.00 0.00 ? 93  GLY B O    2  
ATOM 6755  H H    . GLY B 1 93  ? -21.204 -4.016  -25.735 1.00 0.00 ? 93  GLY B H    2  
ATOM 6756  H HA2  . GLY B 1 93  ? -21.724 -3.578  -28.006 1.00 0.00 ? 93  GLY B HA2  2  
ATOM 6757  H HA3  . GLY B 1 93  ? -22.144 -5.283  -28.201 1.00 0.00 ? 93  GLY B HA3  2  
ATOM 6758  N N    . ARG B 1 94  ? -24.579 -5.060  -27.275 1.00 0.00 ? 94  ARG B N    2  
ATOM 6759  C CA   . ARG B 1 94  ? -26.044 -4.790  -27.143 1.00 0.00 ? 94  ARG B CA   2  
ATOM 6760  C C    . ARG B 1 94  ? -26.702 -5.780  -26.174 1.00 0.00 ? 94  ARG B C    2  
ATOM 6761  O O    . ARG B 1 94  ? -27.882 -5.691  -25.899 1.00 0.00 ? 94  ARG B O    2  
ATOM 6762  C CB   . ARG B 1 94  ? -26.692 -4.945  -28.513 1.00 0.00 ? 94  ARG B CB   2  
ATOM 6763  C CG   . ARG B 1 94  ? -26.027 -3.988  -29.506 1.00 0.00 ? 94  ARG B CG   2  
ATOM 6764  C CD   . ARG B 1 94  ? -26.709 -4.112  -30.870 1.00 0.00 ? 94  ARG B CD   2  
ATOM 6765  N NE   . ARG B 1 94  ? -25.681 -4.365  -31.919 1.00 0.00 ? 94  ARG B NE   2  
ATOM 6766  C CZ   . ARG B 1 94  ? -24.703 -3.518  -32.093 1.00 0.00 ? 94  ARG B CZ   2  
ATOM 6767  N NH1  . ARG B 1 94  ? -24.957 -2.290  -32.455 1.00 0.00 ? 94  ARG B NH1  2  
ATOM 6768  N NH2  . ARG B 1 94  ? -23.468 -3.899  -31.904 1.00 0.00 ? 94  ARG B NH2  2  
ATOM 6769  H H    . ARG B 1 94  ? -24.244 -5.978  -27.252 1.00 0.00 ? 94  ARG B H    2  
ATOM 6770  H HA   . ARG B 1 94  ? -26.199 -3.787  -26.782 1.00 0.00 ? 94  ARG B HA   2  
ATOM 6771  H HB2  . ARG B 1 94  ? -26.560 -5.964  -28.846 1.00 0.00 ? 94  ARG B HB2  2  
ATOM 6772  H HB3  . ARG B 1 94  ? -27.745 -4.719  -28.443 1.00 0.00 ? 94  ARG B HB3  2  
ATOM 6773  H HG2  . ARG B 1 94  ? -26.122 -2.975  -29.146 1.00 0.00 ? 94  ARG B HG2  2  
ATOM 6774  H HG3  . ARG B 1 94  ? -24.983 -4.240  -29.604 1.00 0.00 ? 94  ARG B HG3  2  
ATOM 6775  H HD2  . ARG B 1 94  ? -27.411 -4.933  -30.848 1.00 0.00 ? 94  ARG B HD2  2  
ATOM 6776  H HD3  . ARG B 1 94  ? -27.233 -3.195  -31.094 1.00 0.00 ? 94  ARG B HD3  2  
ATOM 6777  H HE   . ARG B 1 94  ? -25.740 -5.167  -32.479 1.00 0.00 ? 94  ARG B HE   2  
ATOM 6778  H HH11 . ARG B 1 94  ? -25.903 -1.999  -32.600 1.00 0.00 ? 94  ARG B HH11 2  
ATOM 6779  H HH12 . ARG B 1 94  ? -24.208 -1.642  -32.587 1.00 0.00 ? 94  ARG B HH12 2  
ATOM 6780  H HH21 . ARG B 1 94  ? -23.273 -4.840  -31.628 1.00 0.00 ? 94  ARG B HH21 2  
ATOM 6781  H HH22 . ARG B 1 94  ? -22.719 -3.251  -32.037 1.00 0.00 ? 94  ARG B HH22 2  
ATOM 6782  N N    . LYS B 1 95  ? -25.968 -6.725  -25.660 1.00 0.00 ? 95  LYS B N    2  
ATOM 6783  C CA   . LYS B 1 95  ? -26.580 -7.708  -24.722 1.00 0.00 ? 95  LYS B CA   2  
ATOM 6784  C C    . LYS B 1 95  ? -26.276 -7.297  -23.278 1.00 0.00 ? 95  LYS B C    2  
ATOM 6785  O O    . LYS B 1 95  ? -25.158 -6.947  -22.962 1.00 0.00 ? 95  LYS B O    2  
ATOM 6786  C CB   . LYS B 1 95  ? -25.995 -9.097  -24.990 1.00 0.00 ? 95  LYS B CB   2  
ATOM 6787  C CG   . LYS B 1 95  ? -26.606 -9.669  -26.271 1.00 0.00 ? 95  LYS B CG   2  
ATOM 6788  C CD   . LYS B 1 95  ? -25.522 -10.393 -27.076 1.00 0.00 ? 95  LYS B CD   2  
ATOM 6789  C CE   . LYS B 1 95  ? -25.174 -9.570  -28.318 1.00 0.00 ? 95  LYS B CE   2  
ATOM 6790  N NZ   . LYS B 1 95  ? -25.166 -10.457 -29.516 1.00 0.00 ? 95  LYS B NZ   2  
ATOM 6791  H H    . LYS B 1 95  ? -25.023 -6.792  -25.891 1.00 0.00 ? 95  LYS B H    2  
ATOM 6792  H HA   . LYS B 1 95  ? -27.647 -7.732  -24.879 1.00 0.00 ? 95  LYS B HA   2  
ATOM 6793  H HB2  . LYS B 1 95  ? -24.923 -9.019  -25.105 1.00 0.00 ? 95  LYS B HB2  2  
ATOM 6794  H HB3  . LYS B 1 95  ? -26.222 -9.749  -24.162 1.00 0.00 ? 95  LYS B HB3  2  
ATOM 6795  H HG2  . LYS B 1 95  ? -27.390 -10.367 -26.015 1.00 0.00 ? 95  LYS B HG2  2  
ATOM 6796  H HG3  . LYS B 1 95  ? -27.016 -8.868  -26.865 1.00 0.00 ? 95  LYS B HG3  2  
ATOM 6797  H HD2  . LYS B 1 95  ? -24.640 -10.514 -26.463 1.00 0.00 ? 95  LYS B HD2  2  
ATOM 6798  H HD3  . LYS B 1 95  ? -25.886 -11.362 -27.379 1.00 0.00 ? 95  LYS B HD3  2  
ATOM 6799  H HE2  . LYS B 1 95  ? -25.909 -8.791  -28.452 1.00 0.00 ? 95  LYS B HE2  2  
ATOM 6800  H HE3  . LYS B 1 95  ? -24.196 -9.126  -28.193 1.00 0.00 ? 95  LYS B HE3  2  
ATOM 6801  H HZ1  . LYS B 1 95  ? -25.699 -11.326 -29.306 1.00 0.00 ? 95  LYS B HZ1  2  
ATOM 6802  H HZ2  . LYS B 1 95  ? -25.608 -9.963  -30.317 1.00 0.00 ? 95  LYS B HZ2  2  
ATOM 6803  H HZ3  . LYS B 1 95  ? -24.185 -10.701 -29.761 1.00 0.00 ? 95  LYS B HZ3  2  
ATOM 6804  N N    . PRO B 1 96  ? -27.279 -7.356  -22.437 1.00 0.00 ? 96  PRO B N    2  
ATOM 6805  C CA   . PRO B 1 96  ? -27.134 -6.998  -21.016 1.00 0.00 ? 96  PRO B CA   2  
ATOM 6806  C C    . PRO B 1 96  ? -26.467 -8.149  -20.255 1.00 0.00 ? 96  PRO B C    2  
ATOM 6807  O O    . PRO B 1 96  ? -26.697 -9.306  -20.544 1.00 0.00 ? 96  PRO B O    2  
ATOM 6808  C CB   . PRO B 1 96  ? -28.578 -6.797  -20.548 1.00 0.00 ? 96  PRO B CB   2  
ATOM 6809  C CG   . PRO B 1 96  ? -29.469 -7.587  -21.535 1.00 0.00 ? 96  PRO B CG   2  
ATOM 6810  C CD   . PRO B 1 96  ? -28.640 -7.782  -22.818 1.00 0.00 ? 96  PRO B CD   2  
ATOM 6811  H HA   . PRO B 1 96  ? -26.574 -6.082  -20.910 1.00 0.00 ? 96  PRO B HA   2  
ATOM 6812  H HB2  . PRO B 1 96  ? -28.697 -7.181  -19.544 1.00 0.00 ? 96  PRO B HB2  2  
ATOM 6813  H HB3  . PRO B 1 96  ? -28.838 -5.751  -20.580 1.00 0.00 ? 96  PRO B HB3  2  
ATOM 6814  H HG2  . PRO B 1 96  ? -29.730 -8.547  -21.109 1.00 0.00 ? 96  PRO B HG2  2  
ATOM 6815  H HG3  . PRO B 1 96  ? -30.363 -7.026  -21.760 1.00 0.00 ? 96  PRO B HG3  2  
ATOM 6816  H HD2  . PRO B 1 96  ? -28.645 -8.822  -23.117 1.00 0.00 ? 96  PRO B HD2  2  
ATOM 6817  H HD3  . PRO B 1 96  ? -29.018 -7.157  -23.612 1.00 0.00 ? 96  PRO B HD3  2  
ATOM 6818  N N    . LYS B 1 97  ? -25.639 -7.848  -19.290 1.00 0.00 ? 97  LYS B N    2  
ATOM 6819  C CA   . LYS B 1 97  ? -24.962 -8.939  -18.529 1.00 0.00 ? 97  LYS B CA   2  
ATOM 6820  C C    . LYS B 1 97  ? -24.786 -8.531  -17.064 1.00 0.00 ? 97  LYS B C    2  
ATOM 6821  O O    . LYS B 1 97  ? -24.361 -7.435  -16.762 1.00 0.00 ? 97  LYS B O    2  
ATOM 6822  C CB   . LYS B 1 97  ? -23.583 -9.202  -19.140 1.00 0.00 ? 97  LYS B CB   2  
ATOM 6823  C CG   . LYS B 1 97  ? -23.738 -9.949  -20.466 1.00 0.00 ? 97  LYS B CG   2  
ATOM 6824  C CD   . LYS B 1 97  ? -23.718 -11.456 -20.208 1.00 0.00 ? 97  LYS B CD   2  
ATOM 6825  C CE   . LYS B 1 97  ? -25.051 -12.068 -20.642 1.00 0.00 ? 97  LYS B CE   2  
ATOM 6826  N NZ   . LYS B 1 97  ? -25.672 -12.775 -19.488 1.00 0.00 ? 97  LYS B NZ   2  
ATOM 6827  H H    . LYS B 1 97  ? -25.460 -6.911  -19.068 1.00 0.00 ? 97  LYS B H    2  
ATOM 6828  H HA   . LYS B 1 97  ? -25.557 -9.838  -18.585 1.00 0.00 ? 97  LYS B HA   2  
ATOM 6829  H HB2  . LYS B 1 97  ? -23.082 -8.260  -19.314 1.00 0.00 ? 97  LYS B HB2  2  
ATOM 6830  H HB3  . LYS B 1 97  ? -22.998 -9.801  -18.460 1.00 0.00 ? 97  LYS B HB3  2  
ATOM 6831  H HG2  . LYS B 1 97  ? -24.675 -9.673  -20.927 1.00 0.00 ? 97  LYS B HG2  2  
ATOM 6832  H HG3  . LYS B 1 97  ? -22.923 -9.687  -21.123 1.00 0.00 ? 97  LYS B HG3  2  
ATOM 6833  H HD2  . LYS B 1 97  ? -22.913 -11.906 -20.771 1.00 0.00 ? 97  LYS B HD2  2  
ATOM 6834  H HD3  . LYS B 1 97  ? -23.567 -11.639 -19.154 1.00 0.00 ? 97  LYS B HD3  2  
ATOM 6835  H HE2  . LYS B 1 97  ? -25.712 -11.284 -20.984 1.00 0.00 ? 97  LYS B HE2  2  
ATOM 6836  H HE3  . LYS B 1 97  ? -24.880 -12.769 -21.445 1.00 0.00 ? 97  LYS B HE3  2  
ATOM 6837  H HZ1  . LYS B 1 97  ? -25.091 -12.631 -18.638 1.00 0.00 ? 97  LYS B HZ1  2  
ATOM 6838  H HZ2  . LYS B 1 97  ? -26.626 -12.398 -19.321 1.00 0.00 ? 97  LYS B HZ2  2  
ATOM 6839  H HZ3  . LYS B 1 97  ? -25.733 -13.793 -19.698 1.00 0.00 ? 97  LYS B HZ3  2  
ATOM 6840  N N    . VAL B 1 98  ? -25.089 -9.416  -16.153 1.00 0.00 ? 98  VAL B N    2  
ATOM 6841  C CA   . VAL B 1 98  ? -24.916 -9.091  -14.709 1.00 0.00 ? 98  VAL B CA   2  
ATOM 6842  C C    . VAL B 1 98  ? -23.753 -9.916  -14.163 1.00 0.00 ? 98  VAL B C    2  
ATOM 6843  O O    . VAL B 1 98  ? -23.700 -11.116 -14.347 1.00 0.00 ? 98  VAL B O    2  
ATOM 6844  C CB   . VAL B 1 98  ? -26.187 -9.446  -13.935 1.00 0.00 ? 98  VAL B CB   2  
ATOM 6845  C CG1  . VAL B 1 98  ? -25.909 -9.349  -12.433 1.00 0.00 ? 98  VAL B CG1  2  
ATOM 6846  C CG2  . VAL B 1 98  ? -27.303 -8.471  -14.310 1.00 0.00 ? 98  VAL B CG2  2  
ATOM 6847  H H    . VAL B 1 98  ? -25.414 -10.301 -16.419 1.00 0.00 ? 98  VAL B H    2  
ATOM 6848  H HA   . VAL B 1 98  ? -24.700 -8.039  -14.594 1.00 0.00 ? 98  VAL B HA   2  
ATOM 6849  H HB   . VAL B 1 98  ? -26.487 -10.455 -14.182 1.00 0.00 ? 98  VAL B HB   2  
ATOM 6850  H HG11 . VAL B 1 98  ? -25.056 -8.708  -12.264 1.00 0.00 ? 98  VAL B HG11 2  
ATOM 6851  H HG12 . VAL B 1 98  ? -26.773 -8.938  -11.932 1.00 0.00 ? 98  VAL B HG12 2  
ATOM 6852  H HG13 . VAL B 1 98  ? -25.700 -10.334 -12.040 1.00 0.00 ? 98  VAL B HG13 2  
ATOM 6853  H HG21 . VAL B 1 98  ? -26.917 -7.728  -14.994 1.00 0.00 ? 98  VAL B HG21 2  
ATOM 6854  H HG22 . VAL B 1 98  ? -28.109 -9.011  -14.783 1.00 0.00 ? 98  VAL B HG22 2  
ATOM 6855  H HG23 . VAL B 1 98  ? -27.669 -7.984  -13.419 1.00 0.00 ? 98  VAL B HG23 2  
ATOM 6856  N N    . GLU B 1 99  ? -22.816 -9.299  -13.499 1.00 0.00 ? 99  GLU B N    2  
ATOM 6857  C CA   . GLU B 1 99  ? -21.673 -10.084 -12.965 1.00 0.00 ? 99  GLU B CA   2  
ATOM 6858  C C    . GLU B 1 99  ? -21.425 -9.722  -11.509 1.00 0.00 ? 99  GLU B C    2  
ATOM 6859  O O    . GLU B 1 99  ? -22.285 -9.212  -10.818 1.00 0.00 ? 99  GLU B O    2  
ATOM 6860  C CB   . GLU B 1 99  ? -20.417 -9.779  -13.774 1.00 0.00 ? 99  GLU B CB   2  
ATOM 6861  C CG   . GLU B 1 99  ? -19.815 -11.084 -14.299 1.00 0.00 ? 99  GLU B CG   2  
ATOM 6862  C CD   . GLU B 1 99  ? -18.293 -10.951 -14.375 1.00 0.00 ? 99  GLU B CD   2  
ATOM 6863  O OE1  . GLU B 1 99  ? -17.772 -10.003 -13.812 1.00 0.00 ? 99  GLU B OE1  2  
ATOM 6864  O OE2  . GLU B 1 99  ? -17.675 -11.801 -14.994 1.00 0.00 ? 99  GLU B OE2  2  
ATOM 6865  H H    . GLU B 1 99  ? -22.861 -8.327  -13.355 1.00 0.00 ? 99  GLU B H    2  
ATOM 6866  H HA   . GLU B 1 99  ? -21.895 -11.136 -13.038 1.00 0.00 ? 99  GLU B HA   2  
ATOM 6867  H HB2  . GLU B 1 99  ? -20.669 -9.140  -14.601 1.00 0.00 ? 99  GLU B HB2  2  
ATOM 6868  H HB3  . GLU B 1 99  ? -19.700 -9.284  -13.144 1.00 0.00 ? 99  GLU B HB3  2  
ATOM 6869  H HG2  . GLU B 1 99  ? -20.075 -11.893 -13.632 1.00 0.00 ? 99  GLU B HG2  2  
ATOM 6870  H HG3  . GLU B 1 99  ? -20.206 -11.288 -15.285 1.00 0.00 ? 99  GLU B HG3  2  
ATOM 6871  N N    . GLN B 1 100 ? -20.244 -9.990  -11.043 1.00 0.00 ? 100 GLN B N    2  
ATOM 6872  C CA   . GLN B 1 100 ? -19.899 -9.678  -9.635  1.00 0.00 ? 100 GLN B CA   2  
ATOM 6873  C C    . GLN B 1 100 ? -18.414 -9.339  -9.562  1.00 0.00 ? 100 GLN B C    2  
ATOM 6874  O O    . GLN B 1 100 ? -17.591 -10.183 -9.267  1.00 0.00 ? 100 GLN B O    2  
ATOM 6875  C CB   . GLN B 1 100 ? -20.173 -10.900 -8.772  1.00 0.00 ? 100 GLN B CB   2  
ATOM 6876  C CG   . GLN B 1 100 ? -21.597 -11.401 -9.026  1.00 0.00 ? 100 GLN B CG   2  
ATOM 6877  C CD   . GLN B 1 100 ? -21.877 -12.616 -8.141  1.00 0.00 ? 100 GLN B CD   2  
ATOM 6878  O OE1  . GLN B 1 100 ? -21.796 -13.742 -8.591  1.00 0.00 ? 100 GLN B OE1  2  
ATOM 6879  N NE2  . GLN B 1 100 ? -22.208 -12.436 -6.892  1.00 0.00 ? 100 GLN B NE2  2  
ATOM 6880  H H    . GLN B 1 100 ? -19.576 -10.402 -11.627 1.00 0.00 ? 100 GLN B H    2  
ATOM 6881  H HA   . GLN B 1 100 ? -20.487 -8.843  -9.288  1.00 0.00 ? 100 GLN B HA   2  
ATOM 6882  H HB2  . GLN B 1 100 ? -19.466 -11.670 -9.031  1.00 0.00 ? 100 GLN B HB2  2  
ATOM 6883  H HB3  . GLN B 1 100 ? -20.062 -10.641 -7.729  1.00 0.00 ? 100 GLN B HB3  2  
ATOM 6884  H HG2  . GLN B 1 100 ? -22.302 -10.615 -8.793  1.00 0.00 ? 100 GLN B HG2  2  
ATOM 6885  H HG3  . GLN B 1 100 ? -21.700 -11.682 -10.063 1.00 0.00 ? 100 GLN B HG3  2  
ATOM 6886  H HE21 . GLN B 1 100 ? -22.274 -11.528 -6.529  1.00 0.00 ? 100 GLN B HE21 2  
ATOM 6887  H HE22 . GLN B 1 100 ? -22.389 -13.208 -6.316  1.00 0.00 ? 100 GLN B HE22 2  
ATOM 6888  N N    . LEU B 1 101 ? -18.064 -8.120  -9.842  1.00 0.00 ? 101 LEU B N    2  
ATOM 6889  C CA   . LEU B 1 101 ? -16.631 -7.737  -9.801  1.00 0.00 ? 101 LEU B CA   2  
ATOM 6890  C C    . LEU B 1 101 ? -15.987 -8.323  -8.552  1.00 0.00 ? 101 LEU B C    2  
ATOM 6891  O O    . LEU B 1 101 ? -16.606 -8.447  -7.516  1.00 0.00 ? 101 LEU B O    2  
ATOM 6892  C CB   . LEU B 1 101 ? -16.492 -6.215  -9.787  1.00 0.00 ? 101 LEU B CB   2  
ATOM 6893  C CG   . LEU B 1 101 ? -17.197 -5.606  -11.004 1.00 0.00 ? 101 LEU B CG   2  
ATOM 6894  C CD1  . LEU B 1 101 ? -16.610 -4.223  -11.292 1.00 0.00 ? 101 LEU B CD1  2  
ATOM 6895  C CD2  . LEU B 1 101 ? -16.999 -6.505  -12.228 1.00 0.00 ? 101 LEU B CD2  2  
ATOM 6896  H H    . LEU B 1 101 ? -18.742 -7.464  -10.088 1.00 0.00 ? 101 LEU B H    2  
ATOM 6897  H HA   . LEU B 1 101 ? -16.133 -8.132  -10.676 1.00 0.00 ? 101 LEU B HA   2  
ATOM 6898  H HB2  . LEU B 1 101 ? -16.937 -5.824  -8.885  1.00 0.00 ? 101 LEU B HB2  2  
ATOM 6899  H HB3  . LEU B 1 101 ? -15.443 -5.957  -9.813  1.00 0.00 ? 101 LEU B HB3  2  
ATOM 6900  H HG   . LEU B 1 101 ? -18.253 -5.509  -10.794 1.00 0.00 ? 101 LEU B HG   2  
ATOM 6901  H HD11 . LEU B 1 101 ? -15.539 -4.303  -11.404 1.00 0.00 ? 101 LEU B HD11 2  
ATOM 6902  H HD12 . LEU B 1 101 ? -17.040 -3.832  -12.202 1.00 0.00 ? 101 LEU B HD12 2  
ATOM 6903  H HD13 . LEU B 1 101 ? -16.839 -3.558  -10.472 1.00 0.00 ? 101 LEU B HD13 2  
ATOM 6904  H HD21 . LEU B 1 101 ? -17.382 -7.492  -12.015 1.00 0.00 ? 101 LEU B HD21 2  
ATOM 6905  H HD22 . LEU B 1 101 ? -17.529 -6.088  -13.071 1.00 0.00 ? 101 LEU B HD22 2  
ATOM 6906  H HD23 . LEU B 1 101 ? -15.947 -6.570  -12.460 1.00 0.00 ? 101 LEU B HD23 2  
ATOM 6907  N N    . SER B 1 102 ? -14.749 -8.698  -8.655  1.00 0.00 ? 102 SER B N    2  
ATOM 6908  C CA   . SER B 1 102 ? -14.048 -9.301  -7.484  1.00 0.00 ? 102 SER B CA   2  
ATOM 6909  C C    . SER B 1 102 ? -13.147 -8.260  -6.817  1.00 0.00 ? 102 SER B C    2  
ATOM 6910  O O    . SER B 1 102 ? -12.495 -7.481  -7.477  1.00 0.00 ? 102 SER B O    2  
ATOM 6911  C CB   . SER B 1 102 ? -13.196 -10.479 -7.955  1.00 0.00 ? 102 SER B CB   2  
ATOM 6912  O OG   . SER B 1 102 ? -13.668 -11.673 -7.345  1.00 0.00 ? 102 SER B OG   2  
ATOM 6913  H H    . SER B 1 102 ? -14.283 -8.589  -9.513  1.00 0.00 ? 102 SER B H    2  
ATOM 6914  H HA   . SER B 1 102 ? -14.779 -9.651  -6.770  1.00 0.00 ? 102 SER B HA   2  
ATOM 6915  H HB2  . SER B 1 102 ? -13.270 -10.574 -9.026  1.00 0.00 ? 102 SER B HB2  2  
ATOM 6916  H HB3  . SER B 1 102 ? -12.163 -10.307 -7.682  1.00 0.00 ? 102 SER B HB3  2  
ATOM 6917  H HG   . SER B 1 102 ? -13.107 -11.861 -6.588  1.00 0.00 ? 102 SER B HG   2  
ATOM 6918  N N    . ASN B 1 103 ? -13.096 -8.248  -5.510  1.00 0.00 ? 103 ASN B N    2  
ATOM 6919  C CA   . ASN B 1 103 ? -12.220 -7.259  -4.812  1.00 0.00 ? 103 ASN B CA   2  
ATOM 6920  C C    . ASN B 1 103 ? -12.567 -5.848  -5.277  1.00 0.00 ? 103 ASN B C    2  
ATOM 6921  O O    . ASN B 1 103 ? -11.717 -4.983  -5.360  1.00 0.00 ? 103 ASN B O    2  
ATOM 6922  C CB   . ASN B 1 103 ? -10.757 -7.548  -5.144  1.00 0.00 ? 103 ASN B CB   2  
ATOM 6923  C CG   . ASN B 1 103 ? -10.265 -8.734  -4.315  1.00 0.00 ? 103 ASN B CG   2  
ATOM 6924  O OD1  . ASN B 1 103 ? -10.925 -9.158  -3.388  1.00 0.00 ? 103 ASN B OD1  2  
ATOM 6925  N ND2  . ASN B 1 103 ? -9.124  -9.294  -4.612  1.00 0.00 ? 103 ASN B ND2  2  
ATOM 6926  H H    . ASN B 1 103 ? -13.628 -8.892  -4.990  1.00 0.00 ? 103 ASN B H    2  
ATOM 6927  H HA   . ASN B 1 103 ? -12.367 -7.331  -3.743  1.00 0.00 ? 103 ASN B HA   2  
ATOM 6928  H HB2  . ASN B 1 103 ? -10.664 -7.777  -6.196  1.00 0.00 ? 103 ASN B HB2  2  
ATOM 6929  H HB3  . ASN B 1 103 ? -10.164 -6.678  -4.913  1.00 0.00 ? 103 ASN B HB3  2  
ATOM 6930  H HD21 . ASN B 1 103 ? -8.591  -8.952  -5.361  1.00 0.00 ? 103 ASN B HD21 2  
ATOM 6931  H HD22 . ASN B 1 103 ? -8.800  -10.054 -4.087  1.00 0.00 ? 103 ASN B HD22 2  
ATOM 6932  N N    . MET B 1 104 ? -13.808 -5.608  -5.578  1.00 0.00 ? 104 MET B N    2  
ATOM 6933  C CA   . MET B 1 104 ? -14.212 -4.253  -6.033  1.00 0.00 ? 104 MET B CA   2  
ATOM 6934  C C    . MET B 1 104 ? -14.686 -3.448  -4.826  1.00 0.00 ? 104 MET B C    2  
ATOM 6935  O O    . MET B 1 104 ? -15.324 -2.424  -4.961  1.00 0.00 ? 104 MET B O    2  
ATOM 6936  C CB   . MET B 1 104 ? -15.351 -4.372  -7.047  1.00 0.00 ? 104 MET B CB   2  
ATOM 6937  C CG   . MET B 1 104 ? -15.153 -3.345  -8.162  1.00 0.00 ? 104 MET B CG   2  
ATOM 6938  S SD   . MET B 1 104 ? -16.002 -1.807  -7.722  1.00 0.00 ? 104 MET B SD   2  
ATOM 6939  C CE   . MET B 1 104 ? -16.268 -1.206  -9.408  1.00 0.00 ? 104 MET B CE   2  
ATOM 6940  H H    . MET B 1 104 ? -14.473 -6.319  -5.504  1.00 0.00 ? 104 MET B H    2  
ATOM 6941  H HA   . MET B 1 104 ? -13.368 -3.756  -6.491  1.00 0.00 ? 104 MET B HA   2  
ATOM 6942  H HB2  . MET B 1 104 ? -15.354 -5.367  -7.468  1.00 0.00 ? 104 MET B HB2  2  
ATOM 6943  H HB3  . MET B 1 104 ? -16.292 -4.187  -6.552  1.00 0.00 ? 104 MET B HB3  2  
ATOM 6944  H HG2  . MET B 1 104 ? -14.099 -3.150  -8.290  1.00 0.00 ? 104 MET B HG2  2  
ATOM 6945  H HG3  . MET B 1 104 ? -15.563 -3.732  -9.083  1.00 0.00 ? 104 MET B HG3  2  
ATOM 6946  H HE1  . MET B 1 104 ? -15.349 -1.295  -9.970  1.00 0.00 ? 104 MET B HE1  2  
ATOM 6947  H HE2  . MET B 1 104 ? -17.036 -1.794  -9.885  1.00 0.00 ? 104 MET B HE2  2  
ATOM 6948  H HE3  . MET B 1 104 ? -16.578 -0.171  -9.376  1.00 0.00 ? 104 MET B HE3  2  
ATOM 6949  N N    . ILE B 1 105 ? -14.373 -3.902  -3.642  1.00 0.00 ? 105 ILE B N    2  
ATOM 6950  C CA   . ILE B 1 105 ? -14.795 -3.163  -2.420  1.00 0.00 ? 105 ILE B CA   2  
ATOM 6951  C C    . ILE B 1 105 ? -13.732 -3.344  -1.337  1.00 0.00 ? 105 ILE B C    2  
ATOM 6952  O O    . ILE B 1 105 ? -12.850 -4.170  -1.455  1.00 0.00 ? 105 ILE B O    2  
ATOM 6953  C CB   . ILE B 1 105 ? -16.131 -3.712  -1.918  1.00 0.00 ? 105 ILE B CB   2  
ATOM 6954  C CG1  . ILE B 1 105 ? -17.188 -3.571  -3.018  1.00 0.00 ? 105 ILE B CG1  2  
ATOM 6955  C CG2  . ILE B 1 105 ? -16.570 -2.920  -0.685  1.00 0.00 ? 105 ILE B CG2  2  
ATOM 6956  C CD1  . ILE B 1 105 ? -18.563 -3.935  -2.456  1.00 0.00 ? 105 ILE B CD1  2  
ATOM 6957  H H    . ILE B 1 105 ? -13.849 -4.730  -3.556  1.00 0.00 ? 105 ILE B H    2  
ATOM 6958  H HA   . ILE B 1 105 ? -14.899 -2.114  -2.651  1.00 0.00 ? 105 ILE B HA   2  
ATOM 6959  H HB   . ILE B 1 105 ? -16.017 -4.753  -1.656  1.00 0.00 ? 105 ILE B HB   2  
ATOM 6960  H HG12 . ILE B 1 105 ? -17.201 -2.552  -3.375  1.00 0.00 ? 105 ILE B HG12 2  
ATOM 6961  H HG13 . ILE B 1 105 ? -16.948 -4.236  -3.834  1.00 0.00 ? 105 ILE B HG13 2  
ATOM 6962  H HG21 . ILE B 1 105 ? -16.482 -1.863  -0.886  1.00 0.00 ? 105 ILE B HG21 2  
ATOM 6963  H HG22 . ILE B 1 105 ? -17.598 -3.158  -0.450  1.00 0.00 ? 105 ILE B HG22 2  
ATOM 6964  H HG23 . ILE B 1 105 ? -15.940 -3.182  0.153   1.00 0.00 ? 105 ILE B HG23 2  
ATOM 6965  H HD11 . ILE B 1 105 ? -18.475 -4.803  -1.820  1.00 0.00 ? 105 ILE B HD11 2  
ATOM 6966  H HD12 . ILE B 1 105 ? -18.948 -3.106  -1.881  1.00 0.00 ? 105 ILE B HD12 2  
ATOM 6967  H HD13 . ILE B 1 105 ? -19.239 -4.153  -3.270  1.00 0.00 ? 105 ILE B HD13 2  
ATOM 6968  N N    . VAL B 1 106 ? -13.801 -2.576  -0.286  1.00 0.00 ? 106 VAL B N    2  
ATOM 6969  C CA   . VAL B 1 106 ? -12.786 -2.706  0.791   1.00 0.00 ? 106 VAL B CA   2  
ATOM 6970  C C    . VAL B 1 106 ? -13.457 -3.201  2.077   1.00 0.00 ? 106 VAL B C    2  
ATOM 6971  O O    . VAL B 1 106 ? -14.481 -2.696  2.492   1.00 0.00 ? 106 VAL B O    2  
ATOM 6972  C CB   . VAL B 1 106 ? -12.138 -1.337  1.025   1.00 0.00 ? 106 VAL B CB   2  
ATOM 6973  C CG1  . VAL B 1 106 ? -11.499 -1.290  2.414   1.00 0.00 ? 106 VAL B CG1  2  
ATOM 6974  C CG2  . VAL B 1 106 ? -11.062 -1.105  -0.038  1.00 0.00 ? 106 VAL B CG2  2  
ATOM 6975  H H    . VAL B 1 106 ? -14.513 -1.911  -0.207  1.00 0.00 ? 106 VAL B H    2  
ATOM 6976  H HA   . VAL B 1 106 ? -12.028 -3.413  0.487   1.00 0.00 ? 106 VAL B HA   2  
ATOM 6977  H HB   . VAL B 1 106 ? -12.891 -0.567  0.951   1.00 0.00 ? 106 VAL B HB   2  
ATOM 6978  H HG11 . VAL B 1 106 ? -10.760 -2.072  2.496   1.00 0.00 ? 106 VAL B HG11 2  
ATOM 6979  H HG12 . VAL B 1 106 ? -11.027 -0.330  2.560   1.00 0.00 ? 106 VAL B HG12 2  
ATOM 6980  H HG13 . VAL B 1 106 ? -12.263 -1.435  3.165   1.00 0.00 ? 106 VAL B HG13 2  
ATOM 6981  H HG21 . VAL B 1 106 ? -10.453 -1.992  -0.134  1.00 0.00 ? 106 VAL B HG21 2  
ATOM 6982  H HG22 . VAL B 1 106 ? -11.533 -0.888  -0.986  1.00 0.00 ? 106 VAL B HG22 2  
ATOM 6983  H HG23 . VAL B 1 106 ? -10.441 -0.271  0.254   1.00 0.00 ? 106 VAL B HG23 2  
ATOM 6984  N N    . ARG B 1 107 ? -12.874 -4.180  2.713   1.00 0.00 ? 107 ARG B N    2  
ATOM 6985  C CA   . ARG B 1 107 ? -13.460 -4.707  3.977   1.00 0.00 ? 107 ARG B CA   2  
ATOM 6986  C C    . ARG B 1 107 ? -12.494 -4.422  5.128   1.00 0.00 ? 107 ARG B C    2  
ATOM 6987  O O    . ARG B 1 107 ? -12.855 -4.474  6.287   1.00 0.00 ? 107 ARG B O    2  
ATOM 6988  C CB   . ARG B 1 107 ? -13.676 -6.218  3.851   1.00 0.00 ? 107 ARG B CB   2  
ATOM 6989  C CG   . ARG B 1 107 ? -14.987 -6.606  4.539   1.00 0.00 ? 107 ARG B CG   2  
ATOM 6990  C CD   . ARG B 1 107 ? -14.760 -6.711  6.048   1.00 0.00 ? 107 ARG B CD   2  
ATOM 6991  N NE   . ARG B 1 107 ? -15.216 -8.046  6.526   1.00 0.00 ? 107 ARG B NE   2  
ATOM 6992  C CZ   . ARG B 1 107 ? -16.367 -8.519  6.135   1.00 0.00 ? 107 ARG B CZ   2  
ATOM 6993  N NH1  . ARG B 1 107 ? -17.432 -7.767  6.187   1.00 0.00 ? 107 ARG B NH1  2  
ATOM 6994  N NH2  . ARG B 1 107 ? -16.454 -9.743  5.690   1.00 0.00 ? 107 ARG B NH2  2  
ATOM 6995  H H    . ARG B 1 107 ? -12.044 -4.565  2.362   1.00 0.00 ? 107 ARG B H    2  
ATOM 6996  H HA   . ARG B 1 107 ? -14.405 -4.220  4.169   1.00 0.00 ? 107 ARG B HA   2  
ATOM 6997  H HB2  . ARG B 1 107 ? -13.723 -6.488  2.806   1.00 0.00 ? 107 ARG B HB2  2  
ATOM 6998  H HB3  . ARG B 1 107 ? -12.856 -6.739  4.322   1.00 0.00 ? 107 ARG B HB3  2  
ATOM 6999  H HG2  . ARG B 1 107 ? -15.735 -5.854  4.337   1.00 0.00 ? 107 ARG B HG2  2  
ATOM 7000  H HG3  . ARG B 1 107 ? -15.323 -7.560  4.162   1.00 0.00 ? 107 ARG B HG3  2  
ATOM 7001  H HD2  . ARG B 1 107 ? -13.708 -6.591  6.263   1.00 0.00 ? 107 ARG B HD2  2  
ATOM 7002  H HD3  . ARG B 1 107 ? -15.321 -5.938  6.552   1.00 0.00 ? 107 ARG B HD3  2  
ATOM 7003  H HE   . ARG B 1 107 ? -14.651 -8.570  7.132   1.00 0.00 ? 107 ARG B HE   2  
ATOM 7004  H HH11 . ARG B 1 107 ? -17.365 -6.829  6.528   1.00 0.00 ? 107 ARG B HH11 2  
ATOM 7005  H HH12 . ARG B 1 107 ? -18.315 -8.129  5.888   1.00 0.00 ? 107 ARG B HH12 2  
ATOM 7006  H HH21 . ARG B 1 107 ? -15.638 -10.319 5.649   1.00 0.00 ? 107 ARG B HH21 2  
ATOM 7007  H HH22 . ARG B 1 107 ? -17.337 -10.105 5.391   1.00 0.00 ? 107 ARG B HH22 2  
ATOM 7008  N N    . SER B 1 108 ? -11.265 -4.113  4.810   1.00 0.00 ? 108 SER B N    2  
ATOM 7009  C CA   . SER B 1 108 ? -10.264 -3.816  5.871   1.00 0.00 ? 108 SER B CA   2  
ATOM 7010  C C    . SER B 1 108 ? -9.017  -3.203  5.228   1.00 0.00 ? 108 SER B C    2  
ATOM 7011  O O    . SER B 1 108 ? -8.831  -3.273  4.031   1.00 0.00 ? 108 SER B O    2  
ATOM 7012  C CB   . SER B 1 108 ? -9.880  -5.109  6.591   1.00 0.00 ? 108 SER B CB   2  
ATOM 7013  O OG   . SER B 1 108 ? -11.057 -5.742  7.079   1.00 0.00 ? 108 SER B OG   2  
ATOM 7014  H H    . SER B 1 108 ? -11.002 -4.074  3.866   1.00 0.00 ? 108 SER B H    2  
ATOM 7015  H HA   . SER B 1 108 ? -10.685 -3.118  6.581   1.00 0.00 ? 108 SER B HA   2  
ATOM 7016  H HB2  . SER B 1 108 ? -9.380  -5.771  5.904   1.00 0.00 ? 108 SER B HB2  2  
ATOM 7017  H HB3  . SER B 1 108 ? -9.216  -4.879  7.414   1.00 0.00 ? 108 SER B HB3  2  
ATOM 7018  H HG   . SER B 1 108 ? -11.269 -5.354  7.930   1.00 0.00 ? 108 SER B HG   2  
ATOM 7019  N N    . CYS B 1 109 ? -8.171  -2.590  6.012   1.00 0.00 ? 109 CYS B N    2  
ATOM 7020  C CA   . CYS B 1 109 ? -6.939  -1.962  5.440   1.00 0.00 ? 109 CYS B CA   2  
ATOM 7021  C C    . CYS B 1 109 ? -5.722  -2.249  6.329   1.00 0.00 ? 109 CYS B C    2  
ATOM 7022  O O    . CYS B 1 109 ? -5.833  -2.360  7.533   1.00 0.00 ? 109 CYS B O    2  
ATOM 7023  C CB   . CYS B 1 109 ? -7.153  -0.455  5.349   1.00 0.00 ? 109 CYS B CB   2  
ATOM 7024  S SG   . CYS B 1 109 ? -8.555  -0.130  4.255   1.00 0.00 ? 109 CYS B SG   2  
ATOM 7025  H H    . CYS B 1 109 ? -8.353  -2.533  6.970   1.00 0.00 ? 109 CYS B H    2  
ATOM 7026  H HA   . CYS B 1 109 ? -6.761  -2.353  4.453   1.00 0.00 ? 109 CYS B HA   2  
ATOM 7027  H HB2  . CYS B 1 109 ? -7.359  -0.058  6.333   1.00 0.00 ? 109 CYS B HB2  2  
ATOM 7028  H HB3  . CYS B 1 109 ? -6.267  0.014   4.949   1.00 0.00 ? 109 CYS B HB3  2  
ATOM 7029  N N    . LYS B 1 110 ? -4.554  -2.358  5.740   1.00 0.00 ? 110 LYS B N    2  
ATOM 7030  C CA   . LYS B 1 110 ? -3.328  -2.621  6.541   1.00 0.00 ? 110 LYS B CA   2  
ATOM 7031  C C    . LYS B 1 110 ? -2.276  -1.571  6.176   1.00 0.00 ? 110 LYS B C    2  
ATOM 7032  O O    . LYS B 1 110 ? -2.595  -0.424  5.935   1.00 0.00 ? 110 LYS B O    2  
ATOM 7033  C CB   . LYS B 1 110 ? -2.800  -4.022  6.221   1.00 0.00 ? 110 LYS B CB   2  
ATOM 7034  C CG   . LYS B 1 110 ? -2.207  -4.648  7.484   1.00 0.00 ? 110 LYS B CG   2  
ATOM 7035  C CD   . LYS B 1 110 ? -2.756  -6.065  7.656   1.00 0.00 ? 110 LYS B CD   2  
ATOM 7036  C CE   . LYS B 1 110 ? -2.540  -6.526  9.098   1.00 0.00 ? 110 LYS B CE   2  
ATOM 7037  N NZ   . LYS B 1 110 ? -3.119  -7.888  9.277   1.00 0.00 ? 110 LYS B NZ   2  
ATOM 7038  H H    . LYS B 1 110 ? -4.478  -2.256  4.766   1.00 0.00 ? 110 LYS B H    2  
ATOM 7039  H HA   . LYS B 1 110 ? -3.561  -2.551  7.594   1.00 0.00 ? 110 LYS B HA   2  
ATOM 7040  H HB2  . LYS B 1 110 ? -3.612  -4.637  5.861   1.00 0.00 ? 110 LYS B HB2  2  
ATOM 7041  H HB3  . LYS B 1 110 ? -2.035  -3.953  5.462   1.00 0.00 ? 110 LYS B HB3  2  
ATOM 7042  H HG2  . LYS B 1 110 ? -1.130  -4.686  7.396   1.00 0.00 ? 110 LYS B HG2  2  
ATOM 7043  H HG3  . LYS B 1 110 ? -2.478  -4.052  8.343   1.00 0.00 ? 110 LYS B HG3  2  
ATOM 7044  H HD2  . LYS B 1 110 ? -3.814  -6.070  7.431   1.00 0.00 ? 110 LYS B HD2  2  
ATOM 7045  H HD3  . LYS B 1 110 ? -2.241  -6.735  6.984   1.00 0.00 ? 110 LYS B HD3  2  
ATOM 7046  H HE2  . LYS B 1 110 ? -1.481  -6.555  9.312   1.00 0.00 ? 110 LYS B HE2  2  
ATOM 7047  H HE3  . LYS B 1 110 ? -3.025  -5.837  9.773   1.00 0.00 ? 110 LYS B HE3  2  
ATOM 7048  H HZ1  . LYS B 1 110 ? -3.684  -8.137  8.440   1.00 0.00 ? 110 LYS B HZ1  2  
ATOM 7049  H HZ2  . LYS B 1 110 ? -2.352  -8.579  9.392   1.00 0.00 ? 110 LYS B HZ2  2  
ATOM 7050  H HZ3  . LYS B 1 110 ? -3.727  -7.897  10.122  1.00 0.00 ? 110 LYS B HZ3  2  
ATOM 7051  N N    . CYS B 1 111 ? -1.027  -1.941  6.123   1.00 0.00 ? 111 CYS B N    2  
ATOM 7052  C CA   . CYS B 1 111 ? 0.018   -0.942  5.765   1.00 0.00 ? 111 CYS B CA   2  
ATOM 7053  C C    . CYS B 1 111 ? 1.132   -1.624  4.972   1.00 0.00 ? 111 CYS B C    2  
ATOM 7054  O O    . CYS B 1 111 ? 1.982   -2.289  5.529   1.00 0.00 ? 111 CYS B O    2  
ATOM 7055  C CB   . CYS B 1 111 ? 0.602   -0.334  7.042   1.00 0.00 ? 111 CYS B CB   2  
ATOM 7056  S SG   . CYS B 1 111 ? -0.502  0.964   7.651   1.00 0.00 ? 111 CYS B SG   2  
ATOM 7057  H H    . CYS B 1 111 ? -0.777  -2.868  6.315   1.00 0.00 ? 111 CYS B H    2  
ATOM 7058  H HA   . CYS B 1 111 ? -0.423  -0.160  5.165   1.00 0.00 ? 111 CYS B HA   2  
ATOM 7059  H HB2  . CYS B 1 111 ? 0.701   -1.104  7.793   1.00 0.00 ? 111 CYS B HB2  2  
ATOM 7060  H HB3  . CYS B 1 111 ? 1.572   0.089   6.829   1.00 0.00 ? 111 CYS B HB3  2  
ATOM 7061  N N    . SER B 1 112 ? 1.141   -1.463  3.675   1.00 0.00 ? 112 SER B N    2  
ATOM 7062  C CA   . SER B 1 112 ? 2.212   -2.103  2.864   1.00 0.00 ? 112 SER B CA   2  
ATOM 7063  C C    . SER B 1 112 ? 3.291   -1.066  2.545   1.00 0.00 ? 112 SER B C    2  
ATOM 7064  O O    . SER B 1 112 ? 2.934   0.019   2.117   1.00 0.00 ? 112 SER B O    2  
ATOM 7065  C CB   . SER B 1 112 ? 1.618   -2.643  1.563   1.00 0.00 ? 112 SER B CB   2  
ATOM 7066  O OG   . SER B 1 112 ? 2.536   -3.550  0.968   1.00 0.00 ? 112 SER B OG   2  
ATOM 7067  O OXT  . SER B 1 112 ? 4.456   -1.374  2.739   1.00 0.00 ? 112 SER B OXT  2  
ATOM 7068  H H    . SER B 1 112 ? 0.448   -0.918  3.236   1.00 0.00 ? 112 SER B H    2  
ATOM 7069  H HA   . SER B 1 112 ? 2.650   -2.916  3.424   1.00 0.00 ? 112 SER B HA   2  
ATOM 7070  H HB2  . SER B 1 112 ? 0.697   -3.160  1.774   1.00 0.00 ? 112 SER B HB2  2  
ATOM 7071  H HB3  . SER B 1 112 ? 1.420   -1.820  0.889   1.00 0.00 ? 112 SER B HB3  2  
ATOM 7072  H HG   . SER B 1 112 ? 3.424   -3.263  1.194   1.00 0.00 ? 112 SER B HG   2  
ATOM 7073  N N    . ALA A 1 1   ? 6.863   -2.815  -15.222 1.00 0.00 ? 1   ALA A N    3  
ATOM 7074  C CA   . ALA A 1 1   ? 7.721   -3.381  -14.141 1.00 0.00 ? 1   ALA A CA   3  
ATOM 7075  C C    . ALA A 1 1   ? 7.930   -2.326  -13.053 1.00 0.00 ? 1   ALA A C    3  
ATOM 7076  O O    . ALA A 1 1   ? 8.724   -1.418  -13.200 1.00 0.00 ? 1   ALA A O    3  
ATOM 7077  C CB   . ALA A 1 1   ? 9.074   -3.788  -14.726 1.00 0.00 ? 1   ALA A CB   3  
ATOM 7078  H H1   . ALA A 1 1   ? 6.007   -2.401  -14.803 1.00 0.00 ? 1   ALA A H1   3  
ATOM 7079  H H2   . ALA A 1 1   ? 7.393   -2.079  -15.733 1.00 0.00 ? 1   ALA A H2   3  
ATOM 7080  H H3   . ALA A 1 1   ? 6.593   -3.571  -15.882 1.00 0.00 ? 1   ALA A H3   3  
ATOM 7081  H HA   . ALA A 1 1   ? 7.237   -4.248  -13.715 1.00 0.00 ? 1   ALA A HA   3  
ATOM 7082  H HB1  . ALA A 1 1   ? 9.225   -3.285  -15.670 1.00 0.00 ? 1   ALA A HB1  3  
ATOM 7083  H HB2  . ALA A 1 1   ? 9.862   -3.512  -14.041 1.00 0.00 ? 1   ALA A HB2  3  
ATOM 7084  H HB3  . ALA A 1 1   ? 9.093   -4.857  -14.882 1.00 0.00 ? 1   ALA A HB3  3  
ATOM 7085  N N    . LEU A 1 2   ? 7.225   -2.439  -11.961 1.00 0.00 ? 2   LEU A N    3  
ATOM 7086  C CA   . LEU A 1 2   ? 7.384   -1.442  -10.865 1.00 0.00 ? 2   LEU A CA   3  
ATOM 7087  C C    . LEU A 1 2   ? 8.321   -1.998  -9.799  1.00 0.00 ? 2   LEU A C    3  
ATOM 7088  O O    . LEU A 1 2   ? 7.953   -2.157  -8.654  1.00 0.00 ? 2   LEU A O    3  
ATOM 7089  C CB   . LEU A 1 2   ? 6.029   -1.158  -10.227 1.00 0.00 ? 2   LEU A CB   3  
ATOM 7090  C CG   . LEU A 1 2   ? 5.024   -0.742  -11.302 1.00 0.00 ? 2   LEU A CG   3  
ATOM 7091  C CD1  . LEU A 1 2   ? 3.811   -0.092  -10.635 1.00 0.00 ? 2   LEU A CD1  3  
ATOM 7092  C CD2  . LEU A 1 2   ? 5.677   0.260   -12.257 1.00 0.00 ? 2   LEU A CD2  3  
ATOM 7093  H H    . LEU A 1 2   ? 6.591   -3.179  -11.861 1.00 0.00 ? 2   LEU A H    3  
ATOM 7094  H HA   . LEU A 1 2   ? 7.794   -0.526  -11.263 1.00 0.00 ? 2   LEU A HA   3  
ATOM 7095  H HB2  . LEU A 1 2   ? 5.677   -2.049  -9.728  1.00 0.00 ? 2   LEU A HB2  3  
ATOM 7096  H HB3  . LEU A 1 2   ? 6.136   -0.362  -9.509  1.00 0.00 ? 2   LEU A HB3  3  
ATOM 7097  H HG   . LEU A 1 2   ? 4.705   -1.615  -11.854 1.00 0.00 ? 2   LEU A HG   3  
ATOM 7098  H HD11 . LEU A 1 2   ? 3.679   -0.507  -9.647  1.00 0.00 ? 2   LEU A HD11 3  
ATOM 7099  H HD12 . LEU A 1 2   ? 3.969   0.973   -10.560 1.00 0.00 ? 2   LEU A HD12 3  
ATOM 7100  H HD13 . LEU A 1 2   ? 2.929   -0.284  -11.228 1.00 0.00 ? 2   LEU A HD13 3  
ATOM 7101  H HD21 . LEU A 1 2   ? 6.567   -0.180  -12.685 1.00 0.00 ? 2   LEU A HD21 3  
ATOM 7102  H HD22 . LEU A 1 2   ? 4.985   0.509   -13.046 1.00 0.00 ? 2   LEU A HD22 3  
ATOM 7103  H HD23 . LEU A 1 2   ? 5.944   1.154   -11.714 1.00 0.00 ? 2   LEU A HD23 3  
ATOM 7104  N N    . ASP A 1 3   ? 9.529   -2.296  -10.167 1.00 0.00 ? 3   ASP A N    3  
ATOM 7105  C CA   . ASP A 1 3   ? 10.493  -2.843  -9.177  1.00 0.00 ? 3   ASP A CA   3  
ATOM 7106  C C    . ASP A 1 3   ? 11.662  -1.876  -9.008  1.00 0.00 ? 3   ASP A C    3  
ATOM 7107  O O    . ASP A 1 3   ? 11.708  -0.822  -9.612  1.00 0.00 ? 3   ASP A O    3  
ATOM 7108  C CB   . ASP A 1 3   ? 11.018  -4.190  -9.670  1.00 0.00 ? 3   ASP A CB   3  
ATOM 7109  C CG   . ASP A 1 3   ? 11.132  -4.169  -11.195 1.00 0.00 ? 3   ASP A CG   3  
ATOM 7110  O OD1  . ASP A 1 3   ? 10.138  -4.447  -11.848 1.00 0.00 ? 3   ASP A OD1  3  
ATOM 7111  O OD2  . ASP A 1 3   ? 12.209  -3.874  -11.685 1.00 0.00 ? 3   ASP A OD2  3  
ATOM 7112  H H    . ASP A 1 3   ? 9.800   -2.160  -11.094 1.00 0.00 ? 3   ASP A H    3  
ATOM 7113  H HA   . ASP A 1 3   ? 9.996   -2.977  -8.228  1.00 0.00 ? 3   ASP A HA   3  
ATOM 7114  H HB2  . ASP A 1 3   ? 11.991  -4.376  -9.238  1.00 0.00 ? 3   ASP A HB2  3  
ATOM 7115  H HB3  . ASP A 1 3   ? 10.337  -4.970  -9.372  1.00 0.00 ? 3   ASP A HB3  3  
ATOM 7116  N N    . THR A 1 4   ? 12.608  -2.234  -8.189  1.00 0.00 ? 4   THR A N    3  
ATOM 7117  C CA   . THR A 1 4   ? 13.786  -1.351  -7.967  1.00 0.00 ? 4   THR A CA   3  
ATOM 7118  C C    . THR A 1 4   ? 14.762  -1.484  -9.139  1.00 0.00 ? 4   THR A C    3  
ATOM 7119  O O    . THR A 1 4   ? 15.839  -0.920  -9.128  1.00 0.00 ? 4   THR A O    3  
ATOM 7120  C CB   . THR A 1 4   ? 14.474  -1.761  -6.664  1.00 0.00 ? 4   THR A CB   3  
ATOM 7121  O OG1  . THR A 1 4   ? 15.382  -2.823  -6.922  1.00 0.00 ? 4   THR A OG1  3  
ATOM 7122  C CG2  . THR A 1 4   ? 13.414  -2.222  -5.658  1.00 0.00 ? 4   THR A CG2  3  
ATOM 7123  H H    . THR A 1 4   ? 12.544  -3.089  -7.715  1.00 0.00 ? 4   THR A H    3  
ATOM 7124  H HA   . THR A 1 4   ? 13.460  -0.327  -7.892  1.00 0.00 ? 4   THR A HA   3  
ATOM 7125  H HB   . THR A 1 4   ? 15.010  -0.919  -6.256  1.00 0.00 ? 4   THR A HB   3  
ATOM 7126  H HG1  . THR A 1 4   ? 16.169  -2.676  -6.393  1.00 0.00 ? 4   THR A HG1  3  
ATOM 7127  H HG21 . THR A 1 4   ? 12.520  -1.626  -5.778  1.00 0.00 ? 4   THR A HG21 3  
ATOM 7128  H HG22 . THR A 1 4   ? 13.178  -3.261  -5.834  1.00 0.00 ? 4   THR A HG22 3  
ATOM 7129  H HG23 . THR A 1 4   ? 13.793  -2.104  -4.653  1.00 0.00 ? 4   THR A HG23 3  
ATOM 7130  N N    . ASN A 1 5   ? 14.391  -2.214  -10.156 1.00 0.00 ? 5   ASN A N    3  
ATOM 7131  C CA   . ASN A 1 5   ? 15.294  -2.370  -11.331 1.00 0.00 ? 5   ASN A CA   3  
ATOM 7132  C C    . ASN A 1 5   ? 14.901  -1.352  -12.404 1.00 0.00 ? 5   ASN A C    3  
ATOM 7133  O O    . ASN A 1 5   ? 15.737  -0.674  -12.967 1.00 0.00 ? 5   ASN A O    3  
ATOM 7134  C CB   . ASN A 1 5   ? 15.160  -3.787  -11.894 1.00 0.00 ? 5   ASN A CB   3  
ATOM 7135  C CG   . ASN A 1 5   ? 16.368  -4.099  -12.779 1.00 0.00 ? 5   ASN A CG   3  
ATOM 7136  O OD1  . ASN A 1 5   ? 17.055  -3.202  -13.229 1.00 0.00 ? 5   ASN A OD1  3  
ATOM 7137  N ND2  . ASN A 1 5   ? 16.659  -5.342  -13.050 1.00 0.00 ? 5   ASN A ND2  3  
ATOM 7138  H H    . ASN A 1 5   ? 13.518  -2.655  -10.150 1.00 0.00 ? 5   ASN A H    3  
ATOM 7139  H HA   . ASN A 1 5   ? 16.316  -2.196  -11.026 1.00 0.00 ? 5   ASN A HA   3  
ATOM 7140  H HB2  . ASN A 1 5   ? 15.117  -4.495  -11.079 1.00 0.00 ? 5   ASN A HB2  3  
ATOM 7141  H HB3  . ASN A 1 5   ? 14.258  -3.857  -12.482 1.00 0.00 ? 5   ASN A HB3  3  
ATOM 7142  H HD21 . ASN A 1 5   ? 16.105  -6.065  -12.688 1.00 0.00 ? 5   ASN A HD21 3  
ATOM 7143  H HD22 . ASN A 1 5   ? 17.431  -5.552  -13.615 1.00 0.00 ? 5   ASN A HD22 3  
ATOM 7144  N N    . TYR A 1 6   ? 13.630  -1.238  -12.692 1.00 0.00 ? 6   TYR A N    3  
ATOM 7145  C CA   . TYR A 1 6   ? 13.181  -0.267  -13.722 1.00 0.00 ? 6   TYR A CA   3  
ATOM 7146  C C    . TYR A 1 6   ? 13.018  1.114   -13.081 1.00 0.00 ? 6   TYR A C    3  
ATOM 7147  O O    . TYR A 1 6   ? 12.969  2.122   -13.758 1.00 0.00 ? 6   TYR A O    3  
ATOM 7148  C CB   . TYR A 1 6   ? 11.840  -0.735  -14.285 1.00 0.00 ? 6   TYR A CB   3  
ATOM 7149  C CG   . TYR A 1 6   ? 11.204  0.377   -15.085 1.00 0.00 ? 6   TYR A CG   3  
ATOM 7150  C CD1  . TYR A 1 6   ? 11.708  0.714   -16.346 1.00 0.00 ? 6   TYR A CD1  3  
ATOM 7151  C CD2  . TYR A 1 6   ? 10.108  1.070   -14.559 1.00 0.00 ? 6   TYR A CD2  3  
ATOM 7152  C CE1  . TYR A 1 6   ? 11.115  1.746   -17.083 1.00 0.00 ? 6   TYR A CE1  3  
ATOM 7153  C CE2  . TYR A 1 6   ? 9.515   2.102   -15.296 1.00 0.00 ? 6   TYR A CE2  3  
ATOM 7154  C CZ   . TYR A 1 6   ? 10.018  2.440   -16.558 1.00 0.00 ? 6   TYR A CZ   3  
ATOM 7155  O OH   . TYR A 1 6   ? 9.432   3.456   -17.285 1.00 0.00 ? 6   TYR A OH   3  
ATOM 7156  H H    . TYR A 1 6   ? 12.969  -1.791  -12.228 1.00 0.00 ? 6   TYR A H    3  
ATOM 7157  H HA   . TYR A 1 6   ? 13.910  -0.216  -14.516 1.00 0.00 ? 6   TYR A HA   3  
ATOM 7158  H HB2  . TYR A 1 6   ? 12.000  -1.593  -14.919 1.00 0.00 ? 6   TYR A HB2  3  
ATOM 7159  H HB3  . TYR A 1 6   ? 11.186  -1.009  -13.471 1.00 0.00 ? 6   TYR A HB3  3  
ATOM 7160  H HD1  . TYR A 1 6   ? 12.554  0.179   -16.751 1.00 0.00 ? 6   TYR A HD1  3  
ATOM 7161  H HD2  . TYR A 1 6   ? 9.722   0.808   -13.584 1.00 0.00 ? 6   TYR A HD2  3  
ATOM 7162  H HE1  . TYR A 1 6   ? 11.503  2.007   -18.056 1.00 0.00 ? 6   TYR A HE1  3  
ATOM 7163  H HE2  . TYR A 1 6   ? 8.669   2.637   -14.890 1.00 0.00 ? 6   TYR A HE2  3  
ATOM 7164  H HH   . TYR A 1 6   ? 9.770   4.291   -16.953 1.00 0.00 ? 6   TYR A HH   3  
ATOM 7165  N N    . CYS A 1 7   ? 12.932  1.167   -11.780 1.00 0.00 ? 7   CYS A N    3  
ATOM 7166  C CA   . CYS A 1 7   ? 12.770  2.481   -11.097 1.00 0.00 ? 7   CYS A CA   3  
ATOM 7167  C C    . CYS A 1 7   ? 14.147  3.104   -10.854 1.00 0.00 ? 7   CYS A C    3  
ATOM 7168  O O    . CYS A 1 7   ? 14.267  4.282   -10.585 1.00 0.00 ? 7   CYS A O    3  
ATOM 7169  C CB   . CYS A 1 7   ? 12.052  2.276   -9.761  1.00 0.00 ? 7   CYS A CB   3  
ATOM 7170  S SG   . CYS A 1 7   ? 10.265  2.413   -10.020 1.00 0.00 ? 7   CYS A SG   3  
ATOM 7171  H H    . CYS A 1 7   ? 12.971  0.343   -11.252 1.00 0.00 ? 7   CYS A H    3  
ATOM 7172  H HA   . CYS A 1 7   ? 12.185  3.139   -11.721 1.00 0.00 ? 7   CYS A HA   3  
ATOM 7173  H HB2  . CYS A 1 7   ? 12.287  1.295   -9.371  1.00 0.00 ? 7   CYS A HB2  3  
ATOM 7174  H HB3  . CYS A 1 7   ? 12.373  3.030   -9.059  1.00 0.00 ? 7   CYS A HB3  3  
ATOM 7175  N N    . PHE A 1 8   ? 15.187  2.323   -10.953 1.00 0.00 ? 8   PHE A N    3  
ATOM 7176  C CA   . PHE A 1 8   ? 16.555  2.873   -10.733 1.00 0.00 ? 8   PHE A CA   3  
ATOM 7177  C C    . PHE A 1 8   ? 17.126  3.375   -12.062 1.00 0.00 ? 8   PHE A C    3  
ATOM 7178  O O    . PHE A 1 8   ? 18.235  3.866   -12.125 1.00 0.00 ? 8   PHE A O    3  
ATOM 7179  C CB   . PHE A 1 8   ? 17.463  1.778   -10.169 1.00 0.00 ? 8   PHE A CB   3  
ATOM 7180  C CG   . PHE A 1 8   ? 17.412  1.801   -8.659  1.00 0.00 ? 8   PHE A CG   3  
ATOM 7181  C CD1  . PHE A 1 8   ? 16.296  2.333   -8.000  1.00 0.00 ? 8   PHE A CD1  3  
ATOM 7182  C CD2  . PHE A 1 8   ? 18.484  1.290   -7.916  1.00 0.00 ? 8   PHE A CD2  3  
ATOM 7183  C CE1  . PHE A 1 8   ? 16.254  2.355   -6.601  1.00 0.00 ? 8   PHE A CE1  3  
ATOM 7184  C CE2  . PHE A 1 8   ? 18.441  1.312   -6.517  1.00 0.00 ? 8   PHE A CE2  3  
ATOM 7185  C CZ   . PHE A 1 8   ? 17.326  1.844   -5.859  1.00 0.00 ? 8   PHE A CZ   3  
ATOM 7186  H H    . PHE A 1 8   ? 15.068  1.376   -11.175 1.00 0.00 ? 8   PHE A H    3  
ATOM 7187  H HA   . PHE A 1 8   ? 16.503  3.693   -10.033 1.00 0.00 ? 8   PHE A HA   3  
ATOM 7188  H HB2  . PHE A 1 8   ? 17.128  0.815   -10.525 1.00 0.00 ? 8   PHE A HB2  3  
ATOM 7189  H HB3  . PHE A 1 8   ? 18.478  1.948   -10.496 1.00 0.00 ? 8   PHE A HB3  3  
ATOM 7190  H HD1  . PHE A 1 8   ? 15.469  2.727   -8.571  1.00 0.00 ? 8   PHE A HD1  3  
ATOM 7191  H HD2  . PHE A 1 8   ? 19.345  0.880   -8.424  1.00 0.00 ? 8   PHE A HD2  3  
ATOM 7192  H HE1  . PHE A 1 8   ? 15.394  2.766   -6.093  1.00 0.00 ? 8   PHE A HE1  3  
ATOM 7193  H HE2  . PHE A 1 8   ? 19.268  0.918   -5.946  1.00 0.00 ? 8   PHE A HE2  3  
ATOM 7194  H HZ   . PHE A 1 8   ? 17.293  1.860   -4.780  1.00 0.00 ? 8   PHE A HZ   3  
ATOM 7195  N N    . SER A 1 9   ? 16.378  3.258   -13.126 1.00 0.00 ? 9   SER A N    3  
ATOM 7196  C CA   . SER A 1 9   ? 16.881  3.731   -14.447 1.00 0.00 ? 9   SER A CA   3  
ATOM 7197  C C    . SER A 1 9   ? 15.987  4.863   -14.955 1.00 0.00 ? 9   SER A C    3  
ATOM 7198  O O    . SER A 1 9   ? 16.354  6.021   -14.922 1.00 0.00 ? 9   SER A O    3  
ATOM 7199  C CB   . SER A 1 9   ? 16.857  2.573   -15.445 1.00 0.00 ? 9   SER A CB   3  
ATOM 7200  O OG   . SER A 1 9   ? 18.168  2.368   -15.957 1.00 0.00 ? 9   SER A OG   3  
ATOM 7201  H H    . SER A 1 9   ? 15.485  2.860   -13.056 1.00 0.00 ? 9   SER A H    3  
ATOM 7202  H HA   . SER A 1 9   ? 17.893  4.092   -14.338 1.00 0.00 ? 9   SER A HA   3  
ATOM 7203  H HB2  . SER A 1 9   ? 16.525  1.676   -14.951 1.00 0.00 ? 9   SER A HB2  3  
ATOM 7204  H HB3  . SER A 1 9   ? 16.177  2.810   -16.253 1.00 0.00 ? 9   SER A HB3  3  
ATOM 7205  H HG   . SER A 1 9   ? 18.089  1.917   -16.800 1.00 0.00 ? 9   SER A HG   3  
ATOM 7206  N N    . SER A 1 10  ? 14.814  4.539   -15.426 1.00 0.00 ? 10  SER A N    3  
ATOM 7207  C CA   . SER A 1 10  ? 13.897  5.597   -15.936 1.00 0.00 ? 10  SER A CA   3  
ATOM 7208  C C    . SER A 1 10  ? 13.151  6.235   -14.763 1.00 0.00 ? 10  SER A C    3  
ATOM 7209  O O    . SER A 1 10  ? 12.972  5.629   -13.726 1.00 0.00 ? 10  SER A O    3  
ATOM 7210  C CB   . SER A 1 10  ? 12.889  4.975   -16.902 1.00 0.00 ? 10  SER A CB   3  
ATOM 7211  O OG   . SER A 1 10  ? 12.554  5.922   -17.908 1.00 0.00 ? 10  SER A OG   3  
ATOM 7212  H H    . SER A 1 10  ? 14.535  3.599   -15.444 1.00 0.00 ? 10  SER A H    3  
ATOM 7213  H HA   . SER A 1 10  ? 14.471  6.352   -16.453 1.00 0.00 ? 10  SER A HA   3  
ATOM 7214  H HB2  . SER A 1 10  ? 13.322  4.103   -17.366 1.00 0.00 ? 10  SER A HB2  3  
ATOM 7215  H HB3  . SER A 1 10  ? 12.001  4.685   -16.355 1.00 0.00 ? 10  SER A HB3  3  
ATOM 7216  H HG   . SER A 1 10  ? 11.949  5.501   -18.522 1.00 0.00 ? 10  SER A HG   3  
ATOM 7217  N N    . THR A 1 11  ? 12.715  7.455   -14.919 1.00 0.00 ? 11  THR A N    3  
ATOM 7218  C CA   . THR A 1 11  ? 11.979  8.130   -13.812 1.00 0.00 ? 11  THR A CA   3  
ATOM 7219  C C    . THR A 1 11  ? 10.504  8.270   -14.193 1.00 0.00 ? 11  THR A C    3  
ATOM 7220  O O    . THR A 1 11  ? 10.133  8.122   -15.341 1.00 0.00 ? 11  THR A O    3  
ATOM 7221  C CB   . THR A 1 11  ? 12.580  9.517   -13.572 1.00 0.00 ? 11  THR A CB   3  
ATOM 7222  O OG1  . THR A 1 11  ? 13.610  9.754   -14.522 1.00 0.00 ? 11  THR A OG1  3  
ATOM 7223  C CG2  . THR A 1 11  ? 13.160  9.586   -12.159 1.00 0.00 ? 11  THR A CG2  3  
ATOM 7224  H H    . THR A 1 11  ? 12.869  7.928   -15.763 1.00 0.00 ? 11  THR A H    3  
ATOM 7225  H HA   . THR A 1 11  ? 12.064  7.540   -12.911 1.00 0.00 ? 11  THR A HA   3  
ATOM 7226  H HB   . THR A 1 11  ? 11.812  10.266  -13.678 1.00 0.00 ? 11  THR A HB   3  
ATOM 7227  H HG1  . THR A 1 11  ? 14.424  9.378   -14.178 1.00 0.00 ? 11  THR A HG1  3  
ATOM 7228  H HG21 . THR A 1 11  ? 13.903  8.811   -12.037 1.00 0.00 ? 11  THR A HG21 3  
ATOM 7229  H HG22 . THR A 1 11  ? 13.620  10.551  -12.005 1.00 0.00 ? 11  THR A HG22 3  
ATOM 7230  H HG23 . THR A 1 11  ? 12.370  9.444   -11.438 1.00 0.00 ? 11  THR A HG23 3  
ATOM 7231  N N    . GLU A 1 12  ? 9.658   8.552   -13.241 1.00 0.00 ? 12  GLU A N    3  
ATOM 7232  C CA   . GLU A 1 12  ? 8.208   8.700   -13.551 1.00 0.00 ? 12  GLU A CA   3  
ATOM 7233  C C    . GLU A 1 12  ? 7.475   9.255   -12.328 1.00 0.00 ? 12  GLU A C    3  
ATOM 7234  O O    . GLU A 1 12  ? 8.082   9.608   -11.337 1.00 0.00 ? 12  GLU A O    3  
ATOM 7235  C CB   . GLU A 1 12  ? 7.624   7.332   -13.919 1.00 0.00 ? 12  GLU A CB   3  
ATOM 7236  C CG   . GLU A 1 12  ? 8.336   6.238   -13.120 1.00 0.00 ? 12  GLU A CG   3  
ATOM 7237  C CD   . GLU A 1 12  ? 7.827   4.867   -13.565 1.00 0.00 ? 12  GLU A CD   3  
ATOM 7238  O OE1  . GLU A 1 12  ? 7.574   4.705   -14.748 1.00 0.00 ? 12  GLU A OE1  3  
ATOM 7239  O OE2  . GLU A 1 12  ? 7.699   4.000   -12.715 1.00 0.00 ? 12  GLU A OE2  3  
ATOM 7240  H H    . GLU A 1 12  ? 9.976   8.667   -12.321 1.00 0.00 ? 12  GLU A H    3  
ATOM 7241  H HA   . GLU A 1 12  ? 8.085   9.378   -14.383 1.00 0.00 ? 12  GLU A HA   3  
ATOM 7242  H HB2  . GLU A 1 12  ? 6.568   7.319   -13.690 1.00 0.00 ? 12  GLU A HB2  3  
ATOM 7243  H HB3  . GLU A 1 12  ? 7.765   7.154   -14.975 1.00 0.00 ? 12  GLU A HB3  3  
ATOM 7244  H HG2  . GLU A 1 12  ? 9.401   6.302   -13.294 1.00 0.00 ? 12  GLU A HG2  3  
ATOM 7245  H HG3  . GLU A 1 12  ? 8.134   6.372   -12.068 1.00 0.00 ? 12  GLU A HG3  3  
ATOM 7246  N N    . LYS A 1 13  ? 6.173   9.337   -12.389 1.00 0.00 ? 13  LYS A N    3  
ATOM 7247  C CA   . LYS A 1 13  ? 5.404   9.871   -11.230 1.00 0.00 ? 13  LYS A CA   3  
ATOM 7248  C C    . LYS A 1 13  ? 4.261   8.911   -10.887 1.00 0.00 ? 13  LYS A C    3  
ATOM 7249  O O    . LYS A 1 13  ? 3.154   9.325   -10.605 1.00 0.00 ? 13  LYS A O    3  
ATOM 7250  C CB   . LYS A 1 13  ? 4.824   11.240  -11.591 1.00 0.00 ? 13  LYS A CB   3  
ATOM 7251  C CG   . LYS A 1 13  ? 5.546   12.327  -10.791 1.00 0.00 ? 13  LYS A CG   3  
ATOM 7252  C CD   . LYS A 1 13  ? 4.598   13.507  -10.562 1.00 0.00 ? 13  LYS A CD   3  
ATOM 7253  C CE   . LYS A 1 13  ? 5.386   14.693  -10.003 1.00 0.00 ? 13  LYS A CE   3  
ATOM 7254  N NZ   . LYS A 1 13  ? 5.230   15.866  -10.911 1.00 0.00 ? 13  LYS A NZ   3  
ATOM 7255  H H    . LYS A 1 13  ? 5.702   9.047   -13.199 1.00 0.00 ? 13  LYS A H    3  
ATOM 7256  H HA   . LYS A 1 13  ? 6.059   9.970   -10.378 1.00 0.00 ? 13  LYS A HA   3  
ATOM 7257  H HB2  . LYS A 1 13  ? 4.959   11.421  -12.648 1.00 0.00 ? 13  LYS A HB2  3  
ATOM 7258  H HB3  . LYS A 1 13  ? 3.772   11.260  -11.353 1.00 0.00 ? 13  LYS A HB3  3  
ATOM 7259  H HG2  . LYS A 1 13  ? 5.858   11.926  -9.838  1.00 0.00 ? 13  LYS A HG2  3  
ATOM 7260  H HG3  . LYS A 1 13  ? 6.411   12.665  -11.341 1.00 0.00 ? 13  LYS A HG3  3  
ATOM 7261  H HD2  . LYS A 1 13  ? 4.139   13.788  -11.500 1.00 0.00 ? 13  LYS A HD2  3  
ATOM 7262  H HD3  . LYS A 1 13  ? 3.833   13.223  -9.857  1.00 0.00 ? 13  LYS A HD3  3  
ATOM 7263  H HE2  . LYS A 1 13  ? 5.011   14.945  -9.023  1.00 0.00 ? 13  LYS A HE2  3  
ATOM 7264  H HE3  . LYS A 1 13  ? 6.431   14.430  -9.932  1.00 0.00 ? 13  LYS A HE3  3  
ATOM 7265  H HZ1  . LYS A 1 13  ? 5.270   15.547  -11.899 1.00 0.00 ? 13  LYS A HZ1  3  
ATOM 7266  H HZ2  . LYS A 1 13  ? 4.313   16.322  -10.733 1.00 0.00 ? 13  LYS A HZ2  3  
ATOM 7267  H HZ3  . LYS A 1 13  ? 5.998   16.545  -10.732 1.00 0.00 ? 13  LYS A HZ3  3  
ATOM 7268  N N    . ASN A 1 14  ? 4.521   7.633   -10.909 1.00 0.00 ? 14  ASN A N    3  
ATOM 7269  C CA   . ASN A 1 14  ? 3.450   6.649   -10.586 1.00 0.00 ? 14  ASN A CA   3  
ATOM 7270  C C    . ASN A 1 14  ? 3.984   5.632   -9.576  1.00 0.00 ? 14  ASN A C    3  
ATOM 7271  O O    . ASN A 1 14  ? 5.061   5.790   -9.037  1.00 0.00 ? 14  ASN A O    3  
ATOM 7272  C CB   . ASN A 1 14  ? 3.025   5.923   -11.863 1.00 0.00 ? 14  ASN A CB   3  
ATOM 7273  C CG   . ASN A 1 14  ? 2.737   6.948   -12.962 1.00 0.00 ? 14  ASN A CG   3  
ATOM 7274  O OD1  . ASN A 1 14  ? 3.218   6.820   -14.070 1.00 0.00 ? 14  ASN A OD1  3  
ATOM 7275  N ND2  . ASN A 1 14  ? 1.968   7.969   -12.699 1.00 0.00 ? 14  ASN A ND2  3  
ATOM 7276  H H    . ASN A 1 14  ? 5.420   7.319   -11.139 1.00 0.00 ? 14  ASN A H    3  
ATOM 7277  H HA   . ASN A 1 14  ? 2.599   7.164   -10.164 1.00 0.00 ? 14  ASN A HA   3  
ATOM 7278  H HB2  . ASN A 1 14  ? 3.820   5.264   -12.183 1.00 0.00 ? 14  ASN A HB2  3  
ATOM 7279  H HB3  . ASN A 1 14  ? 2.134   5.344   -11.671 1.00 0.00 ? 14  ASN A HB3  3  
ATOM 7280  H HD21 . ASN A 1 14  ? 1.581   8.074   -11.806 1.00 0.00 ? 14  ASN A HD21 3  
ATOM 7281  H HD22 . ASN A 1 14  ? 1.778   8.632   -13.396 1.00 0.00 ? 14  ASN A HD22 3  
ATOM 7282  N N    . CYS A 1 15  ? 3.245   4.585   -9.320  1.00 0.00 ? 15  CYS A N    3  
ATOM 7283  C CA   . CYS A 1 15  ? 3.720   3.558   -8.350  1.00 0.00 ? 15  CYS A CA   3  
ATOM 7284  C C    . CYS A 1 15  ? 5.131   3.127   -8.750  1.00 0.00 ? 15  CYS A C    3  
ATOM 7285  O O    . CYS A 1 15  ? 5.315   2.219   -9.536  1.00 0.00 ? 15  CYS A O    3  
ATOM 7286  C CB   . CYS A 1 15  ? 2.773   2.355   -8.383  1.00 0.00 ? 15  CYS A CB   3  
ATOM 7287  S SG   . CYS A 1 15  ? 3.548   0.922   -7.590  1.00 0.00 ? 15  CYS A SG   3  
ATOM 7288  H H    . CYS A 1 15  ? 2.381   4.473   -9.768  1.00 0.00 ? 15  CYS A H    3  
ATOM 7289  H HA   . CYS A 1 15  ? 3.739   3.980   -7.355  1.00 0.00 ? 15  CYS A HA   3  
ATOM 7290  H HB2  . CYS A 1 15  ? 1.860   2.601   -7.863  1.00 0.00 ? 15  CYS A HB2  3  
ATOM 7291  H HB3  . CYS A 1 15  ? 2.543   2.113   -9.406  1.00 0.00 ? 15  CYS A HB3  3  
ATOM 7292  N N    . CYS A 1 16  ? 6.127   3.781   -8.226  1.00 0.00 ? 16  CYS A N    3  
ATOM 7293  C CA   . CYS A 1 16  ? 7.524   3.421   -8.588  1.00 0.00 ? 16  CYS A CA   3  
ATOM 7294  C C    . CYS A 1 16  ? 8.390   3.412   -7.328  1.00 0.00 ? 16  CYS A C    3  
ATOM 7295  O O    . CYS A 1 16  ? 8.325   4.307   -6.505  1.00 0.00 ? 16  CYS A O    3  
ATOM 7296  C CB   . CYS A 1 16  ? 8.060   4.455   -9.588  1.00 0.00 ? 16  CYS A CB   3  
ATOM 7297  S SG   . CYS A 1 16  ? 9.870   4.364   -9.686  1.00 0.00 ? 16  CYS A SG   3  
ATOM 7298  H H    . CYS A 1 16  ? 5.957   4.517   -7.602  1.00 0.00 ? 16  CYS A H    3  
ATOM 7299  H HA   . CYS A 1 16  ? 7.537   2.441   -9.041  1.00 0.00 ? 16  CYS A HA   3  
ATOM 7300  H HB2  . CYS A 1 16  ? 7.642   4.259   -10.563 1.00 0.00 ? 16  CYS A HB2  3  
ATOM 7301  H HB3  . CYS A 1 16  ? 7.768   5.444   -9.268  1.00 0.00 ? 16  CYS A HB3  3  
ATOM 7302  N N    . VAL A 1 17  ? 9.208   2.409   -7.180  1.00 0.00 ? 17  VAL A N    3  
ATOM 7303  C CA   . VAL A 1 17  ? 10.094  2.338   -5.990  1.00 0.00 ? 17  VAL A CA   3  
ATOM 7304  C C    . VAL A 1 17  ? 11.289  3.269   -6.215  1.00 0.00 ? 17  VAL A C    3  
ATOM 7305  O O    . VAL A 1 17  ? 12.183  2.979   -6.984  1.00 0.00 ? 17  VAL A O    3  
ATOM 7306  C CB   . VAL A 1 17  ? 10.573  0.897   -5.805  1.00 0.00 ? 17  VAL A CB   3  
ATOM 7307  C CG1  . VAL A 1 17  ? 11.568  0.534   -6.902  1.00 0.00 ? 17  VAL A CG1  3  
ATOM 7308  C CG2  . VAL A 1 17  ? 11.244  0.755   -4.442  1.00 0.00 ? 17  VAL A CG2  3  
ATOM 7309  H H    . VAL A 1 17  ? 9.245   1.704   -7.859  1.00 0.00 ? 17  VAL A H    3  
ATOM 7310  H HA   . VAL A 1 17  ? 9.548   2.656   -5.113  1.00 0.00 ? 17  VAL A HA   3  
ATOM 7311  H HB   . VAL A 1 17  ? 9.727   0.232   -5.863  1.00 0.00 ? 17  VAL A HB   3  
ATOM 7312  H HG11 . VAL A 1 17  ? 11.253  0.977   -7.836  1.00 0.00 ? 17  VAL A HG11 3  
ATOM 7313  H HG12 . VAL A 1 17  ? 12.547  0.909   -6.638  1.00 0.00 ? 17  VAL A HG12 3  
ATOM 7314  H HG13 . VAL A 1 17  ? 11.611  -0.539  -7.010  1.00 0.00 ? 17  VAL A HG13 3  
ATOM 7315  H HG21 . VAL A 1 17  ? 11.317  1.726   -3.975  1.00 0.00 ? 17  VAL A HG21 3  
ATOM 7316  H HG22 . VAL A 1 17  ? 10.655  0.098   -3.819  1.00 0.00 ? 17  VAL A HG22 3  
ATOM 7317  H HG23 . VAL A 1 17  ? 12.233  0.341   -4.570  1.00 0.00 ? 17  VAL A HG23 3  
ATOM 7318  N N    . ARG A 1 18  ? 11.302  4.400   -5.573  1.00 0.00 ? 18  ARG A N    3  
ATOM 7319  C CA   . ARG A 1 18  ? 12.432  5.350   -5.781  1.00 0.00 ? 18  ARG A CA   3  
ATOM 7320  C C    . ARG A 1 18  ? 13.524  5.117   -4.735  1.00 0.00 ? 18  ARG A C    3  
ATOM 7321  O O    . ARG A 1 18  ? 13.268  4.657   -3.639  1.00 0.00 ? 18  ARG A O    3  
ATOM 7322  C CB   . ARG A 1 18  ? 11.911  6.783   -5.679  1.00 0.00 ? 18  ARG A CB   3  
ATOM 7323  C CG   . ARG A 1 18  ? 11.085  7.108   -6.922  1.00 0.00 ? 18  ARG A CG   3  
ATOM 7324  C CD   . ARG A 1 18  ? 10.768  8.603   -6.951  1.00 0.00 ? 18  ARG A CD   3  
ATOM 7325  N NE   . ARG A 1 18  ? 9.292   8.796   -7.018  1.00 0.00 ? 18  ARG A NE   3  
ATOM 7326  C CZ   . ARG A 1 18  ? 8.796   9.963   -7.330  1.00 0.00 ? 18  ARG A CZ   3  
ATOM 7327  N NH1  . ARG A 1 18  ? 9.589   10.949  -7.650  1.00 0.00 ? 18  ARG A NH1  3  
ATOM 7328  N NH2  . ARG A 1 18  ? 7.504   10.144  -7.322  1.00 0.00 ? 18  ARG A NH2  3  
ATOM 7329  H H    . ARG A 1 18  ? 10.566  4.632   -4.969  1.00 0.00 ? 18  ARG A H    3  
ATOM 7330  H HA   . ARG A 1 18  ? 12.847  5.194   -6.766  1.00 0.00 ? 18  ARG A HA   3  
ATOM 7331  H HB2  . ARG A 1 18  ? 11.291  6.880   -4.802  1.00 0.00 ? 18  ARG A HB2  3  
ATOM 7332  H HB3  . ARG A 1 18  ? 12.743  7.467   -5.613  1.00 0.00 ? 18  ARG A HB3  3  
ATOM 7333  H HG2  . ARG A 1 18  ? 11.645  6.840   -7.806  1.00 0.00 ? 18  ARG A HG2  3  
ATOM 7334  H HG3  . ARG A 1 18  ? 10.163  6.546   -6.896  1.00 0.00 ? 18  ARG A HG3  3  
ATOM 7335  H HD2  . ARG A 1 18  ? 11.150  9.070   -6.055  1.00 0.00 ? 18  ARG A HD2  3  
ATOM 7336  H HD3  . ARG A 1 18  ? 11.229  9.052   -7.818  1.00 0.00 ? 18  ARG A HD3  3  
ATOM 7337  H HE   . ARG A 1 18  ? 8.692   8.044   -6.828  1.00 0.00 ? 18  ARG A HE   3  
ATOM 7338  H HH11 . ARG A 1 18  ? 10.580  10.812  -7.658  1.00 0.00 ? 18  ARG A HH11 3  
ATOM 7339  H HH12 . ARG A 1 18  ? 9.207   11.841  -7.887  1.00 0.00 ? 18  ARG A HH12 3  
ATOM 7340  H HH21 . ARG A 1 18  ? 6.894   9.390   -7.076  1.00 0.00 ? 18  ARG A HH21 3  
ATOM 7341  H HH22 . ARG A 1 18  ? 7.122   11.037  -7.559  1.00 0.00 ? 18  ARG A HH22 3  
ATOM 7342  N N    . GLN A 1 19  ? 14.745  5.438   -5.073  1.00 0.00 ? 19  GLN A N    3  
ATOM 7343  C CA   . GLN A 1 19  ? 15.871  5.247   -4.113  1.00 0.00 ? 19  GLN A CA   3  
ATOM 7344  C C    . GLN A 1 19  ? 15.537  5.937   -2.795  1.00 0.00 ? 19  GLN A C    3  
ATOM 7345  O O    . GLN A 1 19  ? 14.809  6.909   -2.758  1.00 0.00 ? 19  GLN A O    3  
ATOM 7346  C CB   . GLN A 1 19  ? 17.149  5.854   -4.699  1.00 0.00 ? 19  GLN A CB   3  
ATOM 7347  C CG   . GLN A 1 19  ? 17.037  7.380   -4.700  1.00 0.00 ? 19  GLN A CG   3  
ATOM 7348  C CD   . GLN A 1 19  ? 18.310  7.984   -5.297  1.00 0.00 ? 19  GLN A CD   3  
ATOM 7349  O OE1  . GLN A 1 19  ? 19.136  8.516   -4.582  1.00 0.00 ? 19  GLN A OE1  3  
