data_1KLD
# 
_entry.id   1KLD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KLD         
WWPDB D_1000174453 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1KLA . ensemble                   
PDB 1KLC . 'representative structure' 
PDB 1KLA . split                      
PDB 1KLD . split                      
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KLD 
_pdbx_database_status.recvd_initial_deposition_date   1996-01-16 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hinck, A.P.'      1  
'Archer, S.J.'     2  
'Qian, S.W.'       3  
'Roberts, A.B.'    4  
'Sporn, M.B.'      5  
'Weatherbee, J.A.' 6  
'Tsang, M.L.-S.'   7  
'Lucas, R.'        8  
'Zhang, B.-L.'     9  
'Wenker, J.'       10 
'Torchia, D.A.'    11 
# 
_citation.id                        primary 
_citation.title                     
;Transforming growth factor beta 1: three-dimensional structure in solution and comparison with the X-ray structure of transforming growth factor beta 2.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            35 
_citation.page_first                8517 
_citation.page_last                 8534 
_citation.year                      1996 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8679613 
_citation.pdbx_database_id_DOI      10.1021/bi9604946 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hinck, A.P.'      1  
primary 'Archer, S.J.'     2  
primary 'Qian, S.W.'       3  
primary 'Roberts, A.B.'    4  
primary 'Sporn, M.B.'      5  
primary 'Weatherbee, J.A.' 6  
primary 'Tsang, M.L.'      7  
primary 'Lucas, R.'        8  
primary 'Zhang, B.L.'      9  
primary 'Wenker, J.'       10 
primary 'Torchia, D.A.'    11 
# 
_cell.entry_id           1KLD 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KLD 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'TRANSFORMING GROWTH FACTOR-BETA 1' 
_entity.formula_weight             12809.812 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    '1 MM (IN DIMER), PH 4.2' 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        TGF-B1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVP
QALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVP
QALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   LEU n 
1 3   ASP n 
1 4   THR n 
1 5   ASN n 
1 6   TYR n 
1 7   CYS n 
1 8   PHE n 
1 9   SER n 
1 10  SER n 
1 11  THR n 
1 12  GLU n 
1 13  LYS n 
1 14  ASN n 
1 15  CYS n 
1 16  CYS n 
1 17  VAL n 
1 18  ARG n 
1 19  GLN n 
1 20  LEU n 
1 21  TYR n 
1 22  ILE n 
1 23  ASP n 
1 24  PHE n 
1 25  ARG n 
1 26  LYS n 
1 27  ASP n 
1 28  LEU n 
1 29  GLY n 
1 30  TRP n 
1 31  LYS n 
1 32  TRP n 
1 33  ILE n 
1 34  HIS n 
1 35  GLU n 
1 36  PRO n 
1 37  LYS n 
1 38  GLY n 
1 39  TYR n 
1 40  HIS n 
1 41  ALA n 
1 42  ASN n 
1 43  PHE n 
1 44  CYS n 
1 45  LEU n 
1 46  GLY n 
1 47  PRO n 
1 48  CYS n 
1 49  PRO n 
1 50  TYR n 
1 51  ILE n 
1 52  TRP n 
1 53  SER n 
1 54  LEU n 
1 55  ASP n 
1 56  THR n 
1 57  GLN n 
1 58  TYR n 
1 59  SER n 
1 60  LYS n 
1 61  VAL n 
1 62  LEU n 
1 63  ALA n 
1 64  LEU n 
1 65  TYR n 
1 66  ASN n 
1 67  GLN n 
1 68  HIS n 
1 69  ASN n 
1 70  PRO n 
1 71  GLY n 
1 72  ALA n 
1 73  SER n 
1 74  ALA n 
1 75  ALA n 
1 76  PRO n 
1 77  CYS n 
1 78  CYS n 
1 79  VAL n 
1 80  PRO n 
1 81  GLN n 
1 82  ALA n 
1 83  LEU n 
1 84  GLU n 
1 85  PRO n 
1 86  LEU n 
1 87  PRO n 
1 88  ILE n 
1 89  VAL n 
1 90  TYR n 
1 91  TYR n 
1 92  VAL n 
1 93  GLY n 
1 94  ARG n 
1 95  LYS n 
1 96  PRO n 
1 97  LYS n 
1 98  VAL n 
1 99  GLU n 
1 100 GLN n 
1 101 LEU n 
1 102 SER n 
1 103 ASN n 
1 104 MET n 
1 105 ILE n 
1 106 VAL n 
1 107 ARG n 
1 108 SER n 
1 109 CYS n 
1 110 LYS n 
1 111 CYS n 
1 112 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                OVARY 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'Chinese hamster' 
_entity_src_gen.pdbx_host_org_scientific_name      'Cricetulus griseus' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     Cricetulus 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TGFB1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P01137 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLAL
YNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRL
KLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHAN
FCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KLD A 1 ? 112 ? P01137 279 ? 390 ? 1 112 
2 1 1KLD B 1 ? 112 ? P01137 279 ? 390 ? 1 112 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         ? 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  4.2 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_details.entry_id   1KLD 
_pdbx_nmr_details.text       'THIS ENTRY CONTAINS 18 - 33 OF 33 MODELS. 1 MM (IN DIMER).' 
# 
_pdbx_nmr_ensemble.entry_id                             1KLD 
_pdbx_nmr_ensemble.conformers_calculated_total_number   33 
_pdbx_nmr_ensemble.conformers_submitted_total_number    16 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           X-PLOR 3.1 BRUNGER 1 
'structure solution' XPLOR  3.1 ?       2 
# 
_exptl.entry_id          1KLD 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1KLD 
_struct.title                     'SOLUTION STRUCTURE OF TGF-B1, NMR, MODELS 18-33 OF 33 STRUCTURES' 
_struct.pdbx_descriptor           'TRANSFORMING GROWTH FACTOR-BETA 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KLD 
_struct_keywords.pdbx_keywords   'GROWTH FACTOR' 
_struct_keywords.text            'GROWTH FACTOR, MITOGEN, GLYCOPROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 57 ? HIS A 68 ? GLN A 57 HIS A 68 1 ? 12 
HELX_P HELX_P2 2 GLN B 57 ? HIS B 68 ? GLN B 57 HIS B 68 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 7  SG ? ? ? 1_555 A CYS 16  SG ? ? A CYS 7  A CYS 16  1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 78  SG ? ? A CYS 15 A CYS 78  1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf3 disulf ? ? A CYS 44 SG ? ? ? 1_555 A CYS 109 SG ? ? A CYS 44 A CYS 109 1_555 ? ? ? ? ? ? ? 2.018 ? 
disulf4 disulf ? ? A CYS 48 SG ? ? ? 1_555 A CYS 111 SG ? ? A CYS 48 A CYS 111 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf5 disulf ? ? A CYS 77 SG ? ? ? 1_555 B CYS 77  SG ? ? A CYS 77 B CYS 77  1_555 ? ? ? ? ? ? ? 2.018 ? 
disulf6 disulf ? ? B CYS 7  SG ? ? ? 1_555 B CYS 16  SG ? ? B CYS 7  B CYS 16  1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf7 disulf ? ? B CYS 15 SG ? ? ? 1_555 B CYS 78  SG ? ? B CYS 15 B CYS 78  1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf8 disulf ? ? B CYS 44 SG ? ? ? 1_555 B CYS 109 SG ? ? B CYS 44 B CYS 109 1_555 ? ? ? ? ? ? ? 2.017 ? 
disulf9 disulf ? ? B CYS 48 SG ? ? ? 1_555 B CYS 111 SG ? ? B CYS 48 B CYS 111 1_555 ? ? ? ? ? ? ? 2.022 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 18 -0.08 
2  GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 18 -0.04 
3  GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 19 0.30  
4  GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 19 0.17  
5  GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 20 -0.16 
6  GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 20 -0.09 
7  GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 21 -0.26 
8  GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 21 -0.20 
9  GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 22 -0.12 
10 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 22 -0.15 
11 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 23 -0.36 
12 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 23 -0.20 
13 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 24 -0.09 
14 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 24 -0.01 
15 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 25 0.12  
16 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 25 -0.02 
17 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 26 -0.60 
18 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 26 -0.48 
19 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 27 -0.13 
20 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 27 -0.19 
21 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 28 -0.07 
22 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 28 -0.07 
23 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 29 -0.14 
24 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 29 0.03  
25 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 30 0.26  
26 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 30 0.25  
27 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 31 0.02  
28 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 31 0.01  
29 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 32 -0.46 
30 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 32 -0.42 
31 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 33 0.11  
32 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 33 0.09  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 16  ? ARG A 18  ? CYS A 16  ARG A 18  
A 2 PHE A 43  ? LEU A 45  ? PHE A 43  LEU A 45  
B 1 TYR A 90  ? VAL A 92  ? TYR A 90  VAL A 92  
B 2 LYS A 95  ? LYS A 97  ? LYS A 95  LYS A 97  
C 1 CYS B 16  ? ARG B 18  ? CYS B 16  ARG B 18  
C 2 PHE B 43  ? LEU B 45  ? PHE B 43  LEU B 45  
D 1 TYR B 90  ? VAL B 92  ? TYR B 90  VAL B 92  
D 2 LYS B 95  ? LYS B 97  ? LYS B 95  LYS B 97  
E 1 CYS A 77  ? ALA A 82  ? CYS A 77  ALA A 82  
E 2 SER A 108 ? SER A 112 ? SER A 108 SER A 112 
F 1 CYS B 77  ? ALA B 82  ? CYS B 77  ALA B 82  
F 2 SER B 108 ? SER B 112 ? SER B 108 SER B 112 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O CYS A 16 ? O CYS A 16 N LEU A 45  ? N LEU A 45  
B 1 2 O TYR A 90 ? O TYR A 90 N LYS A 97  ? N LYS A 97  
C 1 2 O CYS B 16 ? O CYS B 16 N LEU B 45  ? N LEU B 45  
D 1 2 O TYR B 90 ? O TYR B 90 N LYS B 97  ? N LYS B 97  
E 1 2 O CYS A 77 ? O CYS A 77 N SER A 112 ? N SER A 112 
F 1 2 O CYS B 77 ? O CYS B 77 N SER B 112 ? N SER B 112 
# 
_database_PDB_matrix.entry_id          1KLD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KLD 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ALA A 1 1   ? 8.241   -3.266  -15.409 1.00 0.00 ? 1   ALA A N    18 
ATOM 2     C CA   . ALA A 1 1   ? 8.297   -3.852  -14.040 1.00 0.00 ? 1   ALA A CA   18 
ATOM 3     C C    . ALA A 1 1   ? 8.355   -2.726  -13.006 1.00 0.00 ? 1   ALA A C    18 
ATOM 4     O O    . ALA A 1 1   ? 8.835   -1.644  -13.279 1.00 0.00 ? 1   ALA A O    18 
ATOM 5     C CB   . ALA A 1 1   ? 9.543   -4.729  -13.911 1.00 0.00 ? 1   ALA A CB   18 
ATOM 6     H H1   . ALA A 1 1   ? 8.815   -2.400  -15.438 1.00 0.00 ? 1   ALA A H1   18 
ATOM 7     H H2   . ALA A 1 1   ? 8.617   -3.951  -16.095 1.00 0.00 ? 1   ALA A H2   18 
ATOM 8     H H3   . ALA A 1 1   ? 7.254   -3.039  -15.648 1.00 0.00 ? 1   ALA A H3   18 
ATOM 9     H HA   . ALA A 1 1   ? 7.415   -4.452  -13.869 1.00 0.00 ? 1   ALA A HA   18 
ATOM 10    H HB1  . ALA A 1 1   ? 9.911   -4.979  -14.896 1.00 0.00 ? 1   ALA A HB1  18 
ATOM 11    H HB2  . ALA A 1 1   ? 10.307  -4.192  -13.368 1.00 0.00 ? 1   ALA A HB2  18 
ATOM 12    H HB3  . ALA A 1 1   ? 9.293   -5.635  -13.379 1.00 0.00 ? 1   ALA A HB3  18 
ATOM 13    N N    . LEU A 1 2   ? 7.870   -2.971  -11.819 1.00 0.00 ? 2   LEU A N    18 
ATOM 14    C CA   . LEU A 1 2   ? 7.897   -1.912  -10.770 1.00 0.00 ? 2   LEU A CA   18 
ATOM 15    C C    . LEU A 1 2   ? 8.927   -2.274  -9.706  1.00 0.00 ? 2   LEU A C    18 
ATOM 16    O O    . LEU A 1 2   ? 8.609   -2.429  -8.543  1.00 0.00 ? 2   LEU A O    18 
ATOM 17    C CB   . LEU A 1 2   ? 6.525   -1.804  -10.117 1.00 0.00 ? 2   LEU A CB   18 
ATOM 18    C CG   . LEU A 1 2   ? 5.454   -1.614  -11.192 1.00 0.00 ? 2   LEU A CG   18 
ATOM 19    C CD1  . LEU A 1 2   ? 4.141   -1.185  -10.535 1.00 0.00 ? 2   LEU A CD1  18 
ATOM 20    C CD2  . LEU A 1 2   ? 5.905   -0.532  -12.177 1.00 0.00 ? 2   LEU A CD2  18 
ATOM 21    H H    . LEU A 1 2   ? 7.486   -3.849  -11.619 1.00 0.00 ? 2   LEU A H    18 
ATOM 22    H HA   . LEU A 1 2   ? 8.160   -0.965  -11.217 1.00 0.00 ? 2   LEU A HA   18 
ATOM 23    H HB2  . LEU A 1 2   ? 6.324   -2.707  -9.561  1.00 0.00 ? 2   LEU A HB2  18 
ATOM 24    H HB3  . LEU A 1 2   ? 6.518   -0.960  -9.448  1.00 0.00 ? 2   LEU A HB3  18 
ATOM 25    H HG   . LEU A 1 2   ? 5.305   -2.544  -11.720 1.00 0.00 ? 2   LEU A HG   18 
ATOM 26    H HD11 . LEU A 1 2   ? 4.021   -1.708  -9.597  1.00 0.00 ? 2   LEU A HD11 18 
ATOM 27    H HD12 . LEU A 1 2   ? 4.159   -0.121  -10.354 1.00 0.00 ? 2   LEU A HD12 18 
ATOM 28    H HD13 . LEU A 1 2   ? 3.316   -1.425  -11.188 1.00 0.00 ? 2   LEU A HD13 18 
ATOM 29    H HD21 . LEU A 1 2   ? 6.865   -0.802  -12.593 1.00 0.00 ? 2   LEU A HD21 18 
ATOM 30    H HD22 . LEU A 1 2   ? 5.180   -0.445  -12.971 1.00 0.00 ? 2   LEU A HD22 18 
ATOM 31    H HD23 . LEU A 1 2   ? 5.990   0.412   -11.661 1.00 0.00 ? 2   LEU A HD23 18 
ATOM 32    N N    . ASP A 1 3   ? 10.157  -2.410  -10.093 1.00 0.00 ? 3   ASP A N    18 
ATOM 33    C CA   . ASP A 1 3   ? 11.214  -2.761  -9.109  1.00 0.00 ? 3   ASP A CA   18 
ATOM 34    C C    . ASP A 1 3   ? 12.157  -1.574  -8.926  1.00 0.00 ? 3   ASP A C    18 
ATOM 35    O O    . ASP A 1 3   ? 11.981  -0.527  -9.518  1.00 0.00 ? 3   ASP A O    18 
ATOM 36    C CB   . ASP A 1 3   ? 12.006  -3.968  -9.615  1.00 0.00 ? 3   ASP A CB   18 
ATOM 37    C CG   . ASP A 1 3   ? 12.069  -3.938  -11.144 1.00 0.00 ? 3   ASP A CG   18 
ATOM 38    O OD1  . ASP A 1 3   ? 12.359  -2.883  -11.683 1.00 0.00 ? 3   ASP A OD1  18 
ATOM 39    O OD2  . ASP A 1 3   ? 11.827  -4.970  -11.747 1.00 0.00 ? 3   ASP A OD2  18 
ATOM 40    H H    . ASP A 1 3   ? 10.385  -2.280  -11.034 1.00 0.00 ? 3   ASP A H    18 
ATOM 41    H HA   . ASP A 1 3   ? 10.756  -3.005  -8.161  1.00 0.00 ? 3   ASP A HA   18 
ATOM 42    H HB2  . ASP A 1 3   ? 13.008  -3.935  -9.211  1.00 0.00 ? 3   ASP A HB2  18 
ATOM 43    H HB3  . ASP A 1 3   ? 11.519  -4.875  -9.295  1.00 0.00 ? 3   ASP A HB3  18 
ATOM 44    N N    . THR A 1 4   ? 13.157  -1.730  -8.105  1.00 0.00 ? 4   THR A N    18 
ATOM 45    C CA   . THR A 1 4   ? 14.117  -0.616  -7.870  1.00 0.00 ? 4   THR A CA   18 
ATOM 46    C C    . THR A 1 4   ? 15.139  -0.557  -9.008  1.00 0.00 ? 4   THR A C    18 
ATOM 47    O O    . THR A 1 4   ? 16.103  0.180   -8.951  1.00 0.00 ? 4   THR A O    18 
ATOM 48    C CB   . THR A 1 4   ? 14.828  -0.843  -6.534  1.00 0.00 ? 4   THR A CB   18 
ATOM 49    O OG1  . THR A 1 4   ? 15.780  -1.888  -6.678  1.00 0.00 ? 4   THR A OG1  18 
ATOM 50    C CG2  . THR A 1 4   ? 13.795  -1.228  -5.469  1.00 0.00 ? 4   THR A CG2  18 
ATOM 51    H H    . THR A 1 4   ? 13.273  -2.582  -7.636  1.00 0.00 ? 4   THR A H    18 
ATOM 52    H HA   . THR A 1 4   ? 13.581  0.319   -7.834  1.00 0.00 ? 4   THR A HA   18 
ATOM 53    H HB   . THR A 1 4   ? 15.329  0.064   -6.232  1.00 0.00 ? 4   THR A HB   18 
ATOM 54    H HG1  . THR A 1 4   ? 16.535  -1.680  -6.122  1.00 0.00 ? 4   THR A HG1  18 
ATOM 55    H HG21 . THR A 1 4   ? 12.892  -1.578  -5.948  1.00 0.00 ? 4   THR A HG21 18 
ATOM 56    H HG22 . THR A 1 4   ? 14.196  -2.013  -4.845  1.00 0.00 ? 4   THR A HG22 18 
ATOM 57    H HG23 . THR A 1 4   ? 13.567  -0.366  -4.859  1.00 0.00 ? 4   THR A HG23 18 
ATOM 58    N N    . ASN A 1 5   ? 14.926  -1.314  -10.050 1.00 0.00 ? 5   ASN A N    18 
ATOM 59    C CA   . ASN A 1 5   ? 15.875  -1.283  -11.198 1.00 0.00 ? 5   ASN A CA   18 
ATOM 60    C C    . ASN A 1 5   ? 15.309  -0.359  -12.277 1.00 0.00 ? 5   ASN A C    18 
ATOM 61    O O    . ASN A 1 5   ? 16.014  0.439   -12.861 1.00 0.00 ? 5   ASN A O    18 
ATOM 62    C CB   . ASN A 1 5   ? 16.042  -2.694  -11.767 1.00 0.00 ? 5   ASN A CB   18 
ATOM 63    C CG   . ASN A 1 5   ? 16.044  -3.709  -10.621 1.00 0.00 ? 5   ASN A CG   18 
ATOM 64    O OD1  . ASN A 1 5   ? 16.303  -3.361  -9.486  1.00 0.00 ? 5   ASN A OD1  18 
ATOM 65    N ND2  . ASN A 1 5   ? 15.767  -4.958  -10.873 1.00 0.00 ? 5   ASN A ND2  18 
ATOM 66    H H    . ASN A 1 5   ? 14.138  -1.892  -10.085 1.00 0.00 ? 5   ASN A H    18 
ATOM 67    H HA   . ASN A 1 5   ? 16.833  -0.908  -10.867 1.00 0.00 ? 5   ASN A HA   18 
ATOM 68    H HB2  . ASN A 1 5   ? 15.224  -2.910  -12.439 1.00 0.00 ? 5   ASN A HB2  18 
ATOM 69    H HB3  . ASN A 1 5   ? 16.976  -2.757  -12.302 1.00 0.00 ? 5   ASN A HB3  18 
ATOM 70    H HD21 . ASN A 1 5   ? 15.559  -5.239  -11.789 1.00 0.00 ? 5   ASN A HD21 18 
ATOM 71    H HD22 . ASN A 1 5   ? 15.766  -5.616  -10.147 1.00 0.00 ? 5   ASN A HD22 18 
ATOM 72    N N    . TYR A 1 6   ? 14.033  -0.460  -12.540 1.00 0.00 ? 6   TYR A N    18 
ATOM 73    C CA   . TYR A 1 6   ? 13.407  0.405   -13.570 1.00 0.00 ? 6   TYR A CA   18 
ATOM 74    C C    . TYR A 1 6   ? 12.884  1.684   -12.908 1.00 0.00 ? 6   TYR A C    18 
ATOM 75    O O    . TYR A 1 6   ? 12.636  2.677   -13.561 1.00 0.00 ? 6   TYR A O    18 
ATOM 76    C CB   . TYR A 1 6   ? 12.247  -0.357  -14.203 1.00 0.00 ? 6   TYR A CB   18 
ATOM 77    C CG   . TYR A 1 6   ? 11.412  0.585   -15.031 1.00 0.00 ? 6   TYR A CG   18 
ATOM 78    C CD1  . TYR A 1 6   ? 11.894  1.057   -16.257 1.00 0.00 ? 6   TYR A CD1  18 
ATOM 79    C CD2  . TYR A 1 6   ? 10.155  0.988   -14.569 1.00 0.00 ? 6   TYR A CD2  18 
ATOM 80    C CE1  . TYR A 1 6   ? 11.117  1.935   -17.022 1.00 0.00 ? 6   TYR A CE1  18 
ATOM 81    C CE2  . TYR A 1 6   ? 9.377   1.865   -15.333 1.00 0.00 ? 6   TYR A CE2  18 
ATOM 82    C CZ   . TYR A 1 6   ? 9.858   2.339   -16.560 1.00 0.00 ? 6   TYR A CZ   18 
ATOM 83    O OH   . TYR A 1 6   ? 9.092   3.204   -17.313 1.00 0.00 ? 6   TYR A OH   18 
ATOM 84    H H    . TYR A 1 6   ? 13.481  -1.109  -12.059 1.00 0.00 ? 6   TYR A H    18 
ATOM 85    H HA   . TYR A 1 6   ? 14.134  0.657   -14.328 1.00 0.00 ? 6   TYR A HA   18 
ATOM 86    H HB2  . TYR A 1 6   ? 12.636  -1.146  -14.826 1.00 0.00 ? 6   TYR A HB2  18 
ATOM 87    H HB3  . TYR A 1 6   ? 11.634  -0.787  -13.425 1.00 0.00 ? 6   TYR A HB3  18 
ATOM 88    H HD1  . TYR A 1 6   ? 12.865  0.745   -16.612 1.00 0.00 ? 6   TYR A HD1  18 
ATOM 89    H HD2  . TYR A 1 6   ? 9.787   0.621   -13.621 1.00 0.00 ? 6   TYR A HD2  18 
ATOM 90    H HE1  . TYR A 1 6   ? 11.489  2.300   -17.967 1.00 0.00 ? 6   TYR A HE1  18 
ATOM 91    H HE2  . TYR A 1 6   ? 8.406   2.176   -14.976 1.00 0.00 ? 6   TYR A HE2  18 
ATOM 92    H HH   . TYR A 1 6   ? 8.664   2.696   -18.005 1.00 0.00 ? 6   TYR A HH   18 
ATOM 93    N N    . CYS A 1 7   ? 12.712  1.662   -11.614 1.00 0.00 ? 7   CYS A N    18 
ATOM 94    C CA   . CYS A 1 7   ? 12.201  2.871   -10.905 1.00 0.00 ? 7   CYS A CA   18 
ATOM 95    C C    . CYS A 1 7   ? 13.350  3.855   -10.677 1.00 0.00 ? 7   CYS A C    18 
ATOM 96    O O    . CYS A 1 7   ? 13.144  4.986   -10.286 1.00 0.00 ? 7   CYS A O    18 
ATOM 97    C CB   . CYS A 1 7   ? 11.605  2.455   -9.560  1.00 0.00 ? 7   CYS A CB   18 
ATOM 98    S SG   . CYS A 1 7   ? 10.018  1.634   -9.841  1.00 0.00 ? 7   CYS A SG   18 
ATOM 99    H H    . CYS A 1 7   ? 12.916  0.848   -11.107 1.00 0.00 ? 7   CYS A H    18 
ATOM 100   H HA   . CYS A 1 7   ? 11.439  3.343   -11.505 1.00 0.00 ? 7   CYS A HA   18 
ATOM 101   H HB2  . CYS A 1 7   ? 12.282  1.776   -9.059  1.00 0.00 ? 7   CYS A HB2  18 
ATOM 102   H HB3  . CYS A 1 7   ? 11.454  3.332   -8.946  1.00 0.00 ? 7   CYS A HB3  18 
ATOM 103   N N    . PHE A 1 8   ? 14.560  3.432   -10.918 1.00 0.00 ? 8   PHE A N    18 
ATOM 104   C CA   . PHE A 1 8   ? 15.723  4.342   -10.716 1.00 0.00 ? 8   PHE A CA   18 
ATOM 105   C C    . PHE A 1 8   ? 15.929  5.199   -11.970 1.00 0.00 ? 8   PHE A C    18 
ATOM 106   O O    . PHE A 1 8   ? 17.040  5.403   -12.416 1.00 0.00 ? 8   PHE A O    18 
ATOM 107   C CB   . PHE A 1 8   ? 16.981  3.510   -10.460 1.00 0.00 ? 8   PHE A CB   18 
ATOM 108   C CG   . PHE A 1 8   ? 17.137  3.267   -8.976  1.00 0.00 ? 8   PHE A CG   18 
ATOM 109   C CD1  . PHE A 1 8   ? 16.013  3.282   -8.139  1.00 0.00 ? 8   PHE A CD1  18 
ATOM 110   C CD2  . PHE A 1 8   ? 18.406  3.026   -8.436  1.00 0.00 ? 8   PHE A CD2  18 
ATOM 111   C CE1  . PHE A 1 8   ? 16.160  3.057   -6.765  1.00 0.00 ? 8   PHE A CE1  18 
ATOM 112   C CE2  . PHE A 1 8   ? 18.553  2.801   -7.063  1.00 0.00 ? 8   PHE A CE2  18 
ATOM 113   C CZ   . PHE A 1 8   ? 17.431  2.817   -6.227  1.00 0.00 ? 8   PHE A CZ   18 
ATOM 114   H H    . PHE A 1 8   ? 14.703  2.515   -11.232 1.00 0.00 ? 8   PHE A H    18 
ATOM 115   H HA   . PHE A 1 8   ? 15.536  4.984   -9.869  1.00 0.00 ? 8   PHE A HA   18 
ATOM 116   H HB2  . PHE A 1 8   ? 16.894  2.564   -10.973 1.00 0.00 ? 8   PHE A HB2  18 
ATOM 117   H HB3  . PHE A 1 8   ? 17.846  4.042   -10.829 1.00 0.00 ? 8   PHE A HB3  18 
ATOM 118   H HD1  . PHE A 1 8   ? 15.033  3.468   -8.554  1.00 0.00 ? 8   PHE A HD1  18 
ATOM 119   H HD2  . PHE A 1 8   ? 19.273  3.014   -9.081  1.00 0.00 ? 8   PHE A HD2  18 
ATOM 120   H HE1  . PHE A 1 8   ? 15.295  3.070   -6.119  1.00 0.00 ? 8   PHE A HE1  18 
ATOM 121   H HE2  . PHE A 1 8   ? 19.532  2.615   -6.648  1.00 0.00 ? 8   PHE A HE2  18 
ATOM 122   H HZ   . PHE A 1 8   ? 17.543  2.643   -5.167  1.00 0.00 ? 8   PHE A HZ   18 
ATOM 123   N N    . SER A 1 9   ? 14.868  5.704   -12.539 1.00 0.00 ? 9   SER A N    18 
ATOM 124   C CA   . SER A 1 9   ? 15.007  6.547   -13.761 1.00 0.00 ? 9   SER A CA   18 
ATOM 125   C C    . SER A 1 9   ? 14.722  8.008   -13.407 1.00 0.00 ? 9   SER A C    18 
ATOM 126   O O    . SER A 1 9   ? 14.908  8.432   -12.285 1.00 0.00 ? 9   SER A O    18 
ATOM 127   C CB   . SER A 1 9   ? 14.011  6.077   -14.821 1.00 0.00 ? 9   SER A CB   18 
ATOM 128   O OG   . SER A 1 9   ? 13.811  4.676   -14.691 1.00 0.00 ? 9   SER A OG   18 
ATOM 129   H H    . SER A 1 9   ? 13.982  5.529   -12.164 1.00 0.00 ? 9   SER A H    18 
ATOM 130   H HA   . SER A 1 9   ? 16.012  6.459   -14.147 1.00 0.00 ? 9   SER A HA   18 
ATOM 131   H HB2  . SER A 1 9   ? 13.071  6.585   -14.686 1.00 0.00 ? 9   SER A HB2  18 
ATOM 132   H HB3  . SER A 1 9   ? 14.400  6.305   -15.805 1.00 0.00 ? 9   SER A HB3  18 
ATOM 133   H HG   . SER A 1 9   ? 13.034  4.439   -15.202 1.00 0.00 ? 9   SER A HG   18 
ATOM 134   N N    . SER A 1 10  ? 14.274  8.782   -14.359 1.00 0.00 ? 10  SER A N    18 
ATOM 135   C CA   . SER A 1 10  ? 13.980  10.216  -14.076 1.00 0.00 ? 10  SER A CA   18 
ATOM 136   C C    . SER A 1 10  ? 12.542  10.539  -14.485 1.00 0.00 ? 10  SER A C    18 
ATOM 137   O O    . SER A 1 10  ? 12.044  11.618  -14.234 1.00 0.00 ? 10  SER A O    18 
ATOM 138   C CB   . SER A 1 10  ? 14.945  11.097  -14.870 1.00 0.00 ? 10  SER A CB   18 
ATOM 139   O OG   . SER A 1 10  ? 14.591  12.461  -14.688 1.00 0.00 ? 10  SER A OG   18 
ATOM 140   H H    . SER A 1 10  ? 14.133  8.420   -15.258 1.00 0.00 ? 10  SER A H    18 
ATOM 141   H HA   . SER A 1 10  ? 14.103  10.405  -13.022 1.00 0.00 ? 10  SER A HA   18 
ATOM 142   H HB2  . SER A 1 10  ? 15.951  10.942  -14.517 1.00 0.00 ? 10  SER A HB2  18 
ATOM 143   H HB3  . SER A 1 10  ? 14.889  10.836  -15.918 1.00 0.00 ? 10  SER A HB3  18 
ATOM 144   H HG   . SER A 1 10  ? 14.331  12.582  -13.771 1.00 0.00 ? 10  SER A HG   18 
ATOM 145   N N    . THR A 1 11  ? 11.874  9.616   -15.115 1.00 0.00 ? 11  THR A N    18 
ATOM 146   C CA   . THR A 1 11  ? 10.472  9.871   -15.544 1.00 0.00 ? 11  THR A CA   18 
ATOM 147   C C    . THR A 1 11  ? 9.532   8.899   -14.826 1.00 0.00 ? 11  THR A C    18 
ATOM 148   O O    . THR A 1 11  ? 9.909   8.236   -13.882 1.00 0.00 ? 11  THR A O    18 
ATOM 149   C CB   . THR A 1 11  ? 10.363  9.662   -17.054 1.00 0.00 ? 11  THR A CB   18 
ATOM 150   O OG1  . THR A 1 11  ? 11.614  9.215   -17.559 1.00 0.00 ? 11  THR A OG1  18 
ATOM 151   C CG2  . THR A 1 11  ? 9.982   10.979  -17.726 1.00 0.00 ? 11  THR A CG2  18 
ATOM 152   H H    . THR A 1 11  ? 12.294  8.755   -15.311 1.00 0.00 ? 11  THR A H    18 
ATOM 153   H HA   . THR A 1 11  ? 10.198  10.886  -15.299 1.00 0.00 ? 11  THR A HA   18 
ATOM 154   H HB   . THR A 1 11  ? 9.606   8.923   -17.261 1.00 0.00 ? 11  THR A HB   18 
ATOM 155   H HG1  . THR A 1 11  ? 12.137  9.989   -17.782 1.00 0.00 ? 11  THR A HG1  18 
ATOM 156   H HG21 . THR A 1 11  ? 10.679  11.750  -17.427 1.00 0.00 ? 11  THR A HG21 18 
ATOM 157   H HG22 . THR A 1 11  ? 10.015  10.860  -18.798 1.00 0.00 ? 11  THR A HG22 18 
ATOM 158   H HG23 . THR A 1 11  ? 8.983   11.261  -17.425 1.00 0.00 ? 11  THR A HG23 18 
ATOM 159   N N    . GLU A 1 12  ? 8.308   8.810   -15.272 1.00 0.00 ? 12  GLU A N    18 
ATOM 160   C CA   . GLU A 1 12  ? 7.343   7.880   -14.622 1.00 0.00 ? 12  GLU A CA   18 
ATOM 161   C C    . GLU A 1 12  ? 7.083   8.338   -13.183 1.00 0.00 ? 12  GLU A C    18 
ATOM 162   O O    . GLU A 1 12  ? 8.000   8.608   -12.433 1.00 0.00 ? 12  GLU A O    18 
ATOM 163   C CB   . GLU A 1 12  ? 7.929   6.468   -14.617 1.00 0.00 ? 12  GLU A CB   18 
ATOM 164   C CG   . GLU A 1 12  ? 6.836   5.460   -14.257 1.00 0.00 ? 12  GLU A CG   18 
ATOM 165   C CD   . GLU A 1 12  ? 7.309   4.593   -13.089 1.00 0.00 ? 12  GLU A CD   18 
ATOM 166   O OE1  . GLU A 1 12  ? 7.856   5.148   -12.151 1.00 0.00 ? 12  GLU A OE1  18 
ATOM 167   O OE2  . GLU A 1 12  ? 7.119   3.391   -13.154 1.00 0.00 ? 12  GLU A OE2  18 
ATOM 168   H H    . GLU A 1 12  ? 8.025   9.353   -16.038 1.00 0.00 ? 12  GLU A H    18 
ATOM 169   H HA   . GLU A 1 12  ? 6.414   7.883   -15.172 1.00 0.00 ? 12  GLU A HA   18 
ATOM 170   H HB2  . GLU A 1 12  ? 8.321   6.239   -15.598 1.00 0.00 ? 12  GLU A HB2  18 
ATOM 171   H HB3  . GLU A 1 12  ? 8.723   6.409   -13.888 1.00 0.00 ? 12  GLU A HB3  18 
ATOM 172   H HG2  . GLU A 1 12  ? 5.938   5.990   -13.974 1.00 0.00 ? 12  GLU A HG2  18 
ATOM 173   H HG3  . GLU A 1 12  ? 6.630   4.831   -15.111 1.00 0.00 ? 12  GLU A HG3  18 
ATOM 174   N N    . LYS A 1 13  ? 5.839   8.436   -12.796 1.00 0.00 ? 13  LYS A N    18 
ATOM 175   C CA   . LYS A 1 13  ? 5.523   8.887   -11.410 1.00 0.00 ? 13  LYS A CA   18 
ATOM 176   C C    . LYS A 1 13  ? 4.437   7.991   -10.806 1.00 0.00 ? 13  LYS A C    18 
ATOM 177   O O    . LYS A 1 13  ? 3.775   8.359   -9.856  1.00 0.00 ? 13  LYS A O    18 
ATOM 178   C CB   . LYS A 1 13  ? 5.024   10.332  -11.452 1.00 0.00 ? 13  LYS A CB   18 
ATOM 179   C CG   . LYS A 1 13  ? 4.849   10.857  -10.026 1.00 0.00 ? 13  LYS A CG   18 
ATOM 180   C CD   . LYS A 1 13  ? 3.476   11.517  -9.891  1.00 0.00 ? 13  LYS A CD   18 
ATOM 181   C CE   . LYS A 1 13  ? 2.933   11.279  -8.481  1.00 0.00 ? 13  LYS A CE   18 
ATOM 182   N NZ   . LYS A 1 13  ? 1.556   11.840  -8.378  1.00 0.00 ? 13  LYS A NZ   18 
ATOM 183   H H    . LYS A 1 13  ? 5.113   8.220   -13.419 1.00 0.00 ? 13  LYS A H    18 
ATOM 184   H HA   . LYS A 1 13  ? 6.414   8.832   -10.802 1.00 0.00 ? 13  LYS A HA   18 
ATOM 185   H HB2  . LYS A 1 13  ? 5.742   10.945  -11.977 1.00 0.00 ? 13  LYS A HB2  18 
ATOM 186   H HB3  . LYS A 1 13  ? 4.075   10.371  -11.966 1.00 0.00 ? 13  LYS A HB3  18 
ATOM 187   H HG2  . LYS A 1 13  ? 4.925   10.036  -9.328  1.00 0.00 ? 13  LYS A HG2  18 
ATOM 188   H HG3  . LYS A 1 13  ? 5.619   11.584  -9.814  1.00 0.00 ? 13  LYS A HG3  18 
ATOM 189   H HD2  . LYS A 1 13  ? 3.568   12.579  -10.067 1.00 0.00 ? 13  LYS A HD2  18 
ATOM 190   H HD3  . LYS A 1 13  ? 2.797   11.089  -10.613 1.00 0.00 ? 13  LYS A HD3  18 
ATOM 191   H HE2  . LYS A 1 13  ? 2.904   10.219  -8.281  1.00 0.00 ? 13  LYS A HE2  18 
ATOM 192   H HE3  . LYS A 1 13  ? 3.575   11.765  -7.761  1.00 0.00 ? 13  LYS A HE3  18 
ATOM 193   H HZ1  . LYS A 1 13  ? 1.549   12.812  -8.749  1.00 0.00 ? 13  LYS A HZ1  18 
ATOM 194   H HZ2  . LYS A 1 13  ? 0.900   11.255  -8.933  1.00 0.00 ? 13  LYS A HZ2  18 
ATOM 195   H HZ3  . LYS A 1 13  ? 1.258   11.847  -7.381  1.00 0.00 ? 13  LYS A HZ3  18 
ATOM 196   N N    . ASN A 1 14  ? 4.246   6.819   -11.347 1.00 0.00 ? 14  ASN A N    18 
ATOM 197   C CA   . ASN A 1 14  ? 3.201   5.908   -10.799 1.00 0.00 ? 14  ASN A CA   18 
ATOM 198   C C    . ASN A 1 14  ? 3.814   5.018   -9.715  1.00 0.00 ? 14  ASN A C    18 
ATOM 199   O O    . ASN A 1 14  ? 4.873   5.302   -9.193  1.00 0.00 ? 14  ASN A O    18 
ATOM 200   C CB   . ASN A 1 14  ? 2.649   5.031   -11.923 1.00 0.00 ? 14  ASN A CB   18 
ATOM 201   C CG   . ASN A 1 14  ? 2.367   5.893   -13.156 1.00 0.00 ? 14  ASN A CG   18 
ATOM 202   O OD1  . ASN A 1 14  ? 1.499   6.742   -13.131 1.00 0.00 ? 14  ASN A OD1  18 
ATOM 203   N ND2  . ASN A 1 14  ? 3.071   5.710   -14.239 1.00 0.00 ? 14  ASN A ND2  18 
ATOM 204   H H    . ASN A 1 14  ? 4.788   6.538   -12.114 1.00 0.00 ? 14  ASN A H    18 
ATOM 205   H HA   . ASN A 1 14  ? 2.399   6.493   -10.373 1.00 0.00 ? 14  ASN A HA   18 
ATOM 206   H HB2  . ASN A 1 14  ? 3.374   4.270   -12.174 1.00 0.00 ? 14  ASN A HB2  18 
ATOM 207   H HB3  . ASN A 1 14  ? 1.734   4.562   -11.598 1.00 0.00 ? 14  ASN A HB3  18 
ATOM 208   H HD21 . ASN A 1 14  ? 3.772   5.025   -14.259 1.00 0.00 ? 14  ASN A HD21 18 
ATOM 209   H HD22 . ASN A 1 14  ? 2.897   6.257   -15.035 1.00 0.00 ? 14  ASN A HD22 18 
ATOM 210   N N    . CYS A 1 15  ? 3.159   3.937   -9.378  1.00 0.00 ? 15  CYS A N    18 
ATOM 211   C CA   . CYS A 1 15  ? 3.709   3.026   -8.333  1.00 0.00 ? 15  CYS A CA   18 
ATOM 212   C C    . CYS A 1 15  ? 5.121   2.599   -8.739  1.00 0.00 ? 15  CYS A C    18 
ATOM 213   O O    . CYS A 1 15  ? 5.312   1.598   -9.400  1.00 0.00 ? 15  CYS A O    18 
ATOM 214   C CB   . CYS A 1 15  ? 2.804   1.794   -8.220  1.00 0.00 ? 15  CYS A CB   18 
ATOM 215   S SG   . CYS A 1 15  ? 3.656   0.448   -7.347  1.00 0.00 ? 15  CYS A SG   18 
ATOM 216   H H    . CYS A 1 15  ? 2.308   3.723   -9.814  1.00 0.00 ? 15  CYS A H    18 
ATOM 217   H HA   . CYS A 1 15  ? 3.744   3.540   -7.384  1.00 0.00 ? 15  CYS A HA   18 
ATOM 218   H HB2  . CYS A 1 15  ? 1.904   2.053   -7.689  1.00 0.00 ? 15  CYS A HB2  18 
ATOM 219   H HB3  . CYS A 1 15  ? 2.541   1.462   -9.210  1.00 0.00 ? 15  CYS A HB3  18 
ATOM 220   N N    . CYS A 1 16  ? 6.113   3.349   -8.346  1.00 0.00 ? 16  CYS A N    18 
ATOM 221   C CA   . CYS A 1 16  ? 7.509   2.982   -8.706  1.00 0.00 ? 16  CYS A CA   18 
ATOM 222   C C    . CYS A 1 16  ? 8.397   3.131   -7.474  1.00 0.00 ? 16  CYS A C    18 
ATOM 223   O O    . CYS A 1 16  ? 8.468   4.183   -6.869  1.00 0.00 ? 16  CYS A O    18 
ATOM 224   C CB   . CYS A 1 16  ? 8.017   3.902   -9.816  1.00 0.00 ? 16  CYS A CB   18 
ATOM 225   S SG   . CYS A 1 16  ? 8.988   2.933   -10.997 1.00 0.00 ? 16  CYS A SG   18 
ATOM 226   H H    . CYS A 1 16  ? 5.939   4.150   -7.810  1.00 0.00 ? 16  CYS A H    18 
ATOM 227   H HA   . CYS A 1 16  ? 7.535   1.957   -9.047  1.00 0.00 ? 16  CYS A HA   18 
ATOM 228   H HB2  . CYS A 1 16  ? 7.179   4.355   -10.323 1.00 0.00 ? 16  CYS A HB2  18 
ATOM 229   H HB3  . CYS A 1 16  ? 8.639   4.675   -9.388  1.00 0.00 ? 16  CYS A HB3  18 
ATOM 230   N N    . VAL A 1 17  ? 9.068   2.083   -7.092  1.00 0.00 ? 17  VAL A N    18 
ATOM 231   C CA   . VAL A 1 17  ? 9.946   2.161   -5.894  1.00 0.00 ? 17  VAL A CA   18 
ATOM 232   C C    . VAL A 1 17  ? 11.062  3.183   -6.134  1.00 0.00 ? 17  VAL A C    18 
ATOM 233   O O    . VAL A 1 17  ? 11.938  2.985   -6.950  1.00 0.00 ? 17  VAL A O    18 
ATOM 234   C CB   . VAL A 1 17  ? 10.556  0.786   -5.626  1.00 0.00 ? 17  VAL A CB   18 
ATOM 235   C CG1  . VAL A 1 17  ? 11.599  0.473   -6.690  1.00 0.00 ? 17  VAL A CG1  18 
ATOM 236   C CG2  . VAL A 1 17  ? 11.225  0.789   -4.256  1.00 0.00 ? 17  VAL A CG2  18 
ATOM 237   H H    . VAL A 1 17  ? 8.991   1.243   -7.590  1.00 0.00 ? 17  VAL A H    18 
ATOM 238   H HA   . VAL A 1 17  ? 9.358   2.464   -5.041  1.00 0.00 ? 17  VAL A HA   18 
ATOM 239   H HB   . VAL A 1 17  ? 9.783   0.036   -5.651  1.00 0.00 ? 17  VAL A HB   18 
ATOM 240   H HG11 . VAL A 1 17  ? 11.358  1.004   -7.597  1.00 0.00 ? 17  VAL A HG11 18 
ATOM 241   H HG12 . VAL A 1 17  ? 12.572  0.784   -6.338  1.00 0.00 ? 17  VAL A HG12 18 
ATOM 242   H HG13 . VAL A 1 17  ? 11.607  -0.589  -6.882  1.00 0.00 ? 17  VAL A HG13 18 
ATOM 243   H HG21 . VAL A 1 17  ? 11.853  1.664   -4.167  1.00 0.00 ? 17  VAL A HG21 18 
ATOM 244   H HG22 . VAL A 1 17  ? 10.469  0.806   -3.488  1.00 0.00 ? 17  VAL A HG22 18 
ATOM 245   H HG23 . VAL A 1 17  ? 11.829  -0.099  -4.151  1.00 0.00 ? 17  VAL A HG23 18 
ATOM 246   N N    . ARG A 1 18  ? 11.039  4.280   -5.427  1.00 0.00 ? 18  ARG A N    18 
ATOM 247   C CA   . ARG A 1 18  ? 12.100  5.308   -5.619  1.00 0.00 ? 18  ARG A CA   18 
ATOM 248   C C    . ARG A 1 18  ? 13.209  5.097   -4.586  1.00 0.00 ? 18  ARG A C    18 
ATOM 249   O O    . ARG A 1 18  ? 13.004  4.485   -3.557  1.00 0.00 ? 18  ARG A O    18 
ATOM 250   C CB   . ARG A 1 18  ? 11.498  6.704   -5.442  1.00 0.00 ? 18  ARG A CB   18 
ATOM 251   C CG   . ARG A 1 18  ? 10.851  7.151   -6.754  1.00 0.00 ? 18  ARG A CG   18 
ATOM 252   C CD   . ARG A 1 18  ? 10.279  8.560   -6.589  1.00 0.00 ? 18  ARG A CD   18 
ATOM 253   N NE   . ARG A 1 18  ? 9.044   8.697   -7.411  1.00 0.00 ? 18  ARG A NE   18 
ATOM 254   C CZ   . ARG A 1 18  ? 9.073   9.376   -8.526  1.00 0.00 ? 18  ARG A CZ   18 
ATOM 255   N NH1  . ARG A 1 18  ? 9.000   10.678  -8.498  1.00 0.00 ? 18  ARG A NH1  18 
ATOM 256   N NH2  . ARG A 1 18  ? 9.176   8.752   -9.668  1.00 0.00 ? 18  ARG A NH2  18 
ATOM 257   H H    . ARG A 1 18  ? 10.326  4.427   -4.770  1.00 0.00 ? 18  ARG A H    18 
ATOM 258   H HA   . ARG A 1 18  ? 12.513  5.217   -6.612  1.00 0.00 ? 18  ARG A HA   18 
ATOM 259   H HB2  . ARG A 1 18  ? 10.751  6.676   -4.662  1.00 0.00 ? 18  ARG A HB2  18 
ATOM 260   H HB3  . ARG A 1 18  ? 12.277  7.400   -5.171  1.00 0.00 ? 18  ARG A HB3  18 
ATOM 261   H HG2  . ARG A 1 18  ? 11.595  7.154   -7.539  1.00 0.00 ? 18  ARG A HG2  18 
ATOM 262   H HG3  . ARG A 1 18  ? 10.056  6.469   -7.015  1.00 0.00 ? 18  ARG A HG3  18 
ATOM 263   H HD2  . ARG A 1 18  ? 10.040  8.731   -5.549  1.00 0.00 ? 18  ARG A HD2  18 
ATOM 264   H HD3  . ARG A 1 18  ? 11.010  9.286   -6.913  1.00 0.00 ? 18  ARG A HD3  18 
ATOM 265   H HE   . ARG A 1 18  ? 8.209   8.277   -7.115  1.00 0.00 ? 18  ARG A HE   18 
ATOM 266   H HH11 . ARG A 1 18  ? 8.921   11.157  -7.623  1.00 0.00 ? 18  ARG A HH11 18 
ATOM 267   H HH12 . ARG A 1 18  ? 9.022   11.199  -9.352  1.00 0.00 ? 18  ARG A HH12 18 
ATOM 268   H HH21 . ARG A 1 18  ? 9.230   7.755   -9.690  1.00 0.00 ? 18  ARG A HH21 18 
ATOM 269   H HH22 . ARG A 1 18  ? 9.198   9.273   -10.521 1.00 0.00 ? 18  ARG A HH22 18 
ATOM 270   N N    . GLN A 1 19  ? 14.385  5.598   -4.852  1.00 0.00 ? 19  GLN A N    18 
ATOM 271   C CA   . GLN A 1 19  ? 15.506  5.427   -3.884  1.00 0.00 ? 19  GLN A CA   18 
ATOM 272   C C    . GLN A 1 19  ? 15.136  6.088   -2.557  1.00 0.00 ? 19  GLN A C    18 
ATOM 273   O O    . GLN A 1 19  ? 14.463  7.099   -2.521  1.00 0.00 ? 19  GLN A O    18 
ATOM 274   C CB   . GLN A 1 19  ? 16.769  6.080   -4.448  1.00 0.00 ? 19  GLN A CB   18 
ATOM 275   C CG   . GLN A 1 19  ? 16.563  7.594   -4.550  1.00 0.00 ? 19  GLN A CG   18 
ATOM 276   C CD   . GLN A 1 19  ? 16.532  8.007   -6.023  1.00 0.00 ? 19  GLN A CD   18 
ATOM 277   O OE1  . GLN A 1 19  ? 15.729  7.509   -6.789  1.00 0.00 ? 19  GLN A OE1  18 
ATOM 278   N NE2  . GLN A 1 19  ? 17.376  8.903   -6.455  1.00 0.00 ? 19  GLN A NE2  18 
ATOM 279   H H    . GLN A 1 19  ? 14.530  6.088   -5.688  1.00 0.00 ? 19  GLN A H    18 
ATOM 280   H HA   . GLN A 1 19  ? 15.687  4.376   -3.721  1.00 0.00 ? 19  GLN A HA   18 
ATOM 281   H HB2  . GLN A 1 19  ? 17.603  5.873   -3.794  1.00 0.00 ? 19  GLN A HB2  18 
ATOM 282   H HB3  . GLN A 1 19  ? 16.973  5.680   -5.430  1.00 0.00 ? 19  GLN A HB3  18 
ATOM 283   H HG2  . GLN A 1 19  ? 15.628  7.862   -4.081  1.00 0.00 ? 19  GLN A HG2  18 
ATOM 284   H HG3  . GLN A 1 19  ? 17.375  8.102   -4.053  1.00 0.00 ? 19  GLN A HG3  18 
ATOM 285   H HE21 . GLN A 1 19  ? 18.022  9.305   -5.837  1.00 0.00 ? 19  GLN A HE21 18 
ATOM 286   H HE22 . GLN A 1 19  ? 17.365  9.173   -7.396  1.00 0.00 ? 19  GLN A HE22 18 
ATOM 287   N N    . LEU A 1 20  ? 15.573  5.529   -1.463  1.00 0.00 ? 20  LEU A N    18 
ATOM 288   C CA   . LEU A 1 20  ? 15.246  6.133   -0.142  1.00 0.00 ? 20  LEU A CA   18 
ATOM 289   C C    . LEU A 1 20  ? 16.344  5.800   0.862   1.00 0.00 ? 20  LEU A C    18 
ATOM 290   O O    . LEU A 1 20  ? 16.069  5.414   1.979   1.00 0.00 ? 20  LEU A O    18 
ATOM 291   C CB   . LEU A 1 20  ? 13.918  5.577   0.371   1.00 0.00 ? 20  LEU A CB   18 
ATOM 292   C CG   . LEU A 1 20  ? 13.480  6.362   1.612   1.00 0.00 ? 20  LEU A CG   18 
ATOM 293   C CD1  . LEU A 1 20  ? 13.361  7.846   1.263   1.00 0.00 ? 20  LEU A CD1  18 
ATOM 294   C CD2  . LEU A 1 20  ? 12.123  5.844   2.093   1.00 0.00 ? 20  LEU A CD2  18 
ATOM 295   H H    . LEU A 1 20  ? 16.116  4.715   -1.510  1.00 0.00 ? 20  LEU A H    18 
ATOM 296   H HA   . LEU A 1 20  ? 15.168  7.205   -0.249  1.00 0.00 ? 20  LEU A HA   18 
ATOM 297   H HB2  . LEU A 1 20  ? 13.171  5.672   -0.397  1.00 0.00 ? 20  LEU A HB2  18 
ATOM 298   H HB3  . LEU A 1 20  ? 14.039  4.536   0.631   1.00 0.00 ? 20  LEU A HB3  18 
ATOM 299   H HG   . LEU A 1 20  ? 14.212  6.237   2.395   1.00 0.00 ? 20  LEU A HG   18 
ATOM 300   H HD11 . LEU A 1 20  ? 13.519  7.981   0.204   1.00 0.00 ? 20  LEU A HD11 18 
ATOM 301   H HD12 . LEU A 1 20  ? 12.376  8.199   1.528   1.00 0.00 ? 20  LEU A HD12 18 
ATOM 302   H HD13 . LEU A 1 20  ? 14.104  8.405   1.813   1.00 0.00 ? 20  LEU A HD13 18 
ATOM 303   H HD21 . LEU A 1 20  ? 11.399  5.943   1.300   1.00 0.00 ? 20  LEU A HD21 18 
ATOM 304   H HD22 . LEU A 1 20  ? 12.213  4.805   2.373   1.00 0.00 ? 20  LEU A HD22 18 
ATOM 305   H HD23 . LEU A 1 20  ? 11.802  6.421   2.947   1.00 0.00 ? 20  LEU A HD23 18 
ATOM 306   N N    . TYR A 1 21  ? 17.586  5.944   0.488   1.00 0.00 ? 21  TYR A N    18 
ATOM 307   C CA   . TYR A 1 21  ? 18.667  5.630   1.461   1.00 0.00 ? 21  TYR A CA   18 
ATOM 308   C C    . TYR A 1 21  ? 18.324  6.291   2.791   1.00 0.00 ? 21  TYR A C    18 
ATOM 309   O O    . TYR A 1 21  ? 17.958  7.449   2.843   1.00 0.00 ? 21  TYR A O    18 
ATOM 310   C CB   . TYR A 1 21  ? 20.011  6.171   0.973   1.00 0.00 ? 21  TYR A CB   18 
ATOM 311   C CG   . TYR A 1 21  ? 21.046  5.924   2.048   1.00 0.00 ? 21  TYR A CG   18 
ATOM 312   C CD1  . TYR A 1 21  ? 21.055  6.710   3.209   1.00 0.00 ? 21  TYR A CD1  18 
ATOM 313   C CD2  . TYR A 1 21  ? 21.990  4.905   1.886   1.00 0.00 ? 21  TYR A CD2  18 
ATOM 314   C CE1  . TYR A 1 21  ? 22.010  6.475   4.209   1.00 0.00 ? 21  TYR A CE1  18 
ATOM 315   C CE2  . TYR A 1 21  ? 22.944  4.670   2.885   1.00 0.00 ? 21  TYR A CE2  18 
ATOM 316   C CZ   . TYR A 1 21  ? 22.954  5.454   4.046   1.00 0.00 ? 21  TYR A CZ   18 
ATOM 317   O OH   . TYR A 1 21  ? 23.896  5.221   5.027   1.00 0.00 ? 21  TYR A OH   18 
ATOM 318   H H    . TYR A 1 21  ? 17.801  6.256   -0.417  1.00 0.00 ? 21  TYR A H    18 
ATOM 319   H HA   . TYR A 1 21  ? 18.733  4.560   1.594   1.00 0.00 ? 21  TYR A HA   18 
ATOM 320   H HB2  . TYR A 1 21  ? 20.299  5.661   0.065   1.00 0.00 ? 21  TYR A HB2  18 
ATOM 321   H HB3  . TYR A 1 21  ? 19.930  7.231   0.786   1.00 0.00 ? 21  TYR A HB3  18 
ATOM 322   H HD1  . TYR A 1 21  ? 20.327  7.497   3.335   1.00 0.00 ? 21  TYR A HD1  18 
ATOM 323   H HD2  . TYR A 1 21  ? 21.980  4.297   0.994   1.00 0.00 ? 21  TYR A HD2  18 
ATOM 324   H HE1  . TYR A 1 21  ? 22.014  7.079   5.108   1.00 0.00 ? 21  TYR A HE1  18 
ATOM 325   H HE2  . TYR A 1 21  ? 23.673  3.882   2.761   1.00 0.00 ? 21  TYR A HE2  18 
ATOM 326   H HH   . TYR A 1 21  ? 24.646  5.797   4.862   1.00 0.00 ? 21  TYR A HH   18 
ATOM 327   N N    . ILE A 1 22  ? 18.434  5.572   3.865   1.00 0.00 ? 22  ILE A N    18 
ATOM 328   C CA   . ILE A 1 22  ? 18.108  6.168   5.184   1.00 0.00 ? 22  ILE A CA   18 
ATOM 329   C C    . ILE A 1 22  ? 19.320  6.052   6.105   1.00 0.00 ? 22  ILE A C    18 
ATOM 330   O O    . ILE A 1 22  ? 19.772  4.968   6.415   1.00 0.00 ? 22  ILE A O    18 
ATOM 331   C CB   . ILE A 1 22  ? 16.924  5.423   5.802   1.00 0.00 ? 22  ILE A CB   18 
ATOM 332   C CG1  . ILE A 1 22  ? 15.659  5.704   4.984   1.00 0.00 ? 22  ILE A CG1  18 
ATOM 333   C CG2  . ILE A 1 22  ? 16.718  5.897   7.240   1.00 0.00 ? 22  ILE A CG2  18 
ATOM 334   C CD1  . ILE A 1 22  ? 14.432  5.212   5.755   1.00 0.00 ? 22  ILE A CD1  18 
ATOM 335   H H    . ILE A 1 22  ? 18.729  4.639   3.805   1.00 0.00 ? 22  ILE A H    18 
ATOM 336   H HA   . ILE A 1 22  ? 17.850  7.209   5.055   1.00 0.00 ? 22  ILE A HA   18 
ATOM 337   H HB   . ILE A 1 22  ? 17.127  4.362   5.800   1.00 0.00 ? 22  ILE A HB   18 
ATOM 338   H HG12 . ILE A 1 22  ? 15.573  6.767   4.809   1.00 0.00 ? 22  ILE A HG12 18 
ATOM 339   H HG13 . ILE A 1 22  ? 15.719  5.186   4.040   1.00 0.00 ? 22  ILE A HG13 18 
ATOM 340   H HG21 . ILE A 1 22  ? 17.513  6.574   7.513   1.00 0.00 ? 22  ILE A HG21 18 
ATOM 341   H HG22 . ILE A 1 22  ? 15.768  6.406   7.319   1.00 0.00 ? 22  ILE A HG22 18 
ATOM 342   H HG23 . ILE A 1 22  ? 16.725  5.047   7.905   1.00 0.00 ? 22  ILE A HG23 18 
ATOM 343   H HD11 . ILE A 1 22  ? 14.557  4.168   6.004   1.00 0.00 ? 22  ILE A HD11 18 
ATOM 344   H HD12 . ILE A 1 22  ? 14.320  5.788   6.661   1.00 0.00 ? 22  ILE A HD12 18 
ATOM 345   H HD13 . ILE A 1 22  ? 13.550  5.331   5.141   1.00 0.00 ? 22  ILE A HD13 18 
ATOM 346   N N    . ASP A 1 23  ? 19.844  7.156   6.557   1.00 0.00 ? 23  ASP A N    18 
ATOM 347   C CA   . ASP A 1 23  ? 21.017  7.093   7.467   1.00 0.00 ? 23  ASP A CA   18 
ATOM 348   C C    . ASP A 1 23  ? 20.501  6.863   8.883   1.00 0.00 ? 23  ASP A C    18 
ATOM 349   O O    . ASP A 1 23  ? 20.102  7.780   9.565   1.00 0.00 ? 23  ASP A O    18 
ATOM 350   C CB   . ASP A 1 23  ? 21.809  8.399   7.394   1.00 0.00 ? 23  ASP A CB   18 
ATOM 351   C CG   . ASP A 1 23  ? 22.863  8.425   8.504   1.00 0.00 ? 23  ASP A CG   18 
ATOM 352   O OD1  . ASP A 1 23  ? 22.976  7.438   9.211   1.00 0.00 ? 23  ASP A OD1  18 
ATOM 353   O OD2  . ASP A 1 23  ? 23.542  9.432   8.624   1.00 0.00 ? 23  ASP A OD2  18 
ATOM 354   H H    . ASP A 1 23  ? 19.463  8.024   6.304   1.00 0.00 ? 23  ASP A H    18 
ATOM 355   H HA   . ASP A 1 23  ? 21.651  6.269   7.182   1.00 0.00 ? 23  ASP A HA   18 
ATOM 356   H HB2  . ASP A 1 23  ? 22.297  8.467   6.432   1.00 0.00 ? 23  ASP A HB2  18 
ATOM 357   H HB3  . ASP A 1 23  ? 21.138  9.231   7.514   1.00 0.00 ? 23  ASP A HB3  18 
ATOM 358   N N    . PHE A 1 24  ? 20.489  5.623   9.291   1.00 0.00 ? 24  PHE A N    18 
ATOM 359   C CA   . PHE A 1 24  ? 19.984  5.229   10.644  1.00 0.00 ? 24  PHE A CA   18 
ATOM 360   C C    . PHE A 1 24  ? 19.858  6.424   11.597  1.00 0.00 ? 24  PHE A C    18 
ATOM 361   O O    . PHE A 1 24  ? 18.813  6.653   12.169  1.00 0.00 ? 24  PHE A O    18 
ATOM 362   C CB   . PHE A 1 24  ? 20.949  4.208   11.253  1.00 0.00 ? 24  PHE A CB   18 
ATOM 363   C CG   . PHE A 1 24  ? 20.582  2.828   10.767  1.00 0.00 ? 24  PHE A CG   18 
ATOM 364   C CD1  . PHE A 1 24  ? 19.412  2.216   11.227  1.00 0.00 ? 24  PHE A CD1  18 
ATOM 365   C CD2  . PHE A 1 24  ? 21.406  2.165   9.850   1.00 0.00 ? 24  PHE A CD2  18 
ATOM 366   C CE1  . PHE A 1 24  ? 19.063  0.942   10.771  1.00 0.00 ? 24  PHE A CE1  18 
ATOM 367   C CE2  . PHE A 1 24  ? 21.058  0.888   9.396   1.00 0.00 ? 24  PHE A CE2  18 
ATOM 368   C CZ   . PHE A 1 24  ? 19.886  0.277   9.857   1.00 0.00 ? 24  PHE A CZ   18 
ATOM 369   H H    . PHE A 1 24  ? 20.804  4.925   8.681   1.00 0.00 ? 24  PHE A H    18 
ATOM 370   H HA   . PHE A 1 24  ? 19.016  4.765   10.534  1.00 0.00 ? 24  PHE A HA   18 
ATOM 371   H HB2  . PHE A 1 24  ? 21.959  4.441   10.951  1.00 0.00 ? 24  PHE A HB2  18 
ATOM 372   H HB3  . PHE A 1 24  ? 20.876  4.241   12.329  1.00 0.00 ? 24  PHE A HB3  18 
ATOM 373   H HD1  . PHE A 1 24  ? 18.779  2.727   11.936  1.00 0.00 ? 24  PHE A HD1  18 
ATOM 374   H HD2  . PHE A 1 24  ? 22.310  2.636   9.496   1.00 0.00 ? 24  PHE A HD2  18 
ATOM 375   H HE1  . PHE A 1 24  ? 18.158  0.468   11.126  1.00 0.00 ? 24  PHE A HE1  18 
ATOM 376   H HE2  . PHE A 1 24  ? 21.693  0.373   8.693   1.00 0.00 ? 24  PHE A HE2  18 
ATOM 377   H HZ   . PHE A 1 24  ? 19.617  -0.705  9.503   1.00 0.00 ? 24  PHE A HZ   18 
ATOM 378   N N    . ARG A 1 25  ? 20.912  7.169   11.795  1.00 0.00 ? 25  ARG A N    18 
ATOM 379   C CA   . ARG A 1 25  ? 20.839  8.316   12.749  1.00 0.00 ? 25  ARG A CA   18 
ATOM 380   C C    . ARG A 1 25  ? 20.332  9.594   12.070  1.00 0.00 ? 25  ARG A C    18 
ATOM 381   O O    . ARG A 1 25  ? 19.609  10.369  12.663  1.00 0.00 ? 25  ARG A O    18 
ATOM 382   C CB   . ARG A 1 25  ? 22.229  8.576   13.336  1.00 0.00 ? 25  ARG A CB   18 
ATOM 383   C CG   . ARG A 1 25  ? 23.250  8.731   12.205  1.00 0.00 ? 25  ARG A CG   18 
ATOM 384   C CD   . ARG A 1 25  ? 24.536  9.342   12.765  1.00 0.00 ? 25  ARG A CD   18 
ATOM 385   N NE   . ARG A 1 25  ? 25.564  9.417   11.687  1.00 0.00 ? 25  ARG A NE   18 
ATOM 386   C CZ   . ARG A 1 25  ? 26.706  10.005  11.917  1.00 0.00 ? 25  ARG A CZ   18 
ATOM 387   N NH1  . ARG A 1 25  ? 27.347  9.774   13.031  1.00 0.00 ? 25  ARG A NH1  18 
ATOM 388   N NH2  . ARG A 1 25  ? 27.210  10.824  11.033  1.00 0.00 ? 25  ARG A NH2  18 
ATOM 389   H H    . ARG A 1 25  ? 21.751  6.963   11.338  1.00 0.00 ? 25  ARG A H    18 
ATOM 390   H HA   . ARG A 1 25  ? 20.168  8.057   13.553  1.00 0.00 ? 25  ARG A HA   18 
ATOM 391   H HB2  . ARG A 1 25  ? 22.206  9.482   13.925  1.00 0.00 ? 25  ARG A HB2  18 
ATOM 392   H HB3  . ARG A 1 25  ? 22.515  7.747   13.964  1.00 0.00 ? 25  ARG A HB3  18 
ATOM 393   H HG2  . ARG A 1 25  ? 23.465  7.762   11.780  1.00 0.00 ? 25  ARG A HG2  18 
ATOM 394   H HG3  . ARG A 1 25  ? 22.848  9.380   11.442  1.00 0.00 ? 25  ARG A HG3  18 
ATOM 395   H HD2  . ARG A 1 25  ? 24.332  10.335  13.135  1.00 0.00 ? 25  ARG A HD2  18 
ATOM 396   H HD3  . ARG A 1 25  ? 24.906  8.726   13.571  1.00 0.00 ? 25  ARG A HD3  18 
ATOM 397   H HE   . ARG A 1 25  ? 25.382  9.026   10.807  1.00 0.00 ? 25  ARG A HE   18 
ATOM 398   H HH11 . ARG A 1 25  ? 26.961  9.147   13.708  1.00 0.00 ? 25  ARG A HH11 18 
ATOM 399   H HH12 . ARG A 1 25  ? 28.222  10.224  13.208  1.00 0.00 ? 25  ARG A HH12 18 
ATOM 400   H HH21 . ARG A 1 25  ? 26.718  11.001  10.180  1.00 0.00 ? 25  ARG A HH21 18 
ATOM 401   H HH22 . ARG A 1 25  ? 28.084  11.274  11.209  1.00 0.00 ? 25  ARG A HH22 18 
ATOM 402   N N    . LYS A 1 26  ? 20.718  9.844   10.851  1.00 0.00 ? 26  LYS A N    18 
ATOM 403   C CA   . LYS A 1 26  ? 20.266  11.097  10.178  1.00 0.00 ? 26  LYS A CA   18 
ATOM 404   C C    . LYS A 1 26  ? 18.750  11.090  9.981   1.00 0.00 ? 26  LYS A C    18 
ATOM 405   O O    . LYS A 1 26  ? 18.067  12.043  10.300  1.00 0.00 ? 26  LYS A O    18 
ATOM 406   C CB   . LYS A 1 26  ? 20.932  11.205  8.810   1.00 0.00 ? 26  LYS A CB   18 
ATOM 407   C CG   . LYS A 1 26  ? 21.144  12.679  8.457   1.00 0.00 ? 26  LYS A CG   18 
ATOM 408   C CD   . LYS A 1 26  ? 20.297  13.037  7.235   1.00 0.00 ? 26  LYS A CD   18 
ATOM 409   C CE   . LYS A 1 26  ? 19.122  13.915  7.669   1.00 0.00 ? 26  LYS A CE   18 
ATOM 410   N NZ   . LYS A 1 26  ? 18.240  14.179  6.497   1.00 0.00 ? 26  LYS A NZ   18 
ATOM 411   H H    . LYS A 1 26  ? 21.320  9.224   10.385  1.00 0.00 ? 26  LYS A H    18 
ATOM 412   H HA   . LYS A 1 26  ? 20.546  11.949  10.779  1.00 0.00 ? 26  LYS A HA   18 
ATOM 413   H HB2  . LYS A 1 26  ? 21.879  10.692  8.829   1.00 0.00 ? 26  LYS A HB2  18 
ATOM 414   H HB3  . LYS A 1 26  ? 20.293  10.753  8.067   1.00 0.00 ? 26  LYS A HB3  18 
ATOM 415   H HG2  . LYS A 1 26  ? 20.849  13.295  9.295   1.00 0.00 ? 26  LYS A HG2  18 
ATOM 416   H HG3  . LYS A 1 26  ? 22.186  12.850  8.234   1.00 0.00 ? 26  LYS A HG3  18 
ATOM 417   H HD2  . LYS A 1 26  ? 20.904  13.574  6.521   1.00 0.00 ? 26  LYS A HD2  18 
ATOM 418   H HD3  . LYS A 1 26  ? 19.919  12.134  6.782   1.00 0.00 ? 26  LYS A HD3  18 
ATOM 419   H HE2  . LYS A 1 26  ? 18.557  13.408  8.437   1.00 0.00 ? 26  LYS A HE2  18 
ATOM 420   H HE3  . LYS A 1 26  ? 19.495  14.852  8.055   1.00 0.00 ? 26  LYS A HE3  18 
ATOM 421   H HZ1  . LYS A 1 26  ? 18.519  13.560  5.707   1.00 0.00 ? 26  LYS A HZ1  18 
ATOM 422   H HZ2  . LYS A 1 26  ? 17.252  13.985  6.754   1.00 0.00 ? 26  LYS A HZ2  18 
ATOM 423   H HZ3  . LYS A 1 26  ? 18.332  15.172  6.208   1.00 0.00 ? 26  LYS A HZ3  18 
ATOM 424   N N    . ASP A 1 27  ? 18.226  10.042  9.414   1.00 0.00 ? 27  ASP A N    18 
ATOM 425   C CA   . ASP A 1 27  ? 16.765  9.989   9.145   1.00 0.00 ? 27  ASP A CA   18 
ATOM 426   C C    . ASP A 1 27  ? 15.983  9.388   10.321  1.00 0.00 ? 27  ASP A C    18 
ATOM 427   O O    . ASP A 1 27  ? 15.066  10.000  10.834  1.00 0.00 ? 27  ASP A O    18 
ATOM 428   C CB   . ASP A 1 27  ? 16.544  9.138   7.901   1.00 0.00 ? 27  ASP A CB   18 
ATOM 429   C CG   . ASP A 1 27  ? 16.556  10.033  6.661   1.00 0.00 ? 27  ASP A CG   18 
ATOM 430   O OD1  . ASP A 1 27  ? 15.713  10.911  6.579   1.00 0.00 ? 27  ASP A OD1  18 
ATOM 431   O OD2  . ASP A 1 27  ? 17.407  9.824   5.813   1.00 0.00 ? 27  ASP A OD2  18 
ATOM 432   H H    . ASP A 1 27  ? 18.799  9.302   9.132   1.00 0.00 ? 27  ASP A H    18 
ATOM 433   H HA   . ASP A 1 27  ? 16.404  10.988  8.953   1.00 0.00 ? 27  ASP A HA   18 
ATOM 434   H HB2  . ASP A 1 27  ? 17.334  8.405   7.824   1.00 0.00 ? 27  ASP A HB2  18 
ATOM 435   H HB3  . ASP A 1 27  ? 15.599  8.637   7.976   1.00 0.00 ? 27  ASP A HB3  18 
ATOM 436   N N    . LEU A 1 28  ? 16.301  8.193   10.738  1.00 0.00 ? 28  LEU A N    18 
ATOM 437   C CA   . LEU A 1 28  ? 15.526  7.575   11.856  1.00 0.00 ? 28  LEU A CA   18 
ATOM 438   C C    . LEU A 1 28  ? 16.135  7.945   13.208  1.00 0.00 ? 28  LEU A C    18 
ATOM 439   O O    . LEU A 1 28  ? 15.505  7.805   14.236  1.00 0.00 ? 28  LEU A O    18 
ATOM 440   C CB   . LEU A 1 28  ? 15.544  6.052   11.712  1.00 0.00 ? 28  LEU A CB   18 
ATOM 441   C CG   . LEU A 1 28  ? 14.984  5.660   10.347  1.00 0.00 ? 28  LEU A CG   18 
ATOM 442   C CD1  . LEU A 1 28  ? 14.954  4.137   10.229  1.00 0.00 ? 28  LEU A CD1  18 
ATOM 443   C CD2  . LEU A 1 28  ? 13.563  6.202   10.205  1.00 0.00 ? 28  LEU A CD2  18 
ATOM 444   H H    . LEU A 1 28  ? 17.026  7.693   10.303  1.00 0.00 ? 28  LEU A H    18 
ATOM 445   H HA   . LEU A 1 28  ? 14.505  7.922   11.818  1.00 0.00 ? 28  LEU A HA   18 
ATOM 446   H HB2  . LEU A 1 28  ? 16.559  5.695   11.801  1.00 0.00 ? 28  LEU A HB2  18 
ATOM 447   H HB3  . LEU A 1 28  ? 14.938  5.610   12.488  1.00 0.00 ? 28  LEU A HB3  18 
ATOM 448   H HG   . LEU A 1 28  ? 15.611  6.073   9.570   1.00 0.00 ? 28  LEU A HG   18 
ATOM 449   H HD11 . LEU A 1 28  ? 15.648  3.707   10.935  1.00 0.00 ? 28  LEU A HD11 18 
ATOM 450   H HD12 . LEU A 1 28  ? 13.956  3.780   10.441  1.00 0.00 ? 28  LEU A HD12 18 
ATOM 451   H HD13 . LEU A 1 28  ? 15.235  3.849   9.226   1.00 0.00 ? 28  LEU A HD13 18 
ATOM 452   H HD21 . LEU A 1 28  ? 13.269  6.690   11.123  1.00 0.00 ? 28  LEU A HD21 18 
ATOM 453   H HD22 . LEU A 1 28  ? 13.530  6.911   9.393   1.00 0.00 ? 28  LEU A HD22 18 
ATOM 454   H HD23 . LEU A 1 28  ? 12.885  5.386   9.999   1.00 0.00 ? 28  LEU A HD23 18 
ATOM 455   N N    . GLY A 1 29  ? 17.355  8.398   13.226  1.00 0.00 ? 29  GLY A N    18 
ATOM 456   C CA   . GLY A 1 29  ? 17.983  8.750   14.530  1.00 0.00 ? 29  GLY A CA   18 
ATOM 457   C C    . GLY A 1 29  ? 18.108  7.481   15.382  1.00 0.00 ? 29  GLY A C    18 
ATOM 458   O O    . GLY A 1 29  ? 18.400  7.535   16.559  1.00 0.00 ? 29  GLY A O    18 
ATOM 459   H H    . GLY A 1 29  ? 17.858  8.494   12.390  1.00 0.00 ? 29  GLY A H    18 
ATOM 460   H HA2  . GLY A 1 29  ? 18.961  9.176   14.361  1.00 0.00 ? 29  GLY A HA2  18 
ATOM 461   H HA3  . GLY A 1 29  ? 17.363  9.465   15.048  1.00 0.00 ? 29  GLY A HA3  18 
ATOM 462   N N    . TRP A 1 30  ? 17.884  6.336   14.788  1.00 0.00 ? 30  TRP A N    18 
ATOM 463   C CA   . TRP A 1 30  ? 17.978  5.059   15.548  1.00 0.00 ? 30  TRP A CA   18 
ATOM 464   C C    . TRP A 1 30  ? 19.235  5.064   16.417  1.00 0.00 ? 30  TRP A C    18 
ATOM 465   O O    . TRP A 1 30  ? 20.331  5.294   15.948  1.00 0.00 ? 30  TRP A O    18 
ATOM 466   C CB   . TRP A 1 30  ? 18.046  3.892   14.560  1.00 0.00 ? 30  TRP A CB   18 
ATOM 467   C CG   . TRP A 1 30  ? 16.659  3.457   14.211  1.00 0.00 ? 30  TRP A CG   18 
ATOM 468   C CD1  . TRP A 1 30  ? 15.534  4.155   14.487  1.00 0.00 ? 30  TRP A CD1  18 
ATOM 469   C CD2  . TRP A 1 30  ? 16.231  2.242   13.532  1.00 0.00 ? 30  TRP A CD2  18 
ATOM 470   N NE1  . TRP A 1 30  ? 14.442  3.445   14.022  1.00 0.00 ? 30  TRP A NE1  18 
ATOM 471   C CE2  . TRP A 1 30  ? 14.820  2.258   13.426  1.00 0.00 ? 30  TRP A CE2  18 
ATOM 472   C CE3  . TRP A 1 30  ? 16.923  1.138   13.005  1.00 0.00 ? 30  TRP A CE3  18 
ATOM 473   C CZ2  . TRP A 1 30  ? 14.121  1.215   12.819  1.00 0.00 ? 30  TRP A CZ2  18 
ATOM 474   C CZ3  . TRP A 1 30  ? 16.221  0.085   12.393  1.00 0.00 ? 30  TRP A CZ3  18 
ATOM 475   C CH2  . TRP A 1 30  ? 14.823  0.124   12.301  1.00 0.00 ? 30  TRP A CH2  18 
ATOM 476   H H    . TRP A 1 30  ? 17.646  6.317   13.841  1.00 0.00 ? 30  TRP A H    18 
ATOM 477   H HA   . TRP A 1 30  ? 17.108  4.946   16.175  1.00 0.00 ? 30  TRP A HA   18 
ATOM 478   H HB2  . TRP A 1 30  ? 18.561  4.208   13.665  1.00 0.00 ? 30  TRP A HB2  18 
ATOM 479   H HB3  . TRP A 1 30  ? 18.580  3.068   15.012  1.00 0.00 ? 30  TRP A HB3  18 
ATOM 480   H HD1  . TRP A 1 30  ? 15.494  5.111   14.988  1.00 0.00 ? 30  TRP A HD1  18 
ATOM 481   H HE1  . TRP A 1 30  ? 13.508  3.731   14.097  1.00 0.00 ? 30  TRP A HE1  18 
ATOM 482   H HE3  . TRP A 1 30  ? 18.002  1.101   13.068  1.00 0.00 ? 30  TRP A HE3  18 
ATOM 483   H HZ2  . TRP A 1 30  ? 13.043  1.250   12.751  1.00 0.00 ? 30  TRP A HZ2  18 
ATOM 484   H HZ3  . TRP A 1 30  ? 16.761  -0.761  11.992  1.00 0.00 ? 30  TRP A HZ3  18 
ATOM 485   H HH2  . TRP A 1 30  ? 14.289  -0.688  11.830  1.00 0.00 ? 30  TRP A HH2  18 
ATOM 486   N N    . LYS A 1 31  ? 19.078  4.816   17.687  1.00 0.00 ? 31  LYS A N    18 
ATOM 487   C CA   . LYS A 1 31  ? 20.242  4.806   18.600  1.00 0.00 ? 31  LYS A CA   18 
ATOM 488   C C    . LYS A 1 31  ? 20.586  3.363   18.973  1.00 0.00 ? 31  LYS A C    18 
ATOM 489   O O    . LYS A 1 31  ? 21.615  3.094   19.559  1.00 0.00 ? 31  LYS A O    18 
ATOM 490   C CB   . LYS A 1 31  ? 19.864  5.573   19.860  1.00 0.00 ? 31  LYS A CB   18 
ATOM 491   C CG   . LYS A 1 31  ? 20.231  7.049   19.699  1.00 0.00 ? 31  LYS A CG   18 
ATOM 492   C CD   . LYS A 1 31  ? 19.475  7.880   20.739  1.00 0.00 ? 31  LYS A CD   18 
ATOM 493   C CE   . LYS A 1 31  ? 17.980  7.868   20.414  1.00 0.00 ? 31  LYS A CE   18 
ATOM 494   N NZ   . LYS A 1 31  ? 17.226  7.301   21.568  1.00 0.00 ? 31  LYS A NZ   18 
ATOM 495   H H    . LYS A 1 31  ? 18.187  4.638   18.048  1.00 0.00 ? 31  LYS A H    18 
ATOM 496   H HA   . LYS A 1 31  ? 21.088  5.277   18.125  1.00 0.00 ? 31  LYS A HA   18 
ATOM 497   H HB2  . LYS A 1 31  ? 18.799  5.480   20.024  1.00 0.00 ? 31  LYS A HB2  18 
ATOM 498   H HB3  . LYS A 1 31  ? 20.388  5.159   20.698  1.00 0.00 ? 31  LYS A HB3  18 
ATOM 499   H HG2  . LYS A 1 31  ? 21.295  7.174   19.842  1.00 0.00 ? 31  LYS A HG2  18 
ATOM 500   H HG3  . LYS A 1 31  ? 19.959  7.382   18.709  1.00 0.00 ? 31  LYS A HG3  18 
ATOM 501   H HD2  . LYS A 1 31  ? 19.635  7.459   21.721  1.00 0.00 ? 31  LYS A HD2  18 
ATOM 502   H HD3  . LYS A 1 31  ? 19.836  8.898   20.719  1.00 0.00 ? 31  LYS A HD3  18 
ATOM 503   H HE2  . LYS A 1 31  ? 17.645  8.877   20.225  1.00 0.00 ? 31  LYS A HE2  18 
ATOM 504   H HE3  . LYS A 1 31  ? 17.807  7.261   19.538  1.00 0.00 ? 31  LYS A HE3  18 
ATOM 505   H HZ1  . LYS A 1 31  ? 17.873  7.158   22.369  1.00 0.00 ? 31  LYS A HZ1  18 
ATOM 506   H HZ2  . LYS A 1 31  ? 16.472  7.961   21.848  1.00 0.00 ? 31  LYS A HZ2  18 
ATOM 507   H HZ3  . LYS A 1 31  ? 16.805  6.389   21.293  1.00 0.00 ? 31  LYS A HZ3  18 
ATOM 508   N N    . TRP A 1 32  ? 19.728  2.433   18.649  1.00 0.00 ? 32  TRP A N    18 
ATOM 509   C CA   . TRP A 1 32  ? 20.012  1.015   19.004  1.00 0.00 ? 32  TRP A CA   18 
ATOM 510   C C    . TRP A 1 32  ? 20.853  0.359   17.911  1.00 0.00 ? 32  TRP A C    18 
ATOM 511   O O    . TRP A 1 32  ? 21.225  -0.789  18.016  1.00 0.00 ? 32  TRP A O    18 
ATOM 512   C CB   . TRP A 1 32  ? 18.697  0.249   19.174  1.00 0.00 ? 32  TRP A CB   18 
ATOM 513   C CG   . TRP A 1 32  ? 18.093  -0.050  17.838  1.00 0.00 ? 32  TRP A CG   18 
ATOM 514   C CD1  . TRP A 1 32  ? 17.390  0.827   17.091  1.00 0.00 ? 32  TRP A CD1  18 
ATOM 515   C CD2  . TRP A 1 32  ? 18.125  -1.297  17.082  1.00 0.00 ? 32  TRP A CD2  18 
ATOM 516   N NE1  . TRP A 1 32  ? 16.974  0.199   15.934  1.00 0.00 ? 32  TRP A NE1  18 
ATOM 517   C CE2  . TRP A 1 32  ? 17.404  -1.112  15.881  1.00 0.00 ? 32  TRP A CE2  18 
ATOM 518   C CE3  . TRP A 1 32  ? 18.701  -2.556  17.321  1.00 0.00 ? 32  TRP A CE3  18 
ATOM 519   C CZ2  . TRP A 1 32  ? 17.255  -2.142  14.950  1.00 0.00 ? 32  TRP A CZ2  18 
ATOM 520   C CZ3  . TRP A 1 32  ? 18.558  -3.595  16.388  1.00 0.00 ? 32  TRP A CZ3  18 
ATOM 521   C CH2  . TRP A 1 32  ? 17.833  -3.387  15.204  1.00 0.00 ? 32  TRP A CH2  18 
ATOM 522   H H    . TRP A 1 32  ? 18.897  2.669   18.183  1.00 0.00 ? 32  TRP A H    18 
ATOM 523   H HA   . TRP A 1 32  ? 20.558  0.988   19.933  1.00 0.00 ? 32  TRP A HA   18 
ATOM 524   H HB2  . TRP A 1 32  ? 18.888  -0.677  19.696  1.00 0.00 ? 32  TRP A HB2  18 
ATOM 525   H HB3  . TRP A 1 32  ? 18.008  0.849   19.751  1.00 0.00 ? 32  TRP A HB3  18 
ATOM 526   H HD1  . TRP A 1 32  ? 17.183  1.850   17.354  1.00 0.00 ? 32  TRP A HD1  18 
ATOM 527   H HE1  . TRP A 1 32  ? 16.441  0.616   15.228  1.00 0.00 ? 32  TRP A HE1  18 
ATOM 528   H HE3  . TRP A 1 32  ? 19.264  -2.722  18.223  1.00 0.00 ? 32  TRP A HE3  18 
ATOM 529   H HZ2  . TRP A 1 32  ? 16.696  -1.976  14.041  1.00 0.00 ? 32  TRP A HZ2  18 
ATOM 530   H HZ3  . TRP A 1 32  ? 19.007  -4.560  16.585  1.00 0.00 ? 32  TRP A HZ3  18 
ATOM 531   H HH2  . TRP A 1 32  ? 17.725  -4.186  14.487  1.00 0.00 ? 32  TRP A HH2  18 
ATOM 532   N N    . ILE A 1 33  ? 21.159  1.076   16.865  1.00 0.00 ? 33  ILE A N    18 
ATOM 533   C CA   . ILE A 1 33  ? 21.979  0.482   15.774  1.00 0.00 ? 33  ILE A CA   18 
ATOM 534   C C    . ILE A 1 33  ? 23.205  1.367   15.524  1.00 0.00 ? 33  ILE A C    18 
ATOM 535   O O    . ILE A 1 33  ? 23.098  2.568   15.369  1.00 0.00 ? 33  ILE A O    18 
ATOM 536   C CB   . ILE A 1 33  ? 21.128  0.372   14.501  1.00 0.00 ? 33  ILE A CB   18 
ATOM 537   C CG1  . ILE A 1 33  ? 20.295  -0.907  14.576  1.00 0.00 ? 33  ILE A CG1  18 
ATOM 538   C CG2  . ILE A 1 33  ? 22.025  0.316   13.261  1.00 0.00 ? 33  ILE A CG2  18 
ATOM 539   C CD1  . ILE A 1 33  ? 19.310  -0.952  13.410  1.00 0.00 ? 33  ILE A CD1  18 
ATOM 540   H H    . ILE A 1 33  ? 20.849  2.002   16.799  1.00 0.00 ? 33  ILE A H    18 
ATOM 541   H HA   . ILE A 1 33  ? 22.307  -0.503  16.072  1.00 0.00 ? 33  ILE A HA   18 
ATOM 542   H HB   . ILE A 1 33  ? 20.470  1.224   14.432  1.00 0.00 ? 33  ILE A HB   18 
ATOM 543   H HG12 . ILE A 1 33  ? 20.949  -1.761  14.528  1.00 0.00 ? 33  ILE A HG12 18 
ATOM 544   H HG13 . ILE A 1 33  ? 19.752  -0.923  15.504  1.00 0.00 ? 33  ILE A HG13 18 
ATOM 545   H HG21 . ILE A 1 33  ? 22.945  -0.193  13.507  1.00 0.00 ? 33  ILE A HG21 18 
ATOM 546   H HG22 . ILE A 1 33  ? 21.516  -0.219  12.474  1.00 0.00 ? 33  ILE A HG22 18 
ATOM 547   H HG23 . ILE A 1 33  ? 22.245  1.320   12.932  1.00 0.00 ? 33  ILE A HG23 18 
ATOM 548   H HD11 . ILE A 1 33  ? 19.703  -0.380  12.583  1.00 0.00 ? 33  ILE A HD11 18 
ATOM 549   H HD12 . ILE A 1 33  ? 19.160  -1.975  13.101  1.00 0.00 ? 33  ILE A HD12 18 
ATOM 550   H HD13 . ILE A 1 33  ? 18.370  -0.533  13.723  1.00 0.00 ? 33  ILE A HD13 18 
ATOM 551   N N    . HIS A 1 34  ? 24.368  0.777   15.485  1.00 0.00 ? 34  HIS A N    18 
ATOM 552   C CA   . HIS A 1 34  ? 25.606  1.571   15.249  1.00 0.00 ? 34  HIS A CA   18 
ATOM 553   C C    . HIS A 1 34  ? 25.965  1.526   13.759  1.00 0.00 ? 34  HIS A C    18 
ATOM 554   O O    . HIS A 1 34  ? 26.146  2.546   13.125  1.00 0.00 ? 34  HIS A O    18 
ATOM 555   C CB   . HIS A 1 34  ? 26.749  0.974   16.079  1.00 0.00 ? 34  HIS A CB   18 
ATOM 556   C CG   . HIS A 1 34  ? 28.074  1.466   15.564  1.00 0.00 ? 34  HIS A CG   18 
ATOM 557   N ND1  . HIS A 1 34  ? 28.447  2.800   15.630  1.00 0.00 ? 34  HIS A ND1  18 
ATOM 558   C CD2  . HIS A 1 34  ? 29.127  0.812   14.972  1.00 0.00 ? 34  HIS A CD2  18 
ATOM 559   C CE1  . HIS A 1 34  ? 29.676  2.906   15.092  1.00 0.00 ? 34  HIS A CE1  18 
ATOM 560   N NE2  . HIS A 1 34  ? 30.137  1.724   14.675  1.00 0.00 ? 34  HIS A NE2  18 
ATOM 561   H H    . HIS A 1 34  ? 24.426  -0.192  15.614  1.00 0.00 ? 34  HIS A H    18 
ATOM 562   H HA   . HIS A 1 34  ? 25.440  2.595   15.549  1.00 0.00 ? 34  HIS A HA   18 
ATOM 563   H HB2  . HIS A 1 34  ? 26.634  1.269   17.111  1.00 0.00 ? 34  HIS A HB2  18 
ATOM 564   H HB3  . HIS A 1 34  ? 26.717  -0.104  16.010  1.00 0.00 ? 34  HIS A HB3  18 
ATOM 565   H HD1  . HIS A 1 34  ? 27.911  3.534   16.000  1.00 0.00 ? 34  HIS A HD1  18 
ATOM 566   H HD2  . HIS A 1 34  ? 29.166  -0.248  14.768  1.00 0.00 ? 34  HIS A HD2  18 
ATOM 567   H HE1  . HIS A 1 34  ? 30.223  3.833   15.009  1.00 0.00 ? 34  HIS A HE1  18 
ATOM 568   N N    . GLU A 1 35  ? 26.074  0.353   13.199  1.00 0.00 ? 35  GLU A N    18 
ATOM 569   C CA   . GLU A 1 35  ? 26.428  0.248   11.755  1.00 0.00 ? 35  GLU A CA   18 
ATOM 570   C C    . GLU A 1 35  ? 25.413  -0.650  11.040  1.00 0.00 ? 35  GLU A C    18 
ATOM 571   O O    . GLU A 1 35  ? 24.773  -1.475  11.661  1.00 0.00 ? 35  GLU A O    18 
ATOM 572   C CB   . GLU A 1 35  ? 27.827  -0.356  11.618  1.00 0.00 ? 35  GLU A CB   18 
ATOM 573   C CG   . GLU A 1 35  ? 28.874  0.756   11.696  1.00 0.00 ? 35  GLU A CG   18 
ATOM 574   C CD   . GLU A 1 35  ? 30.266  0.167   11.455  1.00 0.00 ? 35  GLU A CD   18 
ATOM 575   O OE1  . GLU A 1 35  ? 30.428  -1.023  11.668  1.00 0.00 ? 35  GLU A OE1  18 
ATOM 576   O OE2  . GLU A 1 35  ? 31.145  0.916   11.062  1.00 0.00 ? 35  GLU A OE2  18 
ATOM 577   H H    . GLU A 1 35  ? 25.927  -0.459  13.729  1.00 0.00 ? 35  GLU A H    18 
ATOM 578   H HA   . GLU A 1 35  ? 26.416  1.231   11.310  1.00 0.00 ? 35  GLU A HA   18 
ATOM 579   H HB2  . GLU A 1 35  ? 27.993  -1.064  12.418  1.00 0.00 ? 35  GLU A HB2  18 
ATOM 580   H HB3  . GLU A 1 35  ? 27.911  -0.861  10.667  1.00 0.00 ? 35  GLU A HB3  18 
ATOM 581   H HG2  . GLU A 1 35  ? 28.663  1.502   10.944  1.00 0.00 ? 35  GLU A HG2  18 
ATOM 582   H HG3  . GLU A 1 35  ? 28.844  1.213   12.674  1.00 0.00 ? 35  GLU A HG3  18 
ATOM 583   N N    . PRO A 1 36  ? 25.300  -0.460  9.750   1.00 0.00 ? 36  PRO A N    18 
ATOM 584   C CA   . PRO A 1 36  ? 26.084  0.546   9.009   1.00 0.00 ? 36  PRO A CA   18 
ATOM 585   C C    . PRO A 1 36  ? 25.506  1.946   9.225   1.00 0.00 ? 36  PRO A C    18 
ATOM 586   O O    . PRO A 1 36  ? 24.483  2.117   9.858   1.00 0.00 ? 36  PRO A O    18 
ATOM 587   C CB   . PRO A 1 36  ? 25.938  0.112   7.549   1.00 0.00 ? 36  PRO A CB   18 
ATOM 588   C CG   . PRO A 1 36  ? 24.654  -0.749  7.476   1.00 0.00 ? 36  PRO A CG   18 
ATOM 589   C CD   . PRO A 1 36  ? 24.373  -1.242  8.908   1.00 0.00 ? 36  PRO A CD   18 
ATOM 590   H HA   . PRO A 1 36  ? 27.120  0.515   9.299   1.00 0.00 ? 36  PRO A HA   18 
ATOM 591   H HB2  . PRO A 1 36  ? 25.842  0.982   6.913   1.00 0.00 ? 36  PRO A HB2  18 
ATOM 592   H HB3  . PRO A 1 36  ? 26.788  -0.478  7.249   1.00 0.00 ? 36  PRO A HB3  18 
ATOM 593   H HG2  . PRO A 1 36  ? 23.827  -0.150  7.119   1.00 0.00 ? 36  PRO A HG2  18 
ATOM 594   H HG3  . PRO A 1 36  ? 24.810  -1.594  6.824   1.00 0.00 ? 36  PRO A HG3  18 
ATOM 595   H HD2  . PRO A 1 36  ? 23.347  -1.040  9.182   1.00 0.00 ? 36  PRO A HD2  18 
ATOM 596   H HD3  . PRO A 1 36  ? 24.591  -2.294  8.994   1.00 0.00 ? 36  PRO A HD3  18 
ATOM 597   N N    . LYS A 1 37  ? 26.153  2.947   8.698   1.00 0.00 ? 37  LYS A N    18 
ATOM 598   C CA   . LYS A 1 37  ? 25.654  4.331   8.857   1.00 0.00 ? 37  LYS A CA   18 
ATOM 599   C C    . LYS A 1 37  ? 24.203  4.408   8.388   1.00 0.00 ? 37  LYS A C    18 
ATOM 600   O O    . LYS A 1 37  ? 23.393  5.123   8.943   1.00 0.00 ? 37  LYS A O    18 
ATOM 601   C CB   . LYS A 1 37  ? 26.515  5.249   7.999   1.00 0.00 ? 37  LYS A CB   18 
ATOM 602   C CG   . LYS A 1 37  ? 27.690  5.775   8.823   1.00 0.00 ? 37  LYS A CG   18 
ATOM 603   C CD   . LYS A 1 37  ? 27.939  7.245   8.477   1.00 0.00 ? 37  LYS A CD   18 
ATOM 604   C CE   . LYS A 1 37  ? 28.197  8.037   9.760   1.00 0.00 ? 37  LYS A CE   18 
ATOM 605   N NZ   . LYS A 1 37  ? 29.616  8.492   9.786   1.00 0.00 ? 37  LYS A NZ   18 
ATOM 606   H H    . LYS A 1 37  ? 26.971  2.790   8.187   1.00 0.00 ? 37  LYS A H    18 
ATOM 607   H HA   . LYS A 1 37  ? 25.723  4.631   9.892   1.00 0.00 ? 37  LYS A HA   18 
ATOM 608   H HB2  . LYS A 1 37  ? 26.889  4.692   7.151   1.00 0.00 ? 37  LYS A HB2  18 
ATOM 609   H HB3  . LYS A 1 37  ? 25.920  6.068   7.651   1.00 0.00 ? 37  LYS A HB3  18 
ATOM 610   H HG2  . LYS A 1 37  ? 27.461  5.686   9.876   1.00 0.00 ? 37  LYS A HG2  18 
ATOM 611   H HG3  . LYS A 1 37  ? 28.576  5.199   8.598   1.00 0.00 ? 37  LYS A HG3  18 
ATOM 612   H HD2  . LYS A 1 37  ? 28.799  7.320   7.827   1.00 0.00 ? 37  LYS A HD2  18 
ATOM 613   H HD3  . LYS A 1 37  ? 27.072  7.648   7.975   1.00 0.00 ? 37  LYS A HD3  18 
ATOM 614   H HE2  . LYS A 1 37  ? 27.542  8.895   9.792   1.00 0.00 ? 37  LYS A HE2  18 
ATOM 615   H HE3  . LYS A 1 37  ? 28.005  7.406   10.616  1.00 0.00 ? 37  LYS A HE3  18 
ATOM 616   H HZ1  . LYS A 1 37  ? 29.805  9.088   8.955   1.00 0.00 ? 37  LYS A HZ1  18 
ATOM 617   H HZ2  . LYS A 1 37  ? 29.787  9.043   10.651  1.00 0.00 ? 37  LYS A HZ2  18 
ATOM 618   H HZ3  . LYS A 1 37  ? 30.246  7.664   9.771   1.00 0.00 ? 37  LYS A HZ3  18 
ATOM 619   N N    . GLY A 1 38  ? 23.873  3.674   7.365   1.00 0.00 ? 38  GLY A N    18 
ATOM 620   C CA   . GLY A 1 38  ? 22.477  3.697   6.846   1.00 0.00 ? 38  GLY A CA   18 
ATOM 621   C C    . GLY A 1 38  ? 22.239  2.470   5.964   1.00 0.00 ? 38  GLY A C    18 
ATOM 622   O O    . GLY A 1 38  ? 22.747  1.400   6.225   1.00 0.00 ? 38  GLY A O    18 
ATOM 623   H H    . GLY A 1 38  ? 24.549  3.107   6.936   1.00 0.00 ? 38  GLY A H    18 
ATOM 624   H HA2  . GLY A 1 38  ? 21.785  3.684   7.676   1.00 0.00 ? 38  GLY A HA2  18 
ATOM 625   H HA3  . GLY A 1 38  ? 22.323  4.591   6.263   1.00 0.00 ? 38  GLY A HA3  18 
ATOM 626   N N    . TYR A 1 39  ? 21.468  2.618   4.922   1.00 0.00 ? 39  TYR A N    18 
ATOM 627   C CA   . TYR A 1 39  ? 21.196  1.457   4.027   1.00 0.00 ? 39  TYR A CA   18 
ATOM 628   C C    . TYR A 1 39  ? 20.242  1.886   2.911   1.00 0.00 ? 39  TYR A C    18 
ATOM 629   O O    . TYR A 1 39  ? 19.653  2.947   2.960   1.00 0.00 ? 39  TYR A O    18 
ATOM 630   C CB   . TYR A 1 39  ? 20.555  0.334   4.842   1.00 0.00 ? 39  TYR A CB   18 
ATOM 631   C CG   . TYR A 1 39  ? 19.160  0.740   5.240   1.00 0.00 ? 39  TYR A CG   18 
ATOM 632   C CD1  . TYR A 1 39  ? 18.961  1.820   6.107   1.00 0.00 ? 39  TYR A CD1  18 
ATOM 633   C CD2  . TYR A 1 39  ? 18.065  0.033   4.741   1.00 0.00 ? 39  TYR A CD2  18 
ATOM 634   C CE1  . TYR A 1 39  ? 17.663  2.192   6.475   1.00 0.00 ? 39  TYR A CE1  18 
ATOM 635   C CE2  . TYR A 1 39  ? 16.766  0.404   5.108   1.00 0.00 ? 39  TYR A CE2  18 
ATOM 636   C CZ   . TYR A 1 39  ? 16.566  1.483   5.975   1.00 0.00 ? 39  TYR A CZ   18 
ATOM 637   O OH   . TYR A 1 39  ? 15.287  1.848   6.334   1.00 0.00 ? 39  TYR A OH   18 
ATOM 638   H H    . TYR A 1 39  ? 21.065  3.489   4.729   1.00 0.00 ? 39  TYR A H    18 
ATOM 639   H HA   . TYR A 1 39  ? 22.120  1.106   3.596   1.00 0.00 ? 39  TYR A HA   18 
ATOM 640   H HB2  . TYR A 1 39  ? 20.513  -0.564  4.243   1.00 0.00 ? 39  TYR A HB2  18 
ATOM 641   H HB3  . TYR A 1 39  ? 21.144  0.148   5.727   1.00 0.00 ? 39  TYR A HB3  18 
ATOM 642   H HD1  . TYR A 1 39  ? 19.807  2.368   6.492   1.00 0.00 ? 39  TYR A HD1  18 
ATOM 643   H HD2  . TYR A 1 39  ? 18.223  -0.798  4.072   1.00 0.00 ? 39  TYR A HD2  18 
ATOM 644   H HE1  . TYR A 1 39  ? 17.509  3.026   7.144   1.00 0.00 ? 39  TYR A HE1  18 
ATOM 645   H HE2  . TYR A 1 39  ? 15.919  -0.142  4.725   1.00 0.00 ? 39  TYR A HE2  18 
ATOM 646   H HH   . TYR A 1 39  ? 14.726  1.073   6.266   1.00 0.00 ? 39  TYR A HH   18 
ATOM 647   N N    . HIS A 1 40  ? 20.079  1.069   1.906   1.00 0.00 ? 40  HIS A N    18 
ATOM 648   C CA   . HIS A 1 40  ? 19.159  1.432   0.794   1.00 0.00 ? 40  HIS A CA   18 
ATOM 649   C C    . HIS A 1 40  ? 17.735  1.023   1.172   1.00 0.00 ? 40  HIS A C    18 
ATOM 650   O O    . HIS A 1 40  ? 17.180  0.087   0.629   1.00 0.00 ? 40  HIS A O    18 
ATOM 651   C CB   . HIS A 1 40  ? 19.583  0.700   -0.481  1.00 0.00 ? 40  HIS A CB   18 
ATOM 652   C CG   . HIS A 1 40  ? 20.900  1.248   -0.960  1.00 0.00 ? 40  HIS A CG   18 
ATOM 653   N ND1  . HIS A 1 40  ? 22.103  0.902   -0.364  1.00 0.00 ? 40  HIS A ND1  18 
ATOM 654   C CD2  . HIS A 1 40  ? 21.218  2.117   -1.972  1.00 0.00 ? 40  HIS A CD2  18 
ATOM 655   C CE1  . HIS A 1 40  ? 23.080  1.556   -1.018  1.00 0.00 ? 40  HIS A CE1  18 
ATOM 656   N NE2  . HIS A 1 40  ? 22.596  2.311   -2.009  1.00 0.00 ? 40  HIS A NE2  18 
ATOM 657   H H    . HIS A 1 40  ? 20.560  0.214   1.886   1.00 0.00 ? 40  HIS A H    18 
ATOM 658   H HA   . HIS A 1 40  ? 19.198  2.500   0.628   1.00 0.00 ? 40  HIS A HA   18 
ATOM 659   H HB2  . HIS A 1 40  ? 19.686  -0.355  -0.273  1.00 0.00 ? 40  HIS A HB2  18 
ATOM 660   H HB3  . HIS A 1 40  ? 18.834  0.845   -1.245  1.00 0.00 ? 40  HIS A HB3  18 
ATOM 661   H HD1  . HIS A 1 40  ? 22.220  0.294   0.394   1.00 0.00 ? 40  HIS A HD1  18 
ATOM 662   H HD2  . HIS A 1 40  ? 20.508  2.581   -2.642  1.00 0.00 ? 40  HIS A HD2  18 
ATOM 663   H HE1  . HIS A 1 40  ? 24.129  1.479   -0.773  1.00 0.00 ? 40  HIS A HE1  18 
ATOM 664   N N    . ALA A 1 41  ? 17.143  1.710   2.111   1.00 0.00 ? 41  ALA A N    18 
ATOM 665   C CA   . ALA A 1 41  ? 15.760  1.360   2.539   1.00 0.00 ? 41  ALA A CA   18 
ATOM 666   C C    . ALA A 1 41  ? 14.814  1.394   1.338   1.00 0.00 ? 41  ALA A C    18 
ATOM 667   O O    . ALA A 1 41  ? 13.960  0.543   1.187   1.00 0.00 ? 41  ALA A O    18 
ATOM 668   C CB   . ALA A 1 41  ? 15.288  2.364   3.594   1.00 0.00 ? 41  ALA A CB   18 
ATOM 669   H H    . ALA A 1 41  ? 17.613  2.455   2.539   1.00 0.00 ? 41  ALA A H    18 
ATOM 670   H HA   . ALA A 1 41  ? 15.759  0.368   2.964   1.00 0.00 ? 41  ALA A HA   18 
ATOM 671   H HB1  . ALA A 1 41  ? 16.147  2.799   4.084   1.00 0.00 ? 41  ALA A HB1  18 
ATOM 672   H HB2  . ALA A 1 41  ? 14.713  3.143   3.117   1.00 0.00 ? 41  ALA A HB2  18 
ATOM 673   H HB3  . ALA A 1 41  ? 14.676  1.858   4.323   1.00 0.00 ? 41  ALA A HB3  18 
ATOM 674   N N    . ASN A 1 42  ? 14.955  2.367   0.481   1.00 0.00 ? 42  ASN A N    18 
ATOM 675   C CA   . ASN A 1 42  ? 14.059  2.445   -0.707  1.00 0.00 ? 42  ASN A CA   18 
ATOM 676   C C    . ASN A 1 42  ? 12.610  2.617   -0.248  1.00 0.00 ? 42  ASN A C    18 
ATOM 677   O O    . ASN A 1 42  ? 12.317  2.613   0.931   1.00 0.00 ? 42  ASN A O    18 
ATOM 678   C CB   . ASN A 1 42  ? 14.179  1.153   -1.520  1.00 0.00 ? 42  ASN A CB   18 
ATOM 679   C CG   . ASN A 1 42  ? 15.327  1.283   -2.523  1.00 0.00 ? 42  ASN A CG   18 
ATOM 680   O OD1  . ASN A 1 42  ? 16.280  0.533   -2.474  1.00 0.00 ? 42  ASN A OD1  18 
ATOM 681   N ND2  . ASN A 1 42  ? 15.275  2.213   -3.437  1.00 0.00 ? 42  ASN A ND2  18 
ATOM 682   H H    . ASN A 1 42  ? 15.650  3.045   0.619   1.00 0.00 ? 42  ASN A H    18 
ATOM 683   H HA   . ASN A 1 42  ? 14.346  3.285   -1.322  1.00 0.00 ? 42  ASN A HA   18 
ATOM 684   H HB2  . ASN A 1 42  ? 14.376  0.326   -0.853  1.00 0.00 ? 42  ASN A HB2  18 
ATOM 685   H HB3  . ASN A 1 42  ? 13.257  0.975   -2.052  1.00 0.00 ? 42  ASN A HB3  18 
ATOM 686   H HD21 . ASN A 1 42  ? 14.506  2.819   -3.476  1.00 0.00 ? 42  ASN A HD21 18 
ATOM 687   H HD22 . ASN A 1 42  ? 16.004  2.305   -4.085  1.00 0.00 ? 42  ASN A HD22 18 
ATOM 688   N N    . PHE A 1 43  ? 11.699  2.759   -1.174  1.00 0.00 ? 43  PHE A N    18 
ATOM 689   C CA   . PHE A 1 43  ? 10.266  2.920   -0.799  1.00 0.00 ? 43  PHE A CA   18 
ATOM 690   C C    . PHE A 1 43  ? 9.431   3.104   -2.063  1.00 0.00 ? 43  PHE A C    18 
ATOM 691   O O    . PHE A 1 43  ? 9.953   3.127   -3.159  1.00 0.00 ? 43  PHE A O    18 
ATOM 692   C CB   . PHE A 1 43  ? 10.087  4.126   0.131   1.00 0.00 ? 43  PHE A CB   18 
ATOM 693   C CG   . PHE A 1 43  ? 10.207  5.426   -0.630  1.00 0.00 ? 43  PHE A CG   18 
ATOM 694   C CD1  . PHE A 1 43  ? 11.217  5.611   -1.582  1.00 0.00 ? 43  PHE A CD1  18 
ATOM 695   C CD2  . PHE A 1 43  ? 9.309   6.461   -0.357  1.00 0.00 ? 43  PHE A CD2  18 
ATOM 696   C CE1  . PHE A 1 43  ? 11.327  6.832   -2.255  1.00 0.00 ? 43  PHE A CE1  18 
ATOM 697   C CE2  . PHE A 1 43  ? 9.418   7.678   -1.034  1.00 0.00 ? 43  PHE A CE2  18 
ATOM 698   C CZ   . PHE A 1 43  ? 10.427  7.865   -1.982  1.00 0.00 ? 43  PHE A CZ   18 
ATOM 699   H H    . PHE A 1 43  ? 11.958  2.749   -2.121  1.00 0.00 ? 43  PHE A H    18 
ATOM 700   H HA   . PHE A 1 43  ? 9.934   2.027   -0.287  1.00 0.00 ? 43  PHE A HA   18 
ATOM 701   H HB2  . PHE A 1 43  ? 9.110   4.079   0.585   1.00 0.00 ? 43  PHE A HB2  18 
ATOM 702   H HB3  . PHE A 1 43  ? 10.842  4.096   0.903   1.00 0.00 ? 43  PHE A HB3  18 
ATOM 703   H HD1  . PHE A 1 43  ? 11.914  4.815   -1.794  1.00 0.00 ? 43  PHE A HD1  18 
ATOM 704   H HD2  . PHE A 1 43  ? 8.526   6.321   0.373   1.00 0.00 ? 43  PHE A HD2  18 
ATOM 705   H HE1  . PHE A 1 43  ? 12.104  6.978   -2.985  1.00 0.00 ? 43  PHE A HE1  18 
ATOM 706   H HE2  . PHE A 1 43  ? 8.724   8.471   -0.820  1.00 0.00 ? 43  PHE A HE2  18 
ATOM 707   H HZ   . PHE A 1 43  ? 10.513  8.807   -2.501  1.00 0.00 ? 43  PHE A HZ   18 
ATOM 708   N N    . CYS A 1 44  ? 8.138   3.214   -1.928  1.00 0.00 ? 44  CYS A N    18 
ATOM 709   C CA   . CYS A 1 44  ? 7.282   3.369   -3.139  1.00 0.00 ? 44  CYS A CA   18 
ATOM 710   C C    . CYS A 1 44  ? 6.483   4.671   -3.054  1.00 0.00 ? 44  CYS A C    18 
ATOM 711   O O    . CYS A 1 44  ? 6.018   5.058   -2.001  1.00 0.00 ? 44  CYS A O    18 
ATOM 712   C CB   . CYS A 1 44  ? 6.299   2.196   -3.233  1.00 0.00 ? 44  CYS A CB   18 
ATOM 713   S SG   . CYS A 1 44  ? 7.004   0.716   -2.459  1.00 0.00 ? 44  CYS A SG   18 
ATOM 714   H H    . CYS A 1 44  ? 7.730   3.177   -1.038  1.00 0.00 ? 44  CYS A H    18 
ATOM 715   H HA   . CYS A 1 44  ? 7.908   3.384   -4.020  1.00 0.00 ? 44  CYS A HA   18 
ATOM 716   H HB2  . CYS A 1 44  ? 5.380   2.459   -2.729  1.00 0.00 ? 44  CYS A HB2  18 
ATOM 717   H HB3  . CYS A 1 44  ? 6.091   1.992   -4.271  1.00 0.00 ? 44  CYS A HB3  18 
ATOM 718   N N    . LEU A 1 45  ? 6.307   5.343   -4.161  1.00 0.00 ? 45  LEU A N    18 
ATOM 719   C CA   . LEU A 1 45  ? 5.522   6.610   -4.150  1.00 0.00 ? 45  LEU A CA   18 
ATOM 720   C C    . LEU A 1 45  ? 4.623   6.657   -5.387  1.00 0.00 ? 45  LEU A C    18 
ATOM 721   O O    . LEU A 1 45  ? 4.526   5.703   -6.133  1.00 0.00 ? 45  LEU A O    18 
ATOM 722   C CB   . LEU A 1 45  ? 6.473   7.808   -4.173  1.00 0.00 ? 45  LEU A CB   18 
ATOM 723   C CG   . LEU A 1 45  ? 7.052   8.039   -2.780  1.00 0.00 ? 45  LEU A CG   18 
ATOM 724   C CD1  . LEU A 1 45  ? 7.791   9.376   -2.763  1.00 0.00 ? 45  LEU A CD1  18 
ATOM 725   C CD2  . LEU A 1 45  ? 5.925   8.067   -1.744  1.00 0.00 ? 45  LEU A CD2  18 
ATOM 726   H H    . LEU A 1 45  ? 6.682   5.009   -5.001  1.00 0.00 ? 45  LEU A H    18 
ATOM 727   H HA   . LEU A 1 45  ? 4.910   6.648   -3.263  1.00 0.00 ? 45  LEU A HA   18 
ATOM 728   H HB2  . LEU A 1 45  ? 7.280   7.613   -4.862  1.00 0.00 ? 45  LEU A HB2  18 
ATOM 729   H HB3  . LEU A 1 45  ? 5.935   8.690   -4.487  1.00 0.00 ? 45  LEU A HB3  18 
ATOM 730   H HG   . LEU A 1 45  ? 7.741   7.241   -2.546  1.00 0.00 ? 45  LEU A HG   18 
ATOM 731   H HD11 . LEU A 1 45  ? 7.293   10.069  -3.426  1.00 0.00 ? 45  LEU A HD11 18 
ATOM 732   H HD12 . LEU A 1 45  ? 7.793   9.774   -1.761  1.00 0.00 ? 45  LEU A HD12 18 
ATOM 733   H HD13 . LEU A 1 45  ? 8.807   9.228   -3.096  1.00 0.00 ? 45  LEU A HD13 18 
ATOM 734   H HD21 . LEU A 1 45  ? 5.106   8.660   -2.119  1.00 0.00 ? 45  LEU A HD21 18 
ATOM 735   H HD22 . LEU A 1 45  ? 5.585   7.060   -1.556  1.00 0.00 ? 45  LEU A HD22 18 
ATOM 736   H HD23 . LEU A 1 45  ? 6.292   8.499   -0.827  1.00 0.00 ? 45  LEU A HD23 18 
ATOM 737   N N    . GLY A 1 46  ? 3.965   7.762   -5.612  1.00 0.00 ? 46  GLY A N    18 
ATOM 738   C CA   . GLY A 1 46  ? 3.074   7.870   -6.802  1.00 0.00 ? 46  GLY A CA   18 
ATOM 739   C C    . GLY A 1 46  ? 1.871   6.937   -6.630  1.00 0.00 ? 46  GLY A C    18 
ATOM 740   O O    . GLY A 1 46  ? 1.960   5.930   -5.956  1.00 0.00 ? 46  GLY A O    18 
ATOM 741   H H    . GLY A 1 46  ? 4.058   8.521   -4.999  1.00 0.00 ? 46  GLY A H    18 
ATOM 742   H HA2  . GLY A 1 46  ? 2.729   8.889   -6.901  1.00 0.00 ? 46  GLY A HA2  18 
ATOM 743   H HA3  . GLY A 1 46  ? 3.621   7.585   -7.688  1.00 0.00 ? 46  GLY A HA3  18 
ATOM 744   N N    . PRO A 1 47  ? 0.779   7.304   -7.251  1.00 0.00 ? 47  PRO A N    18 
ATOM 745   C CA   . PRO A 1 47  ? -0.469  6.524   -7.195  1.00 0.00 ? 47  PRO A CA   18 
ATOM 746   C C    . PRO A 1 47  ? -0.391  5.325   -8.144  1.00 0.00 ? 47  PRO A C    18 
ATOM 747   O O    . PRO A 1 47  ? 0.677   4.896   -8.532  1.00 0.00 ? 47  PRO A O    18 
ATOM 748   C CB   . PRO A 1 47  ? -1.535  7.519   -7.663  1.00 0.00 ? 47  PRO A CB   18 
ATOM 749   C CG   . PRO A 1 47  ? -0.792  8.597   -8.489  1.00 0.00 ? 47  PRO A CG   18 
ATOM 750   C CD   . PRO A 1 47  ? 0.687   8.534   -8.065  1.00 0.00 ? 47  PRO A CD   18 
ATOM 751   H HA   . PRO A 1 47  ? -0.679  6.203   -6.189  1.00 0.00 ? 47  PRO A HA   18 
ATOM 752   H HB2  . PRO A 1 47  ? -2.269  7.015   -8.279  1.00 0.00 ? 47  PRO A HB2  18 
ATOM 753   H HB3  . PRO A 1 47  ? -2.014  7.979   -6.813  1.00 0.00 ? 47  PRO A HB3  18 
ATOM 754   H HG2  . PRO A 1 47  ? -0.888  8.384   -9.545  1.00 0.00 ? 47  PRO A HG2  18 
ATOM 755   H HG3  . PRO A 1 47  ? -1.192  9.574   -8.270  1.00 0.00 ? 47  PRO A HG3  18 
ATOM 756   H HD2  . PRO A 1 47  ? 1.326   8.463   -8.936  1.00 0.00 ? 47  PRO A HD2  18 
ATOM 757   H HD3  . PRO A 1 47  ? 0.949   9.394   -7.470  1.00 0.00 ? 47  PRO A HD3  18 
ATOM 758   N N    . CYS A 1 48  ? -1.516  4.785   -8.524  1.00 0.00 ? 48  CYS A N    18 
ATOM 759   C CA   . CYS A 1 48  ? -1.508  3.620   -9.450  1.00 0.00 ? 48  CYS A CA   18 
ATOM 760   C C    . CYS A 1 48  ? -2.547  3.849   -10.559 1.00 0.00 ? 48  CYS A C    18 
ATOM 761   O O    . CYS A 1 48  ? -3.689  4.149   -10.275 1.00 0.00 ? 48  CYS A O    18 
ATOM 762   C CB   . CYS A 1 48  ? -1.867  2.345   -8.678  1.00 0.00 ? 48  CYS A CB   18 
ATOM 763   S SG   . CYS A 1 48  ? -0.615  2.023   -7.408  1.00 0.00 ? 48  CYS A SG   18 
ATOM 764   H H    . CYS A 1 48  ? -2.366  5.151   -8.202  1.00 0.00 ? 48  CYS A H    18 
ATOM 765   H HA   . CYS A 1 48  ? -0.525  3.514   -9.881  1.00 0.00 ? 48  CYS A HA   18 
ATOM 766   H HB2  . CYS A 1 48  ? -2.831  2.470   -8.206  1.00 0.00 ? 48  CYS A HB2  18 
ATOM 767   H HB3  . CYS A 1 48  ? -1.909  1.510   -9.362  1.00 0.00 ? 48  CYS A HB3  18 
ATOM 768   N N    . PRO A 1 49  ? -2.123  3.695   -11.790 1.00 0.00 ? 49  PRO A N    18 
ATOM 769   C CA   . PRO A 1 49  ? -3.005  3.875   -12.958 1.00 0.00 ? 49  PRO A CA   18 
ATOM 770   C C    . PRO A 1 49  ? -3.941  2.672   -13.110 1.00 0.00 ? 49  PRO A C    18 
ATOM 771   O O    . PRO A 1 49  ? -4.059  1.850   -12.224 1.00 0.00 ? 49  PRO A O    18 
ATOM 772   C CB   . PRO A 1 49  ? -2.032  3.976   -14.136 1.00 0.00 ? 49  PRO A CB   18 
ATOM 773   C CG   . PRO A 1 49  ? -0.721  3.299   -13.675 1.00 0.00 ? 49  PRO A CG   18 
ATOM 774   C CD   . PRO A 1 49  ? -0.734  3.330   -12.134 1.00 0.00 ? 49  PRO A CD   18 
ATOM 775   H HA   . PRO A 1 49  ? -3.571  4.789   -12.869 1.00 0.00 ? 49  PRO A HA   18 
ATOM 776   H HB2  . PRO A 1 49  ? -2.438  3.459   -14.996 1.00 0.00 ? 49  PRO A HB2  18 
ATOM 777   H HB3  . PRO A 1 49  ? -1.844  5.009   -14.377 1.00 0.00 ? 49  PRO A HB3  18 
ATOM 778   H HG2  . PRO A 1 49  ? -0.687  2.278   -14.029 1.00 0.00 ? 49  PRO A HG2  18 
ATOM 779   H HG3  . PRO A 1 49  ? 0.130   3.850   -14.042 1.00 0.00 ? 49  PRO A HG3  18 
ATOM 780   H HD2  . PRO A 1 49  ? -0.485  2.359   -11.730 1.00 0.00 ? 49  PRO A HD2  18 
ATOM 781   H HD3  . PRO A 1 49  ? -0.053  4.080   -11.765 1.00 0.00 ? 49  PRO A HD3  18 
ATOM 782   N N    . TYR A 1 50  ? -4.615  2.567   -14.223 1.00 0.00 ? 50  TYR A N    18 
ATOM 783   C CA   . TYR A 1 50  ? -5.552  1.421   -14.420 1.00 0.00 ? 50  TYR A CA   18 
ATOM 784   C C    . TYR A 1 50  ? -4.891  0.348   -15.289 1.00 0.00 ? 50  TYR A C    18 
ATOM 785   O O    . TYR A 1 50  ? -5.532  -0.591  -15.717 1.00 0.00 ? 50  TYR A O    18 
ATOM 786   C CB   . TYR A 1 50  ? -6.842  1.901   -15.109 1.00 0.00 ? 50  TYR A CB   18 
ATOM 787   C CG   . TYR A 1 50  ? -6.870  3.412   -15.191 1.00 0.00 ? 50  TYR A CG   18 
ATOM 788   C CD1  . TYR A 1 50  ? -7.028  4.173   -14.027 1.00 0.00 ? 50  TYR A CD1  18 
ATOM 789   C CD2  . TYR A 1 50  ? -6.735  4.047   -16.430 1.00 0.00 ? 50  TYR A CD2  18 
ATOM 790   C CE1  . TYR A 1 50  ? -7.052  5.571   -14.102 1.00 0.00 ? 50  TYR A CE1  18 
ATOM 791   C CE2  . TYR A 1 50  ? -6.760  5.445   -16.507 1.00 0.00 ? 50  TYR A CE2  18 
ATOM 792   C CZ   . TYR A 1 50  ? -6.918  6.207   -15.343 1.00 0.00 ? 50  TYR A CZ   18 
ATOM 793   O OH   . TYR A 1 50  ? -6.941  7.584   -15.418 1.00 0.00 ? 50  TYR A OH   18 
ATOM 794   H H    . TYR A 1 50  ? -4.513  3.244   -14.924 1.00 0.00 ? 50  TYR A H    18 
ATOM 795   H HA   . TYR A 1 50  ? -5.801  0.997   -13.458 1.00 0.00 ? 50  TYR A HA   18 
ATOM 796   H HB2  . TYR A 1 50  ? -6.887  1.490   -16.106 1.00 0.00 ? 50  TYR A HB2  18 
ATOM 797   H HB3  . TYR A 1 50  ? -7.696  1.558   -14.544 1.00 0.00 ? 50  TYR A HB3  18 
ATOM 798   H HD1  . TYR A 1 50  ? -7.131  3.682   -13.069 1.00 0.00 ? 50  TYR A HD1  18 
ATOM 799   H HD2  . TYR A 1 50  ? -6.614  3.460   -17.329 1.00 0.00 ? 50  TYR A HD2  18 
ATOM 800   H HE1  . TYR A 1 50  ? -7.173  6.159   -13.205 1.00 0.00 ? 50  TYR A HE1  18 
ATOM 801   H HE2  . TYR A 1 50  ? -6.656  5.936   -17.463 1.00 0.00 ? 50  TYR A HE2  18 
ATOM 802   H HH   . TYR A 1 50  ? -7.803  7.849   -15.748 1.00 0.00 ? 50  TYR A HH   18 
ATOM 803   N N    . ILE A 1 51  ? -3.622  0.476   -15.564 1.00 0.00 ? 51  ILE A N    18 
ATOM 804   C CA   . ILE A 1 51  ? -2.945  -0.544  -16.416 1.00 0.00 ? 51  ILE A CA   18 
ATOM 805   C C    . ILE A 1 51  ? -1.667  -1.044  -15.735 1.00 0.00 ? 51  ILE A C    18 
ATOM 806   O O    . ILE A 1 51  ? -1.066  -2.011  -16.159 1.00 0.00 ? 51  ILE A O    18 
ATOM 807   C CB   . ILE A 1 51  ? -2.589  0.080   -17.766 1.00 0.00 ? 51  ILE A CB   18 
ATOM 808   C CG1  . ILE A 1 51  ? -1.926  1.442   -17.538 1.00 0.00 ? 51  ILE A CG1  18 
ATOM 809   C CG2  . ILE A 1 51  ? -3.862  0.268   -18.592 1.00 0.00 ? 51  ILE A CG2  18 
ATOM 810   C CD1  . ILE A 1 51  ? -1.194  1.871   -18.811 1.00 0.00 ? 51  ILE A CD1  18 
ATOM 811   H H    . ILE A 1 51  ? -3.119  1.243   -15.221 1.00 0.00 ? 51  ILE A H    18 
ATOM 812   H HA   . ILE A 1 51  ? -3.614  -1.377  -16.574 1.00 0.00 ? 51  ILE A HA   18 
ATOM 813   H HB   . ILE A 1 51  ? -1.908  -0.571  -18.296 1.00 0.00 ? 51  ILE A HB   18 
ATOM 814   H HG12 . ILE A 1 51  ? -2.683  2.173   -17.294 1.00 0.00 ? 51  ILE A HG12 18 
ATOM 815   H HG13 . ILE A 1 51  ? -1.219  1.368   -16.726 1.00 0.00 ? 51  ILE A HG13 18 
ATOM 816   H HG21 . ILE A 1 51  ? -4.649  -0.351  -18.184 1.00 0.00 ? 51  ILE A HG21 18 
ATOM 817   H HG22 . ILE A 1 51  ? -4.163  1.304   -18.558 1.00 0.00 ? 51  ILE A HG22 18 
ATOM 818   H HG23 . ILE A 1 51  ? -3.672  -0.020  -19.616 1.00 0.00 ? 51  ILE A HG23 18 
ATOM 819   H HD11 . ILE A 1 51  ? -1.657  1.405   -19.667 1.00 0.00 ? 51  ILE A HD11 18 
ATOM 820   H HD12 . ILE A 1 51  ? -1.246  2.945   -18.913 1.00 0.00 ? 51  ILE A HD12 18 
ATOM 821   H HD13 . ILE A 1 51  ? -0.159  1.565   -18.751 1.00 0.00 ? 51  ILE A HD13 18 
ATOM 822   N N    . TRP A 1 52  ? -1.245  -0.397  -14.685 1.00 0.00 ? 52  TRP A N    18 
ATOM 823   C CA   . TRP A 1 52  ? -0.007  -0.840  -13.984 1.00 0.00 ? 52  TRP A CA   18 
ATOM 824   C C    . TRP A 1 52  ? -0.164  -2.291  -13.526 1.00 0.00 ? 52  TRP A C    18 
ATOM 825   O O    . TRP A 1 52  ? -0.963  -3.036  -14.057 1.00 0.00 ? 52  TRP A O    18 
ATOM 826   C CB   . TRP A 1 52  ? 0.227   0.054   -12.770 1.00 0.00 ? 52  TRP A CB   18 
ATOM 827   C CG   . TRP A 1 52  ? 1.637   0.547   -12.782 1.00 0.00 ? 52  TRP A CG   18 
ATOM 828   C CD1  . TRP A 1 52  ? 2.402   0.710   -11.683 1.00 0.00 ? 52  TRP A CD1  18 
ATOM 829   C CD2  . TRP A 1 52  ? 2.461   0.940   -13.918 1.00 0.00 ? 52  TRP A CD2  18 
ATOM 830   N NE1  . TRP A 1 52  ? 3.648   1.173   -12.069 1.00 0.00 ? 52  TRP A NE1  18 
ATOM 831   C CE2  . TRP A 1 52  ? 3.733   1.332   -13.437 1.00 0.00 ? 52  TRP A CE2  18 
ATOM 832   C CE3  . TRP A 1 52  ? 2.233   0.995   -15.307 1.00 0.00 ? 52  TRP A CE3  18 
ATOM 833   C CZ2  . TRP A 1 52  ? 4.743   1.760   -14.300 1.00 0.00 ? 52  TRP A CZ2  18 
ATOM 834   C CZ3  . TRP A 1 52  ? 3.247   1.427   -16.177 1.00 0.00 ? 52  TRP A CZ3  18 
ATOM 835   C CH2  . TRP A 1 52  ? 4.499   1.808   -15.674 1.00 0.00 ? 52  TRP A CH2  18 
ATOM 836   H H    . TRP A 1 52  ? -1.740  0.380   -14.356 1.00 0.00 ? 52  TRP A H    18 
ATOM 837   H HA   . TRP A 1 52  ? 0.837   -0.763  -14.651 1.00 0.00 ? 52  TRP A HA   18 
ATOM 838   H HB2  . TRP A 1 52  ? -0.451  0.893   -12.811 1.00 0.00 ? 52  TRP A HB2  18 
ATOM 839   H HB3  . TRP A 1 52  ? 0.048   -0.510  -11.868 1.00 0.00 ? 52  TRP A HB3  18 
ATOM 840   H HD1  . TRP A 1 52  ? 2.092   0.508   -10.670 1.00 0.00 ? 52  TRP A HD1  18 
ATOM 841   H HE1  . TRP A 1 52  ? 4.391   1.370   -11.460 1.00 0.00 ? 52  TRP A HE1  18 
ATOM 842   H HE3  . TRP A 1 52  ? 1.273   0.706   -15.704 1.00 0.00 ? 52  TRP A HE3  18 
ATOM 843   H HZ2  . TRP A 1 52  ? 5.707   2.049   -13.908 1.00 0.00 ? 52  TRP A HZ2  18 
ATOM 844   H HZ3  . TRP A 1 52  ? 3.062   1.466   -17.240 1.00 0.00 ? 52  TRP A HZ3  18 
ATOM 845   H HH2  . TRP A 1 52  ? 5.274   2.140   -16.349 1.00 0.00 ? 52  TRP A HH2  18 
ATOM 846   N N    . SER A 1 53  ? 0.592   -2.697  -12.543 1.00 0.00 ? 53  SER A N    18 
ATOM 847   C CA   . SER A 1 53  ? 0.486   -4.099  -12.050 1.00 0.00 ? 53  SER A CA   18 
ATOM 848   C C    . SER A 1 53  ? -0.645  -4.193  -11.025 1.00 0.00 ? 53  SER A C    18 
ATOM 849   O O    . SER A 1 53  ? -0.504  -4.806  -9.985  1.00 0.00 ? 53  SER A O    18 
ATOM 850   C CB   . SER A 1 53  ? 1.804   -4.510  -11.393 1.00 0.00 ? 53  SER A CB   18 
ATOM 851   O OG   . SER A 1 53  ? 2.036   -3.690  -10.255 1.00 0.00 ? 53  SER A OG   18 
ATOM 852   H H    . SER A 1 53  ? 1.230   -2.079  -12.127 1.00 0.00 ? 53  SER A H    18 
ATOM 853   H HA   . SER A 1 53  ? 0.276   -4.757  -12.880 1.00 0.00 ? 53  SER A HA   18 
ATOM 854   H HB2  . SER A 1 53  ? 1.747   -5.540  -11.081 1.00 0.00 ? 53  SER A HB2  18 
ATOM 855   H HB3  . SER A 1 53  ? 2.611   -4.396  -12.103 1.00 0.00 ? 53  SER A HB3  18 
ATOM 856   H HG   . SER A 1 53  ? 1.781   -2.792  -10.479 1.00 0.00 ? 53  SER A HG   18 
ATOM 857   N N    . LEU A 1 54  ? -1.768  -3.590  -11.306 1.00 0.00 ? 54  LEU A N    18 
ATOM 858   C CA   . LEU A 1 54  ? -2.903  -3.644  -10.344 1.00 0.00 ? 54  LEU A CA   18 
ATOM 859   C C    . LEU A 1 54  ? -3.094  -5.084  -9.862  1.00 0.00 ? 54  LEU A C    18 
ATOM 860   O O    . LEU A 1 54  ? -3.193  -6.005  -10.649 1.00 0.00 ? 54  LEU A O    18 
ATOM 861   C CB   . LEU A 1 54  ? -4.179  -3.156  -11.028 1.00 0.00 ? 54  LEU A CB   18 
ATOM 862   C CG   . LEU A 1 54  ? -3.982  -1.712  -11.496 1.00 0.00 ? 54  LEU A CG   18 
ATOM 863   C CD1  . LEU A 1 54  ? -4.847  -1.445  -12.730 1.00 0.00 ? 54  LEU A CD1  18 
ATOM 864   C CD2  . LEU A 1 54  ? -4.387  -0.753  -10.373 1.00 0.00 ? 54  LEU A CD2  18 
ATOM 865   H H    . LEU A 1 54  ? -1.863  -3.099  -12.149 1.00 0.00 ? 54  LEU A H    18 
ATOM 866   H HA   . LEU A 1 54  ? -2.684  -3.011  -9.496  1.00 0.00 ? 54  LEU A HA   18 
ATOM 867   H HB2  . LEU A 1 54  ? -4.397  -3.785  -11.878 1.00 0.00 ? 54  LEU A HB2  18 
ATOM 868   H HB3  . LEU A 1 54  ? -5.000  -3.196  -10.328 1.00 0.00 ? 54  LEU A HB3  18 
ATOM 869   H HG   . LEU A 1 54  ? -2.943  -1.555  -11.746 1.00 0.00 ? 54  LEU A HG   18 
ATOM 870   H HD11 . LEU A 1 54  ? -5.344  -2.358  -13.026 1.00 0.00 ? 54  LEU A HD11 18 
ATOM 871   H HD12 . LEU A 1 54  ? -5.586  -0.692  -12.497 1.00 0.00 ? 54  LEU A HD12 18 
ATOM 872   H HD13 . LEU A 1 54  ? -4.222  -1.097  -13.539 1.00 0.00 ? 54  LEU A HD13 18 
ATOM 873   H HD21 . LEU A 1 54  ? -5.385  -0.992  -10.038 1.00 0.00 ? 54  LEU A HD21 18 
ATOM 874   H HD22 . LEU A 1 54  ? -3.696  -0.851  -9.549  1.00 0.00 ? 54  LEU A HD22 18 
ATOM 875   H HD23 . LEU A 1 54  ? -4.364  0.263   -10.742 1.00 0.00 ? 54  LEU A HD23 18 
ATOM 876   N N    . ASP A 1 55  ? -3.142  -5.283  -8.574  1.00 0.00 ? 55  ASP A N    18 
ATOM 877   C CA   . ASP A 1 55  ? -3.322  -6.663  -8.037  1.00 0.00 ? 55  ASP A CA   18 
ATOM 878   C C    . ASP A 1 55  ? -4.783  -6.875  -7.632  1.00 0.00 ? 55  ASP A C    18 
ATOM 879   O O    . ASP A 1 55  ? -5.387  -7.877  -7.959  1.00 0.00 ? 55  ASP A O    18 
ATOM 880   C CB   . ASP A 1 55  ? -2.424  -6.852  -6.812  1.00 0.00 ? 55  ASP A CB   18 
ATOM 881   C CG   . ASP A 1 55  ? -1.027  -7.283  -7.263  1.00 0.00 ? 55  ASP A CG   18 
ATOM 882   O OD1  . ASP A 1 55  ? -0.908  -8.373  -7.798  1.00 0.00 ? 55  ASP A OD1  18 
ATOM 883   O OD2  . ASP A 1 55  ? -0.099  -6.516  -7.065  1.00 0.00 ? 55  ASP A OD2  18 
ATOM 884   H H    . ASP A 1 55  ? -3.058  -4.525  -7.961  1.00 0.00 ? 55  ASP A H    18 
ATOM 885   H HA   . ASP A 1 55  ? -3.051  -7.382  -8.795  1.00 0.00 ? 55  ASP A HA   18 
ATOM 886   H HB2  . ASP A 1 55  ? -2.356  -5.921  -6.268  1.00 0.00 ? 55  ASP A HB2  18 
ATOM 887   H HB3  . ASP A 1 55  ? -2.844  -7.613  -6.171  1.00 0.00 ? 55  ASP A HB3  18 
ATOM 888   N N    . THR A 1 56  ? -5.352  -5.943  -6.919  1.00 0.00 ? 56  THR A N    18 
ATOM 889   C CA   . THR A 1 56  ? -6.771  -6.096  -6.490  1.00 0.00 ? 56  THR A CA   18 
ATOM 890   C C    . THR A 1 56  ? -7.684  -5.385  -7.491  1.00 0.00 ? 56  THR A C    18 
ATOM 891   O O    . THR A 1 56  ? -7.254  -4.527  -8.235  1.00 0.00 ? 56  THR A O    18 
ATOM 892   C CB   . THR A 1 56  ? -6.955  -5.479  -5.099  1.00 0.00 ? 56  THR A CB   18 
ATOM 893   O OG1  . THR A 1 56  ? -7.305  -4.109  -5.235  1.00 0.00 ? 56  THR A OG1  18 
ATOM 894   C CG2  . THR A 1 56  ? -5.652  -5.599  -4.305  1.00 0.00 ? 56  THR A CG2  18 
ATOM 895   H H    . THR A 1 56  ? -4.846  -5.144  -6.663  1.00 0.00 ? 56  THR A H    18 
ATOM 896   H HA   . THR A 1 56  ? -7.025  -7.146  -6.455  1.00 0.00 ? 56  THR A HA   18 
ATOM 897   H HB   . THR A 1 56  ? -7.741  -6.002  -4.575  1.00 0.00 ? 56  THR A HB   18 
ATOM 898   H HG1  . THR A 1 56  ? -7.770  -3.841  -4.438  1.00 0.00 ? 56  THR A HG1  18 
ATOM 899   H HG21 . THR A 1 56  ? -5.338  -6.632  -4.283  1.00 0.00 ? 56  THR A HG21 18 
ATOM 900   H HG22 . THR A 1 56  ? -4.887  -5.000  -4.775  1.00 0.00 ? 56  THR A HG22 18 
ATOM 901   H HG23 . THR A 1 56  ? -5.812  -5.250  -3.295  1.00 0.00 ? 56  THR A HG23 18 
ATOM 902   N N    . GLN A 1 57  ? -8.942  -5.733  -7.518  1.00 0.00 ? 57  GLN A N    18 
ATOM 903   C CA   . GLN A 1 57  ? -9.873  -5.071  -8.475  1.00 0.00 ? 57  GLN A CA   18 
ATOM 904   C C    . GLN A 1 57  ? -10.195 -3.660  -7.979  1.00 0.00 ? 57  GLN A C    18 
ATOM 905   O O    . GLN A 1 57  ? -10.607 -2.805  -8.736  1.00 0.00 ? 57  GLN A O    18 
ATOM 906   C CB   . GLN A 1 57  ? -11.166 -5.884  -8.581  1.00 0.00 ? 57  GLN A CB   18 
ATOM 907   C CG   . GLN A 1 57  ? -11.485 -6.142  -10.055 1.00 0.00 ? 57  GLN A CG   18 
ATOM 908   C CD   . GLN A 1 57  ? -12.740 -7.012  -10.159 1.00 0.00 ? 57  GLN A CD   18 
ATOM 909   O OE1  . GLN A 1 57  ? -13.845 -6.507  -10.152 1.00 0.00 ? 57  GLN A OE1  18 
ATOM 910   N NE2  . GLN A 1 57  ? -12.615 -8.307  -10.252 1.00 0.00 ? 57  GLN A NE2  18 
ATOM 911   H H    . GLN A 1 57  ? -9.273  -6.428  -6.911  1.00 0.00 ? 57  GLN A H    18 
ATOM 912   H HA   . GLN A 1 57  ? -9.406  -5.012  -9.447  1.00 0.00 ? 57  GLN A HA   18 
ATOM 913   H HB2  . GLN A 1 57  ? -11.042 -6.826  -8.067  1.00 0.00 ? 57  GLN A HB2  18 
ATOM 914   H HB3  . GLN A 1 57  ? -11.977 -5.331  -8.131  1.00 0.00 ? 57  GLN A HB3  18 
ATOM 915   H HG2  . GLN A 1 57  ? -11.656 -5.200  -10.557 1.00 0.00 ? 57  GLN A HG2  18 
ATOM 916   H HG3  . GLN A 1 57  ? -10.657 -6.654  -10.519 1.00 0.00 ? 57  GLN A HG3  18 
ATOM 917   H HE21 . GLN A 1 57  ? -11.723 -8.715  -10.257 1.00 0.00 ? 57  GLN A HE21 18 
ATOM 918   H HE22 . GLN A 1 57  ? -13.413 -8.872  -10.318 1.00 0.00 ? 57  GLN A HE22 18 
ATOM 919   N N    . TYR A 1 58  ? -10.006 -3.407  -6.713  1.00 0.00 ? 58  TYR A N    18 
ATOM 920   C CA   . TYR A 1 58  ? -10.297 -2.048  -6.178  1.00 0.00 ? 58  TYR A CA   18 
ATOM 921   C C    . TYR A 1 58  ? -9.165  -1.096  -6.581  1.00 0.00 ? 58  TYR A C    18 
ATOM 922   O O    . TYR A 1 58  ? -9.252  0.100   -6.387  1.00 0.00 ? 58  TYR A O    18 
ATOM 923   C CB   . TYR A 1 58  ? -10.411 -2.114  -4.643  1.00 0.00 ? 58  TYR A CB   18 
ATOM 924   C CG   . TYR A 1 58  ? -10.138 -0.752  -4.049  1.00 0.00 ? 58  TYR A CG   18 
ATOM 925   C CD1  . TYR A 1 58  ? -11.064 0.283   -4.214  1.00 0.00 ? 58  TYR A CD1  18 
ATOM 926   C CD2  . TYR A 1 58  ? -8.949  -0.523  -3.346  1.00 0.00 ? 58  TYR A CD2  18 
ATOM 927   C CE1  . TYR A 1 58  ? -10.801 1.547   -3.675  1.00 0.00 ? 58  TYR A CE1  18 
ATOM 928   C CE2  . TYR A 1 58  ? -8.686  0.742   -2.811  1.00 0.00 ? 58  TYR A CE2  18 
ATOM 929   C CZ   . TYR A 1 58  ? -9.613  1.775   -2.975  1.00 0.00 ? 58  TYR A CZ   18 
ATOM 930   O OH   . TYR A 1 58  ? -9.353  3.023   -2.453  1.00 0.00 ? 58  TYR A OH   18 
ATOM 931   H H    . TYR A 1 58  ? -9.670  -4.109  -6.117  1.00 0.00 ? 58  TYR A H    18 
ATOM 932   H HA   . TYR A 1 58  ? -11.229 -1.693  -6.592  1.00 0.00 ? 58  TYR A HA   18 
ATOM 933   H HB2  . TYR A 1 58  ? -11.408 -2.429  -4.371  1.00 0.00 ? 58  TYR A HB2  18 
ATOM 934   H HB3  . TYR A 1 58  ? -9.694  -2.823  -4.256  1.00 0.00 ? 58  TYR A HB3  18 
ATOM 935   H HD1  . TYR A 1 58  ? -11.981 0.107   -4.756  1.00 0.00 ? 58  TYR A HD1  18 
ATOM 936   H HD2  . TYR A 1 58  ? -8.234  -1.323  -3.219  1.00 0.00 ? 58  TYR A HD2  18 
ATOM 937   H HE1  . TYR A 1 58  ? -11.512 2.348   -3.803  1.00 0.00 ? 58  TYR A HE1  18 
ATOM 938   H HE2  . TYR A 1 58  ? -7.769  0.920   -2.268  1.00 0.00 ? 58  TYR A HE2  18 
ATOM 939   H HH   . TYR A 1 58  ? -8.457  3.020   -2.109  1.00 0.00 ? 58  TYR A HH   18 
ATOM 940   N N    . SER A 1 59  ? -8.103  -1.614  -7.133  1.00 0.00 ? 59  SER A N    18 
ATOM 941   C CA   . SER A 1 59  ? -6.972  -0.732  -7.535  1.00 0.00 ? 59  SER A CA   18 
ATOM 942   C C    . SER A 1 59  ? -7.273  -0.094  -8.893  1.00 0.00 ? 59  SER A C    18 
ATOM 943   O O    . SER A 1 59  ? -6.779  0.971   -9.209  1.00 0.00 ? 59  SER A O    18 
ATOM 944   C CB   . SER A 1 59  ? -5.689  -1.557  -7.630  1.00 0.00 ? 59  SER A CB   18 
ATOM 945   O OG   . SER A 1 59  ? -5.900  -2.658  -8.505  1.00 0.00 ? 59  SER A OG   18 
ATOM 946   H H    . SER A 1 59  ? -8.046  -2.583  -7.277  1.00 0.00 ? 59  SER A H    18 
ATOM 947   H HA   . SER A 1 59  ? -6.845  0.044   -6.796  1.00 0.00 ? 59  SER A HA   18 
ATOM 948   H HB2  . SER A 1 59  ? -4.892  -0.945  -8.018  1.00 0.00 ? 59  SER A HB2  18 
ATOM 949   H HB3  . SER A 1 59  ? -5.418  -1.913  -6.644  1.00 0.00 ? 59  SER A HB3  18 
ATOM 950   H HG   . SER A 1 59  ? -6.517  -2.382  -9.186  1.00 0.00 ? 59  SER A HG   18 
ATOM 951   N N    . LYS A 1 60  ? -8.080  -0.728  -9.700  1.00 0.00 ? 60  LYS A N    18 
ATOM 952   C CA   . LYS A 1 60  ? -8.404  -0.144  -11.032 1.00 0.00 ? 60  LYS A CA   18 
ATOM 953   C C    . LYS A 1 60  ? -9.573  0.832   -10.886 1.00 0.00 ? 60  LYS A C    18 
ATOM 954   O O    . LYS A 1 60  ? -9.687  1.793   -11.621 1.00 0.00 ? 60  LYS A O    18 
ATOM 955   C CB   . LYS A 1 60  ? -8.785  -1.261  -12.007 1.00 0.00 ? 60  LYS A CB   18 
ATOM 956   C CG   . LYS A 1 60  ? -9.922  -2.096  -11.416 1.00 0.00 ? 60  LYS A CG   18 
ATOM 957   C CD   . LYS A 1 60  ? -10.414 -3.099  -12.462 1.00 0.00 ? 60  LYS A CD   18 
ATOM 958   C CE   . LYS A 1 60  ? -11.328 -2.390  -13.464 1.00 0.00 ? 60  LYS A CE   18 
ATOM 959   N NZ   . LYS A 1 60  ? -11.001 -2.846  -14.845 1.00 0.00 ? 60  LYS A NZ   18 
ATOM 960   H H    . LYS A 1 60  ? -8.472  -1.585  -9.430  1.00 0.00 ? 60  LYS A H    18 
ATOM 961   H HA   . LYS A 1 60  ? -7.541  0.383   -11.411 1.00 0.00 ? 60  LYS A HA   18 
ATOM 962   H HB2  . LYS A 1 60  ? -9.107  -0.826  -12.943 1.00 0.00 ? 60  LYS A HB2  18 
ATOM 963   H HB3  . LYS A 1 60  ? -7.929  -1.895  -12.180 1.00 0.00 ? 60  LYS A HB3  18 
ATOM 964   H HG2  . LYS A 1 60  ? -9.562  -2.628  -10.547 1.00 0.00 ? 60  LYS A HG2  18 
ATOM 965   H HG3  . LYS A 1 60  ? -10.736 -1.447  -11.130 1.00 0.00 ? 60  LYS A HG3  18 
ATOM 966   H HD2  . LYS A 1 60  ? -9.566  -3.520  -12.983 1.00 0.00 ? 60  LYS A HD2  18 
ATOM 967   H HD3  . LYS A 1 60  ? -10.964 -3.890  -11.973 1.00 0.00 ? 60  LYS A HD3  18 
ATOM 968   H HE2  . LYS A 1 60  ? -12.358 -2.626  -13.241 1.00 0.00 ? 60  LYS A HE2  18 
ATOM 969   H HE3  . LYS A 1 60  ? -11.180 -1.322  -13.392 1.00 0.00 ? 60  LYS A HE3  18 
ATOM 970   H HZ1  . LYS A 1 60  ? -9.969  -2.858  -14.971 1.00 0.00 ? 60  LYS A HZ1  18 
ATOM 971   H HZ2  . LYS A 1 60  ? -11.381 -3.802  -14.993 1.00 0.00 ? 60  LYS A HZ2  18 
ATOM 972   H HZ3  . LYS A 1 60  ? -11.428 -2.196  -15.535 1.00 0.00 ? 60  LYS A HZ3  18 
ATOM 973   N N    . VAL A 1 61  ? -10.441 0.596   -9.941  1.00 0.00 ? 61  VAL A N    18 
ATOM 974   C CA   . VAL A 1 61  ? -11.598 1.512   -9.750  1.00 0.00 ? 61  VAL A CA   18 
ATOM 975   C C    . VAL A 1 61  ? -11.117 2.802   -9.077  1.00 0.00 ? 61  VAL A C    18 
ATOM 976   O O    . VAL A 1 61  ? -11.115 3.856   -9.676  1.00 0.00 ? 61  VAL A O    18 
ATOM 977   C CB   . VAL A 1 61  ? -12.647 0.821   -8.874  1.00 0.00 ? 61  VAL A CB   18 
ATOM 978   C CG1  . VAL A 1 61  ? -13.600 1.861   -8.285  1.00 0.00 ? 61  VAL A CG1  18 
ATOM 979   C CG2  . VAL A 1 61  ? -13.442 -0.168  -9.729  1.00 0.00 ? 61  VAL A CG2  18 
ATOM 980   H H    . VAL A 1 61  ? -10.332 -0.182  -9.357  1.00 0.00 ? 61  VAL A H    18 
ATOM 981   H HA   . VAL A 1 61  ? -12.030 1.748   -10.710 1.00 0.00 ? 61  VAL A HA   18 
ATOM 982   H HB   . VAL A 1 61  ? -12.154 0.289   -8.073  1.00 0.00 ? 61  VAL A HB   18 
ATOM 983   H HG11 . VAL A 1 61  ? -13.480 2.795   -8.810  1.00 0.00 ? 61  VAL A HG11 18 
ATOM 984   H HG12 . VAL A 1 61  ? -14.619 1.515   -8.390  1.00 0.00 ? 61  VAL A HG12 18 
ATOM 985   H HG13 . VAL A 1 61  ? -13.374 2.003   -7.239  1.00 0.00 ? 61  VAL A HG13 18 
ATOM 986   H HG21 . VAL A 1 61  ? -12.879 -0.408  -10.620 1.00 0.00 ? 61  VAL A HG21 18 
ATOM 987   H HG22 . VAL A 1 61  ? -13.623 -1.070  -9.164  1.00 0.00 ? 61  VAL A HG22 18 
ATOM 988   H HG23 . VAL A 1 61  ? -14.385 0.277   -10.009 1.00 0.00 ? 61  VAL A HG23 18 
ATOM 989   N N    . LEU A 1 62  ? -10.708 2.728   -7.839  1.00 0.00 ? 62  LEU A N    18 
ATOM 990   C CA   . LEU A 1 62  ? -10.230 3.955   -7.139  1.00 0.00 ? 62  LEU A CA   18 
ATOM 991   C C    . LEU A 1 62  ? -9.156  4.628   -7.996  1.00 0.00 ? 62  LEU A C    18 
ATOM 992   O O    . LEU A 1 62  ? -8.968  5.827   -7.942  1.00 0.00 ? 62  LEU A O    18 
ATOM 993   C CB   . LEU A 1 62  ? -9.660  3.566   -5.769  1.00 0.00 ? 62  LEU A CB   18 
ATOM 994   C CG   . LEU A 1 62  ? -8.830  4.710   -5.169  1.00 0.00 ? 62  LEU A CG   18 
ATOM 995   C CD1  . LEU A 1 62  ? -9.726  5.623   -4.326  1.00 0.00 ? 62  LEU A CD1  18 
ATOM 996   C CD2  . LEU A 1 62  ? -7.743  4.115   -4.275  1.00 0.00 ? 62  LEU A CD2  18 
ATOM 997   H H    . LEU A 1 62  ? -10.715 1.868   -7.370  1.00 0.00 ? 62  LEU A H    18 
ATOM 998   H HA   . LEU A 1 62  ? -11.058 4.637   -7.004  1.00 0.00 ? 62  LEU A HA   18 
ATOM 999   H HB2  . LEU A 1 62  ? -10.477 3.337   -5.102  1.00 0.00 ? 62  LEU A HB2  18 
ATOM 1000  H HB3  . LEU A 1 62  ? -9.036  2.692   -5.878  1.00 0.00 ? 62  LEU A HB3  18 
ATOM 1001  H HG   . LEU A 1 62  ? -8.371  5.285   -5.958  1.00 0.00 ? 62  LEU A HG   18 
ATOM 1002  H HD11 . LEU A 1 62  ? -10.754 5.503   -4.633  1.00 0.00 ? 62  LEU A HD11 18 
ATOM 1003  H HD12 . LEU A 1 62  ? -9.629  5.360   -3.282  1.00 0.00 ? 62  LEU A HD12 18 
ATOM 1004  H HD13 . LEU A 1 62  ? -9.427  6.652   -4.466  1.00 0.00 ? 62  LEU A HD13 18 
ATOM 1005  H HD21 . LEU A 1 62  ? -7.988  3.087   -4.047  1.00 0.00 ? 62  LEU A HD21 18 
ATOM 1006  H HD22 . LEU A 1 62  ? -6.795  4.152   -4.788  1.00 0.00 ? 62  LEU A HD22 18 
ATOM 1007  H HD23 . LEU A 1 62  ? -7.681  4.681   -3.358  1.00 0.00 ? 62  LEU A HD23 18 
ATOM 1008  N N    . ALA A 1 63  ? -8.457  3.871   -8.799  1.00 0.00 ? 63  ALA A N    18 
ATOM 1009  C CA   . ALA A 1 63  ? -7.411  4.482   -9.665  1.00 0.00 ? 63  ALA A CA   18 
ATOM 1010  C C    . ALA A 1 63  ? -8.054  5.596   -10.491 1.00 0.00 ? 63  ALA A C    18 
ATOM 1011  O O    . ALA A 1 63  ? -7.542  6.693   -10.583 1.00 0.00 ? 63  ALA A O    18 
ATOM 1012  C CB   . ALA A 1 63  ? -6.828  3.419   -10.599 1.00 0.00 ? 63  ALA A CB   18 
ATOM 1013  H H    . ALA A 1 63  ? -8.629  2.907   -8.840  1.00 0.00 ? 63  ALA A H    18 
ATOM 1014  H HA   . ALA A 1 63  ? -6.626  4.895   -9.048  1.00 0.00 ? 63  ALA A HA   18 
ATOM 1015  H HB1  . ALA A 1 63  ? -7.627  2.812   -10.999 1.00 0.00 ? 63  ALA A HB1  18 
ATOM 1016  H HB2  . ALA A 1 63  ? -6.300  3.901   -11.409 1.00 0.00 ? 63  ALA A HB2  18 
ATOM 1017  H HB3  . ALA A 1 63  ? -6.142  2.792   -10.048 1.00 0.00 ? 63  ALA A HB3  18 
ATOM 1018  N N    . LEU A 1 64  ? -9.186  5.320   -11.082 1.00 0.00 ? 64  LEU A N    18 
ATOM 1019  C CA   . LEU A 1 64  ? -9.888  6.355   -11.894 1.00 0.00 ? 64  LEU A CA   18 
ATOM 1020  C C    . LEU A 1 64  ? -10.556 7.358   -10.953 1.00 0.00 ? 64  LEU A C    18 
ATOM 1021  O O    . LEU A 1 64  ? -10.610 8.537   -11.221 1.00 0.00 ? 64  LEU A O    18 
ATOM 1022  C CB   . LEU A 1 64  ? -10.959 5.674   -12.747 1.00 0.00 ? 64  LEU A CB   18 
ATOM 1023  C CG   . LEU A 1 64  ? -10.285 4.830   -13.827 1.00 0.00 ? 64  LEU A CG   18 
ATOM 1024  C CD1  . LEU A 1 64  ? -11.305 3.865   -14.431 1.00 0.00 ? 64  LEU A CD1  18 
ATOM 1025  C CD2  . LEU A 1 64  ? -9.739  5.748   -14.924 1.00 0.00 ? 64  LEU A CD2  18 
ATOM 1026  H H    . LEU A 1 64  ? -9.580  4.428   -10.983 1.00 0.00 ? 64  LEU A H    18 
ATOM 1027  H HA   . LEU A 1 64  ? -9.180  6.866   -12.533 1.00 0.00 ? 64  LEU A HA   18 
ATOM 1028  H HB2  . LEU A 1 64  ? -11.566 5.037   -12.120 1.00 0.00 ? 64  LEU A HB2  18 
ATOM 1029  H HB3  . LEU A 1 64  ? -11.584 6.421   -13.210 1.00 0.00 ? 64  LEU A HB3  18 
ATOM 1030  H HG   . LEU A 1 64  ? -9.475  4.270   -13.385 1.00 0.00 ? 64  LEU A HG   18 
ATOM 1031  H HD11 . LEU A 1 64  ? -12.173 4.418   -14.760 1.00 0.00 ? 64  LEU A HD11 18 
ATOM 1032  H HD12 . LEU A 1 64  ? -10.863 3.354   -15.273 1.00 0.00 ? 64  LEU A HD12 18 
ATOM 1033  H HD13 . LEU A 1 64  ? -11.601 3.141   -13.685 1.00 0.00 ? 64  LEU A HD13 18 
ATOM 1034  H HD21 . LEU A 1 64  ? -9.204  6.570   -14.473 1.00 0.00 ? 64  LEU A HD21 18 
ATOM 1035  H HD22 . LEU A 1 64  ? -9.068  5.188   -15.560 1.00 0.00 ? 64  LEU A HD22 18 
ATOM 1036  H HD23 . LEU A 1 64  ? -10.558 6.132   -15.514 1.00 0.00 ? 64  LEU A HD23 18 
ATOM 1037  N N    . TYR A 1 65  ? -11.065 6.886   -9.852  1.00 0.00 ? 65  TYR A N    18 
ATOM 1038  C CA   . TYR A 1 65  ? -11.734 7.798   -8.881  1.00 0.00 ? 65  TYR A CA   18 
ATOM 1039  C C    . TYR A 1 65  ? -10.828 8.997   -8.598  1.00 0.00 ? 65  TYR A C    18 
ATOM 1040  O O    . TYR A 1 65  ? -11.290 10.092  -8.344  1.00 0.00 ? 65  TYR A O    18 
ATOM 1041  C CB   . TYR A 1 65  ? -11.997 7.028   -7.585  1.00 0.00 ? 65  TYR A CB   18 
ATOM 1042  C CG   . TYR A 1 65  ? -12.548 7.960   -6.533  1.00 0.00 ? 65  TYR A CG   18 
ATOM 1043  C CD1  . TYR A 1 65  ? -11.674 8.680   -5.710  1.00 0.00 ? 65  TYR A CD1  18 
ATOM 1044  C CD2  . TYR A 1 65  ? -13.933 8.094   -6.373  1.00 0.00 ? 65  TYR A CD2  18 
ATOM 1045  C CE1  . TYR A 1 65  ? -12.184 9.535   -4.726  1.00 0.00 ? 65  TYR A CE1  18 
ATOM 1046  C CE2  . TYR A 1 65  ? -14.441 8.950   -5.388  1.00 0.00 ? 65  TYR A CE2  18 
ATOM 1047  C CZ   . TYR A 1 65  ? -13.567 9.669   -4.564  1.00 0.00 ? 65  TYR A CZ   18 
ATOM 1048  O OH   . TYR A 1 65  ? -14.069 10.511  -3.594  1.00 0.00 ? 65  TYR A OH   18 
ATOM 1049  H H    . TYR A 1 65  ? -11.008 5.928   -9.663  1.00 0.00 ? 65  TYR A H    18 
ATOM 1050  H HA   . TYR A 1 65  ? -12.671 8.142   -9.292  1.00 0.00 ? 65  TYR A HA   18 
ATOM 1051  H HB2  . TYR A 1 65  ? -12.710 6.240   -7.774  1.00 0.00 ? 65  TYR A HB2  18 
ATOM 1052  H HB3  . TYR A 1 65  ? -11.072 6.598   -7.230  1.00 0.00 ? 65  TYR A HB3  18 
ATOM 1053  H HD1  . TYR A 1 65  ? -10.606 8.577   -5.835  1.00 0.00 ? 65  TYR A HD1  18 
ATOM 1054  H HD2  . TYR A 1 65  ? -14.611 7.541   -7.013  1.00 0.00 ? 65  TYR A HD2  18 
ATOM 1055  H HE1  . TYR A 1 65  ? -11.509 10.091  -4.091  1.00 0.00 ? 65  TYR A HE1  18 
ATOM 1056  H HE2  . TYR A 1 65  ? -15.509 9.051   -5.258  1.00 0.00 ? 65  TYR A HE2  18 
ATOM 1057  H HH   . TYR A 1 65  ? -13.554 11.322  -3.608  1.00 0.00 ? 65  TYR A HH   18 
ATOM 1058  N N    . ASN A 1 66  ? -9.541  8.798   -8.646  1.00 0.00 ? 66  ASN A N    18 
ATOM 1059  C CA   . ASN A 1 66  ? -8.595  9.919   -8.387  1.00 0.00 ? 66  ASN A CA   18 
ATOM 1060  C C    . ASN A 1 66  ? -8.195  10.550  -9.718  1.00 0.00 ? 66  ASN A C    18 
ATOM 1061  O O    . ASN A 1 66  ? -8.218  11.752  -9.889  1.00 0.00 ? 66  ASN A O    18 
ATOM 1062  C CB   . ASN A 1 66  ? -7.345  9.365   -7.723  1.00 0.00 ? 66  ASN A CB   18 
ATOM 1063  C CG   . ASN A 1 66  ? -6.738  10.421  -6.801  1.00 0.00 ? 66  ASN A CG   18 
ATOM 1064  O OD1  . ASN A 1 66  ? -7.375  10.865  -5.866  1.00 0.00 ? 66  ASN A OD1  18 
ATOM 1065  N ND2  . ASN A 1 66  ? -5.524  10.845  -7.024  1.00 0.00 ? 66  ASN A ND2  18 
ATOM 1066  H H    . ASN A 1 66  ? -9.191  7.907   -8.855  1.00 0.00 ? 66  ASN A H    18 
ATOM 1067  H HA   . ASN A 1 66  ? -9.058  10.657  -7.749  1.00 0.00 ? 66  ASN A HA   18 
ATOM 1068  H HB2  . ASN A 1 66  ? -7.602  8.485   -7.153  1.00 0.00 ? 66  ASN A HB2  18 
ATOM 1069  H HB3  . ASN A 1 66  ? -6.635  9.102   -8.489  1.00 0.00 ? 66  ASN A HB3  18 
ATOM 1070  H HD21 . ASN A 1 66  ? -5.009  10.486  -7.776  1.00 0.00 ? 66  ASN A HD21 18 
ATOM 1071  H HD22 . ASN A 1 66  ? -5.126  11.524  -6.437  1.00 0.00 ? 66  ASN A HD22 18 
ATOM 1072  N N    . GLN A 1 67  ? -7.829  9.730   -10.663 1.00 0.00 ? 67  GLN A N    18 
ATOM 1073  C CA   . GLN A 1 67  ? -7.421  10.242  -12.002 1.00 0.00 ? 67  GLN A CA   18 
ATOM 1074  C C    . GLN A 1 67  ? -8.537  11.099  -12.596 1.00 0.00 ? 67  GLN A C    18 
ATOM 1075  O O    . GLN A 1 67  ? -8.342  11.816  -13.557 1.00 0.00 ? 67  GLN A O    18 
ATOM 1076  C CB   . GLN A 1 67  ? -7.146  9.055   -12.926 1.00 0.00 ? 67  GLN A CB   18 
ATOM 1077  C CG   . GLN A 1 67  ? -5.670  8.663   -12.835 1.00 0.00 ? 67  GLN A CG   18 
ATOM 1078  C CD   . GLN A 1 67  ? -4.829  9.662   -13.634 1.00 0.00 ? 67  GLN A CD   18 
ATOM 1079  O OE1  . GLN A 1 67  ? -5.166  9.998   -14.751 1.00 0.00 ? 67  GLN A OE1  18 
ATOM 1080  N NE2  . GLN A 1 67  ? -3.743  10.153  -13.103 1.00 0.00 ? 67  GLN A NE2  18 
ATOM 1081  H H    . GLN A 1 67  ? -7.823  8.766   -10.489 1.00 0.00 ? 67  GLN A H    18 
ATOM 1082  H HA   . GLN A 1 67  ? -6.529  10.835  -11.903 1.00 0.00 ? 67  GLN A HA   18 
ATOM 1083  H HB2  . GLN A 1 67  ? -7.760  8.219   -12.623 1.00 0.00 ? 67  GLN A HB2  18 
ATOM 1084  H HB3  . GLN A 1 67  ? -7.386  9.324   -13.943 1.00 0.00 ? 67  GLN A HB3  18 
ATOM 1085  H HG2  . GLN A 1 67  ? -5.358  8.673   -11.801 1.00 0.00 ? 67  GLN A HG2  18 
ATOM 1086  H HG3  . GLN A 1 67  ? -5.534  7.673   -13.245 1.00 0.00 ? 67  GLN A HG3  18 
ATOM 1087  H HE21 . GLN A 1 67  ? -3.471  9.881   -12.202 1.00 0.00 ? 67  GLN A HE21 18 
ATOM 1088  H HE22 . GLN A 1 67  ? -3.199  10.795  -13.606 1.00 0.00 ? 67  GLN A HE22 18 
ATOM 1089  N N    . HIS A 1 68  ? -9.705  11.027  -12.032 1.00 0.00 ? 68  HIS A N    18 
ATOM 1090  C CA   . HIS A 1 68  ? -10.842 11.835  -12.561 1.00 0.00 ? 68  HIS A CA   18 
ATOM 1091  C C    . HIS A 1 68  ? -10.956 13.143  -11.775 1.00 0.00 ? 68  HIS A C    18 
ATOM 1092  O O    . HIS A 1 68  ? -11.177 14.198  -12.337 1.00 0.00 ? 68  HIS A O    18 
ATOM 1093  C CB   . HIS A 1 68  ? -12.144 11.042  -12.420 1.00 0.00 ? 68  HIS A CB   18 
ATOM 1094  C CG   . HIS A 1 68  ? -12.379 10.231  -13.665 1.00 0.00 ? 68  HIS A CG   18 
ATOM 1095  N ND1  . HIS A 1 68  ? -11.886 8.945   -13.820 1.00 0.00 ? 68  HIS A ND1  18 
ATOM 1096  C CD2  . HIS A 1 68  ? -13.059 10.514  -14.822 1.00 0.00 ? 68  HIS A CD2  18 
ATOM 1097  C CE1  . HIS A 1 68  ? -12.274 8.506   -15.031 1.00 0.00 ? 68  HIS A CE1  18 
ATOM 1098  N NE2  . HIS A 1 68  ? -12.992 9.424   -15.683 1.00 0.00 ? 68  HIS A NE2  18 
ATOM 1099  H H    . HIS A 1 68  ? -9.833  10.441  -11.261 1.00 0.00 ? 68  HIS A H    18 
ATOM 1100  H HA   . HIS A 1 68  ? -10.669 12.057  -13.603 1.00 0.00 ? 68  HIS A HA   18 
ATOM 1101  H HB2  . HIS A 1 68  ? -12.073 10.382  -11.569 1.00 0.00 ? 68  HIS A HB2  18 
ATOM 1102  H HB3  . HIS A 1 68  ? -12.966 11.727  -12.279 1.00 0.00 ? 68  HIS A HB3  18 
ATOM 1103  H HD1  . HIS A 1 68  ? -11.355 8.446   -13.167 1.00 0.00 ? 68  HIS A HD1  18 
ATOM 1104  H HD2  . HIS A 1 68  ? -13.572 11.442  -15.028 1.00 0.00 ? 68  HIS A HD2  18 
ATOM 1105  H HE1  . HIS A 1 68  ? -12.035 7.529   -15.426 1.00 0.00 ? 68  HIS A HE1  18 
ATOM 1106  N N    . ASN A 1 69  ? -10.810 13.086  -10.479 1.00 0.00 ? 69  ASN A N    18 
ATOM 1107  C CA   . ASN A 1 69  ? -10.916 14.329  -9.665  1.00 0.00 ? 69  ASN A CA   18 
ATOM 1108  C C    . ASN A 1 69  ? -9.511  14.801  -9.263  1.00 0.00 ? 69  ASN A C    18 
ATOM 1109  O O    . ASN A 1 69  ? -8.800  14.093  -8.577  1.00 0.00 ? 69  ASN A O    18 
ATOM 1110  C CB   . ASN A 1 69  ? -11.730 14.037  -8.402  1.00 0.00 ? 69  ASN A CB   18 
ATOM 1111  C CG   . ASN A 1 69  ? -13.189 13.775  -8.783  1.00 0.00 ? 69  ASN A CG   18 
ATOM 1112  O OD1  . ASN A 1 69  ? -13.723 14.414  -9.667  1.00 0.00 ? 69  ASN A OD1  18 
ATOM 1113  N ND2  . ASN A 1 69  ? -13.860 12.853  -8.147  1.00 0.00 ? 69  ASN A ND2  18 
ATOM 1114  H H    . ASN A 1 69  ? -10.635 12.227  -10.043 1.00 0.00 ? 69  ASN A H    18 
ATOM 1115  H HA   . ASN A 1 69  ? -11.412 15.093  -10.240 1.00 0.00 ? 69  ASN A HA   18 
ATOM 1116  H HB2  . ASN A 1 69  ? -11.325 13.168  -7.905  1.00 0.00 ? 69  ASN A HB2  18 
ATOM 1117  H HB3  . ASN A 1 69  ? -11.682 14.887  -7.738  1.00 0.00 ? 69  ASN A HB3  18 
ATOM 1118  H HD21 . ASN A 1 69  ? -13.429 12.337  -7.434  1.00 0.00 ? 69  ASN A HD21 18 
ATOM 1119  H HD22 . ASN A 1 69  ? -14.794 12.678  -8.384  1.00 0.00 ? 69  ASN A HD22 18 
ATOM 1120  N N    . PRO A 1 70  ? -9.150  15.984  -9.698  1.00 0.00 ? 70  PRO A N    18 
ATOM 1121  C CA   . PRO A 1 70  ? -7.835  16.570  -9.390  1.00 0.00 ? 70  PRO A CA   18 
ATOM 1122  C C    . PRO A 1 70  ? -7.827  17.127  -7.964  1.00 0.00 ? 70  PRO A C    18 
ATOM 1123  O O    . PRO A 1 70  ? -8.711  17.863  -7.571  1.00 0.00 ? 70  PRO A O    18 
ATOM 1124  C CB   . PRO A 1 70  ? -7.690  17.694  -10.419 1.00 0.00 ? 70  PRO A CB   18 
ATOM 1125  C CG   . PRO A 1 70  ? -9.124  18.057  -10.871 1.00 0.00 ? 70  PRO A CG   18 
ATOM 1126  C CD   . PRO A 1 70  ? -10.014 16.847  -10.531 1.00 0.00 ? 70  PRO A CD   18 
ATOM 1127  H HA   . PRO A 1 70  ? -7.051  15.842  -9.522  1.00 0.00 ? 70  PRO A HA   18 
ATOM 1128  H HB2  . PRO A 1 70  ? -7.210  18.551  -9.966  1.00 0.00 ? 70  PRO A HB2  18 
ATOM 1129  H HB3  . PRO A 1 70  ? -7.118  17.351  -11.266 1.00 0.00 ? 70  PRO A HB3  18 
ATOM 1130  H HG2  . PRO A 1 70  ? -9.467  18.934  -10.339 1.00 0.00 ? 70  PRO A HG2  18 
ATOM 1131  H HG3  . PRO A 1 70  ? -9.143  18.236  -11.935 1.00 0.00 ? 70  PRO A HG3  18 
ATOM 1132  H HD2  . PRO A 1 70  ? -10.885 17.164  -9.975  1.00 0.00 ? 70  PRO A HD2  18 
ATOM 1133  H HD3  . PRO A 1 70  ? -10.304 16.325  -11.429 1.00 0.00 ? 70  PRO A HD3  18 
ATOM 1134  N N    . GLY A 1 71  ? -6.841  16.780  -7.185  1.00 0.00 ? 71  GLY A N    18 
ATOM 1135  C CA   . GLY A 1 71  ? -6.784  17.287  -5.786  1.00 0.00 ? 71  GLY A CA   18 
ATOM 1136  C C    . GLY A 1 71  ? -7.263  16.194  -4.829  1.00 0.00 ? 71  GLY A C    18 
ATOM 1137  O O    . GLY A 1 71  ? -7.154  16.318  -3.625  1.00 0.00 ? 71  GLY A O    18 
ATOM 1138  H H    . GLY A 1 71  ? -6.139  16.183  -7.520  1.00 0.00 ? 71  GLY A H    18 
ATOM 1139  H HA2  . GLY A 1 71  ? -5.766  17.561  -5.543  1.00 0.00 ? 71  GLY A HA2  18 
ATOM 1140  H HA3  . GLY A 1 71  ? -7.422  18.151  -5.689  1.00 0.00 ? 71  GLY A HA3  18 
ATOM 1141  N N    . ALA A 1 72  ? -7.787  15.121  -5.355  1.00 0.00 ? 72  ALA A N    18 
ATOM 1142  C CA   . ALA A 1 72  ? -8.265  14.020  -4.484  1.00 0.00 ? 72  ALA A CA   18 
ATOM 1143  C C    . ALA A 1 72  ? -7.072  13.178  -4.049  1.00 0.00 ? 72  ALA A C    18 
ATOM 1144  O O    . ALA A 1 72  ? -6.319  12.675  -4.857  1.00 0.00 ? 72  ALA A O    18 
ATOM 1145  C CB   . ALA A 1 72  ? -9.254  13.145  -5.253  1.00 0.00 ? 72  ALA A CB   18 
ATOM 1146  H H    . ALA A 1 72  ? -7.859  15.037  -6.321  1.00 0.00 ? 72  ALA A H    18 
ATOM 1147  H HA   . ALA A 1 72  ? -8.752  14.434  -3.613  1.00 0.00 ? 72  ALA A HA   18 
ATOM 1148  H HB1  . ALA A 1 72  ? -9.277  13.451  -6.288  1.00 0.00 ? 72  ALA A HB1  18 
ATOM 1149  H HB2  . ALA A 1 72  ? -8.944  12.112  -5.188  1.00 0.00 ? 72  ALA A HB2  18 
ATOM 1150  H HB3  . ALA A 1 72  ? -10.239 13.252  -4.822  1.00 0.00 ? 72  ALA A HB3  18 
ATOM 1151  N N    . SER A 1 73  ? -6.896  13.035  -2.775  1.00 0.00 ? 73  SER A N    18 
ATOM 1152  C CA   . SER A 1 73  ? -5.747  12.236  -2.264  1.00 0.00 ? 73  SER A CA   18 
ATOM 1153  C C    . SER A 1 73  ? -6.233  10.851  -1.826  1.00 0.00 ? 73  SER A C    18 
ATOM 1154  O O    . SER A 1 73  ? -5.659  10.234  -0.952  1.00 0.00 ? 73  SER A O    18 
ATOM 1155  C CB   . SER A 1 73  ? -5.118  12.955  -1.070  1.00 0.00 ? 73  SER A CB   18 
ATOM 1156  O OG   . SER A 1 73  ? -4.369  14.070  -1.535  1.00 0.00 ? 73  SER A OG   18 
ATOM 1157  H H    . SER A 1 73  ? -7.517  13.462  -2.155  1.00 0.00 ? 73  SER A H    18 
ATOM 1158  H HA   . SER A 1 73  ? -5.011  12.127  -3.045  1.00 0.00 ? 73  SER A HA   18 
ATOM 1159  H HB2  . SER A 1 73  ? -5.893  13.301  -0.405  1.00 0.00 ? 73  SER A HB2  18 
ATOM 1160  H HB3  . SER A 1 73  ? -4.472  12.269  -0.538  1.00 0.00 ? 73  SER A HB3  18 
ATOM 1161  H HG   . SER A 1 73  ? -4.880  14.864  -1.361  1.00 0.00 ? 73  SER A HG   18 
ATOM 1162  N N    . ALA A 1 74  ? -7.281  10.353  -2.428  1.00 0.00 ? 74  ALA A N    18 
ATOM 1163  C CA   . ALA A 1 74  ? -7.785  9.004   -2.038  1.00 0.00 ? 74  ALA A CA   18 
ATOM 1164  C C    . ALA A 1 74  ? -7.305  7.968   -3.058  1.00 0.00 ? 74  ALA A C    18 
ATOM 1165  O O    . ALA A 1 74  ? -7.817  6.869   -3.132  1.00 0.00 ? 74  ALA A O    18 
ATOM 1166  C CB   . ALA A 1 74  ? -9.317  9.016   -1.988  1.00 0.00 ? 74  ALA A CB   18 
ATOM 1167  H H    . ALA A 1 74  ? -7.731  10.861  -3.134  1.00 0.00 ? 74  ALA A H    18 
ATOM 1168  H HA   . ALA A 1 74  ? -7.397  8.749   -1.064  1.00 0.00 ? 74  ALA A HA   18 
ATOM 1169  H HB1  . ALA A 1 74  ? -9.706  9.459   -2.892  1.00 0.00 ? 74  ALA A HB1  18 
ATOM 1170  H HB2  . ALA A 1 74  ? -9.681  8.002   -1.898  1.00 0.00 ? 74  ALA A HB2  18 
ATOM 1171  H HB3  . ALA A 1 74  ? -9.645  9.591   -1.134  1.00 0.00 ? 74  ALA A HB3  18 
ATOM 1172  N N    . ALA A 1 75  ? -6.316  8.312   -3.838  1.00 0.00 ? 75  ALA A N    18 
ATOM 1173  C CA   . ALA A 1 75  ? -5.785  7.353   -4.849  1.00 0.00 ? 75  ALA A CA   18 
ATOM 1174  C C    . ALA A 1 75  ? -5.436  6.033   -4.145  1.00 0.00 ? 75  ALA A C    18 
ATOM 1175  O O    . ALA A 1 75  ? -5.715  5.878   -2.973  1.00 0.00 ? 75  ALA A O    18 
ATOM 1176  C CB   . ALA A 1 75  ? -4.532  7.959   -5.482  1.00 0.00 ? 75  ALA A CB   18 
ATOM 1177  H H    . ALA A 1 75  ? -5.916  9.203   -3.754  1.00 0.00 ? 75  ALA A H    18 
ATOM 1178  H HA   . ALA A 1 75  ? -6.530  7.175   -5.610  1.00 0.00 ? 75  ALA A HA   18 
ATOM 1179  H HB1  . ALA A 1 75  ? -4.454  8.999   -5.202  1.00 0.00 ? 75  ALA A HB1  18 
ATOM 1180  H HB2  . ALA A 1 75  ? -3.659  7.426   -5.136  1.00 0.00 ? 75  ALA A HB2  18 
ATOM 1181  H HB3  . ALA A 1 75  ? -4.598  7.881   -6.558  1.00 0.00 ? 75  ALA A HB3  18 
ATOM 1182  N N    . PRO A 1 76  ? -4.834  5.115   -4.869  1.00 0.00 ? 76  PRO A N    18 
ATOM 1183  C CA   . PRO A 1 76  ? -4.449  3.811   -4.304  1.00 0.00 ? 76  PRO A CA   18 
ATOM 1184  C C    . PRO A 1 76  ? -3.189  3.971   -3.459  1.00 0.00 ? 76  PRO A C    18 
ATOM 1185  O O    . PRO A 1 76  ? -2.838  5.063   -3.059  1.00 0.00 ? 76  PRO A O    18 
ATOM 1186  C CB   . PRO A 1 76  ? -4.181  2.944   -5.534  1.00 0.00 ? 76  PRO A CB   18 
ATOM 1187  C CG   . PRO A 1 76  ? -3.874  3.920   -6.690  1.00 0.00 ? 76  PRO A CG   18 
ATOM 1188  C CD   . PRO A 1 76  ? -4.478  5.281   -6.295  1.00 0.00 ? 76  PRO A CD   18 
ATOM 1189  H HA   . PRO A 1 76  ? -5.252  3.392   -3.721  1.00 0.00 ? 76  PRO A HA   18 
ATOM 1190  H HB2  . PRO A 1 76  ? -3.334  2.297   -5.353  1.00 0.00 ? 76  PRO A HB2  18 
ATOM 1191  H HB3  . PRO A 1 76  ? -5.055  2.358   -5.775  1.00 0.00 ? 76  PRO A HB3  18 
ATOM 1192  H HG2  . PRO A 1 76  ? -2.802  4.009   -6.815  1.00 0.00 ? 76  PRO A HG2  18 
ATOM 1193  H HG3  . PRO A 1 76  ? -4.326  3.568   -7.604  1.00 0.00 ? 76  PRO A HG3  18 
ATOM 1194  H HD2  . PRO A 1 76  ? -3.742  6.059   -6.421  1.00 0.00 ? 76  PRO A HD2  18 
ATOM 1195  H HD3  . PRO A 1 76  ? -5.361  5.491   -6.879  1.00 0.00 ? 76  PRO A HD3  18 
ATOM 1196  N N    . CYS A 1 77  ? -2.505  2.900   -3.172  1.00 0.00 ? 77  CYS A N    18 
ATOM 1197  C CA   . CYS A 1 77  ? -1.279  3.031   -2.343  1.00 0.00 ? 77  CYS A CA   18 
ATOM 1198  C C    . CYS A 1 77  ? -0.215  2.020   -2.776  1.00 0.00 ? 77  CYS A C    18 
ATOM 1199  O O    . CYS A 1 77  ? -0.201  0.887   -2.334  1.00 0.00 ? 77  CYS A O    18 
ATOM 1200  C CB   . CYS A 1 77  ? -1.637  2.804   -0.875  1.00 0.00 ? 77  CYS A CB   18 
ATOM 1201  S SG   . CYS A 1 77  ? -0.960  4.161   0.108   1.00 0.00 ? 77  CYS A SG   18 
ATOM 1202  H H    . CYS A 1 77  ? -2.798  2.021   -3.492  1.00 0.00 ? 77  CYS A H    18 
ATOM 1203  H HA   . CYS A 1 77  ? -0.883  4.029   -2.456  1.00 0.00 ? 77  CYS A HA   18 
ATOM 1204  H HB2  . CYS A 1 77  ? -2.711  2.775   -0.764  1.00 0.00 ? 77  CYS A HB2  18 
ATOM 1205  H HB3  . CYS A 1 77  ? -1.213  1.869   -0.540  1.00 0.00 ? 77  CYS A HB3  18 
ATOM 1206  N N    . CYS A 1 78  ? 0.693   2.430   -3.623  1.00 0.00 ? 78  CYS A N    18 
ATOM 1207  C CA   . CYS A 1 78  ? 1.772   1.500   -4.060  1.00 0.00 ? 78  CYS A CA   18 
ATOM 1208  C C    . CYS A 1 78  ? 2.553   1.059   -2.813  1.00 0.00 ? 78  CYS A C    18 
ATOM 1209  O O    . CYS A 1 78  ? 2.743   1.831   -1.895  1.00 0.00 ? 78  CYS A O    18 
ATOM 1210  C CB   . CYS A 1 78  ? 2.696   2.228   -5.046  1.00 0.00 ? 78  CYS A CB   18 
ATOM 1211  S SG   . CYS A 1 78  ? 4.087   1.159   -5.499  1.00 0.00 ? 78  CYS A SG   18 
ATOM 1212  H H    . CYS A 1 78  ? 0.671   3.352   -3.957  1.00 0.00 ? 78  CYS A H    18 
ATOM 1213  H HA   . CYS A 1 78  ? 1.330   0.641   -4.536  1.00 0.00 ? 78  CYS A HA   18 
ATOM 1214  H HB2  . CYS A 1 78  ? 2.140   2.488   -5.931  1.00 0.00 ? 78  CYS A HB2  18 
ATOM 1215  H HB3  . CYS A 1 78  ? 3.073   3.128   -4.583  1.00 0.00 ? 78  CYS A HB3  18 
ATOM 1216  N N    . VAL A 1 79  ? 2.977   -0.179  -2.744  1.00 0.00 ? 79  VAL A N    18 
ATOM 1217  C CA   . VAL A 1 79  ? 3.697   -0.641  -1.522  1.00 0.00 ? 79  VAL A CA   18 
ATOM 1218  C C    . VAL A 1 79  ? 4.839   -1.608  -1.874  1.00 0.00 ? 79  VAL A C    18 
ATOM 1219  O O    . VAL A 1 79  ? 4.873   -2.161  -2.949  1.00 0.00 ? 79  VAL A O    18 
ATOM 1220  C CB   . VAL A 1 79  ? 2.684   -1.342  -0.614  1.00 0.00 ? 79  VAL A CB   18 
ATOM 1221  C CG1  . VAL A 1 79  ? 1.382   -0.549  -0.621  1.00 0.00 ? 79  VAL A CG1  18 
ATOM 1222  C CG2  . VAL A 1 79  ? 2.405   -2.753  -1.137  1.00 0.00 ? 79  VAL A CG2  18 
ATOM 1223  H H    . VAL A 1 79  ? 2.799   -0.802  -3.470  1.00 0.00 ? 79  VAL A H    18 
ATOM 1224  H HA   . VAL A 1 79  ? 4.098   0.213   -1.012  1.00 0.00 ? 79  VAL A HA   18 
ATOM 1225  H HB   . VAL A 1 79  ? 3.070   -1.394  0.391   1.00 0.00 ? 79  VAL A HB   18 
ATOM 1226  H HG11 . VAL A 1 79  ? 1.601   0.498   -0.753  1.00 0.00 ? 79  VAL A HG11 18 
ATOM 1227  H HG12 . VAL A 1 79  ? 0.760   -0.893  -1.434  1.00 0.00 ? 79  VAL A HG12 18 
ATOM 1228  H HG13 . VAL A 1 79  ? 0.869   -0.697  0.315   1.00 0.00 ? 79  VAL A HG13 18 
ATOM 1229  H HG21 . VAL A 1 79  ? 2.350   -2.733  -2.215  1.00 0.00 ? 79  VAL A HG21 18 
ATOM 1230  H HG22 . VAL A 1 79  ? 3.199   -3.416  -0.828  1.00 0.00 ? 79  VAL A HG22 18 
ATOM 1231  H HG23 . VAL A 1 79  ? 1.465   -3.105  -0.736  1.00 0.00 ? 79  VAL A HG23 18 
ATOM 1232  N N    . PRO A 1 80  ? 5.741   -1.786  -0.937  1.00 0.00 ? 80  PRO A N    18 
ATOM 1233  C CA   . PRO A 1 80  ? 6.900   -2.684  -1.103  1.00 0.00 ? 80  PRO A CA   18 
ATOM 1234  C C    . PRO A 1 80  ? 6.472   -4.149  -0.978  1.00 0.00 ? 80  PRO A C    18 
ATOM 1235  O O    . PRO A 1 80  ? 6.363   -4.685  0.108   1.00 0.00 ? 80  PRO A O    18 
ATOM 1236  C CB   . PRO A 1 80  ? 7.835   -2.287  0.044   1.00 0.00 ? 80  PRO A CB   18 
ATOM 1237  C CG   . PRO A 1 80  ? 6.950   -1.600  1.108   1.00 0.00 ? 80  PRO A CG   18 
ATOM 1238  C CD   . PRO A 1 80  ? 5.683   -1.116  0.379   1.00 0.00 ? 80  PRO A CD   18 
ATOM 1239  H HA   . PRO A 1 80  ? 7.387   -2.509  -2.047  1.00 0.00 ? 80  PRO A HA   18 
ATOM 1240  H HB2  . PRO A 1 80  ? 8.302   -3.171  0.460   1.00 0.00 ? 80  PRO A HB2  18 
ATOM 1241  H HB3  . PRO A 1 80  ? 8.587   -1.599  -0.306  1.00 0.00 ? 80  PRO A HB3  18 
ATOM 1242  H HG2  . PRO A 1 80  ? 6.689   -2.306  1.885   1.00 0.00 ? 80  PRO A HG2  18 
ATOM 1243  H HG3  . PRO A 1 80  ? 7.470   -0.755  1.533   1.00 0.00 ? 80  PRO A HG3  18 
ATOM 1244  H HD2  . PRO A 1 80  ? 4.803   -1.420  0.925   1.00 0.00 ? 80  PRO A HD2  18 
ATOM 1245  H HD3  . PRO A 1 80  ? 5.702   -0.045  0.254   1.00 0.00 ? 80  PRO A HD3  18 
ATOM 1246  N N    . GLN A 1 81  ? 6.233   -4.802  -2.082  1.00 0.00 ? 81  GLN A N    18 
ATOM 1247  C CA   . GLN A 1 81  ? 5.819   -6.232  -2.027  1.00 0.00 ? 81  GLN A CA   18 
ATOM 1248  C C    . GLN A 1 81  ? 6.965   -7.065  -1.450  1.00 0.00 ? 81  GLN A C    18 
ATOM 1249  O O    . GLN A 1 81  ? 6.884   -7.572  -0.349  1.00 0.00 ? 81  GLN A O    18 
ATOM 1250  C CB   . GLN A 1 81  ? 5.492   -6.723  -3.438  1.00 0.00 ? 81  GLN A CB   18 
ATOM 1251  C CG   . GLN A 1 81  ? 4.560   -7.933  -3.355  1.00 0.00 ? 81  GLN A CG   18 
ATOM 1252  C CD   . GLN A 1 81  ? 4.530   -8.651  -4.705  1.00 0.00 ? 81  GLN A CD   18 
ATOM 1253  O OE1  . GLN A 1 81  ? 5.467   -9.336  -5.064  1.00 0.00 ? 81  GLN A OE1  18 
ATOM 1254  N NE2  . GLN A 1 81  ? 3.484   -8.522  -5.475  1.00 0.00 ? 81  GLN A NE2  18 
ATOM 1255  H H    . GLN A 1 81  ? 6.330   -4.354  -2.948  1.00 0.00 ? 81  GLN A H    18 
ATOM 1256  H HA   . GLN A 1 81  ? 4.946   -6.332  -1.397  1.00 0.00 ? 81  GLN A HA   18 
ATOM 1257  H HB2  . GLN A 1 81  ? 5.007   -5.931  -3.991  1.00 0.00 ? 81  GLN A HB2  18 
ATOM 1258  H HB3  . GLN A 1 81  ? 6.403   -7.007  -3.941  1.00 0.00 ? 81  GLN A HB3  18 
ATOM 1259  H HG2  . GLN A 1 81  ? 4.919   -8.611  -2.593  1.00 0.00 ? 81  GLN A HG2  18 
ATOM 1260  H HG3  . GLN A 1 81  ? 3.564   -7.604  -3.103  1.00 0.00 ? 81  GLN A HG3  18 
ATOM 1261  H HE21 . GLN A 1 81  ? 2.728   -7.970  -5.187  1.00 0.00 ? 81  GLN A HE21 18 
ATOM 1262  H HE22 . GLN A 1 81  ? 3.455   -8.978  -6.342  1.00 0.00 ? 81  GLN A HE22 18 
ATOM 1263  N N    . ALA A 1 82  ? 8.035   -7.203  -2.183  1.00 0.00 ? 82  ALA A N    18 
ATOM 1264  C CA   . ALA A 1 82  ? 9.188   -7.997  -1.675  1.00 0.00 ? 82  ALA A CA   18 
ATOM 1265  C C    . ALA A 1 82  ? 10.126  -7.075  -0.895  1.00 0.00 ? 82  ALA A C    18 
ATOM 1266  O O    . ALA A 1 82  ? 10.139  -5.877  -1.094  1.00 0.00 ? 82  ALA A O    18 
ATOM 1267  C CB   . ALA A 1 82  ? 9.944   -8.617  -2.851  1.00 0.00 ? 82  ALA A CB   18 
ATOM 1268  H H    . ALA A 1 82  ? 8.082   -6.782  -3.066  1.00 0.00 ? 82  ALA A H    18 
ATOM 1269  H HA   . ALA A 1 82  ? 8.828   -8.780  -1.023  1.00 0.00 ? 82  ALA A HA   18 
ATOM 1270  H HB1  . ALA A 1 82  ? 9.238   -9.037  -3.552  1.00 0.00 ? 82  ALA A HB1  18 
ATOM 1271  H HB2  . ALA A 1 82  ? 10.529  -7.854  -3.345  1.00 0.00 ? 82  ALA A HB2  18 
ATOM 1272  H HB3  . ALA A 1 82  ? 10.598  -9.395  -2.489  1.00 0.00 ? 82  ALA A HB3  18 
ATOM 1273  N N    . LEU A 1 83  ? 10.908  -7.622  -0.006  1.00 0.00 ? 83  LEU A N    18 
ATOM 1274  C CA   . LEU A 1 83  ? 11.838  -6.770  0.784   1.00 0.00 ? 83  LEU A CA   18 
ATOM 1275  C C    . LEU A 1 83  ? 13.196  -7.450  0.891   1.00 0.00 ? 83  LEU A C    18 
ATOM 1276  O O    . LEU A 1 83  ? 13.481  -8.422  0.220   1.00 0.00 ? 83  LEU A O    18 
ATOM 1277  C CB   . LEU A 1 83  ? 11.275  -6.562  2.190   1.00 0.00 ? 83  LEU A CB   18 
ATOM 1278  C CG   . LEU A 1 83  ? 9.959   -5.801  2.095   1.00 0.00 ? 83  LEU A CG   18 
ATOM 1279  C CD1  . LEU A 1 83  ? 9.042   -6.213  3.248   1.00 0.00 ? 83  LEU A CD1  18 
ATOM 1280  C CD2  . LEU A 1 83  ? 10.235  -4.300  2.173   1.00 0.00 ? 83  LEU A CD2  18 
ATOM 1281  H H    . LEU A 1 83  ? 10.882  -8.589  0.144   1.00 0.00 ? 83  LEU A H    18 
ATOM 1282  H HA   . LEU A 1 83  ? 11.952  -5.813  0.300   1.00 0.00 ? 83  LEU A HA   18 
ATOM 1283  H HB2  . LEU A 1 83  ? 11.108  -7.520  2.657   1.00 0.00 ? 83  LEU A HB2  18 
ATOM 1284  H HB3  . LEU A 1 83  ? 11.976  -5.991  2.780   1.00 0.00 ? 83  LEU A HB3  18 
ATOM 1285  H HG   . LEU A 1 83  ? 9.486   -6.032  1.156   1.00 0.00 ? 83  LEU A HG   18 
ATOM 1286  H HD11 . LEU A 1 83  ? 9.098   -7.282  3.389   1.00 0.00 ? 83  LEU A HD11 18 
ATOM 1287  H HD12 . LEU A 1 83  ? 9.355   -5.713  4.153   1.00 0.00 ? 83  LEU A HD12 18 
ATOM 1288  H HD13 . LEU A 1 83  ? 8.025   -5.933  3.017   1.00 0.00 ? 83  LEU A HD13 18 
ATOM 1289  H HD21 . LEU A 1 83  ? 10.989  -4.111  2.922   1.00 0.00 ? 83  LEU A HD21 18 
ATOM 1290  H HD22 . LEU A 1 83  ? 10.584  -3.949  1.214   1.00 0.00 ? 83  LEU A HD22 18 
ATOM 1291  H HD23 . LEU A 1 83  ? 9.326   -3.781  2.438   1.00 0.00 ? 83  LEU A HD23 18 
ATOM 1292  N N    . GLU A 1 84  ? 14.027  -6.939  1.744   1.00 0.00 ? 84  GLU A N    18 
ATOM 1293  C CA   . GLU A 1 84  ? 15.376  -7.532  1.936   1.00 0.00 ? 84  GLU A CA   18 
ATOM 1294  C C    . GLU A 1 84  ? 15.805  -7.290  3.382   1.00 0.00 ? 84  GLU A C    18 
ATOM 1295  O O    . GLU A 1 84  ? 15.325  -6.375  4.018   1.00 0.00 ? 84  GLU A O    18 
ATOM 1296  C CB   . GLU A 1 84  ? 16.373  -6.870  0.981   1.00 0.00 ? 84  GLU A CB   18 
ATOM 1297  C CG   . GLU A 1 84  ? 16.587  -7.769  -0.238  1.00 0.00 ? 84  GLU A CG   18 
ATOM 1298  C CD   . GLU A 1 84  ? 17.814  -7.291  -1.017  1.00 0.00 ? 84  GLU A CD   18 
ATOM 1299  O OE1  . GLU A 1 84  ? 18.785  -6.914  -0.381  1.00 0.00 ? 84  GLU A OE1  18 
ATOM 1300  O OE2  . GLU A 1 84  ? 17.763  -7.310  -2.235  1.00 0.00 ? 84  GLU A OE2  18 
ATOM 1301  H H    . GLU A 1 84  ? 13.755  -6.159  2.271   1.00 0.00 ? 84  GLU A H    18 
ATOM 1302  H HA   . GLU A 1 84  ? 15.337  -8.594  1.742   1.00 0.00 ? 84  GLU A HA   18 
ATOM 1303  H HB2  . GLU A 1 84  ? 15.984  -5.914  0.660   1.00 0.00 ? 84  GLU A HB2  18 
ATOM 1304  H HB3  . GLU A 1 84  ? 17.314  -6.724  1.488   1.00 0.00 ? 84  GLU A HB3  18 
ATOM 1305  H HG2  . GLU A 1 84  ? 16.741  -8.787  0.090   1.00 0.00 ? 84  GLU A HG2  18 
ATOM 1306  H HG3  . GLU A 1 84  ? 15.718  -7.723  -0.876  1.00 0.00 ? 84  GLU A HG3  18 
ATOM 1307  N N    . PRO A 1 85  ? 16.692  -8.117  3.862   1.00 0.00 ? 85  PRO A N    18 
ATOM 1308  C CA   . PRO A 1 85  ? 17.196  -8.018  5.240   1.00 0.00 ? 85  PRO A CA   18 
ATOM 1309  C C    . PRO A 1 85  ? 18.162  -6.840  5.380   1.00 0.00 ? 85  PRO A C    18 
ATOM 1310  O O    . PRO A 1 85  ? 18.174  -5.936  4.568   1.00 0.00 ? 85  PRO A O    18 
ATOM 1311  C CB   . PRO A 1 85  ? 17.893  -9.361  5.469   1.00 0.00 ? 85  PRO A CB   18 
ATOM 1312  C CG   . PRO A 1 85  ? 18.225  -9.923  4.068   1.00 0.00 ? 85  PRO A CG   18 
ATOM 1313  C CD   . PRO A 1 85  ? 17.282  -9.218  3.076   1.00 0.00 ? 85  PRO A CD   18 
ATOM 1314  H HA   . PRO A 1 85  ? 16.375  -7.913  5.932   1.00 0.00 ? 85  PRO A HA   18 
ATOM 1315  H HB2  . PRO A 1 85  ? 18.801  -9.214  6.038   1.00 0.00 ? 85  PRO A HB2  18 
ATOM 1316  H HB3  . PRO A 1 85  ? 17.233  -10.040 5.986   1.00 0.00 ? 85  PRO A HB3  18 
ATOM 1317  H HG2  . PRO A 1 85  ? 19.254  -9.711  3.819   1.00 0.00 ? 85  PRO A HG2  18 
ATOM 1318  H HG3  . PRO A 1 85  ? 18.046  -10.986 4.045   1.00 0.00 ? 85  PRO A HG3  18 
ATOM 1319  H HD2  . PRO A 1 85  ? 17.840  -8.831  2.235   1.00 0.00 ? 85  PRO A HD2  18 
ATOM 1320  H HD3  . PRO A 1 85  ? 16.509  -9.893  2.742   1.00 0.00 ? 85  PRO A HD3  18 
ATOM 1321  N N    . LEU A 1 86  ? 18.955  -6.827  6.415   1.00 0.00 ? 86  LEU A N    18 
ATOM 1322  C CA   . LEU A 1 86  ? 19.895  -5.690  6.617   1.00 0.00 ? 86  LEU A CA   18 
ATOM 1323  C C    . LEU A 1 86  ? 20.951  -6.089  7.658   1.00 0.00 ? 86  LEU A C    18 
ATOM 1324  O O    . LEU A 1 86  ? 20.647  -6.194  8.827   1.00 0.00 ? 86  LEU A O    18 
ATOM 1325  C CB   . LEU A 1 86  ? 19.067  -4.475  7.095   1.00 0.00 ? 86  LEU A CB   18 
ATOM 1326  C CG   . LEU A 1 86  ? 19.873  -3.546  8.020   1.00 0.00 ? 86  LEU A CG   18 
ATOM 1327  C CD1  . LEU A 1 86  ? 20.579  -2.467  7.205   1.00 0.00 ? 86  LEU A CD1  18 
ATOM 1328  C CD2  . LEU A 1 86  ? 18.919  -2.872  9.006   1.00 0.00 ? 86  LEU A CD2  18 
ATOM 1329  H H    . LEU A 1 86  ? 18.918  -7.556  7.073   1.00 0.00 ? 86  LEU A H    18 
ATOM 1330  H HA   . LEU A 1 86  ? 20.374  -5.450  5.680   1.00 0.00 ? 86  LEU A HA   18 
ATOM 1331  H HB2  . LEU A 1 86  ? 18.743  -3.911  6.233   1.00 0.00 ? 86  LEU A HB2  18 
ATOM 1332  H HB3  . LEU A 1 86  ? 18.197  -4.832  7.626   1.00 0.00 ? 86  LEU A HB3  18 
ATOM 1333  H HG   . LEU A 1 86  ? 20.603  -4.113  8.563   1.00 0.00 ? 86  LEU A HG   18 
ATOM 1334  H HD11 . LEU A 1 86  ? 20.181  -2.453  6.203   1.00 0.00 ? 86  LEU A HD11 18 
ATOM 1335  H HD12 . LEU A 1 86  ? 20.416  -1.505  7.671   1.00 0.00 ? 86  LEU A HD12 18 
ATOM 1336  H HD13 . LEU A 1 86  ? 21.638  -2.675  7.174   1.00 0.00 ? 86  LEU A HD13 18 
ATOM 1337  H HD21 . LEU A 1 86  ? 18.176  -3.582  9.331   1.00 0.00 ? 86  LEU A HD21 18 
ATOM 1338  H HD22 . LEU A 1 86  ? 19.476  -2.518  9.860   1.00 0.00 ? 86  LEU A HD22 18 
ATOM 1339  H HD23 . LEU A 1 86  ? 18.434  -2.037  8.523   1.00 0.00 ? 86  LEU A HD23 18 
ATOM 1340  N N    . PRO A 1 87  ? 22.167  -6.288  7.209   1.00 0.00 ? 87  PRO A N    18 
ATOM 1341  C CA   . PRO A 1 87  ? 23.283  -6.663  8.096   1.00 0.00 ? 87  PRO A CA   18 
ATOM 1342  C C    . PRO A 1 87  ? 23.727  -5.441  8.900   1.00 0.00 ? 87  PRO A C    18 
ATOM 1343  O O    . PRO A 1 87  ? 24.330  -4.526  8.377   1.00 0.00 ? 87  PRO A O    18 
ATOM 1344  C CB   . PRO A 1 87  ? 24.376  -7.127  7.130   1.00 0.00 ? 87  PRO A CB   18 
ATOM 1345  C CG   . PRO A 1 87  ? 24.048  -6.482  5.763   1.00 0.00 ? 87  PRO A CG   18 
ATOM 1346  C CD   . PRO A 1 87  ? 22.545  -6.147  5.787   1.00 0.00 ? 87  PRO A CD   18 
ATOM 1347  H HA   . PRO A 1 87  ? 23.000  -7.470  8.753   1.00 0.00 ? 87  PRO A HA   18 
ATOM 1348  H HB2  . PRO A 1 87  ? 25.344  -6.797  7.479   1.00 0.00 ? 87  PRO A HB2  18 
ATOM 1349  H HB3  . PRO A 1 87  ? 24.359  -8.202  7.038   1.00 0.00 ? 87  PRO A HB3  18 
ATOM 1350  H HG2  . PRO A 1 87  ? 24.631  -5.581  5.631   1.00 0.00 ? 87  PRO A HG2  18 
ATOM 1351  H HG3  . PRO A 1 87  ? 24.254  -7.178  4.965   1.00 0.00 ? 87  PRO A HG3  18 
ATOM 1352  H HD2  . PRO A 1 87  ? 22.379  -5.134  5.447   1.00 0.00 ? 87  PRO A HD2  18 
ATOM 1353  H HD3  . PRO A 1 87  ? 21.990  -6.848  5.184   1.00 0.00 ? 87  PRO A HD3  18 
ATOM 1354  N N    . ILE A 1 88  ? 23.409  -5.409  10.165  1.00 0.00 ? 88  ILE A N    18 
ATOM 1355  C CA   . ILE A 1 88  ? 23.787  -4.233  10.994  1.00 0.00 ? 88  ILE A CA   18 
ATOM 1356  C C    . ILE A 1 88  ? 24.759  -4.638  12.093  1.00 0.00 ? 88  ILE A C    18 
ATOM 1357  O O    . ILE A 1 88  ? 25.365  -5.689  12.064  1.00 0.00 ? 88  ILE A O    18 
ATOM 1358  C CB   . ILE A 1 88  ? 22.532  -3.653  11.650  1.00 0.00 ? 88  ILE A CB   18 
ATOM 1359  C CG1  . ILE A 1 88  ? 22.135  -4.516  12.853  1.00 0.00 ? 88  ILE A CG1  18 
ATOM 1360  C CG2  . ILE A 1 88  ? 21.389  -3.652  10.646  1.00 0.00 ? 88  ILE A CG2  18 
ATOM 1361  C CD1  . ILE A 1 88  ? 20.747  -4.117  13.338  1.00 0.00 ? 88  ILE A CD1  18 
ATOM 1362  H H    . ILE A 1 88  ? 22.906  -6.149  10.563  1.00 0.00 ? 88  ILE A H    18 
ATOM 1363  H HA   . ILE A 1 88  ? 24.242  -3.482  10.369  1.00 0.00 ? 88  ILE A HA   18 
ATOM 1364  H HB   . ILE A 1 88  ? 22.728  -2.642  11.978  1.00 0.00 ? 88  ILE A HB   18 
ATOM 1365  H HG12 . ILE A 1 88  ? 22.136  -5.552  12.563  1.00 0.00 ? 88  ILE A HG12 18 
ATOM 1366  H HG13 . ILE A 1 88  ? 22.843  -4.371  13.648  1.00 0.00 ? 88  ILE A HG13 18 
ATOM 1367  H HG21 . ILE A 1 88  ? 21.284  -4.639  10.222  1.00 0.00 ? 88  ILE A HG21 18 
ATOM 1368  H HG22 . ILE A 1 88  ? 20.473  -3.377  11.145  1.00 0.00 ? 88  ILE A HG22 18 
ATOM 1369  H HG23 . ILE A 1 88  ? 21.601  -2.942  9.861   1.00 0.00 ? 88  ILE A HG23 18 
ATOM 1370  H HD11 . ILE A 1 88  ? 20.628  -3.051  13.234  1.00 0.00 ? 88  ILE A HD11 18 
ATOM 1371  H HD12 . ILE A 1 88  ? 20.000  -4.624  12.747  1.00 0.00 ? 88  ILE A HD12 18 
ATOM 1372  H HD13 . ILE A 1 88  ? 20.636  -4.394  14.376  1.00 0.00 ? 88  ILE A HD13 18 
ATOM 1373  N N    . VAL A 1 89  ? 24.866  -3.796  13.078  1.00 0.00 ? 89  VAL A N    18 
ATOM 1374  C CA   . VAL A 1 89  ? 25.751  -4.065  14.238  1.00 0.00 ? 89  VAL A CA   18 
ATOM 1375  C C    . VAL A 1 89  ? 25.357  -3.117  15.367  1.00 0.00 ? 89  VAL A C    18 
ATOM 1376  O O    . VAL A 1 89  ? 25.549  -1.922  15.275  1.00 0.00 ? 89  VAL A O    18 
ATOM 1377  C CB   . VAL A 1 89  ? 27.213  -3.804  13.874  1.00 0.00 ? 89  VAL A CB   18 
ATOM 1378  C CG1  . VAL A 1 89  ? 28.105  -4.329  14.998  1.00 0.00 ? 89  VAL A CG1  18 
ATOM 1379  C CG2  . VAL A 1 89  ? 27.570  -4.510  12.565  1.00 0.00 ? 89  VAL A CG2  18 
ATOM 1380  H H    . VAL A 1 89  ? 24.330  -2.978  13.063  1.00 0.00 ? 89  VAL A H    18 
ATOM 1381  H HA   . VAL A 1 89  ? 25.621  -5.087  14.558  1.00 0.00 ? 89  VAL A HA   18 
ATOM 1382  H HB   . VAL A 1 89  ? 27.369  -2.739  13.764  1.00 0.00 ? 89  VAL A HB   18 
ATOM 1383  H HG11 . VAL A 1 89  ? 27.519  -4.948  15.662  1.00 0.00 ? 89  VAL A HG11 18 
ATOM 1384  H HG12 . VAL A 1 89  ? 28.909  -4.913  14.578  1.00 0.00 ? 89  VAL A HG12 18 
ATOM 1385  H HG13 . VAL A 1 89  ? 28.515  -3.497  15.551  1.00 0.00 ? 89  VAL A HG13 18 
ATOM 1386  H HG21 . VAL A 1 89  ? 27.349  -5.561  12.651  1.00 0.00 ? 89  VAL A HG21 18 
ATOM 1387  H HG22 . VAL A 1 89  ? 26.995  -4.084  11.758  1.00 0.00 ? 89  VAL A HG22 18 
ATOM 1388  H HG23 . VAL A 1 89  ? 28.623  -4.380  12.362  1.00 0.00 ? 89  VAL A HG23 18 
ATOM 1389  N N    . TYR A 1 90  ? 24.808  -3.627  16.430  1.00 0.00 ? 90  TYR A N    18 
ATOM 1390  C CA   . TYR A 1 90  ? 24.410  -2.731  17.545  1.00 0.00 ? 90  TYR A CA   18 
ATOM 1391  C C    . TYR A 1 90  ? 25.145  -3.138  18.820  1.00 0.00 ? 90  TYR A C    18 
ATOM 1392  O O    . TYR A 1 90  ? 26.048  -3.947  18.793  1.00 0.00 ? 90  TYR A O    18 
ATOM 1393  C CB   . TYR A 1 90  ? 22.901  -2.821  17.762  1.00 0.00 ? 90  TYR A CB   18 
ATOM 1394  C CG   . TYR A 1 90  ? 22.420  -4.231  17.528  1.00 0.00 ? 90  TYR A CG   18 
ATOM 1395  C CD1  . TYR A 1 90  ? 22.239  -4.696  16.222  1.00 0.00 ? 90  TYR A CD1  18 
ATOM 1396  C CD2  . TYR A 1 90  ? 22.139  -5.065  18.614  1.00 0.00 ? 90  TYR A CD2  18 
ATOM 1397  C CE1  . TYR A 1 90  ? 21.777  -5.999  15.998  1.00 0.00 ? 90  TYR A CE1  18 
ATOM 1398  C CE2  . TYR A 1 90  ? 21.678  -6.369  18.391  1.00 0.00 ? 90  TYR A CE2  18 
ATOM 1399  C CZ   . TYR A 1 90  ? 21.496  -6.835  17.083  1.00 0.00 ? 90  TYR A CZ   18 
ATOM 1400  O OH   . TYR A 1 90  ? 21.040  -8.120  16.866  1.00 0.00 ? 90  TYR A OH   18 
ATOM 1401  H H    . TYR A 1 90  ? 24.659  -4.592  16.493  1.00 0.00 ? 90  TYR A H    18 
ATOM 1402  H HA   . TYR A 1 90  ? 24.670  -1.713  17.291  1.00 0.00 ? 90  TYR A HA   18 
ATOM 1403  H HB2  . TYR A 1 90  ? 22.662  -2.521  18.771  1.00 0.00 ? 90  TYR A HB2  18 
ATOM 1404  H HB3  . TYR A 1 90  ? 22.411  -2.162  17.066  1.00 0.00 ? 90  TYR A HB3  18 
ATOM 1405  H HD1  . TYR A 1 90  ? 22.456  -4.048  15.388  1.00 0.00 ? 90  TYR A HD1  18 
ATOM 1406  H HD2  . TYR A 1 90  ? 22.281  -4.706  19.623  1.00 0.00 ? 90  TYR A HD2  18 
ATOM 1407  H HE1  . TYR A 1 90  ? 21.637  -6.357  14.987  1.00 0.00 ? 90  TYR A HE1  18 
ATOM 1408  H HE2  . TYR A 1 90  ? 21.458  -7.013  19.227  1.00 0.00 ? 90  TYR A HE2  18 
ATOM 1409  H HH   . TYR A 1 90  ? 21.466  -8.697  17.503  1.00 0.00 ? 90  TYR A HH   18 
ATOM 1410  N N    . TYR A 1 91  ? 24.780  -2.573  19.935  1.00 0.00 ? 91  TYR A N    18 
ATOM 1411  C CA   . TYR A 1 91  ? 25.477  -2.923  21.199  1.00 0.00 ? 91  TYR A CA   18 
ATOM 1412  C C    . TYR A 1 91  ? 24.470  -3.266  22.293  1.00 0.00 ? 91  TYR A C    18 
ATOM 1413  O O    . TYR A 1 91  ? 23.512  -2.553  22.523  1.00 0.00 ? 91  TYR A O    18 
ATOM 1414  C CB   . TYR A 1 91  ? 26.307  -1.730  21.661  1.00 0.00 ? 91  TYR A CB   18 
ATOM 1415  C CG   . TYR A 1 91  ? 27.708  -1.862  21.132  1.00 0.00 ? 91  TYR A CG   18 
ATOM 1416  C CD1  . TYR A 1 91  ? 28.019  -1.372  19.862  1.00 0.00 ? 91  TYR A CD1  18 
ATOM 1417  C CD2  . TYR A 1 91  ? 28.697  -2.463  21.916  1.00 0.00 ? 91  TYR A CD2  18 
ATOM 1418  C CE1  . TYR A 1 91  ? 29.327  -1.484  19.371  1.00 0.00 ? 91  TYR A CE1  18 
ATOM 1419  C CE2  . TYR A 1 91  ? 30.001  -2.575  21.433  1.00 0.00 ? 91  TYR A CE2  18 
ATOM 1420  C CZ   . TYR A 1 91  ? 30.319  -2.085  20.158  1.00 0.00 ? 91  TYR A CZ   18 
ATOM 1421  O OH   . TYR A 1 91  ? 31.608  -2.195  19.678  1.00 0.00 ? 91  TYR A OH   18 
ATOM 1422  H H    . TYR A 1 91  ? 24.062  -1.913  19.938  1.00 0.00 ? 91  TYR A H    18 
ATOM 1423  H HA   . TYR A 1 91  ? 26.127  -3.766  21.031  1.00 0.00 ? 91  TYR A HA   18 
ATOM 1424  H HB2  . TYR A 1 91  ? 25.866  -0.817  21.289  1.00 0.00 ? 91  TYR A HB2  18 
ATOM 1425  H HB3  . TYR A 1 91  ? 26.333  -1.705  22.740  1.00 0.00 ? 91  TYR A HB3  18 
ATOM 1426  H HD1  . TYR A 1 91  ? 27.247  -0.911  19.259  1.00 0.00 ? 91  TYR A HD1  18 
ATOM 1427  H HD2  . TYR A 1 91  ? 28.450  -2.845  22.893  1.00 0.00 ? 91  TYR A HD2  18 
ATOM 1428  H HE1  . TYR A 1 91  ? 29.569  -1.106  18.389  1.00 0.00 ? 91  TYR A HE1  18 
ATOM 1429  H HE2  . TYR A 1 91  ? 30.762  -3.038  22.043  1.00 0.00 ? 91  TYR A HE2  18 
ATOM 1430  H HH   . TYR A 1 91  ? 32.191  -1.737  20.288  1.00 0.00 ? 91  TYR A HH   18 
ATOM 1431  N N    . VAL A 1 92  ? 24.705  -4.338  22.991  1.00 0.00 ? 92  VAL A N    18 
ATOM 1432  C CA   . VAL A 1 92  ? 23.797  -4.725  24.101  1.00 0.00 ? 92  VAL A CA   18 
ATOM 1433  C C    . VAL A 1 92  ? 24.541  -4.490  25.410  1.00 0.00 ? 92  VAL A C    18 
ATOM 1434  O O    . VAL A 1 92  ? 25.282  -5.333  25.874  1.00 0.00 ? 92  VAL A O    18 
ATOM 1435  C CB   . VAL A 1 92  ? 23.425  -6.201  23.993  1.00 0.00 ? 92  VAL A CB   18 
ATOM 1436  C CG1  . VAL A 1 92  ? 22.023  -6.400  24.565  1.00 0.00 ? 92  VAL A CG1  18 
ATOM 1437  C CG2  . VAL A 1 92  ? 23.455  -6.634  22.528  1.00 0.00 ? 92  VAL A CG2  18 
ATOM 1438  H H    . VAL A 1 92  ? 25.497  -4.877  22.798  1.00 0.00 ? 92  VAL A H    18 
ATOM 1439  H HA   . VAL A 1 92  ? 22.905  -4.117  24.072  1.00 0.00 ? 92  VAL A HA   18 
ATOM 1440  H HB   . VAL A 1 92  ? 24.131  -6.791  24.561  1.00 0.00 ? 92  VAL A HB   18 
ATOM 1441  H HG11 . VAL A 1 92  ? 21.869  -5.711  25.383  1.00 0.00 ? 92  VAL A HG11 18 
ATOM 1442  H HG12 . VAL A 1 92  ? 21.291  -6.212  23.794  1.00 0.00 ? 92  VAL A HG12 18 
ATOM 1443  H HG13 . VAL A 1 92  ? 21.920  -7.412  24.922  1.00 0.00 ? 92  VAL A HG13 18 
ATOM 1444  H HG21 . VAL A 1 92  ? 22.901  -5.925  21.931  1.00 0.00 ? 92  VAL A HG21 18 
ATOM 1445  H HG22 . VAL A 1 92  ? 24.480  -6.670  22.185  1.00 0.00 ? 92  VAL A HG22 18 
ATOM 1446  H HG23 . VAL A 1 92  ? 23.009  -7.612  22.433  1.00 0.00 ? 92  VAL A HG23 18 
ATOM 1447  N N    . GLY A 1 93  ? 24.368  -3.344  25.994  1.00 0.00 ? 93  GLY A N    18 
ATOM 1448  C CA   . GLY A 1 93  ? 25.090  -3.045  27.259  1.00 0.00 ? 93  GLY A CA   18 
ATOM 1449  C C    . GLY A 1 93  ? 26.541  -2.677  26.924  1.00 0.00 ? 93  GLY A C    18 
ATOM 1450  O O    . GLY A 1 93  ? 26.910  -1.520  26.911  1.00 0.00 ? 93  GLY A O    18 
ATOM 1451  H H    . GLY A 1 93  ? 23.777  -2.675  25.594  1.00 0.00 ? 93  GLY A H    18 
ATOM 1452  H HA2  . GLY A 1 93  ? 24.611  -2.217  27.762  1.00 0.00 ? 93  GLY A HA2  18 
ATOM 1453  H HA3  . GLY A 1 93  ? 25.080  -3.913  27.899  1.00 0.00 ? 93  GLY A HA3  18 
ATOM 1454  N N    . ARG A 1 94  ? 27.366  -3.656  26.659  1.00 0.00 ? 94  ARG A N    18 
ATOM 1455  C CA   . ARG A 1 94  ? 28.794  -3.359  26.332  1.00 0.00 ? 94  ARG A CA   18 
ATOM 1456  C C    . ARG A 1 94  ? 29.341  -4.346  25.292  1.00 0.00 ? 94  ARG A C    18 
ATOM 1457  O O    . ARG A 1 94  ? 30.469  -4.228  24.857  1.00 0.00 ? 94  ARG A O    18 
ATOM 1458  C CB   . ARG A 1 94  ? 29.624  -3.489  27.602  1.00 0.00 ? 94  ARG A CB   18 
ATOM 1459  C CG   . ARG A 1 94  ? 29.072  -2.553  28.678  1.00 0.00 ? 94  ARG A CG   18 
ATOM 1460  C CD   . ARG A 1 94  ? 29.959  -2.632  29.922  1.00 0.00 ? 94  ARG A CD   18 
ATOM 1461  N NE   . ARG A 1 94  ? 30.154  -1.265  30.480  1.00 0.00 ? 94  ARG A NE   18 
ATOM 1462  C CZ   . ARG A 1 94  ? 29.124  -0.497  30.700  1.00 0.00 ? 94  ARG A CZ   18 
ATOM 1463  N NH1  . ARG A 1 94  ? 28.023  -1.006  31.183  1.00 0.00 ? 94  ARG A NH1  18 
ATOM 1464  N NH2  . ARG A 1 94  ? 29.192  0.779   30.437  1.00 0.00 ? 94  ARG A NH2  18 
ATOM 1465  H H    . ARG A 1 94  ? 27.051  -4.580  26.687  1.00 0.00 ? 94  ARG A H    18 
ATOM 1466  H HA   . ARG A 1 94  ? 28.878  -2.356  25.946  1.00 0.00 ? 94  ARG A HA   18 
ATOM 1467  H HB2  . ARG A 1 94  ? 29.570  -4.512  27.948  1.00 0.00 ? 94  ARG A HB2  18 
ATOM 1468  H HB3  . ARG A 1 94  ? 30.651  -3.233  27.392  1.00 0.00 ? 94  ARG A HB3  18 
ATOM 1469  H HG2  . ARG A 1 94  ? 29.063  -1.540  28.304  1.00 0.00 ? 94  ARG A HG2  18 
ATOM 1470  H HG3  . ARG A 1 94  ? 28.067  -2.852  28.936  1.00 0.00 ? 94  ARG A HG3  18 
ATOM 1471  H HD2  . ARG A 1 94  ? 29.486  -3.259  30.663  1.00 0.00 ? 94  ARG A HD2  18 
ATOM 1472  H HD3  . ARG A 1 94  ? 30.918  -3.052  29.655  1.00 0.00 ? 94  ARG A HD3  18 
ATOM 1473  H HE   . ARG A 1 94  ? 31.058  -0.943  30.681  1.00 0.00 ? 94  ARG A HE   18 
ATOM 1474  H HH11 . ARG A 1 94  ? 27.971  -1.984  31.384  1.00 0.00 ? 94  ARG A HH11 18 
ATOM 1475  H HH12 . ARG A 1 94  ? 27.233  -0.418  31.354  1.00 0.00 ? 94  ARG A HH12 18 
ATOM 1476  H HH21 . ARG A 1 94  ? 30.036  1.167   30.066  1.00 0.00 ? 94  ARG A HH21 18 
ATOM 1477  H HH22 . ARG A 1 94  ? 28.403  1.367   30.607  1.00 0.00 ? 94  ARG A HH22 18 
ATOM 1478  N N    . LYS A 1 95  ? 28.573  -5.318  24.893  1.00 0.00 ? 95  LYS A N    18 
ATOM 1479  C CA   . LYS A 1 95  ? 29.088  -6.293  23.893  1.00 0.00 ? 95  LYS A CA   18 
ATOM 1480  C C    . LYS A 1 95  ? 28.545  -5.941  22.504  1.00 0.00 ? 95  LYS A C    18 
ATOM 1481  O O    . LYS A 1 95  ? 27.371  -5.678  22.353  1.00 0.00 ? 95  LYS A O    18 
ATOM 1482  C CB   . LYS A 1 95  ? 28.642  -7.704  24.276  1.00 0.00 ? 95  LYS A CB   18 
ATOM 1483  C CG   . LYS A 1 95  ? 29.819  -8.451  24.905  1.00 0.00 ? 95  LYS A CG   18 
ATOM 1484  C CD   . LYS A 1 95  ? 29.361  -9.144  26.189  1.00 0.00 ? 95  LYS A CD   18 
ATOM 1485  C CE   . LYS A 1 95  ? 28.708  -8.123  27.123  1.00 0.00 ? 95  LYS A CE   18 
ATOM 1486  N NZ   . LYS A 1 95  ? 28.882  -8.563  28.537  1.00 0.00 ? 95  LYS A NZ   18 
ATOM 1487  H H    . LYS A 1 95  ? 27.670  -5.411  25.250  1.00 0.00 ? 95  LYS A H    18 
ATOM 1488  H HA   . LYS A 1 95  ? 30.166  -6.251  23.884  1.00 0.00 ? 95  LYS A HA   18 
ATOM 1489  H HB2  . LYS A 1 95  ? 27.829  -7.647  24.984  1.00 0.00 ? 95  LYS A HB2  18 
ATOM 1490  H HB3  . LYS A 1 95  ? 28.314  -8.232  23.392  1.00 0.00 ? 95  LYS A HB3  18 
ATOM 1491  H HG2  . LYS A 1 95  ? 30.190  -9.189  24.209  1.00 0.00 ? 95  LYS A HG2  18 
ATOM 1492  H HG3  . LYS A 1 95  ? 30.605  -7.750  25.138  1.00 0.00 ? 95  LYS A HG3  18 
ATOM 1493  H HD2  . LYS A 1 95  ? 28.646  -9.916  25.944  1.00 0.00 ? 95  LYS A HD2  18 
ATOM 1494  H HD3  . LYS A 1 95  ? 30.213  -9.586  26.683  1.00 0.00 ? 95  LYS A HD3  18 
ATOM 1495  H HE2  . LYS A 1 95  ? 29.175  -7.159  26.986  1.00 0.00 ? 95  LYS A HE2  18 
ATOM 1496  H HE3  . LYS A 1 95  ? 27.655  -8.049  26.896  1.00 0.00 ? 95  LYS A HE3  18 
ATOM 1497  H HZ1  . LYS A 1 95  ? 29.846  -8.931  28.669  1.00 0.00 ? 95  LYS A HZ1  18 
ATOM 1498  H HZ2  . LYS A 1 95  ? 28.729  -7.753  29.172  1.00 0.00 ? 95  LYS A HZ2  18 
ATOM 1499  H HZ3  . LYS A 1 95  ? 28.195  -9.310  28.754  1.00 0.00 ? 95  LYS A HZ3  18 
ATOM 1500  N N    . PRO A 1 96  ? 29.418  -5.950  21.526  1.00 0.00 ? 96  PRO A N    18 
ATOM 1501  C CA   . PRO A 1 96  ? 29.046  -5.635  20.138  1.00 0.00 ? 96  PRO A CA   18 
ATOM 1502  C C    . PRO A 1 96  ? 28.348  -6.840  19.498  1.00 0.00 ? 96  PRO A C    18 
ATOM 1503  O O    . PRO A 1 96  ? 28.685  -7.974  19.771  1.00 0.00 ? 96  PRO A O    18 
ATOM 1504  C CB   . PRO A 1 96  ? 30.390  -5.358  19.458  1.00 0.00 ? 96  PRO A CB   18 
ATOM 1505  C CG   . PRO A 1 96  ? 31.465  -6.069  20.314  1.00 0.00 ? 96  PRO A CG   18 
ATOM 1506  C CD   . PRO A 1 96  ? 30.848  -6.276  21.710  1.00 0.00 ? 96  PRO A CD   18 
ATOM 1507  H HA   . PRO A 1 96  ? 28.420  -4.756  20.102  1.00 0.00 ? 96  PRO A HA   18 
ATOM 1508  H HB2  . PRO A 1 96  ? 30.385  -5.758  18.454  1.00 0.00 ? 96  PRO A HB2  18 
ATOM 1509  H HB3  . PRO A 1 96  ? 30.585  -4.297  19.437  1.00 0.00 ? 96  PRO A HB3  18 
ATOM 1510  H HG2  . PRO A 1 96  ? 31.716  -7.024  19.872  1.00 0.00 ? 96  PRO A HG2  18 
ATOM 1511  H HG3  . PRO A 1 96  ? 32.345  -5.452  20.393  1.00 0.00 ? 96  PRO A HG3  18 
ATOM 1512  H HD2  . PRO A 1 96  ? 30.968  -7.302  22.028  1.00 0.00 ? 96  PRO A HD2  18 
ATOM 1513  H HD3  . PRO A 1 96  ? 31.294  -5.602  22.425  1.00 0.00 ? 96  PRO A HD3  18 
ATOM 1514  N N    . LYS A 1 97  ? 27.381  -6.608  18.653  1.00 0.00 ? 97  LYS A N    18 
ATOM 1515  C CA   . LYS A 1 97  ? 26.669  -7.748  18.010  1.00 0.00 ? 97  LYS A CA   18 
ATOM 1516  C C    . LYS A 1 97  ? 26.310  -7.393  16.566  1.00 0.00 ? 97  LYS A C    18 
ATOM 1517  O O    . LYS A 1 97  ? 25.957  -6.272  16.260  1.00 0.00 ? 97  LYS A O    18 
ATOM 1518  C CB   . LYS A 1 97  ? 25.381  -8.046  18.785  1.00 0.00 ? 97  LYS A CB   18 
ATOM 1519  C CG   . LYS A 1 97  ? 25.723  -8.591  20.173  1.00 0.00 ? 97  LYS A CG   18 
ATOM 1520  C CD   . LYS A 1 97  ? 25.075  -9.964  20.357  1.00 0.00 ? 97  LYS A CD   18 
ATOM 1521  C CE   . LYS A 1 97  ? 26.134  -11.056 20.197  1.00 0.00 ? 97  LYS A CE   18 
ATOM 1522  N NZ   . LYS A 1 97  ? 25.507  -12.274 19.609  1.00 0.00 ? 97  LYS A NZ   18 
ATOM 1523  H H    . LYS A 1 97  ? 27.120  -5.688  18.443  1.00 0.00 ? 97  LYS A H    18 
ATOM 1524  H HA   . LYS A 1 97  ? 27.303  -8.622  18.021  1.00 0.00 ? 97  LYS A HA   18 
ATOM 1525  H HB2  . LYS A 1 97  ? 24.807  -7.136  18.888  1.00 0.00 ? 97  LYS A HB2  18 
ATOM 1526  H HB3  . LYS A 1 97  ? 24.799  -8.778  18.246  1.00 0.00 ? 97  LYS A HB3  18 
ATOM 1527  H HG2  . LYS A 1 97  ? 26.794  -8.683  20.270  1.00 0.00 ? 97  LYS A HG2  18 
ATOM 1528  H HG3  . LYS A 1 97  ? 25.350  -7.915  20.926  1.00 0.00 ? 97  LYS A HG3  18 
ATOM 1529  H HD2  . LYS A 1 97  ? 24.638  -10.027 21.344  1.00 0.00 ? 97  LYS A HD2  18 
ATOM 1530  H HD3  . LYS A 1 97  ? 24.304  -10.101 19.613  1.00 0.00 ? 97  LYS A HD3  18 
ATOM 1531  H HE2  . LYS A 1 97  ? 26.917  -10.703 19.543  1.00 0.00 ? 97  LYS A HE2  18 
ATOM 1532  H HE3  . LYS A 1 97  ? 26.552  -11.297 21.162  1.00 0.00 ? 97  LYS A HE3  18 
ATOM 1533  H HZ1  . LYS A 1 97  ? 24.564  -12.412 20.027  1.00 0.00 ? 97  LYS A HZ1  18 
ATOM 1534  H HZ2  . LYS A 1 97  ? 25.417  -12.156 18.580  1.00 0.00 ? 97  LYS A HZ2  18 
ATOM 1535  H HZ3  . LYS A 1 97  ? 26.102  -13.101 19.810  1.00 0.00 ? 97  LYS A HZ3  18 
ATOM 1536  N N    . VAL A 1 98  ? 26.386  -8.348  15.679  1.00 0.00 ? 98  VAL A N    18 
ATOM 1537  C CA   . VAL A 1 98  ? 26.035  -8.080  14.255  1.00 0.00 ? 98  VAL A CA   18 
ATOM 1538  C C    . VAL A 1 98  ? 24.839  -8.951  13.872  1.00 0.00 ? 98  VAL A C    18 
ATOM 1539  O O    . VAL A 1 98  ? 24.847  -10.148 14.080  1.00 0.00 ? 98  VAL A O    18 
ATOM 1540  C CB   . VAL A 1 98  ? 27.222  -8.431  13.356  1.00 0.00 ? 98  VAL A CB   18 
ATOM 1541  C CG1  . VAL A 1 98  ? 26.786  -8.369  11.890  1.00 0.00 ? 98  VAL A CG1  18 
ATOM 1542  C CG2  . VAL A 1 98  ? 28.356  -7.431  13.592  1.00 0.00 ? 98  VAL A CG2  18 
ATOM 1543  H H    . VAL A 1 98  ? 26.664  -9.247  15.952  1.00 0.00 ? 98  VAL A H    18 
ATOM 1544  H HA   . VAL A 1 98  ? 25.780  -7.037  14.132  1.00 0.00 ? 98  VAL A HA   18 
ATOM 1545  H HB   . VAL A 1 98  ? 27.565  -9.429  13.587  1.00 0.00 ? 98  VAL A HB   18 
ATOM 1546  H HG11 . VAL A 1 98  ? 25.894  -8.962  11.755  1.00 0.00 ? 98  VAL A HG11 18 
ATOM 1547  H HG12 . VAL A 1 98  ? 26.581  -7.344  11.618  1.00 0.00 ? 98  VAL A HG12 18 
ATOM 1548  H HG13 . VAL A 1 98  ? 27.574  -8.757  11.262  1.00 0.00 ? 98  VAL A HG13 18 
ATOM 1549  H HG21 . VAL A 1 98  ? 27.970  -6.570  14.119  1.00 0.00 ? 98  VAL A HG21 18 
ATOM 1550  H HG22 . VAL A 1 98  ? 29.130  -7.898  14.182  1.00 0.00 ? 98  VAL A HG22 18 
ATOM 1551  H HG23 . VAL A 1 98  ? 28.764  -7.119  12.642  1.00 0.00 ? 98  VAL A HG23 18 
ATOM 1552  N N    . GLU A 1 99  ? 23.808  -8.372  13.321  1.00 0.00 ? 99  GLU A N    18 
ATOM 1553  C CA   . GLU A 1 99  ? 22.627  -9.195  12.943  1.00 0.00 ? 99  GLU A CA   18 
ATOM 1554  C C    . GLU A 1 99  ? 22.228  -8.912  11.501  1.00 0.00 ? 99  GLU A C    18 
ATOM 1555  O O    . GLU A 1 99  ? 23.002  -8.411  10.710  1.00 0.00 ? 99  GLU A O    18 
ATOM 1556  C CB   . GLU A 1 99  ? 21.450  -8.862  13.856  1.00 0.00 ? 99  GLU A CB   18 
ATOM 1557  C CG   . GLU A 1 99  ? 20.921  -10.145 14.500  1.00 0.00 ? 99  GLU A CG   18 
ATOM 1558  C CD   . GLU A 1 99  ? 19.391  -10.109 14.529  1.00 0.00 ? 99  GLU A CD   18 
ATOM 1559  O OE1  . GLU A 1 99  ? 18.849  -9.440  15.393  1.00 0.00 ? 99  GLU A OE1  18 
ATOM 1560  O OE2  . GLU A 1 99  ? 18.787  -10.752 13.685  1.00 0.00 ? 99  GLU A OE2  18 
ATOM 1561  H H    . GLU A 1 99  ? 23.808  -7.402  13.159  1.00 0.00 ? 99  GLU A H    18 
ATOM 1562  H HA   . GLU A 1 99  ? 22.868  -10.240 13.048  1.00 0.00 ? 99  GLU A HA   18 
ATOM 1563  H HB2  . GLU A 1 99  ? 21.772  -8.180  14.621  1.00 0.00 ? 99  GLU A HB2  18 
ATOM 1564  H HB3  . GLU A 1 99  ? 20.667  -8.405  13.275  1.00 0.00 ? 99  GLU A HB3  18 
ATOM 1565  H HG2  . GLU A 1 99  ? 21.251  -10.997 13.926  1.00 0.00 ? 99  GLU A HG2  18 
ATOM 1566  H HG3  . GLU A 1 99  ? 21.295  -10.222 15.509  1.00 0.00 ? 99  GLU A HG3  18 
ATOM 1567  N N    . GLN A 1 100 ? 21.015  -9.236  11.163  1.00 0.00 ? 100 GLN A N    18 
ATOM 1568  C CA   . GLN A 1 100 ? 20.528  -9.003  9.780   1.00 0.00 ? 100 GLN A CA   18 
ATOM 1569  C C    . GLN A 1 100 ? 19.030  -8.712  9.828   1.00 0.00 ? 100 GLN A C    18 
ATOM 1570  O O    . GLN A 1 100 ? 18.213  -9.586  9.616   1.00 0.00 ? 100 GLN A O    18 
ATOM 1571  C CB   . GLN A 1 100 ? 20.760  -10.256 8.949   1.00 0.00 ? 100 GLN A CB   18 
ATOM 1572  C CG   . GLN A 1 100 ? 22.226  -10.684 9.055   1.00 0.00 ? 100 GLN A CG   18 
ATOM 1573  C CD   . GLN A 1 100 ? 22.411  -11.578 10.283  1.00 0.00 ? 100 GLN A CD   18 
ATOM 1574  O OE1  . GLN A 1 100 ? 21.574  -11.604 11.162  1.00 0.00 ? 100 GLN A OE1  18 
ATOM 1575  N NE2  . GLN A 1 100 ? 23.481  -12.320 10.378  1.00 0.00 ? 100 GLN A NE2  18 
ATOM 1576  H H    . GLN A 1 100 ? 20.420  -9.637  11.829  1.00 0.00 ? 100 GLN A H    18 
ATOM 1577  H HA   . GLN A 1 100 ? 21.052  -8.169  9.340   1.00 0.00 ? 100 GLN A HA   18 
ATOM 1578  H HB2  . GLN A 1 100 ? 20.126  -11.040 9.327   1.00 0.00 ? 100 GLN A HB2  18 
ATOM 1579  H HB3  . GLN A 1 100 ? 20.516  -10.058 7.917   1.00 0.00 ? 100 GLN A HB3  18 
ATOM 1580  H HG2  . GLN A 1 100 ? 22.507  -11.228 8.166   1.00 0.00 ? 100 GLN A HG2  18 
ATOM 1581  H HG3  . GLN A 1 100 ? 22.850  -9.809  9.153   1.00 0.00 ? 100 GLN A HG3  18 
ATOM 1582  H HE21 . GLN A 1 100 ? 24.156  -12.301 9.669   1.00 0.00 ? 100 GLN A HE21 18 
ATOM 1583  H HE22 . GLN A 1 100 ? 23.608  -12.896 11.161  1.00 0.00 ? 100 GLN A HE22 18 
ATOM 1584  N N    . LEU A 1 101 ? 18.663  -7.500  10.116  1.00 0.00 ? 101 LEU A N    18 
ATOM 1585  C CA   . LEU A 1 101 ? 17.216  -7.164  10.190  1.00 0.00 ? 101 LEU A CA   18 
ATOM 1586  C C    . LEU A 1 101 ? 16.488  -7.784  9.003   1.00 0.00 ? 101 LEU A C    18 
ATOM 1587  O O    . LEU A 1 101 ? 17.031  -7.928  7.927   1.00 0.00 ? 101 LEU A O    18 
ATOM 1588  C CB   . LEU A 1 101 ? 17.029  -5.646  10.181  1.00 0.00 ? 101 LEU A CB   18 
ATOM 1589  C CG   . LEU A 1 101 ? 17.840  -5.008  11.317  1.00 0.00 ? 101 LEU A CG   18 
ATOM 1590  C CD1  . LEU A 1 101 ? 17.236  -3.649  11.676  1.00 0.00 ? 101 LEU A CD1  18 
ATOM 1591  C CD2  . LEU A 1 101 ? 17.810  -5.913  12.552  1.00 0.00 ? 101 LEU A CD2  18 
ATOM 1592  H H    . LEU A 1 101 ? 19.335  -6.817  10.292  1.00 0.00 ? 101 LEU A H    18 
ATOM 1593  H HA   . LEU A 1 101 ? 16.807  -7.566  11.105  1.00 0.00 ? 101 LEU A HA   18 
ATOM 1594  H HB2  . LEU A 1 101 ? 17.366  -5.250  9.236   1.00 0.00 ? 101 LEU A HB2  18 
ATOM 1595  H HB3  . LEU A 1 101 ? 15.982  -5.417  10.316  1.00 0.00 ? 101 LEU A HB3  18 
ATOM 1596  H HG   . LEU A 1 101 ? 18.862  -4.871  10.994  1.00 0.00 ? 101 LEU A HG   18 
ATOM 1597  H HD11 . LEU A 1 101 ? 17.138  -3.050  10.784  1.00 0.00 ? 101 LEU A HD11 18 
ATOM 1598  H HD12 . LEU A 1 101 ? 16.262  -3.793  12.121  1.00 0.00 ? 101 LEU A HD12 18 
ATOM 1599  H HD13 . LEU A 1 101 ? 17.881  -3.142  12.380  1.00 0.00 ? 101 LEU A HD13 18 
ATOM 1600  H HD21 . LEU A 1 101 ? 18.203  -6.886  12.293  1.00 0.00 ? 101 LEU A HD21 18 
ATOM 1601  H HD22 . LEU A 1 101 ? 18.414  -5.477  13.333  1.00 0.00 ? 101 LEU A HD22 18 
ATOM 1602  H HD23 . LEU A 1 101 ? 16.792  -6.017  12.897  1.00 0.00 ? 101 LEU A HD23 18 
ATOM 1603  N N    . SER A 1 102 ? 15.265  -8.171  9.206   1.00 0.00 ? 102 SER A N    18 
ATOM 1604  C CA   . SER A 1 102 ? 14.488  -8.811  8.100   1.00 0.00 ? 102 SER A CA   18 
ATOM 1605  C C    . SER A 1 102 ? 13.523  -7.805  7.466   1.00 0.00 ? 102 SER A C    18 
ATOM 1606  O O    . SER A 1 102 ? 12.910  -7.008  8.145   1.00 0.00 ? 102 SER A O    18 
ATOM 1607  C CB   . SER A 1 102 ? 13.693  -9.990  8.659   1.00 0.00 ? 102 SER A CB   18 
ATOM 1608  O OG   . SER A 1 102 ? 14.589  -11.032 9.021   1.00 0.00 ? 102 SER A OG   18 
ATOM 1609  H H    . SER A 1 102 ? 14.861  -8.050  10.094  1.00 0.00 ? 102 SER A H    18 
ATOM 1610  H HA   . SER A 1 102 ? 15.174  -9.170  7.347   1.00 0.00 ? 102 SER A HA   18 
ATOM 1611  H HB2  . SER A 1 102 ? 13.144  -9.676  9.531   1.00 0.00 ? 102 SER A HB2  18 
ATOM 1612  H HB3  . SER A 1 102 ? 12.998  -10.343 7.907   1.00 0.00 ? 102 SER A HB3  18 
ATOM 1613  H HG   . SER A 1 102 ? 14.415  -11.784 8.449   1.00 0.00 ? 102 SER A HG   18 
ATOM 1614  N N    . ASN A 1 103 ? 13.373  -7.850  6.166   1.00 0.00 ? 103 ASN A N    18 
ATOM 1615  C CA   . ASN A 1 103 ? 12.429  -6.907  5.490   1.00 0.00 ? 103 ASN A CA   18 
ATOM 1616  C C    . ASN A 1 103 ? 12.820  -5.466  5.813   1.00 0.00 ? 103 ASN A C    18 
ATOM 1617  O O    . ASN A 1 103 ? 11.985  -4.586  5.876   1.00 0.00 ? 103 ASN A O    18 
ATOM 1618  C CB   . ASN A 1 103 ? 11.007  -7.170  5.986   1.00 0.00 ? 103 ASN A CB   18 
ATOM 1619  C CG   . ASN A 1 103 ? 10.364  -8.269  5.137   1.00 0.00 ? 103 ASN A CG   18 
ATOM 1620  O OD1  . ASN A 1 103 ? 11.006  -8.844  4.280   1.00 0.00 ? 103 ASN A OD1  18 
ATOM 1621  N ND2  . ASN A 1 103 ? 9.115   -8.589  5.342   1.00 0.00 ? 103 ASN A ND2  18 
ATOM 1622  H H    . ASN A 1 103 ? 13.873  -8.511  5.636   1.00 0.00 ? 103 ASN A H    18 
ATOM 1623  H HA   . ASN A 1 103 ? 12.468  -7.054  4.418   1.00 0.00 ? 103 ASN A HA   18 
ATOM 1624  H HB2  . ASN A 1 103 ? 11.037  -7.483  7.019   1.00 0.00 ? 103 ASN A HB2  18 
ATOM 1625  H HB3  . ASN A 1 103 ? 10.425  -6.265  5.900   1.00 0.00 ? 103 ASN A HB3  18 
ATOM 1626  H HD21 . ASN A 1 103 ? 8.599   -8.127  6.034   1.00 0.00 ? 103 ASN A HD21 18 
ATOM 1627  H HD22 . ASN A 1 103 ? 8.696   -9.293  4.803   1.00 0.00 ? 103 ASN A HD22 18 
ATOM 1628  N N    . MET A 1 104 ? 14.082  -5.217  6.008   1.00 0.00 ? 104 MET A N    18 
ATOM 1629  C CA   . MET A 1 104 ? 14.524  -3.832  6.314   1.00 0.00 ? 104 MET A CA   18 
ATOM 1630  C C    . MET A 1 104 ? 14.922  -3.143  5.009   1.00 0.00 ? 104 MET A C    18 
ATOM 1631  O O    . MET A 1 104 ? 15.658  -2.178  5.004   1.00 0.00 ? 104 MET A O    18 
ATOM 1632  C CB   . MET A 1 104 ? 15.727  -3.874  7.258   1.00 0.00 ? 104 MET A CB   18 
ATOM 1633  C CG   . MET A 1 104 ? 15.488  -2.921  8.431   1.00 0.00 ? 104 MET A CG   18 
ATOM 1634  S SD   . MET A 1 104 ? 16.073  -1.266  7.992   1.00 0.00 ? 104 MET A SD   18 
ATOM 1635  C CE   . MET A 1 104 ? 16.564  -0.750  9.654   1.00 0.00 ? 104 MET A CE   18 
ATOM 1636  H H    . MET A 1 104 ? 14.739  -5.940  5.949   1.00 0.00 ? 104 MET A H    18 
ATOM 1637  H HA   . MET A 1 104 ? 13.715  -3.288  6.780   1.00 0.00 ? 104 MET A HA   18 
ATOM 1638  H HB2  . MET A 1 104 ? 15.857  -4.880  7.630   1.00 0.00 ? 104 MET A HB2  18 
ATOM 1639  H HB3  . MET A 1 104 ? 16.614  -3.570  6.725   1.00 0.00 ? 104 MET A HB3  18 
ATOM 1640  H HG2  . MET A 1 104 ? 14.432  -2.882  8.653   1.00 0.00 ? 104 MET A HG2  18 
ATOM 1641  H HG3  . MET A 1 104 ? 16.025  -3.275  9.297   1.00 0.00 ? 104 MET A HG3  18 
ATOM 1642  H HE1  . MET A 1 104 ? 15.774  -0.979  10.352  1.00 0.00 ? 104 MET A HE1  18 
ATOM 1643  H HE2  . MET A 1 104 ? 17.462  -1.279  9.945   1.00 0.00 ? 104 MET A HE2  18 
ATOM 1644  H HE3  . MET A 1 104 ? 16.750  0.315   9.660   1.00 0.00 ? 104 MET A HE3  18 
ATOM 1645  N N    . ILE A 1 105 ? 14.434  -3.633  3.902   1.00 0.00 ? 105 ILE A N    18 
ATOM 1646  C CA   . ILE A 1 105 ? 14.772  -3.009  2.593   1.00 0.00 ? 105 ILE A CA   18 
ATOM 1647  C C    . ILE A 1 105 ? 13.667  -3.330  1.586   1.00 0.00 ? 105 ILE A C    18 
ATOM 1648  O O    . ILE A 1 105 ? 12.830  -4.178  1.820   1.00 0.00 ? 105 ILE A O    18 
ATOM 1649  C CB   . ILE A 1 105 ? 16.104  -3.563  2.087   1.00 0.00 ? 105 ILE A CB   18 
ATOM 1650  C CG1  . ILE A 1 105 ? 17.219  -3.172  3.058   1.00 0.00 ? 105 ILE A CG1  18 
ATOM 1651  C CG2  . ILE A 1 105 ? 16.405  -2.983  0.705   1.00 0.00 ? 105 ILE A CG2  18 
ATOM 1652  C CD1  . ILE A 1 105 ? 18.561  -3.662  2.513   1.00 0.00 ? 105 ILE A CD1  18 
ATOM 1653  H H    . ILE A 1 105 ? 13.838  -4.412  3.930   1.00 0.00 ? 105 ILE A H    18 
ATOM 1654  H HA   . ILE A 1 105 ? 14.849  -1.938  2.714   1.00 0.00 ? 105 ILE A HA   18 
ATOM 1655  H HB   . ILE A 1 105 ? 16.043  -4.640  2.021   1.00 0.00 ? 105 ILE A HB   18 
ATOM 1656  H HG12 . ILE A 1 105 ? 17.242  -2.097  3.164   1.00 0.00 ? 105 ILE A HG12 18 
ATOM 1657  H HG13 . ILE A 1 105 ? 17.036  -3.626  4.020   1.00 0.00 ? 105 ILE A HG13 18 
ATOM 1658  H HG21 . ILE A 1 105 ? 16.219  -1.918  0.712   1.00 0.00 ? 105 ILE A HG21 18 
ATOM 1659  H HG22 . ILE A 1 105 ? 17.441  -3.165  0.456   1.00 0.00 ? 105 ILE A HG22 18 
ATOM 1660  H HG23 . ILE A 1 105 ? 15.770  -3.454  -0.030  1.00 0.00 ? 105 ILE A HG23 18 
ATOM 1661  H HD11 . ILE A 1 105 ? 18.390  -4.411  1.754   1.00 0.00 ? 105 ILE A HD11 18 
ATOM 1662  H HD12 . ILE A 1 105 ? 19.100  -2.831  2.083   1.00 0.00 ? 105 ILE A HD12 18 
ATOM 1663  H HD13 . ILE A 1 105 ? 19.142  -4.090  3.317   1.00 0.00 ? 105 ILE A HD13 18 
ATOM 1664  N N    . VAL A 1 106 ? 13.655  -2.660  0.468   1.00 0.00 ? 106 VAL A N    18 
ATOM 1665  C CA   . VAL A 1 106 ? 12.603  -2.928  -0.546  1.00 0.00 ? 106 VAL A CA   18 
ATOM 1666  C C    . VAL A 1 106 ? 13.257  -3.470  -1.822  1.00 0.00 ? 106 VAL A C    18 
ATOM 1667  O O    . VAL A 1 106 ? 14.335  -3.057  -2.202  1.00 0.00 ? 106 VAL A O    18 
ATOM 1668  C CB   . VAL A 1 106 ? 11.863  -1.622  -0.846  1.00 0.00 ? 106 VAL A CB   18 
ATOM 1669  C CG1  . VAL A 1 106 ? 11.117  -1.742  -2.173  1.00 0.00 ? 106 VAL A CG1  18 
ATOM 1670  C CG2  . VAL A 1 106 ? 10.860  -1.341  0.276   1.00 0.00 ? 106 VAL A CG2  18 
ATOM 1671  H H    . VAL A 1 106 ? 14.334  -1.977  0.296   1.00 0.00 ? 106 VAL A H    18 
ATOM 1672  H HA   . VAL A 1 106 ? 11.906  -3.657  -0.159  1.00 0.00 ? 106 VAL A HA   18 
ATOM 1673  H HB   . VAL A 1 106 ? 12.574  -0.812  -0.906  1.00 0.00 ? 106 VAL A HB   18 
ATOM 1674  H HG11 . VAL A 1 106 ? 11.822  -1.969  -2.960  1.00 0.00 ? 106 VAL A HG11 18 
ATOM 1675  H HG12 . VAL A 1 106 ? 10.386  -2.533  -2.105  1.00 0.00 ? 106 VAL A HG12 18 
ATOM 1676  H HG13 . VAL A 1 106 ? 10.621  -0.808  -2.392  1.00 0.00 ? 106 VAL A HG13 18 
ATOM 1677  H HG21 . VAL A 1 106 ? 10.216  -2.198  0.407   1.00 0.00 ? 106 VAL A HG21 18 
ATOM 1678  H HG22 . VAL A 1 106 ? 11.393  -1.147  1.195   1.00 0.00 ? 106 VAL A HG22 18 
ATOM 1679  H HG23 . VAL A 1 106 ? 10.264  -0.478  0.018   1.00 0.00 ? 106 VAL A HG23 18 
ATOM 1680  N N    . ARG A 1 107 ? 12.613  -4.393  -2.484  1.00 0.00 ? 107 ARG A N    18 
ATOM 1681  C CA   . ARG A 1 107 ? 13.199  -4.961  -3.732  1.00 0.00 ? 107 ARG A CA   18 
ATOM 1682  C C    . ARG A 1 107 ? 12.127  -5.009  -4.825  1.00 0.00 ? 107 ARG A C    18 
ATOM 1683  O O    . ARG A 1 107 ? 12.327  -5.581  -5.878  1.00 0.00 ? 107 ARG A O    18 
ATOM 1684  C CB   . ARG A 1 107 ? 13.710  -6.376  -3.457  1.00 0.00 ? 107 ARG A CB   18 
ATOM 1685  C CG   . ARG A 1 107 ? 14.934  -6.658  -4.330  1.00 0.00 ? 107 ARG A CG   18 
ATOM 1686  C CD   . ARG A 1 107 ? 15.118  -8.169  -4.482  1.00 0.00 ? 107 ARG A CD   18 
ATOM 1687  N NE   . ARG A 1 107 ? 16.102  -8.444  -5.566  1.00 0.00 ? 107 ARG A NE   18 
ATOM 1688  C CZ   . ARG A 1 107 ? 16.322  -9.672  -5.952  1.00 0.00 ? 107 ARG A CZ   18 
ATOM 1689  N NH1  . ARG A 1 107 ? 15.348  -10.384 -6.448  1.00 0.00 ? 107 ARG A NH1  18 
ATOM 1690  N NH2  . ARG A 1 107 ? 17.517  -10.186 -5.842  1.00 0.00 ? 107 ARG A NH2  18 
ATOM 1691  H H    . ARG A 1 107 ? 11.745  -4.713  -2.160  1.00 0.00 ? 107 ARG A H    18 
ATOM 1692  H HA   . ARG A 1 107 ? 14.019  -4.339  -4.060  1.00 0.00 ? 107 ARG A HA   18 
ATOM 1693  H HB2  . ARG A 1 107 ? 13.983  -6.464  -2.415  1.00 0.00 ? 107 ARG A HB2  18 
ATOM 1694  H HB3  . ARG A 1 107 ? 12.934  -7.091  -3.688  1.00 0.00 ? 107 ARG A HB3  18 
ATOM 1695  H HG2  . ARG A 1 107 ? 14.792  -6.211  -5.304  1.00 0.00 ? 107 ARG A HG2  18 
ATOM 1696  H HG3  . ARG A 1 107 ? 15.813  -6.236  -3.866  1.00 0.00 ? 107 ARG A HG3  18 
ATOM 1697  H HD2  . ARG A 1 107 ? 15.479  -8.582  -3.553  1.00 0.00 ? 107 ARG A HD2  18 
ATOM 1698  H HD3  . ARG A 1 107 ? 14.170  -8.623  -4.733  1.00 0.00 ? 107 ARG A HD3  18 
ATOM 1699  H HE   . ARG A 1 107 ? 16.584  -7.704  -5.989  1.00 0.00 ? 107 ARG A HE   18 
ATOM 1700  H HH11 . ARG A 1 107 ? 14.433  -9.989  -6.532  1.00 0.00 ? 107 ARG A HH11 18 
ATOM 1701  H HH12 . ARG A 1 107 ? 15.516  -11.324 -6.744  1.00 0.00 ? 107 ARG A HH12 18 
ATOM 1702  H HH21 . ARG A 1 107 ? 18.263  -9.640  -5.462  1.00 0.00 ? 107 ARG A HH21 18 
ATOM 1703  H HH22 . ARG A 1 107 ? 17.685  -11.126 -6.138  1.00 0.00 ? 107 ARG A HH22 18 
ATOM 1704  N N    . SER A 1 108 ? 10.992  -4.412  -4.584  1.00 0.00 ? 108 SER A N    18 
ATOM 1705  C CA   . SER A 1 108 ? 9.912   -4.425  -5.610  1.00 0.00 ? 108 SER A CA   18 
ATOM 1706  C C    . SER A 1 108 ? 8.594   -3.982  -4.967  1.00 0.00 ? 108 SER A C    18 
ATOM 1707  O O    . SER A 1 108 ? 8.128   -4.575  -4.015  1.00 0.00 ? 108 SER A O    18 
ATOM 1708  C CB   . SER A 1 108 ? 9.758   -5.839  -6.171  1.00 0.00 ? 108 SER A CB   18 
ATOM 1709  O OG   . SER A 1 108 ? 10.154  -6.782  -5.182  1.00 0.00 ? 108 SER A OG   18 
ATOM 1710  H H    . SER A 1 108 ? 10.849  -3.956  -3.729  1.00 0.00 ? 108 SER A H    18 
ATOM 1711  H HA   . SER A 1 108 ? 10.168  -3.746  -6.410  1.00 0.00 ? 108 SER A HA   18 
ATOM 1712  H HB2  . SER A 1 108 ? 8.729   -6.015  -6.434  1.00 0.00 ? 108 SER A HB2  18 
ATOM 1713  H HB3  . SER A 1 108 ? 10.376  -5.945  -7.052  1.00 0.00 ? 108 SER A HB3  18 
ATOM 1714  H HG   . SER A 1 108 ? 10.040  -7.662  -5.548  1.00 0.00 ? 108 SER A HG   18 
ATOM 1715  N N    . CYS A 1 109 ? 7.997   -2.938  -5.475  1.00 0.00 ? 109 CYS A N    18 
ATOM 1716  C CA   . CYS A 1 109 ? 6.714   -2.452  -4.883  1.00 0.00 ? 109 CYS A CA   18 
ATOM 1717  C C    . CYS A 1 109 ? 5.520   -3.048  -5.638  1.00 0.00 ? 109 CYS A C    18 
ATOM 1718  O O    . CYS A 1 109 ? 5.655   -3.988  -6.396  1.00 0.00 ? 109 CYS A O    18 
ATOM 1719  C CB   . CYS A 1 109 ? 6.660   -0.926  -4.973  1.00 0.00 ? 109 CYS A CB   18 
ATOM 1720  S SG   . CYS A 1 109 ? 7.979   -0.217  -3.959  1.00 0.00 ? 109 CYS A SG   18 
ATOM 1721  H H    . CYS A 1 109 ? 8.397   -2.467  -6.238  1.00 0.00 ? 109 CYS A H    18 
ATOM 1722  H HA   . CYS A 1 109 ? 6.667   -2.749  -3.846  1.00 0.00 ? 109 CYS A HA   18 
ATOM 1723  H HB2  . CYS A 1 109 ? 6.791   -0.621  -6.001  1.00 0.00 ? 109 CYS A HB2  18 
ATOM 1724  H HB3  . CYS A 1 109 ? 5.703   -0.578  -4.614  1.00 0.00 ? 109 CYS A HB3  18 
ATOM 1725  N N    . LYS A 1 110 ? 4.347   -2.502  -5.429  1.00 0.00 ? 110 LYS A N    18 
ATOM 1726  C CA   . LYS A 1 110 ? 3.133   -3.018  -6.121  1.00 0.00 ? 110 LYS A CA   18 
ATOM 1727  C C    . LYS A 1 110 ? 1.995   -2.030  -5.873  1.00 0.00 ? 110 LYS A C    18 
ATOM 1728  O O    . LYS A 1 110 ? 2.228   -0.912  -5.478  1.00 0.00 ? 110 LYS A O    18 
ATOM 1729  C CB   . LYS A 1 110 ? 2.762   -4.391  -5.552  1.00 0.00 ? 110 LYS A CB   18 
ATOM 1730  C CG   . LYS A 1 110 ? 2.412   -4.253  -4.069  1.00 0.00 ? 110 LYS A CG   18 
ATOM 1731  C CD   . LYS A 1 110 ? 1.864   -5.583  -3.547  1.00 0.00 ? 110 LYS A CD   18 
ATOM 1732  C CE   . LYS A 1 110 ? 0.431   -5.385  -3.046  1.00 0.00 ? 110 LYS A CE   18 
ATOM 1733  N NZ   . LYS A 1 110 ? -0.402  -6.555  -3.444  1.00 0.00 ? 110 LYS A NZ   18 
ATOM 1734  H H    . LYS A 1 110 ? 4.262   -1.743  -4.812  1.00 0.00 ? 110 LYS A H    18 
ATOM 1735  H HA   . LYS A 1 110 ? 3.323   -3.099  -7.181  1.00 0.00 ? 110 LYS A HA   18 
ATOM 1736  H HB2  . LYS A 1 110 ? 1.910   -4.784  -6.089  1.00 0.00 ? 110 LYS A HB2  18 
ATOM 1737  H HB3  . LYS A 1 110 ? 3.598   -5.064  -5.661  1.00 0.00 ? 110 LYS A HB3  18 
ATOM 1738  H HG2  . LYS A 1 110 ? 3.299   -3.985  -3.513  1.00 0.00 ? 110 LYS A HG2  18 
ATOM 1739  H HG3  . LYS A 1 110 ? 1.663   -3.485  -3.946  1.00 0.00 ? 110 LYS A HG3  18 
ATOM 1740  H HD2  . LYS A 1 110 ? 1.870   -6.313  -4.344  1.00 0.00 ? 110 LYS A HD2  18 
ATOM 1741  H HD3  . LYS A 1 110 ? 2.482   -5.932  -2.734  1.00 0.00 ? 110 LYS A HD3  18 
ATOM 1742  H HE2  . LYS A 1 110 ? 0.436   -5.295  -1.971  1.00 0.00 ? 110 LYS A HE2  18 
ATOM 1743  H HE3  . LYS A 1 110 ? 0.020   -4.485  -3.481  1.00 0.00 ? 110 LYS A HE3  18 
ATOM 1744  H HZ1  . LYS A 1 110 ? -0.207  -6.798  -4.436  1.00 0.00 ? 110 LYS A HZ1  18 
ATOM 1745  H HZ2  . LYS A 1 110 ? -0.172  -7.367  -2.835  1.00 0.00 ? 110 LYS A HZ2  18 
ATOM 1746  H HZ3  . LYS A 1 110 ? -1.408  -6.316  -3.339  1.00 0.00 ? 110 LYS A HZ3  18 
ATOM 1747  N N    . CYS A 1 111 ? 0.771   -2.417  -6.088  1.00 0.00 ? 111 CYS A N    18 
ATOM 1748  C CA   . CYS A 1 111 ? -0.349  -1.461  -5.845  1.00 0.00 ? 111 CYS A CA   18 
ATOM 1749  C C    . CYS A 1 111 ? -1.448  -2.146  -5.028  1.00 0.00 ? 111 CYS A C    18 
ATOM 1750  O O    . CYS A 1 111 ? -2.378  -2.706  -5.572  1.00 0.00 ? 111 CYS A O    18 
ATOM 1751  C CB   . CYS A 1 111 ? -0.927  -0.989  -7.183  1.00 0.00 ? 111 CYS A CB   18 
ATOM 1752  S SG   . CYS A 1 111 ? 0.181   0.237   -7.925  1.00 0.00 ? 111 CYS A SG   18 
ATOM 1753  H H    . CYS A 1 111 ? 0.586   -3.327  -6.404  1.00 0.00 ? 111 CYS A H    18 
ATOM 1754  H HA   . CYS A 1 111 ? 0.026   -0.609  -5.295  1.00 0.00 ? 111 CYS A HA   18 
ATOM 1755  H HB2  . CYS A 1 111 ? -1.028  -1.833  -7.849  1.00 0.00 ? 111 CYS A HB2  18 
ATOM 1756  H HB3  . CYS A 1 111 ? -1.897  -0.544  -7.018  1.00 0.00 ? 111 CYS A HB3  18 
ATOM 1757  N N    . SER A 1 112 ? -1.353  -2.104  -3.724  1.00 0.00 ? 112 SER A N    18 
ATOM 1758  C CA   . SER A 1 112 ? -2.402  -2.748  -2.886  1.00 0.00 ? 112 SER A CA   18 
ATOM 1759  C C    . SER A 1 112 ? -3.529  -1.748  -2.627  1.00 0.00 ? 112 SER A C    18 
ATOM 1760  O O    . SER A 1 112 ? -4.673  -2.097  -2.868  1.00 0.00 ? 112 SER A O    18 
ATOM 1761  C CB   . SER A 1 112 ? -1.795  -3.190  -1.555  1.00 0.00 ? 112 SER A CB   18 
ATOM 1762  O OG   . SER A 1 112 ? -2.769  -3.911  -0.811  1.00 0.00 ? 112 SER A OG   18 
ATOM 1763  O OXT  . SER A 1 112 ? -3.230  -0.647  -2.194  1.00 0.00 ? 112 SER A OXT  18 
ATOM 1764  H H    . SER A 1 112 ? -0.596  -1.644  -3.296  1.00 0.00 ? 112 SER A H    18 
ATOM 1765  H HA   . SER A 1 112 ? -2.798  -3.609  -3.405  1.00 0.00 ? 112 SER A HA   18 
ATOM 1766  H HB2  . SER A 1 112 ? -0.946  -3.827  -1.737  1.00 0.00 ? 112 SER A HB2  18 
ATOM 1767  H HB3  . SER A 1 112 ? -1.475  -2.318  -0.998  1.00 0.00 ? 112 SER A HB3  18 
ATOM 1768  H HG   . SER A 1 112 ? -3.635  -3.576  -1.055  1.00 0.00 ? 112 SER A HG   18 
ATOM 1769  N N    . ALA B 1 1   ? -8.291  -2.084  15.668  1.00 0.00 ? 1   ALA B N    18 
ATOM 1770  C CA   . ALA B 1 1   ? -8.398  -2.755  14.342  1.00 0.00 ? 1   ALA B CA   18 
ATOM 1771  C C    . ALA B 1 1   ? -8.424  -1.700  13.236  1.00 0.00 ? 1   ALA B C    18 
ATOM 1772  O O    . ALA B 1 1   ? -8.869  -0.587  13.437  1.00 0.00 ? 1   ALA B O    18 
ATOM 1773  C CB   . ALA B 1 1   ? -9.686  -3.580  14.292  1.00 0.00 ? 1   ALA B CB   18 
ATOM 1774  H H1   . ALA B 1 1   ? -7.429  -1.502  15.693  1.00 0.00 ? 1   ALA B H1   18 
ATOM 1775  H H2   . ALA B 1 1   ? -9.123  -1.479  15.819  1.00 0.00 ? 1   ALA B H2   18 
ATOM 1776  H H3   . ALA B 1 1   ? -8.248  -2.802  16.419  1.00 0.00 ? 1   ALA B H3   18 