ATOM 7350  N NE2  . GLN A 1 19  ? 18.503  7.926   -6.586  1.00 0.00 ? 19  GLN A NE2  3  
ATOM 7351  H H    . GLN A 1 19  ? 14.921  5.809   -5.964  1.00 0.00 ? 19  GLN A H    3  
ATOM 7352  H HA   . GLN A 1 19  ? 16.023  4.193   -3.933  1.00 0.00 ? 19  GLN A HA   3  
ATOM 7353  H HB2  . GLN A 1 19  ? 17.997  5.554   -4.099  1.00 0.00 ? 19  GLN A HB2  3  
ATOM 7354  H HB3  . GLN A 1 19  ? 17.282  5.503   -5.711  1.00 0.00 ? 19  GLN A HB3  3  
ATOM 7355  H HG2  . GLN A 1 19  ? 16.184  7.677   -5.292  1.00 0.00 ? 19  GLN A HG2  3  
ATOM 7356  H HG3  . GLN A 1 19  ? 16.914  7.733   -3.688  1.00 0.00 ? 19  GLN A HG3  3  
ATOM 7357  H HE21 . GLN A 1 19  ? 17.836  7.497   -7.163  1.00 0.00 ? 19  GLN A HE21 3  
ATOM 7358  H HE22 . GLN A 1 19  ? 19.315  8.310   -6.978  1.00 0.00 ? 19  GLN A HE22 3  
ATOM 7359  N N    . LEU A 1 20  ? 16.059  5.440   -1.709  1.00 0.00 ? 20  LEU A N    3  
ATOM 7360  C CA   . LEU A 1 20  ? 15.764  6.067   -0.395  1.00 0.00 ? 20  LEU A CA   3  
ATOM 7361  C C    . LEU A 1 20  ? 16.693  5.493   0.668   1.00 0.00 ? 20  LEU A C    3  
ATOM 7362  O O    . LEU A 1 20  ? 16.265  5.131   1.746   1.00 0.00 ? 20  LEU A O    3  
ATOM 7363  C CB   . LEU A 1 20  ? 14.314  5.772   -0.018  1.00 0.00 ? 20  LEU A CB   3  
ATOM 7364  C CG   . LEU A 1 20  ? 13.925  6.573   1.225   1.00 0.00 ? 20  LEU A CG   3  
ATOM 7365  C CD1  . LEU A 1 20  ? 13.892  8.061   0.880   1.00 0.00 ? 20  LEU A CD1  3  
ATOM 7366  C CD2  . LEU A 1 20  ? 12.541  6.126   1.698   1.00 0.00 ? 20  LEU A CD2  3  
ATOM 7367  H H    . LEU A 1 20  ? 16.640  4.652   -1.759  1.00 0.00 ? 20  LEU A H    3  
ATOM 7368  H HA   . LEU A 1 20  ? 15.908  7.135   -0.464  1.00 0.00 ? 20  LEU A HA   3  
ATOM 7369  H HB2  . LEU A 1 20  ? 13.674  6.053   -0.836  1.00 0.00 ? 20  LEU A HB2  3  
ATOM 7370  H HB3  . LEU A 1 20  ? 14.201  4.719   0.186   1.00 0.00 ? 20  LEU A HB3  3  
ATOM 7371  H HG   . LEU A 1 20  ? 14.648  6.402   2.008   1.00 0.00 ? 20  LEU A HG   3  
ATOM 7372  H HD11 . LEU A 1 20  ? 13.485  8.191   -0.112  1.00 0.00 ? 20  LEU A HD11 3  
ATOM 7373  H HD12 . LEU A 1 20  ? 13.274  8.583   1.594   1.00 0.00 ? 20  LEU A HD12 3  
ATOM 7374  H HD13 . LEU A 1 20  ? 14.896  8.460   0.911   1.00 0.00 ? 20  LEU A HD13 3  
ATOM 7375  H HD21 . LEU A 1 20  ? 11.823  6.276   0.904   1.00 0.00 ? 20  LEU A HD21 3  
ATOM 7376  H HD22 . LEU A 1 20  ? 12.572  5.080   1.962   1.00 0.00 ? 20  LEU A HD22 3  
ATOM 7377  H HD23 . LEU A 1 20  ? 12.250  6.707   2.561   1.00 0.00 ? 20  LEU A HD23 3  
ATOM 7378  N N    . TYR A 1 21  ? 17.963  5.408   0.383   1.00 0.00 ? 21  TYR A N    3  
ATOM 7379  C CA   . TYR A 1 21  ? 18.903  4.861   1.402   1.00 0.00 ? 21  TYR A CA   3  
ATOM 7380  C C    . TYR A 1 21  ? 18.573  5.493   2.752   1.00 0.00 ? 21  TYR A C    3  
ATOM 7381  O O    . TYR A 1 21  ? 18.336  6.680   2.848   1.00 0.00 ? 21  TYR A O    3  
ATOM 7382  C CB   . TYR A 1 21  ? 20.349  5.200   1.035   1.00 0.00 ? 21  TYR A CB   3  
ATOM 7383  C CG   . TYR A 1 21  ? 21.255  4.759   2.163   1.00 0.00 ? 21  TYR A CG   3  
ATOM 7384  C CD1  . TYR A 1 21  ? 21.299  5.495   3.357   1.00 0.00 ? 21  TYR A CD1  3  
ATOM 7385  C CD2  . TYR A 1 21  ? 22.042  3.612   2.019   1.00 0.00 ? 21  TYR A CD2  3  
ATOM 7386  C CE1  . TYR A 1 21  ? 22.132  5.081   4.405   1.00 0.00 ? 21  TYR A CE1  3  
ATOM 7387  C CE2  . TYR A 1 21  ? 22.874  3.198   3.067   1.00 0.00 ? 21  TYR A CE2  3  
ATOM 7388  C CZ   . TYR A 1 21  ? 22.919  3.932   4.259   1.00 0.00 ? 21  TYR A CZ   3  
ATOM 7389  O OH   . TYR A 1 21  ? 23.740  3.524   5.291   1.00 0.00 ? 21  TYR A OH   3  
ATOM 7390  H H    . TYR A 1 21  ? 18.293  5.703   -0.493  1.00 0.00 ? 21  TYR A H    3  
ATOM 7391  H HA   . TYR A 1 21  ? 18.787  3.789   1.466   1.00 0.00 ? 21  TYR A HA   3  
ATOM 7392  H HB2  . TYR A 1 21  ? 20.623  4.684   0.126   1.00 0.00 ? 21  TYR A HB2  3  
ATOM 7393  H HB3  . TYR A 1 21  ? 20.446  6.266   0.890   1.00 0.00 ? 21  TYR A HB3  3  
ATOM 7394  H HD1  . TYR A 1 21  ? 20.693  6.380   3.468   1.00 0.00 ? 21  TYR A HD1  3  
ATOM 7395  H HD2  . TYR A 1 21  ? 22.005  3.046   1.100   1.00 0.00 ? 21  TYR A HD2  3  
ATOM 7396  H HE1  . TYR A 1 21  ? 22.163  5.646   5.327   1.00 0.00 ? 21  TYR A HE1  3  
ATOM 7397  H HE2  . TYR A 1 21  ? 23.482  2.313   2.956   1.00 0.00 ? 21  TYR A HE2  3  
ATOM 7398  H HH   . TYR A 1 21  ? 24.072  2.648   5.078   1.00 0.00 ? 21  TYR A HH   3  
ATOM 7399  N N    . ILE A 1 22  ? 18.548  4.716   3.794   1.00 0.00 ? 22  ILE A N    3  
ATOM 7400  C CA   . ILE A 1 22  ? 18.221  5.291   5.124   1.00 0.00 ? 22  ILE A CA   3  
ATOM 7401  C C    . ILE A 1 22  ? 19.344  4.990   6.113   1.00 0.00 ? 22  ILE A C    3  
ATOM 7402  O O    . ILE A 1 22  ? 19.599  3.851   6.451   1.00 0.00 ? 22  ILE A O    3  
ATOM 7403  C CB   . ILE A 1 22  ? 16.919  4.675   5.635   1.00 0.00 ? 22  ILE A CB   3  
ATOM 7404  C CG1  . ILE A 1 22  ? 15.792  4.973   4.643   1.00 0.00 ? 22  ILE A CG1  3  
ATOM 7405  C CG2  . ILE A 1 22  ? 16.572  5.275   6.996   1.00 0.00 ? 22  ILE A CG2  3  
ATOM 7406  C CD1  . ILE A 1 22  ? 14.447  4.602   5.272   1.00 0.00 ? 22  ILE A CD1  3  
ATOM 7407  H H    . ILE A 1 22  ? 18.735  3.759   3.702   1.00 0.00 ? 22  ILE A H    3  
ATOM 7408  H HA   . ILE A 1 22  ? 18.099  6.359   5.033   1.00 0.00 ? 22  ILE A HA   3  
ATOM 7409  H HB   . ILE A 1 22  ? 17.041  3.605   5.734   1.00 0.00 ? 22  ILE A HB   3  
ATOM 7410  H HG12 . ILE A 1 22  ? 15.798  6.025   4.398   1.00 0.00 ? 22  ILE A HG12 3  
ATOM 7411  H HG13 . ILE A 1 22  ? 15.939  4.393   3.745   1.00 0.00 ? 22  ILE A HG13 3  
ATOM 7412  H HG21 . ILE A 1 22  ? 17.480  5.437   7.559   1.00 0.00 ? 22  ILE A HG21 3  
ATOM 7413  H HG22 . ILE A 1 22  ? 16.065  6.217   6.854   1.00 0.00 ? 22  ILE A HG22 3  
ATOM 7414  H HG23 . ILE A 1 22  ? 15.928  4.598   7.536   1.00 0.00 ? 22  ILE A HG23 3  
ATOM 7415  H HD11 . ILE A 1 22  ? 14.612  4.189   6.256   1.00 0.00 ? 22  ILE A HD11 3  
ATOM 7416  H HD12 . ILE A 1 22  ? 13.831  5.485   5.350   1.00 0.00 ? 22  ILE A HD12 3  
ATOM 7417  H HD13 . ILE A 1 22  ? 13.950  3.870   4.652   1.00 0.00 ? 22  ILE A HD13 3  
ATOM 7418  N N    . ASP A 1 23  ? 20.008  6.004   6.595   1.00 0.00 ? 23  ASP A N    3  
ATOM 7419  C CA   . ASP A 1 23  ? 21.098  5.771   7.579   1.00 0.00 ? 23  ASP A CA   3  
ATOM 7420  C C    . ASP A 1 23  ? 20.470  5.659   8.963   1.00 0.00 ? 23  ASP A C    3  
ATOM 7421  O O    . ASP A 1 23  ? 20.212  6.644   9.613   1.00 0.00 ? 23  ASP A O    3  
ATOM 7422  C CB   . ASP A 1 23  ? 22.091  6.931   7.544   1.00 0.00 ? 23  ASP A CB   3  
ATOM 7423  C CG   . ASP A 1 23  ? 23.195  6.691   8.575   1.00 0.00 ? 23  ASP A CG   3  
ATOM 7424  O OD1  . ASP A 1 23  ? 23.914  5.716   8.429   1.00 0.00 ? 23  ASP A OD1  3  
ATOM 7425  O OD2  . ASP A 1 23  ? 23.302  7.484   9.496   1.00 0.00 ? 23  ASP A OD2  3  
ATOM 7426  H H    . ASP A 1 23  ? 19.780  6.917   6.321   1.00 0.00 ? 23  ASP A H    3  
ATOM 7427  H HA   . ASP A 1 23  ? 21.608  4.852   7.346   1.00 0.00 ? 23  ASP A HA   3  
ATOM 7428  H HB2  . ASP A 1 23  ? 22.528  7.001   6.558   1.00 0.00 ? 23  ASP A HB2  3  
ATOM 7429  H HB3  . ASP A 1 23  ? 21.578  7.848   7.773   1.00 0.00 ? 23  ASP A HB3  3  
ATOM 7430  N N    . PHE A 1 24  ? 20.207  4.448   9.382   1.00 0.00 ? 24  PHE A N    3  
ATOM 7431  C CA   . PHE A 1 24  ? 19.568  4.175   10.711  1.00 0.00 ? 24  PHE A CA   3  
ATOM 7432  C C    . PHE A 1 24  ? 19.522  5.420   11.607  1.00 0.00 ? 24  PHE A C    3  
ATOM 7433  O O    . PHE A 1 24  ? 18.468  5.833   12.051  1.00 0.00 ? 24  PHE A O    3  
ATOM 7434  C CB   . PHE A 1 24  ? 20.363  3.082   11.428  1.00 0.00 ? 24  PHE A CB   3  
ATOM 7435  C CG   . PHE A 1 24  ? 19.846  1.727   11.011  1.00 0.00 ? 24  PHE A CG   3  
ATOM 7436  C CD1  . PHE A 1 24  ? 18.573  1.311   11.415  1.00 0.00 ? 24  PHE A CD1  3  
ATOM 7437  C CD2  . PHE A 1 24  ? 20.637  0.889   10.217  1.00 0.00 ? 24  PHE A CD2  3  
ATOM 7438  C CE1  . PHE A 1 24  ? 18.090  0.057   11.025  1.00 0.00 ? 24  PHE A CE1  3  
ATOM 7439  C CE2  . PHE A 1 24  ? 20.154  -0.367  9.830   1.00 0.00 ? 24  PHE A CE2  3  
ATOM 7440  C CZ   . PHE A 1 24  ? 18.882  -0.782  10.233  1.00 0.00 ? 24  PHE A CZ   3  
ATOM 7441  H H    . PHE A 1 24  ? 20.423  3.692   8.797   1.00 0.00 ? 24  PHE A H    3  
ATOM 7442  H HA   . PHE A 1 24  ? 18.561  3.821   10.551  1.00 0.00 ? 24  PHE A HA   3  
ATOM 7443  H HB2  . PHE A 1 24  ? 21.408  3.165   11.163  1.00 0.00 ? 24  PHE A HB2  3  
ATOM 7444  H HB3  . PHE A 1 24  ? 20.252  3.196   12.495  1.00 0.00 ? 24  PHE A HB3  3  
ATOM 7445  H HD1  . PHE A 1 24  ? 17.965  1.956   12.029  1.00 0.00 ? 24  PHE A HD1  3  
ATOM 7446  H HD2  . PHE A 1 24  ? 21.619  1.210   9.904   1.00 0.00 ? 24  PHE A HD2  3  
ATOM 7447  H HE1  . PHE A 1 24  ? 17.108  -0.264  11.337  1.00 0.00 ? 24  PHE A HE1  3  
ATOM 7448  H HE2  . PHE A 1 24  ? 20.765  -1.015  9.221   1.00 0.00 ? 24  PHE A HE2  3  
ATOM 7449  H HZ   . PHE A 1 24  ? 18.509  -1.749  9.932   1.00 0.00 ? 24  PHE A HZ   3  
ATOM 7450  N N    . ARG A 1 25  ? 20.651  6.004   11.901  1.00 0.00 ? 25  ARG A N    3  
ATOM 7451  C CA   . ARG A 1 25  ? 20.665  7.193   12.803  1.00 0.00 ? 25  ARG A CA   3  
ATOM 7452  C C    . ARG A 1 25  ? 20.387  8.496   12.039  1.00 0.00 ? 25  ARG A C    3  
ATOM 7453  O O    . ARG A 1 25  ? 19.700  9.369   12.531  1.00 0.00 ? 25  ARG A O    3  
ATOM 7454  C CB   . ARG A 1 25  ? 22.035  7.291   13.476  1.00 0.00 ? 25  ARG A CB   3  
ATOM 7455  C CG   . ARG A 1 25  ? 22.036  8.457   14.467  1.00 0.00 ? 25  ARG A CG   3  
ATOM 7456  C CD   . ARG A 1 25  ? 21.583  7.959   15.840  1.00 0.00 ? 25  ARG A CD   3  
ATOM 7457  N NE   . ARG A 1 25  ? 21.989  8.944   16.884  1.00 0.00 ? 25  ARG A NE   3  
ATOM 7458  C CZ   . ARG A 1 25  ? 23.144  8.824   17.481  1.00 0.00 ? 25  ARG A CZ   3  
ATOM 7459  N NH1  . ARG A 1 25  ? 24.047  8.014   16.999  1.00 0.00 ? 25  ARG A NH1  3  
ATOM 7460  N NH2  . ARG A 1 25  ? 23.393  9.512   18.561  1.00 0.00 ? 25  ARG A NH2  3  
ATOM 7461  H H    . ARG A 1 25  ? 21.493  5.645   11.550  1.00 0.00 ? 25  ARG A H    3  
ATOM 7462  H HA   . ARG A 1 25  ? 19.913  7.062   13.564  1.00 0.00 ? 25  ARG A HA   3  
ATOM 7463  H HB2  . ARG A 1 25  ? 22.244  6.371   14.002  1.00 0.00 ? 25  ARG A HB2  3  
ATOM 7464  H HB3  . ARG A 1 25  ? 22.794  7.458   12.726  1.00 0.00 ? 25  ARG A HB3  3  
ATOM 7465  H HG2  . ARG A 1 25  ? 23.033  8.866   14.541  1.00 0.00 ? 25  ARG A HG2  3  
ATOM 7466  H HG3  . ARG A 1 25  ? 21.357  9.223   14.123  1.00 0.00 ? 25  ARG A HG3  3  
ATOM 7467  H HD2  . ARG A 1 25  ? 20.510  7.848   15.848  1.00 0.00 ? 25  ARG A HD2  3  
ATOM 7468  H HD3  . ARG A 1 25  ? 22.046  7.005   16.047  1.00 0.00 ? 25  ARG A HD3  3  
ATOM 7469  H HE   . ARG A 1 25  ? 21.389  9.681   17.120  1.00 0.00 ? 25  ARG A HE   3  
ATOM 7470  H HH11 . ARG A 1 25  ? 23.855  7.487   16.172  1.00 0.00 ? 25  ARG A HH11 3  
ATOM 7471  H HH12 . ARG A 1 25  ? 24.930  7.922   17.456  1.00 0.00 ? 25  ARG A HH12 3  
ATOM 7472  H HH21 . ARG A 1 25  ? 22.701  10.132  18.932  1.00 0.00 ? 25  ARG A HH21 3  
ATOM 7473  H HH22 . ARG A 1 25  ? 24.278  9.421   19.019  1.00 0.00 ? 25  ARG A HH22 3  
ATOM 7474  N N    . LYS A 1 26  ? 20.935  8.662   10.869  1.00 0.00 ? 26  LYS A N    3  
ATOM 7475  C CA   . LYS A 1 26  ? 20.712  9.940   10.125  1.00 0.00 ? 26  LYS A CA   3  
ATOM 7476  C C    . LYS A 1 26  ? 19.236  10.116  9.768   1.00 0.00 ? 26  LYS A C    3  
ATOM 7477  O O    . LYS A 1 26  ? 18.666  11.175  9.943   1.00 0.00 ? 26  LYS A O    3  
ATOM 7478  C CB   . LYS A 1 26  ? 21.518  9.919   8.830   1.00 0.00 ? 26  LYS A CB   3  
ATOM 7479  C CG   . LYS A 1 26  ? 21.956  11.341  8.475   1.00 0.00 ? 26  LYS A CG   3  
ATOM 7480  C CD   . LYS A 1 26  ? 23.417  11.329  8.020   1.00 0.00 ? 26  LYS A CD   3  
ATOM 7481  C CE   . LYS A 1 26  ? 23.801  12.715  7.500   1.00 0.00 ? 26  LYS A CE   3  
ATOM 7482  N NZ   . LYS A 1 26  ? 25.078  12.624  6.739   1.00 0.00 ? 26  LYS A NZ   3  
ATOM 7483  H H    . LYS A 1 26  ? 21.512  7.962   10.487  1.00 0.00 ? 26  LYS A H    3  
ATOM 7484  H HA   . LYS A 1 26  ? 21.037  10.771  10.732  1.00 0.00 ? 26  LYS A HA   3  
ATOM 7485  H HB2  . LYS A 1 26  ? 22.381  9.287   8.953   1.00 0.00 ? 26  LYS A HB2  3  
ATOM 7486  H HB3  . LYS A 1 26  ? 20.900  9.532   8.033   1.00 0.00 ? 26  LYS A HB3  3  
ATOM 7487  H HG2  . LYS A 1 26  ? 21.333  11.722  7.678   1.00 0.00 ? 26  LYS A HG2  3  
ATOM 7488  H HG3  . LYS A 1 26  ? 21.857  11.975  9.344   1.00 0.00 ? 26  LYS A HG3  3  
ATOM 7489  H HD2  . LYS A 1 26  ? 24.051  11.067  8.855   1.00 0.00 ? 26  LYS A HD2  3  
ATOM 7490  H HD3  . LYS A 1 26  ? 23.542  10.602  7.230   1.00 0.00 ? 26  LYS A HD3  3  
ATOM 7491  H HE2  . LYS A 1 26  ? 23.021  13.085  6.852   1.00 0.00 ? 26  LYS A HE2  3  
ATOM 7492  H HE3  . LYS A 1 26  ? 23.927  13.390  8.335   1.00 0.00 ? 26  LYS A HE3  3  
ATOM 7493  H HZ1  . LYS A 1 26  ? 25.556  11.729  6.967   1.00 0.00 ? 26  LYS A HZ1  3  
ATOM 7494  H HZ2  . LYS A 1 26  ? 24.878  12.657  5.719   1.00 0.00 ? 26  LYS A HZ2  3  
ATOM 7495  H HZ3  . LYS A 1 26  ? 25.693  13.422  6.997   1.00 0.00 ? 26  LYS A HZ3  3  
ATOM 7496  N N    . ASP A 1 27  ? 18.628  9.103   9.226   1.00 0.00 ? 27  ASP A N    3  
ATOM 7497  C CA   . ASP A 1 27  ? 17.209  9.219   8.803   1.00 0.00 ? 27  ASP A CA   3  
ATOM 7498  C C    . ASP A 1 27  ? 16.244  8.852   9.938   1.00 0.00 ? 27  ASP A C    3  
ATOM 7499  O O    . ASP A 1 27  ? 15.432  9.657   10.348  1.00 0.00 ? 27  ASP A O    3  
ATOM 7500  C CB   . ASP A 1 27  ? 16.992  8.275   7.628   1.00 0.00 ? 27  ASP A CB   3  
ATOM 7501  C CG   . ASP A 1 27  ? 17.270  9.016   6.321   1.00 0.00 ? 27  ASP A CG   3  
ATOM 7502  O OD1  . ASP A 1 27  ? 16.629  10.028  6.089   1.00 0.00 ? 27  ASP A OD1  3  
ATOM 7503  O OD2  . ASP A 1 27  ? 18.119  8.560   5.574   1.00 0.00 ? 27  ASP A OD2  3  
ATOM 7504  H H    . ASP A 1 27  ? 19.117  8.275   9.058   1.00 0.00 ? 27  ASP A H    3  
ATOM 7505  H HA   . ASP A 1 27  ? 17.013  10.231  8.482   1.00 0.00 ? 27  ASP A HA   3  
ATOM 7506  H HB2  . ASP A 1 27  ? 17.665  7.433   7.716   1.00 0.00 ? 27  ASP A HB2  3  
ATOM 7507  H HB3  . ASP A 1 27  ? 15.978  7.923   7.636   1.00 0.00 ? 27  ASP A HB3  3  
ATOM 7508  N N    . LEU A 1 28  ? 16.296  7.646   10.432  1.00 0.00 ? 28  LEU A N    3  
ATOM 7509  C CA   . LEU A 1 28  ? 15.345  7.253   11.514  1.00 0.00 ? 28  LEU A CA   3  
ATOM 7510  C C    . LEU A 1 28  ? 15.924  7.591   12.886  1.00 0.00 ? 28  LEU A C    3  
ATOM 7511  O O    . LEU A 1 28  ? 15.221  7.600   13.877  1.00 0.00 ? 28  LEU A O    3  
ATOM 7512  C CB   . LEU A 1 28  ? 15.088  5.746   11.450  1.00 0.00 ? 28  LEU A CB   3  
ATOM 7513  C CG   . LEU A 1 28  ? 14.611  5.362   10.052  1.00 0.00 ? 28  LEU A CG   3  
ATOM 7514  C CD1  . LEU A 1 28  ? 14.193  3.890   10.048  1.00 0.00 ? 28  LEU A CD1  3  
ATOM 7515  C CD2  . LEU A 1 28  ? 13.413  6.230   9.664   1.00 0.00 ? 28  LEU A CD2  3  
ATOM 7516  H H    . LEU A 1 28  ? 16.939  6.995   10.077  1.00 0.00 ? 28  LEU A H    3  
ATOM 7517  H HA   . LEU A 1 28  ? 14.413  7.779   11.380  1.00 0.00 ? 28  LEU A HA   3  
ATOM 7518  H HB2  . LEU A 1 28  ? 16.001  5.217   11.678  1.00 0.00 ? 28  LEU A HB2  3  
ATOM 7519  H HB3  . LEU A 1 28  ? 14.329  5.481   12.172  1.00 0.00 ? 28  LEU A HB3  3  
ATOM 7520  H HG   . LEU A 1 28  ? 15.415  5.513   9.345   1.00 0.00 ? 28  LEU A HG   3  
ATOM 7521  H HD11 . LEU A 1 28  ? 14.440  3.443   11.000  1.00 0.00 ? 28  LEU A HD11 3  
ATOM 7522  H HD12 . LEU A 1 28  ? 13.128  3.818   9.882   1.00 0.00 ? 28  LEU A HD12 3  
ATOM 7523  H HD13 . LEU A 1 28  ? 14.716  3.368   9.259   1.00 0.00 ? 28  LEU A HD13 3  
ATOM 7524  H HD21 . LEU A 1 28  ? 12.964  6.643   10.555  1.00 0.00 ? 28  LEU A HD21 3  
ATOM 7525  H HD22 . LEU A 1 28  ? 13.743  7.032   9.021   1.00 0.00 ? 28  LEU A HD22 3  
ATOM 7526  H HD23 . LEU A 1 28  ? 12.685  5.626   9.141   1.00 0.00 ? 28  LEU A HD23 3  
ATOM 7527  N N    . GLY A 1 29  ? 17.196  7.854   12.967  1.00 0.00 ? 29  GLY A N    3  
ATOM 7528  C CA   . GLY A 1 29  ? 17.790  8.171   14.296  1.00 0.00 ? 29  GLY A CA   3  
ATOM 7529  C C    . GLY A 1 29  ? 17.636  6.952   15.206  1.00 0.00 ? 29  GLY A C    3  
ATOM 7530  O O    . GLY A 1 29  ? 17.811  7.030   16.407  1.00 0.00 ? 29  GLY A O    3  
ATOM 7531  H H    . GLY A 1 29  ? 17.758  7.833   12.163  1.00 0.00 ? 29  GLY A H    3  
ATOM 7532  H HA2  . GLY A 1 29  ? 18.836  8.414   14.179  1.00 0.00 ? 29  GLY A HA2  3  
ATOM 7533  H HA3  . GLY A 1 29  ? 17.271  9.010   14.733  1.00 0.00 ? 29  GLY A HA3  3  
ATOM 7534  N N    . TRP A 1 30  ? 17.304  5.821   14.638  1.00 0.00 ? 30  TRP A N    3  
ATOM 7535  C CA   . TRP A 1 30  ? 17.129  4.589   15.453  1.00 0.00 ? 30  TRP A CA   3  
ATOM 7536  C C    . TRP A 1 30  ? 18.275  4.466   16.454  1.00 0.00 ? 30  TRP A C    3  
ATOM 7537  O O    . TRP A 1 30  ? 19.436  4.519   16.097  1.00 0.00 ? 30  TRP A O    3  
ATOM 7538  C CB   . TRP A 1 30  ? 17.126  3.371   14.529  1.00 0.00 ? 30  TRP A CB   3  
ATOM 7539  C CG   . TRP A 1 30  ? 15.736  3.119   14.045  1.00 0.00 ? 30  TRP A CG   3  
ATOM 7540  C CD1  . TRP A 1 30  ? 14.704  3.988   14.153  1.00 0.00 ? 30  TRP A CD1  3  
ATOM 7541  C CD2  . TRP A 1 30  ? 15.207  1.936   13.385  1.00 0.00 ? 30  TRP A CD2  3  
ATOM 7542  N NE1  . TRP A 1 30  ? 13.576  3.412   13.598  1.00 0.00 ? 30  TRP A NE1  3  
ATOM 7543  C CE2  . TRP A 1 30  ? 13.835  2.146   13.112  1.00 0.00 ? 30  TRP A CE2  3  
ATOM 7544  C CE3  . TRP A 1 30  ? 15.780  0.713   12.999  1.00 0.00 ? 30  TRP A CE3  3  
ATOM 7545  C CZ2  . TRP A 1 30  ? 13.058  1.175   12.480  1.00 0.00 ? 30  TRP A CZ2  3  
ATOM 7546  C CZ3  . TRP A 1 30  ? 15.002  -0.267  12.363  1.00 0.00 ? 30  TRP A CZ3  3  
ATOM 7547  C CH2  . TRP A 1 30  ? 13.643  -0.036  12.104  1.00 0.00 ? 30  TRP A CH2  3  
ATOM 7548  H H    . TRP A 1 30  ? 17.166  5.784   13.671  1.00 0.00 ? 30  TRP A H    3  
ATOM 7549  H HA   . TRP A 1 30  ? 16.190  4.638   15.985  1.00 0.00 ? 30  TRP A HA   3  
ATOM 7550  H HB2  . TRP A 1 30  ? 17.773  3.559   13.685  1.00 0.00 ? 30  TRP A HB2  3  
ATOM 7551  H HB3  . TRP A 1 30  ? 17.483  2.507   15.070  1.00 0.00 ? 30  TRP A HB3  3  
ATOM 7552  H HD1  . TRP A 1 30  ? 14.754  4.971   14.597  1.00 0.00 ? 30  TRP A HD1  3  
ATOM 7553  H HE1  . TRP A 1 30  ? 12.693  3.833   13.549  1.00 0.00 ? 30  TRP A HE1  3  
ATOM 7554  H HE3  . TRP A 1 30  ? 16.828  0.526   13.193  1.00 0.00 ? 30  TRP A HE3  3  
ATOM 7555  H HZ2  . TRP A 1 30  ? 12.012  1.359   12.282  1.00 0.00 ? 30  TRP A HZ2  3  
ATOM 7556  H HZ3  . TRP A 1 30  ? 15.451  -1.205  12.074  1.00 0.00 ? 30  TRP A HZ3  3  
ATOM 7557  H HH2  . TRP A 1 30  ? 13.050  -0.794  11.614  1.00 0.00 ? 30  TRP A HH2  3  
ATOM 7558  N N    . LYS A 1 31  ? 17.956  4.310   17.706  1.00 0.00 ? 31  LYS A N    3  
ATOM 7559  C CA   . LYS A 1 31  ? 19.009  4.192   18.738  1.00 0.00 ? 31  LYS A CA   3  
ATOM 7560  C C    . LYS A 1 31  ? 19.099  2.741   19.209  1.00 0.00 ? 31  LYS A C    3  
ATOM 7561  O O    . LYS A 1 31  ? 20.012  2.365   19.918  1.00 0.00 ? 31  LYS A O    3  
ATOM 7562  C CB   . LYS A 1 31  ? 18.623  5.081   19.911  1.00 0.00 ? 31  LYS A CB   3  
ATOM 7563  C CG   . LYS A 1 31  ? 19.206  6.480   19.708  1.00 0.00 ? 31  LYS A CG   3  
ATOM 7564  C CD   . LYS A 1 31  ? 19.410  7.154   21.067  1.00 0.00 ? 31  LYS A CD   3  
ATOM 7565  C CE   . LYS A 1 31  ? 18.732  8.527   21.072  1.00 0.00 ? 31  LYS A CE   3  
ATOM 7566  N NZ   . LYS A 1 31  ? 18.821  9.138   19.715  1.00 0.00 ? 31  LYS A NZ   3  
ATOM 7567  H H    . LYS A 1 31  ? 17.018  4.277   17.975  1.00 0.00 ? 31  LYS A H    3  
ATOM 7568  H HA   . LYS A 1 31  ? 19.959  4.509   18.335  1.00 0.00 ? 31  LYS A HA   3  
ATOM 7569  H HB2  . LYS A 1 31  ? 17.545  5.141   19.967  1.00 0.00 ? 31  LYS A HB2  3  
ATOM 7570  H HB3  . LYS A 1 31  ? 19.004  4.656   20.818  1.00 0.00 ? 31  LYS A HB3  3  
ATOM 7571  H HG2  . LYS A 1 31  ? 20.156  6.402   19.197  1.00 0.00 ? 31  LYS A HG2  3  
ATOM 7572  H HG3  . LYS A 1 31  ? 18.524  7.068   19.114  1.00 0.00 ? 31  LYS A HG3  3  
ATOM 7573  H HD2  . LYS A 1 31  ? 18.980  6.537   21.843  1.00 0.00 ? 31  LYS A HD2  3  
ATOM 7574  H HD3  . LYS A 1 31  ? 20.467  7.277   21.251  1.00 0.00 ? 31  LYS A HD3  3  
ATOM 7575  H HE2  . LYS A 1 31  ? 17.694  8.414   21.347  1.00 0.00 ? 31  LYS A HE2  3  
ATOM 7576  H HE3  . LYS A 1 31  ? 19.225  9.169   21.788  1.00 0.00 ? 31  LYS A HE3  3  
ATOM 7577  H HZ1  . LYS A 1 31  ? 19.678  8.796   19.237  1.00 0.00 ? 31  LYS A HZ1  3  
ATOM 7578  H HZ2  . LYS A 1 31  ? 17.985  8.870   19.158  1.00 0.00 ? 31  LYS A HZ2  3  
ATOM 7579  H HZ3  . LYS A 1 31  ? 18.862  10.174  19.803  1.00 0.00 ? 31  LYS A HZ3  3  
ATOM 7580  N N    . TRP A 1 32  ? 18.154  1.923   18.834  1.00 0.00 ? 32  TRP A N    3  
ATOM 7581  C CA   . TRP A 1 32  ? 18.190  0.502   19.277  1.00 0.00 ? 32  TRP A CA   3  
ATOM 7582  C C    . TRP A 1 32  ? 19.029  -0.330  18.310  1.00 0.00 ? 32  TRP A C    3  
ATOM 7583  O O    . TRP A 1 32  ? 19.204  -1.515  18.498  1.00 0.00 ? 32  TRP A O    3  
ATOM 7584  C CB   . TRP A 1 32  ? 16.766  -0.059  19.339  1.00 0.00 ? 32  TRP A CB   3  
ATOM 7585  C CG   . TRP A 1 32  ? 16.263  -0.352  17.960  1.00 0.00 ? 32  TRP A CG   3  
ATOM 7586  C CD1  . TRP A 1 32  ? 15.781  0.570   17.099  1.00 0.00 ? 32  TRP A CD1  3  
ATOM 7587  C CD2  . TRP A 1 32  ? 16.180  -1.634  17.270  1.00 0.00 ? 32  TRP A CD2  3  
ATOM 7588  N NE1  . TRP A 1 32  ? 15.392  -0.062  15.936  1.00 0.00 ? 32  TRP A NE1  3  
ATOM 7589  C CE2  . TRP A 1 32  ? 15.621  -1.420  15.990  1.00 0.00 ? 32  TRP A CE2  3  
ATOM 7590  C CE3  . TRP A 1 32  ? 16.531  -2.947  17.628  1.00 0.00 ? 32  TRP A CE3  3  
ATOM 7591  C CZ2  . TRP A 1 32  ? 15.413  -2.472  15.098  1.00 0.00 ? 32  TRP A CZ2  3  
ATOM 7592  C CZ3  . TRP A 1 32  ? 16.326  -4.009  16.733  1.00 0.00 ? 32  TRP A CZ3  3  
ATOM 7593  C CH2  . TRP A 1 32  ? 15.766  -3.772  15.470  1.00 0.00 ? 32  TRP A CH2  3  
ATOM 7594  H H    . TRP A 1 32  ? 17.419  2.246   18.268  1.00 0.00 ? 32  TRP A H    3  
ATOM 7595  H HA   . TRP A 1 32  ? 18.631  0.452   20.260  1.00 0.00 ? 32  TRP A HA   3  
ATOM 7596  H HB2  . TRP A 1 32  ? 16.766  -0.970  19.920  1.00 0.00 ? 32  TRP A HB2  3  
ATOM 7597  H HB3  . TRP A 1 32  ? 16.118  0.664   19.811  1.00 0.00 ? 32  TRP A HB3  3  
ATOM 7598  H HD1  . TRP A 1 32  ? 15.707  1.626   17.289  1.00 0.00 ? 32  TRP A HD1  3  
ATOM 7599  H HE1  . TRP A 1 32  ? 15.004  0.384   15.159  1.00 0.00 ? 32  TRP A HE1  3  
ATOM 7600  H HE3  . TRP A 1 32  ? 16.969  -3.137  18.593  1.00 0.00 ? 32  TRP A HE3  3  
ATOM 7601  H HZ2  . TRP A 1 32  ? 14.981  -2.284  14.126  1.00 0.00 ? 32  TRP A HZ2  3  
ATOM 7602  H HZ3  . TRP A 1 32  ? 16.600  -5.016  17.021  1.00 0.00 ? 32  TRP A HZ3  3  
ATOM 7603  H HH2  . TRP A 1 32  ? 15.610  -4.590  14.782  1.00 0.00 ? 32  TRP A HH2  3  
ATOM 7604  N N    . ILE A 1 33  ? 19.548  0.273   17.277  1.00 0.00 ? 33  ILE A N    3  
ATOM 7605  C CA   . ILE A 1 33  ? 20.373  -0.500  16.308  1.00 0.00 ? 33  ILE A CA   3  
ATOM 7606  C C    . ILE A 1 33  ? 21.740  0.174   16.144  1.00 0.00 ? 33  ILE A C    3  
ATOM 7607  O O    . ILE A 1 33  ? 21.837  1.364   15.916  1.00 0.00 ? 33  ILE A O    3  
ATOM 7608  C CB   . ILE A 1 33  ? 19.644  -0.565  14.959  1.00 0.00 ? 33  ILE A CB   3  
ATOM 7609  C CG1  . ILE A 1 33  ? 18.629  -1.704  15.003  1.00 0.00 ? 33  ILE A CG1  3  
ATOM 7610  C CG2  . ILE A 1 33  ? 20.639  -0.826  13.823  1.00 0.00 ? 33  ILE A CG2  3  
ATOM 7611  C CD1  . ILE A 1 33  ? 17.792  -1.700  13.727  1.00 0.00 ? 33  ILE A CD1  3  
ATOM 7612  H H    . ILE A 1 33  ? 19.395  1.231   17.139  1.00 0.00 ? 33  ILE A H    3  
ATOM 7613  H HA   . ILE A 1 33  ? 20.513  -1.503  16.685  1.00 0.00 ? 33  ILE A HA   3  
ATOM 7614  H HB   . ILE A 1 33  ? 19.130  0.369   14.781  1.00 0.00 ? 33  ILE A HB   3  
ATOM 7615  H HG12 . ILE A 1 33  ? 19.149  -2.644  15.087  1.00 0.00 ? 33  ILE A HG12 3  
ATOM 7616  H HG13 . ILE A 1 33  ? 17.984  -1.574  15.854  1.00 0.00 ? 33  ILE A HG13 3  
ATOM 7617  H HG21 . ILE A 1 33  ? 21.262  -1.670  14.077  1.00 0.00 ? 33  ILE A HG21 3  
ATOM 7618  H HG22 . ILE A 1 33  ? 20.099  -1.038  12.913  1.00 0.00 ? 33  ILE A HG22 3  
ATOM 7619  H HG23 . ILE A 1 33  ? 21.259  0.048   13.679  1.00 0.00 ? 33  ILE A HG23 3  
ATOM 7620  H HD11 . ILE A 1 33  ? 18.355  -1.239  12.932  1.00 0.00 ? 33  ILE A HD11 3  
ATOM 7621  H HD12 . ILE A 1 33  ? 17.547  -2.715  13.454  1.00 0.00 ? 33  ILE A HD12 3  
ATOM 7622  H HD13 . ILE A 1 33  ? 16.885  -1.145  13.896  1.00 0.00 ? 33  ILE A HD13 3  
ATOM 7623  N N    . HIS A 1 34  ? 22.794  -0.586  16.256  1.00 0.00 ? 34  HIS A N    3  
ATOM 7624  C CA   . HIS A 1 34  ? 24.160  -0.009  16.107  1.00 0.00 ? 34  HIS A CA   3  
ATOM 7625  C C    . HIS A 1 34  ? 24.629  -0.195  14.660  1.00 0.00 ? 34  HIS A C    3  
ATOM 7626  O O    . HIS A 1 34  ? 25.036  0.744   14.005  1.00 0.00 ? 34  HIS A O    3  
ATOM 7627  C CB   . HIS A 1 34  ? 25.117  -0.732  17.063  1.00 0.00 ? 34  HIS A CB   3  
ATOM 7628  C CG   . HIS A 1 34  ? 26.544  -0.475  16.660  1.00 0.00 ? 34  HIS A CG   3  
ATOM 7629  N ND1  . HIS A 1 34  ? 27.068  0.805   16.564  1.00 0.00 ? 34  HIS A ND1  3  
ATOM 7630  C CD2  . HIS A 1 34  ? 27.569  -1.326  16.328  1.00 0.00 ? 34  HIS A CD2  3  
ATOM 7631  C CE1  . HIS A 1 34  ? 28.355  0.689   16.188  1.00 0.00 ? 34  HIS A CE1  3  
ATOM 7632  N NE2  . HIS A 1 34  ? 28.712  -0.589  16.031  1.00 0.00 ? 34  HIS A NE2  3  
ATOM 7633  H H    . HIS A 1 34  ? 22.686  -1.541  16.438  1.00 0.00 ? 34  HIS A H    3  
ATOM 7634  H HA   . HIS A 1 34  ? 24.136  1.043   16.347  1.00 0.00 ? 34  HIS A HA   3  
ATOM 7635  H HB2  . HIS A 1 34  ? 24.958  -0.372  18.069  1.00 0.00 ? 34  HIS A HB2  3  
ATOM 7636  H HB3  . HIS A 1 34  ? 24.921  -1.795  17.029  1.00 0.00 ? 34  HIS A HB3  3  
ATOM 7637  H HD1  . HIS A 1 34  ? 26.589  1.641   16.738  1.00 0.00 ? 34  HIS A HD1  3  
ATOM 7638  H HD2  . HIS A 1 34  ? 27.499  -2.404  16.303  1.00 0.00 ? 34  HIS A HD2  3  
ATOM 7639  H HE1  . HIS A 1 34  ? 29.019  1.526   16.033  1.00 0.00 ? 34  HIS A HE1  3  
ATOM 7640  N N    . GLU A 1 35  ? 24.574  -1.398  14.159  1.00 0.00 ? 35  GLU A N    3  
ATOM 7641  C CA   . GLU A 1 35  ? 25.016  -1.643  12.756  1.00 0.00 ? 35  GLU A CA   3  
ATOM 7642  C C    . GLU A 1 35  ? 23.932  -2.432  12.014  1.00 0.00 ? 35  GLU A C    3  
ATOM 7643  O O    . GLU A 1 35  ? 23.173  -3.159  12.620  1.00 0.00 ? 35  GLU A O    3  
ATOM 7644  C CB   . GLU A 1 35  ? 26.317  -2.448  12.763  1.00 0.00 ? 35  GLU A CB   3  
ATOM 7645  C CG   . GLU A 1 35  ? 27.509  -1.492  12.847  1.00 0.00 ? 35  GLU A CG   3  
ATOM 7646  C CD   . GLU A 1 35  ? 28.666  -2.043  12.011  1.00 0.00 ? 35  GLU A CD   3  
ATOM 7647  O OE1  . GLU A 1 35  ? 28.781  -3.253  11.920  1.00 0.00 ? 35  GLU A OE1  3  
ATOM 7648  O OE2  . GLU A 1 35  ? 29.417  -1.244  11.476  1.00 0.00 ? 35  GLU A OE2  3  
ATOM 7649  H H    . GLU A 1 35  ? 24.242  -2.141  14.704  1.00 0.00 ? 35  GLU A H    3  
ATOM 7650  H HA   . GLU A 1 35  ? 25.178  -0.699  12.258  1.00 0.00 ? 35  GLU A HA   3  
ATOM 7651  H HB2  . GLU A 1 35  ? 26.325  -3.112  13.615  1.00 0.00 ? 35  GLU A HB2  3  
ATOM 7652  H HB3  . GLU A 1 35  ? 26.388  -3.028  11.854  1.00 0.00 ? 35  GLU A HB3  3  
ATOM 7653  H HG2  . GLU A 1 35  ? 27.220  -0.523  12.469  1.00 0.00 ? 35  GLU A HG2  3  
ATOM 7654  H HG3  . GLU A 1 35  ? 27.823  -1.399  13.876  1.00 0.00 ? 35  GLU A HG3  3  
ATOM 7655  N N    . PRO A 1 36  ? 23.892  -2.261  10.717  1.00 0.00 ? 36  PRO A N    3  
ATOM 7656  C CA   . PRO A 1 36  ? 24.819  -1.375  9.991   1.00 0.00 ? 36  PRO A CA   3  
ATOM 7657  C C    . PRO A 1 36  ? 24.407  0.087   10.165  1.00 0.00 ? 36  PRO A C    3  
ATOM 7658  O O    . PRO A 1 36  ? 23.369  0.389   10.720  1.00 0.00 ? 36  PRO A O    3  
ATOM 7659  C CB   . PRO A 1 36  ? 24.669  -1.816  8.533   1.00 0.00 ? 36  PRO A CB   3  
ATOM 7660  C CG   . PRO A 1 36  ? 23.291  -2.511  8.428   1.00 0.00 ? 36  PRO A CG   3  
ATOM 7661  C CD   . PRO A 1 36  ? 22.905  -2.942  9.856   1.00 0.00 ? 36  PRO A CD   3  
ATOM 7662  H HA   . PRO A 1 36  ? 25.833  -1.527  10.320  1.00 0.00 ? 36  PRO A HA   3  
ATOM 7663  H HB2  . PRO A 1 36  ? 24.706  -0.955  7.879   1.00 0.00 ? 36  PRO A HB2  3  
ATOM 7664  H HB3  . PRO A 1 36  ? 25.448  -2.514  8.273   1.00 0.00 ? 36  PRO A HB3  3  
ATOM 7665  H HG2  . PRO A 1 36  ? 22.558  -1.819  8.035   1.00 0.00 ? 36  PRO A HG2  3  
ATOM 7666  H HG3  . PRO A 1 36  ? 23.360  -3.379  7.792   1.00 0.00 ? 36  PRO A HG3  3  
ATOM 7667  H HD2  . PRO A 1 36  ? 21.902  -2.612  10.091  1.00 0.00 ? 36  PRO A HD2  3  
ATOM 7668  H HD3  . PRO A 1 36  ? 22.990  -4.011  9.965   1.00 0.00 ? 36  PRO A HD3  3  
ATOM 7669  N N    . LYS A 1 37  ? 25.209  0.996   9.688   1.00 0.00 ? 37  LYS A N    3  
ATOM 7670  C CA   . LYS A 1 37  ? 24.871  2.431   9.812   1.00 0.00 ? 37  LYS A CA   3  
ATOM 7671  C C    . LYS A 1 37  ? 23.557  2.705   9.085   1.00 0.00 ? 37  LYS A C    3  
ATOM 7672  O O    . LYS A 1 37  ? 22.753  3.511   9.508   1.00 0.00 ? 37  LYS A O    3  
ATOM 7673  C CB   . LYS A 1 37  ? 25.988  3.242   9.171   1.00 0.00 ? 37  LYS A CB   3  
ATOM 7674  C CG   . LYS A 1 37  ? 27.043  3.590   10.223  1.00 0.00 ? 37  LYS A CG   3  
ATOM 7675  C CD   . LYS A 1 37  ? 27.435  5.062   10.088  1.00 0.00 ? 37  LYS A CD   3  
ATOM 7676  C CE   . LYS A 1 37  ? 28.957  5.194   10.167  1.00 0.00 ? 37  LYS A CE   3  
ATOM 7677  N NZ   . LYS A 1 37  ? 29.382  6.446   9.478   1.00 0.00 ? 37  LYS A NZ   3  
ATOM 7678  H H    . LYS A 1 37  ? 26.037  0.735   9.238   1.00 0.00 ? 37  LYS A H    3  
ATOM 7679  H HA   . LYS A 1 37  ? 24.778  2.699   10.855  1.00 0.00 ? 37  LYS A HA   3  
ATOM 7680  H HB2  . LYS A 1 37  ? 26.442  2.659   8.383   1.00 0.00 ? 37  LYS A HB2  3  
ATOM 7681  H HB3  . LYS A 1 37  ? 25.579  4.141   8.757   1.00 0.00 ? 37  LYS A HB3  3  
ATOM 7682  H HG2  . LYS A 1 37  ? 26.638  3.413   11.210  1.00 0.00 ? 37  LYS A HG2  3  
ATOM 7683  H HG3  . LYS A 1 37  ? 27.916  2.971   10.076  1.00 0.00 ? 37  LYS A HG3  3  
ATOM 7684  H HD2  . LYS A 1 37  ? 27.089  5.440   9.138   1.00 0.00 ? 37  LYS A HD2  3  
ATOM 7685  H HD3  . LYS A 1 37  ? 26.984  5.629   10.888  1.00 0.00 ? 37  LYS A HD3  3  
ATOM 7686  H HE2  . LYS A 1 37  ? 29.261  5.233   11.203  1.00 0.00 ? 37  LYS A HE2  3  
ATOM 7687  H HE3  . LYS A 1 37  ? 29.419  4.345   9.687   1.00 0.00 ? 37  LYS A HE3  3  
ATOM 7688  H HZ1  . LYS A 1 37  ? 28.711  7.208   9.698   1.00 0.00 ? 37  LYS A HZ1  3  
ATOM 7689  H HZ2  . LYS A 1 37  ? 30.330  6.718   9.806   1.00 0.00 ? 37  LYS A HZ2  3  
ATOM 7690  H HZ3  . LYS A 1 37  ? 29.404  6.285   8.450   1.00 0.00 ? 37  LYS A HZ3  3  
ATOM 7691  N N    . GLY A 1 38  ? 23.339  2.037   7.988   1.00 0.00 ? 38  GLY A N    3  
ATOM 7692  C CA   . GLY A 1 38  ? 22.080  2.251   7.220   1.00 0.00 ? 38  GLY A CA   3  
ATOM 7693  C C    . GLY A 1 38  ? 21.887  1.111   6.220   1.00 0.00 ? 38  GLY A C    3  
ATOM 7694  O O    . GLY A 1 38  ? 22.396  0.022   6.399   1.00 0.00 ? 38  GLY A O    3  
ATOM 7695  H H    . GLY A 1 38  ? 24.007  1.393   7.670   1.00 0.00 ? 38  GLY A H    3  
ATOM 7696  H HA2  . GLY A 1 38  ? 21.243  2.277   7.904   1.00 0.00 ? 38  GLY A HA2  3  
ATOM 7697  H HA3  . GLY A 1 38  ? 22.139  3.187   6.687   1.00 0.00 ? 38  GLY A HA3  3  
ATOM 7698  N N    . TYR A 1 39  ? 21.155  1.351   5.167   1.00 0.00 ? 39  TYR A N    3  
ATOM 7699  C CA   . TYR A 1 39  ? 20.929  0.281   4.158   1.00 0.00 ? 39  TYR A CA   3  
ATOM 7700  C C    . TYR A 1 39  ? 20.045  0.819   3.030   1.00 0.00 ? 39  TYR A C    3  
ATOM 7701  O O    . TYR A 1 39  ? 19.573  1.937   3.079   1.00 0.00 ? 39  TYR A O    3  
ATOM 7702  C CB   . TYR A 1 39  ? 20.241  -0.911  4.830   1.00 0.00 ? 39  TYR A CB   3  
ATOM 7703  C CG   . TYR A 1 39  ? 18.793  -0.579  5.105   1.00 0.00 ? 39  TYR A CG   3  
ATOM 7704  C CD1  . TYR A 1 39  ? 18.460  0.390   6.061   1.00 0.00 ? 39  TYR A CD1  3  
ATOM 7705  C CD2  . TYR A 1 39  ? 17.782  -1.244  4.402   1.00 0.00 ? 39  TYR A CD2  3  
ATOM 7706  C CE1  . TYR A 1 39  ? 17.116  0.691   6.313   1.00 0.00 ? 39  TYR A CE1  3  
ATOM 7707  C CE2  . TYR A 1 39  ? 16.439  -0.942  4.654   1.00 0.00 ? 39  TYR A CE2  3  
ATOM 7708  C CZ   . TYR A 1 39  ? 16.106  0.025   5.609   1.00 0.00 ? 39  TYR A CZ   3  
ATOM 7709  O OH   . TYR A 1 39  ? 14.782  0.321   5.857   1.00 0.00 ? 39  TYR A OH   3  
ATOM 7710  H H    . TYR A 1 39  ? 20.753  2.237   5.042   1.00 0.00 ? 39  TYR A H    3  
ATOM 7711  H HA   . TYR A 1 39  ? 21.878  -0.035  3.751   1.00 0.00 ? 39  TYR A HA   3  
ATOM 7712  H HB2  . TYR A 1 39  ? 20.296  -1.771  4.179   1.00 0.00 ? 39  TYR A HB2  3  
ATOM 7713  H HB3  . TYR A 1 39  ? 20.740  -1.135  5.762   1.00 0.00 ? 39  TYR A HB3  3  
ATOM 7714  H HD1  . TYR A 1 39  ? 19.237  0.905   6.604   1.00 0.00 ? 39  TYR A HD1  3  
ATOM 7715  H HD2  . TYR A 1 39  ? 18.038  -1.989  3.665   1.00 0.00 ? 39  TYR A HD2  3  
ATOM 7716  H HE1  . TYR A 1 39  ? 16.859  1.437   7.049   1.00 0.00 ? 39  TYR A HE1  3  
ATOM 7717  H HE2  . TYR A 1 39  ? 15.662  -1.456  4.111   1.00 0.00 ? 39  TYR A HE2  3  
ATOM 7718  H HH   . TYR A 1 39  ? 14.627  0.221   6.800   1.00 0.00 ? 39  TYR A HH   3  
ATOM 7719  N N    . HIS A 1 40  ? 19.813  0.031   2.015   1.00 0.00 ? 40  HIS A N    3  
ATOM 7720  C CA   . HIS A 1 40  ? 18.957  0.500   0.890   1.00 0.00 ? 40  HIS A CA   3  
ATOM 7721  C C    . HIS A 1 40  ? 17.499  0.161   1.198   1.00 0.00 ? 40  HIS A C    3  
ATOM 7722  O O    . HIS A 1 40  ? 16.965  -0.823  0.722   1.00 0.00 ? 40  HIS A O    3  
ATOM 7723  C CB   . HIS A 1 40  ? 19.383  -0.198  -0.404  1.00 0.00 ? 40  HIS A CB   3  
ATOM 7724  C CG   . HIS A 1 40  ? 20.859  -0.008  -0.614  1.00 0.00 ? 40  HIS A CG   3  
ATOM 7725  N ND1  . HIS A 1 40  ? 21.805  -0.678  0.146   1.00 0.00 ? 40  HIS A ND1  3  
ATOM 7726  C CD2  . HIS A 1 40  ? 21.568  0.772   -1.494  1.00 0.00 ? 40  HIS A CD2  3  
ATOM 7727  C CE1  . HIS A 1 40  ? 23.020  -0.292  -0.287  1.00 0.00 ? 40  HIS A CE1  3  
ATOM 7728  N NE2  . HIS A 1 40  ? 22.932  0.592   -1.285  1.00 0.00 ? 40  HIS A NE2  3  
ATOM 7729  H H    . HIS A 1 40  ? 20.198  -0.870  1.995   1.00 0.00 ? 40  HIS A H    3  
ATOM 7730  H HA   . HIS A 1 40  ? 19.063  1.569   0.777   1.00 0.00 ? 40  HIS A HA   3  
ATOM 7731  H HB2  . HIS A 1 40  ? 19.161  -1.252  -0.334  1.00 0.00 ? 40  HIS A HB2  3  
ATOM 7732  H HB3  . HIS A 1 40  ? 18.843  0.230   -1.237  1.00 0.00 ? 40  HIS A HB3  3  
ATOM 7733  H HD1  . HIS A 1 40  ? 21.624  -1.317  0.866   1.00 0.00 ? 40  HIS A HD1  3  
ATOM 7734  H HD2  . HIS A 1 40  ? 21.133  1.426   -2.235  1.00 0.00 ? 40  HIS A HD2  3  
ATOM 7735  H HE1  . HIS A 1 40  ? 23.952  -0.652  0.123   1.00 0.00 ? 40  HIS A HE1  3  
ATOM 7736  N N    . ALA A 1 41  ? 16.851  0.961   1.998   1.00 0.00 ? 41  ALA A N    3  
ATOM 7737  C CA   . ALA A 1 41  ? 15.431  0.678   2.345   1.00 0.00 ? 41  ALA A CA   3  
ATOM 7738  C C    . ALA A 1 41  ? 14.541  0.894   1.124   1.00 0.00 ? 41  ALA A C    3  
ATOM 7739  O O    . ALA A 1 41  ? 13.484  0.307   1.009   1.00 0.00 ? 41  ALA A O    3  
ATOM 7740  C CB   . ALA A 1 41  ? 14.977  1.615   3.465   1.00 0.00 ? 41  ALA A CB   3  
ATOM 7741  H H    . ALA A 1 41  ? 17.302  1.745   2.376   1.00 0.00 ? 41  ALA A H    3  
ATOM 7742  H HA   . ALA A 1 41  ? 15.341  -0.344  2.674   1.00 0.00 ? 41  ALA A HA   3  
ATOM 7743  H HB1  . ALA A 1 41  ? 15.806  1.815   4.127   1.00 0.00 ? 41  ALA A HB1  3  
ATOM 7744  H HB2  . ALA A 1 41  ? 14.626  2.543   3.037   1.00 0.00 ? 41  ALA A HB2  3  
ATOM 7745  H HB3  . ALA A 1 41  ? 14.175  1.151   4.021   1.00 0.00 ? 41  ALA A HB3  3  
ATOM 7746  N N    . ASN A 1 42  ? 14.941  1.742   0.214   1.00 0.00 ? 42  ASN A N    3  
ATOM 7747  C CA   . ASN A 1 42  ? 14.082  1.986   -0.974  1.00 0.00 ? 42  ASN A CA   3  
ATOM 7748  C C    . ASN A 1 42  ? 12.689  2.357   -0.477  1.00 0.00 ? 42  ASN A C    3  
ATOM 7749  O O    . ASN A 1 42  ? 12.432  2.358   0.711   1.00 0.00 ? 42  ASN A O    3  
ATOM 7750  C CB   . ASN A 1 42  ? 13.999  0.714   -1.819  1.00 0.00 ? 42  ASN A CB   3  
ATOM 7751  C CG   . ASN A 1 42  ? 15.075  0.750   -2.907  1.00 0.00 ? 42  ASN A CG   3  
ATOM 7752  O OD1  . ASN A 1 42  ? 14.769  0.860   -4.077  1.00 0.00 ? 42  ASN A OD1  3  
ATOM 7753  N ND2  . ASN A 1 42  ? 16.332  0.660   -2.566  1.00 0.00 ? 42  ASN A ND2  3  
ATOM 7754  H H    . ASN A 1 42  ? 15.789  2.221   0.320   1.00 0.00 ? 42  ASN A H    3  
ATOM 7755  H HA   . ASN A 1 42  ? 14.490  2.795   -1.563  1.00 0.00 ? 42  ASN A HA   3  
ATOM 7756  H HB2  . ASN A 1 42  ? 14.153  -0.149  -1.186  1.00 0.00 ? 42  ASN A HB2  3  
ATOM 7757  H HB3  . ASN A 1 42  ? 13.025  0.650   -2.280  1.00 0.00 ? 42  ASN A HB3  3  
ATOM 7758  H HD21 . ASN A 1 42  ? 16.579  0.571   -1.623  1.00 0.00 ? 42  ASN A HD21 3  
ATOM 7759  H HD22 . ASN A 1 42  ? 17.029  0.682   -3.256  1.00 0.00 ? 42  ASN A HD22 3  
ATOM 7760  N N    . PHE A 1 43  ? 11.777  2.665   -1.351  1.00 0.00 ? 43  PHE A N    3  
ATOM 7761  C CA   . PHE A 1 43  ? 10.416  3.016   -0.868  1.00 0.00 ? 43  PHE A CA   3  
ATOM 7762  C C    . PHE A 1 43  ? 9.467   3.230   -2.045  1.00 0.00 ? 43  PHE A C    3  
ATOM 7763  O O    . PHE A 1 43  ? 9.819   3.816   -3.049  1.00 0.00 ? 43  PHE A O    3  
ATOM 7764  C CB   . PHE A 1 43  ? 10.491  4.285   -0.007  1.00 0.00 ? 43  PHE A CB   3  
ATOM 7765  C CG   . PHE A 1 43  ? 10.491  5.516   -0.876  1.00 0.00 ? 43  PHE A CG   3  
ATOM 7766  C CD1  . PHE A 1 43  ? 11.571  5.776   -1.723  1.00 0.00 ? 43  PHE A CD1  3  
ATOM 7767  C CD2  . PHE A 1 43  ? 9.411   6.403   -0.823  1.00 0.00 ? 43  PHE A CD2  3  
ATOM 7768  C CE1  . PHE A 1 43  ? 11.573  6.927   -2.516  1.00 0.00 ? 43  PHE A CE1  3  
ATOM 7769  C CE2  . PHE A 1 43  ? 9.413   7.548   -1.617  1.00 0.00 ? 43  PHE A CE2  3  
ATOM 7770  C CZ   . PHE A 1 43  ? 10.492  7.814   -2.464  1.00 0.00 ? 43  PHE A CZ   3  
ATOM 7771  H H    . PHE A 1 43  ? 11.981  2.660   -2.311  1.00 0.00 ? 43  PHE A H    3  
ATOM 7772  H HA   . PHE A 1 43  ? 10.042  2.204   -0.265  1.00 0.00 ? 43  PHE A HA   3  
ATOM 7773  H HB2  . PHE A 1 43  ? 9.640   4.322   0.652   1.00 0.00 ? 43  PHE A HB2  3  
ATOM 7774  H HB3  . PHE A 1 43  ? 11.397  4.265   0.581   1.00 0.00 ? 43  PHE A HB3  3  
ATOM 7775  H HD1  . PHE A 1 43  ? 12.402  5.088   -1.765  1.00 0.00 ? 43  PHE A HD1  3  
ATOM 7776  H HD2  . PHE A 1 43  ? 8.574   6.203   -0.171  1.00 0.00 ? 43  PHE A HD2  3  
ATOM 7777  H HE1  . PHE A 1 43  ? 12.406  7.131   -3.170  1.00 0.00 ? 43  PHE A HE1  3  
ATOM 7778  H HE2  . PHE A 1 43  ? 8.581   8.225   -1.574  1.00 0.00 ? 43  PHE A HE2  3  
ATOM 7779  H HZ   . PHE A 1 43  ? 10.493  8.703   -3.077  1.00 0.00 ? 43  PHE A HZ   3  
ATOM 7780  N N    . CYS A 1 44  ? 8.260   2.761   -1.914  1.00 0.00 ? 44  CYS A N    3  
ATOM 7781  C CA   . CYS A 1 44  ? 7.266   2.930   -3.006  1.00 0.00 ? 44  CYS A CA   3  
ATOM 7782  C C    . CYS A 1 44  ? 6.382   4.127   -2.651  1.00 0.00 ? 44  CYS A C    3  
ATOM 7783  O O    . CYS A 1 44  ? 5.788   4.169   -1.591  1.00 0.00 ? 44  CYS A O    3  
ATOM 7784  C CB   . CYS A 1 44  ? 6.394   1.672   -3.112  1.00 0.00 ? 44  CYS A CB   3  
ATOM 7785  S SG   . CYS A 1 44  ? 7.324   0.217   -2.562  1.00 0.00 ? 44  CYS A SG   3  
ATOM 7786  H H    . CYS A 1 44  ? 8.004   2.298   -1.089  1.00 0.00 ? 44  CYS A H    3  
ATOM 7787  H HA   . CYS A 1 44  ? 7.777   3.109   -3.942  1.00 0.00 ? 44  CYS A HA   3  
ATOM 7788  H HB2  . CYS A 1 44  ? 5.517   1.790   -2.495  1.00 0.00 ? 44  CYS A HB2  3  
ATOM 7789  H HB3  . CYS A 1 44  ? 6.092   1.536   -4.139  1.00 0.00 ? 44  CYS A HB3  3  
ATOM 7790  N N    . LEU A 1 45  ? 6.295   5.110   -3.503  1.00 0.00 ? 45  LEU A N    3  
ATOM 7791  C CA   . LEU A 1 45  ? 5.456   6.293   -3.158  1.00 0.00 ? 45  LEU A CA   3  
ATOM 7792  C C    . LEU A 1 45  ? 3.965   5.937   -3.196  1.00 0.00 ? 45  LEU A C    3  
ATOM 7793  O O    . LEU A 1 45  ? 3.595   4.786   -3.135  1.00 0.00 ? 45  LEU A O    3  
ATOM 7794  C CB   . LEU A 1 45  ? 5.775   7.447   -4.113  1.00 0.00 ? 45  LEU A CB   3  
ATOM 7795  C CG   . LEU A 1 45  ? 6.881   8.311   -3.510  1.00 0.00 ? 45  LEU A CG   3  
ATOM 7796  C CD1  . LEU A 1 45  ? 7.141   9.515   -4.417  1.00 0.00 ? 45  LEU A CD1  3  
ATOM 7797  C CD2  . LEU A 1 45  ? 6.441   8.798   -2.129  1.00 0.00 ? 45  LEU A CD2  3  
ATOM 7798  H H    . LEU A 1 45  ? 6.792   5.078   -4.353  1.00 0.00 ? 45  LEU A H    3  
ATOM 7799  H HA   . LEU A 1 45  ? 5.698   6.593   -2.158  1.00 0.00 ? 45  LEU A HA   3  
ATOM 7800  H HB2  . LEU A 1 45  ? 6.114   7.049   -5.055  1.00 0.00 ? 45  LEU A HB2  3  
ATOM 7801  H HB3  . LEU A 1 45  ? 4.898   8.050   -4.267  1.00 0.00 ? 45  LEU A HB3  3  
ATOM 7802  H HG   . LEU A 1 45  ? 7.785   7.727   -3.418  1.00 0.00 ? 45  LEU A HG   3  
ATOM 7803  H HD11 . LEU A 1 45  ? 6.318   9.630   -5.108  1.00 0.00 ? 45  LEU A HD11 3  
ATOM 7804  H HD12 . LEU A 1 45  ? 7.231   10.407  -3.814  1.00 0.00 ? 45  LEU A HD12 3  
ATOM 7805  H HD13 . LEU A 1 45  ? 8.055   9.359   -4.969  1.00 0.00 ? 45  LEU A HD13 3  
ATOM 7806  H HD21 . LEU A 1 45  ? 5.382   9.009   -2.141  1.00 0.00 ? 45  LEU A HD21 3  
ATOM 7807  H HD22 . LEU A 1 45  ? 6.646   8.031   -1.396  1.00 0.00 ? 45  LEU A HD22 3  
ATOM 7808  H HD23 . LEU A 1 45  ? 6.985   9.694   -1.872  1.00 0.00 ? 45  LEU A HD23 3  
ATOM 7809  N N    . GLY A 1 46  ? 3.103   6.920   -3.227  1.00 0.00 ? 46  GLY A N    3  
ATOM 7810  C CA   . GLY A 1 46  ? 1.637   6.628   -3.206  1.00 0.00 ? 46  GLY A CA   3  
ATOM 7811  C C    . GLY A 1 46  ? 0.908   6.892   -4.553  1.00 0.00 ? 46  GLY A C    3  
ATOM 7812  O O    . GLY A 1 46  ? -0.224  6.471   -4.689  1.00 0.00 ? 46  GLY A O    3  
ATOM 7813  H H    . GLY A 1 46  ? 3.416   7.845   -3.214  1.00 0.00 ? 46  GLY A H    3  
ATOM 7814  H HA2  . GLY A 1 46  ? 1.500   5.590   -2.943  1.00 0.00 ? 46  GLY A HA2  3  
ATOM 7815  H HA3  . GLY A 1 46  ? 1.179   7.239   -2.441  1.00 0.00 ? 46  GLY A HA3  3  
ATOM 7816  N N    . PRO A 1 47  ? 1.515   7.574   -5.511  1.00 0.00 ? 47  PRO A N    3  
ATOM 7817  C CA   . PRO A 1 47  ? 0.835   7.852   -6.792  1.00 0.00 ? 47  PRO A CA   3  
ATOM 7818  C C    . PRO A 1 47  ? 0.789   6.602   -7.669  1.00 0.00 ? 47  PRO A C    3  
ATOM 7819  O O    . PRO A 1 47  ? 1.803   6.060   -8.055  1.00 0.00 ? 47  PRO A O    3  
ATOM 7820  C CB   . PRO A 1 47  ? 1.690   8.934   -7.442  1.00 0.00 ? 47  PRO A CB   3  
ATOM 7821  C CG   . PRO A 1 47  ? 3.086   8.817   -6.799  1.00 0.00 ? 47  PRO A CG   3  
ATOM 7822  C CD   . PRO A 1 47  ? 2.884   8.117   -5.443  1.00 0.00 ? 47  PRO A CD   3  
ATOM 7823  H HA   . PRO A 1 47  ? -0.160  8.228   -6.618  1.00 0.00 ? 47  PRO A HA   3  
ATOM 7824  H HB2  . PRO A 1 47  ? 1.751   8.765   -8.509  1.00 0.00 ? 47  PRO A HB2  3  
ATOM 7825  H HB3  . PRO A 1 47  ? 1.276   9.909   -7.240  1.00 0.00 ? 47  PRO A HB3  3  
ATOM 7826  H HG2  . PRO A 1 47  ? 3.732   8.226   -7.432  1.00 0.00 ? 47  PRO A HG2  3  
ATOM 7827  H HG3  . PRO A 1 47  ? 3.505   9.797   -6.646  1.00 0.00 ? 47  PRO A HG3  3  
ATOM 7828  H HD2  . PRO A 1 47  ? 3.603   7.319   -5.323  1.00 0.00 ? 47  PRO A HD2  3  
ATOM 7829  H HD3  . PRO A 1 47  ? 2.962   8.831   -4.640  1.00 0.00 ? 47  PRO A HD3  3  
ATOM 7830  N N    . CYS A 1 48  ? -0.388  6.157   -7.991  1.00 0.00 ? 48  CYS A N    3  
ATOM 7831  C CA   . CYS A 1 48  ? -0.535  4.952   -8.853  1.00 0.00 ? 48  CYS A CA   3  
ATOM 7832  C C    . CYS A 1 48  ? -1.778  5.123   -9.735  1.00 0.00 ? 48  CYS A C    3  
ATOM 7833  O O    . CYS A 1 48  ? -2.880  5.188   -9.228  1.00 0.00 ? 48  CYS A O    3  
ATOM 7834  C CB   . CYS A 1 48  ? -0.702  3.707   -7.974  1.00 0.00 ? 48  CYS A CB   3  
ATOM 7835  S SG   . CYS A 1 48  ? -0.950  2.250   -9.020  1.00 0.00 ? 48  CYS A SG   3  
ATOM 7836  H H    . CYS A 1 48  ? -1.183  6.628   -7.669  1.00 0.00 ? 48  CYS A H    3  
ATOM 7837  H HA   . CYS A 1 48  ? 0.344   4.842   -9.470  1.00 0.00 ? 48  CYS A HA   3  
ATOM 7838  H HB2  . CYS A 1 48  ? 0.183   3.570   -7.373  1.00 0.00 ? 48  CYS A HB2  3  
ATOM 7839  H HB3  . CYS A 1 48  ? -1.557  3.834   -7.329  1.00 0.00 ? 48  CYS A HB3  3  
ATOM 7840  N N    . PRO A 1 49  ? -1.576  5.191   -11.027 1.00 0.00 ? 49  PRO A N    3  
ATOM 7841  C CA   . PRO A 1 49  ? -2.683  5.353   -11.983 1.00 0.00 ? 49  PRO A CA   3  
ATOM 7842  C C    . PRO A 1 49  ? -3.453  4.034   -12.129 1.00 0.00 ? 49  PRO A C    3  
ATOM 7843  O O    . PRO A 1 49  ? -3.475  3.222   -11.225 1.00 0.00 ? 49  PRO A O    3  
ATOM 7844  C CB   . PRO A 1 49  ? -1.983  5.770   -13.281 1.00 0.00 ? 49  PRO A CB   3  
ATOM 7845  C CG   . PRO A 1 49  ? -0.515  5.304   -13.158 1.00 0.00 ? 49  PRO A CG   3  
ATOM 7846  C CD   . PRO A 1 49  ? -0.241  5.109   -11.653 1.00 0.00 ? 49  PRO A CD   3  
ATOM 7847  H HA   . PRO A 1 49  ? -3.346  6.139   -11.657 1.00 0.00 ? 49  PRO A HA   3  
ATOM 7848  H HB2  . PRO A 1 49  ? -2.455  5.292   -14.128 1.00 0.00 ? 49  PRO A HB2  3  
ATOM 7849  H HB3  . PRO A 1 49  ? -2.015  6.842   -13.393 1.00 0.00 ? 49  PRO A HB3  3  
ATOM 7850  H HG2  . PRO A 1 49  ? -0.377  4.375   -13.688 1.00 0.00 ? 49  PRO A HG2  3  
ATOM 7851  H HG3  . PRO A 1 49  ? 0.148   6.057   -13.552 1.00 0.00 ? 49  PRO A HG3  3  
ATOM 7852  H HD2  . PRO A 1 49  ? 0.206   4.141   -11.473 1.00 0.00 ? 49  PRO A HD2  3  
ATOM 7853  H HD3  . PRO A 1 49  ? 0.394   5.897   -11.279 1.00 0.00 ? 49  PRO A HD3  3  
ATOM 7854  N N    . TYR A 1 50  ? -4.102  3.815   -13.240 1.00 0.00 ? 50  TYR A N    3  
ATOM 7855  C CA   . TYR A 1 50  ? -4.879  2.548   -13.399 1.00 0.00 ? 50  TYR A CA   3  
ATOM 7856  C C    . TYR A 1 50  ? -4.072  1.520   -14.195 1.00 0.00 ? 50  TYR A C    3  
ATOM 7857  O O    . TYR A 1 50  ? -3.424  0.662   -13.631 1.00 0.00 ? 50  TYR A O    3  
ATOM 7858  C CB   . TYR A 1 50  ? -6.211  2.810   -14.127 1.00 0.00 ? 50  TYR A CB   3  
ATOM 7859  C CG   . TYR A 1 50  ? -6.287  4.242   -14.607 1.00 0.00 ? 50  TYR A CG   3  
ATOM 7860  C CD1  . TYR A 1 50  ? -6.537  5.271   -13.694 1.00 0.00 ? 50  TYR A CD1  3  
ATOM 7861  C CD2  . TYR A 1 50  ? -6.108  4.536   -15.964 1.00 0.00 ? 50  TYR A CD2  3  
ATOM 7862  C CE1  . TYR A 1 50  ? -6.609  6.597   -14.136 1.00 0.00 ? 50  TYR A CE1  3  
ATOM 7863  C CE2  . TYR A 1 50  ? -6.179  5.862   -16.407 1.00 0.00 ? 50  TYR A CE2  3  
ATOM 7864  C CZ   . TYR A 1 50  ? -6.429  6.894   -15.492 1.00 0.00 ? 50  TYR A CZ   3  
ATOM 7865  O OH   . TYR A 1 50  ? -6.499  8.200   -15.929 1.00 0.00 ? 50  TYR A OH   3  
ATOM 7866  H H    . TYR A 1 50  ? -4.090  4.481   -13.957 1.00 0.00 ? 50  TYR A H    3  
ATOM 7867  H HA   . TYR A 1 50  ? -5.090  2.145   -12.420 1.00 0.00 ? 50  TYR A HA   3  
ATOM 7868  H HB2  . TYR A 1 50  ? -6.289  2.146   -14.975 1.00 0.00 ? 50  TYR A HB2  3  
ATOM 7869  H HB3  . TYR A 1 50  ? -7.029  2.618   -13.449 1.00 0.00 ? 50  TYR A HB3  3  
ATOM 7870  H HD1  . TYR A 1 50  ? -6.675  5.042   -12.647 1.00 0.00 ? 50  TYR A HD1  3  
ATOM 7871  H HD2  . TYR A 1 50  ? -5.914  3.741   -16.669 1.00 0.00 ? 50  TYR A HD2  3  
ATOM 7872  H HE1  . TYR A 1 50  ? -6.803  7.391   -13.432 1.00 0.00 ? 50  TYR A HE1  3  
ATOM 7873  H HE2  . TYR A 1 50  ? -6.041  6.091   -17.453 1.00 0.00 ? 50  TYR A HE2  3  
ATOM 7874  H HH   . TYR A 1 50  ? -5.882  8.720   -15.406 1.00 0.00 ? 50  TYR A HH   3  
ATOM 7875  N N    . ILE A 1 51  ? -4.133  1.591   -15.499 1.00 0.00 ? 51  ILE A N    3  
ATOM 7876  C CA   . ILE A 1 51  ? -3.401  0.611   -16.361 1.00 0.00 ? 51  ILE A CA   3  
ATOM 7877  C C    . ILE A 1 51  ? -2.084  0.177   -15.707 1.00 0.00 ? 51  ILE A C    3  
ATOM 7878  O O    . ILE A 1 51  ? -1.647  -0.945  -15.868 1.00 0.00 ? 51  ILE A O    3  
ATOM 7879  C CB   . ILE A 1 51  ? -3.109  1.250   -17.719 1.00 0.00 ? 51  ILE A CB   3  
ATOM 7880  C CG1  . ILE A 1 51  ? -2.583  2.672   -17.507 1.00 0.00 ? 51  ILE A CG1  3  
ATOM 7881  C CG2  . ILE A 1 51  ? -4.396  1.300   -18.544 1.00 0.00 ? 51  ILE A CG2  3  
ATOM 7882  C CD1  . ILE A 1 51  ? -1.796  3.114   -18.742 1.00 0.00 ? 51  ILE A CD1  3  
ATOM 7883  H H    . ILE A 1 51  ? -4.681  2.286   -15.919 1.00 0.00 ? 51  ILE A H    3  
ATOM 7884  H HA   . ILE A 1 51  ? -4.024  -0.261  -16.504 1.00 0.00 ? 51  ILE A HA   3  
ATOM 7885  H HB   . ILE A 1 51  ? -2.368  0.663   -18.241 1.00 0.00 ? 51  ILE A HB   3  
ATOM 7886  H HG12 . ILE A 1 51  ? -3.416  3.343   -17.351 1.00 0.00 ? 51  ILE A HG12 3  
ATOM 7887  H HG13 . ILE A 1 51  ? -1.936  2.692   -16.644 1.00 0.00 ? 51  ILE A HG13 3  
ATOM 7888  H HG21 . ILE A 1 51  ? -5.197  0.834   -17.990 1.00 0.00 ? 51  ILE A HG21 3  
ATOM 7889  H HG22 . ILE A 1 51  ? -4.651  2.329   -18.751 1.00 0.00 ? 51  ILE A HG22 3  
ATOM 7890  H HG23 . ILE A 1 51  ? -4.246  0.772   -19.475 1.00 0.00 ? 51  ILE A HG23 3  
ATOM 7891  H HD11 . ILE A 1 51  ? -2.384  2.929   -19.629 1.00 0.00 ? 51  ILE A HD11 3  
ATOM 7892  H HD12 . ILE A 1 51  ? -1.575  4.169   -18.670 1.00 0.00 ? 51  ILE A HD12 3  
ATOM 7893  H HD13 . ILE A 1 51  ? -0.873  2.555   -18.800 1.00 0.00 ? 51  ILE A HD13 3  
ATOM 7894  N N    . TRP A 1 52  ? -1.450  1.046   -14.971 1.00 0.00 ? 52  TRP A N    3  
ATOM 7895  C CA   . TRP A 1 52  ? -0.169  0.662   -14.313 1.00 0.00 ? 52  TRP A CA   3  
ATOM 7896  C C    . TRP A 1 52  ? -0.322  -0.723  -13.682 1.00 0.00 ? 52  TRP A C    3  
ATOM 7897  O O    . TRP A 1 52  ? -1.416  -1.235  -13.553 1.00 0.00 ? 52  TRP A O    3  
ATOM 7898  C CB   . TRP A 1 52  ? 0.164   1.676   -13.224 1.00 0.00 ? 52  TRP A CB   3  
ATOM 7899  C CG   . TRP A 1 52  ? 1.636   1.932   -13.209 1.00 0.00 ? 52  TRP A CG   3  
ATOM 7900  C CD1  . TRP A 1 52  ? 2.401   1.939   -12.099 1.00 0.00 ? 52  TRP A CD1  3  
ATOM 7901  C CD2  . TRP A 1 52  ? 2.531   2.212   -14.326 1.00 0.00 ? 52  TRP A CD2  3  
ATOM 7902  N NE1  . TRP A 1 52  ? 3.709   2.209   -12.456 1.00 0.00 ? 52  TRP A NE1  3  
ATOM 7903  C CE2  . TRP A 1 52  ? 3.841   2.384   -13.818 1.00 0.00 ? 52  TRP A CE2  3  
ATOM 7904  C CE3  . TRP A 1 52  ? 2.337   2.334   -15.714 1.00 0.00 ? 52  TRP A CE3  3  
ATOM 7905  C CZ2  . TRP A 1 52  ? 4.921   2.665   -14.658 1.00 0.00 ? 52  TRP A CZ2  3  
ATOM 7906  C CZ3  . TRP A 1 52  ? 3.421   2.618   -16.561 1.00 0.00 ? 52  TRP A CZ3  3  
ATOM 7907  C CH2  . TRP A 1 52  ? 4.710   2.782   -16.034 1.00 0.00 ? 52  TRP A CH2  3  
ATOM 7908  H H    . TRP A 1 52  ? -1.816  1.947   -14.847 1.00 0.00 ? 52  TRP A H    3  
ATOM 7909  H HA   . TRP A 1 52  ? 0.626   0.643   -15.043 1.00 0.00 ? 52  TRP A HA   3  
ATOM 7910  H HB2  . TRP A 1 52  ? -0.360  2.595   -13.418 1.00 0.00 ? 52  TRP A HB2  3  
ATOM 7911  H HB3  . TRP A 1 52  ? -0.141  1.285   -12.264 1.00 0.00 ? 52  TRP A HB3  3  
ATOM 7912  H HD1  . TRP A 1 52  ? 2.046   1.764   -11.097 1.00 0.00 ? 52  TRP A HD1  3  
ATOM 7913  H HE1  . TRP A 1 52  ? 4.463   2.272   -11.834 1.00 0.00 ? 52  TRP A HE1  3  
ATOM 7914  H HE3  . TRP A 1 52  ? 1.348   2.208   -16.131 1.00 0.00 ? 52  TRP A HE3  3  
ATOM 7915  H HZ2  . TRP A 1 52  ? 5.913   2.790   -14.246 1.00 0.00 ? 52  TRP A HZ2  3  
ATOM 7916  H HZ3  . TRP A 1 52  ? 3.261   2.709   -17.626 1.00 0.00 ? 52  TRP A HZ3  3  
ATOM 7917  H HH2  . TRP A 1 52  ? 5.540   3.000   -16.691 1.00 0.00 ? 52  TRP A HH2  3  
ATOM 7918  N N    . SER A 1 53  ? 0.762   -1.331  -13.290 1.00 0.00 ? 53  SER A N    3  
ATOM 7919  C CA   . SER A 1 53  ? 0.672   -2.682  -12.667 1.00 0.00 ? 53  SER A CA   3  
ATOM 7920  C C    . SER A 1 53  ? -0.306  -2.635  -11.491 1.00 0.00 ? 53  SER A C    3  
ATOM 7921  O O    . SER A 1 53  ? 0.074   -2.383  -10.364 1.00 0.00 ? 53  SER A O    3  
ATOM 7922  C CB   . SER A 1 53  ? 2.052   -3.108  -12.167 1.00 0.00 ? 53  SER A CB   3  
ATOM 7923  O OG   . SER A 1 53  ? 2.749   -3.768  -13.216 1.00 0.00 ? 53  SER A OG   3  
ATOM 7924  H H    . SER A 1 53  ? 1.635   -0.901  -13.403 1.00 0.00 ? 53  SER A H    3  
ATOM 7925  H HA   . SER A 1 53  ? 0.318   -3.393  -13.399 1.00 0.00 ? 53  SER A HA   3  
ATOM 7926  H HB2  . SER A 1 53  ? 2.611   -2.238  -11.863 1.00 0.00 ? 53  SER A HB2  3  
ATOM 7927  H HB3  . SER A 1 53  ? 1.938   -3.773  -11.322 1.00 0.00 ? 53  SER A HB3  3  
ATOM 7928  H HG   . SER A 1 53  ? 2.799   -3.167  -13.963 1.00 0.00 ? 53  SER A HG   3  
ATOM 7929  N N    . LEU A 1 54  ? -1.564  -2.873  -11.743 1.00 0.00 ? 54  LEU A N    3  
ATOM 7930  C CA   . LEU A 1 54  ? -2.564  -2.840  -10.641 1.00 0.00 ? 54  LEU A CA   3  
ATOM 7931  C C    . LEU A 1 54  ? -2.566  -4.187  -9.913  1.00 0.00 ? 54  LEU A C    3  
ATOM 7932  O O    . LEU A 1 54  ? -2.645  -5.234  -10.523 1.00 0.00 ? 54  LEU A O    3  
ATOM 7933  C CB   . LEU A 1 54  ? -3.953  -2.566  -11.223 1.00 0.00 ? 54  LEU A CB   3  
ATOM 7934  C CG   . LEU A 1 54  ? -4.025  -1.115  -11.705 1.00 0.00 ? 54  LEU A CG   3  
ATOM 7935  C CD1  . LEU A 1 54  ? -5.163  -0.960  -12.718 1.00 0.00 ? 54  LEU A CD1  3  
ATOM 7936  C CD2  . LEU A 1 54  ? -4.279  -0.195  -10.508 1.00 0.00 ? 54  LEU A CD2  3  
ATOM 7937  H H    . LEU A 1 54  ? -1.850  -3.074  -12.658 1.00 0.00 ? 54  LEU A H    3  
ATOM 7938  H HA   . LEU A 1 54  ? -2.306  -2.056  -9.945  1.00 0.00 ? 54  LEU A HA   3  
ATOM 7939  H HB2  . LEU A 1 54  ? -4.133  -3.233  -12.054 1.00 0.00 ? 54  LEU A HB2  3  
ATOM 7940  H HB3  . LEU A 1 54  ? -4.701  -2.729  -10.461 1.00 0.00 ? 54  LEU A HB3  3  
ATOM 7941  H HG   . LEU A 1 54  ? -3.089  -0.847  -12.174 1.00 0.00 ? 54  LEU A HG   3  
ATOM 7942  H HD11 . LEU A 1 54  ? -5.865  -1.770  -12.599 1.00 0.00 ? 54  LEU A HD11 3  
ATOM 7943  H HD12 . LEU A 1 54  ? -5.667  -0.018  -12.552 1.00 0.00 ? 54  LEU A HD12 3  