ATOM 1777  H HA   . ALA B 1 1   ? -7.548  -3.407  14.199  1.00 0.00 ? 1   ALA B HA   18 
ATOM 1778  H HB1  . ALA B 1 1   ? -10.121 -3.626  15.279  1.00 0.00 ? 1   ALA B HB1  18 
ATOM 1779  H HB2  . ALA B 1 1   ? -10.384 -3.115  13.612  1.00 0.00 ? 1   ALA B HB2  18 
ATOM 1780  H HB3  . ALA B 1 1   ? -9.461  -4.579  13.950  1.00 0.00 ? 1   ALA B HB3  18 
ATOM 1781  N N    . LEU B 1 2   ? -7.954  -2.040  12.067  1.00 0.00 ? 2   LEU B N    18 
ATOM 1782  C CA   . LEU B 1 2   ? -7.957  -1.055  10.949  1.00 0.00 ? 2   LEU B CA   18 
ATOM 1783  C C    . LEU B 1 2   ? -8.991  -1.469  9.908   1.00 0.00 ? 2   LEU B C    18 
ATOM 1784  O O    . LEU B 1 2   ? -8.673  -1.718  8.762   1.00 0.00 ? 2   LEU B O    18 
ATOM 1785  C CB   . LEU B 1 2   ? -6.580  -1.018  10.295  1.00 0.00 ? 2   LEU B CB   18 
ATOM 1786  C CG   . LEU B 1 2   ? -5.510  -0.772  11.359  1.00 0.00 ? 2   LEU B CG   18 
ATOM 1787  C CD1  . LEU B 1 2   ? -4.184  -0.426  10.680  1.00 0.00 ? 2   LEU B CD1  18 
ATOM 1788  C CD2  . LEU B 1 2   ? -5.942  0.390   12.257  1.00 0.00 ? 2   LEU B CD2  18 
ATOM 1789  H H    . LEU B 1 2   ? -7.603  -2.943  11.924  1.00 0.00 ? 2   LEU B H    18 
ATOM 1790  H HA   . LEU B 1 2   ? -8.202  -0.074  11.330  1.00 0.00 ? 2   LEU B HA   18 
ATOM 1791  H HB2  . LEU B 1 2   ? -6.394  -1.961  9.803   1.00 0.00 ? 2   LEU B HB2  18 
ATOM 1792  H HB3  . LEU B 1 2   ? -6.555  -0.222  9.569   1.00 0.00 ? 2   LEU B HB3  18 
ATOM 1793  H HG   . LEU B 1 2   ? -5.386  -1.664  11.956  1.00 0.00 ? 2   LEU B HG   18 
ATOM 1794  H HD11 . LEU B 1 2   ? -4.048  -1.058  9.815   1.00 0.00 ? 2   LEU B HD11 18 
ATOM 1795  H HD12 . LEU B 1 2   ? -4.198  0.609   10.371  1.00 0.00 ? 2   LEU B HD12 18 
ATOM 1796  H HD13 . LEU B 1 2   ? -3.372  -0.585  11.374  1.00 0.00 ? 2   LEU B HD13 18 
ATOM 1797  H HD21 . LEU B 1 2   ? -6.905  0.172   12.691  1.00 0.00 ? 2   LEU B HD21 18 
ATOM 1798  H HD22 . LEU B 1 2   ? -5.214  0.525   13.044  1.00 0.00 ? 2   LEU B HD22 18 
ATOM 1799  H HD23 . LEU B 1 2   ? -6.008  1.293   11.669  1.00 0.00 ? 2   LEU B HD23 18 
ATOM 1800  N N    . ASP B 1 3   ? -10.227 -1.543  10.298  1.00 0.00 ? 3   ASP B N    18 
ATOM 1801  C CA   . ASP B 1 3   ? -11.289 -1.940  9.337   1.00 0.00 ? 3   ASP B CA   18 
ATOM 1802  C C    . ASP B 1 3   ? -12.211 -0.750  9.075   1.00 0.00 ? 3   ASP B C    18 
ATOM 1803  O O    . ASP B 1 3   ? -12.005 0.334   9.584   1.00 0.00 ? 3   ASP B O    18 
ATOM 1804  C CB   . ASP B 1 3   ? -12.103 -3.098  9.919   1.00 0.00 ? 3   ASP B CB   18 
ATOM 1805  C CG   . ASP B 1 3   ? -12.170 -2.969  11.441  1.00 0.00 ? 3   ASP B CG   18 
ATOM 1806  O OD1  . ASP B 1 3   ? -12.449 -1.879  11.913  1.00 0.00 ? 3   ASP B OD1  18 
ATOM 1807  O OD2  . ASP B 1 3   ? -11.941 -3.964  12.111  1.00 0.00 ? 3   ASP B OD2  18 
ATOM 1808  H H    . ASP B 1 3   ? -10.455 -1.339  11.225  1.00 0.00 ? 3   ASP B H    18 
ATOM 1809  H HA   . ASP B 1 3   ? -10.834 -2.253  8.410   1.00 0.00 ? 3   ASP B HA   18 
ATOM 1810  H HB2  . ASP B 1 3   ? -13.104 -3.075  9.511   1.00 0.00 ? 3   ASP B HB2  18 
ATOM 1811  H HB3  . ASP B 1 3   ? -11.632 -4.032  9.660   1.00 0.00 ? 3   ASP B HB3  18 
ATOM 1812  N N    . THR B 1 4   ? -13.223 -0.947  8.279   1.00 0.00 ? 4   THR B N    18 
ATOM 1813  C CA   . THR B 1 4   ? -14.162 0.166   7.972   1.00 0.00 ? 4   THR B CA   18 
ATOM 1814  C C    . THR B 1 4   ? -15.181 0.313   9.104   1.00 0.00 ? 4   THR B C    18 
ATOM 1815  O O    . THR B 1 4   ? -16.140 1.052   8.996   1.00 0.00 ? 4   THR B O    18 
ATOM 1816  C CB   . THR B 1 4   ? -14.877 -0.133  6.654   1.00 0.00 ? 4   THR B CB   18 
ATOM 1817  O OG1  . THR B 1 4   ? -15.865 -1.132  6.867   1.00 0.00 ? 4   THR B OG1  18 
ATOM 1818  C CG2  . THR B 1 4   ? -13.854 -0.630  5.626   1.00 0.00 ? 4   THR B CG2  18 
ATOM 1819  H H    . THR B 1 4   ? -13.363 -1.828  7.878   1.00 0.00 ? 4   THR B H    18 
ATOM 1820  H HA   . THR B 1 4   ? -13.611 1.087   7.878   1.00 0.00 ? 4   THR B HA   18 
ATOM 1821  H HB   . THR B 1 4   ? -15.345 0.765   6.284   1.00 0.00 ? 4   THR B HB   18 
ATOM 1822  H HG1  . THR B 1 4   ? -16.525 -0.773  7.465   1.00 0.00 ? 4   THR B HG1  18 
ATOM 1823  H HG21 . THR B 1 4   ? -13.127 -1.263  6.115   1.00 0.00 ? 4   THR B HG21 18 
ATOM 1824  H HG22 . THR B 1 4   ? -14.360 -1.193  4.856   1.00 0.00 ? 4   THR B HG22 18 
ATOM 1825  H HG23 . THR B 1 4   ? -13.350 0.216   5.182   1.00 0.00 ? 4   THR B HG23 18 
ATOM 1826  N N    . ASN B 1 5   ? -14.972 -0.369  10.196  1.00 0.00 ? 5   ASN B N    18 
ATOM 1827  C CA   . ASN B 1 5   ? -15.915 -0.251  11.341  1.00 0.00 ? 5   ASN B CA   18 
ATOM 1828  C C    . ASN B 1 5   ? -15.333 0.739   12.351  1.00 0.00 ? 5   ASN B C    18 
ATOM 1829  O O    . ASN B 1 5   ? -16.024 1.594   12.870  1.00 0.00 ? 5   ASN B O    18 
ATOM 1830  C CB   . ASN B 1 5   ? -16.094 -1.617  12.002  1.00 0.00 ? 5   ASN B CB   18 
ATOM 1831  C CG   . ASN B 1 5   ? -16.140 -2.704  10.926  1.00 0.00 ? 5   ASN B CG   18 
ATOM 1832  O OD1  . ASN B 1 5   ? -16.407 -2.423  9.776   1.00 0.00 ? 5   ASN B OD1  18 
ATOM 1833  N ND2  . ASN B 1 5   ? -15.889 -3.942  11.255  1.00 0.00 ? 5   ASN B ND2  18 
ATOM 1834  H H    . ASN B 1 5   ? -14.186 -0.948  10.270  1.00 0.00 ? 5   ASN B H    18 
ATOM 1835  H HA   . ASN B 1 5   ? -16.870 0.111   10.987  1.00 0.00 ? 5   ASN B HA   18 
ATOM 1836  H HB2  . ASN B 1 5   ? -15.265 -1.805  12.669  1.00 0.00 ? 5   ASN B HB2  18 
ATOM 1837  H HB3  . ASN B 1 5   ? -17.017 -1.629  12.563  1.00 0.00 ? 5   ASN B HB3  18 
ATOM 1838  H HD21 . ASN B 1 5   ? -15.673 -4.169  12.183  1.00 0.00 ? 5   ASN B HD21 18 
ATOM 1839  H HD22 . ASN B 1 5   ? -15.916 -4.645  10.573  1.00 0.00 ? 5   ASN B HD22 18 
ATOM 1840  N N    . TYR B 1 6   ? -14.062 0.629   12.629  1.00 0.00 ? 6   TYR B N    18 
ATOM 1841  C CA   . TYR B 1 6   ? -13.421 1.555   13.596  1.00 0.00 ? 6   TYR B CA   18 
ATOM 1842  C C    . TYR B 1 6   ? -12.877 2.774   12.847  1.00 0.00 ? 6   TYR B C    18 
ATOM 1843  O O    . TYR B 1 6   ? -12.612 3.807   13.430  1.00 0.00 ? 6   TYR B O    18 
ATOM 1844  C CB   . TYR B 1 6   ? -12.272 0.818   14.279  1.00 0.00 ? 6   TYR B CB   18 
ATOM 1845  C CG   . TYR B 1 6   ? -11.418 1.802   15.038  1.00 0.00 ? 6   TYR B CG   18 
ATOM 1846  C CD1  . TYR B 1 6   ? -11.893 2.382   16.220  1.00 0.00 ? 6   TYR B CD1  18 
ATOM 1847  C CD2  . TYR B 1 6   ? -10.149 2.134   14.555  1.00 0.00 ? 6   TYR B CD2  18 
ATOM 1848  C CE1  . TYR B 1 6   ? -11.096 3.294   16.920  1.00 0.00 ? 6   TYR B CE1  18 
ATOM 1849  C CE2  . TYR B 1 6   ? -9.350  3.047   15.255  1.00 0.00 ? 6   TYR B CE2  18 
ATOM 1850  C CZ   . TYR B 1 6   ? -9.823  3.627   16.438  1.00 0.00 ? 6   TYR B CZ   18 
ATOM 1851  O OH   . TYR B 1 6   ? -9.037  4.527   17.128  1.00 0.00 ? 6   TYR B OH   18 
ATOM 1852  H H    . TYR B 1 6   ? -13.524 -0.066  12.200  1.00 0.00 ? 6   TYR B H    18 
ATOM 1853  H HA   . TYR B 1 6   ? -14.142 1.870   14.335  1.00 0.00 ? 6   TYR B HA   18 
ATOM 1854  H HB2  . TYR B 1 6   ? -12.673 0.084   14.958  1.00 0.00 ? 6   TYR B HB2  18 
ATOM 1855  H HB3  . TYR B 1 6   ? -11.669 0.324   13.531  1.00 0.00 ? 6   TYR B HB3  18 
ATOM 1856  H HD1  . TYR B 1 6   ? -12.874 2.124   16.591  1.00 0.00 ? 6   TYR B HD1  18 
ATOM 1857  H HD2  . TYR B 1 6   ? -9.786  1.685   13.641  1.00 0.00 ? 6   TYR B HD2  18 
ATOM 1858  H HE1  . TYR B 1 6   ? -11.462 3.742   17.832  1.00 0.00 ? 6   TYR B HE1  18 
ATOM 1859  H HE2  . TYR B 1 6   ? -8.370  3.303   14.881  1.00 0.00 ? 6   TYR B HE2  18 
ATOM 1860  H HH   . TYR B 1 6   ? -9.464  5.385   17.086  1.00 0.00 ? 6   TYR B HH   18 
ATOM 1861  N N    . CYS B 1 7   ? -12.703 2.662   11.557  1.00 0.00 ? 7   CYS B N    18 
ATOM 1862  C CA   . CYS B 1 7   ? -12.173 3.811   10.771  1.00 0.00 ? 7   CYS B CA   18 
ATOM 1863  C C    . CYS B 1 7   ? -13.303 4.797   10.475  1.00 0.00 ? 7   CYS B C    18 
ATOM 1864  O O    . CYS B 1 7   ? -13.076 5.897   10.010  1.00 0.00 ? 7   CYS B O    18 
ATOM 1865  C CB   . CYS B 1 7   ? -11.582 3.298   9.457   1.00 0.00 ? 7   CYS B CB   18 
ATOM 1866  S SG   . CYS B 1 7   ? -10.012 2.464   9.797   1.00 0.00 ? 7   CYS B SG   18 
ATOM 1867  H H    . CYS B 1 7   ? -12.921 1.818   11.106  1.00 0.00 ? 7   CYS B H    18 
ATOM 1868  H HA   . CYS B 1 7   ? -11.401 4.310   11.341  1.00 0.00 ? 7   CYS B HA   18 
ATOM 1869  H HB2  . CYS B 1 7   ? -12.270 2.601   8.999   1.00 0.00 ? 7   CYS B HB2  18 
ATOM 1870  H HB3  . CYS B 1 7   ? -11.410 4.129   8.789   1.00 0.00 ? 7   CYS B HB3  18 
ATOM 1871  N N    . PHE B 1 8   ? -14.519 4.414   10.742  1.00 0.00 ? 8   PHE B N    18 
ATOM 1872  C CA   . PHE B 1 8   ? -15.666 5.329   10.480  1.00 0.00 ? 8   PHE B CA   18 
ATOM 1873  C C    . PHE B 1 8   ? -15.857 6.273   11.672  1.00 0.00 ? 8   PHE B C    18 
ATOM 1874  O O    . PHE B 1 8   ? -16.966 6.535   12.096  1.00 0.00 ? 8   PHE B O    18 
ATOM 1875  C CB   . PHE B 1 8   ? -16.938 4.503   10.279  1.00 0.00 ? 8   PHE B CB   18 
ATOM 1876  C CG   . PHE B 1 8   ? -17.100 4.168   8.814   1.00 0.00 ? 8   PHE B CG   18 
ATOM 1877  C CD1  . PHE B 1 8   ? -15.976 4.105   7.978   1.00 0.00 ? 8   PHE B CD1  18 
ATOM 1878  C CD2  . PHE B 1 8   ? -18.374 3.922   8.291   1.00 0.00 ? 8   PHE B CD2  18 
ATOM 1879  C CE1  . PHE B 1 8   ? -16.130 3.795   6.622   1.00 0.00 ? 8   PHE B CE1  18 
ATOM 1880  C CE2  . PHE B 1 8   ? -18.528 3.611   6.934   1.00 0.00 ? 8   PHE B CE2  18 
ATOM 1881  C CZ   . PHE B 1 8   ? -17.405 3.549   6.100   1.00 0.00 ? 8   PHE B CZ   18 
ATOM 1882  H H    . PHE B 1 8   ? -14.679 3.522   11.117  1.00 0.00 ? 8   PHE B H    18 
ATOM 1883  H HA   . PHE B 1 8   ? -15.469 5.908   9.591   1.00 0.00 ? 8   PHE B HA   18 
ATOM 1884  H HB2  . PHE B 1 8   ? -16.867 3.590   10.851  1.00 0.00 ? 8   PHE B HB2  18 
ATOM 1885  H HB3  . PHE B 1 8   ? -17.793 5.071   10.613  1.00 0.00 ? 8   PHE B HB3  18 
ATOM 1886  H HD1  . PHE B 1 8   ? -14.993 4.295   8.381   1.00 0.00 ? 8   PHE B HD1  18 
ATOM 1887  H HD2  . PHE B 1 8   ? -19.241 3.970   8.935   1.00 0.00 ? 8   PHE B HD2  18 
ATOM 1888  H HE1  . PHE B 1 8   ? -15.265 3.746   5.978   1.00 0.00 ? 8   PHE B HE1  18 
ATOM 1889  H HE2  . PHE B 1 8   ? -19.511 3.421   6.531   1.00 0.00 ? 8   PHE B HE2  18 
ATOM 1890  H HZ   . PHE B 1 8   ? -17.523 3.309   5.054   1.00 0.00 ? 8   PHE B HZ   18 
ATOM 1891  N N    . SER B 1 9   ? -14.788 6.787   12.215  1.00 0.00 ? 9   SER B N    18 
ATOM 1892  C CA   . SER B 1 9   ? -14.912 7.713   13.376  1.00 0.00 ? 9   SER B CA   18 
ATOM 1893  C C    . SER B 1 9   ? -14.605 9.142   12.922  1.00 0.00 ? 9   SER B C    18 
ATOM 1894  O O    . SER B 1 9   ? -14.787 9.491   11.773  1.00 0.00 ? 9   SER B O    18 
ATOM 1895  C CB   . SER B 1 9   ? -13.923 7.302   14.466  1.00 0.00 ? 9   SER B CB   18 
ATOM 1896  O OG   . SER B 1 9   ? -13.705 5.899   14.398  1.00 0.00 ? 9   SER B OG   18 
ATOM 1897  H H    . SER B 1 9   ? -13.904 6.565   11.859  1.00 0.00 ? 9   SER B H    18 
ATOM 1898  H HA   . SER B 1 9   ? -15.918 7.668   13.766  1.00 0.00 ? 9   SER B HA   18 
ATOM 1899  H HB2  . SER B 1 9   ? -12.986 7.813   14.317  1.00 0.00 ? 9   SER B HB2  18 
ATOM 1900  H HB3  . SER B 1 9   ? -14.325 7.568   15.435  1.00 0.00 ? 9   SER B HB3  18 
ATOM 1901  H HG   . SER B 1 9   ? -13.184 5.642   15.162  1.00 0.00 ? 9   SER B HG   18 
ATOM 1902  N N    . SER B 1 10  ? -14.139 9.972   13.816  1.00 0.00 ? 10  SER B N    18 
ATOM 1903  C CA   . SER B 1 10  ? -13.822 11.377  13.434  1.00 0.00 ? 10  SER B CA   18 
ATOM 1904  C C    . SER B 1 10  ? -12.378 11.704  13.823  1.00 0.00 ? 10  SER B C    18 
ATOM 1905  O O    . SER B 1 10  ? -11.862 12.756  13.503  1.00 0.00 ? 10  SER B O    18 
ATOM 1906  C CB   . SER B 1 10  ? -14.772 12.329  14.161  1.00 0.00 ? 10  SER B CB   18 
ATOM 1907  O OG   . SER B 1 10  ? -14.367 13.671  13.921  1.00 0.00 ? 10  SER B OG   18 
ATOM 1908  H H    . SER B 1 10  ? -14.000 9.671   14.739  1.00 0.00 ? 10  SER B H    18 
ATOM 1909  H HA   . SER B 1 10  ? -13.940 11.493  12.369  1.00 0.00 ? 10  SER B HA   18 
ATOM 1910  H HB2  . SER B 1 10  ? -15.774 12.191  13.792  1.00 0.00 ? 10  SER B HB2  18 
ATOM 1911  H HB3  . SER B 1 10  ? -14.750 12.118  15.222  1.00 0.00 ? 10  SER B HB3  18 
ATOM 1912  H HG   . SER B 1 10  ? -14.958 14.250  14.407  1.00 0.00 ? 10  SER B HG   18 
ATOM 1913  N N    . THR B 1 11  ? -11.724 10.812  14.513  1.00 0.00 ? 11  THR B N    18 
ATOM 1914  C CA   . THR B 1 11  ? -10.319 11.070  14.927  1.00 0.00 ? 11  THR B CA   18 
ATOM 1915  C C    . THR B 1 11  ? -9.396  10.037  14.277  1.00 0.00 ? 11  THR B C    18 
ATOM 1916  O O    . THR B 1 11  ? -9.788  9.314   13.383  1.00 0.00 ? 11  THR B O    18 
ATOM 1917  C CB   . THR B 1 11  ? -10.214 10.956  16.447  1.00 0.00 ? 11  THR B CB   18 
ATOM 1918  O OG1  . THR B 1 11  ? -11.471 10.561  16.978  1.00 0.00 ? 11  THR B OG1  18 
ATOM 1919  C CG2  . THR B 1 11  ? -9.811  12.307  17.035  1.00 0.00 ? 11  THR B CG2  18 
ATOM 1920  H H    . THR B 1 11  ? -12.159 9.973   14.763  1.00 0.00 ? 11  THR B H    18 
ATOM 1921  H HA   . THR B 1 11  ? -10.025 12.062  14.617  1.00 0.00 ? 11  THR B HA   18 
ATOM 1922  H HB   . THR B 1 11  ? -9.469  10.219  16.702  1.00 0.00 ? 11  THR B HB   18 
ATOM 1923  H HG1  . THR B 1 11  ? -11.344 9.747   17.470  1.00 0.00 ? 11  THR B HG1  18 
ATOM 1924  H HG21 . THR B 1 11  ? -10.554 13.047  16.775  1.00 0.00 ? 11  THR B HG21 18 
ATOM 1925  H HG22 . THR B 1 11  ? -9.744  12.225  18.109  1.00 0.00 ? 11  THR B HG22 18 
ATOM 1926  H HG23 . THR B 1 11  ? -8.853  12.602  16.635  1.00 0.00 ? 11  THR B HG23 18 
ATOM 1927  N N    . GLU B 1 12  ? -8.172  9.960   14.724  1.00 0.00 ? 12  GLU B N    18 
ATOM 1928  C CA   . GLU B 1 12  ? -7.226  8.970   14.137  1.00 0.00 ? 12  GLU B CA   18 
ATOM 1929  C C    . GLU B 1 12  ? -6.957  9.328   12.672  1.00 0.00 ? 12  GLU B C    18 
ATOM 1930  O O    . GLU B 1 12  ? -7.869  9.565   11.904  1.00 0.00 ? 12  GLU B O    18 
ATOM 1931  C CB   . GLU B 1 12  ? -7.843  7.574   14.221  1.00 0.00 ? 12  GLU B CB   18 
ATOM 1932  C CG   . GLU B 1 12  ? -6.770  6.521   13.946  1.00 0.00 ? 12  GLU B CG   18 
ATOM 1933  C CD   . GLU B 1 12  ? -7.248  5.591   12.831  1.00 0.00 ? 12  GLU B CD   18 
ATOM 1934  O OE1  . GLU B 1 12  ? -7.793  6.093   11.862  1.00 0.00 ? 12  GLU B OE1  18 
ATOM 1935  O OE2  . GLU B 1 12  ? -7.063  4.393   12.965  1.00 0.00 ? 12  GLU B OE2  18 
ATOM 1936  H H    . GLU B 1 12  ? -7.877  10.550  15.448  1.00 0.00 ? 12  GLU B H    18 
ATOM 1937  H HA   . GLU B 1 12  ? -6.298  8.988   14.688  1.00 0.00 ? 12  GLU B HA   18 
ATOM 1938  H HB2  . GLU B 1 12  ? -8.252  7.422   15.210  1.00 0.00 ? 12  GLU B HB2  18 
ATOM 1939  H HB3  . GLU B 1 12  ? -8.630  7.483   13.488  1.00 0.00 ? 12  GLU B HB3  18 
ATOM 1940  H HG2  . GLU B 1 12  ? -5.854  7.009   13.645  1.00 0.00 ? 12  GLU B HG2  18 
ATOM 1941  H HG3  . GLU B 1 12  ? -6.593  5.943   14.843  1.00 0.00 ? 12  GLU B HG3  18 
ATOM 1942  N N    . LYS B 1 13  ? -5.712  9.376   12.279  1.00 0.00 ? 13  LYS B N    18 
ATOM 1943  C CA   . LYS B 1 13  ? -5.390  9.726   10.867  1.00 0.00 ? 13  LYS B CA   18 
ATOM 1944  C C    . LYS B 1 13  ? -4.324  8.771   10.323  1.00 0.00 ? 13  LYS B C    18 
ATOM 1945  O O    . LYS B 1 13  ? -3.663  9.058   9.344   1.00 0.00 ? 13  LYS B O    18 
ATOM 1946  C CB   . LYS B 1 13  ? -4.861  11.161  10.812  1.00 0.00 ? 13  LYS B CB   18 
ATOM 1947  C CG   . LYS B 1 13  ? -4.693  11.593  9.354   1.00 0.00 ? 13  LYS B CG   18 
ATOM 1948  C CD   . LYS B 1 13  ? -3.321  12.246  9.169   1.00 0.00 ? 13  LYS B CD   18 
ATOM 1949  C CE   . LYS B 1 13  ? -2.710  11.786  7.845   1.00 0.00 ? 13  LYS B CE   18 
ATOM 1950  N NZ   . LYS B 1 13  ? -1.406  12.478  7.633   1.00 0.00 ? 13  LYS B NZ   18 
ATOM 1951  H H    . LYS B 1 13  ? -4.990  9.186   12.915  1.00 0.00 ? 13  LYS B H    18 
ATOM 1952  H HA   . LYS B 1 13  ? -6.283  9.649   10.264  1.00 0.00 ? 13  LYS B HA   18 
ATOM 1953  H HB2  . LYS B 1 13  ? -5.561  11.820  11.305  1.00 0.00 ? 13  LYS B HB2  18 
ATOM 1954  H HB3  . LYS B 1 13  ? -3.906  11.211  11.312  1.00 0.00 ? 13  LYS B HB3  18 
ATOM 1955  H HG2  . LYS B 1 13  ? -4.772  10.728  8.710   1.00 0.00 ? 13  LYS B HG2  18 
ATOM 1956  H HG3  . LYS B 1 13  ? -5.466  12.304  9.098   1.00 0.00 ? 13  LYS B HG3  18 
ATOM 1957  H HD2  . LYS B 1 13  ? -3.434  13.321  9.161   1.00 0.00 ? 13  LYS B HD2  18 
ATOM 1958  H HD3  . LYS B 1 13  ? -2.674  11.957  9.982   1.00 0.00 ? 13  LYS B HD3  18 
ATOM 1959  H HE2  . LYS B 1 13  ? -2.550  10.719  7.873   1.00 0.00 ? 13  LYS B HE2  18 
ATOM 1960  H HE3  . LYS B 1 13  ? -3.381  12.029  7.035   1.00 0.00 ? 13  LYS B HE3  18 
ATOM 1961  H HZ1  . LYS B 1 13  ? -0.832  12.410  8.497   1.00 0.00 ? 13  LYS B HZ1  18 
ATOM 1962  H HZ2  . LYS B 1 13  ? -0.900  12.027  6.842   1.00 0.00 ? 13  LYS B HZ2  18 
ATOM 1963  H HZ3  . LYS B 1 13  ? -1.576  13.479  7.411   1.00 0.00 ? 13  LYS B HZ3  18 
ATOM 1964  N N    . ASN B 1 14  ? -4.148  7.637   10.946  1.00 0.00 ? 14  ASN B N    18 
ATOM 1965  C CA   . ASN B 1 14  ? -3.121  6.672   10.458  1.00 0.00 ? 14  ASN B CA   18 
ATOM 1966  C C    . ASN B 1 14  ? -3.754  5.720   9.440   1.00 0.00 ? 14  ASN B C    18 
ATOM 1967  O O    . ASN B 1 14  ? -4.810  5.986   8.902   1.00 0.00 ? 14  ASN B O    18 
ATOM 1968  C CB   . ASN B 1 14  ? -2.581  5.867   11.639  1.00 0.00 ? 14  ASN B CB   18 
ATOM 1969  C CG   . ASN B 1 14  ? -2.285  6.809   12.808  1.00 0.00 ? 14  ASN B CG   18 
ATOM 1970  O OD1  . ASN B 1 14  ? -1.413  7.650   12.719  1.00 0.00 ? 14  ASN B OD1  18 
ATOM 1971  N ND2  . ASN B 1 14  ? -2.981  6.704   13.907  1.00 0.00 ? 14  ASN B ND2  18 
ATOM 1972  H H    . ASN B 1 14  ? -4.689  7.423   11.734  1.00 0.00 ? 14  ASN B H    18 
ATOM 1973  H HA   . ASN B 1 14  ? -2.312  7.213   9.990   1.00 0.00 ? 14  ASN B HA   18 
ATOM 1974  H HB2  . ASN B 1 14  ? -3.316  5.135   11.942  1.00 0.00 ? 14  ASN B HB2  18 
ATOM 1975  H HB3  . ASN B 1 14  ? -1.672  5.365   11.346  1.00 0.00 ? 14  ASN B HB3  18 
ATOM 1976  H HD21 . ASN B 1 14  ? -3.685  6.026   13.977  1.00 0.00 ? 14  ASN B HD21 18 
ATOM 1977  H HD22 . ASN B 1 14  ? -2.800  7.304   14.660  1.00 0.00 ? 14  ASN B HD22 18 
ATOM 1978  N N    . CYS B 1 15  ? -3.118  4.610   9.173   1.00 0.00 ? 15  CYS B N    18 
ATOM 1979  C CA   . CYS B 1 15  ? -3.687  3.642   8.192   1.00 0.00 ? 15  CYS B CA   18 
ATOM 1980  C C    . CYS B 1 15  ? -5.106  3.268   8.625   1.00 0.00 ? 15  CYS B C    18 
ATOM 1981  O O    . CYS B 1 15  ? -5.314  2.317   9.353   1.00 0.00 ? 15  CYS B O    18 
ATOM 1982  C CB   . CYS B 1 15  ? -2.804  2.388   8.158   1.00 0.00 ? 15  CYS B CB   18 
ATOM 1983  S SG   . CYS B 1 15  ? -3.683  1.007   7.374   1.00 0.00 ? 15  CYS B SG   18 
ATOM 1984  H H    . CYS B 1 15  ? -2.269  4.410   9.621   1.00 0.00 ? 15  CYS B H    18 
ATOM 1985  H HA   . CYS B 1 15  ? -3.714  4.093   7.212   1.00 0.00 ? 15  CYS B HA   18 
ATOM 1986  H HB2  . CYS B 1 15  ? -1.900  2.596   7.612   1.00 0.00 ? 15  CYS B HB2  18 
ATOM 1987  H HB3  . CYS B 1 15  ? -2.546  2.114   9.168   1.00 0.00 ? 15  CYS B HB3  18 
ATOM 1988  N N    . CYS B 1 16  ? -6.085  4.008   8.183   1.00 0.00 ? 16  CYS B N    18 
ATOM 1989  C CA   . CYS B 1 16  ? -7.486  3.691   8.567   1.00 0.00 ? 16  CYS B CA   18 
ATOM 1990  C C    . CYS B 1 16  ? -8.375  3.770   7.329   1.00 0.00 ? 16  CYS B C    18 
ATOM 1991  O O    . CYS B 1 16  ? -8.433  4.781   6.656   1.00 0.00 ? 16  CYS B O    18 
ATOM 1992  C CB   . CYS B 1 16  ? -7.978  4.693   9.613   1.00 0.00 ? 16  CYS B CB   18 
ATOM 1993  S SG   . CYS B 1 16  ? -8.954  3.819   10.861  1.00 0.00 ? 16  CYS B SG   18 
ATOM 1994  H H    . CYS B 1 16  ? -5.897  4.768   7.595   1.00 0.00 ? 16  CYS B H    18 
ATOM 1995  H HA   . CYS B 1 16  ? -7.531  2.693   8.977   1.00 0.00 ? 16  CYS B HA   18 
ATOM 1996  H HB2  . CYS B 1 16  ? -7.131  5.170   10.084  1.00 0.00 ? 16  CYS B HB2  18 
ATOM 1997  H HB3  . CYS B 1 16  ? -8.592  5.441   9.134   1.00 0.00 ? 16  CYS B HB3  18 
ATOM 1998  N N    . VAL B 1 17  ? -9.064  2.710   7.020   1.00 0.00 ? 17  VAL B N    18 
ATOM 1999  C CA   . VAL B 1 17  ? -9.944  2.722   5.822   1.00 0.00 ? 17  VAL B CA   18 
ATOM 2000  C C    . VAL B 1 17  ? -11.040 3.779   5.993   1.00 0.00 ? 17  VAL B C    18 
ATOM 2001  O O    . VAL B 1 17  ? -11.914 3.654   6.827   1.00 0.00 ? 17  VAL B O    18 
ATOM 2002  C CB   . VAL B 1 17  ? -10.580 1.344   5.648   1.00 0.00 ? 17  VAL B CB   18 
ATOM 2003  C CG1  . VAL B 1 17  ? -11.629 1.124   6.730   1.00 0.00 ? 17  VAL B CG1  18 
ATOM 2004  C CG2  . VAL B 1 17  ? -11.249 1.265   4.281   1.00 0.00 ? 17  VAL B CG2  18 
ATOM 2005  H H    . VAL B 1 17  ? -9.000  1.904   7.573   1.00 0.00 ? 17  VAL B H    18 
ATOM 2006  H HA   . VAL B 1 17  ? -9.353  2.956   4.950   1.00 0.00 ? 17  VAL B HA   18 
ATOM 2007  H HB   . VAL B 1 17  ? -9.821  0.583   5.727   1.00 0.00 ? 17  VAL B HB   18 
ATOM 2008  H HG11 . VAL B 1 17  ? -11.296 1.574   7.652   1.00 0.00 ? 17  VAL B HG11 18 
ATOM 2009  H HG12 . VAL B 1 17  ? -12.560 1.578   6.423   1.00 0.00 ? 17  VAL B HG12 18 
ATOM 2010  H HG13 . VAL B 1 17  ? -11.777 0.064   6.876   1.00 0.00 ? 17  VAL B HG13 18 
ATOM 2011  H HG21 . VAL B 1 17  ? -11.979 2.056   4.196   1.00 0.00 ? 17  VAL B HG21 18 
ATOM 2012  H HG22 . VAL B 1 17  ? -10.503 1.378   3.510   1.00 0.00 ? 17  VAL B HG22 18 
ATOM 2013  H HG23 . VAL B 1 17  ? -11.738 0.309   4.176   1.00 0.00 ? 17  VAL B HG23 18 
ATOM 2014  N N    . ARG B 1 18  ? -11.002 4.820   5.208   1.00 0.00 ? 18  ARG B N    18 
ATOM 2015  C CA   . ARG B 1 18  ? -12.043 5.880   5.330   1.00 0.00 ? 18  ARG B CA   18 
ATOM 2016  C C    . ARG B 1 18  ? -13.158 5.622   4.315   1.00 0.00 ? 18  ARG B C    18 
ATOM 2017  O O    . ARG B 1 18  ? -12.964 4.948   3.323   1.00 0.00 ? 18  ARG B O    18 
ATOM 2018  C CB   . ARG B 1 18  ? -11.413 7.248   5.059   1.00 0.00 ? 18  ARG B CB   18 
ATOM 2019  C CG   . ARG B 1 18  ? -10.742 7.765   6.333   1.00 0.00 ? 18  ARG B CG   18 
ATOM 2020  C CD   . ARG B 1 18  ? -10.140 9.147   6.068   1.00 0.00 ? 18  ARG B CD   18 
ATOM 2021  N NE   . ARG B 1 18  ? -8.909  9.320   6.889   1.00 0.00 ? 18  ARG B NE   18 
ATOM 2022  C CZ   . ARG B 1 18  ? -8.931  10.088  7.945   1.00 0.00 ? 18  ARG B CZ   18 
ATOM 2023  N NH1  . ARG B 1 18  ? -8.818  11.381  7.813   1.00 0.00 ? 18  ARG B NH1  18 
ATOM 2024  N NH2  . ARG B 1 18  ? -9.064  9.562   9.131   1.00 0.00 ? 18  ARG B NH2  18 
ATOM 2025  H H    . ARG B 1 18  ? -10.291 4.906   4.541   1.00 0.00 ? 18  ARG B H    18 
ATOM 2026  H HA   . ARG B 1 18  ? -12.456 5.867   6.328   1.00 0.00 ? 18  ARG B HA   18 
ATOM 2027  H HB2  . ARG B 1 18  ? -10.676 7.155   4.274   1.00 0.00 ? 18  ARG B HB2  18 
ATOM 2028  H HB3  . ARG B 1 18  ? -12.180 7.943   4.750   1.00 0.00 ? 18  ARG B HB3  18 
ATOM 2029  H HG2  . ARG B 1 18  ? -11.475 7.836   7.122   1.00 0.00 ? 18  ARG B HG2  18 
ATOM 2030  H HG3  . ARG B 1 18  ? -9.957  7.085   6.629   1.00 0.00 ? 18  ARG B HG3  18 
ATOM 2031  H HD2  . ARG B 1 18  ? -9.889  9.235   5.022   1.00 0.00 ? 18  ARG B HD2  18 
ATOM 2032  H HD3  . ARG B 1 18  ? -10.859 9.908   6.331   1.00 0.00 ? 18  ARG B HD3  18 
ATOM 2033  H HE   . ARG B 1 18  ? -8.082  8.857   6.638   1.00 0.00 ? 18  ARG B HE   18 
ATOM 2034  H HH11 . ARG B 1 18  ? -8.715  11.784  6.904   1.00 0.00 ? 18  ARG B HH11 18 
ATOM 2035  H HH12 . ARG B 1 18  ? -8.836  11.970  8.621   1.00 0.00 ? 18  ARG B HH12 18 
ATOM 2036  H HH21 . ARG B 1 18  ? -9.148  8.572   9.232   1.00 0.00 ? 18  ARG B HH21 18 
ATOM 2037  H HH22 . ARG B 1 18  ? -9.081  10.151  9.940   1.00 0.00 ? 18  ARG B HH22 18 
ATOM 2038  N N    . GLN B 1 19  ? -14.326 6.155   4.552   1.00 0.00 ? 19  GLN B N    18 
ATOM 2039  C CA   . GLN B 1 19  ? -15.452 5.943   3.600   1.00 0.00 ? 19  GLN B CA   18 
ATOM 2040  C C    . GLN B 1 19  ? -15.071 6.507   2.232   1.00 0.00 ? 19  GLN B C    18 
ATOM 2041  O O    . GLN B 1 19  ? -14.368 7.493   2.129   1.00 0.00 ? 19  GLN B O    18 
ATOM 2042  C CB   . GLN B 1 19  ? -16.701 6.657   4.119   1.00 0.00 ? 19  GLN B CB   18 
ATOM 2043  C CG   . GLN B 1 19  ? -16.466 8.170   4.118   1.00 0.00 ? 19  GLN B CG   18 
ATOM 2044  C CD   . GLN B 1 19  ? -16.413 8.680   5.559   1.00 0.00 ? 19  GLN B CD   18 
ATOM 2045  O OE1  . GLN B 1 19  ? -15.629 8.205   6.356   1.00 0.00 ? 19  GLN B OE1  18 
ATOM 2046  N NE2  . GLN B 1 19  ? -17.221 9.636   5.929   1.00 0.00 ? 19  GLN B NE2  18 
ATOM 2047  H H    . GLN B 1 19  ? -14.462 6.696   5.358   1.00 0.00 ? 19  GLN B H    18 
ATOM 2048  H HA   . GLN B 1 19  ? -15.655 4.887   3.506   1.00 0.00 ? 19  GLN B HA   18 
ATOM 2049  H HB2  . GLN B 1 19  ? -17.541 6.422   3.482   1.00 0.00 ? 19  GLN B HB2  18 
ATOM 2050  H HB3  . GLN B 1 19  ? -16.911 6.328   5.127   1.00 0.00 ? 19  GLN B HB3  18 
ATOM 2051  H HG2  . GLN B 1 19  ? -15.532 8.389   3.623   1.00 0.00 ? 19  GLN B HG2  18 
ATOM 2052  H HG3  . GLN B 1 19  ? -17.274 8.659   3.595   1.00 0.00 ? 19  GLN B HG3  18 
ATOM 2053  H HE21 . GLN B 1 19  ? -17.853 10.020  5.287   1.00 0.00 ? 19  GLN B HE21 18 
ATOM 2054  H HE22 . GLN B 1 19  ? -17.195 9.971   6.850   1.00 0.00 ? 19  GLN B HE22 18 
ATOM 2055  N N    . LEU B 1 20  ? -15.526 5.889   1.177   1.00 0.00 ? 20  LEU B N    18 
ATOM 2056  C CA   . LEU B 1 20  ? -15.185 6.395   -0.179  1.00 0.00 ? 20  LEU B CA   18 
ATOM 2057  C C    . LEU B 1 20  ? -16.284 6.016   -1.163  1.00 0.00 ? 20  LEU B C    18 
ATOM 2058  O O    . LEU B 1 20  ? -16.015 5.551   -2.252  1.00 0.00 ? 20  LEU B O    18 
ATOM 2059  C CB   . LEU B 1 20  ? -13.868 5.775   -0.644  1.00 0.00 ? 20  LEU B CB   18 
ATOM 2060  C CG   . LEU B 1 20  ? -13.405 6.462   -1.932  1.00 0.00 ? 20  LEU B CG   18 
ATOM 2061  C CD1  . LEU B 1 20  ? -13.273 7.966   -1.693  1.00 0.00 ? 20  LEU B CD1  18 
ATOM 2062  C CD2  . LEU B 1 20  ? -12.049 5.894   -2.353  1.00 0.00 ? 20  LEU B CD2  18 
ATOM 2063  H H    . LEU B 1 20  ? -16.089 5.095   1.279   1.00 0.00 ? 20  LEU B H    18 
ATOM 2064  H HA   . LEU B 1 20  ? -15.082 7.469   -0.148  1.00 0.00 ? 20  LEU B HA   18 
ATOM 2065  H HB2  . LEU B 1 20  ? -13.124 5.906   0.121   1.00 0.00 ? 20  LEU B HB2  18 
ATOM 2066  H HB3  . LEU B 1 20  ? -14.011 4.722   -0.832  1.00 0.00 ? 20  LEU B HB3  18 
ATOM 2067  H HG   . LEU B 1 20  ? -14.127 6.284   -2.714  1.00 0.00 ? 20  LEU B HG   18 
ATOM 2068  H HD11 . LEU B 1 20  ? -13.201 8.156   -0.633  1.00 0.00 ? 20  LEU B HD11 18 
ATOM 2069  H HD12 . LEU B 1 20  ? -12.386 8.331   -2.186  1.00 0.00 ? 20  LEU B HD12 18 
ATOM 2070  H HD13 . LEU B 1 20  ? -14.142 8.470   -2.092  1.00 0.00 ? 20  LEU B HD13 18 
ATOM 2071  H HD21 . LEU B 1 20  ? -12.120 4.821   -2.444  1.00 0.00 ? 20  LEU B HD21 18 
ATOM 2072  H HD22 . LEU B 1 20  ? -11.763 6.318   -3.304  1.00 0.00 ? 20  LEU B HD22 18 
ATOM 2073  H HD23 . LEU B 1 20  ? -11.307 6.146   -1.612  1.00 0.00 ? 20  LEU B HD23 18 
ATOM 2074  N N    . TYR B 1 21  ? -17.523 6.208   -0.806  1.00 0.00 ? 21  TYR B N    18 
ATOM 2075  C CA   . TYR B 1 21  ? -18.607 5.851   -1.758  1.00 0.00 ? 21  TYR B CA   18 
ATOM 2076  C C    . TYR B 1 21  ? -18.253 6.416   -3.130  1.00 0.00 ? 21  TYR B C    18 
ATOM 2077  O O    . TYR B 1 21  ? -17.870 7.561   -3.259  1.00 0.00 ? 21  TYR B O    18 
ATOM 2078  C CB   . TYR B 1 21  ? -19.941 6.444   -1.308  1.00 0.00 ? 21  TYR B CB   18 
ATOM 2079  C CG   . TYR B 1 21  ? -20.982 6.146   -2.364  1.00 0.00 ? 21  TYR B CG   18 
ATOM 2080  C CD1  . TYR B 1 21  ? -20.981 6.855   -3.573  1.00 0.00 ? 21  TYR B CD1  18 
ATOM 2081  C CD2  . TYR B 1 21  ? -21.942 5.155   -2.135  1.00 0.00 ? 21  TYR B CD2  18 
ATOM 2082  C CE1  . TYR B 1 21  ? -21.940 6.572   -4.553  1.00 0.00 ? 21  TYR B CE1  18 
ATOM 2083  C CE2  . TYR B 1 21  ? -22.903 4.871   -3.114  1.00 0.00 ? 21  TYR B CE2  18 
ATOM 2084  C CZ   . TYR B 1 21  ? -22.902 5.580   -4.322  1.00 0.00 ? 21  TYR B CZ   18 
ATOM 2085  O OH   . TYR B 1 21  ? -23.851 5.301   -5.286  1.00 0.00 ? 21  TYR B OH   18 
ATOM 2086  H H    . TYR B 1 21  ? -17.734 6.584   0.076   1.00 0.00 ? 21  TYR B H    18 
ATOM 2087  H HA   . TYR B 1 21  ? -18.692 4.775   -1.821  1.00 0.00 ? 21  TYR B HA   18 
ATOM 2088  H HB2  . TYR B 1 21  ? -20.237 6.001   -0.368  1.00 0.00 ? 21  TYR B HB2  18 
ATOM 2089  H HB3  . TYR B 1 21  ? -19.842 7.512   -1.192  1.00 0.00 ? 21  TYR B HB3  18 
ATOM 2090  H HD1  . TYR B 1 21  ? -20.238 7.619   -3.749  1.00 0.00 ? 21  TYR B HD1  18 
ATOM 2091  H HD2  . TYR B 1 21  ? -21.940 4.607   -1.205  1.00 0.00 ? 21  TYR B HD2  18 
ATOM 2092  H HE1  . TYR B 1 21  ? -21.938 7.118   -5.489  1.00 0.00 ? 21  TYR B HE1  18 
ATOM 2093  H HE2  . TYR B 1 21  ? -23.644 4.106   -2.937  1.00 0.00 ? 21  TYR B HE2  18 
ATOM 2094  H HH   . TYR B 1 21  ? -24.664 5.749   -5.039  1.00 0.00 ? 21  TYR B HH   18 
ATOM 2095  N N    . ILE B 1 22  ? -18.375 5.626   -4.154  1.00 0.00 ? 22  ILE B N    18 
ATOM 2096  C CA   . ILE B 1 22  ? -18.041 6.128   -5.512  1.00 0.00 ? 22  ILE B CA   18 
ATOM 2097  C C    . ILE B 1 22  ? -19.258 5.972   -6.419  1.00 0.00 ? 22  ILE B C    18 
ATOM 2098  O O    . ILE B 1 22  ? -19.732 4.878   -6.655  1.00 0.00 ? 22  ILE B O    18 
ATOM 2099  C CB   . ILE B 1 22  ? -16.873 5.321   -6.081  1.00 0.00 ? 22  ILE B CB   18 
ATOM 2100  C CG1  . ILE B 1 22  ? -15.604 5.620   -5.280  1.00 0.00 ? 22  ILE B CG1  18 
ATOM 2101  C CG2  . ILE B 1 22  ? -16.651 5.707   -7.544  1.00 0.00 ? 22  ILE B CG2  18 
ATOM 2102  C CD1  . ILE B 1 22  ? -14.398 4.996   -5.982  1.00 0.00 ? 22  ILE B CD1  18 
ATOM 2103  H H    . ILE B 1 22  ? -18.686 4.706   -4.031  1.00 0.00 ? 22  ILE B H    18 
ATOM 2104  H HA   . ILE B 1 22  ? -17.765 7.171   -5.454  1.00 0.00 ? 22  ILE B HA   18 
ATOM 2105  H HB   . ILE B 1 22  ? -17.101 4.267   -6.019  1.00 0.00 ? 22  ILE B HB   18 
ATOM 2106  H HG12 . ILE B 1 22  ? -15.467 6.689   -5.208  1.00 0.00 ? 22  ILE B HG12 18 
ATOM 2107  H HG13 . ILE B 1 22  ? -15.697 5.200   -4.290  1.00 0.00 ? 22  ILE B HG13 18 
ATOM 2108  H HG21 . ILE B 1 22  ? -17.590 5.667   -8.074  1.00 0.00 ? 22  ILE B HG21 18 
ATOM 2109  H HG22 . ILE B 1 22  ? -16.252 6.710   -7.593  1.00 0.00 ? 22  ILE B HG22 18 
ATOM 2110  H HG23 . ILE B 1 22  ? -15.951 5.020   -7.995  1.00 0.00 ? 22  ILE B HG23 18 
ATOM 2111  H HD11 . ILE B 1 22  ? -14.723 4.497   -6.884  1.00 0.00 ? 22  ILE B HD11 18 
ATOM 2112  H HD12 . ILE B 1 22  ? -13.688 5.769   -6.237  1.00 0.00 ? 22  ILE B HD12 18 
ATOM 2113  H HD13 . ILE B 1 22  ? -13.929 4.279   -5.325  1.00 0.00 ? 22  ILE B HD13 18 
ATOM 2114  N N    . ASP B 1 23  ? -19.763 7.054   -6.943  1.00 0.00 ? 23  ASP B N    18 
ATOM 2115  C CA   . ASP B 1 23  ? -20.939 6.951   -7.844  1.00 0.00 ? 23  ASP B CA   18 
ATOM 2116  C C    . ASP B 1 23  ? -20.432 6.615   -9.242  1.00 0.00 ? 23  ASP B C    18 
ATOM 2117  O O    . ASP B 1 23  ? -20.023 7.477   -9.988  1.00 0.00 ? 23  ASP B O    18 
ATOM 2118  C CB   . ASP B 1 23  ? -21.704 8.275   -7.858  1.00 0.00 ? 23  ASP B CB   18 
ATOM 2119  C CG   . ASP B 1 23  ? -22.761 8.247   -8.965  1.00 0.00 ? 23  ASP B CG   18 
ATOM 2120  O OD1  . ASP B 1 23  ? -22.896 7.218   -9.605  1.00 0.00 ? 23  ASP B OD1  18 
ATOM 2121  O OD2  . ASP B 1 23  ? -23.422 9.256   -9.152  1.00 0.00 ? 23  ASP B OD2  18 
ATOM 2122  H H    . ASP B 1 23  ? -19.364 7.927   -6.750  1.00 0.00 ? 23  ASP B H    18 
ATOM 2123  H HA   . ASP B 1 23  ? -21.590 6.161   -7.502  1.00 0.00 ? 23  ASP B HA   18 
ATOM 2124  H HB2  . ASP B 1 23  ? -22.189 8.418   -6.903  1.00 0.00 ? 23  ASP B HB2  18 
ATOM 2125  H HB3  . ASP B 1 23  ? -21.017 9.083   -8.036  1.00 0.00 ? 23  ASP B HB3  18 
ATOM 2126  N N    . PHE B 1 24  ? -20.439 5.350   -9.563  1.00 0.00 ? 24  PHE B N    18 
ATOM 2127  C CA   . PHE B 1 24  ? -19.947 4.855   -10.888 1.00 0.00 ? 24  PHE B CA   18 
ATOM 2128  C C    . PHE B 1 24  ? -19.798 5.980   -11.918 1.00 0.00 ? 24  PHE B C    18 
ATOM 2129  O O    . PHE B 1 24  ? -18.751 6.148   -12.506 1.00 0.00 ? 24  PHE B O    18 
ATOM 2130  C CB   . PHE B 1 24  ? -20.934 3.817   -11.426 1.00 0.00 ? 24  PHE B CB   18 
ATOM 2131  C CG   . PHE B 1 24  ? -20.593 2.464   -10.851 1.00 0.00 ? 24  PHE B CG   18 
ATOM 2132  C CD1  . PHE B 1 24  ? -19.435 1.801   -11.271 1.00 0.00 ? 24  PHE B CD1  18 
ATOM 2133  C CD2  . PHE B 1 24  ? -21.426 1.879   -9.892  1.00 0.00 ? 24  PHE B CD2  18 
ATOM 2134  C CE1  . PHE B 1 24  ? -19.111 0.552   -10.733 1.00 0.00 ? 24  PHE B CE1  18 
ATOM 2135  C CE2  . PHE B 1 24  ? -21.103 0.627   -9.356  1.00 0.00 ? 24  PHE B CE2  18 
ATOM 2136  C CZ   . PHE B 1 24  ? -19.945 -0.035  -9.776  1.00 0.00 ? 24  PHE B CZ   18 
ATOM 2137  H H    . PHE B 1 24  ? -20.763 4.700   -8.905  1.00 0.00 ? 24  PHE B H    18 
ATOM 2138  H HA   . PHE B 1 24  ? -18.988 4.381   -10.749 1.00 0.00 ? 24  PHE B HA   18 
ATOM 2139  H HB2  . PHE B 1 24  ? -21.938 4.090   -11.137 1.00 0.00 ? 24  PHE B HB2  18 
ATOM 2140  H HB3  . PHE B 1 24  ? -20.865 3.778   -12.502 1.00 0.00 ? 24  PHE B HB3  18 
ATOM 2141  H HD1  . PHE B 1 24  ? -18.795 2.251   -12.013 1.00 0.00 ? 24  PHE B HD1  18 
ATOM 2142  H HD2  . PHE B 1 24  ? -22.321 2.390   -9.568  1.00 0.00 ? 24  PHE B HD2  18 
ATOM 2143  H HE1  . PHE B 1 24  ? -18.217 0.039   -11.057 1.00 0.00 ? 24  PHE B HE1  18 
ATOM 2144  H HE2  . PHE B 1 24  ? -21.746 0.171   -8.618  1.00 0.00 ? 24  PHE B HE2  18 
ATOM 2145  H HZ   . PHE B 1 24  ? -19.694 -0.997  -9.360  1.00 0.00 ? 24  PHE B HZ   18 
ATOM 2146  N N    . ARG B 1 25  ? -20.836 6.733   -12.163 1.00 0.00 ? 25  ARG B N    18 
ATOM 2147  C CA   . ARG B 1 25  ? -20.745 7.811   -13.192 1.00 0.00 ? 25  ARG B CA   18 
ATOM 2148  C C    . ARG B 1 25  ? -20.212 9.122   -12.600 1.00 0.00 ? 25  ARG B C    18 
ATOM 2149  O O    . ARG B 1 25  ? -19.472 9.840   -13.244 1.00 0.00 ? 25  ARG B O    18 
ATOM 2150  C CB   . ARG B 1 25  ? -22.134 8.058   -13.786 1.00 0.00 ? 25  ARG B CB   18 
ATOM 2151  C CG   . ARG B 1 25  ? -23.058 8.630   -12.709 1.00 0.00 ? 25  ARG B CG   18 
ATOM 2152  C CD   . ARG B 1 25  ? -24.482 8.733   -13.260 1.00 0.00 ? 25  ARG B CD   18 
ATOM 2153  N NE   . ARG B 1 25  ? -25.392 9.230   -12.190 1.00 0.00 ? 25  ARG B NE   18 
ATOM 2154  C CZ   . ARG B 1 25  ? -26.568 9.703   -12.501 1.00 0.00 ? 25  ARG B CZ   18 
ATOM 2155  N NH1  . ARG B 1 25  ? -27.165 9.307   -13.592 1.00 0.00 ? 25  ARG B NH1  18 
ATOM 2156  N NH2  . ARG B 1 25  ? -27.147 10.575  -11.721 1.00 0.00 ? 25  ARG B NH2  18 
ATOM 2157  H H    . ARG B 1 25  ? -21.679 6.573   -11.692 1.00 0.00 ? 25  ARG B H    18 
ATOM 2158  H HA   . ARG B 1 25  ? -20.084 7.487   -13.979 1.00 0.00 ? 25  ARG B HA   18 
ATOM 2159  H HB2  . ARG B 1 25  ? -22.055 8.761   -14.603 1.00 0.00 ? 25  ARG B HB2  18 
ATOM 2160  H HB3  . ARG B 1 25  ? -22.541 7.127   -14.149 1.00 0.00 ? 25  ARG B HB3  18 
ATOM 2161  H HG2  . ARG B 1 25  ? -23.051 7.981   -11.845 1.00 0.00 ? 25  ARG B HG2  18 
ATOM 2162  H HG3  . ARG B 1 25  ? -22.714 9.614   -12.424 1.00 0.00 ? 25  ARG B HG3  18 
ATOM 2163  H HD2  . ARG B 1 25  ? -24.497 9.419   -14.093 1.00 0.00 ? 25  ARG B HD2  18 
ATOM 2164  H HD3  . ARG B 1 25  ? -24.811 7.758   -13.589 1.00 0.00 ? 25  ARG B HD3  18 
ATOM 2165  H HE   . ARG B 1 25  ? -25.108 9.202   -11.253 1.00 0.00 ? 25  ARG B HE   18 
ATOM 2166  H HH11 . ARG B 1 25  ? -26.721 8.639   -14.190 1.00 0.00 ? 25  ARG B HH11 18 
ATOM 2167  H HH12 . ARG B 1 25  ? -28.066 9.670   -13.830 1.00 0.00 ? 25  ARG B HH12 18 
ATOM 2168  H HH21 . ARG B 1 25  ? -26.689 10.878  -10.885 1.00 0.00 ? 25  ARG B HH21 18 
ATOM 2169  H HH22 . ARG B 1 25  ? -28.047 10.938  -11.958 1.00 0.00 ? 25  ARG B HH22 18 
ATOM 2170  N N    . LYS B 1 26  ? -20.598 9.464   -11.403 1.00 0.00 ? 26  LYS B N    18 
ATOM 2171  C CA   . LYS B 1 26  ? -20.122 10.753  -10.817 1.00 0.00 ? 26  LYS B CA   18 
ATOM 2172  C C    . LYS B 1 26  ? -18.607 10.730  -10.616 1.00 0.00 ? 26  LYS B C    18 
ATOM 2173  O O    . LYS B 1 26  ? -17.906 11.647  -10.996 1.00 0.00 ? 26  LYS B O    18 
ATOM 2174  C CB   . LYS B 1 26  ? -20.787 10.969  -9.460  1.00 0.00 ? 26  LYS B CB   18 
ATOM 2175  C CG   . LYS B 1 26  ? -20.976 12.469  -9.217  1.00 0.00 ? 26  LYS B CG   18 
ATOM 2176  C CD   . LYS B 1 26  ? -20.134 12.902  -8.015  1.00 0.00 ? 26  LYS B CD   18 
ATOM 2177  C CE   . LYS B 1 26  ? -18.934 13.716  -8.500  1.00 0.00 ? 26  LYS B CE   18 
ATOM 2178  N NZ   . LYS B 1 26  ? -18.025 13.994  -7.352  1.00 0.00 ? 26  LYS B NZ   18 
ATOM 2179  H H    . LYS B 1 26  ? -21.214 8.891   -10.899 1.00 0.00 ? 26  LYS B H    18 
ATOM 2180  H HA   . LYS B 1 26  ? -20.385 11.567  -11.476 1.00 0.00 ? 26  LYS B HA   18 
ATOM 2181  H HB2  . LYS B 1 26  ? -21.741 10.472  -9.445  1.00 0.00 ? 26  LYS B HB2  18 
ATOM 2182  H HB3  . LYS B 1 26  ? -20.156 10.563  -8.686  1.00 0.00 ? 26  LYS B HB3  18 
ATOM 2183  H HG2  . LYS B 1 26  ? -20.663 13.017  -10.093 1.00 0.00 ? 26  LYS B HG2  18 
ATOM 2184  H HG3  . LYS B 1 26  ? -22.017 12.673  -9.016  1.00 0.00 ? 26  LYS B HG3  18 
ATOM 2185  H HD2  . LYS B 1 26  ? -20.737 13.507  -7.352  1.00 0.00 ? 26  LYS B HD2  18 
ATOM 2186  H HD3  . LYS B 1 26  ? -19.784 12.028  -7.486  1.00 0.00 ? 26  LYS B HD3  18 
ATOM 2187  H HE2  . LYS B 1 26  ? -18.399 13.155  -9.253  1.00 0.00 ? 26  LYS B HE2  18 
ATOM 2188  H HE3  . LYS B 1 26  ? -19.277 14.649  -8.921  1.00 0.00 ? 26  LYS B HE3  18 
ATOM 2189  H HZ1  . LYS B 1 26  ? -17.914 13.132  -6.781  1.00 0.00 ? 26  LYS B HZ1  18 
ATOM 2190  H HZ2  . LYS B 1 26  ? -17.096 14.293  -7.709  1.00 0.00 ? 26  LYS B HZ2  18 
ATOM 2191  H HZ3  . LYS B 1 26  ? -18.432 14.750  -6.764  1.00 0.00 ? 26  LYS B HZ3  18 
ATOM 2192  N N    . ASP B 1 27  ? -18.103 9.712   -9.982  1.00 0.00 ? 27  ASP B N    18 
ATOM 2193  C CA   . ASP B 1 27  ? -16.644 9.651   -9.707  1.00 0.00 ? 27  ASP B CA   18 
ATOM 2194  C C    . ASP B 1 27  ? -15.873 8.958   -10.839 1.00 0.00 ? 27  ASP B C    18 
ATOM 2195  O O    . ASP B 1 27  ? -14.944 9.516   -11.388 1.00 0.00 ? 27  ASP B O    18 
ATOM 2196  C CB   . ASP B 1 27  ? -16.437 8.884   -8.407  1.00 0.00 ? 27  ASP B CB   18 
ATOM 2197  C CG   . ASP B 1 27  ? -16.434 9.862   -7.233  1.00 0.00 ? 27  ASP B CG   18 
ATOM 2198  O OD1  . ASP B 1 27  ? -15.572 10.726  -7.209  1.00 0.00 ? 27  ASP B OD1  18 
ATOM 2199  O OD2  . ASP B 1 27  ? -17.292 9.731   -6.375  1.00 0.00 ? 27  ASP B OD2  18 
ATOM 2200  H H    . ASP B 1 27  ? -18.689 9.003   -9.651  1.00 0.00 ? 27  ASP B H    18 
ATOM 2201  H HA   . ASP B 1 27  ? -16.265 10.654  -9.584  1.00 0.00 ? 27  ASP B HA   18 
ATOM 2202  H HB2  . ASP B 1 27  ? -17.240 8.171   -8.280  1.00 0.00 ? 27  ASP B HB2  18 
ATOM 2203  H HB3  . ASP B 1 27  ? -15.500 8.363   -8.446  1.00 0.00 ? 27  ASP B HB3  18 
ATOM 2204  N N    . LEU B 1 28  ? -16.216 7.744   -11.177 1.00 0.00 ? 28  LEU B N    18 
ATOM 2205  C CA   . LEU B 1 28  ? -15.452 7.040   -12.252 1.00 0.00 ? 28  LEU B CA   18 
ATOM 2206  C C    . LEU B 1 28  ? -16.052 7.331   -13.625 1.00 0.00 ? 28  LEU B C    18 
ATOM 2207  O O    . LEU B 1 28  ? -15.421 7.120   -14.641 1.00 0.00 ? 28  LEU B O    18 
ATOM 2208  C CB   . LEU B 1 28  ? -15.500 5.531   -12.008 1.00 0.00 ? 28  LEU B CB   18 
ATOM 2209  C CG   . LEU B 1 28  ? -14.932 5.217   -10.627 1.00 0.00 ? 28  LEU B CG   18 
ATOM 2210  C CD1  . LEU B 1 28  ? -14.917 3.704   -10.416 1.00 0.00 ? 28  LEU B CD1  18 
ATOM 2211  C CD2  . LEU B 1 28  ? -13.504 5.754   -10.529 1.00 0.00 ? 28  LEU B CD2  18 
ATOM 2212  H H    . LEU B 1 28  ? -16.950 7.288   -10.713 1.00 0.00 ? 28  LEU B H    18 
ATOM 2213  H HA   . LEU B 1 28  ? -14.423 7.369   -12.234 1.00 0.00 ? 28  LEU B HA   18 
ATOM 2214  H HB2  . LEU B 1 28  ? -16.523 5.190   -12.063 1.00 0.00 ? 28  LEU B HB2  18 
ATOM 2215  H HB3  . LEU B 1 28  ? -14.910 5.025   -12.759 1.00 0.00 ? 28  LEU B HB3  18 
ATOM 2216  H HG   . LEU B 1 28  ? -15.549 5.683   -9.872  1.00 0.00 ? 28  LEU B HG   18 
ATOM 2217  H HD11 . LEU B 1 28  ? -15.586 3.236   -11.122 1.00 0.00 ? 28  LEU B HD11 18 
ATOM 2218  H HD12 . LEU B 1 28  ? -13.914 3.330   -10.568 1.00 0.00 ? 28  LEU B HD12 18 
ATOM 2219  H HD13 . LEU B 1 28  ? -15.235 3.478   -9.410  1.00 0.00 ? 28  LEU B HD13 18 
ATOM 2220  H HD21 . LEU B 1 28  ? -13.208 6.165   -11.482 1.00 0.00 ? 28  LEU B HD21 18 
ATOM 2221  H HD22 . LEU B 1 28  ? -13.463 6.525   -9.775  1.00 0.00 ? 28  LEU B HD22 18 
ATOM 2222  H HD23 . LEU B 1 28  ? -12.835 4.951   -10.259 1.00 0.00 ? 28  LEU B HD23 18 
ATOM 2223  N N    . GLY B 1 29  ? -17.265 7.796   -13.674 1.00 0.00 ? 29  GLY B N    18 
ATOM 2224  C CA   . GLY B 1 29  ? -17.887 8.073   -15.000 1.00 0.00 ? 29  GLY B CA   18 
ATOM 2225  C C    . GLY B 1 29  ? -18.038 6.753   -15.765 1.00 0.00 ? 29  GLY B C    18 
ATOM 2226  O O    . GLY B 1 29  ? -18.331 6.736   -16.945 1.00 0.00 ? 29  GLY B O    18 
ATOM 2227  H H    . GLY B 1 29  ? -17.768 7.952   -12.848 1.00 0.00 ? 29  GLY B H    18 
ATOM 2228  H HA2  . GLY B 1 29  ? -18.856 8.529   -14.859 1.00 0.00 ? 29  GLY B HA2  18 
ATOM 2229  H HA3  . GLY B 1 29  ? -17.253 8.741   -15.563 1.00 0.00 ? 29  GLY B HA3  18 
ATOM 2230  N N    . TRP B 1 30  ? -17.834 5.647   -15.098 1.00 0.00 ? 30  TRP B N    18 
ATOM 2231  C CA   . TRP B 1 30  ? -17.953 4.324   -15.769 1.00 0.00 ? 30  TRP B CA   18 
ATOM 2232  C C    . TRP B 1 30  ? -19.211 4.293   -16.639 1.00 0.00 ? 30  TRP B C    18 
ATOM 2233  O O    . TRP B 1 30  ? -20.302 4.576   -16.185 1.00 0.00 ? 30  TRP B O    18 
ATOM 2234  C CB   . TRP B 1 30  ? -18.040 3.227   -14.707 1.00 0.00 ? 30  TRP B CB   18 
ATOM 2235  C CG   . TRP B 1 30  ? -16.661 2.795   -14.325 1.00 0.00 ? 30  TRP B CG   18 
ATOM 2236  C CD1  . TRP B 1 30  ? -15.524 3.455   -14.642 1.00 0.00 ? 30  TRP B CD1  18 
ATOM 2237  C CD2  . TRP B 1 30  ? -16.254 1.621   -13.566 1.00 0.00 ? 30  TRP B CD2  18 
ATOM 2238  N NE1  . TRP B 1 30  ? -14.445 2.759   -14.127 1.00 0.00 ? 30  TRP B NE1  18 
ATOM 2239  C CE2  . TRP B 1 30  ? -14.844 1.621   -13.456 1.00 0.00 ? 30  TRP B CE2  18 
ATOM 2240  C CE3  . TRP B 1 30  ? -16.966 0.566   -12.970 1.00 0.00 ? 30  TRP B CE3  18 
ATOM 2241  C CZ2  . TRP B 1 30  ? -14.164 0.610   -12.778 1.00 0.00 ? 30  TRP B CZ2  18 
ATOM 2242  C CZ3  . TRP B 1 30  ? -16.285 -0.455  -12.287 1.00 0.00 ? 30  TRP B CZ3  18 
ATOM 2243  C CH2  . TRP B 1 30  ? -14.886 -0.433  -12.191 1.00 0.00 ? 30  TRP B CH2  18 
ATOM 2244  H H    . TRP B 1 30  ? -17.594 5.686   -14.152 1.00 0.00 ? 30  TRP B H    18 
ATOM 2245  H HA   . TRP B 1 30  ? -17.085 4.153   -16.389 1.00 0.00 ? 30  TRP B HA   18 
ATOM 2246  H HB2  . TRP B 1 30  ? -18.552 3.609   -13.835 1.00 0.00 ? 30  TRP B HB2  18 
ATOM 2247  H HB3  . TRP B 1 30  ? -18.585 2.383   -15.103 1.00 0.00 ? 30  TRP B HB3  18 
ATOM 2248  H HD1  . TRP B 1 30  ? -15.467 4.375   -15.205 1.00 0.00 ? 30  TRP B HD1  18 
ATOM 2249  H HE1  . TRP B 1 30  ? -13.506 3.025   -14.217 1.00 0.00 ? 30  TRP B HE1  18 
ATOM 2250  H HE3  . TRP B 1 30  ? -18.046 0.543   -13.036 1.00 0.00 ? 30  TRP B HE3  18 
ATOM 2251  H HZ2  . TRP B 1 30  ? -13.086 0.631   -12.707 1.00 0.00 ? 30  TRP B HZ2  18 
ATOM 2252  H HZ3  . TRP B 1 30  ? -16.840 -1.264  -11.835 1.00 0.00 ? 30  TRP B HZ3  18 
ATOM 2253  H HH2  . TRP B 1 30  ? -14.367 -1.221  -11.666 1.00 0.00 ? 30  TRP B HH2  18 
ATOM 2254  N N    . LYS B 1 31  ? -19.060 3.953   -17.887 1.00 0.00 ? 31  LYS B N    18 
ATOM 2255  C CA   . LYS B 1 31  ? -20.225 3.902   -18.798 1.00 0.00 ? 31  LYS B CA   18 
ATOM 2256  C C    . LYS B 1 31  ? -20.594 2.445   -19.077 1.00 0.00 ? 31  LYS B C    18 
ATOM 2257  O O    . LYS B 1 31  ? -21.625 2.156   -19.651 1.00 0.00 ? 31  LYS B O    18 
ATOM 2258  C CB   . LYS B 1 31  ? -19.835 4.579   -20.105 1.00 0.00 ? 31  LYS B CB   18 
ATOM 2259  C CG   . LYS B 1 31  ? -20.181 6.068   -20.039 1.00 0.00 ? 31  LYS B CG   18 
ATOM 2260  C CD   . LYS B 1 31  ? -19.407 6.821   -21.124 1.00 0.00 ? 31  LYS B CD   18 
ATOM 2261  C CE   . LYS B 1 31  ? -17.910 6.768   -20.813 1.00 0.00 ? 31  LYS B CE   18 
ATOM 2262  N NZ   . LYS B 1 31  ? -17.195 6.083   -21.927 1.00 0.00 ? 31  LYS B NZ   18 
ATOM 2263  H H    . LYS B 1 31  ? -18.173 3.734   -18.234 1.00 0.00 ? 31  LYS B H    18 
ATOM 2264  H HA   . LYS B 1 31  ? -21.064 4.417   -18.356 1.00 0.00 ? 31  LYS B HA   18 
ATOM 2265  H HB2  . LYS B 1 31  ? -18.773 4.460   -20.260 1.00 0.00 ? 31  LYS B HB2  18 
ATOM 2266  H HB3  . LYS B 1 31  ? -20.366 4.118   -20.915 1.00 0.00 ? 31  LYS B HB3  18 
ATOM 2267  H HG2  . LYS B 1 31  ? -21.243 6.198   -20.197 1.00 0.00 ? 31  LYS B HG2  18 
ATOM 2268  H HG3  . LYS B 1 31  ? -19.910 6.458   -19.070 1.00 0.00 ? 31  LYS B HG3  18 
ATOM 2269  H HD2  . LYS B 1 31  ? -19.594 6.362   -22.084 1.00 0.00 ? 31  LYS B HD2  18 
ATOM 2270  H HD3  . LYS B 1 31  ? -19.731 7.851   -21.148 1.00 0.00 ? 31  LYS B HD3  18 
ATOM 2271  H HE2  . LYS B 1 31  ? -17.528 7.772   -20.706 1.00 0.00 ? 31  LYS B HE2  18 
ATOM 2272  H HE3  . LYS B 1 31  ? -17.751 6.222   -19.895 1.00 0.00 ? 31  LYS B HE3  18 
ATOM 2273  H HZ1  . LYS B 1 31  ? -17.360 6.597   -22.815 1.00 0.00 ? 31  LYS B HZ1  18 
ATOM 2274  H HZ2  . LYS B 1 31  ? -16.176 6.062   -21.725 1.00 0.00 ? 31  LYS B HZ2  18 
ATOM 2275  H HZ3  . LYS B 1 31  ? -17.551 5.109   -22.019 1.00 0.00 ? 31  LYS B HZ3  18 
ATOM 2276  N N    . TRP B 1 32  ? -19.755 1.524   -18.687 1.00 0.00 ? 32  TRP B N    18 
ATOM 2277  C CA   . TRP B 1 32  ? -20.063 0.092   -18.948 1.00 0.00 ? 32  TRP B CA   18 
ATOM 2278  C C    . TRP B 1 32  ? -20.915 -0.475  -17.814 1.00 0.00 ? 32  TRP B C    18 
ATOM 2279  O O    . TRP B 1 32  ? -21.310 -1.620  -17.844 1.00 0.00 ? 32  TRP B O    18 
ATOM 2280  C CB   . TRP B 1 32  ? -18.763 -0.705  -19.067 1.00 0.00 ? 32  TRP B CB   18 
ATOM 2281  C CG   . TRP B 1 32  ? -18.163 -0.926  -17.713 1.00 0.00 ? 32  TRP B CG   18 
ATOM 2282  C CD1  . TRP B 1 32  ? -17.446 -0.011  -17.025 1.00 0.00 ? 32  TRP B CD1  18 
ATOM 2283  C CD2  . TRP B 1 32  ? -18.212 -2.118  -16.877 1.00 0.00 ? 32  TRP B CD2  18 
ATOM 2284  N NE1  . TRP B 1 32  ? -17.038 -0.567  -15.830 1.00 0.00 ? 32  TRP B NE1  18 
ATOM 2285  C CE2  . TRP B 1 32  ? -17.487 -1.864  -15.689 1.00 0.00 ? 32  TRP B CE2  18 
ATOM 2286  C CE3  . TRP B 1 32  ? -18.806 -3.382  -17.031 1.00 0.00 ? 32  TRP B CE3  18 
ATOM 2287  C CZ2  . TRP B 1 32  ? -17.353 -2.832  -14.693 1.00 0.00 ? 32  TRP B CZ2  18 
ATOM 2288  C CZ3  . TRP B 1 32  ? -18.677 -4.359  -16.030 1.00 0.00 ? 32  TRP B CZ3  18 
ATOM 2289  C CH2  . TRP B 1 32  ? -17.948 -4.083  -14.864 1.00 0.00 ? 32  TRP B CH2  18 
ATOM 2290  H H    . TRP B 1 32  ? -18.922 1.776   -18.233 1.00 0.00 ? 32  TRP B H    18 
ATOM 2291  H HA   . TRP B 1 32  ? -20.611 0.013   -19.873 1.00 0.00 ? 32  TRP B HA   18 
ATOM 2292  H HB2  . TRP B 1 32  ? -18.969 -1.661  -19.525 1.00 0.00 ? 32  TRP B HB2  18 
ATOM 2293  H HB3  . TRP B 1 32  ? -18.064 -0.159  -19.683 1.00 0.00 ? 32  TRP B HB3  18 
ATOM 2294  H HD1  . TRP B 1 32  ? -17.223 0.989   -17.357 1.00 0.00 ? 32  TRP B HD1  18 
ATOM 2295  H HE1  . TRP B 1 32  ? -16.499 -0.112  -15.153 1.00 0.00 ? 32  TRP B HE1  18 
ATOM 2296  H HE3  . TRP B 1 32  ? -19.372 -3.598  -17.920 1.00 0.00 ? 32  TRP B HE3  18 
ATOM 2297  H HZ2  . TRP B 1 32  ? -16.792 -2.615  -13.796 1.00 0.00 ? 32  TRP B HZ2  18 
ATOM 2298  H HZ3  . TRP B 1 32  ? -19.140 -5.328  -16.164 1.00 0.00 ? 32  TRP B HZ3  18 
ATOM 2299  H HH2  . TRP B 1 32  ? -17.851 -4.835  -14.095 1.00 0.00 ? 32  TRP B HH2  18 
ATOM 2300  N N    . ILE B 1 33  ? -21.204 0.315   -16.817 1.00 0.00 ? 33  ILE B N    18 
ATOM 2301  C CA   . ILE B 1 33  ? -22.035 -0.188  -15.689 1.00 0.00 ? 33  ILE B CA   18 
ATOM 2302  C C    . ILE B 1 33  ? -23.245 0.733   -15.498 1.00 0.00 ? 33  ILE B C    18 
ATOM 2303  O O    . ILE B 1 33  ? -23.118 1.939   -15.429 1.00 0.00 ? 33  ILE B O    18 
ATOM 2304  C CB   . ILE B 1 33  ? -21.185 -0.229  -14.411 1.00 0.00 ? 33  ILE B CB   18 
ATOM 2305  C CG1  . ILE B 1 33  ? -20.377 -1.525  -14.399 1.00 0.00 ? 33  ILE B CG1  18 
ATOM 2306  C CG2  . ILE B 1 33  ? -22.084 -0.183  -13.170 1.00 0.00 ? 33  ILE B CG2  18 
ATOM 2307  C CD1  . ILE B 1 33  ? -19.389 -1.507  -13.234 1.00 0.00 ? 33  ILE B CD1  18 
ATOM 2308  H H    . ILE B 1 33  ? -20.876 1.237   -16.811 1.00 0.00 ? 33  ILE B H    18 
ATOM 2309  H HA   . ILE B 1 33  ? -22.380 -1.187  -15.920 1.00 0.00 ? 33  ILE B HA   18 
ATOM 2310  H HB   . ILE B 1 33  ? -20.513 0.614   -14.398 1.00 0.00 ? 33  ILE B HB   18 
ATOM 2311  H HG12 . ILE B 1 33  ? -21.045 -2.362  -14.289 1.00 0.00 ? 33  ILE B HG12 18 
ATOM 2312  H HG13 . ILE B 1 33  ? -19.836 -1.615  -15.324 1.00 0.00 ? 33  ILE B HG13 18 
ATOM 2313  H HG21 . ILE B 1 33  ? -23.094 -0.446  -13.448 1.00 0.00 ? 33  ILE B HG21 18 
ATOM 2314  H HG22 . ILE B 1 33  ? -21.719 -0.885  -12.436 1.00 0.00 ? 33  ILE B HG22 18 
ATOM 2315  H HG23 . ILE B 1 33  ? -22.072 0.813   -12.755 1.00 0.00 ? 33  ILE B HG23 18 
ATOM 2316  H HD11 . ILE B 1 33  ? -19.772 -0.875  -12.447 1.00 0.00 ? 33  ILE B HD11 18 
ATOM 2317  H HD12 . ILE B 1 33  ? -19.254 -2.509  -12.857 1.00 0.00 ? 33  ILE B HD12 18 
ATOM 2318  H HD13 . ILE B 1 33  ? -18.443 -1.125  -13.575 1.00 0.00 ? 33  ILE B HD13 18 
ATOM 2319  N N    . HIS B 1 34  ? -24.417 0.166   -15.416 1.00 0.00 ? 34  HIS B N    18 
ATOM 2320  C CA   . HIS B 1 34  ? -25.642 0.993   -15.234 1.00 0.00 ? 34  HIS B CA   18 
ATOM 2321  C C    . HIS B 1 34  ? -25.999 1.057   -13.745 1.00 0.00 ? 34  HIS B C    18 
ATOM 2322  O O    . HIS B 1 34  ? -26.158 2.122   -13.180 1.00 0.00 ? 34  HIS B O    18 
ATOM 2323  C CB   . HIS B 1 34  ? -26.798 0.358   -16.018 1.00 0.00 ? 34  HIS B CB   18 
ATOM 2324  C CG   . HIS B 1 34  ? -28.114 0.911   -15.539 1.00 0.00 ? 34  HIS B CG   18 
ATOM 2325  N ND1  . HIS B 1 34  ? -28.463 2.241   -15.707 1.00 0.00 ? 34  HIS B ND1  18 
ATOM 2326  C CD2  . HIS B 1 34  ? -29.174 0.323   -14.895 1.00 0.00 ? 34  HIS B CD2  18 
ATOM 2327  C CE1  . HIS B 1 34  ? -29.687 2.409   -15.174 1.00 0.00 ? 34  HIS B CE1  18 
ATOM 2328  N NE2  . HIS B 1 34  ? -30.166 1.270   -14.664 1.00 0.00 ? 34  HIS B NE2  18 
ATOM 2329  H H    . HIS B 1 34  ? -24.491 -0.809  -15.477 1.00 0.00 ? 34  HIS B H    18 
ATOM 2330  H HA   . HIS B 1 34  ? -25.462 1.992   -15.604 1.00 0.00 ? 34  HIS B HA   18 
ATOM 2331  H HB2  . HIS B 1 34  ? -26.680 0.577   -17.069 1.00 0.00 ? 34  HIS B HB2  18 
ATOM 2332  H HB3  . HIS B 1 34  ? -26.785 -0.712  -15.871 1.00 0.00 ? 34  HIS B HB3  18 
ATOM 2333  H HD1  . HIS B 1 34  ? -27.918 2.934   -16.136 1.00 0.00 ? 34  HIS B HD1  18 
ATOM 2334  H HD2  . HIS B 1 34  ? -29.228 -0.719  -14.609 1.00 0.00 ? 34  HIS B HD2  18 
ATOM 2335  H HE1  . HIS B 1 34  ? -30.218 3.349   -15.159 1.00 0.00 ? 34  HIS B HE1  18 
ATOM 2336  N N    . GLU B 1 35  ? -26.131 -0.073  -13.107 1.00 0.00 ? 35  GLU B N    18 
ATOM 2337  C CA   . GLU B 1 35  ? -26.481 -0.073  -11.658 1.00 0.00 ? 35  GLU B CA   18 
ATOM 2338  C C    . GLU B 1 35  ? -25.485 -0.941  -10.886 1.00 0.00 ? 35  GLU B C    18 
ATOM 2339  O O    . GLU B 1 35  ? -24.861 -1.818  -11.450 1.00 0.00 ? 35  GLU B O    18 
ATOM 2340  C CB   . GLU B 1 35  ? -27.893 -0.636  -11.478 1.00 0.00 ? 35  GLU B CB   18 
ATOM 2341  C CG   . GLU B 1 35  ? -28.916 0.491   -11.630 1.00 0.00 ? 35  GLU B CG   18 
ATOM 2342  C CD   . GLU B 1 35  ? -30.318 -0.053  -11.353 1.00 0.00 ? 35  GLU B CD   18 
ATOM 2343  O OE1  . GLU B 1 35  ? -30.508 -1.250  -11.496 1.00 0.00 ? 35  GLU B OE1  18 
ATOM 2344  O OE2  . GLU B 1 35  ? -31.180 0.737   -11.002 1.00 0.00 ? 35  GLU B OE2  18 
ATOM 2345  H H    . GLU B 1 35  ? -26.001 -0.922  -13.580 1.00 0.00 ? 35  GLU B H    18 
ATOM 2346  H HA   . GLU B 1 35  ? -26.447 0.938   -11.279 1.00 0.00 ? 35  GLU B HA   18 
ATOM 2347  H HB2  . GLU B 1 35  ? -28.076 -1.394  -12.225 1.00 0.00 ? 35  GLU B HB2  18 
ATOM 2348  H HB3  . GLU B 1 35  ? -27.984 -1.071  -10.493 1.00 0.00 ? 35  GLU B HB3  18 
ATOM 2349  H HG2  . GLU B 1 35  ? -28.689 1.281   -10.929 1.00 0.00 ? 35  GLU B HG2  18 
ATOM 2350  H HG3  . GLU B 1 35  ? -28.875 0.880   -12.636 1.00 0.00 ? 35  GLU B HG3  18 
ATOM 2351  N N    . PRO B 1 36  ? -25.366 -0.669  -9.611  1.00 0.00 ? 36  PRO B N    18 
ATOM 2352  C CA   . PRO B 1 36  ? -26.129 0.399   -8.938  1.00 0.00 ? 36  PRO B CA   18 
ATOM 2353  C C    . PRO B 1 36  ? -25.524 1.771   -9.245  1.00 0.00 ? 36  PRO B C    18 
ATOM 2354  O O    . PRO B 1 36  ? -24.497 1.880   -9.883  1.00 0.00 ? 36  PRO B O    18 
ATOM 2355  C CB   . PRO B 1 36  ? -25.985 0.059   -7.451  1.00 0.00 ? 36  PRO B CB   18 
ATOM 2356  C CG   . PRO B 1 36  ? -24.717 -0.817  -7.325  1.00 0.00 ? 36  PRO B CG   18 
ATOM 2357  C CD   . PRO B 1 36  ? -24.452 -1.411  -8.720  1.00 0.00 ? 36  PRO B CD   18 
ATOM 2358  H HA   . PRO B 1 36  ? -27.166 0.368   -9.222  1.00 0.00 ? 36  PRO B HA   18 
ATOM 2359  H HB2  . PRO B 1 36  ? -25.873 0.967   -6.873  1.00 0.00 ? 36  PRO B HB2  18 
ATOM 2360  H HB3  . PRO B 1 36  ? -26.845 -0.495  -7.111  1.00 0.00 ? 36  PRO B HB3  18 
ATOM 2361  H HG2  . PRO B 1 36  ? -23.878 -0.211  -7.012  1.00 0.00 ? 36  PRO B HG2  18 
ATOM 2362  H HG3  . PRO B 1 36  ? -24.884 -1.613  -6.617  1.00 0.00 ? 36  PRO B HG3  18 
ATOM 2363  H HD2  . PRO B 1 36  ? -23.422 -1.251  -9.010  1.00 0.00 ? 36  PRO B HD2  18 
ATOM 2364  H HD3  . PRO B 1 36  ? -24.692 -2.462  -8.733  1.00 0.00 ? 36  PRO B HD3  18 
ATOM 2365  N N    . LYS B 1 37  ? -26.155 2.818   -8.790  1.00 0.00 ? 37  LYS B N    18 
ATOM 2366  C CA   . LYS B 1 37  ? -25.629 4.179   -9.042  1.00 0.00 ? 37  LYS B CA   18 
ATOM 2367  C C    . LYS B 1 37  ? -24.176 4.255   -8.580  1.00 0.00 ? 37  LYS B C    18 
ATOM 2368  O O    . LYS B 1 37  ? -23.351 4.910   -9.187  1.00 0.00 ? 37  LYS B O    18 
ATOM 2369  C CB   . LYS B 1 37  ? -26.468 5.167   -8.244  1.00 0.00 ? 37  LYS B CB   18 
ATOM 2370  C CG   . LYS B 1 37  ? -27.637 5.660   -9.097  1.00 0.00 ? 37  LYS B CG   18 
ATOM 2371  C CD   . LYS B 1 37  ? -27.837 7.160   -8.871  1.00 0.00 ? 37  LYS B CD   18 
ATOM 2372  C CE   . LYS B 1 37  ? -28.115 7.847   -10.209 1.00 0.00 ? 37  LYS B CE   18 
ATOM 2373  N NZ   . LYS B 1 37  ? -29.532 8.308   -10.245 1.00 0.00 ? 37  LYS B NZ   18 
ATOM 2374  H H    . LYS B 1 37  ? -26.976 2.711   -8.273  1.00 0.00 ? 37  LYS B H    18 
ATOM 2375  H HA   . LYS B 1 37  ? -25.694 4.410   -10.094 1.00 0.00 ? 37  LYS B HA   18 
ATOM 2376  H HB2  . LYS B 1 37  ? -26.849 4.677   -7.359  1.00 0.00 ? 37  LYS B HB2  18 
ATOM 2377  H HB3  . LYS B 1 37  ? -25.857 5.996   -7.954  1.00 0.00 ? 37  LYS B HB3  18 
ATOM 2378  H HG2  . LYS B 1 37  ? -27.422 5.478   -10.141 1.00 0.00 ? 37  LYS B HG2  18 
ATOM 2379  H HG3  . LYS B 1 37  ? -28.536 5.133   -8.817  1.00 0.00 ? 37  LYS B HG3  18 
ATOM 2380  H HD2  . LYS B 1 37  ? -28.672 7.315   -8.204  1.00 0.00 ? 37  LYS B HD2  18 
ATOM 2381  H HD3  . LYS B 1 37  ? -26.944 7.580   -8.433  1.00 0.00 ? 37  LYS B HD3  18 
ATOM 2382  H HE2  . LYS B 1 37  ? -27.458 8.696   -10.323 1.00 0.00 ? 37  LYS B HE2  18 
ATOM 2383  H HE3  . LYS B 1 37  ? -27.944 7.148   -11.015 1.00 0.00 ? 37  LYS B HE3  18 
ATOM 2384  H HZ1  . LYS B 1 37  ? -30.075 7.823   -9.503  1.00 0.00 ? 37  LYS B HZ1  18 
ATOM 2385  H HZ2  . LYS B 1 37  ? -29.566 9.336   -10.085 1.00 0.00 ? 37  LYS B HZ2  18 
ATOM 2386  H HZ3  . LYS B 1 37  ? -29.946 8.088   -11.173 1.00 0.00 ? 37  LYS B HZ3  18 
ATOM 2387  N N    . GLY B 1 38  ? -23.859 3.589   -7.507  1.00 0.00 ? 38  GLY B N    18 
ATOM 2388  C CA   . GLY B 1 38  ? -22.460 3.620   -6.995  1.00 0.00 ? 38  GLY B CA   18 
ATOM 2389  C C    . GLY B 1 38  ? -22.239 2.449   -6.037  1.00 0.00 ? 38  GLY B C    18 
ATOM 2390  O O    . GLY B 1 38  ? -22.755 1.368   -6.236  1.00 0.00 ? 38  GLY B O    18 
ATOM 2391  H H    . GLY B 1 38  ? -24.545 3.069   -7.037  1.00 0.00 ? 38  GLY B H    18 
ATOM 2392  H HA2  . GLY B 1 38  ? -21.773 3.542   -7.826  1.00 0.00 ? 38  GLY B HA2  18 
ATOM 2393  H HA3  . GLY B 1 38  ? -22.288 4.546   -6.470  1.00 0.00 ? 38  GLY B HA3  18 
ATOM 2394  N N    . TYR B 1 39  ? -21.475 2.655   -4.999  1.00 0.00 ? 39  TYR B N    18 
ATOM 2395  C CA   . TYR B 1 39  ? -21.218 1.553   -4.030  1.00 0.00 ? 39  TYR B CA   18 
ATOM 2396  C C    . TYR B 1 39  ? -20.253 2.040   -2.948  1.00 0.00 ? 39  TYR B C    18 
ATOM 2397  O O    . TYR B 1 39  ? -19.640 3.082   -3.073  1.00 0.00 ? 39  TYR B O    18 
ATOM 2398  C CB   . TYR B 1 39  ? -20.596 0.365   -4.765  1.00 0.00 ? 39  TYR B CB   18 
ATOM 2399  C CG   . TYR B 1 39  ? -19.195 0.722   -5.192  1.00 0.00 ? 39  TYR B CG   18 
ATOM 2400  C CD1  . TYR B 1 39  ? -18.984 1.737   -6.133  1.00 0.00 ? 39  TYR B CD1  18 
ATOM 2401  C CD2  . TYR B 1 39  ? -18.108 0.034   -4.650  1.00 0.00 ? 39  TYR B CD2  18 
ATOM 2402  C CE1  . TYR B 1 39  ? -17.684 2.063   -6.530  1.00 0.00 ? 39  TYR B CE1  18 
ATOM 2403  C CE2  . TYR B 1 39  ? -16.806 0.361   -5.047  1.00 0.00 ? 39  TYR B CE2  18 
ATOM 2404  C CZ   . TYR B 1 39  ? -16.594 1.375   -5.987  1.00 0.00 ? 39  TYR B CZ   18 
ATOM 2405  O OH   . TYR B 1 39  ? -15.310 1.695   -6.377  1.00 0.00 ? 39  TYR B OH   18 
ATOM 2406  H H    . TYR B 1 39  ? -21.067 3.536   -4.859  1.00 0.00 ? 39  TYR B H    18 
ATOM 2407  H HA   . TYR B 1 39  ? -22.145 1.246   -3.574  1.00 0.00 ? 39  TYR B HA   18 
ATOM 2408  H HB2  . TYR B 1 39  ? -20.565 -0.489  -4.106  1.00 0.00 ? 39  TYR B HB2  18 
ATOM 2409  H HB3  . TYR B 1 39  ? -21.188 0.128   -5.636  1.00 0.00 ? 39  TYR B HB3  18 
ATOM 2410  H HD1  . TYR B 1 39  ? -19.825 2.267   -6.551  1.00 0.00 ? 39  TYR B HD1  18 
ATOM 2411  H HD2  . TYR B 1 39  ? -18.275 -0.746  -3.924  1.00 0.00 ? 39  TYR B HD2  18 
ATOM 2412  H HE1  . TYR B 1 39  ? -17.521 2.847   -7.255  1.00 0.00 ? 39  TYR B HE1  18 
ATOM 2413  H HE2  . TYR B 1 39  ? -15.964 -0.169  -4.629  1.00 0.00 ? 39  TYR B HE2  18 
ATOM 2414  H HH   . TYR B 1 39  ? -15.329 2.570   -6.772  1.00 0.00 ? 39  TYR B HH   18 
ATOM 2415  N N    . HIS B 1 40  ? -20.110 1.294   -1.887  1.00 0.00 ? 40  HIS B N    18 
ATOM 2416  C CA   . HIS B 1 40  ? -19.180 1.715   -0.803  1.00 0.00 ? 40  HIS B CA   18 
ATOM 2417  C C    . HIS B 1 40  ? -17.765 1.253   -1.155  1.00 0.00 ? 40  HIS B C    18 
ATOM 2418  O O    . HIS B 1 40  ? -17.229 0.345   -0.553  1.00 0.00 ? 40  HIS B O    18 
ATOM 2419  C CB   . HIS B 1 40  ? -19.613 1.080   0.519   1.00 0.00 ? 40  HIS B CB   18 
ATOM 2420  C CG   . HIS B 1 40  ? -20.918 1.683   0.961   1.00 0.00 ? 40  HIS B CG   18 
ATOM 2421  N ND1  . HIS B 1 40  ? -22.130 1.319   0.395   1.00 0.00 ? 40  HIS B ND1  18 
ATOM 2422  C CD2  . HIS B 1 40  ? -21.217 2.625   1.913   1.00 0.00 ? 40  HIS B CD2  18 
ATOM 2423  C CE1  . HIS B 1 40  ? -23.093 2.033   1.005   1.00 0.00 ? 40  HIS B CE1  18 
ATOM 2424  N NE2  . HIS B 1 40  ? -22.591 2.844   1.940   1.00 0.00 ? 40  HIS B NE2  18 
ATOM 2425  H H    . HIS B 1 40  ? -20.608 0.455   -1.805  1.00 0.00 ? 40  HIS B H    18 
ATOM 2426  H HA   . HIS B 1 40  ? -19.198 2.793   -0.711  1.00 0.00 ? 40  HIS B HA   18 
ATOM 2427  H HB2  . HIS B 1 40  ? -19.736 0.016   0.383   1.00 0.00 ? 40  HIS B HB2  18 
ATOM 2428  H HB3  . HIS B 1 40  ? -18.860 1.263   1.271   1.00 0.00 ? 40  HIS B HB3  18 
ATOM 2429  H HD1  . HIS B 1 40  ? -22.261 0.662   -0.320  1.00 0.00 ? 40  HIS B HD1  18 
ATOM 2430  H HD2  . HIS B 1 40  ? -20.496 3.122   2.546   1.00 0.00 ? 40  HIS B HD2  18 
ATOM 2431  H HE1  . HIS B 1 40  ? -24.144 1.960   0.767   1.00 0.00 ? 40  HIS B HE1  18 
ATOM 2432  N N    . ALA B 1 41  ? -17.162 1.867   -2.136  1.00 0.00 ? 41  ALA B N    18 
ATOM 2433  C CA   . ALA B 1 41  ? -15.788 1.462   -2.543  1.00 0.00 ? 41  ALA B CA   18 
ATOM 2434  C C    . ALA B 1 41  ? -14.836 1.559   -1.347  1.00 0.00 ? 41  ALA B C    18 
ATOM 2435  O O    . ALA B 1 41  ? -14.001 0.700   -1.138  1.00 0.00 ? 41  ALA B O    18 
ATOM 2436  C CB   . ALA B 1 41  ? -15.302 2.383   -3.663  1.00 0.00 ? 41  ALA B CB   18 
ATOM 2437  H H    . ALA B 1 41  ? -17.619 2.592   -2.612  1.00 0.00 ? 41  ALA B H    18 
ATOM 2438  H HA   . ALA B 1 41  ? -15.807 0.444   -2.900  1.00 0.00 ? 41  ALA B HA   18 
ATOM 2439  H HB1  . ALA B 1 41  ? -16.155 2.811   -4.171  1.00 0.00 ? 41  ALA B HB1  18 
ATOM 2440  H HB2  . ALA B 1 41  ? -14.700 3.174   -3.244  1.00 0.00 ? 41  ALA B HB2  18 
ATOM 2441  H HB3  . ALA B 1 41  ? -14.713 1.814   -4.367  1.00 0.00 ? 41  ALA B HB3  18 
ATOM 2442  N N    . ASN B 1 42  ? -14.953 2.592   -0.561  1.00 0.00 ? 42  ASN B N    18 
ATOM 2443  C CA   . ASN B 1 42  ? -14.053 2.735   0.619   1.00 0.00 ? 42  ASN B CA   18 
ATOM 2444  C C    . ASN B 1 42  ? -12.600 2.848   0.149   1.00 0.00 ? 42  ASN B C    18 
ATOM 2445  O O    . ASN B 1 42  ? -12.310 2.760   -1.027  1.00 0.00 ? 42  ASN B O    18 
ATOM 2446  C CB   . ASN B 1 42  ? -14.194 1.506   1.523   1.00 0.00 ? 42  ASN B CB   18 
ATOM 2447  C CG   . ASN B 1 42  ? -15.338 1.728   2.515   1.00 0.00 ? 42  ASN B CG   18 
ATOM 2448  O OD1  . ASN B 1 42  ? -16.307 0.995   2.515   1.00 0.00 ? 42  ASN B OD1  18 
ATOM 2449  N ND2  . ASN B 1 42  ? -15.265 2.713   3.368   1.00 0.00 ? 42  ASN B ND2  18 
ATOM 2450  H H    . ASN B 1 42  ? -15.632 3.274   -0.745  1.00 0.00 ? 42  ASN B H    18 
ATOM 2451  H HA   . ASN B 1 42  ? -14.322 3.621   1.174   1.00 0.00 ? 42  ASN B HA   18 
ATOM 2452  H HB2  . ASN B 1 42  ? -14.406 0.637   0.916   1.00 0.00 ? 42  ASN B HB2  18 
ATOM 2453  H HB3  . ASN B 1 42  ? -13.274 1.349   2.065   1.00 0.00 ? 42  ASN B HB3  18 
ATOM 2454  H HD21 . ASN B 1 42  ? -14.483 3.303   3.368   1.00 0.00 ? 42  ASN B HD21 18 
ATOM 2455  H HD22 . ASN B 1 42  ? -15.992 2.863   4.007   1.00 0.00 ? 42  ASN B HD22 18 
ATOM 2456  N N    . PHE B 1 43  ? -11.686 3.033   1.064   1.00 0.00 ? 43  PHE B N    18 
ATOM 2457  C CA   . PHE B 1 43  ? -10.251 3.144   0.680   1.00 0.00 ? 43  PHE B CA   18 
ATOM 2458  C C    . PHE B 1 43  ? -9.412  3.397   1.930   1.00 0.00 ? 43  PHE B C    18 
ATOM 2459  O O    . PHE B 1 43  ? -9.931  3.492   3.023   1.00 0.00 ? 43  PHE B O    18 
ATOM 2460  C CB   . PHE B 1 43  ? -10.052 4.281   -0.329  1.00 0.00 ? 43  PHE B CB   18 
ATOM 2461  C CG   . PHE B 1 43  ? -10.154 5.630   0.339   1.00 0.00 ? 43  PHE B CG   18 
ATOM 2462  C CD1  . PHE B 1 43  ? -11.162 5.895   1.274   1.00 0.00 ? 43  PHE B CD1  18 
ATOM 2463  C CD2  . PHE B 1 43  ? -9.245  6.634   -0.006  1.00 0.00 ? 43  PHE B CD2  18 
ATOM 2464  C CE1  . PHE B 1 43  ? -11.256 7.162   1.861   1.00 0.00 ? 43  PHE B CE1  18 
ATOM 2465  C CE2  . PHE B 1 43  ? -9.338  7.894   0.582   1.00 0.00 ? 43  PHE B CE2  18 
ATOM 2466  C CZ   . PHE B 1 43  ? -10.344 8.161   1.515   1.00 0.00 ? 43  PHE B CZ   18 
ATOM 2467  H H    . PHE B 1 43  ? -11.945 3.092   2.010   1.00 0.00 ? 43  PHE B H    18 
ATOM 2468  H HA   . PHE B 1 43  ? -9.936  2.213   0.230   1.00 0.00 ? 43  PHE B HA   18 
ATOM 2469  H HB2  . PHE B 1 43  ? -9.075  4.189   -0.776  1.00 0.00 ? 43  PHE B HB2  18 
ATOM 2470  H HB3  . PHE B 1 43  ? -10.805 4.208   -1.100  1.00 0.00 ? 43  PHE B HB3  18 
ATOM 2471  H HD1  . PHE B 1 43  ? -11.868 5.126   1.543   1.00 0.00 ? 43  PHE B HD1  18 
ATOM 2472  H HD2  . PHE B 1 43  ? -8.464  6.432   -0.726  1.00 0.00 ? 43  PHE B HD2  18 
ATOM 2473  H HE1  . PHE B 1 43  ? -12.032 7.368   2.578   1.00 0.00 ? 43  PHE B HE1  18 
ATOM 2474  H HE2  . PHE B 1 43  ? -8.633  8.663   0.315   1.00 0.00 ? 43  PHE B HE2  18 
ATOM 2475  H HZ   . PHE B 1 43  ? -10.417 9.139   1.967   1.00 0.00 ? 43  PHE B HZ   18 
ATOM 2476  N N    . CYS B 1 44  ? -8.117  3.483   1.788   1.00 0.00 ? 44  CYS B N    18 
ATOM 2477  C CA   . CYS B 1 44  ? -7.259  3.699   2.988   1.00 0.00 ? 44  CYS B CA   18 
ATOM 2478  C C    . CYS B 1 44  ? -6.421  4.970   2.816   1.00 0.00 ? 44  CYS B C    18 
ATOM 2479  O O    . CYS B 1 44  ? -5.903  5.244   1.752   1.00 0.00 ? 44  CYS B O    18 
ATOM 2480  C CB   . CYS B 1 44  ? -6.307  2.509   3.162   1.00 0.00 ? 44  CYS B CB   18 
ATOM 2481  S SG   . CYS B 1 44  ? -7.052  0.999   2.492   1.00 0.00 ? 44  CYS B SG   18 
ATOM 2482  H H    . CYS B 1 44  ? -7.710  3.385   0.901   1.00 0.00 ? 44  CYS B H    18 
ATOM 2483  H HA   . CYS B 1 44  ? -7.883  3.790   3.865   1.00 0.00 ? 44  CYS B HA   18 
ATOM 2484  H HB2  . CYS B 1 44  ? -5.382  2.711   2.644   1.00 0.00 ? 44  CYS B HB2  18 
ATOM 2485  H HB3  . CYS B 1 44  ? -6.104  2.371   4.213   1.00 0.00 ? 44  CYS B HB3  18 
ATOM 2486  N N    . LEU B 1 45  ? -6.270  5.739   3.862   1.00 0.00 ? 45  LEU B N    18 
ATOM 2487  C CA   . LEU B 1 45  ? -5.448  6.980   3.767   1.00 0.00 ? 45  LEU B CA   18 
ATOM 2488  C C    . LEU B 1 45  ? -4.548  7.084   5.001   1.00 0.00 ? 45  LEU B C    18 
ATOM 2489  O O    . LEU B 1 45  ? -4.473  6.176   5.803   1.00 0.00 ? 45  LEU B O    18 
ATOM 2490  C CB   . LEU B 1 45  ? -6.362  8.207   3.710   1.00 0.00 ? 45  LEU B CB   18 
ATOM 2491  C CG   . LEU B 1 45  ? -6.933  8.377   2.306   1.00 0.00 ? 45  LEU B CG   18 
ATOM 2492  C CD1  . LEU B 1 45  ? -7.575  9.759   2.196   1.00 0.00 ? 45  LEU B CD1  18 
ATOM 2493  C CD2  . LEU B 1 45  ? -5.816  8.255   1.266   1.00 0.00 ? 45  LEU B CD2  18 
ATOM 2494  H H    . LEU B 1 45  ? -6.687  5.495   4.713   1.00 0.00 ? 45  LEU B H    18 
ATOM 2495  H HA   . LEU B 1 45  ? -4.837  6.940   2.880   1.00 0.00 ? 45  LEU B HA   18 
ATOM 2496  H HB2  . LEU B 1 45  ? -7.177  8.080   4.407   1.00 0.00 ? 45  LEU B HB2  18 
ATOM 2497  H HB3  . LEU B 1 45  ? -5.798  9.088   3.975   1.00 0.00 ? 45  LEU B HB3  18 
ATOM 2498  H HG   . LEU B 1 45  ? -7.676  7.615   2.131   1.00 0.00 ? 45  LEU B HG   18 
ATOM 2499  H HD11 . LEU B 1 45  ? -7.515  10.259  3.152   1.00 0.00 ? 45  LEU B HD11 18 
ATOM 2500  H HD12 . LEU B 1 45  ? -7.052  10.342  1.453   1.00 0.00 ? 45  LEU B HD12 18 
ATOM 2501  H HD13 . LEU B 1 45  ? -8.610  9.656   1.910   1.00 0.00 ? 45  LEU B HD13 18 
ATOM 2502  H HD21 . LEU B 1 45  ? -4.952  8.809   1.599   1.00 0.00 ? 45  LEU B HD21 18 
ATOM 2503  H HD22 . LEU B 1 45  ? -5.551  7.216   1.144   1.00 0.00 ? 45  LEU B HD22 18 
ATOM 2504  H HD23 . LEU B 1 45  ? -6.158  8.652   0.324   1.00 0.00 ? 45  LEU B HD23 18 
ATOM 2505  N N    . GLY B 1 46  ? -3.868  8.186   5.159   1.00 0.00 ? 46  GLY B N    18 
ATOM 2506  C CA   . GLY B 1 46  ? -2.975  8.350   6.341   1.00 0.00 ? 46  GLY B CA   18 
ATOM 2507  C C    . GLY B 1 46  ? -1.786  7.391   6.229   1.00 0.00 ? 46  GLY B C    18 
ATOM 2508  O O    . GLY B 1 46  ? -1.890  6.346   5.618   1.00 0.00 ? 46  GLY B O    18 
ATOM 2509  H H    . GLY B 1 46  ? -3.945  8.908   4.500   1.00 0.00 ? 46  GLY B H    18 
ATOM 2510  H HA2  . GLY B 1 46  ? -2.616  9.368   6.381   1.00 0.00 ? 46  GLY B HA2  18 
ATOM 2511  H HA3  . GLY B 1 46  ? -3.528  8.128   7.242   1.00 0.00 ? 46  GLY B HA3  18 
ATOM 2512  N N    . PRO B 1 47  ? -0.689  7.781   6.827   1.00 0.00 ? 47  PRO B N    18 
ATOM 2513  C CA   . PRO B 1 47  ? 0.548   6.981   6.821   1.00 0.00 ? 47  PRO B CA   18 
ATOM 2514  C C    . PRO B 1 47  ? 0.454   5.850   7.848   1.00 0.00 ? 47  PRO B C    18 
ATOM 2515  O O    . PRO B 1 47  ? -0.620  5.465   8.266   1.00 0.00 ? 47  PRO B O    18 
ATOM 2516  C CB   . PRO B 1 47  ? 1.628   7.991   7.221   1.00 0.00 ? 47  PRO B CB   18 
ATOM 2517  C CG   . PRO B 1 47  ? 0.902   9.133   7.974   1.00 0.00 ? 47  PRO B CG   18 
ATOM 2518  C CD   . PRO B 1 47  ? -0.580  9.058   7.563   1.00 0.00 ? 47  PRO B CD   18 
ATOM 2519  H HA   . PRO B 1 47  ? 0.751   6.592   5.838   1.00 0.00 ? 47  PRO B HA   18 
ATOM 2520  H HB2  . PRO B 1 47  ? 2.354   7.518   7.868   1.00 0.00 ? 47  PRO B HB2  18 
ATOM 2521  H HB3  . PRO B 1 47  ? 2.112   8.385   6.341   1.00 0.00 ? 47  PRO B HB3  18 
ATOM 2522  H HG2  . PRO B 1 47  ? 1.003   8.992   9.041   1.00 0.00 ? 47  PRO B HG2  18 
ATOM 2523  H HG3  . PRO B 1 47  ? 1.312   10.087  7.683   1.00 0.00 ? 47  PRO B HG3  18 
ATOM 2524  H HD2  . PRO B 1 47  ? -1.214  9.048   8.441   1.00 0.00 ? 47  PRO B HD2  18 
ATOM 2525  H HD3  . PRO B 1 47  ? -0.838  9.883   6.918   1.00 0.00 ? 47  PRO B HD3  18 
ATOM 2526  N N    . CYS B 1 48  ? 1.570   5.318   8.260   1.00 0.00 ? 48  CYS B N    18 
ATOM 2527  C CA   . CYS B 1 48  ? 1.545   4.216   9.262   1.00 0.00 ? 48  CYS B CA   18 
ATOM 2528  C C    . CYS B 1 48  ? 2.589   4.499   10.352  1.00 0.00 ? 48  CYS B C    18 
ATOM 2529  O O    . CYS B 1 48  ? 3.737   4.758   10.049  1.00 0.00 ? 48  CYS B O    18 
ATOM 2530  C CB   . CYS B 1 48  ? 1.880   2.887   8.578   1.00 0.00 ? 48  CYS B CB   18 
ATOM 2531  S SG   . CYS B 1 48  ? 0.621   2.503   7.333   1.00 0.00 ? 48  CYS B SG   18 
ATOM 2532  H H    . CYS B 1 48  ? 2.425   5.647   7.913   1.00 0.00 ? 48  CYS B H    18 
ATOM 2533  H HA   . CYS B 1 48  ? 0.561   4.156   9.700   1.00 0.00 ? 48  CYS B HA   18 
ATOM 2534  H HB2  . CYS B 1 48  ? 2.846   2.963   8.100   1.00 0.00 ? 48  CYS B HB2  18 
ATOM 2535  H HB3  . CYS B 1 48  ? 1.907   2.100   9.316   1.00 0.00 ? 48  CYS B HB3  18 
ATOM 2536  N N    . PRO B 1 49  ? 2.164   4.437   11.590  1.00 0.00 ? 49  PRO B N    18 
ATOM 2537  C CA   . PRO B 1 49  ? 3.050   4.678   12.742  1.00 0.00 ? 49  PRO B CA   18 
ATOM 2538  C C    . PRO B 1 49  ? 3.965   3.472   12.973  1.00 0.00 ? 49  PRO B C    18 
ATOM 2539  O O    . PRO B 1 49  ? 4.069   2.592   12.142  1.00 0.00 ? 49  PRO B O    18 
ATOM 2540  C CB   . PRO B 1 49  ? 2.081   4.870   13.912  1.00 0.00 ? 49  PRO B CB   18 
ATOM 2541  C CG   . PRO B 1 49  ? 0.758   4.187   13.495  1.00 0.00 ? 49  PRO B CG   18 
ATOM 2542  C CD   . PRO B 1 49  ? 0.770   4.121   11.957  1.00 0.00 ? 49  PRO B CD   18 
ATOM 2543  H HA   . PRO B 1 49  ? 3.631   5.573   12.594  1.00 0.00 ? 49  PRO B HA   18 
ATOM 2544  H HB2  . PRO B 1 49  ? 2.480   4.404   14.803  1.00 0.00 ? 49  PRO B HB2  18 
ATOM 2545  H HB3  . PRO B 1 49  ? 1.909   5.921   14.085  1.00 0.00 ? 49  PRO B HB3  18 
ATOM 2546  H HG2  . PRO B 1 49  ? 0.710   3.191   13.914  1.00 0.00 ? 49  PRO B HG2  18 
ATOM 2547  H HG3  . PRO B 1 49  ? -0.083  4.773   13.829  1.00 0.00 ? 49  PRO B HG3  18 
ATOM 2548  H HD2  . PRO B 1 49  ? 0.501   3.131   11.616  1.00 0.00 ? 49  PRO B HD2  18 
ATOM 2549  H HD3  . PRO B 1 49  ? 0.102   4.858   11.542  1.00 0.00 ? 49  PRO B HD3  18 
ATOM 2550  N N    . TYR B 1 50  ? 4.639   3.429   14.090  1.00 0.00 ? 50  TYR B N    18 
ATOM 2551  C CA   . TYR B 1 50  ? 5.557   2.284   14.364  1.00 0.00 ? 50  TYR B CA   18 
ATOM 2552  C C    . TYR B 1 50  ? 4.878   1.282   15.302  1.00 0.00 ? 50  TYR B C    18 
ATOM 2553  O O    . TYR B 1 50  ? 5.501   0.358   15.787  1.00 0.00 ? 50  TYR B O    18 
ATOM 2554  C CB   . TYR B 1 50  ? 6.853   2.785   15.023  1.00 0.00 ? 50  TYR B CB   18 
ATOM 2555  C CG   . TYR B 1 50  ? 6.909   4.298   15.004  1.00 0.00 ? 50  TYR B CG   18 
ATOM 2556  C CD1  . TYR B 1 50  ? 7.082   4.977   13.793  1.00 0.00 ? 50  TYR B CD1  18 
ATOM 2557  C CD2  . TYR B 1 50  ? 6.789   5.017   16.199  1.00 0.00 ? 50  TYR B CD2  18 
ATOM 2558  C CE1  . TYR B 1 50  ? 7.133   6.376   13.776  1.00 0.00 ? 50  TYR B CE1  18 
ATOM 2559  C CE2  . TYR B 1 50  ? 6.841   6.416   16.183  1.00 0.00 ? 50  TYR B CE2  18 
ATOM 2560  C CZ   . TYR B 1 50  ? 7.013   7.095   14.972  1.00 0.00 ? 50  TYR B CZ   18 
ATOM 2561  O OH   . TYR B 1 50  ? 7.064   8.475   14.956  1.00 0.00 ? 50  TYR B OH   18 
ATOM 2562  H H    . TYR B 1 50  ? 4.548   4.153   14.745  1.00 0.00 ? 50  TYR B H    18 
ATOM 2563  H HA   . TYR B 1 50  ? 5.798   1.792   13.433  1.00 0.00 ? 50  TYR B HA   18 
ATOM 2564  H HB2  . TYR B 1 50  ? 6.888   2.441   16.046  1.00 0.00 ? 50  TYR B HB2  18 
ATOM 2565  H HB3  . TYR B 1 50  ? 7.702   2.389   14.485  1.00 0.00 ? 50  TYR B HB3  18 
ATOM 2566  H HD1  . TYR B 1 50  ? 7.175   4.423   12.871  1.00 0.00 ? 50  TYR B HD1  18 
ATOM 2567  H HD2  . TYR B 1 50  ? 6.656   4.492   17.134  1.00 0.00 ? 50  TYR B HD2  18 
ATOM 2568  H HE1  . TYR B 1 50  ? 7.267   6.901   12.842  1.00 0.00 ? 50  TYR B HE1  18 
ATOM 2569  H HE2  . TYR B 1 50  ? 6.748   6.970   17.105  1.00 0.00 ? 50  TYR B HE2  18 
ATOM 2570  H HH   . TYR B 1 50  ? 7.398   8.769   15.807  1.00 0.00 ? 50  TYR B HH   18 
ATOM 2571  N N    . ILE B 1 51  ? 3.611   1.452   15.571  1.00 0.00 ? 51  ILE B N    18 
ATOM 2572  C CA   . ILE B 1 51  ? 2.920   0.499   16.488  1.00 0.00 ? 51  ILE B CA   18 
ATOM 2573  C C    . ILE B 1 51  ? 1.631   -0.020  15.841  1.00 0.00 ? 51  ILE B C    18 
ATOM 2574  O O    . ILE B 1 51  ? 1.014   -0.945  16.329  1.00 0.00 ? 51  ILE B O    18 
ATOM 2575  C CB   . ILE B 1 51  ? 2.579   1.210   17.797  1.00 0.00 ? 51  ILE B CB   18 
ATOM 2576  C CG1  . ILE B 1 51  ? 1.934   2.563   17.487  1.00 0.00 ? 51  ILE B CG1  18 
ATOM 2577  C CG2  . ILE B 1 51  ? 3.858   1.429   18.608  1.00 0.00 ? 51  ILE B CG2  18 
ATOM 2578  C CD1  . ILE B 1 51  ? 1.219   3.086   18.733  1.00 0.00 ? 51  ILE B CD1  18 
ATOM 2579  H H    . ILE B 1 51  ? 3.121   2.204   15.179  1.00 0.00 ? 51  ILE B H    18 
ATOM 2580  H HA   . ILE B 1 51  ? 3.575   -0.335  16.695  1.00 0.00 ? 51  ILE B HA   18 
ATOM 2581  H HB   . ILE B 1 51  ? 1.890   0.603   18.369  1.00 0.00 ? 51  ILE B HB   18 
ATOM 2582  H HG12 . ILE B 1 51  ? 2.699   3.266   17.188  1.00 0.00 ? 51  ILE B HG12 18 
ATOM 2583  H HG13 . ILE B 1 51  ? 1.220   2.445   16.686  1.00 0.00 ? 51  ILE B HG13 18 
ATOM 2584  H HG21 . ILE B 1 51  ? 4.680   0.919   18.127  1.00 0.00 ? 51  ILE B HG21 18 
ATOM 2585  H HG22 . ILE B 1 51  ? 4.073   2.486   18.663  1.00 0.00 ? 51  ILE B HG22 18 
ATOM 2586  H HG23 . ILE B 1 51  ? 3.724   1.037   19.605  1.00 0.00 ? 51  ILE B HG23 18 
ATOM 2587  H HD11 . ILE B 1 51  ? 1.211   2.320   19.493  1.00 0.00 ? 51  ILE B HD11 18 
ATOM 2588  H HD12 . ILE B 1 51  ? 1.736   3.958   19.106  1.00 0.00 ? 51  ILE B HD12 18 
ATOM 2589  H HD13 . ILE B 1 51  ? 0.203   3.352   18.479  1.00 0.00 ? 51  ILE B HD13 18 
ATOM 2590  N N    . TRP B 1 52  ? 1.218   0.564   14.752  1.00 0.00 ? 52  TRP B N    18 
ATOM 2591  C CA   . TRP B 1 52  ? -0.028  0.096   14.084  1.00 0.00 ? 52  TRP B CA   18 
ATOM 2592  C C    . TRP B 1 52  ? 0.103   -1.386  13.727  1.00 0.00 ? 52  TRP B C    18 
ATOM 2593  O O    . TRP B 1 52  ? 0.888   -2.107  14.309  1.00 0.00 ? 52  TRP B O    18 
ATOM 2594  C CB   . TRP B 1 52  ? -0.252  0.908   12.812  1.00 0.00 ? 52  TRP B CB   18 
ATOM 2595  C CG   . TRP B 1 52  ? -1.652  1.427   12.795  1.00 0.00 ? 52  TRP B CG   18 
ATOM 2596  C CD1  . TRP B 1 52  ? -2.422  1.530   11.691  1.00 0.00 ? 52  TRP B CD1  18 
ATOM 2597  C CD2  . TRP B 1 52  ? -2.463  1.911   13.907  1.00 0.00 ? 52  TRP B CD2  18 
ATOM 2598  N NE1  . TRP B 1 52  ? -3.656  2.040   12.050  1.00 0.00 ? 52  TRP B NE1  18 
ATOM 2599  C CE2  . TRP B 1 52  ? -3.730  2.291   13.405  1.00 0.00 ? 52  TRP B CE2  18 
ATOM 2600  C CE3  . TRP B 1 52  ? -2.227  2.053   15.288  1.00 0.00 ? 52  TRP B CE3  18 
ATOM 2601  C CZ2  . TRP B 1 52  ? -4.728  2.794   14.241  1.00 0.00 ? 52  TRP B CZ2  18 
ATOM 2602  C CZ3  . TRP B 1 52  ? -3.229  2.560   16.131  1.00 0.00 ? 52  TRP B CZ3  18 
ATOM 2603  C CH2  . TRP B 1 52  ? -4.477  2.929   15.609  1.00 0.00 ? 52  TRP B CH2  18 
ATOM 2604  H H    . TRP B 1 52  ? 1.727   1.308   14.370  1.00 0.00 ? 52  TRP B H    18 
ATOM 2605  H HA   . TRP B 1 52  ? -0.868  0.231   14.746  1.00 0.00 ? 52  TRP B HA   18 
ATOM 2606  H HB2  . TRP B 1 52  ? 0.441   1.734   12.789  1.00 0.00 ? 52  TRP B HB2  18 
ATOM 2607  H HB3  . TRP B 1 52  ? -0.092  0.278   11.950  1.00 0.00 ? 52  TRP B HB3  18 
ATOM 2608  H HD1  . TRP B 1 52  ? -2.120  1.255   10.693  1.00 0.00 ? 52  TRP B HD1  18 
ATOM 2609  H HE1  . TRP B 1 52  ? -4.398  2.209   11.434  1.00 0.00 ? 52  TRP B HE1  18 
ATOM 2610  H HE3  . TRP B 1 52  ? -1.270  1.774   15.701  1.00 0.00 ? 52  TRP B HE3  18 
ATOM 2611  H HZ2  . TRP B 1 52  ? -5.689  3.075   13.835  1.00 0.00 ? 52  TRP B HZ2  18 
ATOM 2612  H HZ3  . TRP B 1 52  ? -3.037  2.666   17.189  1.00 0.00 ? 52  TRP B HZ3  18 
ATOM 2613  H HH2  . TRP B 1 52  ? -5.243  3.319   16.263  1.00 0.00 ? 52  TRP B HH2  18 
ATOM 2614  N N    . SER B 1 53  ? -0.659  -1.844  12.773  1.00 0.00 ? 53  SER B N    18 
ATOM 2615  C CA   . SER B 1 53  ? -0.579  -3.278  12.378  1.00 0.00 ? 53  SER B CA   18 
ATOM 2616  C C    . SER B 1 53  ? 0.551   -3.462  11.362  1.00 0.00 ? 53  SER B C    18 
ATOM 2617  O O    . SER B 1 53  ? 0.403   -4.153  10.373  1.00 0.00 ? 53  SER B O    18 
ATOM 2618  C CB   . SER B 1 53  ? -1.903  -3.706  11.746  1.00 0.00 ? 53  SER B CB   18 
ATOM 2619  O OG   . SER B 1 53  ? -2.139  -2.928  10.580  1.00 0.00 ? 53  SER B OG   18 
ATOM 2620  H H    . SER B 1 53  ? -1.286  -1.245  12.317  1.00 0.00 ? 53  SER B H    18 
ATOM 2621  H HA   . SER B 1 53  ? -0.381  -3.883  13.250  1.00 0.00 ? 53  SER B HA   18 
ATOM 2622  H HB2  . SER B 1 53  ? -1.856  -4.748  11.475  1.00 0.00 ? 53  SER B HB2  18 
ATOM 2623  H HB3  . SER B 1 53  ? -2.704  -3.558  12.458  1.00 0.00 ? 53  SER B HB3  18 
ATOM 2624  H HG   . SER B 1 53  ? -2.073  -3.508  9.818   1.00 0.00 ? 53  SER B HG   18 
ATOM 2625  N N    . LEU B 1 54  ? 1.679   -2.848  11.595  1.00 0.00 ? 54  LEU B N    18 
ATOM 2626  C CA   . LEU B 1 54  ? 2.812   -2.988  10.639  1.00 0.00 ? 54  LEU B CA   18 
ATOM 2627  C C    . LEU B 1 54  ? 2.976   -4.460  10.257  1.00 0.00 ? 54  LEU B C    18 
ATOM 2628  O O    . LEU B 1 54  ? 3.057   -5.328  11.103  1.00 0.00 ? 54  LEU B O    18 
ATOM 2629  C CB   . LEU B 1 54  ? 4.098   -2.479  11.292  1.00 0.00 ? 54  LEU B CB   18 
ATOM 2630  C CG   . LEU B 1 54  ? 3.933   -1.002  11.659  1.00 0.00 ? 54  LEU B CG   18 
ATOM 2631  C CD1  . LEU B 1 54  ? 4.802   -0.675  12.877  1.00 0.00 ? 54  LEU B CD1  18 
ATOM 2632  C CD2  . LEU B 1 54  ? 4.367   -0.132  10.478  1.00 0.00 ? 54  LEU B CD2  18 
ATOM 2633  H H    . LEU B 1 54  ? 1.780   -2.295  12.396  1.00 0.00 ? 54  LEU B H    18 
ATOM 2634  H HA   . LEU B 1 54  ? 2.606   -2.408  9.752   1.00 0.00 ? 54  LEU B HA   18 
ATOM 2635  H HB2  . LEU B 1 54  ? 4.302   -3.054  12.184  1.00 0.00 ? 54  LEU B HB2  18 
ATOM 2636  H HB3  . LEU B 1 54  ? 4.918   -2.587  10.597  1.00 0.00 ? 54  LEU B HB3  18 
ATOM 2637  H HG   . LEU B 1 54  ? 2.897   -0.804  11.894  1.00 0.00 ? 54  LEU B HG   18 
ATOM 2638  H HD11 . LEU B 1 54  ? 5.364   -1.551  13.165  1.00 0.00 ? 54  LEU B HD11 18 
ATOM 2639  H HD12 . LEU B 1 54  ? 5.484   0.125   12.628  1.00 0.00 ? 54  LEU B HD12 18 
ATOM 2640  H HD13 . LEU B 1 54  ? 4.170   -0.367  13.697  1.00 0.00 ? 54  LEU B HD13 18 
ATOM 2641  H HD21 . LEU B 1 54  ? 5.376   -0.393  10.191  1.00 0.00 ? 54  LEU B HD21 18 
ATOM 2642  H HD22 . LEU B 1 54  ? 3.701   -0.298  9.645   1.00 0.00 ? 54  LEU B HD22 18 
ATOM 2643  H HD23 . LEU B 1 54  ? 4.332   0.908   10.766  1.00 0.00 ? 54  LEU B HD23 18 
ATOM 2644  N N    . ASP B 1 55  ? 3.022   -4.747  8.985   1.00 0.00 ? 55  ASP B N    18 
ATOM 2645  C CA   . ASP B 1 55  ? 3.177   -6.162  8.542   1.00 0.00 ? 55  ASP B CA   18 
ATOM 2646  C C    . ASP B 1 55  ? 4.633   -6.427  8.157   1.00 0.00 ? 55  ASP B C    18 
ATOM 2647  O O    . ASP B 1 55  ? 5.221   -7.413  8.552   1.00 0.00 ? 55  ASP B O    18 
ATOM 2648  C CB   . ASP B 1 55  ? 2.276   -6.417  7.332   1.00 0.00 ? 55  ASP B CB   18 
ATOM 2649  C CG   . ASP B 1 55  ? 0.872   -6.795  7.809   1.00 0.00 ? 55  ASP B CG   18 
ATOM 2650  O OD1  . ASP B 1 55  ? 0.739   -7.843  8.419   1.00 0.00 ? 55  ASP B OD1  18 
ATOM 2651  O OD2  . ASP B 1 55  ? -0.043  -6.030  7.556   1.00 0.00 ? 55  ASP B OD2  18 
ATOM 2652  H H    . ASP B 1 55  ? 2.954   -4.030  8.321   1.00 0.00 ? 55  ASP B H    18 
ATOM 2653  H HA   . ASP B 1 55  ? 2.891   -6.823  9.347   1.00 0.00 ? 55  ASP B HA   18 
ATOM 2654  H HB2  . ASP B 1 55  ? 2.224   -5.522  6.728   1.00 0.00 ? 55  ASP B HB2  18 
ATOM 2655  H HB3  . ASP B 1 55  ? 2.685   -7.225  6.744   1.00 0.00 ? 55  ASP B HB3  18 
ATOM 2656  N N    . THR B 1 56  ? 5.219   -5.555  7.381   1.00 0.00 ? 56  THR B N    18 
ATOM 2657  C CA   . THR B 1 56  ? 6.636   -5.761  6.964   1.00 0.00 ? 56  THR B CA   18 
ATOM 2658  C C    . THR B 1 56  ? 7.564   -5.003  7.915   1.00 0.00 ? 56  THR B C    18 
ATOM 2659  O O    . THR B 1 56  ? 7.150   -4.093  8.607   1.00 0.00 ? 56  THR B O    18 
ATOM 2660  C CB   . THR B 1 56  ? 6.828   -5.238  5.537   1.00 0.00 ? 56  THR B CB   18 
ATOM 2661  O OG1  . THR B 1 56  ? 7.199   -3.867  5.584   1.00 0.00 ? 56  THR B OG1  18 
ATOM 2662  C CG2  . THR B 1 56  ? 5.524   -5.388  4.748   1.00 0.00 ? 56  THR B CG2  18 
ATOM 2663  H H    . THR B 1 56  ? 4.725   -4.768  7.069   1.00 0.00 ? 56  THR B H    18 
ATOM 2664  H HA   . THR B 1 56  ? 6.871   -6.815  6.996   1.00 0.00 ? 56  THR B HA   18 
ATOM 2665  H HB   . THR B 1 56  ? 7.605   -5.805  5.049   1.00 0.00 ? 56  THR B HB   18 
ATOM 2666  H HG1  . THR B 1 56  ? 6.840   -3.436  4.805   1.00 0.00 ? 56  THR B HG1  18 
ATOM 2667  H HG21 . THR B 1 56  ? 5.061   -6.332  4.995   1.00 0.00 ? 56  THR B HG21 18 
ATOM 2668  H HG22 . THR B 1 56  ? 4.853   -4.581  5.004   1.00 0.00 ? 56  THR B HG22 18 
ATOM 2669  H HG23 . THR B 1 56  ? 5.737   -5.357  3.690   1.00 0.00 ? 56  THR B HG23 18 
ATOM 2670  N N    . GLN B 1 57  ? 8.817   -5.367  7.957   1.00 0.00 ? 57  GLN B N    18 
ATOM 2671  C CA   . GLN B 1 57  ? 9.769   -4.665  8.865   1.00 0.00 ? 57  GLN B CA   18 
ATOM 2672  C C    . GLN B 1 57  ? 10.134  -3.304  8.267   1.00 0.00 ? 57  GLN B C    18 
ATOM 2673  O O    . GLN B 1 57  ? 10.618  -2.424  8.950   1.00 0.00 ? 57  GLN B O    18 
ATOM 2674  C CB   . GLN B 1 57  ? 11.034  -5.509  9.035   1.00 0.00 ? 57  GLN B CB   18 
ATOM 2675  C CG   . GLN B 1 57  ? 11.335  -5.682  10.527  1.00 0.00 ? 57  GLN B CG   18 
ATOM 2676  C CD   . GLN B 1 57  ? 12.584  -6.550  10.702  1.00 0.00 ? 57  GLN B CD   18 
ATOM 2677  O OE1  . GLN B 1 57  ? 13.693  -6.062  10.614  1.00 0.00 ? 57  GLN B OE1  18 
ATOM 2678  N NE2  . GLN B 1 57  ? 12.449  -7.824  10.948  1.00 0.00 ? 57  GLN B NE2  18 
ATOM 2679  H H    . GLN B 1 57  ? 9.133   -6.104  7.391   1.00 0.00 ? 57  GLN B H    18 
ATOM 2680  H HA   . GLN B 1 57  ? 9.301   -4.519  9.828   1.00 0.00 ? 57  GLN B HA   18 
ATOM 2681  H HB2  . GLN B 1 57  ? 10.882  -6.478  8.583   1.00 0.00 ? 57  GLN B HB2  18 
ATOM 2682  H HB3  . GLN B 1 57  ? 11.865  -5.013  8.557   1.00 0.00 ? 57  GLN B HB3  18 
ATOM 2683  H HG2  . GLN B 1 57  ? 11.502  -4.714  10.975  1.00 0.00 ? 57  GLN B HG2  18 
ATOM 2684  H HG3  . GLN B 1 57  ? 10.496  -6.162  11.009  1.00 0.00 ? 57  GLN B HG3  18 
ATOM 2685  H HE21 . GLN B 1 57  ? 11.555  -8.218  11.020  1.00 0.00 ? 57  GLN B HE21 18 
ATOM 2686  H HE22 . GLN B 1 57  ? 13.243  -8.388  11.063  1.00 0.00 ? 57  GLN B HE22 18 
ATOM 2687  N N    . TYR B 1 58  ? 9.898   -3.119  6.998   1.00 0.00 ? 58  TYR B N    18 
ATOM 2688  C CA   . TYR B 1 58  ? 10.225  -1.809  6.372   1.00 0.00 ? 58  TYR B CA   18 
ATOM 2689  C C    . TYR B 1 58  ? 9.118   -0.805  6.714   1.00 0.00 ? 58  TYR B C    18 
ATOM 2690  O O    . TYR B 1 58  ? 9.236   0.375   6.452   1.00 0.00 ? 58  TYR B O    18 
ATOM 2691  C CB   . TYR B 1 58  ? 10.335  -1.979  4.847   1.00 0.00 ? 58  TYR B CB   18 
ATOM 2692  C CG   . TYR B 1 58  ? 10.081  -0.656  4.164   1.00 0.00 ? 58  TYR B CG   18 
ATOM 2693  C CD1  . TYR B 1 58  ? 11.030  0.368   4.250   1.00 0.00 ? 58  TYR B CD1  18 
ATOM 2694  C CD2  . TYR B 1 58  ? 8.890   -0.451  3.461   1.00 0.00 ? 58  TYR B CD2  18 
ATOM 2695  C CE1  . TYR B 1 58  ? 10.786  1.597   3.629   1.00 0.00 ? 58  TYR B CE1  18 
ATOM 2696  C CE2  . TYR B 1 58  ? 8.647   0.779   2.842   1.00 0.00 ? 58  TYR B CE2  18 
ATOM 2697  C CZ   . TYR B 1 58  ? 9.596   1.802   2.927   1.00 0.00 ? 58  TYR B CZ   18 
ATOM 2698  O OH   . TYR B 1 58  ? 9.356   3.016   2.324   1.00 0.00 ? 58  TYR B OH   18 
ATOM 2699  H H    . TYR B 1 58  ? 9.501   -3.837  6.462   1.00 0.00 ? 58  TYR B H    18 
ATOM 2700  H HA   . TYR B 1 58  ? 11.167  -1.451  6.763   1.00 0.00 ? 58  TYR B HA   18 
ATOM 2701  H HB2  . TYR B 1 58  ? 11.325  -2.329  4.595   1.00 0.00 ? 58  TYR B HB2  18 
ATOM 2702  H HB3  . TYR B 1 58  ? 9.604   -2.700  4.510   1.00 0.00 ? 58  TYR B HB3  18 
ATOM 2703  H HD1  . TYR B 1 58  ? 11.951  0.210   4.792   1.00 0.00 ? 58  TYR B HD1  18 
ATOM 2704  H HD2  . TYR B 1 58  ? 8.158   -1.243  3.395   1.00 0.00 ? 58  TYR B HD2  18 
ATOM 2705  H HE1  . TYR B 1 58  ? 11.515  2.390   3.694   1.00 0.00 ? 58  TYR B HE1  18 
ATOM 2706  H HE2  . TYR B 1 58  ? 7.727   0.939   2.299   1.00 0.00 ? 58  TYR B HE2  18 
ATOM 2707  H HH   . TYR B 1 58  ? 10.064  3.615   2.572   1.00 0.00 ? 58  TYR B HH   18 
ATOM 2708  N N    . SER B 1 59  ? 8.042   -1.264  7.291   1.00 0.00 ? 59  SER B N    18 
ATOM 2709  C CA   . SER B 1 59  ? 6.932   -0.334  7.638   1.00 0.00 ? 59  SER B CA   18 
ATOM 2710  C C    . SER B 1 59  ? 7.252   0.384   8.951   1.00 0.00 ? 59  SER B C    18 
ATOM 2711  O O    . SER B 1 59  ? 6.797   1.484   9.190   1.00 0.00 ? 59  SER B O    18 
ATOM 2712  C CB   . SER B 1 59  ? 5.633   -1.124  7.792   1.00 0.00 ? 59  SER B CB   18 
ATOM 2713  O OG   . SER B 1 59  ? 5.825   -2.167  8.738   1.00 0.00 ? 59  SER B OG   18 
ATOM 2714  H H    . SER B 1 59  ? 7.960   -2.220  7.491   1.00 0.00 ? 59  SER B H    18 
ATOM 2715  H HA   . SER B 1 59  ? 6.818   0.396   6.850   1.00 0.00 ? 59  SER B HA   18 
ATOM 2716  H HB2  . SER B 1 59  ? 4.850   -0.469  8.139   1.00 0.00 ? 59  SER B HB2  18 
ATOM 2717  H HB3  . SER B 1 59  ? 5.351   -1.541  6.834   1.00 0.00 ? 59  SER B HB3  18 
ATOM 2718  H HG   . SER B 1 59  ? 6.418   -1.843  9.420   1.00 0.00 ? 59  SER B HG   18 
ATOM 2719  N N    . LYS B 1 60  ? 8.031   -0.224  9.803   1.00 0.00 ? 60  LYS B N    18 
ATOM 2720  C CA   . LYS B 1 60  ? 8.373   0.438   11.094  1.00 0.00 ? 60  LYS B CA   18 
ATOM 2721  C C    . LYS B 1 60  ? 9.550   1.391   10.876  1.00 0.00 ? 60  LYS B C    18 
ATOM 2722  O O    . LYS B 1 60  ? 9.666   2.408   11.530  1.00 0.00 ? 60  LYS B O    18 
ATOM 2723  C CB   . LYS B 1 60  ? 8.756   -0.618  12.133  1.00 0.00 ? 60  LYS B CB   18 
ATOM 2724  C CG   . LYS B 1 60  ? 9.970   -1.406  11.643  1.00 0.00 ? 60  LYS B CG   18 
ATOM 2725  C CD   . LYS B 1 60  ? 10.414  -2.391  12.726  1.00 0.00 ? 60  LYS B CD   18 
ATOM 2726  C CE   . LYS B 1 60  ? 11.233  -1.652  13.787  1.00 0.00 ? 60  LYS B CE   18 
ATOM 2727  N NZ   . LYS B 1 60  ? 10.827  -2.121  15.142  1.00 0.00 ? 60  LYS B NZ   18 
ATOM 2728  H H    . LYS B 1 60  ? 8.393   -1.111  9.594   1.00 0.00 ? 60  LYS B H    18 
ATOM 2729  H HA   . LYS B 1 60  ? 7.519   0.998   11.447  1.00 0.00 ? 60  LYS B HA   18 
ATOM 2730  H HB2  . LYS B 1 60  ? 8.994   -0.133  13.069  1.00 0.00 ? 60  LYS B HB2  18 
ATOM 2731  H HB3  . LYS B 1 60  ? 7.927   -1.295  12.281  1.00 0.00 ? 60  LYS B HB3  18 
ATOM 2732  H HG2  . LYS B 1 60  ? 9.707   -1.949  10.749  1.00 0.00 ? 60  LYS B HG2  18 
ATOM 2733  H HG3  . LYS B 1 60  ? 10.780  -0.723  11.426  1.00 0.00 ? 60  LYS B HG3  18 
ATOM 2734  H HD2  . LYS B 1 60  ? 9.543   -2.834  13.187  1.00 0.00 ? 60  LYS B HD2  18 
ATOM 2735  H HD3  . LYS B 1 60  ? 11.021  -3.166  12.283  1.00 0.00 ? 60  LYS B HD3  18 
ATOM 2736  H HE2  . LYS B 1 60  ? 12.283  -1.852  13.636  1.00 0.00 ? 60  LYS B HE2  18 
ATOM 2737  H HE3  . LYS B 1 60  ? 11.053  -0.590  13.705  1.00 0.00 ? 60  LYS B HE3  18 
ATOM 2738  H HZ1  . LYS B 1 60  ? 9.899   -2.586  15.083  1.00 0.00 ? 60  LYS B HZ1  18 
ATOM 2739  H HZ2  . LYS B 1 60  ? 11.532  -2.797  15.501  1.00 0.00 ? 60  LYS B HZ2  18 
ATOM 2740  H HZ3  . LYS B 1 60  ? 10.769  -1.309  15.788  1.00 0.00 ? 60  LYS B HZ3  18 
ATOM 2741  N N    . VAL B 1 61  ? 10.423  1.068   9.962   1.00 0.00 ? 61  VAL B N    18 
ATOM 2742  C CA   . VAL B 1 61  ? 11.589  1.954   9.705   1.00 0.00 ? 61  VAL B CA   18 
ATOM 2743  C C    . VAL B 1 61  ? 11.129  3.202   8.944   1.00 0.00 ? 61  VAL B C    18 
ATOM 2744  O O    . VAL B 1 61  ? 11.135  4.293   9.474   1.00 0.00 ? 61  VAL B O    18 
ATOM 2745  C CB   . VAL B 1 61  ? 12.627  1.185   8.883   1.00 0.00 ? 61  VAL B CB   18 
ATOM 2746  C CG1  . VAL B 1 61  ? 13.608  2.164   8.240   1.00 0.00 ? 61  VAL B CG1  18 
ATOM 2747  C CG2  . VAL B 1 61  ? 13.391  0.234   9.806   1.00 0.00 ? 61  VAL B CG2  18 
ATOM 2748  H H    . VAL B 1 61  ? 10.313  0.243   9.445   1.00 0.00 ? 61  VAL B H    18 
ATOM 2749  H HA   . VAL B 1 61  ? 12.027  2.250   10.647  1.00 0.00 ? 61  VAL B HA   18 
ATOM 2750  H HB   . VAL B 1 61  ? 12.127  0.618   8.112   1.00 0.00 ? 61  VAL B HB   18 
ATOM 2751  H HG11 . VAL B 1 61  ? 13.497  3.136   8.696   1.00 0.00 ? 61  VAL B HG11 18 
ATOM 2752  H HG12 . VAL B 1 61  ? 14.618  1.810   8.387   1.00 0.00 ? 61  VAL B HG12 18 
ATOM 2753  H HG13 . VAL B 1 61  ? 13.403  2.236   7.182   1.00 0.00 ? 61  VAL B HG13 18 
ATOM 2754  H HG21 . VAL B 1 61  ? 12.964  0.276   10.797  1.00 0.00 ? 61  VAL B HG21 18 
ATOM 2755  H HG22 . VAL B 1 61  ? 13.316  -0.775  9.424   1.00 0.00 ? 61  VAL B HG22 18 
ATOM 2756  H HG23 . VAL B 1 61  ? 14.428  0.527   9.848   1.00 0.00 ? 61  VAL B HG23 18 
ATOM 2757  N N    . LEU B 1 62  ? 10.729  3.054   7.709   1.00 0.00 ? 62  LEU B N    18 
ATOM 2758  C CA   . LEU B 1 62  ? 10.271  4.240   6.928   1.00 0.00 ? 62  LEU B CA   18 
ATOM 2759  C C    . LEU B 1 62  ? 9.211   4.990   7.738   1.00 0.00 ? 62  LEU B C    18 
ATOM 2760  O O    . LEU B 1 62  ? 9.044   6.186   7.598   1.00 0.00 ? 62  LEU B O    18 
ATOM 2761  C CB   . LEU B 1 62  ? 9.691   3.767   5.587   1.00 0.00 ? 62  LEU B CB   18 
ATOM 2762  C CG   . LEU B 1 62  ? 8.877   4.881   4.912   1.00 0.00 ? 62  LEU B CG   18 
ATOM 2763  C CD1  . LEU B 1 62  ? 9.782   5.716   4.000   1.00 0.00 ? 62  LEU B CD1  18 
ATOM 2764  C CD2  . LEU B 1 62  ? 7.773   4.241   4.069   1.00 0.00 ? 62  LEU B CD2  18 
ATOM 2765  H H    . LEU B 1 62  ? 10.730  2.164   7.296   1.00 0.00 ? 62  LEU B H    18 
ATOM 2766  H HA   . LEU B 1 62  ? 11.111  4.894   6.746   1.00 0.00 ? 62  LEU B HA   18 
ATOM 2767  H HB2  . LEU B 1 62  ? 10.503  3.481   4.938   1.00 0.00 ? 62  LEU B HB2  18 
ATOM 2768  H HB3  . LEU B 1 62  ? 9.053   2.913   5.757   1.00 0.00 ? 62  LEU B HB3  18 
ATOM 2769  H HG   . LEU B 1 62  ? 8.435   5.519   5.660   1.00 0.00 ? 62  LEU B HG   18 
ATOM 2770  H HD11 . LEU B 1 62  ? 10.815  5.559   4.272   1.00 0.00 ? 62  LEU B HD11 18 
ATOM 2771  H HD12 . LEU B 1 62  ? 9.632   5.418   2.971   1.00 0.00 ? 62  LEU B HD12 18 
ATOM 2772  H HD13 . LEU B 1 62  ? 9.536   6.763   4.107   1.00 0.00 ? 62  LEU B HD13 18 
ATOM 2773  H HD21 . LEU B 1 62  ? 7.999   3.197   3.915   1.00 0.00 ? 62  LEU B HD21 18 
ATOM 2774  H HD22 . LEU B 1 62  ? 6.829   4.332   4.585   1.00 0.00 ? 62  LEU B HD22 18 
ATOM 2775  H HD23 . LEU B 1 62  ? 7.713   4.742   3.115   1.00 0.00 ? 62  LEU B HD23 18 
ATOM 2776  N N    . ALA B 1 63  ? 8.500   4.305   8.593   1.00 0.00 ? 63  ALA B N    18 
ATOM 2777  C CA   . ALA B 1 63  ? 7.467   4.994   9.415   1.00 0.00 ? 63  ALA B CA   18 
ATOM 2778  C C    . ALA B 1 63  ? 8.129   6.150   10.164  1.00 0.00 ? 63  ALA B C    18 
ATOM 2779  O O    . ALA B 1 63  ? 7.639   7.262   10.172  1.00 0.00 ? 63  ALA B O    18 
ATOM 2780  C CB   . ALA B 1 63  ? 6.867   4.007   10.421  1.00 0.00 ? 63  ALA B CB   18 
ATOM 2781  H H    . ALA B 1 63  ? 8.654   3.342   8.700   1.00 0.00 ? 63  ALA B H    18 
ATOM 2782  H HA   . ALA B 1 63  ? 6.687   5.376   8.772   1.00 0.00 ? 63  ALA B HA   18 
ATOM 2783  H HB1  . ALA B 1 63  ? 7.658   3.417   10.862  1.00 0.00 ? 63  ALA B HB1  18 
ATOM 2784  H HB2  . ALA B 1 63  ? 6.351   4.553   11.196  1.00 0.00 ? 63  ALA B HB2  18 
ATOM 2785  H HB3  . ALA B 1 63  ? 6.171   3.355   9.915   1.00 0.00 ? 63  ALA B HB3  18 
ATOM 2786  N N    . LEU B 1 64  ? 9.249   5.893   10.782  1.00 0.00 ? 64  LEU B N    18 
ATOM 2787  C CA   . LEU B 1 64  ? 9.967   6.969   11.523  1.00 0.00 ? 64  LEU B CA   18 
ATOM 2788  C C    . LEU B 1 64  ? 10.653  7.891   10.516  1.00 0.00 ? 64  LEU B C    18 
ATOM 2789  O O    . LEU B 1 64  ? 10.735  9.084   10.702  1.00 0.00 ? 64  LEU B O    18 
ATOM 2790  C CB   . LEU B 1 64  ? 11.028  6.333   12.424  1.00 0.00 ? 64  LEU B CB   18 
ATOM 2791  C CG   . LEU B 1 64  ? 10.343  5.586   13.565  1.00 0.00 ? 64  LEU B CG   18 
ATOM 2792  C CD1  . LEU B 1 64  ? 11.348  4.655   14.242  1.00 0.00 ? 64  LEU B CD1  18 
ATOM 2793  C CD2  . LEU B 1 64  ? 9.809   6.592   14.588  1.00 0.00 ? 64  LEU B CD2  18 
ATOM 2794  H H    . LEU B 1 64  ? 9.625   4.989   10.751  1.00 0.00 ? 64  LEU B H    18 
ATOM 2795  H HA   . LEU B 1 64  ? 9.267   7.535   12.121  1.00 0.00 ? 64  LEU B HA   18 
ATOM 2796  H HB2  . LEU B 1 64  ? 11.621  5.640   11.845  1.00 0.00 ? 64  LEU B HB2  18 
ATOM 2797  H HB3  . LEU B 1 64  ? 11.668  7.102   12.828  1.00 0.00 ? 64  LEU B HB3  18 
ATOM 2798  H HG   . LEU B 1 64  ? 9.524   5.004   13.167  1.00 0.00 ? 64  LEU B HG   18 
ATOM 2799  H HD11 . LEU B 1 64  ? 11.733  3.952   13.519  1.00 0.00 ? 64  LEU B HD11 18 
ATOM 2800  H HD12 . LEU B 1 64  ? 12.163  5.238   14.646  1.00 0.00 ? 64  LEU B HD12 18 
ATOM 2801  H HD13 . LEU B 1 64  ? 10.860  4.117   15.042  1.00 0.00 ? 64  LEU B HD13 18 
ATOM 2802  H HD21 . LEU B 1 64  ? 9.243   7.358   14.078  1.00 0.00 ? 64  LEU B HD21 18 
ATOM 2803  H HD22 . LEU B 1 64  ? 9.171   6.082   15.294  1.00 0.00 ? 64  LEU B HD22 18 
ATOM 2804  H HD23 . LEU B 1 64  ? 10.637  7.045   15.113  1.00 0.00 ? 64  LEU B HD23 18 
ATOM 2805  N N    . TYR B 1 65  ? 11.148  7.334   9.448   1.00 0.00 ? 65  TYR B N    18 
ATOM 2806  C CA   . TYR B 1 65  ? 11.832  8.161   8.414   1.00 0.00 ? 65  TYR B CA   18 
ATOM 2807  C C    . TYR B 1 65  ? 10.951  9.358   8.052   1.00 0.00 ? 65  TYR B C    18 
ATOM 2808  O O    . TYR B 1 65  ? 11.435  10.424  7.723   1.00 0.00 ? 65  TYR B O    18 
ATOM 2809  C CB   . TYR B 1 65  ? 12.072  7.300   7.174   1.00 0.00 ? 65  TYR B CB   18 
ATOM 2810  C CG   . TYR B 1 65  ? 12.643  8.144   6.063   1.00 0.00 ? 65  TYR B CG   18 
ATOM 2811  C CD1  . TYR B 1 65  ? 11.785  8.815   5.185   1.00 0.00 ? 65  TYR B CD1  18 
ATOM 2812  C CD2  . TYR B 1 65  ? 14.030  8.249   5.906   1.00 0.00 ? 65  TYR B CD2  18 
ATOM 2813  C CE1  . TYR B 1 65  ? 12.314  9.591   4.146   1.00 0.00 ? 65  TYR B CE1  18 
ATOM 2814  C CE2  . TYR B 1 65  ? 14.559  9.025   4.868   1.00 0.00 ? 65  TYR B CE2  18 
ATOM 2815  C CZ   . TYR B 1 65  ? 13.701  9.694   3.987   1.00 0.00 ? 65  TYR B CZ   18 
ATOM 2816  O OH   . TYR B 1 65  ? 14.223  10.460  2.964   1.00 0.00 ? 65  TYR B OH   18 
ATOM 2817  H H    . TYR B 1 65  ? 11.067  6.367   9.324   1.00 0.00 ? 65  TYR B H    18 
ATOM 2818  H HA   . TYR B 1 65  ? 12.778  8.512   8.800   1.00 0.00 ? 65  TYR B HA   18 
ATOM 2819  H HB2  . TYR B 1 65  ? 12.766  6.508   7.416   1.00 0.00 ? 65  TYR B HB2  18 
ATOM 2820  H HB3  . TYR B 1 65  ? 11.136  6.869   6.852   1.00 0.00 ? 65  TYR B HB3  18 
ATOM 2821  H HD1  . TYR B 1 65  ? 10.714  8.734   5.306   1.00 0.00 ? 65  TYR B HD1  18 
ATOM 2822  H HD2  . TYR B 1 65  ? 14.694  7.734   6.590   1.00 0.00 ? 65  TYR B HD2  18 
ATOM 2823  H HE1  . TYR B 1 65  ? 11.652  10.108  3.467   1.00 0.00 ? 65  TYR B HE1  18 
ATOM 2824  H HE2  . TYR B 1 65  ? 15.628  9.103   4.742   1.00 0.00 ? 65  TYR B HE2  18 
ATOM 2825  H HH   . TYR B 1 65  ? 15.044  10.053  2.678   1.00 0.00 ? 65  TYR B HH   18 
ATOM 2826  N N    . ASN B 1 66  ? 9.661   9.189   8.114   1.00 0.00 ? 66  ASN B N    18 
ATOM 2827  C CA   . ASN B 1 66  ? 8.738   10.308  7.781   1.00 0.00 ? 66  ASN B CA   18 
ATOM 2828  C C    . ASN B 1 66  ? 8.353   11.035  9.065   1.00 0.00 ? 66  ASN B C    18 
ATOM 2829  O O    . ASN B 1 66  ? 8.399   12.246  9.154   1.00 0.00 ? 66  ASN B O    18 
ATOM 2830  C CB   . ASN B 1 66  ? 7.476   9.732   7.159   1.00 0.00 ? 66  ASN B CB   18 
ATOM 2831  C CG   . ASN B 1 66  ? 6.883   10.736  6.169   1.00 0.00 ? 66  ASN B CG   18 
ATOM 2832  O OD1  . ASN B 1 66  ? 7.513   11.085  5.190   1.00 0.00 ? 66  ASN B OD1  18 
ATOM 2833  N ND2  . ASN B 1 66  ? 5.691   11.218  6.384   1.00 0.00 ? 66  ASN B ND2  18 
ATOM 2834  H H    . ASN B 1 66  ? 9.295   8.322   8.385   1.00 0.00 ? 66  ASN B H    18 
ATOM 2835  H HA   . ASN B 1 66  ? 9.211   10.991  7.093   1.00 0.00 ? 66  ASN B HA   18 
ATOM 2836  H HB2  . ASN B 1 66  ? 7.715   8.812   6.648   1.00 0.00 ? 66  ASN B HB2  18 
ATOM 2837  H HB3  . ASN B 1 66  ? 6.764   9.536   7.943   1.00 0.00 ? 66  ASN B HB3  18 
ATOM 2838  H HD21 . ASN B 1 66  ? 5.184   10.937  7.174   1.00 0.00 ? 66  ASN B HD21 18 
ATOM 2839  H HD22 . ASN B 1 66  ? 5.302   11.862  5.756   1.00 0.00 ? 66  ASN B HD22 18 
ATOM 2840  N N    . GLN B 1 67  ? 7.974   10.288  10.063  1.00 0.00 ? 67  GLN B N    18 
ATOM 2841  C CA   . GLN B 1 67  ? 7.577   10.896  11.365  1.00 0.00 ? 67  GLN B CA   18 
ATOM 2842  C C    . GLN B 1 67  ? 8.711   11.770  11.899  1.00 0.00 ? 67  GLN B C    18 
ATOM 2843  O O    . GLN B 1 67  ? 8.529   12.557  12.806  1.00 0.00 ? 67  GLN B O    18 
ATOM 2844  C CB   . GLN B 1 67  ? 7.281   9.778   12.366  1.00 0.00 ? 67  GLN B CB   18 
ATOM 2845  C CG   . GLN B 1 67  ? 5.798   9.408   12.294  1.00 0.00 ? 67  GLN B CG   18 
ATOM 2846  C CD   . GLN B 1 67  ? 4.973   10.462  13.035  1.00 0.00 ? 67  GLN B CD   18 
ATOM 2847  O OE1  . GLN B 1 67  ? 5.325   10.869  14.124  1.00 0.00 ? 67  GLN B OE1  18 
ATOM 2848  N NE2  . GLN B 1 67  ? 3.883   10.925  12.486  1.00 0.00 ? 67  GLN B NE2  18 
ATOM 2849  H H    . GLN B 1 67  ? 7.949   9.315   9.955   1.00 0.00 ? 67  GLN B H    18 
ATOM 2850  H HA   . GLN B 1 67  ? 6.697   11.498  11.225  1.00 0.00 ? 67  GLN B HA   18 
ATOM 2851  H HB2  . GLN B 1 67  ? 7.881   8.914   12.122  1.00 0.00 ? 67  GLN B HB2  18 
ATOM 2852  H HB3  . GLN B 1 67  ? 7.521   10.112  13.362  1.00 0.00 ? 67  GLN B HB3  18 
ATOM 2853  H HG2  . GLN B 1 67  ? 5.487   9.366   11.260  1.00 0.00 ? 67  GLN B HG2  18 
ATOM 2854  H HG3  . GLN B 1 67  ? 5.644   8.444   12.756  1.00 0.00 ? 67  GLN B HG3  18 
ATOM 2855  H HE21 . GLN B 1 67  ? 3.600   10.597  11.608  1.00 0.00 ? 67  GLN B HE21 18 
ATOM 2856  H HE22 . GLN B 1 67  ? 3.348   11.600  12.954  1.00 0.00 ? 67  GLN B HE22 18 
ATOM 2857  N N    . HIS B 1 68  ? 9.877   11.636  11.342  1.00 0.00 ? 68  HIS B N    18 
ATOM 2858  C CA   . HIS B 1 68  ? 11.029  12.457  11.813  1.00 0.00 ? 68  HIS B CA   18 
ATOM 2859  C C    . HIS B 1 68  ? 11.162  13.706  10.940  1.00 0.00 ? 68  HIS B C    18 
ATOM 2860  O O    . HIS B 1 68  ? 11.405  14.791  11.429  1.00 0.00 ? 68  HIS B O    18 
ATOM 2861  C CB   . HIS B 1 68  ? 12.316  11.634  11.724  1.00 0.00 ? 68  HIS B CB   18 
ATOM 2862  C CG   . HIS B 1 68  ? 12.542  10.909  13.022  1.00 0.00 ? 68  HIS B CG   18 
ATOM 2863  N ND1  . HIS B 1 68  ? 12.022  9.649   13.269  1.00 0.00 ? 68  HIS B ND1  18 
ATOM 2864  C CD2  . HIS B 1 68  ? 13.234  11.259  14.153  1.00 0.00 ? 68  HIS B CD2  18 
ATOM 2865  C CE1  . HIS B 1 68  ? 12.408  9.287   14.506  1.00 0.00 ? 68  HIS B CE1  18 
ATOM 2866  N NE2  . HIS B 1 68  ? 13.149  10.233  15.090  1.00 0.00 ? 68  HIS B NE2  18 
ATOM 2867  H H    . HIS B 1 68  ? 9.993   10.995  10.613  1.00 0.00 ? 68  HIS B H    18 
ATOM 2868  H HA   . HIS B 1 68  ? 10.862  12.752  12.838  1.00 0.00 ? 68  HIS B HA   18 
ATOM 2869  H HB2  . HIS B 1 68  ? 12.233  10.918  10.921  1.00 0.00 ? 68  HIS B HB2  18 
ATOM 2870  H HB3  . HIS B 1 68  ? 13.152  12.293  11.534  1.00 0.00 ? 68  HIS B HB3  18 
ATOM 2871  H HD1  . HIS B 1 68  ? 11.473  9.118   12.657  1.00 0.00 ? 68  HIS B HD1  18 
ATOM 2872  H HD2  . HIS B 1 68  ? 13.765  12.188  14.293  1.00 0.00 ? 68  HIS B HD2  18 
ATOM 2873  H HE1  . HIS B 1 68  ? 12.152  8.346   14.970  1.00 0.00 ? 68  HIS B HE1  18 
ATOM 2874  N N    . ASN B 1 69  ? 11.012  13.565  9.652   1.00 0.00 ? 69  ASN B N    18 
ATOM 2875  C CA   . ASN B 1 69  ? 11.136  14.748  8.756   1.00 0.00 ? 69  ASN B CA   18 
ATOM 2876  C C    . ASN B 1 69  ? 9.738   15.215  8.323   1.00 0.00 ? 69  ASN B C    18 
ATOM 2877  O O    . ASN B 1 69  ? 9.016   14.474  7.686   1.00 0.00 ? 69  ASN B O    18 
ATOM 2878  C CB   . ASN B 1 69  ? 11.947  14.362  7.516   1.00 0.00 ? 69  ASN B CB   18 
ATOM 2879  C CG   . ASN B 1 69  ? 13.395  14.082  7.920   1.00 0.00 ? 69  ASN B CG   18 
ATOM 2880  O OD1  . ASN B 1 69  ? 13.953  14.776  8.745   1.00 0.00 ? 69  ASN B OD1  18 
ATOM 2881  N ND2  . ASN B 1 69  ? 14.032  13.086  7.368   1.00 0.00 ? 69  ASN B ND2  18 
ATOM 2882  H H    . ASN B 1 69  ? 10.818  12.681  9.275   1.00 0.00 ? 69  ASN B H    18 
ATOM 2883  H HA   . ASN B 1 69  ? 11.643  15.541  9.281   1.00 0.00 ? 69  ASN B HA   18 
ATOM 2884  H HB2  . ASN B 1 69  ? 11.518  13.477  7.068   1.00 0.00 ? 69  ASN B HB2  18 
ATOM 2885  H HB3  . ASN B 1 69  ? 11.924  15.174  6.805   1.00 0.00 ? 69  ASN B HB3  18 
ATOM 2886  H HD21 . ASN B 1 69  ? 13.581  12.526  6.702   1.00 0.00 ? 69  ASN B HD21 18 
ATOM 2887  H HD22 . ASN B 1 69  ? 14.960  12.897  7.618   1.00 0.00 ? 69  ASN B HD22 18 
ATOM 2888  N N    . PRO B 1 70  ? 9.397   16.430  8.679   1.00 0.00 ? 70  PRO B N    18 
ATOM 2889  C CA   . PRO B 1 70  ? 8.090   17.016  8.332   1.00 0.00 ? 70  PRO B CA   18 
ATOM 2890  C C    . PRO B 1 70  ? 8.090   17.479  6.872   1.00 0.00 ? 70  PRO B C    18 
ATOM 2891  O O    . PRO B 1 70  ? 8.984   18.174  6.432   1.00 0.00 ? 70  PRO B O    18 
ATOM 2892  C CB   . PRO B 1 70  ? 7.964   18.207  9.284   1.00 0.00 ? 70  PRO B CB   18 
ATOM 2893  C CG   . PRO B 1 70  ? 9.404   18.578  9.710   1.00 0.00 ? 70  PRO B CG   18 
ATOM 2894  C CD   . PRO B 1 70  ? 10.273  17.331  9.455   1.00 0.00 ? 70  PRO B CD   18 
ATOM 2895  H HA   . PRO B 1 70  ? 7.294   16.311  8.512   1.00 0.00 ? 70  PRO B HA   18 
ATOM 2896  H HB2  . PRO B 1 70  ? 7.496   19.040  8.776   1.00 0.00 ? 70  PRO B HB2  18 
ATOM 2897  H HB3  . PRO B 1 70  ? 7.388   17.930  10.153  1.00 0.00 ? 70  PRO B HB3  18 
ATOM 2898  H HG2  . PRO B 1 70  ? 9.761   19.410  9.119   1.00 0.00 ? 70  PRO B HG2  18 
ATOM 2899  H HG3  . PRO B 1 70  ? 9.428   18.830  10.759  1.00 0.00 ? 70  PRO B HG3  18 
ATOM 2900  H HD2  . PRO B 1 70  ? 11.151  17.596  8.882   1.00 0.00 ? 70  PRO B HD2  18 
ATOM 2901  H HD3  . PRO B 1 70  ? 10.553  16.867  10.387  1.00 0.00 ? 70  PRO B HD3  18 
ATOM 2902  N N    . GLY B 1 71  ? 7.098   17.097  6.118   1.00 0.00 ? 71  GLY B N    18 
ATOM 2903  C CA   . GLY B 1 71  ? 7.047   17.513  4.688   1.00 0.00 ? 71  GLY B CA   18 
ATOM 2904  C C    . GLY B 1 71  ? 7.505   16.351  3.805   1.00 0.00 ? 71  GLY B C    18 
ATOM 2905  O O    . GLY B 1 71  ? 7.395   16.395  2.596   1.00 0.00 ? 71  GLY B O    18 
ATOM 2906  H H    . GLY B 1 71  ? 6.387   16.534  6.490   1.00 0.00 ? 71  GLY B H    18 
ATOM 2907  H HA2  . GLY B 1 71  ? 6.035   17.787  4.429   1.00 0.00 ? 71  GLY B HA2  18 
ATOM 2908  H HA3  . GLY B 1 71  ? 7.701   18.357  4.534   1.00 0.00 ? 71  GLY B HA3  18 
ATOM 2909  N N    . ALA B 1 72  ? 8.015   15.307  4.401   1.00 0.00 ? 72  ALA B N    18 
ATOM 2910  C CA   . ALA B 1 72  ? 8.474   14.144  3.604   1.00 0.00 ? 72  ALA B CA   18 
ATOM 2911  C C    . ALA B 1 72  ? 7.267   13.295  3.230   1.00 0.00 ? 72  ALA B C    18 
ATOM 2912  O O    . ALA B 1 72  ? 6.505   12.862  4.071   1.00 0.00 ? 72  ALA B O    18 
ATOM 2913  C CB   . ALA B 1 72  ? 9.451   13.306  4.427   1.00 0.00 ? 72  ALA B CB   18 
ATOM 2914  H H    . ALA B 1 72  ? 8.090   15.287  5.370   1.00 0.00 ? 72  ALA B H    18 
ATOM 2915  H HA   . ALA B 1 72  ? 8.963   14.492  2.707   1.00 0.00 ? 72  ALA B HA   18 
ATOM 2916  H HB1  . ALA B 1 72  ? 10.293  13.915  4.717   1.00 0.00 ? 72  ALA B HB1  18 
ATOM 2917  H HB2  . ALA B 1 72  ? 8.952   12.935  5.311   1.00 0.00 ? 72  ALA B HB2  18 
ATOM 2918  H HB3  . ALA B 1 72  ? 9.797   12.472  3.833   1.00 0.00 ? 72  ALA B HB3  18 
ATOM 2919  N N    . SER B 1 73  ? 7.086   13.066  1.970   1.00 0.00 ? 73  SER B N    18 
ATOM 2920  C CA   . SER B 1 73  ? 5.926   12.253  1.513   1.00 0.00 ? 73  SER B CA   18 
ATOM 2921  C C    . SER B 1 73  ? 6.389   10.835  1.169   1.00 0.00 ? 73  SER B C    18 
ATOM 2922  O O    . SER B 1 73  ? 5.810   10.174  0.330   1.00 0.00 ? 73  SER B O    18 
ATOM 2923  C CB   . SER B 1 73  ? 5.307   12.903  0.275   1.00 0.00 ? 73  SER B CB   18 
ATOM 2924  O OG   . SER B 1 73  ? 4.584   14.063  0.666   1.00 0.00 ? 73  SER B OG   18 
ATOM 2925  H H    . SER B 1 73  ? 7.715   13.438  1.322   1.00 0.00 ? 73  SER B H    18 
ATOM 2926  H HA   . SER B 1 73  ? 5.189   12.207  2.301   1.00 0.00 ? 73  SER B HA   18 
ATOM 2927  H HB2  . SER B 1 73  ? 6.085   13.185  -0.413  1.00 0.00 ? 73  SER B HB2  18 
ATOM 2928  H HB3  . SER B 1 73  ? 4.642   12.197  -0.205  1.00 0.00 ? 73  SER B HB3  18 
ATOM 2929  H HG   . SER B 1 73  ? 5.200   14.799  0.699   1.00 0.00 ? 73  SER B HG   18 
ATOM 2930  N N    . ALA B 1 74  ? 7.422   10.357  1.810   1.00 0.00 ? 74  ALA B N    18 
ATOM 2931  C CA   . ALA B 1 74  ? 7.905   8.977   1.511   1.00 0.00 ? 74  ALA B CA   18 
ATOM 2932  C C    . ALA B 1 74  ? 7.403   8.019   2.595   1.00 0.00 ? 74  ALA B C    18 
ATOM 2933  O O    . ALA B 1 74  ? 7.889   6.915   2.738   1.00 0.00 ? 74  ALA B O    18 
ATOM 2934  C CB   . ALA B 1 74  ? 9.437   8.957   1.468   1.00 0.00 ? 74  ALA B CB   18 
ATOM 2935  H H    . ALA B 1 74  ? 7.877   10.901  2.487   1.00 0.00 ? 74  ALA B H    18 
ATOM 2936  H HA   . ALA B 1 74  ? 7.515   8.665   0.556   1.00 0.00 ? 74  ALA B HA   18 
ATOM 2937  H HB1  . ALA B 1 74  ? 9.829   9.473   2.330   1.00 0.00 ? 74  ALA B HB1  18 
ATOM 2938  H HB2  . ALA B 1 74  ? 9.784   7.934   1.469   1.00 0.00 ? 74  ALA B HB2  18 
ATOM 2939  H HB3  . ALA B 1 74  ? 9.777   9.449   0.568   1.00 0.00 ? 74  ALA B HB3  18 
ATOM 2940  N N    . ALA B 1 75  ? 6.422   8.434   3.349   1.00 0.00 ? 75  ALA B N    18 
ATOM 2941  C CA   . ALA B 1 75  ? 5.867   7.555   4.418   1.00 0.00 ? 75  ALA B CA   18 
ATOM 2942  C C    . ALA B 1 75  ? 5.494   6.199   3.805   1.00 0.00 ? 75  ALA B C    18 
ATOM 2943  O O    . ALA B 1 75  ? 5.765   5.962   2.644   1.00 0.00 ? 75  ALA B O    18 
ATOM 2944  C CB   . ALA B 1 75  ? 4.623   8.226   5.004   1.00 0.00 ? 75  ALA B CB   18 
ATOM 2945  H H    . ALA B 1 75  ? 6.042   9.327   3.207   1.00 0.00 ? 75  ALA B H    18 
ATOM 2946  H HA   . ALA B 1 75  ? 6.605   7.415   5.195   1.00 0.00 ? 75  ALA B HA   18 
ATOM 2947  H HB1  . ALA B 1 75  ? 4.618   9.273   4.734   1.00 0.00 ? 75  ALA B HB1  18 
ATOM 2948  H HB2  . ALA B 1 75  ? 3.737   7.750   4.611   1.00 0.00 ? 75  ALA B HB2  18 
ATOM 2949  H HB3  . ALA B 1 75  ? 4.636   8.133   6.080   1.00 0.00 ? 75  ALA B HB3  18 
ATOM 2950  N N    . PRO B 1 76  ? 4.883   5.339   4.589   1.00 0.00 ? 76  PRO B N    18 
ATOM 2951  C CA   . PRO B 1 76  ? 4.476   4.007   4.114   1.00 0.00 ? 76  PRO B CA   18 
ATOM 2952  C C    . PRO B 1 76  ? 3.219   4.129   3.258   1.00 0.00 ? 76  PRO B C    18 
ATOM 2953  O O    . PRO B 1 76  ? 2.888   5.198   2.784   1.00 0.00 ? 76  PRO B O    18 
ATOM 2954  C CB   . PRO B 1 76  ? 4.196   3.229   5.400   1.00 0.00 ? 76  PRO B CB   18 
ATOM 2955  C CG   . PRO B 1 76  ? 3.905   4.285   6.489   1.00 0.00 ? 76  PRO B CG   18 
ATOM 2956  C CD   . PRO B 1 76  ? 4.536   5.605   6.003   1.00 0.00 ? 76  PRO B CD   18 
ATOM 2957  H HA   . PRO B 1 76  ? 5.272   3.536   3.561   1.00 0.00 ? 76  PRO B HA   18 
ATOM 2958  H HB2  . PRO B 1 76  ? 3.338   2.583   5.264   1.00 0.00 ? 76  PRO B HB2  18 
ATOM 2959  H HB3  . PRO B 1 76  ? 5.060   2.648   5.680   1.00 0.00 ? 76  PRO B HB3  18 
ATOM 2960  H HG2  . PRO B 1 76  ? 2.836   4.404   6.604   1.00 0.00 ? 76  PRO B HG2  18 
ATOM 2961  H HG3  . PRO B 1 76  ? 4.349   3.988   7.424   1.00 0.00 ? 76  PRO B HG3  18 
ATOM 2962  H HD2  . PRO B 1 76  ? 3.815   6.406   6.079   1.00 0.00 ? 76  PRO B HD2  18 
ATOM 2963  H HD3  . PRO B 1 76  ? 5.424   5.834   6.570   1.00 0.00 ? 76  PRO B HD3  18 
ATOM 2964  N N    . CYS B 1 77  ? 2.516   3.054   3.045   1.00 0.00 ? 77  CYS B N    18 
ATOM 2965  C CA   . CYS B 1 77  ? 1.293   3.151   2.206   1.00 0.00 ? 77  CYS B CA   18 
ATOM 2966  C C    . CYS B 1 77  ? 0.211   2.192   2.708   1.00 0.00 ? 77  CYS B C    18 
ATOM 2967  O O    . CYS B 1 77  ? 0.175   1.031   2.343   1.00 0.00 ? 77  CYS B O    18 
ATOM 2968  C CB   . CYS B 1 77  ? 1.648   2.813   0.759   1.00 0.00 ? 77  CYS B CB   18 
ATOM 2969  S SG   . CYS B 1 77  ? 1.012   4.116   -0.319  1.00 0.00 ? 77  CYS B SG   18 
ATOM 2970  H H    . CYS B 1 77  ? 2.793   2.195   3.425   1.00 0.00 ? 77  CYS B H    18 
ATOM 2971  H HA   . CYS B 1 77  ? 0.917   4.161   2.248   1.00 0.00 ? 77  CYS B HA   18 
ATOM 2972  H HB2  . CYS B 1 77  ? 2.722   2.748   0.654   1.00 0.00 ? 77  CYS B HB2  18 
ATOM 2973  H HB3  . CYS B 1 77  ? 1.201   1.869   0.487   1.00 0.00 ? 77  CYS B HB3  18 
ATOM 2974  N N    . CYS B 1 78  ? -0.687  2.675   3.525   1.00 0.00 ? 78  CYS B N    18 
ATOM 2975  C CA   . CYS B 1 78  ? -1.783  1.798   4.026   1.00 0.00 ? 78  CYS B CA   18 
ATOM 2976  C C    . CYS B 1 78  ? -2.575  1.289   2.812   1.00 0.00 ? 78  CYS B C    18 
ATOM 2977  O O    . CYS B 1 78  ? -2.753  2.002   1.845   1.00 0.00 ? 78  CYS B O    18 
ATOM 2978  C CB   . CYS B 1 78  ? -2.690  2.610   4.960   1.00 0.00 ? 78  CYS B CB   18 
ATOM 2979  S SG   . CYS B 1 78  ? -4.103  1.606   5.484   1.00 0.00 ? 78  CYS B SG   18 
ATOM 2980  H H    . CYS B 1 78  ? -0.647  3.617   3.795   1.00 0.00 ? 78  CYS B H    18 
ATOM 2981  H HA   . CYS B 1 78  ? -1.358  0.966   4.558   1.00 0.00 ? 78  CYS B HA   18 
ATOM 2982  H HB2  . CYS B 1 78  ? -2.128  2.918   5.825   1.00 0.00 ? 78  CYS B HB2  18 
ATOM 2983  H HB3  . CYS B 1 78  ? -3.048  3.485   4.438   1.00 0.00 ? 78  CYS B HB3  18 
ATOM 2984  N N    . VAL B 1 79  ? -3.019  0.057   2.826   1.00 0.00 ? 79  VAL B N    18 
ATOM 2985  C CA   . VAL B 1 79  ? -3.750  -0.473  1.638   1.00 0.00 ? 79  VAL B CA   18 
ATOM 2986  C C    . VAL B 1 79  ? -4.908  -1.395  2.054   1.00 0.00 ? 79  VAL B C    18 
ATOM 2987  O O    . VAL B 1 79  ? -4.948  -1.876  3.163   1.00 0.00 ? 79  VAL B O    18 
ATOM 2988  C CB   . VAL B 1 79  ? -2.751  -1.250  0.779   1.00 0.00 ? 79  VAL B CB   18 
ATOM 2989  C CG1  . VAL B 1 79  ? -1.437  -0.478  0.734   1.00 0.00 ? 79  VAL B CG1  18 
ATOM 2990  C CG2  . VAL B 1 79  ? -2.493  -2.626  1.396   1.00 0.00 ? 79  VAL B CG2  18 
ATOM 2991  H H    . VAL B 1 79  ? -2.849  -0.520  3.591   1.00 0.00 ? 79  VAL B H    18 
ATOM 2992  H HA   . VAL B 1 79  ? -4.137  0.352   1.072   1.00 0.00 ? 79  VAL B HA   18 
ATOM 2993  H HB   . VAL B 1 79  ? -3.137  -1.364  -0.222  1.00 0.00 ? 79  VAL B HB   18 
ATOM 2994  H HG11 . VAL B 1 79  ? -1.641  0.581   0.785   1.00 0.00 ? 79  VAL B HG11 18 
ATOM 2995  H HG12 . VAL B 1 79  ? -0.824  -0.767  1.576   1.00 0.00 ? 79  VAL B HG12 18 
ATOM 2996  H HG13 . VAL B 1 79  ? -0.919  -0.705  -0.183  1.00 0.00 ? 79  VAL B HG13 18 
ATOM 2997  H HG21 . VAL B 1 79  ? -2.285  -2.514  2.451   1.00 0.00 ? 79  VAL B HG21 18 
ATOM 2998  H HG22 . VAL B 1 79  ? -3.364  -3.249  1.264   1.00 0.00 ? 79  VAL B HG22 18 
ATOM 2999  H HG23 . VAL B 1 79  ? -1.644  -3.084  0.910   1.00 0.00 ? 79  VAL B HG23 18 
ATOM 3000  N N    . PRO B 1 80  ? -5.815  -1.619  1.131   1.00 0.00 ? 80  PRO B N    18 
ATOM 3001  C CA   . PRO B 1 80  ? -6.990  -2.484  1.359   1.00 0.00 ? 80  PRO B CA   18 
ATOM 3002  C C    . PRO B 1 80  ? -6.588  -3.962  1.330   1.00 0.00 ? 80  PRO B C    18 
ATOM 3003  O O    . PRO B 1 80  ? -6.496  -4.571  0.282   1.00 0.00 ? 80  PRO B O    18 
ATOM 3004  C CB   . PRO B 1 80  ? -7.921  -2.146  0.191   1.00 0.00 ? 80  PRO B CB   18 
ATOM 3005  C CG   . PRO B 1 80  ? -7.029  -1.545  -0.919  1.00 0.00 ? 80  PRO B CG   18 
ATOM 3006  C CD   . PRO B 1 80  ? -5.750  -1.036  -0.227  1.00 0.00 ? 80  PRO B CD   18 
ATOM 3007  H HA   . PRO B 1 80  ? -7.471  -2.239  2.290   1.00 0.00 ? 80  PRO B HA   18 
ATOM 3008  H HB2  . PRO B 1 80  ? -8.406  -3.046  -0.167  1.00 0.00 ? 80  PRO B HB2  18 
ATOM 3009  H HB3  . PRO B 1 80  ? -8.660  -1.423  0.497   1.00 0.00 ? 80  PRO B HB3  18 
ATOM 3010  H HG2  . PRO B 1 80  ? -6.783  -2.305  -1.648  1.00 0.00 ? 80  PRO B HG2  18 
ATOM 3011  H HG3  . PRO B 1 80  ? -7.537  -0.722  -1.396  1.00 0.00 ? 80  PRO B HG3  18 
ATOM 3012  H HD2  . PRO B 1 80  ? -4.877  -1.390  -0.752  1.00 0.00 ? 80  PRO B HD2  18 
ATOM 3013  H HD3  . PRO B 1 80  ? -5.752  0.041   -0.171  1.00 0.00 ? 80  PRO B HD3  18 
ATOM 3014  N N    . GLN B 1 81  ? -6.355  -4.545  2.475   1.00 0.00 ? 81  GLN B N    18 
ATOM 3015  C CA   . GLN B 1 81  ? -5.966  -5.984  2.515   1.00 0.00 ? 81  GLN B CA   18 
ATOM 3016  C C    . GLN B 1 81  ? -7.126  -6.832  1.995   1.00 0.00 ? 81  GLN B C    18 
ATOM 3017  O O    . GLN B 1 81  ? -7.054  -7.417  0.932   1.00 0.00 ? 81  GLN B O    18 
ATOM 3018  C CB   . GLN B 1 81  ? -5.647  -6.386  3.957   1.00 0.00 ? 81  GLN B CB   18 
ATOM 3019  C CG   . GLN B 1 81  ? -4.743  -7.621  3.955   1.00 0.00 ? 81  GLN B CG   18 
ATOM 3020  C CD   . GLN B 1 81  ? -4.721  -8.240  5.354   1.00 0.00 ? 81  GLN B CD   18 
ATOM 3021  O OE1  . GLN B 1 81  ? -5.683  -8.851  5.776   1.00 0.00 ? 81  GLN B OE1  18 
ATOM 3022  N NE2  . GLN B 1 81  ? -3.656  -8.107  6.097   1.00 0.00 ? 81  GLN B NE2  18 
ATOM 3023  H H    . GLN B 1 81  ? -6.439  -4.037  3.309   1.00 0.00 ? 81  GLN B H    18 
ATOM 3024  H HA   . GLN B 1 81  ? -5.096  -6.141  1.894   1.00 0.00 ? 81  GLN B HA   18 
ATOM 3025  H HB2  . GLN B 1 81  ? -5.143  -5.571  4.455   1.00 0.00 ? 81  GLN B HB2  18 
ATOM 3026  H HB3  . GLN B 1 81  ? -6.564  -6.616  4.477   1.00 0.00 ? 81  GLN B HB3  18 
ATOM 3027  H HG2  . GLN B 1 81  ? -5.122  -8.343  3.247   1.00 0.00 ? 81  GLN B HG2  18 
ATOM 3028  H HG3  . GLN B 1 81  ? -3.741  -7.334  3.676   1.00 0.00 ? 81  GLN B HG3  18 
ATOM 3029  H HE21 . GLN B 1 81  ? -2.880  -7.615  5.756   1.00 0.00 ? 81  GLN B HE21 18 
ATOM 3030  H HE22 . GLN B 1 81  ? -3.633  -8.500  6.993   1.00 0.00 ? 81  GLN B HE22 18 
ATOM 3031  N N    . ALA B 1 82  ? -8.199  -6.901  2.736   1.00 0.00 ? 82  ALA B N    18 
ATOM 3032  C CA   . ALA B 1 82  ? -9.366  -7.706  2.283   1.00 0.00 ? 82  ALA B CA   18 
ATOM 3033  C C    . ALA B 1 82  ? -10.287 -6.824  1.440   1.00 0.00 ? 82  ALA B C    18 
ATOM 3034  O O    . ALA B 1 82  ? -10.280 -5.615  1.557   1.00 0.00 ? 82  ALA B O    18 
ATOM 3035  C CB   . ALA B 1 82  ? -10.131 -8.226  3.502   1.00 0.00 ? 82  ALA B CB   18 
ATOM 3036  H H    . ALA B 1 82  ? -8.237  -6.418  3.588   1.00 0.00 ? 82  ALA B H    18 
ATOM 3037  H HA   . ALA B 1 82  ? -9.021  -8.540  1.689   1.00 0.00 ? 82  ALA B HA   18 
ATOM 3038  H HB1  . ALA B 1 82  ? -9.725  -7.782  4.398   1.00 0.00 ? 82  ALA B HB1  18 
ATOM 3039  H HB2  . ALA B 1 82  ? -11.174 -7.963  3.410   1.00 0.00 ? 82  ALA B HB2  18 
ATOM 3040  H HB3  . ALA B 1 82  ? -10.034 -9.300  3.556   1.00 0.00 ? 82  ALA B HB3  18 
ATOM 3041  N N    . LEU B 1 83  ? -11.082 -7.415  0.592   1.00 0.00 ? 83  LEU B N    18 
ATOM 3042  C CA   . LEU B 1 83  ? -11.997 -6.602  -0.252  1.00 0.00 ? 83  LEU B CA   18 
ATOM 3043  C C    . LEU B 1 83  ? -13.367 -7.264  -0.314  1.00 0.00 ? 83  LEU B C    18 
ATOM 3044  O O    . LEU B 1 83  ? -13.666 -8.189  0.414   1.00 0.00 ? 83  LEU B O    18 
ATOM 3045  C CB   . LEU B 1 83  ? -11.433 -6.494  -1.670  1.00 0.00 ? 83  LEU B CB   18 
ATOM 3046  C CG   . LEU B 1 83  ? -10.110 -5.739  -1.626  1.00 0.00 ? 83  LEU B CG   18 
ATOM 3047  C CD1  . LEU B 1 83  ? -9.198  -6.229  -2.753  1.00 0.00 ? 83  LEU B CD1  18 
ATOM 3048  C CD2  . LEU B 1 83  ? -10.374 -4.244  -1.797  1.00 0.00 ? 83  LEU B CD2  18 
ATOM 3049  H H    . LEU B 1 83  ? -11.076 -8.391  0.510   1.00 0.00 ? 83  LEU B H    18 
ATOM 3050  H HA   . LEU B 1 83  ? -12.095 -5.613  0.168   1.00 0.00 ? 83  LEU B HA   18 
ATOM 3051  H HB2  . LEU B 1 83  ? -11.275 -7.483  -2.074  1.00 0.00 ? 83  LEU B HB2  18 
ATOM 3052  H HB3  . LEU B 1 83  ? -12.130 -5.957  -2.296  1.00 0.00 ? 83  LEU B HB3  18 
ATOM 3053  H HG   . LEU B 1 83  ? -9.637  -5.915  -0.675  1.00 0.00 ? 83  LEU B HG   18 
ATOM 3054  H HD11 . LEU B 1 83  ? -9.314  -7.296  -2.872  1.00 0.00 ? 83  LEU B HD11 18 
ATOM 3055  H HD12 . LEU B 1 83  ? -9.465  -5.731  -3.674  1.00 0.00 ? 83  LEU B HD12 18 
ATOM 3056  H HD13 . LEU B 1 83  ? -8.170  -6.003  -2.507  1.00 0.00 ? 83  LEU B HD13 18 
ATOM 3057  H HD21 . LEU B 1 83  ? -11.138 -4.097  -2.547  1.00 0.00 ? 83  LEU B HD21 18 
ATOM 3058  H HD22 . LEU B 1 83  ? -10.708 -3.829  -0.858  1.00 0.00 ? 83  LEU B HD22 18 
ATOM 3059  H HD23 . LEU B 1 83  ? -9.465  -3.751  -2.107  1.00 0.00 ? 83  LEU B HD23 18 
ATOM 3060  N N    . GLU B 1 84  ? -14.193 -6.790  -1.192  1.00 0.00 ? 84  GLU B N    18 
ATOM 3061  C CA   . GLU B 1 84  ? -15.553 -7.369  -1.342  1.00 0.00 ? 84  GLU B CA   18 
ATOM 3062  C C    . GLU B 1 84  ? -15.981 -7.218  -2.800  1.00 0.00 ? 84  GLU B C    18 
ATOM 3063  O O    . GLU B 1 84  ? -15.486 -6.355  -3.496  1.00 0.00 ? 84  GLU B O    18 
ATOM 3064  C CB   . GLU B 1 84  ? -16.536 -6.624  -0.433  1.00 0.00 ? 84  GLU B CB   18 
ATOM 3065  C CG   . GLU B 1 84  ? -16.777 -7.440  0.839   1.00 0.00 ? 84  GLU B CG   18 
ATOM 3066  C CD   . GLU B 1 84  ? -17.978 -6.869  1.595   1.00 0.00 ? 84  GLU B CD   18 
ATOM 3067  O OE1  . GLU B 1 84  ? -18.942 -6.502  0.944   1.00 0.00 ? 84  GLU B OE1  18 
ATOM 3068  O OE2  . GLU B 1 84  ? -17.913 -6.808  2.811   1.00 0.00 ? 84  GLU B OE2  18 
ATOM 3069  H H    . GLU B 1 84  ? -13.911 -6.048  -1.765  1.00 0.00 ? 84  GLU B H    18 
ATOM 3070  H HA   . GLU B 1 84  ? -15.534 -8.416  -1.077  1.00 0.00 ? 84  GLU B HA   18 
ATOM 3071  H HB2  . GLU B 1 84  ? -16.123 -5.661  -0.171  1.00 0.00 ? 84  GLU B HB2  18 
ATOM 3072  H HB3  . GLU B 1 84  ? -17.472 -6.485  -0.952  1.00 0.00 ? 84  GLU B HB3  18 
ATOM 3073  H HG2  . GLU B 1 84  ? -16.974 -8.470  0.574   1.00 0.00 ? 84  GLU B HG2  18 
ATOM 3074  H HG3  . GLU B 1 84  ? -15.901 -7.392  1.469   1.00 0.00 ? 84  GLU B HG3  18 
ATOM 3075  N N    . PRO B 1 85  ? -16.879 -8.062  -3.225  1.00 0.00 ? 85  PRO B N    18 
ATOM 3076  C CA   . PRO B 1 85  ? -17.382 -8.047  -4.607  1.00 0.00 ? 85  PRO B CA   18 
ATOM 3077  C C    . PRO B 1 85  ? -18.330 -6.865  -4.825  1.00 0.00 ? 85  PRO B C    18 
ATOM 3078  O O    . PRO B 1 85  ? -18.332 -5.913  -4.070  1.00 0.00 ? 85  PRO B O    18 
ATOM 3079  C CB   . PRO B 1 85  ? -18.104 -9.389  -4.744  1.00 0.00 ? 85  PRO B CB   18 
ATOM 3080  C CG   . PRO B 1 85  ? -18.447 -9.847  -3.308  1.00 0.00 ? 85  PRO B CG   18 
ATOM 3081  C CD   . PRO B 1 85  ? -17.485 -9.099  -2.367  1.00 0.00 ? 85  PRO B CD   18 
ATOM 3082  H HA   . PRO B 1 85  ? -16.561 -8.003  -5.304  1.00 0.00 ? 85  PRO B HA   18 
ATOM 3083  H HB2  . PRO B 1 85  ? -19.008 -9.266  -5.325  1.00 0.00 ? 85  PRO B HB2  18 
ATOM 3084  H HB3  . PRO B 1 85  ? -17.456 -10.114 -5.211  1.00 0.00 ? 85  PRO B HB3  18 
ATOM 3085  H HG2  . PRO B 1 85  ? -19.470 -9.593  -3.074  1.00 0.00 ? 85  PRO B HG2  18 
ATOM 3086  H HG3  . PRO B 1 85  ? -18.293 -10.910 -3.213  1.00 0.00 ? 85  PRO B HG3  18 
ATOM 3087  H HD2  . PRO B 1 85  ? -18.030 -8.649  -1.549  1.00 0.00 ? 85  PRO B HD2  18 
ATOM 3088  H HD3  . PRO B 1 85  ? -16.723 -9.766  -1.995  1.00 0.00 ? 85  PRO B HD3  18 
ATOM 3089  N N    . LEU B 1 86  ? -19.118 -6.904  -5.864  1.00 0.00 ? 86  LEU B N    18 
ATOM 3090  C CA   . LEU B 1 86  ? -20.039 -5.768  -6.140  1.00 0.00 ? 86  LEU B CA   18 
ATOM 3091  C C    . LEU B 1 86  ? -21.102 -6.219  -7.153  1.00 0.00 ? 86  LEU B C    18 
ATOM 3092  O O    . LEU B 1 86  ? -20.801 -6.406  -8.311  1.00 0.00 ? 86  LEU B O    18 
ATOM 3093  C CB   . LEU B 1 86  ? -19.191 -4.601  -6.700  1.00 0.00 ? 86  LEU B CB   18 
ATOM 3094  C CG   . LEU B 1 86  ? -19.983 -3.726  -7.689  1.00 0.00 ? 86  LEU B CG   18 
ATOM 3095  C CD1  . LEU B 1 86  ? -20.674 -2.584  -6.950  1.00 0.00 ? 86  LEU B CD1  18 
ATOM 3096  C CD2  . LEU B 1 86  ? -19.018 -3.135  -8.717  1.00 0.00 ? 86  LEU B CD2  18 
ATOM 3097  H H    . LEU B 1 86  ? -19.090 -7.673  -6.474  1.00 0.00 ? 86  LEU B H    18 
ATOM 3098  H HA   . LEU B 1 86  ? -20.512 -5.457  -5.223  1.00 0.00 ? 86  LEU B HA   18 
ATOM 3099  H HB2  . LEU B 1 86  ? -18.859 -3.985  -5.879  1.00 0.00 ? 86  LEU B HB2  18 
ATOM 3100  H HB3  . LEU B 1 86  ? -18.327 -5.007  -7.203  1.00 0.00 ? 86  LEU B HB3  18 
ATOM 3101  H HG   . LEU B 1 86  ? -20.721 -4.318  -8.193  1.00 0.00 ? 86  LEU B HG   18 
ATOM 3102  H HD11 . LEU B 1 86  ? -20.307 -2.534  -5.937  1.00 0.00 ? 86  LEU B HD11 18 
ATOM 3103  H HD12 . LEU B 1 86  ? -20.461 -1.652  -7.457  1.00 0.00 ? 86  LEU B HD12 18 
ATOM 3104  H HD13 . LEU B 1 86  ? -21.739 -2.753  -6.942  1.00 0.00 ? 86  LEU B HD13 18 
ATOM 3105  H HD21 . LEU B 1 86  ? -18.289 -3.879  -8.998  1.00 0.00 ? 86  LEU B HD21 18 
ATOM 3106  H HD22 . LEU B 1 86  ? -19.570 -2.825  -9.592  1.00 0.00 ? 86  LEU B HD22 18 
ATOM 3107  H HD23 . LEU B 1 86  ? -18.515 -2.280  -8.290  1.00 0.00 ? 86  LEU B HD23 18 
ATOM 3108  N N    . PRO B 1 87  ? -22.320 -6.369  -6.691  1.00 0.00 ? 87  PRO B N    18 
ATOM 3109  C CA   . PRO B 1 87  ? -23.443 -6.784  -7.552  1.00 0.00 ? 87  PRO B CA   18 
ATOM 3110  C C    . PRO B 1 87  ? -23.871 -5.611  -8.433  1.00 0.00 ? 87  PRO B C    18 
ATOM 3111  O O    . PRO B 1 87  ? -24.459 -4.654  -7.971  1.00 0.00 ? 87  PRO B O    18 
ATOM 3112  C CB   . PRO B 1 87  ? -24.541 -7.167  -6.555  1.00 0.00 ? 87  PRO B CB   18 
ATOM 3113  C CG   . PRO B 1 87  ? -24.202 -6.440  -5.234  1.00 0.00 ? 87  PRO B CG   18 
ATOM 3114  C CD   . PRO B 1 87  ? -22.694 -6.129  -5.281  1.00 0.00 ? 87  PRO B CD   18 
ATOM 3115  H HA   . PRO B 1 87  ? -23.173 -7.637  -8.153  1.00 0.00 ? 87  PRO B HA   18 
ATOM 3116  H HB2  . PRO B 1 87  ? -25.506 -6.845  -6.925  1.00 0.00 ? 87  PRO B HB2  18 
ATOM 3117  H HB3  . PRO B 1 87  ? -24.540 -8.234  -6.393  1.00 0.00 ? 87  PRO B HB3  18 
ATOM 3118  H HG2  . PRO B 1 87  ? -24.771 -5.523  -5.160  1.00 0.00 ? 87  PRO B HG2  18 
ATOM 3119  H HG3  . PRO B 1 87  ? -24.416 -7.079  -4.391  1.00 0.00 ? 87  PRO B HG3  18 
ATOM 3120  H HD2  . PRO B 1 87  ? -22.512 -5.099  -5.008  1.00 0.00 ? 87  PRO B HD2  18 
ATOM 3121  H HD3  . PRO B 1 87  ? -22.149 -6.797  -4.634  1.00 0.00 ? 87  PRO B HD3  18 
ATOM 3122  N N    . ILE B 1 88  ? -23.555 -5.666  -9.698  1.00 0.00 ? 88  ILE B N    18 
ATOM 3123  C CA   . ILE B 1 88  ? -23.917 -4.541  -10.601 1.00 0.00 ? 88  ILE B CA   18 
ATOM 3124  C C    . ILE B 1 88  ? -24.900 -5.001  -11.670 1.00 0.00 ? 88  ILE B C    18 
ATOM 3125  O O    . ILE B 1 88  ? -25.527 -6.037  -11.570 1.00 0.00 ? 88  ILE B O    18 
ATOM 3126  C CB   . ILE B 1 88  ? -22.654 -4.028  -11.299 1.00 0.00 ? 88  ILE B CB   18 
ATOM 3127  C CG1  . ILE B 1 88  ? -22.276 -4.977  -12.442 1.00 0.00 ? 88  ILE B CG1  18 
ATOM 3128  C CG2  . ILE B 1 88  ? -21.507 -3.976  -10.299 1.00 0.00 ? 88  ILE B CG2  18 
ATOM 3129  C CD1  . ILE B 1 88  ? -20.881 -4.635  -12.953 1.00 0.00 ? 88  ILE B CD1  18 
ATOM 3130  H H    . ILE B 1 88  ? -23.062 -6.439  -10.047 1.00 0.00 ? 88  ILE B H    18 
ATOM 3131  H HA   . ILE B 1 88  ? -24.356 -3.743  -10.027 1.00 0.00 ? 88  ILE B HA   18 
ATOM 3132  H HB   . ILE B 1 88  ? -22.836 -3.039  -11.693 1.00 0.00 ? 88  ILE B HB   18 
ATOM 3133  H HG12 . ILE B 1 88  ? -22.294 -5.990  -12.083 1.00 0.00 ? 88  ILE B HG12 18 
ATOM 3134  H HG13 . ILE B 1 88  ? -22.981 -4.873  -13.243 1.00 0.00 ? 88  ILE B HG13 18 
ATOM 3135  H HG21 . ILE B 1 88  ? -21.414 -4.936  -9.812  1.00 0.00 ? 88  ILE B HG21 18 
ATOM 3136  H HG22 . ILE B 1 88  ? -20.591 -3.746  -10.818 1.00 0.00 ? 88  ILE B HG22 18 
ATOM 3137  H HG23 . ILE B 1 88  ? -21.706 -3.214  -9.561  1.00 0.00 ? 88  ILE B HG23 18 
ATOM 3138  H HD11 . ILE B 1 88  ? -20.737 -3.569  -12.902 1.00 0.00 ? 88  ILE B HD11 18 
ATOM 3139  H HD12 . ILE B 1 88  ? -20.143 -5.129  -12.339 1.00 0.00 ? 88  ILE B HD12 18 
ATOM 3140  H HD13 . ILE B 1 88  ? -20.783 -4.967  -13.975 1.00 0.00 ? 88  ILE B HD13 18 
ATOM 3141  N N    . VAL B 1 89  ? -24.992 -4.224  -12.710 1.00 0.00 ? 89  VAL B N    18 
ATOM 3142  C CA   . VAL B 1 89  ? -25.886 -4.554  -13.848 1.00 0.00 ? 89  VAL B CA   18 
ATOM 3143  C C    . VAL B 1 89  ? -25.476 -3.692  -15.039 1.00 0.00 ? 89  VAL B C    18 
ATOM 3144  O O    . VAL B 1 89  ? -25.648 -2.489  -15.028 1.00 0.00 ? 89  VAL B O    18 
ATOM 3145  C CB   . VAL B 1 89  ? -27.343 -4.239  -13.502 1.00 0.00 ? 89  VAL B CB   18 
ATOM 3146  C CG1  . VAL B 1 89  ? -28.248 -4.821  -14.585 1.00 0.00 ? 89  VAL B CG1  18 
ATOM 3147  C CG2  . VAL B 1 89  ? -27.710 -4.848  -12.148 1.00 0.00 ? 89  VAL B CG2  18 
ATOM 3148  H H    . VAL B 1 89  ? -24.441 -3.419  -12.751 1.00 0.00 ? 89  VAL B H    18 
ATOM 3149  H HA   . VAL B 1 89  ? -25.778 -5.596  -14.099 1.00 0.00 ? 89  VAL B HA   18 
ATOM 3150  H HB   . VAL B 1 89  ? -27.476 -3.167  -13.464 1.00 0.00 ? 89  VAL B HB   18 
ATOM 3151  H HG11 . VAL B 1 89  ? -27.656 -5.419  -15.263 1.00 0.00 ? 89  VAL B HG11 18 
ATOM 3152  H HG12 . VAL B 1 89  ? -29.006 -5.438  -14.128 1.00 0.00 ? 89  VAL B HG12 18 
ATOM 3153  H HG13 . VAL B 1 89  ? -28.717 -4.016  -15.132 1.00 0.00 ? 89  VAL B HG13 18 
ATOM 3154  H HG21 . VAL B 1 89  ? -27.506 -5.906  -12.162 1.00 0.00 ? 89  VAL B HG21 18 
ATOM 3155  H HG22 . VAL B 1 89  ? -27.125 -4.378  -11.371 1.00 0.00 ? 89  VAL B HG22 18 
ATOM 3156  H HG23 . VAL B 1 89  ? -28.760 -4.686  -11.954 1.00 0.00 ? 89  VAL B HG23 18 
ATOM 3157  N N    . TYR B 1 90  ? -24.936 -4.281  -16.064 1.00 0.00 ? 90  TYR B N    18 
ATOM 3158  C CA   . TYR B 1 90  ? -24.522 -3.471  -17.237 1.00 0.00 ? 90  TYR B CA   18 
ATOM 3159  C C    . TYR B 1 90  ? -25.269 -3.948  -18.481 1.00 0.00 ? 90  TYR B C    18 
ATOM 3160  O O    . TYR B 1 90  ? -26.196 -4.725  -18.397 1.00 0.00 ? 90  TYR B O    18 
ATOM 3161  C CB   . TYR B 1 90  ? -23.016 -3.601  -17.449 1.00 0.00 ? 90  TYR B CB   18 
ATOM 3162  C CG   . TYR B 1 90  ? -22.557 -5.002  -17.121 1.00 0.00 ? 90  TYR B CG   18 
ATOM 3163  C CD1  . TYR B 1 90  ? -22.385 -5.380  -15.787 1.00 0.00 ? 90  TYR B CD1  18 
ATOM 3164  C CD2  . TYR B 1 90  ? -22.290 -5.914  -18.148 1.00 0.00 ? 90  TYR B CD2  18 
ATOM 3165  C CE1  . TYR B 1 90  ? -21.945 -6.673  -15.474 1.00 0.00 ? 90  TYR B CE1  18 
ATOM 3166  C CE2  . TYR B 1 90  ? -21.851 -7.207  -17.836 1.00 0.00 ? 90  TYR B CE2  18 
ATOM 3167  C CZ   . TYR B 1 90  ? -21.677 -7.585  -16.500 1.00 0.00 ? 90  TYR B CZ   18 
ATOM 3168  O OH   . TYR B 1 90  ? -21.243 -8.859  -16.194 1.00 0.00 ? 90  TYR B OH   18 
ATOM 3169  H H    . TYR B 1 90  ? -24.804 -5.250  -16.062 1.00 0.00 ? 90  TYR B H    18 
ATOM 3170  H HA   . TYR B 1 90  ? -24.764 -2.433  -17.051 1.00 0.00 ? 90  TYR B HA   18 
ATOM 3171  H HB2  . TYR B 1 90  ? -22.773 -3.375  -18.476 1.00 0.00 ? 90  TYR B HB2  18 
ATOM 3172  H HB3  . TYR B 1 90  ? -22.512 -2.907  -16.800 1.00 0.00 ? 90  TYR B HB3  18 
ATOM 3173  H HD1  . TYR B 1 90  ? -22.591 -4.674  -14.999 1.00 0.00 ? 90  TYR B HD1  18 
ATOM 3174  H HD2  . TYR B 1 90  ? -22.426 -5.622  -19.179 1.00 0.00 ? 90  TYR B HD2  18 
ATOM 3175  H HE1  . TYR B 1 90  ? -21.811 -6.965  -14.442 1.00 0.00 ? 90  TYR B HE1  18 
ATOM 3176  H HE2  . TYR B 1 90  ? -21.641 -7.909  -18.627 1.00 0.00 ? 90  TYR B HE2  18 
ATOM 3177  H HH   . TYR B 1 90  ? -21.863 -9.484  -16.577 1.00 0.00 ? 90  TYR B HH   18 
ATOM 3178  N N    . TYR B 1 91  ? -24.887 -3.474  -19.634 1.00 0.00 ? 91  TYR B N    18 
ATOM 3179  C CA   . TYR B 1 91  ? -25.595 -3.893  -20.872 1.00 0.00 ? 91  TYR B CA   18 
ATOM 3180  C C    . TYR B 1 91  ? -24.598 -4.321  -21.947 1.00 0.00 ? 91  TYR B C    18 
ATOM 3181  O O    . TYR B 1 91  ? -23.637 -3.635  -22.233 1.00 0.00 ? 91  TYR B O    18 
ATOM 3182  C CB   . TYR B 1 91  ? -26.407 -2.717  -21.404 1.00 0.00 ? 91  TYR B CB   18 
ATOM 3183  C CG   . TYR B 1 91  ? -27.807 -2.791  -20.862 1.00 0.00 ? 91  TYR B CG   18 
ATOM 3184  C CD1  . TYR B 1 91  ? -28.102 -2.225  -19.620 1.00 0.00 ? 91  TYR B CD1  18 
ATOM 3185  C CD2  . TYR B 1 91  ? -28.811 -3.414  -21.609 1.00 0.00 ? 91  TYR B CD2  18 
ATOM 3186  C CE1  . TYR B 1 91  ? -29.408 -2.284  -19.119 1.00 0.00 ? 91  TYR B CE1  18 
ATOM 3187  C CE2  . TYR B 1 91  ? -30.117 -3.472  -21.115 1.00 0.00 ? 91  TYR B CE2  18 
ATOM 3188  C CZ   . TYR B 1 91  ? -30.417 -2.907  -19.868 1.00 0.00 ? 91  TYR B CZ   18 
ATOM 3189  O OH   . TYR B 1 91  ? -31.707 -2.962  -19.378 1.00 0.00 ? 91  TYR B OH   18 
ATOM 3190  H H    . TYR B 1 91  ? -24.152 -2.836  -19.682 1.00 0.00 ? 91  TYR B H    18 
ATOM 3191  H HA   . TYR B 1 91  ? -26.259 -4.713  -20.649 1.00 0.00 ? 91  TYR B HA   18 
ATOM 3192  H HB2  . TYR B 1 91  ? -25.947 -1.792  -21.091 1.00 0.00 ? 91  TYR B HB2  18 
ATOM 3193  H HB3  . TYR B 1 91  ? -26.436 -2.759  -22.483 1.00 0.00 ? 91  TYR B HB3  18 
ATOM 3194  H HD1  . TYR B 1 91  ? -27.317 -1.750  -19.047 1.00 0.00 ? 91  TYR B HD1  18 
ATOM 3195  H HD2  . TYR B 1 91  ? -28.578 -3.853  -22.564 1.00 0.00 ? 91  TYR B HD2  18 
ATOM 3196  H HE1  . TYR B 1 91  ? -29.639 -1.848  -18.159 1.00 0.00 ? 91  TYR B HE1  18 
ATOM 3197  H HE2  . TYR B 1 91  ? -30.890 -3.951  -21.697 1.00 0.00 ? 91  TYR B HE2  18 
ATOM 3198  H HH   . TYR B 1 91  ? -32.152 -3.700  -19.800 1.00 0.00 ? 91  TYR B HH   18 
ATOM 3199  N N    . VAL B 1 92  ? -24.848 -5.437  -22.568 1.00 0.00 ? 92  VAL B N    18 
ATOM 3200  C CA   . VAL B 1 92  ? -23.952 -5.908  -23.656 1.00 0.00 ? 92  VAL B CA   18 
ATOM 3201  C C    . VAL B 1 92  ? -24.701 -5.746  -24.972 1.00 0.00 ? 92  VAL B C    18 
ATOM 3202  O O    . VAL B 1 92  ? -25.471 -6.597  -25.369 1.00 0.00 ? 92  VAL B O    18 
ATOM 3203  C CB   . VAL B 1 92  ? -23.602 -7.380  -23.456 1.00 0.00 ? 92  VAL B CB   18 
ATOM 3204  C CG1  . VAL B 1 92  ? -22.208 -7.639  -24.024 1.00 0.00 ? 92  VAL B CG1  18 
ATOM 3205  C CG2  . VAL B 1 92  ? -23.627 -7.717  -21.966 1.00 0.00 ? 92  VAL B CG2  18 
ATOM 3206  H H    . VAL B 1 92  ? -25.644 -5.954  -22.334 1.00 0.00 ? 92  VAL B H    18 
ATOM 3207  H HA   . VAL B 1 92  ? -23.050 -5.313  -23.672 1.00 0.00 ? 92  VAL B HA   18 
ATOM 3208  H HB   . VAL B 1 92  ? -24.322 -7.994  -23.980 1.00 0.00 ? 92  VAL B HB   18 
ATOM 3209  H HG11 . VAL B 1 92  ? -21.695 -6.698  -24.156 1.00 0.00 ? 92  VAL B HG11 18 
ATOM 3210  H HG12 . VAL B 1 92  ? -21.651 -8.260  -23.339 1.00 0.00 ? 92  VAL B HG12 18 
ATOM 3211  H HG13 . VAL B 1 92  ? -22.295 -8.140  -24.976 1.00 0.00 ? 92  VAL B HG13 18 
ATOM 3212  H HG21 . VAL B 1 92  ? -24.606 -7.492  -21.564 1.00 0.00 ? 92  VAL B HG21 18 
ATOM 3213  H HG22 . VAL B 1 92  ? -23.417 -8.768  -21.831 1.00 0.00 ? 92  VAL B HG22 18 
ATOM 3214  H HG23 . VAL B 1 92  ? -22.883 -7.130  -21.451 1.00 0.00 ? 92  VAL B HG23 18 
ATOM 3215  N N    . GLY B 1 93  ? -24.505 -4.649  -25.640 1.00 0.00 ? 93  GLY B N    18 
ATOM 3216  C CA   . GLY B 1 93  ? -25.232 -4.421  -26.915 1.00 0.00 ? 93  GLY B CA   18 
ATOM 3217  C C    . GLY B 1 93  ? -26.672 -4.009  -26.589 1.00 0.00 ? 93  GLY B C    18 
ATOM 3218  O O    . GLY B 1 93  ? -27.017 -2.844  -26.625 1.00 0.00 ? 93  GLY B O    18 
ATOM 3219  H H    . GLY B 1 93  ? -23.891 -3.969  -25.292 1.00 0.00 ? 93  GLY B H    18 
ATOM 3220  H HA2  . GLY B 1 93  ? -24.745 -3.635  -27.475 1.00 0.00 ? 93  GLY B HA2  18 
ATOM 3221  H HA3  . GLY B 1 93  ? -25.244 -5.329  -27.496 1.00 0.00 ? 93  GLY B HA3  18 
ATOM 3222  N N    . ARG B 1 94  ? -27.515 -4.957  -26.277 1.00 0.00 ? 94  ARG B N    18 
ATOM 3223  C CA   . ARG B 1 94  ? -28.935 -4.619  -25.955 1.00 0.00 ? 94  ARG B CA   18 
ATOM 3224  C C    . ARG B 1 94  ? -29.481 -5.532  -24.850 1.00 0.00 ? 94  ARG B C    18 
ATOM 3225  O O    . ARG B 1 94  ? -30.604 -5.376  -24.411 1.00 0.00 ? 94  ARG B O    18 
ATOM 3226  C CB   . ARG B 1 94  ? -29.777 -4.814  -27.207 1.00 0.00 ? 94  ARG B CB   18 
ATOM 3227  C CG   . ARG B 1 94  ? -29.178 -4.007  -28.361 1.00 0.00 ? 94  ARG B CG   18 
ATOM 3228  C CD   . ARG B 1 94  ? -30.092 -4.104  -29.583 1.00 0.00 ? 94  ARG B CD   18 
ATOM 3229  N NE   . ARG B 1 94  ? -30.260 -2.752  -30.186 1.00 0.00 ? 94  ARG B NE   18 
ATOM 3230  C CZ   . ARG B 1 94  ? -29.212 -2.028  -30.472 1.00 0.00 ? 94  ARG B CZ   18 
ATOM 3231  N NH1  . ARG B 1 94  ? -28.128 -2.598  -30.927 1.00 0.00 ? 94  ARG B NH1  18 
ATOM 3232  N NH2  . ARG B 1 94  ? -29.247 -0.736  -30.301 1.00 0.00 ? 94  ARG B NH2  18 
ATOM 3233  H H    . ARG B 1 94  ? -27.219 -5.887  -26.268 1.00 0.00 ? 94  ARG B H    18 
ATOM 3234  H HA   . ARG B 1 94  ? -29.000 -3.593  -25.632 1.00 0.00 ? 94  ARG B HA   18 
ATOM 3235  H HB2  . ARG B 1 94  ? -29.781 -5.864  -27.463 1.00 0.00 ? 94  ARG B HB2  18 
ATOM 3236  H HB3  . ARG B 1 94  ? -30.788 -4.483  -27.022 1.00 0.00 ? 94  ARG B HB3  18 
ATOM 3237  H HG2  . ARG B 1 94  ? -29.081 -2.973  -28.063 1.00 0.00 ? 94  ARG B HG2  18 
ATOM 3238  H HG3  . ARG B 1 94  ? -28.205 -4.403  -28.609 1.00 0.00 ? 94  ARG B HG3  18 
ATOM 3239  H HD2  . ARG B 1 94  ? -29.652 -4.771  -30.309 1.00 0.00 ? 94  ARG B HD2  18 
ATOM 3240  H HD3  . ARG B 1 94  ? -31.056 -4.486  -29.282 1.00 0.00 ? 94  ARG B HD3  18 
ATOM 3241  H HE   . ARG B 1 94  ? -31.158 -2.406  -30.368 1.00 0.00 ? 94  ARG B HE   18 
ATOM 3242  H HH11 . ARG B 1 94  ? -28.101 -3.589  -31.057 1.00 0.00 ? 94  ARG B HH11 18 
ATOM 3243  H HH12 . ARG B 1 94  ? -27.326 -2.042  -31.146 1.00 0.00 ? 94  ARG B HH12 18 
ATOM 3244  H HH21 . ARG B 1 94  ? -30.076 -0.300  -29.952 1.00 0.00 ? 94  ARG B HH21 18 
ATOM 3245  H HH22 . ARG B 1 94  ? -28.443 -0.180  -30.520 1.00 0.00 ? 94  ARG B HH22 18 
ATOM 3246  N N    . LYS B 1 95  ? -28.717 -6.486  -24.402 1.00 0.00 ? 95  LYS B N    18 
ATOM 3247  C CA   . LYS B 1 95  ? -29.221 -7.399  -23.338 1.00 0.00 ? 95  LYS B CA   18 
ATOM 3248  C C    . LYS B 1 95  ? -28.703 -6.934  -21.972 1.00 0.00 ? 95  LYS B C    18 
ATOM 3249  O O    . LYS B 1 95  ? -27.533 -6.653  -21.823 1.00 0.00 ? 95  LYS B O    18 
ATOM 3250  C CB   . LYS B 1 95  ? -28.711 -8.814  -23.611 1.00 0.00 ? 95  LYS B CB   18 
ATOM 3251  C CG   . LYS B 1 95  ? -29.862 -9.690  -24.112 1.00 0.00 ? 95  LYS B CG   18 
ATOM 3252  C CD   . LYS B 1 95  ? -30.091 -9.443  -25.605 1.00 0.00 ? 95  LYS B CD   18 
ATOM 3253  C CE   . LYS B 1 95  ? -28.774 -9.607  -26.366 1.00 0.00 ? 95  LYS B CE   18 
ATOM 3254  N NZ   . LYS B 1 95  ? -29.054 -10.106 -27.743 1.00 0.00 ? 95  LYS B NZ   18 
ATOM 3255  H H    . LYS B 1 95  ? -27.821 -6.608  -24.764 1.00 0.00 ? 95  LYS B H    18 
ATOM 3256  H HA   . LYS B 1 95  ? -30.298 -7.396  -23.346 1.00 0.00 ? 95  LYS B HA   18 
ATOM 3257  H HB2  . LYS B 1 95  ? -27.932 -8.778  -24.358 1.00 0.00 ? 95  LYS B HB2  18 
ATOM 3258  H HB3  . LYS B 1 95  ? -28.314 -9.235  -22.699 1.00 0.00 ? 95  LYS B HB3  18 
ATOM 3259  H HG2  . LYS B 1 95  ? -29.616 -10.730 -23.953 1.00 0.00 ? 95  LYS B HG2  18 
ATOM 3260  H HG3  . LYS B 1 95  ? -30.761 -9.445  -23.568 1.00 0.00 ? 95  LYS B HG3  18 
ATOM 3261  H HD2  . LYS B 1 95  ? -30.814 -10.153 -25.980 1.00 0.00 ? 95  LYS B HD2  18 
ATOM 3262  H HD3  . LYS B 1 95  ? -30.465 -8.441  -25.751 1.00 0.00 ? 95  LYS B HD3  18 
ATOM 3263  H HE2  . LYS B 1 95  ? -28.270 -8.653  -26.424 1.00 0.00 ? 95  LYS B HE2  18 
ATOM 3264  H HE3  . LYS B 1 95  ? -28.144 -10.315 -25.848 1.00 0.00 ? 95  LYS B HE3  18 
ATOM 3265  H HZ1  . LYS B 1 95  ? -30.077 -10.062 -27.927 1.00 0.00 ? 95  LYS B HZ1  18 
ATOM 3266  H HZ2  . LYS B 1 95  ? -28.551 -9.514  -28.435 1.00 0.00 ? 95  LYS B HZ2  18 
ATOM 3267  H HZ3  . LYS B 1 95  ? -28.727 -11.088 -27.830 1.00 0.00 ? 95  LYS B HZ3  18 
ATOM 3268  N N    . PRO B 1 96  ? -29.588 -6.877  -21.007 1.00 0.00 ? 96  PRO B N    18 
ATOM 3269  C CA   . PRO B 1 96  ? -29.231 -6.464  -19.640 1.00 0.00 ? 96  PRO B CA   18 
ATOM 3270  C C    . PRO B 1 96  ? -28.546 -7.628  -18.912 1.00 0.00 ? 96  PRO B C    18 
ATOM 3271  O O    . PRO B 1 96  ? -28.899 -8.774  -19.098 1.00 0.00 ? 96  PRO B O    18 
ATOM 3272  C CB   . PRO B 1 96  ? -30.583 -6.134  -19.001 1.00 0.00 ? 96  PRO B CB   18 
ATOM 3273  C CG   . PRO B 1 96  ? -31.649 -6.903  -19.817 1.00 0.00 ? 96  PRO B CG   18 
ATOM 3274  C CD   . PRO B 1 96  ? -31.013 -7.219  -21.184 1.00 0.00 ? 96  PRO B CD   18 
ATOM 3275  H HA   . PRO B 1 96  ? -28.601 -5.587  -19.659 1.00 0.00 ? 96  PRO B HA   18 
ATOM 3276  H HB2  . PRO B 1 96  ? -30.594 -6.459  -17.969 1.00 0.00 ? 96  PRO B HB2  18 
ATOM 3277  H HB3  . PRO B 1 96  ? -30.776 -5.074  -19.060 1.00 0.00 ? 96  PRO B HB3  18 
ATOM 3278  H HG2  . PRO B 1 96  ? -31.914 -7.821  -19.307 1.00 0.00 ? 96  PRO B HG2  18 
ATOM 3279  H HG3  . PRO B 1 96  ? -32.526 -6.290  -19.956 1.00 0.00 ? 96  PRO B HG3  18 
ATOM 3280  H HD2  . PRO B 1 96  ? -31.129 -8.268  -21.421 1.00 0.00 ? 96  PRO B HD2  18 
ATOM 3281  H HD3  . PRO B 1 96  ? -31.450 -6.605  -21.956 1.00 0.00 ? 96  PRO B HD3  18 
ATOM 3282  N N    . LYS B 1 97  ? -27.568 -7.351  -18.089 1.00 0.00 ? 97  LYS B N    18 
ATOM 3283  C CA   . LYS B 1 97  ? -26.873 -8.458  -17.369 1.00 0.00 ? 97  LYS B CA   18 
ATOM 3284  C C    . LYS B 1 97  ? -26.509 -8.014  -15.950 1.00 0.00 ? 97  LYS B C    18 
ATOM 3285  O O    . LYS B 1 97  ? -26.149 -6.879  -15.717 1.00 0.00 ? 97  LYS B O    18 
ATOM 3286  C CB   . LYS B 1 97  ? -25.589 -8.826  -18.118 1.00 0.00 ? 97  LYS B CB   18 
ATOM 3287  C CG   . LYS B 1 97  ? -25.938 -9.483  -19.454 1.00 0.00 ? 97  LYS B CG   18 
ATOM 3288  C CD   . LYS B 1 97  ? -25.323 -10.884 -19.510 1.00 0.00 ? 97  LYS B CD   18 
ATOM 3289  C CE   . LYS B 1 97  ? -26.411 -11.931 -19.264 1.00 0.00 ? 97  LYS B CE   18 
ATOM 3290  N NZ   . LYS B 1 97  ? -25.798 -13.153 -18.673 1.00 0.00 ? 97  LYS B NZ   18 
ATOM 3291  H H    . LYS B 1 97  ? -27.290 -6.423  -17.948 1.00 0.00 ? 97  LYS B H    18 
ATOM 3292  H HA   . LYS B 1 97  ? -27.521 -9.320  -17.322 1.00 0.00 ? 97  LYS B HA   18 
ATOM 3293  H HB2  . LYS B 1 97  ? -25.009 -7.933  -18.296 1.00 0.00 ? 97  LYS B HB2  18 
ATOM 3294  H HB3  . LYS B 1 97  ? -25.012 -9.516  -17.520 1.00 0.00 ? 97  LYS B HB3  18 
ATOM 3295  H HG2  . LYS B 1 97  ? -27.010 -9.555  -19.552 1.00 0.00 ? 97  LYS B HG2  18 
ATOM 3296  H HG3  . LYS B 1 97  ? -25.540 -8.886  -20.262 1.00 0.00 ? 97  LYS B HG3  18 
ATOM 3297  H HD2  . LYS B 1 97  ? -24.880 -11.044 -20.481 1.00 0.00 ? 97  LYS B HD2  18 
ATOM 3298  H HD3  . LYS B 1 97  ? -24.564 -10.973 -18.748 1.00 0.00 ? 97  LYS B HD3  18 
ATOM 3299  H HE2  . LYS B 1 97  ? -27.148 -11.532 -18.583 1.00 0.00 ? 97  LYS B HE2  18 
ATOM 3300  H HE3  . LYS B 1 97  ? -26.886 -12.183 -20.201 1.00 0.00 ? 97  LYS B HE3  18 
ATOM 3301  H HZ1  . LYS B 1 97  ? -25.163 -12.882 -17.896 1.00 0.00 ? 97  LYS B HZ1  18 
ATOM 3302  H HZ2  . LYS B 1 97  ? -26.548 -13.776 -18.310 1.00 0.00 ? 97  LYS B HZ2  18 
ATOM 3303  H HZ3  . LYS B 1 97  ? -25.252 -13.656 -19.403 1.00 0.00 ? 97  LYS B HZ3  18 
ATOM 3304  N N    . VAL B 1 98  ? -26.587 -8.911  -15.005 1.00 0.00 ? 98  VAL B N    18 
ATOM 3305  C CA   . VAL B 1 98  ? -26.229 -8.556  -13.601 1.00 0.00 ? 98  VAL B CA   18 
ATOM 3306  C C    . VAL B 1 98  ? -25.051 -9.423  -13.161 1.00 0.00 ? 98  VAL B C    18 
ATOM 3307  O O    . VAL B 1 98  ? -25.080 -10.631 -13.290 1.00 0.00 ? 98  VAL B O    18 
ATOM 3308  C CB   . VAL B 1 98  ? -27.421 -8.818  -12.679 1.00 0.00 ? 98  VAL B CB   18 
ATOM 3309  C CG1  . VAL B 1 98  ? -26.980 -8.654  -11.221 1.00 0.00 ? 98  VAL B CG1  18 
ATOM 3310  C CG2  . VAL B 1 98  ? -28.536 -7.819  -12.988 1.00 0.00 ? 98  VAL B CG2  18 
ATOM 3311  H H    . VAL B 1 98  ? -26.869 -9.826  -15.220 1.00 0.00 ? 98  VAL B H    18 
ATOM 3312  H HA   . VAL B 1 98  ? -25.952 -7.513  -13.551 1.00 0.00 ? 98  VAL B HA   18 
ATOM 3313  H HB   . VAL B 1 98  ? -27.782 -9.825  -12.834 1.00 0.00 ? 98  VAL B HB   18 
ATOM 3314  H HG11 . VAL B 1 98  ? -26.104 -8.024  -11.179 1.00 0.00 ? 98  VAL B HG11 18 
ATOM 3315  H HG12 . VAL B 1 98  ? -27.779 -8.200  -10.653 1.00 0.00 ? 98  VAL B HG12 18 
ATOM 3316  H HG13 . VAL B 1 98  ? -26.747 -9.623  -10.804 1.00 0.00 ? 98  VAL B HG13 18 
ATOM 3317  H HG21 . VAL B 1 98  ? -28.140 -7.009  -13.584 1.00 0.00 ? 98  VAL B HG21 18 
ATOM 3318  H HG22 . VAL B 1 98  ? -29.324 -8.315  -13.533 1.00 0.00 ? 98  VAL B HG22 18 
ATOM 3319  H HG23 . VAL B 1 98  ? -28.931 -7.424  -12.063 1.00 0.00 ? 98  VAL B HG23 18 
ATOM 3320  N N    . GLU B 1 99  ? -24.009 -8.828  -12.647 1.00 0.00 ? 99  GLU B N    18 
ATOM 3321  C CA   . GLU B 1 99  ? -22.844 -9.645  -12.215 1.00 0.00 ? 99  GLU B CA   18 
ATOM 3322  C C    . GLU B 1 99  ? -22.438 -9.272  -10.795 1.00 0.00 ? 99  GLU B C    18 
ATOM 3323  O O    . GLU B 1 99  ? -23.202 -8.704  -10.040 1.00 0.00 ? 99  GLU B O    18 
ATOM 3324  C CB   . GLU B 1 99  ? -21.664 -9.394  -13.149 1.00 0.00 ? 99  GLU B CB   18 
ATOM 3325  C CG   . GLU B 1 99  ? -21.156 -10.725 -13.708 1.00 0.00 ? 99  GLU B CG   18 
ATOM 3326  C CD   . GLU B 1 99  ? -19.627 -10.721 -13.734 1.00 0.00 ? 99  GLU B CD   18 
ATOM 3327  O OE1  . GLU B 1 99  ? -19.071 -10.120 -14.639 1.00 0.00 ? 99  GLU B OE1  18 
ATOM 3328  O OE2  . GLU B 1 99  ? -19.037 -11.318 -12.848 1.00 0.00 ? 99  GLU B OE2  18 
ATOM 3329  H H    . GLU B 1 99  ? -23.992 -7.851  -12.550 1.00 0.00 ? 99  GLU B H    18 
ATOM 3330  H HA   . GLU B 1 99  ? -23.104 -10.689 -12.249 1.00 0.00 ? 99  GLU B HA   18 
ATOM 3331  H HB2  . GLU B 1 99  ? -21.976 -8.760  -13.958 1.00 0.00 ? 99  GLU B HB2  18 
ATOM 3332  H HB3  . GLU B 1 99  ? -20.872 -8.913  -12.601 1.00 0.00 ? 99  GLU B HB3  18 
ATOM 3333  H HG2  . GLU B 1 99  ? -21.504 -11.534 -13.081 1.00 0.00 ? 99  GLU B HG2  18 
ATOM 3334  H HG3  . GLU B 1 99  ? -21.532 -10.860 -14.712 1.00 0.00 ? 99  GLU B HG3  18 
ATOM 3335  N N    . GLN B 1 100 ? -21.232 -9.594  -10.436 1.00 0.00 ? 100 GLN B N    18 
ATOM 3336  C CA   . GLN B 1 100 ? -20.739 -9.277  -9.071  1.00 0.00 ? 100 GLN B CA   18 
ATOM 3337  C C    . GLN B 1 100 ? -19.236 -9.018  -9.136  1.00 0.00 ? 100 GLN B C    18 
ATOM 3338  O O    . GLN B 1 100 ? -18.435 -9.889  -8.863  1.00 0.00 ? 100 GLN B O    18 
ATOM 3339  C CB   . GLN B 1 100 ? -20.996 -10.467 -8.157  1.00 0.00 ? 100 GLN B CB   18 
ATOM 3340  C CG   . GLN B 1 100 ? -22.468 -10.873 -8.236  1.00 0.00 ? 100 GLN B CG   18 
ATOM 3341  C CD   . GLN B 1 100 ? -22.671 -11.843 -9.400  1.00 0.00 ? 100 GLN B CD   18 
ATOM 3342  O OE1  . GLN B 1 100 ? -21.832 -11.946 -10.274 1.00 0.00 ? 100 GLN B OE1  18 
ATOM 3343  N NE2  . GLN B 1 100 ? -23.757 -12.566 -9.451  1.00 0.00 ? 100 GLN B NE2  18 
ATOM 3344  H H    . GLN B 1 100 ? -20.645 -10.051 -11.072 1.00 0.00 ? 100 GLN B H    18 
ATOM 3345  H HA   . GLN B 1 100 ? -21.248 -8.406  -8.689  1.00 0.00 ? 100 GLN B HA   18 
ATOM 3346  H HB2  . GLN B 1 100 ? -20.376 -11.286 -8.480  1.00 0.00 ? 100 GLN B HB2  18 
ATOM 3347  H HB3  . GLN B 1 100 ? -20.748 -10.203 -7.140  1.00 0.00 ? 100 GLN B HB3  18 
ATOM 3348  H HG2  . GLN B 1 100 ? -22.759 -11.352 -7.312  1.00 0.00 ? 100 GLN B HG2  18 
ATOM 3349  H HG3  . GLN B 1 100 ? -23.077 -9.994  -8.392  1.00 0.00 ? 100 GLN B HG3  18 
ATOM 3350  H HE21 . GLN B 1 100 ? -24.433 -12.483 -8.747  1.00 0.00 ? 100 GLN B HE21 18 
ATOM 3351  H HE22 . GLN B 1 100 ? -23.896 -13.191 -10.194 1.00 0.00 ? 100 GLN B HE22 18 
ATOM 3352  N N    . LEU B 1 101 ? -18.847 -7.836  -9.507  1.00 0.00 ? 101 LEU B N    18 
ATOM 3353  C CA   . LEU B 1 101 ? -17.396 -7.531  -9.602  1.00 0.00 ? 101 LEU B CA   18 
ATOM 3354  C C    . LEU B 1 101 ? -16.675 -8.083  -8.377  1.00 0.00 ? 101 LEU B C    18 
ATOM 3355  O O    . LEU B 1 101 ? -17.220 -8.149  -7.293  1.00 0.00 ? 101 LEU B O    18 
ATOM 3356  C CB   . LEU B 1 101 ? -17.187 -6.018  -9.691  1.00 0.00 ? 101 LEU B CB   18 
ATOM 3357  C CG   . LEU B 1 101 ? -17.999 -5.443  -10.856 1.00 0.00 ? 101 LEU B CG   18 
ATOM 3358  C CD1  . LEU B 1 101 ? -17.397 -4.103  -11.281 1.00 0.00 ? 101 LEU B CD1  18 
ATOM 3359  C CD2  . LEU B 1 101 ? -17.966 -6.411  -12.042 1.00 0.00 ? 101 LEU B CD2  18 
ATOM 3360  H H    . LEU B 1 101 ? -19.508 -7.155  -9.732  1.00 0.00 ? 101 LEU B H    18 
ATOM 3361  H HA   . LEU B 1 101 ? -16.994 -7.997  -10.490 1.00 0.00 ? 101 LEU B HA   18 
ATOM 3362  H HB2  . LEU B 1 101 ? -17.509 -5.558  -8.771  1.00 0.00 ? 101 LEU B HB2  18 
ATOM 3363  H HB3  . LEU B 1 101 ? -16.138 -5.814  -9.848  1.00 0.00 ? 101 LEU B HB3  18 
ATOM 3364  H HG   . LEU B 1 101 ? -19.021 -5.292  -10.540 1.00 0.00 ? 101 LEU B HG   18 
ATOM 3365  H HD11 . LEU B 1 101 ? -16.369 -4.050  -10.953 1.00 0.00 ? 101 LEU B HD11 18 
ATOM 3366  H HD12 . LEU B 1 101 ? -17.436 -4.016  -12.357 1.00 0.00 ? 101 LEU B HD12 18 
ATOM 3367  H HD13 . LEU B 1 101 ? -17.960 -3.298  -10.833 1.00 0.00 ? 101 LEU B HD13 18 
ATOM 3368  H HD21 . LEU B 1 101 ? -18.351 -7.372  -11.731 1.00 0.00 ? 101 LEU B HD21 18 
ATOM 3369  H HD22 . LEU B 1 101 ? -18.577 -6.022  -12.842 1.00 0.00 ? 101 LEU B HD22 18 
ATOM 3370  H HD23 . LEU B 1 101 ? -16.949 -6.525  -12.386 1.00 0.00 ? 101 LEU B HD23 18 
ATOM 3371  N N    . SER B 1 102 ? -15.459 -8.499  -8.556  1.00 0.00 ? 102 SER B N    18 
ATOM 3372  C CA   . SER B 1 102 ? -14.688 -9.078  -7.412  1.00 0.00 ? 102 SER B CA   18 
ATOM 3373  C C    . SER B 1 102 ? -13.705 -8.050  -6.847  1.00 0.00 ? 102 SER B C    18 
ATOM 3374  O O    . SER B 1 102 ? -13.068 -7.317  -7.578  1.00 0.00 ? 102 SER B O    18 
ATOM 3375  C CB   . SER B 1 102 ? -13.912 -10.303 -7.895  1.00 0.00 ? 102 SER B CB   18 
ATOM 3376  O OG   . SER B 1 102 ? -14.818 -11.376 -8.119  1.00 0.00 ? 102 SER B OG   18 
ATOM 3377  H H    . SER B 1 102 ? -15.056 -8.442  -9.450  1.00 0.00 ? 102 SER B H    18 
ATOM 3378  H HA   . SER B 1 102 ? -15.375 -9.377  -6.635  1.00 0.00 ? 102 SER B HA   18 
ATOM 3379  H HB2  . SER B 1 102 ? -13.405 -10.070 -8.817  1.00 0.00 ? 102 SER B HB2  18 
ATOM 3380  H HB3  . SER B 1 102 ? -13.183 -10.585 -7.147  1.00 0.00 ? 102 SER B HB3  18 
ATOM 3381  H HG   . SER B 1 102 ? -15.466 -11.086 -8.767  1.00 0.00 ? 102 SER B HG   18 
ATOM 3382  N N    . ASN B 1 103 ? -13.562 -8.002  -5.546  1.00 0.00 ? 103 ASN B N    18 
ATOM 3383  C CA   . ASN B 1 103 ? -12.603 -7.033  -4.936  1.00 0.00 ? 103 ASN B CA   18 
ATOM 3384  C C    . ASN B 1 103 ? -12.970 -5.611  -5.353  1.00 0.00 ? 103 ASN B C    18 
ATOM 3385  O O    . ASN B 1 103 ? -12.122 -4.750  -5.477  1.00 0.00 ? 103 ASN B O    18 
ATOM 3386  C CB   . ASN B 1 103 ? -11.187 -7.349  -5.416  1.00 0.00 ? 103 ASN B CB   18 
ATOM 3387  C CG   . ASN B 1 103 ? -10.566 -8.417  -4.512  1.00 0.00 ? 103 ASN B CG   18 
ATOM 3388  O OD1  . ASN B 1 103 ? -11.213 -8.923  -3.618  1.00 0.00 ? 103 ASN B OD1  18 
ATOM 3389  N ND2  . ASN B 1 103 ? -9.329  -8.780  -4.710  1.00 0.00 ? 103 ASN B ND2  18 
ATOM 3390  H H    . ASN B 1 103 ? -14.080 -8.611  -4.973  1.00 0.00 ? 103 ASN B H    18 
ATOM 3391  H HA   . ASN B 1 103 ? -12.641 -7.107  -3.855  1.00 0.00 ? 103 ASN B HA   18 
ATOM 3392  H HB2  . ASN B 1 103 ? -11.225 -7.713  -6.431  1.00 0.00 ? 103 ASN B HB2  18 
ATOM 3393  H HB3  . ASN B 1 103 ? -10.586 -6.453  -5.376  1.00 0.00 ? 103 ASN B HB3  18 
ATOM 3394  H HD21 . ASN B 1 103 ? -8.807  -8.371  -5.431  1.00 0.00 ? 103 ASN B HD21 18 
ATOM 3395  H HD22 . ASN B 1 103 ? -8.923  -9.465  -4.139  1.00 0.00 ? 103 ASN B HD22 18 
ATOM 3396  N N    . MET B 1 104 ? -14.228 -5.356  -5.563  1.00 0.00 ? 104 MET B N    18 
ATOM 3397  C CA   . MET B 1 104 ? -14.648 -3.989  -5.962  1.00 0.00 ? 104 MET B CA   18 
ATOM 3398  C C    . MET B 1 104 ? -15.032 -3.207  -4.706  1.00 0.00 ? 104 MET B C    18 
ATOM 3399  O O    . MET B 1 104 ? -15.751 -2.232  -4.763  1.00 0.00 ? 104 MET B O    18 
ATOM 3400  C CB   . MET B 1 104 ? -15.854 -4.077  -6.901  1.00 0.00 ? 104 MET B CB   18 
ATOM 3401  C CG   . MET B 1 104 ? -15.597 -3.224  -8.143  1.00 0.00 ? 104 MET B CG   18 
ATOM 3402  S SD   . MET B 1 104 ? -16.089 -1.514  -7.812  1.00 0.00 ? 104 MET B SD   18 
ATOM 3403  C CE   . MET B 1 104 ? -16.675 -1.121  -9.478  1.00 0.00 ? 104 MET B CE   18 
ATOM 3404  H H    . MET B 1 104 ? -14.896 -6.063  -5.455  1.00 0.00 ? 104 MET B H    18 
ATOM 3405  H HA   . MET B 1 104 ? -13.832 -3.491  -6.465  1.00 0.00 ? 104 MET B HA   18 
ATOM 3406  H HB2  . MET B 1 104 ? -16.006 -5.106  -7.194  1.00 0.00 ? 104 MET B HB2  18 
ATOM 3407  H HB3  . MET B 1 104 ? -16.734 -3.714  -6.393  1.00 0.00 ? 104 MET B HB3  18 
ATOM 3408  H HG2  . MET B 1 104 ? -14.545 -3.254  -8.390  1.00 0.00 ? 104 MET B HG2  18 
ATOM 3409  H HG3  . MET B 1 104 ? -16.172 -3.610  -8.971  1.00 0.00 ? 104 MET B HG3  18 
ATOM 3410  H HE1  . MET B 1 104 ? -16.453 -1.947  -10.140 1.00 0.00 ? 104 MET B HE1  18 
ATOM 3411  H HE2  . MET B 1 104 ? -17.740 -0.956  -9.457  1.00 0.00 ? 104 MET B HE2  18 
ATOM 3412  H HE3  . MET B 1 104 ? -16.180 -0.227  -9.831  1.00 0.00 ? 104 MET B HE3  18 
ATOM 3413  N N    . ILE B 1 105 ? -14.547 -3.631  -3.569  1.00 0.00 ? 105 ILE B N    18 
ATOM 3414  C CA   . ILE B 1 105 ? -14.870 -2.916  -2.303  1.00 0.00 ? 105 ILE B CA   18 
ATOM 3415  C C    . ILE B 1 105 ? -13.766 -3.188  -1.279  1.00 0.00 ? 105 ILE B C    18 
ATOM 3416  O O    . ILE B 1 105 ? -12.943 -4.063  -1.459  1.00 0.00 ? 105 ILE B O    18 
ATOM 3417  C CB   . ILE B 1 105 ? -16.210 -3.414  -1.757  1.00 0.00 ? 105 ILE B CB   18 
ATOM 3418  C CG1  . ILE B 1 105 ? -17.322 -3.071  -2.748  1.00 0.00 ? 105 ILE B CG1  18 
ATOM 3419  C CG2  . ILE B 1 105 ? -16.499 -2.736  -0.416  1.00 0.00 ? 105 ILE B CG2  18 
ATOM 3420  C CD1  . ILE B 1 105 ? -18.671 -3.496  -2.167  1.00 0.00 ? 105 ILE B CD1  18 
ATOM 3421  H H    . ILE B 1 105 ? -13.963 -4.420  -3.547  1.00 0.00 ? 105 ILE B H    18 
ATOM 3422  H HA   . ILE B 1 105 ? -14.930 -1.854  -2.493  1.00 0.00 ? 105 ILE B HA   18 
ATOM 3423  H HB   . ILE B 1 105 ? -16.166 -4.485  -1.618  1.00 0.00 ? 105 ILE B HB   18 
ATOM 3424  H HG12 . ILE B 1 105 ? -17.325 -2.006  -2.929  1.00 0.00 ? 105 ILE B HG12 18 
ATOM 3425  H HG13 . ILE B 1 105 ? -17.152 -3.593  -3.678  1.00 0.00 ? 105 ILE B HG13 18 
ATOM 3426  H HG21 . ILE B 1 105 ? -16.307 -1.675  -0.501  1.00 0.00 ? 105 ILE B HG21 18 
ATOM 3427  H HG22 . ILE B 1 105 ? -17.533 -2.894  -0.149  1.00 0.00 ? 105 ILE B HG22 18 
ATOM 3428  H HG23 . ILE B 1 105 ? -15.861 -3.157  0.346   1.00 0.00 ? 105 ILE B HG23 18 
ATOM 3429  H HD11 . ILE B 1 105 ? -18.510 -4.040  -1.248  1.00 0.00 ? 105 ILE B HD11 18 
ATOM 3430  H HD12 . ILE B 1 105 ? -19.268 -2.619  -1.966  1.00 0.00 ? 105 ILE B HD12 18 
ATOM 3431  H HD13 . ILE B 1 105 ? -19.185 -4.128  -2.876  1.00 0.00 ? 105 ILE B HD13 18 
ATOM 3432  N N    . VAL B 1 106 ? -13.740 -2.446  -0.207  1.00 0.00 ? 106 VAL B N    18 
ATOM 3433  C CA   . VAL B 1 106 ? -12.690 -2.663  0.821   1.00 0.00 ? 106 VAL B CA   18 
ATOM 3434  C C    . VAL B 1 106 ? -13.351 -3.106  2.130   1.00 0.00 ? 106 VAL B C    18 
ATOM 3435  O O    . VAL B 1 106 ? -14.416 -2.642  2.488   1.00 0.00 ? 106 VAL B O    18 
ATOM 3436  C CB   . VAL B 1 106 ? -11.927 -1.353  1.033   1.00 0.00 ? 106 VAL B CB   18 
ATOM 3437  C CG1  . VAL B 1 106 ? -11.180 -1.399  2.365   1.00 0.00 ? 106 VAL B CG1  18 
ATOM 3438  C CG2  . VAL B 1 106 ? -10.923 -1.164  -0.107  1.00 0.00 ? 106 VAL B CG2  18 
ATOM 3439  H H    . VAL B 1 106 ? -14.408 -1.743  -0.078  1.00 0.00 ? 106 VAL B H    18 
ATOM 3440  H HA   . VAL B 1 106 ? -12.007 -3.428  0.484   1.00 0.00 ? 106 VAL B HA   18 
ATOM 3441  H HB   . VAL B 1 106 ? -12.624 -0.528  1.041   1.00 0.00 ? 106 VAL B HB   18 
ATOM 3442  H HG11 . VAL B 1 106 ? -10.645 -2.333  2.443   1.00 0.00 ? 106 VAL B HG11 18 
ATOM 3443  H HG12 . VAL B 1 106 ? -10.484 -0.577  2.415   1.00 0.00 ? 106 VAL B HG12 18 
ATOM 3444  H HG13 . VAL B 1 106 ? -11.890 -1.322  3.175   1.00 0.00 ? 106 VAL B HG13 18 
ATOM 3445  H HG21 . VAL B 1 106 ? -10.295 -2.039  -0.183  1.00 0.00 ? 106 VAL B HG21 18 
ATOM 3446  H HG22 . VAL B 1 106 ? -11.456 -1.021  -1.035  1.00 0.00 ? 106 VAL B HG22 18 
ATOM 3447  H HG23 . VAL B 1 106 ? -10.310 -0.297  0.094   1.00 0.00 ? 106 VAL B HG23 18 
ATOM 3448  N N    . ARG B 1 107 ? -12.727 -3.999  2.849   1.00 0.00 ? 107 ARG B N    18 
ATOM 3449  C CA   . ARG B 1 107 ? -13.321 -4.469  4.132   1.00 0.00 ? 107 ARG B CA   18 
ATOM 3450  C C    . ARG B 1 107 ? -12.249 -4.463  5.226   1.00 0.00 ? 107 ARG B C    18 
ATOM 3451  O O    . ARG B 1 107 ? -12.461 -4.954  6.317   1.00 0.00 ? 107 ARG B O    18 
ATOM 3452  C CB   . ARG B 1 107 ? -13.860 -5.891  3.955   1.00 0.00 ? 107 ARG B CB   18 
ATOM 3453  C CG   . ARG B 1 107 ? -15.088 -6.086  4.845   1.00 0.00 ? 107 ARG B CG   18 
ATOM 3454  C CD   . ARG B 1 107 ? -15.305 -7.579  5.099   1.00 0.00 ? 107 ARG B CD   18 
ATOM 3455  N NE   . ARG B 1 107 ? -16.285 -7.756  6.207   1.00 0.00 ? 107 ARG B NE   18 
ATOM 3456  C CZ   . ARG B 1 107 ? -16.529 -8.948  6.677   1.00 0.00 ? 107 ARG B CZ   18 
ATOM 3457  N NH1  . ARG B 1 107 ? -15.565 -9.650  7.206   1.00 0.00 ? 107 ARG B NH1  18 
ATOM 3458  N NH2  . ARG B 1 107 ? -17.737 -9.439  6.619   1.00 0.00 ? 107 ARG B NH2  18 
ATOM 3459  H H    . ARG B 1 107 ? -11.869 -4.362  2.544   1.00 0.00 ? 107 ARG B H    18 
ATOM 3460  H HA   . ARG B 1 107 ? -14.129 -3.811  4.416   1.00 0.00 ? 107 ARG B HA   18 
ATOM 3461  H HB2  . ARG B 1 107 ? -14.135 -6.045  2.920   1.00 0.00 ? 107 ARG B HB2  18 
ATOM 3462  H HB3  . ARG B 1 107 ? -13.098 -6.603  4.235   1.00 0.00 ? 107 ARG B HB3  18 
ATOM 3463  H HG2  . ARG B 1 107 ? -14.934 -5.578  5.787   1.00 0.00 ? 107 ARG B HG2  18 
ATOM 3464  H HG3  . ARG B 1 107 ? -15.957 -5.676  4.354   1.00 0.00 ? 107 ARG B HG3  18 
ATOM 3465  H HD2  . ARG B 1 107 ? -15.685 -8.045  4.203   1.00 0.00 ? 107 ARG B HD2  18 
ATOM 3466  H HD3  . ARG B 1 107 ? -14.366 -8.038  5.372   1.00 0.00 ? 107 ARG B HD3  18 
ATOM 3467  H HE   . ARG B 1 107 ? -16.747 -6.978  6.583   1.00 0.00 ? 107 ARG B HE   18 
ATOM 3468  H HH11 . ARG B 1 107 ? -14.639 -9.274  7.250   1.00 0.00 ? 107 ARG B HH11 18 
ATOM 3469  H HH12 . ARG B 1 107 ? -15.751 -10.564 7.566   1.00 0.00 ? 107 ARG B HH12 18 
ATOM 3470  H HH21 . ARG B 1 107 ? -18.477 -8.901  6.213   1.00 0.00 ? 107 ARG B HH21 18 
ATOM 3471  H HH22 . ARG B 1 107 ? -17.924 -10.352 6.980   1.00 0.00 ? 107 ARG B HH22 18 
ATOM 3472  N N    . SER B 1 108 ? -11.101 -3.911  4.944   1.00 0.00 ? 108 SER B N    18 
ATOM 3473  C CA   . SER B 1 108 ? -10.019 -3.874  5.969   1.00 0.00 ? 108 SER B CA   18 
ATOM 3474  C C    . SER B 1 108 ? -8.696  -3.496  5.300   1.00 0.00 ? 108 SER B C    18 
ATOM 3475  O O    . SER B 1 108 ? -8.239  -4.156  4.388   1.00 0.00 ? 108 SER B O    18 
ATOM 3476  C CB   . SER B 1 108 ? -9.887  -5.252  6.620   1.00 0.00 ? 108 SER B CB   18 
ATOM 3477  O OG   . SER B 1 108 ? -10.351 -6.245  5.716   1.00 0.00 ? 108 SER B OG   18 
ATOM 3478  H H    . SER B 1 108 ? -10.949 -3.521  4.057   1.00 0.00 ? 108 SER B H    18 
ATOM 3479  H HA   . SER B 1 108 ? -10.264 -3.141  6.723   1.00 0.00 ? 108 SER B HA   18 
ATOM 3480  H HB2  . SER B 1 108 ? -8.853  -5.442  6.856   1.00 0.00 ? 108 SER B HB2  18 
ATOM 3481  H HB3  . SER B 1 108 ? -10.472 -5.276  7.530   1.00 0.00 ? 108 SER B HB3  18 
ATOM 3482  H HG   . SER B 1 108 ? -10.967 -6.811  6.188   1.00 0.00 ? 108 SER B HG   18 
ATOM 3483  N N    . CYS B 1 109 ? -8.080  -2.431  5.738   1.00 0.00 ? 109 CYS B N    18 
ATOM 3484  C CA   . CYS B 1 109 ? -6.790  -2.006  5.116   1.00 0.00 ? 109 CYS B CA   18 
ATOM 3485  C C    . CYS B 1 109 ? -5.604  -2.572  5.908   1.00 0.00 ? 109 CYS B C    18 
ATOM 3486  O O    . CYS B 1 109 ? -5.752  -3.458  6.726   1.00 0.00 ? 109 CYS B O    18 
ATOM 3487  C CB   . CYS B 1 109 ? -6.710  -0.480  5.107   1.00 0.00 ? 109 CYS B CB   18 
ATOM 3488  S SG   . CYS B 1 109 ? -8.027  0.183   4.058   1.00 0.00 ? 109 CYS B SG   18 
ATOM 3489  H H    . CYS B 1 109 ? -8.472  -1.905  6.470   1.00 0.00 ? 109 CYS B H    18 
ATOM 3490  H HA   . CYS B 1 109 ? -6.749  -2.372  4.101   1.00 0.00 ? 109 CYS B HA   18 
ATOM 3491  H HB2  . CYS B 1 109 ? -6.829  -0.106  6.114   1.00 0.00 ? 109 CYS B HB2  18 
ATOM 3492  H HB3  . CYS B 1 109 ? -5.751  -0.171  4.719   1.00 0.00 ? 109 CYS B HB3  18 
ATOM 3493  N N    . LYS B 1 110 ? -4.423  -2.060  5.664   1.00 0.00 ? 110 LYS B N    18 
ATOM 3494  C CA   . LYS B 1 110 ? -3.217  -2.550  6.387   1.00 0.00 ? 110 LYS B CA   18 
ATOM 3495  C C    . LYS B 1 110 ? -2.064  -1.598  6.073   1.00 0.00 ? 110 LYS B C    18 
ATOM 3496  O O    . LYS B 1 110 ? -2.281  -0.505  5.603   1.00 0.00 ? 110 LYS B O    18 
ATOM 3497  C CB   . LYS B 1 110 ? -2.866  -3.961  5.908   1.00 0.00 ? 110 LYS B CB   18 
ATOM 3498  C CG   . LYS B 1 110 ? -2.502  -3.921  4.423   1.00 0.00 ? 110 LYS B CG   18 
ATOM 3499  C CD   . LYS B 1 110 ? -1.997  -5.297  3.984   1.00 0.00 ? 110 LYS B CD   18 
ATOM 3500  C CE   . LYS B 1 110 ? -0.556  -5.179  3.486   1.00 0.00 ? 110 LYS B CE   18 
ATOM 3501  N NZ   . LYS B 1 110 ? 0.243   -6.327  4.000   1.00 0.00 ? 110 LYS B NZ   18 
ATOM 3502  H H    . LYS B 1 110 ? -4.327  -1.344  4.999   1.00 0.00 ? 110 LYS B H    18 
ATOM 3503  H HA   . LYS B 1 110 ? -3.405  -2.558  7.450   1.00 0.00 ? 110 LYS B HA   18 
ATOM 3504  H HB2  . LYS B 1 110 ? -2.027  -4.335  6.476   1.00 0.00 ? 110 LYS B HB2  18 
ATOM 3505  H HB3  . LYS B 1 110 ? -3.716  -4.611  6.051   1.00 0.00 ? 110 LYS B HB3  18 
ATOM 3506  H HG2  . LYS B 1 110 ? -3.376  -3.656  3.845   1.00 0.00 ? 110 LYS B HG2  18 
ATOM 3507  H HG3  . LYS B 1 110 ? -1.727  -3.187  4.261   1.00 0.00 ? 110 LYS B HG3  18 
ATOM 3508  H HD2  . LYS B 1 110 ? -2.035  -5.979  4.822   1.00 0.00 ? 110 LYS B HD2  18 
ATOM 3509  H HD3  . LYS B 1 110 ? -2.622  -5.672  3.186   1.00 0.00 ? 110 LYS B HD3  18 
ATOM 3510  H HE2  . LYS B 1 110 ? -0.545  -5.188  2.406   1.00 0.00 ? 110 LYS B HE2  18 
ATOM 3511  H HE3  . LYS B 1 110 ? -0.126  -4.254  3.841   1.00 0.00 ? 110 LYS B HE3  18 
ATOM 3512  H HZ1  . LYS B 1 110 ? 0.116   -6.405  5.029   1.00 0.00 ? 110 LYS B HZ1  18 
ATOM 3513  H HZ2  . LYS B 1 110 ? -0.079  -7.205  3.543   1.00 0.00 ? 110 LYS B HZ2  18 
ATOM 3514  H HZ3  . LYS B 1 110 ? 1.249   -6.173  3.787   1.00 0.00 ? 110 LYS B HZ3  18 
ATOM 3515  N N    . CYS B 1 111 ? -0.846  -1.990  6.316   1.00 0.00 ? 111 CYS B N    18 
ATOM 3516  C CA   . CYS B 1 111 ? 0.289   -1.072  6.009   1.00 0.00 ? 111 CYS B CA   18 
ATOM 3517  C C    . CYS B 1 111 ? 1.373   -1.830  5.241   1.00 0.00 ? 111 CYS B C    18 
ATOM 3518  O O    . CYS B 1 111 ? 2.295   -2.369  5.821   1.00 0.00 ? 111 CYS B O    18 
ATOM 3519  C CB   . CYS B 1 111 ? 0.876   -0.523  7.312   1.00 0.00 ? 111 CYS B CB   18 
ATOM 3520  S SG   . CYS B 1 111 ? -0.207  0.772   7.971   1.00 0.00 ? 111 CYS B SG   18 
ATOM 3521  H H    . CYS B 1 111 ? -0.677  -2.880  6.693   1.00 0.00 ? 111 CYS B H    18 
ATOM 3522  H HA   . CYS B 1 111 ? -0.071  -0.252  5.404   1.00 0.00 ? 111 CYS B HA   18 
ATOM 3523  H HB2  . CYS B 1 111 ? 0.962   -1.322  8.033   1.00 0.00 ? 111 CYS B HB2  18 
ATOM 3524  H HB3  . CYS B 1 111 ? 1.855   -0.109  7.118   1.00 0.00 ? 111 CYS B HB3  18 
ATOM 3525  N N    . SER B 1 112 ? 1.278   -1.872  3.937   1.00 0.00 ? 112 SER B N    18 
ATOM 3526  C CA   . SER B 1 112 ? 2.314   -2.592  3.144   1.00 0.00 ? 112 SER B CA   18 
ATOM 3527  C C    . SER B 1 112 ? 3.458   -1.631  2.818   1.00 0.00 ? 112 SER B C    18 
ATOM 3528  O O    . SER B 1 112 ? 4.596   -1.985  3.079   1.00 0.00 ? 112 SER B O    18 
ATOM 3529  C CB   . SER B 1 112 ? 1.697   -3.109  1.846   1.00 0.00 ? 112 SER B CB   18 
ATOM 3530  O OG   . SER B 1 112 ? 2.659   -3.890  1.150   1.00 0.00 ? 112 SER B OG   18 
ATOM 3531  O OXT  . SER B 1 112 ? 3.177   -0.556  2.314   1.00 0.00 ? 112 SER B OXT  18 
ATOM 3532  H H    . SER B 1 112 ? 0.529   -1.429  3.481   1.00 0.00 ? 112 SER B H    18 
ATOM 3533  H HA   . SER B 1 112 ? 2.694   -3.423  3.719   1.00 0.00 ? 112 SER B HA   18 
ATOM 3534  H HB2  . SER B 1 112 ? 0.839   -3.720  2.071   1.00 0.00 ? 112 SER B HB2  18 
ATOM 3535  H HB3  . SER B 1 112 ? 1.388   -2.270  1.235   1.00 0.00 ? 112 SER B HB3  18 
ATOM 3536  H HG   . SER B 1 112 ? 2.804   -4.695  1.651   1.00 0.00 ? 112 SER B HG   18 
ATOM 3537  N N    . ALA A 1 1   ? 6.507   -1.207  -15.296 1.00 0.00 ? 1   ALA A N    19 
ATOM 3538  C CA   . ALA A 1 1   ? 7.717   -1.636  -14.539 1.00 0.00 ? 1   ALA A CA   19 
ATOM 3539  C C    . ALA A 1 1   ? 8.001   -0.633  -13.421 1.00 0.00 ? 1   ALA A C    19 
ATOM 3540  O O    . ALA A 1 1   ? 8.746   0.312   -13.594 1.00 0.00 ? 1   ALA A O    19 
ATOM 3541  C CB   . ALA A 1 1   ? 8.917   -1.697  -15.488 1.00 0.00 ? 1   ALA A CB   19 
ATOM 3542  H H1   . ALA A 1 1   ? 6.211   -0.265  -14.968 1.00 0.00 ? 1   ALA A H1   19 
ATOM 3543  H H2   . ALA A 1 1   ? 6.728   -1.168  -16.310 1.00 0.00 ? 1   ALA A H2   19 
ATOM 3544  H H3   . ALA A 1 1   ? 5.739   -1.888  -15.136 1.00 0.00 ? 1   ALA A H3   19 
ATOM 3545  H HA   . ALA A 1 1   ? 7.547   -2.614  -14.113 1.00 0.00 ? 1   ALA A HA   19 
ATOM 3546  H HB1  . ALA A 1 1   ? 9.085   -0.720  -15.917 1.00 0.00 ? 1   ALA A HB1  19 
ATOM 3547  H HB2  . ALA A 1 1   ? 9.794   -2.006  -14.939 1.00 0.00 ? 1   ALA A HB2  19 
ATOM 3548  H HB3  . ALA A 1 1   ? 8.717   -2.406  -16.277 1.00 0.00 ? 1   ALA A HB3  19 
ATOM 3549  N N    . LEU A 1 2   ? 7.411   -0.829  -12.273 1.00 0.00 ? 2   LEU A N    19 
ATOM 3550  C CA   . LEU A 1 2   ? 7.646   0.116   -11.144 1.00 0.00 ? 2   LEU A CA   19 
ATOM 3551  C C    . LEU A 1 2   ? 8.628   -0.507  -10.155 1.00 0.00 ? 2   LEU A C    19 
ATOM 3552  O O    . LEU A 1 2   ? 8.268   -0.884  -9.057  1.00 0.00 ? 2   LEU A O    19 
ATOM 3553  C CB   . LEU A 1 2   ? 6.329   0.395   -10.432 1.00 0.00 ? 2   LEU A CB   19 
ATOM 3554  C CG   . LEU A 1 2   ? 5.233   0.641   -11.467 1.00 0.00 ? 2   LEU A CG   19 
ATOM 3555  C CD1  . LEU A 1 2   ? 3.913   0.930   -10.753 1.00 0.00 ? 2   LEU A CD1  19 
ATOM 3556  C CD2  . LEU A 1 2   ? 5.619   1.841   -12.335 1.00 0.00 ? 2   LEU A CD2  19 
ATOM 3557  H H    . LEU A 1 2   ? 6.814   -1.595  -12.154 1.00 0.00 ? 2   LEU A H    19 
ATOM 3558  H HA   . LEU A 1 2   ? 8.055   1.039   -11.524 1.00 0.00 ? 2   LEU A HA   19 
ATOM 3559  H HB2  . LEU A 1 2   ? 6.068   -0.455  -9.821  1.00 0.00 ? 2   LEU A HB2  19 
ATOM 3560  H HB3  . LEU A 1 2   ? 6.437   1.268   -9.807  1.00 0.00 ? 2   LEU A HB3  19 
ATOM 3561  H HG   . LEU A 1 2   ? 5.122   -0.235  -12.089 1.00 0.00 ? 2   LEU A HG   19 
ATOM 3562  H HD11 . LEU A 1 2   ? 3.955   0.543   -9.746  1.00 0.00 ? 2   LEU A HD11 19 
ATOM 3563  H HD12 . LEU A 1 2   ? 3.747   1.996   -10.722 1.00 0.00 ? 2   LEU A HD12 19 
ATOM 3564  H HD13 . LEU A 1 2   ? 3.102   0.456   -11.287 1.00 0.00 ? 2   LEU A HD13 19 
ATOM 3565  H HD21 . LEU A 1 2   ? 6.684   1.829   -12.513 1.00 0.00 ? 2   LEU A HD21 19 
ATOM 3566  H HD22 . LEU A 1 2   ? 5.097   1.786   -13.279 1.00 0.00 ? 2   LEU A HD22 19 
ATOM 3567  H HD23 . LEU A 1 2   ? 5.350   2.755   -11.828 1.00 0.00 ? 2   LEU A HD23 19 
ATOM 3568  N N    . ASP A 1 3   ? 9.864   -0.620  -10.538 1.00 0.00 ? 3   ASP A N    19 
ATOM 3569  C CA   . ASP A 1 3   ? 10.875  -1.219  -9.627  1.00 0.00 ? 3   ASP A CA   19 
ATOM 3570  C C    . ASP A 1 3   ? 11.974  -0.197  -9.335  1.00 0.00 ? 3   ASP A C    19 
ATOM 3571  O O    . ASP A 1 3   ? 11.887  0.954   -9.714  1.00 0.00 ? 3   ASP A O    19 
ATOM 3572  C CB   . ASP A 1 3   ? 11.491  -2.448  -10.294 1.00 0.00 ? 3   ASP A CB   19 
ATOM 3573  C CG   . ASP A 1 3   ? 11.640  -2.194  -11.795 1.00 0.00 ? 3   ASP A CG   19 
ATOM 3574  O OD1  . ASP A 1 3   ? 12.643  -1.618  -12.181 1.00 0.00 ? 3   ASP A OD1  19 
ATOM 3575  O OD2  . ASP A 1 3   ? 10.747  -2.579  -12.532 1.00 0.00 ? 3   ASP A OD2  19 
ATOM 3576  H H    . ASP A 1 3   ? 10.126  -0.311  -11.426 1.00 0.00 ? 3   ASP A H    19 
ATOM 3577  H HA   . ASP A 1 3   ? 10.400  -1.512  -8.702  1.00 0.00 ? 3   ASP A HA   19 
ATOM 3578  H HB2  . ASP A 1 3   ? 12.462  -2.643  -9.862  1.00 0.00 ? 3   ASP A HB2  19 
ATOM 3579  H HB3  . ASP A 1 3   ? 10.850  -3.300  -10.137 1.00 0.00 ? 3   ASP A HB3  19 
ATOM 3580  N N    . THR A 1 4   ? 13.005  -0.615  -8.658  1.00 0.00 ? 4   THR A N    19 
ATOM 3581  C CA   . THR A 1 4   ? 14.118  0.316   -8.328  1.00 0.00 ? 4   THR A CA   19 
ATOM 3582  C C    . THR A 1 4   ? 15.056  0.452   -9.531  1.00 0.00 ? 4   THR A C    19 
ATOM 3583  O O    . THR A 1 4   ? 16.108  1.054   -9.444  1.00 0.00 ? 4   THR A O    19 
ATOM 3584  C CB   . THR A 1 4   ? 14.883  -0.238  -7.126  1.00 0.00 ? 4   THR A CB   19 
ATOM 3585  O OG1  . THR A 1 4   ? 15.812  -1.219  -7.568  1.00 0.00 ? 4   THR A OG1  19 
ATOM 3586  C CG2  . THR A 1 4   ? 13.890  -0.872  -6.148  1.00 0.00 ? 4   THR A CG2  19 
ATOM 3587  H H    . THR A 1 4   ? 13.046  -1.548  -8.362  1.00 0.00 ? 4   THR A H    19 
ATOM 3588  H HA   . THR A 1 4   ? 13.717  1.284   -8.081  1.00 0.00 ? 4   THR A HA   19 
ATOM 3589  H HB   . THR A 1 4   ? 15.409  0.563   -6.631  1.00 0.00 ? 4   THR A HB   19 
ATOM 3590  H HG1  . THR A 1 4   ? 15.479  -1.594  -8.386  1.00 0.00 ? 4   THR A HG1  19 
ATOM 3591  H HG21 . THR A 1 4   ? 12.881  -0.650  -6.466  1.00 0.00 ? 4   THR A HG21 19 
ATOM 3592  H HG22 . THR A 1 4   ? 14.033  -1.942  -6.131  1.00 0.00 ? 4   THR A HG22 19 
ATOM 3593  H HG23 . THR A 1 4   ? 14.050  -0.471  -5.159  1.00 0.00 ? 4   THR A HG23 19 
ATOM 3594  N N    . ASN A 1 5   ? 14.681  -0.095  -10.655 1.00 0.00 ? 5   ASN A N    19 
ATOM 3595  C CA   . ASN A 1 5   ? 15.549  0.015   -11.862 1.00 0.00 ? 5   ASN A CA   19 
ATOM 3596  C C    . ASN A 1 5   ? 15.011  1.116   -12.780 1.00 0.00 ? 5   ASN A C    19 
ATOM 3597  O O    . ASN A 1 5   ? 15.753  1.940   -13.277 1.00 0.00 ? 5   ASN A O    19 
ATOM 3598  C CB   . ASN A 1 5   ? 15.553  -1.320  -12.613 1.00 0.00 ? 5   ASN A CB   19 
ATOM 3599  C CG   . ASN A 1 5   ? 16.564  -1.258  -13.760 1.00 0.00 ? 5   ASN A CG   19 
ATOM 3600  O OD1  . ASN A 1 5   ? 17.757  -1.257  -13.533 1.00 0.00 ? 5   ASN A OD1  19 
ATOM 3601  N ND2  . ASN A 1 5   ? 16.134  -1.207  -14.991 1.00 0.00 ? 5   ASN A ND2  19 
ATOM 3602  H H    . ASN A 1 5   ? 13.826  -0.571  -10.709 1.00 0.00 ? 5   ASN A H    19 
ATOM 3603  H HA   . ASN A 1 5   ? 16.557  0.259   -11.559 1.00 0.00 ? 5   ASN A HA   19 
ATOM 3604  H HB2  . ASN A 1 5   ? 15.825  -2.114  -11.934 1.00 0.00 ? 5   ASN A HB2  19 
ATOM 3605  H HB3  . ASN A 1 5   ? 14.568  -1.509  -13.014 1.00 0.00 ? 5   ASN A HB3  19 
ATOM 3606  H HD21 . ASN A 1 5   ? 15.171  -1.209  -15.174 1.00 0.00 ? 5   ASN A HD21 19 
ATOM 3607  H HD22 . ASN A 1 5   ? 16.773  -1.167  -15.732 1.00 0.00 ? 5   ASN A HD22 19 
ATOM 3608  N N    . TYR A 1 6   ? 13.726  1.133   -13.015 1.00 0.00 ? 6   TYR A N    19 
ATOM 3609  C CA   . TYR A 1 6   ? 13.139  2.172   -13.904 1.00 0.00 ? 6   TYR A CA   19 
ATOM 3610  C C    . TYR A 1 6   ? 12.851  3.443   -13.102 1.00 0.00 ? 6   TYR A C    19 
ATOM 3611  O O    . TYR A 1 6   ? 12.685  4.511   -13.656 1.00 0.00 ? 6   TYR A O    19 
ATOM 3612  C CB   . TYR A 1 6   ? 11.838  1.631   -14.496 1.00 0.00 ? 6   TYR A CB   19 
ATOM 3613  C CG   . TYR A 1 6   ? 11.065  2.753   -15.147 1.00 0.00 ? 6   TYR A CG   19 
ATOM 3614  C CD1  . TYR A 1 6   ? 11.434  3.218   -16.415 1.00 0.00 ? 6   TYR A CD1  19 
ATOM 3615  C CD2  . TYR A 1 6   ? 9.977   3.326   -14.480 1.00 0.00 ? 6   TYR A CD2  19 
ATOM 3616  C CE1  . TYR A 1 6   ? 10.713  4.258   -17.015 1.00 0.00 ? 6   TYR A CE1  19 
ATOM 3617  C CE2  . TYR A 1 6   ? 9.256   4.366   -15.079 1.00 0.00 ? 6   TYR A CE2  19 
ATOM 3618  C CZ   . TYR A 1 6   ? 9.624   4.832   -16.347 1.00 0.00 ? 6   TYR A CZ   19 
ATOM 3619  O OH   . TYR A 1 6   ? 8.913   5.856   -16.939 1.00 0.00 ? 6   TYR A OH   19 
ATOM 3620  H H    . TYR A 1 6   ? 13.143  0.457   -12.612 1.00 0.00 ? 6   TYR A H    19 
ATOM 3621  H HA   . TYR A 1 6   ? 13.831  2.397   -14.702 1.00 0.00 ? 6   TYR A HA   19 
ATOM 3622  H HB2  . TYR A 1 6   ? 12.066  0.874   -15.230 1.00 0.00 ? 6   TYR A HB2  19 
ATOM 3623  H HB3  . TYR A 1 6   ? 11.240  1.196   -13.708 1.00 0.00 ? 6   TYR A HB3  19 
ATOM 3624  H HD1  . TYR A 1 6   ? 12.275  2.777   -16.929 1.00 0.00 ? 6   TYR A HD1  19 
ATOM 3625  H HD2  . TYR A 1 6   ? 9.694   2.965   -13.501 1.00 0.00 ? 6   TYR A HD2  19 
ATOM 3626  H HE1  . TYR A 1 6   ? 10.997  4.618   -17.993 1.00 0.00 ? 6   TYR A HE1  19 
ATOM 3627  H HE2  . TYR A 1 6   ? 8.415   4.808   -14.563 1.00 0.00 ? 6   TYR A HE2  19 
ATOM 3628  H HH   . TYR A 1 6   ? 8.708   6.505   -16.263 1.00 0.00 ? 6   TYR A HH   19 
ATOM 3629  N N    . CYS A 1 7   ? 12.788  3.341   -11.802 1.00 0.00 ? 7   CYS A N    19 
ATOM 3630  C CA   . CYS A 1 7   ? 12.506  4.550   -10.977 1.00 0.00 ? 7   CYS A CA   19 
ATOM 3631  C C    . CYS A 1 7   ? 13.806  5.318   -10.731 1.00 0.00 ? 7   CYS A C    19 
ATOM 3632  O O    . CYS A 1 7   ? 13.794  6.451   -10.293 1.00 0.00 ? 7   CYS A O    19 
ATOM 3633  C CB   . CYS A 1 7   ? 11.896  4.127   -9.639  1.00 0.00 ? 7   CYS A CB   19 
ATOM 3634  S SG   . CYS A 1 7   ? 10.147  3.731   -9.880  1.00 0.00 ? 7   CYS A SG   19 
ATOM 3635  H H    . CYS A 1 7   ? 12.922  2.471   -11.370 1.00 0.00 ? 7   CYS A H    19 
ATOM 3636  H HA   . CYS A 1 7   ? 11.809  5.186   -11.503 1.00 0.00 ? 7   CYS A HA   19 
ATOM 3637  H HB2  . CYS A 1 7   ? 12.415  3.257   -9.260  1.00 0.00 ? 7   CYS A HB2  19 
ATOM 3638  H HB3  . CYS A 1 7   ? 11.986  4.937   -8.932  1.00 0.00 ? 7   CYS A HB3  19 
ATOM 3639  N N    . PHE A 1 8   ? 14.927  4.713   -11.012 1.00 0.00 ? 8   PHE A N    19 
ATOM 3640  C CA   . PHE A 1 8   ? 16.225  5.414   -10.798 1.00 0.00 ? 8   PHE A CA   19 
ATOM 3641  C C    . PHE A 1 8   ? 16.577  6.234   -12.041 1.00 0.00 ? 8   PHE A C    19 
ATOM 3642  O O    . PHE A 1 8   ? 17.567  6.940   -12.070 1.00 0.00 ? 8   PHE A O    19 
ATOM 3643  C CB   . PHE A 1 8   ? 17.327  4.387   -10.534 1.00 0.00 ? 8   PHE A CB   19 
ATOM 3644  C CG   . PHE A 1 8   ? 17.426  4.126   -9.050  1.00 0.00 ? 8   PHE A CG   19 
ATOM 3645  C CD1  . PHE A 1 8   ? 16.289  4.240   -8.241  1.00 0.00 ? 8   PHE A CD1  19 
ATOM 3646  C CD2  . PHE A 1 8   ? 18.656  3.773   -8.484  1.00 0.00 ? 8   PHE A CD2  19 
ATOM 3647  C CE1  . PHE A 1 8   ? 16.383  4.000   -6.866  1.00 0.00 ? 8   PHE A CE1  19 
ATOM 3648  C CE2  . PHE A 1 8   ? 18.750  3.533   -7.107  1.00 0.00 ? 8   PHE A CE2  19 
ATOM 3649  C CZ   . PHE A 1 8   ? 17.613  3.647   -6.298  1.00 0.00 ? 8   PHE A CZ   19 
ATOM 3650  H H    . PHE A 1 8   ? 14.915  3.800   -11.368 1.00 0.00 ? 8   PHE A H    19 
ATOM 3651  H HA   . PHE A 1 8   ? 16.138  6.074   -9.949  1.00 0.00 ? 8   PHE A HA   19 
ATOM 3652  H HB2  . PHE A 1 8   ? 17.089  3.467   -11.046 1.00 0.00 ? 8   PHE A HB2  19 
ATOM 3653  H HB3  . PHE A 1 8   ? 18.269  4.769   -10.896 1.00 0.00 ? 8   PHE A HB3  19 
ATOM 3654  H HD1  . PHE A 1 8   ? 15.340  4.512   -8.679  1.00 0.00 ? 8   PHE A HD1  19 
ATOM 3655  H HD2  . PHE A 1 8   ? 19.533  3.686   -9.108  1.00 0.00 ? 8   PHE A HD2  19 
ATOM 3656  H HE1  . PHE A 1 8   ? 15.506  4.088   -6.240  1.00 0.00 ? 8   PHE A HE1  19 
ATOM 3657  H HE2  . PHE A 1 8   ? 19.700  3.261   -6.670  1.00 0.00 ? 8   PHE A HE2  19 
ATOM 3658  H HZ   . PHE A 1 8   ? 17.685  3.462   -5.237  1.00 0.00 ? 8   PHE A HZ   19 
ATOM 3659  N N    . SER A 1 9   ? 15.777  6.150   -13.068 1.00 0.00 ? 9   SER A N    19 
ATOM 3660  C CA   . SER A 1 9   ? 16.067  6.929   -14.305 1.00 0.00 ? 9   SER A CA   19 
ATOM 3661  C C    . SER A 1 9   ? 15.140  8.144   -14.361 1.00 0.00 ? 9   SER A C    19 
ATOM 3662  O O    . SER A 1 9   ? 15.582  9.275   -14.399 1.00 0.00 ? 9   SER A O    19 
ATOM 3663  C CB   . SER A 1 9   ? 15.829  6.047   -15.532 1.00 0.00 ? 9   SER A CB   19 
ATOM 3664  O OG   . SER A 1 9   ? 14.529  6.299   -16.047 1.00 0.00 ? 9   SER A OG   19 