ATOM 7944  H HD13 . LEU A 1 54  ? -4.757  -0.978  -13.719 1.00 0.00 ? 54  LEU A HD13 3  
ATOM 7945  H HD21 . LEU A 1 54  ? -5.203  -0.479  -10.026 1.00 0.00 ? 54  LEU A HD21 3  
ATOM 7946  H HD22 . LEU A 1 54  ? -3.464  -0.286  -9.805  1.00 0.00 ? 54  LEU A HD22 3  
ATOM 7947  H HD23 . LEU A 1 54  ? -4.350  0.827   -10.848 1.00 0.00 ? 54  LEU A HD23 3  
ATOM 7948  N N    . ASP A 1 55  ? -2.475  -4.166  -8.610  1.00 0.00 ? 55  ASP A N    3  
ATOM 7949  C CA   . ASP A 1 55  ? -2.466  -5.443  -7.842  1.00 0.00 ? 55  ASP A CA   3  
ATOM 7950  C C    . ASP A 1 55  ? -3.901  -5.921  -7.618  1.00 0.00 ? 55  ASP A C    3  
ATOM 7951  O O    . ASP A 1 55  ? -4.324  -6.925  -8.157  1.00 0.00 ? 55  ASP A O    3  
ATOM 7952  C CB   . ASP A 1 55  ? -1.788  -5.219  -6.489  1.00 0.00 ? 55  ASP A CB   3  
ATOM 7953  C CG   . ASP A 1 55  ? -1.687  -6.551  -5.743  1.00 0.00 ? 55  ASP A CG   3  
ATOM 7954  O OD1  . ASP A 1 55  ? -2.725  -7.108  -5.423  1.00 0.00 ? 55  ASP A OD1  3  
ATOM 7955  O OD2  . ASP A 1 55  ? -0.575  -6.992  -5.504  1.00 0.00 ? 55  ASP A OD2  3  
ATOM 7956  H H    . ASP A 1 55  ? -2.409  -3.309  -8.139  1.00 0.00 ? 55  ASP A H    3  
ATOM 7957  H HA   . ASP A 1 55  ? -1.921  -6.192  -8.397  1.00 0.00 ? 55  ASP A HA   3  
ATOM 7958  H HB2  . ASP A 1 55  ? -0.796  -4.817  -6.645  1.00 0.00 ? 55  ASP A HB2  3  
ATOM 7959  H HB3  . ASP A 1 55  ? -2.371  -4.524  -5.904  1.00 0.00 ? 55  ASP A HB3  3  
ATOM 7960  N N    . THR A 1 56  ? -4.654  -5.214  -6.821  1.00 0.00 ? 56  THR A N    3  
ATOM 7961  C CA   . THR A 1 56  ? -6.062  -5.634  -6.560  1.00 0.00 ? 56  THR A CA   3  
ATOM 7962  C C    . THR A 1 56  ? -7.001  -4.891  -7.512  1.00 0.00 ? 56  THR A C    3  
ATOM 7963  O O    . THR A 1 56  ? -6.622  -3.928  -8.147  1.00 0.00 ? 56  THR A O    3  
ATOM 7964  C CB   . THR A 1 56  ? -6.434  -5.298  -5.112  1.00 0.00 ? 56  THR A CB   3  
ATOM 7965  O OG1  . THR A 1 56  ? -6.950  -3.976  -5.053  1.00 0.00 ? 56  THR A OG1  3  
ATOM 7966  C CG2  . THR A 1 56  ? -5.194  -5.404  -4.222  1.00 0.00 ? 56  THR A CG2  3  
ATOM 7967  H H    . THR A 1 56  ? -4.295  -4.409  -6.392  1.00 0.00 ? 56  THR A H    3  
ATOM 7968  H HA   . THR A 1 56  ? -6.154  -6.697  -6.718  1.00 0.00 ? 56  THR A HA   3  
ATOM 7969  H HB   . THR A 1 56  ? -7.181  -5.993  -4.764  1.00 0.00 ? 56  THR A HB   3  
ATOM 7970  H HG1  . THR A 1 56  ? -6.289  -3.383  -5.418  1.00 0.00 ? 56  THR A HG1  3  
ATOM 7971  H HG21 . THR A 1 56  ? -4.726  -6.367  -4.368  1.00 0.00 ? 56  THR A HG21 3  
ATOM 7972  H HG22 . THR A 1 56  ? -4.496  -4.622  -4.483  1.00 0.00 ? 56  THR A HG22 3  
ATOM 7973  H HG23 . THR A 1 56  ? -5.484  -5.298  -3.187  1.00 0.00 ? 56  THR A HG23 3  
ATOM 7974  N N    . GLN A 1 57  ? -8.229  -5.326  -7.616  1.00 0.00 ? 57  GLN A N    3  
ATOM 7975  C CA   . GLN A 1 57  ? -9.185  -4.636  -8.528  1.00 0.00 ? 57  GLN A CA   3  
ATOM 7976  C C    . GLN A 1 57  ? -9.534  -3.265  -7.951  1.00 0.00 ? 57  GLN A C    3  
ATOM 7977  O O    . GLN A 1 57  ? -9.890  -2.353  -8.666  1.00 0.00 ? 57  GLN A O    3  
ATOM 7978  C CB   . GLN A 1 57  ? -10.468 -5.457  -8.656  1.00 0.00 ? 57  GLN A CB   3  
ATOM 7979  C CG   . GLN A 1 57  ? -10.328 -6.462  -9.801  1.00 0.00 ? 57  GLN A CG   3  
ATOM 7980  C CD   . GLN A 1 57  ? -10.362 -5.727  -11.143 1.00 0.00 ? 57  GLN A CD   3  
ATOM 7981  O OE1  . GLN A 1 57  ? -9.541  -4.871  -11.402 1.00 0.00 ? 57  GLN A OE1  3  
ATOM 7982  N NE2  . GLN A 1 57  ? -11.285 -6.031  -12.014 1.00 0.00 ? 57  GLN A NE2  3  
ATOM 7983  H H    . GLN A 1 57  ? -8.520  -6.103  -7.095  1.00 0.00 ? 57  GLN A H    3  
ATOM 7984  H HA   . GLN A 1 57  ? -8.734  -4.514  -9.501  1.00 0.00 ? 57  GLN A HA   3  
ATOM 7985  H HB2  . GLN A 1 57  ? -10.648 -5.985  -7.732  1.00 0.00 ? 57  GLN A HB2  3  
ATOM 7986  H HB3  . GLN A 1 57  ? -11.298 -4.798  -8.860  1.00 0.00 ? 57  GLN A HB3  3  
ATOM 7987  H HG2  . GLN A 1 57  ? -9.389  -6.988  -9.704  1.00 0.00 ? 57  GLN A HG2  3  
ATOM 7988  H HG3  . GLN A 1 57  ? -11.142 -7.169  -9.761  1.00 0.00 ? 57  GLN A HG3  3  
ATOM 7989  H HE21 . GLN A 1 57  ? -11.946 -6.724  -11.806 1.00 0.00 ? 57  GLN A HE21 3  
ATOM 7990  H HE22 . GLN A 1 57  ? -11.317 -5.567  -12.877 1.00 0.00 ? 57  GLN A HE22 3  
ATOM 7991  N N    . TYR A 1 58  ? -9.441  -3.114  -6.661  1.00 0.00 ? 58  TYR A N    3  
ATOM 7992  C CA   . TYR A 1 58  ? -9.773  -1.801  -6.046  1.00 0.00 ? 58  TYR A CA   3  
ATOM 7993  C C    . TYR A 1 58  ? -8.671  -0.788  -6.384  1.00 0.00 ? 58  TYR A C    3  
ATOM 7994  O O    . TYR A 1 58  ? -8.794  0.390   -6.110  1.00 0.00 ? 58  TYR A O    3  
ATOM 7995  C CB   . TYR A 1 58  ? -9.906  -1.973  -4.524  1.00 0.00 ? 58  TYR A CB   3  
ATOM 7996  C CG   . TYR A 1 58  ? -9.613  -0.669  -3.827  1.00 0.00 ? 58  TYR A CG   3  
ATOM 7997  C CD1  . TYR A 1 58  ? -10.622 0.291   -3.676  1.00 0.00 ? 58  TYR A CD1  3  
ATOM 7998  C CD2  . TYR A 1 58  ? -8.329  -0.419  -3.337  1.00 0.00 ? 58  TYR A CD2  3  
ATOM 7999  C CE1  . TYR A 1 58  ? -10.341 1.501   -3.033  1.00 0.00 ? 58  TYR A CE1  3  
ATOM 8000  C CE2  . TYR A 1 58  ? -8.048  0.789   -2.695  1.00 0.00 ? 58  TYR A CE2  3  
ATOM 8001  C CZ   . TYR A 1 58  ? -9.053  1.747   -2.543  1.00 0.00 ? 58  TYR A CZ   3  
ATOM 8002  O OH   . TYR A 1 58  ? -8.771  2.934   -1.909  1.00 0.00 ? 58  TYR A OH   3  
ATOM 8003  H H    . TYR A 1 58  ? -9.155  -3.863  -6.097  1.00 0.00 ? 58  TYR A H    3  
ATOM 8004  H HA   . TYR A 1 58  ? -10.713 -1.450  -6.448  1.00 0.00 ? 58  TYR A HA   3  
ATOM 8005  H HB2  . TYR A 1 58  ? -10.911 -2.289  -4.286  1.00 0.00 ? 58  TYR A HB2  3  
ATOM 8006  H HB3  . TYR A 1 58  ? -9.207  -2.723  -4.183  1.00 0.00 ? 58  TYR A HB3  3  
ATOM 8007  H HD1  . TYR A 1 58  ? -11.613 0.097   -4.055  1.00 0.00 ? 58  TYR A HD1  3  
ATOM 8008  H HD2  . TYR A 1 58  ? -7.553  -1.161  -3.454  1.00 0.00 ? 58  TYR A HD2  3  
ATOM 8009  H HE1  . TYR A 1 58  ? -11.116 2.245   -2.916  1.00 0.00 ? 58  TYR A HE1  3  
ATOM 8010  H HE2  . TYR A 1 58  ? -7.056  0.981   -2.317  1.00 0.00 ? 58  TYR A HE2  3  
ATOM 8011  H HH   . TYR A 1 58  ? -8.174  2.748   -1.180  1.00 0.00 ? 58  TYR A HH   3  
ATOM 8012  N N    . SER A 1 59  ? -7.596  -1.231  -6.978  1.00 0.00 ? 59  SER A N    3  
ATOM 8013  C CA   . SER A 1 59  ? -6.499  -0.284  -7.330  1.00 0.00 ? 59  SER A CA   3  
ATOM 8014  C C    . SER A 1 59  ? -6.849  0.432   -8.635  1.00 0.00 ? 59  SER A C    3  
ATOM 8015  O O    . SER A 1 59  ? -6.489  1.572   -8.840  1.00 0.00 ? 59  SER A O    3  
ATOM 8016  C CB   . SER A 1 59  ? -5.187  -1.054  -7.503  1.00 0.00 ? 59  SER A CB   3  
ATOM 8017  O OG   . SER A 1 59  ? -5.337  -2.032  -8.525  1.00 0.00 ? 59  SER A OG   3  
ATOM 8018  H H    . SER A 1 59  ? -7.512  -2.183  -7.195  1.00 0.00 ? 59  SER A H    3  
ATOM 8019  H HA   . SER A 1 59  ? -6.386  0.449   -6.542  1.00 0.00 ? 59  SER A HA   3  
ATOM 8020  H HB2  . SER A 1 59  ? -4.401  -0.372  -7.779  1.00 0.00 ? 59  SER A HB2  3  
ATOM 8021  H HB3  . SER A 1 59  ? -4.929  -1.535  -6.567  1.00 0.00 ? 59  SER A HB3  3  
ATOM 8022  H HG   . SER A 1 59  ? -6.104  -1.800  -9.052  1.00 0.00 ? 59  SER A HG   3  
ATOM 8023  N N    . LYS A 1 60  ? -7.557  -0.223  -9.516  1.00 0.00 ? 60  LYS A N    3  
ATOM 8024  C CA   . LYS A 1 60  ? -7.932  0.434   -10.799 1.00 0.00 ? 60  LYS A CA   3  
ATOM 8025  C C    . LYS A 1 60  ? -9.144  1.334   -10.558 1.00 0.00 ? 60  LYS A C    3  
ATOM 8026  O O    . LYS A 1 60  ? -9.308  2.357   -11.194 1.00 0.00 ? 60  LYS A O    3  
ATOM 8027  C CB   . LYS A 1 60  ? -8.272  -0.632  -11.849 1.00 0.00 ? 60  LYS A CB   3  
ATOM 8028  C CG   . LYS A 1 60  ? -9.662  -1.211  -11.574 1.00 0.00 ? 60  LYS A CG   3  
ATOM 8029  C CD   . LYS A 1 60  ? -10.028 -2.210  -12.672 1.00 0.00 ? 60  LYS A CD   3  
ATOM 8030  C CE   . LYS A 1 60  ? -9.882  -1.544  -14.041 1.00 0.00 ? 60  LYS A CE   3  
ATOM 8031  N NZ   . LYS A 1 60  ? -10.941 -2.054  -14.957 1.00 0.00 ? 60  LYS A NZ   3  
ATOM 8032  H H    . LYS A 1 60  ? -7.844  -1.142  -9.331  1.00 0.00 ? 60  LYS A H    3  
ATOM 8033  H HA   . LYS A 1 60  ? -7.104  1.033   -11.149 1.00 0.00 ? 60  LYS A HA   3  
ATOM 8034  H HB2  . LYS A 1 60  ? -8.257  -0.185  -12.832 1.00 0.00 ? 60  LYS A HB2  3  
ATOM 8035  H HB3  . LYS A 1 60  ? -7.540  -1.425  -11.805 1.00 0.00 ? 60  LYS A HB3  3  
ATOM 8036  H HG2  . LYS A 1 60  ? -9.659  -1.711  -10.618 1.00 0.00 ? 60  LYS A HG2  3  
ATOM 8037  H HG3  . LYS A 1 60  ? -10.388 -0.412  -11.559 1.00 0.00 ? 60  LYS A HG3  3  
ATOM 8038  H HD2  . LYS A 1 60  ? -9.369  -3.065  -12.614 1.00 0.00 ? 60  LYS A HD2  3  
ATOM 8039  H HD3  . LYS A 1 60  ? -11.049 -2.533  -12.538 1.00 0.00 ? 60  LYS A HD3  3  
ATOM 8040  H HE2  . LYS A 1 60  ? -9.983  -0.474  -13.933 1.00 0.00 ? 60  LYS A HE2  3  
ATOM 8041  H HE3  . LYS A 1 60  ? -8.910  -1.773  -14.452 1.00 0.00 ? 60  LYS A HE3  3  
ATOM 8042  H HZ1  . LYS A 1 60  ? -10.964 -3.093  -14.918 1.00 0.00 ? 60  LYS A HZ1  3  
ATOM 8043  H HZ2  . LYS A 1 60  ? -11.864 -1.678  -14.663 1.00 0.00 ? 60  LYS A HZ2  3  
ATOM 8044  H HZ3  . LYS A 1 60  ? -10.734 -1.747  -15.930 1.00 0.00 ? 60  LYS A HZ3  3  
ATOM 8045  N N    . VAL A 1 61  ? -9.990  0.963   -9.638  1.00 0.00 ? 61  VAL A N    3  
ATOM 8046  C CA   . VAL A 1 61  ? -11.186 1.794   -9.343  1.00 0.00 ? 61  VAL A CA   3  
ATOM 8047  C C    . VAL A 1 61  ? -10.743 3.049   -8.589  1.00 0.00 ? 61  VAL A C    3  
ATOM 8048  O O    . VAL A 1 61  ? -10.724 4.132   -9.133  1.00 0.00 ? 61  VAL A O    3  
ATOM 8049  C CB   . VAL A 1 61  ? -12.160 0.985   -8.484  1.00 0.00 ? 61  VAL A CB   3  
ATOM 8050  C CG1  . VAL A 1 61  ? -13.188 1.920   -7.845  1.00 0.00 ? 61  VAL A CG1  3  
ATOM 8051  C CG2  . VAL A 1 61  ? -12.884 -0.035  -9.364  1.00 0.00 ? 61  VAL A CG2  3  
ATOM 8052  H H    . VAL A 1 61  ? -9.836  0.138   -9.133  1.00 0.00 ? 61  VAL A H    3  
ATOM 8053  H HA   . VAL A 1 61  ? -11.666 2.078   -10.268 1.00 0.00 ? 61  VAL A HA   3  
ATOM 8054  H HB   . VAL A 1 61  ? -11.613 0.471   -7.708  1.00 0.00 ? 61  VAL A HB   3  
ATOM 8055  H HG11 . VAL A 1 61  ? -13.049 2.921   -8.225  1.00 0.00 ? 61  VAL A HG11 3  
ATOM 8056  H HG12 . VAL A 1 61  ? -14.183 1.578   -8.086  1.00 0.00 ? 61  VAL A HG12 3  
ATOM 8057  H HG13 . VAL A 1 61  ? -13.055 1.920   -6.773  1.00 0.00 ? 61  VAL A HG13 3  
ATOM 8058  H HG21 . VAL A 1 61  ? -12.193 -0.441  -10.088 1.00 0.00 ? 61  VAL A HG21 3  
ATOM 8059  H HG22 . VAL A 1 61  ? -13.268 -0.834  -8.747  1.00 0.00 ? 61  VAL A HG22 3  
ATOM 8060  H HG23 . VAL A 1 61  ? -13.702 0.447   -9.878  1.00 0.00 ? 61  VAL A HG23 3  
ATOM 8061  N N    . LEU A 1 62  ? -10.377 2.911   -7.345  1.00 0.00 ? 62  LEU A N    3  
ATOM 8062  C CA   . LEU A 1 62  ? -9.927  4.097   -6.563  1.00 0.00 ? 62  LEU A CA   3  
ATOM 8063  C C    . LEU A 1 62  ? -8.864  4.853   -7.369  1.00 0.00 ? 62  LEU A C    3  
ATOM 8064  O O    . LEU A 1 62  ? -8.678  6.043   -7.206  1.00 0.00 ? 62  LEU A O    3  
ATOM 8065  C CB   . LEU A 1 62  ? -9.332  3.620   -5.233  1.00 0.00 ? 62  LEU A CB   3  
ATOM 8066  C CG   . LEU A 1 62  ? -8.673  4.787   -4.492  1.00 0.00 ? 62  LEU A CG   3  
ATOM 8067  C CD1  . LEU A 1 62  ? -9.673  5.451   -3.539  1.00 0.00 ? 62  LEU A CD1  3  
ATOM 8068  C CD2  . LEU A 1 62  ? -7.490  4.255   -3.689  1.00 0.00 ? 62  LEU A CD2  3  
ATOM 8069  H H    . LEU A 1 62  ? -10.391 2.024   -6.926  1.00 0.00 ? 62  LEU A H    3  
ATOM 8070  H HA   . LEU A 1 62  ? -10.769 4.747   -6.372  1.00 0.00 ? 62  LEU A HA   3  
ATOM 8071  H HB2  . LEU A 1 62  ? -10.119 3.206   -4.620  1.00 0.00 ? 62  LEU A HB2  3  
ATOM 8072  H HB3  . LEU A 1 62  ? -8.592  2.857   -5.427  1.00 0.00 ? 62  LEU A HB3  3  
ATOM 8073  H HG   . LEU A 1 62  ? -8.321  5.516   -5.206  1.00 0.00 ? 62  LEU A HG   3  
ATOM 8074  H HD11 . LEU A 1 62  ? -10.341 4.704   -3.138  1.00 0.00 ? 62  LEU A HD11 3  
ATOM 8075  H HD12 . LEU A 1 62  ? -9.135  5.924   -2.727  1.00 0.00 ? 62  LEU A HD12 3  
ATOM 8076  H HD13 . LEU A 1 62  ? -10.242 6.196   -4.073  1.00 0.00 ? 62  LEU A HD13 3  
ATOM 8077  H HD21 . LEU A 1 62  ? -7.564  3.182   -3.609  1.00 0.00 ? 62  LEU A HD21 3  
ATOM 8078  H HD22 . LEU A 1 62  ? -6.575  4.514   -4.192  1.00 0.00 ? 62  LEU A HD22 3  
ATOM 8079  H HD23 . LEU A 1 62  ? -7.498  4.693   -2.702  1.00 0.00 ? 62  LEU A HD23 3  
ATOM 8080  N N    . ALA A 1 63  ? -8.168  4.172   -8.241  1.00 0.00 ? 63  ALA A N    3  
ATOM 8081  C CA   . ALA A 1 63  ? -7.122  4.853   -9.060  1.00 0.00 ? 63  ALA A CA   3  
ATOM 8082  C C    . ALA A 1 63  ? -7.767  5.983   -9.866  1.00 0.00 ? 63  ALA A C    3  
ATOM 8083  O O    . ALA A 1 63  ? -7.295  7.101   -9.872  1.00 0.00 ? 63  ALA A O    3  
ATOM 8084  C CB   . ALA A 1 63  ? -6.478  3.844   -10.016 1.00 0.00 ? 63  ALA A CB   3  
ATOM 8085  H H    . ALA A 1 63  ? -8.336  3.213   -8.360  1.00 0.00 ? 63  ALA A H    3  
ATOM 8086  H HA   . ALA A 1 63  ? -6.366  5.263   -8.407  1.00 0.00 ? 63  ALA A HA   3  
ATOM 8087  H HB1  . ALA A 1 63  ? -7.184  3.058   -10.243 1.00 0.00 ? 63  ALA A HB1  3  
ATOM 8088  H HB2  . ALA A 1 63  ? -6.190  4.343   -10.930 1.00 0.00 ? 63  ALA A HB2  3  
ATOM 8089  H HB3  . ALA A 1 63  ? -5.602  3.414   -9.550  1.00 0.00 ? 63  ALA A HB3  3  
ATOM 8090  N N    . LEU A 1 64  ? -8.848  5.701   -10.541 1.00 0.00 ? 64  LEU A N    3  
ATOM 8091  C CA   . LEU A 1 64  ? -9.533  6.757   -11.342 1.00 0.00 ? 64  LEU A CA   3  
ATOM 8092  C C    . LEU A 1 64  ? -10.281 7.691   -10.395 1.00 0.00 ? 64  LEU A C    3  
ATOM 8093  O O    . LEU A 1 64  ? -10.246 8.895   -10.530 1.00 0.00 ? 64  LEU A O    3  
ATOM 8094  C CB   . LEU A 1 64  ? -10.532 6.098   -12.294 1.00 0.00 ? 64  LEU A CB   3  
ATOM 8095  C CG   . LEU A 1 64  ? -9.769  5.384   -13.405 1.00 0.00 ? 64  LEU A CG   3  
ATOM 8096  C CD1  . LEU A 1 64  ? -10.652 4.293   -14.013 1.00 0.00 ? 64  LEU A CD1  3  
ATOM 8097  C CD2  . LEU A 1 64  ? -9.385  6.392   -14.489 1.00 0.00 ? 64  LEU A CD2  3  
ATOM 8098  H H    . LEU A 1 64  ? -9.214  4.792   -10.518 1.00 0.00 ? 64  LEU A H    3  
ATOM 8099  H HA   . LEU A 1 64  ? -8.802  7.320   -11.909 1.00 0.00 ? 64  LEU A HA   3  
ATOM 8100  H HB2  . LEU A 1 64  ? -11.129 5.382   -11.748 1.00 0.00 ? 64  LEU A HB2  3  
ATOM 8101  H HB3  . LEU A 1 64  ? -11.175 6.850   -12.724 1.00 0.00 ? 64  LEU A HB3  3  
ATOM 8102  H HG   . LEU A 1 64  ? -8.878  4.936   -12.991 1.00 0.00 ? 64  LEU A HG   3  
ATOM 8103  H HD11 . LEU A 1 64  ? -11.613 4.711   -14.273 1.00 0.00 ? 64  LEU A HD11 3  
ATOM 8104  H HD12 . LEU A 1 64  ? -10.179 3.902   -14.903 1.00 0.00 ? 64  LEU A HD12 3  
ATOM 8105  H HD13 . LEU A 1 64  ? -10.786 3.497   -13.297 1.00 0.00 ? 64  LEU A HD13 3  
ATOM 8106  H HD21 . LEU A 1 64  ? -8.875  7.230   -14.037 1.00 0.00 ? 64  LEU A HD21 3  
ATOM 8107  H HD22 . LEU A 1 64  ? -8.731  5.918   -15.207 1.00 0.00 ? 64  LEU A HD22 3  
ATOM 8108  H HD23 . LEU A 1 64  ? -10.277 6.740   -14.989 1.00 0.00 ? 64  LEU A HD23 3  
ATOM 8109  N N    . TYR A 1 65  ? -10.957 7.133   -9.435  1.00 0.00 ? 65  TYR A N    3  
ATOM 8110  C CA   . TYR A 1 65  ? -11.717 7.961   -8.458  1.00 0.00 ? 65  TYR A CA   3  
ATOM 8111  C C    . TYR A 1 65  ? -10.886 9.186   -8.062  1.00 0.00 ? 65  TYR A C    3  
ATOM 8112  O O    . TYR A 1 65  ? -11.414 10.239  -7.766  1.00 0.00 ? 65  TYR A O    3  
ATOM 8113  C CB   . TYR A 1 65  ? -12.004 7.111   -7.220  1.00 0.00 ? 65  TYR A CB   3  
ATOM 8114  C CG   . TYR A 1 65  ? -12.698 7.946   -6.176  1.00 0.00 ? 65  TYR A CG   3  
ATOM 8115  C CD1  . TYR A 1 65  ? -11.949 8.770   -5.326  1.00 0.00 ? 65  TYR A CD1  3  
ATOM 8116  C CD2  . TYR A 1 65  ? -14.091 7.892   -6.052  1.00 0.00 ? 65  TYR A CD2  3  
ATOM 8117  C CE1  . TYR A 1 65  ? -12.593 9.539   -4.351  1.00 0.00 ? 65  TYR A CE1  3  
ATOM 8118  C CE2  . TYR A 1 65  ? -14.735 8.661   -5.077  1.00 0.00 ? 65  TYR A CE2  3  
ATOM 8119  C CZ   . TYR A 1 65  ? -13.987 9.484   -4.225  1.00 0.00 ? 65  TYR A CZ   3  
ATOM 8120  O OH   . TYR A 1 65  ? -14.624 10.242  -3.264  1.00 0.00 ? 65  TYR A OH   3  
ATOM 8121  H H    . TYR A 1 65  ? -10.964 6.159   -9.355  1.00 0.00 ? 65  TYR A H    3  
ATOM 8122  H HA   . TYR A 1 65  ? -12.649 8.282   -8.900  1.00 0.00 ? 65  TYR A HA   3  
ATOM 8123  H HB2  . TYR A 1 65  ? -12.637 6.280   -7.493  1.00 0.00 ? 65  TYR A HB2  3  
ATOM 8124  H HB3  . TYR A 1 65  ? -11.074 6.738   -6.818  1.00 0.00 ? 65  TYR A HB3  3  
ATOM 8125  H HD1  . TYR A 1 65  ? -10.872 8.809   -5.422  1.00 0.00 ? 65  TYR A HD1  3  
ATOM 8126  H HD2  . TYR A 1 65  ? -14.670 7.258   -6.713  1.00 0.00 ? 65  TYR A HD2  3  
ATOM 8127  H HE1  . TYR A 1 65  ? -12.016 10.174  -3.695  1.00 0.00 ? 65  TYR A HE1  3  
ATOM 8128  H HE2  . TYR A 1 65  ? -15.809 8.616   -4.977  1.00 0.00 ? 65  TYR A HE2  3  
ATOM 8129  H HH   . TYR A 1 65  ? -15.416 10.616  -3.658  1.00 0.00 ? 65  TYR A HH   3  
ATOM 8130  N N    . ASN A 1 66  ? -9.588  9.052   -8.057  1.00 0.00 ? 66  ASN A N    3  
ATOM 8131  C CA   . ASN A 1 66  ? -8.712  10.200  -7.684  1.00 0.00 ? 66  ASN A CA   3  
ATOM 8132  C C    . ASN A 1 66  ? -8.214  10.887  -8.950  1.00 0.00 ? 66  ASN A C    3  
ATOM 8133  O O    . ASN A 1 66  ? -8.299  12.090  -9.101  1.00 0.00 ? 66  ASN A O    3  
ATOM 8134  C CB   . ASN A 1 66  ? -7.506  9.672   -6.923  1.00 0.00 ? 66  ASN A CB   3  
ATOM 8135  C CG   . ASN A 1 66  ? -6.980  10.753  -5.977  1.00 0.00 ? 66  ASN A CG   3  
ATOM 8136  O OD1  . ASN A 1 66  ? -6.915  10.550  -4.781  1.00 0.00 ? 66  ASN A OD1  3  
ATOM 8137  N ND2  . ASN A 1 66  ? -6.598  11.901  -6.469  1.00 0.00 ? 66  ASN A ND2  3  
ATOM 8138  H H    . ASN A 1 66  ? -9.187  8.192   -8.301  1.00 0.00 ? 66  ASN A H    3  
ATOM 8139  H HA   . ASN A 1 66  ? -9.257  10.901  -7.070  1.00 0.00 ? 66  ASN A HA   3  
ATOM 8140  H HB2  . ASN A 1 66  ? -7.789  8.798   -6.359  1.00 0.00 ? 66  ASN A HB2  3  
ATOM 8141  H HB3  . ASN A 1 66  ? -6.737  9.411   -7.632  1.00 0.00 ? 66  ASN A HB3  3  
ATOM 8142  H HD21 . ASN A 1 66  ? -6.652  12.062  -7.433  1.00 0.00 ? 66  ASN A HD21 3  
ATOM 8143  H HD22 . ASN A 1 66  ? -6.258  12.600  -5.873  1.00 0.00 ? 66  ASN A HD22 3  
ATOM 8144  N N    . GLN A 1 67  ? -7.690  10.117  -9.862  1.00 0.00 ? 67  GLN A N    3  
ATOM 8145  C CA   . GLN A 1 67  ? -7.170  10.686  -11.137 1.00 0.00 ? 67  GLN A CA   3  
ATOM 8146  C C    . GLN A 1 67  ? -8.213  11.610  -11.766 1.00 0.00 ? 67  GLN A C    3  
ATOM 8147  O O    . GLN A 1 67  ? -7.909  12.409  -12.631 1.00 0.00 ? 67  GLN A O    3  
ATOM 8148  C CB   . GLN A 1 67  ? -6.850  9.542   -12.101 1.00 0.00 ? 67  GLN A CB   3  
ATOM 8149  C CG   . GLN A 1 67  ? -5.397  9.104   -11.914 1.00 0.00 ? 67  GLN A CG   3  
ATOM 8150  C CD   . GLN A 1 67  ? -5.115  8.892   -10.425 1.00 0.00 ? 67  GLN A CD   3  
ATOM 8151  O OE1  . GLN A 1 67  ? -5.135  9.830   -9.651  1.00 0.00 ? 67  GLN A OE1  3  
ATOM 8152  N NE2  . GLN A 1 67  ? -4.854  7.691   -9.988  1.00 0.00 ? 67  GLN A NE2  3  
ATOM 8153  H H    . GLN A 1 67  ? -7.636  9.151   -9.702  1.00 0.00 ? 67  GLN A H    3  
ATOM 8154  H HA   . GLN A 1 67  ? -6.275  11.247  -10.937 1.00 0.00 ? 67  GLN A HA   3  
ATOM 8155  H HB2  . GLN A 1 67  ? -7.506  8.707   -11.896 1.00 0.00 ? 67  GLN A HB2  3  
ATOM 8156  H HB3  . GLN A 1 67  ? -6.999  9.871   -13.117 1.00 0.00 ? 67  GLN A HB3  3  
ATOM 8157  H HG2  . GLN A 1 67  ? -5.226  8.181   -12.448 1.00 0.00 ? 67  GLN A HG2  3  
ATOM 8158  H HG3  . GLN A 1 67  ? -4.738  9.870   -12.297 1.00 0.00 ? 67  GLN A HG3  3  
ATOM 8159  H HE21 . GLN A 1 67  ? -4.839  6.935   -10.611 1.00 0.00 ? 67  GLN A HE21 3  
ATOM 8160  H HE22 . GLN A 1 67  ? -4.672  7.544   -9.036  1.00 0.00 ? 67  GLN A HE22 3  
ATOM 8161  N N    . HIS A 1 68  ? -9.435  11.507  -11.344 1.00 0.00 ? 68  HIS A N    3  
ATOM 8162  C CA   . HIS A 1 68  ? -10.501 12.376  -11.917 1.00 0.00 ? 68  HIS A CA   3  
ATOM 8163  C C    . HIS A 1 68  ? -10.539 13.708  -11.162 1.00 0.00 ? 68  HIS A C    3  
ATOM 8164  O O    . HIS A 1 68  ? -10.581 14.767  -11.755 1.00 0.00 ? 68  HIS A O    3  
ATOM 8165  C CB   . HIS A 1 68  ? -11.855 11.678  -11.787 1.00 0.00 ? 68  HIS A CB   3  
ATOM 8166  C CG   . HIS A 1 68  ? -12.102 10.833  -13.005 1.00 0.00 ? 68  HIS A CG   3  
ATOM 8167  N ND1  . HIS A 1 68  ? -11.664 9.521   -13.099 1.00 0.00 ? 68  HIS A ND1  3  
ATOM 8168  C CD2  . HIS A 1 68  ? -12.740 11.102  -14.188 1.00 0.00 ? 68  HIS A CD2  3  
ATOM 8169  C CE1  . HIS A 1 68  ? -12.041 9.054   -14.303 1.00 0.00 ? 68  HIS A CE1  3  
ATOM 8170  N NE2  . HIS A 1 68  ? -12.701 9.977   -15.007 1.00 0.00 ? 68  HIS A NE2  3  
ATOM 8171  H H    . HIS A 1 68  ? -9.654  10.857  -10.650 1.00 0.00 ? 68  HIS A H    3  
ATOM 8172  H HA   . HIS A 1 68  ? -10.292 12.561  -12.960 1.00 0.00 ? 68  HIS A HA   3  
ATOM 8173  H HB2  . HIS A 1 68  ? -11.855 11.051  -10.906 1.00 0.00 ? 68  HIS A HB2  3  
ATOM 8174  H HB3  . HIS A 1 68  ? -12.636 12.419  -11.701 1.00 0.00 ? 68  HIS A HB3  3  
ATOM 8175  H HD1  . HIS A 1 68  ? -11.170 9.025   -12.413 1.00 0.00 ? 68  HIS A HD1  3  
ATOM 8176  H HD2  . HIS A 1 68  ? -13.201 12.043  -14.445 1.00 0.00 ? 68  HIS A HD2  3  
ATOM 8177  H HE1  . HIS A 1 68  ? -11.836 8.054   -14.655 1.00 0.00 ? 68  HIS A HE1  3  
ATOM 8178  N N    . ASN A 1 69  ? -10.526 13.663  -9.858  1.00 0.00 ? 69  ASN A N    3  
ATOM 8179  C CA   . ASN A 1 69  ? -10.564 14.928  -9.069  1.00 0.00 ? 69  ASN A CA   3  
ATOM 8180  C C    . ASN A 1 69  ? -9.168  15.220  -8.502  1.00 0.00 ? 69  ASN A C    3  
ATOM 8181  O O    . ASN A 1 69  ? -8.661  14.459  -7.701  1.00 0.00 ? 69  ASN A O    3  
ATOM 8182  C CB   . ASN A 1 69  ? -11.554 14.775  -7.913  1.00 0.00 ? 69  ASN A CB   3  
ATOM 8183  C CG   . ASN A 1 69  ? -12.975 15.037  -8.418  1.00 0.00 ? 69  ASN A CG   3  
ATOM 8184  O OD1  . ASN A 1 69  ? -13.834 15.444  -7.662  1.00 0.00 ? 69  ASN A OD1  3  
ATOM 8185  N ND2  . ASN A 1 69  ? -13.258 14.819  -9.672  1.00 0.00 ? 69  ASN A ND2  3  
ATOM 8186  H H    . ASN A 1 69  ? -10.493 12.799  -9.397  1.00 0.00 ? 69  ASN A H    3  
ATOM 8187  H HA   . ASN A 1 69  ? -10.881 15.736  -9.706  1.00 0.00 ? 69  ASN A HA   3  
ATOM 8188  H HB2  . ASN A 1 69  ? -11.490 13.773  -7.514  1.00 0.00 ? 69  ASN A HB2  3  
ATOM 8189  H HB3  . ASN A 1 69  ? -11.314 15.487  -7.137  1.00 0.00 ? 69  ASN A HB3  3  
ATOM 8190  H HD21 . ASN A 1 69  ? -12.565 14.491  -10.282 1.00 0.00 ? 69  ASN A HD21 3  
ATOM 8191  H HD22 . ASN A 1 69  ? -14.165 14.984  -10.005 1.00 0.00 ? 69  ASN A HD22 3  
ATOM 8192  N N    . PRO A 1 70  ? -8.588  16.317  -8.925  1.00 0.00 ? 70  PRO A N    3  
ATOM 8193  C CA   . PRO A 1 70  ? -7.252  16.730  -8.463  1.00 0.00 ? 70  PRO A CA   3  
ATOM 8194  C C    . PRO A 1 70  ? -7.346  17.350  -7.066  1.00 0.00 ? 70  PRO A C    3  
ATOM 8195  O O    . PRO A 1 70  ? -8.023  18.337  -6.858  1.00 0.00 ? 70  PRO A O    3  
ATOM 8196  C CB   . PRO A 1 70  ? -6.819  17.774  -9.496  1.00 0.00 ? 70  PRO A CB   3  
ATOM 8197  C CG   . PRO A 1 70  ? -8.117  18.309  -10.145 1.00 0.00 ? 70  PRO A CG   3  
ATOM 8198  C CD   . PRO A 1 70  ? -9.203  17.244  -9.898  1.00 0.00 ? 70  PRO A CD   3  
ATOM 8199  H HA   . PRO A 1 70  ? -6.569  15.897  -8.469  1.00 0.00 ? 70  PRO A HA   3  
ATOM 8200  H HB2  . PRO A 1 70  ? -6.284  18.577  -9.008  1.00 0.00 ? 70  PRO A HB2  3  
ATOM 8201  H HB3  . PRO A 1 70  ? -6.198  17.316  -10.250 1.00 0.00 ? 70  PRO A HB3  3  
ATOM 8202  H HG2  . PRO A 1 70  ? -8.401  19.246  -9.684  1.00 0.00 ? 70  PRO A HG2  3  
ATOM 8203  H HG3  . PRO A 1 70  ? -7.974  18.444  -11.205 1.00 0.00 ? 70  PRO A HG3  3  
ATOM 8204  H HD2  . PRO A 1 70  ? -10.090 17.700  -9.481  1.00 0.00 ? 70  PRO A HD2  3  
ATOM 8205  H HD3  . PRO A 1 70  ? -9.436  16.722  -10.813 1.00 0.00 ? 70  PRO A HD3  3  
ATOM 8206  N N    . GLY A 1 71  ? -6.676  16.775  -6.106  1.00 0.00 ? 71  GLY A N    3  
ATOM 8207  C CA   . GLY A 1 71  ? -6.732  17.329  -4.724  1.00 0.00 ? 71  GLY A CA   3  
ATOM 8208  C C    . GLY A 1 71  ? -7.287  16.267  -3.773  1.00 0.00 ? 71  GLY A C    3  
ATOM 8209  O O    . GLY A 1 71  ? -7.083  16.325  -2.577  1.00 0.00 ? 71  GLY A O    3  
ATOM 8210  H H    . GLY A 1 71  ? -6.138  15.977  -6.292  1.00 0.00 ? 71  GLY A H    3  
ATOM 8211  H HA2  . GLY A 1 71  ? -5.738  17.614  -4.409  1.00 0.00 ? 71  GLY A HA2  3  
ATOM 8212  H HA3  . GLY A 1 71  ? -7.377  18.194  -4.707  1.00 0.00 ? 71  GLY A HA3  3  
ATOM 8213  N N    . ALA A 1 72  ? -7.981  15.293  -4.296  1.00 0.00 ? 72  ALA A N    3  
ATOM 8214  C CA   . ALA A 1 72  ? -8.539  14.229  -3.426  1.00 0.00 ? 72  ALA A CA   3  
ATOM 8215  C C    . ALA A 1 72  ? -7.416  13.285  -3.017  1.00 0.00 ? 72  ALA A C    3  
ATOM 8216  O O    . ALA A 1 72  ? -6.763  12.677  -3.840  1.00 0.00 ? 72  ALA A O    3  
ATOM 8217  C CB   . ALA A 1 72  ? -9.610  13.444  -4.179  1.00 0.00 ? 72  ALA A CB   3  
ATOM 8218  H H    . ALA A 1 72  ? -8.130  15.259  -5.258  1.00 0.00 ? 72  ALA A H    3  
ATOM 8219  H HA   . ALA A 1 72  ? -8.974  14.675  -2.543  1.00 0.00 ? 72  ALA A HA   3  
ATOM 8220  H HB1  . ALA A 1 72  ? -9.700  13.830  -5.182  1.00 0.00 ? 72  ALA A HB1  3  
ATOM 8221  H HB2  . ALA A 1 72  ? -9.329  12.401  -4.218  1.00 0.00 ? 72  ALA A HB2  3  
ATOM 8222  H HB3  . ALA A 1 72  ? -10.555 13.543  -3.667  1.00 0.00 ? 72  ALA A HB3  3  
ATOM 8223  N N    . SER A 1 73  ? -7.192  13.166  -1.751  1.00 0.00 ? 73  SER A N    3  
ATOM 8224  C CA   . SER A 1 73  ? -6.111  12.266  -1.262  1.00 0.00 ? 73  SER A CA   3  
ATOM 8225  C C    . SER A 1 73  ? -6.614  10.822  -1.245  1.00 0.00 ? 73  SER A C    3  
ATOM 8226  O O    . SER A 1 73  ? -5.944  9.929   -0.767  1.00 0.00 ? 73  SER A O    3  
ATOM 8227  C CB   . SER A 1 73  ? -5.702  12.681  0.152   1.00 0.00 ? 73  SER A CB   3  
ATOM 8228  O OG   . SER A 1 73  ? -4.309  12.455  0.323   1.00 0.00 ? 73  SER A OG   3  
ATOM 8229  H H    . SER A 1 73  ? -7.737  13.673  -1.119  1.00 0.00 ? 73  SER A H    3  
ATOM 8230  H HA   . SER A 1 73  ? -5.257  12.342  -1.919  1.00 0.00 ? 73  SER A HA   3  
ATOM 8231  H HB2  . SER A 1 73  ? -5.912  13.727  0.298   1.00 0.00 ? 73  SER A HB2  3  
ATOM 8232  H HB3  . SER A 1 73  ? -6.263  12.100  0.872   1.00 0.00 ? 73  SER A HB3  3  
ATOM 8233  H HG   . SER A 1 73  ? -3.965  13.145  0.893   1.00 0.00 ? 73  SER A HG   3  
ATOM 8234  N N    . ALA A 1 74  ? -7.789  10.581  -1.762  1.00 0.00 ? 74  ALA A N    3  
ATOM 8235  C CA   . ALA A 1 74  ? -8.330  9.192   -1.768  1.00 0.00 ? 74  ALA A CA   3  
ATOM 8236  C C    . ALA A 1 74  ? -7.793  8.430   -2.984  1.00 0.00 ? 74  ALA A C    3  
ATOM 8237  O O    . ALA A 1 74  ? -8.515  7.718   -3.651  1.00 0.00 ? 74  ALA A O    3  
ATOM 8238  C CB   . ALA A 1 74  ? -9.856  9.238   -1.827  1.00 0.00 ? 74  ALA A CB   3  
ATOM 8239  H H    . ALA A 1 74  ? -8.316  11.314  -2.143  1.00 0.00 ? 74  ALA A H    3  
ATOM 8240  H HA   . ALA A 1 74  ? -8.021  8.685   -0.866  1.00 0.00 ? 74  ALA A HA   3  
ATOM 8241  H HB1  . ALA A 1 74  ? -10.168 9.752   -2.723  1.00 0.00 ? 74  ALA A HB1  3  
ATOM 8242  H HB2  . ALA A 1 74  ? -10.246 8.231   -1.835  1.00 0.00 ? 74  ALA A HB2  3  
ATOM 8243  H HB3  . ALA A 1 74  ? -10.233 9.763   -0.961  1.00 0.00 ? 74  ALA A HB3  3  
ATOM 8244  N N    . ALA A 1 75  ? -6.529  8.568   -3.270  1.00 0.00 ? 75  ALA A N    3  
ATOM 8245  C CA   . ALA A 1 75  ? -5.934  7.845   -4.430  1.00 0.00 ? 75  ALA A CA   3  
ATOM 8246  C C    . ALA A 1 75  ? -5.401  6.492   -3.938  1.00 0.00 ? 75  ALA A C    3  
ATOM 8247  O O    . ALA A 1 75  ? -5.570  6.158   -2.783  1.00 0.00 ? 75  ALA A O    3  
ATOM 8248  C CB   . ALA A 1 75  ? -4.791  8.682   -5.004  1.00 0.00 ? 75  ALA A CB   3  
ATOM 8249  H H    . ALA A 1 75  ? -5.967  9.141   -2.714  1.00 0.00 ? 75  ALA A H    3  
ATOM 8250  H HA   . ALA A 1 75  ? -6.691  7.687   -5.187  1.00 0.00 ? 75  ALA A HA   3  
ATOM 8251  H HB1  . ALA A 1 75  ? -4.880  9.700   -4.655  1.00 0.00 ? 75  ALA A HB1  3  
ATOM 8252  H HB2  . ALA A 1 75  ? -3.846  8.272   -4.679  1.00 0.00 ? 75  ALA A HB2  3  
ATOM 8253  H HB3  . ALA A 1 75  ? -4.839  8.666   -6.082  1.00 0.00 ? 75  ALA A HB3  3  
ATOM 8254  N N    . PRO A 1 76  ? -4.770  5.747   -4.816  1.00 0.00 ? 76  PRO A N    3  
ATOM 8255  C CA   . PRO A 1 76  ? -4.208  4.431   -4.462  1.00 0.00 ? 76  PRO A CA   3  
ATOM 8256  C C    . PRO A 1 76  ? -2.917  4.622   -3.677  1.00 0.00 ? 76  PRO A C    3  
ATOM 8257  O O    . PRO A 1 76  ? -2.560  5.727   -3.321  1.00 0.00 ? 76  PRO A O    3  
ATOM 8258  C CB   . PRO A 1 76  ? -3.931  3.774   -5.811  1.00 0.00 ? 76  PRO A CB   3  
ATOM 8259  C CG   . PRO A 1 76  ? -3.805  4.924   -6.830  1.00 0.00 ? 76  PRO A CG   3  
ATOM 8260  C CD   . PRO A 1 76  ? -4.547  6.134   -6.225  1.00 0.00 ? 76  PRO A CD   3  
ATOM 8261  H HA   . PRO A 1 76  ? -4.916  3.846   -3.900  1.00 0.00 ? 76  PRO A HA   3  
ATOM 8262  H HB2  . PRO A 1 76  ? -3.009  3.209   -5.766  1.00 0.00 ? 76  PRO A HB2  3  
ATOM 8263  H HB3  . PRO A 1 76  ? -4.750  3.129   -6.088  1.00 0.00 ? 76  PRO A HB3  3  
ATOM 8264  H HG2  . PRO A 1 76  ? -2.760  5.165   -6.979  1.00 0.00 ? 76  PRO A HG2  3  
ATOM 8265  H HG3  . PRO A 1 76  ? -4.260  4.641   -7.762  1.00 0.00 ? 76  PRO A HG3  3  
ATOM 8266  H HD2  . PRO A 1 76  ? -3.928  7.016   -6.290  1.00 0.00 ? 76  PRO A HD2  3  
ATOM 8267  H HD3  . PRO A 1 76  ? -5.491  6.291   -6.725  1.00 0.00 ? 76  PRO A HD3  3  
ATOM 8268  N N    . CYS A 1 77  ? -2.214  3.567   -3.386  1.00 0.00 ? 77  CYS A N    3  
ATOM 8269  C CA   . CYS A 1 77  ? -0.963  3.736   -2.609  1.00 0.00 ? 77  CYS A CA   3  
ATOM 8270  C C    . CYS A 1 77  ? 0.095   2.708   -3.023  1.00 0.00 ? 77  CYS A C    3  
ATOM 8271  O O    . CYS A 1 77  ? 0.131   1.605   -2.515  1.00 0.00 ? 77  CYS A O    3  
ATOM 8272  C CB   . CYS A 1 77  ? -1.283  3.574   -1.124  1.00 0.00 ? 77  CYS A CB   3  
ATOM 8273  S SG   . CYS A 1 77  ? -0.962  5.139   -0.277  1.00 0.00 ? 77  CYS A SG   3  
ATOM 8274  H H    . CYS A 1 77  ? -2.511  2.676   -3.667  1.00 0.00 ? 77  CYS A H    3  
ATOM 8275  H HA   . CYS A 1 77  ? -0.575  4.729   -2.776  1.00 0.00 ? 77  CYS A HA   3  
ATOM 8276  H HB2  . CYS A 1 77  ? -2.323  3.308   -1.007  1.00 0.00 ? 77  CYS A HB2  3  
ATOM 8277  H HB3  . CYS A 1 77  ? -0.663  2.800   -0.703  1.00 0.00 ? 77  CYS A HB3  3  
ATOM 8278  N N    . CYS A 1 78  ? 0.971   3.066   -3.925  1.00 0.00 ? 78  CYS A N    3  
ATOM 8279  C CA   . CYS A 1 78  ? 2.044   2.108   -4.334  1.00 0.00 ? 78  CYS A CA   3  
ATOM 8280  C C    . CYS A 1 78  ? 2.773   1.630   -3.066  1.00 0.00 ? 78  CYS A C    3  
ATOM 8281  O O    . CYS A 1 78  ? 3.046   2.410   -2.176  1.00 0.00 ? 78  CYS A O    3  
ATOM 8282  C CB   . CYS A 1 78  ? 3.037   2.813   -5.270  1.00 0.00 ? 78  CYS A CB   3  
ATOM 8283  S SG   . CYS A 1 78  ? 4.278   1.627   -5.844  1.00 0.00 ? 78  CYS A SG   3  
ATOM 8284  H H    . CYS A 1 78  ? 0.931   3.966   -4.321  1.00 0.00 ? 78  CYS A H    3  
ATOM 8285  H HA   . CYS A 1 78  ? 1.601   1.265   -4.838  1.00 0.00 ? 78  CYS A HA   3  
ATOM 8286  H HB2  . CYS A 1 78  ? 2.506   3.215   -6.120  1.00 0.00 ? 78  CYS A HB2  3  
ATOM 8287  H HB3  . CYS A 1 78  ? 3.532   3.618   -4.740  1.00 0.00 ? 78  CYS A HB3  3  
ATOM 8288  N N    . VAL A 1 79  ? 3.073   0.357   -2.955  1.00 0.00 ? 79  VAL A N    3  
ATOM 8289  C CA   . VAL A 1 79  ? 3.756   -0.140  -1.722  1.00 0.00 ? 79  VAL A CA   3  
ATOM 8290  C C    . VAL A 1 79  ? 4.778   -1.237  -2.069  1.00 0.00 ? 79  VAL A C    3  
ATOM 8291  O O    . VAL A 1 79  ? 4.854   -1.670  -3.194  1.00 0.00 ? 79  VAL A O    3  
ATOM 8292  C CB   . VAL A 1 79  ? 2.693   -0.686  -0.759  1.00 0.00 ? 79  VAL A CB   3  
ATOM 8293  C CG1  . VAL A 1 79  ? 1.445   0.180   -0.850  1.00 0.00 ? 79  VAL A CG1  3  
ATOM 8294  C CG2  . VAL A 1 79  ? 2.322   -2.124  -1.135  1.00 0.00 ? 79  VAL A CG2  3  
ATOM 8295  H H    . VAL A 1 79  ? 2.836   -0.266  -3.665  1.00 0.00 ? 79  VAL A H    3  
ATOM 8296  H HA   . VAL A 1 79  ? 4.266   0.682   -1.256  1.00 0.00 ? 79  VAL A HA   3  
ATOM 8297  H HB   . VAL A 1 79  ? 3.068   -0.658  0.251   1.00 0.00 ? 79  VAL A HB   3  
ATOM 8298  H HG11 . VAL A 1 79  ? 1.729   1.203   -1.042  1.00 0.00 ? 79  VAL A HG11 3  
ATOM 8299  H HG12 . VAL A 1 79  ? 0.819   -0.179  -1.656  1.00 0.00 ? 79  VAL A HG12 3  
ATOM 8300  H HG13 . VAL A 1 79  ? 0.905   0.124   0.080   1.00 0.00 ? 79  VAL A HG13 3  
ATOM 8301  H HG21 . VAL A 1 79  ? 2.080   -2.168  -2.187  1.00 0.00 ? 79  VAL A HG21 3  
ATOM 8302  H HG22 . VAL A 1 79  ? 3.156   -2.777  -0.929  1.00 0.00 ? 79  VAL A HG22 3  
ATOM 8303  H HG23 . VAL A 1 79  ? 1.466   -2.437  -0.556  1.00 0.00 ? 79  VAL A HG23 3  
ATOM 8304  N N    . PRO A 1 80  ? 5.543   -1.648  -1.086  1.00 0.00 ? 80  PRO A N    3  
ATOM 8305  C CA   . PRO A 1 80  ? 6.573   -2.687  -1.262  1.00 0.00 ? 80  PRO A CA   3  
ATOM 8306  C C    . PRO A 1 80  ? 5.948   -4.086  -1.191  1.00 0.00 ? 80  PRO A C    3  
ATOM 8307  O O    . PRO A 1 80  ? 5.690   -4.604  -0.123  1.00 0.00 ? 80  PRO A O    3  
ATOM 8308  C CB   . PRO A 1 80  ? 7.511   -2.463  -0.076  1.00 0.00 ? 80  PRO A CB   3  
ATOM 8309  C CG   . PRO A 1 80  ? 6.685   -1.723  1.000   1.00 0.00 ? 80  PRO A CG   3  
ATOM 8310  C CD   . PRO A 1 80  ? 5.463   -1.114  0.287   1.00 0.00 ? 80  PRO A CD   3  
ATOM 8311  H HA   . PRO A 1 80  ? 7.110   -2.550  -2.186  1.00 0.00 ? 80  PRO A HA   3  
ATOM 8312  H HB2  . PRO A 1 80  ? 7.860   -3.413  0.305   1.00 0.00 ? 80  PRO A HB2  3  
ATOM 8313  H HB3  . PRO A 1 80  ? 8.347   -1.852  -0.376  1.00 0.00 ? 80  PRO A HB3  3  
ATOM 8314  H HG2  . PRO A 1 80  ? 6.363   -2.420  1.761   1.00 0.00 ? 80  PRO A HG2  3  
ATOM 8315  H HG3  . PRO A 1 80  ? 7.275   -0.940  1.442   1.00 0.00 ? 80  PRO A HG3  3  
ATOM 8316  H HD2  . PRO A 1 80  ? 4.557   -1.443  0.768   1.00 0.00 ? 80  PRO A HD2  3  
ATOM 8317  H HD3  . PRO A 1 80  ? 5.524   -0.037  0.275   1.00 0.00 ? 80  PRO A HD3  3  
ATOM 8318  N N    . GLN A 1 81  ? 5.708   -4.702  -2.315  1.00 0.00 ? 81  GLN A N    3  
ATOM 8319  C CA   . GLN A 1 81  ? 5.110   -6.063  -2.305  1.00 0.00 ? 81  GLN A CA   3  
ATOM 8320  C C    . GLN A 1 81  ? 6.095   -7.035  -1.655  1.00 0.00 ? 81  GLN A C    3  
ATOM 8321  O O    . GLN A 1 81  ? 5.862   -7.544  -0.577  1.00 0.00 ? 81  GLN A O    3  
ATOM 8322  C CB   . GLN A 1 81  ? 4.829   -6.501  -3.743  1.00 0.00 ? 81  GLN A CB   3  
ATOM 8323  C CG   . GLN A 1 81  ? 4.391   -7.964  -3.749  1.00 0.00 ? 81  GLN A CG   3  
ATOM 8324  C CD   . GLN A 1 81  ? 4.333   -8.475  -5.189  1.00 0.00 ? 81  GLN A CD   3  
ATOM 8325  O OE1  . GLN A 1 81  ? 4.412   -7.703  -6.124  1.00 0.00 ? 81  GLN A OE1  3  
ATOM 8326  N NE2  . GLN A 1 81  ? 4.195   -9.754  -5.410  1.00 0.00 ? 81  GLN A NE2  3  
ATOM 8327  H H    . GLN A 1 81  ? 5.927   -4.274  -3.166  1.00 0.00 ? 81  GLN A H    3  
ATOM 8328  H HA   . GLN A 1 81  ? 4.189   -6.050  -1.743  1.00 0.00 ? 81  GLN A HA   3  
ATOM 8329  H HB2  . GLN A 1 81  ? 4.043   -5.887  -4.160  1.00 0.00 ? 81  GLN A HB2  3  
ATOM 8330  H HB3  . GLN A 1 81  ? 5.724   -6.392  -4.336  1.00 0.00 ? 81  GLN A HB3  3  
ATOM 8331  H HG2  . GLN A 1 81  ? 5.101   -8.551  -3.186  1.00 0.00 ? 81  GLN A HG2  3  
ATOM 8332  H HG3  . GLN A 1 81  ? 3.415   -8.047  -3.299  1.00 0.00 ? 81  GLN A HG3  3  
ATOM 8333  H HE21 . GLN A 1 81  ? 4.131   -10.377 -4.656  1.00 0.00 ? 81  GLN A HE21 3  
ATOM 8334  H HE22 . GLN A 1 81  ? 4.156   -10.091 -6.329  1.00 0.00 ? 81  GLN A HE22 3  
ATOM 8335  N N    . ALA A 1 82  ? 7.202   -7.288  -2.299  1.00 0.00 ? 82  ALA A N    3  
ATOM 8336  C CA   . ALA A 1 82  ? 8.210   -8.216  -1.713  1.00 0.00 ? 82  ALA A CA   3  
ATOM 8337  C C    . ALA A 1 82  ? 9.206   -7.404  -0.885  1.00 0.00 ? 82  ALA A C    3  
ATOM 8338  O O    . ALA A 1 82  ? 9.327   -6.206  -1.047  1.00 0.00 ? 82  ALA A O    3  
ATOM 8339  C CB   . ALA A 1 82  ? 8.951   -8.942  -2.838  1.00 0.00 ? 82  ALA A CB   3  
ATOM 8340  H H    . ALA A 1 82  ? 7.376   -6.860  -3.163  1.00 0.00 ? 82  ALA A H    3  
ATOM 8341  H HA   . ALA A 1 82  ? 7.714   -8.937  -1.081  1.00 0.00 ? 82  ALA A HA   3  
ATOM 8342  H HB1  . ALA A 1 82  ? 9.073   -8.275  -3.678  1.00 0.00 ? 82  ALA A HB1  3  
ATOM 8343  H HB2  . ALA A 1 82  ? 9.922   -9.259  -2.484  1.00 0.00 ? 82  ALA A HB2  3  
ATOM 8344  H HB3  . ALA A 1 82  ? 8.381   -9.807  -3.144  1.00 0.00 ? 82  ALA A HB3  3  
ATOM 8345  N N    . LEU A 1 83  ? 9.917   -8.036  0.008   1.00 0.00 ? 83  LEU A N    3  
ATOM 8346  C CA   . LEU A 1 83  ? 10.892  -7.280  0.842   1.00 0.00 ? 83  LEU A CA   3  
ATOM 8347  C C    . LEU A 1 83  ? 12.147  -8.119  1.066   1.00 0.00 ? 83  LEU A C    3  
ATOM 8348  O O    . LEU A 1 83  ? 12.355  -9.140  0.443   1.00 0.00 ? 83  LEU A O    3  
ATOM 8349  C CB   . LEU A 1 83  ? 10.260  -6.959  2.198   1.00 0.00 ? 83  LEU A CB   3  
ATOM 8350  C CG   . LEU A 1 83  ? 9.092   -6.002  1.995   1.00 0.00 ? 83  LEU A CG   3  
ATOM 8351  C CD1  . LEU A 1 83  ? 8.024   -6.259  3.059   1.00 0.00 ? 83  LEU A CD1  3  
ATOM 8352  C CD2  . LEU A 1 83  ? 9.590   -4.563  2.121   1.00 0.00 ? 83  LEU A CD2  3  
ATOM 8353  H H    . LEU A 1 83  ? 9.807   -9.001  0.134   1.00 0.00 ? 83  LEU A H    3  
ATOM 8354  H HA   . LEU A 1 83  ? 11.157  -6.361  0.342   1.00 0.00 ? 83  LEU A HA   3  
ATOM 8355  H HB2  . LEU A 1 83  ? 9.910   -7.869  2.659   1.00 0.00 ? 83  LEU A HB2  3  
ATOM 8356  H HB3  . LEU A 1 83  ? 10.996  -6.493  2.836   1.00 0.00 ? 83  LEU A HB3  3  
ATOM 8357  H HG   . LEU A 1 83  ? 8.672   -6.154  1.015   1.00 0.00 ? 83  LEU A HG   3  
ATOM 8358  H HD11 . LEU A 1 83  ? 8.501   -6.513  3.993   1.00 0.00 ? 83  LEU A HD11 3  
ATOM 8359  H HD12 . LEU A 1 83  ? 7.424   -5.371  3.190   1.00 0.00 ? 83  LEU A HD12 3  
ATOM 8360  H HD13 . LEU A 1 83  ? 7.392   -7.076  2.744   1.00 0.00 ? 83  LEU A HD13 3  
ATOM 8361  H HD21 . LEU A 1 83  ? 10.359  -4.517  2.878   1.00 0.00 ? 83  LEU A HD21 3  
ATOM 8362  H HD22 . LEU A 1 83  ? 9.995   -4.239  1.175   1.00 0.00 ? 83  LEU A HD22 3  
ATOM 8363  H HD23 . LEU A 1 83  ? 8.769   -3.922  2.402   1.00 0.00 ? 83  LEU A HD23 3  
ATOM 8364  N N    . GLU A 1 84  ? 12.977  -7.684  1.965   1.00 0.00 ? 84  GLU A N    3  
ATOM 8365  C CA   . GLU A 1 84  ? 14.227  -8.431  2.269   1.00 0.00 ? 84  GLU A CA   3  
ATOM 8366  C C    . GLU A 1 84  ? 14.573  -8.222  3.744   1.00 0.00 ? 84  GLU A C    3  
ATOM 8367  O O    . GLU A 1 84  ? 14.132  -7.265  4.346   1.00 0.00 ? 84  GLU A O    3  
ATOM 8368  C CB   . GLU A 1 84  ? 15.368  -7.905  1.394   1.00 0.00 ? 84  GLU A CB   3  
ATOM 8369  C CG   . GLU A 1 84  ? 15.580  -8.848  0.209   1.00 0.00 ? 84  GLU A CG   3  
ATOM 8370  C CD   . GLU A 1 84  ? 16.386  -8.131  -0.876  1.00 0.00 ? 84  GLU A CD   3  
ATOM 8371  O OE1  . GLU A 1 84  ? 16.460  -6.914  -0.825  1.00 0.00 ? 84  GLU A OE1  3  
ATOM 8372  O OE2  . GLU A 1 84  ? 16.917  -8.811  -1.738  1.00 0.00 ? 84  GLU A OE2  3  
ATOM 8373  H H    . GLU A 1 84  ? 12.770  -6.859  2.451   1.00 0.00 ? 84  GLU A H    3  
ATOM 8374  H HA   . GLU A 1 84  ? 14.077  -9.484  2.078   1.00 0.00 ? 84  GLU A HA   3  
ATOM 8375  H HB2  . GLU A 1 84  ? 15.115  -6.918  1.030   1.00 0.00 ? 84  GLU A HB2  3  
ATOM 8376  H HB3  . GLU A 1 84  ? 16.274  -7.853  1.977   1.00 0.00 ? 84  GLU A HB3  3  
ATOM 8377  H HG2  . GLU A 1 84  ? 16.117  -9.725  0.538   1.00 0.00 ? 84  GLU A HG2  3  
ATOM 8378  H HG3  . GLU A 1 84  ? 14.622  -9.142  -0.194  1.00 0.00 ? 84  GLU A HG3  3  
ATOM 8379  N N    . PRO A 1 85  ? 15.347  -9.124  4.285   1.00 0.00 ? 85  PRO A N    3  
ATOM 8380  C CA   . PRO A 1 85  ? 15.762  -9.064  5.696   1.00 0.00 ? 85  PRO A CA   3  
ATOM 8381  C C    . PRO A 1 85  ? 16.839  -7.994  5.899   1.00 0.00 ? 85  PRO A C    3  
ATOM 8382  O O    . PRO A 1 85  ? 17.055  -7.151  5.052   1.00 0.00 ? 85  PRO A O    3  
ATOM 8383  C CB   . PRO A 1 85  ? 16.298  -10.469 5.975   1.00 0.00 ? 85  PRO A CB   3  
ATOM 8384  C CG   . PRO A 1 85  ? 16.670  -11.073 4.601   1.00 0.00 ? 85  PRO A CG   3  
ATOM 8385  C CD   . PRO A 1 85  ? 15.883  -10.281 3.542   1.00 0.00 ? 85  PRO A CD   3  
ATOM 8386  H HA   . PRO A 1 85  ? 14.912  -8.866  6.329   1.00 0.00 ? 85  PRO A HA   3  
ATOM 8387  H HB2  . PRO A 1 85  ? 17.173  -10.413 6.609   1.00 0.00 ? 85  PRO A HB2  3  
ATOM 8388  H HB3  . PRO A 1 85  ? 15.536  -11.073 6.442   1.00 0.00 ? 85  PRO A HB3  3  
ATOM 8389  H HG2  . PRO A 1 85  ? 17.732  -10.973 4.430   1.00 0.00 ? 85  PRO A HG2  3  
ATOM 8390  H HG3  . PRO A 1 85  ? 16.382  -12.111 4.564   1.00 0.00 ? 85  PRO A HG3  3  
ATOM 8391  H HD2  . PRO A 1 85  ? 16.542  -9.952  2.750   1.00 0.00 ? 85  PRO A HD2  3  
ATOM 8392  H HD3  . PRO A 1 85  ? 15.076  -10.875 3.144   1.00 0.00 ? 85  PRO A HD3  3  
ATOM 8393  N N    . LEU A 1 86  ? 17.499  -8.004  7.026   1.00 0.00 ? 86  LEU A N    3  
ATOM 8394  C CA   . LEU A 1 86  ? 18.538  -6.969  7.287   1.00 0.00 ? 86  LEU A CA   3  
ATOM 8395  C C    . LEU A 1 86  ? 19.409  -7.412  8.475   1.00 0.00 ? 86  LEU A C    3  
ATOM 8396  O O    . LEU A 1 86  ? 18.961  -7.404  9.599   1.00 0.00 ? 86  LEU A O    3  
ATOM 8397  C CB   . LEU A 1 86  ? 17.804  -5.639  7.581   1.00 0.00 ? 86  LEU A CB   3  
ATOM 8398  C CG   . LEU A 1 86  ? 18.574  -4.751  8.572   1.00 0.00 ? 86  LEU A CG   3  
ATOM 8399  C CD1  . LEU A 1 86  ? 19.553  -3.847  7.827   1.00 0.00 ? 86  LEU A CD1  3  
ATOM 8400  C CD2  . LEU A 1 86  ? 17.577  -3.872  9.329   1.00 0.00 ? 86  LEU A CD2  3  
ATOM 8401  H H    . LEU A 1 86  ? 17.299  -8.680  7.709   1.00 0.00 ? 86  LEU A H    3  
ATOM 8402  H HA   . LEU A 1 86  ? 19.151  -6.848  6.408   1.00 0.00 ? 86  LEU A HA   3  
ATOM 8403  H HB2  . LEU A 1 86  ? 17.678  -5.098  6.656   1.00 0.00 ? 86  LEU A HB2  3  
ATOM 8404  H HB3  . LEU A 1 86  ? 16.831  -5.861  7.991   1.00 0.00 ? 86  LEU A HB3  3  
ATOM 8405  H HG   . LEU A 1 86  ? 19.111  -5.360  9.271   1.00 0.00 ? 86  LEU A HG   3  
ATOM 8406  H HD11 . LEU A 1 86  ? 19.542  -4.092  6.778   1.00 0.00 ? 86  LEU A HD11 3  
ATOM 8407  H HD12 . LEU A 1 86  ? 19.260  -2.816  7.962   1.00 0.00 ? 86  LEU A HD12 3  
ATOM 8408  H HD13 . LEU A 1 86  ? 20.547  -3.993  8.224   1.00 0.00 ? 86  LEU A HD13 3  
ATOM 8409  H HD21 . LEU A 1 86  ? 16.604  -4.340  9.320   1.00 0.00 ? 86  LEU A HD21 3  
ATOM 8410  H HD22 . LEU A 1 86  ? 17.907  -3.748  10.349  1.00 0.00 ? 86  LEU A HD22 3  
ATOM 8411  H HD23 . LEU A 1 86  ? 17.515  -2.905  8.851   1.00 0.00 ? 86  LEU A HD23 3  
ATOM 8412  N N    . PRO A 1 87  ? 20.638  -7.776  8.191   1.00 0.00 ? 87  PRO A N    3  
ATOM 8413  C CA   . PRO A 1 87  ? 21.594  -8.216  9.227   1.00 0.00 ? 87  PRO A CA   3  
ATOM 8414  C C    . PRO A 1 87  ? 22.090  -7.006  10.015  1.00 0.00 ? 87  PRO A C    3  
ATOM 8415  O O    . PRO A 1 87  ? 22.764  -6.142  9.489   1.00 0.00 ? 87  PRO A O    3  
ATOM 8416  C CB   . PRO A 1 87  ? 22.726  -8.864  8.425   1.00 0.00 ? 87  PRO A CB   3  
ATOM 8417  C CG   . PRO A 1 87  ? 22.637  -8.279  6.997   1.00 0.00 ? 87  PRO A CG   3  
ATOM 8418  C CD   . PRO A 1 87  ? 21.192  -7.773  6.821   1.00 0.00 ? 87  PRO A CD   3  
ATOM 8419  H HA   . PRO A 1 87  ? 21.145  -8.941  9.889   1.00 0.00 ? 87  PRO A HA   3  
ATOM 8420  H HB2  . PRO A 1 87  ? 23.681  -8.622  8.871   1.00 0.00 ? 87  PRO A HB2  3  
ATOM 8421  H HB3  . PRO A 1 87  ? 22.591  -9.933  8.389   1.00 0.00 ? 87  PRO A HB3  3  
ATOM 8422  H HG2  . PRO A 1 87  ? 23.336  -7.461  6.889   1.00 0.00 ? 87  PRO A HG2  3  
ATOM 8423  H HG3  . PRO A 1 87  ? 22.846  -9.046  6.267   1.00 0.00 ? 87  PRO A HG3  3  
ATOM 8424  H HD2  . PRO A 1 87  ? 21.191  -6.772  6.411   1.00 0.00 ? 87  PRO A HD2  3  
ATOM 8425  H HD3  . PRO A 1 87  ? 20.630  -8.444  6.190   1.00 0.00 ? 87  PRO A HD3  3  
ATOM 8426  N N    . ILE A 1 88  ? 21.742  -6.923  11.268  1.00 0.00 ? 88  ILE A N    3  
ATOM 8427  C CA   . ILE A 1 88  ? 22.173  -5.753  12.078  1.00 0.00 ? 88  ILE A CA   3  
ATOM 8428  C C    . ILE A 1 88  ? 22.904  -6.209  13.334  1.00 0.00 ? 88  ILE A C    3  
ATOM 8429  O O    . ILE A 1 88  ? 23.351  -7.332  13.449  1.00 0.00 ? 88  ILE A O    3  
ATOM 8430  C CB   . ILE A 1 88  ? 20.937  -4.951  12.500  1.00 0.00 ? 88  ILE A CB   3  
ATOM 8431  C CG1  . ILE A 1 88  ? 20.240  -5.651  13.672  1.00 0.00 ? 88  ILE A CG1  3  
ATOM 8432  C CG2  . ILE A 1 88  ? 19.968  -4.869  11.331  1.00 0.00 ? 88  ILE A CG2  3  
ATOM 8433  C CD1  . ILE A 1 88  ? 18.880  -5.007  13.919  1.00 0.00 ? 88  ILE A CD1  3  
ATOM 8434  H H    . ILE A 1 88  ? 21.183  -7.620  11.670  1.00 0.00 ? 88  ILE A H    3  
ATOM 8435  H HA   . ILE A 1 88  ? 22.822  -5.125  11.489  1.00 0.00 ? 88  ILE A HA   3  
ATOM 8436  H HB   . ILE A 1 88  ? 21.235  -3.956  12.795  1.00 0.00 ? 88  ILE A HB   3  
ATOM 8437  H HG12 . ILE A 1 88  ? 20.112  -6.693  13.440  1.00 0.00 ? 88  ILE A HG12 3  
ATOM 8438  H HG13 . ILE A 1 88  ? 20.841  -5.556  14.557  1.00 0.00 ? 88  ILE A HG13 3  
ATOM 8439  H HG21 . ILE A 1 88  ? 20.518  -4.944  10.405  1.00 0.00 ? 88  ILE A HG21 3  
ATOM 8440  H HG22 . ILE A 1 88  ? 19.258  -5.682  11.396  1.00 0.00 ? 88  ILE A HG22 3  
ATOM 8441  H HG23 . ILE A 1 88  ? 19.443  -3.928  11.367  1.00 0.00 ? 88  ILE A HG23 3  
ATOM 8442  H HD11 . ILE A 1 88  ? 18.915  -3.971  13.622  1.00 0.00 ? 88  ILE A HD11 3  
ATOM 8443  H HD12 . ILE A 1 88  ? 18.129  -5.524  13.342  1.00 0.00 ? 88  ILE A HD12 3  
ATOM 8444  H HD13 . ILE A 1 88  ? 18.637  -5.073  14.969  1.00 0.00 ? 88  ILE A HD13 3  
ATOM 8445  N N    . VAL A 1 89  ? 22.981  -5.326  14.283  1.00 0.00 ? 89  VAL A N    3  
ATOM 8446  C CA   . VAL A 1 89  ? 23.636  -5.630  15.579  1.00 0.00 ? 89  VAL A CA   3  
ATOM 8447  C C    . VAL A 1 89  ? 23.216  -4.555  16.575  1.00 0.00 ? 89  VAL A C    3  
ATOM 8448  O O    . VAL A 1 89  ? 23.597  -3.409  16.453  1.00 0.00 ? 89  VAL A O    3  
ATOM 8449  C CB   . VAL A 1 89  ? 25.160  -5.599  15.443  1.00 0.00 ? 89  VAL A CB   3  
ATOM 8450  C CG1  . VAL A 1 89  ? 25.778  -6.210  16.700  1.00 0.00 ? 89  VAL A CG1  3  
ATOM 8451  C CG2  . VAL A 1 89  ? 25.605  -6.396  14.215  1.00 0.00 ? 89  VAL A CG2  3  
ATOM 8452  H H    . VAL A 1 89  ? 22.573  -4.447  14.148  1.00 0.00 ? 89  VAL A H    3  
ATOM 8453  H HA   . VAL A 1 89  ? 23.309  -6.597  15.928  1.00 0.00 ? 89  VAL A HA   3  
ATOM 8454  H HB   . VAL A 1 89  ? 25.488  -4.573  15.348  1.00 0.00 ? 89  VAL A HB   3  
ATOM 8455  H HG11 . VAL A 1 89  ? 25.045  -6.834  17.193  1.00 0.00 ? 89  VAL A HG11 3  
ATOM 8456  H HG12 . VAL A 1 89  ? 26.634  -6.807  16.426  1.00 0.00 ? 89  VAL A HG12 3  
ATOM 8457  H HG13 . VAL A 1 89  ? 26.086  -5.421  17.370  1.00 0.00 ? 89  VAL A HG13 3  
ATOM 8458  H HG21 . VAL A 1 89  ? 25.236  -7.405  14.287  1.00 0.00 ? 89  VAL A HG21 3  
ATOM 8459  H HG22 . VAL A 1 89  ? 25.214  -5.931  13.322  1.00 0.00 ? 89  VAL A HG22 3  
ATOM 8460  H HG23 . VAL A 1 89  ? 26.683  -6.410  14.169  1.00 0.00 ? 89  VAL A HG23 3  
ATOM 8461  N N    . TYR A 1 90  ? 22.433  -4.900  17.552  1.00 0.00 ? 90  TYR A N    3  
ATOM 8462  C CA   . TYR A 1 90  ? 21.998  -3.873  18.533  1.00 0.00 ? 90  TYR A CA   3  
ATOM 8463  C C    . TYR A 1 90  ? 22.456  -4.267  19.933  1.00 0.00 ? 90  TYR A C    3  
ATOM 8464  O O    . TYR A 1 90  ? 23.194  -5.214  20.114  1.00 0.00 ? 90  TYR A O    3  
ATOM 8465  C CB   . TYR A 1 90  ? 20.476  -3.746  18.505  1.00 0.00 ? 90  TYR A CB   3  
ATOM 8466  C CG   . TYR A 1 90  ? 19.843  -5.106  18.336  1.00 0.00 ? 90  TYR A CG   3  
ATOM 8467  C CD1  . TYR A 1 90  ? 19.783  -5.694  17.069  1.00 0.00 ? 90  TYR A CD1  3  
ATOM 8468  C CD2  . TYR A 1 90  ? 19.306  -5.771  19.443  1.00 0.00 ? 90  TYR A CD2  3  
ATOM 8469  C CE1  . TYR A 1 90  ? 19.188  -6.950  16.906  1.00 0.00 ? 90  TYR A CE1  3  
ATOM 8470  C CE2  . TYR A 1 90  ? 18.710  -7.028  19.281  1.00 0.00 ? 90  TYR A CE2  3  
ATOM 8471  C CZ   . TYR A 1 90  ? 18.651  -7.617  18.012  1.00 0.00 ? 90  TYR A CZ   3  
ATOM 8472  O OH   . TYR A 1 90  ? 18.063  -8.856  17.854  1.00 0.00 ? 90  TYR A OH   3  
ATOM 8473  H H    . TYR A 1 90  ? 22.132  -5.826  17.639  1.00 0.00 ? 90  TYR A H    3  
ATOM 8474  H HA   . TYR A 1 90  ? 22.437  -2.921  18.266  1.00 0.00 ? 90  TYR A HA   3  
ATOM 8475  H HB2  . TYR A 1 90  ? 20.135  -3.301  19.428  1.00 0.00 ? 90  TYR A HB2  3  
ATOM 8476  H HB3  . TYR A 1 90  ? 20.192  -3.118  17.678  1.00 0.00 ? 90  TYR A HB3  3  
ATOM 8477  H HD1  . TYR A 1 90  ? 20.196  -5.177  16.217  1.00 0.00 ? 90  TYR A HD1  3  
ATOM 8478  H HD2  . TYR A 1 90  ? 19.352  -5.316  20.421  1.00 0.00 ? 90  TYR A HD2  3  
ATOM 8479  H HE1  . TYR A 1 90  ? 19.141  -7.405  15.925  1.00 0.00 ? 90  TYR A HE1  3  
ATOM 8480  H HE2  . TYR A 1 90  ? 18.294  -7.541  20.133  1.00 0.00 ? 90  TYR A HE2  3  
ATOM 8481  H HH   . TYR A 1 90  ? 17.164  -8.801  18.186  1.00 0.00 ? 90  TYR A HH   3  
ATOM 8482  N N    . TYR A 1 91  ? 22.036  -3.539  20.927  1.00 0.00 ? 91  TYR A N    3  
ATOM 8483  C CA   . TYR A 1 91  ? 22.461  -3.865  22.314  1.00 0.00 ? 91  TYR A CA   3  
ATOM 8484  C C    . TYR A 1 91  ? 21.254  -3.901  23.250  1.00 0.00 ? 91  TYR A C    3  
ATOM 8485  O O    . TYR A 1 91  ? 20.487  -2.963  23.328  1.00 0.00 ? 91  TYR A O    3  
ATOM 8486  C CB   . TYR A 1 91  ? 23.423  -2.790  22.809  1.00 0.00 ? 91  TYR A CB   3  
ATOM 8487  C CG   . TYR A 1 91  ? 24.838  -3.206  22.516  1.00 0.00 ? 91  TYR A CG   3  
ATOM 8488  C CD1  . TYR A 1 91  ? 25.406  -2.912  21.275  1.00 0.00 ? 91  TYR A CD1  3  
ATOM 8489  C CD2  . TYR A 1 91  ? 25.584  -3.871  23.492  1.00 0.00 ? 91  TYR A CD2  3  
ATOM 8490  C CE1  . TYR A 1 91  ? 26.728  -3.287  21.006  1.00 0.00 ? 91  TYR A CE1  3  
ATOM 8491  C CE2  . TYR A 1 91  ? 26.905  -4.244  23.230  1.00 0.00 ? 91  TYR A CE2  3  
ATOM 8492  C CZ   . TYR A 1 91  ? 27.479  -3.953  21.985  1.00 0.00 ? 91  TYR A CZ   3  
ATOM 8493  O OH   . TYR A 1 91  ? 28.784  -4.321  21.725  1.00 0.00 ? 91  TYR A OH   3  
ATOM 8494  H H    . TYR A 1 91  ? 21.454  -2.773  20.757  1.00 0.00 ? 91  TYR A H    3  
ATOM 8495  H HA   . TYR A 1 91  ? 22.957  -4.823  22.325  1.00 0.00 ? 91  TYR A HA   3  
ATOM 8496  H HB2  . TYR A 1 91  ? 23.210  -1.858  22.305  1.00 0.00 ? 91  TYR A HB2  3  
ATOM 8497  H HB3  . TYR A 1 91  ? 23.300  -2.660  23.874  1.00 0.00 ? 91  TYR A HB3  3  
ATOM 8498  H HD1  . TYR A 1 91  ? 24.820  -2.401  20.522  1.00 0.00 ? 91  TYR A HD1  3  
ATOM 8499  H HD2  . TYR A 1 91  ? 25.140  -4.100  24.447  1.00 0.00 ? 91  TYR A HD2  3  
ATOM 8500  H HE1  . TYR A 1 91  ? 27.170  -3.063  20.046  1.00 0.00 ? 91  TYR A HE1  3  
ATOM 8501  H HE2  . TYR A 1 91  ? 27.478  -4.755  23.989  1.00 0.00 ? 91  TYR A HE2  3  
ATOM 8502  H HH   . TYR A 1 91  ? 29.361  -3.751  22.238  1.00 0.00 ? 91  TYR A HH   3  
ATOM 8503  N N    . VAL A 1 92  ? 21.105  -4.964  23.987  1.00 0.00 ? 92  VAL A N    3  
ATOM 8504  C CA   . VAL A 1 92  ? 19.976  -5.045  24.951  1.00 0.00 ? 92  VAL A CA   3  
ATOM 8505  C C    . VAL A 1 92  ? 20.533  -4.738  26.334  1.00 0.00 ? 92  VAL A C    3  
ATOM 8506  O O    . VAL A 1 92  ? 21.019  -5.610  27.027  1.00 0.00 ? 92  VAL A O    3  
ATOM 8507  C CB   . VAL A 1 92  ? 19.369  -6.444  24.946  1.00 0.00 ? 92  VAL A CB   3  
ATOM 8508  C CG1  . VAL A 1 92  ? 17.886  -6.336  25.289  1.00 0.00 ? 92  VAL A CG1  3  
ATOM 8509  C CG2  . VAL A 1 92  ? 19.535  -7.070  23.559  1.00 0.00 ? 92  VAL A CG2  3  
ATOM 8510  H H    . VAL A 1 92  ? 21.751  -5.696  23.928  1.00 0.00 ? 92  VAL A H    3  
ATOM 8511  H HA   . VAL A 1 92  ? 19.223  -4.315  24.691  1.00 0.00 ? 92  VAL A HA   3  
ATOM 8512  H HB   . VAL A 1 92  ? 19.867  -7.056  25.684  1.00 0.00 ? 92  VAL A HB   3  
ATOM 8513  H HG11 . VAL A 1 92  ? 17.739  -5.522  25.986  1.00 0.00 ? 92  VAL A HG11 3  
ATOM 8514  H HG12 . VAL A 1 92  ? 17.321  -6.144  24.390  1.00 0.00 ? 92  VAL A HG12 3  
ATOM 8515  H HG13 . VAL A 1 92  ? 17.551  -7.258  25.737  1.00 0.00 ? 92  VAL A HG13 3  
ATOM 8516  H HG21 . VAL A 1 92  ? 19.293  -6.339  22.803  1.00 0.00 ? 92  VAL A HG21 3  
ATOM 8517  H HG22 . VAL A 1 92  ? 20.557  -7.395  23.433  1.00 0.00 ? 92  VAL A HG22 3  
ATOM 8518  H HG23 . VAL A 1 92  ? 18.873  -7.918  23.467  1.00 0.00 ? 92  VAL A HG23 3  
ATOM 8519  N N    . GLY A 1 93  ? 20.494  -3.502  26.727  1.00 0.00 ? 93  GLY A N    3  
ATOM 8520  C CA   . GLY A 1 93  ? 21.055  -3.130  28.052  1.00 0.00 ? 93  GLY A CA   3  
ATOM 8521  C C    . GLY A 1 93  ? 22.580  -3.048  27.927  1.00 0.00 ? 93  GLY A C    3  
ATOM 8522  O O    . GLY A 1 93  ? 23.149  -1.978  27.836  1.00 0.00 ? 93  GLY A O    3  
ATOM 8523  H H    . GLY A 1 93  ? 20.114  -2.817  26.141  1.00 0.00 ? 93  GLY A H    3  
ATOM 8524  H HA2  . GLY A 1 93  ? 20.660  -2.169  28.357  1.00 0.00 ? 93  GLY A HA2  3  
ATOM 8525  H HA3  . GLY A 1 93  ? 20.796  -3.880  28.783  1.00 0.00 ? 93  GLY A HA3  3  
ATOM 8526  N N    . ARG A 1 94  ? 23.245  -4.173  27.922  1.00 0.00 ? 94  ARG A N    3  
ATOM 8527  C CA   . ARG A 1 94  ? 24.735  -4.162  27.805  1.00 0.00 ? 94  ARG A CA   3  
ATOM 8528  C C    . ARG A 1 94  ? 25.230  -5.365  26.991  1.00 0.00 ? 94  ARG A C    3  
ATOM 8529  O O    . ARG A 1 94  ? 26.412  -5.504  26.743  1.00 0.00 ? 94  ARG A O    3  
ATOM 8530  C CB   . ARG A 1 94  ? 25.334  -4.238  29.202  1.00 0.00 ? 94  ARG A CB   3  
ATOM 8531  C CG   . ARG A 1 94  ? 24.818  -3.071  30.044  1.00 0.00 ? 94  ARG A CG   3  
ATOM 8532  C CD   . ARG A 1 94  ? 25.659  -2.944  31.315  1.00 0.00 ? 94  ARG A CD   3  
ATOM 8533  N NE   . ARG A 1 94  ? 24.836  -2.332  32.396  1.00 0.00 ? 94  ARG A NE   3  
ATOM 8534  C CZ   . ARG A 1 94  ? 24.779  -2.896  33.572  1.00 0.00 ? 94  ARG A CZ   3  
ATOM 8535  N NH1  . ARG A 1 94  ? 24.334  -4.118  33.688  1.00 0.00 ? 94  ARG A NH1  3  
ATOM 8536  N NH2  . ARG A 1 94  ? 25.166  -2.239  34.630  1.00 0.00 ? 94  ARG A NH2  3  
ATOM 8537  H H    . ARG A 1 94  ? 22.765  -5.019  28.005  1.00 0.00 ? 94  ARG A H    3  
ATOM 8538  H HA   . ARG A 1 94  ? 25.056  -3.253  27.323  1.00 0.00 ? 94  ARG A HA   3  