ATOM 3665  H H    . SER A 1 9   ? 14.983  5.578   -13.024 1.00 0.00 ? 9   SER A H    19 
ATOM 3666  H HA   . SER A 1 9   ? 17.094  7.259   -14.291 1.00 0.00 ? 9   SER A HA   19 
ATOM 3667  H HB2  . SER A 1 9   ? 16.560  6.275   -16.289 1.00 0.00 ? 9   SER A HB2  19 
ATOM 3668  H HB3  . SER A 1 9   ? 15.920  5.006   -15.250 1.00 0.00 ? 9   SER A HB3  19 
ATOM 3669  H HG   . SER A 1 9   ? 14.200  5.486   -16.436 1.00 0.00 ? 9   SER A HG   19 
ATOM 3670  N N    . SER A 1 10  ? 13.854  7.917   -14.361 1.00 0.00 ? 10  SER A N    19 
ATOM 3671  C CA   . SER A 1 10  ? 12.897  9.056   -14.408 1.00 0.00 ? 10  SER A CA   19 
ATOM 3672  C C    . SER A 1 10  ? 12.103  9.099   -13.101 1.00 0.00 ? 10  SER A C    19 
ATOM 3673  O O    . SER A 1 10  ? 11.995  8.116   -12.397 1.00 0.00 ? 10  SER A O    19 
ATOM 3674  C CB   . SER A 1 10  ? 11.936  8.869   -15.582 1.00 0.00 ? 10  SER A CB   19 
ATOM 3675  O OG   . SER A 1 10  ? 10.737  8.262   -15.116 1.00 0.00 ? 10  SER A OG   19 
ATOM 3676  H H    . SER A 1 10  ? 13.520  6.997   -14.326 1.00 0.00 ? 10  SER A H    19 
ATOM 3677  H HA   . SER A 1 10  ? 13.440  9.981   -14.530 1.00 0.00 ? 10  SER A HA   19 
ATOM 3678  H HB2  . SER A 1 10  ? 11.703  9.827   -16.016 1.00 0.00 ? 10  SER A HB2  19 
ATOM 3679  H HB3  . SER A 1 10  ? 12.402  8.241   -16.331 1.00 0.00 ? 10  SER A HB3  19 
ATOM 3680  H HG   . SER A 1 10  ? 10.845  7.310   -15.174 1.00 0.00 ? 10  SER A HG   19 
ATOM 3681  N N    . THR A 1 11  ? 11.548  10.231  -12.769 1.00 0.00 ? 11  THR A N    19 
ATOM 3682  C CA   . THR A 1 11  ? 10.765  10.334  -11.507 1.00 0.00 ? 11  THR A CA   19 
ATOM 3683  C C    . THR A 1 11  ? 9.277   10.208  -11.822 1.00 0.00 ? 11  THR A C    19 
ATOM 3684  O O    . THR A 1 11  ? 8.485   9.803   -10.994 1.00 0.00 ? 11  THR A O    19 
ATOM 3685  C CB   . THR A 1 11  ? 11.037  11.688  -10.853 1.00 0.00 ? 11  THR A CB   19 
ATOM 3686  O OG1  . THR A 1 11  ? 11.806  12.492  -11.738 1.00 0.00 ? 11  THR A OG1  19 
ATOM 3687  C CG2  . THR A 1 11  ? 11.808  11.482  -9.548  1.00 0.00 ? 11  THR A CG2  19 
ATOM 3688  H H    . THR A 1 11  ? 11.646  11.016  -13.348 1.00 0.00 ? 11  THR A H    19 
ATOM 3689  H HA   . THR A 1 11  ? 11.056  9.544   -10.841 1.00 0.00 ? 11  THR A HA   19 
ATOM 3690  H HB   . THR A 1 11  ? 10.101  12.179  -10.642 1.00 0.00 ? 11  THR A HB   19 
ATOM 3691  H HG1  . THR A 1 11  ? 12.733  12.285  -11.597 1.00 0.00 ? 11  THR A HG1  19 
ATOM 3692  H HG21 . THR A 1 11  ? 11.577  10.509  -9.142  1.00 0.00 ? 11  THR A HG21 19 
ATOM 3693  H HG22 . THR A 1 11  ? 12.869  11.548  -9.743  1.00 0.00 ? 11  THR A HG22 19 
ATOM 3694  H HG23 . THR A 1 11  ? 11.525  12.246  -8.839  1.00 0.00 ? 11  THR A HG23 19 
ATOM 3695  N N    . GLU A 1 12  ? 8.904   10.553  -13.016 1.00 0.00 ? 12  GLU A N    19 
ATOM 3696  C CA   . GLU A 1 12  ? 7.470   10.466  -13.422 1.00 0.00 ? 12  GLU A CA   19 
ATOM 3697  C C    . GLU A 1 12  ? 6.576   10.943  -12.276 1.00 0.00 ? 12  GLU A C    19 
ATOM 3698  O O    . GLU A 1 12  ? 7.029   11.576  -11.343 1.00 0.00 ? 12  GLU A O    19 
ATOM 3699  C CB   . GLU A 1 12  ? 7.122   9.018   -13.781 1.00 0.00 ? 12  GLU A CB   19 
ATOM 3700  C CG   . GLU A 1 12  ? 7.418   8.103   -12.591 1.00 0.00 ? 12  GLU A CG   19 
ATOM 3701  C CD   . GLU A 1 12  ? 6.835   6.713   -12.859 1.00 0.00 ? 12  GLU A CD   19 
ATOM 3702  O OE1  . GLU A 1 12  ? 6.490   6.447   -13.999 1.00 0.00 ? 12  GLU A OE1  19 
ATOM 3703  O OE2  . GLU A 1 12  ? 6.744   5.940   -11.920 1.00 0.00 ? 12  GLU A OE2  19 
ATOM 3704  H H    . GLU A 1 12  ? 9.573   10.871  -13.652 1.00 0.00 ? 12  GLU A H    19 
ATOM 3705  H HA   . GLU A 1 12  ? 7.307   11.096  -14.286 1.00 0.00 ? 12  GLU A HA   19 
ATOM 3706  H HB2  . GLU A 1 12  ? 6.074   8.953   -14.033 1.00 0.00 ? 12  GLU A HB2  19 
ATOM 3707  H HB3  . GLU A 1 12  ? 7.715   8.706   -14.628 1.00 0.00 ? 12  GLU A HB3  19 
ATOM 3708  H HG2  . GLU A 1 12  ? 8.485   8.025   -12.453 1.00 0.00 ? 12  GLU A HG2  19 
ATOM 3709  H HG3  . GLU A 1 12  ? 6.966   8.514   -11.701 1.00 0.00 ? 12  GLU A HG3  19 
ATOM 3710  N N    . LYS A 1 13  ? 5.306   10.650  -12.340 1.00 0.00 ? 13  LYS A N    19 
ATOM 3711  C CA   . LYS A 1 13  ? 4.383   11.090  -11.256 1.00 0.00 ? 13  LYS A CA   19 
ATOM 3712  C C    . LYS A 1 13  ? 3.453   9.936   -10.875 1.00 0.00 ? 13  LYS A C    19 
ATOM 3713  O O    . LYS A 1 13  ? 2.294   10.138  -10.570 1.00 0.00 ? 13  LYS A O    19 
ATOM 3714  C CB   . LYS A 1 13  ? 3.550   12.276  -11.747 1.00 0.00 ? 13  LYS A CB   19 
ATOM 3715  C CG   . LYS A 1 13  ? 2.961   13.020  -10.546 1.00 0.00 ? 13  LYS A CG   19 
ATOM 3716  C CD   . LYS A 1 13  ? 4.084   13.722  -9.779  1.00 0.00 ? 13  LYS A CD   19 
ATOM 3717  C CE   . LYS A 1 13  ? 3.804   15.225  -9.725  1.00 0.00 ? 13  LYS A CE   19 
ATOM 3718  N NZ   . LYS A 1 13  ? 3.449   15.615  -8.331  1.00 0.00 ? 13  LYS A NZ   19 
ATOM 3719  H H    . LYS A 1 13  ? 4.958   10.143  -13.103 1.00 0.00 ? 13  LYS A H    19 
ATOM 3720  H HA   . LYS A 1 13  ? 4.959   11.388  -10.392 1.00 0.00 ? 13  LYS A HA   19 
ATOM 3721  H HB2  . LYS A 1 13  ? 4.179   12.947  -12.314 1.00 0.00 ? 13  LYS A HB2  19 
ATOM 3722  H HB3  . LYS A 1 13  ? 2.747   11.918  -12.374 1.00 0.00 ? 13  LYS A HB3  19 
ATOM 3723  H HG2  . LYS A 1 13  ? 2.247   13.753  -10.892 1.00 0.00 ? 13  LYS A HG2  19 
ATOM 3724  H HG3  . LYS A 1 13  ? 2.468   12.316  -9.892  1.00 0.00 ? 13  LYS A HG3  19 
ATOM 3725  H HD2  . LYS A 1 13  ? 4.135   13.328  -8.774  1.00 0.00 ? 13  LYS A HD2  19 
ATOM 3726  H HD3  . LYS A 1 13  ? 5.024   13.551  -10.281 1.00 0.00 ? 13  LYS A HD3  19 
ATOM 3727  H HE2  . LYS A 1 13  ? 4.684   15.767  -10.038 1.00 0.00 ? 13  LYS A HE2  19 
ATOM 3728  H HE3  . LYS A 1 13  ? 2.983   15.461  -10.386 1.00 0.00 ? 13  LYS A HE3  19 
ATOM 3729  H HZ1  . LYS A 1 13  ? 4.039   15.081  -7.662  1.00 0.00 ? 13  LYS A HZ1  19 
ATOM 3730  H HZ2  . LYS A 1 13  ? 3.613   16.633  -8.203  1.00 0.00 ? 13  LYS A HZ2  19 
ATOM 3731  H HZ3  . LYS A 1 13  ? 2.447   15.403  -8.156  1.00 0.00 ? 13  LYS A HZ3  19 
ATOM 3732  N N    . ASN A 1 14  ? 3.946   8.727   -10.894 1.00 0.00 ? 14  ASN A N    19 
ATOM 3733  C CA   . ASN A 1 14  ? 3.080   7.568   -10.536 1.00 0.00 ? 14  ASN A CA   19 
ATOM 3734  C C    . ASN A 1 14  ? 3.834   6.622   -9.596  1.00 0.00 ? 14  ASN A C    19 
ATOM 3735  O O    . ASN A 1 14  ? 4.963   6.868   -9.224  1.00 0.00 ? 14  ASN A O    19 
ATOM 3736  C CB   . ASN A 1 14  ? 2.689   6.812   -11.808 1.00 0.00 ? 14  ASN A CB   19 
ATOM 3737  C CG   . ASN A 1 14  ? 2.255   7.811   -12.882 1.00 0.00 ? 14  ASN A CG   19 
ATOM 3738  O OD1  . ASN A 1 14  ? 2.938   7.992   -13.871 1.00 0.00 ? 14  ASN A OD1  19 
ATOM 3739  N ND2  . ASN A 1 14  ? 1.139   8.471   -12.731 1.00 0.00 ? 14  ASN A ND2  19 
ATOM 3740  H H    . ASN A 1 14  ? 4.882   8.582   -11.147 1.00 0.00 ? 14  ASN A H    19 
ATOM 3741  H HA   . ASN A 1 14  ? 2.187   7.926   -10.044 1.00 0.00 ? 14  ASN A HA   19 
ATOM 3742  H HB2  . ASN A 1 14  ? 3.537   6.245   -12.164 1.00 0.00 ? 14  ASN A HB2  19 
ATOM 3743  H HB3  . ASN A 1 14  ? 1.872   6.142   -11.592 1.00 0.00 ? 14  ASN A HB3  19 
ATOM 3744  H HD21 . ASN A 1 14  ? 0.589   8.324   -11.933 1.00 0.00 ? 14  ASN A HD21 19 
ATOM 3745  H HD22 . ASN A 1 14  ? 0.853   9.113   -13.413 1.00 0.00 ? 14  ASN A HD22 19 
ATOM 3746  N N    . CYS A 1 15  ? 3.209   5.540   -9.217  1.00 0.00 ? 15  CYS A N    19 
ATOM 3747  C CA   . CYS A 1 15  ? 3.873   4.566   -8.304  1.00 0.00 ? 15  CYS A CA   19 
ATOM 3748  C C    . CYS A 1 15  ? 5.310   4.319   -8.771  1.00 0.00 ? 15  CYS A C    19 
ATOM 3749  O O    . CYS A 1 15  ? 5.557   3.522   -9.654  1.00 0.00 ? 15  CYS A O    19 
ATOM 3750  C CB   . CYS A 1 15  ? 3.092   3.248   -8.335  1.00 0.00 ? 15  CYS A CB   19 
ATOM 3751  S SG   . CYS A 1 15  ? 4.042   1.942   -7.512  1.00 0.00 ? 15  CYS A SG   19 
ATOM 3752  H H    . CYS A 1 15  ? 2.300   5.368   -9.534  1.00 0.00 ? 15  CYS A H    19 
ATOM 3753  H HA   . CYS A 1 15  ? 3.881   4.958   -7.298  1.00 0.00 ? 15  CYS A HA   19 
ATOM 3754  H HB2  . CYS A 1 15  ? 2.145   3.376   -7.835  1.00 0.00 ? 15  CYS A HB2  19 
ATOM 3755  H HB3  . CYS A 1 15  ? 2.913   2.966   -9.362  1.00 0.00 ? 15  CYS A HB3  19 
ATOM 3756  N N    . CYS A 1 16  ? 6.262   4.994   -8.183  1.00 0.00 ? 16  CYS A N    19 
ATOM 3757  C CA   . CYS A 1 16  ? 7.680   4.791   -8.596  1.00 0.00 ? 16  CYS A CA   19 
ATOM 3758  C C    . CYS A 1 16  ? 8.564   4.678   -7.350  1.00 0.00 ? 16  CYS A C    19 
ATOM 3759  O O    . CYS A 1 16  ? 8.667   5.601   -6.566  1.00 0.00 ? 16  CYS A O    19 
ATOM 3760  C CB   . CYS A 1 16  ? 8.146   5.977   -9.441  1.00 0.00 ? 16  CYS A CB   19 
ATOM 3761  S SG   . CYS A 1 16  ? 9.355   5.415   -10.671 1.00 0.00 ? 16  CYS A SG   19 
ATOM 3762  H H    . CYS A 1 16  ? 6.044   5.631   -7.471  1.00 0.00 ? 16  CYS A H    19 
ATOM 3763  H HA   . CYS A 1 16  ? 7.756   3.882   -9.175  1.00 0.00 ? 16  CYS A HA   19 
ATOM 3764  H HB2  . CYS A 1 16  ? 7.298   6.414   -9.946  1.00 0.00 ? 16  CYS A HB2  19 
ATOM 3765  H HB3  . CYS A 1 16  ? 8.604   6.717   -8.800  1.00 0.00 ? 16  CYS A HB3  19 
ATOM 3766  N N    . VAL A 1 17  ? 9.199   3.555   -7.162  1.00 0.00 ? 17  VAL A N    19 
ATOM 3767  C CA   . VAL A 1 17  ? 10.073  3.380   -5.969  1.00 0.00 ? 17  VAL A CA   19 
ATOM 3768  C C    . VAL A 1 17  ? 11.195  4.423   -5.989  1.00 0.00 ? 17  VAL A C    19 
ATOM 3769  O O    . VAL A 1 17  ? 11.967  4.496   -6.921  1.00 0.00 ? 17  VAL A O    19 
ATOM 3770  C CB   . VAL A 1 17  ? 10.688  1.981   -5.995  1.00 0.00 ? 17  VAL A CB   19 
ATOM 3771  C CG1  . VAL A 1 17  ? 11.742  1.910   -7.092  1.00 0.00 ? 17  VAL A CG1  19 
ATOM 3772  C CG2  . VAL A 1 17  ? 11.354  1.690   -4.654  1.00 0.00 ? 17  VAL A CG2  19 
ATOM 3773  H H    . VAL A 1 17  ? 9.097   2.822   -7.805  1.00 0.00 ? 17  VAL A H    19 
ATOM 3774  H HA   . VAL A 1 17  ? 9.485   3.499   -5.073  1.00 0.00 ? 17  VAL A HA   19 
ATOM 3775  H HB   . VAL A 1 17  ? 9.919   1.249   -6.187  1.00 0.00 ? 17  VAL A HB   19 
ATOM 3776  H HG11 . VAL A 1 17  ? 11.333  2.299   -8.010  1.00 0.00 ? 17  VAL A HG11 19 
ATOM 3777  H HG12 . VAL A 1 17  ? 12.601  2.498   -6.800  1.00 0.00 ? 17  VAL A HG12 19 
ATOM 3778  H HG13 . VAL A 1 17  ? 12.041  0.883   -7.234  1.00 0.00 ? 17  VAL A HG13 19 
ATOM 3779  H HG21 . VAL A 1 17  ? 11.761  2.606   -4.251  1.00 0.00 ? 17  VAL A HG21 19 
ATOM 3780  H HG22 . VAL A 1 17  ? 10.623  1.287   -3.970  1.00 0.00 ? 17  VAL A HG22 19 
ATOM 3781  H HG23 . VAL A 1 17  ? 12.150  0.975   -4.799  1.00 0.00 ? 17  VAL A HG23 19 
ATOM 3782  N N    . ARG A 1 18  ? 11.300  5.225   -4.967  1.00 0.00 ? 18  ARG A N    19 
ATOM 3783  C CA   . ARG A 1 18  ? 12.381  6.251   -4.939  1.00 0.00 ? 18  ARG A CA   19 
ATOM 3784  C C    . ARG A 1 18  ? 13.509  5.784   -4.016  1.00 0.00 ? 18  ARG A C    19 
ATOM 3785  O O    . ARG A 1 18  ? 13.297  5.011   -3.103  1.00 0.00 ? 18  ARG A O    19 
ATOM 3786  C CB   . ARG A 1 18  ? 11.813  7.576   -4.426  1.00 0.00 ? 18  ARG A CB   19 
ATOM 3787  C CG   . ARG A 1 18  ? 11.354  8.426   -5.613  1.00 0.00 ? 18  ARG A CG   19 
ATOM 3788  C CD   . ARG A 1 18  ? 10.649  9.683   -5.101  1.00 0.00 ? 18  ARG A CD   19 
ATOM 3789  N NE   . ARG A 1 18  ? 9.373   9.877   -5.848  1.00 0.00 ? 18  ARG A NE   19 
ATOM 3790  C CZ   . ARG A 1 18  ? 9.374   9.888   -7.152  1.00 0.00 ? 18  ARG A CZ   19 
ATOM 3791  N NH1  . ARG A 1 18  ? 9.656   10.988  -7.794  1.00 0.00 ? 18  ARG A NH1  19 
ATOM 3792  N NH2  . ARG A 1 18  ? 9.092   8.800   -7.816  1.00 0.00 ? 18  ARG A NH2  19 
ATOM 3793  H H    . ARG A 1 18  ? 10.673  5.150   -4.217  1.00 0.00 ? 18  ARG A H    19 
ATOM 3794  H HA   . ARG A 1 18  ? 12.770  6.390   -5.938  1.00 0.00 ? 18  ARG A HA   19 
ATOM 3795  H HB2  . ARG A 1 18  ? 10.972  7.379   -3.776  1.00 0.00 ? 18  ARG A HB2  19 
ATOM 3796  H HB3  . ARG A 1 18  ? 12.576  8.109   -3.878  1.00 0.00 ? 18  ARG A HB3  19 
ATOM 3797  H HG2  . ARG A 1 18  ? 12.212  8.709   -6.204  1.00 0.00 ? 18  ARG A HG2  19 
ATOM 3798  H HG3  . ARG A 1 18  ? 10.669  7.855   -6.220  1.00 0.00 ? 18  ARG A HG3  19 
ATOM 3799  H HD2  . ARG A 1 18  ? 10.437  9.574   -4.048  1.00 0.00 ? 18  ARG A HD2  19 
ATOM 3800  H HD3  . ARG A 1 18  ? 11.288  10.541  -5.253  1.00 0.00 ? 18  ARG A HD3  19 
ATOM 3801  H HE   . ARG A 1 18  ? 8.534   9.997   -5.359  1.00 0.00 ? 18  ARG A HE   19 
ATOM 3802  H HH11 . ARG A 1 18  ? 9.873   11.822  -7.287  1.00 0.00 ? 18  ARG A HH11 19 
ATOM 3803  H HH12 . ARG A 1 18  ? 9.652   10.998  -8.794  1.00 0.00 ? 18  ARG A HH12 19 
ATOM 3804  H HH21 . ARG A 1 18  ? 8.875   7.957   -7.324  1.00 0.00 ? 18  ARG A HH21 19 
ATOM 3805  H HH22 . ARG A 1 18  ? 9.093   8.809   -8.816  1.00 0.00 ? 18  ARG A HH22 19 
ATOM 3806  N N    . GLN A 1 19  ? 14.710  6.243   -4.245  1.00 0.00 ? 19  GLN A N    19 
ATOM 3807  C CA   . GLN A 1 19  ? 15.847  5.824   -3.377  1.00 0.00 ? 19  GLN A CA   19 
ATOM 3808  C C    . GLN A 1 19  ? 15.556  6.228   -1.933  1.00 0.00 ? 19  GLN A C    19 
ATOM 3809  O O    . GLN A 1 19  ? 14.996  7.274   -1.672  1.00 0.00 ? 19  GLN A O    19 
ATOM 3810  C CB   . GLN A 1 19  ? 17.130  6.509   -3.852  1.00 0.00 ? 19  GLN A CB   19 
ATOM 3811  C CG   . GLN A 1 19  ? 17.051  8.007   -3.552  1.00 0.00 ? 19  GLN A CG   19 
ATOM 3812  C CD   . GLN A 1 19  ? 17.698  8.791   -4.694  1.00 0.00 ? 19  GLN A CD   19 
ATOM 3813  O OE1  . GLN A 1 19  ? 18.027  8.232   -5.721  1.00 0.00 ? 19  GLN A OE1  19 
ATOM 3814  N NE2  . GLN A 1 19  ? 17.899  10.073  -4.558  1.00 0.00 ? 19  GLN A NE2  19 
ATOM 3815  H H    . GLN A 1 19  ? 14.862  6.866   -4.986  1.00 0.00 ? 19  GLN A H    19 
ATOM 3816  H HA   . GLN A 1 19  ? 15.970  4.753   -3.431  1.00 0.00 ? 19  GLN A HA   19 
ATOM 3817  H HB2  . GLN A 1 19  ? 17.978  6.082   -3.337  1.00 0.00 ? 19  GLN A HB2  19 
ATOM 3818  H HB3  . GLN A 1 19  ? 17.243  6.363   -4.916  1.00 0.00 ? 19  GLN A HB3  19 
ATOM 3819  H HG2  . GLN A 1 19  ? 16.014  8.299   -3.455  1.00 0.00 ? 19  GLN A HG2  19 
ATOM 3820  H HG3  . GLN A 1 19  ? 17.572  8.218   -2.631  1.00 0.00 ? 19  GLN A HG3  19 
ATOM 3821  H HE21 . GLN A 1 19  ? 17.633  10.525  -3.730  1.00 0.00 ? 19  GLN A HE21 19 
ATOM 3822  H HE22 . GLN A 1 19  ? 18.314  10.585  -5.283  1.00 0.00 ? 19  GLN A HE22 19 
ATOM 3823  N N    . LEU A 1 20  ? 15.923  5.406   -0.989  1.00 0.00 ? 20  LEU A N    19 
ATOM 3824  C CA   . LEU A 1 20  ? 15.656  5.752   0.433   1.00 0.00 ? 20  LEU A CA   19 
ATOM 3825  C C    . LEU A 1 20  ? 16.654  5.042   1.344   1.00 0.00 ? 20  LEU A C    19 
ATOM 3826  O O    . LEU A 1 20  ? 16.283  4.462   2.343   1.00 0.00 ? 20  LEU A O    19 
ATOM 3827  C CB   . LEU A 1 20  ? 14.242  5.313   0.807   1.00 0.00 ? 20  LEU A CB   19 
ATOM 3828  C CG   . LEU A 1 20  ? 13.878  5.874   2.183   1.00 0.00 ? 20  LEU A CG   19 
ATOM 3829  C CD1  . LEU A 1 20  ? 13.768  7.395   2.102   1.00 0.00 ? 20  LEU A CD1  19 
ATOM 3830  C CD2  . LEU A 1 20  ? 12.536  5.290   2.629   1.00 0.00 ? 20  LEU A CD2  19 
ATOM 3831  H H    . LEU A 1 20  ? 16.371  4.565   -1.216  1.00 0.00 ? 20  LEU A H    19 
ATOM 3832  H HA   . LEU A 1 20  ? 15.743  6.819   0.564   1.00 0.00 ? 20  LEU A HA   19 
ATOM 3833  H HB2  . LEU A 1 20  ? 13.551  5.686   0.073   1.00 0.00 ? 20  LEU A HB2  19 
ATOM 3834  H HB3  . LEU A 1 20  ? 14.195  4.235   0.835   1.00 0.00 ? 20  LEU A HB3  19 
ATOM 3835  H HG   . LEU A 1 20  ? 14.642  5.607   2.897   1.00 0.00 ? 20  LEU A HG   19 
ATOM 3836  H HD11 . LEU A 1 20  ? 13.786  7.703   1.067   1.00 0.00 ? 20  LEU A HD11 19 
ATOM 3837  H HD12 . LEU A 1 20  ? 12.843  7.715   2.558   1.00 0.00 ? 20  LEU A HD12 19 
ATOM 3838  H HD13 . LEU A 1 20  ? 14.600  7.844   2.626   1.00 0.00 ? 20  LEU A HD13 19 
ATOM 3839  H HD21 . LEU A 1 20  ? 12.435  4.286   2.246   1.00 0.00 ? 20  LEU A HD21 19 
ATOM 3840  H HD22 . LEU A 1 20  ? 12.495  5.270   3.707   1.00 0.00 ? 20  LEU A HD22 19 
ATOM 3841  H HD23 . LEU A 1 20  ? 11.733  5.903   2.249   1.00 0.00 ? 20  LEU A HD23 19 
ATOM 3842  N N    . TYR A 1 21  ? 17.917  5.079   1.023   1.00 0.00 ? 21  TYR A N    19 
ATOM 3843  C CA   . TYR A 1 21  ? 18.902  4.399   1.908   1.00 0.00 ? 21  TYR A CA   19 
ATOM 3844  C C    . TYR A 1 21  ? 18.613  4.802   3.352   1.00 0.00 ? 21  TYR A C    19 
ATOM 3845  O O    . TYR A 1 21  ? 18.267  5.933   3.631   1.00 0.00 ? 21  TYR A O    19 
ATOM 3846  C CB   . TYR A 1 21  ? 20.327  4.816   1.550   1.00 0.00 ? 21  TYR A CB   19 
ATOM 3847  C CG   . TYR A 1 21  ? 21.279  4.139   2.508   1.00 0.00 ? 21  TYR A CG   19 
ATOM 3848  C CD1  . TYR A 1 21  ? 21.375  4.585   3.832   1.00 0.00 ? 21  TYR A CD1  19 
ATOM 3849  C CD2  . TYR A 1 21  ? 22.055  3.059   2.075   1.00 0.00 ? 21  TYR A CD2  19 
ATOM 3850  C CE1  . TYR A 1 21  ? 22.249  3.951   4.724   1.00 0.00 ? 21  TYR A CE1  19 
ATOM 3851  C CE2  . TYR A 1 21  ? 22.928  2.423   2.967   1.00 0.00 ? 21  TYR A CE2  19 
ATOM 3852  C CZ   . TYR A 1 21  ? 23.025  2.868   4.292   1.00 0.00 ? 21  TYR A CZ   19 
ATOM 3853  O OH   . TYR A 1 21  ? 23.886  2.242   5.169   1.00 0.00 ? 21  TYR A OH   19 
ATOM 3854  H H    . TYR A 1 21  ? 18.211  5.551   0.216   1.00 0.00 ? 21  TYR A H    19 
ATOM 3855  H HA   . TYR A 1 21  ? 18.802  3.327   1.805   1.00 0.00 ? 21  TYR A HA   19 
ATOM 3856  H HB2  . TYR A 1 21  ? 20.550  4.512   0.537   1.00 0.00 ? 21  TYR A HB2  19 
ATOM 3857  H HB3  . TYR A 1 21  ? 20.426  5.887   1.638   1.00 0.00 ? 21  TYR A HB3  19 
ATOM 3858  H HD1  . TYR A 1 21  ? 20.776  5.420   4.165   1.00 0.00 ? 21  TYR A HD1  19 
ATOM 3859  H HD2  . TYR A 1 21  ? 21.980  2.715   1.054   1.00 0.00 ? 21  TYR A HD2  19 
ATOM 3860  H HE1  . TYR A 1 21  ? 22.321  4.293   5.748   1.00 0.00 ? 21  TYR A HE1  19 
ATOM 3861  H HE2  . TYR A 1 21  ? 23.527  1.587   2.634   1.00 0.00 ? 21  TYR A HE2  19 
ATOM 3862  H HH   . TYR A 1 21  ? 24.442  1.646   4.664   1.00 0.00 ? 21  TYR A HH   19 
ATOM 3863  N N    . ILE A 1 22  ? 18.743  3.894   4.274   1.00 0.00 ? 22  ILE A N    19 
ATOM 3864  C CA   . ILE A 1 22  ? 18.463  4.242   5.693   1.00 0.00 ? 22  ILE A CA   19 
ATOM 3865  C C    . ILE A 1 22  ? 19.590  3.727   6.588   1.00 0.00 ? 22  ILE A C    19 
ATOM 3866  O O    . ILE A 1 22  ? 19.792  2.536   6.722   1.00 0.00 ? 22  ILE A O    19 
ATOM 3867  C CB   . ILE A 1 22  ? 17.143  3.603   6.125   1.00 0.00 ? 22  ILE A CB   19 
ATOM 3868  C CG1  . ILE A 1 22  ? 16.021  4.063   5.192   1.00 0.00 ? 22  ILE A CG1  19 
ATOM 3869  C CG2  . ILE A 1 22  ? 16.821  4.025   7.559   1.00 0.00 ? 22  ILE A CG2  19 
ATOM 3870  C CD1  . ILE A 1 22  ? 14.664  3.705   5.802   1.00 0.00 ? 22  ILE A CD1  19 
ATOM 3871  H H    . ILE A 1 22  ? 19.018  2.985   4.036   1.00 0.00 ? 22  ILE A H    19 
ATOM 3872  H HA   . ILE A 1 22  ? 18.390  5.315   5.791   1.00 0.00 ? 22  ILE A HA   19 
ATOM 3873  H HB   . ILE A 1 22  ? 17.234  2.526   6.079   1.00 0.00 ? 22  ILE A HB   19 
ATOM 3874  H HG12 . ILE A 1 22  ? 16.083  5.134   5.054   1.00 0.00 ? 22  ILE A HG12 19 
ATOM 3875  H HG13 . ILE A 1 22  ? 16.123  3.571   4.237   1.00 0.00 ? 22  ILE A HG13 19 
ATOM 3876  H HG21 . ILE A 1 22  ? 17.738  4.102   8.125   1.00 0.00 ? 22  ILE A HG21 19 
ATOM 3877  H HG22 . ILE A 1 22  ? 16.322  4.983   7.548   1.00 0.00 ? 22  ILE A HG22 19 
ATOM 3878  H HG23 . ILE A 1 22  ? 16.177  3.288   8.015   1.00 0.00 ? 22  ILE A HG23 19 
ATOM 3879  H HD11 . ILE A 1 22  ? 14.579  4.156   6.780   1.00 0.00 ? 22  ILE A HD11 19 
ATOM 3880  H HD12 . ILE A 1 22  ? 13.872  4.075   5.166   1.00 0.00 ? 22  ILE A HD12 19 
ATOM 3881  H HD13 . ILE A 1 22  ? 14.581  2.632   5.892   1.00 0.00 ? 22  ILE A HD13 19 
ATOM 3882  N N    . ASP A 1 23  ? 20.313  4.611   7.217   1.00 0.00 ? 23  ASP A N    19 
ATOM 3883  C CA   . ASP A 1 23  ? 21.408  4.164   8.118   1.00 0.00 ? 23  ASP A CA   19 
ATOM 3884  C C    . ASP A 1 23  ? 20.803  3.850   9.481   1.00 0.00 ? 23  ASP A C    19 
ATOM 3885  O O    . ASP A 1 23  ? 20.560  4.729   10.275  1.00 0.00 ? 23  ASP A O    19 
ATOM 3886  C CB   . ASP A 1 23  ? 22.462  5.263   8.244   1.00 0.00 ? 23  ASP A CB   19 
ATOM 3887  C CG   . ASP A 1 23  ? 23.420  4.932   9.392   1.00 0.00 ? 23  ASP A CG   19 
ATOM 3888  O OD1  . ASP A 1 23  ? 23.330  3.833   9.915   1.00 0.00 ? 23  ASP A OD1  19 
ATOM 3889  O OD2  . ASP A 1 23  ? 24.230  5.781   9.724   1.00 0.00 ? 23  ASP A OD2  19 
ATOM 3890  H H    . ASP A 1 23  ? 20.127  5.568   7.108   1.00 0.00 ? 23  ASP A H    19 
ATOM 3891  H HA   . ASP A 1 23  ? 21.864  3.273   7.720   1.00 0.00 ? 23  ASP A HA   19 
ATOM 3892  H HB2  . ASP A 1 23  ? 23.018  5.333   7.320   1.00 0.00 ? 23  ASP A HB2  19 
ATOM 3893  H HB3  . ASP A 1 23  ? 21.977  6.201   8.440   1.00 0.00 ? 23  ASP A HB3  19 
ATOM 3894  N N    . PHE A 1 24  ? 20.545  2.592   9.721   1.00 0.00 ? 24  PHE A N    19 
ATOM 3895  C CA   . PHE A 1 24  ? 19.930  2.124   11.006  1.00 0.00 ? 24  PHE A CA   19 
ATOM 3896  C C    . PHE A 1 24  ? 19.887  3.224   12.073  1.00 0.00 ? 24  PHE A C    19 
ATOM 3897  O O    . PHE A 1 24  ? 18.834  3.572   12.573  1.00 0.00 ? 24  PHE A O    19 
ATOM 3898  C CB   . PHE A 1 24  ? 20.746  0.946   11.543  1.00 0.00 ? 24  PHE A CB   19 
ATOM 3899  C CG   . PHE A 1 24  ? 20.189  -0.338  10.980  1.00 0.00 ? 24  PHE A CG   19 
ATOM 3900  C CD1  . PHE A 1 24  ? 18.924  -0.778  11.376  1.00 0.00 ? 24  PHE A CD1  19 
ATOM 3901  C CD2  . PHE A 1 24  ? 20.931  -1.080  10.055  1.00 0.00 ? 24  PHE A CD2  19 
ATOM 3902  C CE1  . PHE A 1 24  ? 18.397  -1.957  10.847  1.00 0.00 ? 24  PHE A CE1  19 
ATOM 3903  C CE2  . PHE A 1 24  ? 20.404  -2.265  9.528   1.00 0.00 ? 24  PHE A CE2  19 
ATOM 3904  C CZ   . PHE A 1 24  ? 19.136  -2.704  9.924   1.00 0.00 ? 24  PHE A CZ   19 
ATOM 3905  H H    . PHE A 1 24  ? 20.749  1.930   9.028   1.00 0.00 ? 24  PHE A H    19 
ATOM 3906  H HA   . PHE A 1 24  ? 18.924  1.786   10.810  1.00 0.00 ? 24  PHE A HA   19 
ATOM 3907  H HB2  . PHE A 1 24  ? 21.779  1.055   11.243  1.00 0.00 ? 24  PHE A HB2  19 
ATOM 3908  H HB3  . PHE A 1 24  ? 20.683  0.924   12.621  1.00 0.00 ? 24  PHE A HB3  19 
ATOM 3909  H HD1  . PHE A 1 24  ? 18.357  -0.209  12.094  1.00 0.00 ? 24  PHE A HD1  19 
ATOM 3910  H HD2  . PHE A 1 24  ? 21.909  -0.740  9.749   1.00 0.00 ? 24  PHE A HD2  19 
ATOM 3911  H HE1  . PHE A 1 24  ? 17.420  -2.295  11.155  1.00 0.00 ? 24  PHE A HE1  19 
ATOM 3912  H HE2  . PHE A 1 24  ? 20.975  -2.844  8.821   1.00 0.00 ? 24  PHE A HE2  19 
ATOM 3913  H HZ   . PHE A 1 24  ? 18.728  -3.614  9.514   1.00 0.00 ? 24  PHE A HZ   19 
ATOM 3914  N N    . ARG A 1 25  ? 21.019  3.753   12.448  1.00 0.00 ? 25  ARG A N    19 
ATOM 3915  C CA   . ARG A 1 25  ? 21.037  4.797   13.514  1.00 0.00 ? 25  ARG A CA   19 
ATOM 3916  C C    . ARG A 1 25  ? 20.822  6.205   12.940  1.00 0.00 ? 25  ARG A C    19 
ATOM 3917  O O    . ARG A 1 25  ? 20.174  7.032   13.551  1.00 0.00 ? 25  ARG A O    19 
ATOM 3918  C CB   . ARG A 1 25  ? 22.385  4.750   14.234  1.00 0.00 ? 25  ARG A CB   19 
ATOM 3919  C CG   . ARG A 1 25  ? 22.439  3.516   15.138  1.00 0.00 ? 25  ARG A CG   19 
ATOM 3920  C CD   . ARG A 1 25  ? 23.453  2.516   14.577  1.00 0.00 ? 25  ARG A CD   19 
ATOM 3921  N NE   . ARG A 1 25  ? 24.785  2.756   15.199  1.00 0.00 ? 25  ARG A NE   19 
ATOM 3922  C CZ   . ARG A 1 25  ? 25.874  2.508   14.524  1.00 0.00 ? 25  ARG A CZ   19 
ATOM 3923  N NH1  . ARG A 1 25  ? 26.225  1.275   14.281  1.00 0.00 ? 25  ARG A NH1  19 
ATOM 3924  N NH2  . ARG A 1 25  ? 26.613  3.494   14.093  1.00 0.00 ? 25  ARG A NH2  19 
ATOM 3925  H H    . ARG A 1 25  ? 21.859  3.445   12.049  1.00 0.00 ? 25  ARG A H    19 
ATOM 3926  H HA   . ARG A 1 25  ? 20.255  4.580   14.224  1.00 0.00 ? 25  ARG A HA   19 
ATOM 3927  H HB2  . ARG A 1 25  ? 23.180  4.699   13.505  1.00 0.00 ? 25  ARG A HB2  19 
ATOM 3928  H HB3  . ARG A 1 25  ? 22.503  5.639   14.834  1.00 0.00 ? 25  ARG A HB3  19 
ATOM 3929  H HG2  . ARG A 1 25  ? 22.739  3.813   16.133  1.00 0.00 ? 25  ARG A HG2  19 
ATOM 3930  H HG3  . ARG A 1 25  ? 21.465  3.055   15.177  1.00 0.00 ? 25  ARG A HG3  19 
ATOM 3931  H HD2  . ARG A 1 25  ? 23.126  1.511   14.801  1.00 0.00 ? 25  ARG A HD2  19 
ATOM 3932  H HD3  . ARG A 1 25  ? 23.527  2.640   13.506  1.00 0.00 ? 25  ARG A HD3  19 
ATOM 3933  H HE   . ARG A 1 25  ? 24.843  3.100   16.115  1.00 0.00 ? 25  ARG A HE   19 
ATOM 3934  H HH11 . ARG A 1 25  ? 25.659  0.519   14.611  1.00 0.00 ? 25  ARG A HH11 19 
ATOM 3935  H HH12 . ARG A 1 25  ? 27.060  1.085   13.764  1.00 0.00 ? 25  ARG A HH12 19 
ATOM 3936  H HH21 . ARG A 1 25  ? 26.344  4.439   14.278  1.00 0.00 ? 25  ARG A HH21 19 
ATOM 3937  H HH22 . ARG A 1 25  ? 27.448  3.304   13.576  1.00 0.00 ? 25  ARG A HH22 19 
ATOM 3938  N N    . LYS A 1 26  ? 21.377  6.506   11.801  1.00 0.00 ? 26  LYS A N    19 
ATOM 3939  C CA   . LYS A 1 26  ? 21.212  7.884   11.242  1.00 0.00 ? 26  LYS A CA   19 
ATOM 3940  C C    . LYS A 1 26  ? 19.738  8.184   10.973  1.00 0.00 ? 26  LYS A C    19 
ATOM 3941  O O    . LYS A 1 26  ? 19.236  9.240   11.306  1.00 0.00 ? 26  LYS A O    19 
ATOM 3942  C CB   . LYS A 1 26  ? 21.969  7.989   9.923   1.00 0.00 ? 26  LYS A CB   19 
ATOM 3943  C CG   . LYS A 1 26  ? 22.488  9.416   9.739   1.00 0.00 ? 26  LYS A CG   19 
ATOM 3944  C CD   . LYS A 1 26  ? 22.735  9.679   8.251   1.00 0.00 ? 26  LYS A CD   19 
ATOM 3945  C CE   . LYS A 1 26  ? 23.342  11.070  8.070   1.00 0.00 ? 26  LYS A CE   19 
ATOM 3946  N NZ   . LYS A 1 26  ? 24.232  11.382  9.223   1.00 0.00 ? 26  LYS A NZ   19 
ATOM 3947  H H    . LYS A 1 26  ? 21.920  5.841   11.321  1.00 0.00 ? 26  LYS A H    19 
ATOM 3948  H HA   . LYS A 1 26  ? 21.608  8.606   11.940  1.00 0.00 ? 26  LYS A HA   19 
ATOM 3949  H HB2  . LYS A 1 26  ? 22.792  7.294   9.925   1.00 0.00 ? 26  LYS A HB2  19 
ATOM 3950  H HB3  . LYS A 1 26  ? 21.299  7.751   9.112   1.00 0.00 ? 26  LYS A HB3  19 
ATOM 3951  H HG2  . LYS A 1 26  ? 21.755  10.116  10.114  1.00 0.00 ? 26  LYS A HG2  19 
ATOM 3952  H HG3  . LYS A 1 26  ? 23.413  9.535   10.283  1.00 0.00 ? 26  LYS A HG3  19 
ATOM 3953  H HD2  . LYS A 1 26  ? 23.416  8.935   7.864   1.00 0.00 ? 26  LYS A HD2  19 
ATOM 3954  H HD3  . LYS A 1 26  ? 21.798  9.624   7.717   1.00 0.00 ? 26  LYS A HD3  19 
ATOM 3955  H HE2  . LYS A 1 26  ? 23.916  11.096  7.155   1.00 0.00 ? 26  LYS A HE2  19 
ATOM 3956  H HE3  . LYS A 1 26  ? 22.551  11.805  8.018   1.00 0.00 ? 26  LYS A HE3  19 
ATOM 3957  H HZ1  . LYS A 1 26  ? 24.768  10.530  9.489   1.00 0.00 ? 26  LYS A HZ1  19 
ATOM 3958  H HZ2  . LYS A 1 26  ? 24.895  12.139  8.956   1.00 0.00 ? 26  LYS A HZ2  19 
ATOM 3959  H HZ3  . LYS A 1 26  ? 23.658  11.693  10.032  1.00 0.00 ? 26  LYS A HZ3  19 
ATOM 3960  N N    . ASP A 1 27  ? 19.054  7.283   10.332  1.00 0.00 ? 27  ASP A N    19 
ATOM 3961  C CA   . ASP A 1 27  ? 17.630  7.524   9.988   1.00 0.00 ? 27  ASP A CA   19 
ATOM 3962  C C    . ASP A 1 27  ? 16.689  7.058   11.105  1.00 0.00 ? 27  ASP A C    19 
ATOM 3963  O O    . ASP A 1 27  ? 15.956  7.845   11.671  1.00 0.00 ? 27  ASP A O    19 
ATOM 3964  C CB   . ASP A 1 27  ? 17.317  6.756   8.710   1.00 0.00 ? 27  ASP A CB   19 
ATOM 3965  C CG   . ASP A 1 27  ? 17.580  7.653   7.500   1.00 0.00 ? 27  ASP A CG   19 
ATOM 3966  O OD1  . ASP A 1 27  ? 16.983  8.716   7.434   1.00 0.00 ? 27  ASP A OD1  19 
ATOM 3967  O OD2  . ASP A 1 27  ? 18.373  7.262   6.659   1.00 0.00 ? 27  ASP A OD2  19 
ATOM 3968  H H    . ASP A 1 27  ? 19.488  6.458   10.041  1.00 0.00 ? 27  ASP A H    19 
ATOM 3969  H HA   . ASP A 1 27  ? 17.479  8.578   9.811   1.00 0.00 ? 27  ASP A HA   19 
ATOM 3970  H HB2  . ASP A 1 27  ? 17.949  5.882   8.654   1.00 0.00 ? 27  ASP A HB2  19 
ATOM 3971  H HB3  . ASP A 1 27  ? 16.288  6.454   8.718   1.00 0.00 ? 27  ASP A HB3  19 
ATOM 3972  N N    . LEU A 1 28  ? 16.672  5.789   11.413  1.00 0.00 ? 28  LEU A N    19 
ATOM 3973  C CA   . LEU A 1 28  ? 15.739  5.303   12.473  1.00 0.00 ? 28  LEU A CA   19 
ATOM 3974  C C    . LEU A 1 28  ? 16.395  5.386   13.850  1.00 0.00 ? 28  LEU A C    19 
ATOM 3975  O O    . LEU A 1 28  ? 15.734  5.263   14.863  1.00 0.00 ? 28  LEU A O    19 
ATOM 3976  C CB   . LEU A 1 28  ? 15.364  3.845   12.200  1.00 0.00 ? 28  LEU A CB   19 
ATOM 3977  C CG   . LEU A 1 28  ? 14.830  3.704   10.777  1.00 0.00 ? 28  LEU A CG   19 
ATOM 3978  C CD1  . LEU A 1 28  ? 14.410  2.253   10.540  1.00 0.00 ? 28  LEU A CD1  19 
ATOM 3979  C CD2  . LEU A 1 28  ? 13.617  4.619   10.595  1.00 0.00 ? 28  LEU A CD2  19 
ATOM 3980  H H    . LEU A 1 28  ? 17.249  5.157   10.932  1.00 0.00 ? 28  LEU A H    19 
ATOM 3981  H HA   . LEU A 1 28  ? 14.843  5.906   12.466  1.00 0.00 ? 28  LEU A HA   19 
ATOM 3982  H HB2  . LEU A 1 28  ? 16.238  3.221   12.319  1.00 0.00 ? 28  LEU A HB2  19 
ATOM 3983  H HB3  . LEU A 1 28  ? 14.602  3.535   12.898  1.00 0.00 ? 28  LEU A HB3  19 
ATOM 3984  H HG   . LEU A 1 28  ? 15.603  3.978   10.073  1.00 0.00 ? 28  LEU A HG   19 
ATOM 3985  H HD11 . LEU A 1 28  ? 14.692  1.654   11.394  1.00 0.00 ? 28  LEU A HD11 19 
ATOM 3986  H HD12 . LEU A 1 28  ? 13.339  2.206   10.405  1.00 0.00 ? 28  LEU A HD12 19 
ATOM 3987  H HD13 . LEU A 1 28  ? 14.903  1.875   9.657   1.00 0.00 ? 28  LEU A HD13 19 
ATOM 3988  H HD21 . LEU A 1 28  ? 13.347  5.052   11.547  1.00 0.00 ? 28  LEU A HD21 19 
ATOM 3989  H HD22 . LEU A 1 28  ? 13.862  5.406   9.898   1.00 0.00 ? 28  LEU A HD22 19 
ATOM 3990  H HD23 . LEU A 1 28  ? 12.787  4.044   10.213  1.00 0.00 ? 28  LEU A HD23 19 
ATOM 3991  N N    . GLY A 1 29  ? 17.679  5.582   13.911  1.00 0.00 ? 29  GLY A N    19 
ATOM 3992  C CA   . GLY A 1 29  ? 18.342  5.656   15.243  1.00 0.00 ? 29  GLY A CA   19 
ATOM 3993  C C    . GLY A 1 29  ? 18.196  4.301   15.943  1.00 0.00 ? 29  GLY A C    19 
ATOM 3994  O O    . GLY A 1 29  ? 18.441  4.171   17.125  1.00 0.00 ? 29  GLY A O    19 
ATOM 3995  H H    . GLY A 1 29  ? 18.205  5.673   13.088  1.00 0.00 ? 29  GLY A H    19 
ATOM 3996  H HA2  . GLY A 1 29  ? 19.387  5.894   15.119  1.00 0.00 ? 29  GLY A HA2  19 
ATOM 3997  H HA3  . GLY A 1 29  ? 17.867  6.418   15.841  1.00 0.00 ? 29  GLY A HA3  19 
ATOM 3998  N N    . TRP A 1 30  ? 17.790  3.293   15.216  1.00 0.00 ? 30  TRP A N    19 
ATOM 3999  C CA   . TRP A 1 30  ? 17.616  1.946   15.829  1.00 0.00 ? 30  TRP A CA   19 
ATOM 4000  C C    . TRP A 1 30  ? 18.829  1.611   16.695  1.00 0.00 ? 30  TRP A C    19 
ATOM 4001  O O    . TRP A 1 30  ? 19.955  1.624   16.238  1.00 0.00 ? 30  TRP A O    19 
ATOM 4002  C CB   . TRP A 1 30  ? 17.470  0.898   14.724  1.00 0.00 ? 30  TRP A CB   19 
ATOM 4003  C CG   . TRP A 1 30  ? 16.057  0.886   14.239  1.00 0.00 ? 30  TRP A CG   19 
ATOM 4004  C CD1  . TRP A 1 30  ? 15.160  1.878   14.440  1.00 0.00 ? 30  TRP A CD1  19 
ATOM 4005  C CD2  . TRP A 1 30  ? 15.361  -0.146  13.483  1.00 0.00 ? 30  TRP A CD2  19 
ATOM 4006  N NE1  . TRP A 1 30  ? 13.959  1.523   13.854  1.00 0.00 ? 30  TRP A NE1  19 
ATOM 4007  C CE2  . TRP A 1 30  ? 14.032  0.283   13.251  1.00 0.00 ? 30  TRP A CE2  19 
ATOM 4008  C CE3  . TRP A 1 30  ? 15.750  -1.400  12.980  1.00 0.00 ? 30  TRP A CE3  19 
ATOM 4009  C CZ2  . TRP A 1 30  ? 13.122  -0.505  12.546  1.00 0.00 ? 30  TRP A CZ2  19 
ATOM 4010  C CZ3  . TRP A 1 30  ? 14.835  -2.196  12.271  1.00 0.00 ? 30  TRP A CZ3  19 
ATOM 4011  C CH2  . TRP A 1 30  ? 13.524  -1.749  12.055  1.00 0.00 ? 30  TRP A CH2  19 
ATOM 4012  H H    . TRP A 1 30  ? 17.594  3.423   14.265  1.00 0.00 ? 30  TRP A H    19 
ATOM 4013  H HA   . TRP A 1 30  ? 16.727  1.944   16.443  1.00 0.00 ? 30  TRP A HA   19 
ATOM 4014  H HB2  . TRP A 1 30  ? 18.130  1.143   13.905  1.00 0.00 ? 30  TRP A HB2  19 
ATOM 4015  H HB3  . TRP A 1 30  ? 17.726  -0.076  15.114  1.00 0.00 ? 30  TRP A HB3  19 
ATOM 4016  H HD1  . TRP A 1 30  ? 15.352  2.800   14.970  1.00 0.00 ? 30  TRP A HD1  19 
ATOM 4017  H HE1  . TRP A 1 30  ? 13.147  2.068   13.856  1.00 0.00 ? 30  TRP A HE1  19 
ATOM 4018  H HE3  . TRP A 1 30  ? 16.759  -1.753  13.140  1.00 0.00 ? 30  TRP A HE3  19 
ATOM 4019  H HZ2  . TRP A 1 30  ? 12.113  -0.155  12.384  1.00 0.00 ? 30  TRP A HZ2  19 
ATOM 4020  H HZ3  . TRP A 1 30  ? 15.143  -3.159  11.890  1.00 0.00 ? 30  TRP A HZ3  19 
ATOM 4021  H HH2  . TRP A 1 30  ? 12.825  -2.365  11.509  1.00 0.00 ? 30  TRP A HH2  19 
ATOM 4022  N N    . LYS A 1 31  ? 18.607  1.315   17.944  1.00 0.00 ? 31  LYS A N    19 
ATOM 4023  C CA   . LYS A 1 31  ? 19.729  0.985   18.849  1.00 0.00 ? 31  LYS A CA   19 
ATOM 4024  C C    . LYS A 1 31  ? 19.746  -0.520  19.121  1.00 0.00 ? 31  LYS A C    19 
ATOM 4025  O O    . LYS A 1 31  ? 20.692  -1.049  19.669  1.00 0.00 ? 31  LYS A O    19 
ATOM 4026  C CB   . LYS A 1 31  ? 19.521  1.730   20.159  1.00 0.00 ? 31  LYS A CB   19 
ATOM 4027  C CG   . LYS A 1 31  ? 20.215  3.091   20.094  1.00 0.00 ? 31  LYS A CG   19 
ATOM 4028  C CD   . LYS A 1 31  ? 19.243  4.181   20.551  1.00 0.00 ? 31  LYS A CD   19 
ATOM 4029  C CE   . LYS A 1 31  ? 19.349  4.360   22.066  1.00 0.00 ? 31  LYS A CE   19 
ATOM 4030  N NZ   . LYS A 1 31  ? 20.690  4.913   22.408  1.00 0.00 ? 31  LYS A NZ   19 
ATOM 4031  H H    . LYS A 1 31  ? 17.694  1.315   18.295  1.00 0.00 ? 31  LYS A H    19 
ATOM 4032  H HA   . LYS A 1 31  ? 20.663  1.288   18.402  1.00 0.00 ? 31  LYS A HA   19 
ATOM 4033  H HB2  . LYS A 1 31  ? 18.462  1.870   20.320  1.00 0.00 ? 31  LYS A HB2  19 
ATOM 4034  H HB3  . LYS A 1 31  ? 19.929  1.152   20.964  1.00 0.00 ? 31  LYS A HB3  19 
ATOM 4035  H HG2  . LYS A 1 31  ? 21.081  3.086   20.743  1.00 0.00 ? 31  LYS A HG2  19 
ATOM 4036  H HG3  . LYS A 1 31  ? 20.526  3.291   19.080  1.00 0.00 ? 31  LYS A HG3  19 
ATOM 4037  H HD2  . LYS A 1 31  ? 19.489  5.111   20.058  1.00 0.00 ? 31  LYS A HD2  19 
ATOM 4038  H HD3  . LYS A 1 31  ? 18.234  3.894   20.294  1.00 0.00 ? 31  LYS A HD3  19 
ATOM 4039  H HE2  . LYS A 1 31  ? 18.582  5.041   22.403  1.00 0.00 ? 31  LYS A HE2  19 
ATOM 4040  H HE3  . LYS A 1 31  ? 19.220  3.404   22.551  1.00 0.00 ? 31  LYS A HE3  19 
ATOM 4041  H HZ1  . LYS A 1 31  ? 21.345  4.751   21.615  1.00 0.00 ? 31  LYS A HZ1  19 
ATOM 4042  H HZ2  . LYS A 1 31  ? 20.609  5.935   22.587  1.00 0.00 ? 31  LYS A HZ2  19 
ATOM 4043  H HZ3  . LYS A 1 31  ? 21.053  4.442   23.260  1.00 0.00 ? 31  LYS A HZ3  19 
ATOM 4044  N N    . TRP A 1 32  ? 18.703  -1.213  18.752  1.00 0.00 ? 32  TRP A N    19 
ATOM 4045  C CA   . TRP A 1 32  ? 18.670  -2.681  19.005  1.00 0.00 ? 32  TRP A CA   19 
ATOM 4046  C C    . TRP A 1 32  ? 19.382  -3.412  17.875  1.00 0.00 ? 32  TRP A C    19 
ATOM 4047  O O    . TRP A 1 32  ? 19.307  -4.618  17.763  1.00 0.00 ? 32  TRP A O    19 
ATOM 4048  C CB   . TRP A 1 32  ? 17.220  -3.158  19.084  1.00 0.00 ? 32  TRP A CB   19 
ATOM 4049  C CG   . TRP A 1 32  ? 16.615  -3.228  17.715  1.00 0.00 ? 32  TRP A CG   19 
ATOM 4050  C CD1  . TRP A 1 32  ? 16.137  -2.170  17.027  1.00 0.00 ? 32  TRP A CD1  19 
ATOM 4051  C CD2  . TRP A 1 32  ? 16.417  -4.391  16.856  1.00 0.00 ? 32  TRP A CD2  19 
ATOM 4052  N NE1  . TRP A 1 32  ? 15.636  -2.605  15.819  1.00 0.00 ? 32  TRP A NE1  19 
ATOM 4053  C CE2  . TRP A 1 32  ? 15.786  -3.966  15.663  1.00 0.00 ? 32  TRP A CE2  19 
ATOM 4054  C CE3  . TRP A 1 32  ? 16.714  -5.758  16.997  1.00 0.00 ? 32  TRP A CE3  19 
ATOM 4055  C CZ2  . TRP A 1 32  ? 15.459  -4.864  14.648  1.00 0.00 ? 32  TRP A CZ2  19 
ATOM 4056  C CZ3  . TRP A 1 32  ? 16.389  -6.666  15.976  1.00 0.00 ? 32  TRP A CZ3  19 
ATOM 4057  C CH2  . TRP A 1 32  ? 15.760  -6.219  14.803  1.00 0.00 ? 32  TRP A CH2  19 
ATOM 4058  H H    . TRP A 1 32  ? 17.945  -0.770  18.314  1.00 0.00 ? 32  TRP A H    19 
ATOM 4059  H HA   . TRP A 1 32  ? 19.167  -2.894  19.937  1.00 0.00 ? 32  TRP A HA   19 
ATOM 4060  H HB2  . TRP A 1 32  ? 17.189  -4.137  19.539  1.00 0.00 ? 32  TRP A HB2  19 
ATOM 4061  H HB3  . TRP A 1 32  ? 16.654  -2.466  19.688  1.00 0.00 ? 32  TRP A HB3  19 
ATOM 4062  H HD1  . TRP A 1 32  ? 16.141  -1.152  17.366  1.00 0.00 ? 32  TRP A HD1  19 
ATOM 4063  H HE1  . TRP A 1 32  ? 15.224  -2.032  15.145  1.00 0.00 ? 32  TRP A HE1  19 
ATOM 4064  H HE3  . TRP A 1 32  ? 17.205  -6.107  17.888  1.00 0.00 ? 32  TRP A HE3  19 
ATOM 4065  H HZ2  . TRP A 1 32  ? 14.974  -4.515  13.748  1.00 0.00 ? 32  TRP A HZ2  19 
ATOM 4066  H HZ3  . TRP A 1 32  ? 16.622  -7.716  16.096  1.00 0.00 ? 32  TRP A HZ3  19 
ATOM 4067  H HH2  . TRP A 1 32  ? 15.511  -6.919  14.020  1.00 0.00 ? 32  TRP A HH2  19 
ATOM 4068  N N    . ILE A 1 33  ? 20.060  -2.694  17.031  1.00 0.00 ? 33  ILE A N    19 
ATOM 4069  C CA   . ILE A 1 33  ? 20.764  -3.355  15.903  1.00 0.00 ? 33  ILE A CA   19 
ATOM 4070  C C    . ILE A 1 33  ? 22.174  -2.779  15.759  1.00 0.00 ? 33  ILE A C    19 
ATOM 4071  O O    . ILE A 1 33  ? 22.364  -1.581  15.693  1.00 0.00 ? 33  ILE A O    19 
ATOM 4072  C CB   . ILE A 1 33  ? 19.966  -3.124  14.623  1.00 0.00 ? 33  ILE A CB   19 
ATOM 4073  C CG1  . ILE A 1 33  ? 18.723  -4.009  14.662  1.00 0.00 ? 33  ILE A CG1  19 
ATOM 4074  C CG2  . ILE A 1 33  ? 20.816  -3.476  13.401  1.00 0.00 ? 33  ILE A CG2  19 
ATOM 4075  C CD1  . ILE A 1 33  ? 18.025  -3.984  13.307  1.00 0.00 ? 33  ILE A CD1  19 
ATOM 4076  H H    . ILE A 1 33  ? 20.099  -1.721  17.134  1.00 0.00 ? 33  ILE A H    19 
ATOM 4077  H HA   . ILE A 1 33  ? 20.826  -4.418  16.098  1.00 0.00 ? 33  ILE A HA   19 
ATOM 4078  H HB   . ILE A 1 33  ? 19.667  -2.088  14.569  1.00 0.00 ? 33  ILE A HB   19 
ATOM 4079  H HG12 . ILE A 1 33  ? 19.008  -5.022  14.901  1.00 0.00 ? 33  ILE A HG12 19 
ATOM 4080  H HG13 . ILE A 1 33  ? 18.052  -3.637  15.416  1.00 0.00 ? 33  ILE A HG13 19 
ATOM 4081  H HG21 . ILE A 1 33  ? 21.767  -3.871  13.725  1.00 0.00 ? 33  ILE A HG21 19 
ATOM 4082  H HG22 . ILE A 1 33  ? 20.301  -4.214  12.805  1.00 0.00 ? 33  ILE A HG22 19 
ATOM 4083  H HG23 . ILE A 1 33  ? 20.979  -2.586  12.810  1.00 0.00 ? 33  ILE A HG23 19 
ATOM 4084  H HD11 . ILE A 1 33  ? 18.610  -3.400  12.617  1.00 0.00 ? 33  ILE A HD11 19 
ATOM 4085  H HD12 . ILE A 1 33  ? 17.927  -4.993  12.933  1.00 0.00 ? 33  ILE A HD12 19 
ATOM 4086  H HD13 . ILE A 1 33  ? 17.046  -3.545  13.415  1.00 0.00 ? 33  ILE A HD13 19 
ATOM 4087  N N    . HIS A 1 34  ? 23.161  -3.628  15.710  1.00 0.00 ? 34  HIS A N    19 
ATOM 4088  C CA   . HIS A 1 34  ? 24.564  -3.144  15.570  1.00 0.00 ? 34  HIS A CA   19 
ATOM 4089  C C    . HIS A 1 34  ? 24.953  -3.148  14.089  1.00 0.00 ? 34  HIS A C    19 
ATOM 4090  O O    . HIS A 1 34  ? 25.382  -2.147  13.548  1.00 0.00 ? 34  HIS A O    19 
ATOM 4091  C CB   . HIS A 1 34  ? 25.496  -4.074  16.355  1.00 0.00 ? 34  HIS A CB   19 
ATOM 4092  C CG   . HIS A 1 34  ? 26.922  -3.859  15.923  1.00 0.00 ? 34  HIS A CG   19 
ATOM 4093  N ND1  . HIS A 1 34  ? 27.502  -2.601  15.886  1.00 0.00 ? 34  HIS A ND1  19 
ATOM 4094  C CD2  . HIS A 1 34  ? 27.896  -4.733  15.508  1.00 0.00 ? 34  HIS A CD2  19 
ATOM 4095  C CE1  . HIS A 1 34  ? 28.770  -2.752  15.462  1.00 0.00 ? 34  HIS A CE1  19 
ATOM 4096  N NE2  . HIS A 1 34  ? 29.062  -4.032  15.217  1.00 0.00 ? 34  HIS A NE2  19 
ATOM 4097  H H    . HIS A 1 34  ? 22.979  -4.588  15.765  1.00 0.00 ? 34  HIS A H    19 
ATOM 4098  H HA   . HIS A 1 34  ? 24.640  -2.142  15.961  1.00 0.00 ? 34  HIS A HA   19 
ATOM 4099  H HB2  . HIS A 1 34  ? 25.406  -3.865  17.411  1.00 0.00 ? 34  HIS A HB2  19 
ATOM 4100  H HB3  . HIS A 1 34  ? 25.218  -5.101  16.170  1.00 0.00 ? 34  HIS A HB3  19 
ATOM 4101  H HD1  . HIS A 1 34  ? 27.069  -1.755  16.126  1.00 0.00 ? 34  HIS A HD1  19 
ATOM 4102  H HD2  . HIS A 1 34  ? 27.775  -5.804  15.420  1.00 0.00 ? 34  HIS A HD2  19 
ATOM 4103  H HE1  . HIS A 1 34  ? 29.467  -1.936  15.334  1.00 0.00 ? 34  HIS A HE1  19 
ATOM 4104  N N    . GLU A 1 35  ? 24.807  -4.263  13.429  1.00 0.00 ? 35  GLU A N    19 
ATOM 4105  C CA   . GLU A 1 35  ? 25.167  -4.328  11.985  1.00 0.00 ? 35  GLU A CA   19 
ATOM 4106  C C    . GLU A 1 35  ? 23.999  -4.928  11.195  1.00 0.00 ? 35  GLU A C    19 
ATOM 4107  O O    . GLU A 1 35  ? 23.220  -5.690  11.729  1.00 0.00 ? 35  GLU A O    19 
ATOM 4108  C CB   . GLU A 1 35  ? 26.411  -5.202  11.805  1.00 0.00 ? 35  GLU A CB   19 
ATOM 4109  C CG   . GLU A 1 35  ? 27.665  -4.329  11.896  1.00 0.00 ? 35  GLU A CG   19 
ATOM 4110  C CD   . GLU A 1 35  ? 28.807  -4.994  11.126  1.00 0.00 ? 35  GLU A CD   19 
ATOM 4111  O OE1  . GLU A 1 35  ? 28.921  -4.742  9.938   1.00 0.00 ? 35  GLU A OE1  19 
ATOM 4112  O OE2  . GLU A 1 35  ? 29.550  -5.744  11.739  1.00 0.00 ? 35  GLU A OE2  19 
ATOM 4113  H H    . GLU A 1 35  ? 24.459  -5.059  13.883  1.00 0.00 ? 35  GLU A H    19 
ATOM 4114  H HA   . GLU A 1 35  ? 25.373  -3.332  11.621  1.00 0.00 ? 35  GLU A HA   19 
ATOM 4115  H HB2  . GLU A 1 35  ? 26.437  -5.953  12.581  1.00 0.00 ? 35  GLU A HB2  19 
ATOM 4116  H HB3  . GLU A 1 35  ? 26.378  -5.682  10.839  1.00 0.00 ? 35  GLU A HB3  19 
ATOM 4117  H HG2  . GLU A 1 35  ? 27.459  -3.359  11.468  1.00 0.00 ? 35  GLU A HG2  19 
ATOM 4118  H HG3  . GLU A 1 35  ? 27.949  -4.215  12.931  1.00 0.00 ? 35  GLU A HG3  19 
ATOM 4119  N N    . PRO A 1 36  ? 23.914  -4.557  9.943   1.00 0.00 ? 36  PRO A N    19 
ATOM 4120  C CA   . PRO A 1 36  ? 24.869  -3.630  9.308   1.00 0.00 ? 36  PRO A CA   19 
ATOM 4121  C C    . PRO A 1 36  ? 24.585  -2.189  9.734   1.00 0.00 ? 36  PRO A C    19 
ATOM 4122  O O    . PRO A 1 36  ? 23.562  -1.894  10.321  1.00 0.00 ? 36  PRO A O    19 
ATOM 4123  C CB   . PRO A 1 36  ? 24.614  -3.821  7.810   1.00 0.00 ? 36  PRO A CB   19 
ATOM 4124  C CG   . PRO A 1 36  ? 23.183  -4.396  7.683   1.00 0.00 ? 36  PRO A CG   19 
ATOM 4125  C CD   . PRO A 1 36  ? 22.843  -5.031  9.045   1.00 0.00 ? 36  PRO A CD   19 
ATOM 4126  H HA   . PRO A 1 36  ? 25.884  -3.904  9.545   1.00 0.00 ? 36  PRO A HA   19 
ATOM 4127  H HB2  . PRO A 1 36  ? 24.681  -2.869  7.300   1.00 0.00 ? 36  PRO A HB2  19 
ATOM 4128  H HB3  . PRO A 1 36  ? 25.325  -4.518  7.397   1.00 0.00 ? 36  PRO A HB3  19 
ATOM 4129  H HG2  . PRO A 1 36  ? 22.484  -3.603  7.454   1.00 0.00 ? 36  PRO A HG2  19 
ATOM 4130  H HG3  . PRO A 1 36  ? 23.154  -5.151  6.912   1.00 0.00 ? 36  PRO A HG3  19 
ATOM 4131  H HD2  . PRO A 1 36  ? 21.877  -4.687  9.389   1.00 0.00 ? 36  PRO A HD2  19 
ATOM 4132  H HD3  . PRO A 1 36  ? 22.862  -6.107  8.978   1.00 0.00 ? 36  PRO A HD3  19 
ATOM 4133  N N    . LYS A 1 37  ? 25.481  -1.288  9.439   1.00 0.00 ? 37  LYS A N    19 
ATOM 4134  C CA   . LYS A 1 37  ? 25.272  0.129   9.814   1.00 0.00 ? 37  LYS A CA   19 
ATOM 4135  C C    . LYS A 1 37  ? 23.978  0.637   9.179   1.00 0.00 ? 37  LYS A C    19 
ATOM 4136  O O    . LYS A 1 37  ? 23.244  1.406   9.766   1.00 0.00 ? 37  LYS A O    19 
ATOM 4137  C CB   . LYS A 1 37  ? 26.451  0.941   9.291   1.00 0.00 ? 37  LYS A CB   19 
ATOM 4138  C CG   . LYS A 1 37  ? 27.543  1.011   10.359  1.00 0.00 ? 37  LYS A CG   19 
ATOM 4139  C CD   . LYS A 1 37  ? 28.398  2.260   10.135  1.00 0.00 ? 37  LYS A CD   19 
ATOM 4140  C CE   . LYS A 1 37  ? 29.879  1.878   10.166  1.00 0.00 ? 37  LYS A CE   19 
ATOM 4141  N NZ   . LYS A 1 37  ? 30.635  2.745   9.219   1.00 0.00 ? 37  LYS A NZ   19 
ATOM 4142  H H    . LYS A 1 37  ? 26.295  -1.542  8.962   1.00 0.00 ? 37  LYS A H    19 
ATOM 4143  H HA   . LYS A 1 37  ? 25.215  0.220   10.888  1.00 0.00 ? 37  LYS A HA   19 
ATOM 4144  H HB2  . LYS A 1 37  ? 26.844  0.466   8.404   1.00 0.00 ? 37  LYS A HB2  19 
ATOM 4145  H HB3  . LYS A 1 37  ? 26.120  1.930   9.047   1.00 0.00 ? 37  LYS A HB3  19 
ATOM 4146  H HG2  . LYS A 1 37  ? 27.088  1.055   11.338  1.00 0.00 ? 37  LYS A HG2  19 
ATOM 4147  H HG3  . LYS A 1 37  ? 28.169  0.134   10.293  1.00 0.00 ? 37  LYS A HG3  19 
ATOM 4148  H HD2  . LYS A 1 37  ? 28.157  2.693   9.175   1.00 0.00 ? 37  LYS A HD2  19 
ATOM 4149  H HD3  . LYS A 1 37  ? 28.197  2.979   10.917  1.00 0.00 ? 37  LYS A HD3  19 
ATOM 4150  H HE2  . LYS A 1 37  ? 30.265  2.014   11.166  1.00 0.00 ? 37  LYS A HE2  19 
ATOM 4151  H HE3  . LYS A 1 37  ? 29.990  0.844   9.875   1.00 0.00 ? 37  LYS A HE3  19 
ATOM 4152  H HZ1  . LYS A 1 37  ? 30.408  3.743   9.407   1.00 0.00 ? 37  LYS A HZ1  19 
ATOM 4153  H HZ2  . LYS A 1 37  ? 31.656  2.591   9.348   1.00 0.00 ? 37  LYS A HZ2  19 
ATOM 4154  H HZ3  . LYS A 1 37  ? 30.372  2.506   8.243   1.00 0.00 ? 37  LYS A HZ3  19 
ATOM 4155  N N    . GLY A 1 38  ? 23.698  0.209   7.982   1.00 0.00 ? 38  GLY A N    19 
ATOM 4156  C CA   . GLY A 1 38  ? 22.453  0.661   7.298   1.00 0.00 ? 38  GLY A CA   19 
ATOM 4157  C C    . GLY A 1 38  ? 22.144  -0.279  6.134   1.00 0.00 ? 38  GLY A C    19 
ATOM 4158  O O    . GLY A 1 38  ? 22.705  -1.351  6.024   1.00 0.00 ? 38  GLY A O    19 
ATOM 4159  H H    . GLY A 1 38  ? 24.308  -0.412  7.531   1.00 0.00 ? 38  GLY A H    19 
ATOM 4160  H HA2  . GLY A 1 38  ? 21.632  0.649   8.000   1.00 0.00 ? 38  GLY A HA2  19 
ATOM 4161  H HA3  . GLY A 1 38  ? 22.592  1.662   6.921   1.00 0.00 ? 38  GLY A HA3  19 
ATOM 4162  N N    . TYR A 1 39  ? 21.255  0.110   5.261   1.00 0.00 ? 39  TYR A N    19 
ATOM 4163  C CA   . TYR A 1 39  ? 20.916  -0.770  4.108   1.00 0.00 ? 39  TYR A CA   19 
ATOM 4164  C C    . TYR A 1 39  ? 20.046  0.000   3.110   1.00 0.00 ? 39  TYR A C    19 
ATOM 4165  O O    . TYR A 1 39  ? 19.546  1.066   3.402   1.00 0.00 ? 39  TYR A O    19 
ATOM 4166  C CB   . TYR A 1 39  ? 20.161  -2.003  4.617   1.00 0.00 ? 39  TYR A CB   19 
ATOM 4167  C CG   . TYR A 1 39  ? 18.726  -1.638  4.933   1.00 0.00 ? 39  TYR A CG   19 
ATOM 4168  C CD1  . TYR A 1 39  ? 18.430  -0.805  6.020   1.00 0.00 ? 39  TYR A CD1  19 
ATOM 4169  C CD2  . TYR A 1 39  ? 17.691  -2.139  4.136   1.00 0.00 ? 39  TYR A CD2  19 
ATOM 4170  C CE1  . TYR A 1 39  ? 17.101  -0.474  6.308   1.00 0.00 ? 39  TYR A CE1  19 
ATOM 4171  C CE2  . TYR A 1 39  ? 16.363  -1.807  4.424   1.00 0.00 ? 39  TYR A CE2  19 
ATOM 4172  C CZ   . TYR A 1 39  ? 16.067  -0.976  5.509   1.00 0.00 ? 39  TYR A CZ   19 
ATOM 4173  O OH   . TYR A 1 39  ? 14.756  -0.650  5.792   1.00 0.00 ? 39  TYR A OH   19 
ATOM 4174  H H    . TYR A 1 39  ? 20.810  0.977   5.364   1.00 0.00 ? 39  TYR A H    19 
ATOM 4175  H HA   . TYR A 1 39  ? 21.826  -1.084  3.619   1.00 0.00 ? 39  TYR A HA   19 
ATOM 4176  H HB2  . TYR A 1 39  ? 20.177  -2.771  3.858   1.00 0.00 ? 39  TYR A HB2  19 
ATOM 4177  H HB3  . TYR A 1 39  ? 20.641  -2.372  5.512   1.00 0.00 ? 39  TYR A HB3  19 
ATOM 4178  H HD1  . TYR A 1 39  ? 19.226  -0.417  6.637   1.00 0.00 ? 39  TYR A HD1  19 
ATOM 4179  H HD2  . TYR A 1 39  ? 17.918  -2.780  3.298   1.00 0.00 ? 39  TYR A HD2  19 
ATOM 4180  H HE1  . TYR A 1 39  ? 16.874  0.168   7.145   1.00 0.00 ? 39  TYR A HE1  19 
ATOM 4181  H HE2  . TYR A 1 39  ? 15.565  -2.195  3.807   1.00 0.00 ? 39  TYR A HE2  19 
ATOM 4182  H HH   . TYR A 1 39  ? 14.354  -1.397  6.239   1.00 0.00 ? 39  TYR A HH   19 
ATOM 4183  N N    . HIS A 1 40  ? 19.860  -0.536  1.935   1.00 0.00 ? 40  HIS A N    19 
ATOM 4184  C CA   . HIS A 1 40  ? 19.020  0.164   0.921   1.00 0.00 ? 40  HIS A CA   19 
ATOM 4185  C C    . HIS A 1 40  ? 17.547  -0.165  1.170   1.00 0.00 ? 40  HIS A C    19 
ATOM 4186  O O    . HIS A 1 40  ? 16.982  -1.040  0.543   1.00 0.00 ? 40  HIS A O    19 
ATOM 4187  C CB   . HIS A 1 40  ? 19.421  -0.300  -0.480  1.00 0.00 ? 40  HIS A CB   19 
ATOM 4188  C CG   . HIS A 1 40  ? 20.840  0.116   -0.759  1.00 0.00 ? 40  HIS A CG   19 
ATOM 4189  N ND1  . HIS A 1 40  ? 21.928  -0.555  -0.223  1.00 0.00 ? 40  HIS A ND1  19 
ATOM 4190  C CD2  . HIS A 1 40  ? 21.365  1.134   -1.517  1.00 0.00 ? 40  HIS A CD2  19 
ATOM 4191  C CE1  . HIS A 1 40  ? 23.041  0.060   -0.661  1.00 0.00 ? 40  HIS A CE1  19 
ATOM 4192  N NE2  . HIS A 1 40  ? 22.755  1.097   -1.453  1.00 0.00 ? 40  HIS A NE2  19 
ATOM 4193  H H    . HIS A 1 40  ? 20.270  -1.399  1.718   1.00 0.00 ? 40  HIS A H    19 
ATOM 4194  H HA   . HIS A 1 40  ? 19.169  1.231   1.004   1.00 0.00 ? 40  HIS A HA   19 
ATOM 4195  H HB2  . HIS A 1 40  ? 19.344  -1.376  -0.539  1.00 0.00 ? 40  HIS A HB2  19 
ATOM 4196  H HB3  . HIS A 1 40  ? 18.765  0.149   -1.211  1.00 0.00 ? 40  HIS A HB3  19 
ATOM 4197  H HD1  . HIS A 1 40  ? 21.893  -1.337  0.368   1.00 0.00 ? 40  HIS A HD1  19 
ATOM 4198  H HD2  . HIS A 1 40  ? 20.787  1.855   -2.076  1.00 0.00 ? 40  HIS A HD2  19 
ATOM 4199  H HE1  . HIS A 1 40  ? 24.044  -0.247  -0.403  1.00 0.00 ? 40  HIS A HE1  19 
ATOM 4200  N N    . ALA A 1 41  ? 16.921  0.525   2.084   1.00 0.00 ? 41  ALA A N    19 
ATOM 4201  C CA   . ALA A 1 41  ? 15.486  0.248   2.379   1.00 0.00 ? 41  ALA A CA   19 
ATOM 4202  C C    . ALA A 1 41  ? 14.623  0.645   1.178   1.00 0.00 ? 41  ALA A C    19 
ATOM 4203  O O    . ALA A 1 41  ? 13.715  -0.066  0.795   1.00 0.00 ? 41  ALA A O    19 
ATOM 4204  C CB   . ALA A 1 41  ? 15.056  1.052   3.608   1.00 0.00 ? 41  ALA A CB   19 
ATOM 4205  H H    . ALA A 1 41  ? 17.396  1.223   2.581   1.00 0.00 ? 41  ALA A H    19 
ATOM 4206  H HA   . ALA A 1 41  ? 15.358  -0.805  2.576   1.00 0.00 ? 41  ALA A HA   19 
ATOM 4207  H HB1  . ALA A 1 41  ? 15.860  1.066   4.329   1.00 0.00 ? 41  ALA A HB1  19 
ATOM 4208  H HB2  . ALA A 1 41  ? 14.819  2.063   3.314   1.00 0.00 ? 41  ALA A HB2  19 
ATOM 4209  H HB3  . ALA A 1 41  ? 14.184  0.592   4.053   1.00 0.00 ? 41  ALA A HB3  19 
ATOM 4210  N N    . ASN A 1 42  ? 14.898  1.771   0.578   1.00 0.00 ? 42  ASN A N    19 
ATOM 4211  C CA   . ASN A 1 42  ? 14.092  2.205   -0.599  1.00 0.00 ? 42  ASN A CA   19 
ATOM 4212  C C    . ASN A 1 42  ? 12.644  2.448   -0.169  1.00 0.00 ? 42  ASN A C    19 
ATOM 4213  O O    . ASN A 1 42  ? 12.297  2.306   0.987   1.00 0.00 ? 42  ASN A O    19 
ATOM 4214  C CB   . ASN A 1 42  ? 14.122  1.110   -1.668  1.00 0.00 ? 42  ASN A CB   19 
ATOM 4215  C CG   . ASN A 1 42  ? 15.219  1.422   -2.688  1.00 0.00 ? 42  ASN A CG   19 
ATOM 4216  O OD1  . ASN A 1 42  ? 15.474  2.571   -2.991  1.00 0.00 ? 42  ASN A OD1  19 
ATOM 4217  N ND2  . ASN A 1 42  ? 15.884  0.441   -3.234  1.00 0.00 ? 42  ASN A ND2  19 
ATOM 4218  H H    . ASN A 1 42  ? 15.635  2.331   0.900   1.00 0.00 ? 42  ASN A H    19 
ATOM 4219  H HA   . ASN A 1 42  ? 14.505  3.117   -1.004  1.00 0.00 ? 42  ASN A HA   19 
ATOM 4220  H HB2  . ASN A 1 42  ? 14.323  0.157   -1.201  1.00 0.00 ? 42  ASN A HB2  19 
ATOM 4221  H HB3  . ASN A 1 42  ? 13.167  1.070   -2.169  1.00 0.00 ? 42  ASN A HB3  19 
ATOM 4222  H HD21 . ASN A 1 42  ? 15.679  -0.486  -2.989  1.00 0.00 ? 42  ASN A HD21 19 
ATOM 4223  H HD22 . ASN A 1 42  ? 16.588  0.631   -3.887  1.00 0.00 ? 42  ASN A HD22 19 
ATOM 4224  N N    . PHE A 1 43  ? 11.792  2.801   -1.095  1.00 0.00 ? 43  PHE A N    19 
ATOM 4225  C CA   . PHE A 1 43  ? 10.363  3.039   -0.744  1.00 0.00 ? 43  PHE A CA   19 
ATOM 4226  C C    . PHE A 1 43  ? 9.606   3.461   -2.001  1.00 0.00 ? 43  PHE A C    19 
ATOM 4227  O O    . PHE A 1 43  ? 10.094  3.306   -3.101  1.00 0.00 ? 43  PHE A O    19 
ATOM 4228  C CB   . PHE A 1 43  ? 10.252  4.122   0.334   1.00 0.00 ? 43  PHE A CB   19 
ATOM 4229  C CG   . PHE A 1 43  ? 10.468  5.491   -0.258  1.00 0.00 ? 43  PHE A CG   19 
ATOM 4230  C CD1  . PHE A 1 43  ? 11.575  5.744   -1.073  1.00 0.00 ? 43  PHE A CD1  19 
ATOM 4231  C CD2  . PHE A 1 43  ? 9.560   6.516   0.026   1.00 0.00 ? 43  PHE A CD2  19 
ATOM 4232  C CE1  . PHE A 1 43  ? 11.774  7.023   -1.605  1.00 0.00 ? 43  PHE A CE1  19 
ATOM 4233  C CE2  . PHE A 1 43  ? 9.758   7.792   -0.505  1.00 0.00 ? 43  PHE A CE2  19 
ATOM 4234  C CZ   . PHE A 1 43  ? 10.866  8.047   -1.321  1.00 0.00 ? 43  PHE A CZ   19 
ATOM 4235  H H    . PHE A 1 43  ? 12.091  2.898   -2.029  1.00 0.00 ? 43  PHE A H    19 
ATOM 4236  H HA   . PHE A 1 43  ? 9.936   2.120   -0.370  1.00 0.00 ? 43  PHE A HA   19 
ATOM 4237  H HB2  . PHE A 1 43  ? 9.267   4.085   0.773   1.00 0.00 ? 43  PHE A HB2  19 
ATOM 4238  H HB3  . PHE A 1 43  ? 10.992  3.944   1.100   1.00 0.00 ? 43  PHE A HB3  19 
ATOM 4239  H HD1  . PHE A 1 43  ? 12.279  4.953   -1.288  1.00 0.00 ? 43  PHE A HD1  19 
ATOM 4240  H HD2  . PHE A 1 43  ? 8.704   6.321   0.655   1.00 0.00 ? 43  PHE A HD2  19 
ATOM 4241  H HE1  . PHE A 1 43  ? 12.629  7.219   -2.233  1.00 0.00 ? 43  PHE A HE1  19 
ATOM 4242  H HE2  . PHE A 1 43  ? 9.057   8.579   -0.283  1.00 0.00 ? 43  PHE A HE2  19 
ATOM 4243  H HZ   . PHE A 1 43  ? 11.018  9.035   -1.731  1.00 0.00 ? 43  PHE A HZ   19 
ATOM 4244  N N    . CYS A 1 44  ? 8.413   3.974   -1.863  1.00 0.00 ? 44  CYS A N    19 
ATOM 4245  C CA   . CYS A 1 44  ? 7.646   4.370   -3.079  1.00 0.00 ? 44  CYS A CA   19 
ATOM 4246  C C    . CYS A 1 44  ? 6.895   5.680   -2.830  1.00 0.00 ? 44  CYS A C    19 
ATOM 4247  O O    . CYS A 1 44  ? 6.591   6.034   -1.708  1.00 0.00 ? 44  CYS A O    19 
ATOM 4248  C CB   . CYS A 1 44  ? 6.630   3.276   -3.429  1.00 0.00 ? 44  CYS A CB   19 
ATOM 4249  S SG   . CYS A 1 44  ? 7.236   1.656   -2.885  1.00 0.00 ? 44  CYS A SG   19 
ATOM 4250  H H    . CYS A 1 44  ? 8.020   4.082   -0.971  1.00 0.00 ? 44  CYS A H    19 
ATOM 4251  H HA   . CYS A 1 44  ? 8.329   4.500   -3.906  1.00 0.00 ? 44  CYS A HA   19 
ATOM 4252  H HB2  . CYS A 1 44  ? 5.691   3.488   -2.940  1.00 0.00 ? 44  CYS A HB2  19 
ATOM 4253  H HB3  . CYS A 1 44  ? 6.480   3.260   -4.498  1.00 0.00 ? 44  CYS A HB3  19 
ATOM 4254  N N    . LEU A 1 45  ? 6.584   6.395   -3.878  1.00 0.00 ? 45  LEU A N    19 
ATOM 4255  C CA   . LEU A 1 45  ? 5.840   7.678   -3.725  1.00 0.00 ? 45  LEU A CA   19 
ATOM 4256  C C    . LEU A 1 45  ? 4.985   7.913   -4.974  1.00 0.00 ? 45  LEU A C    19 
ATOM 4257  O O    . LEU A 1 45  ? 5.317   7.468   -6.055  1.00 0.00 ? 45  LEU A O    19 
ATOM 4258  C CB   . LEU A 1 45  ? 6.833   8.831   -3.573  1.00 0.00 ? 45  LEU A CB   19 
ATOM 4259  C CG   . LEU A 1 45  ? 7.507   8.757   -2.205  1.00 0.00 ? 45  LEU A CG   19 
ATOM 4260  C CD1  . LEU A 1 45  ? 8.426   9.968   -2.033  1.00 0.00 ? 45  LEU A CD1  19 
ATOM 4261  C CD2  . LEU A 1 45  ? 6.443   8.765   -1.106  1.00 0.00 ? 45  LEU A CD2  19 
ATOM 4262  H H    . LEU A 1 45  ? 6.835   6.083   -4.772  1.00 0.00 ? 45  LEU A H    19 
ATOM 4263  H HA   . LEU A 1 45  ? 5.205   7.627   -2.854  1.00 0.00 ? 45  LEU A HA   19 
ATOM 4264  H HB2  . LEU A 1 45  ? 7.583   8.762   -4.345  1.00 0.00 ? 45  LEU A HB2  19 
ATOM 4265  H HB3  . LEU A 1 45  ? 6.308   9.771   -3.664  1.00 0.00 ? 45  LEU A HB3  19 
ATOM 4266  H HG   . LEU A 1 45  ? 8.090   7.851   -2.140  1.00 0.00 ? 45  LEU A HG   19 
ATOM 4267  H HD11 . LEU A 1 45  ? 8.027   10.804  -2.589  1.00 0.00 ? 45  LEU A HD11 19 
ATOM 4268  H HD12 . LEU A 1 45  ? 8.487   10.227  -0.987  1.00 0.00 ? 45  LEU A HD12 19 
ATOM 4269  H HD13 . LEU A 1 45  ? 9.411   9.725   -2.402  1.00 0.00 ? 45  LEU A HD13 19 
ATOM 4270  H HD21 . LEU A 1 45  ? 5.471   8.936   -1.546  1.00 0.00 ? 45  LEU A HD21 19 
ATOM 4271  H HD22 . LEU A 1 45  ? 6.445   7.814   -0.595  1.00 0.00 ? 45  LEU A HD22 19 
ATOM 4272  H HD23 . LEU A 1 45  ? 6.661   9.553   -0.399  1.00 0.00 ? 45  LEU A HD23 19 
ATOM 4273  N N    . GLY A 1 46  ? 3.892   8.613   -4.840  1.00 0.00 ? 46  GLY A N    19 
ATOM 4274  C CA   . GLY A 1 46  ? 3.027   8.878   -6.026  1.00 0.00 ? 46  GLY A CA   19 
ATOM 4275  C C    . GLY A 1 46  ? 1.817   7.938   -6.007  1.00 0.00 ? 46  GLY A C    19 
ATOM 4276  O O    . GLY A 1 46  ? 1.853   6.895   -5.384  1.00 0.00 ? 46  GLY A O    19 
ATOM 4277  H H    . GLY A 1 46  ? 3.642   8.969   -3.961  1.00 0.00 ? 46  GLY A H    19 
ATOM 4278  H HA2  . GLY A 1 46  ? 2.687   9.903   -6.001  1.00 0.00 ? 46  GLY A HA2  19 
ATOM 4279  H HA3  . GLY A 1 46  ? 3.594   8.708   -6.929  1.00 0.00 ? 46  GLY A HA3  19 
ATOM 4280  N N    . PRO A 1 47  ? 0.779   8.340   -6.697  1.00 0.00 ? 47  PRO A N    19 
ATOM 4281  C CA   . PRO A 1 47  ? -0.469  7.561   -6.787  1.00 0.00 ? 47  PRO A CA   19 
ATOM 4282  C C    . PRO A 1 47  ? -0.312  6.411   -7.787  1.00 0.00 ? 47  PRO A C    19 
ATOM 4283  O O    . PRO A 1 47  ? 0.772   6.124   -8.255  1.00 0.00 ? 47  PRO A O    19 
ATOM 4284  C CB   . PRO A 1 47  ? -1.494  8.581   -7.288  1.00 0.00 ? 47  PRO A CB   19 
ATOM 4285  C CG   . PRO A 1 47  ? -0.689  9.701   -7.988  1.00 0.00 ? 47  PRO A CG   19 
ATOM 4286  C CD   . PRO A 1 47  ? 0.751   9.613   -7.448  1.00 0.00 ? 47  PRO A CD   19 
ATOM 4287  H HA   . PRO A 1 47  ? -0.760  7.189   -5.818  1.00 0.00 ? 47  PRO A HA   19 
ATOM 4288  H HB2  . PRO A 1 47  ? -2.171  8.111   -7.990  1.00 0.00 ? 47  PRO A HB2  19 
ATOM 4289  H HB3  . PRO A 1 47  ? -2.046  8.993   -6.458  1.00 0.00 ? 47  PRO A HB3  19 
ATOM 4290  H HG2  . PRO A 1 47  ? -0.696  9.548   -9.058  1.00 0.00 ? 47  PRO A HG2  19 
ATOM 4291  H HG3  . PRO A 1 47  ? -1.109  10.665  -7.747  1.00 0.00 ? 47  PRO A HG3  19 
ATOM 4292  H HD2  . PRO A 1 47  ? 1.459   9.589   -8.265  1.00 0.00 ? 47  PRO A HD2  19 
ATOM 4293  H HD3  . PRO A 1 47  ? 0.960   10.440  -6.788  1.00 0.00 ? 47  PRO A HD3  19 
ATOM 4294  N N    . CYS A 1 48  ? -1.388  5.750   -8.115  1.00 0.00 ? 48  CYS A N    19 
ATOM 4295  C CA   . CYS A 1 48  ? -1.305  4.618   -9.081  1.00 0.00 ? 48  CYS A CA   19 
ATOM 4296  C C    . CYS A 1 48  ? -2.582  4.573   -9.931  1.00 0.00 ? 48  CYS A C    19 
ATOM 4297  O O    . CYS A 1 48  ? -3.656  4.358   -9.407  1.00 0.00 ? 48  CYS A O    19 
ATOM 4298  C CB   . CYS A 1 48  ? -1.173  3.304   -8.306  1.00 0.00 ? 48  CYS A CB   19 
ATOM 4299  S SG   . CYS A 1 48  ? -0.757  1.963   -9.447  1.00 0.00 ? 48  CYS A SG   19 
ATOM 4300  H H    . CYS A 1 48  ? -2.252  5.998   -7.725  1.00 0.00 ? 48  CYS A H    19 
ATOM 4301  H HA   . CYS A 1 48  ? -0.443  4.749   -9.715  1.00 0.00 ? 48  CYS A HA   19 
ATOM 4302  H HB2  . CYS A 1 48  ? -0.395  3.401   -7.565  1.00 0.00 ? 48  CYS A HB2  19 
ATOM 4303  H HB3  . CYS A 1 48  ? -2.110  3.080   -7.817  1.00 0.00 ? 48  CYS A HB3  19 
ATOM 4304  N N    . PRO A 1 49  ? -2.437  4.764   -11.219 1.00 0.00 ? 49  PRO A N    19 
ATOM 4305  C CA   . PRO A 1 49  ? -3.578  4.730   -12.145 1.00 0.00 ? 49  PRO A CA   19 
ATOM 4306  C C    . PRO A 1 49  ? -4.020  3.273   -12.370 1.00 0.00 ? 49  PRO A C    19 
ATOM 4307  O O    . PRO A 1 49  ? -3.942  2.461   -11.469 1.00 0.00 ? 49  PRO A O    19 
ATOM 4308  C CB   . PRO A 1 49  ? -3.031  5.400   -13.415 1.00 0.00 ? 49  PRO A CB   19 
ATOM 4309  C CG   . PRO A 1 49  ? -1.493  5.285   -13.345 1.00 0.00 ? 49  PRO A CG   19 
ATOM 4310  C CD   . PRO A 1 49  ? -1.135  5.024   -11.868 1.00 0.00 ? 49  PRO A CD   19 
ATOM 4311  H HA   . PRO A 1 49  ? -4.397  5.311   -11.749 1.00 0.00 ? 49  PRO A HA   19 
ATOM 4312  H HB2  . PRO A 1 49  ? -3.401  4.897   -14.295 1.00 0.00 ? 49  PRO A HB2  19 
ATOM 4313  H HB3  . PRO A 1 49  ? -3.316  6.440   -13.437 1.00 0.00 ? 49  PRO A HB3  19 
ATOM 4314  H HG2  . PRO A 1 49  ? -1.156  4.471   -13.967 1.00 0.00 ? 49  PRO A HG2  19 
ATOM 4315  H HG3  . PRO A 1 49  ? -1.039  6.209   -13.670 1.00 0.00 ? 49  PRO A HG3  19 
ATOM 4316  H HD2  . PRO A 1 49  ? -0.487  4.164   -11.782 1.00 0.00 ? 49  PRO A HD2  19 
ATOM 4317  H HD3  . PRO A 1 49  ? -0.670  5.895   -11.431 1.00 0.00 ? 49  PRO A HD3  19 
ATOM 4318  N N    . TYR A 1 50  ? -4.497  2.927   -13.535 1.00 0.00 ? 50  TYR A N    19 
ATOM 4319  C CA   . TYR A 1 50  ? -4.948  1.515   -13.748 1.00 0.00 ? 50  TYR A CA   19 
ATOM 4320  C C    . TYR A 1 50  ? -3.800  0.658   -14.291 1.00 0.00 ? 50  TYR A C    19 
ATOM 4321  O O    . TYR A 1 50  ? -3.111  -0.014  -13.552 1.00 0.00 ? 50  TYR A O    19 
ATOM 4322  C CB   . TYR A 1 50  ? -6.130  1.452   -14.736 1.00 0.00 ? 50  TYR A CB   19 
ATOM 4323  C CG   . TYR A 1 50  ? -6.405  2.810   -15.340 1.00 0.00 ? 50  TYR A CG   19 
ATOM 4324  C CD1  . TYR A 1 50  ? -7.017  3.806   -14.569 1.00 0.00 ? 50  TYR A CD1  19 
ATOM 4325  C CD2  . TYR A 1 50  ? -6.049  3.073   -16.668 1.00 0.00 ? 50  TYR A CD2  19 
ATOM 4326  C CE1  . TYR A 1 50  ? -7.272  5.064   -15.126 1.00 0.00 ? 50  TYR A CE1  19 
ATOM 4327  C CE2  . TYR A 1 50  ? -6.306  4.331   -17.226 1.00 0.00 ? 50  TYR A CE2  19 
ATOM 4328  C CZ   . TYR A 1 50  ? -6.917  5.327   -16.455 1.00 0.00 ? 50  TYR A CZ   19 
ATOM 4329  O OH   . TYR A 1 50  ? -7.170  6.567   -17.004 1.00 0.00 ? 50  TYR A OH   19 
ATOM 4330  H H    . TYR A 1 50  ? -4.571  3.584   -14.253 1.00 0.00 ? 50  TYR A H    19 
ATOM 4331  H HA   . TYR A 1 50  ? -5.266  1.107   -12.800 1.00 0.00 ? 50  TYR A HA   19 
ATOM 4332  H HB2  . TYR A 1 50  ? -5.894  0.755   -15.526 1.00 0.00 ? 50  TYR A HB2  19 
ATOM 4333  H HB3  . TYR A 1 50  ? -7.011  1.110   -14.213 1.00 0.00 ? 50  TYR A HB3  19 
ATOM 4334  H HD1  . TYR A 1 50  ? -7.291  3.603   -13.545 1.00 0.00 ? 50  TYR A HD1  19 
ATOM 4335  H HD2  . TYR A 1 50  ? -5.577  2.304   -17.263 1.00 0.00 ? 50  TYR A HD2  19 
ATOM 4336  H HE1  . TYR A 1 50  ? -7.745  5.830   -14.532 1.00 0.00 ? 50  TYR A HE1  19 
ATOM 4337  H HE2  . TYR A 1 50  ? -6.030  4.534   -18.251 1.00 0.00 ? 50  TYR A HE2  19 
ATOM 4338  H HH   . TYR A 1 50  ? -6.875  6.553   -17.917 1.00 0.00 ? 50  TYR A HH   19 
ATOM 4339  N N    . ILE A 1 51  ? -3.608  0.658   -15.580 1.00 0.00 ? 51  ILE A N    19 
ATOM 4340  C CA   . ILE A 1 51  ? -2.529  -0.177  -16.186 1.00 0.00 ? 51  ILE A CA   19 
ATOM 4341  C C    . ILE A 1 51  ? -1.257  -0.153  -15.327 1.00 0.00 ? 51  ILE A C    19 
ATOM 4342  O O    . ILE A 1 51  ? -0.460  -1.068  -15.372 1.00 0.00 ? 51  ILE A O    19 
ATOM 4343  C CB   . ILE A 1 51  ? -2.203  0.353   -17.584 1.00 0.00 ? 51  ILE A CB   19 
ATOM 4344  C CG1  . ILE A 1 51  ? -2.151  1.883   -17.550 1.00 0.00 ? 51  ILE A CG1  19 
ATOM 4345  C CG2  . ILE A 1 51  ? -3.286  -0.096  -18.566 1.00 0.00 ? 51  ILE A CG2  19 
ATOM 4346  C CD1  . ILE A 1 51  ? -1.439  2.396   -18.802 1.00 0.00 ? 51  ILE A CD1  19 
ATOM 4347  H H    . ILE A 1 51  ? -4.191  1.194   -16.158 1.00 0.00 ? 51  ILE A H    19 
ATOM 4348  H HA   . ILE A 1 51  ? -2.879  -1.195  -16.267 1.00 0.00 ? 51  ILE A HA   19 
ATOM 4349  H HB   . ILE A 1 51  ? -1.246  -0.035  -17.902 1.00 0.00 ? 51  ILE A HB   19 
ATOM 4350  H HG12 . ILE A 1 51  ? -3.158  2.276   -17.519 1.00 0.00 ? 51  ILE A HG12 19 
ATOM 4351  H HG13 . ILE A 1 51  ? -1.612  2.205   -16.672 1.00 0.00 ? 51  ILE A HG13 19 
ATOM 4352  H HG21 . ILE A 1 51  ? -4.161  -0.412  -18.019 1.00 0.00 ? 51  ILE A HG21 19 
ATOM 4353  H HG22 . ILE A 1 51  ? -3.546  0.726   -19.217 1.00 0.00 ? 51  ILE A HG22 19 
ATOM 4354  H HG23 . ILE A 1 51  ? -2.914  -0.920  -19.158 1.00 0.00 ? 51  ILE A HG23 19 
ATOM 4355  H HD11 . ILE A 1 51  ? -1.302  1.583   -19.499 1.00 0.00 ? 51  ILE A HD11 19 
ATOM 4356  H HD12 . ILE A 1 51  ? -2.034  3.169   -19.264 1.00 0.00 ? 51  ILE A HD12 19 
ATOM 4357  H HD13 . ILE A 1 51  ? -0.475  2.801   -18.527 1.00 0.00 ? 51  ILE A HD13 19 
ATOM 4358  N N    . TRP A 1 52  ? -1.044  0.882   -14.560 1.00 0.00 ? 52  TRP A N    19 
ATOM 4359  C CA   . TRP A 1 52  ? 0.192   0.947   -13.721 1.00 0.00 ? 52  TRP A CA   19 
ATOM 4360  C C    . TRP A 1 52  ? 0.245   -0.234  -12.749 1.00 0.00 ? 52  TRP A C    19 
ATOM 4361  O O    . TRP A 1 52  ? -0.193  -0.126  -11.621 1.00 0.00 ? 52  TRP A O    19 
ATOM 4362  C CB   . TRP A 1 52  ? 0.200   2.247   -12.923 1.00 0.00 ? 52  TRP A CB   19 
ATOM 4363  C CG   . TRP A 1 52  ? 1.573   2.837   -12.946 1.00 0.00 ? 52  TRP A CG   19 
ATOM 4364  C CD1  . TRP A 1 52  ? 2.216   3.337   -11.868 1.00 0.00 ? 52  TRP A CD1  19 
ATOM 4365  C CD2  . TRP A 1 52  ? 2.482   2.993   -14.074 1.00 0.00 ? 52  TRP A CD2  19 
ATOM 4366  N NE1  . TRP A 1 52  ? 3.462   3.792   -12.260 1.00 0.00 ? 52  TRP A NE1  19 
ATOM 4367  C CE2  . TRP A 1 52  ? 3.673   3.601   -13.611 1.00 0.00 ? 52  TRP A CE2  19 
ATOM 4368  C CE3  . TRP A 1 52  ? 2.391   2.670   -15.440 1.00 0.00 ? 52  TRP A CE3  19 
ATOM 4369  C CZ2  . TRP A 1 52  ? 4.737   3.878   -14.473 1.00 0.00 ? 52  TRP A CZ2  19 
ATOM 4370  C CZ3  . TRP A 1 52  ? 3.459   2.948   -16.309 1.00 0.00 ? 52  TRP A CZ3  19 
ATOM 4371  C CH2  . TRP A 1 52  ? 4.629   3.551   -15.826 1.00 0.00 ? 52  TRP A CH2  19 
ATOM 4372  H H    . TRP A 1 52  ? -1.689  1.620   -14.542 1.00 0.00 ? 52  TRP A H    19 
ATOM 4373  H HA   . TRP A 1 52  ? 1.061   0.920   -14.362 1.00 0.00 ? 52  TRP A HA   19 
ATOM 4374  H HB2  . TRP A 1 52  ? -0.497  2.938   -13.362 1.00 0.00 ? 52  TRP A HB2  19 
ATOM 4375  H HB3  . TRP A 1 52  ? -0.088  2.044   -11.903 1.00 0.00 ? 52  TRP A HB3  19 
ATOM 4376  H HD1  . TRP A 1 52  ? 1.821   3.374   -10.865 1.00 0.00 ? 52  TRP A HD1  19 
ATOM 4377  H HE1  . TRP A 1 52  ? 4.127   4.200   -11.668 1.00 0.00 ? 52  TRP A HE1  19 
ATOM 4378  H HE3  . TRP A 1 52  ? 1.494   2.205   -15.823 1.00 0.00 ? 52  TRP A HE3  19 
ATOM 4379  H HZ2  . TRP A 1 52  ? 5.637   4.342   -14.095 1.00 0.00 ? 52  TRP A HZ2  19 
ATOM 4380  H HZ3  . TRP A 1 52  ? 3.378   2.696   -17.357 1.00 0.00 ? 52  TRP A HZ3  19 
ATOM 4381  H HH2  . TRP A 1 52  ? 5.446   3.762   -16.500 1.00 0.00 ? 52  TRP A HH2  19 
ATOM 4382  N N    . SER A 1 53  ? 0.801   -1.343  -13.182 1.00 0.00 ? 53  SER A N    19 
ATOM 4383  C CA   . SER A 1 53  ? 0.926   -2.558  -12.310 1.00 0.00 ? 53  SER A CA   19 
ATOM 4384  C C    . SER A 1 53  ? -0.098  -2.532  -11.171 1.00 0.00 ? 53  SER A C    19 
ATOM 4385  O O    . SER A 1 53  ? 0.158   -2.002  -10.109 1.00 0.00 ? 53  SER A O    19 
ATOM 4386  C CB   . SER A 1 53  ? 2.334   -2.608  -11.716 1.00 0.00 ? 53  SER A CB   19 
ATOM 4387  O OG   . SER A 1 53  ? 2.669   -3.956  -11.417 1.00 0.00 ? 53  SER A OG   19 
ATOM 4388  H H    . SER A 1 53  ? 1.156   -1.373  -14.095 1.00 0.00 ? 53  SER A H    19 
ATOM 4389  H HA   . SER A 1 53  ? 0.765   -3.442  -12.909 1.00 0.00 ? 53  SER A HA   19 
ATOM 4390  H HB2  . SER A 1 53  ? 3.040   -2.217  -12.429 1.00 0.00 ? 53  SER A HB2  19 
ATOM 4391  H HB3  . SER A 1 53  ? 2.365   -2.009  -10.816 1.00 0.00 ? 53  SER A HB3  19 
ATOM 4392  H HG   . SER A 1 53  ? 2.582   -4.079  -10.468 1.00 0.00 ? 53  SER A HG   19 
ATOM 4393  N N    . LEU A 1 54  ? -1.251  -3.103  -11.378 1.00 0.00 ? 54  LEU A N    19 
ATOM 4394  C CA   . LEU A 1 54  ? -2.278  -3.107  -10.301 1.00 0.00 ? 54  LEU A CA   19 
ATOM 4395  C C    . LEU A 1 54  ? -2.117  -4.373  -9.457  1.00 0.00 ? 54  LEU A C    19 
ATOM 4396  O O    . LEU A 1 54  ? -2.023  -5.468  -9.973  1.00 0.00 ? 54  LEU A O    19 
ATOM 4397  C CB   . LEU A 1 54  ? -3.670  -3.070  -10.931 1.00 0.00 ? 54  LEU A CB   19 
ATOM 4398  C CG   . LEU A 1 54  ? -3.851  -1.738  -11.658 1.00 0.00 ? 54  LEU A CG   19 
ATOM 4399  C CD1  . LEU A 1 54  ? -4.780  -1.925  -12.860 1.00 0.00 ? 54  LEU A CD1  19 
ATOM 4400  C CD2  . LEU A 1 54  ? -4.461  -0.712  -10.700 1.00 0.00 ? 54  LEU A CD2  19 
ATOM 4401  H H    . LEU A 1 54  ? -1.440  -3.529  -12.240 1.00 0.00 ? 54  LEU A H    19 
ATOM 4402  H HA   . LEU A 1 54  ? -2.145  -2.238  -9.674  1.00 0.00 ? 54  LEU A HA   19 
ATOM 4403  H HB2  . LEU A 1 54  ? -3.772  -3.886  -11.633 1.00 0.00 ? 54  LEU A HB2  19 
ATOM 4404  H HB3  . LEU A 1 54  ? -4.419  -3.162  -10.158 1.00 0.00 ? 54  LEU A HB3  19 
ATOM 4405  H HG   . LEU A 1 54  ? -2.889  -1.386  -12.000 1.00 0.00 ? 54  LEU A HG   19 
ATOM 4406  H HD11 . LEU A 1 54  ? -5.452  -2.749  -12.671 1.00 0.00 ? 54  LEU A HD11 19 
ATOM 4407  H HD12 . LEU A 1 54  ? -5.351  -1.022  -13.017 1.00 0.00 ? 54  LEU A HD12 19 
ATOM 4408  H HD13 . LEU A 1 54  ? -4.190  -2.136  -13.740 1.00 0.00 ? 54  LEU A HD13 19 
ATOM 4409  H HD21 . LEU A 1 54  ? -4.953  -1.226  -9.888  1.00 0.00 ? 54  LEU A HD21 19 
ATOM 4410  H HD22 . LEU A 1 54  ? -3.679  -0.081  -10.305 1.00 0.00 ? 54  LEU A HD22 19 
ATOM 4411  H HD23 . LEU A 1 54  ? -5.179  -0.106  -11.231 1.00 0.00 ? 54  LEU A HD23 19 
ATOM 4412  N N    . ASP A 1 55  ? -2.068  -4.228  -8.160  1.00 0.00 ? 55  ASP A N    19 
ATOM 4413  C CA   . ASP A 1 55  ? -1.896  -5.422  -7.283  1.00 0.00 ? 55  ASP A CA   19 
ATOM 4414  C C    . ASP A 1 55  ? -3.258  -6.038  -6.959  1.00 0.00 ? 55  ASP A C    19 
ATOM 4415  O O    . ASP A 1 55  ? -3.546  -7.158  -7.331  1.00 0.00 ? 55  ASP A O    19 
ATOM 4416  C CB   . ASP A 1 55  ? -1.206  -5.002  -5.984  1.00 0.00 ? 55  ASP A CB   19 
ATOM 4417  C CG   . ASP A 1 55  ? -0.822  -6.248  -5.184  1.00 0.00 ? 55  ASP A CG   19 
ATOM 4418  O OD1  . ASP A 1 55  ? -1.686  -6.786  -4.510  1.00 0.00 ? 55  ASP A OD1  19 
ATOM 4419  O OD2  . ASP A 1 55  ? 0.328   -6.646  -5.260  1.00 0.00 ? 55  ASP A OD2  19 
ATOM 4420  H H    . ASP A 1 55  ? -2.135  -3.333  -7.764  1.00 0.00 ? 55  ASP A H    19 
ATOM 4421  H HA   . ASP A 1 55  ? -1.285  -6.153  -7.791  1.00 0.00 ? 55  ASP A HA   19 
ATOM 4422  H HB2  . ASP A 1 55  ? -0.317  -4.433  -6.216  1.00 0.00 ? 55  ASP A HB2  19 
ATOM 4423  H HB3  . ASP A 1 55  ? -1.879  -4.395  -5.399  1.00 0.00 ? 55  ASP A HB3  19 
ATOM 4424  N N    . THR A 1 56  ? -4.096  -5.322  -6.263  1.00 0.00 ? 56  THR A N    19 
ATOM 4425  C CA   . THR A 1 56  ? -5.433  -5.878  -5.912  1.00 0.00 ? 56  THR A CA   19 
ATOM 4426  C C    . THR A 1 56  ? -6.464  -5.429  -6.948  1.00 0.00 ? 56  THR A C    19 
ATOM 4427  O O    . THR A 1 56  ? -6.175  -4.637  -7.822  1.00 0.00 ? 56  THR A O    19 
ATOM 4428  C CB   . THR A 1 56  ? -5.847  -5.372  -4.528  1.00 0.00 ? 56  THR A CB   19 
ATOM 4429  O OG1  . THR A 1 56  ? -6.376  -4.058  -4.645  1.00 0.00 ? 56  THR A OG1  19 
ATOM 4430  C CG2  . THR A 1 56  ? -4.630  -5.354  -3.603  1.00 0.00 ? 56  THR A CG2  19 
ATOM 4431  H H    . THR A 1 56  ? -3.845  -4.422  -5.966  1.00 0.00 ? 56  THR A H    19 
ATOM 4432  H HA   . THR A 1 56  ? -5.382  -6.957  -5.900  1.00 0.00 ? 56  THR A HA   19 
ATOM 4433  H HB   . THR A 1 56  ? -6.598  -6.027  -4.115  1.00 0.00 ? 56  THR A HB   19 
ATOM 4434  H HG1  . THR A 1 56  ? -6.698  -3.790  -3.781  1.00 0.00 ? 56  THR A HG1  19 
ATOM 4435  H HG21 . THR A 1 56  ? -3.780  -5.780  -4.116  1.00 0.00 ? 56  THR A HG21 19 
ATOM 4436  H HG22 . THR A 1 56  ? -4.406  -4.334  -3.323  1.00 0.00 ? 56  THR A HG22 19 
ATOM 4437  H HG23 . THR A 1 56  ? -4.842  -5.933  -2.716  1.00 0.00 ? 56  THR A HG23 19 
ATOM 4438  N N    . GLN A 1 57  ? -7.664  -5.927  -6.855  1.00 0.00 ? 57  GLN A N    19 
ATOM 4439  C CA   . GLN A 1 57  ? -8.711  -5.527  -7.834  1.00 0.00 ? 57  GLN A CA   19 
ATOM 4440  C C    . GLN A 1 57  ? -9.213  -4.126  -7.485  1.00 0.00 ? 57  GLN A C    19 
ATOM 4441  O O    . GLN A 1 57  ? -9.454  -3.309  -8.352  1.00 0.00 ? 57  GLN A O    19 
ATOM 4442  C CB   . GLN A 1 57  ? -9.871  -6.518  -7.769  1.00 0.00 ? 57  GLN A CB   19 
ATOM 4443  C CG   . GLN A 1 57  ? -9.491  -7.795  -8.523  1.00 0.00 ? 57  GLN A CG   19 
ATOM 4444  C CD   . GLN A 1 57  ? -10.375 -7.940  -9.762  1.00 0.00 ? 57  GLN A CD   19 
ATOM 4445  O OE1  . GLN A 1 57  ? -10.633 -6.975  -10.455 1.00 0.00 ? 57  GLN A OE1  19 
ATOM 4446  N NE2  . GLN A 1 57  ? -10.854 -9.112  -10.074 1.00 0.00 ? 57  GLN A NE2  19 
ATOM 4447  H H    . GLN A 1 57  ? -7.876  -6.565  -6.142  1.00 0.00 ? 57  GLN A H    19 
ATOM 4448  H HA   . GLN A 1 57  ? -8.293  -5.523  -8.829  1.00 0.00 ? 57  GLN A HA   19 
ATOM 4449  H HB2  . GLN A 1 57  ? -10.081 -6.755  -6.736  1.00 0.00 ? 57  GLN A HB2  19 
ATOM 4450  H HB3  . GLN A 1 57  ? -10.747 -6.080  -8.224  1.00 0.00 ? 57  GLN A HB3  19 
ATOM 4451  H HG2  . GLN A 1 57  ? -8.454  -7.736  -8.825  1.00 0.00 ? 57  GLN A HG2  19 
ATOM 4452  H HG3  . GLN A 1 57  ? -9.630  -8.649  -7.880  1.00 0.00 ? 57  GLN A HG3  19 
ATOM 4453  H HE21 . GLN A 1 57  ? -10.647 -9.891  -9.516  1.00 0.00 ? 57  GLN A HE21 19 
ATOM 4454  H HE22 . GLN A 1 57  ? -11.423 -9.215  -10.865 1.00 0.00 ? 57  GLN A HE22 19 
ATOM 4455  N N    . TYR A 1 58  ? -9.365  -3.837  -6.222  1.00 0.00 ? 58  TYR A N    19 
ATOM 4456  C CA   . TYR A 1 58  ? -9.842  -2.484  -5.824  1.00 0.00 ? 58  TYR A CA   19 
ATOM 4457  C C    . TYR A 1 58  ? -8.870  -1.436  -6.383  1.00 0.00 ? 58  TYR A C    19 
ATOM 4458  O O    . TYR A 1 58  ? -9.264  -0.349  -6.757  1.00 0.00 ? 58  TYR A O    19 
ATOM 4459  C CB   . TYR A 1 58  ? -9.914  -2.394  -4.287  1.00 0.00 ? 58  TYR A CB   19 
ATOM 4460  C CG   . TYR A 1 58  ? -9.674  -0.973  -3.830  1.00 0.00 ? 58  TYR A CG   19 
ATOM 4461  C CD1  . TYR A 1 58  ? -10.694 -0.021  -3.928  1.00 0.00 ? 58  TYR A CD1  19 
ATOM 4462  C CD2  . TYR A 1 58  ? -8.424  -0.612  -3.315  1.00 0.00 ? 58  TYR A CD2  19 
ATOM 4463  C CE1  . TYR A 1 58  ? -10.463 1.295   -3.511  1.00 0.00 ? 58  TYR A CE1  19 
ATOM 4464  C CE2  . TYR A 1 58  ? -8.194  0.704   -2.899  1.00 0.00 ? 58  TYR A CE2  19 
ATOM 4465  C CZ   . TYR A 1 58  ? -9.212  1.656   -2.998  1.00 0.00 ? 58  TYR A CZ   19 
ATOM 4466  O OH   . TYR A 1 58  ? -8.984  2.952   -2.590  1.00 0.00 ? 58  TYR A OH   19 
ATOM 4467  H H    . TYR A 1 58  ? -9.160  -4.506  -5.536  1.00 0.00 ? 58  TYR A H    19 
ATOM 4468  H HA   . TYR A 1 58  ? -10.824 -2.316  -6.242  1.00 0.00 ? 58  TYR A HA   19 
ATOM 4469  H HB2  . TYR A 1 58  ? -10.893 -2.712  -3.958  1.00 0.00 ? 58  TYR A HB2  19 
ATOM 4470  H HB3  . TYR A 1 58  ? -9.167  -3.040  -3.851  1.00 0.00 ? 58  TYR A HB3  19 
ATOM 4471  H HD1  . TYR A 1 58  ? -11.659 -0.300  -4.325  1.00 0.00 ? 58  TYR A HD1  19 
ATOM 4472  H HD2  . TYR A 1 58  ? -7.637  -1.348  -3.239  1.00 0.00 ? 58  TYR A HD2  19 
ATOM 4473  H HE1  . TYR A 1 58  ? -11.248 2.032   -3.587  1.00 0.00 ? 58  TYR A HE1  19 
ATOM 4474  H HE2  . TYR A 1 58  ? -7.229  0.984   -2.503  1.00 0.00 ? 58  TYR A HE2  19 
ATOM 4475  H HH   . TYR A 1 58  ? -8.197  2.956   -2.042  1.00 0.00 ? 58  TYR A HH   19 
ATOM 4476  N N    . SER A 1 59  ? -7.604  -1.753  -6.445  1.00 0.00 ? 59  SER A N    19 
ATOM 4477  C CA   . SER A 1 59  ? -6.621  -0.771  -6.981  1.00 0.00 ? 59  SER A CA   19 
ATOM 4478  C C    . SER A 1 59  ? -7.013  -0.397  -8.412  1.00 0.00 ? 59  SER A C    19 
ATOM 4479  O O    . SER A 1 59  ? -6.829  0.724   -8.842  1.00 0.00 ? 59  SER A O    19 
ATOM 4480  C CB   . SER A 1 59  ? -5.218  -1.382  -6.973  1.00 0.00 ? 59  SER A CB   19 
ATOM 4481  O OG   . SER A 1 59  ? -5.197  -2.534  -7.804  1.00 0.00 ? 59  SER A OG   19 
ATOM 4482  H H    . SER A 1 59  ? -7.302  -2.635  -6.140  1.00 0.00 ? 59  SER A H    19 
ATOM 4483  H HA   . SER A 1 59  ? -6.629  0.116   -6.364  1.00 0.00 ? 59  SER A HA   19 
ATOM 4484  H HB2  . SER A 1 59  ? -4.509  -0.663  -7.347  1.00 0.00 ? 59  SER A HB2  19 
ATOM 4485  H HB3  . SER A 1 59  ? -4.950  -1.652  -5.960  1.00 0.00 ? 59  SER A HB3  19 
ATOM 4486  H HG   . SER A 1 59  ? -5.714  -2.344  -8.589  1.00 0.00 ? 59  SER A HG   19 
ATOM 4487  N N    . LYS A 1 60  ? -7.565  -1.323  -9.149  1.00 0.00 ? 60  LYS A N    19 
ATOM 4488  C CA   . LYS A 1 60  ? -7.980  -1.013  -10.544 1.00 0.00 ? 60  LYS A CA   19 
ATOM 4489  C C    . LYS A 1 60  ? -9.229  -0.134  -10.500 1.00 0.00 ? 60  LYS A C    19 
ATOM 4490  O O    . LYS A 1 60  ? -9.414  0.746   -11.318 1.00 0.00 ? 60  LYS A O    19 
ATOM 4491  C CB   . LYS A 1 60  ? -8.293  -2.316  -11.288 1.00 0.00 ? 60  LYS A CB   19 
ATOM 4492  C CG   . LYS A 1 60  ? -9.058  -2.002  -12.575 1.00 0.00 ? 60  LYS A CG   19 
ATOM 4493  C CD   . LYS A 1 60  ? -8.624  -2.971  -13.677 1.00 0.00 ? 60  LYS A CD   19 
ATOM 4494  C CE   . LYS A 1 60  ? -9.069  -2.430  -15.038 1.00 0.00 ? 60  LYS A CE   19 
ATOM 4495  N NZ   . LYS A 1 60  ? -7.964  -2.592  -16.024 1.00 0.00 ? 60  LYS A NZ   19 
ATOM 4496  H H    . LYS A 1 60  ? -7.714  -2.219  -8.781  1.00 0.00 ? 60  LYS A H    19 
ATOM 4497  H HA   . LYS A 1 60  ? -7.184  -0.488  -11.052 1.00 0.00 ? 60  LYS A HA   19 
ATOM 4498  H HB2  . LYS A 1 60  ? -7.369  -2.821  -11.530 1.00 0.00 ? 60  LYS A HB2  19 
ATOM 4499  H HB3  . LYS A 1 60  ? -8.897  -2.951  -10.658 1.00 0.00 ? 60  LYS A HB3  19 
ATOM 4500  H HG2  . LYS A 1 60  ? -10.119 -2.109  -12.398 1.00 0.00 ? 60  LYS A HG2  19 
ATOM 4501  H HG3  . LYS A 1 60  ? -8.845  -0.991  -12.885 1.00 0.00 ? 60  LYS A HG3  19 
ATOM 4502  H HD2  . LYS A 1 60  ? -7.549  -3.074  -13.663 1.00 0.00 ? 60  LYS A HD2  19 
ATOM 4503  H HD3  . LYS A 1 60  ? -9.080  -3.936  -13.509 1.00 0.00 ? 60  LYS A HD3  19 
ATOM 4504  H HE2  . LYS A 1 60  ? -9.936  -2.978  -15.377 1.00 0.00 ? 60  LYS A HE2  19 
ATOM 4505  H HE3  . LYS A 1 60  ? -9.319  -1.384  -14.945 1.00 0.00 ? 60  LYS A HE3  19 
ATOM 4506  H HZ1  . LYS A 1 60  ? -7.081  -2.814  -15.522 1.00 0.00 ? 60  LYS A HZ1  19 
ATOM 4507  H HZ2  . LYS A 1 60  ? -8.195  -3.366  -16.679 1.00 0.00 ? 60  LYS A HZ2  19 
ATOM 4508  H HZ3  . LYS A 1 60  ? -7.843  -1.708  -16.558 1.00 0.00 ? 60  LYS A HZ3  19 
ATOM 4509  N N    . VAL A 1 61  ? -10.084 -0.364  -9.542  1.00 0.00 ? 61  VAL A N    19 
ATOM 4510  C CA   . VAL A 1 61  ? -11.317 0.454   -9.428  1.00 0.00 ? 61  VAL A CA   19 
ATOM 4511  C C    . VAL A 1 61  ? -10.941 1.864   -8.974  1.00 0.00 ? 61  VAL A C    19 
ATOM 4512  O O    . VAL A 1 61  ? -10.899 2.785   -9.760  1.00 0.00 ? 61  VAL A O    19 
ATOM 4513  C CB   . VAL A 1 61  ? -12.246 -0.189  -8.398  1.00 0.00 ? 61  VAL A CB   19 
ATOM 4514  C CG1  . VAL A 1 61  ? -13.360 0.789   -8.029  1.00 0.00 ? 61  VAL A CG1  19 
ATOM 4515  C CG2  . VAL A 1 61  ? -12.856 -1.460  -8.990  1.00 0.00 ? 61  VAL A CG2  19 
ATOM 4516  H H    . VAL A 1 61  ? -9.911  -1.075  -8.892  1.00 0.00 ? 61  VAL A H    19 
ATOM 4517  H HA   . VAL A 1 61  ? -11.813 0.499   -10.386 1.00 0.00 ? 61  VAL A HA   19 
ATOM 4518  H HB   . VAL A 1 61  ? -11.680 -0.439  -7.511  1.00 0.00 ? 61  VAL A HB   19 
ATOM 4519  H HG11 . VAL A 1 61  ? -13.227 1.710   -8.577  1.00 0.00 ? 61  VAL A HG11 19 
ATOM 4520  H HG12 . VAL A 1 61  ? -14.315 0.355   -8.280  1.00 0.00 ? 61  VAL A HG12 19 
ATOM 4521  H HG13 . VAL A 1 61  ? -13.323 0.992   -6.969  1.00 0.00 ? 61  VAL A HG13 19 
ATOM 4522  H HG21 . VAL A 1 61  ? -12.332 -1.721  -9.898  1.00 0.00 ? 61  VAL A HG21 19 
ATOM 4523  H HG22 . VAL A 1 61  ? -12.768 -2.268  -8.279  1.00 0.00 ? 61  VAL A HG22 19 
ATOM 4524  H HG23 . VAL A 1 61  ? -13.899 -1.289  -9.214  1.00 0.00 ? 61  VAL A HG23 19 
ATOM 4525  N N    . LEU A 1 62  ? -10.665 2.035   -7.711  1.00 0.00 ? 62  LEU A N    19 
ATOM 4526  C CA   . LEU A 1 62  ? -10.286 3.383   -7.199  1.00 0.00 ? 62  LEU A CA   19 
ATOM 4527  C C    . LEU A 1 62  ? -9.313  4.045   -8.180  1.00 0.00 ? 62  LEU A C    19 
ATOM 4528  O O    . LEU A 1 62  ? -9.280  5.253   -8.311  1.00 0.00 ? 62  LEU A O    19 
ATOM 4529  C CB   . LEU A 1 62  ? -9.633  3.222   -5.820  1.00 0.00 ? 62  LEU A CB   19 
ATOM 4530  C CG   . LEU A 1 62  ? -8.898  4.501   -5.405  1.00 0.00 ? 62  LEU A CG   19 
ATOM 4531  C CD1  . LEU A 1 62  ? -9.848  5.425   -4.639  1.00 0.00 ? 62  LEU A CD1  19 
ATOM 4532  C CD2  . LEU A 1 62  ? -7.726  4.122   -4.499  1.00 0.00 ? 62  LEU A CD2  19 
ATOM 4533  H H    . LEU A 1 62  ? -10.704 1.273   -7.095  1.00 0.00 ? 62  LEU A H    19 
ATOM 4534  H HA   . LEU A 1 62  ? -11.173 3.992   -7.107  1.00 0.00 ? 62  LEU A HA   19 
ATOM 4535  H HB2  . LEU A 1 62  ? -10.398 3.002   -5.091  1.00 0.00 ? 62  LEU A HB2  19 
ATOM 4536  H HB3  . LEU A 1 62  ? -8.930  2.403   -5.854  1.00 0.00 ? 62  LEU A HB3  19 
ATOM 4537  H HG   . LEU A 1 62  ? -8.525  5.014   -6.278  1.00 0.00 ? 62  LEU A HG   19 
ATOM 4538  H HD11 . LEU A 1 62  ? -10.864 5.230   -4.945  1.00 0.00 ? 62  LEU A HD11 19 
ATOM 4539  H HD12 . LEU A 1 62  ? -9.751  5.242   -3.578  1.00 0.00 ? 62  LEU A HD12 19 
ATOM 4540  H HD13 . LEU A 1 62  ? -9.600  6.454   -4.849  1.00 0.00 ? 62  LEU A HD13 19 
ATOM 4541  H HD21 . LEU A 1 62  ? -7.764  3.063   -4.288  1.00 0.00 ? 62  LEU A HD21 19 
ATOM 4542  H HD22 . LEU A 1 62  ? -6.798  4.357   -4.994  1.00 0.00 ? 62  LEU A HD22 19 
ATOM 4543  H HD23 . LEU A 1 62  ? -7.792  4.676   -3.573  1.00 0.00 ? 62  LEU A HD23 19 
ATOM 4544  N N    . ALA A 1 63  ? -8.522  3.270   -8.874  1.00 0.00 ? 63  ALA A N    19 
ATOM 4545  C CA   . ALA A 1 63  ? -7.562  3.870   -9.845  1.00 0.00 ? 63  ALA A CA   19 
ATOM 4546  C C    . ALA A 1 63  ? -8.325  4.784   -10.804 1.00 0.00 ? 63  ALA A C    19 
ATOM 4547  O O    . ALA A 1 63  ? -8.004  5.945   -10.955 1.00 0.00 ? 63  ALA A O    19 
ATOM 4548  C CB   . ALA A 1 63  ? -6.866  2.756   -10.632 1.00 0.00 ? 63  ALA A CB   19 
ATOM 4549  H H    . ALA A 1 63  ? -8.564  2.297   -8.759  1.00 0.00 ? 63  ALA A H    19 
ATOM 4550  H HA   . ALA A 1 63  ? -6.824  4.449   -9.310  1.00 0.00 ? 63  ALA A HA   19 
ATOM 4551  H HB1  . ALA A 1 63  ? -7.573  1.969   -10.846 1.00 0.00 ? 63  ALA A HB1  19 
ATOM 4552  H HB2  . ALA A 1 63  ? -6.481  3.156   -11.559 1.00 0.00 ? 63  ALA A HB2  19 
ATOM 4553  H HB3  . ALA A 1 63  ? -6.049  2.358   -10.047 1.00 0.00 ? 63  ALA A HB3  19 
ATOM 4554  N N    . LEU A 1 64  ? -9.343  4.275   -11.442 1.00 0.00 ? 64  LEU A N    19 
ATOM 4555  C CA   . LEU A 1 64  ? -10.140 5.119   -12.377 1.00 0.00 ? 64  LEU A CA   19 
ATOM 4556  C C    . LEU A 1 64  ? -10.960 6.112   -11.558 1.00 0.00 ? 64  LEU A C    19 
ATOM 4557  O O    . LEU A 1 64  ? -11.182 7.236   -11.955 1.00 0.00 ? 64  LEU A O    19 
ATOM 4558  C CB   . LEU A 1 64  ? -11.082 4.224   -13.185 1.00 0.00 ? 64  LEU A CB   19 
ATOM 4559  C CG   . LEU A 1 64  ? -10.261 3.382   -14.157 1.00 0.00 ? 64  LEU A CG   19 
ATOM 4560  C CD1  . LEU A 1 64  ? -11.064 2.147   -14.571 1.00 0.00 ? 64  LEU A CD1  19 
ATOM 4561  C CD2  . LEU A 1 64  ? -9.933  4.213   -15.400 1.00 0.00 ? 64  LEU A CD2  19 
ATOM 4562  H H    . LEU A 1 64  ? -9.591  3.338   -11.297 1.00 0.00 ? 64  LEU A H    19 
ATOM 4563  H HA   . LEU A 1 64  ? -9.477  5.653   -13.046 1.00 0.00 ? 64  LEU A HA   19 
ATOM 4564  H HB2  . LEU A 1 64  ? -11.622 3.573   -12.511 1.00 0.00 ? 64  LEU A HB2  19 
ATOM 4565  H HB3  . LEU A 1 64  ? -11.780 4.834   -13.735 1.00 0.00 ? 64  LEU A HB3  19 
ATOM 4566  H HG   . LEU A 1 64  ? -9.346  3.072   -13.675 1.00 0.00 ? 64  LEU A HG   19 
ATOM 4567  H HD11 . LEU A 1 64  ? -11.307 1.567   -13.693 1.00 0.00 ? 64  LEU A HD11 19 
ATOM 4568  H HD12 . LEU A 1 64  ? -11.975 2.459   -15.060 1.00 0.00 ? 64  LEU A HD12 19 
ATOM 4569  H HD13 . LEU A 1 64  ? -10.477 1.547   -15.248 1.00 0.00 ? 64  LEU A HD13 19 
ATOM 4570  H HD21 . LEU A 1 64  ? -9.622  5.202   -15.098 1.00 0.00 ? 64  LEU A HD21 19 
ATOM 4571  H HD22 . LEU A 1 64  ? -9.136  3.737   -15.951 1.00 0.00 ? 64  LEU A HD22 19 
ATOM 4572  H HD23 . LEU A 1 64  ? -10.810 4.287   -16.025 1.00 0.00 ? 64  LEU A HD23 19 
ATOM 4573  N N    . TYR A 1 65  ? -11.406 5.696   -10.411 1.00 0.00 ? 65  TYR A N    19 
ATOM 4574  C CA   . TYR A 1 65  ? -12.209 6.592   -9.537  1.00 0.00 ? 65  TYR A CA   19 
ATOM 4575  C C    . TYR A 1 65  ? -11.510 7.949   -9.418  1.00 0.00 ? 65  TYR A C    19 
ATOM 4576  O O    . TYR A 1 65  ? -12.143 8.979   -9.297  1.00 0.00 ? 65  TYR A O    19 
ATOM 4577  C CB   . TYR A 1 65  ? -12.328 5.947   -8.156  1.00 0.00 ? 65  TYR A CB   19 
ATOM 4578  C CG   . TYR A 1 65  ? -13.019 6.888   -7.205  1.00 0.00 ? 65  TYR A CG   19 
ATOM 4579  C CD1  . TYR A 1 65  ? -12.266 7.804   -6.459  1.00 0.00 ? 65  TYR A CD1  19 
ATOM 4580  C CD2  . TYR A 1 65  ? -14.410 6.839   -7.063  1.00 0.00 ? 65  TYR A CD2  19 
ATOM 4581  C CE1  . TYR A 1 65  ? -12.907 8.672   -5.568  1.00 0.00 ? 65  TYR A CE1  19 
ATOM 4582  C CE2  . TYR A 1 65  ? -15.051 7.708   -6.171  1.00 0.00 ? 65  TYR A CE2  19 
ATOM 4583  C CZ   . TYR A 1 65  ? -14.299 8.624   -5.423  1.00 0.00 ? 65  TYR A CZ   19 
ATOM 4584  O OH   . TYR A 1 65  ? -14.931 9.480   -4.544  1.00 0.00 ? 65  TYR A OH   19 
ATOM 4585  H H    . TYR A 1 65  ? -11.205 4.784   -10.119 1.00 0.00 ? 65  TYR A H    19 
ATOM 4586  H HA   . TYR A 1 65  ? -13.194 6.728   -9.960  1.00 0.00 ? 65  TYR A HA   19 
ATOM 4587  H HB2  . TYR A 1 65  ? -12.898 5.034   -8.236  1.00 0.00 ? 65  TYR A HB2  19 
ATOM 4588  H HB3  . TYR A 1 65  ? -11.341 5.721   -7.782  1.00 0.00 ? 65  TYR A HB3  19 
ATOM 4589  H HD1  . TYR A 1 65  ? -11.190 7.839   -6.570  1.00 0.00 ? 65  TYR A HD1  19 
ATOM 4590  H HD2  . TYR A 1 65  ? -14.992 6.133   -7.644  1.00 0.00 ? 65  TYR A HD2  19 
ATOM 4591  H HE1  . TYR A 1 65  ? -12.327 9.379   -4.991  1.00 0.00 ? 65  TYR A HE1  19 
ATOM 4592  H HE2  . TYR A 1 65  ? -16.123 7.671   -6.055  1.00 0.00 ? 65  TYR A HE2  19 
ATOM 4593  H HH   . TYR A 1 65  ? -15.444 10.107  -5.059  1.00 0.00 ? 65  TYR A HH   19 
ATOM 4594  N N    . ASN A 1 66  ? -10.207 7.953   -9.455  1.00 0.00 ? 66  ASN A N    19 
ATOM 4595  C CA   . ASN A 1 66  ? -9.454  9.234   -9.350  1.00 0.00 ? 66  ASN A CA   19 
ATOM 4596  C C    . ASN A 1 66  ? -9.130  9.738   -10.753 1.00 0.00 ? 66  ASN A C    19 
ATOM 4597  O O    . ASN A 1 66  ? -9.358  10.883  -11.088 1.00 0.00 ? 66  ASN A O    19 
ATOM 4598  C CB   . ASN A 1 66  ? -8.145  8.978   -8.619  1.00 0.00 ? 66  ASN A CB   19 
ATOM 4599  C CG   . ASN A 1 66  ? -7.716  10.241  -7.872  1.00 0.00 ? 66  ASN A CG   19 
ATOM 4600  O OD1  . ASN A 1 66  ? -8.341  10.633  -6.906  1.00 0.00 ? 66  ASN A OD1  19 
ATOM 4601  N ND2  . ASN A 1 66  ? -6.666  10.900  -8.281  1.00 0.00 ? 66  ASN A ND2  19 
ATOM 4602  H H    . ASN A 1 66  ? -9.719  7.110   -9.556  1.00 0.00 ? 66  ASN A H    19 
ATOM 4603  H HA   . ASN A 1 66  ? -10.038 9.967   -8.817  1.00 0.00 ? 66  ASN A HA   19 
ATOM 4604  H HB2  . ASN A 1 66  ? -8.277  8.166   -7.921  1.00 0.00 ? 66  ASN A HB2  19 
ATOM 4605  H HB3  . ASN A 1 66  ? -7.392  8.712   -9.342  1.00 0.00 ? 66  ASN A HB3  19 
ATOM 4606  H HD21 . ASN A 1 66  ? -6.161  10.585  -9.059  1.00 0.00 ? 66  ASN A HD21 19 
ATOM 4607  H HD22 . ASN A 1 66  ? -6.382  11.711  -7.810  1.00 0.00 ? 66  ASN A HD22 19 
ATOM 4608  N N    . GLN A 1 67  ? -8.596  8.876   -11.572 1.00 0.00 ? 67  GLN A N    19 
ATOM 4609  C CA   . GLN A 1 67  ? -8.243  9.270   -12.966 1.00 0.00 ? 67  GLN A CA   19 
ATOM 4610  C C    . GLN A 1 67  ? -9.452  9.908   -13.651 1.00 0.00 ? 67  GLN A C    19 
ATOM 4611  O O    . GLN A 1 67  ? -9.331  10.559  -14.670 1.00 0.00 ? 67  GLN A O    19 
ATOM 4612  C CB   . GLN A 1 67  ? -7.813  8.025   -13.744 1.00 0.00 ? 67  GLN A CB   19 
ATOM 4613  C CG   . GLN A 1 67  ? -6.302  7.832   -13.609 1.00 0.00 ? 67  GLN A CG   19 
ATOM 4614  C CD   . GLN A 1 67  ? -5.574  8.943   -14.369 1.00 0.00 ? 67  GLN A CD   19 
ATOM 4615  O OE1  . GLN A 1 67  ? -6.164  9.626   -15.182 1.00 0.00 ? 67  GLN A OE1  19 
ATOM 4616  N NE2  . GLN A 1 67  ? -4.308  9.154   -14.136 1.00 0.00 ? 67  GLN A NE2  19 
ATOM 4617  H H    . GLN A 1 67  ? -8.425  7.961   -11.266 1.00 0.00 ? 67  GLN A H    19 
ATOM 4618  H HA   . GLN A 1 67  ? -7.434  9.977   -12.943 1.00 0.00 ? 67  GLN A HA   19 
ATOM 4619  H HB2  . GLN A 1 67  ? -8.323  7.160   -13.345 1.00 0.00 ? 67  GLN A HB2  19 
ATOM 4620  H HB3  . GLN A 1 67  ? -8.069  8.142   -14.785 1.00 0.00 ? 67  GLN A HB3  19 
ATOM 4621  H HG2  . GLN A 1 67  ? -6.027  7.870   -12.564 1.00 0.00 ? 67  GLN A HG2  19 
ATOM 4622  H HG3  . GLN A 1 67  ? -6.022  6.874   -14.020 1.00 0.00 ? 67  GLN A HG3  19 
ATOM 4623  H HE21 . GLN A 1 67  ? -3.832  8.603   -13.479 1.00 0.00 ? 67  GLN A HE21 19 
ATOM 4624  H HE22 . GLN A 1 67  ? -3.832  9.862   -14.617 1.00 0.00 ? 67  GLN A HE22 19 
ATOM 4625  N N    . HIS A 1 68  ? -10.614 9.730   -13.097 1.00 0.00 ? 68  HIS A N    19 
ATOM 4626  C CA   . HIS A 1 68  ? -11.835 10.326  -13.710 1.00 0.00 ? 68  HIS A CA   19 
ATOM 4627  C C    . HIS A 1 68  ? -12.090 11.705  -13.097 1.00 0.00 ? 68  HIS A C    19 
ATOM 4628  O O    . HIS A 1 68  ? -12.414 12.651  -13.786 1.00 0.00 ? 68  HIS A O    19 
ATOM 4629  C CB   . HIS A 1 68  ? -13.040 9.422   -13.440 1.00 0.00 ? 68  HIS A CB   19 
ATOM 4630  C CG   . HIS A 1 68  ? -13.189 8.428   -14.558 1.00 0.00 ? 68  HIS A CG   19 
ATOM 4631  N ND1  . HIS A 1 68  ? -12.594 7.176   -14.527 1.00 0.00 ? 68  HIS A ND1  19 
ATOM 4632  C CD2  . HIS A 1 68  ? -13.876 8.487   -15.743 1.00 0.00 ? 68  HIS A CD2  19 
ATOM 4633  C CE1  . HIS A 1 68  ? -12.932 6.538   -15.661 1.00 0.00 ? 68  HIS A CE1  19 
ATOM 4634  N NE2  . HIS A 1 68  ? -13.713 7.293   -16.440 1.00 0.00 ? 68  HIS A NE2  19 
ATOM 4635  H H    . HIS A 1 68  ? -10.683 9.205   -12.276 1.00 0.00 ? 68  HIS A H    19 
ATOM 4636  H HA   . HIS A 1 68  ? -11.692 10.427  -14.775 1.00 0.00 ? 68  HIS A HA   19 
ATOM 4637  H HB2  . HIS A 1 68  ? -12.894 8.895   -12.508 1.00 0.00 ? 68  HIS A HB2  19 
ATOM 4638  H HB3  . HIS A 1 68  ? -13.934 10.024  -13.377 1.00 0.00 ? 68  HIS A HB3  19 
ATOM 4639  H HD1  . HIS A 1 68  ? -12.030 6.821   -13.811 1.00 0.00 ? 68  HIS A HD1  19 
ATOM 4640  H HD2  . HIS A 1 68  ? -14.457 9.332   -16.082 1.00 0.00 ? 68  HIS A HD2  19 
ATOM 4641  H HE1  . HIS A 1 68  ? -12.615 5.537   -15.911 1.00 0.00 ? 68  HIS A HE1  19 
ATOM 4642  N N    . ASN A 1 69  ? -11.947 11.825  -11.806 1.00 0.00 ? 69  ASN A N    19 
ATOM 4643  C CA   . ASN A 1 69  ? -12.183 13.140  -11.147 1.00 0.00 ? 69  ASN A CA   19 
ATOM 4644  C C    . ASN A 1 69  ? -10.835 13.789  -10.805 1.00 0.00 ? 69  ASN A C    19 
ATOM 4645  O O    . ASN A 1 69  ? -10.144 13.333  -9.916  1.00 0.00 ? 69  ASN A O    19 
ATOM 4646  C CB   . ASN A 1 69  ? -12.978 12.924  -9.859  1.00 0.00 ? 69  ASN A CB   19 
ATOM 4647  C CG   . ASN A 1 69  ? -14.355 12.347  -10.198 1.00 0.00 ? 69  ASN A CG   19 
ATOM 4648  O OD1  . ASN A 1 69  ? -14.469 11.470  -11.031 1.00 0.00 ? 69  ASN A OD1  19 
ATOM 4649  N ND2  . ASN A 1 69  ? -15.411 12.807  -9.584  1.00 0.00 ? 69  ASN A ND2  19 
ATOM 4650  H H    . ASN A 1 69  ? -11.686 11.048  -11.268 1.00 0.00 ? 69  ASN A H    19 
ATOM 4651  H HA   . ASN A 1 69  ? -12.743 13.780  -11.810 1.00 0.00 ? 69  ASN A HA   19 
ATOM 4652  H HB2  . ASN A 1 69  ? -12.446 12.235  -9.218  1.00 0.00 ? 69  ASN A HB2  19 
ATOM 4653  H HB3  . ASN A 1 69  ? -13.101 13.867  -9.349  1.00 0.00 ? 69  ASN A HB3  19 
ATOM 4654  H HD21 . ASN A 1 69  ? -15.319 13.514  -8.913  1.00 0.00 ? 69  ASN A HD21 19 
ATOM 4655  H HD22 . ASN A 1 69  ? -16.297 12.444  -9.796  1.00 0.00 ? 69  ASN A HD22 19 
ATOM 4656  N N    . PRO A 1 70  ? -10.500 14.837  -11.517 1.00 0.00 ? 70  PRO A N    19 
ATOM 4657  C CA   . PRO A 1 70  ? -9.239  15.566  -11.298 1.00 0.00 ? 70  PRO A CA   19 
ATOM 4658  C C    . PRO A 1 70  ? -9.355  16.463  -10.063 1.00 0.00 ? 70  PRO A C    19 
ATOM 4659  O O    . PRO A 1 70  ? -10.113 17.412  -10.043 1.00 0.00 ? 70  PRO A O    19 
ATOM 4660  C CB   . PRO A 1 70  ? -9.080  16.401  -12.572 1.00 0.00 ? 70  PRO A CB   19 
ATOM 4661  C CG   . PRO A 1 70  ? -10.496 16.544  -13.178 1.00 0.00 ? 70  PRO A CG   19 
ATOM 4662  C CD   . PRO A 1 70  ? -11.340 15.393  -12.597 1.00 0.00 ? 70  PRO A CD   19 
ATOM 4663  H HA   . PRO A 1 70  ? -8.413  14.880  -11.199 1.00 0.00 ? 70  PRO A HA   19 
ATOM 4664  H HB2  . PRO A 1 70  ? -8.676  17.375  -12.328 1.00 0.00 ? 70  PRO A HB2  19 
ATOM 4665  H HB3  . PRO A 1 70  ? -8.435  15.894  -13.271 1.00 0.00 ? 70  PRO A HB3  19 
ATOM 4666  H HG2  . PRO A 1 70  ? -10.923 17.498  -12.899 1.00 0.00 ? 70  PRO A HG2  19 
ATOM 4667  H HG3  . PRO A 1 70  ? -10.452 16.455  -14.252 1.00 0.00 ? 70  PRO A HG3  19 
ATOM 4668  H HD2  . PRO A 1 70  ? -12.272 15.772  -12.200 1.00 0.00 ? 70  PRO A HD2  19 
ATOM 4669  H HD3  . PRO A 1 70  ? -11.525 14.641  -13.349 1.00 0.00 ? 70  PRO A HD3  19 
ATOM 4670  N N    . GLY A 1 71  ? -8.612  16.166  -9.033  1.00 0.00 ? 71  GLY A N    19 
ATOM 4671  C CA   . GLY A 1 71  ? -8.683  16.998  -7.799  1.00 0.00 ? 71  GLY A CA   19 
ATOM 4672  C C    . GLY A 1 71  ? -9.117  16.125  -6.619  1.00 0.00 ? 71  GLY A C    19 
ATOM 4673  O O    . GLY A 1 71  ? -9.282  16.600  -5.512  1.00 0.00 ? 71  GLY A O    19 
ATOM 4674  H H    . GLY A 1 71  ? -8.010  15.393  -9.069  1.00 0.00 ? 71  GLY A H    19 
ATOM 4675  H HA2  . GLY A 1 71  ? -7.710  17.423  -7.596  1.00 0.00 ? 71  GLY A HA2  19 
ATOM 4676  H HA3  . GLY A 1 71  ? -9.402  17.790  -7.939  1.00 0.00 ? 71  GLY A HA3  19 
ATOM 4677  N N    . ALA A 1 72  ? -9.296  14.852  -6.842  1.00 0.00 ? 72  ALA A N    19 
ATOM 4678  C CA   . ALA A 1 72  ? -9.709  13.952  -5.735  1.00 0.00 ? 72  ALA A CA   19 
ATOM 4679  C C    . ALA A 1 72  ? -8.466  13.344  -5.098  1.00 0.00 ? 72  ALA A C    19 
ATOM 4680  O O    . ALA A 1 72  ? -7.663  12.706  -5.751  1.00 0.00 ? 72  ALA A O    19 
ATOM 4681  C CB   . ALA A 1 72  ? -10.599 12.835  -6.278  1.00 0.00 ? 72  ALA A CB   19 
ATOM 4682  H H    . ALA A 1 72  ? -9.153  14.486  -7.735  1.00 0.00 ? 72  ALA A H    19 
ATOM 4683  H HA   . ALA A 1 72  ? -10.254 14.519  -4.995  1.00 0.00 ? 72  ALA A HA   19 
ATOM 4684  H HB1  . ALA A 1 72  ? -10.928 13.090  -7.274  1.00 0.00 ? 72  ALA A HB1  19 
ATOM 4685  H HB2  . ALA A 1 72  ? -10.038 11.912  -6.308  1.00 0.00 ? 72  ALA A HB2  19 
ATOM 4686  H HB3  . ALA A 1 72  ? -11.456 12.715  -5.634  1.00 0.00 ? 72  ALA A HB3  19 
ATOM 4687  N N    . SER A 1 73  ? -8.303  13.543  -3.829  1.00 0.00 ? 73  SER A N    19 
ATOM 4688  C CA   . SER A 1 73  ? -7.110  12.988  -3.130  1.00 0.00 ? 73  SER A CA   19 
ATOM 4689  C C    . SER A 1 73  ? -7.455  11.625  -2.528  1.00 0.00 ? 73  SER A C    19 
ATOM 4690  O O    . SER A 1 73  ? -7.126  11.337  -1.393  1.00 0.00 ? 73  SER A O    19 
ATOM 4691  C CB   . SER A 1 73  ? -6.683  13.943  -2.014  1.00 0.00 ? 73  SER A CB   19 
ATOM 4692  O OG   . SER A 1 73  ? -7.481  15.118  -2.070  1.00 0.00 ? 73  SER A OG   19 
ATOM 4693  H H    . SER A 1 73  ? -8.966  14.063  -3.337  1.00 0.00 ? 73  SER A H    19 
ATOM 4694  H HA   . SER A 1 73  ? -6.302  12.875  -3.835  1.00 0.00 ? 73  SER A HA   19 
ATOM 4695  H HB2  . SER A 1 73  ? -6.819  13.467  -1.058  1.00 0.00 ? 73  SER A HB2  19 
ATOM 4696  H HB3  . SER A 1 73  ? -5.639  14.198  -2.142  1.00 0.00 ? 73  SER A HB3  19 
ATOM 4697  H HG   . SER A 1 73  ? -7.388  15.498  -2.947  1.00 0.00 ? 73  SER A HG   19 
ATOM 4698  N N    . ALA A 1 74  ? -8.111  10.779  -3.275  1.00 0.00 ? 74  ALA A N    19 
ATOM 4699  C CA   . ALA A 1 74  ? -8.466  9.436   -2.736  1.00 0.00 ? 74  ALA A CA   19 
ATOM 4700  C C    . ALA A 1 74  ? -7.819  8.354   -3.601  1.00 0.00 ? 74  ALA A C    19 
ATOM 4701  O O    . ALA A 1 74  ? -8.157  7.190   -3.513  1.00 0.00 ? 74  ALA A O    19 
ATOM 4702  C CB   . ALA A 1 74  ? -9.987  9.260   -2.745  1.00 0.00 ? 74  ALA A CB   19 
ATOM 4703  H H    . ALA A 1 74  ? -8.366  11.025  -4.188  1.00 0.00 ? 74  ALA A H    19 
ATOM 4704  H HA   . ALA A 1 74  ? -8.100  9.351   -1.726  1.00 0.00 ? 74  ALA A HA   19 
ATOM 4705  H HB1  . ALA A 1 74  ? -10.377 9.536   -3.713  1.00 0.00 ? 74  ALA A HB1  19 
ATOM 4706  H HB2  . ALA A 1 74  ? -10.231 8.228   -2.539  1.00 0.00 ? 74  ALA A HB2  19 
ATOM 4707  H HB3  . ALA A 1 74  ? -10.426 9.892   -1.986  1.00 0.00 ? 74  ALA A HB3  19 
ATOM 4708  N N    . ALA A 1 75  ? -6.884  8.728   -4.432  1.00 0.00 ? 75  ALA A N    19 
ATOM 4709  C CA   . ALA A 1 75  ? -6.207  7.723   -5.299  1.00 0.00 ? 75  ALA A CA   19 
ATOM 4710  C C    . ALA A 1 75  ? -5.700  6.567   -4.428  1.00 0.00 ? 75  ALA A C    19 
ATOM 4711  O O    . ALA A 1 75  ? -5.934  6.552   -3.235  1.00 0.00 ? 75  ALA A O    19 
ATOM 4712  C CB   . ALA A 1 75  ? -5.032  8.396   -6.010  1.00 0.00 ? 75  ALA A CB   19 
ATOM 4713  H H    . ALA A 1 75  ? -6.626  9.672   -4.482  1.00 0.00 ? 75  ALA A H    19 
ATOM 4714  H HA   . ALA A 1 75  ? -6.908  7.347   -6.032  1.00 0.00 ? 75  ALA A HA   19 
ATOM 4715  H HB1  . ALA A 1 75  ? -5.103  9.467   -5.890  1.00 0.00 ? 75  ALA A HB1  19 
ATOM 4716  H HB2  . ALA A 1 75  ? -4.103  8.048   -5.580  1.00 0.00 ? 75  ALA A HB2  19 
ATOM 4717  H HB3  . ALA A 1 75  ? -5.056  8.149   -7.061  1.00 0.00 ? 75  ALA A HB3  19 
ATOM 4718  N N    . PRO A 1 76  ? -5.024  5.627   -5.043  1.00 0.00 ? 76  PRO A N    19 
ATOM 4719  C CA   . PRO A 1 76  ? -4.483  4.454   -4.333  1.00 0.00 ? 76  PRO A CA   19 
ATOM 4720  C C    . PRO A 1 76  ? -3.203  4.831   -3.592  1.00 0.00 ? 76  PRO A C    19 
ATOM 4721  O O    . PRO A 1 76  ? -2.950  5.987   -3.319  1.00 0.00 ? 76  PRO A O    19 
ATOM 4722  C CB   . PRO A 1 76  ? -4.181  3.461   -5.454  1.00 0.00 ? 76  PRO A CB   19 
ATOM 4723  C CG   . PRO A 1 76  ? -4.014  4.298   -6.739  1.00 0.00 ? 76  PRO A CG   19 
ATOM 4724  C CD   . PRO A 1 76  ? -4.733  5.639   -6.492  1.00 0.00 ? 76  PRO A CD   19 
ATOM 4725  H HA   . PRO A 1 76  ? -5.213  4.041   -3.657  1.00 0.00 ? 76  PRO A HA   19 
ATOM 4726  H HB2  . PRO A 1 76  ? -3.269  2.922   -5.236  1.00 0.00 ? 76  PRO A HB2  19 
ATOM 4727  H HB3  . PRO A 1 76  ? -5.003  2.772   -5.573  1.00 0.00 ? 76  PRO A HB3  19 
ATOM 4728  H HG2  . PRO A 1 76  ? -2.961  4.471   -6.928  1.00 0.00 ? 76  PRO A HG2  19 
ATOM 4729  H HG3  . PRO A 1 76  ? -4.464  3.790   -7.573  1.00 0.00 ? 76  PRO A HG3  19 
ATOM 4730  H HD2  . PRO A 1 76  ? -4.080  6.460   -6.747  1.00 0.00 ? 76  PRO A HD2  19 
ATOM 4731  H HD3  . PRO A 1 76  ? -5.651  5.688   -7.058  1.00 0.00 ? 76  PRO A HD3  19 
ATOM 4732  N N    . CYS A 1 77  ? -2.394  3.866   -3.263  1.00 0.00 ? 77  CYS A N    19 
ATOM 4733  C CA   . CYS A 1 77  ? -1.135  4.180   -2.539  1.00 0.00 ? 77  CYS A CA   19 
ATOM 4734  C C    . CYS A 1 77  ? -0.019  3.225   -2.973  1.00 0.00 ? 77  CYS A C    19 
ATOM 4735  O O    . CYS A 1 77  ? 0.075   2.112   -2.498  1.00 0.00 ? 77  CYS A O    19 
ATOM 4736  C CB   . CYS A 1 77  ? -1.369  4.041   -1.034  1.00 0.00 ? 77  CYS A CB   19 
ATOM 4737  S SG   . CYS A 1 77  ? -0.986  5.611   -0.220  1.00 0.00 ? 77  CYS A SG   19 
ATOM 4738  H H    . CYS A 1 77  ? -2.615  2.939   -3.489  1.00 0.00 ? 77  CYS A H    19 
ATOM 4739  H HA   . CYS A 1 77  ? -0.841  5.196   -2.761  1.00 0.00 ? 77  CYS A HA   19 
ATOM 4740  H HB2  . CYS A 1 77  ? -2.401  3.781   -0.853  1.00 0.00 ? 77  CYS A HB2  19 
ATOM 4741  H HB3  . CYS A 1 77  ? -0.728  3.265   -0.641  1.00 0.00 ? 77  CYS A HB3  19 
ATOM 4742  N N    . CYS A 1 78  ? 0.834   3.657   -3.862  1.00 0.00 ? 78  CYS A N    19 
ATOM 4743  C CA   . CYS A 1 78  ? 1.959   2.781   -4.307  1.00 0.00 ? 78  CYS A CA   19 
ATOM 4744  C C    . CYS A 1 78  ? 2.727   2.302   -3.066  1.00 0.00 ? 78  CYS A C    19 
ATOM 4745  O O    . CYS A 1 78  ? 2.936   3.054   -2.134  1.00 0.00 ? 78  CYS A O    19 
ATOM 4746  C CB   . CYS A 1 78  ? 2.891   3.590   -5.215  1.00 0.00 ? 78  CYS A CB   19 
ATOM 4747  S SG   . CYS A 1 78  ? 4.355   2.608   -5.627  1.00 0.00 ? 78  CYS A SG   19 
ATOM 4748  H H    . CYS A 1 78  ? 0.741   4.561   -4.229  1.00 0.00 ? 78  CYS A H    19 
ATOM 4749  H HA   . CYS A 1 78  ? 1.569   1.931   -4.846  1.00 0.00 ? 78  CYS A HA   19 
ATOM 4750  H HB2  . CYS A 1 78  ? 2.369   3.857   -6.117  1.00 0.00 ? 78  CYS A HB2  19 
ATOM 4751  H HB3  . CYS A 1 78  ? 3.198   4.489   -4.700  1.00 0.00 ? 78  CYS A HB3  19 
ATOM 4752  N N    . VAL A 1 79  ? 3.135   1.059   -3.029  1.00 0.00 ? 79  VAL A N    19 
ATOM 4753  C CA   . VAL A 1 79  ? 3.865   0.555   -1.828  1.00 0.00 ? 79  VAL A CA   19 
ATOM 4754  C C    . VAL A 1 79  ? 4.926   -0.477  -2.248  1.00 0.00 ? 79  VAL A C    19 
ATOM 4755  O O    . VAL A 1 79  ? 5.098   -0.736  -3.418  1.00 0.00 ? 79  VAL A O    19 
ATOM 4756  C CB   . VAL A 1 79  ? 2.848   -0.065  -0.853  1.00 0.00 ? 79  VAL A CB   19 
ATOM 4757  C CG1  . VAL A 1 79  ? 1.513   0.658   -0.997  1.00 0.00 ? 79  VAL A CG1  19 
ATOM 4758  C CG2  . VAL A 1 79  ? 2.636   -1.551  -1.164  1.00 0.00 ? 79  VAL A CG2  19 
ATOM 4759  H H    . VAL A 1 79  ? 2.953   0.459   -3.774  1.00 0.00 ? 79  VAL A H    19 
ATOM 4760  H HA   . VAL A 1 79  ? 4.353   1.385   -1.351  1.00 0.00 ? 79  VAL A HA   19 
ATOM 4761  H HB   . VAL A 1 79  ? 3.201   0.052   0.158   1.00 0.00 ? 79  VAL A HB   19 
ATOM 4762  H HG11 . VAL A 1 79  ? 1.685   1.721   -1.056  1.00 0.00 ? 79  VAL A HG11 19 
ATOM 4763  H HG12 . VAL A 1 79  ? 1.020   0.322   -1.898  1.00 0.00 ? 79  VAL A HG12 19 
ATOM 4764  H HG13 . VAL A 1 79  ? 0.893   0.439   -0.145  1.00 0.00 ? 79  VAL A HG13 19 
ATOM 4765  H HG21 . VAL A 1 79  ? 2.770   -1.720  -2.223  1.00 0.00 ? 79  VAL A HG21 19 
ATOM 4766  H HG22 . VAL A 1 79  ? 3.351   -2.140  -0.611  1.00 0.00 ? 79  VAL A HG22 19 
ATOM 4767  H HG23 . VAL A 1 79  ? 1.634   -1.838  -0.879  1.00 0.00 ? 79  VAL A HG23 19 
ATOM 4768  N N    . PRO A 1 80  ? 5.612   -1.033  -1.279  1.00 0.00 ? 80  PRO A N    19 
ATOM 4769  C CA   . PRO A 1 80  ? 6.665   -2.034  -1.525  1.00 0.00 ? 80  PRO A CA   19 
ATOM 4770  C C    . PRO A 1 80  ? 6.042   -3.416  -1.747  1.00 0.00 ? 80  PRO A C    19 
ATOM 4771  O O    . PRO A 1 80  ? 5.666   -4.096  -0.814  1.00 0.00 ? 80  PRO A O    19 
ATOM 4772  C CB   . PRO A 1 80  ? 7.492   -2.009  -0.238  1.00 0.00 ? 80  PRO A CB   19 
ATOM 4773  C CG   . PRO A 1 80  ? 6.567   -1.441  0.864   1.00 0.00 ? 80  PRO A CG   19 
ATOM 4774  C CD   . PRO A 1 80  ? 5.409   -0.720  0.148   1.00 0.00 ? 80  PRO A CD   19 
ATOM 4775  H HA   . PRO A 1 80  ? 7.278   -1.749  -2.364  1.00 0.00 ? 80  PRO A HA   19 
ATOM 4776  H HB2  . PRO A 1 80  ? 7.809   -3.012  0.017   1.00 0.00 ? 80  PRO A HB2  19 
ATOM 4777  H HB3  . PRO A 1 80  ? 8.349   -1.367  -0.360  1.00 0.00 ? 80  PRO A HB3  19 
ATOM 4778  H HG2  . PRO A 1 80  ? 6.184   -2.247  1.475   1.00 0.00 ? 80  PRO A HG2  19 
ATOM 4779  H HG3  . PRO A 1 80  ? 7.109   -0.738  1.476   1.00 0.00 ? 80  PRO A HG3  19 
ATOM 4780  H HD2  . PRO A 1 80  ? 4.464   -1.115  0.491   1.00 0.00 ? 80  PRO A HD2  19 
ATOM 4781  H HD3  . PRO A 1 80  ? 5.462   0.345   0.311   1.00 0.00 ? 80  PRO A HD3  19 
ATOM 4782  N N    . GLN A 1 81  ? 5.927   -3.831  -2.978  1.00 0.00 ? 81  GLN A N    19 
ATOM 4783  C CA   . GLN A 1 81  ? 5.325   -5.163  -3.264  1.00 0.00 ? 81  GLN A CA   19 
ATOM 4784  C C    . GLN A 1 81  ? 6.298   -6.267  -2.848  1.00 0.00 ? 81  GLN A C    19 
ATOM 4785  O O    . GLN A 1 81  ? 6.078   -6.970  -1.882  1.00 0.00 ? 81  GLN A O    19 
ATOM 4786  C CB   . GLN A 1 81  ? 5.043   -5.278  -4.761  1.00 0.00 ? 81  GLN A CB   19 
ATOM 4787  C CG   . GLN A 1 81  ? 3.827   -6.179  -4.984  1.00 0.00 ? 81  GLN A CG   19 
ATOM 4788  C CD   . GLN A 1 81  ? 4.282   -7.526  -5.545  1.00 0.00 ? 81  GLN A CD   19 
ATOM 4789  O OE1  . GLN A 1 81  ? 4.521   -8.458  -4.803  1.00 0.00 ? 81  GLN A OE1  19 
ATOM 4790  N NE2  . GLN A 1 81  ? 4.414   -7.670  -6.836  1.00 0.00 ? 81  GLN A NE2  19 
ATOM 4791  H H    . GLN A 1 81  ? 6.233   -3.265  -3.714  1.00 0.00 ? 81  GLN A H    19 
ATOM 4792  H HA   . GLN A 1 81  ? 4.402   -5.269  -2.714  1.00 0.00 ? 81  GLN A HA   19 
ATOM 4793  H HB2  . GLN A 1 81  ? 4.844   -4.295  -5.164  1.00 0.00 ? 81  GLN A HB2  19 
ATOM 4794  H HB3  . GLN A 1 81  ? 5.901   -5.704  -5.258  1.00 0.00 ? 81  GLN A HB3  19 
ATOM 4795  H HG2  . GLN A 1 81  ? 3.319   -6.333  -4.043  1.00 0.00 ? 81  GLN A HG2  19 
ATOM 4796  H HG3  . GLN A 1 81  ? 3.155   -5.708  -5.684  1.00 0.00 ? 81  GLN A HG3  19 
ATOM 4797  H HE21 . GLN A 1 81  ? 4.221   -6.919  -7.434  1.00 0.00 ? 81  GLN A HE21 19 
ATOM 4798  H HE22 . GLN A 1 81  ? 4.703   -8.529  -7.206  1.00 0.00 ? 81  GLN A HE22 19 
ATOM 4799  N N    . ALA A 1 82  ? 7.372   -6.426  -3.571  1.00 0.00 ? 82  ALA A N    19 
ATOM 4800  C CA   . ALA A 1 82  ? 8.356   -7.487  -3.217  1.00 0.00 ? 82  ALA A CA   19 
ATOM 4801  C C    . ALA A 1 82  ? 9.394   -6.913  -2.252  1.00 0.00 ? 82  ALA A C    19 
ATOM 4802  O O    . ALA A 1 82  ? 10.035  -5.921  -2.535  1.00 0.00 ? 82  ALA A O    19 
ATOM 4803  C CB   . ALA A 1 82  ? 9.055   -7.980  -4.485  1.00 0.00 ? 82  ALA A CB   19 
ATOM 4804  H H    . ALA A 1 82  ? 7.530   -5.849  -4.346  1.00 0.00 ? 82  ALA A H    19 
ATOM 4805  H HA   . ALA A 1 82  ? 7.843   -8.312  -2.744  1.00 0.00 ? 82  ALA A HA   19 
ATOM 4806  H HB1  . ALA A 1 82  ? 8.726   -7.392  -5.330  1.00 0.00 ? 82  ALA A HB1  19 
ATOM 4807  H HB2  . ALA A 1 82  ? 10.124  -7.877  -4.370  1.00 0.00 ? 82  ALA A HB2  19 
ATOM 4808  H HB3  . ALA A 1 82  ? 8.809   -9.018  -4.652  1.00 0.00 ? 82  ALA A HB3  19 
ATOM 4809  N N    . LEU A 1 83  ? 9.564   -7.528  -1.114  1.00 0.00 ? 83  LEU A N    19 
ATOM 4810  C CA   . LEU A 1 83  ? 10.559  -7.016  -0.136  1.00 0.00 ? 83  LEU A CA   19 
ATOM 4811  C C    . LEU A 1 83  ? 11.735  -7.983  -0.053  1.00 0.00 ? 83  LEU A C    19 
ATOM 4812  O O    . LEU A 1 83  ? 11.894  -8.868  -0.871  1.00 0.00 ? 83  LEU A O    19 
ATOM 4813  C CB   . LEU A 1 83  ? 9.912   -6.904  1.248   1.00 0.00 ? 83  LEU A CB   19 
ATOM 4814  C CG   . LEU A 1 83  ? 8.850   -5.810  1.228   1.00 0.00 ? 83  LEU A CG   19 
ATOM 4815  C CD1  . LEU A 1 83  ? 7.734   -6.159  2.214   1.00 0.00 ? 83  LEU A CD1  19 
ATOM 4816  C CD2  . LEU A 1 83  ? 9.489   -4.483  1.639   1.00 0.00 ? 83  LEU A CD2  19 
ATOM 4817  H H    . LEU A 1 83  ? 9.038   -8.326  -0.904  1.00 0.00 ? 83  LEU A H    19 
ATOM 4818  H HA   . LEU A 1 83  ? 10.910  -6.044  -0.449  1.00 0.00 ? 83  LEU A HA   19 
ATOM 4819  H HB2  . LEU A 1 83  ? 9.456   -7.845  1.511   1.00 0.00 ? 83  LEU A HB2  19 
ATOM 4820  H HB3  . LEU A 1 83  ? 10.663  -6.655  1.980   1.00 0.00 ? 83  LEU A HB3  19 
ATOM 4821  H HG   . LEU A 1 83  ? 8.445   -5.724  0.233   1.00 0.00 ? 83  LEU A HG   19 
ATOM 4822  H HD11 . LEU A 1 83  ? 7.534   -7.220  2.170   1.00 0.00 ? 83  LEU A HD11 19 
ATOM 4823  H HD12 . LEU A 1 83  ? 8.042   -5.893  3.215   1.00 0.00 ? 83  LEU A HD12 19 
ATOM 4824  H HD13 . LEU A 1 83  ? 6.839   -5.613  1.954   1.00 0.00 ? 83  LEU A HD13 19 
ATOM 4825  H HD21 . LEU A 1 83  ? 10.235  -4.665  2.400   1.00 0.00 ? 83  LEU A HD21 19 
ATOM 4826  H HD22 . LEU A 1 83  ? 9.956   -4.027  0.779   1.00 0.00 ? 83  LEU A HD22 19 
ATOM 4827  H HD23 . LEU A 1 83  ? 8.729   -3.824  2.030   1.00 0.00 ? 83  LEU A HD23 19 
ATOM 4828  N N    . GLU A 1 84  ? 12.553  -7.817  0.939   1.00 0.00 ? 84  GLU A N    19 
ATOM 4829  C CA   . GLU A 1 84  ? 13.725  -8.714  1.115   1.00 0.00 ? 84  GLU A CA   19 
ATOM 4830  C C    . GLU A 1 84  ? 14.102  -8.732  2.597   1.00 0.00 ? 84  GLU A C    19 
ATOM 4831  O O    . GLU A 1 84  ? 13.774  -7.817  3.324   1.00 0.00 ? 84  GLU A O    19 
ATOM 4832  C CB   . GLU A 1 84  ? 14.901  -8.191  0.287   1.00 0.00 ? 84  GLU A CB   19 
ATOM 4833  C CG   . GLU A 1 84  ? 14.908  -8.871  -1.083  1.00 0.00 ? 84  GLU A CG   19 
ATOM 4834  C CD   . GLU A 1 84  ? 15.321  -10.336 -0.925  1.00 0.00 ? 84  GLU A CD   19 
ATOM 4835  O OE1  . GLU A 1 84  ? 14.517  -11.107 -0.427  1.00 0.00 ? 84  GLU A OE1  19 
ATOM 4836  O OE2  . GLU A 1 84  ? 16.433  -10.662 -1.307  1.00 0.00 ? 84  GLU A OE2  19 
ATOM 4837  H H    . GLU A 1 84  ? 12.389  -7.097  1.581   1.00 0.00 ? 84  GLU A H    19 
ATOM 4838  H HA   . GLU A 1 84  ? 13.469  -9.713  0.792   1.00 0.00 ? 84  GLU A HA   19 
ATOM 4839  H HB2  . GLU A 1 84  ? 14.804  -7.123  0.158   1.00 0.00 ? 84  GLU A HB2  19 
ATOM 4840  H HB3  . GLU A 1 84  ? 15.827  -8.408  0.800   1.00 0.00 ? 84  GLU A HB3  19 
ATOM 4841  H HG2  . GLU A 1 84  ? 13.919  -8.819  -1.516  1.00 0.00 ? 84  GLU A HG2  19 
ATOM 4842  H HG3  . GLU A 1 84  ? 15.612  -8.369  -1.731  1.00 0.00 ? 84  GLU A HG3  19 
ATOM 4843  N N    . PRO A 1 85  ? 14.775  -9.774  3.004   1.00 0.00 ? 85  PRO A N    19 
ATOM 4844  C CA   . PRO A 1 85  ? 15.203  -9.937  4.402   1.00 0.00 ? 85  PRO A CA   19 
ATOM 4845  C C    . PRO A 1 85  ? 16.385  -9.015  4.716   1.00 0.00 ? 85  PRO A C    19 
ATOM 4846  O O    . PRO A 1 85  ? 16.676  -8.094  3.980   1.00 0.00 ? 85  PRO A O    19 
ATOM 4847  C CB   . PRO A 1 85  ? 15.593  -11.415 4.490   1.00 0.00 ? 85  PRO A CB   19 
ATOM 4848  C CG   . PRO A 1 85  ? 15.888  -11.875 3.044   1.00 0.00 ? 85  PRO A CG   19 
ATOM 4849  C CD   . PRO A 1 85  ? 15.176  -10.879 2.111   1.00 0.00 ? 85  PRO A CD   19 
ATOM 4850  H HA   . PRO A 1 85  ? 14.381  -9.737  5.070   1.00 0.00 ? 85  PRO A HA   19 
ATOM 4851  H HB2  . PRO A 1 85  ? 16.475  -11.528 5.107   1.00 0.00 ? 85  PRO A HB2  19 
ATOM 4852  H HB3  . PRO A 1 85  ? 14.777  -11.992 4.896   1.00 0.00 ? 85  PRO A HB3  19 
ATOM 4853  H HG2  . PRO A 1 85  ? 16.952  -11.862 2.863   1.00 0.00 ? 85  PRO A HG2  19 
ATOM 4854  H HG3  . PRO A 1 85  ? 15.493  -12.866 2.885   1.00 0.00 ? 85  PRO A HG3  19 
ATOM 4855  H HD2  . PRO A 1 85  ? 15.856  -10.525 1.347   1.00 0.00 ? 85  PRO A HD2  19 
ATOM 4856  H HD3  . PRO A 1 85  ? 14.305  -11.333 1.664   1.00 0.00 ? 85  PRO A HD3  19 
ATOM 4857  N N    . LEU A 1 86  ? 17.053  -9.238  5.815   1.00 0.00 ? 86  LEU A N    19 
ATOM 4858  C CA   . LEU A 1 86  ? 18.193  -8.353  6.183   1.00 0.00 ? 86  LEU A CA   19 
ATOM 4859  C C    . LEU A 1 86  ? 19.027  -9.037  7.281   1.00 0.00 ? 86  LEU A C    19 
ATOM 4860  O O    . LEU A 1 86  ? 18.597  -9.126  8.410   1.00 0.00 ? 86  LEU A O    19 
ATOM 4861  C CB   . LEU A 1 86  ? 17.604  -7.009  6.672   1.00 0.00 ? 86  LEU A CB   19 
ATOM 4862  C CG   . LEU A 1 86  ? 18.484  -6.337  7.741   1.00 0.00 ? 86  LEU A CG   19 
ATOM 4863  C CD1  . LEU A 1 86  ? 19.521  -5.430  7.085   1.00 0.00 ? 86  LEU A CD1  19 
ATOM 4864  C CD2  . LEU A 1 86  ? 17.598  -5.487  8.654   1.00 0.00 ? 86  LEU A CD2  19 
ATOM 4865  H H    . LEU A 1 86  ? 16.793  -9.974  6.409   1.00 0.00 ? 86  LEU A H    19 
ATOM 4866  H HA   . LEU A 1 86  ? 18.805  -8.179  5.313   1.00 0.00 ? 86  LEU A HA   19 
ATOM 4867  H HB2  . LEU A 1 86  ? 17.512  -6.341  5.828   1.00 0.00 ? 86  LEU A HB2  19 
ATOM 4868  H HB3  . LEU A 1 86  ? 16.623  -7.186  7.085   1.00 0.00 ? 86  LEU A HB3  19 
ATOM 4869  H HG   . LEU A 1 86  ? 18.983  -7.083  8.325   1.00 0.00 ? 86  LEU A HG   19 
ATOM 4870  H HD11 . LEU A 1 86  ? 20.145  -6.013  6.427   1.00 0.00 ? 86  LEU A HD11 19 
ATOM 4871  H HD12 . LEU A 1 86  ? 19.017  -4.659  6.522   1.00 0.00 ? 86  LEU A HD12 19 
ATOM 4872  H HD13 . LEU A 1 86  ? 20.131  -4.975  7.853   1.00 0.00 ? 86  LEU A HD13 19 
ATOM 4873  H HD21 . LEU A 1 86  ? 16.646  -5.975  8.789   1.00 0.00 ? 86  LEU A HD21 19 
ATOM 4874  H HD22 . LEU A 1 86  ? 18.080  -5.364  9.611   1.00 0.00 ? 86  LEU A HD22 19 
ATOM 4875  H HD23 . LEU A 1 86  ? 17.444  -4.517  8.202   1.00 0.00 ? 86  LEU A HD23 19 
ATOM 4876  N N    . PRO A 1 87  ? 20.203  -9.491  6.920   1.00 0.00 ? 87  PRO A N    19 
ATOM 4877  C CA   . PRO A 1 87  ? 21.118  -10.159 7.866   1.00 0.00 ? 87  PRO A CA   19 
ATOM 4878  C C    . PRO A 1 87  ? 21.766  -9.118  8.777   1.00 0.00 ? 87  PRO A C    19 
ATOM 4879  O O    . PRO A 1 87  ? 22.601  -8.343  8.357   1.00 0.00 ? 87  PRO A O    19 
ATOM 4880  C CB   . PRO A 1 87  ? 22.152  -10.831 6.958   1.00 0.00 ? 87  PRO A CB   19 
ATOM 4881  C CG   . PRO A 1 87  ? 22.109  -10.069 5.614   1.00 0.00 ? 87  PRO A CG   19 
ATOM 4882  C CD   . PRO A 1 87  ? 20.735  -9.375  5.546   1.00 0.00 ? 87  PRO A CD   19 
ATOM 4883  H HA   . PRO A 1 87  ? 20.596  -10.903 8.449   1.00 0.00 ? 87  PRO A HA   19 
ATOM 4884  H HB2  . PRO A 1 87  ? 23.136  -10.757 7.401   1.00 0.00 ? 87  PRO A HB2  19 
ATOM 4885  H HB3  . PRO A 1 87  ? 21.892  -11.865 6.799   1.00 0.00 ? 87  PRO A HB3  19 
ATOM 4886  H HG2  . PRO A 1 87  ? 22.902  -9.334  5.580   1.00 0.00 ? 87  PRO A HG2  19 
ATOM 4887  H HG3  . PRO A 1 87  ? 22.208  -10.761 4.792   1.00 0.00 ? 87  PRO A HG3  19 
ATOM 4888  H HD2  . PRO A 1 87  ? 20.850  -8.336  5.268   1.00 0.00 ? 87  PRO A HD2  19 
ATOM 4889  H HD3  . PRO A 1 87  ? 20.086  -9.886  4.851   1.00 0.00 ? 87  PRO A HD3  19 
ATOM 4890  N N    . ILE A 1 88  ? 21.369  -9.081  10.018  1.00 0.00 ? 88  ILE A N    19 
ATOM 4891  C CA   . ILE A 1 88  ? 21.943  -8.073  10.950  1.00 0.00 ? 88  ILE A CA   19 
ATOM 4892  C C    . ILE A 1 88  ? 22.668  -8.760  12.100  1.00 0.00 ? 88  ILE A C    19 
ATOM 4893  O O    . ILE A 1 88  ? 23.005  -9.924  12.045  1.00 0.00 ? 88  ILE A O    19 
ATOM 4894  C CB   . ILE A 1 88  ? 20.810  -7.220  11.531  1.00 0.00 ? 88  ILE A CB   19 
ATOM 4895  C CG1  . ILE A 1 88  ? 20.089  -7.994  12.643  1.00 0.00 ? 88  ILE A CG1  19 
ATOM 4896  C CG2  . ILE A 1 88  ? 19.811  -6.902  10.432  1.00 0.00 ? 88  ILE A CG2  19 
ATOM 4897  C CD1  . ILE A 1 88  ? 18.804  -7.267  13.028  1.00 0.00 ? 88  ILE A CD1  19 
ATOM 4898  H H    . ILE A 1 88  ? 20.682  -9.705  10.333  1.00 0.00 ? 88  ILE A H    19 
ATOM 4899  H HA   . ILE A 1 88  ? 22.632  -7.437  10.417  1.00 0.00 ? 88  ILE A HA   19 
ATOM 4900  H HB   . ILE A 1 88  ? 21.215  -6.302  11.931  1.00 0.00 ? 88  ILE A HB   19 
ATOM 4901  H HG12 . ILE A 1 88  ? 19.853  -8.984  12.292  1.00 0.00 ? 88  ILE A HG12 19 
ATOM 4902  H HG13 . ILE A 1 88  ? 20.725  -8.066  13.506  1.00 0.00 ? 88  ILE A HG13 19 
ATOM 4903  H HG21 . ILE A 1 88  ? 19.502  -7.821  9.954   1.00 0.00 ? 88  ILE A HG21 19 
ATOM 4904  H HG22 . ILE A 1 88  ? 18.951  -6.414  10.860  1.00 0.00 ? 88  ILE A HG22 19 
ATOM 4905  H HG23 . ILE A 1 88  ? 20.272  -6.253  9.703   1.00 0.00 ? 88  ILE A HG23 19 
ATOM 4906  H HD11 . ILE A 1 88  ? 18.235  -7.041  12.139  1.00 0.00 ? 88  ILE A HD11 19 
ATOM 4907  H HD12 . ILE A 1 88  ? 18.219  -7.896  13.682  1.00 0.00 ? 88  ILE A HD12 19 
ATOM 4908  H HD13 . ILE A 1 88  ? 19.053  -6.349  13.540  1.00 0.00 ? 88  ILE A HD13 19 
ATOM 4909  N N    . VAL A 1 89  ? 22.864  -8.026  13.152  1.00 0.00 ? 89  VAL A N    19 
ATOM 4910  C CA   . VAL A 1 89  ? 23.527  -8.571  14.360  1.00 0.00 ? 89  VAL A CA   19 
ATOM 4911  C C    . VAL A 1 89  ? 23.223  -7.630  15.518  1.00 0.00 ? 89  VAL A C    19 
ATOM 4912  O O    . VAL A 1 89  ? 23.698  -6.514  15.556  1.00 0.00 ? 89  VAL A O    19 
ATOM 4913  C CB   . VAL A 1 89  ? 25.041  -8.641  14.163  1.00 0.00 ? 89  VAL A CB   19 
ATOM 4914  C CG1  . VAL A 1 89  ? 25.650  -9.448  15.309  1.00 0.00 ? 89  VAL A CG1  19 
ATOM 4915  C CG2  . VAL A 1 89  ? 25.368  -9.315  12.829  1.00 0.00 ? 89  VAL A CG2  19 
ATOM 4916  H H    . VAL A 1 89  ? 22.544  -7.101  13.154  1.00 0.00 ? 89  VAL A H    19 
ATOM 4917  H HA   . VAL A 1 89  ? 23.130  -9.551  14.575  1.00 0.00 ? 89  VAL A HA   19 
ATOM 4918  H HB   . VAL A 1 89  ? 25.450  -7.640  14.174  1.00 0.00 ? 89  VAL A HB   19 
ATOM 4919  H HG11 . VAL A 1 89  ? 24.858  -9.896  15.892  1.00 0.00 ? 89  VAL A HG11 19 
ATOM 4920  H HG12 . VAL A 1 89  ? 26.284  -10.223 14.907  1.00 0.00 ? 89  VAL A HG12 19 
ATOM 4921  H HG13 . VAL A 1 89  ? 26.234  -8.793  15.939  1.00 0.00 ? 89  VAL A HG13 19 
ATOM 4922  H HG21 . VAL A 1 89  ? 24.902  -10.285 12.790  1.00 0.00 ? 89  VAL A HG21 19 
ATOM 4923  H HG22 . VAL A 1 89  ? 25.001  -8.704  12.017  1.00 0.00 ? 89  VAL A HG22 19 
ATOM 4924  H HG23 . VAL A 1 89  ? 26.439  -9.428  12.737  1.00 0.00 ? 89  VAL A HG23 19 
ATOM 4925  N N    . TYR A 1 90  ? 22.431  -8.057  16.452  1.00 0.00 ? 90  TYR A N    19 
ATOM 4926  C CA   . TYR A 1 90  ? 22.095  -7.161  17.588  1.00 0.00 ? 90  TYR A CA   19 
ATOM 4927  C C    . TYR A 1 90  ? 22.461  -7.832  18.908  1.00 0.00 ? 90  TYR A C    19 
ATOM 4928  O O    . TYR A 1 90  ? 23.108  -8.858  18.936  1.00 0.00 ? 90  TYR A O    19 
ATOM 4929  C CB   . TYR A 1 90  ? 20.598  -6.856  17.565  1.00 0.00 ? 90  TYR A CB   19 
ATOM 4930  C CG   . TYR A 1 90  ? 19.825  -8.097  17.187  1.00 0.00 ? 90  TYR A CG   19 
ATOM 4931  C CD1  . TYR A 1 90  ? 19.402  -8.991  18.178  1.00 0.00 ? 90  TYR A CD1  19 
ATOM 4932  C CD2  . TYR A 1 90  ? 19.524  -8.347  15.844  1.00 0.00 ? 90  TYR A CD2  19 
ATOM 4933  C CE1  . TYR A 1 90  ? 18.679  -10.136 17.822  1.00 0.00 ? 90  TYR A CE1  19 
ATOM 4934  C CE2  . TYR A 1 90  ? 18.801  -9.493  15.488  1.00 0.00 ? 90  TYR A CE2  19 
ATOM 4935  C CZ   . TYR A 1 90  ? 18.379  -10.386 16.478  1.00 0.00 ? 90  TYR A CZ   19 
ATOM 4936  O OH   . TYR A 1 90  ? 17.666  -11.516 16.129  1.00 0.00 ? 90  TYR A OH   19 
ATOM 4937  H H    . TYR A 1 90  ? 22.052  -8.957  16.403  1.00 0.00 ? 90  TYR A H    19 
ATOM 4938  H HA   . TYR A 1 90  ? 22.646  -6.236  17.485  1.00 0.00 ? 90  TYR A HA   19 
ATOM 4939  H HB2  . TYR A 1 90  ? 20.285  -6.516  18.540  1.00 0.00 ? 90  TYR A HB2  19 
ATOM 4940  H HB3  . TYR A 1 90  ? 20.410  -6.085  16.838  1.00 0.00 ? 90  TYR A HB3  19 
ATOM 4941  H HD1  . TYR A 1 90  ? 19.633  -8.799  19.214  1.00 0.00 ? 90  TYR A HD1  19 
ATOM 4942  H HD2  . TYR A 1 90  ? 19.849  -7.656  15.082  1.00 0.00 ? 90  TYR A HD2  19 
ATOM 4943  H HE1  . TYR A 1 90  ? 18.351  -10.825 18.584  1.00 0.00 ? 90  TYR A HE1  19 
ATOM 4944  H HE2  . TYR A 1 90  ? 18.569  -9.688  14.450  1.00 0.00 ? 90  TYR A HE2  19 
ATOM 4945  H HH   . TYR A 1 90  ? 17.018  -11.681 16.817  1.00 0.00 ? 90  TYR A HH   19 
ATOM 4946  N N    . TYR A 1 91  ? 22.064  -7.251  20.004  1.00 0.00 ? 91  TYR A N    19 
ATOM 4947  C CA   . TYR A 1 91  ? 22.402  -7.849  21.322  1.00 0.00 ? 91  TYR A CA   19 
ATOM 4948  C C    . TYR A 1 91  ? 21.162  -7.926  22.210  1.00 0.00 ? 91  TYR A C    19 
ATOM 4949  O O    . TYR A 1 91  ? 20.453  -6.958  22.396  1.00 0.00 ? 91  TYR A O    19 
ATOM 4950  C CB   . TYR A 1 91  ? 23.440  -6.974  22.016  1.00 0.00 ? 91  TYR A CB   19 
ATOM 4951  C CG   . TYR A 1 91  ? 24.819  -7.475  21.688  1.00 0.00 ? 91  TYR A CG   19 
ATOM 4952  C CD1  . TYR A 1 91  ? 25.457  -7.039  20.524  1.00 0.00 ? 91  TYR A CD1  19 
ATOM 4953  C CD2  . TYR A 1 91  ? 25.463  -8.364  22.553  1.00 0.00 ? 91  TYR A CD2  19 
ATOM 4954  C CE1  . TYR A 1 91  ? 26.746  -7.497  20.223  1.00 0.00 ? 91  TYR A CE1  19 
ATOM 4955  C CE2  . TYR A 1 91  ? 26.748  -8.819  22.260  1.00 0.00 ? 91  TYR A CE2  19 
ATOM 4956  C CZ   . TYR A 1 91  ? 27.394  -8.387  21.092  1.00 0.00 ? 91  TYR A CZ   19 
ATOM 4957  O OH   . TYR A 1 91  ? 28.665  -8.836  20.799  1.00 0.00 ? 91  TYR A OH   19 
ATOM 4958  H H    . TYR A 1 91  ? 21.557  -6.418  19.959  1.00 0.00 ? 91  TYR A H    19 
ATOM 4959  H HA   . TYR A 1 91  ? 22.806  -8.839  21.178  1.00 0.00 ? 91  TYR A HA   19 
ATOM 4960  H HB2  . TYR A 1 91  ? 23.336  -5.955  21.677  1.00 0.00 ? 91  TYR A HB2  19 
ATOM 4961  H HB3  . TYR A 1 91  ? 23.289  -7.016  23.085  1.00 0.00 ? 91  TYR A HB3  19 
ATOM 4962  H HD1  . TYR A 1 91  ? 24.951  -6.355  19.857  1.00 0.00 ? 91  TYR A HD1  19 
ATOM 4963  H HD2  . TYR A 1 91  ? 24.962  -8.702  23.446  1.00 0.00 ? 91  TYR A HD2  19 
ATOM 4964  H HE1  . TYR A 1 91  ? 27.242  -7.163  19.324  1.00 0.00 ? 91  TYR A HE1  19 
ATOM 4965  H HE2  . TYR A 1 91  ? 27.242  -9.503  22.933  1.00 0.00 ? 91  TYR A HE2  19 
ATOM 4966  H HH   . TYR A 1 91  ? 29.173  -8.842  21.614  1.00 0.00 ? 91  TYR A HH   19 
ATOM 4967  N N    . VAL A 1 92  ? 20.921  -9.067  22.791  1.00 0.00 ? 92  VAL A N    19 
ATOM 4968  C CA   . VAL A 1 92  ? 19.758  -9.208  23.705  1.00 0.00 ? 92  VAL A CA   19 
ATOM 4969  C C    . VAL A 1 92  ? 20.294  -9.197  25.130  1.00 0.00 ? 92  VAL A C    19 
ATOM 4970  O O    . VAL A 1 92  ? 20.681  -10.216 25.667  1.00 0.00 ? 92  VAL A O    19 
ATOM 4971  C CB   . VAL A 1 92  ? 19.036  -10.526 23.447  1.00 0.00 ? 92  VAL A CB   19 
ATOM 4972  C CG1  . VAL A 1 92  ? 17.555  -10.346 23.770  1.00 0.00 ? 92  VAL A CG1  19 
ATOM 4973  C CG2  . VAL A 1 92  ? 19.201  -10.924 21.979  1.00 0.00 ? 92  VAL A CG2  19 
ATOM 4974  H H    . VAL A 1 92  ? 21.523  -9.822  22.648  1.00 0.00 ? 92  VAL A H    19 
ATOM 4975  H HA   . VAL A 1 92  ? 19.078  -8.381  23.563  1.00 0.00 ? 92  VAL A HA   19 
ATOM 4976  H HB   . VAL A 1 92  ? 19.452  -11.296 24.081  1.00 0.00 ? 92  VAL A HB   19 
ATOM 4977  H HG11 . VAL A 1 92  ? 17.379  -9.324  24.078  1.00 0.00 ? 92  VAL A HG11 19 
ATOM 4978  H HG12 . VAL A 1 92  ? 16.965  -10.565 22.894  1.00 0.00 ? 92  VAL A HG12 19 
ATOM 4979  H HG13 . VAL A 1 92  ? 17.278  -11.015 24.571  1.00 0.00 ? 92  VAL A HG13 19 
ATOM 4980  H HG21 . VAL A 1 92  ? 18.986  -10.073 21.349  1.00 0.00 ? 92  VAL A HG21 19 
ATOM 4981  H HG22 . VAL A 1 92  ? 20.215  -11.252 21.807  1.00 0.00 ? 92  VAL A HG22 19 
ATOM 4982  H HG23 . VAL A 1 92  ? 18.517  -11.726 21.745  1.00 0.00 ? 92  VAL A HG23 19 
ATOM 4983  N N    . GLY A 1 93  ? 20.348  -8.049  25.733  1.00 0.00 ? 93  GLY A N    19 
ATOM 4984  C CA   . GLY A 1 93  ? 20.895  -7.965  27.113  1.00 0.00 ? 93  GLY A CA   19 
ATOM 4985  C C    . GLY A 1 93  ? 22.426  -8.014  27.032  1.00 0.00 ? 93  GLY A C    19 
ATOM 4986  O O    . GLY A 1 93  ? 23.094  -7.005  27.132  1.00 0.00 ? 93  GLY A O    19 
ATOM 4987  H H    . GLY A 1 93  ? 20.047  -7.241  25.271  1.00 0.00 ? 93  GLY A H    19 
ATOM 4988  H HA2  . GLY A 1 93  ? 20.582  -7.038  27.572  1.00 0.00 ? 93  GLY A HA2  19 
ATOM 4989  H HA3  . GLY A 1 93  ? 20.541  -8.800  27.698  1.00 0.00 ? 93  GLY A HA3  19 
ATOM 4990  N N    . ARG A 1 94  ? 22.984  -9.183  26.856  1.00 0.00 ? 94  ARG A N    19 
ATOM 4991  C CA   . ARG A 1 94  ? 24.473  -9.295  26.772  1.00 0.00 ? 94  ARG A CA   19 
ATOM 4992  C C    . ARG A 1 94  ? 24.889  -10.388 25.779  1.00 0.00 ? 94  ARG A C    19 
ATOM 4993  O O    . ARG A 1 94  ? 26.061  -10.590 25.533  1.00 0.00 ? 94  ARG A O    19 
ATOM 4994  C CB   . ARG A 1 94  ? 25.013  -9.657  28.150  1.00 0.00 ? 94  ARG A CB   19 
ATOM 4995  C CG   . ARG A 1 94  ? 24.589  -8.592  29.164  1.00 0.00 ? 94  ARG A CG   19 
ATOM 4996  C CD   . ARG A 1 94  ? 25.360  -7.297  28.896  1.00 0.00 ? 94  ARG A CD   19 
ATOM 4997  N NE   . ARG A 1 94  ? 24.514  -6.129  29.273  1.00 0.00 ? 94  ARG A NE   19 
ATOM 4998  C CZ   . ARG A 1 94  ? 25.003  -5.188  30.034  1.00 0.00 ? 94  ARG A CZ   19 
ATOM 4999  N NH1  . ARG A 1 94  ? 26.270  -4.885  29.967  1.00 0.00 ? 94  ARG A NH1  19 
ATOM 5000  N NH2  . ARG A 1 94  ? 24.223  -4.551  30.864  1.00 0.00 ? 94  ARG A NH2  19 
ATOM 5001  H H    . ARG A 1 94  ? 22.427  -9.983  26.789  1.00 0.00 ? 94  ARG A H    19 
ATOM 5002  H HA   . ARG A 1 94  ? 24.892  -8.354  26.457  1.00 0.00 ? 94  ARG A HA   19 
ATOM 5003  H HB2  . ARG A 1 94  ? 24.610  -10.617 28.440  1.00 0.00 ? 94  ARG A HB2  19 
ATOM 5004  H HB3  . ARG A 1 94  ? 26.090  -9.712  28.114  1.00 0.00 ? 94  ARG A HB3  19 
ATOM 5005  H HG2  . ARG A 1 94  ? 23.529  -8.408  29.069  1.00 0.00 ? 94  ARG A HG2  19 
ATOM 5006  H HG3  . ARG A 1 94  ? 24.807  -8.938  30.163  1.00 0.00 ? 94  ARG A HG3  19 
ATOM 5007  H HD2  . ARG A 1 94  ? 26.266  -7.290  29.483  1.00 0.00 ? 94  ARG A HD2  19 
ATOM 5008  H HD3  . ARG A 1 94  ? 25.609  -7.238  27.848  1.00 0.00 ? 94  ARG A HD3  19 
ATOM 5009  H HE   . ARG A 1 94  ? 23.592  -6.067  28.949  1.00 0.00 ? 94  ARG A HE   19 
ATOM 5010  H HH11 . ARG A 1 94  ? 26.868  -5.374  29.332  1.00 0.00 ? 94  ARG A HH11 19 
ATOM 5011  H HH12 . ARG A 1 94  ? 26.644  -4.164  30.550  1.00 0.00 ? 94  ARG A HH12 19 
ATOM 5012  H HH21 . ARG A 1 94  ? 23.251  -4.783  30.917  1.00 0.00 ? 94  ARG A HH21 19 
ATOM 5013  H HH22 . ARG A 1 94  ? 24.597  -3.829  31.448  1.00 0.00 ? 94  ARG A HH22 19 
ATOM 5014  N N    . LYS A 1 95  ? 23.957  -11.097 25.211  1.00 0.00 ? 95  LYS A N    19 
ATOM 5015  C CA   . LYS A 1 95  ? 24.331  -12.170 24.247  1.00 0.00 ? 95  LYS A CA   19 
ATOM 5016  C C    . LYS A 1 95  ? 24.169  -11.647 22.815  1.00 0.00 ? 95  LYS A C    19 
ATOM 5017  O O    . LYS A 1 95  ? 23.155  -11.071 22.485  1.00 0.00 ? 95  LYS A O    19 
ATOM 5018  C CB   . LYS A 1 95  ? 23.418  -13.381 24.453  1.00 0.00 ? 95  LYS A CB   19 
ATOM 5019  C CG   . LYS A 1 95  ? 23.706  -14.013 25.816  1.00 0.00 ? 95  LYS A CG   19 
ATOM 5020  C CD   . LYS A 1 95  ? 22.875  -15.287 25.974  1.00 0.00 ? 95  LYS A CD   19 
ATOM 5021  C CE   . LYS A 1 95  ? 23.127  -15.894 27.356  1.00 0.00 ? 95  LYS A CE   19 
ATOM 5022  N NZ   . LYS A 1 95  ? 24.523  -16.414 27.422  1.00 0.00 ? 95  LYS A NZ   19 
ATOM 5023  H H    . LYS A 1 95  ? 23.019  -10.930 25.417  1.00 0.00 ? 95  LYS A H    19 
ATOM 5024  H HA   . LYS A 1 95  ? 25.356  -12.460 24.419  1.00 0.00 ? 95  LYS A HA   19 
ATOM 5025  H HB2  . LYS A 1 95  ? 22.386  -13.063 24.414  1.00 0.00 ? 95  LYS A HB2  19 
ATOM 5026  H HB3  . LYS A 1 95  ? 23.602  -14.107 23.676  1.00 0.00 ? 95  LYS A HB3  19 
ATOM 5027  H HG2  . LYS A 1 95  ? 24.756  -14.256 25.886  1.00 0.00 ? 95  LYS A HG2  19 
ATOM 5028  H HG3  . LYS A 1 95  ? 23.445  -13.316 26.599  1.00 0.00 ? 95  LYS A HG3  19 
ATOM 5029  H HD2  . LYS A 1 95  ? 21.826  -15.049 25.871  1.00 0.00 ? 95  LYS A HD2  19 
ATOM 5030  H HD3  . LYS A 1 95  ? 23.159  -15.999 25.213  1.00 0.00 ? 95  LYS A HD3  19 
ATOM 5031  H HE2  . LYS A 1 95  ? 22.990  -15.136 28.112  1.00 0.00 ? 95  LYS A HE2  19 
ATOM 5032  H HE3  . LYS A 1 95  ? 22.433  -16.703 27.526  1.00 0.00 ? 95  LYS A HE3  19 
ATOM 5033  H HZ1  . LYS A 1 95  ? 24.730  -16.962 26.563  1.00 0.00 ? 95  LYS A HZ1  19 
ATOM 5034  H HZ2  . LYS A 1 95  ? 25.187  -15.619 27.492  1.00 0.00 ? 95  LYS A HZ2  19 
ATOM 5035  H HZ3  . LYS A 1 95  ? 24.624  -17.027 28.258  1.00 0.00 ? 95  LYS A HZ3  19 
ATOM 5036  N N    . PRO A 1 96  ? 25.171  -11.867 22.000  1.00 0.00 ? 96  PRO A N    19 
ATOM 5037  C CA   . PRO A 1 96  ? 25.151  -11.426 20.596  1.00 0.00 ? 96  PRO A CA   19 
ATOM 5038  C C    . PRO A 1 96  ? 24.284  -12.375 19.761  1.00 0.00 ? 96  PRO A C    19 
ATOM 5039  O O    . PRO A 1 96  ? 24.310  -13.574 19.954  1.00 0.00 ? 96  PRO A O    19 
ATOM 5040  C CB   . PRO A 1 96  ? 26.619  -11.511 20.171  1.00 0.00 ? 96  PRO A CB   19 
ATOM 5041  C CG   . PRO A 1 96  ? 27.295  -12.511 21.140  1.00 0.00 ? 96  PRO A CG   19 
ATOM 5042  C CD   . PRO A 1 96  ? 26.405  -12.575 22.396  1.00 0.00 ? 96  PRO A CD   19 
ATOM 5043  H HA   . PRO A 1 96  ? 24.800  -10.408 20.523  1.00 0.00 ? 96  PRO A HA   19 
ATOM 5044  H HB2  . PRO A 1 96  ? 26.690  -11.871 19.153  1.00 0.00 ? 96  PRO A HB2  19 
ATOM 5045  H HB3  . PRO A 1 96  ? 27.090  -10.545 20.258  1.00 0.00 ? 96  PRO A HB3  19 
ATOM 5046  H HG2  . PRO A 1 96  ? 27.359  -13.487 20.678  1.00 0.00 ? 96  PRO A HG2  19 
ATOM 5047  H HG3  . PRO A 1 96  ? 28.280  -12.162 21.409  1.00 0.00 ? 96  PRO A HG3  19 
ATOM 5048  H HD2  . PRO A 1 96  ? 26.190  -13.603 22.654  1.00 0.00 ? 96  PRO A HD2  19 
ATOM 5049  H HD3  . PRO A 1 96  ? 26.877  -12.066 23.221  1.00 0.00 ? 96  PRO A HD3  19 
ATOM 5050  N N    . LYS A 1 97  ? 23.514  -11.857 18.842  1.00 0.00 ? 97  LYS A N    19 
ATOM 5051  C CA   . LYS A 1 97  ? 22.650  -12.749 18.017  1.00 0.00 ? 97  LYS A CA   19 
ATOM 5052  C C    . LYS A 1 97  ? 22.534  -12.205 16.591  1.00 0.00 ? 97  LYS A C    19 
ATOM 5053  O O    . LYS A 1 97  ? 22.075  -11.102 16.371  1.00 0.00 ? 97  LYS A O    19 
ATOM 5054  C CB   . LYS A 1 97  ? 21.253  -12.821 18.640  1.00 0.00 ? 97  LYS A CB   19 
ATOM 5055  C CG   . LYS A 1 97  ? 21.305  -13.650 19.925  1.00 0.00 ? 97  LYS A CG   19 
ATOM 5056  C CD   . LYS A 1 97  ? 20.250  -14.757 19.861  1.00 0.00 ? 97  LYS A CD   19 
ATOM 5057  C CE   . LYS A 1 97  ? 20.778  -16.008 20.567  1.00 0.00 ? 97  LYS A CE   19 
ATOM 5058  N NZ   . LYS A 1 97  ? 19.928  -17.177 20.209  1.00 0.00 ? 97  LYS A NZ   19 
ATOM 5059  H H    . LYS A 1 97  ? 23.499  -10.888 18.698  1.00 0.00 ? 97  LYS A H    19 
ATOM 5060  H HA   . LYS A 1 97  ? 23.080  -13.739 17.989  1.00 0.00 ? 97  LYS A HA   19 
ATOM 5061  H HB2  . LYS A 1 97  ? 20.911  -11.823 18.869  1.00 0.00 ? 97  LYS A HB2  19 
ATOM 5062  H HB3  . LYS A 1 97  ? 20.572  -13.285 17.943  1.00 0.00 ? 97  LYS A HB3  19 
ATOM 5063  H HG2  . LYS A 1 97  ? 22.284  -14.091 20.030  1.00 0.00 ? 97  LYS A HG2  19 
ATOM 5064  H HG3  . LYS A 1 97  ? 21.102  -13.012 20.773  1.00 0.00 ? 97  LYS A HG3  19 
ATOM 5065  H HD2  . LYS A 1 97  ? 19.346  -14.422 20.350  1.00 0.00 ? 97  LYS A HD2  19 
ATOM 5066  H HD3  . LYS A 1 97  ? 20.036  -14.992 18.830  1.00 0.00 ? 97  LYS A HD3  19 
ATOM 5067  H HE2  . LYS A 1 97  ? 21.795  -16.193 20.255  1.00 0.00 ? 97  LYS A HE2  19 
ATOM 5068  H HE3  . LYS A 1 97  ? 20.752  -15.856 21.635  1.00 0.00 ? 97  LYS A HE3  19 
ATOM 5069  H HZ1  . LYS A 1 97  ? 18.989  -16.845 19.910  1.00 0.00 ? 97  LYS A HZ1  19 
ATOM 5070  H HZ2  . LYS A 1 97  ? 20.374  -17.706 19.431  1.00 0.00 ? 97  LYS A HZ2  19 
ATOM 5071  H HZ3  . LYS A 1 97  ? 19.825  -17.798 21.037  1.00 0.00 ? 97  LYS A HZ3  19 
ATOM 5072  N N    . VAL A 1 98  ? 22.926  -12.983 15.618  1.00 0.00 ? 98  VAL A N    19 
ATOM 5073  C CA   . VAL A 1 98  ? 22.818  -12.529 14.203  1.00 0.00 ? 98  VAL A CA   19 
ATOM 5074  C C    . VAL A 1 98  ? 21.513  -13.069 13.622  1.00 0.00 ? 98  VAL A C    19 
ATOM 5075  O O    . VAL A 1 98  ? 21.222  -14.244 13.735  1.00 0.00 ? 98  VAL A O    19 
ATOM 5076  C CB   . VAL A 1 98  ? 23.992  -13.082 13.391  1.00 0.00 ? 98  VAL A CB   19 
ATOM 5077  C CG1  . VAL A 1 98  ? 23.725  -12.882 11.897  1.00 0.00 ? 98  VAL A CG1  19 
ATOM 5078  C CG2  . VAL A 1 98  ? 25.273  -12.347 13.782  1.00 0.00 ? 98  VAL A CG2  19 
ATOM 5079  H H    . VAL A 1 98  ? 23.277  -13.877 15.818  1.00 0.00 ? 98  VAL A H    19 
ATOM 5080  H HA   . VAL A 1 98  ? 22.818  -11.450 14.161  1.00 0.00 ? 98  VAL A HA   19 
ATOM 5081  H HB   . VAL A 1 98  ? 24.104  -14.137 13.597  1.00 0.00 ? 98  VAL A HB   19 
ATOM 5082  H HG11 . VAL A 1 98  ? 22.744  -13.260 11.650  1.00 0.00 ? 98  VAL A HG11 19 
ATOM 5083  H HG12 . VAL A 1 98  ? 23.774  -11.830 11.659  1.00 0.00 ? 98  VAL A HG12 19 
ATOM 5084  H HG13 . VAL A 1 98  ? 24.470  -13.414 11.323  1.00 0.00 ? 98  VAL A HG13 19 
ATOM 5085  H HG21 . VAL A 1 98  ? 25.031  -11.534 14.451  1.00 0.00 ? 98  VAL A HG21 19 
ATOM 5086  H HG22 . VAL A 1 98  ? 25.946  -13.032 14.275  1.00 0.00 ? 98  VAL A HG22 19 
ATOM 5087  H HG23 . VAL A 1 98  ? 25.746  -11.953 12.894  1.00 0.00 ? 98  VAL A HG23 19 
ATOM 5088  N N    . GLU A 1 99  ? 20.715  -12.241 13.009  1.00 0.00 ? 99  GLU A N    19 
ATOM 5089  C CA   . GLU A 1 99  ? 19.442  -12.753 12.447  1.00 0.00 ? 99  GLU A CA   19 
ATOM 5090  C C    . GLU A 1 99  ? 19.281  -12.289 11.007  1.00 0.00 ? 99  GLU A C    19 
ATOM 5091  O O    . GLU A 1 99  ? 20.223  -11.885 10.354  1.00 0.00 ? 99  GLU A O    19 
ATOM 5092  C CB   . GLU A 1 99  ? 18.269  -12.228 13.269  1.00 0.00 ? 99  GLU A CB   19 
ATOM 5093  C CG   . GLU A 1 99  ? 17.472  -13.404 13.839  1.00 0.00 ? 99  GLU A CG   19 
ATOM 5094  C CD   . GLU A 1 99  ? 16.195  -13.600 13.020  1.00 0.00 ? 99  GLU A CD   19 
ATOM 5095  O OE1  . GLU A 1 99  ? 15.205  -12.966 13.343  1.00 0.00 ? 99  GLU A OE1  19 
ATOM 5096  O OE2  . GLU A 1 99  ? 16.230  -14.383 12.085  1.00 0.00 ? 99  GLU A OE2  19 
ATOM 5097  H H    . GLU A 1 99  ? 20.949  -11.289 12.920  1.00 0.00 ? 99  GLU A H    19 
ATOM 5098  H HA   . GLU A 1 99  ? 19.442  -13.831 12.477  1.00 0.00 ? 99  GLU A HA   19 
ATOM 5099  H HB2  . GLU A 1 99  ? 18.640  -11.619 14.072  1.00 0.00 ? 99  GLU A HB2  19 
ATOM 5100  H HB3  . GLU A 1 99  ? 17.631  -11.636 12.637  1.00 0.00 ? 99  GLU A HB3  19 
ATOM 5101  H HG2  . GLU A 1 99  ? 18.073  -14.300 13.792  1.00 0.00 ? 99  GLU A HG2  19 
ATOM 5102  H HG3  . GLU A 1 99  ? 17.211  -13.198 14.866  1.00 0.00 ? 99  GLU A HG3  19 
ATOM 5103  N N    . GLN A 1 100 ? 18.082  -12.343 10.521  1.00 0.00 ? 100 GLN A N    19 
ATOM 5104  C CA   . GLN A 1 100 ? 17.809  -11.911 9.128   1.00 0.00 ? 100 GLN A CA   19 
ATOM 5105  C C    . GLN A 1 100 ? 16.415  -11.301 9.082   1.00 0.00 ? 100 GLN A C    19 
ATOM 5106  O O    . GLN A 1 100 ? 15.450  -11.959 8.748   1.00 0.00 ? 100 GLN A O    19 
ATOM 5107  C CB   . GLN A 1 100 ? 17.854  -13.120 8.205   1.00 0.00 ? 100 GLN A CB   19 
ATOM 5108  C CG   . GLN A 1 100 ? 19.171  -13.872 8.405   1.00 0.00 ? 100 GLN A CG   19 
ATOM 5109  C CD   . GLN A 1 100 ? 18.983  -14.958 9.465   1.00 0.00 ? 100 GLN A CD   19 
ATOM 5110  O OE1  . GLN A 1 100 ? 17.870  -15.334 9.777   1.00 0.00 ? 100 GLN A OE1  19 
ATOM 5111  N NE2  . GLN A 1 100 ? 20.032  -15.484 10.037  1.00 0.00 ? 100 GLN A NE2  19 
ATOM 5112  H H    . GLN A 1 100 ? 17.348  -12.671 11.081  1.00 0.00 ? 100 GLN A H    19 
ATOM 5113  H HA   . GLN A 1 100 ? 18.542  -11.182 8.818   1.00 0.00 ? 100 GLN A HA   19 
ATOM 5114  H HB2  . GLN A 1 100 ? 17.027  -13.768 8.445   1.00 0.00 ? 100 GLN A HB2  19 
ATOM 5115  H HB3  . GLN A 1 100 ? 17.776  -12.796 7.178   1.00 0.00 ? 100 GLN A HB3  19 
ATOM 5116  H HG2  . GLN A 1 100 ? 19.471  -14.327 7.471   1.00 0.00 ? 100 GLN A HG2  19 
ATOM 5117  H HG3  . GLN A 1 100 ? 19.935  -13.183 8.730   1.00 0.00 ? 100 GLN A HG3  19 
ATOM 5118  H HE21 . GLN A 1 100 ? 20.930  -15.181 9.786   1.00 0.00 ? 100 GLN A HE21 19 
ATOM 5119  H HE22 . GLN A 1 100 ? 19.922  -16.181 10.718  1.00 0.00 ? 100 GLN A HE22 19 
ATOM 5120  N N    . LEU A 1 101 ? 16.298  -10.056 9.431   1.00 0.00 ? 101 LEU A N    19 
ATOM 5121  C CA   . LEU A 1 101 ? 14.962  -9.410  9.425   1.00 0.00 ? 101 LEU A CA   19 
ATOM 5122  C C    . LEU A 1 101 ? 14.225  -9.798  8.151   1.00 0.00 ? 101 LEU A C    19 
ATOM 5123  O O    . LEU A 1 101 ? 14.815  -9.995  7.107   1.00 0.00 ? 101 LEU A O    19 
ATOM 5124  C CB   . LEU A 1 101 ? 15.116  -7.891  9.504   1.00 0.00 ? 101 LEU A CB   19 
ATOM 5125  C CG   . LEU A 1 101 ? 15.938  -7.511  10.743  1.00 0.00 ? 101 LEU A CG   19 
ATOM 5126  C CD1  . LEU A 1 101 ? 15.619  -6.071  11.144  1.00 0.00 ? 101 LEU A CD1  19 
ATOM 5127  C CD2  . LEU A 1 101 ? 15.596  -8.446  11.908  1.00 0.00 ? 101 LEU A CD2  19 
ATOM 5128  H H    . LEU A 1 101 ? 17.083  -9.553  9.711   1.00 0.00 ? 101 LEU A H    19 
ATOM 5129  H HA   . LEU A 1 101 ? 14.398  -9.756  10.279  1.00 0.00 ? 101 LEU A HA   19 
ATOM 5130  H HB2  . LEU A 1 101 ? 15.620  -7.535  8.619   1.00 0.00 ? 101 LEU A HB2  19 
ATOM 5131  H HB3  . LEU A 1 101 ? 14.136  -7.441  9.569   1.00 0.00 ? 101 LEU A HB3  19 
ATOM 5132  H HG   . LEU A 1 101 ? 16.991  -7.592  10.513  1.00 0.00 ? 101 LEU A HG   19 
ATOM 5133  H HD11 . LEU A 1 101 ? 14.557  -5.899  11.052  1.00 0.00 ? 101 LEU A HD11 19 
ATOM 5134  H HD12 . LEU A 1 101 ? 15.923  -5.905  12.167  1.00 0.00 ? 101 LEU A HD12 19 
ATOM 5135  H HD13 . LEU A 1 101 ? 16.151  -5.393  10.496  1.00 0.00 ? 101 LEU A HD13 19 
ATOM 5136  H HD21 . LEU A 1 101 ? 14.543  -8.365  12.135  1.00 0.00 ? 101 LEU A HD21 19 
ATOM 5137  H HD22 . LEU A 1 101 ? 15.828  -9.463  11.630  1.00 0.00 ? 101 LEU A HD22 19 
ATOM 5138  H HD23 . LEU A 1 101 ? 16.174  -8.168  12.775  1.00 0.00 ? 101 LEU A HD23 19 
ATOM 5139  N N    . SER A 1 102 ? 12.939  -9.935  8.240   1.00 0.00 ? 102 SER A N    19 
ATOM 5140  C CA   . SER A 1 102 ? 12.146  -10.346 7.044   1.00 0.00 ? 102 SER A CA   19 
ATOM 5141  C C    . SER A 1 102 ? 11.458  -9.137  6.407   1.00 0.00 ? 102 SER A C    19 
ATOM 5142  O O    . SER A 1 102 ? 10.979  -8.253  7.085   1.00 0.00 ? 102 SER A O    19 
ATOM 5143  C CB   . SER A 1 102 ? 11.085  -11.362 7.468   1.00 0.00 ? 102 SER A CB   19 
ATOM 5144  O OG   . SER A 1 102 ? 9.925   -10.670 7.912   1.00 0.00 ? 102 SER A OG   19 
ATOM 5145  H H    . SER A 1 102 ? 12.497  -9.783  9.105   1.00 0.00 ? 102 SER A H    19 
ATOM 5146  H HA   . SER A 1 102 ? 12.804  -10.803 6.321   1.00 0.00 ? 102 SER A HA   19 
ATOM 5147  H HB2  . SER A 1 102 ? 10.827  -11.986 6.630   1.00 0.00 ? 102 SER A HB2  19 
ATOM 5148  H HB3  . SER A 1 102 ? 11.477  -11.979 8.266   1.00 0.00 ? 102 SER A HB3  19 
ATOM 5149  H HG   . SER A 1 102 ? 9.364   -10.511 7.149   1.00 0.00 ? 102 SER A HG   19 
ATOM 5150  N N    . ASN A 1 103 ? 11.393  -9.105  5.101   1.00 0.00 ? 103 ASN A N    19 
ATOM 5151  C CA   . ASN A 1 103 ? 10.718  -7.966  4.411   1.00 0.00 ? 103 ASN A CA   19 
ATOM 5152  C C    . ASN A 1 103 ? 11.249  -6.639  4.948   1.00 0.00 ? 103 ASN A C    19 
ATOM 5153  O O    . ASN A 1 103 ? 10.531  -5.662  5.029   1.00 0.00 ? 103 ASN A O    19 
ATOM 5154  C CB   . ASN A 1 103 ? 9.212   -8.045  4.664   1.00 0.00 ? 103 ASN A CB   19 
ATOM 5155  C CG   . ASN A 1 103 ? 8.556   -8.911  3.588   1.00 0.00 ? 103 ASN A CG   19 
ATOM 5156  O OD1  . ASN A 1 103 ? 9.233   -9.513  2.778   1.00 0.00 ? 103 ASN A OD1  19 
ATOM 5157  N ND2  . ASN A 1 103 ? 7.255   -9.001  3.543   1.00 0.00 ? 103 ASN A ND2  19 
ATOM 5158  H H    . ASN A 1 103 ? 11.781  -9.840  4.573   1.00 0.00 ? 103 ASN A H    19 
ATOM 5159  H HA   . ASN A 1 103 ? 10.905  -8.023  3.349   1.00 0.00 ? 103 ASN A HA   19 
ATOM 5160  H HB2  . ASN A 1 103 ? 9.033   -8.481  5.637   1.00 0.00 ? 103 ASN A HB2  19 
ATOM 5161  H HB3  . ASN A 1 103 ? 8.792   -7.052  4.631   1.00 0.00 ? 103 ASN A HB3  19 
ATOM 5162  H HD21 . ASN A 1 103 ? 6.707   -8.516  4.196   1.00 0.00 ? 103 ASN A HD21 19 
ATOM 5163  H HD22 . ASN A 1 103 ? 6.825   -9.554  2.857   1.00 0.00 ? 103 ASN A HD22 19 
ATOM 5164  N N    . MET A 1 104 ? 12.499  -6.588  5.307   1.00 0.00 ? 104 MET A N    19 
ATOM 5165  C CA   . MET A 1 104 ? 13.065  -5.316  5.827   1.00 0.00 ? 104 MET A CA   19 
ATOM 5166  C C    . MET A 1 104 ? 13.724  -4.551  4.678   1.00 0.00 ? 104 MET A C    19 
ATOM 5167  O O    . MET A 1 104 ? 14.535  -3.671  4.889   1.00 0.00 ? 104 MET A O    19 
ATOM 5168  C CB   . MET A 1 104 ? 14.108  -5.618  6.904   1.00 0.00 ? 104 MET A CB   19 
ATOM 5169  C CG   . MET A 1 104 ? 14.670  -4.304  7.447   1.00 0.00 ? 104 MET A CG   19 
ATOM 5170  S SD   . MET A 1 104 ? 14.335  -4.191  9.220   1.00 0.00 ? 104 MET A SD   19 
ATOM 5171  C CE   . MET A 1 104 ? 15.713  -3.095  9.632   1.00 0.00 ? 104 MET A CE   19 
ATOM 5172  H H    . MET A 1 104 ? 13.063  -7.383  5.231   1.00 0.00 ? 104 MET A H    19 
ATOM 5173  H HA   . MET A 1 104 ? 12.273  -4.716  6.251   1.00 0.00 ? 104 MET A HA   19 
ATOM 5174  H HB2  . MET A 1 104 ? 13.646  -6.174  7.706   1.00 0.00 ? 104 MET A HB2  19 
ATOM 5175  H HB3  . MET A 1 104 ? 14.910  -6.200  6.476   1.00 0.00 ? 104 MET A HB3  19 
ATOM 5176  H HG2  . MET A 1 104 ? 15.736  -4.272  7.280   1.00 0.00 ? 104 MET A HG2  19 
ATOM 5177  H HG3  . MET A 1 104 ? 14.201  -3.474  6.940   1.00 0.00 ? 104 MET A HG3  19 
ATOM 5178  H HE1  . MET A 1 104 ? 16.320  -2.932  8.756   1.00 0.00 ? 104 MET A HE1  19 
ATOM 5179  H HE2  . MET A 1 104 ? 15.327  -2.148  9.982   1.00 0.00 ? 104 MET A HE2  19 
ATOM 5180  H HE3  . MET A 1 104 ? 16.314  -3.553  10.404  1.00 0.00 ? 104 MET A HE3  19 
ATOM 5181  N N    . ILE A 1 105 ? 13.383  -4.876  3.460   1.00 0.00 ? 105 ILE A N    19 
ATOM 5182  C CA   . ILE A 1 105 ? 13.992  -4.160  2.305   1.00 0.00 ? 105 ILE A CA   19 
ATOM 5183  C C    . ILE A 1 105 ? 12.980  -4.067  1.167   1.00 0.00 ? 105 ILE A C    19 
ATOM 5184  O O    . ILE A 1 105 ? 11.991  -4.773  1.142   1.00 0.00 ? 105 ILE A O    19 
ATOM 5185  C CB   . ILE A 1 105 ? 15.227  -4.916  1.821   1.00 0.00 ? 105 ILE A CB   19 
ATOM 5186  C CG1  . ILE A 1 105 ? 16.290  -4.909  2.921   1.00 0.00 ? 105 ILE A CG1  19 
ATOM 5187  C CG2  . ILE A 1 105 ? 15.780  -4.233  0.569   1.00 0.00 ? 105 ILE A CG2  19 
ATOM 5188  C CD1  . ILE A 1 105 ? 17.612  -5.433  2.359   1.00 0.00 ? 105 ILE A CD1  19 
ATOM 5189  H H    . ILE A 1 105 ? 12.724  -5.588  3.306   1.00 0.00 ? 105 ILE A H    19 
ATOM 5190  H HA   . ILE A 1 105 ? 14.279  -3.165  2.613   1.00 0.00 ? 105 ILE A HA   19 
ATOM 5191  H HB   . ILE A 1 105 ? 14.956  -5.935  1.586   1.00 0.00 ? 105 ILE A HB   19 
ATOM 5192  H HG12 . ILE A 1 105 ? 16.424  -3.900  3.282   1.00 0.00 ? 105 ILE A HG12 19 
ATOM 5193  H HG13 . ILE A 1 105 ? 15.972  -5.543  3.734   1.00 0.00 ? 105 ILE A HG13 19 
ATOM 5194  H HG21 . ILE A 1 105 ? 15.904  -3.177  0.761   1.00 0.00 ? 105 ILE A HG21 19 
ATOM 5195  H HG22 . ILE A 1 105 ? 16.735  -4.666  0.312   1.00 0.00 ? 105 ILE A HG22 19 
ATOM 5196  H HG23 . ILE A 1 105 ? 15.090  -4.370  -0.251  1.00 0.00 ? 105 ILE A HG23 19 
ATOM 5197  H HD11 . ILE A 1 105 ? 17.430  -5.940  1.423   1.00 0.00 ? 105 ILE A HD11 19 
ATOM 5198  H HD12 . ILE A 1 105 ? 18.286  -4.605  2.193   1.00 0.00 ? 105 ILE A HD12 19 
ATOM 5199  H HD13 . ILE A 1 105 ? 18.055  -6.121  3.061   1.00 0.00 ? 105 ILE A HD13 19 
ATOM 5200  N N    . VAL A 1 106 ? 13.218  -3.200  0.224   1.00 0.00 ? 106 VAL A N    19 
ATOM 5201  C CA   . VAL A 1 106 ? 12.273  -3.055  -0.910  1.00 0.00 ? 106 VAL A CA   19 
ATOM 5202  C C    . VAL A 1 106 ? 12.977  -3.455  -2.212  1.00 0.00 ? 106 VAL A C    19 
ATOM 5203  O O    . VAL A 1 106 ? 14.143  -3.177  -2.408  1.00 0.00 ? 106 VAL A O    19 
ATOM 5204  C CB   . VAL A 1 106 ? 11.822  -1.597  -0.987  1.00 0.00 ? 106 VAL A CB   19 
ATOM 5205  C CG1  . VAL A 1 106 ? 11.187  -1.327  -2.348  1.00 0.00 ? 106 VAL A CG1  19 
ATOM 5206  C CG2  . VAL A 1 106 ? 10.800  -1.324  0.119   1.00 0.00 ? 106 VAL A CG2  19 
ATOM 5207  H H    . VAL A 1 106 ? 14.018  -2.638  0.262   1.00 0.00 ? 106 VAL A H    19 
ATOM 5208  H HA   . VAL A 1 106 ? 11.415  -3.691  -0.753  1.00 0.00 ? 106 VAL A HA   19 
ATOM 5209  H HB   . VAL A 1 106 ? 12.677  -0.949  -0.857  1.00 0.00 ? 106 VAL A HB   19 
ATOM 5210  H HG11 . VAL A 1 106 ? 10.833  -2.257  -2.766  1.00 0.00 ? 106 VAL A HG11 19 
ATOM 5211  H HG12 . VAL A 1 106 ? 10.359  -0.646  -2.228  1.00 0.00 ? 106 VAL A HG12 19 
ATOM 5212  H HG13 . VAL A 1 106 ? 11.924  -0.892  -3.006  1.00 0.00 ? 106 VAL A HG13 19 
ATOM 5213  H HG21 . VAL A 1 106 ? 10.086  -2.132  0.157   1.00 0.00 ? 106 VAL A HG21 19 
ATOM 5214  H HG22 . VAL A 1 106 ? 11.310  -1.250  1.069   1.00 0.00 ? 106 VAL A HG22 19 
ATOM 5215  H HG23 . VAL A 1 106 ? 10.287  -0.396  -0.086  1.00 0.00 ? 106 VAL A HG23 19 
ATOM 5216  N N    . ARG A 1 107 ? 12.276  -4.102  -3.104  1.00 0.00 ? 107 ARG A N    19 
ATOM 5217  C CA   . ARG A 1 107 ? 12.905  -4.516  -4.391  1.00 0.00 ? 107 ARG A CA   19 
ATOM 5218  C C    . ARG A 1 107 ? 11.902  -4.308  -5.527  1.00 0.00 ? 107 ARG A C    19 
ATOM 5219  O O    . ARG A 1 107 ? 12.083  -4.796  -6.626  1.00 0.00 ? 107 ARG A O    19 
ATOM 5220  C CB   . ARG A 1 107 ? 13.296  -5.993  -4.316  1.00 0.00 ? 107 ARG A CB   19 
ATOM 5221  C CG   . ARG A 1 107 ? 14.610  -6.211  -5.068  1.00 0.00 ? 107 ARG A CG   19 
ATOM 5222  C CD   . ARG A 1 107 ? 15.755  -6.360  -4.063  1.00 0.00 ? 107 ARG A CD   19 
ATOM 5223  N NE   . ARG A 1 107 ? 16.657  -7.464  -4.498  1.00 0.00 ? 107 ARG A NE   19 
ATOM 5224  C CZ   . ARG A 1 107 ? 17.530  -7.959  -3.664  1.00 0.00 ? 107 ARG A CZ   19 
ATOM 5225  N NH1  . ARG A 1 107 ? 18.246  -7.161  -2.919  1.00 0.00 ? 107 ARG A NH1  19 
ATOM 5226  N NH2  . ARG A 1 107 ? 17.687  -9.252  -3.575  1.00 0.00 ? 107 ARG A NH2  19 
ATOM 5227  H H    . ARG A 1 107 ? 11.335  -4.315  -2.928  1.00 0.00 ? 107 ARG A H    19 
ATOM 5228  H HA   . ARG A 1 107 ? 13.785  -3.916  -4.572  1.00 0.00 ? 107 ARG A HA   19 
ATOM 5229  H HB2  . ARG A 1 107 ? 13.420  -6.280  -3.282  1.00 0.00 ? 107 ARG A HB2  19 
ATOM 5230  H HB3  . ARG A 1 107 ? 12.521  -6.593  -4.768  1.00 0.00 ? 107 ARG A HB3  19 
ATOM 5231  H HG2  . ARG A 1 107 ? 14.537  -7.109  -5.667  1.00 0.00 ? 107 ARG A HG2  19 
ATOM 5232  H HG3  . ARG A 1 107 ? 14.804  -5.365  -5.710  1.00 0.00 ? 107 ARG A HG3  19 
ATOM 5233  H HD2  . ARG A 1 107 ? 16.314  -5.436  -4.016  1.00 0.00 ? 107 ARG A HD2  19 
ATOM 5234  H HD3  . ARG A 1 107 ? 15.351  -6.587  -3.089  1.00 0.00 ? 107 ARG A HD3  19 
ATOM 5235  H HE   . ARG A 1 107 ? 16.594  -7.818  -5.409  1.00 0.00 ? 107 ARG A HE   19 
ATOM 5236  H HH11 . ARG A 1 107 ? 18.126  -6.171  -2.987  1.00 0.00 ? 107 ARG A HH11 19 
ATOM 5237  H HH12 . ARG A 1 107 ? 18.915  -7.541  -2.280  1.00 0.00 ? 107 ARG A HH12 19 
ATOM 5238  H HH21 . ARG A 1 107 ? 17.139  -9.862  -4.145  1.00 0.00 ? 107 ARG A HH21 19 
ATOM 5239  H HH22 . ARG A 1 107 ? 18.356  -9.630  -2.936  1.00 0.00 ? 107 ARG A HH22 19 
ATOM 5240  N N    . SER A 1 108 ? 10.845  -3.591  -5.267  1.00 0.00 ? 108 SER A N    19 
ATOM 5241  C CA   . SER A 1 108 ? 9.822   -3.347  -6.319  1.00 0.00 ? 108 SER A CA   19 
ATOM 5242  C C    . SER A 1 108 ? 8.531   -2.873  -5.650  1.00 0.00 ? 108 SER A C    19 
ATOM 5243  O O    . SER A 1 108 ? 8.053   -3.481  -4.713  1.00 0.00 ? 108 SER A O    19 
ATOM 5244  C CB   . SER A 1 108 ? 9.557   -4.642  -7.087  1.00 0.00 ? 108 SER A CB   19 
ATOM 5245  O OG   . SER A 1 108 ? 9.708   -5.748  -6.207  1.00 0.00 ? 108 SER A OG   19 
ATOM 5246  H H    . SER A 1 108 ? 10.724  -3.211  -4.372  1.00 0.00 ? 108 SER A H    19 
ATOM 5247  H HA   . SER A 1 108 ? 10.176  -2.587  -7.000  1.00 0.00 ? 108 SER A HA   19 
ATOM 5248  H HB2  . SER A 1 108 ? 8.552   -4.634  -7.475  1.00 0.00 ? 108 SER A HB2  19 
ATOM 5249  H HB3  . SER A 1 108 ? 10.257  -4.722  -7.908  1.00 0.00 ? 108 SER A HB3  19 
ATOM 5250  H HG   . SER A 1 108 ? 10.453  -6.271  -6.513  1.00 0.00 ? 108 SER A HG   19 
ATOM 5251  N N    . CYS A 1 109 ? 7.970   -1.789  -6.109  1.00 0.00 ? 109 CYS A N    19 
ATOM 5252  C CA   . CYS A 1 109 ? 6.717   -1.278  -5.480  1.00 0.00 ? 109 CYS A CA   19 
ATOM 5253  C C    . CYS A 1 109 ? 5.491   -1.800  -6.238  1.00 0.00 ? 109 CYS A C    19 
ATOM 5254  O O    . CYS A 1 109 ? 5.594   -2.672  -7.077  1.00 0.00 ? 109 CYS A O    19 
ATOM 5255  C CB   . CYS A 1 109 ? 6.719   0.250   -5.511  1.00 0.00 ? 109 CYS A CB   19 
ATOM 5256  S SG   . CYS A 1 109 ? 8.105   0.870   -4.528  1.00 0.00 ? 109 CYS A SG   19 
ATOM 5257  H H    . CYS A 1 109 ? 8.380   -1.305  -6.858  1.00 0.00 ? 109 CYS A H    19 
ATOM 5258  H HA   . CYS A 1 109 ? 6.673   -1.613  -4.455  1.00 0.00 ? 109 CYS A HA   19 
ATOM 5259  H HB2  . CYS A 1 109 ? 6.819   0.590   -6.531  1.00 0.00 ? 109 CYS A HB2  19 
ATOM 5260  H HB3  . CYS A 1 109 ? 5.792   0.619   -5.099  1.00 0.00 ? 109 CYS A HB3  19 
ATOM 5261  N N    . LYS A 1 110 ? 4.330   -1.272  -5.943  1.00 0.00 ? 110 LYS A N    19 
ATOM 5262  C CA   . LYS A 1 110 ? 3.098   -1.733  -6.640  1.00 0.00 ? 110 LYS A CA   19 
ATOM 5263  C C    . LYS A 1 110 ? 1.956   -0.764  -6.314  1.00 0.00 ? 110 LYS A C    19 
ATOM 5264  O O    . LYS A 1 110 ? 2.151   0.432   -6.251  1.00 0.00 ? 110 LYS A O    19 
ATOM 5265  C CB   . LYS A 1 110 ? 2.741   -3.145  -6.164  1.00 0.00 ? 110 LYS A CB   19 
ATOM 5266  C CG   . LYS A 1 110 ? 2.503   -3.131  -4.652  1.00 0.00 ? 110 LYS A CG   19 
ATOM 5267  C CD   . LYS A 1 110 ? 1.423   -4.155  -4.294  1.00 0.00 ? 110 LYS A CD   19 
ATOM 5268  C CE   . LYS A 1 110 ? 1.396   -4.359  -2.778  1.00 0.00 ? 110 LYS A CE   19 
ATOM 5269  N NZ   . LYS A 1 110 ? 0.531   -5.528  -2.448  1.00 0.00 ? 110 LYS A NZ   19 
ATOM 5270  H H    . LYS A 1 110 ? 4.266   -0.569  -5.261  1.00 0.00 ? 110 LYS A H    19 
ATOM 5271  H HA   . LYS A 1 110 ? 3.268   -1.743  -7.706  1.00 0.00 ? 110 LYS A HA   19 
ATOM 5272  H HB2  . LYS A 1 110 ? 1.848   -3.481  -6.669  1.00 0.00 ? 110 LYS A HB2  19 
ATOM 5273  H HB3  . LYS A 1 110 ? 3.555   -3.815  -6.393  1.00 0.00 ? 110 LYS A HB3  19 
ATOM 5274  H HG2  . LYS A 1 110 ? 3.421   -3.383  -4.141  1.00 0.00 ? 110 LYS A HG2  19 
ATOM 5275  H HG3  . LYS A 1 110 ? 2.178   -2.148  -4.347  1.00 0.00 ? 110 LYS A HG3  19 
ATOM 5276  H HD2  . LYS A 1 110 ? 0.460   -3.794  -4.627  1.00 0.00 ? 110 LYS A HD2  19 
ATOM 5277  H HD3  . LYS A 1 110 ? 1.642   -5.093  -4.778  1.00 0.00 ? 110 LYS A HD3  19 
ATOM 5278  H HE2  . LYS A 1 110 ? 2.398   -4.542  -2.421  1.00 0.00 ? 110 LYS A HE2  19 
ATOM 5279  H HE3  . LYS A 1 110 ? 1.001   -3.474  -2.302  1.00 0.00 ? 110 LYS A HE3  19 
ATOM 5280  H HZ1  . LYS A 1 110 ? 0.706   -6.293  -3.130  1.00 0.00 ? 110 LYS A HZ1  19 
ATOM 5281  H HZ2  . LYS A 1 110 ? 0.753   -5.864  -1.490  1.00 0.00 ? 110 LYS A HZ2  19 
ATOM 5282  H HZ3  . LYS A 1 110 ? -0.469  -5.243  -2.494  1.00 0.00 ? 110 LYS A HZ3  19 
ATOM 5283  N N    . CYS A 1 111 ? 0.766   -1.257  -6.105  1.00 0.00 ? 111 CYS A N    19 
ATOM 5284  C CA   . CYS A 1 111 ? -0.362  -0.339  -5.790  1.00 0.00 ? 111 CYS A CA   19 
ATOM 5285  C C    . CYS A 1 111 ? -1.364  -1.051  -4.879  1.00 0.00 ? 111 CYS A C    19 
ATOM 5286  O O    . CYS A 1 111 ? -2.312  -1.655  -5.339  1.00 0.00 ? 111 CYS A O    19 
ATOM 5287  C CB   . CYS A 1 111 ? -1.054  0.073   -7.092  1.00 0.00 ? 111 CYS A CB   19 
ATOM 5288  S SG   . CYS A 1 111 ? 0.196   0.607   -8.291  1.00 0.00 ? 111 CYS A SG   19 
ATOM 5289  H H    . CYS A 1 111 ? 0.613   -2.222  -6.158  1.00 0.00 ? 111 CYS A H    19 
ATOM 5290  H HA   . CYS A 1 111 ? 0.017   0.539   -5.290  1.00 0.00 ? 111 CYS A HA   19 
ATOM 5291  H HB2  . CYS A 1 111 ? -1.599  -0.769  -7.492  1.00 0.00 ? 111 CYS A HB2  19 
ATOM 5292  H HB3  . CYS A 1 111 ? -1.737  0.884   -6.898  1.00 0.00 ? 111 CYS A HB3  19 
ATOM 5293  N N    . SER A 1 112 ? -1.167  -0.984  -3.589  1.00 0.00 ? 112 SER A N    19 
ATOM 5294  C CA   . SER A 1 112 ? -2.116  -1.659  -2.661  1.00 0.00 ? 112 SER A CA   19 
ATOM 5295  C C    . SER A 1 112 ? -3.301  -0.729  -2.387  1.00 0.00 ? 112 SER A C    19 
ATOM 5296  O O    . SER A 1 112 ? -3.065  0.442   -2.144  1.00 0.00 ? 112 SER A O    19 
ATOM 5297  C CB   . SER A 1 112 ? -1.405  -1.981  -1.347  1.00 0.00 ? 112 SER A CB   19 
ATOM 5298  O OG   . SER A 1 112 ? -2.107  -3.018  -0.675  1.00 0.00 ? 112 SER A OG   19 
ATOM 5299  O OXT  . SER A 1 112 ? -4.424  -1.205  -2.429  1.00 0.00 ? 112 SER A OXT  19 
ATOM 5300  H H    . SER A 1 112 ? -0.397  -0.491  -3.230  1.00 0.00 ? 112 SER A H    19 
ATOM 5301  H HA   . SER A 1 112 ? -2.473  -2.574  -3.113  1.00 0.00 ? 112 SER A HA   19 
ATOM 5302  H HB2  . SER A 1 112 ? -0.400  -2.309  -1.551  1.00 0.00 ? 112 SER A HB2  19 
ATOM 5303  H HB3  . SER A 1 112 ? -1.373  -1.094  -0.729  1.00 0.00 ? 112 SER A HB3  19 
ATOM 5304  H HG   . SER A 1 112 ? -1.594  -3.826  -0.759  1.00 0.00 ? 112 SER A HG   19 
ATOM 5305  N N    . ALA B 1 1   ? -6.564  -0.065  15.433  1.00 0.00 ? 1   ALA B N    19 
ATOM 5306  C CA   . ALA B 1 1   ? -7.773  -0.529  14.695  1.00 0.00 ? 1   ALA B CA   19 
ATOM 5307  C C    . ALA B 1 1   ? -8.038  0.407   13.515  1.00 0.00 ? 1   ALA B C    19 
ATOM 5308  O O    . ALA B 1 1   ? -8.755  1.382   13.631  1.00 0.00 ? 1   ALA B O    19 
ATOM 5309  C CB   . ALA B 1 1   ? -8.980  -0.520  15.635  1.00 0.00 ? 1   ALA B CB   19 
ATOM 5310  H H1   . ALA B 1 1   ? -6.620  0.963   15.579  1.00 0.00 ? 1   ALA B H1   19 
ATOM 5311  H H2   . ALA B 1 1   ? -6.517  -0.541  16.355  1.00 0.00 ? 1   ALA B H2   19 
ATOM 5312  H H3   . ALA B 1 1   ? -5.713  -0.293  14.879  1.00 0.00 ? 1   ALA B H3   19 
ATOM 5313  H HA   . ALA B 1 1   ? -7.609  -1.532  14.329  1.00 0.00 ? 1   ALA B HA   19 
ATOM 5314  H HB1  . ALA B 1 1   ? -8.671  -0.835  16.621  1.00 0.00 ? 1   ALA B HB1  19 
ATOM 5315  H HB2  . ALA B 1 1   ? -9.387  0.478   15.688  1.00 0.00 ? 1   ALA B HB2  19 
ATOM 5316  H HB3  . ALA B 1 1   ? -9.733  -1.196  15.261  1.00 0.00 ? 1   ALA B HB3  19 
ATOM 5317  N N    . LEU B 1 2   ? -7.464  0.120   12.379  1.00 0.00 ? 2   LEU B N    19 
ATOM 5318  C CA   . LEU B 1 2   ? -7.681  0.994   11.192  1.00 0.00 ? 2   LEU B CA   19 
ATOM 5319  C C    . LEU B 1 2   ? -8.672  0.326   10.242  1.00 0.00 ? 2   LEU B C    19 
ATOM 5320  O O    . LEU B 1 2   ? -8.316  -0.127  9.172   1.00 0.00 ? 2   LEU B O    19 
ATOM 5321  C CB   . LEU B 1 2   ? -6.358  1.205   10.468  1.00 0.00 ? 2   LEU B CB   19 
ATOM 5322  C CG   . LEU B 1 2   ? -5.262  1.495   11.492  1.00 0.00 ? 2   LEU B CG   19 
ATOM 5323  C CD1  . LEU B 1 2   ? -3.928  1.690   10.772  1.00 0.00 ? 2   LEU B CD1  19 
ATOM 5324  C CD2  . LEU B 1 2   ? -5.617  2.767   12.264  1.00 0.00 ? 2   LEU B CD2  19 
ATOM 5325  H H    . LEU B 1 2   ? -6.889  -0.670  12.307  1.00 0.00 ? 2   LEU B H    19 
ATOM 5326  H HA   . LEU B 1 2   ? -8.075  1.946   11.512  1.00 0.00 ? 2   LEU B HA   19 
ATOM 5327  H HB2  . LEU B 1 2   ? -6.110  0.314   9.912   1.00 0.00 ? 2   LEU B HB2  19 
ATOM 5328  H HB3  . LEU B 1 2   ? -6.448  2.041   9.792   1.00 0.00 ? 2   LEU B HB3  19 
ATOM 5329  H HG   . LEU B 1 2   ? -5.183  0.665   12.180  1.00 0.00 ? 2   LEU B HG   19 
ATOM 5330  H HD11 . LEU B 1 2   ? -4.058  2.389   9.959   1.00 0.00 ? 2   LEU B HD11 19 
ATOM 5331  H HD12 . LEU B 1 2   ? -3.197  2.076   11.466  1.00 0.00 ? 2   LEU B HD12 19 
ATOM 5332  H HD13 . LEU B 1 2   ? -3.588  0.742   10.381  1.00 0.00 ? 2   LEU B HD13 19 
ATOM 5333  H HD21 . LEU B 1 2   ? -6.684  2.803   12.427  1.00 0.00 ? 2   LEU B HD21 19 
ATOM 5334  H HD22 . LEU B 1 2   ? -5.106  2.766   13.215  1.00 0.00 ? 2   LEU B HD22 19 
ATOM 5335  H HD23 . LEU B 1 2   ? -5.313  3.631   11.692  1.00 0.00 ? 2   LEU B HD23 19 
ATOM 5336  N N    . ASP B 1 3   ? -9.909  0.259   10.628  1.00 0.00 ? 3   ASP B N    19 
ATOM 5337  C CA   . ASP B 1 3   ? -10.929 -0.380  9.755   1.00 0.00 ? 3   ASP B CA   19 
ATOM 5338  C C    . ASP B 1 3   ? -12.011 0.637   9.396   1.00 0.00 ? 3   ASP B C    19 
ATOM 5339  O O    . ASP B 1 3   ? -11.905 1.810   9.698   1.00 0.00 ? 3   ASP B O    19 
ATOM 5340  C CB   . ASP B 1 3   ? -11.564 -1.555  10.498  1.00 0.00 ? 3   ASP B CB   19 
ATOM 5341  C CG   . ASP B 1 3   ? -11.710 -1.202  11.979  1.00 0.00 ? 3   ASP B CG   19 
ATOM 5342  O OD1  . ASP B 1 3   ? -12.703 -0.586  12.326  1.00 0.00 ? 3   ASP B OD1  19 
ATOM 5343  O OD2  . ASP B 1 3   ? -10.825 -1.553  12.741  1.00 0.00 ? 3   ASP B OD2  19 
ATOM 5344  H H    . ASP B 1 3   ? -10.168 0.629   11.494  1.00 0.00 ? 3   ASP B H    19 
ATOM 5345  H HA   . ASP B 1 3   ? -10.457 -0.738  8.851   1.00 0.00 ? 3   ASP B HA   19 
ATOM 5346  H HB2  . ASP B 1 3   ? -12.538 -1.763  10.077  1.00 0.00 ? 3   ASP B HB2  19 
ATOM 5347  H HB3  . ASP B 1 3   ? -10.935 -2.424  10.397  1.00 0.00 ? 3   ASP B HB3  19 
ATOM 5348  N N    . THR B 1 4   ? -13.051 0.193   8.750   1.00 0.00 ? 4   THR B N    19 
ATOM 5349  C CA   . THR B 1 4   ? -14.149 1.119   8.361   1.00 0.00 ? 4   THR B CA   19 
ATOM 5350  C C    . THR B 1 4   ? -15.082 1.351   9.552   1.00 0.00 ? 4   THR B C    19 
ATOM 5351  O O    . THR B 1 4   ? -16.122 1.966   9.427   1.00 0.00 ? 4   THR B O    19 
ATOM 5352  C CB   . THR B 1 4   ? -14.926 0.501   7.199   1.00 0.00 ? 4   THR B CB   19 
ATOM 5353  O OG1  . THR B 1 4   ? -15.877 -0.426  7.706   1.00 0.00 ? 4   THR B OG1  19 
ATOM 5354  C CG2  . THR B 1 4   ? -13.946 -0.221  6.270   1.00 0.00 ? 4   THR B CG2  19 
ATOM 5355  H H    . THR B 1 4   ? -13.108 -0.757  8.516   1.00 0.00 ? 4   THR B H    19 
ATOM 5356  H HA   . THR B 1 4   ? -13.731 2.063   8.050   1.00 0.00 ? 4   THR B HA   19 
ATOM 5357  H HB   . THR B 1 4   ? -15.434 1.276   6.648   1.00 0.00 ? 4   THR B HB   19 
ATOM 5358  H HG1  . THR B 1 4   ? -16.521 -0.598  7.016   1.00 0.00 ? 4   THR B HG1  19 
ATOM 5359  H HG21 . THR B 1 4   ? -12.940 0.110   6.481   1.00 0.00 ? 4   THR B HG21 19 
ATOM 5360  H HG22 . THR B 1 4   ? -14.014 -1.287  6.432   1.00 0.00 ? 4   THR B HG22 19 
ATOM 5361  H HG23 . THR B 1 4   ? -14.191 0.002   5.243   1.00 0.00 ? 4   THR B HG23 19 
ATOM 5362  N N    . ASN B 1 5   ? -14.714 0.872   10.710  1.00 0.00 ? 5   ASN B N    19 
ATOM 5363  C CA   . ASN B 1 5   ? -15.578 1.076   11.906  1.00 0.00 ? 5   ASN B CA   19 
ATOM 5364  C C    . ASN B 1 5   ? -15.020 2.226   12.750  1.00 0.00 ? 5   ASN B C    19 
ATOM 5365  O O    . ASN B 1 5   ? -15.748 3.092   13.194  1.00 0.00 ? 5   ASN B O    19 
ATOM 5366  C CB   . ASN B 1 5   ? -15.603 -0.205  12.744  1.00 0.00 ? 5   ASN B CB   19 
ATOM 5367  C CG   . ASN B 1 5   ? -16.611 -0.052  13.885  1.00 0.00 ? 5   ASN B CG   19 
ATOM 5368  O OD1  . ASN B 1 5   ? -17.806 -0.049  13.659  1.00 0.00 ? 5   ASN B OD1  19 
ATOM 5369  N ND2  . ASN B 1 5   ? -16.178 0.077   15.109  1.00 0.00 ? 5   ASN B ND2  19 
ATOM 5370  H H    . ASN B 1 5   ? -13.868 0.385   10.793  1.00 0.00 ? 5   ASN B H    19 
ATOM 5371  H HA   . ASN B 1 5   ? -16.582 1.317   11.589  1.00 0.00 ? 5   ASN B HA   19 
ATOM 5372  H HB2  . ASN B 1 5   ? -15.891 -1.039  12.118  1.00 0.00 ? 5   ASN B HB2  19 
ATOM 5373  H HB3  . ASN B 1 5   ? -14.622 -0.386  13.156  1.00 0.00 ? 5   ASN B HB3  19 
ATOM 5374  H HD21 . ASN B 1 5   ? -15.215 0.075   15.291  1.00 0.00 ? 5   ASN B HD21 19 
ATOM 5375  H HD22 . ASN B 1 5   ? -16.816 0.176   15.847  1.00 0.00 ? 5   ASN B HD22 19 
ATOM 5376  N N    . TYR B 1 6   ? -13.734 2.238   12.981  1.00 0.00 ? 6   TYR B N    19 
ATOM 5377  C CA   . TYR B 1 6   ? -13.128 3.322   13.800  1.00 0.00 ? 6   TYR B CA   19 
ATOM 5378  C C    . TYR B 1 6   ? -12.823 4.534   12.915  1.00 0.00 ? 6   TYR B C    19 
ATOM 5379  O O    . TYR B 1 6   ? -12.643 5.635   13.399  1.00 0.00 ? 6   TYR B O    19 
ATOM 5380  C CB   . TYR B 1 6   ? -11.833 2.798   14.420  1.00 0.00 ? 6   TYR B CB   19 
ATOM 5381  C CG   . TYR B 1 6   ? -11.041 3.947   14.996  1.00 0.00 ? 6   TYR B CG   19 
ATOM 5382  C CD1  . TYR B 1 6   ? -11.400 4.503   16.230  1.00 0.00 ? 6   TYR B CD1  19 
ATOM 5383  C CD2  . TYR B 1 6   ? -9.944  4.456   14.291  1.00 0.00 ? 6   TYR B CD2  19 
ATOM 5384  C CE1  . TYR B 1 6   ? -10.661 5.568   16.759  1.00 0.00 ? 6   TYR B CE1  19 
ATOM 5385  C CE2  . TYR B 1 6   ? -9.204  5.520   14.820  1.00 0.00 ? 6   TYR B CE2  19 
ATOM 5386  C CZ   . TYR B 1 6   ? -9.562  6.076   16.054  1.00 0.00 ? 6   TYR B CZ   19 
ATOM 5387  O OH   . TYR B 1 6   ? -8.834  7.126   16.575  1.00 0.00 ? 6   TYR B OH   19 
ATOM 5388  H H    . TYR B 1 6   ? -13.164 1.528   12.621  1.00 0.00 ? 6   TYR B H    19 
ATOM 5389  H HA   . TYR B 1 6   ? -13.813 3.608   14.584  1.00 0.00 ? 6   TYR B HA   19 
ATOM 5390  H HB2  . TYR B 1 6   ? -12.071 2.094   15.202  1.00 0.00 ? 6   TYR B HB2  19 
ATOM 5391  H HB3  . TYR B 1 6   ? -11.246 2.305   13.661  1.00 0.00 ? 6   TYR B HB3  19 
ATOM 5392  H HD1  . TYR B 1 6   ? -12.247 4.111   16.773  1.00 0.00 ? 6   TYR B HD1  19 
ATOM 5393  H HD2  . TYR B 1 6   ? -9.668  4.025   13.340  1.00 0.00 ? 6   TYR B HD2  19 
ATOM 5394  H HE1  . TYR B 1 6   ? -10.937 5.997   17.711  1.00 0.00 ? 6   TYR B HE1  19 
ATOM 5395  H HE2  . TYR B 1 6   ? -8.357  5.913   14.276  1.00 0.00 ? 6   TYR B HE2  19 
ATOM 5396  H HH   . TYR B 1 6   ? -9.194  7.336   17.440  1.00 0.00 ? 6   TYR B HH   19 
ATOM 5397  N N    . CYS B 1 7   ? -12.756 4.345   11.626  1.00 0.00 ? 7   CYS B N    19 
ATOM 5398  C CA   . CYS B 1 7   ? -12.457 5.493   10.722  1.00 0.00 ? 7   CYS B CA   19 
ATOM 5399  C C    . CYS B 1 7   ? -13.744 6.265   10.427  1.00 0.00 ? 7   CYS B C    19 
ATOM 5400  O O    . CYS B 1 7   ? -13.714 7.367   9.916   1.00 0.00 ? 7   CYS B O    19 
ATOM 5401  C CB   . CYS B 1 7   ? -11.857 4.974   9.415   1.00 0.00 ? 7   CYS B CB   19 
ATOM 5402  S SG   . CYS B 1 7   ? -10.115 4.559   9.682   1.00 0.00 ? 7   CYS B SG   19 
ATOM 5403  H H    . CYS B 1 7   ? -12.900 3.451   11.252  1.00 0.00 ? 7   CYS B H    19 
ATOM 5404  H HA   . CYS B 1 7   ? -11.749 6.151   11.204  1.00 0.00 ? 7   CYS B HA   19 
ATOM 5405  H HB2  . CYS B 1 7   ? -12.393 4.092   9.093   1.00 0.00 ? 7   CYS B HB2  19 
ATOM 5406  H HB3  . CYS B 1 7   ? -11.931 5.738   8.656   1.00 0.00 ? 7   CYS B HB3  19 
ATOM 5407  N N    . PHE B 1 8   ? -14.874 5.700   10.748  1.00 0.00 ? 8   PHE B N    19 
ATOM 5408  C CA   . PHE B 1 8   ? -16.160 6.408   10.488  1.00 0.00 ? 8   PHE B CA   19 
ATOM 5409  C C    . PHE B 1 8   ? -16.497 7.315   11.673  1.00 0.00 ? 8   PHE B C    19 
ATOM 5410  O O    . PHE B 1 8   ? -17.468 8.044   11.652  1.00 0.00 ? 8   PHE B O    19 
ATOM 5411  C CB   . PHE B 1 8   ? -17.280 5.385   10.292  1.00 0.00 ? 8   PHE B CB   19 
ATOM 5412  C CG   . PHE B 1 8   ? -17.385 5.030   8.829   1.00 0.00 ? 8   PHE B CG   19 
ATOM 5413  C CD1  . PHE B 1 8   ? -16.246 5.065   8.016   1.00 0.00 ? 8   PHE B CD1  19 
ATOM 5414  C CD2  . PHE B 1 8   ? -18.623 4.665   8.285   1.00 0.00 ? 8   PHE B CD2  19 
ATOM 5415  C CE1  . PHE B 1 8   ? -16.344 4.738   6.659   1.00 0.00 ? 8   PHE B CE1  19 
ATOM 5416  C CE2  . PHE B 1 8   ? -18.721 4.336   6.927   1.00 0.00 ? 8   PHE B CE2  19 
ATOM 5417  C CZ   . PHE B 1 8   ? -17.583 4.373   6.114   1.00 0.00 ? 8   PHE B CZ   19 
ATOM 5418  H H    . PHE B 1 8   ? -14.879 4.812   11.162  1.00 0.00 ? 8   PHE B H    19 
ATOM 5419  H HA   . PHE B 1 8   ? -16.063 7.009   9.597   1.00 0.00 ? 8   PHE B HA   19 
ATOM 5420  H HB2  . PHE B 1 8   ? -17.059 4.496   10.865  1.00 0.00 ? 8   PHE B HB2  19 
ATOM 5421  H HB3  . PHE B 1 8   ? -18.216 5.806   10.627  1.00 0.00 ? 8   PHE B HB3  19 
ATOM 5422  H HD1  . PHE B 1 8   ? -15.292 5.347   8.436   1.00 0.00 ? 8   PHE B HD1  19 
ATOM 5423  H HD2  . PHE B 1 8   ? -19.501 4.637   8.912   1.00 0.00 ? 8   PHE B HD2  19 
ATOM 5424  H HE1  . PHE B 1 8   ? -15.466 4.766   6.031   1.00 0.00 ? 8   PHE B HE1  19 
ATOM 5425  H HE2  . PHE B 1 8   ? -19.675 4.055   6.508   1.00 0.00 ? 8   PHE B HE2  19 
ATOM 5426  H HZ   . PHE B 1 8   ? -17.658 4.119   5.067   1.00 0.00 ? 8   PHE B HZ   19 
ATOM 5427  N N    . SER B 1 9   ? -15.701 7.280   12.706  1.00 0.00 ? 9   SER B N    19 
ATOM 5428  C CA   . SER B 1 9   ? -15.975 8.143   13.888  1.00 0.00 ? 9   SER B CA   19 
ATOM 5429  C C    . SER B 1 9   ? -15.028 9.344   13.863  1.00 0.00 ? 9   SER B C    19 
ATOM 5430  O O    . SER B 1 9   ? -15.453 10.481  13.822  1.00 0.00 ? 9   SER B O    19 
ATOM 5431  C CB   . SER B 1 9   ? -15.752 7.341   15.171  1.00 0.00 ? 9   SER B CB   19 
ATOM 5432  O OG   . SER B 1 9   ? -14.447 7.606   15.670  1.00 0.00 ? 9   SER B OG   19 
ATOM 5433  H H    . SER B 1 9   ? -14.920 6.687   12.702  1.00 0.00 ? 9   SER B H    19 
ATOM 5434  H HA   . SER B 1 9   ? -16.997 8.490   13.851  1.00 0.00 ? 9   SER B HA   19 
ATOM 5435  H HB2  . SER B 1 9   ? -16.480 7.630   15.910  1.00 0.00 ? 9   SER B HB2  19 
ATOM 5436  H HB3  . SER B 1 9   ? -15.859 6.285   14.957  1.00 0.00 ? 9   SER B HB3  19 
ATOM 5437  H HG   . SER B 1 9   ? -14.454 7.448   16.618  1.00 0.00 ? 9   SER B HG   19 
ATOM 5438  N N    . SER B 1 10  ? -13.745 9.099   13.883  1.00 0.00 ? 10  SER B N    19 
ATOM 5439  C CA   . SER B 1 10  ? -12.769 10.224  13.857  1.00 0.00 ? 10  SER B CA   19 
ATOM 5440  C C    . SER B 1 10  ? -11.974 10.169  12.549  1.00 0.00 ? 10  SER B C    19 
ATOM 5441  O O    . SER B 1 10  ? -11.877 9.138   11.916  1.00 0.00 ? 10  SER B O    19 
ATOM 5442  C CB   . SER B 1 10  ? -11.812 10.097  15.042  1.00 0.00 ? 10  SER B CB   19 
ATOM 5443  O OG   . SER B 1 10  ? -10.619 9.454   14.616  1.00 0.00 ? 10  SER B OG   19 
ATOM 5444  H H    . SER B 1 10  ? -13.425 8.173   13.913  1.00 0.00 ? 10  SER B H    19 
ATOM 5445  H HA   . SER B 1 10  ? -13.299 11.163  13.917  1.00 0.00 ? 10  SER B HA   19 
ATOM 5446  H HB2  . SER B 1 10  ? -11.571 11.077  15.419  1.00 0.00 ? 10  SER B HB2  19 
ATOM 5447  H HB3  . SER B 1 10  ? -12.286 9.519   15.824  1.00 0.00 ? 10  SER B HB3  19 
ATOM 5448  H HG   . SER B 1 10  ? -9.923  10.113  14.578  1.00 0.00 ? 10  SER B HG   19 
ATOM 5449  N N    . THR B 1 11  ? -11.407 11.270  12.139  1.00 0.00 ? 11  THR B N    19 
ATOM 5450  C CA   . THR B 1 11  ? -10.623 11.274  10.874  1.00 0.00 ? 11  THR B CA   19 
ATOM 5451  C C    . THR B 1 11  ? -9.137  11.140  11.196  1.00 0.00 ? 11  THR B C    19 
ATOM 5452  O O    . THR B 1 11  ? -8.354  10.666  10.397  1.00 0.00 ? 11  THR B O    19 
ATOM 5453  C CB   . THR B 1 11  ? -10.868 12.586  10.128  1.00 0.00 ? 11  THR B CB   19 
ATOM 5454  O OG1  . THR B 1 11  ? -11.620 13.464  10.954  1.00 0.00 ? 11  THR B OG1  19 
ATOM 5455  C CG2  . THR B 1 11  ? -11.640 12.307  8.838   1.00 0.00 ? 11  THR B CG2  19 
ATOM 5456  H H    . THR B 1 11  ? -11.496 12.094  12.661  1.00 0.00 ? 11  THR B H    19 
ATOM 5457  H HA   . THR B 1 11  ? -10.929 10.447  10.261  1.00 0.00 ? 11  THR B HA   19 
ATOM 5458  H HB   . THR B 1 11  ? -9.922  13.041  9.887   1.00 0.00 ? 11  THR B HB   19 
ATOM 5459  H HG1  . THR B 1 11  ? -11.377 14.364  10.727  1.00 0.00 ? 11  THR B HG1  19 
ATOM 5460  H HG21 . THR B 1 11  ? -11.406 11.314  8.485   1.00 0.00 ? 11  THR B HG21 19 
ATOM 5461  H HG22 . THR B 1 11  ? -12.700 12.381  9.030   1.00 0.00 ? 11  THR B HG22 19 
ATOM 5462  H HG23 . THR B 1 11  ? -11.359 13.031  8.087   1.00 0.00 ? 11  THR B HG23 19 
ATOM 5463  N N    . GLU B 1 12  ? -8.755  11.559  12.364  1.00 0.00 ? 12  GLU B N    19 
ATOM 5464  C CA   . GLU B 1 12  ? -7.323  11.472  12.775  1.00 0.00 ? 12  GLU B CA   19 
ATOM 5465  C C    . GLU B 1 12  ? -6.420  11.854  11.599  1.00 0.00 ? 12  GLU B C    19 
ATOM 5466  O O    . GLU B 1 12  ? -6.861  12.430  10.624  1.00 0.00 ? 12  GLU B O    19 
ATOM 5467  C CB   . GLU B 1 12  ? -7.004  10.046  13.232  1.00 0.00 ? 12  GLU B CB   19 
ATOM 5468  C CG   . GLU B 1 12  ? -7.316  9.058   12.107  1.00 0.00 ? 12  GLU B CG   19 
ATOM 5469  C CD   . GLU B 1 12  ? -6.748  7.684   12.464  1.00 0.00 ? 12  GLU B CD   19 
ATOM 5470  O OE1  . GLU B 1 12  ? -6.394  7.492   13.615  1.00 0.00 ? 12  GLU B OE1  19 
ATOM 5471  O OE2  . GLU B 1 12  ? -6.675  6.846   11.580  1.00 0.00 ? 12  GLU B OE2  19 
ATOM 5472  H H    . GLU B 1 12  ? -9.419  11.932  12.976  1.00 0.00 ? 12  GLU B H    19 
ATOM 5473  H HA   . GLU B 1 12  ? -7.148  12.156  13.594  1.00 0.00 ? 12  GLU B HA   19 
ATOM 5474  H HB2  . GLU B 1 12  ? -5.958  9.979   13.491  1.00 0.00 ? 12  GLU B HB2  19 
ATOM 5475  H HB3  . GLU B 1 12  ? -7.605  9.803   14.096  1.00 0.00 ? 12  GLU B HB3  19 
ATOM 5476  H HG2  . GLU B 1 12  ? -8.387  8.985   11.979  1.00 0.00 ? 12  GLU B HG2  19 
ATOM 5477  H HG3  . GLU B 1 12  ? -6.866  9.405   11.188  1.00 0.00 ? 12  GLU B HG3  19 
ATOM 5478  N N    . LYS B 1 13  ? -5.155  11.543  11.685  1.00 0.00 ? 13  LYS B N    19 
ATOM 5479  C CA   . LYS B 1 13  ? -4.224  11.894  10.574  1.00 0.00 ? 13  LYS B CA   19 
ATOM 5480  C C    . LYS B 1 13  ? -3.314  10.701  10.273  1.00 0.00 ? 13  LYS B C    19 
ATOM 5481  O O    . LYS B 1 13  ? -2.151  10.862  9.956   1.00 0.00 ? 13  LYS B O    19 
ATOM 5482  C CB   . LYS B 1 13  ? -3.369  13.094  10.988  1.00 0.00 ? 13  LYS B CB   19 
ATOM 5483  C CG   . LYS B 1 13  ? -2.758  13.741  9.743   1.00 0.00 ? 13  LYS B CG   19 
ATOM 5484  C CD   . LYS B 1 13  ? -3.862  14.400  8.915   1.00 0.00 ? 13  LYS B CD   19 
ATOM 5485  C CE   . LYS B 1 13  ? -3.575  15.896  8.776   1.00 0.00 ? 13  LYS B CE   19 
ATOM 5486  N NZ   . LYS B 1 13  ? -3.208  16.204  7.366   1.00 0.00 ? 13  LYS B NZ   19 
ATOM 5487  H H    . LYS B 1 13  ? -4.817  11.084  12.482  1.00 0.00 ? 13  LYS B H    19 
ATOM 5488  H HA   . LYS B 1 13  ? -4.794  12.145  9.693   1.00 0.00 ? 13  LYS B HA   19 
ATOM 5489  H HB2  . LYS B 1 13  ? -3.986  13.816  11.503  1.00 0.00 ? 13  LYS B HB2  19 
ATOM 5490  H HB3  . LYS B 1 13  ? -2.577  12.763  11.644  1.00 0.00 ? 13  LYS B HB3  19 
ATOM 5491  H HG2  . LYS B 1 13  ? -2.038  14.488  10.043  1.00 0.00 ? 13  LYS B HG2  19 
ATOM 5492  H HG3  . LYS B 1 13  ? -2.268  12.985  9.149   1.00 0.00 ? 13  LYS B HG3  19 
ATOM 5493  H HD2  . LYS B 1 13  ? -3.895  13.946  7.935   1.00 0.00 ? 13  LYS B HD2  19 
ATOM 5494  H HD3  . LYS B 1 13  ? -4.813  14.262  9.408   1.00 0.00 ? 13  LYS B HD3  19 
ATOM 5495  H HE2  . LYS B 1 13  ? -4.455  16.459  9.051   1.00 0.00 ? 13  LYS B HE2  19 
ATOM 5496  H HE3  . LYS B 1 13  ? -2.757  16.167  9.428   1.00 0.00 ? 13  LYS B HE3  19 
ATOM 5497  H HZ1  . LYS B 1 13  ? -3.165  15.322  6.817   1.00 0.00 ? 13  LYS B HZ1  19 
ATOM 5498  H HZ2  . LYS B 1 13  ? -3.924  16.836  6.952   1.00 0.00 ? 13  LYS B HZ2  19 
ATOM 5499  H HZ3  . LYS B 1 13  ? -2.279  16.669  7.342   1.00 0.00 ? 13  LYS B HZ3  19 
ATOM 5500  N N    . ASN B 1 14  ? -3.828  9.505   10.370  1.00 0.00 ? 14  ASN B N    19 
ATOM 5501  C CA   . ASN B 1 14  ? -2.983  8.309   10.091  1.00 0.00 ? 14  ASN B CA   19 
ATOM 5502  C C    . ASN B 1 14  ? -3.752  7.318   9.214   1.00 0.00 ? 14  ASN B C    19 
ATOM 5503  O O    . ASN B 1 14  ? -4.877  7.557   8.824   1.00 0.00 ? 14  ASN B O    19 
ATOM 5504  C CB   . ASN B 1 14  ? -2.606  7.633   11.410  1.00 0.00 ? 14  ASN B CB   19 
ATOM 5505  C CG   . ASN B 1 14  ? -2.155  8.692   12.417  1.00 0.00 ? 14  ASN B CG   19 
ATOM 5506  O OD1  . ASN B 1 14  ? -2.833  8.949   13.391  1.00 0.00 ? 14  ASN B OD1  19 
ATOM 5507  N ND2  . ASN B 1 14  ? -1.029  9.321   12.222  1.00 0.00 ? 14  ASN B ND2  19 
ATOM 5508  H H    . ASN B 1 14  ? -4.766  9.394   10.629  1.00 0.00 ? 14  ASN B H    19 
ATOM 5509  H HA   . ASN B 1 14  ? -2.084  8.619   9.578   1.00 0.00 ? 14  ASN B HA   19 
ATOM 5510  H HB2  . ASN B 1 14  ? -3.464  7.105   11.800  1.00 0.00 ? 14  ASN B HB2  19 
ATOM 5511  H HB3  . ASN B 1 14  ? -1.800  6.935   11.239  1.00 0.00 ? 14  ASN B HB3  19 
ATOM 5512  H HD21 . ASN B 1 14  ? -0.481  9.114   11.436  1.00 0.00 ? 14  ASN B HD21 19 
ATOM 5513  H HD22 . ASN B 1 14  ? -0.731  10.000  12.861  1.00 0.00 ? 14  ASN B HD22 19 
ATOM 5514  N N    . CYS B 1 15  ? -3.147  6.202   8.908   1.00 0.00 ? 15  CYS B N    19 
ATOM 5515  C CA   . CYS B 1 15  ? -3.826  5.181   8.062   1.00 0.00 ? 15  CYS B CA   19 
ATOM 5516  C C    . CYS B 1 15  ? -5.268  4.991   8.543   1.00 0.00 ? 15  CYS B C    19 
ATOM 5517  O O    . CYS B 1 15  ? -5.529  4.259   9.477   1.00 0.00 ? 15  CYS B O    19 
ATOM 5518  C CB   . CYS B 1 15  ? -3.067  3.856   8.181   1.00 0.00 ? 15  CYS B CB   19 
ATOM 5519  S SG   . CYS B 1 15  ? -4.039  2.514   7.449   1.00 0.00 ? 15  CYS B SG   19 
ATOM 5520  H H    . CYS B 1 15  ? -2.240  6.036   9.239   1.00 0.00 ? 15  CYS B H    19 
ATOM 5521  H HA   . CYS B 1 15  ? -3.827  5.505   7.033   1.00 0.00 ? 15  CYS B HA   19 
ATOM 5522  H HB2  . CYS B 1 15  ? -2.120  3.934   7.672   1.00 0.00 ? 15  CYS B HB2  19 
ATOM 5523  H HB3  . CYS B 1 15  ? -2.891  3.641   9.225   1.00 0.00 ? 15  CYS B HB3  19 
ATOM 5524  N N    . CYS B 1 16  ? -6.209  5.641   7.910   1.00 0.00 ? 16  CYS B N    19 
ATOM 5525  C CA   . CYS B 1 16  ? -7.630  5.489   8.333   1.00 0.00 ? 16  CYS B CA   19 
ATOM 5526  C C    . CYS B 1 16  ? -8.516  5.312   7.098   1.00 0.00 ? 16  CYS B C    19 
ATOM 5527  O O    . CYS B 1 16  ? -8.605  6.184   6.256   1.00 0.00 ? 16  CYS B O    19 
ATOM 5528  C CB   . CYS B 1 16  ? -8.074  6.735   9.103   1.00 0.00 ? 16  CYS B CB   19 
ATOM 5529  S SG   . CYS B 1 16  ? -9.289  6.273   10.367  1.00 0.00 ? 16  CYS B SG   19 
ATOM 5530  H H    . CYS B 1 16  ? -5.980  6.225   7.156   1.00 0.00 ? 16  CYS B H    19 
ATOM 5531  H HA   . CYS B 1 16  ? -7.722  4.621   8.969   1.00 0.00 ? 16  CYS B HA   19 
ATOM 5532  H HB2  . CYS B 1 16  ? -7.217  7.189   9.577   1.00 0.00 ? 16  CYS B HB2  19 
ATOM 5533  H HB3  . CYS B 1 16  ? -8.521  7.440   8.416   1.00 0.00 ? 16  CYS B HB3  19 
ATOM 5534  N N    . VAL B 1 17  ? -9.172  4.190   6.984   1.00 0.00 ? 17  VAL B N    19 
ATOM 5535  C CA   . VAL B 1 17  ? -10.050 3.953   5.805   1.00 0.00 ? 17  VAL B CA   19 
ATOM 5536  C C    . VAL B 1 17  ? -11.155 5.013   5.755   1.00 0.00 ? 17  VAL B C    19 
ATOM 5537  O O    . VAL B 1 17  ? -11.930 5.155   6.676   1.00 0.00 ? 17  VAL B O    19 
ATOM 5538  C CB   . VAL B 1 17  ? -10.689 2.570   5.924   1.00 0.00 ? 17  VAL B CB   19 
ATOM 5539  C CG1  . VAL B 1 17  ? -11.745 2.591   7.022   1.00 0.00 ? 17  VAL B CG1  19 
ATOM 5540  C CG2  . VAL B 1 17  ? -11.359 2.200   4.606   1.00 0.00 ? 17  VAL B CG2  19 
ATOM 5541  H H    . VAL B 1 17  ? -9.083  3.500   7.673   1.00 0.00 ? 17  VAL B H    19 
ATOM 5542  H HA   . VAL B 1 17  ? -9.462  4.001   4.903   1.00 0.00 ? 17  VAL B HA   19 
ATOM 5543  H HB   . VAL B 1 17  ? -9.933  1.840   6.168   1.00 0.00 ? 17  VAL B HB   19 
ATOM 5544  H HG11 . VAL B 1 17  ? -11.331 3.042   7.910   1.00 0.00 ? 17  VAL B HG11 19 
ATOM 5545  H HG12 . VAL B 1 17  ? -12.597 3.165   6.688   1.00 0.00 ? 17  VAL B HG12 19 
ATOM 5546  H HG13 . VAL B 1 17  ? -12.057 1.581   7.241   1.00 0.00 ? 17  VAL B HG13 19 
ATOM 5547  H HG21 . VAL B 1 17  ? -11.738 3.094   4.135   1.00 0.00 ? 17  VAL B HG21 19 
ATOM 5548  H HG22 . VAL B 1 17  ? -10.639 1.726   3.957   1.00 0.00 ? 17  VAL B HG22 19 
ATOM 5549  H HG23 . VAL B 1 17  ? -12.176 1.520   4.798   1.00 0.00 ? 17  VAL B HG23 19 
ATOM 5550  N N    . ARG B 1 18  ? -11.241 5.752   4.685   1.00 0.00 ? 18  ARG B N    19 
ATOM 5551  C CA   . ARG B 1 18  ? -12.304 6.791   4.588   1.00 0.00 ? 18  ARG B CA   19 
ATOM 5552  C C    . ARG B 1 18  ? -13.440 6.279   3.698   1.00 0.00 ? 18  ARG B C    19 