ATOM 8539  H HB2  . ARG A 1 94  ? 25.037  -5.173  29.656  1.00 0.00 ? 94  ARG A HB2  3  
ATOM 8540  H HB3  . ARG A 1 94  ? 26.411  -4.191  29.140  1.00 0.00 ? 94  ARG A HB3  3  
ATOM 8541  H HG2  . ARG A 1 94  ? 24.888  -2.156  29.472  1.00 0.00 ? 94  ARG A HG2  3  
ATOM 8542  H HG3  . ARG A 1 94  ? 23.788  -3.249  30.314  1.00 0.00 ? 94  ARG A HG3  3  
ATOM 8543  H HD2  . ARG A 1 94  ? 25.992  -3.923  31.627  1.00 0.00 ? 94  ARG A HD2  3  
ATOM 8544  H HD3  . ARG A 1 94  ? 26.518  -2.317  31.118  1.00 0.00 ? 94  ARG A HD3  3  
ATOM 8545  H HE   . ARG A 1 94  ? 24.337  -1.506  32.223  1.00 0.00 ? 94  ARG A HE   3  
ATOM 8546  H HH11 . ARG A 1 94  ? 24.037  -4.620  32.876  1.00 0.00 ? 94  ARG A HH11 3  
ATOM 8547  H HH12 . ARG A 1 94  ? 24.290  -4.550  34.588  1.00 0.00 ? 94  ARG A HH12 3  
ATOM 8548  H HH21 . ARG A 1 94  ? 25.508  -1.303  34.540  1.00 0.00 ? 94  ARG A HH21 3  
ATOM 8549  H HH22 . ARG A 1 94  ? 25.122  -2.671  35.530  1.00 0.00 ? 94  ARG A HH22 3  
ATOM 8550  N N    . LYS A 1 95  ? 24.355  -6.237  26.579  1.00 0.00 ? 95  LYS A N    3  
ATOM 8551  C CA   . LYS A 1 95  ? 24.805  -7.420  25.793  1.00 0.00 ? 95  LYS A CA   3  
ATOM 8552  C C    . LYS A 1 95  ? 24.628  -7.142  24.296  1.00 0.00 ? 95  LYS A C    3  
ATOM 8553  O O    . LYS A 1 95  ? 23.583  -6.687  23.877  1.00 0.00 ? 95  LYS A O    3  
ATOM 8554  C CB   . LYS A 1 95  ? 23.968  -8.637  26.188  1.00 0.00 ? 95  LYS A CB   3  
ATOM 8555  C CG   . LYS A 1 95  ? 24.129  -8.903  27.687  1.00 0.00 ? 95  LYS A CG   3  
ATOM 8556  C CD   . LYS A 1 95  ? 24.043  -10.408 27.952  1.00 0.00 ? 95  LYS A CD   3  
ATOM 8557  C CE   . LYS A 1 95  ? 24.479  -10.705 29.390  1.00 0.00 ? 95  LYS A CE   3  
ATOM 8558  N NZ   . LYS A 1 95  ? 24.163  -9.540  30.263  1.00 0.00 ? 95  LYS A NZ   3  
ATOM 8559  H H    . LYS A 1 95  ? 23.411  -6.118  26.787  1.00 0.00 ? 95  LYS A H    3  
ATOM 8560  H HA   . LYS A 1 95  ? 25.844  -7.615  26.010  1.00 0.00 ? 95  LYS A HA   3  
ATOM 8561  H HB2  . LYS A 1 95  ? 22.928  -8.447  25.965  1.00 0.00 ? 95  LYS A HB2  3  
ATOM 8562  H HB3  . LYS A 1 95  ? 24.303  -9.501  25.633  1.00 0.00 ? 95  LYS A HB3  3  
ATOM 8563  H HG2  . LYS A 1 95  ? 25.089  -8.532  28.015  1.00 0.00 ? 95  LYS A HG2  3  
ATOM 8564  H HG3  . LYS A 1 95  ? 23.343  -8.398  28.228  1.00 0.00 ? 95  LYS A HG3  3  
ATOM 8565  H HD2  . LYS A 1 95  ? 23.024  -10.739 27.809  1.00 0.00 ? 95  LYS A HD2  3  
ATOM 8566  H HD3  . LYS A 1 95  ? 24.691  -10.931 27.267  1.00 0.00 ? 95  LYS A HD3  3  
ATOM 8567  H HE2  . LYS A 1 95  ? 23.955  -11.577 29.751  1.00 0.00 ? 95  LYS A HE2  3  
ATOM 8568  H HE3  . LYS A 1 95  ? 25.544  -10.891 29.410  1.00 0.00 ? 95  LYS A HE3  3  
ATOM 8569  H HZ1  . LYS A 1 95  ? 23.223  -9.166  30.016  1.00 0.00 ? 95  LYS A HZ1  3  
ATOM 8570  H HZ2  . LYS A 1 95  ? 24.165  -9.840  31.258  1.00 0.00 ? 95  LYS A HZ2  3  
ATOM 8571  H HZ3  . LYS A 1 95  ? 24.879  -8.797  30.126  1.00 0.00 ? 95  LYS A HZ3  3  
ATOM 8572  N N    . PRO A 1 96  ? 25.653  -7.425  23.530  1.00 0.00 ? 96  PRO A N    3  
ATOM 8573  C CA   . PRO A 1 96  ? 25.630  -7.215  22.072  1.00 0.00 ? 96  PRO A CA   3  
ATOM 8574  C C    . PRO A 1 96  ? 24.856  -8.350  21.392  1.00 0.00 ? 96  PRO A C    3  
ATOM 8575  O O    . PRO A 1 96  ? 24.951  -9.495  21.789  1.00 0.00 ? 96  PRO A O    3  
ATOM 8576  C CB   . PRO A 1 96  ? 27.108  -7.255  21.679  1.00 0.00 ? 96  PRO A CB   3  
ATOM 8577  C CG   . PRO A 1 96  ? 27.836  -8.036  22.800  1.00 0.00 ? 96  PRO A CG   3  
ATOM 8578  C CD   . PRO A 1 96  ? 26.924  -7.980  24.040  1.00 0.00 ? 96  PRO A CD   3  
ATOM 8579  H HA   . PRO A 1 96  ? 25.204  -6.252  21.833  1.00 0.00 ? 96  PRO A HA   3  
ATOM 8580  H HB2  . PRO A 1 96  ? 27.226  -7.763  20.732  1.00 0.00 ? 96  PRO A HB2  3  
ATOM 8581  H HB3  . PRO A 1 96  ? 27.504  -6.255  21.618  1.00 0.00 ? 96  PRO A HB3  3  
ATOM 8582  H HG2  . PRO A 1 96  ? 27.988  -9.063  22.494  1.00 0.00 ? 96  PRO A HG2  3  
ATOM 8583  H HG3  . PRO A 1 96  ? 28.783  -7.570  23.023  1.00 0.00 ? 96  PRO A HG3  3  
ATOM 8584  H HD2  . PRO A 1 96  ? 26.773  -8.972  24.443  1.00 0.00 ? 96  PRO A HD2  3  
ATOM 8585  H HD3  . PRO A 1 96  ? 27.341  -7.324  24.788  1.00 0.00 ? 96  PRO A HD3  3  
ATOM 8586  N N    . LYS A 1 97  ? 24.088  -8.052  20.378  1.00 0.00 ? 97  LYS A N    3  
ATOM 8587  C CA   . LYS A 1 97  ? 23.314  -9.128  19.697  1.00 0.00 ? 97  LYS A CA   3  
ATOM 8588  C C    . LYS A 1 97  ? 23.220  -8.841  18.195  1.00 0.00 ? 97  LYS A C    3  
ATOM 8589  O O    . LYS A 1 97  ? 22.974  -7.728  17.780  1.00 0.00 ? 97  LYS A O    3  
ATOM 8590  C CB   . LYS A 1 97  ? 21.900  -9.184  20.281  1.00 0.00 ? 97  LYS A CB   3  
ATOM 8591  C CG   . LYS A 1 97  ? 21.953  -9.682  21.727  1.00 0.00 ? 97  LYS A CG   3  
ATOM 8592  C CD   . LYS A 1 97  ? 21.797  -11.203 21.749  1.00 0.00 ? 97  LYS A CD   3  
ATOM 8593  C CE   . LYS A 1 97  ? 22.249  -11.744 23.106  1.00 0.00 ? 97  LYS A CE   3  
ATOM 8594  N NZ   . LYS A 1 97  ? 22.293  -13.233 23.058  1.00 0.00 ? 97  LYS A NZ   3  
ATOM 8595  H H    . LYS A 1 97  ? 24.017  -7.125  20.069  1.00 0.00 ? 97  LYS A H    3  
ATOM 8596  H HA   . LYS A 1 97  ? 23.803  -10.078 19.853  1.00 0.00 ? 97  LYS A HA   3  
ATOM 8597  H HB2  . LYS A 1 97  ? 21.462  -8.196  20.257  1.00 0.00 ? 97  LYS A HB2  3  
ATOM 8598  H HB3  . LYS A 1 97  ? 21.294  -9.858  19.693  1.00 0.00 ? 97  LYS A HB3  3  
ATOM 8599  H HG2  . LYS A 1 97  ? 22.901  -9.409  22.168  1.00 0.00 ? 97  LYS A HG2  3  
ATOM 8600  H HG3  . LYS A 1 97  ? 21.151  -9.232  22.293  1.00 0.00 ? 97  LYS A HG3  3  
ATOM 8601  H HD2  . LYS A 1 97  ? 20.761  -11.460 21.584  1.00 0.00 ? 97  LYS A HD2  3  
ATOM 8602  H HD3  . LYS A 1 97  ? 22.405  -11.638 20.970  1.00 0.00 ? 97  LYS A HD3  3  
ATOM 8603  H HE2  . LYS A 1 97  ? 23.232  -11.361 23.337  1.00 0.00 ? 97  LYS A HE2  3  
ATOM 8604  H HE3  . LYS A 1 97  ? 21.552  -11.429 23.868  1.00 0.00 ? 97  LYS A HE3  3  
ATOM 8605  H HZ1  . LYS A 1 97  ? 21.396  -13.594 22.679  1.00 0.00 ? 97  LYS A HZ1  3  
ATOM 8606  H HZ2  . LYS A 1 97  ? 23.074  -13.537 22.443  1.00 0.00 ? 97  LYS A HZ2  3  
ATOM 8607  H HZ3  . LYS A 1 97  ? 22.442  -13.606 24.019  1.00 0.00 ? 97  LYS A HZ3  3  
ATOM 8608  N N    . VAL A 1 98  ? 23.393  -9.846  17.380  1.00 0.00 ? 98  VAL A N    3  
ATOM 8609  C CA   . VAL A 1 98  ? 23.289  -9.640  15.907  1.00 0.00 ? 98  VAL A CA   3  
ATOM 8610  C C    . VAL A 1 98  ? 22.050  -10.374 15.404  1.00 0.00 ? 98  VAL A C    3  
ATOM 8611  O O    . VAL A 1 98  ? 21.830  -11.524 15.729  1.00 0.00 ? 98  VAL A O    3  
ATOM 8612  C CB   . VAL A 1 98  ? 24.526  -10.212 15.209  1.00 0.00 ? 98  VAL A CB   3  
ATOM 8613  C CG1  . VAL A 1 98  ? 24.275  -10.269 13.699  1.00 0.00 ? 98  VAL A CG1  3  
ATOM 8614  C CG2  . VAL A 1 98  ? 25.732  -9.317  15.491  1.00 0.00 ? 98  VAL A CG2  3  
ATOM 8615  H H    . VAL A 1 98  ? 23.574  -10.740 17.737  1.00 0.00 ? 98  VAL A H    3  
ATOM 8616  H HA   . VAL A 1 98  ? 23.202  -8.586  15.691  1.00 0.00 ? 98  VAL A HA   3  
ATOM 8617  H HB   . VAL A 1 98  ? 24.719  -11.209 15.580  1.00 0.00 ? 98  VAL A HB   3  
ATOM 8618  H HG11 . VAL A 1 98  ? 23.656  -9.435  13.404  1.00 0.00 ? 98  VAL A HG11 3  
ATOM 8619  H HG12 . VAL A 1 98  ? 25.219  -10.219 13.175  1.00 0.00 ? 98  VAL A HG12 3  
ATOM 8620  H HG13 . VAL A 1 98  ? 23.774  -11.193 13.452  1.00 0.00 ? 98  VAL A HG13 3  
ATOM 8621  H HG21 . VAL A 1 98  ? 25.394  -8.383  15.915  1.00 0.00 ? 98  VAL A HG21 3  
ATOM 8622  H HG22 . VAL A 1 98  ? 26.393  -9.811  16.186  1.00 0.00 ? 98  VAL A HG22 3  
ATOM 8623  H HG23 . VAL A 1 98  ? 26.258  -9.123  14.567  1.00 0.00 ? 98  VAL A HG23 3  
ATOM 8624  N N    . GLU A 1 99  ? 21.233  -9.735  14.615  1.00 0.00 ? 99  GLU A N    3  
ATOM 8625  C CA   . GLU A 1 99  ? 20.020  -10.430 14.117  1.00 0.00 ? 99  GLU A CA   3  
ATOM 8626  C C    . GLU A 1 99  ? 19.845  -10.166 12.630  1.00 0.00 ? 99  GLU A C    3  
ATOM 8627  O O    . GLU A 1 99  ? 20.774  -9.818  11.927  1.00 0.00 ? 99  GLU A O    3  
ATOM 8628  C CB   . GLU A 1 99  ? 18.791  -9.919  14.862  1.00 0.00 ? 99  GLU A CB   3  
ATOM 8629  C CG   . GLU A 1 99  ? 18.031  -11.100 15.470  1.00 0.00 ? 99  GLU A CG   3  
ATOM 8630  C CD   . GLU A 1 99  ? 16.528  -10.818 15.425  1.00 0.00 ? 99  GLU A CD   3  
ATOM 8631  O OE1  . GLU A 1 99  ? 16.070  -10.307 14.415  1.00 0.00 ? 99  GLU A OE1  3  
ATOM 8632  O OE2  . GLU A 1 99  ? 15.860  -11.115 16.401  1.00 0.00 ? 99  GLU A OE2  3  
ATOM 8633  H H    . GLU A 1 99  ? 21.413  -8.803  14.354  1.00 0.00 ? 99  GLU A H    3  
ATOM 8634  H HA   . GLU A 1 99  ? 20.119  -11.490 14.283  1.00 0.00 ? 99  GLU A HA   3  
ATOM 8635  H HB2  . GLU A 1 99  ? 19.098  -9.247  15.642  1.00 0.00 ? 99  GLU A HB2  3  
ATOM 8636  H HB3  . GLU A 1 99  ? 18.150  -9.398  14.172  1.00 0.00 ? 99  GLU A HB3  3  
ATOM 8637  H HG2  . GLU A 1 99  ? 18.246  -11.995 14.905  1.00 0.00 ? 99  GLU A HG2  3  
ATOM 8638  H HG3  . GLU A 1 99  ? 18.339  -11.237 16.495  1.00 0.00 ? 99  GLU A HG3  3  
ATOM 8639  N N    . GLN A 1 100 ? 18.652  -10.331 12.152  1.00 0.00 ? 100 GLN A N    3  
ATOM 8640  C CA   . GLN A 1 100 ? 18.376  -10.098 10.714  1.00 0.00 ? 100 GLN A CA   3  
ATOM 8641  C C    . GLN A 1 100 ? 16.937  -9.620  10.570  1.00 0.00 ? 100 GLN A C    3  
ATOM 8642  O O    . GLN A 1 100 ? 16.035  -10.399 10.335  1.00 0.00 ? 100 GLN A O    3  
ATOM 8643  C CB   . GLN A 1 100 ? 18.547  -11.405 9.953   1.00 0.00 ? 100 GLN A CB   3  
ATOM 8644  C CG   . GLN A 1 100 ? 19.939  -11.979 10.224  1.00 0.00 ? 100 GLN A CG   3  
ATOM 8645  C CD   . GLN A 1 100 ? 20.212  -13.135 9.262   1.00 0.00 ? 100 GLN A CD   3  
ATOM 8646  O OE1  . GLN A 1 100 ? 20.277  -14.278 9.670   1.00 0.00 ? 100 GLN A OE1  3  
ATOM 8647  N NE2  . GLN A 1 100 ? 20.375  -12.885 7.991   1.00 0.00 ? 100 GLN A NE2  3  
ATOM 8648  H H    . GLN A 1 100 ? 17.927  -10.612 12.748  1.00 0.00 ? 100 GLN A H    3  
ATOM 8649  H HA   . GLN A 1 100 ? 19.054  -9.355  10.325  1.00 0.00 ? 100 GLN A HA   3  
ATOM 8650  H HB2  . GLN A 1 100 ? 17.796  -12.100 10.289  1.00 0.00 ? 100 GLN A HB2  3  
ATOM 8651  H HB3  . GLN A 1 100 ? 18.430  -11.227 8.895   1.00 0.00 ? 100 GLN A HB3  3  
ATOM 8652  H HG2  . GLN A 1 100 ? 20.681  -11.206 10.080  1.00 0.00 ? 100 GLN A HG2  3  
ATOM 8653  H HG3  . GLN A 1 100 ? 19.988  -12.340 11.241  1.00 0.00 ? 100 GLN A HG3  3  
ATOM 8654  H HE21 . GLN A 1 100 ? 20.322  -11.963 7.663   1.00 0.00 ? 100 GLN A HE21 3  
ATOM 8655  H HE22 . GLN A 1 100 ? 20.552  -13.619 7.366   1.00 0.00 ? 100 GLN A HE22 3  
ATOM 8656  N N    . LEU A 1 101 ? 16.713  -8.350  10.725  1.00 0.00 ? 101 LEU A N    3  
ATOM 8657  C CA   . LEU A 1 101 ? 15.329  -7.829  10.613  1.00 0.00 ? 101 LEU A CA   3  
ATOM 8658  C C    . LEU A 1 101 ? 14.650  -8.461  9.407   1.00 0.00 ? 101 LEU A C    3  
ATOM 8659  O O    . LEU A 1 101 ? 15.267  -8.726  8.394   1.00 0.00 ? 101 LEU A O    3  
ATOM 8660  C CB   . LEU A 1 101 ? 15.346  -6.308  10.465  1.00 0.00 ? 101 LEU A CB   3  
ATOM 8661  C CG   . LEU A 1 101 ? 16.079  -5.668  11.653  1.00 0.00 ? 101 LEU A CG   3  
ATOM 8662  C CD1  . LEU A 1 101 ? 15.604  -4.225  11.828  1.00 0.00 ? 101 LEU A CD1  3  
ATOM 8663  C CD2  . LEU A 1 101 ? 15.785  -6.447  12.937  1.00 0.00 ? 101 LEU A CD2  3  
ATOM 8664  H H    . LEU A 1 101 ? 17.449  -7.748  10.926  1.00 0.00 ? 101 LEU A H    3  
ATOM 8665  H HA   . LEU A 1 101 ? 14.779  -8.092  11.505  1.00 0.00 ? 101 LEU A HA   3  
ATOM 8666  H HB2  . LEU A 1 101 ? 15.853  -6.043  9.549   1.00 0.00 ? 101 LEU A HB2  3  
ATOM 8667  H HB3  . LEU A 1 101 ? 14.328  -5.948  10.433  1.00 0.00 ? 101 LEU A HB3  3  
ATOM 8668  H HG   . LEU A 1 101 ? 17.142  -5.673  11.463  1.00 0.00 ? 101 LEU A HG   3  
ATOM 8669  H HD11 . LEU A 1 101 ? 14.556  -4.158  11.574  1.00 0.00 ? 101 LEU A HD11 3  
ATOM 8670  H HD12 . LEU A 1 101 ? 15.746  -3.921  12.854  1.00 0.00 ? 101 LEU A HD12 3  
ATOM 8671  H HD13 . LEU A 1 101 ? 16.173  -3.580  11.179  1.00 0.00 ? 101 LEU A HD13 3  
ATOM 8672  H HD21 . LEU A 1 101 ? 16.093  -7.474  12.809  1.00 0.00 ? 101 LEU A HD21 3  
ATOM 8673  H HD22 . LEU A 1 101 ? 16.330  -6.006  13.757  1.00 0.00 ? 101 LEU A HD22 3  
ATOM 8674  H HD23 . LEU A 1 101 ? 14.726  -6.411  13.143  1.00 0.00 ? 101 LEU A HD23 3  
ATOM 8675  N N    . SER A 1 102 ? 13.389  -8.729  9.525   1.00 0.00 ? 102 SER A N    3  
ATOM 8676  C CA   . SER A 1 102 ? 12.654  -9.377  8.400   1.00 0.00 ? 102 SER A CA   3  
ATOM 8677  C C    . SER A 1 102 ? 11.828  -8.349  7.626   1.00 0.00 ? 102 SER A C    3  
ATOM 8678  O O    . SER A 1 102 ? 11.109  -7.557  8.202   1.00 0.00 ? 102 SER A O    3  
ATOM 8679  C CB   . SER A 1 102 ? 11.724  -10.454 8.960   1.00 0.00 ? 102 SER A CB   3  
ATOM 8680  O OG   . SER A 1 102 ? 12.441  -11.676 9.083   1.00 0.00 ? 102 SER A OG   3  
ATOM 8681  H H    . SER A 1 102 ? 12.926  -8.513  10.364  1.00 0.00 ? 102 SER A H    3  
ATOM 8682  H HA   . SER A 1 102 ? 13.364  -9.838  7.730   1.00 0.00 ? 102 SER A HA   3  
ATOM 8683  H HB2  . SER A 1 102 ? 11.367  -10.154 9.931   1.00 0.00 ? 102 SER A HB2  3  
ATOM 8684  H HB3  . SER A 1 102 ? 10.882  -10.584 8.294   1.00 0.00 ? 102 SER A HB3  3  
ATOM 8685  H HG   . SER A 1 102 ? 11.898  -12.290 9.580   1.00 0.00 ? 102 SER A HG   3  
ATOM 8686  N N    . ASN A 1 103 ? 11.908  -8.369  6.322   1.00 0.00 ? 103 ASN A N    3  
ATOM 8687  C CA   . ASN A 1 103 ? 11.104  -7.407  5.512   1.00 0.00 ? 103 ASN A CA   3  
ATOM 8688  C C    . ASN A 1 103 ? 11.519  -5.971  5.829   1.00 0.00 ? 103 ASN A C    3  
ATOM 8689  O O    . ASN A 1 103 ? 10.710  -5.065  5.808   1.00 0.00 ? 103 ASN A O    3  
ATOM 8690  C CB   . ASN A 1 103 ? 9.624   -7.587  5.849   1.00 0.00 ? 103 ASN A CB   3  
ATOM 8691  C CG   . ASN A 1 103 ? 9.009   -8.626  4.908   1.00 0.00 ? 103 ASN A CG   3  
ATOM 8692  O OD1  . ASN A 1 103 ? 9.718   -9.336  4.224   1.00 0.00 ? 103 ASN A OD1  3  
ATOM 8693  N ND2  . ASN A 1 103 ? 7.712   -8.745  4.846   1.00 0.00 ? 103 ASN A ND2  3  
ATOM 8694  H H    . ASN A 1 103 ? 12.485  -9.029  5.874   1.00 0.00 ? 103 ASN A H    3  
ATOM 8695  H HA   . ASN A 1 103 ? 11.257  -7.597  4.460   1.00 0.00 ? 103 ASN A HA   3  
ATOM 8696  H HB2  . ASN A 1 103 ? 9.525   -7.924  6.871   1.00 0.00 ? 103 ASN A HB2  3  
ATOM 8697  H HB3  . ASN A 1 103 ? 9.111   -6.645  5.729   1.00 0.00 ? 103 ASN A HB3  3  
ATOM 8698  H HD21 . ASN A 1 103 ? 7.140   -8.172  5.400   1.00 0.00 ? 103 ASN A HD21 3  
ATOM 8699  H HD22 . ASN A 1 103 ? 7.308   -9.407  4.248   1.00 0.00 ? 103 ASN A HD22 3  
ATOM 8700  N N    . MET A 1 104 ? 12.768  -5.750  6.115   1.00 0.00 ? 104 MET A N    3  
ATOM 8701  C CA   . MET A 1 104 ? 13.220  -4.367  6.421   1.00 0.00 ? 104 MET A CA   3  
ATOM 8702  C C    . MET A 1 104 ? 13.755  -3.717  5.144   1.00 0.00 ? 104 MET A C    3  
ATOM 8703  O O    . MET A 1 104 ? 14.336  -2.653  5.176   1.00 0.00 ? 104 MET A O    3  
ATOM 8704  C CB   . MET A 1 104 ? 14.325  -4.405  7.476   1.00 0.00 ? 104 MET A CB   3  
ATOM 8705  C CG   . MET A 1 104 ? 14.759  -2.977  7.807   1.00 0.00 ? 104 MET A CG   3  
ATOM 8706  S SD   . MET A 1 104 ? 14.484  -2.653  9.565   1.00 0.00 ? 104 MET A SD   3  
ATOM 8707  C CE   . MET A 1 104 ? 15.859  -1.500  9.796   1.00 0.00 ? 104 MET A CE   3  
ATOM 8708  H H    . MET A 1 104 ? 13.408  -6.490  6.125   1.00 0.00 ? 104 MET A H    3  
ATOM 8709  H HA   . MET A 1 104 ? 12.385  -3.791  6.794   1.00 0.00 ? 104 MET A HA   3  
ATOM 8710  H HB2  . MET A 1 104 ? 13.954  -4.888  8.369   1.00 0.00 ? 104 MET A HB2  3  
ATOM 8711  H HB3  . MET A 1 104 ? 15.170  -4.957  7.093   1.00 0.00 ? 104 MET A HB3  3  
ATOM 8712  H HG2  . MET A 1 104 ? 15.808  -2.856  7.579   1.00 0.00 ? 104 MET A HG2  3  
ATOM 8713  H HG3  . MET A 1 104 ? 14.181  -2.279  7.220   1.00 0.00 ? 104 MET A HG3  3  
ATOM 8714  H HE1  . MET A 1 104 ? 16.408  -1.408  8.870   1.00 0.00 ? 104 MET A HE1  3  
ATOM 8715  H HE2  . MET A 1 104 ? 15.471  -0.535  10.088  1.00 0.00 ? 104 MET A HE2  3  
ATOM 8716  H HE3  . MET A 1 104 ? 16.515  -1.868  10.567  1.00 0.00 ? 104 MET A HE3  3  
ATOM 8717  N N    . ILE A 1 105 ? 13.557  -4.344  4.014   1.00 0.00 ? 105 ILE A N    3  
ATOM 8718  C CA   . ILE A 1 105 ? 14.051  -3.750  2.740   1.00 0.00 ? 105 ILE A CA   3  
ATOM 8719  C C    . ILE A 1 105 ? 13.003  -3.951  1.648   1.00 0.00 ? 105 ILE A C    3  
ATOM 8720  O O    . ILE A 1 105 ? 12.124  -4.780  1.763   1.00 0.00 ? 105 ILE A O    3  
ATOM 8721  C CB   . ILE A 1 105 ? 15.359  -4.423  2.323   1.00 0.00 ? 105 ILE A CB   3  
ATOM 8722  C CG1  . ILE A 1 105 ? 16.433  -4.143  3.378   1.00 0.00 ? 105 ILE A CG1  3  
ATOM 8723  C CG2  . ILE A 1 105 ? 15.808  -3.860  0.973   1.00 0.00 ? 105 ILE A CG2  3  
ATOM 8724  C CD1  . ILE A 1 105 ? 17.806  -4.539  2.831   1.00 0.00 ? 105 ILE A CD1  3  
ATOM 8725  H H    . ILE A 1 105 ? 13.078  -5.202  4.004   1.00 0.00 ? 105 ILE A H    3  
ATOM 8726  H HA   . ILE A 1 105 ? 14.222  -2.692  2.882   1.00 0.00 ? 105 ILE A HA   3  
ATOM 8727  H HB   . ILE A 1 105 ? 15.204  -5.489  2.236   1.00 0.00 ? 105 ILE A HB   3  
ATOM 8728  H HG12 . ILE A 1 105 ? 16.432  -3.090  3.620   1.00 0.00 ? 105 ILE A HG12 3  
ATOM 8729  H HG13 . ILE A 1 105 ? 16.223  -4.718  4.267   1.00 0.00 ? 105 ILE A HG13 3  
ATOM 8730  H HG21 . ILE A 1 105 ? 15.857  -2.782  1.029   1.00 0.00 ? 105 ILE A HG21 3  
ATOM 8731  H HG22 . ILE A 1 105 ? 16.783  -4.252  0.725   1.00 0.00 ? 105 ILE A HG22 3  
ATOM 8732  H HG23 . ILE A 1 105 ? 15.099  -4.147  0.209   1.00 0.00 ? 105 ILE A HG23 3  
ATOM 8733  H HD11 . ILE A 1 105 ? 17.710  -5.436  2.236   1.00 0.00 ? 105 ILE A HD11 3  
ATOM 8734  H HD12 . ILE A 1 105 ? 18.195  -3.739  2.219   1.00 0.00 ? 105 ILE A HD12 3  
ATOM 8735  H HD13 . ILE A 1 105 ? 18.481  -4.725  3.653   1.00 0.00 ? 105 ILE A HD13 3  
ATOM 8736  N N    . VAL A 1 106 ? 13.084  -3.194  0.589   1.00 0.00 ? 106 VAL A N    3  
ATOM 8737  C CA   . VAL A 1 106 ? 12.087  -3.334  -0.502  1.00 0.00 ? 106 VAL A CA   3  
ATOM 8738  C C    . VAL A 1 106 ? 12.743  -3.981  -1.727  1.00 0.00 ? 106 VAL A C    3  
ATOM 8739  O O    . VAL A 1 106 ? 13.858  -3.663  -2.090  1.00 0.00 ? 106 VAL A O    3  
ATOM 8740  C CB   . VAL A 1 106 ? 11.563  -1.945  -0.868  1.00 0.00 ? 106 VAL A CB   3  
ATOM 8741  C CG1  . VAL A 1 106 ? 10.857  -2.000  -2.220  1.00 0.00 ? 106 VAL A CG1  3  
ATOM 8742  C CG2  . VAL A 1 106 ? 10.575  -1.477  0.203   1.00 0.00 ? 106 VAL A CG2  3  
ATOM 8743  H H    . VAL A 1 106 ? 13.794  -2.525  0.516   1.00 0.00 ? 106 VAL A H    3  
ATOM 8744  H HA   . VAL A 1 106 ? 11.267  -3.950  -0.165  1.00 0.00 ? 106 VAL A HA   3  
ATOM 8745  H HB   . VAL A 1 106 ? 12.390  -1.252  -0.923  1.00 0.00 ? 106 VAL A HB   3  
ATOM 8746  H HG11 . VAL A 1 106 ? 10.250  -2.891  -2.271  1.00 0.00 ? 106 VAL A HG11 3  
ATOM 8747  H HG12 . VAL A 1 106 ? 10.231  -1.129  -2.333  1.00 0.00 ? 106 VAL A HG12 3  
ATOM 8748  H HG13 . VAL A 1 106 ? 11.596  -2.021  -3.007  1.00 0.00 ? 106 VAL A HG13 3  
ATOM 8749  H HG21 . VAL A 1 106 ? 10.038  -2.329  0.594   1.00 0.00 ? 106 VAL A HG21 3  
ATOM 8750  H HG22 . VAL A 1 106 ? 11.115  -0.994  1.005   1.00 0.00 ? 106 VAL A HG22 3  
ATOM 8751  H HG23 . VAL A 1 106 ? 9.876   -0.779  -0.231  1.00 0.00 ? 106 VAL A HG23 3  
ATOM 8752  N N    . ARG A 1 107 ? 12.049  -4.882  -2.369  1.00 0.00 ? 107 ARG A N    3  
ATOM 8753  C CA   . ARG A 1 107 ? 12.618  -5.549  -3.575  1.00 0.00 ? 107 ARG A CA   3  
ATOM 8754  C C    . ARG A 1 107 ? 11.706  -5.286  -4.777  1.00 0.00 ? 107 ARG A C    3  
ATOM 8755  O O    . ARG A 1 107 ? 12.096  -5.453  -5.916  1.00 0.00 ? 107 ARG A O    3  
ATOM 8756  C CB   . ARG A 1 107 ? 12.716  -7.055  -3.329  1.00 0.00 ? 107 ARG A CB   3  
ATOM 8757  C CG   . ARG A 1 107 ? 14.125  -7.538  -3.676  1.00 0.00 ? 107 ARG A CG   3  
ATOM 8758  C CD   . ARG A 1 107 ? 14.236  -9.038  -3.393  1.00 0.00 ? 107 ARG A CD   3  
ATOM 8759  N NE   . ARG A 1 107 ? 13.679  -9.803  -4.545  1.00 0.00 ? 107 ARG A NE   3  
ATOM 8760  C CZ   . ARG A 1 107 ? 14.473  -10.507 -5.304  1.00 0.00 ? 107 ARG A CZ   3  
ATOM 8761  N NH1  . ARG A 1 107 ? 15.039  -9.959  -6.344  1.00 0.00 ? 107 ARG A NH1  3  
ATOM 8762  N NH2  . ARG A 1 107 ? 14.699  -11.762 -5.024  1.00 0.00 ? 107 ARG A NH2  3  
ATOM 8763  H H    . ARG A 1 107 ? 11.150  -5.118  -2.059  1.00 0.00 ? 107 ARG A H    3  
ATOM 8764  H HA   . ARG A 1 107 ? 13.602  -5.152  -3.776  1.00 0.00 ? 107 ARG A HA   3  
ATOM 8765  H HB2  . ARG A 1 107 ? 12.507  -7.264  -2.290  1.00 0.00 ? 107 ARG A HB2  3  
ATOM 8766  H HB3  . ARG A 1 107 ? 11.998  -7.569  -3.951  1.00 0.00 ? 107 ARG A HB3  3  
ATOM 8767  H HG2  . ARG A 1 107 ? 14.321  -7.352  -4.722  1.00 0.00 ? 107 ARG A HG2  3  
ATOM 8768  H HG3  . ARG A 1 107 ? 14.847  -7.006  -3.075  1.00 0.00 ? 107 ARG A HG3  3  
ATOM 8769  H HD2  . ARG A 1 107 ? 15.274  -9.302  -3.254  1.00 0.00 ? 107 ARG A HD2  3  
ATOM 8770  H HD3  . ARG A 1 107 ? 13.680  -9.277  -2.499  1.00 0.00 ? 107 ARG A HD3  3  
ATOM 8771  H HE   . ARG A 1 107 ? 12.718  -9.776  -4.732  1.00 0.00 ? 107 ARG A HE   3  
ATOM 8772  H HH11 . ARG A 1 107 ? 14.865  -8.998  -6.559  1.00 0.00 ? 107 ARG A HH11 3  
ATOM 8773  H HH12 . ARG A 1 107 ? 15.648  -10.499 -6.925  1.00 0.00 ? 107 ARG A HH12 3  
ATOM 8774  H HH21 . ARG A 1 107 ? 14.264  -12.182 -4.227  1.00 0.00 ? 107 ARG A HH21 3  
ATOM 8775  H HH22 . ARG A 1 107 ? 15.307  -12.303 -5.605  1.00 0.00 ? 107 ARG A HH22 3  
ATOM 8776  N N    . SER A 1 108 ? 10.491  -4.875  -4.530  1.00 0.00 ? 108 SER A N    3  
ATOM 8777  C CA   . SER A 1 108 ? 9.547   -4.597  -5.649  1.00 0.00 ? 108 SER A CA   3  
ATOM 8778  C C    . SER A 1 108 ? 8.263   -3.991  -5.079  1.00 0.00 ? 108 SER A C    3  
ATOM 8779  O O    . SER A 1 108 ? 7.860   -4.300  -3.976  1.00 0.00 ? 108 SER A O    3  
ATOM 8780  C CB   . SER A 1 108 ? 9.220   -5.901  -6.380  1.00 0.00 ? 108 SER A CB   3  
ATOM 8781  O OG   . SER A 1 108 ? 8.566   -6.790  -5.484  1.00 0.00 ? 108 SER A OG   3  
ATOM 8782  H H    . SER A 1 108 ? 10.199  -4.748  -3.604  1.00 0.00 ? 108 SER A H    3  
ATOM 8783  H HA   . SER A 1 108 ? 10.001  -3.900  -6.338  1.00 0.00 ? 108 SER A HA   3  
ATOM 8784  H HB2  . SER A 1 108 ? 8.569   -5.695  -7.212  1.00 0.00 ? 108 SER A HB2  3  
ATOM 8785  H HB3  . SER A 1 108 ? 10.135  -6.348  -6.743  1.00 0.00 ? 108 SER A HB3  3  
ATOM 8786  H HG   . SER A 1 108 ? 7.754   -7.087  -5.901  1.00 0.00 ? 108 SER A HG   3  
ATOM 8787  N N    . CYS A 1 109 ? 7.625   -3.120  -5.812  1.00 0.00 ? 109 CYS A N    3  
ATOM 8788  C CA   . CYS A 1 109 ? 6.377   -2.487  -5.291  1.00 0.00 ? 109 CYS A CA   3  
ATOM 8789  C C    . CYS A 1 109 ? 5.180   -2.813  -6.189  1.00 0.00 ? 109 CYS A C    3  
ATOM 8790  O O    . CYS A 1 109 ? 5.311   -3.410  -7.240  1.00 0.00 ? 109 CYS A O    3  
ATOM 8791  C CB   . CYS A 1 109 ? 6.564   -0.972  -5.237  1.00 0.00 ? 109 CYS A CB   3  
ATOM 8792  S SG   . CYS A 1 109 ? 8.040   -0.592  -4.266  1.00 0.00 ? 109 CYS A SG   3  
ATOM 8793  H H    . CYS A 1 109 ? 7.974   -2.871  -6.693  1.00 0.00 ? 109 CYS A H    3  
ATOM 8794  H HA   . CYS A 1 109 ? 6.183   -2.854  -4.297  1.00 0.00 ? 109 CYS A HA   3  
ATOM 8795  H HB2  . CYS A 1 109 ? 6.680   -0.586  -6.239  1.00 0.00 ? 109 CYS A HB2  3  
ATOM 8796  H HB3  . CYS A 1 109 ? 5.701   -0.519  -4.773  1.00 0.00 ? 109 CYS A HB3  3  
ATOM 8797  N N    . LYS A 1 110 ? 4.008   -2.410  -5.770  1.00 0.00 ? 110 LYS A N    3  
ATOM 8798  C CA   . LYS A 1 110 ? 2.777   -2.662  -6.558  1.00 0.00 ? 110 LYS A CA   3  
ATOM 8799  C C    . LYS A 1 110 ? 1.771   -1.574  -6.183  1.00 0.00 ? 110 LYS A C    3  
ATOM 8800  O O    . LYS A 1 110 ? 2.150   -0.509  -5.745  1.00 0.00 ? 110 LYS A O    3  
ATOM 8801  C CB   . LYS A 1 110 ? 2.212   -4.038  -6.199  1.00 0.00 ? 110 LYS A CB   3  
ATOM 8802  C CG   . LYS A 1 110 ? 2.035   -4.876  -7.467  1.00 0.00 ? 110 LYS A CG   3  
ATOM 8803  C CD   . LYS A 1 110 ? 3.371   -4.992  -8.204  1.00 0.00 ? 110 LYS A CD   3  
ATOM 8804  C CE   . LYS A 1 110 ? 3.308   -6.164  -9.187  1.00 0.00 ? 110 LYS A CE   3  
ATOM 8805  N NZ   . LYS A 1 110 ? 4.511   -6.142  -10.067 1.00 0.00 ? 110 LYS A NZ   3  
ATOM 8806  H H    . LYS A 1 110 ? 3.937   -1.925  -4.922  1.00 0.00 ? 110 LYS A H    3  
ATOM 8807  H HA   . LYS A 1 110 ? 2.997   -2.613  -7.614  1.00 0.00 ? 110 LYS A HA   3  
ATOM 8808  H HB2  . LYS A 1 110 ? 2.893   -4.541  -5.527  1.00 0.00 ? 110 LYS A HB2  3  
ATOM 8809  H HB3  . LYS A 1 110 ? 1.254   -3.917  -5.715  1.00 0.00 ? 110 LYS A HB3  3  
ATOM 8810  H HG2  . LYS A 1 110 ? 1.687   -5.863  -7.198  1.00 0.00 ? 110 LYS A HG2  3  
ATOM 8811  H HG3  . LYS A 1 110 ? 1.311   -4.403  -8.113  1.00 0.00 ? 110 LYS A HG3  3  
ATOM 8812  H HD2  . LYS A 1 110 ? 3.565   -4.077  -8.744  1.00 0.00 ? 110 LYS A HD2  3  
ATOM 8813  H HD3  . LYS A 1 110 ? 4.163   -5.166  -7.491  1.00 0.00 ? 110 LYS A HD3  3  
ATOM 8814  H HE2  . LYS A 1 110 ? 3.281   -7.094  -8.638  1.00 0.00 ? 110 LYS A HE2  3  
ATOM 8815  H HE3  . LYS A 1 110 ? 2.418   -6.078  -9.792  1.00 0.00 ? 110 LYS A HE3  3  
ATOM 8816  H HZ1  . LYS A 1 110 ? 4.656   -5.181  -10.433 1.00 0.00 ? 110 LYS A HZ1  3  
ATOM 8817  H HZ2  . LYS A 1 110 ? 5.346   -6.432  -9.520  1.00 0.00 ? 110 LYS A HZ2  3  
ATOM 8818  H HZ3  . LYS A 1 110 ? 4.370   -6.800  -10.861 1.00 0.00 ? 110 LYS A HZ3  3  
ATOM 8819  N N    . CYS A 1 111 ? 0.503   -1.818  -6.326  1.00 0.00 ? 111 CYS A N    3  
ATOM 8820  C CA   . CYS A 1 111 ? -0.484  -0.767  -5.950  1.00 0.00 ? 111 CYS A CA   3  
ATOM 8821  C C    . CYS A 1 111 ? -1.570  -1.375  -5.057  1.00 0.00 ? 111 CYS A C    3  
ATOM 8822  O O    . CYS A 1 111 ? -2.569  -1.875  -5.534  1.00 0.00 ? 111 CYS A O    3  
ATOM 8823  C CB   . CYS A 1 111 ? -1.119  -0.184  -7.216  1.00 0.00 ? 111 CYS A CB   3  
ATOM 8824  S SG   . CYS A 1 111 ? 0.117   0.796   -8.109  1.00 0.00 ? 111 CYS A SG   3  
ATOM 8825  H H    . CYS A 1 111 ? 0.199   -2.684  -6.669  1.00 0.00 ? 111 CYS A H    3  
ATOM 8826  H HA   . CYS A 1 111 ? 0.023   0.019   -5.409  1.00 0.00 ? 111 CYS A HA   3  
ATOM 8827  H HB2  . CYS A 1 111 ? -1.465  -0.988  -7.848  1.00 0.00 ? 111 CYS A HB2  3  
ATOM 8828  H HB3  . CYS A 1 111 ? -1.951  0.447   -6.945  1.00 0.00 ? 111 CYS A HB3  3  
ATOM 8829  N N    . SER A 1 112 ? -1.385  -1.335  -3.761  1.00 0.00 ? 112 SER A N    3  
ATOM 8830  C CA   . SER A 1 112 ? -2.414  -1.912  -2.851  1.00 0.00 ? 112 SER A CA   3  
ATOM 8831  C C    . SER A 1 112 ? -3.466  -0.848  -2.536  1.00 0.00 ? 112 SER A C    3  
ATOM 8832  O O    . SER A 1 112 ? -3.085  0.219   -2.086  1.00 0.00 ? 112 SER A O    3  
ATOM 8833  C CB   . SER A 1 112 ? -1.748  -2.371  -1.554  1.00 0.00 ? 112 SER A CB   3  
ATOM 8834  O OG   . SER A 1 112 ? -2.612  -3.272  -0.876  1.00 0.00 ? 112 SER A OG   3  
ATOM 8835  O OXT  . SER A 1 112 ? -4.637  -1.118  -2.752  1.00 0.00 ? 112 SER A OXT  3  
ATOM 8836  H H    . SER A 1 112 ? -0.572  -0.926  -3.387  1.00 0.00 ? 112 SER A H    3  
ATOM 8837  H HA   . SER A 1 112 ? -2.887  -2.756  -3.331  1.00 0.00 ? 112 SER A HA   3  
ATOM 8838  H HB2  . SER A 1 112 ? -0.821  -2.872  -1.781  1.00 0.00 ? 112 SER A HB2  3  
ATOM 8839  H HB3  . SER A 1 112 ? -1.546  -1.511  -0.930  1.00 0.00 ? 112 SER A HB3  3  
ATOM 8840  H HG   . SER A 1 112 ? -3.002  -3.858  -1.529  1.00 0.00 ? 112 SER A HG   3  
ATOM 8841  N N    . ALA B 1 1   ? -6.945  -1.661  15.459  1.00 0.00 ? 1   ALA B N    3  
ATOM 8842  C CA   . ALA B 1 1   ? -7.807  -2.285  14.416  1.00 0.00 ? 1   ALA B CA   3  
ATOM 8843  C C    . ALA B 1 1   ? -7.999  -1.303  13.259  1.00 0.00 ? 1   ALA B C    3  
ATOM 8844  O O    . ALA B 1 1   ? -8.775  -0.371  13.345  1.00 0.00 ? 1   ALA B O    3  
ATOM 8845  C CB   . ALA B 1 1   ? -9.168  -2.635  15.020  1.00 0.00 ? 1   ALA B CB   3  
ATOM 8846  H H1   . ALA B 1 1   ? -6.199  -1.099  15.002  1.00 0.00 ? 1   ALA B H1   3  
ATOM 8847  H H2   . ALA B 1 1   ? -7.524  -1.041  16.061  1.00 0.00 ? 1   ALA B H2   3  
ATOM 8848  H H3   . ALA B 1 1   ? -6.512  -2.406  16.042  1.00 0.00 ? 1   ALA B H3   3  
ATOM 8849  H HA   . ALA B 1 1   ? -7.334  -3.185  14.050  1.00 0.00 ? 1   ALA B HA   3  
ATOM 8850  H HB1  . ALA B 1 1   ? -9.023  -3.160  15.953  1.00 0.00 ? 1   ALA B HB1  3  
ATOM 8851  H HB2  . ALA B 1 1   ? -9.726  -1.727  15.201  1.00 0.00 ? 1   ALA B HB2  3  
ATOM 8852  H HB3  . ALA B 1 1   ? -9.717  -3.263  14.334  1.00 0.00 ? 1   ALA B HB3  3  
ATOM 8853  N N    . LEU B 1 2   ? -7.297  -1.503  12.177  1.00 0.00 ? 2   LEU B N    3  
ATOM 8854  C CA   . LEU B 1 2   ? -7.440  -0.579  11.016  1.00 0.00 ? 2   LEU B CA   3  
ATOM 8855  C C    . LEU B 1 2   ? -8.388  -1.189  9.989   1.00 0.00 ? 2   LEU B C    3  
ATOM 8856  O O    . LEU B 1 2   ? -8.023  -1.426  8.856   1.00 0.00 ? 2   LEU B O    3  
ATOM 8857  C CB   . LEU B 1 2   ? -6.080  -0.361  10.361  1.00 0.00 ? 2   LEU B CB   3  
ATOM 8858  C CG   . LEU B 1 2   ? -5.066  0.102   11.409  1.00 0.00 ? 2   LEU B CG   3  
ATOM 8859  C CD1  . LEU B 1 2   ? -3.840  0.683   10.703  1.00 0.00 ? 2   LEU B CD1  3  
ATOM 8860  C CD2  . LEU B 1 2   ? -5.700  1.178   12.296  1.00 0.00 ? 2   LEU B CD2  3  
ATOM 8861  H H    . LEU B 1 2   ? -6.676  -2.259  12.127  1.00 0.00 ? 2   LEU B H    3  
ATOM 8862  H HA   . LEU B 1 2   ? -7.834  0.368   11.352  1.00 0.00 ? 2   LEU B HA   3  
ATOM 8863  H HB2  . LEU B 1 2   ? -5.746  -1.287  9.919   1.00 0.00 ? 2   LEU B HB2  3  
ATOM 8864  H HB3  . LEU B 1 2   ? -6.174  0.391   9.595   1.00 0.00 ? 2   LEU B HB3  3  
ATOM 8865  H HG   . LEU B 1 2   ? -4.767  -0.738  12.017  1.00 0.00 ? 2   LEU B HG   3  
ATOM 8866  H HD11 . LEU B 1 2   ? -3.722  0.208   9.741   1.00 0.00 ? 2   LEU B HD11 3  
ATOM 8867  H HD12 . LEU B 1 2   ? -3.972  1.746   10.566  1.00 0.00 ? 2   LEU B HD12 3  
ATOM 8868  H HD13 . LEU B 1 2   ? -2.960  0.503   11.304  1.00 0.00 ? 2   LEU B HD13 3  
ATOM 8869  H HD21 . LEU B 1 2   ? -6.596  0.786   12.752  1.00 0.00 ? 2   LEU B HD21 3  
ATOM 8870  H HD22 . LEU B 1 2   ? -5.001  1.467   13.065  1.00 0.00 ? 2   LEU B HD22 3  
ATOM 8871  H HD23 . LEU B 1 2   ? -5.951  2.039   11.695  1.00 0.00 ? 2   LEU B HD23 3  
ATOM 8872  N N    . ASP B 1 3   ? -9.598  -1.444  10.378  1.00 0.00 ? 3   ASP B N    3  
ATOM 8873  C CA   . ASP B 1 3   ? -10.573 -2.040  9.427   1.00 0.00 ? 3   ASP B CA   3  
ATOM 8874  C C    . ASP B 1 3   ? -11.723 -1.065  9.191   1.00 0.00 ? 3   ASP B C    3  
ATOM 8875  O O    . ASP B 1 3   ? -11.749 0.029   9.720   1.00 0.00 ? 3   ASP B O    3  
ATOM 8876  C CB   . ASP B 1 3   ? -11.124 -3.340  10.011  1.00 0.00 ? 3   ASP B CB   3  
ATOM 8877  C CG   . ASP B 1 3   ? -11.234 -3.211  11.532  1.00 0.00 ? 3   ASP B CG   3  
ATOM 8878  O OD1  . ASP B 1 3   ? -10.244 -3.462  12.200  1.00 0.00 ? 3   ASP B OD1  3  
ATOM 8879  O OD2  . ASP B 1 3   ? -12.305 -2.866  12.002  1.00 0.00 ? 3   ASP B OD2  3  
ATOM 8880  H H    . ASP B 1 3   ? -9.865  -1.246  11.294  1.00 0.00 ? 3   ASP B H    3  
ATOM 8881  H HA   . ASP B 1 3   ? -10.080 -2.248  8.489   1.00 0.00 ? 3   ASP B HA   3  
ATOM 8882  H HB2  . ASP B 1 3   ? -12.101 -3.536  9.594   1.00 0.00 ? 3   ASP B HB2  3  
ATOM 8883  H HB3  . ASP B 1 3   ? -10.460 -4.152  9.768   1.00 0.00 ? 3   ASP B HB3  3  
ATOM 8884  N N    . THR B 1 4   ? -12.677 -1.460  8.399   1.00 0.00 ? 4   THR B N    3  
ATOM 8885  C CA   . THR B 1 4   ? -13.838 -0.573  8.115   1.00 0.00 ? 4   THR B CA   3  
ATOM 8886  C C    . THR B 1 4   ? -14.817 -0.607  9.292   1.00 0.00 ? 4   THR B C    3  
ATOM 8887  O O    . THR B 1 4   ? -15.885 -0.030  9.240   1.00 0.00 ? 4   THR B O    3  
ATOM 8888  C CB   . THR B 1 4   ? -14.532 -1.056  6.841   1.00 0.00 ? 4   THR B CB   3  
ATOM 8889  O OG1  . THR B 1 4   ? -15.455 -2.087  7.166   1.00 0.00 ? 4   THR B OG1  3  
ATOM 8890  C CG2  . THR B 1 4   ? -13.480 -1.595  5.867   1.00 0.00 ? 4   THR B CG2  3  
ATOM 8891  H H    . THR B 1 4   ? -12.629 -2.346  7.984   1.00 0.00 ? 4   THR B H    3  
ATOM 8892  H HA   . THR B 1 4   ? -13.492 0.439   7.973   1.00 0.00 ? 4   THR B HA   3  
ATOM 8893  H HB   . THR B 1 4   ? -15.056 -0.234  6.380   1.00 0.00 ? 4   THR B HB   3  
ATOM 8894  H HG1  . THR B 1 4   ? -15.921 -2.331  6.365   1.00 0.00 ? 4   THR B HG1  3  
ATOM 8895  H HG21 . THR B 1 4   ? -12.590 -0.984  5.925   1.00 0.00 ? 4   THR B HG21 3  
ATOM 8896  H HG22 . THR B 1 4   ? -13.232 -2.613  6.131   1.00 0.00 ? 4   THR B HG22 3  
ATOM 8897  H HG23 . THR B 1 4   ? -13.870 -1.567  4.861   1.00 0.00 ? 4   THR B HG23 3  
ATOM 8898  N N    . ASN B 1 5   ? -14.459 -1.272  10.359  1.00 0.00 ? 5   ASN B N    3  
ATOM 8899  C CA   . ASN B 1 5   ? -15.365 -1.331  11.539  1.00 0.00 ? 5   ASN B CA   3  
ATOM 8900  C C    . ASN B 1 5   ? -14.954 -0.249  12.542  1.00 0.00 ? 5   ASN B C    3  
ATOM 8901  O O    . ASN B 1 5   ? -15.779 0.479   13.056  1.00 0.00 ? 5   ASN B O    3  
ATOM 8902  C CB   . ASN B 1 5   ? -15.256 -2.708  12.199  1.00 0.00 ? 5   ASN B CB   3  
ATOM 8903  C CG   . ASN B 1 5   ? -16.468 -2.937  13.103  1.00 0.00 ? 5   ASN B CG   3  
ATOM 8904  O OD1  . ASN B 1 5   ? -17.136 -2.000  13.494  1.00 0.00 ? 5   ASN B OD1  3  
ATOM 8905  N ND2  . ASN B 1 5   ? -16.783 -4.155  13.454  1.00 0.00 ? 5   ASN B ND2  3  
ATOM 8906  H H    . ASN B 1 5   ? -13.592 -1.726  10.386  1.00 0.00 ? 5   ASN B H    3  
ATOM 8907  H HA   . ASN B 1 5   ? -16.383 -1.161  11.222  1.00 0.00 ? 5   ASN B HA   3  
ATOM 8908  H HB2  . ASN B 1 5   ? -15.226 -3.472  11.435  1.00 0.00 ? 5   ASN B HB2  3  
ATOM 8909  H HB3  . ASN B 1 5   ? -14.354 -2.753  12.791  1.00 0.00 ? 5   ASN B HB3  3  
ATOM 8910  H HD21 . ASN B 1 5   ? -16.245 -4.910  13.140  1.00 0.00 ? 5   ASN B HD21 3  
ATOM 8911  H HD22 . ASN B 1 5   ? -17.559 -4.312  14.034  1.00 0.00 ? 5   ASN B HD22 3  
ATOM 8912  N N    . TYR B 1 6   ? -13.682 -0.138  12.822  1.00 0.00 ? 6   TYR B N    3  
ATOM 8913  C CA   . TYR B 1 6   ? -13.214 0.892   13.784  1.00 0.00 ? 6   TYR B CA   3  
ATOM 8914  C C    . TYR B 1 6   ? -13.025 2.223   13.052  1.00 0.00 ? 6   TYR B C    3  
ATOM 8915  O O    . TYR B 1 6   ? -12.954 3.272   13.659  1.00 0.00 ? 6   TYR B O    3  
ATOM 8916  C CB   . TYR B 1 6   ? -11.882 0.438   14.379  1.00 0.00 ? 6   TYR B CB   3  
ATOM 8917  C CG   . TYR B 1 6   ? -11.225 1.588   15.101  1.00 0.00 ? 6   TYR B CG   3  
ATOM 8918  C CD1  . TYR B 1 6   ? -11.720 2.017   16.337  1.00 0.00 ? 6   TYR B CD1  3  
ATOM 8919  C CD2  . TYR B 1 6   ? -10.119 2.226   14.530  1.00 0.00 ? 6   TYR B CD2  3  
ATOM 8920  C CE1  . TYR B 1 6   ? -11.106 3.087   17.003  1.00 0.00 ? 6   TYR B CE1  3  
ATOM 8921  C CE2  . TYR B 1 6   ? -9.506  3.295   15.194  1.00 0.00 ? 6   TYR B CE2  3  
ATOM 8922  C CZ   . TYR B 1 6   ? -9.999  3.725   16.432  1.00 0.00 ? 6   TYR B CZ   3  
ATOM 8923  O OH   . TYR B 1 6   ? -9.395  4.778   17.088  1.00 0.00 ? 6   TYR B OH   3  
ATOM 8924  H H    . TYR B 1 6   ? -13.030 -0.734  12.398  1.00 0.00 ? 6   TYR B H    3  
ATOM 8925  H HA   . TYR B 1 6   ? -13.942 1.011   14.572  1.00 0.00 ? 6   TYR B HA   3  
ATOM 8926  H HB2  . TYR B 1 6   ? -12.058 -0.372  15.071  1.00 0.00 ? 6   TYR B HB2  3  
ATOM 8927  H HB3  . TYR B 1 6   ? -11.233 0.096   13.586  1.00 0.00 ? 6   TYR B HB3  3  
ATOM 8928  H HD1  . TYR B 1 6   ? -12.574 1.525   16.778  1.00 0.00 ? 6   TYR B HD1  3  
ATOM 8929  H HD2  . TYR B 1 6   ? -9.738  1.893   13.574  1.00 0.00 ? 6   TYR B HD2  3  
ATOM 8930  H HE1  . TYR B 1 6   ? -11.488 3.419   17.958  1.00 0.00 ? 6   TYR B HE1  3  
ATOM 8931  H HE2  . TYR B 1 6   ? -8.651  3.788   14.753  1.00 0.00 ? 6   TYR B HE2  3  
ATOM 8932  H HH   . TYR B 1 6   ? -10.086 5.336   17.452  1.00 0.00 ? 6   TYR B HH   3  
ATOM 8933  N N    . CYS B 1 7   ? -12.940 2.185   11.750  1.00 0.00 ? 7   CYS B N    3  
ATOM 8934  C CA   . CYS B 1 7   ? -12.754 3.446   10.979  1.00 0.00 ? 7   CYS B CA   3  
ATOM 8935  C C    . CYS B 1 7   ? -14.117 4.077   10.693  1.00 0.00 ? 7   CYS B C    3  
ATOM 8936  O O    . CYS B 1 7   ? -14.215 5.235   10.342  1.00 0.00 ? 7   CYS B O    3  
ATOM 8937  C CB   . CYS B 1 7   ? -12.041 3.136   9.661   1.00 0.00 ? 7   CYS B CB   3  
ATOM 8938  S SG   . CYS B 1 7   ? -10.252 3.252   9.912   1.00 0.00 ? 7   CYS B SG   3  
ATOM 8939  H H    . CYS B 1 7   ? -12.998 1.328   11.279  1.00 0.00 ? 7   CYS B H    3  
ATOM 8940  H HA   . CYS B 1 7   ? -12.155 4.134   11.557  1.00 0.00 ? 7   CYS B HA   3  
ATOM 8941  H HB2  . CYS B 1 7   ? -12.296 2.136   9.337   1.00 0.00 ? 7   CYS B HB2  3  
ATOM 8942  H HB3  . CYS B 1 7   ? -12.346 3.847   8.910   1.00 0.00 ? 7   CYS B HB3  3  
ATOM 8943  N N    . PHE B 1 8   ? -15.172 3.324   10.846  1.00 0.00 ? 8   PHE B N    3  
ATOM 8944  C CA   . PHE B 1 8   ? -16.531 3.882   10.589  1.00 0.00 ? 8   PHE B CA   3  
ATOM 8945  C C    . PHE B 1 8   ? -17.092 4.484   11.881  1.00 0.00 ? 8   PHE B C    3  
ATOM 8946  O O    . PHE B 1 8   ? -18.192 4.997   11.909  1.00 0.00 ? 8   PHE B O    3  
ATOM 8947  C CB   . PHE B 1 8   ? -17.458 2.767   10.100  1.00 0.00 ? 8   PHE B CB   3  
ATOM 8948  C CG   . PHE B 1 8   ? -17.409 2.688   8.591   1.00 0.00 ? 8   PHE B CG   3  
ATOM 8949  C CD1  . PHE B 1 8   ? -16.284 3.153   7.898   1.00 0.00 ? 8   PHE B CD1  3  
ATOM 8950  C CD2  . PHE B 1 8   ? -18.491 2.148   7.886   1.00 0.00 ? 8   PHE B CD2  3  
ATOM 8951  C CE1  . PHE B 1 8   ? -16.243 3.079   6.501   1.00 0.00 ? 8   PHE B CE1  3  
ATOM 8952  C CE2  . PHE B 1 8   ? -18.449 2.074   6.488   1.00 0.00 ? 8   PHE B CE2  3  
ATOM 8953  C CZ   . PHE B 1 8   ? -17.325 2.540   5.796   1.00 0.00 ? 8   PHE B CZ   3  
ATOM 8954  H H    . PHE B 1 8   ? -15.072 2.393   11.134  1.00 0.00 ? 8   PHE B H    3  
ATOM 8955  H HA   . PHE B 1 8   ? -16.465 4.652   9.835   1.00 0.00 ? 8   PHE B HA   3  
ATOM 8956  H HB2  . PHE B 1 8   ? -17.140 1.825   10.521  1.00 0.00 ? 8   PHE B HB2  3  
ATOM 8957  H HB3  . PHE B 1 8   ? -18.470 2.978   10.415  1.00 0.00 ? 8   PHE B HB3  3  
ATOM 8958  H HD1  . PHE B 1 8   ? -15.449 3.569   8.442   1.00 0.00 ? 8   PHE B HD1  3  
ATOM 8959  H HD2  . PHE B 1 8   ? -19.358 1.789   8.419   1.00 0.00 ? 8   PHE B HD2  3  
ATOM 8960  H HE1  . PHE B 1 8   ? -15.376 3.438   5.967   1.00 0.00 ? 8   PHE B HE1  3  
ATOM 8961  H HE2  . PHE B 1 8   ? -19.284 1.657   5.944   1.00 0.00 ? 8   PHE B HE2  3  
ATOM 8962  H HZ   . PHE B 1 8   ? -17.294 2.482   4.717   1.00 0.00 ? 8   PHE B HZ   3  
ATOM 8963  N N    . SER B 1 9   ? -16.344 4.427   12.950  1.00 0.00 ? 9   SER B N    3  
ATOM 8964  C CA   . SER B 1 9   ? -16.839 4.997   14.235  1.00 0.00 ? 9   SER B CA   3  
ATOM 8965  C C    . SER B 1 9   ? -15.925 6.146   14.667  1.00 0.00 ? 9   SER B C    3  
ATOM 8966  O O    . SER B 1 9   ? -16.275 7.304   14.558  1.00 0.00 ? 9   SER B O    3  
ATOM 8967  C CB   . SER B 1 9   ? -16.835 3.910   15.311  1.00 0.00 ? 9   SER B CB   3  
ATOM 8968  O OG   . SER B 1 9   ? -18.149 3.760   15.832  1.00 0.00 ? 9   SER B OG   3  
ATOM 8969  H H    . SER B 1 9   ? -15.459 4.010   12.908  1.00 0.00 ? 9   SER B H    3  
ATOM 8970  H HA   . SER B 1 9   ? -17.845 5.367   14.101  1.00 0.00 ? 9   SER B HA   3  
ATOM 8971  H HB2  . SER B 1 9   ? -16.515 2.976   14.881  1.00 0.00 ? 9   SER B HB2  3  
ATOM 8972  H HB3  . SER B 1 9   ? -16.152 4.192   16.102  1.00 0.00 ? 9   SER B HB3  3  
ATOM 8973  H HG   . SER B 1 9   ? -18.197 4.244   16.660  1.00 0.00 ? 9   SER B HG   3  
ATOM 8974  N N    . SER B 1 10  ? -14.757 5.835   15.156  1.00 0.00 ? 10  SER B N    3  
ATOM 8975  C CA   . SER B 1 10  ? -13.822 6.909   15.594  1.00 0.00 ? 10  SER B CA   3  
ATOM 8976  C C    . SER B 1 10  ? -13.063 7.451   14.382  1.00 0.00 ? 10  SER B C    3  
ATOM 8977  O O    . SER B 1 10  ? -12.894 6.772   13.389  1.00 0.00 ? 10  SER B O    3  
ATOM 8978  C CB   . SER B 1 10  ? -12.826 6.337   16.603  1.00 0.00 ? 10  SER B CB   3  
ATOM 8979  O OG   . SER B 1 10  ? -12.467 7.349   17.535  1.00 0.00 ? 10  SER B OG   3  
ATOM 8980  H H    . SER B 1 10  ? -14.494 4.894   15.236  1.00 0.00 ? 10  SER B H    3  
ATOM 8981  H HA   . SER B 1 10  ? -14.382 7.708   16.056  1.00 0.00 ? 10  SER B HA   3  
ATOM 8982  H HB2  . SER B 1 10  ? -13.276 5.513   17.131  1.00 0.00 ? 10  SER B HB2  3  
ATOM 8983  H HB3  . SER B 1 10  ? -11.946 5.986   16.080  1.00 0.00 ? 10  SER B HB3  3  
ATOM 8984  H HG   . SER B 1 10  ? -11.667 7.068   17.985  1.00 0.00 ? 10  SER B HG   3  
ATOM 8985  N N    . THR B 1 11  ? -12.604 8.670   14.454  1.00 0.00 ? 11  THR B N    3  
ATOM 8986  C CA   . THR B 1 11  ? -11.857 9.254   13.305  1.00 0.00 ? 11  THR B CA   3  
ATOM 8987  C C    . THR B 1 11  ? -10.377 9.390   13.676  1.00 0.00 ? 11  THR B C    3  
ATOM 8988  O O    . THR B 1 11  ? -10.007 9.311   14.831  1.00 0.00 ? 11  THR B O    3  
ATOM 8989  C CB   . THR B 1 11  ? -12.429 10.635  12.974  1.00 0.00 ? 11  THR B CB   3  
ATOM 8990  O OG1  . THR B 1 11  ? -13.464 10.948  13.895  1.00 0.00 ? 11  THR B OG1  3  
ATOM 8991  C CG2  . THR B 1 11  ? -12.991 10.628  11.553  1.00 0.00 ? 11  THR B CG2  3  
ATOM 8992  H H    . THR B 1 11  ? -12.751 9.202   15.263  1.00 0.00 ? 11  THR B H    3  
ATOM 8993  H HA   . THR B 1 11  ? -11.955 8.608   12.446  1.00 0.00 ? 11  THR B HA   3  
ATOM 8994  H HB   . THR B 1 11  ? -11.647 11.376  13.045  1.00 0.00 ? 11  THR B HB   3  
ATOM 8995  H HG1  . THR B 1 11  ? -13.936 11.715  13.562  1.00 0.00 ? 11  THR B HG1  3  
ATOM 8996  H HG21 . THR B 1 11  ? -13.164 9.609   11.240  1.00 0.00 ? 11  THR B HG21 3  
ATOM 8997  H HG22 . THR B 1 11  ? -13.923 11.174  11.532  1.00 0.00 ? 11  THR B HG22 3  
ATOM 8998  H HG23 . THR B 1 11  ? -12.284 11.095  10.884  1.00 0.00 ? 11  THR B HG23 3  
ATOM 8999  N N    . GLU B 1 12  ? -9.528  9.592   12.705  1.00 0.00 ? 12  GLU B N    3  
ATOM 9000  C CA   . GLU B 1 12  ? -8.074  9.731   13.006  1.00 0.00 ? 12  GLU B CA   3  
ATOM 9001  C C    . GLU B 1 12  ? -7.332  10.187  11.747  1.00 0.00 ? 12  GLU B C    3  
ATOM 9002  O O    . GLU B 1 12  ? -7.934  10.479  10.733  1.00 0.00 ? 12  GLU B O    3  
ATOM 9003  C CB   . GLU B 1 12  ? -7.517  8.382   13.467  1.00 0.00 ? 12  GLU B CB   3  
ATOM 9004  C CG   . GLU B 1 12  ? -8.251  7.249   12.744  1.00 0.00 ? 12  GLU B CG   3  
ATOM 9005  C CD   . GLU B 1 12  ? -7.767  5.902   13.282  1.00 0.00 ? 12  GLU B CD   3  
ATOM 9006  O OE1  . GLU B 1 12  ? -7.514  5.818   14.473  1.00 0.00 ? 12  GLU B OE1  3  
ATOM 9007  O OE2  . GLU B 1 12  ? -7.656  4.978   12.495  1.00 0.00 ? 12  GLU B OE2  3  
ATOM 9008  H H    . GLU B 1 12  ? -9.846  9.652   11.780  1.00 0.00 ? 12  GLU B H    3  
ATOM 9009  H HA   . GLU B 1 12  ? -7.938  10.462  13.788  1.00 0.00 ? 12  GLU B HA   3  
ATOM 9010  H HB2  . GLU B 1 12  ? -6.463  8.332   13.239  1.00 0.00 ? 12  GLU B HB2  3  
ATOM 9011  H HB3  . GLU B 1 12  ? -7.661  8.279   14.532  1.00 0.00 ? 12  GLU B HB3  3  
ATOM 9012  H HG2  . GLU B 1 12  ? -9.314  7.345   12.913  1.00 0.00 ? 12  GLU B HG2  3  
ATOM 9013  H HG3  . GLU B 1 12  ? -8.047  7.306   11.685  1.00 0.00 ? 12  GLU B HG3  3  
ATOM 9014  N N    . LYS B 1 13  ? -6.029  10.251  11.804  1.00 0.00 ? 13  LYS B N    3  
ATOM 9015  C CA   . LYS B 1 13  ? -5.251  10.689  10.611  1.00 0.00 ? 13  LYS B CA   3  
ATOM 9016  C C    . LYS B 1 13  ? -4.125  9.689   10.338  1.00 0.00 ? 13  LYS B C    3  
ATOM 9017  O O    . LYS B 1 13  ? -3.010  10.061  10.035  1.00 0.00 ? 13  LYS B O    3  
ATOM 9018  C CB   . LYS B 1 13  ? -4.647  12.071  10.876  1.00 0.00 ? 13  LYS B CB   3  
ATOM 9019  C CG   . LYS B 1 13  ? -5.368  13.117  10.026  1.00 0.00 ? 13  LYS B CG   3  
ATOM 9020  C CD   . LYS B 1 13  ? -4.393  14.239  9.662   1.00 0.00 ? 13  LYS B CD   3  
ATOM 9021  C CE   . LYS B 1 13  ? -5.166  15.411  9.052   1.00 0.00 ? 13  LYS B CE   3  
ATOM 9022  N NZ   . LYS B 1 13  ? -4.935  16.637  9.867   1.00 0.00 ? 13  LYS B NZ   3  
ATOM 9023  H H    . LYS B 1 13  ? -5.564  10.012  12.632  1.00 0.00 ? 13  LYS B H    3  
ATOM 9024  H HA   . LYS B 1 13  ? -5.904  10.741  9.753   1.00 0.00 ? 13  LYS B HA   3  
ATOM 9025  H HB2  . LYS B 1 13  ? -4.758  12.317  11.923  1.00 0.00 ? 13  LYS B HB2  3  
ATOM 9026  H HB3  . LYS B 1 13  ? -3.599  12.060  10.619  1.00 0.00 ? 13  LYS B HB3  3  
ATOM 9027  H HG2  . LYS B 1 13  ? -5.738  12.654  9.122   1.00 0.00 ? 13  LYS B HG2  3  
ATOM 9028  H HG3  . LYS B 1 13  ? -6.195  13.530  10.584  1.00 0.00 ? 13  LYS B HG3  3  
ATOM 9029  H HD2  . LYS B 1 13  ? -3.878  14.571  10.552  1.00 0.00 ? 13  LYS B HD2  3  
ATOM 9030  H HD3  . LYS B 1 13  ? -3.674  13.873  8.945   1.00 0.00 ? 13  LYS B HD3  3  
ATOM 9031  H HE2  . LYS B 1 13  ? -4.824  15.580  8.042   1.00 0.00 ? 13  LYS B HE2  3  
ATOM 9032  H HE3  . LYS B 1 13  ? -6.220  15.179  9.042   1.00 0.00 ? 13  LYS B HE3  3  
ATOM 9033  H HZ1  . LYS B 1 13  ? -4.293  16.415  10.654  1.00 0.00 ? 13  LYS B HZ1  3  
ATOM 9034  H HZ2  . LYS B 1 13  ? -4.509  17.375  9.270   1.00 0.00 ? 13  LYS B HZ2  3  
ATOM 9035  H HZ3  . LYS B 1 13  ? -5.840  16.978  10.246  1.00 0.00 ? 13  LYS B HZ3  3  
ATOM 9036  N N    . ASN B 1 14  ? -4.410  8.419   10.442  1.00 0.00 ? 14  ASN B N    3  
ATOM 9037  C CA   . ASN B 1 14  ? -3.356  7.395   10.187  1.00 0.00 ? 14  ASN B CA   3  
ATOM 9038  C C    . ASN B 1 14  ? -3.909  6.321   9.250   1.00 0.00 ? 14  ASN B C    3  
ATOM 9039  O O    . ASN B 1 14  ? -4.981  6.463   8.697   1.00 0.00 ? 14  ASN B O    3  
ATOM 9040  C CB   . ASN B 1 14  ? -2.944  6.751   11.514  1.00 0.00 ? 14  ASN B CB   3  
ATOM 9041  C CG   . ASN B 1 14  ? -2.638  7.845   12.539  1.00 0.00 ? 14  ASN B CG   3  
ATOM 9042  O OD1  . ASN B 1 14  ? -3.119  7.800   13.655  1.00 0.00 ? 14  ASN B OD1  3  
ATOM 9043  N ND2  . ASN B 1 14  ? -1.853  8.832   12.208  1.00 0.00 ? 14  ASN B ND2  3  
ATOM 9044  H H    . ASN B 1 14  ? -5.315  8.138   10.687  1.00 0.00 ? 14  ASN B H    3  
ATOM 9045  H HA   . ASN B 1 14  ? -2.496  7.865   9.732   1.00 0.00 ? 14  ASN B HA   3  
ATOM 9046  H HB2  . ASN B 1 14  ? -3.751  6.131   11.878  1.00 0.00 ? 14  ASN B HB2  3  
ATOM 9047  H HB3  . ASN B 1 14  ? -2.064  6.145   11.364  1.00 0.00 ? 14  ASN B HB3  3  
ATOM 9048  H HD21 . ASN B 1 14  ? -1.465  8.870   11.308  1.00 0.00 ? 14  ASN B HD21 3  
ATOM 9049  H HD22 . ASN B 1 14  ? -1.650  9.537   12.858  1.00 0.00 ? 14  ASN B HD22 3  
ATOM 9050  N N    . CYS B 1 15  ? -3.190  5.245   9.067   1.00 0.00 ? 15  CYS B N    3  
ATOM 9051  C CA   . CYS B 1 15  ? -3.683  4.162   8.169   1.00 0.00 ? 15  CYS B CA   3  
ATOM 9052  C C    . CYS B 1 15  ? -5.100  3.781   8.597   1.00 0.00 ? 15  CYS B C    3  
ATOM 9053  O O    . CYS B 1 15  ? -5.299  2.926   9.436   1.00 0.00 ? 15  CYS B O    3  
ATOM 9054  C CB   . CYS B 1 15  ? -2.754  2.948   8.284   1.00 0.00 ? 15  CYS B CB   3  
ATOM 9055  S SG   . CYS B 1 15  ? -3.548  1.477   7.584   1.00 0.00 ? 15  CYS B SG   3  
ATOM 9056  H H    . CYS B 1 15  ? -2.329  5.147   9.524   1.00 0.00 ? 15  CYS B H    3  
ATOM 9057  H HA   . CYS B 1 15  ? -3.695  4.515   7.149   1.00 0.00 ? 15  CYS B HA   3  
ATOM 9058  H HB2  . CYS B 1 15  ? -1.837  3.145   7.752   1.00 0.00 ? 15  CYS B HB2  3  
ATOM 9059  H HB3  . CYS B 1 15  ? -2.530  2.771   9.321   1.00 0.00 ? 15  CYS B HB3  3  
ATOM 9060  N N    . CYS B 1 16  ? -6.086  4.421   8.034   1.00 0.00 ? 16  CYS B N    3  
ATOM 9061  C CA   . CYS B 1 16  ? -7.489  4.109   8.418   1.00 0.00 ? 16  CYS B CA   3  
ATOM 9062  C C    . CYS B 1 16  ? -8.357  4.035   7.161   1.00 0.00 ? 16  CYS B C    3  
ATOM 9063  O O    . CYS B 1 16  ? -8.273  4.870   6.279   1.00 0.00 ? 16  CYS B O    3  
ATOM 9064  C CB   . CYS B 1 16  ? -8.006  5.214   9.350   1.00 0.00 ? 16  CYS B CB   3  
ATOM 9065  S SG   . CYS B 1 16  ? -9.816  5.169   9.448   1.00 0.00 ? 16  CYS B SG   3  
ATOM 9066  H H    . CYS B 1 16  ? -5.903  5.115   7.367   1.00 0.00 ? 16  CYS B H    3  
ATOM 9067  H HA   . CYS B 1 16  ? -7.519  3.161   8.933   1.00 0.00 ? 16  CYS B HA   3  
ATOM 9068  H HB2  . CYS B 1 16  ? -7.593  5.070   10.337  1.00 0.00 ? 16  CYS B HB2  3  
ATOM 9069  H HB3  . CYS B 1 16  ? -7.692  6.177   8.972   1.00 0.00 ? 16  CYS B HB3  3  
ATOM 9070  N N    . VAL B 1 17  ? -9.195  3.040   7.079   1.00 0.00 ? 17  VAL B N    3  
ATOM 9071  C CA   . VAL B 1 17  ? -10.083 2.908   5.895   1.00 0.00 ? 17  VAL B CA   3  
ATOM 9072  C C    . VAL B 1 17  ? -11.261 3.872   6.058   1.00 0.00 ? 17  VAL B C    3  
ATOM 9073  O O    . VAL B 1 17  ? -12.160 3.649   6.842   1.00 0.00 ? 17  VAL B O    3  
ATOM 9074  C CB   . VAL B 1 17  ? -10.586 1.466   5.805   1.00 0.00 ? 17  VAL B CB   3  
ATOM 9075  C CG1  . VAL B 1 17  ? -11.584 1.192   6.926   1.00 0.00 ? 17  VAL B CG1  3  
ATOM 9076  C CG2  . VAL B 1 17  ? -11.265 1.247   4.456   1.00 0.00 ? 17  VAL B CG2  3  
ATOM 9077  H H    . VAL B 1 17  ? -9.246  2.382   7.804   1.00 0.00 ? 17  VAL B H    3  
ATOM 9078  H HA   . VAL B 1 17  ? -9.532  3.157   4.999   1.00 0.00 ? 17  VAL B HA   3  
ATOM 9079  H HB   . VAL B 1 17  ? -9.753  0.791   5.903   1.00 0.00 ? 17  VAL B HB   3  
ATOM 9080  H HG11 . VAL B 1 17  ? -11.257 1.690   7.827   1.00 0.00 ? 17  VAL B HG11 3  
ATOM 9081  H HG12 . VAL B 1 17  ? -12.557 1.565   6.640   1.00 0.00 ? 17  VAL B HG12 3  
ATOM 9082  H HG13 . VAL B 1 17  ? -11.644 0.129   7.102   1.00 0.00 ? 17  VAL B HG13 3  
ATOM 9083  H HG21 . VAL B 1 17  ? -10.770 1.843   3.704   1.00 0.00 ? 17  VAL B HG21 3  
ATOM 9084  H HG22 . VAL B 1 17  ? -11.204 0.203   4.188   1.00 0.00 ? 17  VAL B HG22 3  
ATOM 9085  H HG23 . VAL B 1 17  ? -12.302 1.542   4.523   1.00 0.00 ? 17  VAL B HG23 3  
ATOM 9086  N N    . ARG B 1 18  ? -11.256 4.958   5.340   1.00 0.00 ? 18  ARG B N    3  
ATOM 9087  C CA   . ARG B 1 18  ? -12.370 5.939   5.484   1.00 0.00 ? 18  ARG B CA   3  
ATOM 9088  C C    . ARG B 1 18  ? -13.465 5.656   4.455   1.00 0.00 ? 18  ARG B C    3  
ATOM 9089  O O    . ARG B 1 18  ? -13.217 5.116   3.393   1.00 0.00 ? 18  ARG B O    3  
ATOM 9090  C CB   . ARG B 1 18  ? -11.825 7.353   5.288   1.00 0.00 ? 18  ARG B CB   3  
ATOM 9091  C CG   . ARG B 1 18  ? -10.993 7.746   6.508   1.00 0.00 ? 18  ARG B CG   3  
ATOM 9092  C CD   . ARG B 1 18  ? -10.651 9.235   6.438   1.00 0.00 ? 18  ARG B CD   3  
ATOM 9093  N NE   . ARG B 1 18  ? -9.171  9.406   6.488   1.00 0.00 ? 18  ARG B NE   3  
ATOM 9094  C CZ   . ARG B 1 18  ? -8.654  10.584  6.718   1.00 0.00 ? 18  ARG B CZ   3  
ATOM 9095  N NH1  . ARG B 1 18  ? -9.430  11.603  6.976   1.00 0.00 ? 18  ARG B NH1  3  
ATOM 9096  N NH2  . ARG B 1 18  ? -7.359  10.742  6.694   1.00 0.00 ? 18  ARG B NH2  3  
ATOM 9097  H H    . ARG B 1 18  ? -10.515 5.137   4.722   1.00 0.00 ? 18  ARG B H    3  
ATOM 9098  H HA   . ARG B 1 18  ? -12.788 5.855   6.477   1.00 0.00 ? 18  ARG B HA   3  
ATOM 9099  H HB2  . ARG B 1 18  ? -11.203 7.381   4.406   1.00 0.00 ? 18  ARG B HB2  3  
ATOM 9100  H HB3  . ARG B 1 18  ? -12.646 8.045   5.175   1.00 0.00 ? 18  ARG B HB3  3  
ATOM 9101  H HG2  . ARG B 1 18  ? -11.557 7.546   7.406   1.00 0.00 ? 18  ARG B HG2  3  
ATOM 9102  H HG3  . ARG B 1 18  ? -10.080 7.169   6.520   1.00 0.00 ? 18  ARG B HG3  3  
ATOM 9103  H HD2  . ARG B 1 18  ? -11.031 9.649   5.515   1.00 0.00 ? 18  ARG B HD2  3  
ATOM 9104  H HD3  . ARG B 1 18  ? -11.101 9.747   7.275   1.00 0.00 ? 18  ARG B HD3  3  
ATOM 9105  H HE   . ARG B 1 18  ? -8.584  8.634   6.346   1.00 0.00 ? 18  ARG B HE   3  
ATOM 9106  H HH11 . ARG B 1 18  ? -10.422 11.485  6.995   1.00 0.00 ? 18  ARG B HH11 3  
ATOM 9107  H HH12 . ARG B 1 18  ? -9.030  12.502  7.151   1.00 0.00 ? 18  ARG B HH12 3  
ATOM 9108  H HH21 . ARG B 1 18  ? -6.764  9.963   6.499   1.00 0.00 ? 18  ARG B HH21 3  
ATOM 9109  H HH22 . ARG B 1 18  ? -6.963  11.643  6.872   1.00 0.00 ? 18  ARG B HH22 3  
ATOM 9110  N N    . GLN B 1 19  ? -14.680 6.022   4.769   1.00 0.00 ? 19  GLN B N    3  
ATOM 9111  C CA   . GLN B 1 19  ? -15.811 5.788   3.824   1.00 0.00 ? 19  GLN B CA   3  
ATOM 9112  C C    . GLN B 1 19  ? -15.466 6.382   2.462   1.00 0.00 ? 19  GLN B C    3  
ATOM 9113  O O    . GLN B 1 19  ? -14.721 7.335   2.359   1.00 0.00 ? 19  GLN B O    3  
ATOM 9114  C CB   . GLN B 1 19  ? -17.076 6.455   4.368   1.00 0.00 ? 19  GLN B CB   3  
ATOM 9115  C CG   . GLN B 1 19  ? -16.938 7.976   4.265   1.00 0.00 ? 19  GLN B CG   3  
ATOM 9116  C CD   . GLN B 1 19  ? -18.199 8.641   4.820   1.00 0.00 ? 19  GLN B CD   3  
ATOM 9117  O OE1  . GLN B 1 19  ? -19.005 9.160   4.073   1.00 0.00 ? 19  GLN B OE1  3  
ATOM 9118  N NE2  . GLN B 1 19  ? -18.406 8.646   6.109   1.00 0.00 ? 19  GLN B NE2  3  
ATOM 9119  H H    . GLN B 1 19  ? -14.848 6.456   5.631   1.00 0.00 ? 19  GLN B H    3  
ATOM 9120  H HA   . GLN B 1 19  ? -15.983 4.728   3.715   1.00 0.00 ? 19  GLN B HA   3  
ATOM 9121  H HB2  . GLN B 1 19  ? -17.930 6.131   3.791   1.00 0.00 ? 19  GLN B HB2  3  
ATOM 9122  H HB3  . GLN B 1 19  ? -17.213 6.178   5.402   1.00 0.00 ? 19  GLN B HB3  3  
ATOM 9123  H HG2  . GLN B 1 19  ? -16.078 8.299   4.835   1.00 0.00 ? 19  GLN B HG2  3  
ATOM 9124  H HG3  . GLN B 1 19  ? -16.811 8.257   3.231   1.00 0.00 ? 19  GLN B HG3  3  
ATOM 9125  H HE21 . GLN B 1 19  ? -17.758 8.226   6.711   1.00 0.00 ? 19  GLN B HE21 3  
ATOM 9126  H HE22 . GLN B 1 19  ? -19.212 9.070   6.474   1.00 0.00 ? 19  GLN B HE22 3  
ATOM 9127  N N    . LEU B 1 20  ? -15.998 5.821   1.412   1.00 0.00 ? 20  LEU B N    3  
ATOM 9128  C CA   . LEU B 1 20  ? -15.692 6.351   0.060   1.00 0.00 ? 20  LEU B CA   3  
ATOM 9129  C C    . LEU B 1 20  ? -16.633 5.723   -0.964  1.00 0.00 ? 20  LEU B C    3  
ATOM 9130  O O    . LEU B 1 20  ? -16.211 5.281   -2.014  1.00 0.00 ? 20  LEU B O    3  
ATOM 9131  C CB   . LEU B 1 20  ? -14.248 6.009   -0.297  1.00 0.00 ? 20  LEU B CB   3  
ATOM 9132  C CG   . LEU B 1 20  ? -13.847 6.713   -1.592  1.00 0.00 ? 20  LEU B CG   3  
ATOM 9133  C CD1  . LEU B 1 20  ? -13.792 8.222   -1.354  1.00 0.00 ? 20  LEU B CD1  3  
ATOM 9134  C CD2  . LEU B 1 20  ? -12.468 6.212   -2.030  1.00 0.00 ? 20  LEU B CD2  3  
ATOM 9135  H H    . LEU B 1 20  ? -16.593 5.049   1.515   1.00 0.00 ? 20  LEU B H    3  
ATOM 9136  H HA   . LEU B 1 20  ? -15.818 7.424   0.055   1.00 0.00 ? 20  LEU B HA   3  
ATOM 9137  H HB2  . LEU B 1 20  ? -13.603 6.336   0.501   1.00 0.00 ? 20  LEU B HB2  3  
ATOM 9138  H HB3  . LEU B 1 20  ? -14.151 4.941   -0.423  1.00 0.00 ? 20  LEU B HB3  3  
ATOM 9139  H HG   . LEU B 1 20  ? -14.571 6.497   -2.362  1.00 0.00 ? 20  LEU B HG   3  
ATOM 9140  H HD11 . LEU B 1 20  ? -13.786 8.418   -0.293  1.00 0.00 ? 20  LEU B HD11 3  
ATOM 9141  H HD12 . LEU B 1 20  ? -12.896 8.623   -1.800  1.00 0.00 ? 20  LEU B HD12 3  
ATOM 9142  H HD13 . LEU B 1 20  ? -14.658 8.687   -1.803  1.00 0.00 ? 20  LEU B HD13 3  
ATOM 9143  H HD21 . LEU B 1 20  ? -11.750 6.407   -1.247  1.00 0.00 ? 20  LEU B HD21 3  
ATOM 9144  H HD22 . LEU B 1 20  ? -12.515 5.150   -2.219  1.00 0.00 ? 20  LEU B HD22 3  
ATOM 9145  H HD23 . LEU B 1 20  ? -12.168 6.726   -2.931  1.00 0.00 ? 20  LEU B HD23 3  
ATOM 9146  N N    . TYR B 1 21  ? -17.905 5.680   -0.675  1.00 0.00 ? 21  TYR B N    3  
ATOM 9147  C CA   . TYR B 1 21  ? -18.854 5.083   -1.655  1.00 0.00 ? 21  TYR B CA   3  
ATOM 9148  C C    . TYR B 1 21  ? -18.514 5.615   -3.045  1.00 0.00 ? 21  TYR B C    3  
ATOM 9149  O O    . TYR B 1 21  ? -18.257 6.789   -3.221  1.00 0.00 ? 21  TYR B O    3  
ATOM 9150  C CB   . TYR B 1 21  ? -20.293 5.471   -1.313  1.00 0.00 ? 21  TYR B CB   3  
ATOM 9151  C CG   . TYR B 1 21  ? -21.208 4.972   -2.409  1.00 0.00 ? 21  TYR B CG   3  
ATOM 9152  C CD1  . TYR B 1 21  ? -21.240 5.623   -3.650  1.00 0.00 ? 21  TYR B CD1  3  
ATOM 9153  C CD2  . TYR B 1 21  ? -22.015 3.851   -2.187  1.00 0.00 ? 21  TYR B CD2  3  
ATOM 9154  C CE1  . TYR B 1 21  ? -22.081 5.154   -4.668  1.00 0.00 ? 21  TYR B CE1  3  
ATOM 9155  C CE2  . TYR B 1 21  ? -22.857 3.382   -3.204  1.00 0.00 ? 21  TYR B CE2  3  
ATOM 9156  C CZ   . TYR B 1 21  ? -22.889 4.033   -4.444  1.00 0.00 ? 21  TYR B CZ   3  
ATOM 9157  O OH   . TYR B 1 21  ? -23.717 3.570   -5.445  1.00 0.00 ? 21  TYR B OH   3  
ATOM 9158  H H    . TYR B 1 21  ? -18.229 6.041   0.179   1.00 0.00 ? 21  TYR B H    3  
ATOM 9159  H HA   . TYR B 1 21  ? -18.757 4.006   -1.646  1.00 0.00 ? 21  TYR B HA   3  
ATOM 9160  H HB2  . TYR B 1 21  ? -20.576 5.021   -0.372  1.00 0.00 ? 21  TYR B HB2  3  
ATOM 9161  H HB3  . TYR B 1 21  ? -20.371 6.546   -1.240  1.00 0.00 ? 21  TYR B HB3  3  
ATOM 9162  H HD1  . TYR B 1 21  ? -20.617 6.489   -3.821  1.00 0.00 ? 21  TYR B HD1  3  
ATOM 9163  H HD2  . TYR B 1 21  ? -21.989 3.348   -1.232  1.00 0.00 ? 21  TYR B HD2  3  
ATOM 9164  H HE1  . TYR B 1 21  ? -22.103 5.656   -5.626  1.00 0.00 ? 21  TYR B HE1  3  
ATOM 9165  H HE2  . TYR B 1 21  ? -23.481 2.517   -3.033  1.00 0.00 ? 21  TYR B HE2  3  
ATOM 9166  H HH   . TYR B 1 21  ? -23.645 4.169   -6.192  1.00 0.00 ? 21  TYR B HH   3  
ATOM 9167  N N    . ILE B 1 22  ? -18.498 4.769   -4.031  1.00 0.00 ? 22  ILE B N    3  
ATOM 9168  C CA   . ILE B 1 22  ? -18.161 5.247   -5.397  1.00 0.00 ? 22  ILE B CA   3  
ATOM 9169  C C    . ILE B 1 22  ? -19.290 4.899   -6.365  1.00 0.00 ? 22  ILE B C    3  
ATOM 9170  O O    . ILE B 1 22  ? -19.563 3.744   -6.627  1.00 0.00 ? 22  ILE B O    3  
ATOM 9171  C CB   . ILE B 1 22  ? -16.868 4.578   -5.862  1.00 0.00 ? 22  ILE B CB   3  
ATOM 9172  C CG1  . ILE B 1 22  ? -15.737 4.922   -4.891  1.00 0.00 ? 22  ILE B CG1  3  
ATOM 9173  C CG2  . ILE B 1 22  ? -16.510 5.082   -7.260  1.00 0.00 ? 22  ILE B CG2  3  
ATOM 9174  C CD1  . ILE B 1 22  ? -14.398 4.483   -5.487  1.00 0.00 ? 22  ILE B CD1  3  
ATOM 9175  H H    . ILE B 1 22  ? -18.701 3.824   -3.876  1.00 0.00 ? 22  ILE B H    3  
ATOM 9176  H HA   . ILE B 1 22  ? -18.022 6.318   -5.378  1.00 0.00 ? 22  ILE B HA   3  
ATOM 9177  H HB   . ILE B 1 22  ? -17.008 3.506   -5.891  1.00 0.00 ? 22  ILE B HB   3  
ATOM 9178  H HG12 . ILE B 1 22  ? -15.724 5.989   -4.718  1.00 0.00 ? 22  ILE B HG12 3  
ATOM 9179  H HG13 . ILE B 1 22  ? -15.897 4.408   -3.955  1.00 0.00 ? 22  ILE B HG13 3  
ATOM 9180  H HG21 . ILE B 1 22  ? -17.414 5.225   -7.832  1.00 0.00 ? 22  ILE B HG21 3  
ATOM 9181  H HG22 . ILE B 1 22  ? -15.984 6.020   -7.178  1.00 0.00 ? 22  ILE B HG22 3  
ATOM 9182  H HG23 . ILE B 1 22  ? -15.881 4.357   -7.753  1.00 0.00 ? 22  ILE B HG23 3  
ATOM 9183  H HD11 . ILE B 1 22  ? -14.306 4.872   -6.490  1.00 0.00 ? 22  ILE B HD11 3  
ATOM 9184  H HD12 . ILE B 1 22  ? -13.591 4.863   -4.878  1.00 0.00 ? 22  ILE B HD12 3  
ATOM 9185  H HD13 . ILE B 1 22  ? -14.354 3.404   -5.513  1.00 0.00 ? 22  ILE B HD13 3  
ATOM 9186  N N    . ASP B 1 23  ? -19.937 5.889   -6.914  1.00 0.00 ? 23  ASP B N    3  
ATOM 9187  C CA   . ASP B 1 23  ? -21.031 5.609   -7.881  1.00 0.00 ? 23  ASP B CA   3  
ATOM 9188  C C    . ASP B 1 23  ? -20.406 5.394   -9.254  1.00 0.00 ? 23  ASP B C    3  
ATOM 9189  O O    . ASP B 1 23  ? -20.132 6.328   -9.970  1.00 0.00 ? 23  ASP B O    3  
ATOM 9190  C CB   . ASP B 1 23  ? -22.004 6.788   -7.925  1.00 0.00 ? 23  ASP B CB   3  
ATOM 9191  C CG   . ASP B 1 23  ? -23.112 6.495   -8.938  1.00 0.00 ? 23  ASP B CG   3  
ATOM 9192  O OD1  . ASP B 1 23  ? -23.845 5.545   -8.727  1.00 0.00 ? 23  ASP B OD1  3  
ATOM 9193  O OD2  . ASP B 1 23  ? -23.208 7.227   -9.910  1.00 0.00 ? 23  ASP B OD2  3  
ATOM 9194  H H    . ASP B 1 23  ? -19.693 6.815   -6.702  1.00 0.00 ? 23  ASP B H    3  
ATOM 9195  H HA   . ASP B 1 23  ? -21.557 4.718   -7.587  1.00 0.00 ? 23  ASP B HA   3  
ATOM 9196  H HB2  . ASP B 1 23  ? -22.439 6.931   -6.946  1.00 0.00 ? 23  ASP B HB2  3  
ATOM 9197  H HB3  . ASP B 1 23  ? -21.476 7.676   -8.216  1.00 0.00 ? 23  ASP B HB3  3  
ATOM 9198  N N    . PHE B 1 24  ? -20.167 4.153   -9.590  1.00 0.00 ? 24  PHE B N    3  
ATOM 9199  C CA   . PHE B 1 24  ? -19.535 3.779   -10.898 1.00 0.00 ? 24  PHE B CA   3  
ATOM 9200  C C    . PHE B 1 24  ? -19.467 4.959   -11.876 1.00 0.00 ? 24  PHE B C    3  
ATOM 9201  O O    . PHE B 1 24  ? -18.407 5.321   -12.346 1.00 0.00 ? 24  PHE B O    3  
ATOM 9202  C CB   . PHE B 1 24  ? -20.353 2.655   -11.539 1.00 0.00 ? 24  PHE B CB   3  
ATOM 9203  C CG   . PHE B 1 24  ? -19.858 1.322   -11.031 1.00 0.00 ? 24  PHE B CG   3  
ATOM 9204  C CD1  . PHE B 1 24  ? -18.594 0.857   -11.405 1.00 0.00 ? 24  PHE B CD1  3  
ATOM 9205  C CD2  . PHE B 1 24  ? -20.664 0.554   -10.182 1.00 0.00 ? 24  PHE B CD2  3  
ATOM 9206  C CE1  . PHE B 1 24  ? -18.133 -0.376  -10.930 1.00 0.00 ? 24  PHE B CE1  3  
ATOM 9207  C CE2  . PHE B 1 24  ? -20.203 -0.680  -9.709  1.00 0.00 ? 24  PHE B CE2  3  
ATOM 9208  C CZ   . PHE B 1 24  ? -18.937 -1.145  -10.083 1.00 0.00 ? 24  PHE B CZ   3  
ATOM 9209  H H    . PHE B 1 24  ? -20.396 3.443   -8.955  1.00 0.00 ? 24  PHE B H    3  
ATOM 9210  H HA   . PHE B 1 24  ? -18.536 3.418   -10.714 1.00 0.00 ? 24  PHE B HA   3  
ATOM 9211  H HB2  . PHE B 1 24  ? -21.395 2.775   -11.280 1.00 0.00 ? 24  PHE B HB2  3  
ATOM 9212  H HB3  . PHE B 1 24  ? -20.241 2.694   -12.612 1.00 0.00 ? 24  PHE B HB3  3  
ATOM 9213  H HD1  . PHE B 1 24  ? -17.974 1.448   -12.062 1.00 0.00 ? 24  PHE B HD1  3  
ATOM 9214  H HD2  . PHE B 1 24  ? -21.640 0.913   -9.893  1.00 0.00 ? 24  PHE B HD2  3  
ATOM 9215  H HE1  . PHE B 1 24  ? -17.156 -0.735  -11.219 1.00 0.00 ? 24  PHE B HE1  3  
ATOM 9216  H HE2  . PHE B 1 24  ? -20.824 -1.275  -9.058  1.00 0.00 ? 24  PHE B HE2  3  
ATOM 9217  H HZ   . PHE B 1 24  ? -18.583 -2.095  -9.716  1.00 0.00 ? 24  PHE B HZ   3  
ATOM 9218  N N    . ARG B 1 25  ? -20.586 5.541   -12.209 1.00 0.00 ? 25  ARG B N    3  
ATOM 9219  C CA   . ARG B 1 25  ? -20.578 6.667   -13.190 1.00 0.00 ? 25  ARG B CA   3  
ATOM 9220  C C    . ARG B 1 25  ? -20.277 8.014   -12.517 1.00 0.00 ? 25  ARG B C    3  
ATOM 9221  O O    . ARG B 1 25  ? -19.577 8.839   -13.066 1.00 0.00 ? 25  ARG B O    3  
ATOM 9222  C CB   . ARG B 1 25  ? -21.947 6.744   -13.869 1.00 0.00 ? 25  ARG B CB   3  
ATOM 9223  C CG   . ARG B 1 25  ? -21.929 7.843   -14.933 1.00 0.00 ? 25  ARG B CG   3  
ATOM 9224  C CD   . ARG B 1 25  ? -21.485 7.250   -16.272 1.00 0.00 ? 25  ARG B CD   3  
ATOM 9225  N NE   . ARG B 1 25  ? -21.877 8.169   -17.376 1.00 0.00 ? 25  ARG B NE   3  
ATOM 9226  C CZ   . ARG B 1 25  ? -23.031 8.025   -17.968 1.00 0.00 ? 25  ARG B CZ   3  
ATOM 9227  N NH1  . ARG B 1 25  ? -23.945 7.258   -17.438 1.00 0.00 ? 25  ARG B NH1  3  
ATOM 9228  N NH2  . ARG B 1 25  ? -23.270 8.646   -19.090 1.00 0.00 ? 25  ARG B NH2  3  
ATOM 9229  H H    . ARG B 1 25  ? -21.433 5.223   -11.835 1.00 0.00 ? 25  ARG B H    3  
ATOM 9230  H HA   . ARG B 1 25  ? -19.830 6.471   -13.940 1.00 0.00 ? 25  ARG B HA   3  
ATOM 9231  H HB2  . ARG B 1 25  ? -22.172 5.795   -14.334 1.00 0.00 ? 25  ARG B HB2  3  
ATOM 9232  H HB3  . ARG B 1 25  ? -22.702 6.972   -13.133 1.00 0.00 ? 25  ARG B HB3  3  
ATOM 9233  H HG2  . ARG B 1 25  ? -22.920 8.262   -15.036 1.00 0.00 ? 25  ARG B HG2  3  
ATOM 9234  H HG3  . ARG B 1 25  ? -21.238 8.618   -14.639 1.00 0.00 ? 25  ARG B HG3  3  
ATOM 9235  H HD2  . ARG B 1 25  ? -20.413 7.122   -16.272 1.00 0.00 ? 25  ARG B HD2  3  
ATOM 9236  H HD3  . ARG B 1 25  ? -21.960 6.290   -16.416 1.00 0.00 ? 25  ARG B HD3  3  
ATOM 9237  H HE   . ARG B 1 25  ? -21.268 8.884   -17.657 1.00 0.00 ? 25  ARG B HE   3  
ATOM 9238  H HH11 . ARG B 1 25  ? -23.761 6.782   -16.578 1.00 0.00 ? 25  ARG B HH11 3  
ATOM 9239  H HH12 . ARG B 1 25  ? -24.828 7.147   -17.892 1.00 0.00 ? 25  ARG B HH12 3  
ATOM 9240  H HH21 . ARG B 1 25  ? -22.570 9.233   -19.496 1.00 0.00 ? 25  ARG B HH21 3  
ATOM 9241  H HH22 . ARG B 1 25  ? -24.154 8.535   -19.544 1.00 0.00 ? 25  ARG B HH22 3  
ATOM 9242  N N    . LYS B 1 26  ? -20.821 8.267   -11.359 1.00 0.00 ? 26  LYS B N    3  
ATOM 9243  C CA   . LYS B 1 26  ? -20.576 9.589   -10.704 1.00 0.00 ? 26  LYS B CA   3  
ATOM 9244  C C    . LYS B 1 26  ? -19.097 9.765   -10.361 1.00 0.00 ? 26  LYS B C    3  
ATOM 9245  O O    . LYS B 1 26  ? -18.510 10.799  -10.605 1.00 0.00 ? 26  LYS B O    3  
ATOM 9246  C CB   . LYS B 1 26  ? -21.379 9.669   -9.410  1.00 0.00 ? 26  LYS B CB   3  
ATOM 9247  C CG   . LYS B 1 26  ? -21.794 11.119  -9.152  1.00 0.00 ? 26  LYS B CG   3  
ATOM 9248  C CD   . LYS B 1 26  ? -23.234 11.153  -8.635  1.00 0.00 ? 26  LYS B CD   3  
ATOM 9249  C CE   . LYS B 1 26  ? -23.641 12.600  -8.352  1.00 0.00 ? 26  LYS B CE   3  
ATOM 9250  N NZ   . LYS B 1 26  ? -24.851 12.615  -7.482  1.00 0.00 ? 26  LYS B NZ   3  
ATOM 9251  H H    . LYS B 1 26  ? -21.410 7.606   -10.932 1.00 0.00 ? 26  LYS B H    3  
ATOM 9252  H HA   . LYS B 1 26  ? -20.888 10.383  -11.366 1.00 0.00 ? 26  LYS B HA   3  
ATOM 9253  H HB2  . LYS B 1 26  ? -22.252 9.045   -9.490  1.00 0.00 ? 26  LYS B HB2  3  
ATOM 9254  H HB3  . LYS B 1 26  ? -20.767 9.327   -8.590  1.00 0.00 ? 26  LYS B HB3  3  
ATOM 9255  H HG2  . LYS B 1 26  ? -21.135 11.556  -8.417  1.00 0.00 ? 26  LYS B HG2  3  
ATOM 9256  H HG3  . LYS B 1 26  ? -21.732 11.680  -10.072 1.00 0.00 ? 26  LYS B HG3  3  
ATOM 9257  H HD2  . LYS B 1 26  ? -23.893 10.731  -9.378  1.00 0.00 ? 26  LYS B HD2  3  
ATOM 9258  H HD3  . LYS B 1 26  ? -23.303 10.578  -7.723  1.00 0.00 ? 26  LYS B HD3  3  
ATOM 9259  H HE2  . LYS B 1 26  ? -22.830 13.111  -7.851  1.00 0.00 ? 26  LYS B HE2  3  
ATOM 9260  H HE3  . LYS B 1 26  ? -23.861 13.101  -9.283  1.00 0.00 ? 26  LYS B HE3  3  
ATOM 9261  H HZ1  . LYS B 1 26  ? -24.926 11.710  -6.976  1.00 0.00 ? 26  LYS B HZ1  3  
ATOM 9262  H HZ2  . LYS B 1 26  ? -24.774 13.390  -6.794  1.00 0.00 ? 26  LYS B HZ2  3  
ATOM 9263  H HZ3  . LYS B 1 26  ? -25.697 12.756  -8.070  1.00 0.00 ? 26  LYS B HZ3  3  
ATOM 9264  N N    . ASP B 1 27  ? -18.505 8.780   -9.752  1.00 0.00 ? 27  ASP B N    3  
ATOM 9265  C CA   . ASP B 1 27  ? -17.083 8.898   -9.338  1.00 0.00 ? 27  ASP B CA   3  
ATOM 9266  C C    . ASP B 1 27  ? -16.126 8.439   -10.446 1.00 0.00 ? 27  ASP B C    3  
ATOM 9267  O O    . ASP B 1 27  ? -15.302 9.201   -10.911 1.00 0.00 ? 27  ASP B O    3  
ATOM 9268  C CB   . ASP B 1 27  ? -16.882 8.030   -8.102  1.00 0.00 ? 27  ASP B CB   3  
ATOM 9269  C CG   . ASP B 1 27  ? -17.146 8.863   -6.848  1.00 0.00 ? 27  ASP B CG   3  
ATOM 9270  O OD1  . ASP B 1 27  ? -16.493 9.880   -6.688  1.00 0.00 ? 27  ASP B OD1  3  
ATOM 9271  O OD2  . ASP B 1 27  ? -17.997 8.469   -6.068  1.00 0.00 ? 27  ASP B OD2  3  
ATOM 9272  H H    . ASP B 1 27  ? -19.008 7.973   -9.529  1.00 0.00 ? 27  ASP B H    3  
ATOM 9273  H HA   . ASP B 1 27  ? -16.870 9.925   -9.085  1.00 0.00 ? 27  ASP B HA   3  
ATOM 9274  H HB2  . ASP B 1 27  ? -17.572 7.197   -8.134  1.00 0.00 ? 27  ASP B HB2  3  
ATOM 9275  H HB3  . ASP B 1 27  ? -15.876 7.660   -8.086  1.00 0.00 ? 27  ASP B HB3  3  
ATOM 9276  N N    . LEU B 1 28  ? -16.200 7.202   -10.856 1.00 0.00 ? 28  LEU B N    3  
ATOM 9277  C CA   . LEU B 1 28  ? -15.257 6.720   -11.910 1.00 0.00 ? 28  LEU B CA   3  
ATOM 9278  C C    . LEU B 1 28  ? -15.833 6.974   -13.301 1.00 0.00 ? 28  LEU B C    3  
ATOM 9279  O O    . LEU B 1 28  ? -15.130 6.906   -14.291 1.00 0.00 ? 28  LEU B O    3  
ATOM 9280  C CB   . LEU B 1 28  ? -15.026 5.217   -11.744 1.00 0.00 ? 28  LEU B CB   3  
ATOM 9281  C CG   . LEU B 1 28  ? -14.549 4.919   -10.326 1.00 0.00 ? 28  LEU B CG   3  
ATOM 9282  C CD1  . LEU B 1 28  ? -14.135 3.449   -10.231 1.00 0.00 ? 28  LEU B CD1  3  
ATOM 9283  C CD2  . LEU B 1 28  ? -13.349 5.809   -9.996  1.00 0.00 ? 28  LEU B CD2  3  
ATOM 9284  H H    . LEU B 1 28  ? -16.852 6.588   -10.457 1.00 0.00 ? 28  LEU B H    3  
ATOM 9285  H HA   . LEU B 1 28  ? -14.314 7.236   -11.812 1.00 0.00 ? 28  LEU B HA   3  
ATOM 9286  H HB2  . LEU B 1 28  ? -15.951 4.689   -11.931 1.00 0.00 ? 28  LEU B HB2  3  
ATOM 9287  H HB3  . LEU B 1 28  ? -14.278 4.889   -12.450 1.00 0.00 ? 28  LEU B HB3  3  
ATOM 9288  H HG   . LEU B 1 28  ? -15.351 5.117   -9.630  1.00 0.00 ? 28  LEU B HG   3  
ATOM 9289  H HD11 . LEU B 1 28  ? -14.373 2.949   -11.158 1.00 0.00 ? 28  LEU B HD11 3  
ATOM 9290  H HD12 . LEU B 1 28  ? -13.072 3.386   -10.050 1.00 0.00 ? 28  LEU B HD12 3  
ATOM 9291  H HD13 . LEU B 1 28  ? -14.667 2.977   -9.419  1.00 0.00 ? 28  LEU B HD13 3  
ATOM 9292  H HD21 . LEU B 1 28  ? -12.874 6.129   -10.912 1.00 0.00 ? 28  LEU B HD21 3  
ATOM 9293  H HD22 . LEU B 1 28  ? -13.683 6.675   -9.443  1.00 0.00 ? 28  LEU B HD22 3  
ATOM 9294  H HD23 . LEU B 1 28  ? -12.641 5.252   -9.399  1.00 0.00 ? 28  LEU B HD23 3  
ATOM 9295  N N    . GLY B 1 29  ? -17.100 7.251   -13.399 1.00 0.00 ? 29  GLY B N    3  
ATOM 9296  C CA   . GLY B 1 29  ? -17.691 7.487   -14.746 1.00 0.00 ? 29  GLY B CA   3  
ATOM 9297  C C    . GLY B 1 29  ? -17.561 6.206   -15.572 1.00 0.00 ? 29  GLY B C    3  
ATOM 9298  O O    . GLY B 1 29  ? -17.734 6.206   -16.775 1.00 0.00 ? 29  GLY B O    3  
ATOM 9299  H H    . GLY B 1 29  ? -17.660 7.292   -12.596 1.00 0.00 ? 29  GLY B H    3  
ATOM 9300  H HA2  . GLY B 1 29  ? -18.732 7.756   -14.645 1.00 0.00 ? 29  GLY B HA2  3  
ATOM 9301  H HA3  . GLY B 1 29  ? -17.158 8.285   -15.240 1.00 0.00 ? 29  GLY B HA3  3  
ATOM 9302  N N    . TRP B 1 30  ? -17.250 5.111   -14.929 1.00 0.00 ? 30  TRP B N    3  
ATOM 9303  C CA   . TRP B 1 30  ? -17.098 3.824   -15.659 1.00 0.00 ? 30  TRP B CA   3  
ATOM 9304  C C    . TRP B 1 30  ? -18.246 3.653   -16.652 1.00 0.00 ? 30  TRP B C    3  
ATOM 9305  O O    . TRP B 1 30  ? -19.405 3.743   -16.301 1.00 0.00 ? 30  TRP B O    3  
ATOM 9306  C CB   . TRP B 1 30  ? -17.117 2.671   -14.657 1.00 0.00 ? 30  TRP B CB   3  
ATOM 9307  C CG   . TRP B 1 30  ? -15.731 2.429   -14.154 1.00 0.00 ? 30  TRP B CG   3  
ATOM 9308  C CD1  . TRP B 1 30  ? -14.685 3.271   -14.320 1.00 0.00 ? 30  TRP B CD1  3  
ATOM 9309  C CD2  . TRP B 1 30  ? -15.222 1.286   -13.412 1.00 0.00 ? 30  TRP B CD2  3  
ATOM 9310  N NE1  . TRP B 1 30  ? -13.566 2.714   -13.728 1.00 0.00 ? 30  TRP B NE1  3  
ATOM 9311  C CE2  . TRP B 1 30  ? -13.846 1.491   -13.155 1.00 0.00 ? 30  TRP B CE2  3  
ATOM 9312  C CE3  . TRP B 1 30  ? -15.815 0.101   -12.944 1.00 0.00 ? 30  TRP B CE3  3  
ATOM 9313  C CZ2  . TRP B 1 30  ? -13.085 0.553   -12.457 1.00 0.00 ? 30  TRP B CZ2  3  
ATOM 9314  C CZ3  . TRP B 1 30  ? -15.052 -0.844  -12.240 1.00 0.00 ? 30  TRP B CZ3  3  
ATOM 9315  C CH2  . TRP B 1 30  ? -13.690 -0.619  -11.998 1.00 0.00 ? 30  TRP B CH2  3  
ATOM 9316  H H    . TRP B 1 30  ? -17.110 5.138   -13.961 1.00 0.00 ? 30  TRP B H    3  
ATOM 9317  H HA   . TRP B 1 30  ? -16.158 3.819   -16.192 1.00 0.00 ? 30  TRP B HA   3  
ATOM 9318  H HB2  . TRP B 1 30  ? -17.762 2.925   -13.828 1.00 0.00 ? 30  TRP B HB2  3  
ATOM 9319  H HB3  . TRP B 1 30  ? -17.486 1.779   -15.140 1.00 0.00 ? 30  TRP B HB3  3  
ATOM 9320  H HD1  . TRP B 1 30  ? -14.719 4.221   -14.832 1.00 0.00 ? 30  TRP B HD1  3  
ATOM 9321  H HE1  . TRP B 1 30  ? -12.675 3.123   -13.708 1.00 0.00 ? 30  TRP B HE1  3  
ATOM 9322  H HE3  . TRP B 1 30  ? -16.865 -0.082  -13.125 1.00 0.00 ? 30  TRP B HE3  3  
ATOM 9323  H HZ2  . TRP B 1 30  ? -12.035 0.732   -12.273 1.00 0.00 ? 30  TRP B HZ2  3  
ATOM 9324  H HZ3  . TRP B 1 30  ? -15.516 -1.752  -11.888 1.00 0.00 ? 30  TRP B HZ3  3  
ATOM 9325  H HH2  . TRP B 1 30  ? -13.109 -1.351  -11.457 1.00 0.00 ? 30  TRP B HH2  3  
ATOM 9326  N N    . LYS B 1 31  ? -17.928 3.410   -17.892 1.00 0.00 ? 31  LYS B N    3  
ATOM 9327  C CA   . LYS B 1 31  ? -18.980 3.235   -18.917 1.00 0.00 ? 31  LYS B CA   3  
ATOM 9328  C C    . LYS B 1 31  ? -19.099 1.755   -19.281 1.00 0.00 ? 31  LYS B C    3  
ATOM 9329  O O    . LYS B 1 31  ? -20.020 1.347   -19.961 1.00 0.00 ? 31  LYS B O    3  
ATOM 9330  C CB   . LYS B 1 31  ? -18.573 4.021   -20.155 1.00 0.00 ? 31  LYS B CB   3  
ATOM 9331  C CG   . LYS B 1 31  ? -19.143 5.439   -20.083 1.00 0.00 ? 31  LYS B CG   3  
ATOM 9332  C CD   . LYS B 1 31  ? -19.110 6.071   -21.477 1.00 0.00 ? 31  LYS B CD   3  
ATOM 9333  C CE   . LYS B 1 31  ? -19.186 7.594   -21.358 1.00 0.00 ? 31  LYS B CE   3  
ATOM 9334  N NZ   . LYS B 1 31  ? -18.339 8.052   -20.220 1.00 0.00 ? 31  LYS B NZ   3  
ATOM 9335  H H    . LYS B 1 31  ? -16.989 3.347   -18.155 1.00 0.00 ? 31  LYS B H    3  
ATOM 9336  H HA   . LYS B 1 31  ? -19.924 3.602   -18.545 1.00 0.00 ? 31  LYS B HA   3  
ATOM 9337  H HB2  . LYS B 1 31  ? -17.495 4.067   -20.204 1.00 0.00 ? 31  LYS B HB2  3  
ATOM 9338  H HB3  . LYS B 1 31  ? -18.948 3.525   -21.028 1.00 0.00 ? 31  LYS B HB3  3  
ATOM 9339  H HG2  . LYS B 1 31  ? -20.161 5.400   -19.726 1.00 0.00 ? 31  LYS B HG2  3  
ATOM 9340  H HG3  . LYS B 1 31  ? -18.546 6.032   -19.406 1.00 0.00 ? 31  LYS B HG3  3  
ATOM 9341  H HD2  . LYS B 1 31  ? -18.192 5.794   -21.974 1.00 0.00 ? 31  LYS B HD2  3  
ATOM 9342  H HD3  . LYS B 1 31  ? -19.952 5.715   -22.052 1.00 0.00 ? 31  LYS B HD3  3  
ATOM 9343  H HE2  . LYS B 1 31  ? -18.830 8.044   -22.273 1.00 0.00 ? 31  LYS B HE2  3  
ATOM 9344  H HE3  . LYS B 1 31  ? -20.210 7.891   -21.186 1.00 0.00 ? 31  LYS B HE3  3  
ATOM 9345  H HZ1  . LYS B 1 31  ? -17.508 7.432   -20.136 1.00 0.00 ? 31  LYS B HZ1  3  
ATOM 9346  H HZ2  . LYS B 1 31  ? -18.029 9.030   -20.391 1.00 0.00 ? 31  LYS B HZ2  3  
ATOM 9347  H HZ3  . LYS B 1 31  ? -18.890 8.010   -19.340 1.00 0.00 ? 31  LYS B HZ3  3  
ATOM 9348  N N    . TRP B 1 32  ? -18.169 0.949   -18.848 1.00 0.00 ? 32  TRP B N    3  
ATOM 9349  C CA   . TRP B 1 32  ? -18.233 -0.499  -19.192 1.00 0.00 ? 32  TRP B CA   3  
ATOM 9350  C C    . TRP B 1 32  ? -19.085 -1.246  -18.168 1.00 0.00 ? 32  TRP B C    3  
ATOM 9351  O O    . TRP B 1 32  ? -19.279 -2.437  -18.273 1.00 0.00 ? 32  TRP B O    3  
ATOM 9352  C CB   . TRP B 1 32  ? -16.821 -1.089  -19.217 1.00 0.00 ? 32  TRP B CB   3  
ATOM 9353  C CG   . TRP B 1 32  ? -16.318 -1.293  -17.821 1.00 0.00 ? 32  TRP B CG   3  
ATOM 9354  C CD1  . TRP B 1 32  ? -15.819 -0.322  -17.025 1.00 0.00 ? 32  TRP B CD1  3  
ATOM 9355  C CD2  . TRP B 1 32  ? -16.257 -2.526  -17.045 1.00 0.00 ? 32  TRP B CD2  3  
ATOM 9356  N NE1  . TRP B 1 32  ? -15.440 -0.879  -15.822 1.00 0.00 ? 32  TRP B NE1  3  
ATOM 9357  C CE2  . TRP B 1 32  ? -15.691 -2.234  -15.782 1.00 0.00 ? 32  TRP B CE2  3  
ATOM 9358  C CE3  . TRP B 1 32  ? -16.630 -3.854  -17.310 1.00 0.00 ? 32  TRP B CE3  3  
ATOM 9359  C CZ2  . TRP B 1 32  ? -15.499 -3.226  -14.820 1.00 0.00 ? 32  TRP B CZ2  3  
ATOM 9360  C CZ3  . TRP B 1 32  ? -16.442 -4.856  -16.345 1.00 0.00 ? 32  TRP B CZ3  3  
ATOM 9361  C CH2  . TRP B 1 32  ? -15.874 -4.542  -15.101 1.00 0.00 ? 32  TRP B CH2  3  
ATOM 9362  H H    . TRP B 1 32  ? -17.425 1.296   -18.308 1.00 0.00 ? 32  TRP B H    3  
ATOM 9363  H HA   . TRP B 1 32  ? -18.678 -0.608  -20.168 1.00 0.00 ? 32  TRP B HA   3  
ATOM 9364  H HB2  . TRP B 1 32  ? -16.839 -2.038  -19.731 1.00 0.00 ? 32  TRP B HB2  3  
ATOM 9365  H HB3  . TRP B 1 32  ? -16.160 -0.412  -19.738 1.00 0.00 ? 32  TRP B HB3  3  
ATOM 9366  H HD1  . TRP B 1 32  ? -15.728 0.717   -17.288 1.00 0.00 ? 32  TRP B HD1  3  
ATOM 9367  H HE1  . TRP B 1 32  ? -15.042 -0.387  -15.078 1.00 0.00 ? 32  TRP B HE1  3  
ATOM 9368  H HE3  . TRP B 1 32  ? -17.074 -4.103  -18.259 1.00 0.00 ? 32  TRP B HE3  3  
ATOM 9369  H HZ2  . TRP B 1 32  ? -15.061 -2.979  -13.863 1.00 0.00 ? 32  TRP B HZ2  3  
ATOM 9370  H HZ3  . TRP B 1 32  ? -16.733 -5.875  -16.564 1.00 0.00 ? 32  TRP B HZ3  3  
ATOM 9371  H HH2  . TRP B 1 32  ? -15.732 -5.312  -14.359 1.00 0.00 ? 32  TRP B HH2  3  
ATOM 9372  N N    . ILE B 1 33  ? -19.593 -0.564  -17.181 1.00 0.00 ? 33  ILE B N    3  
ATOM 9373  C CA   . ILE B 1 33  ? -20.430 -1.254  -16.161 1.00 0.00 ? 33  ILE B CA   3  
ATOM 9374  C C    . ILE B 1 33  ? -21.783 -0.545  -16.044 1.00 0.00 ? 33  ILE B C    3  
ATOM 9375  O O    . ILE B 1 33  ? -21.858 0.659   -15.895 1.00 0.00 ? 33  ILE B O    3  
ATOM 9376  C CB   . ILE B 1 33  ? -19.699 -1.240  -14.812 1.00 0.00 ? 33  ILE B CB   3  
ATOM 9377  C CG1  . ILE B 1 33  ? -18.704 -2.399  -14.780 1.00 0.00 ? 33  ILE B CG1  3  
ATOM 9378  C CG2  . ILE B 1 33  ? -20.697 -1.405  -13.661 1.00 0.00 ? 33  ILE B CG2  3  
ATOM 9379  C CD1  . ILE B 1 33  ? -17.866 -2.323  -13.507 1.00 0.00 ? 33  ILE B CD1  3  
ATOM 9380  H H    . ILE B 1 33  ? -19.425 0.399   -17.110 1.00 0.00 ? 33  ILE B H    3  
ATOM 9381  H HA   . ILE B 1 33  ? -20.588 -2.278  -16.470 1.00 0.00 ? 33  ILE B HA   3  
ATOM 9382  H HB   . ILE B 1 33  ? -19.168 -0.308  -14.699 1.00 0.00 ? 33  ILE B HB   3  
ATOM 9383  H HG12 . ILE B 1 33  ? -19.243 -3.332  -14.799 1.00 0.00 ? 33  ILE B HG12 3  
ATOM 9384  H HG13 . ILE B 1 33  ? -18.059 -2.338  -15.638 1.00 0.00 ? 33  ILE B HG13 3  
ATOM 9385  H HG21 . ILE B 1 33  ? -21.434 -0.616  -13.709 1.00 0.00 ? 33  ILE B HG21 3  
ATOM 9386  H HG22 . ILE B 1 33  ? -21.188 -2.362  -13.744 1.00 0.00 ? 33  ILE B HG22 3  
ATOM 9387  H HG23 . ILE B 1 33  ? -20.172 -1.350  -12.718 1.00 0.00 ? 33  ILE B HG23 3  
ATOM 9388  H HD11 . ILE B 1 33  ? -18.418 -1.799  -12.744 1.00 0.00 ? 33  ILE B HD11 3  
ATOM 9389  H HD12 . ILE B 1 33  ? -17.637 -3.322  -13.166 1.00 0.00 ? 33  ILE B HD12 3  
ATOM 9390  H HD13 . ILE B 1 33  ? -16.949 -1.796  -13.714 1.00 0.00 ? 33  ILE B HD13 3  
ATOM 9391  N N    . HIS B 1 34  ? -22.851 -1.290  -16.106 1.00 0.00 ? 34  HIS B N    3  
ATOM 9392  C CA   . HIS B 1 34  ? -24.204 -0.679  -15.996 1.00 0.00 ? 34  HIS B CA   3  
ATOM 9393  C C    . HIS B 1 34  ? -24.676 -0.757  -14.539 1.00 0.00 ? 34  HIS B C    3  
ATOM 9394  O O    . HIS B 1 34  ? -25.061 0.231   -13.947 1.00 0.00 ? 34  HIS B O    3  
ATOM 9395  C CB   . HIS B 1 34  ? -25.176 -1.445  -16.902 1.00 0.00 ? 34  HIS B CB   3  
ATOM 9396  C CG   . HIS B 1 34  ? -26.598 -1.132  -16.516 1.00 0.00 ? 34  HIS B CG   3  
ATOM 9397  N ND1  . HIS B 1 34  ? -27.097 0.161   -16.509 1.00 0.00 ? 34  HIS B ND1  3  
ATOM 9398  C CD2  . HIS B 1 34  ? -27.638 -1.939  -16.122 1.00 0.00 ? 34  HIS B CD2  3  
ATOM 9399  C CE1  . HIS B 1 34  ? -28.385 0.096   -16.123 1.00 0.00 ? 34  HIS B CE1  3  
ATOM 9400  N NE2  . HIS B 1 34  ? -28.765 -1.161  -15.874 1.00 0.00 ? 34  HIS B NE2  3  
ATOM 9401  H H    . HIS B 1 34  ? -22.761 -2.257  -16.224 1.00 0.00 ? 34  HIS B H    3  
ATOM 9402  H HA   . HIS B 1 34  ? -24.160 0.355   -16.305 1.00 0.00 ? 34  HIS B HA   3  
ATOM 9403  H HB2  . HIS B 1 34  ? -25.013 -1.154  -17.929 1.00 0.00 ? 34  HIS B HB2  3  
ATOM 9404  H HB3  . HIS B 1 34  ? -25.001 -2.506  -16.797 1.00 0.00 ? 34  HIS B HB3  3  
ATOM 9405  H HD1  . HIS B 1 34  ? -26.602 0.974   -16.742 1.00 0.00 ? 34  HIS B HD1  3  
ATOM 9406  H HD2  . HIS B 1 34  ? -27.587 -3.013  -16.021 1.00 0.00 ? 34  HIS B HD2  3  
ATOM 9407  H HE1  . HIS B 1 34  ? -29.032 0.954   -16.026 1.00 0.00 ? 34  HIS B HE1  3  
ATOM 9408  N N    . GLU B 1 35  ? -24.647 -1.927  -13.958 1.00 0.00 ? 35  GLU B N    3  
ATOM 9409  C CA   . GLU B 1 35  ? -25.091 -2.067  -12.542 1.00 0.00 ? 35  GLU B CA   3  
ATOM 9410  C C    . GLU B 1 35  ? -24.021 -2.822  -11.746 1.00 0.00 ? 35  GLU B C    3  
ATOM 9411  O O    . GLU B 1 35  ? -23.276 -3.603  -12.301 1.00 0.00 ? 35  GLU B O    3  
ATOM 9412  C CB   . GLU B 1 35  ? -26.408 -2.844  -12.495 1.00 0.00 ? 35  GLU B CB   3  
ATOM 9413  C CG   . GLU B 1 35  ? -27.581 -1.874  -12.641 1.00 0.00 ? 35  GLU B CG   3  
ATOM 9414  C CD   . GLU B 1 35  ? -28.748 -2.347  -11.771 1.00 0.00 ? 35  GLU B CD   3  
ATOM 9415  O OE1  . GLU B 1 35  ? -28.882 -3.547  -11.597 1.00 0.00 ? 35  GLU B OE1  3  
ATOM 9416  O OE2  . GLU B 1 35  ? -29.488 -1.502  -11.296 1.00 0.00 ? 35  GLU B OE2  3  
ATOM 9417  H H    . GLU B 1 35  ? -24.332 -2.712  -14.453 1.00 0.00 ? 35  GLU B H    3  
ATOM 9418  H HA   . GLU B 1 35  ? -25.235 -1.087  -12.112 1.00 0.00 ? 35  GLU B HA   3  
ATOM 9419  H HB2  . GLU B 1 35  ? -26.431 -3.563  -13.301 1.00 0.00 ? 35  GLU B HB2  3  
ATOM 9420  H HB3  . GLU B 1 35  ? -26.487 -3.361  -11.549 1.00 0.00 ? 35  GLU B HB3  3  
ATOM 9421  H HG2  . GLU B 1 35  ? -27.273 -0.887  -12.326 1.00 0.00 ? 35  GLU B HG2  3  
ATOM 9422  H HG3  . GLU B 1 35  ? -27.895 -1.841  -13.674 1.00 0.00 ? 35  GLU B HG3  3  
ATOM 9423  N N    . PRO B 1 36  ? -23.979 -2.563  -10.464 1.00 0.00 ? 36  PRO B N    3  
ATOM 9424  C CA   . PRO B 1 36  ? -24.891 -1.611  -9.803  1.00 0.00 ? 36  PRO B CA   3  
ATOM 9425  C C    . PRO B 1 36  ? -24.450 -0.172  -10.075 1.00 0.00 ? 36  PRO B C    3  
ATOM 9426  O O    . PRO B 1 36  ? -23.408 0.072   -10.649 1.00 0.00 ? 36  PRO B O    3  
ATOM 9427  C CB   . PRO B 1 36  ? -24.751 -1.954  -8.317  1.00 0.00 ? 36  PRO B CB   3  
ATOM 9428  C CG   . PRO B 1 36  ? -23.386 -2.666  -8.161  1.00 0.00 ? 36  PRO B CG   3  
ATOM 9429  C CD   . PRO B 1 36  ? -23.008 -3.202  -9.554  1.00 0.00 ? 36  PRO B CD   3  
ATOM 9430  H HA   . PRO B 1 36  ? -25.906 -1.766  -10.123 1.00 0.00 ? 36  PRO B HA   3  
ATOM 9431  H HB2  . PRO B 1 36  ? -24.772 -1.048  -7.725  1.00 0.00 ? 36  PRO B HB2  3  
ATOM 9432  H HB3  . PRO B 1 36  ? -25.545 -2.617  -8.012  1.00 0.00 ? 36  PRO B HB3  3  
ATOM 9433  H HG2  . PRO B 1 36  ? -22.641 -1.962  -7.816  1.00 0.00 ? 36  PRO B HG2  3  
ATOM 9434  H HG3  . PRO B 1 36  ? -23.473 -3.486  -7.466  1.00 0.00 ? 36  PRO B HG3  3  
ATOM 9435  H HD2  . PRO B 1 36  ? -21.998 -2.910  -9.809  1.00 0.00 ? 36  PRO B HD2  3  
ATOM 9436  H HD3  . PRO B 1 36  ? -23.115 -4.275  -9.590  1.00 0.00 ? 36  PRO B HD3  3  
ATOM 9437  N N    . LYS B 1 37  ? -25.236 0.782   -9.660  1.00 0.00 ? 37  LYS B N    3  
ATOM 9438  C CA   . LYS B 1 37  ? -24.872 2.199   -9.882  1.00 0.00 ? 37  LYS B CA   3  
ATOM 9439  C C    . LYS B 1 37  ? -23.552 2.498   -9.174  1.00 0.00 ? 37  LYS B C    3  
ATOM 9440  O O    . LYS B 1 37  ? -22.733 3.258   -9.651  1.00 0.00 ? 37  LYS B O    3  
ATOM 9441  C CB   . LYS B 1 37  ? -25.971 3.072   -9.293  1.00 0.00 ? 37  LYS B CB   3  
ATOM 9442  C CG   . LYS B 1 37  ? -27.025 3.367   -10.363 1.00 0.00 ? 37  LYS B CG   3  
ATOM 9443  C CD   . LYS B 1 37  ? -27.385 4.854   -10.331 1.00 0.00 ? 37  LYS B CD   3  
ATOM 9444  C CE   . LYS B 1 37  ? -28.899 5.015   -10.469 1.00 0.00 ? 37  LYS B CE   3  
ATOM 9445  N NZ   . LYS B 1 37  ? -29.327 6.273   -9.793  1.00 0.00 ? 37  LYS B NZ   3  
ATOM 9446  H H    . LYS B 1 37  ? -26.067 0.567   -9.195  1.00 0.00 ? 37  LYS B H    3  
ATOM 9447  H HA   . LYS B 1 37  ? -24.776 2.395   -10.939 1.00 0.00 ? 37  LYS B HA   3  
ATOM 9448  H HB2  . LYS B 1 37  ? -26.433 2.551   -8.467  1.00 0.00 ? 37  LYS B HB2  3  
ATOM 9449  H HB3  . LYS B 1 37  ? -25.546 3.989   -8.942  1.00 0.00 ? 37  LYS B HB3  3  
ATOM 9450  H HG2  . LYS B 1 37  ? -26.630 3.112   -11.336 1.00 0.00 ? 37  LYS B HG2  3  
ATOM 9451  H HG3  . LYS B 1 37  ? -27.910 2.779   -10.169 1.00 0.00 ? 37  LYS B HG3  3  
ATOM 9452  H HD2  . LYS B 1 37  ? -27.060 5.282   -9.393  1.00 0.00 ? 37  LYS B HD2  3  
ATOM 9453  H HD3  . LYS B 1 37  ? -26.895 5.362   -11.147 1.00 0.00 ? 37  LYS B HD3  3  
ATOM 9454  H HE2  . LYS B 1 37  ? -29.163 5.059   -11.515 1.00 0.00 ? 37  LYS B HE2  3  
ATOM 9455  H HE3  . LYS B 1 37  ? -29.395 4.173   -10.008 1.00 0.00 ? 37  LYS B HE3  3  
ATOM 9456  H HZ1  . LYS B 1 37  ? -28.822 6.371   -8.890  1.00 0.00 ? 37  LYS B HZ1  3  
ATOM 9457  H HZ2  . LYS B 1 37  ? -29.104 7.086   -10.402 1.00 0.00 ? 37  LYS B HZ2  3  
ATOM 9458  H HZ3  . LYS B 1 37  ? -30.352 6.240   -9.618  1.00 0.00 ? 37  LYS B HZ3  3  
ATOM 9459  N N    . GLY B 1 38  ? -23.344 1.901   -8.036  1.00 0.00 ? 38  GLY B N    3  
ATOM 9460  C CA   . GLY B 1 38  ? -22.079 2.143   -7.285  1.00 0.00 ? 38  GLY B CA   3  
ATOM 9461  C C    . GLY B 1 38  ? -21.906 1.071   -6.209  1.00 0.00 ? 38  GLY B C    3  
ATOM 9462  O O    . GLY B 1 38  ? -22.434 -0.018  -6.315  1.00 0.00 ? 38  GLY B O    3  
ATOM 9463  H H    . GLY B 1 38  ? -24.022 1.293   -7.676  1.00 0.00 ? 38  GLY B H    3  
ATOM 9464  H HA2  . GLY B 1 38  ? -21.243 2.108   -7.969  1.00 0.00 ? 38  GLY B HA2  3  
ATOM 9465  H HA3  . GLY B 1 38  ? -22.120 3.114   -6.816  1.00 0.00 ? 38  GLY B HA3  3  
ATOM 9466  N N    . TYR B 1 39  ? -21.168 1.369   -5.175  1.00 0.00 ? 39  TYR B N    3  
ATOM 9467  C CA   . TYR B 1 39  ? -20.961 0.365   -4.096  1.00 0.00 ? 39  TYR B CA   3  
ATOM 9468  C C    . TYR B 1 39  ? -20.067 0.962   -3.006  1.00 0.00 ? 39  TYR B C    3  
ATOM 9469  O O    . TYR B 1 39  ? -19.576 2.066   -3.129  1.00 0.00 ? 39  TYR B O    3  
ATOM 9470  C CB   . TYR B 1 39  ? -20.295 -0.882  -4.685  1.00 0.00 ? 39  TYR B CB   3  
ATOM 9471  C CG   . TYR B 1 39  ? -18.840 -0.596  -4.979  1.00 0.00 ? 39  TYR B CG   3  
ATOM 9472  C CD1  . TYR B 1 39  ? -18.488 0.300   -5.998  1.00 0.00 ? 39  TYR B CD1  3  
ATOM 9473  C CD2  . TYR B 1 39  ? -17.842 -1.231  -4.233  1.00 0.00 ? 39  TYR B CD2  3  
ATOM 9474  C CE1  . TYR B 1 39  ? -17.138 0.558   -6.267  1.00 0.00 ? 39  TYR B CE1  3  
ATOM 9475  C CE2  . TYR B 1 39  ? -16.494 -0.972  -4.502  1.00 0.00 ? 39  TYR B CE2  3  
ATOM 9476  C CZ   . TYR B 1 39  ? -16.142 -0.079  -5.519  1.00 0.00 ? 39  TYR B CZ   3  
ATOM 9477  O OH   . TYR B 1 39  ? -14.811 0.176   -5.784  1.00 0.00 ? 39  TYR B OH   3  
ATOM 9478  H H    . TYR B 1 39  ? -20.750 2.253   -5.110  1.00 0.00 ? 39  TYR B H    3  
ATOM 9479  H HA   . TYR B 1 39  ? -21.915 0.093   -3.669  1.00 0.00 ? 39  TYR B HA   3  
ATOM 9480  H HB2  . TYR B 1 39  ? -20.365 -1.695  -3.978  1.00 0.00 ? 39  TYR B HB2  3  
ATOM 9481  H HB3  . TYR B 1 39  ? -20.797 -1.159  -5.601  1.00 0.00 ? 39  TYR B HB3  3  
ATOM 9482  H HD1  . TYR B 1 39  ? -19.256 0.792   -6.576  1.00 0.00 ? 39  TYR B HD1  3  
ATOM 9483  H HD2  . TYR B 1 39  ? -18.112 -1.921  -3.447  1.00 0.00 ? 39  TYR B HD2  3  
ATOM 9484  H HE1  . TYR B 1 39  ? -16.867 1.249   -7.052  1.00 0.00 ? 39  TYR B HE1  3  
ATOM 9485  H HE2  . TYR B 1 39  ? -15.726 -1.464  -3.925  1.00 0.00 ? 39  TYR B HE2  3  
ATOM 9486  H HH   . TYR B 1 39  ? -14.752 1.035   -6.210  1.00 0.00 ? 39  TYR B HH   3  
ATOM 9487  N N    . HIS B 1 40  ? -19.848 0.241   -1.939  1.00 0.00 ? 40  HIS B N    3  
ATOM 9488  C CA   . HIS B 1 40  ? -18.983 0.770   -0.848  1.00 0.00 ? 40  HIS B CA   3  
ATOM 9489  C C    . HIS B 1 40  ? -17.531 0.384   -1.130  1.00 0.00 ? 40  HIS B C    3  
ATOM 9490  O O    . HIS B 1 40  ? -17.016 -0.574  -0.588  1.00 0.00 ? 40  HIS B O    3  
ATOM 9491  C CB   . HIS B 1 40  ? -19.422 0.169   0.490   1.00 0.00 ? 40  HIS B CB   3  
ATOM 9492  C CG   . HIS B 1 40  ? -20.896 0.401   0.684   1.00 0.00 ? 40  HIS B CG   3  
ATOM 9493  N ND1  . HIS B 1 40  ? -21.855 -0.301  -0.028  1.00 0.00 ? 40  HIS B ND1  3  
ATOM 9494  C CD2  . HIS B 1 40  ? -21.589 1.255   1.505   1.00 0.00 ? 40  HIS B CD2  3  
ATOM 9495  C CE1  . HIS B 1 40  ? -23.061 0.139   0.375   1.00 0.00 ? 40  HIS B CE1  3  
ATOM 9496  N NE2  . HIS B 1 40  ? -22.956 1.088   1.308   1.00 0.00 ? 40  HIS B NE2  3  
ATOM 9497  H H    . HIS B 1 40  ? -20.250 -0.650  -1.858  1.00 0.00 ? 40  HIS B H    3  
ATOM 9498  H HA   . HIS B 1 40  ? -19.072 1.846   -0.807  1.00 0.00 ? 40  HIS B HA   3  
ATOM 9499  H HB2  . HIS B 1 40  ? -19.221 -0.892  0.491   1.00 0.00 ? 40  HIS B HB2  3  
ATOM 9500  H HB3  . HIS B 1 40  ? -18.875 0.640   1.292   1.00 0.00 ? 40  HIS B HB3  3  
ATOM 9501  H HD1  . HIS B 1 40  ? -21.686 -0.993  -0.701  1.00 0.00 ? 40  HIS B HD1  3  
ATOM 9502  H HD2  . HIS B 1 40  ? -21.141 1.952   2.199   1.00 0.00 ? 40  HIS B HD2  3  
ATOM 9503  H HE1  . HIS B 1 40  ? -24.001 -0.231  -0.010  1.00 0.00 ? 40  HIS B HE1  3  
ATOM 9504  N N    . ALA B 1 41  ? -16.869 1.117   -1.983  1.00 0.00 ? 41  ALA B N    3  
ATOM 9505  C CA   . ALA B 1 41  ? -15.453 0.785   -2.308  1.00 0.00 ? 41  ALA B CA   3  
ATOM 9506  C C    . ALA B 1 41  ? -14.559 1.068   -1.104  1.00 0.00 ? 41  ALA B C    3  
ATOM 9507  O O    . ALA B 1 41  ? -13.511 0.473   -0.951  1.00 0.00 ? 41  ALA B O    3  
ATOM 9508  C CB   . ALA B 1 41  ? -14.981 1.636   -3.490  1.00 0.00 ? 41  ALA B CB   3  
ATOM 9509  H H    . ALA B 1 41  ? -17.305 1.881   -2.415  1.00 0.00 ? 41  ALA B H    3  
ATOM 9510  H HA   . ALA B 1 41  ? -15.383 -0.260  -2.568  1.00 0.00 ? 41  ALA B HA   3  
ATOM 9511  H HB1  . ALA B 1 41  ? -15.805 1.804   -4.166  1.00 0.00 ? 41  ALA B HB1  3  
ATOM 9512  H HB2  . ALA B 1 41  ? -14.613 2.585   -3.125  1.00 0.00 ? 41  ALA B HB2  3  
ATOM 9513  H HB3  . ALA B 1 41  ? -14.187 1.120   -4.010  1.00 0.00 ? 41  ALA B HB3  3  
ATOM 9514  N N    . ASN B 1 42  ? -14.944 1.980   -0.255  1.00 0.00 ? 42  ASN B N    3  
ATOM 9515  C CA   . ASN B 1 42  ? -14.081 2.292   0.915   1.00 0.00 ? 42  ASN B CA   3  
ATOM 9516  C C    . ASN B 1 42  ? -12.680 2.602   0.394   1.00 0.00 ? 42  ASN B C    3  
ATOM 9517  O O    . ASN B 1 42  ? -12.426 2.521   -0.791  1.00 0.00 ? 42  ASN B O    3  
ATOM 9518  C CB   . ASN B 1 42  ? -14.021 1.079   1.847   1.00 0.00 ? 42  ASN B CB   3  
ATOM 9519  C CG   . ASN B 1 42  ? -15.098 1.210   2.925   1.00 0.00 ? 42  ASN B CG   3  
ATOM 9520  O OD1  . ASN B 1 42  ? -14.792 1.388   4.088   1.00 0.00 ? 42  ASN B OD1  3  
ATOM 9521  N ND2  . ASN B 1 42  ? -16.355 1.129   2.587   1.00 0.00 ? 42  ASN B ND2  3  
ATOM 9522  H H    . ASN B 1 42  ? -15.785 2.464   -0.393  1.00 0.00 ? 42  ASN B H    3  
ATOM 9523  H HA   . ASN B 1 42  ? -14.475 3.146   1.445   1.00 0.00 ? 42  ASN B HA   3  
ATOM 9524  H HB2  . ASN B 1 42  ? -14.188 0.178   1.275   1.00 0.00 ? 42  ASN B HB2  3  
ATOM 9525  H HB3  . ASN B 1 42  ? -13.048 1.032   2.314   1.00 0.00 ? 42  ASN B HB3  3  
ATOM 9526  H HD21 . ASN B 1 42  ? -16.602 0.985   1.649   1.00 0.00 ? 42  ASN B HD21 3  
ATOM 9527  H HD22 . ASN B 1 42  ? -17.054 1.213   3.270   1.00 0.00 ? 42  ASN B HD22 3  
ATOM 9528  N N    . PHE B 1 43  ? -11.764 2.954   1.247   1.00 0.00 ? 43  PHE B N    3  
ATOM 9529  C CA   . PHE B 1 43  ? -10.398 3.250   0.740   1.00 0.00 ? 43  PHE B CA   3  
ATOM 9530  C C    . PHE B 1 43  ? -9.443  3.525   1.899   1.00 0.00 ? 43  PHE B C    3  
ATOM 9531  O O    . PHE B 1 43  ? -9.778  4.193   2.858   1.00 0.00 ? 43  PHE B O    3  
ATOM 9532  C CB   . PHE B 1 43  ? -10.456 4.459   -0.203  1.00 0.00 ? 43  PHE B CB   3  
ATOM 9533  C CG   . PHE B 1 43  ? -10.432 5.745   0.581   1.00 0.00 ? 43  PHE B CG   3  
ATOM 9534  C CD1  . PHE B 1 43  ? -11.507 6.083   1.408   1.00 0.00 ? 43  PHE B CD1  3  
ATOM 9535  C CD2  . PHE B 1 43  ? -9.337  6.607   0.469   1.00 0.00 ? 43  PHE B CD2  3  
ATOM 9536  C CE1  . PHE B 1 43  ? -11.487 7.285   2.121   1.00 0.00 ? 43  PHE B CE1  3  
ATOM 9537  C CE2  . PHE B 1 43  ? -9.315  7.803   1.183   1.00 0.00 ? 43  PHE B CE2  3  
ATOM 9538  C CZ   . PHE B 1 43  ? -10.390 8.147   2.010   1.00 0.00 ? 43  PHE B CZ   3  
ATOM 9539  H H    . PHE B 1 43  ? -11.967 3.017   2.204   1.00 0.00 ? 43  PHE B H    3  
ATOM 9540  H HA   . PHE B 1 43  ? -10.039 2.393   0.192   1.00 0.00 ? 43  PHE B HA   3  
ATOM 9541  H HB2  . PHE B 1 43  ? -9.608  4.440   -0.865  1.00 0.00 ? 43  PHE B HB2  3  
ATOM 9542  H HB3  . PHE B 1 43  ? -11.365 4.415   -0.785  1.00 0.00 ? 43  PHE B HB3  3  
ATOM 9543  H HD1  . PHE B 1 43  ? -12.351 5.416   1.496   1.00 0.00 ? 43  PHE B HD1  3  
ATOM 9544  H HD2  . PHE B 1 43  ? -8.503  6.347   -0.167  1.00 0.00 ? 43  PHE B HD2  3  
ATOM 9545  H HE1  . PHE B 1 43  ? -12.317 7.549   2.758   1.00 0.00 ? 43  PHE B HE1  3  
ATOM 9546  H HE2  . PHE B 1 43  ? -8.472  8.460   1.095   1.00 0.00 ? 43  PHE B HE2  3  
ATOM 9547  H HZ   . PHE B 1 43  ? -10.374 9.075   2.560   1.00 0.00 ? 43  PHE B HZ   3  
ATOM 9548  N N    . CYS B 1 44  ? -8.248  3.017   1.806   1.00 0.00 ? 44  CYS B N    3  
ATOM 9549  C CA   . CYS B 1 44  ? -7.249  3.241   2.882   1.00 0.00 ? 44  CYS B CA   3  
ATOM 9550  C C    . CYS B 1 44  ? -6.342  4.392   2.447   1.00 0.00 ? 44  CYS B C    3  
ATOM 9551  O O    . CYS B 1 44  ? -5.743  4.348   1.391   1.00 0.00 ? 44  CYS B O    3  
ATOM 9552  C CB   . CYS B 1 44  ? -6.400  1.977   3.075   1.00 0.00 ? 44  CYS B CB   3  
ATOM 9553  S SG   . CYS B 1 44  ? -7.357  0.505   2.623   1.00 0.00 ? 44  CYS B SG   3  
ATOM 9554  H H    . CYS B 1 44  ? -8.004  2.487   1.017   1.00 0.00 ? 44  CYS B H    3  
ATOM 9555  H HA   . CYS B 1 44  ? -7.755  3.494   3.805   1.00 0.00 ? 44  CYS B HA   3  
ATOM 9556  H HB2  . CYS B 1 44  ? -5.521  2.036   2.452   1.00 0.00 ? 44  CYS B HB2  3  
ATOM 9557  H HB3  . CYS B 1 44  ? -6.101  1.904   4.109   1.00 0.00 ? 44  CYS B HB3  3  
ATOM 9558  N N    . LEU B 1 45  ? -6.242  5.434   3.225   1.00 0.00 ? 45  LEU B N    3  
ATOM 9559  C CA   . LEU B 1 45  ? -5.380  6.574   2.800   1.00 0.00 ? 45  LEU B CA   3  
ATOM 9560  C C    . LEU B 1 45  ? -3.896  6.194   2.863   1.00 0.00 ? 45  LEU B C    3  
ATOM 9561  O O    . LEU B 1 45  ? -3.548  5.034   2.882   1.00 0.00 ? 45  LEU B O    3  
ATOM 9562  C CB   . LEU B 1 45  ? -5.677  7.798   3.673   1.00 0.00 ? 45  LEU B CB   3  
ATOM 9563  C CG   . LEU B 1 45  ? -6.765  8.639   3.008   1.00 0.00 ? 45  LEU B CG   3  
ATOM 9564  C CD1  . LEU B 1 45  ? -7.003  9.907   3.829   1.00 0.00 ? 45  LEU B CD1  3  
ATOM 9565  C CD2  . LEU B 1 45  ? -6.313  9.021   1.597   1.00 0.00 ? 45  LEU B CD2  3  
ATOM 9566  H H    . LEU B 1 45  ? -6.742  5.474   4.073   1.00 0.00 ? 45  LEU B H    3  
ATOM 9567  H HA   . LEU B 1 45  ? -5.617  6.809   1.781   1.00 0.00 ? 45  LEU B HA   3  
ATOM 9568  H HB2  . LEU B 1 45  ? -6.023  7.472   4.639   1.00 0.00 ? 45  LEU B HB2  3  
ATOM 9569  H HB3  . LEU B 1 45  ? -4.788  8.393   3.786   1.00 0.00 ? 45  LEU B HB3  3  
ATOM 9570  H HG   . LEU B 1 45  ? -7.681  8.067   2.954   1.00 0.00 ? 45  LEU B HG   3  
ATOM 9571  H HD11 . LEU B 1 45  ? -6.121  10.130  4.411   1.00 0.00 ? 45  LEU B HD11 3  
ATOM 9572  H HD12 . LEU B 1 45  ? -7.212  10.733  3.164   1.00 0.00 ? 45  LEU B HD12 3  
ATOM 9573  H HD13 . LEU B 1 45  ? -7.843  9.757   4.490   1.00 0.00 ? 45  LEU B HD13 3  
ATOM 9574  H HD21 . LEU B 1 45  ? -5.243  9.166   1.588   1.00 0.00 ? 45  LEU B HD21 3  
ATOM 9575  H HD22 . LEU B 1 45  ? -6.574  8.229   0.910   1.00 0.00 ? 45  LEU B HD22 3  
ATOM 9576  H HD23 . LEU B 1 45  ? -6.804  9.934   1.296   1.00 0.00 ? 45  LEU B HD23 3  
ATOM 9577  N N    . GLY B 1 46  ? -3.015  7.160   2.829   1.00 0.00 ? 46  GLY B N    3  
ATOM 9578  C CA   . GLY B 1 46  ? -1.556  6.841   2.829   1.00 0.00 ? 46  GLY B CA   3  
ATOM 9579  C C    . GLY B 1 46  ? -0.822  7.184   4.156   1.00 0.00 ? 46  GLY B C    3  
ATOM 9580  O O    . GLY B 1 46  ? 0.302   6.754   4.322   1.00 0.00 ? 46  GLY B O    3  
ATOM 9581  H H    . GLY B 1 46  ? -3.312  8.088   2.753   1.00 0.00 ? 46  GLY B H    3  
ATOM 9582  H HA2  . GLY B 1 46  ? -1.436  5.785   2.639   1.00 0.00 ? 46  GLY B HA2  3  
ATOM 9583  H HA3  . GLY B 1 46  ? -1.086  7.388   2.025   1.00 0.00 ? 46  GLY B HA3  3  
ATOM 9584  N N    . PRO B 1 47  ? -1.416  7.940   5.065   1.00 0.00 ? 47  PRO B N    3  
ATOM 9585  C CA   . PRO B 1 47  ? -0.729  8.293   6.324   1.00 0.00 ? 47  PRO B CA   3  
ATOM 9586  C C    . PRO B 1 47  ? -0.707  7.107   7.286   1.00 0.00 ? 47  PRO B C    3  
ATOM 9587  O O    . PRO B 1 47  ? -1.731  6.611   7.709   1.00 0.00 ? 47  PRO B O    3  
ATOM 9588  C CB   . PRO B 1 47  ? -1.566  9.433   6.897   1.00 0.00 ? 47  PRO B CB   3  
ATOM 9589  C CG   . PRO B 1 47  ? -2.963  9.298   6.263   1.00 0.00 ? 47  PRO B CG   3  
ATOM 9590  C CD   . PRO B 1 47  ? -2.775  8.502   4.959   1.00 0.00 ? 47  PRO B CD   3  
ATOM 9591  H HA   . PRO B 1 47  ? 0.272   8.639   6.126   1.00 0.00 ? 47  PRO B HA   3  
ATOM 9592  H HB2  . PRO B 1 47  ? -1.630  9.341   7.973   1.00 0.00 ? 47  PRO B HB2  3  
ATOM 9593  H HB3  . PRO B 1 47  ? -1.134  10.384  6.628   1.00 0.00 ? 47  PRO B HB3  3  
ATOM 9594  H HG2  . PRO B 1 47  ? -3.620  8.764   6.935   1.00 0.00 ? 47  PRO B HG2  3  
ATOM 9595  H HG3  . PRO B 1 47  ? -3.365  10.272  6.041   1.00 0.00 ? 47  PRO B HG3  3  
ATOM 9596  H HD2  . PRO B 1 47  ? -3.508  7.711   4.893   1.00 0.00 ? 47  PRO B HD2  3  
ATOM 9597  H HD3  . PRO B 1 47  ? -2.840  9.160   4.107   1.00 0.00 ? 47  PRO B HD3  3  
ATOM 9598  N N    . CYS B 1 48  ? 0.462   6.663   7.638   1.00 0.00 ? 48  CYS B N    3  
ATOM 9599  C CA   . CYS B 1 48  ? 0.586   5.519   8.583   1.00 0.00 ? 48  CYS B CA   3  
ATOM 9600  C C    . CYS B 1 48  ? 1.834   5.725   9.451   1.00 0.00 ? 48  CYS B C    3  
ATOM 9601  O O    . CYS B 1 48  ? 2.936   5.732   8.941   1.00 0.00 ? 48  CYS B O    3  
ATOM 9602  C CB   . CYS B 1 48  ? 0.725   4.213   7.794   1.00 0.00 ? 48  CYS B CB   3  
ATOM 9603  S SG   . CYS B 1 48  ? 0.959   2.832   8.942   1.00 0.00 ? 48  CYS B SG   3  
ATOM 9604  H H    . CYS B 1 48  ? 1.264   7.095   7.284   1.00 0.00 ? 48  CYS B H    3  
ATOM 9605  H HA   . CYS B 1 48  ? -0.294  5.471   9.205   1.00 0.00 ? 48  CYS B HA   3  
ATOM 9606  H HB2  . CYS B 1 48  ? -0.169  4.047   7.212   1.00 0.00 ? 48  CYS B HB2  3  
ATOM 9607  H HB3  . CYS B 1 48  ? 1.576   4.278   7.134   1.00 0.00 ? 48  CYS B HB3  3  
ATOM 9608  N N    . PRO B 1 49  ? 1.635   5.886   10.735  1.00 0.00 ? 49  PRO B N    3  
ATOM 9609  C CA   . PRO B 1 49  ? 2.746   6.091   11.679  1.00 0.00 ? 49  PRO B CA   3  
ATOM 9610  C C    . PRO B 1 49  ? 3.491   4.771   11.913  1.00 0.00 ? 49  PRO B C    3  
ATOM 9611  O O    . PRO B 1 49  ? 3.497   3.900   11.066  1.00 0.00 ? 49  PRO B O    3  
ATOM 9612  C CB   . PRO B 1 49  ? 2.054   6.608   12.946  1.00 0.00 ? 49  PRO B CB   3  
ATOM 9613  C CG   . PRO B 1 49  ? 0.577   6.166   12.852  1.00 0.00 ? 49  PRO B CG   3  
ATOM 9614  C CD   . PRO B 1 49  ? 0.299   5.873   11.365  1.00 0.00 ? 49  PRO B CD   3  
ATOM 9615  H HA   . PRO B 1 49  ? 3.423   6.840   11.301  1.00 0.00 ? 49  PRO B HA   3  
ATOM 9616  H HB2  . PRO B 1 49  ? 2.517   6.181   13.824  1.00 0.00 ? 49  PRO B HB2  3  
ATOM 9617  H HB3  . PRO B 1 49  ? 2.108   7.685   12.984  1.00 0.00 ? 49  PRO B HB3  3  
ATOM 9618  H HG2  . PRO B 1 49  ? 0.419   5.279   13.446  1.00 0.00 ? 49  PRO B HG2  3  
ATOM 9619  H HG3  . PRO B 1 49  ? -0.070  6.958   13.193  1.00 0.00 ? 49  PRO B HG3  3  
ATOM 9620  H HD2  . PRO B 1 49  ? -0.167  4.905   11.251  1.00 0.00 ? 49  PRO B HD2  3  
ATOM 9621  H HD3  . PRO B 1 49  ? -0.321  6.647   10.937  1.00 0.00 ? 49  PRO B HD3  3  
ATOM 9622  N N    . TYR B 1 50  ? 4.138   4.615   13.036  1.00 0.00 ? 50  TYR B N    3  
ATOM 9623  C CA   . TYR B 1 50  ? 4.895   3.348   13.277  1.00 0.00 ? 50  TYR B CA   3  
ATOM 9624  C C    . TYR B 1 50  ? 4.073   2.387   14.140  1.00 0.00 ? 50  TYR B C    3  
ATOM 9625  O O    . TYR B 1 50  ? 3.411   1.503   13.634  1.00 0.00 ? 50  TYR B O    3  
ATOM 9626  C CB   . TYR B 1 50  ? 6.233   3.636   13.982  1.00 0.00 ? 50  TYR B CB   3  
ATOM 9627  C CG   . TYR B 1 50  ? 6.337   5.097   14.364  1.00 0.00 ? 50  TYR B CG   3  
ATOM 9628  C CD1  . TYR B 1 50  ? 6.602   6.058   13.382  1.00 0.00 ? 50  TYR B CD1  3  
ATOM 9629  C CD2  . TYR B 1 50  ? 6.172   5.486   15.699  1.00 0.00 ? 50  TYR B CD2  3  
ATOM 9630  C CE1  . TYR B 1 50  ? 6.701   7.409   13.734  1.00 0.00 ? 50  TYR B CE1  3  
ATOM 9631  C CE2  . TYR B 1 50  ? 6.272   6.837   16.051  1.00 0.00 ? 50  TYR B CE2  3  
ATOM 9632  C CZ   . TYR B 1 50  ? 6.536   7.799   15.068  1.00 0.00 ? 50  TYR B CZ   3  
ATOM 9633  O OH   . TYR B 1 50  ? 6.633   9.132   15.416  1.00 0.00 ? 50  TYR B OH   3  
ATOM 9634  H H    . TYR B 1 50  ? 4.141   5.329   13.706  1.00 0.00 ? 50  TYR B H    3  
ATOM 9635  H HA   . TYR B 1 50  ? 5.096   2.878   12.326  1.00 0.00 ? 50  TYR B HA   3  
ATOM 9636  H HB2  . TYR B 1 50  ? 6.302   3.031   14.874  1.00 0.00 ? 50  TYR B HB2  3  
ATOM 9637  H HB3  . TYR B 1 50  ? 7.046   3.383   13.317  1.00 0.00 ? 50  TYR B HB3  3  
ATOM 9638  H HD1  . TYR B 1 50  ? 6.729   5.757   12.353  1.00 0.00 ? 50  TYR B HD1  3  
ATOM 9639  H HD2  . TYR B 1 50  ? 5.969   4.744   16.457  1.00 0.00 ? 50  TYR B HD2  3  
ATOM 9640  H HE1  . TYR B 1 50  ? 6.906   8.151   12.975  1.00 0.00 ? 50  TYR B HE1  3  
ATOM 9641  H HE2  . TYR B 1 50  ? 6.144   7.138   17.080  1.00 0.00 ? 50  TYR B HE2  3  
ATOM 9642  H HH   . TYR B 1 50  ? 7.146   9.190   16.225  1.00 0.00 ? 50  TYR B HH   3  
ATOM 9643  N N    . ILE B 1 51  ? 4.136   2.544   15.437  1.00 0.00 ? 51  ILE B N    3  
ATOM 9644  C CA   . ILE B 1 51  ? 3.389   1.634   16.360  1.00 0.00 ? 51  ILE B CA   3  
ATOM 9645  C C    . ILE B 1 51  ? 2.063   1.186   15.737  1.00 0.00 ? 51  ILE B C    3  
ATOM 9646  O O    . ILE B 1 51  ? 1.603   0.085   15.972  1.00 0.00 ? 51  ILE B O    3  
ATOM 9647  C CB   . ILE B 1 51  ? 3.111   2.363   17.674  1.00 0.00 ? 51  ILE B CB   3  
ATOM 9648  C CG1  . ILE B 1 51  ? 2.613   3.778   17.375  1.00 0.00 ? 51  ILE B CG1  3  
ATOM 9649  C CG2  . ILE B 1 51  ? 4.399   2.440   18.498  1.00 0.00 ? 51  ILE B CG2  3  
ATOM 9650  C CD1  . ILE B 1 51  ? 1.835   4.311   18.580  1.00 0.00 ? 51  ILE B CD1  3  
ATOM 9651  H H    . ILE B 1 51  ? 4.695   3.257   15.810  1.00 0.00 ? 51  ILE B H    3  
ATOM 9652  H HA   . ILE B 1 51  ? 3.997   0.762   16.558  1.00 0.00 ? 51  ILE B HA   3  
ATOM 9653  H HB   . ILE B 1 51  ? 2.360   1.825   18.233  1.00 0.00 ? 51  ILE B HB   3  
ATOM 9654  H HG12 . ILE B 1 51  ? 3.458   4.423   17.177  1.00 0.00 ? 51  ILE B HG12 3  
ATOM 9655  H HG13 . ILE B 1 51  ? 1.966   3.758   16.511  1.00 0.00 ? 51  ILE B HG13 3  
ATOM 9656  H HG21 . ILE B 1 51  ? 5.018   1.583   18.280  1.00 0.00 ? 51  ILE B HG21 3  
ATOM 9657  H HG22 . ILE B 1 51  ? 4.932   3.345   18.247  1.00 0.00 ? 51  ILE B HG22 3  
ATOM 9658  H HG23 . ILE B 1 51  ? 4.153   2.449   19.550  1.00 0.00 ? 51  ILE B HG23 3  
ATOM 9659  H HD11 . ILE B 1 51  ? 1.493   3.483   19.182  1.00 0.00 ? 51  ILE B HD11 3  
ATOM 9660  H HD12 . ILE B 1 51  ? 2.478   4.946   19.172  1.00 0.00 ? 51  ILE B HD12 3  
ATOM 9661  H HD13 . ILE B 1 51  ? 0.984   4.881   18.235  1.00 0.00 ? 51  ILE B HD13 3  
ATOM 9662  N N    . TRP B 1 52  ? 1.445   2.017   14.946  1.00 0.00 ? 52  TRP B N    3  
ATOM 9663  C CA   . TRP B 1 52  ? 0.156   1.617   14.315  1.00 0.00 ? 52  TRP B CA   3  
ATOM 9664  C C    . TRP B 1 52  ? 0.280   0.190   13.778  1.00 0.00 ? 52  TRP B C    3  
ATOM 9665  O O    . TRP B 1 52  ? 1.364   -0.349  13.672  1.00 0.00 ? 52  TRP B O    3  
ATOM 9666  C CB   . TRP B 1 52  ? -0.158  2.564   13.162  1.00 0.00 ? 52  TRP B CB   3  
ATOM 9667  C CG   . TRP B 1 52  ? -1.625  2.841   13.129  1.00 0.00 ? 52  TRP B CG   3  
ATOM 9668  C CD1  . TRP B 1 52  ? -2.390  2.782   12.020  1.00 0.00 ? 52  TRP B CD1  3  
ATOM 9669  C CD2  . TRP B 1 52  ? -2.514  3.212   14.222  1.00 0.00 ? 52  TRP B CD2  3  
ATOM 9670  N NE1  . TRP B 1 52  ? -3.694  3.096   12.357  1.00 0.00 ? 52  TRP B NE1  3  
ATOM 9671  C CE2  . TRP B 1 52  ? -3.822  3.368   13.705  1.00 0.00 ? 52  TRP B CE2  3  
ATOM 9672  C CE3  . TRP B 1 52  ? -2.316  3.428   15.599  1.00 0.00 ? 52  TRP B CE3  3  
ATOM 9673  C CZ2  . TRP B 1 52  ? -4.897  3.724   14.522  1.00 0.00 ? 52  TRP B CZ2  3  
ATOM 9674  C CZ3  . TRP B 1 52  ? -3.396  3.786   16.424  1.00 0.00 ? 52  TRP B CZ3  3  
ATOM 9675  C CH2  . TRP B 1 52  ? -4.683  3.933   15.886  1.00 0.00 ? 52  TRP B CH2  3  
ATOM 9676  H H    . TRP B 1 52  ? 1.830   2.899   14.762  1.00 0.00 ? 52  TRP B H    3  
ATOM 9677  H HA   . TRP B 1 52  ? -0.636  1.661   15.046  1.00 0.00 ? 52  TRP B HA   3  
ATOM 9678  H HB2  . TRP B 1 52  ? 0.382   3.486   13.300  1.00 0.00 ? 52  TRP B HB2  3  
ATOM 9679  H HB3  . TRP B 1 52  ? 0.143   2.108   12.230  1.00 0.00 ? 52  TRP B HB3  3  
ATOM 9680  H HD1  . TRP B 1 52  ? -2.039  2.532   11.033  1.00 0.00 ? 52  TRP B HD1  3  
ATOM 9681  H HE1  . TRP B 1 52  ? -4.448  3.127   11.732  1.00 0.00 ? 52  TRP B HE1  3  
ATOM 9682  H HE3  . TRP B 1 52  ? -1.329  3.317   16.022  1.00 0.00 ? 52  TRP B HE3  3  
ATOM 9683  H HZ2  . TRP B 1 52  ? -5.887  3.834   14.102  1.00 0.00 ? 52  TRP B HZ2  3  
ATOM 9684  H HZ3  . TRP B 1 52  ? -3.233  3.949   17.479  1.00 0.00 ? 52  TRP B HZ3  3  
ATOM 9685  H HH2  . TRP B 1 52  ? -5.507  4.208   16.527  1.00 0.00 ? 52  TRP B HH2  3  
ATOM 9686  N N    . SER B 1 53  ? -0.818  -0.427  13.435  1.00 0.00 ? 53  SER B N    3  
ATOM 9687  C CA   . SER B 1 53  ? -0.752  -1.816  12.905  1.00 0.00 ? 53  SER B CA   3  
ATOM 9688  C C    . SER B 1 53  ? 0.225   -1.865  11.729  1.00 0.00 ? 53  SER B C    3  
ATOM 9689  O O    . SER B 1 53  ? -0.152  -1.679  10.588  1.00 0.00 ? 53  SER B O    3  
ATOM 9690  C CB   . SER B 1 53  ? -2.141  -2.247  12.432  1.00 0.00 ? 53  SER B CB   3  
ATOM 9691  O OG   . SER B 1 53  ? -2.860  -2.801  13.527  1.00 0.00 ? 53  SER B OG   3  
ATOM 9692  H H    . SER B 1 53  ? -1.683  0.024   13.526  1.00 0.00 ? 53  SER B H    3  
ATOM 9693  H HA   . SER B 1 53  ? -0.413  -2.484  13.684  1.00 0.00 ? 53  SER B HA   3  
ATOM 9694  H HB2  . SER B 1 53  ? -2.676  -1.393  12.054  1.00 0.00 ? 53  SER B HB2  3  
ATOM 9695  H HB3  . SER B 1 53  ? -2.041  -2.984  11.645  1.00 0.00 ? 53  SER B HB3  3  
ATOM 9696  H HG   . SER B 1 53  ? -2.235  -3.272  14.083  1.00 0.00 ? 53  SER B HG   3  
ATOM 9697  N N    . LEU B 1 54  ? 1.479   -2.112  11.995  1.00 0.00 ? 54  LEU B N    3  
ATOM 9698  C CA   . LEU B 1 54  ? 2.476   -2.171  10.891  1.00 0.00 ? 54  LEU B CA   3  
ATOM 9699  C C    . LEU B 1 54  ? 2.445   -3.561  10.254  1.00 0.00 ? 54  LEU B C    3  
ATOM 9700  O O    . LEU B 1 54  ? 2.491   -4.567  10.933  1.00 0.00 ? 54  LEU B O    3  
ATOM 9701  C CB   . LEU B 1 54  ? 3.874   -1.887  11.447  1.00 0.00 ? 54  LEU B CB   3  
ATOM 9702  C CG   . LEU B 1 54  ? 3.979   -0.407  11.824  1.00 0.00 ? 54  LEU B CG   3  
ATOM 9703  C CD1  . LEU B 1 54  ? 5.124   -0.206  12.821  1.00 0.00 ? 54  LEU B CD1  3  
ATOM 9704  C CD2  . LEU B 1 54  ? 4.249   0.418   10.564  1.00 0.00 ? 54  LEU B CD2  3  
ATOM 9705  H H    . LEU B 1 54  ? 1.764   -2.260  12.921  1.00 0.00 ? 54  LEU B H    3  
ATOM 9706  H HA   . LEU B 1 54  ? 2.229   -1.430  10.144  1.00 0.00 ? 54  LEU B HA   3  
ATOM 9707  H HB2  . LEU B 1 54  ? 4.045   -2.497  12.322  1.00 0.00 ? 54  LEU B HB2  3  
ATOM 9708  H HB3  . LEU B 1 54  ? 4.614   -2.119  10.695  1.00 0.00 ? 54  LEU B HB3  3  
ATOM 9709  H HG   . LEU B 1 54  ? 3.050   -0.086  12.273  1.00 0.00 ? 54  LEU B HG   3  
ATOM 9710  H HD11 . LEU B 1 54  ? 5.799   -1.047  12.770  1.00 0.00 ? 54  LEU B HD11 3  
ATOM 9711  H HD12 . LEU B 1 54  ? 5.658   0.701   12.576  1.00 0.00 ? 54  LEU B HD12 3  
ATOM 9712  H HD13 . LEU B 1 54  ? 4.722   -0.127  13.820  1.00 0.00 ? 54  LEU B HD13 3  
ATOM 9713  H HD21 . LEU B 1 54  ? 3.793   -0.065  9.712   1.00 0.00 ? 54  LEU B HD21 3  
ATOM 9714  H HD22 . LEU B 1 54  ? 3.830   1.406   10.684  1.00 0.00 ? 54  LEU B HD22 3  
ATOM 9715  H HD23 . LEU B 1 54  ? 5.314   0.496   10.405  1.00 0.00 ? 54  LEU B HD23 3  
ATOM 9716  N N    . ASP B 1 55  ? 2.357   -3.625  8.954   1.00 0.00 ? 55  ASP B N    3  
ATOM 9717  C CA   . ASP B 1 55  ? 2.313   -4.951  8.275   1.00 0.00 ? 55  ASP B CA   3  
ATOM 9718  C C    . ASP B 1 55  ? 3.736   -5.474  8.073   1.00 0.00 ? 55  ASP B C    3  
ATOM 9719  O O    . ASP B 1 55  ? 4.135   -6.458  8.665   1.00 0.00 ? 55  ASP B O    3  
ATOM 9720  C CB   . ASP B 1 55  ? 1.630   -4.804  6.914   1.00 0.00 ? 55  ASP B CB   3  
ATOM 9721  C CG   . ASP B 1 55  ? 1.529   -6.175  6.245   1.00 0.00 ? 55  ASP B CG   3  
ATOM 9722  O OD1  . ASP B 1 55  ? 2.565   -6.758  5.971   1.00 0.00 ? 55  ASP B OD1  3  
ATOM 9723  O OD2  . ASP B 1 55  ? 0.416   -6.622  6.019   1.00 0.00 ? 55  ASP B OD2  3  
ATOM 9724  H H    . ASP B 1 55  ? 2.316   -2.801  8.425   1.00 0.00 ? 55  ASP B H    3  
ATOM 9725  H HA   . ASP B 1 55  ? 1.757   -5.648  8.883   1.00 0.00 ? 55  ASP B HA   3  
ATOM 9726  H HB2  . ASP B 1 55  ? 0.640   -4.394  7.050   1.00 0.00 ? 55  ASP B HB2  3  
ATOM 9727  H HB3  . ASP B 1 55  ? 2.211   -4.142  6.288   1.00 0.00 ? 55  ASP B HB3  3  
ATOM 9728  N N    . THR B 1 56  ? 4.504   -4.828  7.240   1.00 0.00 ? 56  THR B N    3  