ATOM 5553  O O    . ARG B 1 18  ? -13.238 5.444   2.839   1.00 0.00 ? 18  ARG B O    19 
ATOM 5554  C CB   . ARG B 1 18  ? -11.714 8.068   3.988   1.00 0.00 ? 18  ARG B CB   19 
ATOM 5555  C CG   . ARG B 1 18  ? -11.234 8.984   5.114   1.00 0.00 ? 18  ARG B CG   19 
ATOM 5556  C CD   . ARG B 1 18  ? -10.506 10.190  4.519   1.00 0.00 ? 18  ARG B CD   19 
ATOM 5557  N NE   . ARG B 1 18  ? -9.235  10.419  5.263   1.00 0.00 ? 18  ARG B NE   19 
ATOM 5558  C CZ   . ARG B 1 18  ? -9.249  10.519  6.564   1.00 0.00 ? 18  ARG B CZ   19 
ATOM 5559  N NH1  . ARG B 1 18  ? -9.464  11.677  7.127   1.00 0.00 ? 18  ARG B NH1  19 
ATOM 5560  N NH2  . ARG B 1 18  ? -9.049  9.461   7.302   1.00 0.00 ? 18  ARG B NH2  19 
ATOM 5561  H H    . ARG B 1 18  ? -10.612 5.622   3.945   1.00 0.00 ? 18  ARG B H    19 
ATOM 5562  H HA   . ARG B 1 18  ? -12.690 7.004   5.574   1.00 0.00 ? 18  ARG B HA   19 
ATOM 5563  H HB2  . ARG B 1 18  ? -10.880 7.813   3.350   1.00 0.00 ? 18  ARG B HB2  19 
ATOM 5564  H HB3  . ARG B 1 18  ? -12.470 8.577   3.409   1.00 0.00 ? 18  ARG B HB3  19 
ATOM 5565  H HG2  . ARG B 1 18  ? -12.084 9.323   5.689   1.00 0.00 ? 18  ARG B HG2  19 
ATOM 5566  H HG3  . ARG B 1 18  ? -10.558 8.440   5.758   1.00 0.00 ? 18  ARG B HG3  19 
ATOM 5567  H HD2  . ARG B 1 18  ? -10.286 10.002  3.479   1.00 0.00 ? 18  ARG B HD2  19 
ATOM 5568  H HD3  . ARG B 1 18  ? -11.134 11.066  4.602   1.00 0.00 ? 18  ARG B HD3  19 
ATOM 5569  H HE   . ARG B 1 18  ? -8.388  10.491  4.775   1.00 0.00 ? 18  ARG B HE   19 
ATOM 5570  H HH11 . ARG B 1 18  ? -9.617  12.487  6.562   1.00 0.00 ? 18  ARG B HH11 19 
ATOM 5571  H HH12 . ARG B 1 18  ? -9.475  11.753  8.125   1.00 0.00 ? 18  ARG B HH12 19 
ATOM 5572  H HH21 . ARG B 1 18  ? -8.886  8.574   6.870   1.00 0.00 ? 18  ARG B HH21 19 
ATOM 5573  H HH22 . ARG B 1 18  ? -9.060  9.537   8.299   1.00 0.00 ? 18  ARG B HH22 19 
ATOM 5574  N N    . GLN B 1 19  ? -14.633 6.772   3.895   1.00 0.00 ? 19  GLN B N    19 
ATOM 5575  C CA   . GLN B 1 19  ? -15.779 6.312   3.056   1.00 0.00 ? 19  GLN B CA   19 
ATOM 5576  C C    . GLN B 1 19  ? -15.484 6.616   1.590   1.00 0.00 ? 19  GLN B C    19 
ATOM 5577  O O    . GLN B 1 19  ? -14.912 7.637   1.261   1.00 0.00 ? 19  GLN B O    19 
ATOM 5578  C CB   . GLN B 1 19  ? -17.052 7.043   3.485   1.00 0.00 ? 19  GLN B CB   19 
ATOM 5579  C CG   . GLN B 1 19  ? -16.962 8.513   3.068   1.00 0.00 ? 19  GLN B CG   19 
ATOM 5580  C CD   . GLN B 1 19  ? -17.571 9.392   4.163   1.00 0.00 ? 19  GLN B CD   19 
ATOM 5581  O OE1  . GLN B 1 19  ? -17.912 8.910   5.225   1.00 0.00 ? 19  GLN B OE1  19 
ATOM 5582  N NE2  . GLN B 1 19  ? -17.722 10.670  3.948   1.00 0.00 ? 19  GLN B NE2  19 
ATOM 5583  H H    . GLN B 1 19  ? -14.776 7.444   4.592   1.00 0.00 ? 19  GLN B H    19 
ATOM 5584  H HA   . GLN B 1 19  ? -15.917 5.248   3.180   1.00 0.00 ? 19  GLN B HA   19 
ATOM 5585  H HB2  . GLN B 1 19  ? -17.907 6.584   3.013   1.00 0.00 ? 19  GLN B HB2  19 
ATOM 5586  H HB3  . GLN B 1 19  ? -17.158 6.982   4.558   1.00 0.00 ? 19  GLN B HB3  19 
ATOM 5587  H HG2  . GLN B 1 19  ? -15.927 8.783   2.921   1.00 0.00 ? 19  GLN B HG2  19 
ATOM 5588  H HG3  . GLN B 1 19  ? -17.507 8.659   2.148   1.00 0.00 ? 19  GLN B HG3  19 
ATOM 5589  H HE21 . GLN B 1 19  ? -17.447 11.058  3.091   1.00 0.00 ? 19  GLN B HE21 19 
ATOM 5590  H HE22 . GLN B 1 19  ? -18.110 11.241  4.643   1.00 0.00 ? 19  GLN B HE22 19 
ATOM 5591  N N    . LEU B 1 20  ? -15.863 5.739   0.701   1.00 0.00 ? 20  LEU B N    19 
ATOM 5592  C CA   . LEU B 1 20  ? -15.594 5.989   -0.740  1.00 0.00 ? 20  LEU B CA   19 
ATOM 5593  C C    . LEU B 1 20  ? -16.604 5.236   -1.602  1.00 0.00 ? 20  LEU B C    19 
ATOM 5594  O O    . LEU B 1 20  ? -16.242 4.585   -2.559  1.00 0.00 ? 20  LEU B O    19 
ATOM 5595  C CB   . LEU B 1 20  ? -14.186 5.507   -1.085  1.00 0.00 ? 20  LEU B CB   19 
ATOM 5596  C CG   . LEU B 1 20  ? -13.815 5.970   -2.495  1.00 0.00 ? 20  LEU B CG   19 
ATOM 5597  C CD1  . LEU B 1 20  ? -13.678 7.491   -2.512  1.00 0.00 ? 20  LEU B CD1  19 
ATOM 5598  C CD2  . LEU B 1 20  ? -12.487 5.332   -2.905  1.00 0.00 ? 20  LEU B CD2  19 
ATOM 5599  H H    . LEU B 1 20  ? -16.321 4.919   0.983   1.00 0.00 ? 20  LEU B H    19 
ATOM 5600  H HA   . LEU B 1 20  ? -15.666 7.047   -0.939  1.00 0.00 ? 20  LEU B HA   19 
ATOM 5601  H HB2  . LEU B 1 20  ? -13.488 5.917   -0.377  1.00 0.00 ? 20  LEU B HB2  19 
ATOM 5602  H HB3  . LEU B 1 20  ? -14.153 4.429   -1.041  1.00 0.00 ? 20  LEU B HB3  19 
ATOM 5603  H HG   . LEU B 1 20  ? -14.588 5.673   -3.188  1.00 0.00 ? 20  LEU B HG   19 
ATOM 5604  H HD11 . LEU B 1 20  ? -13.358 7.834   -1.539  1.00 0.00 ? 20  LEU B HD11 19 
ATOM 5605  H HD12 . LEU B 1 20  ? -12.946 7.778   -3.253  1.00 0.00 ? 20  LEU B HD12 19 
ATOM 5606  H HD13 . LEU B 1 20  ? -14.632 7.935   -2.755  1.00 0.00 ? 20  LEU B HD13 19 
ATOM 5607  H HD21 . LEU B 1 20  ? -12.398 4.358   -2.446  1.00 0.00 ? 20  LEU B HD21 19 
ATOM 5608  H HD22 . LEU B 1 20  ? -12.456 5.227   -3.979  1.00 0.00 ? 20  LEU B HD22 19 
ATOM 5609  H HD23 . LEU B 1 20  ? -11.671 5.959   -2.580  1.00 0.00 ? 20  LEU B HD23 19 
ATOM 5610  N N    . TYR B 1 21  ? -17.866 5.316   -1.286  1.00 0.00 ? 21  TYR B N    19 
ATOM 5611  C CA   . TYR B 1 21  ? -18.862 4.594   -2.125  1.00 0.00 ? 21  TYR B CA   19 
ATOM 5612  C C    . TYR B 1 21  ? -18.568 4.898   -3.592  1.00 0.00 ? 21  TYR B C    19 
ATOM 5613  O O    . TYR B 1 21  ? -18.201 6.001   -3.943  1.00 0.00 ? 21  TYR B O    19 
ATOM 5614  C CB   . TYR B 1 21  ? -20.282 5.055   -1.795  1.00 0.00 ? 21  TYR B CB   19 
ATOM 5615  C CG   . TYR B 1 21  ? -21.243 4.335   -2.710  1.00 0.00 ? 21  TYR B CG   19 
ATOM 5616  C CD1  . TYR B 1 21  ? -21.332 4.699   -4.061  1.00 0.00 ? 21  TYR B CD1  19 
ATOM 5617  C CD2  . TYR B 1 21  ? -22.038 3.297   -2.213  1.00 0.00 ? 21  TYR B CD2  19 
ATOM 5618  C CE1  . TYR B 1 21  ? -22.215 4.023   -4.913  1.00 0.00 ? 21  TYR B CE1  19 
ATOM 5619  C CE2  . TYR B 1 21  ? -22.921 2.621   -3.064  1.00 0.00 ? 21  TYR B CE2  19 
ATOM 5620  C CZ   . TYR B 1 21  ? -23.010 2.985   -4.414  1.00 0.00 ? 21  TYR B CZ   19 
ATOM 5621  O OH   . TYR B 1 21  ? -23.882 2.319   -5.252  1.00 0.00 ? 21  TYR B OH   19 
ATOM 5622  H H    . TYR B 1 21  ? -18.151 5.846   -0.512  1.00 0.00 ? 21  TYR B H    19 
ATOM 5623  H HA   . TYR B 1 21  ? -18.777 3.531   -1.951  1.00 0.00 ? 21  TYR B HA   19 
ATOM 5624  H HB2  . TYR B 1 21  ? -20.511 4.817   -0.766  1.00 0.00 ? 21  TYR B HB2  19 
ATOM 5625  H HB3  . TYR B 1 21  ? -20.364 6.120   -1.950  1.00 0.00 ? 21  TYR B HB3  19 
ATOM 5626  H HD1  . TYR B 1 21  ? -20.719 5.501   -4.445  1.00 0.00 ? 21  TYR B HD1  19 
ATOM 5627  H HD2  . TYR B 1 21  ? -21.968 3.016   -1.173  1.00 0.00 ? 21  TYR B HD2  19 
ATOM 5628  H HE1  . TYR B 1 21  ? -22.283 4.303   -5.957  1.00 0.00 ? 21  TYR B HE1  19 
ATOM 5629  H HE2  . TYR B 1 21  ? -23.533 1.818   -2.680  1.00 0.00 ? 21  TYR B HE2  19 
ATOM 5630  H HH   . TYR B 1 21  ? -24.535 2.949   -5.563  1.00 0.00 ? 21  TYR B HH   19 
ATOM 5631  N N    . ILE B 1 22  ? -18.716 3.934   -4.453  1.00 0.00 ? 22  ILE B N    19 
ATOM 5632  C CA   . ILE B 1 22  ? -18.431 4.183   -5.891  1.00 0.00 ? 22  ILE B CA   19 
ATOM 5633  C C    . ILE B 1 22  ? -19.566 3.627   -6.751  1.00 0.00 ? 22  ILE B C    19 
ATOM 5634  O O    . ILE B 1 22  ? -19.789 2.434   -6.805  1.00 0.00 ? 22  ILE B O    19 
ATOM 5635  C CB   . ILE B 1 22  ? -17.121 3.496   -6.277  1.00 0.00 ? 22  ILE B CB   19 
ATOM 5636  C CG1  . ILE B 1 22  ? -15.992 4.004   -5.376  1.00 0.00 ? 22  ILE B CG1  19 
ATOM 5637  C CG2  . ILE B 1 22  ? -16.791 3.813   -7.737  1.00 0.00 ? 22  ILE B CG2  19 
ATOM 5638  C CD1  . ILE B 1 22  ? -14.640 3.581   -5.956  1.00 0.00 ? 22  ILE B CD1  19 
ATOM 5639  H H    . ILE B 1 22  ? -19.007 3.048   -4.156  1.00 0.00 ? 22  ILE B H    19 
ATOM 5640  H HA   . ILE B 1 22  ? -18.341 5.246   -6.060  1.00 0.00 ? 22  ILE B HA   19 
ATOM 5641  H HB   . ILE B 1 22  ? -17.227 2.427   -6.158  1.00 0.00 ? 22  ILE B HB   19 
ATOM 5642  H HG12 . ILE B 1 22  ? -16.037 5.081   -5.315  1.00 0.00 ? 22  ILE B HG12 19 
ATOM 5643  H HG13 . ILE B 1 22  ? -16.104 3.582   -4.390  1.00 0.00 ? 22  ILE B HG13 19 
ATOM 5644  H HG21 . ILE B 1 22  ? -17.706 3.868   -8.308  1.00 0.00 ? 22  ILE B HG21 19 
ATOM 5645  H HG22 . ILE B 1 22  ? -16.275 4.760   -7.791  1.00 0.00 ? 22  ILE B HG22 19 
ATOM 5646  H HG23 . ILE B 1 22  ? -16.161 3.035   -8.140  1.00 0.00 ? 22  ILE B HG23 19 
ATOM 5647  H HD11 . ILE B 1 22  ? -14.654 2.522   -6.167  1.00 0.00 ? 22  ILE B HD11 19 
ATOM 5648  H HD12 . ILE B 1 22  ? -14.453 4.126   -6.870  1.00 0.00 ? 22  ILE B HD12 19 
ATOM 5649  H HD13 . ILE B 1 22  ? -13.859 3.797   -5.242  1.00 0.00 ? 22  ILE B HD13 19 
ATOM 5650  N N    . ASP B 1 23  ? -20.273 4.480   -7.439  1.00 0.00 ? 23  ASP B N    19 
ATOM 5651  C CA   . ASP B 1 23  ? -21.374 3.992   -8.309  1.00 0.00 ? 23  ASP B CA   19 
ATOM 5652  C C    . ASP B 1 23  ? -20.775 3.575   -9.649  1.00 0.00 ? 23  ASP B C    19 
ATOM 5653  O O    . ASP B 1 23  ? -20.517 4.394   -10.499 1.00 0.00 ? 23  ASP B O    19 
ATOM 5654  C CB   . ASP B 1 23  ? -22.408 5.101   -8.512  1.00 0.00 ? 23  ASP B CB   19 
ATOM 5655  C CG   . ASP B 1 23  ? -23.374 4.708   -9.633  1.00 0.00 ? 23  ASP B CG   19 
ATOM 5656  O OD1  . ASP B 1 23  ? -23.303 3.575   -10.080 1.00 0.00 ? 23  ASP B OD1  19 
ATOM 5657  O OD2  . ASP B 1 23  ? -24.171 5.545   -10.021 1.00 0.00 ? 23  ASP B OD2  19 
ATOM 5658  H H    . ASP B 1 23  ? -20.069 5.438   -7.395  1.00 0.00 ? 23  ASP B H    19 
ATOM 5659  H HA   . ASP B 1 23  ? -21.847 3.139   -7.852  1.00 0.00 ? 23  ASP B HA   19 
ATOM 5660  H HB2  . ASP B 1 23  ? -22.961 5.246   -7.595  1.00 0.00 ? 23  ASP B HB2  19 
ATOM 5661  H HB3  . ASP B 1 23  ? -21.904 6.013   -8.776  1.00 0.00 ? 23  ASP B HB3  19 
ATOM 5662  N N    . PHE B 1 24  ? -20.540 2.299   -9.803  1.00 0.00 ? 24  PHE B N    19 
ATOM 5663  C CA   . PHE B 1 24  ? -19.934 1.737   -11.055 1.00 0.00 ? 24  PHE B CA   19 
ATOM 5664  C C    . PHE B 1 24  ? -19.872 2.765   -12.192 1.00 0.00 ? 24  PHE B C    19 
ATOM 5665  O O    . PHE B 1 24  ? -18.813 3.062   -12.712 1.00 0.00 ? 24  PHE B O    19 
ATOM 5666  C CB   . PHE B 1 24  ? -20.771 0.542   -11.517 1.00 0.00 ? 24  PHE B CB   19 
ATOM 5667  C CG   . PHE B 1 24  ? -20.247 -0.716  -10.870 1.00 0.00 ? 24  PHE B CG   19 
ATOM 5668  C CD1  . PHE B 1 24  ? -18.997 -1.222  -11.242 1.00 0.00 ? 24  PHE B CD1  19 
ATOM 5669  C CD2  . PHE B 1 24  ? -21.003 -1.371  -9.893  1.00 0.00 ? 24  PHE B CD2  19 
ATOM 5670  C CE1  . PHE B 1 24  ? -18.504 -2.381  -10.637 1.00 0.00 ? 24  PHE B CE1  19 
ATOM 5671  C CE2  . PHE B 1 24  ? -20.510 -2.534  -9.289  1.00 0.00 ? 24  PHE B CE2  19 
ATOM 5672  C CZ   . PHE B 1 24  ? -19.260 -3.037  -9.661  1.00 0.00 ? 24  PHE B CZ   19 
ATOM 5673  H H    . PHE B 1 24  ? -20.757 1.689   -9.067  1.00 0.00 ? 24  PHE B H    19 
ATOM 5674  H HA   . PHE B 1 24  ? -18.934 1.395   -10.837 1.00 0.00 ? 24  PHE B HA   19 
ATOM 5675  H HB2  . PHE B 1 24  ? -21.802 0.692   -11.231 1.00 0.00 ? 24  PHE B HB2  19 
ATOM 5676  H HB3  . PHE B 1 24  ? -20.704 0.449   -12.590 1.00 0.00 ? 24  PHE B HB3  19 
ATOM 5677  H HD1  . PHE B 1 24  ? -18.417 -0.720  -11.999 1.00 0.00 ? 24  PHE B HD1  19 
ATOM 5678  H HD2  . PHE B 1 24  ? -21.969 -0.981  -9.605  1.00 0.00 ? 24  PHE B HD2  19 
ATOM 5679  H HE1  . PHE B 1 24  ? -17.539 -2.769  -10.926 1.00 0.00 ? 24  PHE B HE1  19 
ATOM 5680  H HE2  . PHE B 1 24  ? -21.094 -3.043  -8.540  1.00 0.00 ? 24  PHE B HE2  19 
ATOM 5681  H HZ   . PHE B 1 24  ? -18.878 -3.931  -9.192  1.00 0.00 ? 24  PHE B HZ   19 
ATOM 5682  N N    . ARG B 1 25  ? -20.996 3.285   -12.601 1.00 0.00 ? 25  ARG B N    19 
ATOM 5683  C CA   . ARG B 1 25  ? -20.999 4.257   -13.733 1.00 0.00 ? 25  ARG B CA   19 
ATOM 5684  C C    . ARG B 1 25  ? -20.761 5.697   -13.256 1.00 0.00 ? 25  ARG B C    19 
ATOM 5685  O O    . ARG B 1 25  ? -20.103 6.471   -13.921 1.00 0.00 ? 25  ARG B O    19 
ATOM 5686  C CB   . ARG B 1 25  ? -22.349 4.186   -14.449 1.00 0.00 ? 25  ARG B CB   19 
ATOM 5687  C CG   . ARG B 1 25  ? -22.433 2.890   -15.258 1.00 0.00 ? 25  ARG B CG   19 
ATOM 5688  C CD   . ARG B 1 25  ? -23.438 1.941   -14.603 1.00 0.00 ? 25  ARG B CD   19 
ATOM 5689  N NE   . ARG B 1 25  ? -24.761 2.075   -15.276 1.00 0.00 ? 25  ARG B NE   19 
ATOM 5690  C CZ   . ARG B 1 25  ? -25.861 1.979   -14.581 1.00 0.00 ? 25  ARG B CZ   19 
ATOM 5691  N NH1  . ARG B 1 25  ? -26.277 0.811   -14.174 1.00 0.00 ? 25  ARG B NH1  19 
ATOM 5692  N NH2  . ARG B 1 25  ? -26.544 3.053   -14.291 1.00 0.00 ? 25  ARG B NH2  19 
ATOM 5693  H H    . ARG B 1 25  ? -21.841 3.018   -12.184 1.00 0.00 ? 25  ARG B H    19 
ATOM 5694  H HA   . ARG B 1 25  ? -20.223 3.981   -14.429 1.00 0.00 ? 25  ARG B HA   19 
ATOM 5695  H HB2  . ARG B 1 25  ? -23.144 4.207   -13.717 1.00 0.00 ? 25  ARG B HB2  19 
ATOM 5696  H HB3  . ARG B 1 25  ? -22.449 5.030   -15.114 1.00 0.00 ? 25  ARG B HB3  19 
ATOM 5697  H HG2  . ARG B 1 25  ? -22.753 3.116   -16.265 1.00 0.00 ? 25  ARG B HG2  19 
ATOM 5698  H HG3  . ARG B 1 25  ? -21.462 2.419   -15.285 1.00 0.00 ? 25  ARG B HG3  19 
ATOM 5699  H HD2  . ARG B 1 25  ? -23.087 0.924   -14.696 1.00 0.00 ? 25  ARG B HD2  19 
ATOM 5700  H HD3  . ARG B 1 25  ? -23.540 2.192   -13.557 1.00 0.00 ? 25  ARG B HD3  19 
ATOM 5701  H HE   . ARG B 1 25  ? -24.804 2.234   -16.242 1.00 0.00 ? 25  ARG B HE   19 
ATOM 5702  H HH11 . ARG B 1 25  ? -25.754 -0.011  -14.397 1.00 0.00 ? 25  ARG B HH11 19 
ATOM 5703  H HH12 . ARG B 1 25  ? -27.120 0.738   -13.641 1.00 0.00 ? 25  ARG B HH12 19 
ATOM 5704  H HH21 . ARG B 1 25  ? -26.226 3.947   -14.601 1.00 0.00 ? 25  ARG B HH21 19 
ATOM 5705  H HH22 . ARG B 1 25  ? -27.387 2.979   -13.758 1.00 0.00 ? 25  ARG B HH22 19 
ATOM 5706  N N    . LYS B 1 26  ? -21.309 6.082   -12.137 1.00 0.00 ? 26  LYS B N    19 
ATOM 5707  C CA   . LYS B 1 26  ? -21.123 7.491   -11.677 1.00 0.00 ? 26  LYS B CA   19 
ATOM 5708  C C    . LYS B 1 26  ? -19.644 7.785   -11.421 1.00 0.00 ? 26  LYS B C    19 
ATOM 5709  O O    . LYS B 1 26  ? -19.123 8.806   -11.821 1.00 0.00 ? 26  LYS B O    19 
ATOM 5710  C CB   . LYS B 1 26  ? -21.887 7.705   -10.375 1.00 0.00 ? 26  LYS B CB   19 
ATOM 5711  C CG   . LYS B 1 26  ? -22.390 9.149   -10.308 1.00 0.00 ? 26  LYS B CG   19 
ATOM 5712  C CD   . LYS B 1 26  ? -22.302 9.657   -8.866  1.00 0.00 ? 26  LYS B CD   19 
ATOM 5713  C CE   . LYS B 1 26  ? -23.439 10.649  -8.594  1.00 0.00 ? 26  LYS B CE   19 
ATOM 5714  N NZ   . LYS B 1 26  ? -23.852 11.309  -9.865  1.00 0.00 ? 26  LYS B NZ   19 
ATOM 5715  H H    . LYS B 1 26  ? -21.862 5.460   -11.614 1.00 0.00 ? 26  LYS B H    19 
ATOM 5716  H HA   . LYS B 1 26  ? -21.499 8.169   -12.428 1.00 0.00 ? 26  LYS B HA   19 
ATOM 5717  H HB2  . LYS B 1 26  ? -22.718 7.023   -10.331 1.00 0.00 ? 26  LYS B HB2  19 
ATOM 5718  H HB3  . LYS B 1 26  ? -21.226 7.522   -9.541  1.00 0.00 ? 26  LYS B HB3  19 
ATOM 5719  H HG2  . LYS B 1 26  ? -21.781 9.772   -10.947 1.00 0.00 ? 26  LYS B HG2  19 
ATOM 5720  H HG3  . LYS B 1 26  ? -23.417 9.188   -10.639 1.00 0.00 ? 26  LYS B HG3  19 
ATOM 5721  H HD2  . LYS B 1 26  ? -22.382 8.822   -8.186  1.00 0.00 ? 26  LYS B HD2  19 
ATOM 5722  H HD3  . LYS B 1 26  ? -21.354 10.152  -8.717  1.00 0.00 ? 26  LYS B HD3  19 
ATOM 5723  H HE2  . LYS B 1 26  ? -24.283 10.120  -8.174  1.00 0.00 ? 26  LYS B HE2  19 
ATOM 5724  H HE3  . LYS B 1 26  ? -23.101 11.397  -7.892  1.00 0.00 ? 26  LYS B HE3  19 
ATOM 5725  H HZ1  . LYS B 1 26  ? -23.012 11.484  -10.453 1.00 0.00 ? 26  LYS B HZ1  19 
ATOM 5726  H HZ2  . LYS B 1 26  ? -24.512 10.690  -10.378 1.00 0.00 ? 26  LYS B HZ2  19 
ATOM 5727  H HZ3  . LYS B 1 26  ? -24.319 12.212  -9.652  1.00 0.00 ? 26  LYS B HZ3  19 
ATOM 5728  N N    . ASP B 1 27  ? -18.976 6.916   -10.719 1.00 0.00 ? 27  ASP B N    19 
ATOM 5729  C CA   . ASP B 1 27  ? -17.548 7.157   -10.389 1.00 0.00 ? 27  ASP B CA   19 
ATOM 5730  C C    . ASP B 1 27  ? -16.615 6.602   -11.472 1.00 0.00 ? 27  ASP B C    19 
ATOM 5731  O O    . ASP B 1 27  ? -15.869 7.338   -12.088 1.00 0.00 ? 27  ASP B O    19 
ATOM 5732  C CB   . ASP B 1 27  ? -17.249 6.471   -9.062  1.00 0.00 ? 27  ASP B CB   19 
ATOM 5733  C CG   . ASP B 1 27  ? -17.499 7.451   -7.914  1.00 0.00 ? 27  ASP B CG   19 
ATOM 5734  O OD1  . ASP B 1 27  ? -16.879 8.502   -7.915  1.00 0.00 ? 27  ASP B OD1  19 
ATOM 5735  O OD2  . ASP B 1 27  ? -18.304 7.134   -7.055  1.00 0.00 ? 27  ASP B OD2  19 
ATOM 5736  H H    . ASP B 1 27  ? -19.424 6.119   -10.377 1.00 0.00 ? 27  ASP B H    19 
ATOM 5737  H HA   . ASP B 1 27  ? -17.381 8.217   -10.283 1.00 0.00 ? 27  ASP B HA   19 
ATOM 5738  H HB2  . ASP B 1 27  ? -17.896 5.613   -8.949  1.00 0.00 ? 27  ASP B HB2  19 
ATOM 5739  H HB3  . ASP B 1 27  ? -16.226 6.151   -9.048  1.00 0.00 ? 27  ASP B HB3  19 
ATOM 5740  N N    . LEU B 1 28  ? -16.618 5.316   -11.696 1.00 0.00 ? 28  LEU B N    19 
ATOM 5741  C CA   . LEU B 1 28  ? -15.693 4.746   -12.723 1.00 0.00 ? 28  LEU B CA   19 
ATOM 5742  C C    . LEU B 1 28  ? -16.349 4.749   -14.104 1.00 0.00 ? 28  LEU B C    19 
ATOM 5743  O O    . LEU B 1 28  ? -15.691 4.546   -15.105 1.00 0.00 ? 28  LEU B O    19 
ATOM 5744  C CB   . LEU B 1 28  ? -15.337 3.306   -12.353 1.00 0.00 ? 28  LEU B CB   19 
ATOM 5745  C CG   . LEU B 1 28  ? -14.815 3.251   -10.921 1.00 0.00 ? 28  LEU B CG   19 
ATOM 5746  C CD1  . LEU B 1 28  ? -14.454 1.806   -10.572 1.00 0.00 ? 28  LEU B CD1  19 
ATOM 5747  C CD2  . LEU B 1 28  ? -13.568 4.128   -10.801 1.00 0.00 ? 28  LEU B CD2  19 
ATOM 5748  H H    . LEU B 1 28  ? -17.207 4.725   -11.177 1.00 0.00 ? 28  LEU B H    19 
ATOM 5749  H HA   . LEU B 1 28  ? -14.789 5.337   -12.757 1.00 0.00 ? 28  LEU B HA   19 
ATOM 5750  H HB2  . LEU B 1 28  ? -16.216 2.685   -12.440 1.00 0.00 ? 28  LEU B HB2  19 
ATOM 5751  H HB3  . LEU B 1 28  ? -14.573 2.944   -13.024 1.00 0.00 ? 28  LEU B HB3  19 
ATOM 5752  H HG   . LEU B 1 28  ? -15.577 3.607   -10.244 1.00 0.00 ? 28  LEU B HG   19 
ATOM 5753  H HD11 . LEU B 1 28  ? -14.838 1.146   -11.337 1.00 0.00 ? 28  LEU B HD11 19 
ATOM 5754  H HD12 . LEU B 1 28  ? -13.381 1.706   -10.518 1.00 0.00 ? 28  LEU B HD12 19 
ATOM 5755  H HD13 . LEU B 1 28  ? -14.890 1.546   -9.620  1.00 0.00 ? 28  LEU B HD13 19 
ATOM 5756  H HD21 . LEU B 1 28  ? -13.263 4.457   -11.784 1.00 0.00 ? 28  LEU B HD21 19 
ATOM 5757  H HD22 . LEU B 1 28  ? -13.791 4.987   -10.187 1.00 0.00 ? 28  LEU B HD22 19 
ATOM 5758  H HD23 . LEU B 1 28  ? -12.769 3.559   -10.348 1.00 0.00 ? 28  LEU B HD23 19 
ATOM 5759  N N    . GLY B 1 29  ? -17.629 4.961   -14.177 1.00 0.00 ? 29  GLY B N    19 
ATOM 5760  C CA   . GLY B 1 29  ? -18.290 4.955   -15.513 1.00 0.00 ? 29  GLY B CA   19 
ATOM 5761  C C    . GLY B 1 29  ? -18.164 3.556   -16.121 1.00 0.00 ? 29  GLY B C    19 
ATOM 5762  O O    . GLY B 1 29  ? -18.409 3.351   -17.293 1.00 0.00 ? 29  GLY B O    19 
ATOM 5763  H H    . GLY B 1 29  ? -18.155 5.115   -13.365 1.00 0.00 ? 29  GLY B H    19 
ATOM 5764  H HA2  . GLY B 1 29  ? -19.332 5.217   -15.407 1.00 0.00 ? 29  GLY B HA2  19 
ATOM 5765  H HA3  . GLY B 1 29  ? -17.803 5.668   -16.159 1.00 0.00 ? 29  GLY B HA3  19 
ATOM 5766  N N    . TRP B 1 30  ? -17.773 2.590   -15.329 1.00 0.00 ? 30  TRP B N    19 
ATOM 5767  C CA   . TRP B 1 30  ? -17.620 1.204   -15.855 1.00 0.00 ? 30  TRP B CA   19 
ATOM 5768  C C    . TRP B 1 30  ? -18.841 0.833   -16.692 1.00 0.00 ? 30  TRP B C    19 
ATOM 5769  O O    . TRP B 1 30  ? -19.965 0.893   -16.235 1.00 0.00 ? 30  TRP B O    19 
ATOM 5770  C CB   . TRP B 1 30  ? -17.481 0.224   -14.688 1.00 0.00 ? 30  TRP B CB   19 
ATOM 5771  C CG   . TRP B 1 30  ? -16.070 0.236   -14.197 1.00 0.00 ? 30  TRP B CG   19 
ATOM 5772  C CD1  . TRP B 1 30  ? -15.174 1.215   -14.449 1.00 0.00 ? 30  TRP B CD1  19 
ATOM 5773  C CD2  . TRP B 1 30  ? -15.376 -0.754  -13.384 1.00 0.00 ? 30  TRP B CD2  19 
ATOM 5774  N NE1  . TRP B 1 30  ? -13.976 0.894   -13.837 1.00 0.00 ? 30  TRP B NE1  19 
ATOM 5775  C CE2  . TRP B 1 30  ? -14.050 -0.312  -13.170 1.00 0.00 ? 30  TRP B CE2  19 
ATOM 5776  C CE3  . TRP B 1 30  ? -15.765 -1.978  -12.816 1.00 0.00 ? 30  TRP B CE3  19 
ATOM 5777  C CZ2  . TRP B 1 30  ? -13.141 -1.059  -12.419 1.00 0.00 ? 30  TRP B CZ2  19 
ATOM 5778  C CZ3  . TRP B 1 30  ? -14.854 -2.735  -12.061 1.00 0.00 ? 30  TRP B CZ3  19 
ATOM 5779  C CH2  . TRP B 1 30  ? -13.545 -2.275  -11.861 1.00 0.00 ? 30  TRP B CH2  19 
ATOM 5780  H H    . TRP B 1 30  ? -17.575 2.778   -14.389 1.00 0.00 ? 30  TRP B H    19 
ATOM 5781  H HA   . TRP B 1 30  ? -16.734 1.152   -16.472 1.00 0.00 ? 30  TRP B HA   19 
ATOM 5782  H HB2  . TRP B 1 30  ? -18.144 0.518   -13.889 1.00 0.00 ? 30  TRP B HB2  19 
ATOM 5783  H HB3  . TRP B 1 30  ? -17.738 -0.771  -15.021 1.00 0.00 ? 30  TRP B HB3  19 
ATOM 5784  H HD1  . TRP B 1 30  ? -15.363 2.107   -15.030 1.00 0.00 ? 30  TRP B HD1  19 
ATOM 5785  H HE1  . TRP B 1 30  ? -13.164 1.441   -13.863 1.00 0.00 ? 30  TRP B HE1  19 
ATOM 5786  H HE3  . TRP B 1 30  ? -16.769 -2.341  -12.966 1.00 0.00 ? 30  TRP B HE3  19 
ATOM 5787  H HZ2  . TRP B 1 30  ? -12.134 -0.700  -12.269 1.00 0.00 ? 30  TRP B HZ2  19 
ATOM 5788  H HZ3  . TRP B 1 30  ? -15.163 -3.675  -11.630 1.00 0.00 ? 30  TRP B HZ3  19 
ATOM 5789  H HH2  . TRP B 1 30  ? -12.849 -2.862  -11.281 1.00 0.00 ? 30  TRP B HH2  19 
ATOM 5790  N N    . LYS B 1 31  ? -18.628 0.456   -17.921 1.00 0.00 ? 31  LYS B N    19 
ATOM 5791  C CA   . LYS B 1 31  ? -19.758 0.087   -18.801 1.00 0.00 ? 31  LYS B CA   19 
ATOM 5792  C C    . LYS B 1 31  ? -19.805 -1.432  -18.971 1.00 0.00 ? 31  LYS B C    19 
ATOM 5793  O O    . LYS B 1 31  ? -20.761 -1.978  -19.483 1.00 0.00 ? 31  LYS B O    19 
ATOM 5794  C CB   . LYS B 1 31  ? -19.537 0.740   -20.157 1.00 0.00 ? 31  LYS B CB   19 
ATOM 5795  C CG   . LYS B 1 31  ? -20.207 2.115   -20.185 1.00 0.00 ? 31  LYS B CG   19 
ATOM 5796  C CD   . LYS B 1 31  ? -19.219 3.157   -20.713 1.00 0.00 ? 31  LYS B CD   19 
ATOM 5797  C CE   . LYS B 1 31  ? -19.326 3.236   -22.237 1.00 0.00 ? 31  LYS B CE   19 
ATOM 5798  N NZ   . LYS B 1 31  ? -20.641 3.830   -22.613 1.00 0.00 ? 31  LYS B NZ   19 
ATOM 5799  H H    . LYS B 1 31  ? -17.717 0.423   -18.274 1.00 0.00 ? 31  LYS B H    19 
ATOM 5800  H HA   . LYS B 1 31  ? -20.686 0.438   -18.375 1.00 0.00 ? 31  LYS B HA   19 
ATOM 5801  H HB2  . LYS B 1 31  ? -18.475 0.851   -20.326 1.00 0.00 ? 31  LYS B HB2  19 
ATOM 5802  H HB3  . LYS B 1 31  ? -19.954 0.117   -20.924 1.00 0.00 ? 31  LYS B HB3  19 
ATOM 5803  H HG2  . LYS B 1 31  ? -21.074 2.079   -20.830 1.00 0.00 ? 31  LYS B HG2  19 
ATOM 5804  H HG3  . LYS B 1 31  ? -20.513 2.385   -19.186 1.00 0.00 ? 31  LYS B HG3  19 
ATOM 5805  H HD2  . LYS B 1 31  ? -19.451 4.121   -20.284 1.00 0.00 ? 31  LYS B HD2  19 
ATOM 5806  H HD3  . LYS B 1 31  ? -18.215 2.872   -20.438 1.00 0.00 ? 31  LYS B HD3  19 
ATOM 5807  H HE2  . LYS B 1 31  ? -18.529 3.854   -22.622 1.00 0.00 ? 31  LYS B HE2  19 
ATOM 5808  H HE3  . LYS B 1 31  ? -19.247 2.244   -22.656 1.00 0.00 ? 31  LYS B HE3  19 
ATOM 5809  H HZ1  . LYS B 1 31  ? -21.343 3.612   -21.878 1.00 0.00 ? 31  LYS B HZ1  19 
ATOM 5810  H HZ2  . LYS B 1 31  ? -20.541 4.861   -22.702 1.00 0.00 ? 31  LYS B HZ2  19 
ATOM 5811  H HZ3  . LYS B 1 31  ? -20.956 3.430   -23.518 1.00 0.00 ? 31  LYS B HZ3  19 
ATOM 5812  N N    . TRP B 1 32  ? -18.777 -2.120  -18.553 1.00 0.00 ? 32  TRP B N    19 
ATOM 5813  C CA   . TRP B 1 32  ? -18.774 -3.602  -18.707 1.00 0.00 ? 32  TRP B CA   19 
ATOM 5814  C C    . TRP B 1 32  ? -19.495 -4.244  -17.533 1.00 0.00 ? 32  TRP B C    19 
ATOM 5815  O O    . TRP B 1 32  ? -19.437 -5.439  -17.337 1.00 0.00 ? 32  TRP B O    19 
ATOM 5816  C CB   . TRP B 1 32  ? -17.338 -4.115  -18.758 1.00 0.00 ? 32  TRP B CB   19 
ATOM 5817  C CG   . TRP B 1 32  ? -16.720 -4.104  -17.390 1.00 0.00 ? 32  TRP B CG   19 
ATOM 5818  C CD1  . TRP B 1 32  ? -16.221 -3.011  -16.775 1.00 0.00 ? 32  TRP B CD1  19 
ATOM 5819  C CD2  . TRP B 1 32  ? -16.522 -5.213  -16.463 1.00 0.00 ? 32  TRP B CD2  19 
ATOM 5820  N NE1  . TRP B 1 32  ? -15.694 -3.378  -15.557 1.00 0.00 ? 32  TRP B NE1  19 
ATOM 5821  C CE2  . TRP B 1 32  ? -15.858 -4.725  -15.314 1.00 0.00 ? 32  TRP B CE2  19 
ATOM 5822  C CE3  . TRP B 1 32  ? -16.839 -6.580  -16.509 1.00 0.00 ? 32  TRP B CE3  19 
ATOM 5823  C CZ2  . TRP B 1 32  ? -15.515 -5.563  -14.254 1.00 0.00 ? 32  TRP B CZ2  19 
ATOM 5824  C CZ3  . TRP B 1 32  ? -16.501 -7.429  -15.442 1.00 0.00 ? 32  TRP B CZ3  19 
ATOM 5825  C CH2  . TRP B 1 32  ? -15.837 -6.919  -14.317 1.00 0.00 ? 32  TRP B CH2  19 
ATOM 5826  H H    . TRP B 1 32  ? -18.009 -1.664  -18.145 1.00 0.00 ? 32  TRP B H    19 
ATOM 5827  H HA   . TRP B 1 32  ? -19.279 -3.866  -19.622 1.00 0.00 ? 32  TRP B HA   19 
ATOM 5828  H HB2  . TRP B 1 32  ? -17.333 -5.124  -19.142 1.00 0.00 ? 32  TRP B HB2  19 
ATOM 5829  H HB3  . TRP B 1 32  ? -16.762 -3.481  -19.412 1.00 0.00 ? 32  TRP B HB3  19 
ATOM 5830  H HD1  . TRP B 1 32  ? -16.222 -2.016  -17.173 1.00 0.00 ? 32  TRP B HD1  19 
ATOM 5831  H HE1  . TRP B 1 32  ? -15.258 -2.771  -14.929 1.00 0.00 ? 32  TRP B HE1  19 
ATOM 5832  H HE3  . TRP B 1 32  ? -17.360 -6.975  -17.361 1.00 0.00 ? 32  TRP B HE3  19 
ATOM 5833  H HZ2  . TRP B 1 32  ? -15.003 -5.165  -13.390 1.00 0.00 ? 32  TRP B HZ2  19 
ATOM 5834  H HZ3  . TRP B 1 32  ? -16.752 -8.479  -15.491 1.00 0.00 ? 32  TRP B HZ3  19 
ATOM 5835  H HH2  . TRP B 1 32  ? -15.580 -7.573  -13.497 1.00 0.00 ? 32  TRP B HH2  19 
ATOM 5836  N N    . ILE B 1 33  ? -20.163 -3.461  -16.743 1.00 0.00 ? 33  ILE B N    19 
ATOM 5837  C CA   . ILE B 1 33  ? -20.875 -4.036  -15.577 1.00 0.00 ? 33  ILE B CA   19 
ATOM 5838  C C    . ILE B 1 33  ? -22.276 -3.430  -15.476 1.00 0.00 ? 33  ILE B C    19 
ATOM 5839  O O    . ILE B 1 33  ? -22.450 -2.228  -15.496 1.00 0.00 ? 33  ILE B O    19 
ATOM 5840  C CB   . ILE B 1 33  ? -20.079 -3.728  -14.313 1.00 0.00 ? 33  ILE B CB   19 
ATOM 5841  C CG1  . ILE B 1 33  ? -18.849 -4.633  -14.270 1.00 0.00 ? 33  ILE B CG1  19 
ATOM 5842  C CG2  . ILE B 1 33  ? -20.946 -3.977  -13.076 1.00 0.00 ? 33  ILE B CG2  19 
ATOM 5843  C CD1  . ILE B 1 33  ? -18.206 -4.536  -12.893 1.00 0.00 ? 33  ILE B CD1  19 
ATOM 5844  H H    . ILE B 1 33  ? -20.189 -2.497  -16.913 1.00 0.00 ? 33  ILE B H    19 
ATOM 5845  H HA   . ILE B 1 33  ? -20.951 -5.108  -15.700 1.00 0.00 ? 33  ILE B HA   19 
ATOM 5846  H HB   . ILE B 1 33  ? -19.766 -2.695  -14.330 1.00 0.00 ? 33  ILE B HB   19 
ATOM 5847  H HG12 . ILE B 1 33  ? -19.144 -5.652  -14.460 1.00 0.00 ? 33  ILE B HG12 19 
ATOM 5848  H HG13 . ILE B 1 33  ? -18.141 -4.315  -15.020 1.00 0.00 ? 33  ILE B HG13 19 
ATOM 5849  H HG21 . ILE B 1 33  ? -21.824 -3.351  -13.119 1.00 0.00 ? 33  ILE B HG21 19 
ATOM 5850  H HG22 . ILE B 1 33  ? -21.243 -5.015  -13.048 1.00 0.00 ? 33  ILE B HG22 19 
ATOM 5851  H HG23 . ILE B 1 33  ? -20.378 -3.741  -12.187 1.00 0.00 ? 33  ILE B HG23 19 
ATOM 5852  H HD11 . ILE B 1 33  ? -18.094 -3.499  -12.628 1.00 0.00 ? 33  ILE B HD11 19 
ATOM 5853  H HD12 . ILE B 1 33  ? -18.835 -5.028  -12.170 1.00 0.00 ? 33  ILE B HD12 19 
ATOM 5854  H HD13 . ILE B 1 33  ? -17.241 -5.009  -12.911 1.00 0.00 ? 33  ILE B HD13 19 
ATOM 5855  N N    . HIS B 1 34  ? -23.276 -4.259  -15.367 1.00 0.00 ? 34  HIS B N    19 
ATOM 5856  C CA   . HIS B 1 34  ? -24.670 -3.743  -15.263 1.00 0.00 ? 34  HIS B CA   19 
ATOM 5857  C C    . HIS B 1 34  ? -25.059 -3.637  -13.786 1.00 0.00 ? 34  HIS B C    19 
ATOM 5858  O O    . HIS B 1 34  ? -25.470 -2.595  -13.316 1.00 0.00 ? 34  HIS B O    19 
ATOM 5859  C CB   . HIS B 1 34  ? -25.619 -4.709  -15.984 1.00 0.00 ? 34  HIS B CB   19 
ATOM 5860  C CG   . HIS B 1 34  ? -27.039 -4.440  -15.566 1.00 0.00 ? 34  HIS B CG   19 
ATOM 5861  N ND1  . HIS B 1 34  ? -27.599 -3.173  -15.618 1.00 0.00 ? 34  HIS B ND1  19 
ATOM 5862  C CD2  . HIS B 1 34  ? -28.025 -5.265  -15.087 1.00 0.00 ? 34  HIS B CD2  19 
ATOM 5863  C CE1  . HIS B 1 34  ? -28.867 -3.271  -15.180 1.00 0.00 ? 34  HIS B CE1  19 
ATOM 5864  N NE2  . HIS B 1 34  ? -29.179 -4.526  -14.843 1.00 0.00 ? 34  HIS B NE2  19 
ATOM 5865  H H    . HIS B 1 34  ? -23.108 -5.222  -15.355 1.00 0.00 ? 34  HIS B H    19 
ATOM 5866  H HA   . HIS B 1 34  ? -24.729 -2.768  -15.724 1.00 0.00 ? 34  HIS B HA   19 
ATOM 5867  H HB2  . HIS B 1 34  ? -25.527 -4.572  -17.051 1.00 0.00 ? 34  HIS B HB2  19 
ATOM 5868  H HB3  . HIS B 1 34  ? -25.356 -5.725  -15.728 1.00 0.00 ? 34  HIS B HB3  19 
ATOM 5869  H HD1  . HIS B 1 34  ? -27.152 -2.353  -15.919 1.00 0.00 ? 34  HIS B HD1  19 
ATOM 5870  H HD2  . HIS B 1 34  ? -27.921 -6.328  -14.923 1.00 0.00 ? 34  HIS B HD2  19 
ATOM 5871  H HE1  . HIS B 1 34  ? -29.550 -2.437  -15.109 1.00 0.00 ? 34  HIS B HE1  19 
ATOM 5872  N N    . GLU B 1 35  ? -24.928 -4.707  -13.049 1.00 0.00 ? 35  GLU B N    19 
ATOM 5873  C CA   . GLU B 1 35  ? -25.288 -4.665  -11.603 1.00 0.00 ? 35  GLU B CA   19 
ATOM 5874  C C    . GLU B 1 35  ? -24.132 -5.234  -10.776 1.00 0.00 ? 35  GLU B C    19 
ATOM 5875  O O    . GLU B 1 35  ? -23.367 -6.045  -11.259 1.00 0.00 ? 35  GLU B O    19 
ATOM 5876  C CB   . GLU B 1 35  ? -26.548 -5.498  -11.364 1.00 0.00 ? 35  GLU B CB   19 
ATOM 5877  C CG   . GLU B 1 35  ? -27.783 -4.608  -11.514 1.00 0.00 ? 35  GLU B CG   19 
ATOM 5878  C CD   . GLU B 1 35  ? -28.941 -5.203  -10.711 1.00 0.00 ? 35  GLU B CD   19 
ATOM 5879  O OE1  . GLU B 1 35  ? -29.060 -4.871  -9.544  1.00 0.00 ? 35  GLU B OE1  19 
ATOM 5880  O OE2  . GLU B 1 35  ? -29.691 -5.982  -11.278 1.00 0.00 ? 35  GLU B OE2  19 
ATOM 5881  H H    . GLU B 1 35  ? -24.591 -5.537  -13.447 1.00 0.00 ? 35  GLU B H    19 
ATOM 5882  H HA   . GLU B 1 35  ? -25.470 -3.642  -11.308 1.00 0.00 ? 35  GLU B HA   19 
ATOM 5883  H HB2  . GLU B 1 35  ? -26.591 -6.301  -12.086 1.00 0.00 ? 35  GLU B HB2  19 
ATOM 5884  H HB3  . GLU B 1 35  ? -26.523 -5.911  -10.367 1.00 0.00 ? 35  GLU B HB3  19 
ATOM 5885  H HG2  . GLU B 1 35  ? -27.560 -3.618  -11.144 1.00 0.00 ? 35  GLU B HG2  19 
ATOM 5886  H HG3  . GLU B 1 35  ? -28.061 -4.551  -12.555 1.00 0.00 ? 35  GLU B HG3  19 
ATOM 5887  N N    . PRO B 1 36  ? -24.039 -4.787  -9.550  1.00 0.00 ? 36  PRO B N    19 
ATOM 5888  C CA   . PRO B 1 36  ? -24.976 -3.802  -8.976  1.00 0.00 ? 36  PRO B CA   19 
ATOM 5889  C C    . PRO B 1 36  ? -24.664 -2.396  -9.495  1.00 0.00 ? 36  PRO B C    19 
ATOM 5890  O O    . PRO B 1 36  ? -23.634 -2.160  -10.094 1.00 0.00 ? 36  PRO B O    19 
ATOM 5891  C CB   . PRO B 1 36  ? -24.720 -3.898  -7.469  1.00 0.00 ? 36  PRO B CB   19 
ATOM 5892  C CG   . PRO B 1 36  ? -23.300 -4.492  -7.307  1.00 0.00 ? 36  PRO B CG   19 
ATOM 5893  C CD   . PRO B 1 36  ? -22.977 -5.224  -8.622  1.00 0.00 ? 36  PRO B CD   19 
ATOM 5894  H HA   . PRO B 1 36  ? -25.995 -4.070  -9.194  1.00 0.00 ? 36  PRO B HA   19 
ATOM 5895  H HB2  . PRO B 1 36  ? -24.770 -2.915  -7.021  1.00 0.00 ? 36  PRO B HB2  19 
ATOM 5896  H HB3  . PRO B 1 36  ? -25.442 -4.554  -7.011  1.00 0.00 ? 36  PRO B HB3  19 
ATOM 5897  H HG2  . PRO B 1 36  ? -22.586 -3.697  -7.134  1.00 0.00 ? 36  PRO B HG2  19 
ATOM 5898  H HG3  . PRO B 1 36  ? -23.282 -5.192  -6.486  1.00 0.00 ? 36  PRO B HG3  19 
ATOM 5899  H HD2  . PRO B 1 36  ? -22.004 -4.927  -8.989  1.00 0.00 ? 36  PRO B HD2  19 
ATOM 5900  H HD3  . PRO B 1 36  ? -23.022 -6.292  -8.483  1.00 0.00 ? 36  PRO B HD3  19 
ATOM 5901  N N    . LYS B 1 37  ? -25.546 -1.463  -9.266  1.00 0.00 ? 37  LYS B N    19 
ATOM 5902  C CA   . LYS B 1 37  ? -25.310 -0.078  -9.734  1.00 0.00 ? 37  LYS B CA   19 
ATOM 5903  C C    . LYS B 1 37  ? -24.005 0.445   -9.133  1.00 0.00 ? 37  LYS B C    19 
ATOM 5904  O O    . LYS B 1 37  ? -23.253 1.153   -9.773  1.00 0.00 ? 37  LYS B O    19 
ATOM 5905  C CB   . LYS B 1 37  ? -26.472 0.790   -9.267  1.00 0.00 ? 37  LYS B CB   19 
ATOM 5906  C CG   . LYS B 1 37  ? -27.563 0.810   -10.339 1.00 0.00 ? 37  LYS B CG   19 
ATOM 5907  C CD   . LYS B 1 37  ? -28.404 2.081   -10.190 1.00 0.00 ? 37  LYS B CD   19 
ATOM 5908  C CE   . LYS B 1 37  ? -29.888 1.712   -10.177 1.00 0.00 ? 37  LYS B CE   19 
ATOM 5909  N NZ   . LYS B 1 37  ? -30.625 2.652   -9.285  1.00 0.00 ? 37  LYS B NZ   19 
ATOM 5910  H H    . LYS B 1 37  ? -26.367 -1.670  -8.779  1.00 0.00 ? 37  LYS B H    19 
ATOM 5911  H HA   . LYS B 1 37  ? -25.250 -0.060  -10.811 1.00 0.00 ? 37  LYS B HA   19 
ATOM 5912  H HB2  . LYS B 1 37  ? -26.875 0.384   -8.350  1.00 0.00 ? 37  LYS B HB2  19 
ATOM 5913  H HB3  . LYS B 1 37  ? -26.122 1.786   -9.091  1.00 0.00 ? 37  LYS B HB3  19 
ATOM 5914  H HG2  . LYS B 1 37  ? -27.107 0.792   -11.318 1.00 0.00 ? 37  LYS B HG2  19 
ATOM 5915  H HG3  . LYS B 1 37  ? -28.199 -0.055  -10.221 1.00 0.00 ? 37  LYS B HG3  19 
ATOM 5916  H HD2  . LYS B 1 37  ? -28.145 2.576   -9.265  1.00 0.00 ? 37  LYS B HD2  19 
ATOM 5917  H HD3  . LYS B 1 37  ? -28.206 2.742   -11.021 1.00 0.00 ? 37  LYS B HD3  19 
ATOM 5918  H HE2  . LYS B 1 37  ? -30.285 1.781   -11.179 1.00 0.00 ? 37  LYS B HE2  19 
ATOM 5919  H HE3  . LYS B 1 37  ? -30.005 0.703   -9.811  1.00 0.00 ? 37  LYS B HE3  19 
ATOM 5920  H HZ1  . LYS B 1 37  ? -29.949 3.303   -8.834  1.00 0.00 ? 37  LYS B HZ1  19 
ATOM 5921  H HZ2  . LYS B 1 37  ? -31.312 3.195   -9.844  1.00 0.00 ? 37  LYS B HZ2  19 
ATOM 5922  H HZ3  . LYS B 1 37  ? -31.128 2.112   -8.553  1.00 0.00 ? 37  LYS B HZ3  19 
ATOM 5923  N N    . GLY B 1 38  ? -23.736 0.100   -7.906  1.00 0.00 ? 38  GLY B N    19 
ATOM 5924  C CA   . GLY B 1 38  ? -22.481 0.571   -7.256  1.00 0.00 ? 38  GLY B CA   19 
ATOM 5925  C C    . GLY B 1 38  ? -22.183 -0.298  -6.034  1.00 0.00 ? 38  GLY B C    19 
ATOM 5926  O O    . GLY B 1 38  ? -22.756 -1.354  -5.859  1.00 0.00 ? 38  GLY B O    19 
ATOM 5927  H H    . GLY B 1 38  ? -24.360 -0.474  -7.412  1.00 0.00 ? 38  GLY B H    19 
ATOM 5928  H HA2  . GLY B 1 38  ? -21.663 0.500   -7.959  1.00 0.00 ? 38  GLY B HA2  19 
ATOM 5929  H HA3  . GLY B 1 38  ? -22.600 1.597   -6.942  1.00 0.00 ? 38  GLY B HA3  19 
ATOM 5930  N N    . TYR B 1 39  ? -21.290 0.134   -5.187  1.00 0.00 ? 39  TYR B N    19 
ATOM 5931  C CA   . TYR B 1 39  ? -20.961 -0.675  -3.981  1.00 0.00 ? 39  TYR B CA   19 
ATOM 5932  C C    . TYR B 1 39  ? -20.078 0.143   -3.035  1.00 0.00 ? 39  TYR B C    19 
ATOM 5933  O O    . TYR B 1 39  ? -19.556 1.177   -3.399  1.00 0.00 ? 39  TYR B O    19 
ATOM 5934  C CB   . TYR B 1 39  ? -20.227 -1.951  -4.412  1.00 0.00 ? 39  TYR B CB   19 
ATOM 5935  C CG   . TYR B 1 39  ? -18.788 -1.633  -4.750  1.00 0.00 ? 39  TYR B CG   19 
ATOM 5936  C CD1  . TYR B 1 39  ? -18.478 -0.882  -5.893  1.00 0.00 ? 39  TYR B CD1  19 
ATOM 5937  C CD2  . TYR B 1 39  ? -17.760 -2.094  -3.920  1.00 0.00 ? 39  TYR B CD2  19 
ATOM 5938  C CE1  . TYR B 1 39  ? -17.144 -0.594  -6.201  1.00 0.00 ? 39  TYR B CE1  19 
ATOM 5939  C CE2  . TYR B 1 39  ? -16.427 -1.806  -4.229  1.00 0.00 ? 39  TYR B CE2  19 
ATOM 5940  C CZ   . TYR B 1 39  ? -16.117 -1.056  -5.369  1.00 0.00 ? 39  TYR B CZ   19 
ATOM 5941  O OH   . TYR B 1 39  ? -14.802 -0.772  -5.673  1.00 0.00 ? 39  TYR B OH   19 
ATOM 5942  H H    . TYR B 1 39  ? -20.836 0.989   -5.344  1.00 0.00 ? 39  TYR B H    19 
ATOM 5943  H HA   . TYR B 1 39  ? -21.876 -0.943  -3.472  1.00 0.00 ? 39  TYR B HA   19 
ATOM 5944  H HB2  . TYR B 1 39  ? -20.255 -2.670  -3.606  1.00 0.00 ? 39  TYR B HB2  19 
ATOM 5945  H HB3  . TYR B 1 39  ? -20.715 -2.369  -5.281  1.00 0.00 ? 39  TYR B HB3  19 
ATOM 5946  H HD1  . TYR B 1 39  ? -19.267 -0.524  -6.535  1.00 0.00 ? 39  TYR B HD1  19 
ATOM 5947  H HD2  . TYR B 1 39  ? -17.998 -2.673  -3.040  1.00 0.00 ? 39  TYR B HD2  19 
ATOM 5948  H HE1  . TYR B 1 39  ? -16.905 -0.015  -7.081  1.00 0.00 ? 39  TYR B HE1  19 
ATOM 5949  H HE2  . TYR B 1 39  ? -15.635 -2.163  -3.587  1.00 0.00 ? 39  TYR B HE2  19 
ATOM 5950  H HH   . TYR B 1 39  ? -14.354 -1.602  -5.853  1.00 0.00 ? 39  TYR B HH   19 
ATOM 5951  N N    . HIS B 1 40  ? -19.904 -0.313  -1.825  1.00 0.00 ? 40  HIS B N    19 
ATOM 5952  C CA   . HIS B 1 40  ? -19.053 0.439   -0.861  1.00 0.00 ? 40  HIS B CA   19 
ATOM 5953  C C    . HIS B 1 40  ? -17.586 0.068   -1.084  1.00 0.00 ? 40  HIS B C    19 
ATOM 5954  O O    . HIS B 1 40  ? -17.035 -0.769  -0.397  1.00 0.00 ? 40  HIS B O    19 
ATOM 5955  C CB   . HIS B 1 40  ? -19.462 0.077   0.569   1.00 0.00 ? 40  HIS B CB   19 
ATOM 5956  C CG   . HIS B 1 40  ? -20.872 0.537   0.820   1.00 0.00 ? 40  HIS B CG   19 
ATOM 5957  N ND1  . HIS B 1 40  ? -21.973 -0.151  0.332   1.00 0.00 ? 40  HIS B ND1  19 
ATOM 5958  C CD2  . HIS B 1 40  ? -21.379 1.613   1.506   1.00 0.00 ? 40  HIS B CD2  19 
ATOM 5959  C CE1  . HIS B 1 40  ? -23.074 0.513   0.727   1.00 0.00 ? 40  HIS B CE1  19 
ATOM 5960  N NE2  . HIS B 1 40  ? -22.768 1.596   1.446   1.00 0.00 ? 40  HIS B NE2  19 
ATOM 5961  H H    . HIS B 1 40  ? -20.332 -1.151  -1.551  1.00 0.00 ? 40  HIS B H    19 
ATOM 5962  H HA   . HIS B 1 40  ? -19.185 1.500   -1.015  1.00 0.00 ? 40  HIS B HA   19 
ATOM 5963  H HB2  . HIS B 1 40  ? -19.403 -0.993  0.700   1.00 0.00 ? 40  HIS B HB2  19 
ATOM 5964  H HB3  . HIS B 1 40  ? -18.796 0.563   1.267   1.00 0.00 ? 40  HIS B HB3  19 
ATOM 5965  H HD1  . HIS B 1 40  ? -21.952 -0.971  -0.204  1.00 0.00 ? 40  HIS B HD1  19 
ATOM 5966  H HD2  . HIS B 1 40  ? -20.787 2.360   2.015   1.00 0.00 ? 40  HIS B HD2  19 
ATOM 5967  H HE1  . HIS B 1 40  ? -24.084 0.208   0.492   1.00 0.00 ? 40  HIS B HE1  19 
ATOM 5968  N N    . ALA B 1 41  ? -16.950 0.682   -2.044  1.00 0.00 ? 41  ALA B N    19 
ATOM 5969  C CA   . ALA B 1 41  ? -15.520 0.361   -2.318  1.00 0.00 ? 41  ALA B CA   19 
ATOM 5970  C C    . ALA B 1 41  ? -14.651 0.823   -1.144  1.00 0.00 ? 41  ALA B C    19 
ATOM 5971  O O    . ALA B 1 41  ? -13.755 0.124   -0.714  1.00 0.00 ? 41  ALA B O    19 
ATOM 5972  C CB   . ALA B 1 41  ? -15.076 1.075   -3.597  1.00 0.00 ? 41  ALA B CB   19 
ATOM 5973  H H    . ALA B 1 41  ? -17.414 1.351   -2.589  1.00 0.00 ? 41  ALA B H    19 
ATOM 5974  H HA   . ALA B 1 41  ? -15.410 -0.704  -2.446  1.00 0.00 ? 41  ALA B HA   19 
ATOM 5975  H HB1  . ALA B 1 41  ? -15.885 1.066   -4.313  1.00 0.00 ? 41  ALA B HB1  19 
ATOM 5976  H HB2  . ALA B 1 41  ? -14.809 2.095   -3.368  1.00 0.00 ? 41  ALA B HB2  19 
ATOM 5977  H HB3  . ALA B 1 41  ? -14.221 0.564   -4.016  1.00 0.00 ? 41  ALA B HB3  19 
ATOM 5978  N N    . ASN B 1 42  ? -14.905 1.992   -0.623  1.00 0.00 ? 42  ASN B N    19 
ATOM 5979  C CA   . ASN B 1 42  ? -14.090 2.489   0.523   1.00 0.00 ? 42  ASN B CA   19 
ATOM 5980  C C    . ASN B 1 42  ? -12.638 2.678   0.078   1.00 0.00 ? 42  ASN B C    19 
ATOM 5981  O O    . ASN B 1 42  ? -12.295 2.454   -1.065  1.00 0.00 ? 42  ASN B O    19 
ATOM 5982  C CB   . ASN B 1 42  ? -14.137 1.470   1.663   1.00 0.00 ? 42  ASN B CB   19 
ATOM 5983  C CG   . ASN B 1 42  ? -15.231 1.865   2.658   1.00 0.00 ? 42  ASN B CG   19 
ATOM 5984  O OD1  . ASN B 1 42  ? -15.474 3.035   2.876   1.00 0.00 ? 42  ASN B OD1  19 
ATOM 5985  N ND2  . ASN B 1 42  ? -15.906 0.933   3.273   1.00 0.00 ? 42  ASN B ND2  19 
ATOM 5986  H H    . ASN B 1 42  ? -15.631 2.543   -0.984  1.00 0.00 ? 42  ASN B H    19 
ATOM 5987  H HA   . ASN B 1 42  ? -14.487 3.433   0.867   1.00 0.00 ? 42  ASN B HA   19 
ATOM 5988  H HB2  . ASN B 1 42  ? -14.352 0.490   1.261   1.00 0.00 ? 42  ASN B HB2  19 
ATOM 5989  H HB3  . ASN B 1 42  ? -13.183 1.450   2.167   1.00 0.00 ? 42  ASN B HB3  19 
ATOM 5990  H HD21 . ASN B 1 42  ? -15.710 -0.011  3.096   1.00 0.00 ? 42  ASN B HD21 19 
ATOM 5991  H HD22 . ASN B 1 42  ? -16.608 1.177   3.912   1.00 0.00 ? 42  ASN B HD22 19 
ATOM 5992  N N    . PHE B 1 43  ? -11.780 3.076   0.980   1.00 0.00 ? 43  PHE B N    19 
ATOM 5993  C CA   . PHE B 1 43  ? -10.347 3.266   0.616   1.00 0.00 ? 43  PHE B CA   19 
ATOM 5994  C C    . PHE B 1 43  ? -9.583  3.760   1.842   1.00 0.00 ? 43  PHE B C    19 
ATOM 5995  O O    . PHE B 1 43  ? -10.075 3.691   2.948   1.00 0.00 ? 43  PHE B O    19 
ATOM 5996  C CB   . PHE B 1 43  ? -10.219 4.272   -0.533  1.00 0.00 ? 43  PHE B CB   19 
ATOM 5997  C CG   . PHE B 1 43  ? -10.408 5.680   -0.034  1.00 0.00 ? 43  PHE B CG   19 
ATOM 5998  C CD1  . PHE B 1 43  ? -11.509 6.006   0.764   1.00 0.00 ? 43  PHE B CD1  19 
ATOM 5999  C CD2  . PHE B 1 43  ? -9.482  6.667   -0.384  1.00 0.00 ? 43  PHE B CD2  19 
ATOM 6000  C CE1  . PHE B 1 43  ? -11.683 7.320   1.211   1.00 0.00 ? 43  PHE B CE1  19 
ATOM 6001  C CE2  . PHE B 1 43  ? -9.654  7.977   0.063   1.00 0.00 ? 43  PHE B CE2  19 
ATOM 6002  C CZ   . PHE B 1 43  ? -10.756 8.307   0.861   1.00 0.00 ? 43  PHE B CZ   19 
ATOM 6003  H H    . PHE B 1 43  ? -12.078 3.241   1.904   1.00 0.00 ? 43  PHE B H    19 
ATOM 6004  H HA   . PHE B 1 43  ? -9.935  2.316   0.305   1.00 0.00 ? 43  PHE B HA   19 
ATOM 6005  H HB2  . PHE B 1 43  ? -9.236  4.186   -0.970  1.00 0.00 ? 43  PHE B HB2  19 
ATOM 6006  H HB3  . PHE B 1 43  ? -10.964 4.056   -1.285  1.00 0.00 ? 43  PHE B HB3  19 
ATOM 6007  H HD1  . PHE B 1 43  ? -12.228 5.244   1.029   1.00 0.00 ? 43  PHE B HD1  19 
ATOM 6008  H HD2  . PHE B 1 43  ? -8.631  6.415   -1.000  1.00 0.00 ? 43  PHE B HD2  19 
ATOM 6009  H HE1  . PHE B 1 43  ? -12.534 7.573   1.826   1.00 0.00 ? 43  PHE B HE1  19 
ATOM 6010  H HE2  . PHE B 1 43  ? -8.941  8.734   -0.210  1.00 0.00 ? 43  PHE B HE2  19 
ATOM 6011  H HZ   . PHE B 1 43  ? -10.890 9.321   1.205   1.00 0.00 ? 43  PHE B HZ   19 
ATOM 6012  N N    . CYS B 1 44  ? -8.381  4.240   1.672   1.00 0.00 ? 44  CYS B N    19 
ATOM 6013  C CA   . CYS B 1 44  ? -7.608  4.706   2.859   1.00 0.00 ? 44  CYS B CA   19 
ATOM 6014  C C    . CYS B 1 44  ? -6.838  5.985   2.524   1.00 0.00 ? 44  CYS B C    19 
ATOM 6015  O O    . CYS B 1 44  ? -6.535  6.263   1.380   1.00 0.00 ? 44  CYS B O    19 
ATOM 6016  C CB   . CYS B 1 44  ? -6.608  3.624   3.284   1.00 0.00 ? 44  CYS B CB   19 
ATOM 6017  S SG   . CYS B 1 44  ? -7.237  1.979   2.849   1.00 0.00 ? 44  CYS B SG   19 
ATOM 6018  H H    . CYS B 1 44  ? -7.985  4.279   0.776   1.00 0.00 ? 44  CYS B H    19 
ATOM 6019  H HA   . CYS B 1 44  ? -8.289  4.901   3.674   1.00 0.00 ? 44  CYS B HA   19 
ATOM 6020  H HB2  . CYS B 1 44  ? -5.666  3.790   2.783   1.00 0.00 ? 44  CYS B HB2  19 
ATOM 6021  H HB3  . CYS B 1 44  ? -6.458  3.678   4.351   1.00 0.00 ? 44  CYS B HB3  19 
ATOM 6022  N N    . LEU B 1 45  ? -6.508  6.760   3.524   1.00 0.00 ? 45  LEU B N    19 
ATOM 6023  C CA   . LEU B 1 45  ? -5.746  8.018   3.286   1.00 0.00 ? 45  LEU B CA   19 
ATOM 6024  C C    . LEU B 1 45  ? -4.884  8.321   4.516   1.00 0.00 ? 45  LEU B C    19 
ATOM 6025  O O    . LEU B 1 45  ? -5.219  7.951   5.623   1.00 0.00 ? 45  LEU B O    19 
ATOM 6026  C CB   . LEU B 1 45  ? -6.720  9.174   3.058   1.00 0.00 ? 45  LEU B CB   19 
ATOM 6027  C CG   . LEU B 1 45  ? -7.397  9.022   1.699   1.00 0.00 ? 45  LEU B CG   19 
ATOM 6028  C CD1  . LEU B 1 45  ? -8.302  10.230  1.451   1.00 0.00 ? 45  LEU B CD1  19 
ATOM 6029  C CD2  . LEU B 1 45  ? -6.334  8.947   0.600   1.00 0.00 ? 45  LEU B CD2  19 
ATOM 6030  H H    . LEU B 1 45  ? -6.758  6.510   4.436   1.00 0.00 ? 45  LEU B H    19 
ATOM 6031  H HA   . LEU B 1 45  ? -5.112  7.901   2.419   1.00 0.00 ? 45  LEU B HA   19 
ATOM 6032  H HB2  . LEU B 1 45  ? -7.470  9.168   3.834   1.00 0.00 ? 45  LEU B HB2  19 
ATOM 6033  H HB3  . LEU B 1 45  ? -6.181  10.109  3.087   1.00 0.00 ? 45  LEU B HB3  19 
ATOM 6034  H HG   . LEU B 1 45  ? -7.990  8.120   1.692   1.00 0.00 ? 45  LEU B HG   19 
ATOM 6035  H HD11 . LEU B 1 45  ? -7.880  11.100  1.932   1.00 0.00 ? 45  LEU B HD11 19 
ATOM 6036  H HD12 . LEU B 1 45  ? -8.381  10.409  0.389   1.00 0.00 ? 45  LEU B HD12 19 
ATOM 6037  H HD13 . LEU B 1 45  ? -9.283  10.033  1.858   1.00 0.00 ? 45  LEU B HD13 19 
ATOM 6038  H HD21 . LEU B 1 45  ? -5.360  9.132   1.028   1.00 0.00 ? 45  LEU B HD21 19 
ATOM 6039  H HD22 . LEU B 1 45  ? -6.349  7.965   0.151   1.00 0.00 ? 45  LEU B HD22 19 
ATOM 6040  H HD23 . LEU B 1 45  ? -6.543  9.690   -0.155  1.00 0.00 ? 45  LEU B HD23 19 
ATOM 6041  N N    . GLY B 1 46  ? -3.780  8.994   4.333   1.00 0.00 ? 46  GLY B N    19 
ATOM 6042  C CA   . GLY B 1 46  ? -2.909  9.322   5.499   1.00 0.00 ? 46  GLY B CA   19 
ATOM 6043  C C    . GLY B 1 46  ? -1.716  8.361   5.544   1.00 0.00 ? 46  GLY B C    19 
ATOM 6044  O O    . GLY B 1 46  ? -1.770  7.281   4.991   1.00 0.00 ? 46  GLY B O    19 
ATOM 6045  H H    . GLY B 1 46  ? -3.527  9.288   3.434   1.00 0.00 ? 46  GLY B H    19 
ATOM 6046  H HA2  . GLY B 1 46  ? -2.551  10.337  5.405   1.00 0.00 ? 46  GLY B HA2  19 
ATOM 6047  H HA3  . GLY B 1 46  ? -3.477  9.225   6.412   1.00 0.00 ? 46  GLY B HA3  19 
ATOM 6048  N N    . PRO B 1 47  ? -0.670  8.791   6.207   1.00 0.00 ? 47  PRO B N    19 
ATOM 6049  C CA   . PRO B 1 47  ? 0.563   7.997   6.353   1.00 0.00 ? 47  PRO B CA   19 
ATOM 6050  C C    . PRO B 1 47  ? 0.387   6.919   7.427   1.00 0.00 ? 47  PRO B C    19 
ATOM 6051  O O    . PRO B 1 47  ? -0.703  6.681   7.911   1.00 0.00 ? 47  PRO B O    19 
ATOM 6052  C CB   . PRO B 1 47  ? 1.605   9.031   6.787   1.00 0.00 ? 47  PRO B CB   19 
ATOM 6053  C CG   . PRO B 1 47  ? 0.818   10.210  7.409   1.00 0.00 ? 47  PRO B CG   19 
ATOM 6054  C CD   . PRO B 1 47  ? -0.623  10.109  6.874   1.00 0.00 ? 47  PRO B CD   19 
ATOM 6055  H HA   . PRO B 1 47  ? 0.849   7.557   5.412   1.00 0.00 ? 47  PRO B HA   19 
ATOM 6056  H HB2  . PRO B 1 47  ? 2.272   8.597   7.520   1.00 0.00 ? 47  PRO B HB2  19 
ATOM 6057  H HB3  . PRO B 1 47  ? 2.164   9.377   5.933   1.00 0.00 ? 47  PRO B HB3  19 
ATOM 6058  H HG2  . PRO B 1 47  ? 0.822   10.128  8.487   1.00 0.00 ? 47  PRO B HG2  19 
ATOM 6059  H HG3  . PRO B 1 47  ? 1.255   11.148  7.105   1.00 0.00 ? 47  PRO B HG3  19 
ATOM 6060  H HD2  . PRO B 1 47  ? -1.332  10.151  7.689   1.00 0.00 ? 47  PRO B HD2  19 
ATOM 6061  H HD3  . PRO B 1 47  ? -0.819  10.894  6.159   1.00 0.00 ? 47  PRO B HD3  19 
ATOM 6062  N N    . CYS B 1 48  ? 1.452   6.263   7.801   1.00 0.00 ? 48  CYS B N    19 
ATOM 6063  C CA   . CYS B 1 48  ? 1.350   5.199   8.840   1.00 0.00 ? 48  CYS B CA   19 
ATOM 6064  C C    . CYS B 1 48  ? 2.627   5.188   9.691   1.00 0.00 ? 48  CYS B C    19 
ATOM 6065  O O    . CYS B 1 48  ? 3.696   4.918   9.183   1.00 0.00 ? 48  CYS B O    19 
ATOM 6066  C CB   . CYS B 1 48  ? 1.197   3.838   8.153   1.00 0.00 ? 48  CYS B CB   19 
ATOM 6067  S SG   . CYS B 1 48  ? 0.759   2.583   9.380   1.00 0.00 ? 48  CYS B SG   19 
ATOM 6068  H H    . CYS B 1 48  ? 2.320   6.471   7.396   1.00 0.00 ? 48  CYS B H    19 
ATOM 6069  H HA   . CYS B 1 48  ? 0.491   5.385   9.463   1.00 0.00 ? 48  CYS B HA   19 
ATOM 6070  H HB2  . CYS B 1 48  ? 0.420   3.897   7.406   1.00 0.00 ? 48  CYS B HB2  19 
ATOM 6071  H HB3  . CYS B 1 48  ? 2.131   3.568   7.682   1.00 0.00 ? 48  CYS B HB3  19 
ATOM 6072  N N    . PRO B 1 49  ? 2.486   5.467   10.963  1.00 0.00 ? 49  PRO B N    19 
ATOM 6073  C CA   . PRO B 1 49  ? 3.630   5.474   11.890  1.00 0.00 ? 49  PRO B CA   19 
ATOM 6074  C C    . PRO B 1 49  ? 4.044   4.027   12.208  1.00 0.00 ? 49  PRO B C    19 
ATOM 6075  O O    . PRO B 1 49  ? 3.951   3.159   11.363  1.00 0.00 ? 49  PRO B O    19 
ATOM 6076  C CB   . PRO B 1 49  ? 3.096   6.235   13.113  1.00 0.00 ? 49  PRO B CB   19 
ATOM 6077  C CG   . PRO B 1 49  ? 1.555   6.145   13.051  1.00 0.00 ? 49  PRO B CG   19 
ATOM 6078  C CD   . PRO B 1 49  ? 1.191   5.796   11.594  1.00 0.00 ? 49  PRO B CD   19 
ATOM 6079  H HA   . PRO B 1 49  ? 4.457   6.012   11.455  1.00 0.00 ? 49  PRO B HA   19 
ATOM 6080  H HB2  . PRO B 1 49  ? 3.457   5.783   14.024  1.00 0.00 ? 49  PRO B HB2  19 
ATOM 6081  H HB3  . PRO B 1 49  ? 3.399   7.268   13.067  1.00 0.00 ? 49  PRO B HB3  19 
ATOM 6082  H HG2  . PRO B 1 49  ? 1.205   5.379   13.725  1.00 0.00 ? 49  PRO B HG2  19 
ATOM 6083  H HG3  . PRO B 1 49  ? 1.120   7.096   13.316  1.00 0.00 ? 49  PRO B HG3  19 
ATOM 6084  H HD2  . PRO B 1 49  ? 0.526   4.945   11.564  1.00 0.00 ? 49  PRO B HD2  19 
ATOM 6085  H HD3  . PRO B 1 49  ? 0.743   6.645   11.102  1.00 0.00 ? 49  PRO B HD3  19 
ATOM 6086  N N    . TYR B 1 50  ? 4.515   3.749   13.394  1.00 0.00 ? 50  TYR B N    19 
ATOM 6087  C CA   . TYR B 1 50  ? 4.940   2.346   13.700  1.00 0.00 ? 50  TYR B CA   19 
ATOM 6088  C C    . TYR B 1 50  ? 3.776   1.549   14.297  1.00 0.00 ? 50  TYR B C    19 
ATOM 6089  O O    . TYR B 1 50  ? 3.073   0.844   13.603  1.00 0.00 ? 50  TYR B O    19 
ATOM 6090  C CB   . TYR B 1 50  ? 6.121   2.327   14.690  1.00 0.00 ? 50  TYR B CB   19 
ATOM 6091  C CG   . TYR B 1 50  ? 6.421   3.717   15.202  1.00 0.00 ? 50  TYR B CG   19 
ATOM 6092  C CD1  . TYR B 1 50  ? 7.047   4.650   14.367  1.00 0.00 ? 50  TYR B CD1  19 
ATOM 6093  C CD2  . TYR B 1 50  ? 6.073   4.072   16.511  1.00 0.00 ? 50  TYR B CD2  19 
ATOM 6094  C CE1  . TYR B 1 50  ? 7.325   5.938   14.840  1.00 0.00 ? 50  TYR B CE1  19 
ATOM 6095  C CE2  . TYR B 1 50  ? 6.351   5.360   16.984  1.00 0.00 ? 50  TYR B CE2  19 
ATOM 6096  C CZ   . TYR B 1 50  ? 6.977   6.293   16.149  1.00 0.00 ? 50  TYR B CZ   19 
ATOM 6097  O OH   . TYR B 1 50  ? 7.250   7.562   16.615  1.00 0.00 ? 50  TYR B OH   19 
ATOM 6098  H H    . TYR B 1 50  ? 4.601   4.450   14.068  1.00 0.00 ? 50  TYR B H    19 
ATOM 6099  H HA   . TYR B 1 50  ? 5.249   1.871   12.780  1.00 0.00 ? 50  TYR B HA   19 
ATOM 6100  H HB2  . TYR B 1 50  ? 5.874   1.688   15.524  1.00 0.00 ? 50  TYR B HB2  19 
ATOM 6101  H HB3  . TYR B 1 50  ? 6.996   1.936   14.190  1.00 0.00 ? 50  TYR B HB3  19 
ATOM 6102  H HD1  . TYR B 1 50  ? 7.314   4.376   13.358  1.00 0.00 ? 50  TYR B HD1  19 
ATOM 6103  H HD2  . TYR B 1 50  ? 5.590   3.352   17.156  1.00 0.00 ? 50  TYR B HD2  19 
ATOM 6104  H HE1  . TYR B 1 50  ? 7.807   6.656   14.195  1.00 0.00 ? 50  TYR B HE1  19 
ATOM 6105  H HE2  . TYR B 1 50  ? 6.082   5.634   17.995  1.00 0.00 ? 50  TYR B HE2  19 
ATOM 6106  H HH   . TYR B 1 50  ? 7.924   7.490   17.295  1.00 0.00 ? 50  TYR B HH   19 
ATOM 6107  N N    . ILE B 1 51  ? 3.588   1.635   15.583  1.00 0.00 ? 51  ILE B N    19 
ATOM 6108  C CA   . ILE B 1 51  ? 2.492   0.863   16.243  1.00 0.00 ? 51  ILE B CA   19 
ATOM 6109  C C    . ILE B 1 51  ? 1.220   0.854   15.384  1.00 0.00 ? 51  ILE B C    19 
ATOM 6110  O O    . ILE B 1 51  ? 0.407   -0.040  15.490  1.00 0.00 ? 51  ILE B O    19 
ATOM 6111  C CB   . ILE B 1 51  ? 2.179   1.492   17.601  1.00 0.00 ? 51  ILE B CB   19 
ATOM 6112  C CG1  . ILE B 1 51  ? 2.113   3.014   17.454  1.00 0.00 ? 51  ILE B CG1  19 
ATOM 6113  C CG2  . ILE B 1 51  ? 3.279   1.126   18.599  1.00 0.00 ? 51  ILE B CG2  19 
ATOM 6114  C CD1  . ILE B 1 51  ? 1.433   3.618   18.684  1.00 0.00 ? 51  ILE B CD1  19 
ATOM 6115  H H    . ILE B 1 51  ? 4.181   2.195   16.126  1.00 0.00 ? 51  ILE B H    19 
ATOM 6116  H HA   . ILE B 1 51  ? 2.824   -0.155  16.392  1.00 0.00 ? 51  ILE B HA   19 
ATOM 6117  H HB   . ILE B 1 51  ? 1.230   1.121   17.960  1.00 0.00 ? 51  ILE B HB   19 
ATOM 6118  H HG12 . ILE B 1 51  ? 3.114   3.410   17.363  1.00 0.00 ? 51  ILE B HG12 19 
ATOM 6119  H HG13 . ILE B 1 51  ? 1.544   3.266   16.571  1.00 0.00 ? 51  ILE B HG13 19 
ATOM 6120  H HG21 . ILE B 1 51  ? 3.690   0.160   18.344  1.00 0.00 ? 51  ILE B HG21 19 
ATOM 6121  H HG22 . ILE B 1 51  ? 4.061   1.871   18.564  1.00 0.00 ? 51  ILE B HG22 19 
ATOM 6122  H HG23 . ILE B 1 51  ? 2.863   1.088   19.595  1.00 0.00 ? 51  ILE B HG23 19 
ATOM 6123  H HD11 . ILE B 1 51  ? 0.689   2.930   19.058  1.00 0.00 ? 51  ILE B HD11 19 
ATOM 6124  H HD12 . ILE B 1 51  ? 2.171   3.800   19.450  1.00 0.00 ? 51  ILE B HD12 19 
ATOM 6125  H HD13 . ILE B 1 51  ? 0.957   4.549   18.412  1.00 0.00 ? 51  ILE B HD13 19 
ATOM 6126  N N    . TRP B 1 52  ? 1.027   1.839   14.548  1.00 0.00 ? 52  TRP B N    19 
ATOM 6127  C CA   . TRP B 1 52  ? -0.209  1.871   13.707  1.00 0.00 ? 52  TRP B CA   19 
ATOM 6128  C C    . TRP B 1 52  ? -0.284  0.629   12.814  1.00 0.00 ? 52  TRP B C    19 
ATOM 6129  O O    . TRP B 1 52  ? 0.150   0.656   11.680  1.00 0.00 ? 52  TRP B O    19 
ATOM 6130  C CB   . TRP B 1 52  ? -0.192  3.116   12.825  1.00 0.00 ? 52  TRP B CB   19 
ATOM 6131  C CG   . TRP B 1 52  ? -1.554  3.731   12.807  1.00 0.00 ? 52  TRP B CG   19 
ATOM 6132  C CD1  . TRP B 1 52  ? -2.187  4.172   11.698  1.00 0.00 ? 52  TRP B CD1  19 
ATOM 6133  C CD2  . TRP B 1 52  ? -2.461  3.980   13.922  1.00 0.00 ? 52  TRP B CD2  19 
ATOM 6134  N NE1  . TRP B 1 52  ? -3.424  4.674   12.057  1.00 0.00 ? 52  TRP B NE1  19 
ATOM 6135  C CE2  . TRP B 1 52  ? -3.640  4.578   13.417  1.00 0.00 ? 52  TRP B CE2  19 
ATOM 6136  C CE3  . TRP B 1 52  ? -2.377  3.747   15.306  1.00 0.00 ? 52  TRP B CE3  19 
ATOM 6137  C CZ2  . TRP B 1 52  ? -4.699  4.932   14.255  1.00 0.00 ? 52  TRP B CZ2  19 
ATOM 6138  C CZ3  . TRP B 1 52  ? -3.440  4.102   16.153  1.00 0.00 ? 52  TRP B CZ3  19 
ATOM 6139  C CH2  . TRP B 1 52  ? -4.599  4.693   15.629  1.00 0.00 ? 52  TRP B CH2  19 
ATOM 6140  H H    . TRP B 1 52  ? 1.685   2.562   14.480  1.00 0.00 ? 52  TRP B H    19 
ATOM 6141  H HA   . TRP B 1 52  ? -1.077  1.903   14.347  1.00 0.00 ? 52  TRP B HA   19 
ATOM 6142  H HB2  . TRP B 1 52  ? 0.518   3.821   13.218  1.00 0.00 ? 52  TRP B HB2  19 
ATOM 6143  H HB3  . TRP B 1 52  ? 0.092   2.841   11.821  1.00 0.00 ? 52  TRP B HB3  19 
ATOM 6144  H HD1  . TRP B 1 52  ? -1.790  4.135   10.695  1.00 0.00 ? 52  TRP B HD1  19 
ATOM 6145  H HE1  . TRP B 1 52  ? -4.081  5.055   11.437  1.00 0.00 ? 52  TRP B HE1  19 
ATOM 6146  H HE3  . TRP B 1 52  ? -1.489  3.292   15.721  1.00 0.00 ? 52  TRP B HE3  19 
ATOM 6147  H HZ2  . TRP B 1 52  ? -5.590  5.386   13.846  1.00 0.00 ? 52  TRP B HZ2  19 
ATOM 6148  H HZ3  . TRP B 1 52  ? -3.365  3.918   17.216  1.00 0.00 ? 52  TRP B HZ3  19 
ATOM 6149  H HH2  . TRP B 1 52  ? -5.412  4.964   16.285  1.00 0.00 ? 52  TRP B HH2  19 
ATOM 6150  N N    . SER B 1 53  ? -0.857  -0.440  13.321  1.00 0.00 ? 53  SER B N    19 
ATOM 6151  C CA   . SER B 1 53  ? -1.003  -1.708  12.530  1.00 0.00 ? 53  SER B CA   19 
ATOM 6152  C C    . SER B 1 53  ? 0.022   -1.777  11.396  1.00 0.00 ? 53  SER B C    19 
ATOM 6153  O O    . SER B 1 53  ? -0.221  -1.312  10.301  1.00 0.00 ? 53  SER B O    19 
ATOM 6154  C CB   . SER B 1 53  ? -2.411  -1.771  11.937  1.00 0.00 ? 53  SER B CB   19 
ATOM 6155  O OG   . SER B 1 53  ? -2.760  -3.128  11.703  1.00 0.00 ? 53  SER B OG   19 
ATOM 6156  H H    . SER B 1 53  ? -1.209  -0.405  14.235  1.00 0.00 ? 53  SER B H    19 
ATOM 6157  H HA   . SER B 1 53  ? -0.860  -2.553  13.188  1.00 0.00 ? 53  SER B HA   19 
ATOM 6158  H HB2  . SER B 1 53  ? -3.114  -1.337  12.627  1.00 0.00 ? 53  SER B HB2  19 
ATOM 6159  H HB3  . SER B 1 53  ? -2.432  -1.216  11.009  1.00 0.00 ? 53  SER B HB3  19 
ATOM 6160  H HG   . SER B 1 53  ? -2.912  -3.547  12.552  1.00 0.00 ? 53  SER B HG   19 
ATOM 6161  N N    . LEU B 1 54  ? 1.163   -2.353  11.645  1.00 0.00 ? 54  LEU B N    19 
ATOM 6162  C CA   . LEU B 1 54  ? 2.194   -2.448  10.575  1.00 0.00 ? 54  LEU B CA   19 
ATOM 6163  C C    . LEU B 1 54  ? 2.008   -3.760  9.811   1.00 0.00 ? 54  LEU B C    19 
ATOM 6164  O O    . LEU B 1 54  ? 1.883   -4.818  10.396  1.00 0.00 ? 54  LEU B O    19 
ATOM 6165  C CB   . LEU B 1 54  ? 3.584   -2.404  11.210  1.00 0.00 ? 54  LEU B CB   19 
ATOM 6166  C CG   . LEU B 1 54  ? 3.811   -1.017  11.812  1.00 0.00 ? 54  LEU B CG   19 
ATOM 6167  C CD1  . LEU B 1 54  ? 4.724   -1.126  13.035  1.00 0.00 ? 54  LEU B CD1  19 
ATOM 6168  C CD2  . LEU B 1 54  ? 4.468   -0.112  10.766  1.00 0.00 ? 54  LEU B CD2  19 
ATOM 6169  H H    . LEU B 1 54  ? 1.343   -2.724  12.534  1.00 0.00 ? 54  LEU B H    19 
ATOM 6170  H HA   . LEU B 1 54  ? 2.083   -1.617  9.894   1.00 0.00 ? 54  LEU B HA   19 
ATOM 6171  H HB2  . LEU B 1 54  ? 3.650   -3.153  11.988  1.00 0.00 ? 54  LEU B HB2  19 
ATOM 6172  H HB3  . LEU B 1 54  ? 4.332   -2.597  10.457  1.00 0.00 ? 54  LEU B HB3  19 
ATOM 6173  H HG   . LEU B 1 54  ? 2.862   -0.596  12.107  1.00 0.00 ? 54  LEU B HG   19 
ATOM 6174  H HD11 . LEU B 1 54  ? 5.211   -2.088  13.037  1.00 0.00 ? 54  LEU B HD11 19 
ATOM 6175  H HD12 . LEU B 1 54  ? 5.468   -0.344  13.001  1.00 0.00 ? 54  LEU B HD12 19 
ATOM 6176  H HD13 . LEU B 1 54  ? 4.133   -1.019  13.935  1.00 0.00 ? 54  LEU B HD13 19 
ATOM 6177  H HD21 . LEU B 1 54  ? 5.247   -0.659  10.254  1.00 0.00 ? 54  LEU B HD21 19 
ATOM 6178  H HD22 . LEU B 1 54  ? 3.726   0.211   10.051  1.00 0.00 ? 54  LEU B HD22 19 
ATOM 6179  H HD23 . LEU B 1 54  ? 4.897   0.751   11.255  1.00 0.00 ? 54  LEU B HD23 19 
ATOM 6180  N N    . ASP B 1 55  ? 1.974   -3.701  8.507   1.00 0.00 ? 55  ASP B N    19 
ATOM 6181  C CA   . ASP B 1 55  ? 1.780   -4.948  7.712   1.00 0.00 ? 55  ASP B CA   19 
ATOM 6182  C C    . ASP B 1 55  ? 3.133   -5.602  7.427   1.00 0.00 ? 55  ASP B C    19 
ATOM 6183  O O    . ASP B 1 55  ? 3.410   -6.697  7.874   1.00 0.00 ? 55  ASP B O    19 
ATOM 6184  C CB   . ASP B 1 55  ? 1.093   -4.609  6.388   1.00 0.00 ? 55  ASP B CB   19 
ATOM 6185  C CG   . ASP B 1 55  ? 0.700   -5.903  5.673   1.00 0.00 ? 55  ASP B CG   19 
ATOM 6186  O OD1  . ASP B 1 55  ? 1.551   -6.473  5.012   1.00 0.00 ? 55  ASP B OD1  19 
ATOM 6187  O OD2  . ASP B 1 55  ? -0.446  -6.302  5.800   1.00 0.00 ? 55  ASP B OD2  19 
ATOM 6188  H H    . ASP B 1 55  ? 2.068   -2.837  8.053   1.00 0.00 ? 55  ASP B H    19 
ATOM 6189  H HA   . ASP B 1 55  ? 1.162   -5.635  8.269   1.00 0.00 ? 55  ASP B HA   19 
ATOM 6190  H HB2  . ASP B 1 55  ? 0.209   -4.020  6.581   1.00 0.00 ? 55  ASP B HB2  19 
ATOM 6191  H HB3  . ASP B 1 55  ? 1.771   -4.047  5.763   1.00 0.00 ? 55  ASP B HB3  19 
ATOM 6192  N N    . THR B 1 56  ? 3.975   -4.946  6.678   1.00 0.00 ? 56  THR B N    19 
ATOM 6193  C CA   . THR B 1 56  ? 5.304   -5.539  6.360   1.00 0.00 ? 56  THR B CA   19 
ATOM 6194  C C    . THR B 1 56  ? 6.344   -5.031  7.358   1.00 0.00 ? 56  THR B C    19 
ATOM 6195  O O    . THR B 1 56  ? 6.083   -4.146  8.148   1.00 0.00 ? 56  THR B O    19 
ATOM 6196  C CB   . THR B 1 56  ? 5.718   -5.134  4.943   1.00 0.00 ? 56  THR B CB   19 
ATOM 6197  O OG1  . THR B 1 56  ? 6.268   -3.823  4.970   1.00 0.00 ? 56  THR B OG1  19 
ATOM 6198  C CG2  . THR B 1 56  ? 4.496   -5.158  4.024   1.00 0.00 ? 56  THR B CG2  19 
ATOM 6199  H H    . THR B 1 56  ? 3.732   -4.067  6.320   1.00 0.00 ? 56  THR B H    19 
ATOM 6200  H HA   . THR B 1 56  ? 5.242   -6.616  6.422   1.00 0.00 ? 56  THR B HA   19 
ATOM 6201  H HB   . THR B 1 56  ? 6.457   -5.826  4.572   1.00 0.00 ? 56  THR B HB   19 
ATOM 6202  H HG1  . THR B 1 56  ? 5.638   -3.247  5.409   1.00 0.00 ? 56  THR B HG1  19 
ATOM 6203  H HG21 . THR B 1 56  ? 3.723   -4.526  4.435   1.00 0.00 ? 56  THR B HG21 19 
ATOM 6204  H HG22 . THR B 1 56  ? 4.775   -4.796  3.045   1.00 0.00 ? 56  THR B HG22 19 
ATOM 6205  H HG23 . THR B 1 56  ? 4.128   -6.170  3.942   1.00 0.00 ? 56  THR B HG23 19 
ATOM 6206  N N    . GLN B 1 57  ? 7.526   -5.586  7.326   1.00 0.00 ? 57  GLN B N    19 
ATOM 6207  C CA   . GLN B 1 57  ? 8.584   -5.135  8.271   1.00 0.00 ? 57  GLN B CA   19 
ATOM 6208  C C    . GLN B 1 57  ? 9.109   -3.769  7.827   1.00 0.00 ? 57  GLN B C    19 
ATOM 6209  O O    . GLN B 1 57  ? 9.366   -2.900  8.636   1.00 0.00 ? 57  GLN B O    19 
ATOM 6210  C CB   . GLN B 1 57  ? 9.729   -6.147  8.272   1.00 0.00 ? 57  GLN B CB   19 
ATOM 6211  C CG   . GLN B 1 57  ? 9.332   -7.363  9.113   1.00 0.00 ? 57  GLN B CG   19 
ATOM 6212  C CD   . GLN B 1 57  ? 10.222  -7.438  10.355  1.00 0.00 ? 57  GLN B CD   19 
ATOM 6213  O OE1  . GLN B 1 57  ? 10.500  -6.434  10.980  1.00 0.00 ? 57  GLN B OE1  19 
ATOM 6214  N NE2  . GLN B 1 57  ? 10.685  -8.595  10.742  1.00 0.00 ? 57  GLN B NE2  19 
ATOM 6215  H H    . GLN B 1 57  ? 7.716   -6.297  6.681   1.00 0.00 ? 57  GLN B H    19 
ATOM 6216  H HA   . GLN B 1 57  ? 8.170   -5.056  9.266   1.00 0.00 ? 57  GLN B HA   19 
ATOM 6217  H HB2  . GLN B 1 57  ? 9.933   -6.459  7.259   1.00 0.00 ? 57  GLN B HB2  19 
ATOM 6218  H HB3  . GLN B 1 57  ? 10.613  -5.692  8.695   1.00 0.00 ? 57  GLN B HB3  19 
ATOM 6219  H HG2  . GLN B 1 57  ? 8.299   -7.269  9.416   1.00 0.00 ? 57  GLN B HG2  19 
ATOM 6220  H HG3  . GLN B 1 57  ? 9.457   -8.262  8.529   1.00 0.00 ? 57  GLN B HG3  19 
ATOM 6221  H HE21 . GLN B 1 57  ? 10.462  -9.406  10.239  1.00 0.00 ? 57  GLN B HE21 19 
ATOM 6222  H HE22 . GLN B 1 57  ? 11.257  -8.654  11.536  1.00 0.00 ? 57  GLN B HE22 19 
ATOM 6223  N N    . TYR B 1 58  ? 9.266   -3.569  6.547   1.00 0.00 ? 58  TYR B N    19 
ATOM 6224  C CA   . TYR B 1 58  ? 9.767   -2.254  6.061   1.00 0.00 ? 58  TYR B CA   19 
ATOM 6225  C C    . TYR B 1 58  ? 8.813   -1.155  6.549   1.00 0.00 ? 58  TYR B C    19 
ATOM 6226  O O    . TYR B 1 58  ? 9.226   -0.053  6.851   1.00 0.00 ? 58  TYR B O    19 
ATOM 6227  C CB   . TYR B 1 58  ? 9.842   -2.269  4.520   1.00 0.00 ? 58  TYR B CB   19 
ATOM 6228  C CG   . TYR B 1 58  ? 9.624   -0.878  3.969   1.00 0.00 ? 58  TYR B CG   19 
ATOM 6229  C CD1  . TYR B 1 58  ? 10.659  0.063   4.010   1.00 0.00 ? 58  TYR B CD1  19 
ATOM 6230  C CD2  . TYR B 1 58  ? 8.382   -0.531  3.428   1.00 0.00 ? 58  TYR B CD2  19 
ATOM 6231  C CE1  . TYR B 1 58  ? 10.449  1.351   3.506   1.00 0.00 ? 58  TYR B CE1  19 
ATOM 6232  C CE2  . TYR B 1 58  ? 8.173   0.757   2.926   1.00 0.00 ? 58  TYR B CE2  19 
ATOM 6233  C CZ   . TYR B 1 58  ? 9.207   1.698   2.965   1.00 0.00 ? 58  TYR B CZ   19 
ATOM 6234  O OH   . TYR B 1 58  ? 9.000   2.967   2.473   1.00 0.00 ? 58  TYR B OH   19 
ATOM 6235  H H    . TYR B 1 58  ? 9.050   -4.279  5.906   1.00 0.00 ? 58  TYR B H    19 
ATOM 6236  H HA   . TYR B 1 58  ? 10.753  -2.076  6.467   1.00 0.00 ? 58  TYR B HA   19 
ATOM 6237  H HB2  . TYR B 1 58  ? 10.814  -2.623  4.215   1.00 0.00 ? 58  TYR B HB2  19 
ATOM 6238  H HB3  . TYR B 1 58  ? 9.083   -2.930  4.128   1.00 0.00 ? 58  TYR B HB3  19 
ATOM 6239  H HD1  . TYR B 1 58  ? 11.618  -0.206  4.427   1.00 0.00 ? 58  TYR B HD1  19 
ATOM 6240  H HD2  . TYR B 1 58  ? 7.584   -1.259  3.397   1.00 0.00 ? 58  TYR B HD2  19 
ATOM 6241  H HE1  . TYR B 1 58  ? 11.245  2.080   3.537   1.00 0.00 ? 58  TYR B HE1  19 
ATOM 6242  H HE2  . TYR B 1 58  ? 7.214   1.025   2.508   1.00 0.00 ? 58  TYR B HE2  19 
ATOM 6243  H HH   . TYR B 1 58  ? 8.227   2.943   1.905   1.00 0.00 ? 58  TYR B HH   19 
ATOM 6244  N N    . SER B 1 59  ? 7.545   -1.450  6.629   1.00 0.00 ? 59  SER B N    19 
ATOM 6245  C CA   . SER B 1 59  ? 6.574   -0.424  7.100   1.00 0.00 ? 59  SER B CA   19 
ATOM 6246  C C    . SER B 1 59  ? 6.976   0.044   8.501   1.00 0.00 ? 59  SER B C    19 
ATOM 6247  O O    . SER B 1 59  ? 6.812   1.195   8.851   1.00 0.00 ? 59  SER B O    19 
ATOM 6248  C CB   . SER B 1 59  ? 5.171   -1.029  7.145   1.00 0.00 ? 59  SER B CB   19 
ATOM 6249  O OG   . SER B 1 59  ? 5.117   -2.018  8.164   1.00 0.00 ? 59  SER B OG   19 
ATOM 6250  H H    . SER B 1 59  ? 7.232   -2.345  6.383   1.00 0.00 ? 59  SER B H    19 
ATOM 6251  H HA   . SER B 1 59  ? 6.584   0.417   6.424   1.00 0.00 ? 59  SER B HA   19 
ATOM 6252  H HB2  . SER B 1 59  ? 4.451   -0.258  7.361   1.00 0.00 ? 59  SER B HB2  19 
ATOM 6253  H HB3  . SER B 1 59  ? 4.941   -1.473  6.185   1.00 0.00 ? 59  SER B HB3  19 
ATOM 6254  H HG   . SER B 1 59  ? 4.218   -2.051  8.499   1.00 0.00 ? 59  SER B HG   19 
ATOM 6255  N N    . LYS B 1 60  ? 7.508   -0.840  9.301   1.00 0.00 ? 60  LYS B N    19 
ATOM 6256  C CA   . LYS B 1 60  ? 7.929   -0.441  10.672  1.00 0.00 ? 60  LYS B CA   19 
ATOM 6257  C C    . LYS B 1 60  ? 9.192   0.414   10.570  1.00 0.00 ? 60  LYS B C    19 
ATOM 6258  O O    . LYS B 1 60  ? 9.391   1.344   11.326  1.00 0.00 ? 60  LYS B O    19 
ATOM 6259  C CB   . LYS B 1 60  ? 8.220   -1.694  11.503  1.00 0.00 ? 60  LYS B CB   19 
ATOM 6260  C CG   . LYS B 1 60  ? 8.985   -1.303  12.770  1.00 0.00 ? 60  LYS B CG   19 
ATOM 6261  C CD   . LYS B 1 60  ? 8.545   -2.199  13.930  1.00 0.00 ? 60  LYS B CD   19 
ATOM 6262  C CE   . LYS B 1 60  ? 9.015   -1.588  15.252  1.00 0.00 ? 60  LYS B CE   19 
ATOM 6263  N NZ   . LYS B 1 60  ? 7.912   -1.656  16.251  1.00 0.00 ? 60  LYS B NZ   19 
ATOM 6264  H H    . LYS B 1 60  ? 7.639   -1.761  8.997   1.00 0.00 ? 60  LYS B H    19 
ATOM 6265  H HA   . LYS B 1 60  ? 7.142   0.130   11.140  1.00 0.00 ? 60  LYS B HA   19 
ATOM 6266  H HB2  . LYS B 1 60  ? 7.289   -2.169  11.776  1.00 0.00 ? 60  LYS B HB2  19 
ATOM 6267  H HB3  . LYS B 1 60  ? 8.817   -2.381  10.922  1.00 0.00 ? 60  LYS B HB3  19 
ATOM 6268  H HG2  . LYS B 1 60  ? 10.045  -1.425  12.602  1.00 0.00 ? 60  LYS B HG2  19 
ATOM 6269  H HG3  . LYS B 1 60  ? 8.774   -0.274  13.013  1.00 0.00 ? 60  LYS B HG3  19 
ATOM 6270  H HD2  . LYS B 1 60  ? 7.469   -2.282  13.933  1.00 0.00 ? 60  LYS B HD2  19 
ATOM 6271  H HD3  . LYS B 1 60  ? 8.983   -3.179  13.814  1.00 0.00 ? 60  LYS B HD3  19 
ATOM 6272  H HE2  . LYS B 1 60  ? 9.869   -2.137  15.619  1.00 0.00 ? 60  LYS B HE2  19 
ATOM 6273  H HE3  . LYS B 1 60  ? 9.292   -0.556  15.092  1.00 0.00 ? 60  LYS B HE3  19 
ATOM 6274  H HZ1  . LYS B 1 60  ? 7.048   -2.009  15.790  1.00 0.00 ? 60  LYS B HZ1  19 
ATOM 6275  H HZ2  . LYS B 1 60  ? 8.182   -2.299  17.022  1.00 0.00 ? 60  LYS B HZ2  19 
ATOM 6276  H HZ3  . LYS B 1 60  ? 7.736   -0.708  16.639  1.00 0.00 ? 60  LYS B HZ3  19 
ATOM 6277  N N    . VAL B 1 61  ? 10.044  0.105   9.632   1.00 0.00 ? 61  VAL B N    19 
ATOM 6278  C CA   . VAL B 1 61  ? 11.290  0.894   9.466   1.00 0.00 ? 61  VAL B CA   19 
ATOM 6279  C C    . VAL B 1 61  ? 10.939  2.276   8.915   1.00 0.00 ? 61  VAL B C    19 
ATOM 6280  O O    . VAL B 1 61  ? 10.916  3.250   9.636   1.00 0.00 ? 61  VAL B O    19 
ATOM 6281  C CB   . VAL B 1 61  ? 12.214  0.165   8.490   1.00 0.00 ? 61  VAL B CB   19 
ATOM 6282  C CG1  . VAL B 1 61  ? 13.345  1.095   8.057   1.00 0.00 ? 61  VAL B CG1  19 
ATOM 6283  C CG2  . VAL B 1 61  ? 12.800  -1.070  9.177   1.00 0.00 ? 61  VAL B CG2  19 
ATOM 6284  H H    . VAL B 1 61  ? 9.861   -0.646  9.033   1.00 0.00 ? 61  VAL B H    19 
ATOM 6285  H HA   . VAL B 1 61  ? 11.783  0.999   10.421  1.00 0.00 ? 61  VAL B HA   19 
ATOM 6286  H HB   . VAL B 1 61  ? 11.649  -0.140  7.621   1.00 0.00 ? 61  VAL B HB   19 
ATOM 6287  H HG11 . VAL B 1 61  ? 13.227  2.054   8.539   1.00 0.00 ? 61  VAL B HG11 19 
ATOM 6288  H HG12 . VAL B 1 61  ? 14.293  0.663   8.344   1.00 0.00 ? 61  VAL B HG12 19 
ATOM 6289  H HG13 . VAL B 1 61  ? 13.316  1.223   6.986   1.00 0.00 ? 61  VAL B HG13 19 
ATOM 6290  H HG21 . VAL B 1 61  ? 12.133  -1.396  9.961   1.00 0.00 ? 61  VAL B HG21 19 
ATOM 6291  H HG22 . VAL B 1 61  ? 12.920  -1.862  8.453   1.00 0.00 ? 61  VAL B HG22 19 
ATOM 6292  H HG23 . VAL B 1 61  ? 13.762  -0.822  9.602   1.00 0.00 ? 61  VAL B HG23 19 
ATOM 6293  N N    . LEU B 1 62  ? 10.664  2.366   7.643   1.00 0.00 ? 62  LEU B N    19 
ATOM 6294  C CA   . LEU B 1 62  ? 10.310  3.685   7.042   1.00 0.00 ? 62  LEU B CA   19 
ATOM 6295  C C    . LEU B 1 62  ? 9.349   4.428   7.976   1.00 0.00 ? 62  LEU B C    19 
ATOM 6296  O O    . LEU B 1 62  ? 9.336   5.643   8.024   1.00 0.00 ? 62  LEU B O    19 
ATOM 6297  C CB   . LEU B 1 62  ? 9.654   3.448   5.675   1.00 0.00 ? 62  LEU B CB   19 
ATOM 6298  C CG   . LEU B 1 62  ? 8.945   4.714   5.178   1.00 0.00 ? 62  LEU B CG   19 
ATOM 6299  C CD1  . LEU B 1 62  ? 9.917   5.571   4.362   1.00 0.00 ? 62  LEU B CD1  19 
ATOM 6300  C CD2  . LEU B 1 62  ? 7.771   4.305   4.290   1.00 0.00 ? 62  LEU B CD2  19 
ATOM 6301  H H    . LEU B 1 62  ? 10.686  1.564   7.080   1.00 0.00 ? 62  LEU B H    19 
ATOM 6302  H HA   . LEU B 1 62  ? 11.208  4.271   6.912   1.00 0.00 ? 62  LEU B HA   19 
ATOM 6303  H HB2  . LEU B 1 62  ? 10.414  3.167   4.964   1.00 0.00 ? 62  LEU B HB2  19 
ATOM 6304  H HB3  . LEU B 1 62  ? 8.933   2.648   5.760   1.00 0.00 ? 62  LEU B HB3  19 
ATOM 6305  H HG   . LEU B 1 62  ? 8.579   5.287   6.016   1.00 0.00 ? 62  LEU B HG   19 
ATOM 6306  H HD11 . LEU B 1 62  ? 10.926  5.389   4.698   1.00 0.00 ? 62  LEU B HD11 19 
ATOM 6307  H HD12 . LEU B 1 62  ? 9.834   5.313   3.315   1.00 0.00 ? 62  LEU B HD12 19 
ATOM 6308  H HD13 . LEU B 1 62  ? 9.676   6.615   4.494   1.00 0.00 ? 62  LEU B HD13 19 
ATOM 6309  H HD21 . LEU B 1 62  ? 7.782   3.233   4.154   1.00 0.00 ? 62  LEU B HD21 19 
ATOM 6310  H HD22 . LEU B 1 62  ? 6.846   4.596   4.761   1.00 0.00 ? 62  LEU B HD22 19 
ATOM 6311  H HD23 . LEU B 1 62  ? 7.858   4.791   3.331   1.00 0.00 ? 62  LEU B HD23 19 
ATOM 6312  N N    . ALA B 1 63  ? 8.547   3.717   8.722   1.00 0.00 ? 63  ALA B N    19 
ATOM 6313  C CA   . ALA B 1 63  ? 7.599   4.399   9.649   1.00 0.00 ? 63  ALA B CA   19 
ATOM 6314  C C    . ALA B 1 63  ? 8.380   5.361   10.544  1.00 0.00 ? 63  ALA B C    19 
ATOM 6315  O O    . ALA B 1 63  ? 8.085   6.537   10.611  1.00 0.00 ? 63  ALA B O    19 
ATOM 6316  C CB   . ALA B 1 63  ? 6.881   3.359   10.512  1.00 0.00 ? 63  ALA B CB   19 
ATOM 6317  H H    . ALA B 1 63  ? 8.571   2.737   8.675   1.00 0.00 ? 63  ALA B H    19 
ATOM 6318  H HA   . ALA B 1 63  ? 6.872   4.955   9.075   1.00 0.00 ? 63  ALA B HA   19 
ATOM 6319  H HB1  . ALA B 1 63  ? 7.502   2.479   10.608  1.00 0.00 ? 63  ALA B HB1  19 
ATOM 6320  H HB2  . ALA B 1 63  ? 6.691   3.773   11.491  1.00 0.00 ? 63  ALA B HB2  19 
ATOM 6321  H HB3  . ALA B 1 63  ? 5.945   3.090   10.047  1.00 0.00 ? 63  ALA B HB3  19 
ATOM 6322  N N    . LEU B 1 64  ? 9.384   4.876   11.222  1.00 0.00 ? 64  LEU B N    19 
ATOM 6323  C CA   . LEU B 1 64  ? 10.194  5.768   12.099  1.00 0.00 ? 64  LEU B CA   19 
ATOM 6324  C C    . LEU B 1 64  ? 11.033  6.688   11.213  1.00 0.00 ? 64  LEU B C    19 
ATOM 6325  O O    . LEU B 1 64  ? 11.274  7.832   11.532  1.00 0.00 ? 64  LEU B O    19 
ATOM 6326  C CB   . LEU B 1 64  ? 11.119  4.916   12.969  1.00 0.00 ? 64  LEU B CB   19 
ATOM 6327  C CG   . LEU B 1 64  ? 10.282  4.145   13.986  1.00 0.00 ? 64  LEU B CG   19 
ATOM 6328  C CD1  . LEU B 1 64  ? 11.060  2.922   14.470  1.00 0.00 ? 64  LEU B CD1  19 
ATOM 6329  C CD2  . LEU B 1 64  ? 9.967   5.052   15.179  1.00 0.00 ? 64  LEU B CD2  19 
ATOM 6330  H H    . LEU B 1 64  ? 9.612   3.926   11.145  1.00 0.00 ? 64  LEU B H    19 
ATOM 6331  H HA   . LEU B 1 64  ? 9.541   6.359   12.725  1.00 0.00 ? 64  LEU B HA   19 
ATOM 6332  H HB2  . LEU B 1 64  ? 11.660  4.220   12.345  1.00 0.00 ? 64  LEU B HB2  19 
ATOM 6333  H HB3  . LEU B 1 64  ? 11.819  5.553   13.487  1.00 0.00 ? 64  LEU B HB3  19 
ATOM 6334  H HG   . LEU B 1 64  ? 9.361   3.826   13.520  1.00 0.00 ? 64  LEU B HG   19 
ATOM 6335  H HD11 . LEU B 1 64  ? 12.013  3.235   14.867  1.00 0.00 ? 64  LEU B HD11 19 
ATOM 6336  H HD12 . LEU B 1 64  ? 10.496  2.418   15.242  1.00 0.00 ? 64  LEU B HD12 19 
ATOM 6337  H HD13 . LEU B 1 64  ? 11.218  2.246   13.642  1.00 0.00 ? 64  LEU B HD13 19 
ATOM 6338  H HD21 . LEU B 1 64  ? 9.713   6.039   14.822  1.00 0.00 ? 64  LEU B HD21 19 
ATOM 6339  H HD22 . LEU B 1 64  ? 9.133   4.643   15.730  1.00 0.00 ? 64  LEU B HD22 19 
ATOM 6340  H HD23 . LEU B 1 64  ? 10.830  5.112   15.823  1.00 0.00 ? 64  LEU B HD23 19 
ATOM 6341  N N    . TYR B 1 65  ? 11.470  6.186   10.097  1.00 0.00 ? 65  TYR B N    19 
ATOM 6342  C CA   . TYR B 1 65  ? 12.288  7.009   9.166   1.00 0.00 ? 65  TYR B CA   19 
ATOM 6343  C C    . TYR B 1 65  ? 11.613  8.367   8.957   1.00 0.00 ? 65  TYR B C    19 
ATOM 6344  O O    . TYR B 1 65  ? 12.264  9.376   8.768   1.00 0.00 ? 65  TYR B O    19 
ATOM 6345  C CB   . TYR B 1 65  ? 12.392  6.273   7.830   1.00 0.00 ? 65  TYR B CB   19 
ATOM 6346  C CG   . TYR B 1 65  ? 13.102  7.137   6.821   1.00 0.00 ? 65  TYR B CG   19 
ATOM 6347  C CD1  . TYR B 1 65  ? 12.368  8.018   6.017   1.00 0.00 ? 65  TYR B CD1  19 
ATOM 6348  C CD2  . TYR B 1 65  ? 14.493  7.051   6.683   1.00 0.00 ? 65  TYR B CD2  19 
ATOM 6349  C CE1  . TYR B 1 65  ? 13.026  8.815   5.073   1.00 0.00 ? 65  TYR B CE1  19 
ATOM 6350  C CE2  . TYR B 1 65  ? 15.149  7.849   5.737   1.00 0.00 ? 65  TYR B CE2  19 
ATOM 6351  C CZ   . TYR B 1 65  ? 14.417  8.729   4.933   1.00 0.00 ? 65  TYR B CZ   19 
ATOM 6352  O OH   . TYR B 1 65  ? 15.065  9.514   4.001   1.00 0.00 ? 65  TYR B OH   19 
ATOM 6353  H H    . TYR B 1 65  ? 11.253  5.262   9.868   1.00 0.00 ? 65  TYR B H    19 
ATOM 6354  H HA   . TYR B 1 65  ? 13.275  7.154   9.578   1.00 0.00 ? 65  TYR B HA   19 
ATOM 6355  H HB2  . TYR B 1 65  ? 12.946  5.355   7.968   1.00 0.00 ? 65  TYR B HB2  19 
ATOM 6356  H HB3  . TYR B 1 65  ? 11.401  6.043   7.469   1.00 0.00 ? 65  TYR B HB3  19 
ATOM 6357  H HD1  . TYR B 1 65  ? 11.293  8.082   6.125   1.00 0.00 ? 65  TYR B HD1  19 
ATOM 6358  H HD2  . TYR B 1 65  ? 15.061  6.372   7.309   1.00 0.00 ? 65  TYR B HD2  19 
ATOM 6359  H HE1  . TYR B 1 65  ? 12.461  9.495   4.452   1.00 0.00 ? 65  TYR B HE1  19 
ATOM 6360  H HE2  . TYR B 1 65  ? 16.221  7.780   5.625   1.00 0.00 ? 65  TYR B HE2  19 
ATOM 6361  H HH   . TYR B 1 65  ? 14.400  9.934   3.451   1.00 0.00 ? 65  TYR B HH   19 
ATOM 6362  N N    . ASN B 1 66  ? 10.308  8.399   8.995   1.00 0.00 ? 66  ASN B N    19 
ATOM 6363  C CA   . ASN B 1 66  ? 9.578   9.683   8.806   1.00 0.00 ? 66  ASN B CA   19 
ATOM 6364  C C    . ASN B 1 66  ? 9.265   10.286  10.170  1.00 0.00 ? 66  ASN B C    19 
ATOM 6365  O O    . ASN B 1 66  ? 9.514   11.446  10.429  1.00 0.00 ? 66  ASN B O    19 
ATOM 6366  C CB   . ASN B 1 66  ? 8.265   9.404   8.092   1.00 0.00 ? 66  ASN B CB   19 
ATOM 6367  C CG   . ASN B 1 66  ? 7.858   10.620  7.260   1.00 0.00 ? 66  ASN B CG   19 
ATOM 6368  O OD1  . ASN B 1 66  ? 8.502   10.945  6.282   1.00 0.00 ? 66  ASN B OD1  19 
ATOM 6369  N ND2  . ASN B 1 66  ? 6.807   11.313  7.607   1.00 0.00 ? 66  ASN B ND2  19 
ATOM 6370  H H    . ASN B 1 66  ? 9.806   7.573   9.151   1.00 0.00 ? 66  ASN B H    19 
ATOM 6371  H HA   . ASN B 1 66  ? 10.175  10.369  8.224   1.00 0.00 ? 66  ASN B HA   19 
ATOM 6372  H HB2  . ASN B 1 66  ? 8.379   8.543   7.451   1.00 0.00 ? 66  ASN B HB2  19 
ATOM 6373  H HB3  . ASN B 1 66  ? 7.506   9.203   8.832   1.00 0.00 ? 66  ASN B HB3  19 
ATOM 6374  H HD21 . ASN B 1 66  ? 6.287   11.051  8.396   1.00 0.00 ? 66  ASN B HD21 19 
ATOM 6375  H HD22 . ASN B 1 66  ? 6.540   12.095  7.081   1.00 0.00 ? 66  ASN B HD22 19 
ATOM 6376  N N    . GLN B 1 67  ? 8.715   9.490   11.046  1.00 0.00 ? 67  GLN B N    19 
ATOM 6377  C CA   . GLN B 1 67  ? 8.370   9.983   12.409  1.00 0.00 ? 67  GLN B CA   19 
ATOM 6378  C C    . GLN B 1 67  ? 9.590   10.645  13.049  1.00 0.00 ? 67  GLN B C    19 
ATOM 6379  O O    . GLN B 1 67  ? 9.480   11.366  14.021  1.00 0.00 ? 67  GLN B O    19 
ATOM 6380  C CB   . GLN B 1 67  ? 7.921   8.800   13.269  1.00 0.00 ? 67  GLN B CB   19 
ATOM 6381  C CG   . GLN B 1 67  ? 6.406   8.623   13.146  1.00 0.00 ? 67  GLN B CG   19 
ATOM 6382  C CD   . GLN B 1 67  ? 5.698   9.798   13.824  1.00 0.00 ? 67  GLN B CD   19 
ATOM 6383  O OE1  . GLN B 1 67  ? 6.292   10.509  14.610  1.00 0.00 ? 67  GLN B OE1  19 
ATOM 6384  N NE2  . GLN B 1 67  ? 4.444   10.033  13.549  1.00 0.00 ? 67  GLN B NE2  19 
ATOM 6385  H H    . GLN B 1 67  ? 8.527   8.560   10.801  1.00 0.00 ? 67  GLN B H    19 
ATOM 6386  H HA   . GLN B 1 67  ? 7.572   10.699  12.338  1.00 0.00 ? 67  GLN B HA   19 
ATOM 6387  H HB2  . GLN B 1 67  ? 8.417   7.902   12.929  1.00 0.00 ? 67  GLN B HB2  19 
ATOM 6388  H HB3  . GLN B 1 67  ? 8.179   8.982   14.301  1.00 0.00 ? 67  GLN B HB3  19 
ATOM 6389  H HG2  . GLN B 1 67  ? 6.132   8.591   12.101  1.00 0.00 ? 67  GLN B HG2  19 
ATOM 6390  H HG3  . GLN B 1 67  ? 6.111   7.702   13.625  1.00 0.00 ? 67  GLN B HG3  19 
ATOM 6391  H HE21 . GLN B 1 67  ? 3.965   9.460   12.915  1.00 0.00 ? 67  GLN B HE21 19 
ATOM 6392  H HE22 . GLN B 1 67  ? 3.982   10.783  13.977  1.00 0.00 ? 67  GLN B HE22 19 
ATOM 6393  N N    . HIS B 1 68  ? 10.748  10.407  12.511  1.00 0.00 ? 68  HIS B N    19 
ATOM 6394  C CA   . HIS B 1 68  ? 11.980  11.021  13.083  1.00 0.00 ? 68  HIS B CA   19 
ATOM 6395  C C    . HIS B 1 68  ? 12.256  12.352  12.382  1.00 0.00 ? 68  HIS B C    19 
ATOM 6396  O O    . HIS B 1 68  ? 12.597  13.336  13.008  1.00 0.00 ? 68  HIS B O    19 
ATOM 6397  C CB   . HIS B 1 68  ? 13.169  10.081  12.872  1.00 0.00 ? 68  HIS B CB   19 
ATOM 6398  C CG   . HIS B 1 68  ? 13.302  9.161   14.053  1.00 0.00 ? 68  HIS B CG   19 
ATOM 6399  N ND1  . HIS B 1 68  ? 12.685  7.921   14.104  1.00 0.00 ? 68  HIS B ND1  19 
ATOM 6400  C CD2  . HIS B 1 68  ? 13.989  9.287   15.233  1.00 0.00 ? 68  HIS B CD2  19 
ATOM 6401  C CE1  . HIS B 1 68  ? 13.011  7.354   15.279  1.00 0.00 ? 68  HIS B CE1  19 
ATOM 6402  N NE2  . HIS B 1 68  ? 13.805  8.145   16.007  1.00 0.00 ? 68  HIS B NE2  19 
ATOM 6403  H H    . HIS B 1 68  ? 10.807  9.825   11.730  1.00 0.00 ? 68  HIS B H    19 
ATOM 6404  H HA   . HIS B 1 68  ? 11.839  11.194  14.140  1.00 0.00 ? 68  HIS B HA   19 
ATOM 6405  H HB2  . HIS B 1 68  ? 13.013  9.498   11.977  1.00 0.00 ? 68  HIS B HB2  19 
ATOM 6406  H HB3  . HIS B 1 68  ? 14.073  10.663  12.770  1.00 0.00 ? 68  HIS B HB3  19 
ATOM 6407  H HD1  . HIS B 1 68  ? 12.115  7.528   13.411  1.00 0.00 ? 68  HIS B HD1  19 
ATOM 6408  H HD2  . HIS B 1 68  ? 14.584  10.142  15.515  1.00 0.00 ? 68  HIS B HD2  19 
ATOM 6409  H HE1  . HIS B 1 68  ? 12.675  6.378   15.594  1.00 0.00 ? 68  HIS B HE1  19 
ATOM 6410  N N    . ASN B 1 69  ? 12.115  12.389  11.085  1.00 0.00 ? 69  ASN B N    19 
ATOM 6411  C CA   . ASN B 1 69  ? 12.372  13.654  10.343  1.00 0.00 ? 69  ASN B CA   19 
ATOM 6412  C C    . ASN B 1 69  ? 11.036  14.302  9.956   1.00 0.00 ? 69  ASN B C    19 
ATOM 6413  O O    . ASN B 1 69  ? 10.339  13.800  9.097   1.00 0.00 ? 69  ASN B O    19 
ATOM 6414  C CB   . ASN B 1 69  ? 13.166  13.341  9.073   1.00 0.00 ? 69  ASN B CB   19 
ATOM 6415  C CG   . ASN B 1 69  ? 14.529  12.761  9.453   1.00 0.00 ? 69  ASN B CG   19 
ATOM 6416  O OD1  . ASN B 1 69  ? 14.626  11.939  10.343  1.00 0.00 ? 69  ASN B OD1  19 
ATOM 6417  N ND2  . ASN B 1 69  ? 15.595  13.156  8.812   1.00 0.00 ? 69  ASN B ND2  19 
ATOM 6418  H H    . ASN B 1 69  ? 11.841  11.584  10.600  1.00 0.00 ? 69  ASN B H    19 
ATOM 6419  H HA   . ASN B 1 69  ? 12.943  14.326  10.964  1.00 0.00 ? 69  ASN B HA   19 
ATOM 6420  H HB2  . ASN B 1 69  ? 12.621  12.623  8.477   1.00 0.00 ? 69  ASN B HB2  19 
ATOM 6421  H HB3  . ASN B 1 69  ? 13.308  14.248  8.504   1.00 0.00 ? 69  ASN B HB3  19 
ATOM 6422  H HD21 . ASN B 1 69  ? 15.517  13.819  8.094   1.00 0.00 ? 69  ASN B HD21 19 
ATOM 6423  H HD22 . ASN B 1 69  ? 16.473  12.789  9.048   1.00 0.00 ? 69  ASN B HD22 19 
ATOM 6424  N N    . PRO B 1 70  ? 10.719  15.400  10.597  1.00 0.00 ? 70  PRO B N    19 
ATOM 6425  C CA   . PRO B 1 70  ? 9.471   16.135  10.330  1.00 0.00 ? 70  PRO B CA   19 
ATOM 6426  C C    . PRO B 1 70  ? 9.603   16.944  9.037   1.00 0.00 ? 70  PRO B C    19 
ATOM 6427  O O    . PRO B 1 70  ? 10.379  17.874  8.951   1.00 0.00 ? 70  PRO B O    19 
ATOM 6428  C CB   . PRO B 1 70  ? 9.328   17.056  11.544  1.00 0.00 ? 70  PRO B CB   19 
ATOM 6429  C CG   . PRO B 1 70  ? 10.746  17.213  12.142  1.00 0.00 ? 70  PRO B CG   19 
ATOM 6430  C CD   . PRO B 1 70  ? 11.569  16.011  11.641  1.00 0.00 ? 70  PRO B CD   19 
ATOM 6431  H HA   . PRO B 1 70  ? 8.634   15.459  10.276  1.00 0.00 ? 70  PRO B HA   19 
ATOM 6432  H HB2  . PRO B 1 70  ? 8.943   18.019  11.234  1.00 0.00 ? 70  PRO B HB2  19 
ATOM 6433  H HB3  . PRO B 1 70  ? 8.672   16.610  12.275  1.00 0.00 ? 70  PRO B HB3  19 
ATOM 6434  H HG2  . PRO B 1 70  ? 11.190  18.139  11.801  1.00 0.00 ? 70  PRO B HG2  19 
ATOM 6435  H HG3  . PRO B 1 70  ? 10.698  17.197  13.219  1.00 0.00 ? 70  PRO B HG3  19 
ATOM 6436  H HD2  . PRO B 1 70  ? 12.507  16.346  11.221  1.00 0.00 ? 70  PRO B HD2  19 
ATOM 6437  H HD3  . PRO B 1 70  ? 11.739  15.309  12.441  1.00 0.00 ? 70  PRO B HD3  19 
ATOM 6438  N N    . GLY B 1 71  ? 8.853   16.594  8.029   1.00 0.00 ? 71  GLY B N    19 
ATOM 6439  C CA   . GLY B 1 71  ? 8.939   17.339  6.742   1.00 0.00 ? 71  GLY B CA   19 
ATOM 6440  C C    . GLY B 1 71  ? 9.353   16.383  5.622   1.00 0.00 ? 71  GLY B C    19 
ATOM 6441  O O    . GLY B 1 71  ? 9.522   16.778  4.486   1.00 0.00 ? 71  GLY B O    19 
ATOM 6442  H H    . GLY B 1 71  ? 8.235   15.838  8.117   1.00 0.00 ? 71  GLY B H    19 
ATOM 6443  H HA2  . GLY B 1 71  ? 7.975   17.770  6.512   1.00 0.00 ? 71  GLY B HA2  19 
ATOM 6444  H HA3  . GLY B 1 71  ? 9.673   18.125  6.830   1.00 0.00 ? 71  GLY B HA3  19 
ATOM 6445  N N    . ALA B 1 72  ? 9.513   15.123  5.931   1.00 0.00 ? 72  ALA B N    19 
ATOM 6446  C CA   . ALA B 1 72  ? 9.910   14.146  4.885   1.00 0.00 ? 72  ALA B CA   19 
ATOM 6447  C C    . ALA B 1 72  ? 8.656   13.518  4.288   1.00 0.00 ? 72  ALA B C    19 
ATOM 6448  O O    . ALA B 1 72  ? 7.844   12.937  4.980   1.00 0.00 ? 72  ALA B O    19 
ATOM 6449  C CB   . ALA B 1 72  ? 10.780  13.052  5.500   1.00 0.00 ? 72  ALA B CB   19 
ATOM 6450  H H    . ALA B 1 72  ? 9.369   14.822  6.846   1.00 0.00 ? 72  ALA B H    19 
ATOM 6451  H HA   . ALA B 1 72  ? 10.464  14.654  4.109   1.00 0.00 ? 72  ALA B HA   19 
ATOM 6452  H HB1  . ALA B 1 72  ? 11.558  13.504  6.096   1.00 0.00 ? 72  ALA B HB1  19 
ATOM 6453  H HB2  . ALA B 1 72  ? 10.170  12.417  6.124   1.00 0.00 ? 72  ALA B HB2  19 
ATOM 6454  H HB3  . ALA B 1 72  ? 11.226  12.464  4.712   1.00 0.00 ? 72  ALA B HB3  19 
ATOM 6455  N N    . SER B 1 73  ? 8.495   13.639  3.008   1.00 0.00 ? 73  SER B N    19 
ATOM 6456  C CA   . SER B 1 73  ? 7.295   13.059  2.344   1.00 0.00 ? 73  SER B CA   19 
ATOM 6457  C C    . SER B 1 73  ? 7.615   11.653  1.833   1.00 0.00 ? 73  SER B C    19 
ATOM 6458  O O    . SER B 1 73  ? 7.281   11.298  0.720   1.00 0.00 ? 73  SER B O    19 
ATOM 6459  C CB   . SER B 1 73  ? 6.887   13.947  1.166   1.00 0.00 ? 73  SER B CB   19 
ATOM 6460  O OG   . SER B 1 73  ? 7.727   15.093  1.129   1.00 0.00 ? 73  SER B OG   19 
ATOM 6461  H H    . SER B 1 73  ? 9.167   14.115  2.485   1.00 0.00 ? 73  SER B H    19 
ATOM 6462  H HA   . SER B 1 73  ? 6.482   13.007  3.052   1.00 0.00 ? 73  SER B HA   19 
ATOM 6463  H HB2  . SER B 1 73  ? 6.993   13.399  0.245   1.00 0.00 ? 73  SER B HB2  19 
ATOM 6464  H HB3  . SER B 1 73  ? 5.854   14.248  1.286   1.00 0.00 ? 73  SER B HB3  19 
ATOM 6465  H HG   . SER B 1 73  ? 8.381   14.958  0.439   1.00 0.00 ? 73  SER B HG   19 
ATOM 6466  N N    . ALA B 1 74  ? 8.255   10.847  2.634   1.00 0.00 ? 74  ALA B N    19 
ATOM 6467  C CA   . ALA B 1 74  ? 8.586   9.465   2.186   1.00 0.00 ? 74  ALA B CA   19 
ATOM 6468  C C    . ALA B 1 74  ? 7.923   8.453   3.121   1.00 0.00 ? 74  ALA B C    19 
ATOM 6469  O O    . ALA B 1 74  ? 8.243   7.280   3.109   1.00 0.00 ? 74  ALA B O    19 
ATOM 6470  C CB   . ALA B 1 74  ? 10.103  9.266   2.203   1.00 0.00 ? 74  ALA B CB   19 
ATOM 6471  H H    . ALA B 1 74  ? 8.515   11.149  3.530   1.00 0.00 ? 74  ALA B H    19 
ATOM 6472  H HA   . ALA B 1 74  ? 8.216   9.319   1.183   1.00 0.00 ? 74  ALA B HA   19 
ATOM 6473  H HB1  . ALA B 1 74  ? 10.529  9.804   3.037   1.00 0.00 ? 74  ALA B HB1  19 
ATOM 6474  H HB2  . ALA B 1 74  ? 10.327  8.214   2.302   1.00 0.00 ? 74  ALA B HB2  19 
ATOM 6475  H HB3  . ALA B 1 74  ? 10.526  9.638   1.281   1.00 0.00 ? 74  ALA B HB3  19 
ATOM 6476  N N    . ALA B 1 75  ? 6.998   8.895   3.927   1.00 0.00 ? 75  ALA B N    19 
ATOM 6477  C CA   . ALA B 1 75  ? 6.305   7.962   4.860   1.00 0.00 ? 75  ALA B CA   19 
ATOM 6478  C C    . ALA B 1 75  ? 5.777   6.759   4.067   1.00 0.00 ? 75  ALA B C    19 
ATOM 6479  O O    . ALA B 1 75  ? 6.011   6.660   2.878   1.00 0.00 ? 75  ALA B O    19 
ATOM 6480  C CB   . ALA B 1 75  ? 5.143   8.700   5.526   1.00 0.00 ? 75  ALA B CB   19 
ATOM 6481  H H    . ALA B 1 75  ? 6.754   9.845   3.916   1.00 0.00 ? 75  ALA B H    19 
ATOM 6482  H HA   . ALA B 1 75  ? 7.002   7.622   5.614   1.00 0.00 ? 75  ALA B HA   19 
ATOM 6483  H HB1  . ALA B 1 75  ? 5.190   9.749   5.271   1.00 0.00 ? 75  ALA B HB1  19 
ATOM 6484  H HB2  . ALA B 1 75  ? 4.208   8.286   5.180   1.00 0.00 ? 75  ALA B HB2  19 
ATOM 6485  H HB3  . ALA B 1 75  ? 5.212   8.587   6.598   1.00 0.00 ? 75  ALA B HB3  19 
ATOM 6486  N N    . PRO B 1 76  ? 5.083   5.875   4.742   1.00 0.00 ? 76  PRO B N    19 
ATOM 6487  C CA   . PRO B 1 76  ? 4.521   4.667   4.111   1.00 0.00 ? 76  PRO B CA   19 
ATOM 6488  C C    . PRO B 1 76  ? 3.248   5.017   3.347   1.00 0.00 ? 76  PRO B C    19 
ATOM 6489  O O    . PRO B 1 76  ? 3.013   6.157   2.999   1.00 0.00 ? 76  PRO B O    19 
ATOM 6490  C CB   . PRO B 1 76  ? 4.202   3.755   5.295   1.00 0.00 ? 76  PRO B CB   19 
ATOM 6491  C CG   . PRO B 1 76  ? 4.051   4.679   6.522   1.00 0.00 ? 76  PRO B CG   19 
ATOM 6492  C CD   . PRO B 1 76  ? 4.793   5.988   6.186   1.00 0.00 ? 76  PRO B CD   19 
ATOM 6493  H HA   . PRO B 1 76  ? 5.242   4.197   3.464   1.00 0.00 ? 76  PRO B HA   19 
ATOM 6494  H HB2  . PRO B 1 76  ? 3.280   3.219   5.113   1.00 0.00 ? 76  PRO B HB2  19 
ATOM 6495  H HB3  . PRO B 1 76  ? 5.011   3.061   5.460   1.00 0.00 ? 76  PRO B HB3  19 