ATOM 9729  C CA   . THR B 1 56  ? 5.899   -5.294  7.000   1.00 0.00 ? 56  THR B CA   3  
ATOM 9730  C C    . THR B 1 56  ? 6.858   -4.532  7.914   1.00 0.00 ? 56  THR B C    3  
ATOM 9731  O O    . THR B 1 56  ? 6.499   -3.542  8.520   1.00 0.00 ? 56  THR B O    3  
ATOM 9732  C CB   . THR B 1 56  ? 6.279   -5.041  5.538   1.00 0.00 ? 56  THR B CB   3  
ATOM 9733  O OG1  . THR B 1 56  ? 6.808   -3.728  5.410   1.00 0.00 ? 56  THR B OG1  3  
ATOM 9734  C CG2  . THR B 1 56  ? 5.040   -5.183  4.651   1.00 0.00 ? 56  THR B CG2  3  
ATOM 9735  H H    . THR B 1 56  ? 4.163   -4.038  6.769   1.00 0.00 ? 56  THR B H    3  
ATOM 9736  H HA   . THR B 1 56  ? 5.964   -6.351  7.210   1.00 0.00 ? 56  THR B HA   3  
ATOM 9737  H HB   . THR B 1 56  ? 7.021   -5.760  5.229   1.00 0.00 ? 56  THR B HB   3  
ATOM 9738  H HG1  . THR B 1 56  ? 7.180   -3.644  4.529   1.00 0.00 ? 56  THR B HG1  3  
ATOM 9739  H HG21 . THR B 1 56  ? 4.359   -5.894  5.093   1.00 0.00 ? 56  THR B HG21 3  
ATOM 9740  H HG22 . THR B 1 56  ? 4.550   -4.224  4.560   1.00 0.00 ? 56  THR B HG22 3  
ATOM 9741  H HG23 . THR B 1 56  ? 5.337   -5.528  3.671   1.00 0.00 ? 56  THR B HG23 3  
ATOM 9742  N N    . GLN B 1 57  ? 8.074   -4.990  8.022   1.00 0.00 ? 57  GLN B N    3  
ATOM 9743  C CA   . GLN B 1 57  ? 9.056   -4.297  8.898   1.00 0.00 ? 57  GLN B CA   3  
ATOM 9744  C C    . GLN B 1 57  ? 9.489   -2.983  8.242   1.00 0.00 ? 57  GLN B C    3  
ATOM 9745  O O    . GLN B 1 57  ? 9.978   -2.084  8.895   1.00 0.00 ? 57  GLN B O    3  
ATOM 9746  C CB   . GLN B 1 57  ? 10.273  -5.201  9.102   1.00 0.00 ? 57  GLN B CB   3  
ATOM 9747  C CG   . GLN B 1 57  ? 11.099  -4.694  10.284  1.00 0.00 ? 57  GLN B CG   3  
ATOM 9748  C CD   . GLN B 1 57  ? 10.359  -4.976  11.593  1.00 0.00 ? 57  GLN B CD   3  
ATOM 9749  O OE1  . GLN B 1 57  ? 9.259   -4.504  11.798  1.00 0.00 ? 57  GLN B OE1  3  
ATOM 9750  N NE2  . GLN B 1 57  ? 10.925  -5.727  12.497  1.00 0.00 ? 57  GLN B NE2  3  
ATOM 9751  H H    . GLN B 1 57  ? 8.340   -5.792  7.526   1.00 0.00 ? 57  GLN B H    3  
ATOM 9752  H HA   . GLN B 1 57  ? 8.600   -4.086  9.853   1.00 0.00 ? 57  GLN B HA   3  
ATOM 9753  H HB2  . GLN B 1 57  ? 9.940   -6.209  9.302   1.00 0.00 ? 57  GLN B HB2  3  
ATOM 9754  H HB3  . GLN B 1 57  ? 10.881  -5.193  8.210   1.00 0.00 ? 57  GLN B HB3  3  
ATOM 9755  H HG2  . GLN B 1 57  ? 12.055  -5.197  10.294  1.00 0.00 ? 57  GLN B HG2  3  
ATOM 9756  H HG3  . GLN B 1 57  ? 11.255  -3.630  10.183  1.00 0.00 ? 57  GLN B HG3  3  
ATOM 9757  H HE21 . GLN B 1 57  ? 11.815  -6.105  12.334  1.00 0.00 ? 57  GLN B HE21 3  
ATOM 9758  H HE22 . GLN B 1 57  ? 10.460  -5.915  13.339  1.00 0.00 ? 57  GLN B HE22 3  
ATOM 9759  N N    . TYR B 1 58  ? 9.309   -2.862  6.955   1.00 0.00 ? 58  TYR B N    3  
ATOM 9760  C CA   . TYR B 1 58  ? 9.705   -1.602  6.266   1.00 0.00 ? 58  TYR B CA   3  
ATOM 9761  C C    . TYR B 1 58  ? 8.634   -0.534  6.532   1.00 0.00 ? 58  TYR B C    3  
ATOM 9762  O O    . TYR B 1 58  ? 8.805   0.623   6.202   1.00 0.00 ? 58  TYR B O    3  
ATOM 9763  C CB   . TYR B 1 58  ? 9.846   -1.868  4.756   1.00 0.00 ? 58  TYR B CB   3  
ATOM 9764  C CG   . TYR B 1 58  ? 9.576   -0.604  3.973   1.00 0.00 ? 58  TYR B CG   3  
ATOM 9765  C CD1  . TYR B 1 58  ? 10.602  0.322   3.753   1.00 0.00 ? 58  TYR B CD1  3  
ATOM 9766  C CD2  . TYR B 1 58  ? 8.294   -0.363  3.470   1.00 0.00 ? 58  TYR B CD2  3  
ATOM 9767  C CE1  . TYR B 1 58  ? 10.342  1.491   3.027   1.00 0.00 ? 58  TYR B CE1  3  
ATOM 9768  C CE2  . TYR B 1 58  ? 8.036   0.803   2.746   1.00 0.00 ? 58  TYR B CE2  3  
ATOM 9769  C CZ   . TYR B 1 58  ? 9.059   1.728   2.524   1.00 0.00 ? 58  TYR B CZ   3  
ATOM 9770  O OH   . TYR B 1 58  ? 8.801   2.874   1.808   1.00 0.00 ? 58  TYR B OH   3  
ATOM 9771  H H    . TYR B 1 58  ? 8.908   -3.596  6.443   1.00 0.00 ? 58  TYR B H    3  
ATOM 9772  H HA   . TYR B 1 58  ? 10.651  -1.263  6.661   1.00 0.00 ? 58  TYR B HA   3  
ATOM 9773  H HB2  . TYR B 1 58  ? 10.849  -2.208  4.547   1.00 0.00 ? 58  TYR B HB2  3  
ATOM 9774  H HB3  . TYR B 1 58  ? 9.142   -2.629  4.456   1.00 0.00 ? 58  TYR B HB3  3  
ATOM 9775  H HD1  . TYR B 1 58  ? 11.592  0.136   4.143   1.00 0.00 ? 58  TYR B HD1  3  
ATOM 9776  H HD2  . TYR B 1 58  ? 7.504   -1.079  3.640   1.00 0.00 ? 58  TYR B HD2  3  
ATOM 9777  H HE1  . TYR B 1 58  ? 11.131  2.211   2.858   1.00 0.00 ? 58  TYR B HE1  3  
ATOM 9778  H HE2  . TYR B 1 58  ? 7.046   0.990   2.357   1.00 0.00 ? 58  TYR B HE2  3  
ATOM 9779  H HH   . TYR B 1 58  ? 8.632   2.623   0.897   1.00 0.00 ? 58  TYR B HH   3  
ATOM 9780  N N    . SER B 1 59  ? 7.536   -0.912  7.127   1.00 0.00 ? 59  SER B N    3  
ATOM 9781  C CA   . SER B 1 59  ? 6.463   0.082   7.415   1.00 0.00 ? 59  SER B CA   3  
ATOM 9782  C C    . SER B 1 59  ? 6.835   0.876   8.667   1.00 0.00 ? 59  SER B C    3  
ATOM 9783  O O    . SER B 1 59  ? 6.517   2.041   8.789   1.00 0.00 ? 59  SER B O    3  
ATOM 9784  C CB   . SER B 1 59  ? 5.139   -0.646  7.644   1.00 0.00 ? 59  SER B CB   3  
ATOM 9785  O OG   . SER B 1 59  ? 5.280   -1.543  8.738   1.00 0.00 ? 59  SER B OG   3  
ATOM 9786  H H    . SER B 1 59  ? 7.417   -1.848  7.388   1.00 0.00 ? 59  SER B H    3  
ATOM 9787  H HA   . SER B 1 59  ? 6.363   0.761   6.579   1.00 0.00 ? 59  SER B HA   3  
ATOM 9788  H HB2  . SER B 1 59  ? 4.366   0.068   7.869   1.00 0.00 ? 59  SER B HB2  3  
ATOM 9789  H HB3  . SER B 1 59  ? 4.871   -1.193  6.748   1.00 0.00 ? 59  SER B HB3  3  
ATOM 9790  H HG   . SER B 1 59  ? 4.618   -2.233  8.644   1.00 0.00 ? 59  SER B HG   3  
ATOM 9791  N N    . LYS B 1 60  ? 7.513   0.260   9.597   1.00 0.00 ? 60  LYS B N    3  
ATOM 9792  C CA   . LYS B 1 60  ? 7.908   0.991   10.834  1.00 0.00 ? 60  LYS B CA   3  
ATOM 9793  C C    . LYS B 1 60  ? 9.128   1.859   10.529  1.00 0.00 ? 60  LYS B C    3  
ATOM 9794  O O    . LYS B 1 60  ? 9.301   2.926   11.084  1.00 0.00 ? 60  LYS B O    3  
ATOM 9795  C CB   . LYS B 1 60  ? 8.248   -0.013  11.940  1.00 0.00 ? 60  LYS B CB   3  
ATOM 9796  C CG   . LYS B 1 60  ? 9.616   -0.645  11.667  1.00 0.00 ? 60  LYS B CG   3  
ATOM 9797  C CD   . LYS B 1 60  ? 10.004  -1.553  12.836  1.00 0.00 ? 60  LYS B CD   3  
ATOM 9798  C CE   . LYS B 1 60  ? 9.847   -0.786  14.151  1.00 0.00 ? 60  LYS B CE   3  
ATOM 9799  N NZ   . LYS B 1 60  ? 10.872  -1.256  15.125  1.00 0.00 ? 60  LYS B NZ   3  
ATOM 9800  H H    . LYS B 1 60  ? 7.767   -0.680  9.479   1.00 0.00 ? 60  LYS B H    3  
ATOM 9801  H HA   . LYS B 1 60  ? 7.091   1.619   11.155  1.00 0.00 ? 60  LYS B HA   3  
ATOM 9802  H HB2  . LYS B 1 60  ? 8.272   0.498   12.892  1.00 0.00 ? 60  LYS B HB2  3  
ATOM 9803  H HB3  . LYS B 1 60  ? 7.496   -0.788  11.967  1.00 0.00 ? 60  LYS B HB3  3  
ATOM 9804  H HG2  . LYS B 1 60  ? 9.567   -1.228  10.760  1.00 0.00 ? 60  LYS B HG2  3  
ATOM 9805  H HG3  . LYS B 1 60  ? 10.357  0.133   11.557  1.00 0.00 ? 60  LYS B HG3  3  
ATOM 9806  H HD2  . LYS B 1 60  ? 9.362   -2.421  12.845  1.00 0.00 ? 60  LYS B HD2  3  
ATOM 9807  H HD3  . LYS B 1 60  ? 11.030  -1.865  12.725  1.00 0.00 ? 60  LYS B HD3  3  
ATOM 9808  H HE2  . LYS B 1 60  ? 9.980   0.270   13.970  1.00 0.00 ? 60  LYS B HE2  3  
ATOM 9809  H HE3  . LYS B 1 60  ? 8.860   -0.961  14.554  1.00 0.00 ? 60  LYS B HE3  3  
ATOM 9810  H HZ1  . LYS B 1 60  ? 10.999  -2.284  15.028  1.00 0.00 ? 60  LYS B HZ1  3  
ATOM 9811  H HZ2  . LYS B 1 60  ? 11.776  -0.776  14.935  1.00 0.00 ? 60  LYS B HZ2  3  
ATOM 9812  H HZ3  . LYS B 1 60  ? 10.559  -1.038  16.091  1.00 0.00 ? 60  LYS B HZ3  3  
ATOM 9813  N N    . VAL B 1 61  ? 9.974   1.411   9.640   1.00 0.00 ? 61  VAL B N    3  
ATOM 9814  C CA   . VAL B 1 61  ? 11.178  2.205   9.287   1.00 0.00 ? 61  VAL B CA   3  
ATOM 9815  C C    . VAL B 1 61  ? 10.754  3.412   8.451   1.00 0.00 ? 61  VAL B C    3  
ATOM 9816  O O    . VAL B 1 61  ? 10.746  4.529   8.922   1.00 0.00 ? 61  VAL B O    3  
ATOM 9817  C CB   . VAL B 1 61  ? 12.138  1.326   8.482   1.00 0.00 ? 61  VAL B CB   3  
ATOM 9818  C CG1  . VAL B 1 61  ? 13.182  2.201   7.788   1.00 0.00 ? 61  VAL B CG1  3  
ATOM 9819  C CG2  . VAL B 1 61  ? 12.841  0.350   9.427   1.00 0.00 ? 61  VAL B CG2  3  
ATOM 9820  H H    . VAL B 1 61  ? 9.812   0.551   9.200   1.00 0.00 ? 61  VAL B H    3  
ATOM 9821  H HA   . VAL B 1 61  ? 11.667  2.542   10.189  1.00 0.00 ? 61  VAL B HA   3  
ATOM 9822  H HB   . VAL B 1 61  ? 11.582  0.773   7.739   1.00 0.00 ? 61  VAL B HB   3  
ATOM 9823  H HG11 . VAL B 1 61  ? 13.061  3.226   8.105   1.00 0.00 ? 61  VAL B HG11 3  
ATOM 9824  H HG12 . VAL B 1 61  ? 14.170  1.857   8.050   1.00 0.00 ? 61  VAL B HG12 3  
ATOM 9825  H HG13 . VAL B 1 61  ? 13.049  2.136   6.719   1.00 0.00 ? 61  VAL B HG13 3  
ATOM 9826  H HG21 . VAL B 1 61  ? 12.137  -0.010  10.161  1.00 0.00 ? 61  VAL B HG21 3  
ATOM 9827  H HG22 . VAL B 1 61  ? 13.230  -0.482  8.860   1.00 0.00 ? 61  VAL B HG22 3  
ATOM 9828  H HG23 . VAL B 1 61  ? 13.655  0.857   9.927   1.00 0.00 ? 61  VAL B HG23 3  
ATOM 9829  N N    . LEU B 1 62  ? 10.393  3.196   7.216   1.00 0.00 ? 62  LEU B N    3  
ATOM 9830  C CA   . LEU B 1 62  ? 9.963   4.335   6.354   1.00 0.00 ? 62  LEU B CA   3  
ATOM 9831  C C    . LEU B 1 62  ? 8.915   5.164   7.106   1.00 0.00 ? 62  LEU B C    3  
ATOM 9832  O O    . LEU B 1 62  ? 8.751   6.343   6.861   1.00 0.00 ? 62  LEU B O    3  
ATOM 9833  C CB   . LEU B 1 62  ? 9.361   3.778   5.059   1.00 0.00 ? 62  LEU B CB   3  
ATOM 9834  C CG   . LEU B 1 62  ? 8.719   4.902   4.239   1.00 0.00 ? 62  LEU B CG   3  
ATOM 9835  C CD1  . LEU B 1 62  ? 9.728   5.482   3.242   1.00 0.00 ? 62  LEU B CD1  3  
ATOM 9836  C CD2  . LEU B 1 62  ? 7.526   4.337   3.477   1.00 0.00 ? 62  LEU B CD2  3  
ATOM 9837  H H    . LEU B 1 62  ? 10.399  2.284   6.856   1.00 0.00 ? 62  LEU B H    3  
ATOM 9838  H HA   . LEU B 1 62  ? 10.817  4.954   6.121   1.00 0.00 ? 62  LEU B HA   3  
ATOM 9839  H HB2  . LEU B 1 62  ? 10.141  3.313   4.476   1.00 0.00 ? 62  LEU B HB2  3  
ATOM 9840  H HB3  . LEU B 1 62  ? 8.610   3.042   5.302   1.00 0.00 ? 62  LEU B HB3  3  
ATOM 9841  H HG   . LEU B 1 62  ? 8.382   5.685   4.902   1.00 0.00 ? 62  LEU B HG   3  
ATOM 9842  H HD11 . LEU B 1 62  ? 10.480  4.742   3.015   1.00 0.00 ? 62  LEU B HD11 3  
ATOM 9843  H HD12 . LEU B 1 62  ? 9.213   5.760   2.331   1.00 0.00 ? 62  LEU B HD12 3  
ATOM 9844  H HD13 . LEU B 1 62  ? 10.197  6.356   3.668   1.00 0.00 ? 62  LEU B HD13 3  
ATOM 9845  H HD21 . LEU B 1 62  ? 7.583   3.259   3.470   1.00 0.00 ? 62  LEU B HD21 3  
ATOM 9846  H HD22 . LEU B 1 62  ? 6.618   4.644   3.962   1.00 0.00 ? 62  LEU B HD22 3  
ATOM 9847  H HD23 . LEU B 1 62  ? 7.539   4.705   2.462   1.00 0.00 ? 62  LEU B HD23 3  
ATOM 9848  N N    . ALA B 1 63  ? 8.206   4.557   8.023   1.00 0.00 ? 63  ALA B N    3  
ATOM 9849  C CA   . ALA B 1 63  ? 7.174   5.313   8.790   1.00 0.00 ? 63  ALA B CA   3  
ATOM 9850  C C    . ALA B 1 63  ? 7.842   6.482   9.520   1.00 0.00 ? 63  ALA B C    3  
ATOM 9851  O O    . ALA B 1 63  ? 7.390   7.607   9.450   1.00 0.00 ? 63  ALA B O    3  
ATOM 9852  C CB   . ALA B 1 63  ? 6.505   4.386   9.811   1.00 0.00 ? 63  ALA B CB   3  
ATOM 9853  H H    . ALA B 1 63  ? 8.356   3.606   8.208   1.00 0.00 ? 63  ALA B H    3  
ATOM 9854  H HA   . ALA B 1 63  ? 6.428   5.695   8.109   1.00 0.00 ? 63  ALA B HA   3  
ATOM 9855  H HB1  . ALA B 1 63  ? 7.198   3.609   10.100  1.00 0.00 ? 63  ALA B HB1  3  
ATOM 9856  H HB2  . ALA B 1 63  ? 6.218   4.955   10.682  1.00 0.00 ? 63  ALA B HB2  3  
ATOM 9857  H HB3  . ALA B 1 63  ? 5.627   3.937   9.369   1.00 0.00 ? 63  ALA B HB3  3  
ATOM 9858  N N    . LEU B 1 64  ? 8.917   6.224   10.214  1.00 0.00 ? 64  LEU B N    3  
ATOM 9859  C CA   . LEU B 1 64  ? 9.622   7.319   10.942  1.00 0.00 ? 64  LEU B CA   3  
ATOM 9860  C C    . LEU B 1 64  ? 10.389  8.172   9.935   1.00 0.00 ? 64  LEU B C    3  
ATOM 9861  O O    . LEU B 1 64  ? 10.378  9.382   9.992   1.00 0.00 ? 64  LEU B O    3  
ATOM 9862  C CB   . LEU B 1 64  ? 10.608  6.705   11.938  1.00 0.00 ? 64  LEU B CB   3  
ATOM 9863  C CG   . LEU B 1 64  ? 9.830   6.085   13.094  1.00 0.00 ? 64  LEU B CG   3  
ATOM 9864  C CD1  . LEU B 1 64  ? 10.687  5.015   13.773  1.00 0.00 ? 64  LEU B CD1  3  
ATOM 9865  C CD2  . LEU B 1 64  ? 9.474   7.173   14.109  1.00 0.00 ? 64  LEU B CD2  3  
ATOM 9866  H H    . LEU B 1 64  ? 9.265   5.309   10.251  1.00 0.00 ? 64  LEU B H    3  
ATOM 9867  H HA   . LEU B 1 64  ? 8.904   7.932   11.470  1.00 0.00 ? 64  LEU B HA   3  
ATOM 9868  H HB2  . LEU B 1 64  ? 11.189  5.939   11.441  1.00 0.00 ? 64  LEU B HB2  3  
ATOM 9869  H HB3  . LEU B 1 64  ? 11.268  7.469   12.315  1.00 0.00 ? 64  LEU B HB3  3  
ATOM 9870  H HG   . LEU B 1 64  ? 8.927   5.635   12.711  1.00 0.00 ? 64  LEU B HG   3  
ATOM 9871  H HD11 . LEU B 1 64  ? 11.681  5.403   13.941  1.00 0.00 ? 64  LEU B HD11 3  
ATOM 9872  H HD12 . LEU B 1 64  ? 10.240  4.745   14.719  1.00 0.00 ? 64  LEU B HD12 3  
ATOM 9873  H HD13 . LEU B 1 64  ? 10.742  4.143   13.138  1.00 0.00 ? 64  LEU B HD13 3  
ATOM 9874  H HD21 . LEU B 1 64  ? 8.969   7.984   13.605  1.00 0.00 ? 64  LEU B HD21 3  
ATOM 9875  H HD22 . LEU B 1 64  ? 8.823   6.760   14.866  1.00 0.00 ? 64  LEU B HD22 3  
ATOM 9876  H HD23 . LEU B 1 64  ? 10.376  7.544   14.572  1.00 0.00 ? 64  LEU B HD23 3  
ATOM 9877  N N    . TYR B 1 65  ? 11.051  7.537   9.015   1.00 0.00 ? 65  TYR B N    3  
ATOM 9878  C CA   . TYR B 1 65  ? 11.826  8.284   7.986   1.00 0.00 ? 65  TYR B CA   3  
ATOM 9879  C C    . TYR B 1 65  ? 11.019  9.496   7.509   1.00 0.00 ? 65  TYR B C    3  
ATOM 9880  O O    . TYR B 1 65  ? 11.566  10.519  7.149   1.00 0.00 ? 65  TYR B O    3  
ATOM 9881  C CB   . TYR B 1 65  ? 12.097  7.349   6.806   1.00 0.00 ? 65  TYR B CB   3  
ATOM 9882  C CG   . TYR B 1 65  ? 12.803  8.101   5.709   1.00 0.00 ? 65  TYR B CG   3  
ATOM 9883  C CD1  . TYR B 1 65  ? 12.066  8.872   4.802   1.00 0.00 ? 65  TYR B CD1  3  
ATOM 9884  C CD2  . TYR B 1 65  ? 14.196  8.021   5.593   1.00 0.00 ? 65  TYR B CD2  3  
ATOM 9885  C CE1  . TYR B 1 65  ? 12.722  9.563   3.776   1.00 0.00 ? 65  TYR B CE1  3  
ATOM 9886  C CE2  . TYR B 1 65  ? 14.852  8.712   4.569   1.00 0.00 ? 65  TYR B CE2  3  
ATOM 9887  C CZ   . TYR B 1 65  ? 14.115  9.482   3.660   1.00 0.00 ? 65  TYR B CZ   3  
ATOM 9888  O OH   . TYR B 1 65  ? 14.762  10.163  2.648   1.00 0.00 ? 65  TYR B OH   3  
ATOM 9889  H H    . TYR B 1 65  ? 11.038  6.560   9.000   1.00 0.00 ? 65  TYR B H    3  
ATOM 9890  H HA   . TYR B 1 65  ? 12.764  8.616   8.406   1.00 0.00 ? 65  TYR B HA   3  
ATOM 9891  H HB2  . TYR B 1 65  ? 12.716  6.528   7.135   1.00 0.00 ? 65  TYR B HB2  3  
ATOM 9892  H HB3  . TYR B 1 65  ? 11.159  6.966   6.431   1.00 0.00 ? 65  TYR B HB3  3  
ATOM 9893  H HD1  . TYR B 1 65  ? 10.990  8.932   4.893   1.00 0.00 ? 65  TYR B HD1  3  
ATOM 9894  H HD2  . TYR B 1 65  ? 14.765  7.429   6.299   1.00 0.00 ? 65  TYR B HD2  3  
ATOM 9895  H HE1  . TYR B 1 65  ? 12.154  10.159  3.077   1.00 0.00 ? 65  TYR B HE1  3  
ATOM 9896  H HE2  . TYR B 1 65  ? 15.924  8.647   4.476   1.00 0.00 ? 65  TYR B HE2  3  
ATOM 9897  H HH   . TYR B 1 65  ? 15.164  10.947  3.030   1.00 0.00 ? 65  TYR B HH   3  
ATOM 9898  N N    . ASN B 1 66  ? 9.719   9.385   7.508   1.00 0.00 ? 66  ASN B N    3  
ATOM 9899  C CA   . ASN B 1 66  ? 8.864   10.524  7.059   1.00 0.00 ? 66  ASN B CA   3  
ATOM 9900  C C    . ASN B 1 66  ? 8.383   11.304  8.277   1.00 0.00 ? 66  ASN B C    3  
ATOM 9901  O O    . ASN B 1 66  ? 8.497   12.511  8.349   1.00 0.00 ? 66  ASN B O    3  
ATOM 9902  C CB   . ASN B 1 66  ? 7.645   9.970   6.336   1.00 0.00 ? 66  ASN B CB   3  
ATOM 9903  C CG   . ASN B 1 66  ? 7.138   10.993  5.320   1.00 0.00 ? 66  ASN B CG   3  
ATOM 9904  O OD1  . ASN B 1 66  ? 7.068   10.711  4.140   1.00 0.00 ? 66  ASN B OD1  3  
ATOM 9905  N ND2  . ASN B 1 66  ? 6.779   12.178  5.731   1.00 0.00 ? 66  ASN B ND2  3  
ATOM 9906  H H    . ASN B 1 66  ? 9.300   8.551   7.803   1.00 0.00 ? 66  ASN B H    3  
ATOM 9907  H HA   . ASN B 1 66  ? 9.421   11.170  6.399   1.00 0.00 ? 66  ASN B HA   3  
ATOM 9908  H HB2  . ASN B 1 66  ? 7.910   9.053   5.833   1.00 0.00 ? 66  ASN B HB2  3  
ATOM 9909  H HB3  . ASN B 1 66  ? 6.874   9.773   7.063   1.00 0.00 ? 66  ASN B HB3  3  
ATOM 9910  H HD21 . ASN B 1 66  ? 6.836   12.405  6.683   1.00 0.00 ? 66  ASN B HD21 3  
ATOM 9911  H HD22 . ASN B 1 66  ? 6.451   12.842  5.088   1.00 0.00 ? 66  ASN B HD22 3  
ATOM 9912  N N    . GLN B 1 67  ? 7.840   10.608  9.236   1.00 0.00 ? 67  GLN B N    3  
ATOM 9913  C CA   . GLN B 1 67  ? 7.334   11.273  10.470  1.00 0.00 ? 67  GLN B CA   3  
ATOM 9914  C C    . GLN B 1 67  ? 8.393   12.217  11.036  1.00 0.00 ? 67  GLN B C    3  
ATOM 9915  O O    . GLN B 1 67  ? 8.105   13.080  11.841  1.00 0.00 ? 67  GLN B O    3  
ATOM 9916  C CB   . GLN B 1 67  ? 6.991   10.202  11.509  1.00 0.00 ? 67  GLN B CB   3  
ATOM 9917  C CG   . GLN B 1 67  ? 5.528   9.787   11.353  1.00 0.00 ? 67  GLN B CG   3  
ATOM 9918  C CD   . GLN B 1 67  ? 5.240   9.470   9.884   1.00 0.00 ? 67  GLN B CD   3  
ATOM 9919  O OE1  . GLN B 1 67  ? 5.275   10.347  9.044   1.00 0.00 ? 67  GLN B OE1  3  
ATOM 9920  N NE2  . GLN B 1 67  ? 4.954   8.245   9.536   1.00 0.00 ? 67  GLN B NE2  3  
ATOM 9921  H H    . GLN B 1 67  ? 7.762   9.636   9.140   1.00 0.00 ? 67  GLN B H    3  
ATOM 9922  H HA   . GLN B 1 67  ? 6.449   11.836  10.232  1.00 0.00 ? 67  GLN B HA   3  
ATOM 9923  H HB2  . GLN B 1 67  ? 7.627   9.342   11.358  1.00 0.00 ? 67  GLN B HB2  3  
ATOM 9924  H HB3  . GLN B 1 67  ? 7.150   10.596  12.501  1.00 0.00 ? 67  GLN B HB3  3  
ATOM 9925  H HG2  . GLN B 1 67  ? 5.337   8.910   11.955  1.00 0.00 ? 67  GLN B HG2  3  
ATOM 9926  H HG3  . GLN B 1 67  ? 4.888   10.593  11.677  1.00 0.00 ? 67  GLN B HG3  3  
ATOM 9927  H HE21 . GLN B 1 67  ? 4.926   7.537   10.214  1.00 0.00 ? 67  GLN B HE21 3  
ATOM 9928  H HE22 . GLN B 1 67  ? 4.767   8.033   8.598   1.00 0.00 ? 67  GLN B HE22 3  
ATOM 9929  N N    . HIS B 1 68  ? 9.615   12.061  10.623  1.00 0.00 ? 68  HIS B N    3  
ATOM 9930  C CA   . HIS B 1 68  ? 10.696  12.949  11.136  1.00 0.00 ? 68  HIS B CA   3  
ATOM 9931  C C    . HIS B 1 68  ? 10.757  14.223  10.291  1.00 0.00 ? 68  HIS B C    3  
ATOM 9932  O O    . HIS B 1 68  ? 10.817  15.320  10.811  1.00 0.00 ? 68  HIS B O    3  
ATOM 9933  C CB   . HIS B 1 68  ? 12.037  12.218  11.056  1.00 0.00 ? 68  HIS B CB   3  
ATOM 9934  C CG   . HIS B 1 68  ? 12.269  11.455  12.329  1.00 0.00 ? 68  HIS B CG   3  
ATOM 9935  N ND1  . HIS B 1 68  ? 11.810  10.160  12.511  1.00 0.00 ? 68  HIS B ND1  3  
ATOM 9936  C CD2  . HIS B 1 68  ? 12.908  11.794  13.494  1.00 0.00 ? 68  HIS B CD2  3  
ATOM 9937  C CE1  . HIS B 1 68  ? 12.177  9.770   13.745  1.00 0.00 ? 68  HIS B CE1  3  
ATOM 9938  N NE2  . HIS B 1 68  ? 12.849  10.729  14.388  1.00 0.00 ? 68  HIS B NE2  3  
ATOM 9939  H H    . HIS B 1 68  ? 9.821   11.360  9.976   1.00 0.00 ? 68  HIS B H    3  
ATOM 9940  H HA   . HIS B 1 68  ? 10.490  13.208  12.164  1.00 0.00 ? 68  HIS B HA   3  
ATOM 9941  H HB2  . HIS B 1 68  ? 12.026  11.532  10.221  1.00 0.00 ? 68  HIS B HB2  3  
ATOM 9942  H HB3  . HIS B 1 68  ? 12.832  12.937  10.920  1.00 0.00 ? 68  HIS B HB3  3  
ATOM 9943  H HD1  . HIS B 1 68  ? 11.310  9.626   11.860  1.00 0.00 ? 68  HIS B HD1  3  
ATOM 9944  H HD2  . HIS B 1 68  ? 13.385  12.743  13.687  1.00 0.00 ? 68  HIS B HD2  3  
ATOM 9945  H HE1  . HIS B 1 68  ? 11.955  8.799   14.166  1.00 0.00 ? 68  HIS B HE1  3  
ATOM 9946  N N    . ASN B 1 69  ? 10.744  14.089  8.993   1.00 0.00 ? 69  ASN B N    3  
ATOM 9947  C CA   . ASN B 1 69  ? 10.804  15.295  8.119   1.00 0.00 ? 69  ASN B CA   3  
ATOM 9948  C C    . ASN B 1 69  ? 9.413   15.573  7.532   1.00 0.00 ? 69  ASN B C    3  
ATOM 9949  O O    . ASN B 1 69  ? 8.892   14.768  6.786   1.00 0.00 ? 69  ASN B O    3  
ATOM 9950  C CB   . ASN B 1 69  ? 11.790  15.045  6.976   1.00 0.00 ? 69  ASN B CB   3  
ATOM 9951  C CG   . ASN B 1 69  ? 13.215  15.316  7.464   1.00 0.00 ? 69  ASN B CG   3  
ATOM 9952  O OD1  . ASN B 1 69  ? 14.082  15.654  6.683   1.00 0.00 ? 69  ASN B OD1  3  
ATOM 9953  N ND2  . ASN B 1 69  ? 13.494  15.179  8.731   1.00 0.00 ? 69  ASN B ND2  3  
ATOM 9954  H H    . ASN B 1 69  ? 10.696  13.195  8.593   1.00 0.00 ? 69  ASN B H    3  
ATOM 9955  H HA   . ASN B 1 69  ? 11.137  16.140  8.699   1.00 0.00 ? 69  ASN B HA   3  
ATOM 9956  H HB2  . ASN B 1 69  ? 11.708  14.019  6.649   1.00 0.00 ? 69  ASN B HB2  3  
ATOM 9957  H HB3  . ASN B 1 69  ? 11.563  15.706  6.154   1.00 0.00 ? 69  ASN B HB3  3  
ATOM 9958  H HD21 . ASN B 1 69  ? 12.794  14.907  9.360   1.00 0.00 ? 69  ASN B HD21 3  
ATOM 9959  H HD22 . ASN B 1 69  ? 14.403  15.351  9.054   1.00 0.00 ? 69  ASN B HD22 3  
ATOM 9960  N N    . PRO B 1 70  ? 8.854   16.707  7.879   1.00 0.00 ? 70  PRO B N    3  
ATOM 9961  C CA   . PRO B 1 70  ? 7.525   17.112  7.389   1.00 0.00 ? 70  PRO B CA   3  
ATOM 9962  C C    . PRO B 1 70  ? 7.629   17.634  5.953   1.00 0.00 ? 70  PRO B C    3  
ATOM 9963  O O    . PRO B 1 70  ? 8.325   18.592  5.679   1.00 0.00 ? 70  PRO B O    3  
ATOM 9964  C CB   . PRO B 1 70  ? 7.112   18.229  8.350   1.00 0.00 ? 70  PRO B CB   3  
ATOM 9965  C CG   . PRO B 1 70  ? 8.419   18.782  8.964   1.00 0.00 ? 70  PRO B CG   3  
ATOM 9966  C CD   . PRO B 1 70  ? 9.487   17.687  8.785   1.00 0.00 ? 70  PRO B CD   3  
ATOM 9967  H HA   . PRO B 1 70  ? 6.828   16.293  7.449   1.00 0.00 ? 70  PRO B HA   3  
ATOM 9968  H HB2  . PRO B 1 70  ? 6.592   19.008  7.809   1.00 0.00 ? 70  PRO B HB2  3  
ATOM 9969  H HB3  . PRO B 1 70  ? 6.482   17.833  9.131   1.00 0.00 ? 70  PRO B HB3  3  
ATOM 9970  H HG2  . PRO B 1 70  ? 8.717   19.684  8.446   1.00 0.00 ? 70  PRO B HG2  3  
ATOM 9971  H HG3  . PRO B 1 70  ? 8.278   18.987  10.014  1.00 0.00 ? 70  PRO B HG3  3  
ATOM 9972  H HD2  . PRO B 1 70  ? 10.380  18.100  8.336   1.00 0.00 ? 70  PRO B HD2  3  
ATOM 9973  H HD3  . PRO B 1 70  ? 9.717   17.223  9.732   1.00 0.00 ? 70  PRO B HD3  3  
ATOM 9974  N N    . GLY B 1 71  ? 6.948   17.008  5.034   1.00 0.00 ? 71  GLY B N    3  
ATOM 9975  C CA   . GLY B 1 71  ? 7.013   17.466  3.617   1.00 0.00 ? 71  GLY B CA   3  
ATOM 9976  C C    . GLY B 1 71  ? 7.546   16.331  2.742   1.00 0.00 ? 71  GLY B C    3  
ATOM 9977  O O    . GLY B 1 71  ? 7.339   16.308  1.545   1.00 0.00 ? 71  GLY B O    3  
ATOM 9978  H H    . GLY B 1 71  ? 6.395   16.236  5.275   1.00 0.00 ? 71  GLY B H    3  
ATOM 9979  H HA2  . GLY B 1 71  ? 6.022   17.745  3.285   1.00 0.00 ? 71  GLY B HA2  3  
ATOM 9980  H HA3  . GLY B 1 71  ? 7.673   18.315  3.543   1.00 0.00 ? 71  GLY B HA3  3  
ATOM 9981  N N    . ALA B 1 72  ? 8.226   15.384  3.330   1.00 0.00 ? 72  ALA B N    3  
ATOM 9982  C CA   . ALA B 1 72  ? 8.763   14.252  2.534   1.00 0.00 ? 72  ALA B CA   3  
ATOM 9983  C C    . ALA B 1 72  ? 7.622   13.304  2.192   1.00 0.00 ? 72  ALA B C    3  
ATOM 9984  O O    . ALA B 1 72  ? 6.957   12.769  3.055   1.00 0.00 ? 72  ALA B O    3  
ATOM 9985  C CB   . ALA B 1 72  ? 9.820   13.500  3.339   1.00 0.00 ? 72  ALA B CB   3  
ATOM 9986  H H    . ALA B 1 72  ? 8.377   15.415  4.291   1.00 0.00 ? 72  ALA B H    3  
ATOM 9987  H HA   . ALA B 1 72  ? 9.204   14.630  1.623   1.00 0.00 ? 72  ALA B HA   3  
ATOM 9988  H HB1  . ALA B 1 72  ? 9.833   13.873  4.352   1.00 0.00 ? 72  ALA B HB1  3  
ATOM 9989  H HB2  . ALA B 1 72  ? 9.582   12.447  3.345   1.00 0.00 ? 72  ALA B HB2  3  
ATOM 9990  H HB3  . ALA B 1 72  ? 10.788  13.649  2.886   1.00 0.00 ? 72  ALA B HB3  3  
ATOM 9991  N N    . SER B 1 73  ? 7.395   13.101  0.936   1.00 0.00 ? 73  SER B N    3  
ATOM 9992  C CA   . SER B 1 73  ? 6.296   12.191  0.511   1.00 0.00 ? 73  SER B CA   3  
ATOM 9993  C C    . SER B 1 73  ? 6.772   10.738  0.595   1.00 0.00 ? 73  SER B C    3  
ATOM 9994  O O    . SER B 1 73  ? 6.083   9.828   0.183   1.00 0.00 ? 73  SER B O    3  
ATOM 9995  C CB   . SER B 1 73  ? 5.895   12.512  -0.929  1.00 0.00 ? 73  SER B CB   3  
ATOM 9996  O OG   . SER B 1 73  ? 4.498   12.303  -1.086  1.00 0.00 ? 73  SER B OG   3  
ATOM 9997  H H    . SER B 1 73  ? 7.949   13.553  0.272   1.00 0.00 ? 73  SER B H    3  
ATOM 9998  H HA   . SER B 1 73  ? 5.445   12.328  1.160   1.00 0.00 ? 73  SER B HA   3  
ATOM 9999  H HB2  . SER B 1 73  ? 6.126   13.542  -1.148  1.00 0.00 ? 73  SER B HB2  3  
ATOM 10000 H HB3  . SER B 1 73  ? 6.445   11.872  -1.606  1.00 0.00 ? 73  SER B HB3  3  
ATOM 10001 H HG   . SER B 1 73  ? 4.321   11.369  -0.955  1.00 0.00 ? 73  SER B HG   3  
ATOM 10002 N N    . ALA B 1 74  ? 7.944   10.513  1.128   1.00 0.00 ? 74  ALA B N    3  
ATOM 10003 C CA   . ALA B 1 74  ? 8.458   9.118   1.233   1.00 0.00 ? 74  ALA B CA   3  
ATOM 10004 C C    . ALA B 1 74  ? 7.905   8.450   2.496   1.00 0.00 ? 74  ALA B C    3  
ATOM 10005 O O    . ALA B 1 74  ? 8.612   7.771   3.210   1.00 0.00 ? 74  ALA B O    3  
ATOM 10006 C CB   . ALA B 1 74  ? 9.985   9.140   1.296   1.00 0.00 ? 74  ALA B CB   3  
ATOM 10007 H H    . ALA B 1 74  ? 8.486   11.261  1.456   1.00 0.00 ? 74  ALA B H    3  
ATOM 10008 H HA   . ALA B 1 74  ? 8.145   8.555   0.366   1.00 0.00 ? 74  ALA B HA   3  
ATOM 10009 H HB1  . ALA B 1 74  ? 10.311  10.024  1.823   1.00 0.00 ? 74  ALA B HB1  3  
ATOM 10010 H HB2  . ALA B 1 74  ? 10.336  8.261   1.816   1.00 0.00 ? 74  ALA B HB2  3  
ATOM 10011 H HB3  . ALA B 1 74  ? 10.386  9.150   0.294   1.00 0.00 ? 74  ALA B HB3  3  
ATOM 10012 N N    . ALA B 1 75  ? 6.645   8.632   2.769   1.00 0.00 ? 75  ALA B N    3  
ATOM 10013 C CA   . ALA B 1 75  ? 6.036   7.999   3.975   1.00 0.00 ? 75  ALA B CA   3  
ATOM 10014 C C    . ALA B 1 75  ? 5.481   6.626   3.574   1.00 0.00 ? 75  ALA B C    3  
ATOM 10015 O O    . ALA B 1 75  ? 5.646   6.212   2.443   1.00 0.00 ? 75  ALA B O    3  
ATOM 10016 C CB   . ALA B 1 75  ? 4.906   8.893   4.487   1.00 0.00 ? 75  ALA B CB   3  
ATOM 10017 H H    . ALA B 1 75  ? 6.093   9.176   2.176   1.00 0.00 ? 75  ALA B H    3  
ATOM 10018 H HA   . ALA B 1 75  ? 6.788   7.881   4.742   1.00 0.00 ? 75  ALA B HA   3  
ATOM 10019 H HB1  . ALA B 1 75  ? 4.912   9.827   3.944   1.00 0.00 ? 75  ALA B HB1  3  
ATOM 10020 H HB2  . ALA B 1 75  ? 3.958   8.396   4.338   1.00 0.00 ? 75  ALA B HB2  3  
ATOM 10021 H HB3  . ALA B 1 75  ? 5.049   9.087   5.539   1.00 0.00 ? 75  ALA B HB3  3  
ATOM 10022 N N    . PRO B 1 76  ? 4.835   5.954   4.499   1.00 0.00 ? 76  PRO B N    3  
ATOM 10023 C CA   . PRO B 1 76  ? 4.251   4.627   4.233   1.00 0.00 ? 76  PRO B CA   3  
ATOM 10024 C C    . PRO B 1 76  ? 2.963   4.790   3.436   1.00 0.00 ? 76  PRO B C    3  
ATOM 10025 O O    . PRO B 1 76  ? 2.626   5.877   3.009   1.00 0.00 ? 76  PRO B O    3  
ATOM 10026 C CB   . PRO B 1 76  ? 3.964   4.066   5.624   1.00 0.00 ? 76  PRO B CB   3  
ATOM 10027 C CG   . PRO B 1 76  ? 3.858   5.285   6.562   1.00 0.00 ? 76  PRO B CG   3  
ATOM 10028 C CD   . PRO B 1 76  ? 4.618   6.440   5.878   1.00 0.00 ? 76  PRO B CD   3  
ATOM 10029 H HA   . PRO B 1 76  ? 4.948   3.993   3.710   1.00 0.00 ? 76  PRO B HA   3  
ATOM 10030 H HB2  . PRO B 1 76  ? 3.033   3.514   5.616   1.00 0.00 ? 76  PRO B HB2  3  
ATOM 10031 H HB3  . PRO B 1 76  ? 4.774   3.429   5.943   1.00 0.00 ? 76  PRO B HB3  3  
ATOM 10032 H HG2  . PRO B 1 76  ? 2.818   5.552   6.695   1.00 0.00 ? 76  PRO B HG2  3  
ATOM 10033 H HG3  . PRO B 1 76  ? 4.309   5.058   7.512   1.00 0.00 ? 76  PRO B HG3  3  
ATOM 10034 H HD2  . PRO B 1 76  ? 4.013   7.333   5.881   1.00 0.00 ? 76  PRO B HD2  3  
ATOM 10035 H HD3  . PRO B 1 76  ? 5.563   6.616   6.366   1.00 0.00 ? 76  PRO B HD3  3  
ATOM 10036 N N    . CYS B 1 77  ? 2.241   3.731   3.216   1.00 0.00 ? 77  CYS B N    3  
ATOM 10037 C CA   . CYS B 1 77  ? 0.993   3.871   2.429   1.00 0.00 ? 77  CYS B CA   3  
ATOM 10038 C C    . CYS B 1 77  ? -0.083  2.895   2.913   1.00 0.00 ? 77  CYS B C    3  
ATOM 10039 O O    . CYS B 1 77  ? -0.140  1.762   2.482   1.00 0.00 ? 77  CYS B O    3  
ATOM 10040 C CB   . CYS B 1 77  ? 1.307   3.603   0.960   1.00 0.00 ? 77  CYS B CB   3  
ATOM 10041 S SG   . CYS B 1 77  ? 1.034   5.117   0.011   1.00 0.00 ? 77  CYS B SG   3  
ATOM 10042 H H    . CYS B 1 77  ? 2.522   2.856   3.555   1.00 0.00 ? 77  CYS B H    3  
ATOM 10043 H HA   . CYS B 1 77  ? 0.624   4.881   2.529   1.00 0.00 ? 77  CYS B HA   3  
ATOM 10044 H HB2  . CYS B 1 77  ? 2.338   3.297   0.862   1.00 0.00 ? 77  CYS B HB2  3  
ATOM 10045 H HB3  . CYS B 1 77  ? 0.662   2.823   0.590   1.00 0.00 ? 77  CYS B HB3  3  
ATOM 10046 N N    . CYS B 1 78  ? -0.951  3.329   3.789   1.00 0.00 ? 78  CYS B N    3  
ATOM 10047 C CA   . CYS B 1 78  ? -2.040  2.420   4.261   1.00 0.00 ? 78  CYS B CA   3  
ATOM 10048 C C    . CYS B 1 78  ? -2.775  1.867   3.028   1.00 0.00 ? 78  CYS B C    3  
ATOM 10049 O O    . CYS B 1 78  ? -3.027  2.587   2.082   1.00 0.00 ? 78  CYS B O    3  
ATOM 10050 C CB   . CYS B 1 78  ? -3.021  3.205   5.144   1.00 0.00 ? 78  CYS B CB   3  
ATOM 10051 S SG   . CYS B 1 78  ? -4.278  2.081   5.801   1.00 0.00 ? 78  CYS B SG   3  
ATOM 10052 H H    . CYS B 1 78  ? -0.894  4.253   4.123   1.00 0.00 ? 78  CYS B H    3  
ATOM 10053 H HA   . CYS B 1 78  ? -1.610  1.607   4.824   1.00 0.00 ? 78  CYS B HA   3  
ATOM 10054 H HB2  . CYS B 1 78  ? -2.484  3.659   5.962   1.00 0.00 ? 78  CYS B HB2  3  
ATOM 10055 H HB3  . CYS B 1 78  ? -3.504  3.976   4.558   1.00 0.00 ? 78  CYS B HB3  3  
ATOM 10056 N N    . VAL B 1 79  ? -3.103  0.597   3.010   1.00 0.00 ? 79  VAL B N    3  
ATOM 10057 C CA   . VAL B 1 79  ? -3.794  0.029   1.812   1.00 0.00 ? 79  VAL B CA   3  
ATOM 10058 C C    . VAL B 1 79  ? -4.834  -1.025  2.233   1.00 0.00 ? 79  VAL B C    3  
ATOM 10059 O O    . VAL B 1 79  ? -4.913  -1.385  3.384   1.00 0.00 ? 79  VAL B O    3  
ATOM 10060 C CB   . VAL B 1 79  ? -2.741  -0.602  0.891   1.00 0.00 ? 79  VAL B CB   3  
ATOM 10061 C CG1  . VAL B 1 79  ? -1.473  0.239   0.930   1.00 0.00 ? 79  VAL B CG1  3  
ATOM 10062 C CG2  . VAL B 1 79  ? -2.401  -2.019  1.360   1.00 0.00 ? 79  VAL B CG2  3  
ATOM 10063 H H    . VAL B 1 79  ? -2.884  0.022   3.764   1.00 0.00 ? 79  VAL B H    3  
ATOM 10064 H HA   . VAL B 1 79  ? -4.290  0.826   1.289   1.00 0.00 ? 79  VAL B HA   3  
ATOM 10065 H HB   . VAL B 1 79  ? -3.112  -0.631  -0.120  1.00 0.00 ? 79  VAL B HB   3  
ATOM 10066 H HG11 . VAL B 1 79  ? -1.735  1.280   1.040   1.00 0.00 ? 79  VAL B HG11 3  
ATOM 10067 H HG12 . VAL B 1 79  ? -0.864  -0.070  1.768   1.00 0.00 ? 79  VAL B HG12 3  
ATOM 10068 H HG13 . VAL B 1 79  ? -0.924  0.100   0.014   1.00 0.00 ? 79  VAL B HG13 3  
ATOM 10069 H HG21 . VAL B 1 79  ? -2.170  -2.004  2.415   1.00 0.00 ? 79  VAL B HG21 3  
ATOM 10070 H HG22 . VAL B 1 79  ? -3.245  -2.669  1.184   1.00 0.00 ? 79  VAL B HG22 3  
ATOM 10071 H HG23 . VAL B 1 79  ? -1.545  -2.384  0.810   1.00 0.00 ? 79  VAL B HG23 3  
ATOM 10072 N N    . PRO B 1 80  ? -5.608  -1.484  1.279   1.00 0.00 ? 80  PRO B N    3  
ATOM 10073 C CA   . PRO B 1 80  ? -6.656  -2.494  1.519   1.00 0.00 ? 80  PRO B CA   3  
ATOM 10074 C C    . PRO B 1 80  ? -6.052  -3.902  1.539   1.00 0.00 ? 80  PRO B C    3  
ATOM 10075 O O    . PRO B 1 80  ? -5.793  -4.489  0.507   1.00 0.00 ? 80  PRO B O    3  
ATOM 10076 C CB   . PRO B 1 80  ? -7.590  -2.329  0.321   1.00 0.00 ? 80  PRO B CB   3  
ATOM 10077 C CG   . PRO B 1 80  ? -6.753  -1.669  -0.799  1.00 0.00 ? 80  PRO B CG   3  
ATOM 10078 C CD   . PRO B 1 80  ? -5.522  -1.038  -0.125  1.00 0.00 ? 80  PRO B CD   3  
ATOM 10079 H HA   . PRO B 1 80  ? -7.190  -2.289  2.432   1.00 0.00 ? 80  PRO B HA   3  
ATOM 10080 H HB2  . PRO B 1 80  ? -7.952  -3.297  -0.001  1.00 0.00 ? 80  PRO B HB2  3  
ATOM 10081 H HB3  . PRO B 1 80  ? -8.417  -1.689  0.581   1.00 0.00 ? 80  PRO B HB3  3  
ATOM 10082 H HG2  . PRO B 1 80  ? -6.442  -2.417  -1.517  1.00 0.00 ? 80  PRO B HG2  3  
ATOM 10083 H HG3  . PRO B 1 80  ? -7.330  -0.905  -1.288  1.00 0.00 ? 80  PRO B HG3  3  
ATOM 10084 H HD2  . PRO B 1 80  ? -4.620  -1.407  -0.585  1.00 0.00 ? 80  PRO B HD2  3  
ATOM 10085 H HD3  . PRO B 1 80  ? -5.566  0.040   -0.180  1.00 0.00 ? 80  PRO B HD3  3  
ATOM 10086 N N    . GLN B 1 81  ? -5.832  -4.452  2.702   1.00 0.00 ? 81  GLN B N    3  
ATOM 10087 C CA   . GLN B 1 81  ? -5.255  -5.821  2.780   1.00 0.00 ? 81  GLN B CA   3  
ATOM 10088 C C    . GLN B 1 81  ? -6.259  -6.818  2.200   1.00 0.00 ? 81  GLN B C    3  
ATOM 10089 O O    . GLN B 1 81  ? -6.035  -7.407  1.161   1.00 0.00 ? 81  GLN B O    3  
ATOM 10090 C CB   . GLN B 1 81  ? -4.973  -6.167  4.243   1.00 0.00 ? 81  GLN B CB   3  
ATOM 10091 C CG   . GLN B 1 81  ? -4.626  -7.650  4.357   1.00 0.00 ? 81  GLN B CG   3  
ATOM 10092 C CD   . GLN B 1 81  ? -4.522  -8.039  5.832   1.00 0.00 ? 81  GLN B CD   3  
ATOM 10093 O OE1  . GLN B 1 81  ? -4.561  -7.191  6.701   1.00 0.00 ? 81  GLN B OE1  3  
ATOM 10094 N NE2  . GLN B 1 81  ? -4.390  -9.297  6.155   1.00 0.00 ? 81  GLN B NE2  3  
ATOM 10095 H H    . GLN B 1 81  ? -6.051  -3.969  3.521   1.00 0.00 ? 81  GLN B H    3  
ATOM 10096 H HA   . GLN B 1 81  ? -4.336  -5.860  2.215   1.00 0.00 ? 81  GLN B HA   3  
ATOM 10097 H HB2  . GLN B 1 81  ? -4.144  -5.572  4.600   1.00 0.00 ? 81  GLN B HB2  3  
ATOM 10098 H HB3  . GLN B 1 81  ? -5.850  -5.957  4.838   1.00 0.00 ? 81  GLN B HB3  3  
ATOM 10099 H HG2  . GLN B 1 81  ? -5.399  -8.235  3.881   1.00 0.00 ? 81  GLN B HG2  3  
ATOM 10100 H HG3  . GLN B 1 81  ? -3.682  -7.834  3.869   1.00 0.00 ? 81  GLN B HG3  3  
ATOM 10101 H HE21 . GLN B 1 81  ? -4.358  -9.982  5.455   1.00 0.00 ? 81  GLN B HE21 3  
ATOM 10102 H HE22 . GLN B 1 81  ? -4.321  -9.557  7.097   1.00 0.00 ? 81  GLN B HE22 3  
ATOM 10103 N N    . ALA B 1 82  ? -7.371  -7.001  2.858   1.00 0.00 ? 82  ALA B N    3  
ATOM 10104 C CA   . ALA B 1 82  ? -8.397  -7.948  2.339   1.00 0.00 ? 82  ALA B CA   3  
ATOM 10105 C C    . ALA B 1 82  ? -9.380  -7.175  1.457   1.00 0.00 ? 82  ALA B C    3  
ATOM 10106 O O    . ALA B 1 82  ? -9.482  -5.968  1.541   1.00 0.00 ? 82  ALA B O    3  
ATOM 10107 C CB   . ALA B 1 82  ? -9.148  -8.582  3.511   1.00 0.00 ? 82  ALA B CB   3  
ATOM 10108 H H    . ALA B 1 82  ? -7.536  -6.508  3.688   1.00 0.00 ? 82  ALA B H    3  
ATOM 10109 H HA   . ALA B 1 82  ? -7.916  -8.719  1.756   1.00 0.00 ? 82  ALA B HA   3  
ATOM 10110 H HB1  . ALA B 1 82  ? -8.550  -8.504  4.407   1.00 0.00 ? 82  ALA B HB1  3  
ATOM 10111 H HB2  . ALA B 1 82  ? -10.086 -8.066  3.659   1.00 0.00 ? 82  ALA B HB2  3  
ATOM 10112 H HB3  . ALA B 1 82  ? -9.340  -9.622  3.296   1.00 0.00 ? 82  ALA B HB3  3  
ATOM 10113 N N    . LEU B 1 83  ? -10.100 -7.855  0.606   1.00 0.00 ? 83  LEU B N    3  
ATOM 10114 C CA   . LEU B 1 83  ? -11.065 -7.141  -0.275  1.00 0.00 ? 83  LEU B CA   3  
ATOM 10115 C C    . LEU B 1 83  ? -12.334 -7.969  -0.438  1.00 0.00 ? 83  LEU B C    3  
ATOM 10116 O O    . LEU B 1 83  ? -12.558 -8.943  0.254   1.00 0.00 ? 83  LEU B O    3  
ATOM 10117 C CB   . LEU B 1 83  ? -10.436 -6.924  -1.653  1.00 0.00 ? 83  LEU B CB   3  
ATOM 10118 C CG   . LEU B 1 83  ? -9.246  -5.980  -1.525  1.00 0.00 ? 83  LEU B CG   3  
ATOM 10119 C CD1  . LEU B 1 83  ? -8.200  -6.326  -2.585  1.00 0.00 ? 83  LEU B CD1  3  
ATOM 10120 C CD2  . LEU B 1 83  ? -9.719  -4.542  -1.732  1.00 0.00 ? 83  LEU B CD2  3  
ATOM 10121 H H    . LEU B 1 83  ? -10.005 -8.827  0.545   1.00 0.00 ? 83  LEU B H    3  
ATOM 10122 H HA   . LEU B 1 83  ? -11.311 -6.185  0.160   1.00 0.00 ? 83  LEU B HA   3  
ATOM 10123 H HB2  . LEU B 1 83  ? -10.107 -7.870  -2.054  1.00 0.00 ? 83  LEU B HB2  3  
ATOM 10124 H HB3  . LEU B 1 83  ? -11.166 -6.487  -2.318  1.00 0.00 ? 83  LEU B HB3  3  
ATOM 10125 H HG   . LEU B 1 83  ? -8.817  -6.082  -0.542  1.00 0.00 ? 83  LEU B HG   3  
ATOM 10126 H HD11 . LEU B 1 83  ? -7.927  -7.367  -2.496  1.00 0.00 ? 83  LEU B HD11 3  
ATOM 10127 H HD12 . LEU B 1 83  ? -8.609  -6.143  -3.568  1.00 0.00 ? 83  LEU B HD12 3  
ATOM 10128 H HD13 . LEU B 1 83  ? -7.324  -5.710  -2.441  1.00 0.00 ? 83  LEU B HD13 3  
ATOM 10129 H HD21 . LEU B 1 83  ? -10.490 -4.523  -2.488  1.00 0.00 ? 83  LEU B HD21 3  
ATOM 10130 H HD22 . LEU B 1 83  ? -10.114 -4.156  -0.804  1.00 0.00 ? 83  LEU B HD22 3  
ATOM 10131 H HD23 . LEU B 1 83  ? -8.888  -3.933  -2.052  1.00 0.00 ? 83  LEU B HD23 3  
ATOM 10132 N N    . GLU B 1 84  ? -13.160 -7.582  -1.363  1.00 0.00 ? 84  GLU B N    3  
ATOM 10133 C CA   . GLU B 1 84  ? -14.424 -8.325  -1.614  1.00 0.00 ? 84  GLU B CA   3  
ATOM 10134 C C    . GLU B 1 84  ? -14.769 -8.210  -3.099  1.00 0.00 ? 84  GLU B C    3  
ATOM 10135 O O    . GLU B 1 84  ? -14.314 -7.304  -3.765  1.00 0.00 ? 84  GLU B O    3  
ATOM 10136 C CB   . GLU B 1 84  ? -15.551 -7.718  -0.774  1.00 0.00 ? 84  GLU B CB   3  
ATOM 10137 C CG   . GLU B 1 84  ? -15.774 -8.571  0.476   1.00 0.00 ? 84  GLU B CG   3  
ATOM 10138 C CD   . GLU B 1 84  ? -16.572 -7.769  1.506   1.00 0.00 ? 84  GLU B CD   3  
ATOM 10139 O OE1  . GLU B 1 84  ? -16.629 -6.558  1.369   1.00 0.00 ? 84  GLU B OE1  3  
ATOM 10140 O OE2  . GLU B 1 84  ? -17.111 -8.380  2.414   1.00 0.00 ? 84  GLU B OE2  3  
ATOM 10141 H H    . GLU B 1 84  ? -12.939 -6.795  -1.904  1.00 0.00 ? 84  GLU B H    3  
ATOM 10142 H HA   . GLU B 1 84  ? -14.292 -9.364  -1.350  1.00 0.00 ? 84  GLU B HA   3  
ATOM 10143 H HB2  . GLU B 1 84  ? -15.281 -6.713  -0.482  1.00 0.00 ? 84  GLU B HB2  3  
ATOM 10144 H HB3  . GLU B 1 84  ? -16.460 -7.692  -1.357  1.00 0.00 ? 84  GLU B HB3  3  
ATOM 10145 H HG2  . GLU B 1 84  ? -16.322 -9.463  0.210   1.00 0.00 ? 84  GLU B HG2  3  
ATOM 10146 H HG3  . GLU B 1 84  ? -14.820 -8.847  0.899   1.00 0.00 ? 84  GLU B HG3  3  
ATOM 10147 N N    . PRO B 1 85  ? -15.559 -9.134  -3.578  1.00 0.00 ? 85  PRO B N    3  
ATOM 10148 C CA   . PRO B 1 85  ? -15.975 -9.163  -4.989  1.00 0.00 ? 85  PRO B CA   3  
ATOM 10149 C C    . PRO B 1 85  ? -17.029 -8.086  -5.265  1.00 0.00 ? 85  PRO B C    3  
ATOM 10150 O O    . PRO B 1 85  ? -17.227 -7.183  -4.478  1.00 0.00 ? 85  PRO B O    3  
ATOM 10151 C CB   . PRO B 1 85  ? -16.542 -10.572 -5.171  1.00 0.00 ? 85  PRO B CB   3  
ATOM 10152 C CG   . PRO B 1 85  ? -16.924 -11.072 -3.759  1.00 0.00 ? 85  PRO B CG   3  
ATOM 10153 C CD   . PRO B 1 85  ? -16.113 -10.228 -2.757  1.00 0.00 ? 85  PRO B CD   3  
ATOM 10154 H HA   . PRO B 1 85  ? -15.122 -9.027  -5.634  1.00 0.00 ? 85  PRO B HA   3  
ATOM 10155 H HB2  . PRO B 1 85  ? -17.417 -10.539 -5.807  1.00 0.00 ? 85  PRO B HB2  3  
ATOM 10156 H HB3  . PRO B 1 85  ? -15.795 -11.222 -5.598  1.00 0.00 ? 85  PRO B HB3  3  
ATOM 10157 H HG2  . PRO B 1 85  ? -17.982 -10.934 -3.593  1.00 0.00 ? 85  PRO B HG2  3  
ATOM 10158 H HG3  . PRO B 1 85  ? -16.661 -12.113 -3.653  1.00 0.00 ? 85  PRO B HG3  3  
ATOM 10159 H HD2  . PRO B 1 85  ? -16.760 -9.835  -1.985  1.00 0.00 ? 85  PRO B HD2  3  
ATOM 10160 H HD3  . PRO B 1 85  ? -15.315 -10.812 -2.327  1.00 0.00 ? 85  PRO B HD3  3  
ATOM 10161 N N    . LEU B 1 86  ? -17.690 -8.160  -6.389  1.00 0.00 ? 86  LEU B N    3  
ATOM 10162 C CA   . LEU B 1 86  ? -18.707 -7.123  -6.721  1.00 0.00 ? 86  LEU B CA   3  
ATOM 10163 C C    . LEU B 1 86  ? -19.589 -7.629  -7.877  1.00 0.00 ? 86  LEU B C    3  
ATOM 10164 O O    . LEU B 1 86  ? -19.140 -7.705  -9.000  1.00 0.00 ? 86  LEU B O    3  
ATOM 10165 C CB   . LEU B 1 86  ? -17.946 -5.833  -7.105  1.00 0.00 ? 86  LEU B CB   3  
ATOM 10166 C CG   . LEU B 1 86  ? -18.697 -4.997  -8.156  1.00 0.00 ? 86  LEU B CG   3  
ATOM 10167 C CD1  . LEU B 1 86  ? -19.664 -4.031  -7.476  1.00 0.00 ? 86  LEU B CD1  3  
ATOM 10168 C CD2  . LEU B 1 86  ? -17.683 -4.186  -8.962  1.00 0.00 ? 86  LEU B CD2  3  
ATOM 10169 H H    . LEU B 1 86  ? -17.505 -8.884  -7.024  1.00 0.00 ? 86  LEU B H    3  
ATOM 10170 H HA   . LEU B 1 86  ? -19.318 -6.931  -5.853  1.00 0.00 ? 86  LEU B HA   3  
ATOM 10171 H HB2  . LEU B 1 86  ? -17.810 -5.232  -6.218  1.00 0.00 ? 86  LEU B HB2  3  
ATOM 10172 H HB3  . LEU B 1 86  ? -16.978 -6.102  -7.495  1.00 0.00 ? 86  LEU B HB3  3  
ATOM 10173 H HG   . LEU B 1 86  ? -19.242 -5.641  -8.816  1.00 0.00 ? 86  LEU B HG   3  
ATOM 10174 H HD11 . LEU B 1 86  ? -20.298 -4.576  -6.795  1.00 0.00 ? 86  LEU B HD11 3  
ATOM 10175 H HD12 . LEU B 1 86  ? -19.102 -3.286  -6.933  1.00 0.00 ? 86  LEU B HD12 3  
ATOM 10176 H HD13 . LEU B 1 86  ? -20.271 -3.547  -8.228  1.00 0.00 ? 86  LEU B HD13 3  
ATOM 10177 H HD21 . LEU B 1 86  ? -16.715 -4.662  -8.906  1.00 0.00 ? 86  LEU B HD21 3  
ATOM 10178 H HD22 . LEU B 1 86  ? -17.999 -4.134  -9.993  1.00 0.00 ? 86  LEU B HD22 3  
ATOM 10179 H HD23 . LEU B 1 86  ? -17.617 -3.189  -8.556  1.00 0.00 ? 86  LEU B HD23 3  
ATOM 10180 N N    . PRO B 1 87  ? -20.823 -7.952  -7.570  1.00 0.00 ? 87  PRO B N    3  
ATOM 10181 C CA   . PRO B 1 87  ? -21.787 -8.442  -8.574  1.00 0.00 ? 87  PRO B CA   3  
ATOM 10182 C C    . PRO B 1 87  ? -22.262 -7.278  -9.442  1.00 0.00 ? 87  PRO B C    3  
ATOM 10183 O O    . PRO B 1 87  ? -22.918 -6.369  -8.975  1.00 0.00 ? 87  PRO B O    3  
ATOM 10184 C CB   . PRO B 1 87  ? -22.929 -9.016  -7.730  1.00 0.00 ? 87  PRO B CB   3  
ATOM 10185 C CG   . PRO B 1 87  ? -22.828 -8.338  -6.344  1.00 0.00 ? 87  PRO B CG   3  
ATOM 10186 C CD   . PRO B 1 87  ? -21.375 -7.847  -6.203  1.00 0.00 ? 87  PRO B CD   3  
ATOM 10187 H HA   . PRO B 1 87  ? -21.353 -9.218  -9.185  1.00 0.00 ? 87  PRO B HA   3  
ATOM 10188 H HB2  . PRO B 1 87  ? -23.881 -8.786  -8.191  1.00 0.00 ? 87  PRO B HB2  3  
ATOM 10189 H HB3  . PRO B 1 87  ? -22.815 -10.083 -7.623  1.00 0.00 ? 87  PRO B HB3  3  
ATOM 10190 H HG2  . PRO B 1 87  ? -23.513 -7.503  -6.290  1.00 0.00 ? 87  PRO B HG2  3  
ATOM 10191 H HG3  . PRO B 1 87  ? -23.048 -9.053  -5.566  1.00 0.00 ? 87  PRO B HG3  3  
ATOM 10192 H HD2  . PRO B 1 87  ? -21.355 -6.822  -5.861  1.00 0.00 ? 87  PRO B HD2  3  
ATOM 10193 H HD3  . PRO B 1 87  ? -20.823 -8.484  -5.529  1.00 0.00 ? 87  PRO B HD3  3  
ATOM 10194 N N    . ILE B 1 88  ? -21.912 -7.288  -10.697 1.00 0.00 ? 88  ILE B N    3  
ATOM 10195 C CA   . ILE B 1 88  ? -22.321 -6.168  -11.585 1.00 0.00 ? 88  ILE B CA   3  
ATOM 10196 C C    . ILE B 1 88  ? -23.062 -6.696  -12.807 1.00 0.00 ? 88  ILE B C    3  
ATOM 10197 O O    . ILE B 1 88  ? -23.528 -7.815  -12.846 1.00 0.00 ? 88  ILE B O    3  
ATOM 10198 C CB   . ILE B 1 88  ? -21.070 -5.422  -12.059 1.00 0.00 ? 88  ILE B CB   3  
ATOM 10199 C CG1  . ILE B 1 88  ? -20.390 -6.211  -13.183 1.00 0.00 ? 88  ILE B CG1  3  
ATOM 10200 C CG2  . ILE B 1 88  ? -20.097 -5.284  -10.899 1.00 0.00 ? 88  ILE B CG2  3  
ATOM 10201 C CD1  . ILE B 1 88  ? -19.017 -5.617  -13.471 1.00 0.00 ? 88  ILE B CD1  3  
ATOM 10202 H H    . ILE B 1 88  ? -21.367 -8.021  -11.051 1.00 0.00 ? 88  ILE B H    3  
ATOM 10203 H HA   . ILE B 1 88  ? -22.958 -5.488  -11.041 1.00 0.00 ? 88  ILE B HA   3  
ATOM 10204 H HB   . ILE B 1 88  ? -21.347 -4.441  -12.420 1.00 0.00 ? 88  ILE B HB   3  
ATOM 10205 H HG12 . ILE B 1 88  ? -20.285 -7.239  -12.883 1.00 0.00 ? 88  ILE B HG12 3  
ATOM 10206 H HG13 . ILE B 1 88  ? -20.990 -6.162  -14.073 1.00 0.00 ? 88  ILE B HG13 3  
ATOM 10207 H HG21 . ILE B 1 88  ? -20.647 -5.237  -9.973  1.00 0.00 ? 88  ILE B HG21 3  
ATOM 10208 H HG22 . ILE B 1 88  ? -19.435 -6.139  -10.883 1.00 0.00 ? 88  ILE B HG22 3  
ATOM 10209 H HG23 . ILE B 1 88  ? -19.517 -4.382  -11.024 1.00 0.00 ? 88  ILE B HG23 3  
ATOM 10210 H HD11 . ILE B 1 88  ? -18.996 -4.590  -13.143 1.00 0.00 ? 88  ILE B HD11 3  
ATOM 10211 H HD12 . ILE B 1 88  ? -18.264 -6.181  -12.944 1.00 0.00 ? 88  ILE B HD12 3  
ATOM 10212 H HD13 . ILE B 1 88  ? -18.823 -5.659  -14.533 1.00 0.00 ? 88  ILE B HD13 3  
ATOM 10213 N N    . VAL B 1 89  ? -23.125 -5.877  -13.816 1.00 0.00 ? 89  VAL B N    3  
ATOM 10214 C CA   . VAL B 1 89  ? -23.786 -6.259  -15.088 1.00 0.00 ? 89  VAL B CA   3  
ATOM 10215 C C    . VAL B 1 89  ? -23.347 -5.263  -16.156 1.00 0.00 ? 89  VAL B C    3  
ATOM 10216 O O    . VAL B 1 89  ? -23.708 -4.104  -16.113 1.00 0.00 ? 89  VAL B O    3  
ATOM 10217 C CB   . VAL B 1 89  ? -25.308 -6.192  -14.957 1.00 0.00 ? 89  VAL B CB   3  
ATOM 10218 C CG1  . VAL B 1 89  ? -25.940 -6.874  -16.168 1.00 0.00 ? 89  VAL B CG1  3  
ATOM 10219 C CG2  . VAL B 1 89  ? -25.765 -6.895  -13.677 1.00 0.00 ? 89  VAL B CG2  3  
ATOM 10220 H H    . VAL B 1 89  ? -22.703 -4.999  -13.741 1.00 0.00 ? 89  VAL B H    3  
ATOM 10221 H HA   . VAL B 1 89  ? -23.477 -7.255  -15.370 1.00 0.00 ? 89  VAL B HA   3  
ATOM 10222 H HB   . VAL B 1 89  ? -25.617 -5.156  -14.930 1.00 0.00 ? 89  VAL B HB   3  
ATOM 10223 H HG11 . VAL B 1 89  ? -25.204 -7.504  -16.649 1.00 0.00 ? 89  VAL B HG11 3  
ATOM 10224 H HG12 . VAL B 1 89  ? -26.775 -7.478  -15.849 1.00 0.00 ? 89  VAL B HG12 3  
ATOM 10225 H HG13 . VAL B 1 89  ? -26.282 -6.124  -16.866 1.00 0.00 ? 89  VAL B HG13 3  
ATOM 10226 H HG21 . VAL B 1 89  ? -25.411 -7.913  -13.679 1.00 0.00 ? 89  VAL B HG21 3  
ATOM 10227 H HG22 . VAL B 1 89  ? -25.368 -6.375  -12.818 1.00 0.00 ? 89  VAL B HG22 3  
ATOM 10228 H HG23 . VAL B 1 89  ? -26.844 -6.891  -13.631 1.00 0.00 ? 89  VAL B HG23 3  
ATOM 10229 N N    . TYR B 1 90  ? -22.572 -5.689  -17.105 1.00 0.00 ? 90  TYR B N    3  
ATOM 10230 C CA   . TYR B 1 90  ? -22.117 -4.740  -18.154 1.00 0.00 ? 90  TYR B CA   3  
ATOM 10231 C C    . TYR B 1 90  ? -22.583 -5.221  -19.524 1.00 0.00 ? 90  TYR B C    3  
ATOM 10232 O O    . TYR B 1 90  ? -23.336 -6.165  -19.640 1.00 0.00 ? 90  TYR B O    3  
ATOM 10233 C CB   . TYR B 1 90  ? -20.594 -4.639  -18.133 1.00 0.00 ? 90  TYR B CB   3  
ATOM 10234 C CG   . TYR B 1 90  ? -19.985 -5.995  -17.872 1.00 0.00 ? 90  TYR B CG   3  
ATOM 10235 C CD1  . TYR B 1 90  ? -19.935 -6.497  -16.568 1.00 0.00 ? 90  TYR B CD1  3  
ATOM 10236 C CD2  . TYR B 1 90  ? -19.460 -6.744  -18.931 1.00 0.00 ? 90  TYR B CD2  3  
ATOM 10237 C CE1  . TYR B 1 90  ? -19.360 -7.750  -16.319 1.00 0.00 ? 90  TYR B CE1  3  
ATOM 10238 C CE2  . TYR B 1 90  ? -18.886 -7.997  -18.683 1.00 0.00 ? 90  TYR B CE2  3  
ATOM 10239 C CZ   . TYR B 1 90  ? -18.836 -8.499  -17.377 1.00 0.00 ? 90  TYR B CZ   3  
ATOM 10240 O OH   . TYR B 1 90  ? -18.269 -9.734  -17.135 1.00 0.00 ? 90  TYR B OH   3  
ATOM 10241 H H    . TYR B 1 90  ? -22.286 -6.624  -17.128 1.00 0.00 ? 90  TYR B H    3  
ATOM 10242 H HA   . TYR B 1 90  ? -22.539 -3.763  -17.953 1.00 0.00 ? 90  TYR B HA   3  
ATOM 10243 H HB2  . TYR B 1 90  ? -20.244 -4.265  -19.083 1.00 0.00 ? 90  TYR B HB2  3  
ATOM 10244 H HB3  . TYR B 1 90  ? -20.298 -3.962  -17.350 1.00 0.00 ? 90  TYR B HB3  3  
ATOM 10245 H HD1  . TYR B 1 90  ? -20.339 -5.917  -15.754 1.00 0.00 ? 90  TYR B HD1  3  
ATOM 10246 H HD2  . TYR B 1 90  ? -19.499 -6.356  -19.938 1.00 0.00 ? 90  TYR B HD2  3  
ATOM 10247 H HE1  . TYR B 1 90  ? -19.322 -8.137  -15.310 1.00 0.00 ? 90  TYR B HE1  3  
ATOM 10248 H HE2  . TYR B 1 90  ? -18.479 -8.574  -19.498 1.00 0.00 ? 90  TYR B HE2  3  
ATOM 10249 H HH   . TYR B 1 90  ? -18.795 -10.396 -17.589 1.00 0.00 ? 90  TYR B HH   3  
ATOM 10250 N N    . TYR B 1 91  ? -22.152 -4.568  -20.564 1.00 0.00 ? 91  TYR B N    3  
ATOM 10251 C CA   . TYR B 1 91  ? -22.583 -4.980  -21.926 1.00 0.00 ? 91  TYR B CA   3  
ATOM 10252 C C    . TYR B 1 91  ? -21.378 -5.102  -22.856 1.00 0.00 ? 91  TYR B C    3  
ATOM 10253 O O    . TYR B 1 91  ? -20.595 -4.184  -23.000 1.00 0.00 ? 91  TYR B O    3  
ATOM 10254 C CB   . TYR B 1 91  ? -23.526 -3.923  -22.492 1.00 0.00 ? 91  TYR B CB   3  
ATOM 10255 C CG   . TYR B 1 91  ? -24.948 -4.292  -22.174 1.00 0.00 ? 91  TYR B CG   3  
ATOM 10256 C CD1  . TYR B 1 91  ? -25.511 -3.904  -20.957 1.00 0.00 ? 91  TYR B CD1  3  
ATOM 10257 C CD2  . TYR B 1 91  ? -25.707 -5.009  -23.104 1.00 0.00 ? 91  TYR B CD2  3  
ATOM 10258 C CE1  . TYR B 1 91  ? -26.840 -4.236  -20.664 1.00 0.00 ? 91  TYR B CE1  3  
ATOM 10259 C CE2  . TYR B 1 91  ? -27.033 -5.340  -22.819 1.00 0.00 ? 91  TYR B CE2  3  
ATOM 10260 C CZ   . TYR B 1 91  ? -27.603 -4.954  -21.598 1.00 0.00 ? 91  TYR B CZ   3  
ATOM 10261 O OH   . TYR B 1 91  ? -28.913 -5.278  -21.314 1.00 0.00 ? 91  TYR B OH   3  
ATOM 10262 H H    . TYR B 1 91  ? -21.557 -3.803  -20.447 1.00 0.00 ? 91  TYR B H    3  
ATOM 10263 H HA   . TYR B 1 91  ? -23.097 -5.927  -21.874 1.00 0.00 ? 91  TYR B HA   3  
ATOM 10264 H HB2  . TYR B 1 91  ? -23.295 -2.964  -22.053 1.00 0.00 ? 91  TYR B HB2  3  
ATOM 10265 H HB3  . TYR B 1 91  ? -23.400 -3.868  -23.563 1.00 0.00 ? 91  TYR B HB3  3  
ATOM 10266 H HD1  . TYR B 1 91  ? -24.916 -3.354  -20.240 1.00 0.00 ? 91  TYR B HD1  3  
ATOM 10267 H HD2  . TYR B 1 91  ? -25.266 -5.311  -24.039 1.00 0.00 ? 91  TYR B HD2  3  
ATOM 10268 H HE1  . TYR B 1 91  ? -27.278 -3.939  -19.724 1.00 0.00 ? 91  TYR B HE1  3  
ATOM 10269 H HE2  . TYR B 1 91  ? -27.616 -5.891  -23.541 1.00 0.00 ? 91  TYR B HE2  3  
ATOM 10270 H HH   . TYR B 1 91  ? -29.428 -5.167  -22.117 1.00 0.00 ? 91  TYR B HH   3  
ATOM 10271 N N    . VAL B 1 92  ? -21.249 -6.215  -23.520 1.00 0.00 ? 92  VAL B N    3  
ATOM 10272 C CA   . VAL B 1 92  ? -20.124 -6.381  -24.476 1.00 0.00 ? 92  VAL B CA   3  
ATOM 10273 C C    . VAL B 1 92  ? -20.675 -6.159  -25.877 1.00 0.00 ? 92  VAL B C    3  
ATOM 10274 O O    . VAL B 1 92  ? -21.178 -7.066  -26.510 1.00 0.00 ? 92  VAL B O    3  
ATOM 10275 C CB   . VAL B 1 92  ? -19.542 -7.787  -24.376 1.00 0.00 ? 92  VAL B CB   3  
ATOM 10276 C CG1  . VAL B 1 92  ? -18.058 -7.731  -24.727 1.00 0.00 ? 92  VAL B CG1  3  
ATOM 10277 C CG2  . VAL B 1 92  ? -19.718 -8.316  -22.952 1.00 0.00 ? 92  VAL B CG2  3  
ATOM 10278 H H    . VAL B 1 92  ? -21.909 -6.929  -23.411 1.00 0.00 ? 92  VAL B H    3  
ATOM 10279 H HA   . VAL B 1 92  ? -19.356 -5.651  -24.266 1.00 0.00 ? 92  VAL B HA   3  
ATOM 10280 H HB   . VAL B 1 92  ? -20.052 -8.438  -25.072 1.00 0.00 ? 92  VAL B HB   3  
ATOM 10281 H HG11 . VAL B 1 92  ? -17.778 -6.708  -24.936 1.00 0.00 ? 92  VAL B HG11 3  
ATOM 10282 H HG12 . VAL B 1 92  ? -17.477 -8.100  -23.896 1.00 0.00 ? 92  VAL B HG12 3  
ATOM 10283 H HG13 . VAL B 1 92  ? -17.871 -8.338  -25.599 1.00 0.00 ? 92  VAL B HG13 3  
ATOM 10284 H HG21 . VAL B 1 92  ? -19.324 -7.598  -22.249 1.00 0.00 ? 92  VAL B HG21 3  
ATOM 10285 H HG22 . VAL B 1 92  ? -20.768 -8.474  -22.754 1.00 0.00 ? 92  VAL B HG22 3  
ATOM 10286 H HG23 . VAL B 1 92  ? -19.188 -9.250  -22.847 1.00 0.00 ? 92  VAL B HG23 3  
ATOM 10287 N N    . GLY B 1 93  ? -20.615 -4.953  -26.353 1.00 0.00 ? 93  GLY B N    3  
ATOM 10288 C CA   . GLY B 1 93  ? -21.170 -4.660  -27.701 1.00 0.00 ? 93  GLY B CA   3  
ATOM 10289 C C    . GLY B 1 93  ? -22.693 -4.544  -27.581 1.00 0.00 ? 93  GLY B C    3  
ATOM 10290 O O    . GLY B 1 93  ? -23.243 -3.461  -27.563 1.00 0.00 ? 93  GLY B O    3  
ATOM 10291 H H    . GLY B 1 93  ? -20.221 -4.236  -25.815 1.00 0.00 ? 93  GLY B H    3  
ATOM 10292 H HA2  . GLY B 1 93  ? -20.758 -3.731  -28.069 1.00 0.00 ? 93  GLY B HA2  3  
ATOM 10293 H HA3  . GLY B 1 93  ? -20.923 -5.462  -28.379 1.00 0.00 ? 93  GLY B HA3  3  
ATOM 10294 N N    . ARG B 1 94  ? -23.377 -5.655  -27.502 1.00 0.00 ? 94  ARG B N    3  
ATOM 10295 C CA   . ARG B 1 94  ? -24.867 -5.611  -27.385 1.00 0.00 ? 94  ARG B CA   3  
ATOM 10296 C C    . ARG B 1 94  ? -25.382 -6.747  -26.491 1.00 0.00 ? 94  ARG B C    3  
ATOM 10297 O O    . ARG B 1 94  ? -26.565 -6.849  -26.232 1.00 0.00 ? 94  ARG B O    3  
ATOM 10298 C CB   . ARG B 1 94  ? -25.467 -5.773  -28.775 1.00 0.00 ? 94  ARG B CB   3  
ATOM 10299 C CG   . ARG B 1 94  ? -24.924 -4.679  -29.698 1.00 0.00 ? 94  ARG B CG   3  
ATOM 10300 C CD   . ARG B 1 94  ? -25.770 -4.616  -30.970 1.00 0.00 ? 94  ARG B CD   3  
ATOM 10301 N NE   . ARG B 1 94  ? -24.942 -4.087  -32.091 1.00 0.00 ? 94  ARG B NE   3  
ATOM 10302 C CZ   . ARG B 1 94  ? -24.892 -4.730  -33.225 1.00 0.00 ? 94  ARG B CZ   3  
ATOM 10303 N NH1  . ARG B 1 94  ? -24.466 -5.964  -33.259 1.00 0.00 ? 94  ARG B NH1  3  
ATOM 10304 N NH2  . ARG B 1 94  ? -25.267 -4.139  -34.327 1.00 0.00 ? 94  ARG B NH2  3  
ATOM 10305 H H    . ARG B 1 94  ? -22.912 -6.513  -27.529 1.00 0.00 ? 94  ARG B H    3  
ATOM 10306 H HA   . ARG B 1 94  ? -25.172 -4.666  -26.968 1.00 0.00 ? 94  ARG B HA   3  
ATOM 10307 H HB2  . ARG B 1 94  ? -25.192 -6.744  -29.161 1.00 0.00 ? 94  ARG B HB2  3  
ATOM 10308 H HB3  . ARG B 1 94  ? -26.542 -5.697  -28.718 1.00 0.00 ? 94  ARG B HB3  3  
ATOM 10309 H HG2  . ARG B 1 94  ? -24.966 -3.727  -29.188 1.00 0.00 ? 94  ARG B HG2  3  
ATOM 10310 H HG3  . ARG B 1 94  ? -23.901 -4.903  -29.959 1.00 0.00 ? 94  ARG B HG3  3  
ATOM 10311 H HD2  . ARG B 1 94  ? -26.122 -5.607  -31.219 1.00 0.00 ? 94  ARG B HD2  3  
ATOM 10312 H HD3  . ARG B 1 94  ? -26.616 -3.964  -30.809 1.00 0.00 ? 94  ARG B HD3  3  
ATOM 10313 H HE   . ARG B 1 94  ? -24.434 -3.257  -31.976 1.00 0.00 ? 94  ARG B HE   3  
ATOM 10314 H HH11 . ARG B 1 94  ? -24.178 -6.416  -32.414 1.00 0.00 ? 94  ARG B HH11 3  
ATOM 10315 H HH12 . ARG B 1 94  ? -24.428 -6.456  -34.127 1.00 0.00 ? 94  ARG B HH12 3  
ATOM 10316 H HH21 . ARG B 1 94  ? -25.594 -3.195  -34.301 1.00 0.00 ? 94  ARG B HH21 3  
ATOM 10317 H HH22 . ARG B 1 94  ? -25.229 -4.632  -35.196 1.00 0.00 ? 94  ARG B HH22 3  
ATOM 10318 N N    . LYS B 1 95  ? -24.520 -7.603  -26.021 1.00 0.00 ? 95  LYS B N    3  
ATOM 10319 C CA   . LYS B 1 95  ? -24.987 -8.723  -25.154 1.00 0.00 ? 95  LYS B CA   3  
ATOM 10320 C C    . LYS B 1 95  ? -24.812 -8.341  -23.680 1.00 0.00 ? 95  LYS B C    3  
ATOM 10321 O O    . LYS B 1 95  ? -23.762 -7.873  -23.289 1.00 0.00 ? 95  LYS B O    3  
ATOM 10322 C CB   . LYS B 1 95  ? -24.161 -9.976  -25.455 1.00 0.00 ? 95  LYS B CB   3  
ATOM 10323 C CG   . LYS B 1 95  ? -24.280 -10.323 -26.940 1.00 0.00 ? 95  LYS B CG   3  
ATOM 10324 C CD   . LYS B 1 95  ? -24.637 -11.804 -27.091 1.00 0.00 ? 95  LYS B CD   3  
ATOM 10325 C CE   . LYS B 1 95  ? -24.369 -12.257 -28.529 1.00 0.00 ? 95  LYS B CE   3  
ATOM 10326 N NZ   . LYS B 1 95  ? -24.575 -11.113 -29.462 1.00 0.00 ? 95  LYS B NZ   3  
ATOM 10327 H H    . LYS B 1 95  ? -23.574 -7.515  -26.237 1.00 0.00 ? 95  LYS B H    3  
ATOM 10328 H HA   . LYS B 1 95  ? -26.027 -8.922  -25.361 1.00 0.00 ? 95  LYS B HA   3  
ATOM 10329 H HB2  . LYS B 1 95  ? -23.125 -9.790  -25.210 1.00 0.00 ? 95  LYS B HB2  3  
ATOM 10330 H HB3  . LYS B 1 95  ? -24.529 -10.801 -24.863 1.00 0.00 ? 95  LYS B HB3  3  
ATOM 10331 H HG2  . LYS B 1 95  ? -25.052 -9.718  -27.391 1.00 0.00 ? 95  LYS B HG2  3  
ATOM 10332 H HG3  . LYS B 1 95  ? -23.338 -10.132 -27.432 1.00 0.00 ? 95  LYS B HG3  3  
ATOM 10333 H HD2  . LYS B 1 95  ? -24.036 -12.390 -26.410 1.00 0.00 ? 95  LYS B HD2  3  
ATOM 10334 H HD3  . LYS B 1 95  ? -25.682 -11.946 -26.861 1.00 0.00 ? 95  LYS B HD3  3  
ATOM 10335 H HE2  . LYS B 1 95  ? -23.351 -12.608 -28.610 1.00 0.00 ? 95  LYS B HE2  3  
ATOM 10336 H HE3  . LYS B 1 95  ? -25.047 -13.058 -28.786 1.00 0.00 ? 95  LYS B HE3  3  
ATOM 10337 H HZ1  . LYS B 1 95  ? -25.441 -10.603 -29.199 1.00 0.00 ? 95  LYS B HZ1  3  
ATOM 10338 H HZ2  . LYS B 1 95  ? -23.759 -10.469 -29.405 1.00 0.00 ? 95  LYS B HZ2  3  
ATOM 10339 H HZ3  . LYS B 1 95  ? -24.666 -11.469 -30.434 1.00 0.00 ? 95  LYS B HZ3  3  
ATOM 10340 N N    . PRO B 1 96  ? -25.841 -8.557  -22.900 1.00 0.00 ? 96  PRO B N    3  
ATOM 10341 C CA   . PRO B 1 96  ? -25.817 -8.247  -21.460 1.00 0.00 ? 96  PRO B CA   3  
ATOM 10342 C C    . PRO B 1 96  ? -25.064 -9.346  -20.702 1.00 0.00 ? 96  PRO B C    3  
ATOM 10343 O O    . PRO B 1 96  ? -25.182 -10.514 -21.017 1.00 0.00 ? 96  PRO B O    3  
ATOM 10344 C CB   . PRO B 1 96  ? -27.298 -8.235  -21.070 1.00 0.00 ? 96  PRO B CB   3  
ATOM 10345 C CG   . PRO B 1 96  ? -28.036 -9.079  -22.136 1.00 0.00 ? 96  PRO B CG   3  
ATOM 10346 C CD   . PRO B 1 96  ? -27.119 -9.127  -23.373 1.00 0.00 ? 96  PRO B CD   3  
ATOM 10347 H HA   . PRO B 1 96  ? -25.376 -7.278  -21.287 1.00 0.00 ? 96  PRO B HA   3  
ATOM 10348 H HB2  . PRO B 1 96  ? -27.425 -8.673  -20.089 1.00 0.00 ? 96  PRO B HB2  3  
ATOM 10349 H HB3  . PRO B 1 96  ? -27.677 -7.226  -21.080 1.00 0.00 ? 96  PRO B HB3  3  
ATOM 10350 H HG2  . PRO B 1 96  ? -28.209 -10.079 -21.760 1.00 0.00 ? 96  PRO B HG2  3  
ATOM 10351 H HG3  . PRO B 1 96  ? -28.974 -8.612  -22.396 1.00 0.00 ? 96  PRO B HG3  3  
ATOM 10352 H HD2  . PRO B 1 96  ? -26.983 -10.149 -23.701 1.00 0.00 ? 96  PRO B HD2  3  
ATOM 10353 H HD3  . PRO B 1 96  ? -27.524 -8.522  -24.169 1.00 0.00 ? 96  PRO B HD3  3  
ATOM 10354 N N    . LYS B 1 97  ? -24.289 -8.992  -19.711 1.00 0.00 ? 97  LYS B N    3  
ATOM 10355 C CA   . LYS B 1 97  ? -23.535 -10.035 -18.957 1.00 0.00 ? 97  LYS B CA   3  
ATOM 10356 C C    . LYS B 1 97  ? -23.435 -9.647  -17.478 1.00 0.00 ? 97  LYS B C    3  
ATOM 10357 O O    . LYS B 1 97  ? -23.175 -8.511  -17.140 1.00 0.00 ? 97  LYS B O    3  
ATOM 10358 C CB   . LYS B 1 97  ? -22.121 -10.158 -19.533 1.00 0.00 ? 97  LYS B CB   3  
ATOM 10359 C CG   . LYS B 1 97  ? -22.186 -10.751 -20.941 1.00 0.00 ? 97  LYS B CG   3  
ATOM 10360 C CD   . LYS B 1 97  ? -22.050 -12.273 -20.859 1.00 0.00 ? 97  LYS B CD   3  
ATOM 10361 C CE   . LYS B 1 97  ? -22.482 -12.897 -22.186 1.00 0.00 ? 97  LYS B CE   3  
ATOM 10362 N NZ   . LYS B 1 97  ? -22.609 -14.373 -22.023 1.00 0.00 ? 97  LYS B NZ   3  
ATOM 10363 H H    . LYS B 1 97  ? -24.200 -8.048  -19.467 1.00 0.00 ? 97  LYS B H    3  
ATOM 10364 H HA   . LYS B 1 97  ? -24.042 -10.982 -19.046 1.00 0.00 ? 97  LYS B HA   3  
ATOM 10365 H HB2  . LYS B 1 97  ? -21.665 -9.179  -19.577 1.00 0.00 ? 97  LYS B HB2  3  
ATOM 10366 H HB3  . LYS B 1 97  ? -21.530 -10.802 -18.900 1.00 0.00 ? 97  LYS B HB3  3  
ATOM 10367 H HG2  . LYS B 1 97  ? -23.131 -10.498 -21.397 1.00 0.00 ? 97  LYS B HG2  3  
ATOM 10368 H HG3  . LYS B 1 97  ? -21.380 -10.352 -21.538 1.00 0.00 ? 97  LYS B HG3  3  
ATOM 10369 H HD2  . LYS B 1 97  ? -21.020 -12.531 -20.657 1.00 0.00 ? 97  LYS B HD2  3  
ATOM 10370 H HD3  . LYS B 1 97  ? -22.677 -12.648 -20.065 1.00 0.00 ? 97  LYS B HD3  3  
ATOM 10371 H HE2  . LYS B 1 97  ? -23.434 -12.485 -22.486 1.00 0.00 ? 97  LYS B HE2  3  
ATOM 10372 H HE3  . LYS B 1 97  ? -21.742 -12.681 -22.943 1.00 0.00 ? 97  LYS B HE3  3  
ATOM 10373 H HZ1  . LYS B 1 97  ? -22.424 -14.630 -21.033 1.00 0.00 ? 97  LYS B HZ1  3  
ATOM 10374 H HZ2  . LYS B 1 97  ? -23.573 -14.669 -22.285 1.00 0.00 ? 97  LYS B HZ2  3  
ATOM 10375 H HZ3  . LYS B 1 97  ? -21.920 -14.851 -22.638 1.00 0.00 ? 97  LYS B HZ3  3  
ATOM 10376 N N    . VAL B 1 98  ? -23.621 -10.592 -16.597 1.00 0.00 ? 98  VAL B N    3  
ATOM 10377 C CA   . VAL B 1 98  ? -23.515 -10.290 -15.141 1.00 0.00 ? 98  VAL B CA   3  
ATOM 10378 C C    . VAL B 1 98  ? -22.289 -11.009 -14.586 1.00 0.00 ? 98  VAL B C    3  
ATOM 10379 O O    . VAL B 1 98  ? -22.093 -12.184 -14.827 1.00 0.00 ? 98  VAL B O    3  
ATOM 10380 C CB   . VAL B 1 98  ? -24.762 -10.794 -14.410 1.00 0.00 ? 98  VAL B CB   3  
ATOM 10381 C CG1  . VAL B 1 98  ? -24.514 -10.763 -12.899 1.00 0.00 ? 98  VAL B CG1  3  
ATOM 10382 C CG2  . VAL B 1 98  ? -25.950 -9.893  -14.747 1.00 0.00 ? 98  VAL B CG2  3  
ATOM 10383 H H    . VAL B 1 98  ? -23.815 -11.505 -16.894 1.00 0.00 ? 98  VAL B H    3  
ATOM 10384 H HA   . VAL B 1 98  ? -23.412 -9.225  -14.994 1.00 0.00 ? 98  VAL B HA   3  
ATOM 10385 H HB   . VAL B 1 98  ? -24.977 -11.807 -14.720 1.00 0.00 ? 98  VAL B HB   3  
ATOM 10386 H HG11 . VAL B 1 98  ? -23.993 -9.855  -12.638 1.00 0.00 ? 98  VAL B HG11 3  
ATOM 10387 H HG12 . VAL B 1 98  ? -25.459 -10.799 -12.377 1.00 0.00 ? 98  VAL B HG12 3  
ATOM 10388 H HG13 . VAL B 1 98  ? -23.915 -11.616 -12.615 1.00 0.00 ? 98  VAL B HG13 3  
ATOM 10389 H HG21 . VAL B 1 98  ? -25.596 -8.998  -15.239 1.00 0.00 ? 98  VAL B HG21 3  
ATOM 10390 H HG22 . VAL B 1 98  ? -26.628 -10.419 -15.402 1.00 0.00 ? 98  VAL B HG22 3  
ATOM 10391 H HG23 . VAL B 1 98  ? -26.466 -9.622  -13.838 1.00 0.00 ? 98  VAL B HG23 3  
ATOM 10392 N N    . GLU B 1 99  ? -21.457 -10.331 -13.847 1.00 0.00 ? 99  GLU B N    3  
ATOM 10393 C CA   . GLU B 1 99  ? -20.258 -11.013 -13.301 1.00 0.00 ? 99  GLU B CA   3  
ATOM 10394 C C    . GLU B 1 99  ? -20.077 -10.650 -11.834 1.00 0.00 ? 99  GLU B C    3  
ATOM 10395 O O    . GLU B 1 99  ? -20.999 -10.235 -11.160 1.00 0.00 ? 99  GLU B O    3  
ATOM 10396 C CB   . GLU B 1 99  ? -19.019 -10.578 -14.078 1.00 0.00 ? 99  GLU B CB   3  
ATOM 10397 C CG   . GLU B 1 99  ? -18.282 -11.811 -14.603 1.00 0.00 ? 99  GLU B CG   3  
ATOM 10398 C CD   . GLU B 1 99  ? -16.774 -11.553 -14.583 1.00 0.00 ? 99  GLU B CD   3  
ATOM 10399 O OE1  . GLU B 1 99  ? -16.300 -11.005 -13.601 1.00 0.00 ? 99  GLU B OE1  3  
ATOM 10400 O OE2  . GLU B 1 99  ? -16.119 -11.908 -15.550 1.00 0.00 ? 99  GLU B OE2  3  
ATOM 10401 H H    . GLU B 1 99  ? -21.617 -9.379  -13.654 1.00 0.00 ? 99  GLU B H    3  
ATOM 10402 H HA   . GLU B 1 99  ? -20.377 -12.079 -13.392 1.00 0.00 ? 99  GLU B HA   3  
ATOM 10403 H HB2  . GLU B 1 99  ? -19.315 -9.955  -14.902 1.00 0.00 ? 99  GLU B HB2  3  
ATOM 10404 H HB3  . GLU B 1 99  ? -18.368 -10.023 -13.425 1.00 0.00 ? 99  GLU B HB3  3  
ATOM 10405 H HG2  . GLU B 1 99  ? -18.511 -12.660 -13.976 1.00 0.00 ? 99  GLU B HG2  3  
ATOM 10406 H HG3  . GLU B 1 99  ? -18.597 -12.014 -15.615 1.00 0.00 ? 99  GLU B HG3  3  
ATOM 10407 N N    . GLN B 1 100 ? -18.888 -10.807 -11.346 1.00 0.00 ? 100 GLN B N    3  
ATOM 10408 C CA   . GLN B 1 100 ? -18.607 -10.482 -9.926  1.00 0.00 ? 100 GLN B CA   3  
ATOM 10409 C C    . GLN B 1 100 ? -17.159 -10.024 -9.815  1.00 0.00 ? 100 GLN B C    3  
ATOM 10410 O O    . GLN B 1 100 ? -16.273 -10.803 -9.527  1.00 0.00 ? 100 GLN B O    3  
ATOM 10411 C CB   . GLN B 1 100 ? -18.801 -11.729 -9.077  1.00 0.00 ? 100 GLN B CB   3  
ATOM 10412 C CG   . GLN B 1 100 ? -20.201 -12.298 -9.309  1.00 0.00 ? 100 GLN B CG   3  
ATOM 10413 C CD   . GLN B 1 100 ? -20.487 -13.390 -8.277  1.00 0.00 ? 100 GLN B CD   3  
ATOM 10414 O OE1  . GLN B 1 100 ? -20.592 -14.552 -8.618  1.00 0.00 ? 100 GLN B OE1  3  
ATOM 10415 N NE2  . GLN B 1 100 ? -20.618 -13.066 -7.021  1.00 0.00 ? 100 GLN B NE2  3  
ATOM 10416 H H    . GLN B 1 100 ? -18.169 -11.144 -11.920 1.00 0.00 ? 100 GLN B H    3  
ATOM 10417 H HA   . GLN B 1 100 ? -19.269 -9.701  -9.588  1.00 0.00 ? 100 GLN B HA   3  
ATOM 10418 H HB2  . GLN B 1 100 ? -18.062 -12.459 -9.363  1.00 0.00 ? 100 GLN B HB2  3  
ATOM 10419 H HB3  . GLN B 1 100 ? -18.680 -11.481 -8.034  1.00 0.00 ? 100 GLN B HB3  3  
ATOM 10420 H HG2  . GLN B 1 100 ? -20.932 -11.507 -9.209  1.00 0.00 ? 100 GLN B HG2  3  
ATOM 10421 H HG3  . GLN B 1 100 ? -20.260 -12.719 -10.302 1.00 0.00 ? 100 GLN B HG3  3  
ATOM 10422 H HE21 . GLN B 1 100 ? -20.534 -12.129 -6.745  1.00 0.00 ? 100 GLN B HE21 3  
ATOM 10423 H HE22 . GLN B 1 100 ? -20.800 -13.759 -6.352  1.00 0.00 ? 100 GLN B HE22 3  
ATOM 10424 N N    . LEU B 1 101 ? -16.909 -8.773  -10.054 1.00 0.00 ? 101 LEU B N    3  
ATOM 10425 C CA   . LEU B 1 101 ? -15.514 -8.273  -9.977  1.00 0.00 ? 101 LEU B CA   3  
ATOM 10426 C C    . LEU B 1 101 ? -14.848 -8.837  -8.730  1.00 0.00 ? 101 LEU B C    3  
ATOM 10427 O O    . LEU B 1 101 ? -15.469 -9.019  -7.702  1.00 0.00 ? 101 LEU B O    3  
ATOM 10428 C CB   . LEU B 1 101 ? -15.502 -6.745  -9.931  1.00 0.00 ? 101 LEU B CB   3  
ATOM 10429 C CG   . LEU B 1 101 ? -16.226 -6.173  -11.158 1.00 0.00 ? 101 LEU B CG   3  
ATOM 10430 C CD1  . LEU B 1 101 ? -15.724 -4.755  -11.431 1.00 0.00 ? 101 LEU B CD1  3  
ATOM 10431 C CD2  . LEU B 1 101 ? -15.952 -7.044  -12.386 1.00 0.00 ? 101 LEU B CD2  3  
ATOM 10432 H H    . LEU B 1 101 ? -17.633 -8.169  -10.296 1.00 0.00 ? 101 LEU B H    3  
ATOM 10433 H HA   . LEU B 1 101 ? -14.970 -8.606  -10.849 1.00 0.00 ? 101 LEU B HA   3  
ATOM 10434 H HB2  . LEU B 1 101 ? -16.001 -6.409  -9.035  1.00 0.00 ? 101 LEU B HB2  3  
ATOM 10435 H HB3  . LEU B 1 101 ? -14.477 -6.403  -9.925  1.00 0.00 ? 101 LEU B HB3  3  
ATOM 10436 H HG   . LEU B 1 101 ? -17.289 -6.145  -10.965 1.00 0.00 ? 101 LEU B HG   3  
ATOM 10437 H HD11 . LEU B 1 101 ? -14.675 -4.691  -11.185 1.00 0.00 ? 101 LEU B HD11 3  
ATOM 10438 H HD12 . LEU B 1 101 ? -15.864 -4.519  -12.475 1.00 0.00 ? 101 LEU B HD12 3  
ATOM 10439 H HD13 . LEU B 1 101 ? -16.279 -4.057  -10.826 1.00 0.00 ? 101 LEU B HD13 3  
ATOM 10440 H HD21 . LEU B 1 101 ? -14.890 -7.074  -12.574 1.00 0.00 ? 101 LEU B HD21 3  
ATOM 10441 H HD22 . LEU B 1 101 ? -16.315 -8.044  -12.202 1.00 0.00 ? 101 LEU B HD22 3  
ATOM 10442 H HD23 . LEU B 1 101 ? -16.459 -6.627  -13.242 1.00 0.00 ? 101 LEU B HD23 3  
ATOM 10443 N N    . SER B 1 102 ? -13.591 -9.139  -8.829  1.00 0.00 ? 102 SER B N    3  
ATOM 10444 C CA   . SER B 1 102 ? -12.868 -9.727  -7.662  1.00 0.00 ? 102 SER B CA   3  
ATOM 10445 C C    . SER B 1 102 ? -12.018 -8.667  -6.959  1.00 0.00 ? 102 SER B C    3  
ATOM 10446 O O    . SER B 1 102 ? -11.265 -7.951  -7.585  1.00 0.00 ? 102 SER B O    3  
ATOM 10447 C CB   . SER B 1 102 ? -11.960 -10.857 -8.149  1.00 0.00 ? 102 SER B CB   3  
ATOM 10448 O OG   . SER B 1 102 ? -12.710 -12.062 -8.224  1.00 0.00 ? 102 SER B OG   3  
ATOM 10449 H H    . SER B 1 102 ? -13.126 -8.990  -9.682  1.00 0.00 ? 102 SER B H    3  
ATOM 10450 H HA   . SER B 1 102 ? -13.587 -10.127 -6.963  1.00 0.00 ? 102 SER B HA   3  
ATOM 10451 H HB2  . SER B 1 102 ? -11.576 -10.617 -9.127  1.00 0.00 ? 102 SER B HB2  3  
ATOM 10452 H HB3  . SER B 1 102 ? -11.135 -10.976 -7.460  1.00 0.00 ? 102 SER B HB3  3  
ATOM 10453 H HG   . SER B 1 102 ? -12.091 -12.796 -8.235  1.00 0.00 ? 102 SER B HG   3  
ATOM 10454 N N    . ASN B 1 103 ? -12.116 -8.582  -5.658  1.00 0.00 ? 103 ASN B N    3  
ATOM 10455 C CA   . ASN B 1 103 ? -11.292 -7.583  -4.910  1.00 0.00 ? 103 ASN B CA   3  
ATOM 10456 C C    . ASN B 1 103 ? -11.671 -6.164  -5.329  1.00 0.00 ? 103 ASN B C    3  
ATOM 10457 O O    . ASN B 1 103 ? -10.841 -5.277  -5.368  1.00 0.00 ? 103 ASN B O    3  
ATOM 10458 C CB   . ASN B 1 103 ? -9.812  -7.820  -5.213  1.00 0.00 ? 103 ASN B CB   3  
ATOM 10459 C CG   . ASN B 1 103 ? -9.231  -8.800  -4.192  1.00 0.00 ? 103 ASN B CG   3  
ATOM 10460 O OD1  . ASN B 1 103 ? -9.962  -9.443  -3.465  1.00 0.00 ? 103 ASN B OD1  3  
ATOM 10461 N ND2  . ASN B 1 103 ? -7.937  -8.942  -4.107  1.00 0.00 ? 103 ASN B ND2  3  
ATOM 10462 H H    . ASN B 1 103 ? -12.721 -9.185  -5.170  1.00 0.00 ? 103 ASN B H    3  
ATOM 10463 H HA   . ASN B 1 103 ? -11.460 -7.696  -3.848  1.00 0.00 ? 103 ASN B HA   3  
ATOM 10464 H HB2  . ASN B 1 103 ? -9.709  -8.232  -6.207  1.00 0.00 ? 103 ASN B HB2  3  
ATOM 10465 H HB3  . ASN B 1 103 ? -9.279  -6.884  -5.155  1.00 0.00 ? 103 ASN B HB3  3  
ATOM 10466 H HD21 . ASN B 1 103 ? -7.347  -8.425  -4.694  1.00 0.00 ? 103 ASN B HD21 3  
ATOM 10467 H HD22 . ASN B 1 103 ? -7.553  -9.566  -3.455  1.00 0.00 ? 103 ASN B HD22 3  
ATOM 10468 N N    . MET B 1 104 ? -12.915 -5.935  -5.633  1.00 0.00 ? 104 MET B N    3  
ATOM 10469 C CA   . MET B 1 104 ? -13.337 -4.567  -6.035  1.00 0.00 ? 104 MET B CA   3  
ATOM 10470 C C    . MET B 1 104 ? -13.859 -3.821  -4.805  1.00 0.00 ? 104 MET B C    3  
ATOM 10471 O O    . MET B 1 104 ? -14.415 -2.747  -4.910  1.00 0.00 ? 104 MET B O    3  
ATOM 10472 C CB   . MET B 1 104 ? -14.443 -4.655  -7.087  1.00 0.00 ? 104 MET B CB   3  
ATOM 10473 C CG   . MET B 1 104 ? -14.851 -3.245  -7.515  1.00 0.00 ? 104 MET B CG   3  
ATOM 10474 S SD   . MET B 1 104 ? -14.570 -3.045  -9.289  1.00 0.00 ? 104 MET B SD   3  
ATOM 10475 C CE   . MET B 1 104 ? -15.926 -1.889  -9.597  1.00 0.00 ? 104 MET B CE   3  
ATOM 10476 H H    . MET B 1 104 ? -13.573 -6.660  -5.592  1.00 0.00 ? 104 MET B H    3  
ATOM 10477 H HA   . MET B 1 104 ? -12.490 -4.036  -6.445  1.00 0.00 ? 104 MET B HA   3  
ATOM 10478 H HB2  . MET B 1 104 ? -14.080 -5.203  -7.945  1.00 0.00 ? 104 MET B HB2  3  
ATOM 10479 H HB3  . MET B 1 104 ? -15.298 -5.164  -6.669  1.00 0.00 ? 104 MET B HB3  3  
ATOM 10480 H HG2  . MET B 1 104 ? -15.897 -3.090  -7.297  1.00 0.00 ? 104 MET B HG2  3  
ATOM 10481 H HG3  . MET B 1 104 ? -14.261 -2.520  -6.975  1.00 0.00 ? 104 MET B HG3  3  
ATOM 10482 H HE1  . MET B 1 104 ? -16.471 -1.720  -8.682  1.00 0.00 ? 104 MET B HE1  3  
ATOM 10483 H HE2  . MET B 1 104 ? -15.524 -0.951  -9.951  1.00 0.00 ? 104 MET B HE2  3  
ATOM 10484 H HE3  . MET B 1 104 ? -16.593 -2.305  -10.339 1.00 0.00 ? 104 MET B HE3  3  
ATOM 10485 N N    . ILE B 1 105 ? -13.679 -4.377  -3.637  1.00 0.00 ? 105 ILE B N    3  
ATOM 10486 C CA   . ILE B 1 105 ? -14.162 -3.688  -2.406  1.00 0.00 ? 105 ILE B CA   3  
ATOM 10487 C C    . ILE B 1 105 ? -13.117 -3.834  -1.300  1.00 0.00 ? 105 ILE B C    3  
ATOM 10488 O O    . ILE B 1 105 ? -12.255 -4.687  -1.356  1.00 0.00 ? 105 ILE B O    3  
ATOM 10489 C CB   . ILE B 1 105 ? -15.482 -4.309  -1.946  1.00 0.00 ? 105 ILE B CB   3  
ATOM 10490 C CG1  . ILE B 1 105 ? -16.553 -4.076  -3.016  1.00 0.00 ? 105 ILE B CG1  3  
ATOM 10491 C CG2  . ILE B 1 105 ? -15.919 -3.651  -0.634  1.00 0.00 ? 105 ILE B CG2  3  
ATOM 10492 C CD1  . ILE B 1 105 ? -17.931 -4.416  -2.447  1.00 0.00 ? 105 ILE B CD1  3  
ATOM 10493 H H    . ILE B 1 105 ? -13.222 -5.243  -3.567  1.00 0.00 ? 105 ILE B H    3  
ATOM 10494 H HA   . ILE B 1 105 ? -14.314 -2.640  -2.618  1.00 0.00 ? 105 ILE B HA   3  
ATOM 10495 H HB   . ILE B 1 105 ? -15.347 -5.369  -1.790  1.00 0.00 ? 105 ILE B HB   3  
ATOM 10496 H HG12 . ILE B 1 105 ? -16.535 -3.040  -3.323  1.00 0.00 ? 105 ILE B HG12 3  
ATOM 10497 H HG13 . ILE B 1 105 ? -16.352 -4.707  -3.868  1.00 0.00 ? 105 ILE B HG13 3  
ATOM 10498 H HG21 . ILE B 1 105 ? -15.931 -2.579  -0.755  1.00 0.00 ? 105 ILE B HG21 3  
ATOM 10499 H HG22 . ILE B 1 105 ? -16.907 -3.996  -0.368  1.00 0.00 ? 105 ILE B HG22 3  
ATOM 10500 H HG23 . ILE B 1 105 ? -15.222 -3.915  0.150   1.00 0.00 ? 105 ILE B HG23 3  
ATOM 10501 H HD11 . ILE B 1 105 ? -17.824 -4.781  -1.436  1.00 0.00 ? 105 ILE B HD11 3  
ATOM 10502 H HD12 . ILE B 1 105 ? -18.549 -3.529  -2.445  1.00 0.00 ? 105 ILE B HD12 3  
ATOM 10503 H HD13 . ILE B 1 105 ? -18.395 -5.176  -3.058  1.00 0.00 ? 105 ILE B HD13 3  
ATOM 10504 N N    . VAL B 1 106 ? -13.182 -3.002  -0.298  1.00 0.00 ? 106 VAL B N    3  
ATOM 10505 C CA   . VAL B 1 106 ? -12.188 -3.085  0.803   1.00 0.00 ? 106 VAL B CA   3  
ATOM 10506 C C    . VAL B 1 106 ? -12.855 -3.638  2.067   1.00 0.00 ? 106 VAL B C    3  
ATOM 10507 O O    . VAL B 1 106 ? -13.967 -3.282  2.403   1.00 0.00 ? 106 VAL B O    3  
ATOM 10508 C CB   . VAL B 1 106 ? -11.640 -1.684  1.077   1.00 0.00 ? 106 VAL B CB   3  
ATOM 10509 C CG1  . VAL B 1 106 ? -10.940 -1.662  2.433   1.00 0.00 ? 106 VAL B CG1  3  
ATOM 10510 C CG2  . VAL B 1 106 ? -10.640 -1.305  -0.018  1.00 0.00 ? 106 VAL B CG2  3  
ATOM 10511 H H    . VAL B 1 106 ? -13.879 -2.315  -0.271  1.00 0.00 ? 106 VAL B H    3  
ATOM 10512 H HA   . VAL B 1 106 ? -11.378 -3.736  0.509   1.00 0.00 ? 106 VAL B HA   3  
ATOM 10513 H HB   . VAL B 1 106 ? -12.455 -0.974  1.083   1.00 0.00 ? 106 VAL B HB   3  
ATOM 10514 H HG11 . VAL B 1 106 ? -10.198 -2.444  2.466   1.00 0.00 ? 106 VAL B HG11 3  
ATOM 10515 H HG12 . VAL B 1 106 ? -10.465 -0.705  2.577   1.00 0.00 ? 106 VAL B HG12 3  
ATOM 10516 H HG13 . VAL B 1 106 ? -11.670 -1.824  3.213   1.00 0.00 ? 106 VAL B HG13 3  
ATOM 10517 H HG21 . VAL B 1 106 ? -10.110 -2.188  -0.342  1.00 0.00 ? 106 VAL B HG21 3  
ATOM 10518 H HG22 . VAL B 1 106 ? -11.169 -0.875  -0.855  1.00 0.00 ? 106 VAL B HG22 3  
ATOM 10519 H HG23 . VAL B 1 106 ? -9.935  -0.585  0.371   1.00 0.00 ? 106 VAL B HG23 3  
ATOM 10520 N N    . ARG B 1 107 ? -12.175 -4.502  2.771   1.00 0.00 ? 107 ARG B N    3  
ATOM 10521 C CA   . ARG B 1 107 ? -12.755 -5.078  4.018   1.00 0.00 ? 107 ARG B CA   3  
ATOM 10522 C C    . ARG B 1 107 ? -11.839 -4.752  5.202   1.00 0.00 ? 107 ARG B C    3  
ATOM 10523 O O    . ARG B 1 107 ? -12.232 -4.838  6.349   1.00 0.00 ? 107 ARG B O    3  
ATOM 10524 C CB   . ARG B 1 107 ? -12.877 -6.595  3.870   1.00 0.00 ? 107 ARG B CB   3  
ATOM 10525 C CG   . ARG B 1 107 ? -14.292 -7.033  4.253   1.00 0.00 ? 107 ARG B CG   3  
ATOM 10526 C CD   . ARG B 1 107 ? -14.422 -8.548  4.079   1.00 0.00 ? 107 ARG B CD   3  
ATOM 10527 N NE   . ARG B 1 107 ? -13.889 -9.236  5.289   1.00 0.00 ? 107 ARG B NE   3  
ATOM 10528 C CZ   . ARG B 1 107 ? -14.700 -9.877  6.085   1.00 0.00 ? 107 ARG B CZ   3  
ATOM 10529 N NH1  . ARG B 1 107 ? -15.260 -9.252  7.085   1.00 0.00 ? 107 ARG B NH1  3  
ATOM 10530 N NH2  . ARG B 1 107 ? -14.950 -11.141 5.884   1.00 0.00 ? 107 ARG B NH2  3  
ATOM 10531 H H    . ARG B 1 107 ? -11.279 -4.769  2.480   1.00 0.00 ? 107 ARG B H    3  
ATOM 10532 H HA   . ARG B 1 107 ? -13.733 -4.652  4.191   1.00 0.00 ? 107 ARG B HA   3  
ATOM 10533 H HB2  . ARG B 1 107 ? -12.676 -6.875  2.846   1.00 0.00 ? 107 ARG B HB2  3  
ATOM 10534 H HB3  . ARG B 1 107 ? -12.165 -7.079  4.522   1.00 0.00 ? 107 ARG B HB3  3  
ATOM 10535 H HG2  . ARG B 1 107 ? -14.483 -6.771  5.284   1.00 0.00 ? 107 ARG B HG2  3  
ATOM 10536 H HG3  . ARG B 1 107 ? -15.007 -6.537  3.616   1.00 0.00 ? 107 ARG B HG3  3  
ATOM 10537 H HD2  . ARG B 1 107 ? -15.462 -8.807  3.946   1.00 0.00 ? 107 ARG B HD2  3  
ATOM 10538 H HD3  . ARG B 1 107 ? -13.861 -8.860  3.210   1.00 0.00 ? 107 ARG B HD3  3  
ATOM 10539 H HE   . ARG B 1 107 ? -12.930 -9.208  5.484   1.00 0.00 ? 107 ARG B HE   3  
ATOM 10540 H HH11 . ARG B 1 107 ? -15.068 -8.284  7.241   1.00 0.00 ? 107 ARG B HH11 3  
ATOM 10541 H HH12 . ARG B 1 107 ? -15.881 -9.743  7.697   1.00 0.00 ? 107 ARG B HH12 3  
ATOM 10542 H HH21 . ARG B 1 107 ? -14.521 -11.621 5.119   1.00 0.00 ? 107 ARG B HH21 3  
ATOM 10543 H HH22 . ARG B 1 107 ? -15.572 -11.632 6.495   1.00 0.00 ? 107 ARG B HH22 3  
ATOM 10544 N N    . SER B 1 108 ? -10.617 -4.376  4.929   1.00 0.00 ? 108 SER B N    3  
ATOM 10545 C CA   . SER B 1 108 ? -9.667  -4.041  6.028   1.00 0.00 ? 108 SER B CA   3  
ATOM 10546 C C    . SER B 1 108 ? -8.369  -3.506  5.420   1.00 0.00 ? 108 SER B C    3  
ATOM 10547 O O    . SER B 1 108 ? -7.972  -3.903  4.342   1.00 0.00 ? 108 SER B O    3  
ATOM 10548 C CB   . SER B 1 108 ? -9.369  -5.296  6.849   1.00 0.00 ? 108 SER B CB   3  
ATOM 10549 O OG   . SER B 1 108 ? -8.736  -6.260  6.018   1.00 0.00 ? 108 SER B OG   3  
ATOM 10550 H H    . SER B 1 108 ? -10.324 -4.312  3.997   1.00 0.00 ? 108 SER B H    3  
ATOM 10551 H HA   . SER B 1 108 ? -10.105 -3.286  6.666   1.00 0.00 ? 108 SER B HA   3  
ATOM 10552 H HB2  . SER B 1 108 ? -8.713  -5.047  7.666   1.00 0.00 ? 108 SER B HB2  3  
ATOM 10553 H HB3  . SER B 1 108 ? -10.295 -5.696  7.242   1.00 0.00 ? 108 SER B HB3  3  
ATOM 10554 H HG   . SER B 1 108 ? -7.866  -6.441  6.382   1.00 0.00 ? 108 SER B HG   3  
ATOM 10555 N N    . CYS B 1 109 ? -7.710  -2.600  6.090   1.00 0.00 ? 109 CYS B N    3  
ATOM 10556 C CA   . CYS B 1 109 ? -6.447  -2.035  5.528   1.00 0.00 ? 109 CYS B CA   3  
ATOM 10557 C C    . CYS B 1 109 ? -5.257  -2.321  6.452   1.00 0.00 ? 109 CYS B C    3  
ATOM 10558 O O    . CYS B 1 109 ? -5.400  -2.860  7.532   1.00 0.00 ? 109 CYS B O    3  
ATOM 10559 C CB   . CYS B 1 109 ? -6.600  -0.525  5.363   1.00 0.00 ? 109 CYS B CB   3  
ATOM 10560 S SG   . CYS B 1 109 ? -8.077  -0.183  4.377   1.00 0.00 ? 109 CYS B SG   3  
ATOM 10561 H H    . CYS B 1 109 ? -8.054  -2.281  6.950   1.00 0.00 ? 109 CYS B H    3  
ATOM 10562 H HA   . CYS B 1 109 ? -6.260  -2.477  4.563   1.00 0.00 ? 109 CYS B HA   3  
ATOM 10563 H HB2  . CYS B 1 109 ? -6.698  -0.064  6.335   1.00 0.00 ? 109 CYS B HB2  3  
ATOM 10564 H HB3  . CYS B 1 109 ? -5.731  -0.127  4.860   1.00 0.00 ? 109 CYS B HB3  3  
ATOM 10565 N N    . LYS B 1 110 ? -4.080  -1.942  6.022   1.00 0.00 ? 110 LYS B N    3  
ATOM 10566 C CA   . LYS B 1 110 ? -2.853  -2.152  6.834   1.00 0.00 ? 110 LYS B CA   3  
ATOM 10567 C C    . LYS B 1 110 ? -1.823  -1.125  6.359   1.00 0.00 ? 110 LYS B C    3  
ATOM 10568 O O    . LYS B 1 110 ? -2.184  -0.103  5.816   1.00 0.00 ? 110 LYS B O    3  
ATOM 10569 C CB   . LYS B 1 110 ? -2.324  -3.574  6.616   1.00 0.00 ? 110 LYS B CB   3  
ATOM 10570 C CG   . LYS B 1 110 ? -3.222  -4.573  7.347   1.00 0.00 ? 110 LYS B CG   3  
ATOM 10571 C CD   . LYS B 1 110 ? -3.264  -4.235  8.838   1.00 0.00 ? 110 LYS B CD   3  
ATOM 10572 C CE   . LYS B 1 110 ? -3.373  -5.525  9.654   1.00 0.00 ? 110 LYS B CE   3  
ATOM 10573 N NZ   . LYS B 1 110 ? -4.538  -5.432  10.577  1.00 0.00 ? 110 LYS B NZ   3  
ATOM 10574 H H    . LYS B 1 110 ? -4.001  -1.499  5.151   1.00 0.00 ? 110 LYS B H    3  
ATOM 10575 H HA   . LYS B 1 110 ? -3.074  -1.994  7.881   1.00 0.00 ? 110 LYS B HA   3  
ATOM 10576 H HB2  . LYS B 1 110 ? -2.321  -3.798  5.559   1.00 0.00 ? 110 LYS B HB2  3  
ATOM 10577 H HB3  . LYS B 1 110 ? -1.321  -3.651  7.002   1.00 0.00 ? 110 LYS B HB3  3  
ATOM 10578 H HG2  . LYS B 1 110 ? -4.222  -4.524  6.939   1.00 0.00 ? 110 LYS B HG2  3  
ATOM 10579 H HG3  . LYS B 1 110 ? -2.831  -5.571  7.217   1.00 0.00 ? 110 LYS B HG3  3  
ATOM 10580 H HD2  . LYS B 1 110 ? -2.359  -3.709  9.112   1.00 0.00 ? 110 LYS B HD2  3  
ATOM 10581 H HD3  . LYS B 1 110 ? -4.120  -3.609  9.042   1.00 0.00 ? 110 LYS B HD3  3  
ATOM 10582 H HE2  . LYS B 1 110 ? -3.508  -6.362  8.985   1.00 0.00 ? 110 LYS B HE2  3  
ATOM 10583 H HE3  . LYS B 1 110 ? -2.468  -5.665  10.228  1.00 0.00 ? 110 LYS B HE3  3  
ATOM 10584 H HZ1  . LYS B 1 110 ? -4.480  -4.547  11.120  1.00 0.00 ? 110 LYS B HZ1  3  
ATOM 10585 H HZ2  . LYS B 1 110 ? -5.420  -5.441  10.027  1.00 0.00 ? 110 LYS B HZ2  3  
ATOM 10586 H HZ3  . LYS B 1 110 ? -4.528  -6.242  11.230  1.00 0.00 ? 110 LYS B HZ3  3  
ATOM 10587 N N    . CYS B 1 111 ? -0.557  -1.367  6.539   1.00 0.00 ? 111 CYS B N    3  
ATOM 10588 C CA   . CYS B 1 111 ? 0.442   -0.368  6.068   1.00 0.00 ? 111 CYS B CA   3  
ATOM 10589 C C    . CYS B 1 111 ? 1.507   -1.063  5.217   1.00 0.00 ? 111 CYS B C    3  
ATOM 10590 O O    . CYS B 1 111 ? 2.500   -1.547  5.725   1.00 0.00 ? 111 CYS B O    3  
ATOM 10591 C CB   . CYS B 1 111 ? 1.103   0.304   7.274   1.00 0.00 ? 111 CYS B CB   3  
ATOM 10592 S SG   . CYS B 1 111 ? -0.120  1.325   8.137   1.00 0.00 ? 111 CYS B SG   3  
ATOM 10593 H H    . CYS B 1 111 ? -0.263  -2.193  6.973   1.00 0.00 ? 111 CYS B H    3  
ATOM 10594 H HA   . CYS B 1 111 ? -0.058  0.381   5.470   1.00 0.00 ? 111 CYS B HA   3  
ATOM 10595 H HB2  . CYS B 1 111 ? 1.480   -0.453  7.947   1.00 0.00 ? 111 CYS B HB2  3  
ATOM 10596 H HB3  . CYS B 1 111 ? 1.919   0.926   6.938   1.00 0.00 ? 111 CYS B HB3  3  
ATOM 10597 N N    . SER B 1 112 ? 1.315   -1.115  3.924   1.00 0.00 ? 112 SER B N    3  
ATOM 10598 C CA   . SER B 1 112 ? 2.325   -1.777  3.054   1.00 0.00 ? 112 SER B CA   3  
ATOM 10599 C C    . SER B 1 112 ? 3.410   -0.766  2.679   1.00 0.00 ? 112 SER B C    3  
ATOM 10600 O O    . SER B 1 112 ? 3.062   0.282   2.164   1.00 0.00 ? 112 SER B O    3  
ATOM 10601 C CB   . SER B 1 112 ? 1.650   -2.296  1.785   1.00 0.00 ? 112 SER B CB   3  
ATOM 10602 O OG   . SER B 1 112 ? 2.488   -3.263  1.168   1.00 0.00 ? 112 SER B OG   3  
ATOM 10603 O OXT  . SER B 1 112 ? 4.571   -1.058  2.914   1.00 0.00 ? 112 SER B OXT  3  
ATOM 10604 H H    . SER B 1 112 ? 0.509   -0.717  3.525   1.00 0.00 ? 112 SER B H    3  
ATOM 10605 H HA   . SER B 1 112 ? 2.773   -2.604  3.586   1.00 0.00 ? 112 SER B HA   3  
ATOM 10606 H HB2  . SER B 1 112 ? 0.708   -2.753  2.037   1.00 0.00 ? 112 SER B HB2  3  
ATOM 10607 H HB3  . SER B 1 112 ? 1.476   -1.470  1.107   1.00 0.00 ? 112 SER B HB3  3  
ATOM 10608 H HG   . SER B 1 112 ? 2.499   -4.044  1.725   1.00 0.00 ? 112 SER B HG   3  
ATOM 10609 N N    . ALA A 1 1   ? 7.234   -2.600  -15.487 1.00 0.00 ? 1   ALA A N    4  
ATOM 10610 C CA   . ALA A 1 1   ? 8.169   -3.091  -14.434 1.00 0.00 ? 1   ALA A CA   4  
ATOM 10611 C C    . ALA A 1 1   ? 8.294   -2.036  -13.333 1.00 0.00 ? 1   ALA A C    4  
ATOM 10612 O O    . ALA A 1 1   ? 8.867   -0.982  -13.531 1.00 0.00 ? 1   ALA A O    4  
ATOM 10613 C CB   . ALA A 1 1   ? 9.544   -3.348  -15.053 1.00 0.00 ? 1   ALA A CB   4  
ATOM 10614 H H1   . ALA A 1 1   ? 7.078   -1.580  -15.364 1.00 0.00 ? 1   ALA A H1   4  
ATOM 10615 H H2   . ALA A 1 1   ? 7.647   -2.778  -16.426 1.00 0.00 ? 1   ALA A H2   4  
ATOM 10616 H H3   . ALA A 1 1   ? 6.327   -3.099  -15.404 1.00 0.00 ? 1   ALA A H3   4  
ATOM 10617 H HA   . ALA A 1 1   ? 7.786   -4.008  -14.012 1.00 0.00 ? 1   ALA A HA   4  
ATOM 10618 H HB1  . ALA A 1 1   ? 9.431   -3.958  -15.937 1.00 0.00 ? 1   ALA A HB1  4  
ATOM 10619 H HB2  . ALA A 1 1   ? 10.000  -2.407  -15.322 1.00 0.00 ? 1   ALA A HB2  4  
ATOM 10620 H HB3  . ALA A 1 1   ? 10.170  -3.861  -14.339 1.00 0.00 ? 1   ALA A HB3  4  
ATOM 10621 N N    . LEU A 1 2   ? 7.759   -2.308  -12.174 1.00 0.00 ? 2   LEU A N    4  
ATOM 10622 C CA   . LEU A 1 2   ? 7.844   -1.319  -11.062 1.00 0.00 ? 2   LEU A CA   4  
ATOM 10623 C C    . LEU A 1 2   ? 8.779   -1.844  -9.976  1.00 0.00 ? 2   LEU A C    4  
ATOM 10624 O O    . LEU A 1 2   ? 8.456   -1.831  -8.806  1.00 0.00 ? 2   LEU A O    4  
ATOM 10625 C CB   . LEU A 1 2   ? 6.457   -1.107  -10.466 1.00 0.00 ? 2   LEU A CB   4  
ATOM 10626 C CG   . LEU A 1 2   ? 5.734   -0.015  -11.250 1.00 0.00 ? 2   LEU A CG   4  
ATOM 10627 C CD1  . LEU A 1 2   ? 4.331   0.189   -10.675 1.00 0.00 ? 2   LEU A CD1  4  
ATOM 10628 C CD2  . LEU A 1 2   ? 6.526   1.290   -11.143 1.00 0.00 ? 2   LEU A CD2  4  
ATOM 10629 H H    . LEU A 1 2   ? 7.299   -3.162  -12.035 1.00 0.00 ? 2   LEU A H    4  
ATOM 10630 H HA   . LEU A 1 2   ? 8.220   -0.381  -11.441 1.00 0.00 ? 2   LEU A HA   4  
ATOM 10631 H HB2  . LEU A 1 2   ? 5.899   -2.029  -10.520 1.00 0.00 ? 2   LEU A HB2  4  
ATOM 10632 H HB3  . LEU A 1 2   ? 6.554   -0.804  -9.435  1.00 0.00 ? 2   LEU A HB3  4  
ATOM 10633 H HG   . LEU A 1 2   ? 5.658   -0.307  -12.288 1.00 0.00 ? 2   LEU A HG   4  
ATOM 10634 H HD11 . LEU A 1 2   ? 4.156   -0.532  -9.890  1.00 0.00 ? 2   LEU A HD11 4  
ATOM 10635 H HD12 . LEU A 1 2   ? 4.249   1.187   -10.272 1.00 0.00 ? 2   LEU A HD12 4  
ATOM 10636 H HD13 . LEU A 1 2   ? 3.598   0.055   -11.456 1.00 0.00 ? 2   LEU A HD13 4  
ATOM 10637 H HD21 . LEU A 1 2   ? 7.447   1.109   -10.610 1.00 0.00 ? 2   LEU A HD21 4  
ATOM 10638 H HD22 . LEU A 1 2   ? 6.750   1.658   -12.134 1.00 0.00 ? 2   LEU A HD22 4  
ATOM 10639 H HD23 . LEU A 1 2   ? 5.941   2.025   -10.610 1.00 0.00 ? 2   LEU A HD23 4  
ATOM 10640 N N    . ASP A 1 3   ? 9.934   -2.300  -10.353 1.00 0.00 ? 3   ASP A N    4  
ATOM 10641 C CA   . ASP A 1 3   ? 10.890  -2.822  -9.339  1.00 0.00 ? 3   ASP A CA   4  
ATOM 10642 C C    . ASP A 1 3   ? 11.972  -1.777  -9.075  1.00 0.00 ? 3   ASP A C    4  
ATOM 10643 O O    . ASP A 1 3   ? 11.989  -0.718  -9.670  1.00 0.00 ? 3   ASP A O    4  
ATOM 10644 C CB   . ASP A 1 3   ? 11.540  -4.114  -9.842  1.00 0.00 ? 3   ASP A CB   4  
ATOM 10645 C CG   . ASP A 1 3   ? 11.642  -4.084  -11.369 1.00 0.00 ? 3   ASP A CG   4  
ATOM 10646 O OD1  . ASP A 1 3   ? 12.601  -3.518  -11.868 1.00 0.00 ? 3   ASP A OD1  4  
ATOM 10647 O OD2  . ASP A 1 3   ? 10.760  -4.628  -12.012 1.00 0.00 ? 3   ASP A OD2  4  
ATOM 10648 H H    . ASP A 1 3   ? 10.173  -2.296  -11.301 1.00 0.00 ? 3   ASP A H    4  
ATOM 10649 H HA   . ASP A 1 3   ? 10.359  -3.023  -8.420  1.00 0.00 ? 3   ASP A HA   4  
ATOM 10650 H HB2  . ASP A 1 3   ? 12.530  -4.205  -9.418  1.00 0.00 ? 3   ASP A HB2  4  
ATOM 10651 H HB3  . ASP A 1 3   ? 10.942  -4.958  -9.540  1.00 0.00 ? 3   ASP A HB3  4  
ATOM 10652 N N    . THR A 1 4   ? 12.874  -2.068  -8.183  1.00 0.00 ? 4   THR A N    4  
ATOM 10653 C CA   . THR A 1 4   ? 13.960  -1.100  -7.869  1.00 0.00 ? 4   THR A CA   4  
ATOM 10654 C C    . THR A 1 4   ? 14.994  -1.097  -8.997  1.00 0.00 ? 4   THR A C    4  
ATOM 10655 O O    . THR A 1 4   ? 15.975  -0.382  -8.948  1.00 0.00 ? 4   THR A O    4  
ATOM 10656 C CB   . THR A 1 4   ? 14.619  -1.507  -6.552  1.00 0.00 ? 4   THR A CB   4  
ATOM 10657 O OG1  . THR A 1 4   ? 15.584  -2.520  -6.797  1.00 0.00 ? 4   THR A OG1  4  
ATOM 10658 C CG2  . THR A 1 4   ? 13.546  -2.036  -5.597  1.00 0.00 ? 4   THR A CG2  4  
ATOM 10659 H H    . THR A 1 4   ? 12.837  -2.929  -7.715  1.00 0.00 ? 4   THR A H    4  
ATOM 10660 H HA   . THR A 1 4   ? 13.541  -0.112  -7.768  1.00 0.00 ? 4   THR A HA   4  
ATOM 10661 H HB   . THR A 1 4   ? 15.099  -0.648  -6.107  1.00 0.00 ? 4   THR A HB   4  
ATOM 10662 H HG1  . THR A 1 4   ? 16.036  -2.706  -5.971  1.00 0.00 ? 4   THR A HG1  4  
ATOM 10663 H HG21 . THR A 1 4   ? 12.567  -1.792  -5.985  1.00 0.00 ? 4   THR A HG21 4  
ATOM 10664 H HG22 . THR A 1 4   ? 13.640  -3.109  -5.508  1.00 0.00 ? 4   THR A HG22 4  
ATOM 10665 H HG23 . THR A 1 4   ? 13.671  -1.582  -4.625  1.00 0.00 ? 4   THR A HG23 4  
ATOM 10666 N N    . ASN A 1 5   ? 14.780  -1.883  -10.017 1.00 0.00 ? 5   ASN A N    4  
ATOM 10667 C CA   . ASN A 1 5   ? 15.749  -1.914  -11.147 1.00 0.00 ? 5   ASN A CA   4  
ATOM 10668 C C    . ASN A 1 5   ? 15.213  -1.066  -12.303 1.00 0.00 ? 5   ASN A C    4  
ATOM 10669 O O    . ASN A 1 5   ? 15.965  -0.554  -13.109 1.00 0.00 ? 5   ASN A O    4  
ATOM 10670 C CB   . ASN A 1 5   ? 15.938  -3.359  -11.618 1.00 0.00 ? 5   ASN A CB   4  
ATOM 10671 C CG   . ASN A 1 5   ? 17.359  -3.820  -11.294 1.00 0.00 ? 5   ASN A CG   4  
ATOM 10672 O OD1  . ASN A 1 5   ? 17.576  -4.518  -10.324 1.00 0.00 ? 5   ASN A OD1  4  
ATOM 10673 N ND2  . ASN A 1 5   ? 18.344  -3.458  -12.071 1.00 0.00 ? 5   ASN A ND2  4  
ATOM 10674 H H    . ASN A 1 5   ? 13.982  -2.449  -10.042 1.00 0.00 ? 5   ASN A H    4  
ATOM 10675 H HA   . ASN A 1 5   ? 16.697  -1.516  -10.819 1.00 0.00 ? 5   ASN A HA   4  
ATOM 10676 H HB2  . ASN A 1 5   ? 15.227  -3.997  -11.115 1.00 0.00 ? 5   ASN A HB2  4  
ATOM 10677 H HB3  . ASN A 1 5   ? 15.778  -3.413  -12.685 1.00 0.00 ? 5   ASN A HB3  4  
ATOM 10678 H HD21 . ASN A 1 5   ? 18.168  -2.894  -12.854 1.00 0.00 ? 5   ASN A HD21 4  
ATOM 10679 H HD22 . ASN A 1 5   ? 19.258  -3.748  -11.871 1.00 0.00 ? 5   ASN A HD22 4  
ATOM 10680 N N    . TYR A 1 6   ? 13.919  -0.917  -12.396 1.00 0.00 ? 6   TYR A N    4  
ATOM 10681 C CA   . TYR A 1 6   ? 13.339  -0.112  -13.500 1.00 0.00 ? 6   TYR A CA   4  
ATOM 10682 C C    . TYR A 1 6   ? 13.221  1.352   -13.067 1.00 0.00 ? 6   TYR A C    4  
ATOM 10683 O O    . TYR A 1 6   ? 13.228  2.252   -13.884 1.00 0.00 ? 6   TYR A O    4  
ATOM 10684 C CB   . TYR A 1 6   ? 11.953  -0.662  -13.830 1.00 0.00 ? 6   TYR A CB   4  
ATOM 10685 C CG   . TYR A 1 6   ? 11.239  0.292   -14.754 1.00 0.00 ? 6   TYR A CG   4  
ATOM 10686 C CD1  . TYR A 1 6   ? 11.550  0.316   -16.119 1.00 0.00 ? 6   TYR A CD1  4  
ATOM 10687 C CD2  . TYR A 1 6   ? 10.265  1.153   -14.243 1.00 0.00 ? 6   TYR A CD2  4  
ATOM 10688 C CE1  . TYR A 1 6   ? 10.886  1.204   -16.972 1.00 0.00 ? 6   TYR A CE1  4  
ATOM 10689 C CE2  . TYR A 1 6   ? 9.598   2.042   -15.094 1.00 0.00 ? 6   TYR A CE2  4  
ATOM 10690 C CZ   . TYR A 1 6   ? 9.910   2.067   -16.460 1.00 0.00 ? 6   TYR A CZ   4  
ATOM 10691 O OH   . TYR A 1 6   ? 9.254   2.944   -17.302 1.00 0.00 ? 6   TYR A OH   4  
ATOM 10692 H H    . TYR A 1 6   ? 13.326  -1.342  -11.743 1.00 0.00 ? 6   TYR A H    4  
ATOM 10693 H HA   . TYR A 1 6   ? 13.971  -0.182  -14.371 1.00 0.00 ? 6   TYR A HA   4  
ATOM 10694 H HB2  . TYR A 1 6   ? 12.056  -1.623  -14.306 1.00 0.00 ? 6   TYR A HB2  4  
ATOM 10695 H HB3  . TYR A 1 6   ? 11.384  -0.770  -12.919 1.00 0.00 ? 6   TYR A HB3  4  
ATOM 10696 H HD1  . TYR A 1 6   ? 12.304  -0.350  -16.513 1.00 0.00 ? 6   TYR A HD1  4  
ATOM 10697 H HD2  . TYR A 1 6   ? 10.028  1.131   -13.189 1.00 0.00 ? 6   TYR A HD2  4  
ATOM 10698 H HE1  . TYR A 1 6   ? 11.126  1.224   -18.025 1.00 0.00 ? 6   TYR A HE1  4  
ATOM 10699 H HE2  . TYR A 1 6   ? 8.845   2.708   -14.699 1.00 0.00 ? 6   TYR A HE2  4  
ATOM 10700 H HH   . TYR A 1 6   ? 8.402   3.148   -16.911 1.00 0.00 ? 6   TYR A HH   4  
ATOM 10701 N N    . CYS A 1 7   ? 13.112  1.600   -11.789 1.00 0.00 ? 7   CYS A N    4  
ATOM 10702 C CA   . CYS A 1 7   ? 12.992  3.008   -11.314 1.00 0.00 ? 7   CYS A CA   4  
ATOM 10703 C C    . CYS A 1 7   ? 14.386  3.618   -11.164 1.00 0.00 ? 7   CYS A C    4  
ATOM 10704 O O    . CYS A 1 7   ? 14.541  4.818   -11.058 1.00 0.00 ? 7   CYS A O    4  
ATOM 10705 C CB   . CYS A 1 7   ? 12.274  3.036   -9.964  1.00 0.00 ? 7   CYS A CB   4  
ATOM 10706 S SG   . CYS A 1 7   ? 10.485  3.039   -10.236 1.00 0.00 ? 7   CYS A SG   4  
ATOM 10707 H H    . CYS A 1 7   ? 13.106  0.861   -11.145 1.00 0.00 ? 7   CYS A H    4  
ATOM 10708 H HA   . CYS A 1 7   ? 12.426  3.583   -12.033 1.00 0.00 ? 7   CYS A HA   4  
ATOM 10709 H HB2  . CYS A 1 7   ? 12.552  2.163   -9.392  1.00 0.00 ? 7   CYS A HB2  4  
ATOM 10710 H HB3  . CYS A 1 7   ? 12.558  3.926   -9.423  1.00 0.00 ? 7   CYS A HB3  4  
ATOM 10711 N N    . PHE A 1 8   ? 15.403  2.800   -11.155 1.00 0.00 ? 8   PHE A N    4  
ATOM 10712 C CA   . PHE A 1 8   ? 16.785  3.335   -11.013 1.00 0.00 ? 8   PHE A CA   4  
ATOM 10713 C C    . PHE A 1 8   ? 17.349  3.656   -12.398 1.00 0.00 ? 8   PHE A C    4  
ATOM 10714 O O    . PHE A 1 8   ? 18.542  3.804   -12.575 1.00 0.00 ? 8   PHE A O    4  
ATOM 10715 C CB   . PHE A 1 8   ? 17.670  2.290   -10.332 1.00 0.00 ? 8   PHE A CB   4  
ATOM 10716 C CG   . PHE A 1 8   ? 17.624  2.490   -8.837  1.00 0.00 ? 8   PHE A CG   4  
ATOM 10717 C CD1  . PHE A 1 8   ? 16.472  3.012   -8.235  1.00 0.00 ? 8   PHE A CD1  4  
ATOM 10718 C CD2  . PHE A 1 8   ? 18.734  2.157   -8.051  1.00 0.00 ? 8   PHE A CD2  4  
ATOM 10719 C CE1  . PHE A 1 8   ? 16.430  3.200   -6.849  1.00 0.00 ? 8   PHE A CE1  4  
ATOM 10720 C CE2  . PHE A 1 8   ? 18.692  2.344   -6.665  1.00 0.00 ? 8   PHE A CE2  4  
ATOM 10721 C CZ   . PHE A 1 8   ? 17.541  2.866   -6.064  1.00 0.00 ? 8   PHE A CZ   4  
ATOM 10722 H H    . PHE A 1 8   ? 15.256  1.835   -11.242 1.00 0.00 ? 8   PHE A H    4  
ATOM 10723 H HA   . PHE A 1 8   ? 16.764  4.235   -10.415 1.00 0.00 ? 8   PHE A HA   4  
ATOM 10724 H HB2  . PHE A 1 8   ? 17.309  1.301   -10.574 1.00 0.00 ? 8   PHE A HB2  4  
ATOM 10725 H HB3  . PHE A 1 8   ? 18.686  2.397   -10.678 1.00 0.00 ? 8   PHE A HB3  4  
ATOM 10726 H HD1  . PHE A 1 8   ? 15.616  3.270   -8.841  1.00 0.00 ? 8   PHE A HD1  4  
ATOM 10727 H HD2  . PHE A 1 8   ? 19.622  1.754   -8.516  1.00 0.00 ? 8   PHE A HD2  4  
ATOM 10728 H HE1  . PHE A 1 8   ? 15.543  3.603   -6.385  1.00 0.00 ? 8   PHE A HE1  4  
ATOM 10729 H HE2  . PHE A 1 8   ? 19.548  2.086   -6.060  1.00 0.00 ? 8   PHE A HE2  4  
ATOM 10730 H HZ   . PHE A 1 8   ? 17.509  3.011   -4.994  1.00 0.00 ? 8   PHE A HZ   4  
ATOM 10731 N N    . SER A 1 9   ? 16.500  3.765   -13.383 1.00 0.00 ? 9   SER A N    4  
ATOM 10732 C CA   . SER A 1 9   ? 16.987  4.076   -14.756 1.00 0.00 ? 9   SER A CA   4  
ATOM 10733 C C    . SER A 1 9   ? 16.523  5.478   -15.157 1.00 0.00 ? 9   SER A C    4  
ATOM 10734 O O    . SER A 1 9   ? 17.303  6.293   -15.608 1.00 0.00 ? 9   SER A O    4  
ATOM 10735 C CB   . SER A 1 9   ? 16.423  3.050   -15.741 1.00 0.00 ? 9   SER A CB   4  
ATOM 10736 O OG   . SER A 1 9   ? 17.495  2.316   -16.318 1.00 0.00 ? 9   SER A OG   4  
ATOM 10737 H H    . SER A 1 9   ? 15.542  3.642   -13.219 1.00 0.00 ? 9   SER A H    4  
ATOM 10738 H HA   . SER A 1 9   ? 18.066  4.035   -14.773 1.00 0.00 ? 9   SER A HA   4  
ATOM 10739 H HB2  . SER A 1 9   ? 15.767  2.371   -15.221 1.00 0.00 ? 9   SER A HB2  4  
ATOM 10740 H HB3  . SER A 1 9   ? 15.868  3.564   -16.514 1.00 0.00 ? 9   SER A HB3  4  
ATOM 10741 H HG   . SER A 1 9   ? 17.497  2.486   -17.263 1.00 0.00 ? 9   SER A HG   4  
ATOM 10742 N N    . SER A 1 10  ? 15.261  5.767   -14.996 1.00 0.00 ? 10  SER A N    4  
ATOM 10743 C CA   . SER A 1 10  ? 14.754  7.117   -15.369 1.00 0.00 ? 10  SER A CA   4  
ATOM 10744 C C    . SER A 1 10  ? 13.543  7.467   -14.500 1.00 0.00 ? 10  SER A C    4  
ATOM 10745 O O    . SER A 1 10  ? 13.197  6.750   -13.582 1.00 0.00 ? 10  SER A O    4  
ATOM 10746 C CB   . SER A 1 10  ? 14.342  7.119   -16.841 1.00 0.00 ? 10  SER A CB   4  
ATOM 10747 O OG   . SER A 1 10  ? 14.461  5.803   -17.364 1.00 0.00 ? 10  SER A OG   4  
ATOM 10748 H H    . SER A 1 10  ? 14.648  5.096   -14.629 1.00 0.00 ? 10  SER A H    4  
ATOM 10749 H HA   . SER A 1 10  ? 15.531  7.849   -15.212 1.00 0.00 ? 10  SER A HA   4  
ATOM 10750 H HB2  . SER A 1 10  ? 13.318  7.444   -16.930 1.00 0.00 ? 10  SER A HB2  4  
ATOM 10751 H HB3  . SER A 1 10  ? 14.980  7.796   -17.391 1.00 0.00 ? 10  SER A HB3  4  
ATOM 10752 H HG   . SER A 1 10  ? 13.808  5.700   -18.061 1.00 0.00 ? 10  SER A HG   4  
ATOM 10753 N N    . THR A 1 11  ? 12.896  8.565   -14.783 1.00 0.00 ? 11  THR A N    4  
ATOM 10754 C CA   . THR A 1 11  ? 11.709  8.961   -13.975 1.00 0.00 ? 11  THR A CA   4  
ATOM 10755 C C    . THR A 1 11  ? 10.442  8.399   -14.622 1.00 0.00 ? 11  THR A C    4  
ATOM 10756 O O    . THR A 1 11  ? 10.503  7.588   -15.525 1.00 0.00 ? 11  THR A O    4  
ATOM 10757 C CB   . THR A 1 11  ? 11.621  10.488  -13.915 1.00 0.00 ? 11  THR A CB   4  
ATOM 10758 O OG1  . THR A 1 11  ? 12.801  11.050  -14.473 1.00 0.00 ? 11  THR A OG1  4  
ATOM 10759 C CG2  . THR A 1 11  ? 11.478  10.937  -12.460 1.00 0.00 ? 11  THR A CG2  4  
ATOM 10760 H H    . THR A 1 11  ? 13.193  9.129   -15.528 1.00 0.00 ? 11  THR A H    4  
ATOM 10761 H HA   . THR A 1 11  ? 11.808  8.566   -12.974 1.00 0.00 ? 11  THR A HA   4  
ATOM 10762 H HB   . THR A 1 11  ? 10.762  10.822  -14.477 1.00 0.00 ? 11  THR A HB   4  
ATOM 10763 H HG1  . THR A 1 11  ? 12.659  11.164  -15.415 1.00 0.00 ? 11  THR A HG1  4  
ATOM 10764 H HG21 . THR A 1 11  ? 12.173  10.386  -11.844 1.00 0.00 ? 11  THR A HG21 4  
ATOM 10765 H HG22 . THR A 1 11  ? 11.693  11.994  -12.388 1.00 0.00 ? 11  THR A HG22 4  
ATOM 10766 H HG23 . THR A 1 11  ? 10.470  10.750  -12.123 1.00 0.00 ? 11  THR A HG23 4  
ATOM 10767 N N    . GLU A 1 12  ? 9.293   8.823   -14.170 1.00 0.00 ? 12  GLU A N    4  
ATOM 10768 C CA   . GLU A 1 12  ? 8.026   8.309   -14.763 1.00 0.00 ? 12  GLU A CA   4  
ATOM 10769 C C    . GLU A 1 12  ? 6.839   9.078   -14.179 1.00 0.00 ? 12  GLU A C    4  
ATOM 10770 O O    . GLU A 1 12  ? 6.981   9.851   -13.252 1.00 0.00 ? 12  GLU A O    4  
ATOM 10771 C CB   . GLU A 1 12  ? 7.878   6.821   -14.437 1.00 0.00 ? 12  GLU A CB   4  
ATOM 10772 C CG   . GLU A 1 12  ? 7.555   6.046   -15.715 1.00 0.00 ? 12  GLU A CG   4  
ATOM 10773 C CD   . GLU A 1 12  ? 6.343   5.144   -15.473 1.00 0.00 ? 12  GLU A CD   4  
ATOM 10774 O OE1  . GLU A 1 12  ? 6.004   4.940   -14.320 1.00 0.00 ? 12  GLU A OE1  4  
ATOM 10775 O OE2  . GLU A 1 12  ? 5.777   4.673   -16.446 1.00 0.00 ? 12  GLU A OE2  4  
ATOM 10776 H H    . GLU A 1 12  ? 9.265   9.477   -13.441 1.00 0.00 ? 12  GLU A H    4  
ATOM 10777 H HA   . GLU A 1 12  ? 8.050   8.442   -15.834 1.00 0.00 ? 12  GLU A HA   4  
ATOM 10778 H HB2  . GLU A 1 12  ? 8.801   6.452   -14.013 1.00 0.00 ? 12  GLU A HB2  4  
ATOM 10779 H HB3  . GLU A 1 12  ? 7.077   6.687   -13.725 1.00 0.00 ? 12  GLU A HB3  4  
ATOM 10780 H HG2  . GLU A 1 12  ? 7.334   6.743   -16.512 1.00 0.00 ? 12  GLU A HG2  4  
ATOM 10781 H HG3  . GLU A 1 12  ? 8.404   5.439   -15.993 1.00 0.00 ? 12  GLU A HG3  4  
ATOM 10782 N N    . LYS A 1 13  ? 5.668   8.872   -14.716 1.00 0.00 ? 13  LYS A N    4  
ATOM 10783 C CA   . LYS A 1 13  ? 4.471   9.589   -14.193 1.00 0.00 ? 13  LYS A CA   4  
ATOM 10784 C C    . LYS A 1 13  ? 3.714   8.680   -13.223 1.00 0.00 ? 13  LYS A C    4  
ATOM 10785 O O    . LYS A 1 13  ? 3.112   9.135   -12.271 1.00 0.00 ? 13  LYS A O    4  
ATOM 10786 C CB   . LYS A 1 13  ? 3.554   9.969   -15.358 1.00 0.00 ? 13  LYS A CB   4  
ATOM 10787 C CG   . LYS A 1 13  ? 3.703   11.461  -15.661 1.00 0.00 ? 13  LYS A CG   4  
ATOM 10788 C CD   . LYS A 1 13  ? 4.224   11.643  -17.088 1.00 0.00 ? 13  LYS A CD   4  
ATOM 10789 C CE   . LYS A 1 13  ? 5.405   12.615  -17.079 1.00 0.00 ? 13  LYS A CE   4  
ATOM 10790 N NZ   . LYS A 1 13  ? 5.027   13.864  -17.800 1.00 0.00 ? 13  LYS A NZ   4  
ATOM 10791 H H    . LYS A 1 13  ? 5.575   8.244   -15.462 1.00 0.00 ? 13  LYS A H    4  
ATOM 10792 H HA   . LYS A 1 13  ? 4.785   10.485  -13.677 1.00 0.00 ? 13  LYS A HA   4  
ATOM 10793 H HB2  . LYS A 1 13  ? 3.827   9.394   -16.232 1.00 0.00 ? 13  LYS A HB2  4  
ATOM 10794 H HB3  . LYS A 1 13  ? 2.529   9.758   -15.093 1.00 0.00 ? 13  LYS A HB3  4  
ATOM 10795 H HG2  . LYS A 1 13  ? 2.743   11.946  -15.562 1.00 0.00 ? 13  LYS A HG2  4  
ATOM 10796 H HG3  . LYS A 1 13  ? 4.403   11.900  -14.966 1.00 0.00 ? 13  LYS A HG3  4  
ATOM 10797 H HD2  . LYS A 1 13  ? 4.545   10.689  -17.479 1.00 0.00 ? 13  LYS A HD2  4  
ATOM 10798 H HD3  . LYS A 1 13  ? 3.437   12.043  -17.710 1.00 0.00 ? 13  LYS A HD3  4  
ATOM 10799 H HE2  . LYS A 1 13  ? 5.667   12.854  -16.058 1.00 0.00 ? 13  LYS A HE2  4  
ATOM 10800 H HE3  . LYS A 1 13  ? 6.252   12.159  -17.569 1.00 0.00 ? 13  LYS A HE3  4  
ATOM 10801 H HZ1  . LYS A 1 13  ? 3.993   13.976  -17.778 1.00 0.00 ? 13  LYS A HZ1  4  
ATOM 10802 H HZ2  . LYS A 1 13  ? 5.475   14.680  -17.340 1.00 0.00 ? 13  LYS A HZ2  4  
ATOM 10803 H HZ3  . LYS A 1 13  ? 5.349   13.804  -18.787 1.00 0.00 ? 13  LYS A HZ3  4  
ATOM 10804 N N    . ASN A 1 14  ? 3.740   7.396   -13.457 1.00 0.00 ? 14  ASN A N    4  
ATOM 10805 C CA   . ASN A 1 14  ? 3.022   6.458   -12.549 1.00 0.00 ? 14  ASN A CA   4  
ATOM 10806 C C    . ASN A 1 14  ? 3.921   6.107   -11.362 1.00 0.00 ? 14  ASN A C    4  
ATOM 10807 O O    . ASN A 1 14  ? 5.041   6.570   -11.261 1.00 0.00 ? 14  ASN A O    4  
ATOM 10808 C CB   . ASN A 1 14  ? 2.663   5.181   -13.314 1.00 0.00 ? 14  ASN A CB   4  
ATOM 10809 C CG   . ASN A 1 14  ? 2.044   5.552   -14.663 1.00 0.00 ? 14  ASN A CG   4  
ATOM 10810 O OD1  . ASN A 1 14  ? 2.063   4.766   -15.589 1.00 0.00 ? 14  ASN A OD1  4  
ATOM 10811 N ND2  . ASN A 1 14  ? 1.494   6.726   -14.814 1.00 0.00 ? 14  ASN A ND2  4  
ATOM 10812 H H    . ASN A 1 14  ? 4.231   7.049   -14.230 1.00 0.00 ? 14  ASN A H    4  
ATOM 10813 H HA   . ASN A 1 14  ? 2.118   6.927   -12.188 1.00 0.00 ? 14  ASN A HA   4  
ATOM 10814 H HB2  . ASN A 1 14  ? 3.557   4.596   -13.474 1.00 0.00 ? 14  ASN A HB2  4  
ATOM 10815 H HB3  . ASN A 1 14  ? 1.953   4.606   -12.740 1.00 0.00 ? 14  ASN A HB3  4  
ATOM 10816 H HD21 . ASN A 1 14  ? 1.479   7.360   -14.067 1.00 0.00 ? 14  ASN A HD21 4  
ATOM 10817 H HD22 . ASN A 1 14  ? 1.095   6.973   -15.674 1.00 0.00 ? 14  ASN A HD22 4  
ATOM 10818 N N    . CYS A 1 15  ? 3.442   5.294   -10.461 1.00 0.00 ? 15  CYS A N    4  
ATOM 10819 C CA   . CYS A 1 15  ? 4.273   4.920   -9.281  1.00 0.00 ? 15  CYS A CA   4  
ATOM 10820 C C    . CYS A 1 15  ? 5.696   4.596   -9.738  1.00 0.00 ? 15  CYS A C    4  
ATOM 10821 O O    . CYS A 1 15  ? 5.936   4.286   -10.888 1.00 0.00 ? 15  CYS A O    4  
ATOM 10822 C CB   . CYS A 1 15  ? 3.671   3.686   -8.599  1.00 0.00 ? 15  CYS A CB   4  
ATOM 10823 S SG   . CYS A 1 15  ? 4.832   3.058   -7.354  1.00 0.00 ? 15  CYS A SG   4  
ATOM 10824 H H    . CYS A 1 15  ? 2.536   4.932   -10.556 1.00 0.00 ? 15  CYS A H    4  
ATOM 10825 H HA   . CYS A 1 15  ? 4.297   5.742   -8.581  1.00 0.00 ? 15  CYS A HA   4  
ATOM 10826 H HB2  . CYS A 1 15  ? 2.741   3.954   -8.123  1.00 0.00 ? 15  CYS A HB2  4  
ATOM 10827 H HB3  . CYS A 1 15  ? 3.489   2.920   -9.339  1.00 0.00 ? 15  CYS A HB3  4  
ATOM 10828 N N    . CYS A 1 16  ? 6.640   4.658   -8.842  1.00 0.00 ? 16  CYS A N    4  
ATOM 10829 C CA   . CYS A 1 16  ? 8.046   4.344   -9.214  1.00 0.00 ? 16  CYS A CA   4  
ATOM 10830 C C    . CYS A 1 16  ? 8.886   4.224   -7.943  1.00 0.00 ? 16  CYS A C    4  
ATOM 10831 O O    . CYS A 1 16  ? 9.106   5.191   -7.240  1.00 0.00 ? 16  CYS A O    4  
ATOM 10832 C CB   . CYS A 1 16  ? 8.612   5.461   -10.095 1.00 0.00 ? 16  CYS A CB   4  
ATOM 10833 S SG   . CYS A 1 16  ? 10.090  4.880   -10.980 1.00 0.00 ? 16  CYS A SG   4  
ATOM 10834 H H    . CYS A 1 16  ? 6.423   4.905   -7.920  1.00 0.00 ? 16  CYS A H    4  
ATOM 10835 H HA   . CYS A 1 16  ? 8.071   3.410   -9.754  1.00 0.00 ? 16  CYS A HA   4  
ATOM 10836 H HB2  . CYS A 1 16  ? 7.864   5.764   -10.813 1.00 0.00 ? 16  CYS A HB2  4  
ATOM 10837 H HB3  . CYS A 1 16  ? 8.875   6.305   -9.475  1.00 0.00 ? 16  CYS A HB3  4  
ATOM 10838 N N    . VAL A 1 17  ? 9.356   3.046   -7.640  1.00 0.00 ? 17  VAL A N    4  
ATOM 10839 C CA   . VAL A 1 17  ? 10.183  2.869   -6.416  1.00 0.00 ? 17  VAL A CA   4  
ATOM 10840 C C    . VAL A 1 17  ? 11.445  3.724   -6.538  1.00 0.00 ? 17  VAL A C    4  
ATOM 10841 O O    . VAL A 1 17  ? 12.277  3.501   -7.394  1.00 0.00 ? 17  VAL A O    4  
ATOM 10842 C CB   . VAL A 1 17  ? 10.569  1.396   -6.274  1.00 0.00 ? 17  VAL A CB   4  
ATOM 10843 C CG1  . VAL A 1 17  ? 11.586  1.029   -7.346  1.00 0.00 ? 17  VAL A CG1  4  
ATOM 10844 C CG2  . VAL A 1 17  ? 11.184  1.155   -4.896  1.00 0.00 ? 17  VAL A CG2  4  
ATOM 10845 H H    . VAL A 1 17  ? 9.167   2.279   -8.219  1.00 0.00 ? 17  VAL A H    4  
ATOM 10846 H HA   . VAL A 1 17  ? 9.617   3.181   -5.552  1.00 0.00 ? 17  VAL A HA   4  
ATOM 10847 H HB   . VAL A 1 17  ? 9.690   0.782   -6.393  1.00 0.00 ? 17  VAL A HB   4  
ATOM 10848 H HG11 . VAL A 1 17  ? 11.262  1.421   -8.296  1.00 0.00 ? 17  VAL A HG11 4  
ATOM 10849 H HG12 . VAL A 1 17  ? 12.546  1.451   -7.088  1.00 0.00 ? 17  VAL A HG12 4  
ATOM 10850 H HG13 . VAL A 1 17  ? 11.670  -0.046  -7.406  1.00 0.00 ? 17  VAL A HG13 4  
ATOM 10851 H HG21 . VAL A 1 17  ? 11.513  2.095   -4.481  1.00 0.00 ? 17  VAL A HG21 4  
ATOM 10852 H HG22 . VAL A 1 17  ? 10.446  0.710   -4.246  1.00 0.00 ? 17  VAL A HG22 4  
ATOM 10853 H HG23 . VAL A 1 17  ? 12.028  0.488   -4.993  1.00 0.00 ? 17  VAL A HG23 4  
ATOM 10854 N N    . ARG A 1 18  ? 11.595  4.707   -5.694  1.00 0.00 ? 18  ARG A N    4  
ATOM 10855 C CA   . ARG A 1 18  ? 12.804  5.573   -5.775  1.00 0.00 ? 18  ARG A CA   4  
ATOM 10856 C C    . ARG A 1 18  ? 13.808  5.159   -4.700  1.00 0.00 ? 18  ARG A C    4  
ATOM 10857 O O    . ARG A 1 18  ? 13.461  4.535   -3.718  1.00 0.00 ? 18  ARG A O    4  
ATOM 10858 C CB   . ARG A 1 18  ? 12.400  7.033   -5.560  1.00 0.00 ? 18  ARG A CB   4  
ATOM 10859 C CG   . ARG A 1 18  ? 11.683  7.551   -6.806  1.00 0.00 ? 18  ARG A CG   4  
ATOM 10860 C CD   . ARG A 1 18  ? 10.947  8.848   -6.470  1.00 0.00 ? 18  ARG A CD   4  
ATOM 10861 N NE   . ARG A 1 18  ? 9.620   8.853   -7.144  1.00 0.00 ? 18  ARG A NE   4  
ATOM 10862 C CZ   . ARG A 1 18  ? 9.090   9.980   -7.534  1.00 0.00 ? 18  ARG A CZ   4  
ATOM 10863 N NH1  . ARG A 1 18  ? 9.831   10.881  -8.119  1.00 0.00 ? 18  ARG A NH1  4  
ATOM 10864 N NH2  . ARG A 1 18  ? 7.820   10.206  -7.339  1.00 0.00 ? 18  ARG A NH2  4  
ATOM 10865 H H    . ARG A 1 18  ? 10.913  4.877   -5.013  1.00 0.00 ? 18  ARG A H    4  
ATOM 10866 H HA   . ARG A 1 18  ? 13.256  5.468   -6.749  1.00 0.00 ? 18  ARG A HA   4  
ATOM 10867 H HB2  . ARG A 1 18  ? 11.738  7.101   -4.708  1.00 0.00 ? 18  ARG A HB2  4  
ATOM 10868 H HB3  . ARG A 1 18  ? 13.282  7.628   -5.380  1.00 0.00 ? 18  ARG A HB3  4  
ATOM 10869 H HG2  . ARG A 1 18  ? 12.407  7.738   -7.587  1.00 0.00 ? 18  ARG A HG2  4  
ATOM 10870 H HG3  . ARG A 1 18  ? 10.971  6.813   -7.146  1.00 0.00 ? 18  ARG A HG3  4  
ATOM 10871 H HD2  . ARG A 1 18  ? 10.810  8.916   -5.401  1.00 0.00 ? 18  ARG A HD2  4  
ATOM 10872 H HD3  . ARG A 1 18  ? 11.529  9.691   -6.813  1.00 0.00 ? 18  ARG A HD3  4  
ATOM 10873 H HE   . ARG A 1 18  ? 9.143   8.011   -7.295  1.00 0.00 ? 18  ARG A HE   4  
ATOM 10874 H HH11 . ARG A 1 18  ? 10.805  10.708  -8.267  1.00 0.00 ? 18  ARG A HH11 4  
ATOM 10875 H HH12 . ARG A 1 18  ? 9.426   11.745  -8.418  1.00 0.00 ? 18  ARG A HH12 4  
ATOM 10876 H HH21 . ARG A 1 18  ? 7.252   9.515   -6.891  1.00 0.00 ? 18  ARG A HH21 4  
ATOM 10877 H HH22 . ARG A 1 18  ? 7.413   11.070  -7.638  1.00 0.00 ? 18  ARG A HH22 4  
ATOM 10878 N N    . GLN A 1 19  ? 15.054  5.503   -4.881  1.00 0.00 ? 19  GLN A N    4  
ATOM 10879 C CA   . GLN A 1 19  ? 16.083  5.131   -3.871  1.00 0.00 ? 19  GLN A CA   4  
ATOM 10880 C C    . GLN A 1 19  ? 15.733  5.774   -2.531  1.00 0.00 ? 19  GLN A C    4  
ATOM 10881 O O    . GLN A 1 19  ? 15.313  6.912   -2.468  1.00 0.00 ? 19  GLN A O    4  
ATOM 10882 C CB   . GLN A 1 19  ? 17.456  5.626   -4.332  1.00 0.00 ? 19  GLN A CB   4  
ATOM 10883 C CG   . GLN A 1 19  ? 17.386  7.127   -4.630  1.00 0.00 ? 19  GLN A CG   4  
ATOM 10884 C CD   . GLN A 1 19  ? 18.759  7.759   -4.393  1.00 0.00 ? 19  GLN A CD   4  
ATOM 10885 O OE1  . GLN A 1 19  ? 19.408  7.480   -3.405  1.00 0.00 ? 19  GLN A OE1  4  
ATOM 10886 N NE2  . GLN A 1 19  ? 19.231  8.607   -5.266  1.00 0.00 ? 19  GLN A NE2  4  
ATOM 10887 H H    . GLN A 1 19  ? 15.312  6.007   -5.681  1.00 0.00 ? 19  GLN A H    4  
ATOM 10888 H HA   . GLN A 1 19  ? 16.106  4.058   -3.758  1.00 0.00 ? 19  GLN A HA   4  
ATOM 10889 H HB2  . GLN A 1 19  ? 18.184  5.446   -3.554  1.00 0.00 ? 19  GLN A HB2  4  
ATOM 10890 H HB3  . GLN A 1 19  ? 17.747  5.098   -5.228  1.00 0.00 ? 19  GLN A HB3  4  
ATOM 10891 H HG2  . GLN A 1 19  ? 17.092  7.276   -5.659  1.00 0.00 ? 19  GLN A HG2  4  
ATOM 10892 H HG3  . GLN A 1 19  ? 16.661  7.589   -3.977  1.00 0.00 ? 19  GLN A HG3  4  
ATOM 10893 H HE21 . GLN A 1 19  ? 18.709  8.833   -6.063  1.00 0.00 ? 19  GLN A HE21 4  
ATOM 10894 H HE22 . GLN A 1 19  ? 20.110  9.018   -5.124  1.00 0.00 ? 19  GLN A HE22 4  
ATOM 10895 N N    . LEU A 1 20  ? 15.898  5.054   -1.457  1.00 0.00 ? 20  LEU A N    4  
ATOM 10896 C CA   . LEU A 1 20  ? 15.571  5.628   -0.124  1.00 0.00 ? 20  LEU A CA   4  
ATOM 10897 C C    . LEU A 1 20  ? 16.555  5.111   0.919   1.00 0.00 ? 20  LEU A C    4  
ATOM 10898 O O    . LEU A 1 20  ? 16.167  4.679   1.986   1.00 0.00 ? 20  LEU A O    4  
ATOM 10899 C CB   . LEU A 1 20  ? 14.157  5.214   0.278   1.00 0.00 ? 20  LEU A CB   4  
ATOM 10900 C CG   . LEU A 1 20  ? 13.737  5.989   1.528   1.00 0.00 ? 20  LEU A CG   4  
ATOM 10901 C CD1  . LEU A 1 20  ? 13.738  7.487   1.226   1.00 0.00 ? 20  LEU A CD1  4  
ATOM 10902 C CD2  . LEU A 1 20  ? 12.331  5.559   1.945   1.00 0.00 ? 20  LEU A CD2  4  
ATOM 10903 H H    . LEU A 1 20  ? 16.237  4.137   -1.527  1.00 0.00 ? 20  LEU A H    4  
ATOM 10904 H HA   . LEU A 1 20  ? 15.627  6.706   -0.173  1.00 0.00 ? 20  LEU A HA   4  
ATOM 10905 H HB2  . LEU A 1 20  ? 13.479  5.434   -0.528  1.00 0.00 ? 20  LEU A HB2  4  
ATOM 10906 H HB3  . LEU A 1 20  ? 14.138  4.156   0.490   1.00 0.00 ? 20  LEU A HB3  4  
ATOM 10907 H HG   . LEU A 1 20  ? 14.430  5.783   2.330   1.00 0.00 ? 20  LEU A HG   4  
ATOM 10908 H HD11 . LEU A 1 20  ? 13.306  7.657   0.250   1.00 0.00 ? 20  LEU A HD11 4  
ATOM 10909 H HD12 . LEU A 1 20  ? 13.156  8.005   1.973   1.00 0.00 ? 20  LEU A HD12 4  
ATOM 10910 H HD13 . LEU A 1 20  ? 14.753  7.856   1.238   1.00 0.00 ? 20  LEU A HD13 4  
ATOM 10911 H HD21 . LEU A 1 20  ? 11.675  5.596   1.089   1.00 0.00 ? 20  LEU A HD21 4  
ATOM 10912 H HD22 . LEU A 1 20  ? 12.362  4.552   2.332   1.00 0.00 ? 20  LEU A HD22 4  
ATOM 10913 H HD23 . LEU A 1 20  ? 11.965  6.228   2.708   1.00 0.00 ? 20  LEU A HD23 4  
ATOM 10914 N N    . TYR A 1 21  ? 17.827  5.148   0.634   1.00 0.00 ? 21  TYR A N    4  
ATOM 10915 C CA   . TYR A 1 21  ? 18.806  4.654   1.636   1.00 0.00 ? 21  TYR A CA   4  
ATOM 10916 C C    . TYR A 1 21  ? 18.449  5.243   2.998   1.00 0.00 ? 21  TYR A C    4  
ATOM 10917 O O    . TYR A 1 21  ? 18.196  6.424   3.126   1.00 0.00 ? 21  TYR A O    4  
ATOM 10918 C CB   . TYR A 1 21  ? 20.221  5.090   1.262   1.00 0.00 ? 21  TYR A CB   4  
ATOM 10919 C CG   . TYR A 1 21  ? 21.162  4.697   2.378   1.00 0.00 ? 21  TYR A CG   4  
ATOM 10920 C CD1  . TYR A 1 21  ? 21.167  5.420   3.580   1.00 0.00 ? 21  TYR A CD1  4  
ATOM 10921 C CD2  . TYR A 1 21  ? 22.026  3.610   2.214   1.00 0.00 ? 21  TYR A CD2  4  
ATOM 10922 C CE1  . TYR A 1 21  ? 22.035  5.054   4.617   1.00 0.00 ? 21  TYR A CE1  4  
ATOM 10923 C CE2  . TYR A 1 21  ? 22.895  3.243   3.249   1.00 0.00 ? 21  TYR A CE2  4  
ATOM 10924 C CZ   . TYR A 1 21  ? 22.900  3.964   4.450   1.00 0.00 ? 21  TYR A CZ   4  
ATOM 10925 O OH   . TYR A 1 21  ? 23.757  3.603   5.469   1.00 0.00 ? 21  TYR A OH   4  
ATOM 10926 H H    . TYR A 1 21  ? 18.131  5.499   -0.229  1.00 0.00 ? 21  TYR A H    4  
ATOM 10927 H HA   . TYR A 1 21  ? 18.760  3.576   1.686   1.00 0.00 ? 21  TYR A HA   4  
ATOM 10928 H HB2  . TYR A 1 21  ? 20.520  4.601   0.346   1.00 0.00 ? 21  TYR A HB2  4  
ATOM 10929 H HB3  . TYR A 1 21  ? 20.248  6.161   1.128   1.00 0.00 ? 21  TYR A HB3  4  
ATOM 10930 H HD1  . TYR A 1 21  ? 20.498  6.258   3.706   1.00 0.00 ? 21  TYR A HD1  4  
ATOM 10931 H HD2  . TYR A 1 21  ? 22.019  3.052   1.288   1.00 0.00 ? 21  TYR A HD2  4  
ATOM 10932 H HE1  . TYR A 1 21  ? 22.035  5.611   5.545   1.00 0.00 ? 21  TYR A HE1  4  
ATOM 10933 H HE2  . TYR A 1 21  ? 23.561  2.403   3.122   1.00 0.00 ? 21  TYR A HE2  4  
ATOM 10934 H HH   . TYR A 1 21  ? 24.655  3.661   5.136   1.00 0.00 ? 21  TYR A HH   4  
ATOM 10935 N N    . ILE A 1 22  ? 18.437  4.436   4.016   1.00 0.00 ? 22  ILE A N    4  
ATOM 10936 C CA   . ILE A 1 22  ? 18.107  4.956   5.366   1.00 0.00 ? 22  ILE A CA   4  
ATOM 10937 C C    . ILE A 1 22  ? 19.274  4.670   6.306   1.00 0.00 ? 22  ILE A C    4  
ATOM 10938 O O    . ILE A 1 22  ? 19.570  3.534   6.619   1.00 0.00 ? 22  ILE A O    4  
ATOM 10939 C CB   . ILE A 1 22  ? 16.843  4.271   5.889   1.00 0.00 ? 22  ILE A CB   4  
ATOM 10940 C CG1  . ILE A 1 22  ? 15.718  4.429   4.862   1.00 0.00 ? 22  ILE A CG1  4  
ATOM 10941 C CG2  . ILE A 1 22  ? 16.426  4.922   7.209   1.00 0.00 ? 22  ILE A CG2  4  
ATOM 10942 C CD1  . ILE A 1 22  ? 14.378  4.058   5.505   1.00 0.00 ? 22  ILE A CD1  4  
ATOM 10943 H H    . ILE A 1 22  ? 18.652  3.489   3.894   1.00 0.00 ? 22  ILE A H    4  
ATOM 10944 H HA   . ILE A 1 22  ? 17.943  6.022   5.310   1.00 0.00 ? 22  ILE A HA   4  
ATOM 10945 H HB   . ILE A 1 22  ? 17.044  3.222   6.051   1.00 0.00 ? 22  ILE A HB   4  
ATOM 10946 H HG12 . ILE A 1 22  ? 15.682  5.454   4.523   1.00 0.00 ? 22  ILE A HG12 4  
ATOM 10947 H HG13 . ILE A 1 22  ? 15.903  3.778   4.022   1.00 0.00 ? 22  ILE A HG13 4  
ATOM 10948 H HG21 . ILE A 1 22  ? 16.303  5.985   7.063   1.00 0.00 ? 22  ILE A HG21 4  
ATOM 10949 H HG22 . ILE A 1 22  ? 15.490  4.494   7.540   1.00 0.00 ? 22  ILE A HG22 4  
ATOM 10950 H HG23 . ILE A 1 22  ? 17.187  4.745   7.954   1.00 0.00 ? 22  ILE A HG23 4  
ATOM 10951 H HD11 . ILE A 1 22  ? 14.492  3.147   6.073   1.00 0.00 ? 22  ILE A HD11 4  
ATOM 10952 H HD12 . ILE A 1 22  ? 14.061  4.855   6.161   1.00 0.00 ? 22  ILE A HD12 4  
ATOM 10953 H HD13 . ILE A 1 22  ? 13.638  3.910   4.732   1.00 0.00 ? 22  ILE A HD13 4  
ATOM 10954 N N    . ASP A 1 23  ? 19.938  5.693   6.764   1.00 0.00 ? 23  ASP A N    4  
ATOM 10955 C CA   . ASP A 1 23  ? 21.082  5.477   7.687   1.00 0.00 ? 23  ASP A CA   4  
ATOM 10956 C C    . ASP A 1 23  ? 20.539  5.325   9.102   1.00 0.00 ? 23  ASP A C    4  
ATOM 10957 O O    . ASP A 1 23  ? 20.378  6.288   9.813   1.00 0.00 ? 23  ASP A O    4  
ATOM 10958 C CB   . ASP A 1 23  ? 22.026  6.676   7.618   1.00 0.00 ? 23  ASP A CB   4  
ATOM 10959 C CG   . ASP A 1 23  ? 23.445  6.198   7.303   1.00 0.00 ? 23  ASP A CG   4  
ATOM 10960 O OD1  . ASP A 1 23  ? 23.816  5.143   7.791   1.00 0.00 ? 23  ASP A OD1  4  
ATOM 10961 O OD2  . ASP A 1 23  ? 24.137  6.894   6.577   1.00 0.00 ? 23  ASP A OD2  4  
ATOM 10962 H H    . ASP A 1 23  ? 19.682  6.601   6.502   1.00 0.00 ? 23  ASP A H    4  
ATOM 10963 H HA   . ASP A 1 23  ? 21.613  4.583   7.408   1.00 0.00 ? 23  ASP A HA   4  
ATOM 10964 H HB2  . ASP A 1 23  ? 21.693  7.354   6.846   1.00 0.00 ? 23  ASP A HB2  4  
ATOM 10965 H HB3  . ASP A 1 23  ? 22.025  7.182   8.563   1.00 0.00 ? 23  ASP A HB3  4  
ATOM 10966 N N    . PHE A 1 24  ? 20.247  4.108   9.485   1.00 0.00 ? 24  PHE A N    4  
ATOM 10967 C CA   . PHE A 1 24  ? 19.690  3.802   10.845  1.00 0.00 ? 24  PHE A CA   4  
ATOM 10968 C C    . PHE A 1 24  ? 19.690  5.026   11.767  1.00 0.00 ? 24  PHE A C    4  
ATOM 10969 O O    . PHE A 1 24  ? 18.656  5.462   12.226  1.00 0.00 ? 24  PHE A O    4  
ATOM 10970 C CB   . PHE A 1 24  ? 20.531  2.698   11.488  1.00 0.00 ? 24  PHE A CB   4  
ATOM 10971 C CG   . PHE A 1 24  ? 20.013  1.351   11.047  1.00 0.00 ? 24  PHE A CG   4  
ATOM 10972 C CD1  . PHE A 1 24  ? 18.738  0.930   11.443  1.00 0.00 ? 24  PHE A CD1  4  
ATOM 10973 C CD2  . PHE A 1 24  ? 20.803  0.525   10.241  1.00 0.00 ? 24  PHE A CD2  4  
ATOM 10974 C CE1  . PHE A 1 24  ? 18.254  -0.317  11.031  1.00 0.00 ? 24  PHE A CE1  4  
ATOM 10975 C CE2  . PHE A 1 24  ? 20.319  -0.723  9.832   1.00 0.00 ? 24  PHE A CE2  4  
ATOM 10976 C CZ   . PHE A 1 24  ? 19.045  -1.143  10.227  1.00 0.00 ? 24  PHE A CZ   4  
ATOM 10977 H H    . PHE A 1 24  ? 20.388  3.370   8.855   1.00 0.00 ? 24  PHE A H    4  
ATOM 10978 H HA   . PHE A 1 24  ? 18.677  3.446   10.735  1.00 0.00 ? 24  PHE A HA   4  
ATOM 10979 H HB2  . PHE A 1 24  ? 21.561  2.805   11.181  1.00 0.00 ? 24  PHE A HB2  4  
ATOM 10980 H HB3  . PHE A 1 24  ? 20.465  2.775   12.563  1.00 0.00 ? 24  PHE A HB3  4  
ATOM 10981 H HD1  . PHE A 1 24  ? 18.129  1.566   12.066  1.00 0.00 ? 24  PHE A HD1  4  
ATOM 10982 H HD2  . PHE A 1 24  ? 21.786  0.849   9.936   1.00 0.00 ? 24  PHE A HD2  4  
ATOM 10983 H HE1  . PHE A 1 24  ? 17.272  -0.641  11.335  1.00 0.00 ? 24  PHE A HE1  4  
ATOM 10984 H HE2  . PHE A 1 24  ? 20.928  -1.364  9.215   1.00 0.00 ? 24  PHE A HE2  4  
ATOM 10985 H HZ   . PHE A 1 24  ? 18.671  -2.104  9.908   1.00 0.00 ? 24  PHE A HZ   4  
ATOM 10986 N N    . ARG A 1 25  ? 20.840  5.569   12.062  1.00 0.00 ? 25  ARG A N    4  
ATOM 10987 C CA   . ARG A 1 25  ? 20.897  6.743   12.985  1.00 0.00 ? 25  ARG A CA   4  
ATOM 10988 C C    . ARG A 1 25  ? 20.650  8.063   12.240  1.00 0.00 ? 25  ARG A C    4  
ATOM 10989 O O    . ARG A 1 25  ? 19.982  8.945   12.742  1.00 0.00 ? 25  ARG A O    4  
ATOM 10990 C CB   . ARG A 1 25  ? 22.279  6.791   13.642  1.00 0.00 ? 25  ARG A CB   4  
ATOM 10991 C CG   . ARG A 1 25  ? 22.172  6.325   15.095  1.00 0.00 ? 25  ARG A CG   4  
ATOM 10992 C CD   . ARG A 1 25  ? 23.573  6.058   15.649  1.00 0.00 ? 25  ARG A CD   4  
ATOM 10993 N NE   . ARG A 1 25  ? 24.518  7.083   15.124  1.00 0.00 ? 25  ARG A NE   4  
ATOM 10994 C CZ   . ARG A 1 25  ? 25.641  6.713   14.571  1.00 0.00 ? 25  ARG A CZ   4  
ATOM 10995 N NH1  . ARG A 1 25  ? 26.397  5.827   15.160  1.00 0.00 ? 25  ARG A NH1  4  
ATOM 10996 N NH2  . ARG A 1 25  ? 26.009  7.231   13.431  1.00 0.00 ? 25  ARG A NH2  4  
ATOM 10997 H H    . ARG A 1 25  ? 21.666  5.195   11.694  1.00 0.00 ? 25  ARG A H    4  
ATOM 10998 H HA   . ARG A 1 25  ? 20.150  6.622   13.752  1.00 0.00 ? 25  ARG A HA   4  
ATOM 10999 H HB2  . ARG A 1 25  ? 22.955  6.143   13.102  1.00 0.00 ? 25  ARG A HB2  4  
ATOM 11000 H HB3  . ARG A 1 25  ? 22.653  7.803   13.617  1.00 0.00 ? 25  ARG A HB3  4  
ATOM 11001 H HG2  . ARG A 1 25  ? 21.691  7.092   15.684  1.00 0.00 ? 25  ARG A HG2  4  
ATOM 11002 H HG3  . ARG A 1 25  ? 21.590  5.416   15.140  1.00 0.00 ? 25  ARG A HG3  4  
ATOM 11003 H HD2  . ARG A 1 25  ? 23.549  6.109   16.727  1.00 0.00 ? 25  ARG A HD2  4  
ATOM 11004 H HD3  . ARG A 1 25  ? 23.900  5.076   15.343  1.00 0.00 ? 25  ARG A HD3  4  
ATOM 11005 H HE   . ARG A 1 25  ? 24.296  8.035   15.193  1.00 0.00 ? 25  ARG A HE   4  
ATOM 11006 H HH11 . ARG A 1 25  ? 26.115  5.431   16.033  1.00 0.00 ? 25  ARG A HH11 4  
ATOM 11007 H HH12 . ARG A 1 25  ? 27.257  5.544   14.736  1.00 0.00 ? 25  ARG A HH12 4  
ATOM 11008 H HH21 . ARG A 1 25  ? 25.430  7.909   12.980  1.00 0.00 ? 25  ARG A HH21 4  
ATOM 11009 H HH22 . ARG A 1 25  ? 26.869  6.948   13.008  1.00 0.00 ? 25  ARG A HH22 4  
ATOM 11010 N N    . LYS A 1 26  ? 21.202  8.225   11.070  1.00 0.00 ? 26  LYS A N    4  
ATOM 11011 C CA   . LYS A 1 26  ? 21.016  9.511   10.331  1.00 0.00 ? 26  LYS A CA   4  
ATOM 11012 C C    . LYS A 1 26  ? 19.540  9.743   9.999   1.00 0.00 ? 26  LYS A C    4  
ATOM 11013 O O    . LYS A 1 26  ? 19.005  10.812  10.217  1.00 0.00 ? 26  LYS A O    4  
ATOM 11014 C CB   . LYS A 1 26  ? 21.806  9.455   9.026   1.00 0.00 ? 26  LYS A CB   4  
ATOM 11015 C CG   . LYS A 1 26  ? 22.278  10.860  8.648   1.00 0.00 ? 26  LYS A CG   4  
ATOM 11016 C CD   . LYS A 1 26  ? 23.738  10.801  8.191   1.00 0.00 ? 26  LYS A CD   4  
ATOM 11017 C CE   . LYS A 1 26  ? 24.437  12.117  8.540   1.00 0.00 ? 26  LYS A CE   4  
ATOM 11018 N NZ   . LYS A 1 26  ? 25.468  12.418  7.506   1.00 0.00 ? 26  LYS A NZ   4  
ATOM 11019 H H    . LYS A 1 26  ? 21.759  7.515   10.684  1.00 0.00 ? 26  LYS A H    4  
ATOM 11020 H HA   . LYS A 1 26  ? 21.381  10.328  10.934  1.00 0.00 ? 26  LYS A HA   4  
ATOM 11021 H HB2  . LYS A 1 26  ? 22.656  8.807   9.154   1.00 0.00 ? 26  LYS A HB2  4  
ATOM 11022 H HB3  . LYS A 1 26  ? 21.175  9.068   8.240   1.00 0.00 ? 26  LYS A HB3  4  
ATOM 11023 H HG2  . LYS A 1 26  ? 21.664  11.241  7.844   1.00 0.00 ? 26  LYS A HG2  4  
ATOM 11024 H HG3  . LYS A 1 26  ? 22.197  11.511  9.504   1.00 0.00 ? 26  LYS A HG3  4  
ATOM 11025 H HD2  . LYS A 1 26  ? 24.238  9.984   8.692   1.00 0.00 ? 26  LYS A HD2  4  
ATOM 11026 H HD3  . LYS A 1 26  ? 23.776  10.647  7.124   1.00 0.00 ? 26  LYS A HD3  4  
ATOM 11027 H HE2  . LYS A 1 26  ? 23.709  12.914  8.566   1.00 0.00 ? 26  LYS A HE2  4  
ATOM 11028 H HE3  . LYS A 1 26  ? 24.910  12.028  9.506   1.00 0.00 ? 26  LYS A HE3  4  
ATOM 11029 H HZ1  . LYS A 1 26  ? 25.749  11.539  7.030   1.00 0.00 ? 26  LYS A HZ1  4  
ATOM 11030 H HZ2  . LYS A 1 26  ? 25.075  13.079  6.807   1.00 0.00 ? 26  LYS A HZ2  4  
ATOM 11031 H HZ3  . LYS A 1 26  ? 26.299  12.849  7.963   1.00 0.00 ? 26  LYS A HZ3  4  
ATOM 11032 N N    . ASP A 1 27  ? 18.895  8.768   9.434   1.00 0.00 ? 27  ASP A N    4  
ATOM 11033 C CA   . ASP A 1 27  ? 17.473  8.939   9.037   1.00 0.00 ? 27  ASP A CA   4  
ATOM 11034 C C    . ASP A 1 27  ? 16.511  8.558   10.172  1.00 0.00 ? 27  ASP A C    4  
ATOM 11035 O O    . ASP A 1 27  ? 15.710  9.362   10.604  1.00 0.00 ? 27  ASP A O    4  
ATOM 11036 C CB   . ASP A 1 27  ? 17.208  8.048   7.828   1.00 0.00 ? 27  ASP A CB   4  
ATOM 11037 C CG   . ASP A 1 27  ? 17.475  8.837   6.547   1.00 0.00 ? 27  ASP A CG   4  
ATOM 11038 O OD1  . ASP A 1 27  ? 17.106  9.999   6.501   1.00 0.00 ? 27  ASP A OD1  4  
ATOM 11039 O OD2  . ASP A 1 27  ? 18.044  8.266   5.631   1.00 0.00 ? 27  ASP A OD2  4  
ATOM 11040 H H    . ASP A 1 27  ? 19.356  7.931   9.235   1.00 0.00 ? 27  ASP A H    4  
ATOM 11041 H HA   . ASP A 1 27  ? 17.302  9.967   8.758   1.00 0.00 ? 27  ASP A HA   4  
ATOM 11042 H HB2  . ASP A 1 27  ? 17.864  7.190   7.867   1.00 0.00 ? 27  ASP A HB2  4  
ATOM 11043 H HB3  . ASP A 1 27  ? 16.188  7.719   7.845   1.00 0.00 ? 27  ASP A HB3  4  
ATOM 11044 N N    . LEU A 1 28  ? 16.556  7.340   10.641  1.00 0.00 ? 28  LEU A N    4  
ATOM 11045 C CA   . LEU A 1 28  ? 15.607  6.933   11.722  1.00 0.00 ? 28  LEU A CA   4  
ATOM 11046 C C    . LEU A 1 28  ? 16.192  7.240   13.098  1.00 0.00 ? 28  LEU A C    4  
ATOM 11047 O O    . LEU A 1 28  ? 15.488  7.247   14.090  1.00 0.00 ? 28  LEU A O    4  
ATOM 11048 C CB   . LEU A 1 28  ? 15.344  5.430   11.636  1.00 0.00 ? 28  LEU A CB   4  
ATOM 11049 C CG   . LEU A 1 28  ? 14.838  5.072   10.241  1.00 0.00 ? 28  LEU A CG   4  
ATOM 11050 C CD1  . LEU A 1 28  ? 14.468  3.590   10.205  1.00 0.00 ? 28  LEU A CD1  4  
ATOM 11051 C CD2  . LEU A 1 28  ? 13.600  5.909   9.919   1.00 0.00 ? 28  LEU A CD2  4  
ATOM 11052 H H    . LEU A 1 28  ? 17.188  6.691   10.268  1.00 0.00 ? 28  LEU A H    4  
ATOM 11053 H HA   . LEU A 1 28  ? 14.675  7.466   11.602  1.00 0.00 ? 28  LEU A HA   4  
ATOM 11054 H HB2  . LEU A 1 28  ? 16.260  4.893   11.834  1.00 0.00 ? 28  LEU A HB2  4  
ATOM 11055 H HB3  . LEU A 1 28  ? 14.600  5.153   12.368  1.00 0.00 ? 28  LEU A HB3  4  
ATOM 11056 H HG   . LEU A 1 28  ? 15.613  5.271   9.517   1.00 0.00 ? 28  LEU A HG   4  
ATOM 11057 H HD11 . LEU A 1 28  ? 14.895  3.092   11.064  1.00 0.00 ? 28  LEU A HD11 4  
ATOM 11058 H HD12 . LEU A 1 28  ? 13.393  3.487   10.227  1.00 0.00 ? 28  LEU A HD12 4  
ATOM 11059 H HD13 . LEU A 1 28  ? 14.855  3.145   9.302   1.00 0.00 ? 28  LEU A HD13 4  
ATOM 11060 H HD21 . LEU A 1 28  ? 13.094  6.171   10.837  1.00 0.00 ? 28  LEU A HD21 4  
ATOM 11061 H HD22 . LEU A 1 28  ? 13.901  6.807   9.403   1.00 0.00 ? 28  LEU A HD22 4  
ATOM 11062 H HD23 . LEU A 1 28  ? 12.934  5.337   9.290   1.00 0.00 ? 28  LEU A HD23 4  
ATOM 11063 N N    . GLY A 1 29  ? 17.467  7.476   13.183  1.00 0.00 ? 29  GLY A N    4  
ATOM 11064 C CA   . GLY A 1 29  ? 18.067  7.758   14.518  1.00 0.00 ? 29  GLY A CA   4  
ATOM 11065 C C    . GLY A 1 29  ? 17.903  6.518   15.403  1.00 0.00 ? 29  GLY A C    4  
ATOM 11066 O O    . GLY A 1 29  ? 18.091  6.567   16.602  1.00 0.00 ? 29  GLY A O    4  
ATOM 11067 H H    . GLY A 1 29  ? 18.028  7.456   12.380  1.00 0.00 ? 29  GLY A H    4  
ATOM 11068 H HA2  . GLY A 1 29  ? 19.115  7.992   14.403  1.00 0.00 ? 29  GLY A HA2  4  
ATOM 11069 H HA3  . GLY A 1 29  ? 17.557  8.593   14.974  1.00 0.00 ? 29  GLY A HA3  4  
ATOM 11070 N N    . TRP A 1 30  ? 17.546  5.406   14.812  1.00 0.00 ? 30  TRP A N    4  
ATOM 11071 C CA   . TRP A 1 30  ? 17.359  4.156   15.600  1.00 0.00 ? 30  TRP A CA   4  
ATOM 11072 C C    . TRP A 1 30  ? 18.507  3.994   16.594  1.00 0.00 ? 30  TRP A C    4  
ATOM 11073 O O    . TRP A 1 30  ? 19.667  4.055   16.236  1.00 0.00 ? 30  TRP A O    4  
ATOM 11074 C CB   . TRP A 1 30  ? 17.345  2.958   14.648  1.00 0.00 ? 30  TRP A CB   4  
ATOM 11075 C CG   . TRP A 1 30  ? 15.951  2.718   14.164  1.00 0.00 ? 30  TRP A CG   4  
ATOM 11076 C CD1  . TRP A 1 30  ? 14.921  3.584   14.298  1.00 0.00 ? 30  TRP A CD1  4  
ATOM 11077 C CD2  . TRP A 1 30  ? 15.419  1.551   13.473  1.00 0.00 ? 30  TRP A CD2  4  
ATOM 11078 N NE1  . TRP A 1 30  ? 13.790  3.023   13.734  1.00 0.00 ? 30  TRP A NE1  4  
ATOM 11079 C CE2  . TRP A 1 30  ? 14.045  1.771   13.213  1.00 0.00 ? 30  TRP A CE2  4  
ATOM 11080 C CE3  . TRP A 1 30  ? 15.988  0.338   13.052  1.00 0.00 ? 30  TRP A CE3  4  
ATOM 11081 C CZ2  . TRP A 1 30  ? 13.263  0.817   12.558  1.00 0.00 ? 30  TRP A CZ2  4  
ATOM 11082 C CZ3  . TRP A 1 30  ? 15.203  -0.626  12.394  1.00 0.00 ? 30  TRP A CZ3  4  
ATOM 11083 C CH2  . TRP A 1 30  ? 13.844  -0.385  12.148  1.00 0.00 ? 30  TRP A CH2  4  
ATOM 11084 H H    . TRP A 1 30  ? 17.394  5.394   13.848  1.00 0.00 ? 30  TRP A H    4  
ATOM 11085 H HA   . TRP A 1 30  ? 16.421  4.201   16.134  1.00 0.00 ? 30  TRP A HA   4  
ATOM 11086 H HB2  . TRP A 1 30  ? 17.988  3.161   13.805  1.00 0.00 ? 30  TRP A HB2  4  
ATOM 11087 H HB3  . TRP A 1 30  ? 17.700  2.082   15.169  1.00 0.00 ? 30  TRP A HB3  4  
ATOM 11088 H HD1  . TRP A 1 30  ? 14.974  4.556   14.768  1.00 0.00 ? 30  TRP A HD1  4  
ATOM 11089 H HE1  . TRP A 1 30  ? 12.908  3.445   13.699  1.00 0.00 ? 30  TRP A HE1  4  
ATOM 11090 H HE3  . TRP A 1 30  ? 17.034  0.143   13.237  1.00 0.00 ? 30  TRP A HE3  4  
ATOM 11091 H HZ2  . TRP A 1 30  ? 12.217  1.008   12.372  1.00 0.00 ? 30  TRP A HZ2  4  
ATOM 11092 H HZ3  . TRP A 1 30  ? 15.650  -1.557  12.077  1.00 0.00 ? 30  TRP A HZ3  4  
ATOM 11093 H HH2  . TRP A 1 30  ? 13.247  -1.128  11.641  1.00 0.00 ? 30  TRP A HH2  4  
ATOM 11094 N N    . LYS A 1 31  ? 18.190  3.790   17.840  1.00 0.00 ? 31  LYS A N    4  
ATOM 11095 C CA   . LYS A 1 31  ? 19.244  3.626   18.864  1.00 0.00 ? 31  LYS A CA   4  
ATOM 11096 C C    . LYS A 1 31  ? 19.311  2.162   19.296  1.00 0.00 ? 31  LYS A C    4  
ATOM 11097 O O    . LYS A 1 31  ? 20.220  1.752   19.992  1.00 0.00 ? 31  LYS A O    4  
ATOM 11098 C CB   . LYS A 1 31  ? 18.880  4.489   20.063  1.00 0.00 ? 31  LYS A CB   4  
ATOM 11099 C CG   . LYS A 1 31  ? 19.506  5.876   19.908  1.00 0.00 ? 31  LYS A CG   4  
ATOM 11100 C CD   . LYS A 1 31  ? 19.106  6.752   21.097  1.00 0.00 ? 31  LYS A CD   4  
ATOM 11101 C CE   . LYS A 1 31  ? 17.700  7.309   20.870  1.00 0.00 ? 31  LYS A CE   4  
ATOM 11102 N NZ   . LYS A 1 31  ? 16.944  7.282   22.154  1.00 0.00 ? 31  LYS A NZ   4  
ATOM 11103 H H    . LYS A 1 31  ? 17.252  3.749   18.109  1.00 0.00 ? 31  LYS A H    4  
ATOM 11104 H HA   . LYS A 1 31  ? 20.198  3.938   18.466  1.00 0.00 ? 31  LYS A HA   4  
ATOM 11105 H HB2  . LYS A 1 31  ? 17.805  4.579   20.118  1.00 0.00 ? 31  LYS A HB2  4  
ATOM 11106 H HB3  . LYS A 1 31  ? 19.245  4.025   20.958  1.00 0.00 ? 31  LYS A HB3  4  
ATOM 11107 H HG2  . LYS A 1 31  ? 20.582  5.785   19.872  1.00 0.00 ? 31  LYS A HG2  4  
ATOM 11108 H HG3  . LYS A 1 31  ? 19.152  6.331   18.994  1.00 0.00 ? 31  LYS A HG3  4  
ATOM 11109 H HD2  . LYS A 1 31  ? 19.120  6.160   22.001  1.00 0.00 ? 31  LYS A HD2  4  
ATOM 11110 H HD3  . LYS A 1 31  ? 19.804  7.571   21.191  1.00 0.00 ? 31  LYS A HD3  4  
ATOM 11111 H HE2  . LYS A 1 31  ? 17.767  8.326   20.513  1.00 0.00 ? 31  LYS A HE2  4  
ATOM 11112 H HE3  . LYS A 1 31  ? 17.186  6.702   20.138  1.00 0.00 ? 31  LYS A HE3  4  
ATOM 11113 H HZ1  . LYS A 1 31  ? 17.486  6.752   22.864  1.00 0.00 ? 31  LYS A HZ1  4  
ATOM 11114 H HZ2  . LYS A 1 31  ? 16.797  8.254   22.490  1.00 0.00 ? 31  LYS A HZ2  4  
ATOM 11115 H HZ3  . LYS A 1 31  ? 16.023  6.822   22.004  1.00 0.00 ? 31  LYS A HZ3  4  
ATOM 11116 N N    . TRP A 1 32  ? 18.351  1.370   18.902  1.00 0.00 ? 32  TRP A N    4  
ATOM 11117 C CA   . TRP A 1 32  ? 18.366  -0.062  19.308  1.00 0.00 ? 32  TRP A CA   4  
ATOM 11118 C C    . TRP A 1 32  ? 19.191  -0.878  18.315  1.00 0.00 ? 32  TRP A C    4  
ATOM 11119 O O    . TRP A 1 32  ? 19.374  -2.066  18.481  1.00 0.00 ? 32  TRP A O    4  
ATOM 11120 C CB   . TRP A 1 32  ? 16.936  -0.605  19.357  1.00 0.00 ? 32  TRP A CB   4  
ATOM 11121 C CG   . TRP A 1 32  ? 16.424  -0.853  17.972  1.00 0.00 ? 32  TRP A CG   4  
ATOM 11122 C CD1  . TRP A 1 32  ? 15.962  0.101   17.133  1.00 0.00 ? 32  TRP A CD1  4  
ATOM 11123 C CD2  . TRP A 1 32  ? 16.310  -2.115  17.253  1.00 0.00 ? 32  TRP A CD2  4  
ATOM 11124 N NE1  . TRP A 1 32  ? 15.554  -0.495  15.958  1.00 0.00 ? 32  TRP A NE1  4  
ATOM 11125 C CE2  . TRP A 1 32  ? 15.750  -1.860  15.981  1.00 0.00 ? 32  TRP A CE2  4  
ATOM 11126 C CE3  . TRP A 1 32  ? 16.630  -3.443  17.580  1.00 0.00 ? 32  TRP A CE3  4  
ATOM 11127 C CZ2  . TRP A 1 32  ? 15.513  -2.886  15.066  1.00 0.00 ? 32  TRP A CZ2  4  
ATOM 11128 C CZ3  . TRP A 1 32  ? 16.396  -4.480  16.662  1.00 0.00 ? 32  TRP A CZ3  4  
ATOM 11129 C CH2  . TRP A 1 32  ? 15.836  -4.201  15.407  1.00 0.00 ? 32  TRP A CH2  4  
ATOM 11130 H H    . TRP A 1 32  ? 17.620  1.719   18.347  1.00 0.00 ? 32  TRP A H    4  
ATOM 11131 H HA   . TRP A 1 32  ? 18.809  -0.146  20.287  1.00 0.00 ? 32  TRP A HA   4  
ATOM 11132 H HB2  . TRP A 1 32  ? 16.924  -1.531  19.912  1.00 0.00 ? 32  TRP A HB2  4  
ATOM 11133 H HB3  . TRP A 1 32  ? 16.299  0.114   19.851  1.00 0.00 ? 32  TRP A HB3  4  
ATOM 11134 H HD1  . TRP A 1 32  ? 15.915  1.153   17.346  1.00 0.00 ? 32  TRP A HD1  4  
ATOM 11135 H HE1  . TRP A 1 32  ? 15.173  -0.022  15.193  1.00 0.00 ? 32  TRP A HE1  4  
ATOM 11136 H HE3  . TRP A 1 32  ? 17.067  -3.666  18.537  1.00 0.00 ? 32  TRP A HE3  4  
ATOM 11137 H HZ2  . TRP A 1 32  ? 15.081  -2.666  14.100  1.00 0.00 ? 32  TRP A HZ2  4  
ATOM 11138 H HZ3  . TRP A 1 32  ? 16.647  -5.500  16.927  1.00 0.00 ? 32  TRP A HZ3  4  
ATOM 11139 H HH2  . TRP A 1 32  ? 15.659  -5.000  14.703  1.00 0.00 ? 32  TRP A HH2  4  
ATOM 11140 N N    . ILE A 1 33  ? 19.691  -0.256  17.287  1.00 0.00 ? 33  ILE A N    4  
ATOM 11141 C CA   . ILE A 1 33  ? 20.503  -1.012  16.297  1.00 0.00 ? 33  ILE A CA   4  
ATOM 11142 C C    . ILE A 1 33  ? 21.874  -0.346  16.146  1.00 0.00 ? 33  ILE A C    4  
ATOM 11143 O O    . ILE A 1 33  ? 21.983  0.846   15.943  1.00 0.00 ? 33  ILE A O    4  
ATOM 11144 C CB   . ILE A 1 33  ? 19.770  -1.040  14.949  1.00 0.00 ? 33  ILE A CB   4  
ATOM 11145 C CG1  . ILE A 1 33  ? 18.748  -2.174  14.973  1.00 0.00 ? 33  ILE A CG1  4  
ATOM 11146 C CG2  . ILE A 1 33  ? 20.761  -1.280  13.806  1.00 0.00 ? 33  ILE A CG2  4  
ATOM 11147 C CD1  . ILE A 1 33  ? 17.915  -2.146  13.695  1.00 0.00 ? 33  ILE A CD1  4  
ATOM 11148 H H    . ILE A 1 33  ? 19.535  0.703   17.167  1.00 0.00 ? 33  ILE A H    4  
ATOM 11149 H HA   . ILE A 1 33  ? 20.634  -2.026  16.650  1.00 0.00 ? 33  ILE A HA   4  
ATOM 11150 H HB   . ILE A 1 33  ? 19.261  -0.100  14.795  1.00 0.00 ? 33  ILE A HB   4  
ATOM 11151 H HG12 . ILE A 1 33  ? 19.264  -3.118  15.043  1.00 0.00 ? 33  ILE A HG12 4  
ATOM 11152 H HG13 . ILE A 1 33  ? 18.102  -2.054  15.824  1.00 0.00 ? 33  ILE A HG13 4  
ATOM 11153 H HG21 . ILE A 1 33  ? 21.637  -1.784  14.189  1.00 0.00 ? 33  ILE A HG21 4  
ATOM 11154 H HG22 . ILE A 1 33  ? 20.296  -1.893  13.048  1.00 0.00 ? 33  ILE A HG22 4  
ATOM 11155 H HG23 . ILE A 1 33  ? 21.050  -0.333  13.375  1.00 0.00 ? 33  ILE A HG23 4  
ATOM 11156 H HD11 . ILE A 1 33  ? 18.483  -1.680  12.906  1.00 0.00 ? 33  ILE A HD11 4  
ATOM 11157 H HD12 . ILE A 1 33  ? 17.660  -3.156  13.409  1.00 0.00 ? 33  ILE A HD12 4  
ATOM 11158 H HD13 . ILE A 1 33  ? 17.012  -1.584  13.869  1.00 0.00 ? 33  ILE A HD13 4  
ATOM 11159 N N    . HIS A 1 34  ? 22.918  -1.119  16.245  1.00 0.00 ? 34  HIS A N    4  
ATOM 11160 C CA   . HIS A 1 34  ? 24.289  -0.552  16.111  1.00 0.00 ? 34  HIS A CA   4  
ATOM 11161 C C    . HIS A 1 34  ? 24.759  -0.698  14.659  1.00 0.00 ? 34  HIS A C    4  
ATOM 11162 O O    . HIS A 1 34  ? 25.222  0.246   14.050  1.00 0.00 ? 34  HIS A O    4  
ATOM 11163 C CB   . HIS A 1 34  ? 25.239  -1.312  17.045  1.00 0.00 ? 34  HIS A CB   4  
ATOM 11164 C CG   . HIS A 1 34  ? 26.669  -1.047  16.653  1.00 0.00 ? 34  HIS A CG   4  
ATOM 11165 N ND1  . HIS A 1 34  ? 27.173  0.237   16.518  1.00 0.00 ? 34  HIS A ND1  4  
ATOM 11166 C CD2  . HIS A 1 34  ? 27.710  -1.893  16.363  1.00 0.00 ? 34  HIS A CD2  4  
ATOM 11167 C CE1  . HIS A 1 34  ? 28.467  0.127   16.161  1.00 0.00 ? 34  HIS A CE1  4  
ATOM 11168 N NE2  . HIS A 1 34  ? 28.845  -1.149  16.053  1.00 0.00 ? 34  HIS A NE2  4  
ATOM 11169 H H    . HIS A 1 34  ? 22.798  -2.075  16.410  1.00 0.00 ? 34  HIS A H    4  
ATOM 11170 H HA   . HIS A 1 34  ? 24.275  0.493   16.383  1.00 0.00 ? 34  HIS A HA   4  
ATOM 11171 H HB2  . HIS A 1 34  ? 25.080  -0.983  18.062  1.00 0.00 ? 34  HIS A HB2  4  
ATOM 11172 H HB3  . HIS A 1 34  ? 25.039  -2.371  16.976  1.00 0.00 ? 34  HIS A HB3  4  
ATOM 11173 H HD1  . HIS A 1 34  ? 26.680  1.070   16.658  1.00 0.00 ? 34  HIS A HD1  4  
ATOM 11174 H HD2  . HIS A 1 34  ? 27.657  -2.973  16.373  1.00 0.00 ? 34  HIS A HD2  4  
ATOM 11175 H HE1  . HIS A 1 34  ? 29.120  0.969   15.984  1.00 0.00 ? 34  HIS A HE1  4  
ATOM 11176 N N    . GLU A 1 35  ? 24.646  -1.873  14.102  1.00 0.00 ? 35  GLU A N    4  
ATOM 11177 C CA   . GLU A 1 35  ? 25.088  -2.075  12.693  1.00 0.00 ? 35  GLU A CA   4  
ATOM 11178 C C    . GLU A 1 35  ? 23.999  -2.823  11.919  1.00 0.00 ? 35  GLU A C    4  
ATOM 11179 O O    . GLU A 1 35  ? 23.221  -3.553  12.499  1.00 0.00 ? 35  GLU A O    4  
ATOM 11180 C CB   . GLU A 1 35  ? 26.381  -2.895  12.678  1.00 0.00 ? 35  GLU A CB   4  
ATOM 11181 C CG   . GLU A 1 35  ? 27.584  -1.955  12.778  1.00 0.00 ? 35  GLU A CG   4  
ATOM 11182 C CD   . GLU A 1 35  ? 28.877  -2.763  12.655  1.00 0.00 ? 35  GLU A CD   4  
ATOM 11183 O OE1  . GLU A 1 35  ? 28.805  -3.978  12.750  1.00 0.00 ? 35  GLU A OE1  4  
ATOM 11184 O OE2  . GLU A 1 35  ? 29.917  -2.154  12.467  1.00 0.00 ? 35  GLU A OE2  4  
ATOM 11185 H H    . GLU A 1 35  ? 24.272  -2.622  14.610  1.00 0.00 ? 35  GLU A H    4  
ATOM 11186 H HA   . GLU A 1 35  ? 25.265  -1.115  12.230  1.00 0.00 ? 35  GLU A HA   4  
ATOM 11187 H HB2  . GLU A 1 35  ? 26.384  -3.576  13.517  1.00 0.00 ? 35  GLU A HB2  4  
ATOM 11188 H HB3  . GLU A 1 35  ? 26.441  -3.456  11.758  1.00 0.00 ? 35  GLU A HB3  4  
ATOM 11189 H HG2  . GLU A 1 35  ? 27.537  -1.225  11.983  1.00 0.00 ? 35  GLU A HG2  4  
ATOM 11190 H HG3  . GLU A 1 35  ? 27.568  -1.450  13.733  1.00 0.00 ? 35  GLU A HG3  4  
ATOM 11191 N N    . PRO A 1 36  ? 23.975  -2.615  10.626  1.00 0.00 ? 36  PRO A N    4  
ATOM 11192 C CA   . PRO A 1 36  ? 24.926  -1.725  9.932   1.00 0.00 ? 36  PRO A CA   4  
ATOM 11193 C C    . PRO A 1 36  ? 24.539  -0.262  10.140  1.00 0.00 ? 36  PRO A C    4  
ATOM 11194 O O    . PRO A 1 36  ? 23.536  0.045   10.752  1.00 0.00 ? 36  PRO A O    4  
ATOM 11195 C CB   . PRO A 1 36  ? 24.781  -2.126  8.460   1.00 0.00 ? 36  PRO A CB   4  
ATOM 11196 C CG   . PRO A 1 36  ? 23.392  -2.793  8.325   1.00 0.00 ? 36  PRO A CG   4  
ATOM 11197 C CD   . PRO A 1 36  ? 22.986  -3.255  9.738   1.00 0.00 ? 36  PRO A CD   4  
ATOM 11198 H HA   . PRO A 1 36  ? 25.933  -1.904  10.263  1.00 0.00 ? 36  PRO A HA   4  
ATOM 11199 H HB2  . PRO A 1 36  ? 24.837  -1.247  7.831   1.00 0.00 ? 36  PRO A HB2  4  
ATOM 11200 H HB3  . PRO A 1 36  ? 25.551  -2.830  8.188   1.00 0.00 ? 36  PRO A HB3  4  
ATOM 11201 H HG2  . PRO A 1 36  ? 22.674  -2.080  7.945   1.00 0.00 ? 36  PRO A HG2  4  
ATOM 11202 H HG3  . PRO A 1 36  ? 23.453  -3.646  7.668   1.00 0.00 ? 36  PRO A HG3  4  
ATOM 11203 H HD2  . PRO A 1 36  ? 21.987  -2.914  9.972   1.00 0.00 ? 36  PRO A HD2  4  
ATOM 11204 H HD3  . PRO A 1 36  ? 23.051  -4.328  9.819   1.00 0.00 ? 36  PRO A HD3  4  
ATOM 11205 N N    . LYS A 1 37  ? 25.327  0.644   9.632   1.00 0.00 ? 37  LYS A N    4  
ATOM 11206 C CA   . LYS A 1 37  ? 25.011  2.081   9.788   1.00 0.00 ? 37  LYS A CA   4  
ATOM 11207 C C    . LYS A 1 37  ? 23.685  2.380   9.094   1.00 0.00 ? 37  LYS A C    4  
ATOM 11208 O O    . LYS A 1 37  ? 22.899  3.188   9.546   1.00 0.00 ? 37  LYS A O    4  
ATOM 11209 C CB   . LYS A 1 37  ? 26.121  2.891   9.132   1.00 0.00 ? 37  LYS A CB   4  
ATOM 11210 C CG   . LYS A 1 37  ? 27.206  3.212   10.163  1.00 0.00 ? 37  LYS A CG   4  
ATOM 11211 C CD   . LYS A 1 37  ? 28.321  2.168   10.074  1.00 0.00 ? 37  LYS A CD   4  
ATOM 11212 C CE   . LYS A 1 37  ? 29.665  2.872   9.892   1.00 0.00 ? 37  LYS A CE   4  
ATOM 11213 N NZ   . LYS A 1 37  ? 30.684  2.236   10.775  1.00 0.00 ? 37  LYS A NZ   4  
ATOM 11214 H H    . LYS A 1 37  ? 26.128  0.380   9.139   1.00 0.00 ? 37  LYS A H    4  
ATOM 11215 H HA   . LYS A 1 37  ? 24.944  2.333   10.836  1.00 0.00 ? 37  LYS A HA   4  
ATOM 11216 H HB2  . LYS A 1 37  ? 26.551  2.315   8.324   1.00 0.00 ? 37  LYS A HB2  4  
ATOM 11217 H HB3  . LYS A 1 37  ? 25.713  3.801   8.741   1.00 0.00 ? 37  LYS A HB3  4  
ATOM 11218 H HG2  . LYS A 1 37  ? 27.612  4.192   9.962   1.00 0.00 ? 37  LYS A HG2  4  
ATOM 11219 H HG3  . LYS A 1 37  ? 26.777  3.194   11.153  1.00 0.00 ? 37  LYS A HG3  4  
ATOM 11220 H HD2  . LYS A 1 37  ? 28.339  1.583   10.981  1.00 0.00 ? 37  LYS A HD2  4  
ATOM 11221 H HD3  . LYS A 1 37  ? 28.140  1.519   9.230   1.00 0.00 ? 37  LYS A HD3  4  
ATOM 11222 H HE2  . LYS A 1 37  ? 29.980  2.790   8.862   1.00 0.00 ? 37  LYS A HE2  4  
ATOM 11223 H HE3  . LYS A 1 37  ? 29.564  3.915   10.153  1.00 0.00 ? 37  LYS A HE3  4  
ATOM 11224 H HZ1  . LYS A 1 37  ? 30.289  2.117   11.730  1.00 0.00 ? 37  LYS A HZ1  4  
ATOM 11225 H HZ2  . LYS A 1 37  ? 30.944  1.306   10.389  1.00 0.00 ? 37  LYS A HZ2  4  
ATOM 11226 H HZ3  . LYS A 1 37  ? 31.527  2.842   10.824  1.00 0.00 ? 37  LYS A HZ3  4  
ATOM 11227 N N    . GLY A 1 38  ? 23.438  1.732   7.993   1.00 0.00 ? 38  GLY A N    4  
ATOM 11228 C CA   . GLY A 1 38  ? 22.164  1.969   7.254   1.00 0.00 ? 38  GLY A CA   4  
ATOM 11229 C C    . GLY A 1 38  ? 21.946  0.853   6.232   1.00 0.00 ? 38  GLY A C    4  
ATOM 11230 O O    . GLY A 1 38  ? 22.494  -0.225  6.349   1.00 0.00 ? 38  GLY A O    4  
ATOM 11231 H H    . GLY A 1 38  ? 24.093  1.085   7.651   1.00 0.00 ? 38  GLY A H    4  
ATOM 11232 H HA2  . GLY A 1 38  ? 21.341  1.983   7.955   1.00 0.00 ? 38  GLY A HA2  4  
ATOM 11233 H HA3  . GLY A 1 38  ? 22.217  2.917   6.741   1.00 0.00 ? 38  GLY A HA3  4  
ATOM 11234 N N    . TYR A 1 39  ? 21.147  1.101   5.228   1.00 0.00 ? 39  TYR A N    4  
ATOM 11235 C CA   . TYR A 1 39  ? 20.896  0.052   4.200   1.00 0.00 ? 39  TYR A CA   4  
ATOM 11236 C C    . TYR A 1 39  ? 20.033  0.632   3.076   1.00 0.00 ? 39  TYR A C    4  
ATOM 11237 O O    . TYR A 1 39  ? 19.529  1.732   3.172   1.00 0.00 ? 39  TYR A O    4  
ATOM 11238 C CB   . TYR A 1 39  ? 20.168  -1.132  4.850   1.00 0.00 ? 39  TYR A CB   4  
ATOM 11239 C CG   . TYR A 1 39  ? 18.715  -0.779  5.081   1.00 0.00 ? 39  TYR A CG   4  
ATOM 11240 C CD1  . TYR A 1 39  ? 18.366  0.177   6.042   1.00 0.00 ? 39  TYR A CD1  4  
ATOM 11241 C CD2  . TYR A 1 39  ? 17.716  -1.412  4.333   1.00 0.00 ? 39  TYR A CD2  4  
ATOM 11242 C CE1  . TYR A 1 39  ? 17.021  0.500   6.254   1.00 0.00 ? 39  TYR A CE1  4  
ATOM 11243 C CE2  . TYR A 1 39  ? 16.370  -1.090  4.545   1.00 0.00 ? 39  TYR A CE2  4  
ATOM 11244 C CZ   . TYR A 1 39  ? 16.023  -0.134  5.505   1.00 0.00 ? 39  TYR A CZ   4  
ATOM 11245 O OH   . TYR A 1 39  ? 14.696  0.184   5.713   1.00 0.00 ? 39  TYR A OH   4  
ATOM 11246 H H    . TYR A 1 39  ? 20.715  1.977   5.152   1.00 0.00 ? 39  TYR A H    4  
ATOM 11247 H HA   . TYR A 1 39  ? 21.838  -0.285  3.793   1.00 0.00 ? 39  TYR A HA   4  
ATOM 11248 H HB2  . TYR A 1 39  ? 20.230  -1.990  4.198   1.00 0.00 ? 39  TYR A HB2  4  
ATOM 11249 H HB3  . TYR A 1 39  ? 20.635  -1.364  5.795   1.00 0.00 ? 39  TYR A HB3  4  
ATOM 11250 H HD1  . TYR A 1 39  ? 19.133  0.666   6.621   1.00 0.00 ? 39  TYR A HD1  4  
ATOM 11251 H HD2  . TYR A 1 39  ? 17.983  -2.149  3.590   1.00 0.00 ? 39  TYR A HD2  4  
ATOM 11252 H HE1  . TYR A 1 39  ? 16.752  1.238   6.995   1.00 0.00 ? 39  TYR A HE1  4  
ATOM 11253 H HE2  . TYR A 1 39  ? 15.601  -1.580  3.968   1.00 0.00 ? 39  TYR A HE2  4  
ATOM 11254 H HH   . TYR A 1 39  ? 14.161  -0.535  5.368   1.00 0.00 ? 39  TYR A HH   4  
ATOM 11255 N N    . HIS A 1 40  ? 19.853  -0.103  2.012   1.00 0.00 ? 40  HIS A N    4  
ATOM 11256 C CA   . HIS A 1 40  ? 19.015  0.406   0.890   1.00 0.00 ? 40  HIS A CA   4  
ATOM 11257 C C    . HIS A 1 40  ? 17.551  0.059   1.168   1.00 0.00 ? 40  HIS A C    4  
ATOM 11258 O O    . HIS A 1 40  ? 17.053  -0.961  0.737   1.00 0.00 ? 40  HIS A O    4  
ATOM 11259 C CB   . HIS A 1 40  ? 19.458  -0.250  -0.419  1.00 0.00 ? 40  HIS A CB   4  
ATOM 11260 C CG   . HIS A 1 40  ? 20.864  0.174   -0.743  1.00 0.00 ? 40  HIS A CG   4  
ATOM 11261 N ND1  . HIS A 1 40  ? 21.952  -0.238  0.009   1.00 0.00 ? 40  HIS A ND1  4  
ATOM 11262 C CD2  . HIS A 1 40  ? 21.375  0.976   -1.734  1.00 0.00 ? 40  HIS A CD2  4  
ATOM 11263 C CE1  . HIS A 1 40  ? 23.054  0.310   -0.536  1.00 0.00 ? 40  HIS A CE1  4  
ATOM 11264 N NE2  . HIS A 1 40  ? 22.758  1.060   -1.601  1.00 0.00 ? 40  HIS A NE2  4  
ATOM 11265 H H    . HIS A 1 40  ? 20.263  -0.991  1.953   1.00 0.00 ? 40  HIS A H    4  
ATOM 11266 H HA   . HIS A 1 40  ? 19.126  1.479   0.814   1.00 0.00 ? 40  HIS A HA   4  
ATOM 11267 H HB2  . HIS A 1 40  ? 19.421  -1.324  -0.314  1.00 0.00 ? 40  HIS A HB2  4  
ATOM 11268 H HB3  . HIS A 1 40  ? 18.797  0.057   -1.217  1.00 0.00 ? 40  HIS A HB3  4  
ATOM 11269 H HD1  . HIS A 1 40  ? 21.925  -0.824  0.795   1.00 0.00 ? 40  HIS A HD1  4  
ATOM 11270 H HD2  . HIS A 1 40  ? 20.792  1.466   -2.500  1.00 0.00 ? 40  HIS A HD2  4  
ATOM 11271 H HE1  . HIS A 1 40  ? 24.055  0.162   -0.159  1.00 0.00 ? 40  HIS A HE1  4  
ATOM 11272 N N    . ALA A 1 41  ? 16.862  0.893   1.897   1.00 0.00 ? 41  ALA A N    4  
ATOM 11273 C CA   . ALA A 1 41  ? 15.436  0.604   2.218   1.00 0.00 ? 41  ALA A CA   4  
ATOM 11274 C C    . ALA A 1 41  ? 14.562  0.804   0.974   1.00 0.00 ? 41  ALA A C    4  
ATOM 11275 O O    . ALA A 1 41  ? 13.654  0.040   0.719   1.00 0.00 ? 41  ALA A O    4  
ATOM 11276 C CB   . ALA A 1 41  ? 14.970  1.539   3.335   1.00 0.00 ? 41  ALA A CB   4  
ATOM 11277 H H    . ALA A 1 41  ? 17.286  1.706   2.245   1.00 0.00 ? 41  ALA A H    4  
ATOM 11278 H HA   . ALA A 1 41  ? 15.349  -0.419  2.551   1.00 0.00 ? 41  ALA A HA   4  
ATOM 11279 H HB1  . ALA A 1 41  ? 15.785  1.714   4.022   1.00 0.00 ? 41  ALA A HB1  4  
ATOM 11280 H HB2  . ALA A 1 41  ? 14.649  2.478   2.909   1.00 0.00 ? 41  ALA A HB2  4  
ATOM 11281 H HB3  . ALA A 1 41  ? 14.146  1.084   3.865   1.00 0.00 ? 41  ALA A HB3  4  
ATOM 11282 N N    . ASN A 1 42  ? 14.826  1.821   0.200   1.00 0.00 ? 42  ASN A N    4  
ATOM 11283 C CA   . ASN A 1 42  ? 14.004  2.057   -1.023  1.00 0.00 ? 42  ASN A CA   4  
ATOM 11284 C C    . ASN A 1 42  ? 12.556  2.356   -0.621  1.00 0.00 ? 42  ASN A C    4  
ATOM 11285 O O    . ASN A 1 42  ? 12.201  2.294   0.540   1.00 0.00 ? 42  ASN A O    4  
ATOM 11286 C CB   . ASN A 1 42  ? 14.031  0.806   -1.906  1.00 0.00 ? 42  ASN A CB   4  
ATOM 11287 C CG   . ASN A 1 42  ? 15.125  0.951   -2.965  1.00 0.00 ? 42  ASN A CG   4  
ATOM 11288 O OD1  . ASN A 1 42  ? 14.991  1.726   -3.891  1.00 0.00 ? 42  ASN A OD1  4  
ATOM 11289 N ND2  . ASN A 1 42  ? 16.211  0.233   -2.868  1.00 0.00 ? 42  ASN A ND2  4  
ATOM 11290 H H    . ASN A 1 42  ? 15.562  2.429   0.421   1.00 0.00 ? 42  ASN A H    4  
ATOM 11291 H HA   . ASN A 1 42  ? 14.406  2.895   -1.573  1.00 0.00 ? 42  ASN A HA   4  
ATOM 11292 H HB2  . ASN A 1 42  ? 14.233  -0.061  -1.294  1.00 0.00 ? 42  ASN A HB2  4  
ATOM 11293 H HB3  . ASN A 1 42  ? 13.075  0.688   -2.392  1.00 0.00 ? 42  ASN A HB3  4  
ATOM 11294 H HD21 . ASN A 1 42  ? 16.319  -0.392  -2.122  1.00 0.00 ? 42  ASN A HD21 4  
ATOM 11295 H HD22 . ASN A 1 42  ? 16.917  0.319   -3.542  1.00 0.00 ? 42  ASN A HD22 4  
ATOM 11296 N N    . PHE A 1 43  ? 11.717  2.672   -1.572  1.00 0.00 ? 43  PHE A N    4  
ATOM 11297 C CA   . PHE A 1 43  ? 10.292  2.964   -1.239  1.00 0.00 ? 43  PHE A CA   4  
ATOM 11298 C C    . PHE A 1 43  ? 9.529   3.320   -2.516  1.00 0.00 ? 43  PHE A C    4  
ATOM 11299 O O    . PHE A 1 43  ? 10.114  3.546   -3.556  1.00 0.00 ? 43  PHE A O    4  
ATOM 11300 C CB   . PHE A 1 43  ? 10.211  4.120   -0.237  1.00 0.00 ? 43  PHE A CB   4  
ATOM 11301 C CG   . PHE A 1 43  ? 10.486  5.441   -0.914  1.00 0.00 ? 43  PHE A CG   4  
ATOM 11302 C CD1  . PHE A 1 43  ? 11.574  5.586   -1.784  1.00 0.00 ? 43  PHE A CD1  4  
ATOM 11303 C CD2  . PHE A 1 43  ? 9.653   6.534   -0.649  1.00 0.00 ? 43  PHE A CD2  4  
ATOM 11304 C CE1  . PHE A 1 43  ? 11.825  6.825   -2.385  1.00 0.00 ? 43  PHE A CE1  4  
ATOM 11305 C CE2  . PHE A 1 43  ? 9.904   7.766   -1.251  1.00 0.00 ? 43  PHE A CE2  4  
ATOM 11306 C CZ   . PHE A 1 43  ? 10.991  7.914   -2.119  1.00 0.00 ? 43  PHE A CZ   4  
ATOM 11307 H H    . PHE A 1 43  ? 12.021  2.707   -2.507  1.00 0.00 ? 43  PHE A H    4  
ATOM 11308 H HA   . PHE A 1 43  ? 9.846   2.083   -0.800  1.00 0.00 ? 43  PHE A HA   4  
ATOM 11309 H HB2  . PHE A 1 43  ? 9.223   4.146   0.194   1.00 0.00 ? 43  PHE A HB2  4  
ATOM 11310 H HB3  . PHE A 1 43  ? 10.937  3.964   0.547   1.00 0.00 ? 43  PHE A HB3  4  
ATOM 11311 H HD1  . PHE A 1 43  ? 12.221  4.748   -1.990  1.00 0.00 ? 43  PHE A HD1  4  
ATOM 11312 H HD2  . PHE A 1 43  ? 8.812   6.422   0.019   1.00 0.00 ? 43  PHE A HD2  4  
ATOM 11313 H HE1  . PHE A 1 43  ? 12.663  6.939   -3.054  1.00 0.00 ? 43  PHE A HE1  4  
ATOM 11314 H HE2  . PHE A 1 43  ? 9.260   8.605   -1.045  1.00 0.00 ? 43  PHE A HE2  4  
ATOM 11315 H HZ   . PHE A 1 43  ? 11.187  8.871   -2.583  1.00 0.00 ? 43  PHE A HZ   4  
ATOM 11316 N N    . CYS A 1 44  ? 8.224   3.350   -2.451  1.00 0.00 ? 44  CYS A N    4  
ATOM 11317 C CA   . CYS A 1 44  ? 7.425   3.665   -3.672  1.00 0.00 ? 44  CYS A CA   4  
ATOM 11318 C C    . CYS A 1 44  ? 6.748   5.028   -3.523  1.00 0.00 ? 44  CYS A C    4  
ATOM 11319 O O    . CYS A 1 44  ? 6.258   5.379   -2.468  1.00 0.00 ? 44  CYS A O    4  
ATOM 11320 C CB   . CYS A 1 44  ? 6.338   2.600   -3.870  1.00 0.00 ? 44  CYS A CB   4  
ATOM 11321 S SG   . CYS A 1 44  ? 6.885   1.009   -3.195  1.00 0.00 ? 44  CYS A SG   4  
ATOM 11322 H H    . CYS A 1 44  ? 7.771   3.149   -1.607  1.00 0.00 ? 44  CYS A H    4  
ATOM 11323 H HA   . CYS A 1 44  ? 8.075   3.677   -4.534  1.00 0.00 ? 44  CYS A HA   4  
ATOM 11324 H HB2  . CYS A 1 44  ? 5.437   2.910   -3.363  1.00 0.00 ? 44  CYS A HB2  4  
ATOM 11325 H HB3  . CYS A 1 44  ? 6.134   2.490   -4.925  1.00 0.00 ? 44  CYS A HB3  4  
ATOM 11326 N N    . LEU A 1 45  ? 6.701   5.792   -4.581  1.00 0.00 ? 45  LEU A N    4  
ATOM 11327 C CA   . LEU A 1 45  ? 6.036   7.124   -4.513  1.00 0.00 ? 45  LEU A CA   4  
ATOM 11328 C C    . LEU A 1 45  ? 5.152   7.302   -5.750  1.00 0.00 ? 45  LEU A C    4  
ATOM 11329 O O    . LEU A 1 45  ? 5.413   6.743   -6.796  1.00 0.00 ? 45  LEU A O    4  
ATOM 11330 C CB   . LEU A 1 45  ? 7.090   8.231   -4.479  1.00 0.00 ? 45  LEU A CB   4  
ATOM 11331 C CG   . LEU A 1 45  ? 7.646   8.379   -3.065  1.00 0.00 ? 45  LEU A CG   4  
ATOM 11332 C CD1  . LEU A 1 45  ? 8.529   9.626   -3.004  1.00 0.00 ? 45  LEU A CD1  4  
ATOM 11333 C CD2  . LEU A 1 45  ? 6.498   8.521   -2.063  1.00 0.00 ? 45  LEU A CD2  4  
ATOM 11334 H H    . LEU A 1 45  ? 7.091   5.484   -5.427  1.00 0.00 ? 45  LEU A H    4  
ATOM 11335 H HA   . LEU A 1 45  ? 5.424   7.176   -3.626  1.00 0.00 ? 45  LEU A HA   4  
ATOM 11336 H HB2  . LEU A 1 45  ? 7.897   7.981   -5.151  1.00 0.00 ? 45  LEU A HB2  4  
ATOM 11337 H HB3  . LEU A 1 45  ? 6.641   9.165   -4.785  1.00 0.00 ? 45  LEU A HB3  4  
ATOM 11338 H HG   . LEU A 1 45  ? 8.234   7.507   -2.822  1.00 0.00 ? 45  LEU A HG   4  
ATOM 11339 H HD11 . LEU A 1 45  ? 8.148   10.368  -3.689  1.00 0.00 ? 45  LEU A HD11 4  
ATOM 11340 H HD12 . LEU A 1 45  ? 8.521   10.024  -2.000  1.00 0.00 ? 45  LEU A HD12 4  
ATOM 11341 H HD13 . LEU A 1 45  ? 9.539   9.365   -3.281  1.00 0.00 ? 45  LEU A HD13 4  
ATOM 11342 H HD21 . LEU A 1 45  ? 5.763   9.210   -2.451  1.00 0.00 ? 45  LEU A HD21 4  
ATOM 11343 H HD22 . LEU A 1 45  ? 6.039   7.555   -1.903  1.00 0.00 ? 45  LEU A HD22 4  
ATOM 11344 H HD23 . LEU A 1 45  ? 6.883   8.895   -1.126  1.00 0.00 ? 45  LEU A HD23 4  
ATOM 11345 N N    . GLY A 1 46  ? 4.107   8.075   -5.638  1.00 0.00 ? 46  GLY A N    4  
ATOM 11346 C CA   . GLY A 1 46  ? 3.209   8.284   -6.808  1.00 0.00 ? 46  GLY A CA   4  
ATOM 11347 C C    . GLY A 1 46  ? 1.953   7.420   -6.650  1.00 0.00 ? 46  GLY A C    4  
ATOM 11348 O O    . GLY A 1 46  ? 1.968   6.430   -5.947  1.00 0.00 ? 46  GLY A O    4  
ATOM 11349 H H    . GLY A 1 46  ? 3.913   8.516   -4.785  1.00 0.00 ? 46  GLY A H    4  
ATOM 11350 H HA2  . GLY A 1 46  ? 2.926   9.326   -6.864  1.00 0.00 ? 46  GLY A HA2  4  
ATOM 11351 H HA3  . GLY A 1 46  ? 3.723   8.002   -7.714  1.00 0.00 ? 46  GLY A HA3  4  
ATOM 11352 N N    . PRO A 1 47  ? 0.900   7.827   -7.313  1.00 0.00 ? 47  PRO A N    4  
ATOM 11353 C CA   . PRO A 1 47  ? -0.390  7.116   -7.271  1.00 0.00 ? 47  PRO A CA   4  
ATOM 11354 C C    . PRO A 1 47  ? -0.359  5.885   -8.183  1.00 0.00 ? 47  PRO A C    4  
ATOM 11355 O O    . PRO A 1 47  ? 0.691   5.398   -8.551  1.00 0.00 ? 47  PRO A O    4  
ATOM 11356 C CB   . PRO A 1 47  ? -1.387  8.154   -7.795  1.00 0.00 ? 47  PRO A CB   4  
ATOM 11357 C CG   . PRO A 1 47  ? -0.565  9.170   -8.625  1.00 0.00 ? 47  PRO A CG   4  
ATOM 11358 C CD   . PRO A 1 47  ? 0.898   9.036   -8.162  1.00 0.00 ? 47  PRO A CD   4  
ATOM 11359 H HA   . PRO A 1 47  ? -0.643  6.838   -6.262  1.00 0.00 ? 47  PRO A HA   4  
ATOM 11360 H HB2  . PRO A 1 47  ? -2.128  7.673   -8.418  1.00 0.00 ? 47  PRO A HB2  4  
ATOM 11361 H HB3  . PRO A 1 47  ? -1.864  8.661   -6.970  1.00 0.00 ? 47  PRO A HB3  4  
ATOM 11362 H HG2  . PRO A 1 47  ? -0.646  8.936   -9.678  1.00 0.00 ? 47  PRO A HG2  4  
ATOM 11363 H HG3  . PRO A 1 47  ? -0.916  10.172  -8.438  1.00 0.00 ? 47  PRO A HG3  4  
ATOM 11364 H HD2  . PRO A 1 47  ? 1.553   8.905   -9.014  1.00 0.00 ? 47  PRO A HD2  4  
ATOM 11365 H HD3  . PRO A 1 47  ? 1.193   9.898   -7.585  1.00 0.00 ? 47  PRO A HD3  4  
ATOM 11366 N N    . CYS A 1 48  ? -1.507  5.387   -8.554  1.00 0.00 ? 48  CYS A N    4  
ATOM 11367 C CA   . CYS A 1 48  ? -1.554  4.193   -9.445  1.00 0.00 ? 48  CYS A CA   4  
ATOM 11368 C C    . CYS A 1 48  ? -2.719  4.351   -10.434 1.00 0.00 ? 48  CYS A C    4  
ATOM 11369 O O    . CYS A 1 48  ? -3.860  4.426   -10.026 1.00 0.00 ? 48  CYS A O    4  
ATOM 11370 C CB   . CYS A 1 48  ? -1.777  2.931   -8.606  1.00 0.00 ? 48  CYS A CB   4  
ATOM 11371 S SG   . CYS A 1 48  ? -0.255  2.505   -7.723  1.00 0.00 ? 48  CYS A SG   4  
ATOM 11372 H H    . CYS A 1 48  ? -2.340  5.800   -8.247  1.00 0.00 ? 48  CYS A H    4  
ATOM 11373 H HA   . CYS A 1 48  ? -0.621  4.108   -9.980  1.00 0.00 ? 48  CYS A HA   4  
ATOM 11374 H HB2  . CYS A 1 48  ? -2.568  3.108   -7.893  1.00 0.00 ? 48  CYS A HB2  4  
ATOM 11375 H HB3  . CYS A 1 48  ? -2.057  2.113   -9.255  1.00 0.00 ? 48  CYS A HB3  4  
ATOM 11376 N N    . PRO A 1 49  ? -2.402  4.395   -11.705 1.00 0.00 ? 49  PRO A N    4  
ATOM 11377 C CA   . PRO A 1 49  ? -3.414  4.541   -12.765 1.00 0.00 ? 49  PRO A CA   4  
ATOM 11378 C C    . PRO A 1 49  ? -4.149  3.216   -12.989 1.00 0.00 ? 49  PRO A C    4  
ATOM 11379 O O    . PRO A 1 49  ? -4.167  2.354   -12.131 1.00 0.00 ? 49  PRO A O    4  
ATOM 11380 C CB   . PRO A 1 49  ? -2.596  4.936   -13.997 1.00 0.00 ? 49  PRO A CB   4  
ATOM 11381 C CG   . PRO A 1 49  ? -1.151  4.455   -13.730 1.00 0.00 ? 49  PRO A CG   4  
ATOM 11382 C CD   . PRO A 1 49  ? -1.015  4.302   -12.202 1.00 0.00 ? 49  PRO A CD   4  
ATOM 11383 H HA   . PRO A 1 49  ? -4.111  5.326   -12.520 1.00 0.00 ? 49  PRO A HA   4  
ATOM 11384 H HB2  . PRO A 1 49  ? -2.995  4.453   -14.878 1.00 0.00 ? 49  PRO A HB2  4  
ATOM 11385 H HB3  . PRO A 1 49  ? -2.604  6.007   -14.122 1.00 0.00 ? 49  PRO A HB3  4  
ATOM 11386 H HG2  . PRO A 1 49  ? -0.983  3.506   -14.219 1.00 0.00 ? 49  PRO A HG2  4  
ATOM 11387 H HG3  . PRO A 1 49  ? -0.444  5.188   -14.087 1.00 0.00 ? 49  PRO A HG3  4  
ATOM 11388 H HD2  . PRO A 1 49  ? -0.586  3.342   -11.953 1.00 0.00 ? 49  PRO A HD2  4  
ATOM 11389 H HD3  . PRO A 1 49  ? -0.419  5.103   -11.793 1.00 0.00 ? 49  PRO A HD3  4  
ATOM 11390 N N    . TYR A 1 50  ? -4.764  3.047   -14.128 1.00 0.00 ? 50  TYR A N    4  
ATOM 11391 C CA   . TYR A 1 50  ? -5.502  1.774   -14.391 1.00 0.00 ? 50  TYR A CA   4  
ATOM 11392 C C    . TYR A 1 50  ? -4.664  0.852   -15.280 1.00 0.00 ? 50  TYR A C    4  
ATOM 11393 O O    . TYR A 1 50  ? -5.195  0.055   -16.027 1.00 0.00 ? 50  TYR A O    4  
ATOM 11394 C CB   . TYR A 1 50  ? -6.845  2.058   -15.086 1.00 0.00 ? 50  TYR A CB   4  
ATOM 11395 C CG   . TYR A 1 50  ? -6.887  3.475   -15.610 1.00 0.00 ? 50  TYR A CG   4  
ATOM 11396 C CD1  . TYR A 1 50  ? -6.933  4.548   -14.713 1.00 0.00 ? 50  TYR A CD1  4  
ATOM 11397 C CD2  . TYR A 1 50  ? -6.882  3.715   -16.989 1.00 0.00 ? 50  TYR A CD2  4  
ATOM 11398 C CE1  . TYR A 1 50  ? -6.975  5.863   -15.195 1.00 0.00 ? 50  TYR A CE1  4  
ATOM 11399 C CE2  . TYR A 1 50  ? -6.924  5.029   -17.472 1.00 0.00 ? 50  TYR A CE2  4  
ATOM 11400 C CZ   . TYR A 1 50  ? -6.970  6.103   -16.574 1.00 0.00 ? 50  TYR A CZ   4  
ATOM 11401 O OH   . TYR A 1 50  ? -7.012  7.398   -17.049 1.00 0.00 ? 50  TYR A OH   4  
ATOM 11402 H H    . TYR A 1 50  ? -4.741  3.753   -14.805 1.00 0.00 ? 50  TYR A H    4  
ATOM 11403 H HA   . TYR A 1 50  ? -5.691  1.280   -13.450 1.00 0.00 ? 50  TYR A HA   4  
ATOM 11404 H HB2  . TYR A 1 50  ? -6.971  1.370   -15.909 1.00 0.00 ? 50  TYR A HB2  4  
ATOM 11405 H HB3  . TYR A 1 50  ? -7.648  1.914   -14.378 1.00 0.00 ? 50  TYR A HB3  4  
ATOM 11406 H HD1  . TYR A 1 50  ? -6.936  4.362   -13.649 1.00 0.00 ? 50  TYR A HD1  4  
ATOM 11407 H HD2  . TYR A 1 50  ? -6.847  2.886   -17.681 1.00 0.00 ? 50  TYR A HD2  4  
ATOM 11408 H HE1  . TYR A 1 50  ? -7.011  6.690   -14.503 1.00 0.00 ? 50  TYR A HE1  4  
ATOM 11409 H HE2  . TYR A 1 50  ? -6.920  5.214   -18.535 1.00 0.00 ? 50  TYR A HE2  4  
ATOM 11410 H HH   . TYR A 1 50  ? -6.210  7.843   -16.766 1.00 0.00 ? 50  TYR A HH   4  
ATOM 11411 N N    . ILE A 1 51  ? -3.362  0.946   -15.214 1.00 0.00 ? 51  ILE A N    4  
ATOM 11412 C CA   . ILE A 1 51  ? -2.519  0.061   -16.070 1.00 0.00 ? 51  ILE A CA   4  
ATOM 11413 C C    . ILE A 1 51  ? -1.094  -0.013  -15.517 1.00 0.00 ? 51  ILE A C    4  
ATOM 11414 O O    . ILE A 1 51  ? -0.163  -0.344  -16.224 1.00 0.00 ? 51  ILE A O    4  
ATOM 11415 C CB   . ILE A 1 51  ? -2.463  0.634   -17.483 1.00 0.00 ? 51  ILE A CB   4  
ATOM 11416 C CG1  . ILE A 1 51  ? -2.083  2.114   -17.410 1.00 0.00 ? 51  ILE A CG1  4  
ATOM 11417 C CG2  . ILE A 1 51  ? -3.831  0.489   -18.153 1.00 0.00 ? 51  ILE A CG2  4  
ATOM 11418 C CD1  . ILE A 1 51  ? -1.308  2.505   -18.669 1.00 0.00 ? 51  ILE A CD1  4  
ATOM 11419 H H    . ILE A 1 51  ? -2.944  1.593   -14.608 1.00 0.00 ? 51  ILE A H    4  
ATOM 11420 H HA   . ILE A 1 51  ? -2.949  -0.929  -16.100 1.00 0.00 ? 51  ILE A HA   4  
ATOM 11421 H HB   . ILE A 1 51  ? -1.722  0.098   -18.055 1.00 0.00 ? 51  ILE A HB   4  
ATOM 11422 H HG12 . ILE A 1 51  ? -2.979  2.712   -17.337 1.00 0.00 ? 51  ILE A HG12 4  
ATOM 11423 H HG13 . ILE A 1 51  ? -1.464  2.284   -16.542 1.00 0.00 ? 51  ILE A HG13 4  
ATOM 11424 H HG21 . ILE A 1 51  ? -4.215  -0.505  -17.976 1.00 0.00 ? 51  ILE A HG21 4  
ATOM 11425 H HG22 . ILE A 1 51  ? -4.513  1.218   -17.739 1.00 0.00 ? 51  ILE A HG22 4  
ATOM 11426 H HG23 . ILE A 1 51  ? -3.730  0.652   -19.216 1.00 0.00 ? 51  ILE A HG23 4  
ATOM 11427 H HD11 . ILE A 1 51  ? -1.376  1.709   -19.396 1.00 0.00 ? 51  ILE A HD11 4  
ATOM 11428 H HD12 . ILE A 1 51  ? -1.729  3.408   -19.085 1.00 0.00 ? 51  ILE A HD12 4  
ATOM 11429 H HD13 . ILE A 1 51  ? -0.272  2.674   -18.417 1.00 0.00 ? 51  ILE A HD13 4  
ATOM 11430 N N    . TRP A 1 52  ? -0.910  0.297   -14.268 1.00 0.00 ? 52  TRP A N    4  
ATOM 11431 C CA   . TRP A 1 52  ? 0.462   0.247   -13.689 1.00 0.00 ? 52  TRP A CA   4  
ATOM 11432 C C    . TRP A 1 52  ? 0.596   -0.955  -12.752 1.00 0.00 ? 52  TRP A C    4  
ATOM 11433 O O    . TRP A 1 52  ? 0.456   -0.838  -11.551 1.00 0.00 ? 52  TRP A O    4  
ATOM 11434 C CB   . TRP A 1 52  ? 0.732   1.534   -12.917 1.00 0.00 ? 52  TRP A CB   4  
ATOM 11435 C CG   . TRP A 1 52  ? 2.170   1.903   -13.068 1.00 0.00 ? 52  TRP A CG   4  
ATOM 11436 C CD1  . TRP A 1 52  ? 2.985   2.262   -12.055 1.00 0.00 ? 52  TRP A CD1  4  
ATOM 11437 C CD2  . TRP A 1 52  ? 2.976   1.952   -14.281 1.00 0.00 ? 52  TRP A CD2  4  
ATOM 11438 N NE1  . TRP A 1 52  ? 4.242   2.528   -12.565 1.00 0.00 ? 52  TRP A NE1  4  
ATOM 11439 C CE2  . TRP A 1 52  ? 4.287   2.350   -13.932 1.00 0.00 ? 52  TRP A CE2  4  
ATOM 11440 C CE3  . TRP A 1 52  ? 2.700   1.691   -15.636 1.00 0.00 ? 52  TRP A CE3  4  
ATOM 11441 C CZ2  . TRP A 1 52  ? 5.291   2.485   -14.892 1.00 0.00 ? 52  TRP A CZ2  4  
ATOM 11442 C CZ3  . TRP A 1 52  ? 3.708   1.826   -16.605 1.00 0.00 ? 52  TRP A CZ3  4  
ATOM 11443 C CH2  . TRP A 1 52  ? 5.001   2.221   -16.233 1.00 0.00 ? 52  TRP A CH2  4  
ATOM 11444 H H    . TRP A 1 52  ? -1.669  0.568   -13.715 1.00 0.00 ? 52  TRP A H    4  
ATOM 11445 H HA   . TRP A 1 52  ? 1.183   0.157   -14.487 1.00 0.00 ? 52  TRP A HA   4  
ATOM 11446 H HB2  . TRP A 1 52  ? 0.115   2.326   -13.313 1.00 0.00 ? 52  TRP A HB2  4  
ATOM 11447 H HB3  . TRP A 1 52  ? 0.504   1.386   -11.872 1.00 0.00 ? 52  TRP A HB3  4  
ATOM 11448 H HD1  . TRP A 1 52  ? 2.700   2.329   -11.016 1.00 0.00 ? 52  TRP A HD1  4  
ATOM 11449 H HE1  . TRP A 1 52  ? 5.016   2.809   -12.038 1.00 0.00 ? 52  TRP A HE1  4  
ATOM 11450 H HE3  . TRP A 1 52  ? 1.706   1.386   -15.933 1.00 0.00 ? 52  TRP A HE3  4  
ATOM 11451 H HZ2  . TRP A 1 52  ? 6.287   2.787   -14.599 1.00 0.00 ? 52  TRP A HZ2  4  
ATOM 11452 H HZ3  . TRP A 1 52  ? 3.486   1.623   -17.642 1.00 0.00 ? 52  TRP A HZ3  4  
ATOM 11453 H HH2  . TRP A 1 52  ? 5.771   2.322   -16.983 1.00 0.00 ? 52  TRP A HH2  4  
ATOM 11454 N N    . SER A 1 53  ? 0.878   -2.109  -13.298 1.00 0.00 ? 53  SER A N    4  
ATOM 11455 C CA   . SER A 1 53  ? 1.037   -3.328  -12.452 1.00 0.00 ? 53  SER A CA   4  
ATOM 11456 C C    . SER A 1 53  ? -0.019  -3.343  -11.345 1.00 0.00 ? 53  SER A C    4  
ATOM 11457 O O    . SER A 1 53  ? 0.281   -3.590  -10.194 1.00 0.00 ? 53  SER A O    4  
ATOM 11458 C CB   . SER A 1 53  ? 2.431   -3.332  -11.825 1.00 0.00 ? 53  SER A CB   4  
ATOM 11459 O OG   . SER A 1 53  ? 3.306   -4.111  -12.631 1.00 0.00 ? 53  SER A OG   4  
ATOM 11460 H H    . SER A 1 53  ? 0.993   -2.172  -14.269 1.00 0.00 ? 53  SER A H    4  
ATOM 11461 H HA   . SER A 1 53  ? 0.921   -4.207  -13.069 1.00 0.00 ? 53  SER A HA   4  
ATOM 11462 H HB2  . SER A 1 53  ? 2.805   -2.324  -11.767 1.00 0.00 ? 53  SER A HB2  4  
ATOM 11463 H HB3  . SER A 1 53  ? 2.375   -3.751  -10.828 1.00 0.00 ? 53  SER A HB3  4  
ATOM 11464 H HG   . SER A 1 53  ? 4.179   -4.083  -12.233 1.00 0.00 ? 53  SER A HG   4  
ATOM 11465 N N    . LEU A 1 54  ? -1.253  -3.087  -11.680 1.00 0.00 ? 54  LEU A N    4  
ATOM 11466 C CA   . LEU A 1 54  ? -2.319  -3.095  -10.640 1.00 0.00 ? 54  LEU A CA   4  
ATOM 11467 C C    . LEU A 1 54  ? -2.389  -4.486  -10.008 1.00 0.00 ? 54  LEU A C    4  
ATOM 11468 O O    . LEU A 1 54  ? -2.425  -5.489  -10.694 1.00 0.00 ? 54  LEU A O    4  
ATOM 11469 C CB   . LEU A 1 54  ? -3.664  -2.751  -11.282 1.00 0.00 ? 54  LEU A CB   4  
ATOM 11470 C CG   . LEU A 1 54  ? -3.685  -1.268  -11.654 1.00 0.00 ? 54  LEU A CG   4  
ATOM 11471 C CD1  . LEU A 1 54  ? -4.799  -1.011  -12.671 1.00 0.00 ? 54  LEU A CD1  4  
ATOM 11472 C CD2  . LEU A 1 54  ? -3.938  -0.432  -10.398 1.00 0.00 ? 54  LEU A CD2  4  
ATOM 11473 H H    . LEU A 1 54  ? -1.479  -2.894  -12.615 1.00 0.00 ? 54  LEU A H    4  
ATOM 11474 H HA   . LEU A 1 54  ? -2.085  -2.365  -9.879  1.00 0.00 ? 54  LEU A HA   4  
ATOM 11475 H HB2  . LEU A 1 54  ? -3.801  -3.350  -12.172 1.00 0.00 ? 54  LEU A HB2  4  
ATOM 11476 H HB3  . LEU A 1 54  ? -4.461  -2.958  -10.584 1.00 0.00 ? 54  LEU A HB3  4  
ATOM 11477 H HG   . LEU A 1 54  ? -2.734  -0.993  -12.087 1.00 0.00 ? 54  LEU A HG   4  
ATOM 11478 H HD11 . LEU A 1 54  ? -5.405  -1.899  -12.774 1.00 0.00 ? 54  LEU A HD11 4  
ATOM 11479 H HD12 . LEU A 1 54  ? -5.415  -0.192  -12.329 1.00 0.00 ? 54  LEU A HD12 4  
ATOM 11480 H HD13 . LEU A 1 54  ? -4.363  -0.761  -13.625 1.00 0.00 ? 54  LEU A HD13 4  
ATOM 11481 H HD21 . LEU A 1 54  ? -3.182  -0.655  -9.659  1.00 0.00 ? 54  LEU A HD21 4  
ATOM 11482 H HD22 . LEU A 1 54  ? -3.895  0.618   -10.649 1.00 0.00 ? 54  LEU A HD22 4  
ATOM 11483 H HD23 . LEU A 1 54  ? -4.912  -0.668  -9.998  1.00 0.00 ? 54  LEU A HD23 4  
ATOM 11484 N N    . ASP A 1 55  ? -2.397  -4.559  -8.705  1.00 0.00 ? 55  ASP A N    4  
ATOM 11485 C CA   . ASP A 1 55  ? -2.453  -5.889  -8.033  1.00 0.00 ? 55  ASP A CA   4  
ATOM 11486 C C    . ASP A 1 55  ? -3.890  -6.199  -7.609  1.00 0.00 ? 55  ASP A C    4  
ATOM 11487 O O    . ASP A 1 55  ? -4.426  -7.244  -7.922  1.00 0.00 ? 55  ASP A O    4  
ATOM 11488 C CB   . ASP A 1 55  ? -1.550  -5.873  -6.799  1.00 0.00 ? 55  ASP A CB   4  
ATOM 11489 C CG   . ASP A 1 55  ? -1.470  -7.281  -6.208  1.00 0.00 ? 55  ASP A CG   4  
ATOM 11490 O OD1  . ASP A 1 55  ? -1.328  -8.218  -6.977  1.00 0.00 ? 55  ASP A OD1  4  
ATOM 11491 O OD2  . ASP A 1 55  ? -1.552  -7.400  -4.996  1.00 0.00 ? 55  ASP A OD2  4  
ATOM 11492 H H    . ASP A 1 55  ? -2.360  -3.739  -8.168  1.00 0.00 ? 55  ASP A H    4  
ATOM 11493 H HA   . ASP A 1 55  ? -2.109  -6.650  -8.718  1.00 0.00 ? 55  ASP A HA   4  
ATOM 11494 H HB2  . ASP A 1 55  ? -0.560  -5.543  -7.080  1.00 0.00 ? 55  ASP A HB2  4  
ATOM 11495 H HB3  . ASP A 1 55  ? -1.959  -5.199  -6.062  1.00 0.00 ? 55  ASP A HB3  4  
ATOM 11496 N N    . THR A 1 56  ? -4.518  -5.306  -6.895  1.00 0.00 ? 56  THR A N    4  
ATOM 11497 C CA   . THR A 1 56  ? -5.918  -5.562  -6.450  1.00 0.00 ? 56  THR A CA   4  
ATOM 11498 C C    . THR A 1 56  ? -6.896  -4.902  -7.423  1.00 0.00 ? 56  THR A C    4  
ATOM 11499 O O    . THR A 1 56  ? -6.559  -3.963  -8.117  1.00 0.00 ? 56  THR A O    4  
ATOM 11500 C CB   . THR A 1 56  ? -6.124  -4.980  -5.048  1.00 0.00 ? 56  THR A CB   4  
ATOM 11501 O OG1  . THR A 1 56  ? -6.518  -3.619  -5.156  1.00 0.00 ? 56  THR A OG1  4  
ATOM 11502 C CG2  . THR A 1 56  ? -4.820  -5.076  -4.256  1.00 0.00 ? 56  THR A CG2  4  
ATOM 11503 H H    . THR A 1 56  ? -4.069  -4.471  -6.648  1.00 0.00 ? 56  THR A H    4  
ATOM 11504 H HA   . THR A 1 56  ? -6.098  -6.626  -6.427  1.00 0.00 ? 56  THR A HA   4  
ATOM 11505 H HB   . THR A 1 56  ? -6.893  -5.538  -4.537  1.00 0.00 ? 56  THR A HB   4  
ATOM 11506 H HG1  . THR A 1 56  ? -5.725  -3.078  -5.129  1.00 0.00 ? 56  THR A HG1  4  
ATOM 11507 H HG21 . THR A 1 56  ? -4.251  -5.927  -4.600  1.00 0.00 ? 56  THR A HG21 4  
ATOM 11508 H HG22 . THR A 1 56  ? -4.243  -4.174  -4.401  1.00 0.00 ? 56  THR A HG22 4  
ATOM 11509 H HG23 . THR A 1 56  ? -5.044  -5.193  -3.205  1.00 0.00 ? 56  THR A HG23 4  
ATOM 11510 N N    . GLN A 1 57  ? -8.107  -5.385  -7.479  1.00 0.00 ? 57  GLN A N    4  
ATOM 11511 C CA   . GLN A 1 57  ? -9.108  -4.785  -8.405  1.00 0.00 ? 57  GLN A CA   4  
ATOM 11512 C C    . GLN A 1 57  ? -9.523  -3.409  -7.877  1.00 0.00 ? 57  GLN A C    4  
ATOM 11513 O O    . GLN A 1 57  ? -9.822  -2.509  -8.635  1.00 0.00 ? 57  GLN A O    4