ATOM 6496  H HG2  . PRO B 1 76  ? 3.002   4.882   6.700   1.00 0.00 ? 76  PRO B HG2  19 
ATOM 6497  H HG3  . PRO B 1 76  ? 4.492   4.219   7.388   1.00 0.00 ? 76  PRO B HG3  19 
ATOM 6498  H HD2  . PRO B 1 76  ? 4.154   6.835   6.386   1.00 0.00 ? 76  PRO B HD2  19 
ATOM 6499  H HD3  . PRO B 1 76  ? 5.711   6.059   6.749   1.00 0.00 ? 76  PRO B HD3  19 
ATOM 6500  N N    . CYS B 1 77  ? 2.421   4.046   3.081   1.00 0.00 ? 77  CYS B N    19 
ATOM 6501  C CA   . CYS B 1 77  ? 1.167   4.334   2.338   1.00 0.00 ? 77  CYS B CA   19 
ATOM 6502  C C    . CYS B 1 77  ? 0.036   3.428   2.832   1.00 0.00 ? 77  CYS B C    19 
ATOM 6503  O O    . CYS B 1 77  ? -0.079  2.289   2.430   1.00 0.00 ? 77  CYS B O    19 
ATOM 6504  C CB   . CYS B 1 77  ? 1.398   4.091   0.846   1.00 0.00 ? 77  CYS B CB   19 
ATOM 6505  S SG   . CYS B 1 77  ? 1.028   5.606   -0.072  1.00 0.00 ? 77  CYS B SG   19 
ATOM 6506  H H    . CYS B 1 77  ? 2.626   3.131   3.368   1.00 0.00 ? 77  CYS B H    19 
ATOM 6507  H HA   . CYS B 1 77  ? 0.891   5.366   2.491   1.00 0.00 ? 77  CYS B HA   19 
ATOM 6508  H HB2  . CYS B 1 77  ? 2.427   3.812   0.681   1.00 0.00 ? 77  CYS B HB2  19 
ATOM 6509  H HB3  . CYS B 1 77  ? 0.750   3.298   0.505   1.00 0.00 ? 77  CYS B HB3  19 
ATOM 6510  N N    . CYS B 1 78  ? -0.808  3.932   3.693   1.00 0.00 ? 78  CYS B N    19 
ATOM 6511  C CA   . CYS B 1 78  ? -1.947  3.106   4.195   1.00 0.00 ? 78  CYS B CA   19 
ATOM 6512  C C    . CYS B 1 78  ? -2.724  2.559   2.987   1.00 0.00 ? 78  CYS B C    19 
ATOM 6513  O O    . CYS B 1 78  ? -2.920  3.250   2.008   1.00 0.00 ? 78  CYS B O    19 
ATOM 6514  C CB   . CYS B 1 78  ? -2.865  3.987   5.046   1.00 0.00 ? 78  CYS B CB   19 
ATOM 6515  S SG   . CYS B 1 78  ? -4.343  3.057   5.523   1.00 0.00 ? 78  CYS B SG   19 
ATOM 6516  H H    . CYS B 1 78  ? -0.698  4.855   4.002   1.00 0.00 ? 78  CYS B H    19 
ATOM 6517  H HA   . CYS B 1 78  ? -1.571  2.286   4.788   1.00 0.00 ? 78  CYS B HA   19 
ATOM 6518  H HB2  . CYS B 1 78  ? -2.338  4.306   5.929   1.00 0.00 ? 78  CYS B HB2  19 
ATOM 6519  H HB3  . CYS B 1 78  ? -3.159  4.854   4.473   1.00 0.00 ? 78  CYS B HB3  19 
ATOM 6520  N N    . VAL B 1 79  ? -3.153  1.322   3.032   1.00 0.00 ? 79  VAL B N    19 
ATOM 6521  C CA   . VAL B 1 79  ? -3.892  0.753   1.868   1.00 0.00 ? 79  VAL B CA   19 
ATOM 6522  C C    . VAL B 1 79  ? -4.971  -0.232  2.355   1.00 0.00 ? 79  VAL B C    19 
ATOM 6523  O O    . VAL B 1 79  ? -5.146  -0.408  3.539   1.00 0.00 ? 79  VAL B O    19 
ATOM 6524  C CB   . VAL B 1 79  ? -2.887  0.052   0.936   1.00 0.00 ? 79  VAL B CB   19 
ATOM 6525  C CG1  . VAL B 1 79  ? -1.538  0.756   1.032   1.00 0.00 ? 79  VAL B CG1  19 
ATOM 6526  C CG2  . VAL B 1 79  ? -2.702  -1.414  1.343   1.00 0.00 ? 79  VAL B CG2  19 
ATOM 6527  H H    . VAL B 1 79  ? -2.981  0.770   3.815   1.00 0.00 ? 79  VAL B H    19 
ATOM 6528  H HA   . VAL B 1 79  ? -4.366  1.557   1.336   1.00 0.00 ? 79  VAL B HA   19 
ATOM 6529  H HB   . VAL B 1 79  ? -3.239  0.108   -0.081  1.00 0.00 ? 79  VAL B HB   19 
ATOM 6530  H HG11 . VAL B 1 79  ? -1.690  1.825   1.025   1.00 0.00 ? 79  VAL B HG11 19 
ATOM 6531  H HG12 . VAL B 1 79  ? -1.048  0.469   1.951   1.00 0.00 ? 79  VAL B HG12 19 
ATOM 6532  H HG13 . VAL B 1 79  ? -0.926  0.473   0.192   1.00 0.00 ? 79  VAL B HG13 19 
ATOM 6533  H HG21 . VAL B 1 79  ? -2.760  -1.499  2.418   1.00 0.00 ? 79  VAL B HG21 19 
ATOM 6534  H HG22 . VAL B 1 79  ? -3.475  -2.015  0.890   1.00 0.00 ? 79  VAL B HG22 19 
ATOM 6535  H HG23 . VAL B 1 79  ? -1.734  -1.760  1.007   1.00 0.00 ? 79  VAL B HG23 19 
ATOM 6536  N N    . PRO B 1 80  ? -5.667  -0.839  1.424   1.00 0.00 ? 80  PRO B N    19 
ATOM 6537  C CA   . PRO B 1 80  ? -6.737  -1.804  1.735   1.00 0.00 ? 80  PRO B CA   19 
ATOM 6538  C C    . PRO B 1 80  ? -6.139  -3.178  2.047   1.00 0.00 ? 80  PRO B C    19 
ATOM 6539  O O    . PRO B 1 80  ? -5.777  -3.926  1.160   1.00 0.00 ? 80  PRO B O    19 
ATOM 6540  C CB   . PRO B 1 80  ? -7.565  -1.848  0.449   1.00 0.00 ? 80  PRO B CB   19 
ATOM 6541  C CG   . PRO B 1 80  ? -6.631  -1.369  -0.688  1.00 0.00 ? 80  PRO B CG   19 
ATOM 6542  C CD   . PRO B 1 80  ? -5.458  -0.625  -0.021  1.00 0.00 ? 80  PRO B CD   19 
ATOM 6543  H HA   . PRO B 1 80  ? -7.344  -1.453  2.553   1.00 0.00 ? 80  PRO B HA   19 
ATOM 6544  H HB2  . PRO B 1 80  ? -7.898  -2.860  0.259   1.00 0.00 ? 80  PRO B HB2  19 
ATOM 6545  H HB3  . PRO B 1 80  ? -8.411  -1.185  0.528   1.00 0.00 ? 80  PRO B HB3  19 
ATOM 6546  H HG2  . PRO B 1 80  ? -6.263  -2.219  -1.246  1.00 0.00 ? 80  PRO B HG2  19 
ATOM 6547  H HG3  . PRO B 1 80  ? -7.161  -0.697  -1.344  1.00 0.00 ? 80  PRO B HG3  19 
ATOM 6548  H HD2  . PRO B 1 80  ? -4.522  -1.059  -0.336  1.00 0.00 ? 80  PRO B HD2  19 
ATOM 6549  H HD3  . PRO B 1 80  ? -5.492  0.428   -0.253  1.00 0.00 ? 80  PRO B HD3  19 
ATOM 6550  N N    . GLN B 1 81  ? -6.029  -3.512  3.301   1.00 0.00 ? 81  GLN B N    19 
ATOM 6551  C CA   . GLN B 1 81  ? -5.449  -4.832  3.676   1.00 0.00 ? 81  GLN B CA   19 
ATOM 6552  C C    . GLN B 1 81  ? -6.440  -5.946  3.335   1.00 0.00 ? 81  GLN B C    19 
ATOM 6553  O O    . GLN B 1 81  ? -6.232  -6.717  2.420   1.00 0.00 ? 81  GLN B O    19 
ATOM 6554  C CB   . GLN B 1 81  ? -5.166  -4.850  5.178   1.00 0.00 ? 81  GLN B CB   19 
ATOM 6555  C CG   . GLN B 1 81  ? -3.965  -5.752  5.460   1.00 0.00 ? 81  GLN B CG   19 
ATOM 6556  C CD   . GLN B 1 81  ? -4.443  -7.052  6.109   1.00 0.00 ? 81  GLN B CD   19 
ATOM 6557  O OE1  . GLN B 1 81  ? -4.693  -8.028  5.429   1.00 0.00 ? 81  GLN B OE1  19 
ATOM 6558  N NE2  . GLN B 1 81  ? -4.579  -7.109  7.406   1.00 0.00 ? 81  GLN B NE2  19 
ATOM 6559  H H    . GLN B 1 81  ? -6.322  -2.892  4.000   1.00 0.00 ? 81  GLN B H    19 
ATOM 6560  H HA   . GLN B 1 81  ? -4.528  -4.989  3.135   1.00 0.00 ? 81  GLN B HA   19 
ATOM 6561  H HB2  . GLN B 1 81  ? -4.952  -3.847  5.514   1.00 0.00 ? 81  GLN B HB2  19 
ATOM 6562  H HB3  . GLN B 1 81  ? -6.030  -5.229  5.703   1.00 0.00 ? 81  GLN B HB3  19 
ATOM 6563  H HG2  . GLN B 1 81  ? -3.460  -5.978  4.532   1.00 0.00 ? 81  GLN B HG2  19 
ATOM 6564  H HG3  . GLN B 1 81  ? -3.285  -5.247  6.128   1.00 0.00 ? 81  GLN B HG3  19 
ATOM 6565  H HE21 . GLN B 1 81  ? -4.376  -6.322  7.954   1.00 0.00 ? 81  GLN B HE21 19 
ATOM 6566  H HE22 . GLN B 1 81  ? -4.884  -7.937  7.830   1.00 0.00 ? 81  GLN B HE22 19 
ATOM 6567  N N    . ALA B 1 82  ? -7.516  -6.037  4.065   1.00 0.00 ? 82  ALA B N    19 
ATOM 6568  C CA   . ALA B 1 82  ? -8.520  -7.101  3.785   1.00 0.00 ? 82  ALA B CA   19 
ATOM 6569  C C    . ALA B 1 82  ? -9.549  -6.577  2.783   1.00 0.00 ? 82  ALA B C    19 
ATOM 6570  O O    . ALA B 1 82  ? -10.176 -5.559  2.998   1.00 0.00 ? 82  ALA B O    19 
ATOM 6571  C CB   . ALA B 1 82  ? -9.226  -7.494  5.084   1.00 0.00 ? 82  ALA B CB   19 
ATOM 6572  H H    . ALA B 1 82  ? -7.665  -5.404  4.799   1.00 0.00 ? 82  ALA B H    19 
ATOM 6573  H HA   . ALA B 1 82  ? -8.021  -7.965  3.370   1.00 0.00 ? 82  ALA B HA   19 
ATOM 6574  H HB1  . ALA B 1 82  ? -8.632  -7.172  5.928   1.00 0.00 ? 82  ALA B HB1  19 
ATOM 6575  H HB2  . ALA B 1 82  ? -10.195 -7.019  5.125   1.00 0.00 ? 82  ALA B HB2  19 
ATOM 6576  H HB3  . ALA B 1 82  ? -9.348  -8.567  5.119   1.00 0.00 ? 82  ALA B HB3  19 
ATOM 6577  N N    . LEU B 1 83  ? -9.729  -7.264  1.688   1.00 0.00 ? 83  LEU B N    19 
ATOM 6578  C CA   . LEU B 1 83  ? -10.716 -6.803  0.677   1.00 0.00 ? 83  LEU B CA   19 
ATOM 6579  C C    . LEU B 1 83  ? -11.908 -7.754  0.657   1.00 0.00 ? 83  LEU B C    19 
ATOM 6580  O O    . LEU B 1 83  ? -12.078 -8.584  1.527   1.00 0.00 ? 83  LEU B O    19 
ATOM 6581  C CB   . LEU B 1 83  ? -10.067 -6.791  -0.710  1.00 0.00 ? 83  LEU B CB   19 
ATOM 6582  C CG   . LEU B 1 83  ? -8.990  -5.714  -0.760  1.00 0.00 ? 83  LEU B CG   19 
ATOM 6583  C CD1  . LEU B 1 83  ? -7.879  -6.144  -1.719  1.00 0.00 ? 83  LEU B CD1  19 
ATOM 6584  C CD2  . LEU B 1 83  ? -9.610  -4.409  -1.256  1.00 0.00 ? 83  LEU B CD2  19 
ATOM 6585  H H    . LEU B 1 83  ? -9.215  -8.082  1.531   1.00 0.00 ? 83  LEU B H    19 
ATOM 6586  H HA   . LEU B 1 83  ? -11.052 -5.807  0.926   1.00 0.00 ? 83  LEU B HA   19 
ATOM 6587  H HB2  . LEU B 1 83  ? -9.626  -7.755  -0.911  1.00 0.00 ? 83  LEU B HB2  19 
ATOM 6588  H HB3  . LEU B 1 83  ? -10.816 -6.578  -1.457  1.00 0.00 ? 83  LEU B HB3  19 
ATOM 6589  H HG   . LEU B 1 83  ? -8.584  -5.571  0.227   1.00 0.00 ? 83  LEU B HG   19 
ATOM 6590  H HD11 . LEU B 1 83  ? -7.676  -7.196  -1.587  1.00 0.00 ? 83  LEU B HD11 19 
ATOM 6591  H HD12 . LEU B 1 83  ? -8.192  -5.963  -2.737  1.00 0.00 ? 83  LEU B HD12 19 
ATOM 6592  H HD13 . LEU B 1 83  ? -6.984  -5.576  -1.511  1.00 0.00 ? 83  LEU B HD13 19 
ATOM 6593  H HD21 . LEU B 1 83  ? -10.295 -4.621  -2.063  1.00 0.00 ? 83  LEU B HD21 19 
ATOM 6594  H HD22 . LEU B 1 83  ? -10.145 -3.934  -0.446  1.00 0.00 ? 83  LEU B HD22 19 
ATOM 6595  H HD23 . LEU B 1 83  ? -8.831  -3.751  -1.608  1.00 0.00 ? 83  LEU B HD23 19 
ATOM 6596  N N    . GLU B 1 84  ? -12.724 -7.636  -0.344  1.00 0.00 ? 84  GLU B N    19 
ATOM 6597  C CA   . GLU B 1 84  ? -13.911 -8.524  -0.462  1.00 0.00 ? 84  GLU B CA   19 
ATOM 6598  C C    . GLU B 1 84  ? -14.287 -8.635  -1.939  1.00 0.00 ? 84  GLU B C    19 
ATOM 6599  O O    . GLU B 1 84  ? -13.942 -7.778  -2.726  1.00 0.00 ? 84  GLU B O    19 
ATOM 6600  C CB   . GLU B 1 84  ? -15.079 -7.929  0.327   1.00 0.00 ? 84  GLU B CB   19 
ATOM 6601  C CG   . GLU B 1 84  ? -15.093 -8.515  1.740   1.00 0.00 ? 84  GLU B CG   19 
ATOM 6602  C CD   . GLU B 1 84  ? -15.534 -9.978  1.683   1.00 0.00 ? 84  GLU B CD   19 
ATOM 6603  O OE1  . GLU B 1 84  ? -14.749 -10.796 1.233   1.00 0.00 ? 84  GLU B OE1  19 
ATOM 6604  O OE2  . GLU B 1 84  ? -16.651 -10.255 2.089   1.00 0.00 ? 84  GLU B OE2  19 
ATOM 6605  H H    . GLU B 1 84  ? -12.550 -6.961  -1.030  1.00 0.00 ? 84  GLU B H    19 
ATOM 6606  H HA   . GLU B 1 84  ? -13.670 -9.504  -0.074  1.00 0.00 ? 84  GLU B HA   19 
ATOM 6607  H HB2  . GLU B 1 84  ? -14.965 -6.856  0.384   1.00 0.00 ? 84  GLU B HB2  19 
ATOM 6608  H HB3  . GLU B 1 84  ? -16.008 -8.168  -0.168  1.00 0.00 ? 84  GLU B HB3  19 
ATOM 6609  H HG2  . GLU B 1 84  ? -14.100 -8.454  2.165   1.00 0.00 ? 84  GLU B HG2  19 
ATOM 6610  H HG3  . GLU B 1 84  ? -15.782 -7.957  2.355   1.00 0.00 ? 84  GLU B HG3  19 
ATOM 6611  N N    . PRO B 1 85  ? -14.979 -9.690  -2.276  1.00 0.00 ? 85  PRO B N    19 
ATOM 6612  C CA   . PRO B 1 85  ? -15.409 -9.940  -3.660  1.00 0.00 ? 85  PRO B CA   19 
ATOM 6613  C C    . PRO B 1 85  ? -16.573 -9.019  -4.037  1.00 0.00 ? 85  PRO B C    19 
ATOM 6614  O O    . PRO B 1 85  ? -16.843 -8.042  -3.367  1.00 0.00 ? 85  PRO B O    19 
ATOM 6615  C CB   . PRO B 1 85  ? -15.828 -11.411 -3.649  1.00 0.00 ? 85  PRO B CB   19 
ATOM 6616  C CG   . PRO B 1 85  ? -16.134 -11.767 -2.176  1.00 0.00 ? 85  PRO B CG   19 
ATOM 6617  C CD   . PRO B 1 85  ? -15.402 -10.724 -1.311  1.00 0.00 ? 85  PRO B CD   19 
ATOM 6618  H HA   . PRO B 1 85  ? -14.585 -9.800  -4.340  1.00 0.00 ? 85  PRO B HA   19 
ATOM 6619  H HB2  . PRO B 1 85  ? -16.710 -11.551 -4.259  1.00 0.00 ? 85  PRO B HB2  19 
ATOM 6620  H HB3  . PRO B 1 85  ? -15.022 -12.030 -4.012  1.00 0.00 ? 85  PRO B HB3  19 
ATOM 6621  H HG2  . PRO B 1 85  ? -17.197 -11.718 -2.000  1.00 0.00 ? 85  PRO B HG2  19 
ATOM 6622  H HG3  . PRO B 1 85  ? -15.760 -12.752 -1.949  1.00 0.00 ? 85  PRO B HG3  19 
ATOM 6623  H HD2  . PRO B 1 85  ? -16.075 -10.306 -0.574  1.00 0.00 ? 85  PRO B HD2  19 
ATOM 6624  H HD3  . PRO B 1 85  ? -14.540 -11.163 -0.834  1.00 0.00 ? 85  PRO B HD3  19 
ATOM 6625  N N    . LEU B 1 86  ? -17.248 -9.304  -5.117  1.00 0.00 ? 86  LEU B N    19 
ATOM 6626  C CA   . LEU B 1 86  ? -18.371 -8.425  -5.544  1.00 0.00 ? 86  LEU B CA   19 
ATOM 6627  C C    . LEU B 1 86  ? -19.219 -9.162  -6.596  1.00 0.00 ? 86  LEU B C    19 
ATOM 6628  O O    . LEU B 1 86  ? -18.790 -9.336  -7.715  1.00 0.00 ? 86  LEU B O    19 
ATOM 6629  C CB   . LEU B 1 86  ? -17.753 -7.127  -6.113  1.00 0.00 ? 86  LEU B CB   19 
ATOM 6630  C CG   . LEU B 1 86  ? -18.613 -6.512  -7.227  1.00 0.00 ? 86  LEU B CG   19 
ATOM 6631  C CD1  . LEU B 1 86  ? -19.696 -5.617  -6.629  1.00 0.00 ? 86  LEU B CD1  19 
ATOM 6632  C CD2  . LEU B 1 86  ? -17.719 -5.665  -8.135  1.00 0.00 ? 86  LEU B CD2  19 
ATOM 6633  H H    . LEU B 1 86  ? -17.004 -10.087 -5.658  1.00 0.00 ? 86  LEU B H    19 
ATOM 6634  H HA   . LEU B 1 86  ? -18.979 -8.183  -4.686  1.00 0.00 ? 86  LEU B HA   19 
ATOM 6635  H HB2  . LEU B 1 86  ? -17.651 -6.408  -5.315  1.00 0.00 ? 86  LEU B HB2  19 
ATOM 6636  H HB3  . LEU B 1 86  ? -16.773 -7.351  -6.508  1.00 0.00 ? 86  LEU B HB3  19 
ATOM 6637  H HG   . LEU B 1 86  ? -19.070 -7.288  -7.804  1.00 0.00 ? 86  LEU B HG   19 
ATOM 6638  H HD11 . LEU B 1 86  ? -19.502 -5.469  -5.578  1.00 0.00 ? 86  LEU B HD11 19 
ATOM 6639  H HD12 . LEU B 1 86  ? -19.690 -4.663  -7.135  1.00 0.00 ? 86  LEU B HD12 19 
ATOM 6640  H HD13 . LEU B 1 86  ? -20.660 -6.086  -6.758  1.00 0.00 ? 86  LEU B HD13 19 
ATOM 6641  H HD21 . LEU B 1 86  ? -16.697 -6.003  -8.051  1.00 0.00 ? 86  LEU B HD21 19 
ATOM 6642  H HD22 . LEU B 1 86  ? -18.047 -5.764  -9.158  1.00 0.00 ? 86  LEU B HD22 19 
ATOM 6643  H HD23 . LEU B 1 86  ? -17.782 -4.629  -7.837  1.00 0.00 ? 86  LEU B HD23 19 
ATOM 6644  N N    . PRO B 1 87  ? -20.403 -9.569  -6.205  1.00 0.00 ? 87  PRO B N    19 
ATOM 6645  C CA   . PRO B 1 87  ? -21.331 -10.284 -7.105  1.00 0.00 ? 87  PRO B CA   19 
ATOM 6646  C C    . PRO B 1 87  ? -21.963 -9.295  -8.084  1.00 0.00 ? 87  PRO B C    19 
ATOM 6647  O O    . PRO B 1 87  ? -22.784 -8.478  -7.715  1.00 0.00 ? 87  PRO B O    19 
ATOM 6648  C CB   . PRO B 1 87  ? -22.376 -10.874 -6.153  1.00 0.00 ? 87  PRO B CB   19 
ATOM 6649  C CG   . PRO B 1 87  ? -22.317 -10.025 -4.862  1.00 0.00 ? 87  PRO B CG   19 
ATOM 6650  C CD   . PRO B 1 87  ? -20.930 -9.351  -4.843  1.00 0.00 ? 87  PRO B CD   19 
ATOM 6651  H HA   . PRO B 1 87  ? -20.826 -11.074 -7.638  1.00 0.00 ? 87  PRO B HA   19 
ATOM 6652  H HB2  . PRO B 1 87  ? -23.360 -10.812 -6.598  1.00 0.00 ? 87  PRO B HB2  19 
ATOM 6653  H HB3  . PRO B 1 87  ? -22.134 -11.900 -5.925  1.00 0.00 ? 87  PRO B HB3  19 
ATOM 6654  H HG2  . PRO B 1 87  ? -23.096 -9.276  -4.875  1.00 0.00 ? 87  PRO B HG2  19 
ATOM 6655  H HG3  . PRO B 1 87  ? -22.425 -10.659 -3.995  1.00 0.00 ? 87  PRO B HG3  19 
ATOM 6656  H HD2  . PRO B 1 87  ? -21.029 -8.295  -4.636  1.00 0.00 ? 87  PRO B HD2  19 
ATOM 6657  H HD3  . PRO B 1 87  ? -20.289 -9.824  -4.115  1.00 0.00 ? 87  PRO B HD3  19 
ATOM 6658  N N    . ILE B 1 88  ? -21.570 -9.348  -9.325  1.00 0.00 ? 88  ILE B N    19 
ATOM 6659  C CA   . ILE B 1 88  ? -22.130 -8.397  -10.322 1.00 0.00 ? 88  ILE B CA   19 
ATOM 6660  C C    . ILE B 1 88  ? -22.861 -9.148  -11.424 1.00 0.00 ? 88  ILE B C    19 
ATOM 6661  O O    . ILE B 1 88  ? -23.214 -10.302 -11.295 1.00 0.00 ? 88  ILE B O    19 
ATOM 6662  C CB   . ILE B 1 88  ? -20.988 -7.596  -10.957 1.00 0.00 ? 88  ILE B CB   19 
ATOM 6663  C CG1  . ILE B 1 88  ? -20.270 -8.452  -12.008 1.00 0.00 ? 88  ILE B CG1  19 
ATOM 6664  C CG2  . ILE B 1 88  ? -19.993 -7.206  -9.879  1.00 0.00 ? 88  ILE B CG2  19 
ATOM 6665  C CD1  . ILE B 1 88  ? -18.976 -7.763  -12.432 1.00 0.00 ? 88  ILE B CD1  19 
ATOM 6666  H H    . ILE B 1 88  ? -20.896 -10.005 -9.599  1.00 0.00 ? 88  ILE B H    19 
ATOM 6667  H HA   . ILE B 1 88  ? -22.812 -7.719  -9.831  1.00 0.00 ? 88  ILE B HA   19 
ATOM 6668  H HB   . ILE B 1 88  ? -21.384 -6.706  -11.422 1.00 0.00 ? 88  ILE B HB   19 
ATOM 6669  H HG12 . ILE B 1 88  ? -20.047 -9.417  -11.589 1.00 0.00 ? 88  ILE B HG12 19 
ATOM 6670  H HG13 . ILE B 1 88  ? -20.901 -8.576  -12.868 1.00 0.00 ? 88  ILE B HG13 19 
ATOM 6671  H HG21 . ILE B 1 88  ? -20.512 -7.086  -8.940  1.00 0.00 ? 88  ILE B HG21 19 
ATOM 6672  H HG22 . ILE B 1 88  ? -19.246 -7.981  -9.783  1.00 0.00 ? 88  ILE B HG22 19 
ATOM 6673  H HG23 . ILE B 1 88  ? -19.517 -6.278  -10.150 1.00 0.00 ? 88  ILE B HG23 19 
ATOM 6674  H HD11 . ILE B 1 88  ? -18.342 -7.629  -11.571 1.00 0.00 ? 88  ILE B HD11 19 
ATOM 6675  H HD12 . ILE B 1 88  ? -18.469 -8.374  -13.163 1.00 0.00 ? 88  ILE B HD12 19 
ATOM 6676  H HD13 . ILE B 1 88  ? -19.208 -6.801  -12.865 1.00 0.00 ? 88  ILE B HD13 19 
ATOM 6677  N N    . VAL B 1 89  ? -23.048 -8.481  -12.521 1.00 0.00 ? 89  VAL B N    19 
ATOM 6678  C CA   . VAL B 1 89  ? -23.716 -9.093  -13.692 1.00 0.00 ? 89  VAL B CA   19 
ATOM 6679  C C    . VAL B 1 89  ? -23.399 -8.235  -14.909 1.00 0.00 ? 89  VAL B C    19 
ATOM 6680  O O    . VAL B 1 89  ? -23.855 -7.118  -15.022 1.00 0.00 ? 89  VAL B O    19 
ATOM 6681  C CB   . VAL B 1 89  ? -25.231 -9.129  -13.493 1.00 0.00 ? 89  VAL B CB   19 
ATOM 6682  C CG1  . VAL B 1 89  ? -25.853 -9.989  -14.592 1.00 0.00 ? 89  VAL B CG1  19 
ATOM 6683  C CG2  . VAL B 1 89  ? -25.569 -9.723  -12.124 1.00 0.00 ? 89  VAL B CG2  19 
ATOM 6684  H H    . VAL B 1 89  ? -22.715 -7.563  -12.583 1.00 0.00 ? 89  VAL B H    19 
ATOM 6685  H HA   . VAL B 1 89  ? -23.334 -10.091 -13.842 1.00 0.00 ? 89  VAL B HA   19 
ATOM 6686  H HB   . VAL B 1 89  ? -25.624 -8.125  -13.560 1.00 0.00 ? 89  VAL B HB   19 
ATOM 6687  H HG11 . VAL B 1 89  ? -25.074 -10.537 -15.103 1.00 0.00 ? 89  VAL B HG11 19 
ATOM 6688  H HG12 . VAL B 1 89  ? -26.553 -10.684 -14.153 1.00 0.00 ? 89  VAL B HG12 19 
ATOM 6689  H HG13 . VAL B 1 89  ? -26.367 -9.354  -15.297 1.00 0.00 ? 89  VAL B HG13 19 
ATOM 6690  H HG21 . VAL B 1 89  ? -25.112 -10.695 -12.029 1.00 0.00 ? 89  VAL B HG21 19 
ATOM 6691  H HG22 . VAL B 1 89  ? -25.195 -9.072  -11.347 1.00 0.00 ? 89  VAL B HG22 19 
ATOM 6692  H HG23 . VAL B 1 89  ? -26.640 -9.819  -12.028 1.00 0.00 ? 89  VAL B HG23 19 
ATOM 6693  N N    . TYR B 1 90  ? -22.613 -8.735  -15.813 1.00 0.00 ? 90  TYR B N    19 
ATOM 6694  C CA   . TYR B 1 90  ? -22.262 -7.923  -17.005 1.00 0.00 ? 90  TYR B CA   19 
ATOM 6695  C C    . TYR B 1 90  ? -22.640 -8.672  -18.278 1.00 0.00 ? 90  TYR B C    19 
ATOM 6696  O O    . TYR B 1 90  ? -23.302 -9.688  -18.239 1.00 0.00 ? 90  TYR B O    19 
ATOM 6697  C CB   . TYR B 1 90  ? -20.762 -7.640  -16.999 1.00 0.00 ? 90  TYR B CB   19 
ATOM 6698  C CG   . TYR B 1 90  ? -20.007 -8.866  -16.538 1.00 0.00 ? 90  TYR B CG   19 
ATOM 6699  C CD1  . TYR B 1 90  ? -19.601 -9.833  -17.465 1.00 0.00 ? 90  TYR B CD1  19 
ATOM 6700  C CD2  . TYR B 1 90  ? -19.704 -9.027  -15.181 1.00 0.00 ? 90  TYR B CD2  19 
ATOM 6701  C CE1  . TYR B 1 90  ? -18.895 -10.963 -17.033 1.00 0.00 ? 90  TYR B CE1  19 
ATOM 6702  C CE2  . TYR B 1 90  ? -18.996 -10.156 -14.749 1.00 0.00 ? 90  TYR B CE2  19 
ATOM 6703  C CZ   . TYR B 1 90  ? -18.592 -11.123 -15.675 1.00 0.00 ? 90  TYR B CZ   19 
ATOM 6704  O OH   . TYR B 1 90  ? -17.894 -12.236 -15.252 1.00 0.00 ? 90  TYR B OH   19 
ATOM 6705  H H    . TYR B 1 90  ? -22.248 -9.637  -15.704 1.00 0.00 ? 90  TYR B H    19 
ATOM 6706  H HA   . TYR B 1 90  ? -22.799 -6.985  -16.965 1.00 0.00 ? 90  TYR B HA   19 
ATOM 6707  H HB2  . TYR B 1 90  ? -20.442 -7.370  -17.994 1.00 0.00 ? 90  TYR B HB2  19 
ATOM 6708  H HB3  . TYR B 1 90  ? -20.562 -6.827  -16.324 1.00 0.00 ? 90  TYR B HB3  19 
ATOM 6709  H HD1  . TYR B 1 90  ? -19.835 -9.711  -18.512 1.00 0.00 ? 90  TYR B HD1  19 
ATOM 6710  H HD2  . TYR B 1 90  ? -20.015 -8.280  -14.468 1.00 0.00 ? 90  TYR B HD2  19 
ATOM 6711  H HE1  . TYR B 1 90  ? -18.580 -11.707 -17.746 1.00 0.00 ? 90  TYR B HE1  19 
ATOM 6712  H HE2  . TYR B 1 90  ? -18.763 -10.281 -13.701 1.00 0.00 ? 90  TYR B HE2  19 
ATOM 6713  H HH   . TYR B 1 90  ? -17.303 -11.964 -14.546 1.00 0.00 ? 90  TYR B HH   19 
ATOM 6714  N N    . TYR B 1 91  ? -22.235 -8.171  -19.410 1.00 0.00 ? 91  TYR B N    19 
ATOM 6715  C CA   . TYR B 1 91  ? -22.583 -8.849  -20.687 1.00 0.00 ? 91  TYR B CA   19 
ATOM 6716  C C    . TYR B 1 91  ? -21.346 -9.006  -21.567 1.00 0.00 ? 91  TYR B C    19 
ATOM 6717  O O    . TYR B 1 91  ? -20.621 -8.063  -21.819 1.00 0.00 ? 91  TYR B O    19 
ATOM 6718  C CB   . TYR B 1 91  ? -23.606 -8.005  -21.438 1.00 0.00 ? 91  TYR B CB   19 
ATOM 6719  C CG   . TYR B 1 91  ? -24.994 -8.458  -21.079 1.00 0.00 ? 91  TYR B CG   19 
ATOM 6720  C CD1  . TYR B 1 91  ? -25.626 -7.934  -19.951 1.00 0.00 ? 91  TYR B CD1  19 
ATOM 6721  C CD2  . TYR B 1 91  ? -25.651 -9.393  -21.884 1.00 0.00 ? 91  TYR B CD2  19 
ATOM 6722  C CE1  . TYR B 1 91  ? -26.924 -8.347  -19.622 1.00 0.00 ? 91  TYR B CE1  19 
ATOM 6723  C CE2  . TYR B 1 91  ? -26.946 -9.806  -21.562 1.00 0.00 ? 91  TYR B CE2  19 
ATOM 6724  C CZ   . TYR B 1 91  ? -27.585 -9.283  -20.429 1.00 0.00 ? 91  TYR B CZ   19 
ATOM 6725  O OH   . TYR B 1 91  ? -28.864 -9.689  -20.109 1.00 0.00 ? 91  TYR B OH   19 
ATOM 6726  H H    . TYR B 1 91  ? -21.714 -7.344  -19.419 1.00 0.00 ? 91  TYR B H    19 
ATOM 6727  H HA   . TYR B 1 91  ? -23.005 -9.820  -20.478 1.00 0.00 ? 91  TYR B HA   19 
ATOM 6728  H HB2  . TYR B 1 91  ? -23.485 -6.967  -21.167 1.00 0.00 ? 91  TYR B HB2  19 
ATOM 6729  H HB3  . TYR B 1 91  ? -23.455 -8.120  -22.501 1.00 0.00 ? 91  TYR B HB3  19 
ATOM 6730  H HD1  . TYR B 1 91  ? -25.109 -7.214  -19.329 1.00 0.00 ? 91  TYR B HD1  19 
ATOM 6731  H HD2  . TYR B 1 91  ? -25.156 -9.800  -22.750 1.00 0.00 ? 91  TYR B HD2  19 
ATOM 6732  H HE1  . TYR B 1 91  ? -27.414 -7.944  -18.748 1.00 0.00 ? 91  TYR B HE1  19 
ATOM 6733  H HE2  . TYR B 1 91  ? -27.450 -10.526 -22.189 1.00 0.00 ? 91  TYR B HE2  19 
ATOM 6734  H HH   . TYR B 1 91  ? -29.088 -9.319  -19.252 1.00 0.00 ? 91  TYR B HH   19 
ATOM 6735  N N    . VAL B 1 92  ? -21.124 -10.187 -22.069 1.00 0.00 ? 92  VAL B N    19 
ATOM 6736  C CA   . VAL B 1 92  ? -19.966 -10.408 -22.973 1.00 0.00 ? 92  VAL B CA   19 
ATOM 6737  C C    . VAL B 1 92  ? -20.505 -10.480 -24.394 1.00 0.00 ? 92  VAL B C    19 
ATOM 6738  O O    . VAL B 1 92  ? -20.916 -11.522 -24.863 1.00 0.00 ? 92  VAL B O    19 
ATOM 6739  C CB   . VAL B 1 92  ? -19.266 -11.720 -22.630 1.00 0.00 ? 92  VAL B CB   19 
ATOM 6740  C CG1  . VAL B 1 92  ? -17.783 -11.589 -22.969 1.00 0.00 ? 92  VAL B CG1  19 
ATOM 6741  C CG2  . VAL B 1 92  ? -19.434 -12.018 -21.140 1.00 0.00 ? 92  VAL B CG2  19 
ATOM 6742  H H    . VAL B 1 92  ? -21.739 -10.921 -21.876 1.00 0.00 ? 92  VAL B H    19 
ATOM 6743  H HA   . VAL B 1 92  ? -19.272 -9.586  -22.886 1.00 0.00 ? 92  VAL B HA   19 
ATOM 6744  H HB   . VAL B 1 92  ? -19.699 -12.521 -23.213 1.00 0.00 ? 92  VAL B HB   19 
ATOM 6745  H HG11 . VAL B 1 92  ? -17.673 -11.002 -23.870 1.00 0.00 ? 92  VAL B HG11 19 
ATOM 6746  H HG12 . VAL B 1 92  ? -17.271 -11.097 -22.155 1.00 0.00 ? 92  VAL B HG12 19 
ATOM 6747  H HG13 . VAL B 1 92  ? -17.360 -12.569 -23.123 1.00 0.00 ? 92  VAL B HG13 19 
ATOM 6748  H HG21 . VAL B 1 92  ? -19.498 -11.089 -20.592 1.00 0.00 ? 92  VAL B HG21 19 
ATOM 6749  H HG22 . VAL B 1 92  ? -20.338 -12.589 -20.987 1.00 0.00 ? 92  VAL B HG22 19 
ATOM 6750  H HG23 . VAL B 1 92  ? -18.586 -12.586 -20.788 1.00 0.00 ? 92  VAL B HG23 19 
ATOM 6751  N N    . GLY B 1 93  ? -20.536 -9.374  -25.073 1.00 0.00 ? 93  GLY B N    19 
ATOM 6752  C CA   . GLY B 1 93  ? -21.086 -9.370  -26.454 1.00 0.00 ? 93  GLY B CA   19 
ATOM 6753  C C    . GLY B 1 93  ? -22.616 -9.387  -26.368 1.00 0.00 ? 93  GLY B C    19 
ATOM 6754  O O    . GLY B 1 93  ? -23.266 -8.373  -26.523 1.00 0.00 ? 93  GLY B O    19 
ATOM 6755  H H    . GLY B 1 93  ? -20.216 -8.543  -24.665 1.00 0.00 ? 93  GLY B H    19 
ATOM 6756  H HA2  . GLY B 1 93  ? -20.757 -8.481  -26.973 1.00 0.00 ? 93  GLY B HA2  19 
ATOM 6757  H HA3  . GLY B 1 93  ? -20.747 -10.248 -26.983 1.00 0.00 ? 93  GLY B HA3  19 
ATOM 6758  N N    . ARG B 1 94  ? -23.195 -10.533 -26.122 1.00 0.00 ? 94  ARG B N    19 
ATOM 6759  C CA   . ARG B 1 94  ? -24.685 -10.614 -26.030 1.00 0.00 ? 94  ARG B CA   19 
ATOM 6760  C C    . ARG B 1 94  ? -25.118 -11.631 -24.966 1.00 0.00 ? 94  ARG B C    19 
ATOM 6761  O O    . ARG B 1 94  ? -26.293 -11.798 -24.706 1.00 0.00 ? 94  ARG B O    19 
ATOM 6762  C CB   . ARG B 1 94  ? -25.237 -11.056 -27.379 1.00 0.00 ? 94  ARG B CB   19 
ATOM 6763  C CG   . ARG B 1 94  ? -24.791 -10.075 -28.465 1.00 0.00 ? 94  ARG B CG   19 
ATOM 6764  C CD   . ARG B 1 94  ? -25.563 -8.762  -28.318 1.00 0.00 ? 94  ARG B CD   19 
ATOM 6765  N NE   . ARG B 1 94  ? -24.696 -7.624  -28.735 1.00 0.00 ? 94  ARG B NE   19 
ATOM 6766  C CZ   . ARG B 1 94  ? -25.152 -6.724  -29.563 1.00 0.00 ? 94  ARG B CZ   19 
ATOM 6767  N NH1  . ARG B 1 94  ? -26.416 -6.399  -29.542 1.00 0.00 ? 94  ARG B NH1  19 
ATOM 6768  N NH2  . ARG B 1 94  ? -24.344 -6.149  -30.412 1.00 0.00 ? 94  ARG B NH2  19 
ATOM 6769  H H    . ARG B 1 94  ? -22.652 -11.338 -26.009 1.00 0.00 ? 94  ARG B H    19 
ATOM 6770  H HA   . ARG B 1 94  ? -25.087 -9.645  -25.776 1.00 0.00 ? 94  ARG B HA   19 
ATOM 6771  H HB2  . ARG B 1 94  ? -24.857 -12.042 -27.602 1.00 0.00 ? 94  ARG B HB2  19 
ATOM 6772  H HB3  . ARG B 1 94  ? -26.316 -11.083 -27.339 1.00 0.00 ? 94  ARG B HB3  19 
ATOM 6773  H HG2  . ARG B 1 94  ? -23.732 -9.884  -28.365 1.00 0.00 ? 94  ARG B HG2  19 
ATOM 6774  H HG3  . ARG B 1 94  ? -24.989 -10.499 -29.437 1.00 0.00 ? 94  ARG B HG3  19 
ATOM 6775  H HD2  . ARG B 1 94  ? -26.444 -8.791  -28.942 1.00 0.00 ? 94  ARG B HD2  19 
ATOM 6776  H HD3  . ARG B 1 94  ? -25.857 -8.631  -27.286 1.00 0.00 ? 94  ARG B HD3  19 
ATOM 6777  H HE   . ARG B 1 94  ? -23.783 -7.551  -28.388 1.00 0.00 ? 94  ARG B HE   19 
ATOM 6778  H HH11 . ARG B 1 94  ? -27.035 -6.839  -28.891 1.00 0.00 ? 94  ARG B HH11 19 
ATOM 6779  H HH12 . ARG B 1 94  ? -26.766 -5.710  -30.176 1.00 0.00 ? 94  ARG B HH12 19 
ATOM 6780  H HH21 . ARG B 1 94  ? -23.377 -6.398  -30.428 1.00 0.00 ? 94  ARG B HH21 19 
ATOM 6781  H HH22 . ARG B 1 94  ? -24.695 -5.460  -31.046 1.00 0.00 ? 94  ARG B HH22 19 
ATOM 6782  N N    . LYS B 1 95  ? -24.196 -12.316 -24.353 1.00 0.00 ? 95  LYS B N    19 
ATOM 6783  C CA   . LYS B 1 95  ? -24.587 -13.317 -23.320 1.00 0.00 ? 95  LYS B CA   19 
ATOM 6784  C C    . LYS B 1 95  ? -24.415 -12.705 -21.925 1.00 0.00 ? 95  LYS B C    19 
ATOM 6785  O O    . LYS B 1 95  ? -23.393 -12.124 -21.634 1.00 0.00 ? 95  LYS B O    19 
ATOM 6786  C CB   . LYS B 1 95  ? -23.692 -14.552 -23.447 1.00 0.00 ? 95  LYS B CB   19 
ATOM 6787  C CG   . LYS B 1 95  ? -24.031 -15.299 -24.739 1.00 0.00 ? 95  LYS B CG   19 
ATOM 6788  C CD   . LYS B 1 95  ? -23.113 -16.516 -24.881 1.00 0.00 ? 95  LYS B CD   19 
ATOM 6789  C CE   . LYS B 1 95  ? -23.448 -17.258 -26.177 1.00 0.00 ? 95  LYS B CE   19 
ATOM 6790  N NZ   . LYS B 1 95  ? -24.853 -17.751 -26.119 1.00 0.00 ? 95  LYS B NZ   19 
ATOM 6791  H H    . LYS B 1 95  ? -23.255 -12.177 -24.571 1.00 0.00 ? 95  LYS B H    19 
ATOM 6792  H HA   . LYS B 1 95  ? -25.615 -13.602 -23.473 1.00 0.00 ? 95  LYS B HA   19 
ATOM 6793  H HB2  . LYS B 1 95  ? -22.656 -14.245 -23.468 1.00 0.00 ? 95  LYS B HB2  19 
ATOM 6794  H HB3  . LYS B 1 95  ? -23.857 -15.204 -22.602 1.00 0.00 ? 95  LYS B HB3  19 
ATOM 6795  H HG2  . LYS B 1 95  ? -25.061 -15.625 -24.706 1.00 0.00 ? 95  LYS B HG2  19 
ATOM 6796  H HG3  . LYS B 1 95  ? -23.887 -14.642 -25.583 1.00 0.00 ? 95  LYS B HG3  19 
ATOM 6797  H HD2  . LYS B 1 95  ? -22.084 -16.189 -24.908 1.00 0.00 ? 95  LYS B HD2  19 
ATOM 6798  H HD3  . LYS B 1 95  ? -23.260 -17.178 -24.042 1.00 0.00 ? 95  LYS B HD3  19 
ATOM 6799  H HE2  . LYS B 1 95  ? -23.334 -16.588 -27.016 1.00 0.00 ? 95  LYS B HE2  19 
ATOM 6800  H HE3  . LYS B 1 95  ? -22.777 -18.097 -26.293 1.00 0.00 ? 95  LYS B HE3  19 
ATOM 6801  H HZ1  . LYS B 1 95  ? -25.244 -17.576 -25.173 1.00 0.00 ? 95  LYS B HZ1  19 
ATOM 6802  H HZ2  . LYS B 1 95  ? -25.424 -17.247 -26.829 1.00 0.00 ? 95  LYS B HZ2  19 
ATOM 6803  H HZ3  . LYS B 1 95  ? -24.872 -18.770 -26.317 1.00 0.00 ? 95  LYS B HZ3  19 
ATOM 6804  N N    . PRO B 1 96  ? -25.421 -12.854 -21.099 1.00 0.00 ? 96  PRO B N    19 
ATOM 6805  C CA   . PRO B 1 96  ? -25.395 -12.321 -19.727 1.00 0.00 ? 96  PRO B CA   19 
ATOM 6806  C C    . PRO B 1 96  ? -24.546 -13.229 -18.829 1.00 0.00 ? 96  PRO B C    19 
ATOM 6807  O O    . PRO B 1 96  ? -24.594 -14.438 -18.941 1.00 0.00 ? 96  PRO B O    19 
ATOM 6808  C CB   . PRO B 1 96  ? -26.865 -12.352 -19.302 1.00 0.00 ? 96  PRO B CB   19 
ATOM 6809  C CG   . PRO B 1 96  ? -27.558 -13.401 -20.204 1.00 0.00 ? 96  PRO B CG   19 
ATOM 6810  C CD   . PRO B 1 96  ? -26.667 -13.567 -21.449 1.00 0.00 ? 96  PRO B CD   19 
ATOM 6811  H HA   . PRO B 1 96  ? -25.024 -11.308 -19.720 1.00 0.00 ? 96  PRO B HA   19 
ATOM 6812  H HB2  . PRO B 1 96  ? -26.943 -12.641 -18.262 1.00 0.00 ? 96  PRO B HB2  19 
ATOM 6813  H HB3  . PRO B 1 96  ? -27.317 -11.386 -19.454 1.00 0.00 ? 96  PRO B HB3  19 
ATOM 6814  H HG2  . PRO B 1 96  ? -27.643 -14.341 -19.677 1.00 0.00 ? 96  PRO B HG2  19 
ATOM 6815  H HG3  . PRO B 1 96  ? -28.534 -13.050 -20.498 1.00 0.00 ? 96  PRO B HG3  19 
ATOM 6816  H HD2  . PRO B 1 96  ? -26.469 -14.613 -21.635 1.00 0.00 ? 96  PRO B HD2  19 
ATOM 6817  H HD3  . PRO B 1 96  ? -27.128 -13.107 -22.310 1.00 0.00 ? 96  PRO B HD3  19 
ATOM 6818  N N    . LYS B 1 97  ? -23.765 -12.665 -17.946 1.00 0.00 ? 97  LYS B N    19 
ATOM 6819  C CA   . LYS B 1 97  ? -22.918 -13.516 -17.062 1.00 0.00 ? 97  LYS B CA   19 
ATOM 6820  C C    . LYS B 1 97  ? -22.789 -12.881 -15.674 1.00 0.00 ? 97  LYS B C    19 
ATOM 6821  O O    . LYS B 1 97  ? -22.301 -11.777 -15.529 1.00 0.00 ? 97  LYS B O    19 
ATOM 6822  C CB   . LYS B 1 97  ? -21.524 -13.657 -17.678 1.00 0.00 ? 97  LYS B CB   19 
ATOM 6823  C CG   . LYS B 1 97  ? -21.591 -14.569 -18.904 1.00 0.00 ? 97  LYS B CG   19 
ATOM 6824  C CD   . LYS B 1 97  ? -20.553 -15.684 -18.770 1.00 0.00 ? 97  LYS B CD   19 
ATOM 6825  C CE   . LYS B 1 97  ? -21.096 -16.967 -19.402 1.00 0.00 ? 97  LYS B CE   19 
ATOM 6826  N NZ   . LYS B 1 97  ? -20.273 -18.128 -18.957 1.00 0.00 ? 97  LYS B NZ   19 
ATOM 6827  H H    . LYS B 1 97  ? -23.732 -11.689 -17.867 1.00 0.00 ? 97  LYS B H    19 
ATOM 6828  H HA   . LYS B 1 97  ? -23.367 -14.494 -16.968 1.00 0.00 ? 97  LYS B HA   19 
ATOM 6829  H HB2  . LYS B 1 97  ? -21.162 -12.682 -17.974 1.00 0.00 ? 97  LYS B HB2  19 
ATOM 6830  H HB3  . LYS B 1 97  ? -20.851 -14.085 -16.950 1.00 0.00 ? 97  LYS B HB3  19 
ATOM 6831  H HG2  . LYS B 1 97  ? -22.578 -15.001 -18.977 1.00 0.00 ? 97  LYS B HG2  19 
ATOM 6832  H HG3  . LYS B 1 97  ? -21.384 -13.992 -19.794 1.00 0.00 ? 97  LYS B HG3  19 
ATOM 6833  H HD2  . LYS B 1 97  ? -19.643 -15.392 -19.273 1.00 0.00 ? 97  LYS B HD2  19 
ATOM 6834  H HD3  . LYS B 1 97  ? -20.346 -15.860 -17.724 1.00 0.00 ? 97  LYS B HD3  19 
ATOM 6835  H HE2  . LYS B 1 97  ? -22.121 -17.115 -19.094 1.00 0.00 ? 97  LYS B HE2  19 
ATOM 6836  H HE3  . LYS B 1 97  ? -21.052 -16.886 -20.478 1.00 0.00 ? 97  LYS B HE3  19 
ATOM 6837  H HZ1  . LYS B 1 97  ? -19.269 -17.936 -19.154 1.00 0.00 ? 97  LYS B HZ1  19 
ATOM 6838  H HZ2  . LYS B 1 97  ? -20.404 -18.275 -17.936 1.00 0.00 ? 97  LYS B HZ2  19 
ATOM 6839  H HZ3  . LYS B 1 97  ? -20.571 -18.982 -19.470 1.00 0.00 ? 97  LYS B HZ3  19 
ATOM 6840  N N    . VAL B 1 98  ? -23.200 -13.580 -14.652 1.00 0.00 ? 98  VAL B N    19 
ATOM 6841  C CA   . VAL B 1 98  ? -23.077 -13.032 -13.270 1.00 0.00 ? 98  VAL B CA   19 
ATOM 6842  C C    . VAL B 1 98  ? -21.781 -13.557 -12.659 1.00 0.00 ? 98  VAL B C    19 
ATOM 6843  O O    . VAL B 1 98  ? -21.509 -14.740 -12.699 1.00 0.00 ? 98  VAL B O    19 
ATOM 6844  C CB   . VAL B 1 98  ? -24.260 -13.500 -12.418 1.00 0.00 ? 98  VAL B CB   19 
ATOM 6845  C CG1  . VAL B 1 98  ? -24.009 -13.153 -10.947 1.00 0.00 ? 98  VAL B CG1  19 
ATOM 6846  C CG2  . VAL B 1 98  ? -25.537 -12.804 -12.891 1.00 0.00 ? 98  VAL B CG2  19 
ATOM 6847  H H    . VAL B 1 98  ? -23.573 -14.476 -14.789 1.00 0.00 ? 98  VAL B H    19 
ATOM 6848  H HA   . VAL B 1 98  ? -23.055 -11.952 -13.305 1.00 0.00 ? 98  VAL B HA   19 
ATOM 6849  H HB   . VAL B 1 98  ? -24.374 -14.570 -12.519 1.00 0.00 ? 98  VAL B HB   19 
ATOM 6850  H HG11 . VAL B 1 98  ? -22.992 -13.403 -10.683 1.00 0.00 ? 98  VAL B HG11 19 
ATOM 6851  H HG12 . VAL B 1 98  ? -24.170 -12.097 -10.793 1.00 0.00 ? 98  VAL B HG12 19 
ATOM 6852  H HG13 . VAL B 1 98  ? -24.690 -13.714 -10.323 1.00 0.00 ? 98  VAL B HG13 19 
ATOM 6853  H HG21 . VAL B 1 98  ? -25.285 -12.052 -13.624 1.00 0.00 ? 98  VAL B HG21 19 
ATOM 6854  H HG22 . VAL B 1 98  ? -26.201 -13.531 -13.334 1.00 0.00 ? 98  VAL B HG22 19 
ATOM 6855  H HG23 . VAL B 1 98  ? -26.024 -12.336 -12.048 1.00 0.00 ? 98  VAL B HG23 19 
ATOM 6856  N N    . GLU B 1 99  ? -20.969 -12.705 -12.097 1.00 0.00 ? 99  GLU B N    19 
ATOM 6857  C CA   . GLU B 1 99  ? -19.703 -13.204 -11.505 1.00 0.00 ? 99  GLU B CA   19 
ATOM 6858  C C    . GLU B 1 99  ? -19.532 -12.651 -10.097 1.00 0.00 ? 99  GLU B C    19 
ATOM 6859  O O    . GLU B 1 99  ? -20.467 -12.194 -9.469  1.00 0.00 ? 99  GLU B O    19 
ATOM 6860  C CB   . GLU B 1 99  ? -18.522 -12.751 -12.357 1.00 0.00 ? 99  GLU B CB   19 
ATOM 6861  C CG   . GLU B 1 99  ? -17.746 -13.974 -12.850 1.00 0.00 ? 99  GLU B CG   19 
ATOM 6862  C CD   . GLU B 1 99  ? -16.473 -14.140 -12.018 1.00 0.00 ? 99  GLU B CD   19 
ATOM 6863  O OE1  . GLU B 1 99  ? -15.470 -13.546 -12.380 1.00 0.00 ? 99  GLU B OE1  19 
ATOM 6864  O OE2  . GLU B 1 99  ? -16.521 -14.860 -11.034 1.00 0.00 ? 99  GLU B OE2  19 
ATOM 6865  H H    . GLU B 1 99  ? -21.185 -11.745 -12.067 1.00 0.00 ? 99  GLU B H    19 
ATOM 6866  H HA   . GLU B 1 99  ? -19.722 -14.280 -11.466 1.00 0.00 ? 99  GLU B HA   19 
ATOM 6867  H HB2  . GLU B 1 99  ? -18.883 -12.188 -13.199 1.00 0.00 ? 99  GLU B HB2  19 
ATOM 6868  H HB3  . GLU B 1 99  ? -17.873 -12.131 -11.764 1.00 0.00 ? 99  GLU B HB3  19 
ATOM 6869  H HG2  . GLU B 1 99  ? -18.362 -14.856 -12.749 1.00 0.00 ? 99  GLU B HG2  19 
ATOM 6870  H HG3  . GLU B 1 99  ? -17.480 -13.837 -13.888 1.00 0.00 ? 99  GLU B HG3  19 
ATOM 6871  N N    . GLN B 1 100 ? -18.333 -12.691 -9.609  1.00 0.00 ? 100 GLN B N    19 
ATOM 6872  C CA   . GLN B 1 100 ? -18.052 -12.176 -8.247  1.00 0.00 ? 100 GLN B CA   19 
ATOM 6873  C C    . GLN B 1 100 ? -16.648 -11.586 -8.241  1.00 0.00 ? 100 GLN B C    19 
ATOM 6874  O O    . GLN B 1 100 ? -15.694 -12.236 -7.863  1.00 0.00 ? 100 GLN B O    19 
ATOM 6875  C CB   . GLN B 1 100 ? -18.115 -13.322 -7.249  1.00 0.00 ? 100 GLN B CB   19 
ATOM 6876  C CG   . GLN B 1 100 ? -19.447 -14.060 -7.392  1.00 0.00 ? 100 GLN B CG   19 
ATOM 6877  C CD   . GLN B 1 100 ? -19.289 -15.207 -8.392  1.00 0.00 ? 100 GLN B CD   19 
ATOM 6878  O OE1  . GLN B 1 100 ? -18.188 -15.630 -8.682  1.00 0.00 ? 100 GLN B OE1  19 
ATOM 6879  N NE2  . GLN B 1 100 ? -20.354 -15.734 -8.934  1.00 0.00 ? 100 GLN B NE2  19 
ATOM 6880  H H    . GLN B 1 100 ? -17.605 -13.064 -10.149 1.00 0.00 ? 100 GLN B H    19 
ATOM 6881  H HA   . GLN B 1 100 ? -18.773 -11.417 -7.983  1.00 0.00 ? 100 GLN B HA   19 
ATOM 6882  H HB2  . GLN B 1 100 ? -17.302 -14.000 -7.450  1.00 0.00 ? 100 GLN B HB2  19 
ATOM 6883  H HB3  . GLN B 1 100 ? -18.023 -12.936 -6.245  1.00 0.00 ? 100 GLN B HB3  19 
ATOM 6884  H HG2  . GLN B 1 100 ? -19.744 -14.455 -6.432  1.00 0.00 ? 100 GLN B HG2  19 
ATOM 6885  H HG3  . GLN B 1 100 ? -20.201 -13.375 -7.749  1.00 0.00 ? 100 GLN B HG3  19 
ATOM 6886  H HE21 . GLN B 1 100 ? -21.242 -15.393 -8.699  1.00 0.00 ? 100 GLN B HE21 19 
ATOM 6887  H HE22 . GLN B 1 100 ? -20.264 -16.469 -9.575  1.00 0.00 ? 100 GLN B HE22 19 
ATOM 6888  N N    . LEU B 1 101 ? -16.512 -10.369 -8.672  1.00 0.00 ? 101 LEU B N    19 
ATOM 6889  C CA   . LEU B 1 101 ? -15.168 -9.744  -8.708  1.00 0.00 ? 101 LEU B CA   19 
ATOM 6890  C C    . LEU B 1 101 ? -14.434 -10.060 -7.412  1.00 0.00 ? 101 LEU B C    19 
ATOM 6891  O O    . LEU B 1 101 ? -15.026 -10.181 -6.358  1.00 0.00 ? 101 LEU B O    19 
ATOM 6892  C CB   . LEU B 1 101 ? -15.301 -8.232  -8.882  1.00 0.00 ? 101 LEU B CB   19 
ATOM 6893  C CG   . LEU B 1 101 ? -16.116 -7.917  -10.142 1.00 0.00 ? 101 LEU B CG   19 
ATOM 6894  C CD1  . LEU B 1 101 ? -15.790 -6.502  -10.620 1.00 0.00 ? 101 LEU B CD1  19 
ATOM 6895  C CD2  . LEU B 1 101 ? -15.773 -8.915  -11.252 1.00 0.00 ? 101 LEU B CD2  19 
ATOM 6896  H H    . LEU B 1 101 ? -17.291 -9.875  -8.984  1.00 0.00 ? 101 LEU B H    19 
ATOM 6897  H HA   . LEU B 1 101 ? -14.610 -10.151 -9.539  1.00 0.00 ? 101 LEU B HA   19 
ATOM 6898  H HB2  . LEU B 1 101 ? -15.801 -7.814  -8.022  1.00 0.00 ? 101 LEU B HB2  19 
ATOM 6899  H HB3  . LEU B 1 101 ? -14.315 -7.799  -8.973  1.00 0.00 ? 101 LEU B HB3  19 
ATOM 6900  H HG   . LEU B 1 101 ? -17.170 -7.982  -9.912  1.00 0.00 ? 101 LEU B HG   19 
ATOM 6901  H HD11 . LEU B 1 101 ? -14.723 -6.343  -10.575 1.00 0.00 ? 101 LEU B HD11 19 
ATOM 6902  H HD12 . LEU B 1 101 ? -16.129 -6.378  -11.638 1.00 0.00 ? 101 LEU B HD12 19 
ATOM 6903  H HD13 . LEU B 1 101 ? -16.288 -5.786  -9.985  1.00 0.00 ? 101 LEU B HD13 19 
ATOM 6904  H HD21 . LEU B 1 101 ? -14.712 -8.888  -11.445 1.00 0.00 ? 101 LEU B HD21 19 
ATOM 6905  H HD22 . LEU B 1 101 ? -16.057 -9.910  -10.940 1.00 0.00 ? 101 LEU B HD22 19 
ATOM 6906  H HD23 . LEU B 1 101 ? -16.312 -8.654  -12.150 1.00 0.00 ? 101 LEU B HD23 19 
ATOM 6907  N N    . SER B 1 102 ? -13.151 -10.224 -7.494  1.00 0.00 ? 102 SER B N    19 
ATOM 6908  C CA   . SER B 1 102 ? -12.364 -10.569 -6.273  1.00 0.00 ? 102 SER B CA   19 
ATOM 6909  C C    . SER B 1 102 ? -11.657 -9.333  -5.716  1.00 0.00 ? 102 SER B C    19 
ATOM 6910  O O    . SER B 1 102 ? -11.161 -8.506  -6.452  1.00 0.00 ? 102 SER B O    19 
ATOM 6911  C CB   . SER B 1 102 ? -11.321 -11.627 -6.629  1.00 0.00 ? 102 SER B CB   19 
ATOM 6912  O OG   . SER B 1 102 ? -10.118 -10.985 -7.029  1.00 0.00 ? 102 SER B OG   19 
ATOM 6913  H H    . SER B 1 102 ? -12.709 -10.136 -8.366  1.00 0.00 ? 102 SER B H    19 
ATOM 6914  H HA   . SER B 1 102 ? -13.030 -10.966 -5.522  1.00 0.00 ? 102 SER B HA   19 
ATOM 6915  H HB2  . SER B 1 102 ? -11.123 -12.246 -5.768  1.00 0.00 ? 102 SER B HB2  19 
ATOM 6916  H HB3  . SER B 1 102 ? -11.697 -12.246 -7.434  1.00 0.00 ? 102 SER B HB3  19 
ATOM 6917  H HG   . SER B 1 102 ? -9.621  -11.598 -7.576  1.00 0.00 ? 102 SER B HG   19 
ATOM 6918  N N    . ASN B 1 103 ? -11.593 -9.215  -4.416  1.00 0.00 ? 103 ASN B N    19 
ATOM 6919  C CA   . ASN B 1 103 ? -10.896 -8.043  -3.802  1.00 0.00 ? 103 ASN B CA   19 
ATOM 6920  C C    . ASN B 1 103 ? -11.404 -6.745  -4.425  1.00 0.00 ? 103 ASN B C    19 
ATOM 6921  O O    . ASN B 1 103 ? -10.669 -5.788  -4.571  1.00 0.00 ? 103 ASN B O    19 
ATOM 6922  C CB   . ASN B 1 103 ? -9.393  -8.164  -4.049  1.00 0.00 ? 103 ASN B CB   19 
ATOM 6923  C CG   . ASN B 1 103 ? -8.750  -8.966  -2.916  1.00 0.00 ? 103 ASN B CG   19 
ATOM 6924  O OD1  . ASN B 1 103 ? -9.438  -9.501  -2.069  1.00 0.00 ? 103 ASN B OD1  19 
ATOM 6925  N ND2  . ASN B 1 103 ? -7.450  -9.072  -2.863  1.00 0.00 ? 103 ASN B ND2  19 
ATOM 6926  H H    . ASN B 1 103 ? -11.993 -9.904  -3.840  1.00 0.00 ? 103 ASN B H    19 
ATOM 6927  H HA   . ASN B 1 103 ? -11.084 -8.025  -2.739  1.00 0.00 ? 103 ASN B HA   19 
ATOM 6928  H HB2  . ASN B 1 103 ? -9.222  -8.668  -4.990  1.00 0.00 ? 103 ASN B HB2  19 
ATOM 6929  H HB3  . ASN B 1 103 ? -8.955  -7.179  -4.084  1.00 0.00 ? 103 ASN B HB3  19 
ATOM 6930  H HD21 . ASN B 1 103 ? -6.895  -8.639  -3.545  1.00 0.00 ? 103 ASN B HD21 19 
ATOM 6931  H HD22 . ASN B 1 103 ? -7.029  -9.584  -2.141  1.00 0.00 ? 103 ASN B HD22 19 
ATOM 6932  N N    . MET B 1 104 ? -12.652 -6.695  -4.788  1.00 0.00 ? 104 MET B N    19 
ATOM 6933  C CA   . MET B 1 104 ? -13.196 -5.450  -5.391  1.00 0.00 ? 104 MET B CA   19 
ATOM 6934  C C    . MET B 1 104 ? -13.841 -4.600  -4.295  1.00 0.00 ? 104 MET B C    19 
ATOM 6935  O O    . MET B 1 104 ? -14.633 -3.720  -4.566  1.00 0.00 ? 104 MET B O    19 
ATOM 6936  C CB   . MET B 1 104 ? -14.245 -5.803  -6.448  1.00 0.00 ? 104 MET B CB   19 
ATOM 6937  C CG   . MET B 1 104 ? -14.771 -4.517  -7.089  1.00 0.00 ? 104 MET B CG   19 
ATOM 6938  S SD   . MET B 1 104 ? -14.408 -4.532  -8.861  1.00 0.00 ? 104 MET B SD   19 
ATOM 6939  C CE   . MET B 1 104 ? -15.776 -3.467  -9.378  1.00 0.00 ? 104 MET B CE   19 
ATOM 6940  H H    . MET B 1 104 ? -13.232 -7.474  -4.661  1.00 0.00 ? 104 MET B H    19 
ATOM 6941  H HA   . MET B 1 104 ? -12.393 -4.893  -5.852  1.00 0.00 ? 104 MET B HA   19 
ATOM 6942  H HB2  . MET B 1 104 ? -13.796 -6.427  -7.206  1.00 0.00 ? 104 MET B HB2  19 
ATOM 6943  H HB3  . MET B 1 104 ? -15.062 -6.331  -5.982  1.00 0.00 ? 104 MET B HB3  19 
ATOM 6944  H HG2  . MET B 1 104 ? -15.838 -4.451  -6.941  1.00 0.00 ? 104 MET B HG2  19 
ATOM 6945  H HG3  . MET B 1 104 ? -14.290 -3.664  -6.632  1.00 0.00 ? 104 MET B HG3  19 
ATOM 6946  H HE1  . MET B 1 104 ? -16.444 -3.311  -8.543  1.00 0.00 ? 104 MET B HE1  19 
ATOM 6947  H HE2  . MET B 1 104 ? -15.384 -2.518  -9.717  1.00 0.00 ? 104 MET B HE2  19 
ATOM 6948  H HE3  . MET B 1 104 ? -16.315 -3.939  -10.183 1.00 0.00 ? 104 MET B HE3  19 
ATOM 6949  N N    . ILE B 1 105 ? -13.507 -4.852  -3.057  1.00 0.00 ? 105 ILE B N    19 
ATOM 6950  C CA   . ILE B 1 105 ? -14.103 -4.051  -1.953  1.00 0.00 ? 105 ILE B CA   19 
ATOM 6951  C C    . ILE B 1 105 ? -13.089 -3.903  -0.821  1.00 0.00 ? 105 ILE B C    19 
ATOM 6952  O O    . ILE B 1 105 ? -12.118 -4.628  -0.745  1.00 0.00 ? 105 ILE B O    19 
ATOM 6953  C CB   . ILE B 1 105 ? -15.352 -4.751  -1.419  1.00 0.00 ? 105 ILE B CB   19 
ATOM 6954  C CG1  . ILE B 1 105 ? -16.415 -4.799  -2.515  1.00 0.00 ? 105 ILE B CG1  19 
ATOM 6955  C CG2  . ILE B 1 105 ? -15.890 -3.973  -0.216  1.00 0.00 ? 105 ILE B CG2  19 
ATOM 6956  C CD1  . ILE B 1 105 ? -17.750 -5.240  -1.912  1.00 0.00 ? 105 ILE B CD1  19 
ATOM 6957  H H    . ILE B 1 105 ? -12.864 -5.567  -2.855  1.00 0.00 ? 105 ILE B H    19 
ATOM 6958  H HA   . ILE B 1 105 ? -14.373 -3.072  -2.324  1.00 0.00 ? 105 ILE B HA   19 
ATOM 6959  H HB   . ILE B 1 105 ? -15.097 -5.756  -1.115  1.00 0.00 ? 105 ILE B HB   19 
ATOM 6960  H HG12 . ILE B 1 105 ? -16.524 -3.819  -2.953  1.00 0.00 ? 105 ILE B HG12 19 
ATOM 6961  H HG13 . ILE B 1 105 ? -16.117 -5.503  -3.278  1.00 0.00 ? 105 ILE B HG13 19 
ATOM 6962  H HG21 . ILE B 1 105 ? -16.023 -2.937  -0.487  1.00 0.00 ? 105 ILE B HG21 19 
ATOM 6963  H HG22 . ILE B 1 105 ? -16.839 -4.390  0.088   1.00 0.00 ? 105 ILE B HG22 19 
ATOM 6964  H HG23 . ILE B 1 105 ? -15.188 -4.044  0.603   1.00 0.00 ? 105 ILE B HG23 19 
ATOM 6965  H HD11 . ILE B 1 105 ? -18.043 -4.545  -1.140  1.00 0.00 ? 105 ILE B HD11 19 
ATOM 6966  H HD12 . ILE B 1 105 ? -18.504 -5.260  -2.685  1.00 0.00 ? 105 ILE B HD12 19 
ATOM 6967  H HD13 . ILE B 1 105 ? -17.643 -6.228  -1.488  1.00 0.00 ? 105 ILE B HD13 19 
ATOM 6968  N N    . VAL B 1 106 ? -13.307 -2.966  0.059   1.00 0.00 ? 106 VAL B N    19 
ATOM 6969  C CA   . VAL B 1 106 ? -12.360 -2.765  1.182   1.00 0.00 ? 106 VAL B CA   19 
ATOM 6970  C C    . VAL B 1 106 ? -13.071 -3.064  2.507   1.00 0.00 ? 106 VAL B C    19 
ATOM 6971  O O    . VAL B 1 106 ? -14.232 -2.752  2.683   1.00 0.00 ? 106 VAL B O    19 
ATOM 6972  C CB   . VAL B 1 106 ? -11.883 -1.313  1.163   1.00 0.00 ? 106 VAL B CB   19 
ATOM 6973  C CG1  . VAL B 1 106 ? -11.244 -0.963  2.502   1.00 0.00 ? 106 VAL B CG1  19 
ATOM 6974  C CG2  . VAL B 1 106 ? -10.857 -1.133  0.041   1.00 0.00 ? 106 VAL B CG2  19 
ATOM 6975  H H    . VAL B 1 106 ? -14.093 -2.391  -0.021  1.00 0.00 ? 106 VAL B H    19 
ATOM 6976  H HA   . VAL B 1 106 ? -11.514 -3.425  1.068   1.00 0.00 ? 106 VAL B HA   19 
ATOM 6977  H HB   . VAL B 1 106 ? -12.727 -0.660  0.987   1.00 0.00 ? 106 VAL B HB   19 
ATOM 6978  H HG11 . VAL B 1 106 ? -10.454 -1.668  2.717   1.00 0.00 ? 106 VAL B HG11 19 
ATOM 6979  H HG12 . VAL B 1 106 ? -10.835 0.034   2.456   1.00 0.00 ? 106 VAL B HG12 19 
ATOM 6980  H HG13 . VAL B 1 106 ? -11.992 -1.012  3.278   1.00 0.00 ? 106 VAL B HG13 19 
ATOM 6981  H HG21 . VAL B 1 106 ? -10.350 -2.071  -0.137  1.00 0.00 ? 106 VAL B HG21 19 
ATOM 6982  H HG22 . VAL B 1 106 ? -11.361 -0.821  -0.862  1.00 0.00 ? 106 VAL B HG22 19 
ATOM 6983  H HG23 . VAL B 1 106 ? -10.135 -0.384  0.329   1.00 0.00 ? 106 VAL B HG23 19 
ATOM 6984  N N    . ARG B 1 107 ? -12.382 -3.664  3.440   1.00 0.00 ? 107 ARG B N    19 
ATOM 6985  C CA   . ARG B 1 107 ? -13.017 -3.980  4.751   1.00 0.00 ? 107 ARG B CA   19 
ATOM 6986  C C    . ARG B 1 107 ? -12.008 -3.726  5.872   1.00 0.00 ? 107 ARG B C    19 
ATOM 6987  O O    . ARG B 1 107 ? -12.192 -4.150  6.995   1.00 0.00 ? 107 ARG B O    19 
ATOM 6988  C CB   . ARG B 1 107 ? -13.444 -5.450  4.770   1.00 0.00 ? 107 ARG B CB   19 
ATOM 6989  C CG   . ARG B 1 107 ? -14.762 -5.589  5.534   1.00 0.00 ? 107 ARG B CG   19 
ATOM 6990  C CD   . ARG B 1 107 ? -15.912 -5.765  4.542   1.00 0.00 ? 107 ARG B CD   19 
ATOM 6991  N NE   . ARG B 1 107 ? -16.848 -6.809  5.047   1.00 0.00 ? 107 ARG B NE   19 
ATOM 6992  C CZ   . ARG B 1 107 ? -17.691 -7.380  4.231   1.00 0.00 ? 107 ARG B CZ   19 
ATOM 6993  N NH1  . ARG B 1 107 ? -18.417 -6.651  3.426   1.00 0.00 ? 107 ARG B NH1  19 
ATOM 6994  N NH2  . ARG B 1 107 ? -17.810 -8.680  4.219   1.00 0.00 ? 107 ARG B NH2  19 
ATOM 6995  H H    . ARG B 1 107 ? -11.445 -3.906  3.279   1.00 0.00 ? 107 ARG B H    19 
ATOM 6996  H HA   . ARG B 1 107 ? -13.882 -3.350  4.894   1.00 0.00 ? 107 ARG B HA   19 
ATOM 6997  H HB2  . ARG B 1 107 ? -13.576 -5.798  3.756   1.00 0.00 ? 107 ARG B HB2  19 
ATOM 6998  H HB3  . ARG B 1 107 ? -12.683 -6.039  5.257   1.00 0.00 ? 107 ARG B HB3  19 
ATOM 6999  H HG2  . ARG B 1 107 ? -14.710 -6.449  6.185   1.00 0.00 ? 107 ARG B HG2  19 
ATOM 7000  H HG3  . ARG B 1 107 ? -14.931 -4.700  6.123   1.00 0.00 ? 107 ARG B HG3  19 
ATOM 7001  H HD2  . ARG B 1 107 ? -16.441 -4.830  4.432   1.00 0.00 ? 107 ARG B HD2  19 
ATOM 7002  H HD3  . ARG B 1 107 ? -15.517 -6.069  3.583   1.00 0.00 ? 107 ARG B HD3  19 
ATOM 7003  H HE   . ARG B 1 107 ? -16.829 -7.067  5.992   1.00 0.00 ? 107 ARG B HE   19 
ATOM 7004  H HH11 . ARG B 1 107 ? -18.326 -5.655  3.435   1.00 0.00 ? 107 ARG B HH11 19 
ATOM 7005  H HH12 . ARG B 1 107 ? -19.064 -7.089  2.802   1.00 0.00 ? 107 ARG B HH12 19 
ATOM 7006  H HH21 . ARG B 1 107 ? -17.254 -9.238  4.836   1.00 0.00 ? 107 ARG B HH21 19 
ATOM 7007  H HH22 . ARG B 1 107 ? -18.456 -9.117  3.595   1.00 0.00 ? 107 ARG B HH22 19 
ATOM 7008  N N    . SER B 1 108 ? -10.943 -3.037  5.568   1.00 0.00 ? 108 SER B N    19 
ATOM 7009  C CA   . SER B 1 108 ? -9.911  -2.748  6.603   1.00 0.00 ? 108 SER B CA   19 
ATOM 7010  C C    . SER B 1 108 ? -8.612  -2.340  5.906   1.00 0.00 ? 108 SER B C    19 
ATOM 7011  O O    . SER B 1 108 ? -8.142  -3.014  5.012   1.00 0.00 ? 108 SER B O    19 
ATOM 7012  C CB   . SER B 1 108 ? -9.667  -4.000  7.448   1.00 0.00 ? 108 SER B CB   19 
ATOM 7013  O OG   . SER B 1 108 ? -9.821  -5.154  6.634   1.00 0.00 ? 108 SER B OG   19 
ATOM 7014  H H    . SER B 1 108 ? -10.819 -2.709  4.654   1.00 0.00 ? 108 SER B H    19 
ATOM 7015  H HA   . SER B 1 108 ? -10.250 -1.943  7.237   1.00 0.00 ? 108 SER B HA   19 
ATOM 7016  H HB2  . SER B 1 108 ? -8.667  -3.978  7.848   1.00 0.00 ? 108 SER B HB2  19 
ATOM 7017  H HB3  . SER B 1 108 ? -10.378 -4.024  8.265   1.00 0.00 ? 108 SER B HB3  19 
ATOM 7018  H HG   . SER B 1 108 ? -9.349  -5.003  5.813   1.00 0.00 ? 108 SER B HG   19 
ATOM 7019  N N    . CYS B 1 109 ? -8.036  -1.235  6.294   1.00 0.00 ? 109 CYS B N    19 
ATOM 7020  C CA   . CYS B 1 109 ? -6.774  -0.785  5.633   1.00 0.00 ? 109 CYS B CA   19 
ATOM 7021  C C    . CYS B 1 109 ? -5.556  -1.274  6.424   1.00 0.00 ? 109 CYS B C    19 
ATOM 7022  O O    . CYS B 1 109 ? -5.670  -2.087  7.320   1.00 0.00 ? 109 CYS B O    19 
ATOM 7023  C CB   . CYS B 1 109 ? -6.752  0.742   5.565   1.00 0.00 ? 109 CYS B CB   19 
ATOM 7024  S SG   . CYS B 1 109 ? -8.124  1.319   4.538   1.00 0.00 ? 109 CYS B SG   19 
ATOM 7025  H H    . CYS B 1 109 ? -8.439  -0.697  7.008   1.00 0.00 ? 109 CYS B H    19 
ATOM 7026  H HA   . CYS B 1 109 ? -6.736  -1.187  4.633   1.00 0.00 ? 109 CYS B HA   19 
ATOM 7027  H HB2  . CYS B 1 109 ? -6.852  1.148   6.561   1.00 0.00 ? 109 CYS B HB2  19 
ATOM 7028  H HB3  . CYS B 1 109 ? -5.818  1.069   5.136   1.00 0.00 ? 109 CYS B HB3  19 
ATOM 7029  N N    . LYS B 1 110 ? -4.386  -0.784  6.095   1.00 0.00 ? 110 LYS B N    19 
ATOM 7030  C CA   . LYS B 1 110 ? -3.160  -1.219  6.819   1.00 0.00 ? 110 LYS B CA   19 
ATOM 7031  C C    . LYS B 1 110 ? -2.002  -0.294  6.429   1.00 0.00 ? 110 LYS B C    19 
ATOM 7032  O O    . LYS B 1 110 ? -2.176  0.898   6.288   1.00 0.00 ? 110 LYS B O    19 
ATOM 7033  C CB   . LYS B 1 110 ? -2.828  -2.664  6.436   1.00 0.00 ? 110 LYS B CB   19 
ATOM 7034  C CG   . LYS B 1 110 ? -2.588  -2.750  4.927   1.00 0.00 ? 110 LYS B CG   19 
ATOM 7035  C CD   . LYS B 1 110 ? -1.509  -3.796  4.640   1.00 0.00 ? 110 LYS B CD   19 
ATOM 7036  C CE   . LYS B 1 110 ? -1.660  -4.303  3.204   1.00 0.00 ? 110 LYS B CE   19 
ATOM 7037  N NZ   . LYS B 1 110 ? -0.560  -5.261  2.898   1.00 0.00 ? 110 LYS B NZ   19 
ATOM 7038  H H    . LYS B 1 110 ? -4.313  -0.130  5.368   1.00 0.00 ? 110 LYS B H    19 
ATOM 7039  H HA   . LYS B 1 110 ? -3.329  -1.156  7.884   1.00 0.00 ? 110 LYS B HA   19 
ATOM 7040  H HB2  . LYS B 1 110 ? -1.942  -2.983  6.964   1.00 0.00 ? 110 LYS B HB2  19 
ATOM 7041  H HB3  . LYS B 1 110 ? -3.655  -3.304  6.704   1.00 0.00 ? 110 LYS B HB3  19 
ATOM 7042  H HG2  . LYS B 1 110 ? -3.506  -3.033  4.433   1.00 0.00 ? 110 LYS B HG2  19 
ATOM 7043  H HG3  . LYS B 1 110 ? -2.262  -1.789  4.559   1.00 0.00 ? 110 LYS B HG3  19 
ATOM 7044  H HD2  . LYS B 1 110 ? -0.534  -3.349  4.764   1.00 0.00 ? 110 LYS B HD2  19 
ATOM 7045  H HD3  . LYS B 1 110 ? -1.618  -4.622  5.325   1.00 0.00 ? 110 LYS B HD3  19 
ATOM 7046  H HE2  . LYS B 1 110 ? -2.612  -4.803  3.096   1.00 0.00 ? 110 LYS B HE2  19 
ATOM 7047  H HE3  . LYS B 1 110 ? -1.612  -3.470  2.520   1.00 0.00 ? 110 LYS B HE3  19 
ATOM 7048  H HZ1  . LYS B 1 110 ? 0.251   -5.066  3.520   1.00 0.00 ? 110 LYS B HZ1  19 
ATOM 7049  H HZ2  . LYS B 1 110 ? -0.892  -6.234  3.054   1.00 0.00 ? 110 LYS B HZ2  19 
ATOM 7050  H HZ3  . LYS B 1 110 ? -0.271  -5.152  1.905   1.00 0.00 ? 110 LYS B HZ3  19 
ATOM 7051  N N    . CYS B 1 111 ? -0.821  -0.821  6.255   1.00 0.00 ? 111 CYS B N    19 
ATOM 7052  C CA   . CYS B 1 111 ? 0.324   0.053   5.879   1.00 0.00 ? 111 CYS B CA   19 
ATOM 7053  C C    . CYS B 1 111 ? 1.312   -0.734  5.019   1.00 0.00 ? 111 CYS B C    19 
ATOM 7054  O O    . CYS B 1 111 ? 2.250   -1.323  5.518   1.00 0.00 ? 111 CYS B O    19 
ATOM 7055  C CB   . CYS B 1 111 ? 1.023   0.538   7.153   1.00 0.00 ? 111 CYS B CB   19 
ATOM 7056  S SG   . CYS B 1 111 ? -0.216  1.168   8.315   1.00 0.00 ? 111 CYS B SG   19 
ATOM 7057  H H    . CYS B 1 111 ? -0.685  -1.782  6.372   1.00 0.00 ? 111 CYS B H    19 
ATOM 7058  H HA   . CYS B 1 111 ? -0.041  0.904   5.323   1.00 0.00 ? 111 CYS B HA   19 
ATOM 7059  H HB2  . CYS B 1 111 ? 1.556   -0.284  7.606   1.00 0.00 ? 111 CYS B HB2  19 
ATOM 7060  H HB3  . CYS B 1 111 ? 1.718   1.325   6.906   1.00 0.00 ? 111 CYS B HB3  19 
ATOM 7061  N N    . SER B 1 112 ? 1.116   -0.751  3.726   1.00 0.00 ? 112 SER B N    19 
ATOM 7062  C CA   . SER B 1 112 ? 2.055   -1.502  2.848   1.00 0.00 ? 112 SER B CA   19 
ATOM 7063  C C    . SER B 1 112 ? 3.254   -0.614  2.513   1.00 0.00 ? 112 SER B C    19 
ATOM 7064  O O    . SER B 1 112 ? 3.039   0.544   2.192   1.00 0.00 ? 112 SER B O    19 
ATOM 7065  C CB   . SER B 1 112 ? 1.339   -1.903  1.557   1.00 0.00 ? 112 SER B CB   19 
ATOM 7066  O OG   . SER B 1 112 ? 2.024   -2.996  0.962   1.00 0.00 ? 112 SER B OG   19 
ATOM 7067  O OXT  . SER B 1 112 ? 4.369   -1.104  2.588   1.00 0.00 ? 112 SER B OXT  19 
ATOM 7068  H H    . SER B 1 112 ? 0.354   -0.269  3.333   1.00 0.00 ? 112 SER B H    19 
ATOM 7069  H HA   . SER B 1 112 ? 2.396   -2.389  3.361   1.00 0.00 ? 112 SER B HA   19 
ATOM 7070  H HB2  . SER B 1 112 ? 0.328   -2.197  1.780   1.00 0.00 ? 112 SER B HB2  19 
ATOM 7071  H HB3  . SER B 1 112 ? 1.327   -1.060  0.878   1.00 0.00 ? 112 SER B HB3  19 
ATOM 7072  H HG   . SER B 1 112 ? 2.373   -3.547  1.666   1.00 0.00 ? 112 SER B HG   19 
ATOM 7073  N N    . ALA A 1 1   ? 6.711   -0.371  -15.993 1.00 0.00 ? 1   ALA A N    20 
ATOM 7074  C CA   . ALA A 1 1   ? 7.779   -0.848  -15.071 1.00 0.00 ? 1   ALA A CA   20 
ATOM 7075  C C    . ALA A 1 1   ? 7.836   0.061   -13.841 1.00 0.00 ? 1   ALA A C    20 
ATOM 7076  O O    . ALA A 1 1   ? 8.036   1.254   -13.948 1.00 0.00 ? 1   ALA A O    20 
ATOM 7077  C CB   . ALA A 1 1   ? 9.128   -0.812  -15.793 1.00 0.00 ? 1   ALA A CB   20 
ATOM 7078  H H1   . ALA A 1 1   ? 6.526   0.637   -15.819 1.00 0.00 ? 1   ALA A H1   20 
ATOM 7079  H H2   . ALA A 1 1   ? 7.018   -0.500  -16.977 1.00 0.00 ? 1   ALA A H2   20 
ATOM 7080  H H3   . ALA A 1 1   ? 5.840   -0.918  -15.826 1.00 0.00 ? 1   ALA A H3   20 
ATOM 7081  H HA   . ALA A 1 1   ? 7.563   -1.859  -14.761 1.00 0.00 ? 1   ALA A HA   20 
ATOM 7082  H HB1  . ALA A 1 1   ? 9.211   0.106   -16.355 1.00 0.00 ? 1   ALA A HB1  20 
ATOM 7083  H HB2  . ALA A 1 1   ? 9.926   -0.864  -15.068 1.00 0.00 ? 1   ALA A HB2  20 
ATOM 7084  H HB3  . ALA A 1 1   ? 9.198   -1.654  -16.466 1.00 0.00 ? 1   ALA A HB3  20 
ATOM 7085  N N    . LEU A 1 2   ? 7.663   -0.494  -12.672 1.00 0.00 ? 2   LEU A N    20 
ATOM 7086  C CA   . LEU A 1 2   ? 7.709   0.340   -11.438 1.00 0.00 ? 2   LEU A CA   20 
ATOM 7087  C C    . LEU A 1 2   ? 8.720   -0.252  -10.461 1.00 0.00 ? 2   LEU A C    20 
ATOM 7088  O O    . LEU A 1 2   ? 8.424   -0.476  -9.304  1.00 0.00 ? 2   LEU A O    20 
ATOM 7089  C CB   . LEU A 1 2   ? 6.333   0.361   -10.782 1.00 0.00 ? 2   LEU A CB   20 
ATOM 7090  C CG   . LEU A 1 2   ? 5.396   1.261   -11.587 1.00 0.00 ? 2   LEU A CG   20 
ATOM 7091  C CD1  . LEU A 1 2   ? 4.074   1.425   -10.835 1.00 0.00 ? 2   LEU A CD1  20 
ATOM 7092  C CD2  . LEU A 1 2   ? 6.049   2.632   -11.775 1.00 0.00 ? 2   LEU A CD2  20 
ATOM 7093  H H    . LEU A 1 2   ? 7.505   -1.458  -12.606 1.00 0.00 ? 2   LEU A H    20 
ATOM 7094  H HA   . LEU A 1 2   ? 8.004   1.348   -11.693 1.00 0.00 ? 2   LEU A HA   20 
ATOM 7095  H HB2  . LEU A 1 2   ? 5.937   -0.643  -10.752 1.00 0.00 ? 2   LEU A HB2  20 
ATOM 7096  H HB3  . LEU A 1 2   ? 6.424   0.743   -9.779  1.00 0.00 ? 2   LEU A HB3  20 
ATOM 7097  H HG   . LEU A 1 2   ? 5.208   0.813   -12.552 1.00 0.00 ? 2   LEU A HG   20 
ATOM 7098  H HD11 . LEU A 1 2   ? 4.158   0.975   -9.857  1.00 0.00 ? 2   LEU A HD11 20 
ATOM 7099  H HD12 . LEU A 1 2   ? 3.849   2.476   -10.729 1.00 0.00 ? 2   LEU A HD12 20 
ATOM 7100  H HD13 . LEU A 1 2   ? 3.283   0.942   -11.388 1.00 0.00 ? 2   LEU A HD13 20 
ATOM 7101  H HD21 . LEU A 1 2   ? 6.893   2.724   -11.108 1.00 0.00 ? 2   LEU A HD21 20 
ATOM 7102  H HD22 . LEU A 1 2   ? 6.385   2.735   -12.797 1.00 0.00 ? 2   LEU A HD22 20 
ATOM 7103  H HD23 . LEU A 1 2   ? 5.330   3.406   -11.553 1.00 0.00 ? 2   LEU A HD23 20 
ATOM 7104  N N    . ASP A 1 3   ? 9.907   -0.507  -10.919 1.00 0.00 ? 3   ASP A N    20 
ATOM 7105  C CA   . ASP A 1 3   ? 10.942  -1.084  -10.020 1.00 0.00 ? 3   ASP A CA   20 
ATOM 7106  C C    . ASP A 1 3   ? 11.977  -0.012  -9.681  1.00 0.00 ? 3   ASP A C    20 
ATOM 7107  O O    . ASP A 1 3   ? 11.866  1.127   -10.089 1.00 0.00 ? 3   ASP A O    20 
ATOM 7108  C CB   . ASP A 1 3   ? 11.635  -2.257  -10.716 1.00 0.00 ? 3   ASP A CB   20 
ATOM 7109  C CG   . ASP A 1 3   ? 11.691  -2.001  -12.225 1.00 0.00 ? 3   ASP A CG   20 
ATOM 7110  O OD1  . ASP A 1 3   ? 10.716  -2.302  -12.893 1.00 0.00 ? 3   ASP A OD1  20 
ATOM 7111  O OD2  . ASP A 1 3   ? 12.708  -1.509  -12.684 1.00 0.00 ? 3   ASP A OD2  20 
ATOM 7112  H H    . ASP A 1 3   ? 10.116  -0.317  -11.854 1.00 0.00 ? 3   ASP A H    20 
ATOM 7113  H HA   . ASP A 1 3   ? 10.475  -1.432  -9.111  1.00 0.00 ? 3   ASP A HA   20 
ATOM 7114  H HB2  . ASP A 1 3   ? 12.639  -2.361  -10.332 1.00 0.00 ? 3   ASP A HB2  20 
ATOM 7115  H HB3  . ASP A 1 3   ? 11.082  -3.165  -10.528 1.00 0.00 ? 3   ASP A HB3  20 
ATOM 7116  N N    . THR A 1 4   ? 12.980  -0.371  -8.931  1.00 0.00 ? 4   THR A N    20 
ATOM 7117  C CA   . THR A 1 4   ? 14.027  0.618   -8.553  1.00 0.00 ? 4   THR A CA   20 
ATOM 7118  C C    . THR A 1 4   ? 15.033  0.783   -9.696  1.00 0.00 ? 4   THR A C    20 
ATOM 7119  O O    . THR A 1 4   ? 16.069  1.397   -9.538  1.00 0.00 ? 4   THR A O    20 
ATOM 7120  C CB   . THR A 1 4   ? 14.740  0.131   -7.290  1.00 0.00 ? 4   THR A CB   20 
ATOM 7121  O OG1  . THR A 1 4   ? 15.650  -0.906  -7.630  1.00 0.00 ? 4   THR A OG1  20 
ATOM 7122  C CG2  . THR A 1 4   ? 13.704  -0.400  -6.290  1.00 0.00 ? 4   THR A CG2  20 
ATOM 7123  H H    . THR A 1 4   ? 13.043  -1.293  -8.609  1.00 0.00 ? 4   THR A H    20 
ATOM 7124  H HA   . THR A 1 4   ? 13.566  1.572   -8.357  1.00 0.00 ? 4   THR A HA   20 
ATOM 7125  H HB   . THR A 1 4   ? 15.280  0.951   -6.840  1.00 0.00 ? 4   THR A HB   20 
ATOM 7126  H HG1  . THR A 1 4   ? 15.177  -1.740  -7.592  1.00 0.00 ? 4   THR A HG1  20 
ATOM 7127  H HG21 . THR A 1 4   ? 12.747  -0.506  -6.781  1.00 0.00 ? 4   THR A HG21 20 
ATOM 7128  H HG22 . THR A 1 4   ? 14.023  -1.362  -5.917  1.00 0.00 ? 4   THR A HG22 20 
ATOM 7129  H HG23 . THR A 1 4   ? 13.608  0.293   -5.468  1.00 0.00 ? 4   THR A HG23 20 
ATOM 7130  N N    . ASN A 1 5   ? 14.730  0.258   -10.853 1.00 0.00 ? 5   ASN A N    20 
ATOM 7131  C CA   . ASN A 1 5   ? 15.662  0.407   -12.004 1.00 0.00 ? 5   ASN A CA   20 
ATOM 7132  C C    . ASN A 1 5   ? 15.156  1.537   -12.903 1.00 0.00 ? 5   ASN A C    20 
ATOM 7133  O O    . ASN A 1 5   ? 15.899  2.413   -13.298 1.00 0.00 ? 5   ASN A O    20 
ATOM 7134  C CB   . ASN A 1 5   ? 15.714  -0.899  -12.800 1.00 0.00 ? 5   ASN A CB   20 
ATOM 7135  C CG   . ASN A 1 5   ? 17.081  -1.032  -13.473 1.00 0.00 ? 5   ASN A CG   20 
ATOM 7136  O OD1  . ASN A 1 5   ? 18.076  -1.255  -12.812 1.00 0.00 ? 5   ASN A OD1  20 
ATOM 7137  N ND2  . ASN A 1 5   ? 17.174  -0.902  -14.768 1.00 0.00 ? 5   ASN A ND2  20 
ATOM 7138  H H    . ASN A 1 5   ? 13.885  -0.223  -10.967 1.00 0.00 ? 5   ASN A H    20 
ATOM 7139  H HA   . ASN A 1 5   ? 16.650  0.650   -11.640 1.00 0.00 ? 5   ASN A HA   20 
ATOM 7140  H HB2  . ASN A 1 5   ? 15.557  -1.734  -12.132 1.00 0.00 ? 5   ASN A HB2  20 
ATOM 7141  H HB3  . ASN A 1 5   ? 14.942  -0.893  -13.555 1.00 0.00 ? 5   ASN A HB3  20 
ATOM 7142  H HD21 . ASN A 1 5   ? 16.372  -0.721  -15.301 1.00 0.00 ? 5   ASN A HD21 20 
ATOM 7143  H HD22 . ASN A 1 5   ? 18.046  -0.984  -15.207 1.00 0.00 ? 5   ASN A HD22 20 
ATOM 7144  N N    . TYR A 1 6   ? 13.889  1.525   -13.225 1.00 0.00 ? 6   TYR A N    20 
ATOM 7145  C CA   . TYR A 1 6   ? 13.323  2.592   -14.089 1.00 0.00 ? 6   TYR A CA   20 
ATOM 7146  C C    . TYR A 1 6   ? 12.890  3.777   -13.220 1.00 0.00 ? 6   TYR A C    20 
ATOM 7147  O O    . TYR A 1 6   ? 12.721  4.881   -13.698 1.00 0.00 ? 6   TYR A O    20 
ATOM 7148  C CB   . TYR A 1 6   ? 12.111  2.027   -14.828 1.00 0.00 ? 6   TYR A CB   20 
ATOM 7149  C CG   . TYR A 1 6   ? 11.314  3.151   -15.442 1.00 0.00 ? 6   TYR A CG   20 
ATOM 7150  C CD1  . TYR A 1 6   ? 11.801  3.827   -16.567 1.00 0.00 ? 6   TYR A CD1  20 
ATOM 7151  C CD2  . TYR A 1 6   ? 10.086  3.519   -14.881 1.00 0.00 ? 6   TYR A CD2  20 
ATOM 7152  C CE1  . TYR A 1 6   ? 11.058  4.871   -17.131 1.00 0.00 ? 6   TYR A CE1  20 
ATOM 7153  C CE2  . TYR A 1 6   ? 9.343   4.563   -15.445 1.00 0.00 ? 6   TYR A CE2  20 
ATOM 7154  C CZ   . TYR A 1 6   ? 9.829   5.239   -16.570 1.00 0.00 ? 6   TYR A CZ   20 
ATOM 7155  O OH   . TYR A 1 6   ? 9.097   6.269   -17.126 1.00 0.00 ? 6   TYR A OH   20 
ATOM 7156  H H    . TYR A 1 6   ? 13.306  0.811   -12.895 1.00 0.00 ? 6   TYR A H    20 
ATOM 7157  H HA   . TYR A 1 6   ? 14.065  2.916   -14.803 1.00 0.00 ? 6   TYR A HA   20 
ATOM 7158  H HB2  . TYR A 1 6   ? 12.446  1.353   -15.600 1.00 0.00 ? 6   TYR A HB2  20 
ATOM 7159  H HB3  . TYR A 1 6   ? 11.487  1.486   -14.131 1.00 0.00 ? 6   TYR A HB3  20 
ATOM 7160  H HD1  . TYR A 1 6   ? 12.749  3.543   -16.999 1.00 0.00 ? 6   TYR A HD1  20 
ATOM 7161  H HD2  . TYR A 1 6   ? 9.712   2.996   -14.011 1.00 0.00 ? 6   TYR A HD2  20 
ATOM 7162  H HE1  . TYR A 1 6   ? 11.433  5.393   -17.999 1.00 0.00 ? 6   TYR A HE1  20 
ATOM 7163  H HE2  . TYR A 1 6   ? 8.394   4.846   -15.012 1.00 0.00 ? 6   TYR A HE2  20 
ATOM 7164  H HH   . TYR A 1 6   ? 9.694   7.004   -17.286 1.00 0.00 ? 6   TYR A HH   20 
ATOM 7165  N N    . CYS A 1 7   ? 12.705  3.554   -11.947 1.00 0.00 ? 7   CYS A N    20 
ATOM 7166  C CA   . CYS A 1 7   ? 12.280  4.665   -11.048 1.00 0.00 ? 7   CYS A CA   20 
ATOM 7167  C C    . CYS A 1 7   ? 13.493  5.519   -10.674 1.00 0.00 ? 7   CYS A C    20 
ATOM 7168  O O    . CYS A 1 7   ? 13.361  6.594   -10.124 1.00 0.00 ? 7   CYS A O    20 
ATOM 7169  C CB   . CYS A 1 7   ? 11.668  4.081   -9.776  1.00 0.00 ? 7   CYS A CB   20 
ATOM 7170  S SG   . CYS A 1 7   ? 9.898   3.784   -10.026 1.00 0.00 ? 7   CYS A SG   20 
ATOM 7171  H H    . CYS A 1 7   ? 12.845  2.656   -11.582 1.00 0.00 ? 7   CYS A H    20 
ATOM 7172  H HA   . CYS A 1 7   ? 11.549  5.278   -11.553 1.00 0.00 ? 7   CYS A HA   20 
ATOM 7173  H HB2  . CYS A 1 7   ? 12.161  3.149   -9.541  1.00 0.00 ? 7   CYS A HB2  20 
ATOM 7174  H HB3  . CYS A 1 7   ? 11.805  4.774   -8.962  1.00 0.00 ? 7   CYS A HB3  20 
ATOM 7175  N N    . PHE A 1 8   ? 14.672  5.047   -10.965 1.00 0.00 ? 8   PHE A N    20 
ATOM 7176  C CA   . PHE A 1 8   ? 15.897  5.829   -10.627 1.00 0.00 ? 8   PHE A CA   20 
ATOM 7177  C C    . PHE A 1 8   ? 16.171  6.867   -11.721 1.00 0.00 ? 8   PHE A C    20 
ATOM 7178  O O    . PHE A 1 8   ? 17.297  7.062   -12.133 1.00 0.00 ? 8   PHE A O    20 
ATOM 7179  C CB   . PHE A 1 8   ? 17.093  4.881   -10.520 1.00 0.00 ? 8   PHE A CB   20 
ATOM 7180  C CG   . PHE A 1 8   ? 17.240  4.388   -9.096  1.00 0.00 ? 8   PHE A CG   20 
ATOM 7181  C CD1  . PHE A 1 8   ? 16.182  4.519   -8.186  1.00 0.00 ? 8   PHE A CD1  20 
ATOM 7182  C CD2  . PHE A 1 8   ? 18.443  3.798   -8.686  1.00 0.00 ? 8   PHE A CD2  20 
ATOM 7183  C CE1  . PHE A 1 8   ? 16.329  4.062   -6.870  1.00 0.00 ? 8   PHE A CE1  20 
ATOM 7184  C CE2  . PHE A 1 8   ? 18.588  3.341   -7.372  1.00 0.00 ? 8   PHE A CE2  20 
ATOM 7185  C CZ   . PHE A 1 8   ? 17.532  3.472   -6.463  1.00 0.00 ? 8   PHE A CZ   20 
ATOM 7186  H H    . PHE A 1 8   ? 14.753  4.175   -11.405 1.00 0.00 ? 8   PHE A H    20 
ATOM 7187  H HA   . PHE A 1 8   ? 15.752  6.333   -9.683  1.00 0.00 ? 8   PHE A HA   20 
ATOM 7188  H HB2  . PHE A 1 8   ? 16.938  4.038   -11.177 1.00 0.00 ? 8   PHE A HB2  20 
ATOM 7189  H HB3  . PHE A 1 8   ? 17.991  5.403   -10.813 1.00 0.00 ? 8   PHE A HB3  20 
ATOM 7190  H HD1  . PHE A 1 8   ? 15.254  4.973   -8.498  1.00 0.00 ? 8   PHE A HD1  20 
ATOM 7191  H HD2  . PHE A 1 8   ? 19.260  3.696   -9.386  1.00 0.00 ? 8   PHE A HD2  20 
ATOM 7192  H HE1  . PHE A 1 8   ? 15.514  4.163   -6.168  1.00 0.00 ? 8   PHE A HE1  20 
ATOM 7193  H HE2  . PHE A 1 8   ? 19.517  2.887   -7.057  1.00 0.00 ? 8   PHE A HE2  20 
ATOM 7194  H HZ   . PHE A 1 8   ? 17.645  3.120   -5.449  1.00 0.00 ? 8   PHE A HZ   20 
ATOM 7195  N N    . SER A 1 9   ? 15.154  7.535   -12.191 1.00 0.00 ? 9   SER A N    20 
ATOM 7196  C CA   . SER A 1 9   ? 15.359  8.558   -13.254 1.00 0.00 ? 9   SER A CA   20 
ATOM 7197  C C    . SER A 1 9   ? 14.804  9.902   -12.773 1.00 0.00 ? 9   SER A C    20 
ATOM 7198  O O    . SER A 1 9   ? 14.846  10.215  -11.599 1.00 0.00 ? 9   SER A O    20 
ATOM 7199  C CB   . SER A 1 9   ? 14.626  8.127   -14.524 1.00 0.00 ? 9   SER A CB   20 
ATOM 7200  O OG   . SER A 1 9   ? 15.303  8.654   -15.659 1.00 0.00 ? 9   SER A OG   20 
ATOM 7201  H H    . SER A 1 9   ? 14.256  7.365   -11.846 1.00 0.00 ? 9   SER A H    20 
ATOM 7202  H HA   . SER A 1 9   ? 16.414  8.657   -13.461 1.00 0.00 ? 9   SER A HA   20 
ATOM 7203  H HB2  . SER A 1 9   ? 14.612  7.052   -14.587 1.00 0.00 ? 9   SER A HB2  20 
ATOM 7204  H HB3  . SER A 1 9   ? 13.609  8.496   -14.495 1.00 0.00 ? 9   SER A HB3  20 
ATOM 7205  H HG   . SER A 1 9   ? 14.744  9.328   -16.051 1.00 0.00 ? 9   SER A HG   20 
ATOM 7206  N N    . SER A 1 10  ? 14.285  10.699  -13.667 1.00 0.00 ? 10  SER A N    20 
ATOM 7207  C CA   . SER A 1 10  ? 13.730  12.019  -13.252 1.00 0.00 ? 10  SER A CA   20 
ATOM 7208  C C    . SER A 1 10  ? 12.342  12.211  -13.869 1.00 0.00 ? 10  SER A C    20 
ATOM 7209  O O    . SER A 1 10  ? 11.706  13.230  -13.684 1.00 0.00 ? 10  SER A O    20 
ATOM 7210  C CB   . SER A 1 10  ? 14.659  13.135  -13.731 1.00 0.00 ? 10  SER A CB   20 
ATOM 7211  O OG   . SER A 1 10  ? 14.494  14.273  -12.894 1.00 0.00 ? 10  SER A OG   20 
ATOM 7212  H H    . SER A 1 10  ? 14.260  10.431  -14.609 1.00 0.00 ? 10  SER A H    20 
ATOM 7213  H HA   . SER A 1 10  ? 13.652  12.053  -12.176 1.00 0.00 ? 10  SER A HA   20 
ATOM 7214  H HB2  . SER A 1 10  ? 15.682  12.802  -13.677 1.00 0.00 ? 10  SER A HB2  20 
ATOM 7215  H HB3  . SER A 1 10  ? 14.418  13.389  -14.754 1.00 0.00 ? 10  SER A HB3  20 
ATOM 7216  H HG   . SER A 1 10  ? 13.856  14.856  -13.309 1.00 0.00 ? 10  SER A HG   20 
ATOM 7217  N N    . THR A 1 11  ? 11.865  11.240  -14.601 1.00 0.00 ? 11  THR A N    20 
ATOM 7218  C CA   . THR A 1 11  ? 10.519  11.371  -15.225 1.00 0.00 ? 11  THR A CA   20 
ATOM 7219  C C    . THR A 1 11  ? 9.514   10.506  -14.461 1.00 0.00 ? 11  THR A C    20 
ATOM 7220  O O    . THR A 1 11  ? 9.844   9.883   -13.471 1.00 0.00 ? 11  THR A O    20 
ATOM 7221  C CB   . THR A 1 11  ? 10.584  10.908  -16.683 1.00 0.00 ? 11  THR A CB   20 
ATOM 7222  O OG1  . THR A 1 11  ? 11.889  10.422  -16.966 1.00 0.00 ? 11  THR A OG1  20 
ATOM 7223  C CG2  . THR A 1 11  ? 10.262  12.081  -17.609 1.00 0.00 ? 11  THR A CG2  20 
ATOM 7224  H H    . THR A 1 11  ? 12.391  10.425  -14.739 1.00 0.00 ? 11  THR A H    20 
ATOM 7225  H HA   . THR A 1 11  ? 10.204  12.404  -15.191 1.00 0.00 ? 11  THR A HA   20 
ATOM 7226  H HB   . THR A 1 11  ? 9.864   10.121  -16.843 1.00 0.00 ? 11  THR A HB   20 
ATOM 7227  H HG1  . THR A 1 11  ? 12.519  11.100  -16.714 1.00 0.00 ? 11  THR A HG1  20 
ATOM 7228  H HG21 . THR A 1 11  ? 9.417   12.628  -17.217 1.00 0.00 ? 11  THR A HG21 20 
ATOM 7229  H HG22 . THR A 1 11  ? 11.118  12.736  -17.670 1.00 0.00 ? 11  THR A HG22 20 
ATOM 7230  H HG23 . THR A 1 11  ? 10.023  11.708  -18.594 1.00 0.00 ? 11  THR A HG23 20 
ATOM 7231  N N    . GLU A 1 12  ? 8.290   10.462  -14.912 1.00 0.00 ? 12  GLU A N    20 
ATOM 7232  C CA   . GLU A 1 12  ? 7.267   9.636   -14.211 1.00 0.00 ? 12  GLU A CA   20 
ATOM 7233  C C    . GLU A 1 12  ? 7.092   10.147  -12.778 1.00 0.00 ? 12  GLU A C    20 
ATOM 7234  O O    . GLU A 1 12  ? 8.009   10.113  -11.982 1.00 0.00 ? 12  GLU A O    20 
ATOM 7235  C CB   . GLU A 1 12  ? 7.726   8.177   -14.179 1.00 0.00 ? 12  GLU A CB   20 
ATOM 7236  C CG   . GLU A 1 12  ? 6.655   7.290   -14.815 1.00 0.00 ? 12  GLU A CG   20 
ATOM 7237  C CD   . GLU A 1 12  ? 6.815   7.304   -16.337 1.00 0.00 ? 12  GLU A CD   20 
ATOM 7238  O OE1  . GLU A 1 12  ? 7.448   8.220   -16.837 1.00 0.00 ? 12  GLU A OE1  20 
ATOM 7239  O OE2  . GLU A 1 12  ? 6.302   6.399   -16.975 1.00 0.00 ? 12  GLU A OE2  20 
ATOM 7240  H H    . GLU A 1 12  ? 8.044   10.972  -15.712 1.00 0.00 ? 12  GLU A H    20 
ATOM 7241  H HA   . GLU A 1 12  ? 6.325   9.706   -14.736 1.00 0.00 ? 12  GLU A HA   20 
ATOM 7242  H HB2  . GLU A 1 12  ? 8.651   8.079   -14.731 1.00 0.00 ? 12  GLU A HB2  20 
ATOM 7243  H HB3  . GLU A 1 12  ? 7.883   7.872   -13.156 1.00 0.00 ? 12  GLU A HB3  20 
ATOM 7244  H HG2  . GLU A 1 12  ? 6.765   6.278   -14.450 1.00 0.00 ? 12  GLU A HG2  20 
ATOM 7245  H HG3  . GLU A 1 12  ? 5.676   7.663   -14.555 1.00 0.00 ? 12  GLU A HG3  20 
ATOM 7246  N N    . LYS A 1 13  ? 5.923   10.623  -12.446 1.00 0.00 ? 13  LYS A N    20 
ATOM 7247  C CA   . LYS A 1 13  ? 5.693   11.137  -11.066 1.00 0.00 ? 13  LYS A CA   20 
ATOM 7248  C C    . LYS A 1 13  ? 4.572   10.335  -10.402 1.00 0.00 ? 13  LYS A C    20 
ATOM 7249  O O    . LYS A 1 13  ? 3.896   10.815  -9.512  1.00 0.00 ? 13  LYS A O    20 
ATOM 7250  C CB   . LYS A 1 13  ? 5.297   12.613  -11.130 1.00 0.00 ? 13  LYS A CB   20 
ATOM 7251  C CG   . LYS A 1 13  ? 5.964   13.371  -9.980  1.00 0.00 ? 13  LYS A CG   20 
ATOM 7252  C CD   . LYS A 1 13  ? 5.059   14.519  -9.531  1.00 0.00 ? 13  LYS A CD   20 
ATOM 7253  C CE   . LYS A 1 13  ? 5.753   15.854  -9.807  1.00 0.00 ? 13  LYS A CE   20 
ATOM 7254  N NZ   . LYS A 1 13  ? 4.785   16.968  -9.599  1.00 0.00 ? 13  LYS A NZ   20 
ATOM 7255  H H    . LYS A 1 13  ? 5.196   10.643  -13.103 1.00 0.00 ? 13  LYS A H    20 
ATOM 7256  H HA   . LYS A 1 13  ? 6.600   11.032  -10.488 1.00 0.00 ? 13  LYS A HA   20 
ATOM 7257  H HB2  . LYS A 1 13  ? 5.618   13.031  -12.073 1.00 0.00 ? 13  LYS A HB2  20 
ATOM 7258  H HB3  . LYS A 1 13  ? 4.225   12.703  -11.043 1.00 0.00 ? 13  LYS A HB3  20 
ATOM 7259  H HG2  . LYS A 1 13  ? 6.129   12.696  -9.153  1.00 0.00 ? 13  LYS A HG2  20 
ATOM 7260  H HG3  . LYS A 1 13  ? 6.911   13.770  -10.314 1.00 0.00 ? 13  LYS A HG3  20 
ATOM 7261  H HD2  . LYS A 1 13  ? 4.128   14.477  -10.078 1.00 0.00 ? 13  LYS A HD2  20 
ATOM 7262  H HD3  . LYS A 1 13  ? 4.862   14.430  -8.474  1.00 0.00 ? 13  LYS A HD3  20 
ATOM 7263  H HE2  . LYS A 1 13  ? 6.588   15.972  -9.132  1.00 0.00 ? 13  LYS A HE2  20 
ATOM 7264  H HE3  . LYS A 1 13  ? 6.109   15.871  -10.826 1.00 0.00 ? 13  LYS A HE3  20 
ATOM 7265  H HZ1  . LYS A 1 13  ? 4.017   16.649  -8.976  1.00 0.00 ? 13  LYS A HZ1  20 
ATOM 7266  H HZ2  . LYS A 1 13  ? 5.274   17.774  -9.159  1.00 0.00 ? 13  LYS A HZ2  20 
ATOM 7267  H HZ3  . LYS A 1 13  ? 4.391   17.259  -10.517 1.00 0.00 ? 13  LYS A HZ3  20 
ATOM 7268  N N    . ASN A 1 14  ? 4.368   9.118   -10.824 1.00 0.00 ? 14  ASN A N    20 
ATOM 7269  C CA   . ASN A 1 14  ? 3.291   8.288   -10.214 1.00 0.00 ? 14  ASN A CA   20 
ATOM 7270  C C    . ASN A 1 14  ? 3.917   7.233   -9.300  1.00 0.00 ? 14  ASN A C    20 
ATOM 7271  O O    . ASN A 1 14  ? 5.013   7.402   -8.803  1.00 0.00 ? 14  ASN A O    20 
ATOM 7272  C CB   . ASN A 1 14  ? 2.492   7.594   -11.320 1.00 0.00 ? 14  ASN A CB   20 
ATOM 7273  C CG   . ASN A 1 14  ? 2.433   8.497   -12.553 1.00 0.00 ? 14  ASN A CG   20 
ATOM 7274  O OD1  . ASN A 1 14  ? 2.766   8.078   -13.644 1.00 0.00 ? 14  ASN A OD1  20 
ATOM 7275  N ND2  . ASN A 1 14  ? 2.020   9.728   -12.427 1.00 0.00 ? 14  ASN A ND2  20 
ATOM 7276  H H    . ASN A 1 14  ? 4.924   8.749   -11.540 1.00 0.00 ? 14  ASN A H    20 
ATOM 7277  H HA   . ASN A 1 14  ? 2.632   8.920   -9.636  1.00 0.00 ? 14  ASN A HA   20 
ATOM 7278  H HB2  . ASN A 1 14  ? 2.971   6.661   -11.579 1.00 0.00 ? 14  ASN A HB2  20 
ATOM 7279  H HB3  . ASN A 1 14  ? 1.489   7.399   -10.971 1.00 0.00 ? 14  ASN A HB3  20 
ATOM 7280  H HD21 . ASN A 1 14  ? 1.750   10.067  -11.547 1.00 0.00 ? 14  ASN A HD21 20 
ATOM 7281  H HD22 . ASN A 1 14  ? 1.979   10.315  -13.210 1.00 0.00 ? 14  ASN A HD22 20 
ATOM 7282  N N    . CYS A 1 15  ? 3.231   6.145   -9.076  1.00 0.00 ? 15  CYS A N    20 
ATOM 7283  C CA   . CYS A 1 15  ? 3.787   5.078   -8.197  1.00 0.00 ? 15  CYS A CA   20 
ATOM 7284  C C    . CYS A 1 15  ? 5.195   4.711   -8.676  1.00 0.00 ? 15  CYS A C    20 
ATOM 7285  O O    . CYS A 1 15  ? 5.373   3.833   -9.494  1.00 0.00 ? 15  CYS A O    20 
ATOM 7286  C CB   . CYS A 1 15  ? 2.878   3.846   -8.266  1.00 0.00 ? 15  CYS A CB   20 
ATOM 7287  S SG   . CYS A 1 15  ? 3.721   2.406   -7.555  1.00 0.00 ? 15  CYS A SG   20 
ATOM 7288  H H    . CYS A 1 15  ? 2.350   6.029   -9.489  1.00 0.00 ? 15  CYS A H    20 
ATOM 7289  H HA   . CYS A 1 15  ? 3.834   5.436   -7.179  1.00 0.00 ? 15  CYS A HA   20 
ATOM 7290  H HB2  . CYS A 1 15  ? 1.971   4.038   -7.713  1.00 0.00 ? 15  CYS A HB2  20 
ATOM 7291  H HB3  . CYS A 1 15  ? 2.632   3.642   -9.297  1.00 0.00 ? 15  CYS A HB3  20 
ATOM 7292  N N    . CYS A 1 16  ? 6.195   5.378   -8.170  1.00 0.00 ? 16  CYS A N    20 
ATOM 7293  C CA   . CYS A 1 16  ? 7.586   5.064   -8.598  1.00 0.00 ? 16  CYS A CA   20 
ATOM 7294  C C    . CYS A 1 16  ? 8.479   4.920   -7.364  1.00 0.00 ? 16  CYS A C    20 
ATOM 7295  O O    . CYS A 1 16  ? 8.629   5.839   -6.583  1.00 0.00 ? 16  CYS A O    20 
ATOM 7296  C CB   . CYS A 1 16  ? 8.122   6.196   -9.478  1.00 0.00 ? 16  CYS A CB   20 
ATOM 7297  S SG   . CYS A 1 16  ? 9.185   5.519   -10.782 1.00 0.00 ? 16  CYS A SG   20 
ATOM 7298  H H    . CYS A 1 16  ? 6.033   6.084   -7.510  1.00 0.00 ? 16  CYS A H    20 
ATOM 7299  H HA   . CYS A 1 16  ? 7.590   4.140   -9.155  1.00 0.00 ? 16  CYS A HA   20 
ATOM 7300  H HB2  . CYS A 1 16  ? 7.292   6.721   -9.930  1.00 0.00 ? 16  CYS A HB2  20 
ATOM 7301  H HB3  . CYS A 1 16  ? 8.692   6.884   -8.871  1.00 0.00 ? 16  CYS A HB3  20 
ATOM 7302  N N    . VAL A 1 17  ? 9.075   3.775   -7.187  1.00 0.00 ? 17  VAL A N    20 
ATOM 7303  C CA   . VAL A 1 17  ? 9.965   3.570   -6.011  1.00 0.00 ? 17  VAL A CA   20 
ATOM 7304  C C    . VAL A 1 17  ? 11.054  4.651   -6.017  1.00 0.00 ? 17  VAL A C    20 
ATOM 7305  O O    . VAL A 1 17  ? 11.301  5.285   -7.023  1.00 0.00 ? 17  VAL A O    20 
ATOM 7306  C CB   . VAL A 1 17  ? 10.601  2.178   -6.115  1.00 0.00 ? 17  VAL A CB   20 
ATOM 7307  C CG1  . VAL A 1 17  ? 11.701  2.191   -7.168  1.00 0.00 ? 17  VAL A CG1  20 
ATOM 7308  C CG2  . VAL A 1 17  ? 11.206  1.767   -4.773  1.00 0.00 ? 17  VAL A CG2  20 
ATOM 7309  H H    . VAL A 1 17  ? 8.940   3.049   -7.832  1.00 0.00 ? 17  VAL A H    20 
ATOM 7310  H HA   . VAL A 1 17  ? 9.388   3.639   -5.101  1.00 0.00 ? 17  VAL A HA   20 
ATOM 7311  H HB   . VAL A 1 17  ? 9.846   1.462   -6.403  1.00 0.00 ? 17  VAL A HB   20 
ATOM 7312  H HG11 . VAL A 1 17  ? 12.395  2.991   -6.956  1.00 0.00 ? 17  VAL A HG11 20 
ATOM 7313  H HG12 . VAL A 1 17  ? 12.222  1.247   -7.148  1.00 0.00 ? 17  VAL A HG12 20 
ATOM 7314  H HG13 . VAL A 1 17  ? 11.262  2.340   -8.142  1.00 0.00 ? 17  VAL A HG13 20 
ATOM 7315  H HG21 . VAL A 1 17  ? 11.805  2.575   -4.385  1.00 0.00 ? 17  VAL A HG21 20 
ATOM 7316  H HG22 . VAL A 1 17  ? 10.416  1.534   -4.077  1.00 0.00 ? 17  VAL A HG22 20 
ATOM 7317  H HG23 . VAL A 1 17  ? 11.828  0.895   -4.915  1.00 0.00 ? 17  VAL A HG23 20 
ATOM 7318  N N    . ARG A 1 18  ? 11.706  4.872   -4.911  1.00 0.00 ? 18  ARG A N    20 
ATOM 7319  C CA   . ARG A 1 18  ? 12.771  5.911   -4.871  1.00 0.00 ? 18  ARG A CA   20 
ATOM 7320  C C    . ARG A 1 18  ? 13.877  5.452   -3.921  1.00 0.00 ? 18  ARG A C    20 
ATOM 7321  O O    . ARG A 1 18  ? 13.632  4.737   -2.969  1.00 0.00 ? 18  ARG A O    20 
ATOM 7322  C CB   . ARG A 1 18  ? 12.179  7.232   -4.377  1.00 0.00 ? 18  ARG A CB   20 
ATOM 7323  C CG   . ARG A 1 18  ? 11.697  8.054   -5.574  1.00 0.00 ? 18  ARG A CG   20 
ATOM 7324  C CD   . ARG A 1 18  ? 11.222  9.427   -5.094  1.00 0.00 ? 18  ARG A CD   20 
ATOM 7325  N NE   . ARG A 1 18  ? 10.160  9.932   -6.009  1.00 0.00 ? 18  ARG A NE   20 
ATOM 7326  C CZ   . ARG A 1 18  ? 10.466  10.760  -6.970  1.00 0.00 ? 18  ARG A CZ   20 
ATOM 7327  N NH1  . ARG A 1 18  ? 11.497  10.522  -7.734  1.00 0.00 ? 18  ARG A NH1  20 
ATOM 7328  N NH2  . ARG A 1 18  ? 9.741   11.828  -7.166  1.00 0.00 ? 18  ARG A NH2  20 
ATOM 7329  H H    . ARG A 1 18  ? 11.497  4.359   -4.108  1.00 0.00 ? 18  ARG A H    20 
ATOM 7330  H HA   . ARG A 1 18  ? 13.180  6.045   -5.861  1.00 0.00 ? 18  ARG A HA   20 
ATOM 7331  H HB2  . ARG A 1 18  ? 11.344  7.028   -3.722  1.00 0.00 ? 18  ARG A HB2  20 
ATOM 7332  H HB3  . ARG A 1 18  ? 12.932  7.787   -3.840  1.00 0.00 ? 18  ARG A HB3  20 
ATOM 7333  H HG2  . ARG A 1 18  ? 12.510  8.179   -6.276  1.00 0.00 ? 18  ARG A HG2  20 
ATOM 7334  H HG3  . ARG A 1 18  ? 10.880  7.542   -6.058  1.00 0.00 ? 18  ARG A HG3  20 
ATOM 7335  H HD2  . ARG A 1 18  ? 10.824  9.342   -4.094  1.00 0.00 ? 18  ARG A HD2  20 
ATOM 7336  H HD3  . ARG A 1 18  ? 12.054  10.116  -5.094  1.00 0.00 ? 18  ARG A HD3  20 
ATOM 7337  H HE   . ARG A 1 18  ? 9.232   9.641   -5.890  1.00 0.00 ? 18  ARG A HE   20 
ATOM 7338  H HH11 . ARG A 1 18  ? 12.052  9.703   -7.584  1.00 0.00 ? 18  ARG A HH11 20 
ATOM 7339  H HH12 . ARG A 1 18  ? 11.731  11.157  -8.470  1.00 0.00 ? 18  ARG A HH12 20 
ATOM 7340  H HH21 . ARG A 1 18  ? 8.951   12.010  -6.581  1.00 0.00 ? 18  ARG A HH21 20 
ATOM 7341  H HH22 . ARG A 1 18  ? 9.975   12.463  -7.903  1.00 0.00 ? 18  ARG A HH22 20 
ATOM 7342  N N    . GLN A 1 19  ? 15.094  5.846   -4.169  1.00 0.00 ? 19  GLN A N    20 
ATOM 7343  C CA   . GLN A 1 19  ? 16.206  5.418   -3.274  1.00 0.00 ? 19  GLN A CA   20 
ATOM 7344  C C    . GLN A 1 19  ? 15.918  5.880   -1.848  1.00 0.00 ? 19  GLN A C    20 
ATOM 7345  O O    . GLN A 1 19  ? 15.524  7.006   -1.615  1.00 0.00 ? 19  GLN A O    20 
ATOM 7346  C CB   . GLN A 1 19  ? 17.521  6.031   -3.761  1.00 0.00 ? 19  GLN A CB   20 
ATOM 7347  C CG   . GLN A 1 19  ? 17.518  7.536   -3.485  1.00 0.00 ? 19  GLN A CG   20 
ATOM 7348  C CD   . GLN A 1 19  ? 18.085  8.279   -4.696  1.00 0.00 ? 19  GLN A CD   20 
ATOM 7349  O OE1  . GLN A 1 19  ? 17.484  8.292   -5.752  1.00 0.00 ? 19  GLN A OE1  20 
ATOM 7350  N NE2  . GLN A 1 19  ? 19.227  8.900   -4.587  1.00 0.00 ? 19  GLN A NE2  20 
ATOM 7351  H H    . GLN A 1 19  ? 15.279  6.417   -4.944  1.00 0.00 ? 19  GLN A H    20 
ATOM 7352  H HA   . GLN A 1 19  ? 16.282  4.342   -3.289  1.00 0.00 ? 19  GLN A HA   20 
ATOM 7353  H HB2  . GLN A 1 19  ? 18.347  5.570   -3.241  1.00 0.00 ? 19  GLN A HB2  20 
ATOM 7354  H HB3  . GLN A 1 19  ? 17.625  5.863   -4.822  1.00 0.00 ? 19  GLN A HB3  20 
ATOM 7355  H HG2  . GLN A 1 19  ? 16.505  7.865   -3.301  1.00 0.00 ? 19  GLN A HG2  20 
ATOM 7356  H HG3  . GLN A 1 19  ? 18.127  7.744   -2.619  1.00 0.00 ? 19  GLN A HG3  20 
ATOM 7357  H HE21 . GLN A 1 19  ? 19.712  8.890   -3.736  1.00 0.00 ? 19  GLN A HE21 20 
ATOM 7358  H HE22 . GLN A 1 19  ? 19.599  9.379   -5.356  1.00 0.00 ? 19  GLN A HE22 20 
ATOM 7359  N N    . LEU A 1 20  ? 16.104  5.015   -0.889  1.00 0.00 ? 20  LEU A N    20 
ATOM 7360  C CA   . LEU A 1 20  ? 15.834  5.401   0.522   1.00 0.00 ? 20  LEU A CA   20 
ATOM 7361  C C    . LEU A 1 20  ? 16.791  4.661   1.454   1.00 0.00 ? 20  LEU A C    20 
ATOM 7362  O O    . LEU A 1 20  ? 16.381  4.064   2.428   1.00 0.00 ? 20  LEU A O    20 
ATOM 7363  C CB   . LEU A 1 20  ? 14.397  5.027   0.880   1.00 0.00 ? 20  LEU A CB   20 
ATOM 7364  C CG   . LEU A 1 20  ? 14.044  5.580   2.263   1.00 0.00 ? 20  LEU A CG   20 
ATOM 7365  C CD1  . LEU A 1 20  ? 13.978  7.106   2.205   1.00 0.00 ? 20  LEU A CD1  20 
ATOM 7366  C CD2  . LEU A 1 20  ? 12.685  5.029   2.696   1.00 0.00 ? 20  LEU A CD2  20 
ATOM 7367  H H    . LEU A 1 20  ? 16.418  4.110   -1.099  1.00 0.00 ? 20  LEU A H    20 
ATOM 7368  H HA   . LEU A 1 20  ? 15.967  6.465   0.636   1.00 0.00 ? 20  LEU A HA   20 
ATOM 7369  H HB2  . LEU A 1 20  ? 13.730  5.447   0.148   1.00 0.00 ? 20  LEU A HB2  20 
ATOM 7370  H HB3  . LEU A 1 20  ? 14.295  3.953   0.888   1.00 0.00 ? 20  LEU A HB3  20 
ATOM 7371  H HG   . LEU A 1 20  ? 14.798  5.282   2.976   1.00 0.00 ? 20  LEU A HG   20 
ATOM 7372  H HD11 . LEU A 1 20  ? 13.805  7.419   1.186   1.00 0.00 ? 20  LEU A HD11 20 
ATOM 7373  H HD12 . LEU A 1 20  ? 13.171  7.455   2.832   1.00 0.00 ? 20  LEU A HD12 20 
ATOM 7374  H HD13 . LEU A 1 20  ? 14.912  7.520   2.556   1.00 0.00 ? 20  LEU A HD13 20 
ATOM 7375  H HD21 . LEU A 1 20  ? 12.659  3.963   2.526   1.00 0.00 ? 20  LEU A HD21 20 
ATOM 7376  H HD22 . LEU A 1 20  ? 12.534  5.230   3.745   1.00 0.00 ? 20  LEU A HD22 20 
ATOM 7377  H HD23 . LEU A 1 20  ? 11.905  5.505   2.120   1.00 0.00 ? 20  LEU A HD23 20 
ATOM 7378  N N    . TYR A 1 21  ? 18.066  4.686   1.177   1.00 0.00 ? 21  TYR A N    20 
ATOM 7379  C CA   . TYR A 1 21  ? 19.009  3.975   2.079   1.00 0.00 ? 21  TYR A CA   20 
ATOM 7380  C C    . TYR A 1 21  ? 18.694  4.370   3.519   1.00 0.00 ? 21  TYR A C    20 
ATOM 7381  O O    . TYR A 1 21  ? 18.461  5.524   3.816   1.00 0.00 ? 21  TYR A O    20 
ATOM 7382  C CB   . TYR A 1 21  ? 20.452  4.359   1.763   1.00 0.00 ? 21  TYR A CB   20 
ATOM 7383  C CG   . TYR A 1 21  ? 21.362  3.659   2.743   1.00 0.00 ? 21  TYR A CG   20 
ATOM 7384  C CD1  . TYR A 1 21  ? 21.435  4.101   4.071   1.00 0.00 ? 21  TYR A CD1  20 
ATOM 7385  C CD2  . TYR A 1 21  ? 22.125  2.563   2.327   1.00 0.00 ? 21  TYR A CD2  20 
ATOM 7386  C CE1  . TYR A 1 21  ? 22.272  3.444   4.984   1.00 0.00 ? 21  TYR A CE1  20 
ATOM 7387  C CE2  . TYR A 1 21  ? 22.961  1.906   3.238   1.00 0.00 ? 21  TYR A CE2  20 
ATOM 7388  C CZ   . TYR A 1 21  ? 23.035  2.347   4.566   1.00 0.00 ? 21  TYR A CZ   20 
ATOM 7389  O OH   . TYR A 1 21  ? 23.861  1.701   5.462   1.00 0.00 ? 21  TYR A OH   20 
ATOM 7390  H H    . TYR A 1 21  ? 18.394  5.170   0.391   1.00 0.00 ? 21  TYR A H    20 
ATOM 7391  H HA   . TYR A 1 21  ? 18.886  2.907   1.962   1.00 0.00 ? 21  TYR A HA   20 
ATOM 7392  H HB2  . TYR A 1 21  ? 20.697  4.055   0.756   1.00 0.00 ? 21  TYR A HB2  20 
ATOM 7393  H HB3  . TYR A 1 21  ? 20.573  5.429   1.859   1.00 0.00 ? 21  TYR A HB3  20 
ATOM 7394  H HD1  . TYR A 1 21  ? 20.846  4.947   4.392   1.00 0.00 ? 21  TYR A HD1  20 
ATOM 7395  H HD2  . TYR A 1 21  ? 22.065  2.222   1.304   1.00 0.00 ? 21  TYR A HD2  20 
ATOM 7396  H HE1  . TYR A 1 21  ? 22.326  3.783   6.011   1.00 0.00 ? 21  TYR A HE1  20 
ATOM 7397  H HE2  . TYR A 1 21  ? 23.550  1.059   2.917   1.00 0.00 ? 21  TYR A HE2  20 
ATOM 7398  H HH   . TYR A 1 21  ? 24.122  2.334   6.135   1.00 0.00 ? 21  TYR A HH   20 
ATOM 7399  N N    . ILE A 1 22  ? 18.678  3.428   4.416   1.00 0.00 ? 22  ILE A N    20 
ATOM 7400  C CA   . ILE A 1 22  ? 18.371  3.769   5.829   1.00 0.00 ? 22  ILE A CA   20 
ATOM 7401  C C    . ILE A 1 22  ? 19.467  3.222   6.741   1.00 0.00 ? 22  ILE A C    20 
ATOM 7402  O O    . ILE A 1 22  ? 19.653  2.026   6.857   1.00 0.00 ? 22  ILE A O    20 
ATOM 7403  C CB   . ILE A 1 22  ? 17.028  3.151   6.222   1.00 0.00 ? 22  ILE A CB   20 
ATOM 7404  C CG1  . ILE A 1 22  ? 15.934  3.674   5.287   1.00 0.00 ? 22  ILE A CG1  20 
ATOM 7405  C CG2  . ILE A 1 22  ? 16.694  3.534   7.665   1.00 0.00 ? 22  ILE A CG2  20 
ATOM 7406  C CD1  . ILE A 1 22  ? 14.559  3.321   5.858   1.00 0.00 ? 22  ILE A CD1  20 
ATOM 7407  H H    . ILE A 1 22  ? 18.864  2.500   4.162   1.00 0.00 ? 22  ILE A H    20 
ATOM 7408  H HA   . ILE A 1 22  ? 18.317  4.841   5.936   1.00 0.00 ? 22  ILE A HA   20 
ATOM 7409  H HB   . ILE A 1 22  ? 17.090  2.075   6.141   1.00 0.00 ? 22  ILE A HB   20 
ATOM 7410  H HG12 . ILE A 1 22  ? 16.023  4.747   5.195   1.00 0.00 ? 22  ILE A HG12 20 
ATOM 7411  H HG13 . ILE A 1 22  ? 16.045  3.218   4.315   1.00 0.00 ? 22  ILE A HG13 20 
ATOM 7412  H HG21 . ILE A 1 22  ? 17.565  3.386   8.288   1.00 0.00 ? 22  ILE A HG21 20 
ATOM 7413  H HG22 . ILE A 1 22  ? 16.398  4.572   7.702   1.00 0.00 ? 22  ILE A HG22 20 
ATOM 7414  H HG23 . ILE A 1 22  ? 15.885  2.916   8.024   1.00 0.00 ? 22  ILE A HG23 20 
ATOM 7415  H HD11 . ILE A 1 22  ? 14.668  2.558   6.614   1.00 0.00 ? 22  ILE A HD11 20 
ATOM 7416  H HD12 . ILE A 1 22  ? 14.114  4.203   6.297   1.00 0.00 ? 22  ILE A HD12 20 
ATOM 7417  H HD13 . ILE A 1 22  ? 13.924  2.954   5.065   1.00 0.00 ? 22  ILE A HD13 20 
ATOM 7418  N N    . ASP A 1 23  ? 20.184  4.085   7.405   1.00 0.00 ? 23  ASP A N    20 
ATOM 7419  C CA   . ASP A 1 23  ? 21.250  3.606   8.323   1.00 0.00 ? 23  ASP A CA   20 
ATOM 7420  C C    . ASP A 1 23  ? 20.601  3.265   9.660   1.00 0.00 ? 23  ASP A C    20 
ATOM 7421  O O    . ASP A 1 23  ? 20.347  4.124   10.473  1.00 0.00 ? 23  ASP A O    20 
ATOM 7422  C CB   . ASP A 1 23  ? 22.308  4.694   8.505   1.00 0.00 ? 23  ASP A CB   20 
ATOM 7423  C CG   . ASP A 1 23  ? 23.256  4.307   9.643   1.00 0.00 ? 23  ASP A CG   20 
ATOM 7424  O OD1  . ASP A 1 23  ? 23.116  3.209   10.158  1.00 0.00 ? 23  ASP A OD1  20 
ATOM 7425  O OD2  . ASP A 1 23  ? 24.110  5.112   9.977   1.00 0.00 ? 23  ASP A OD2  20 
ATOM 7426  H H    . ASP A 1 23  ? 20.011  5.046   7.310   1.00 0.00 ? 23  ASP A H    20 
ATOM 7427  H HA   . ASP A 1 23  ? 21.709  2.721   7.915   1.00 0.00 ? 23  ASP A HA   20 
ATOM 7428  H HB2  . ASP A 1 23  ? 22.872  4.803   7.589   1.00 0.00 ? 23  ASP A HB2  20 
ATOM 7429  H HB3  . ASP A 1 23  ? 21.826  5.625   8.740   1.00 0.00 ? 23  ASP A HB3  20 
ATOM 7430  N N    . PHE A 1 24  ? 20.316  2.003   9.851   1.00 0.00 ? 24  PHE A N    20 
ATOM 7431  C CA   . PHE A 1 24  ? 19.651  1.507   11.101  1.00 0.00 ? 24  PHE A CA   20 
ATOM 7432  C C    . PHE A 1 24  ? 19.622  2.561   12.212  1.00 0.00 ? 24  PHE A C    20 
ATOM 7433  O O    . PHE A 1 24  ? 18.572  2.903   12.720  1.00 0.00 ? 24  PHE A O    20 
ATOM 7434  C CB   . PHE A 1 24  ? 20.405  0.276   11.607  1.00 0.00 ? 24  PHE A CB   20 
ATOM 7435  C CG   . PHE A 1 24  ? 19.831  -0.960  10.961  1.00 0.00 ? 24  PHE A CG   20 
ATOM 7436  C CD1  . PHE A 1 24  ? 18.531  -1.372  11.273  1.00 0.00 ? 24  PHE A CD1  20 
ATOM 7437  C CD2  . PHE A 1 24  ? 20.595  -1.689  10.044  1.00 0.00 ? 24  PHE A CD2  20 
ATOM 7438  C CE1  . PHE A 1 24  ? 17.995  -2.513  10.667  1.00 0.00 ? 24  PHE A CE1  20 
ATOM 7439  C CE2  . PHE A 1 24  ? 20.059  -2.832  9.441   1.00 0.00 ? 24  PHE A CE2  20 
ATOM 7440  C CZ   . PHE A 1 24  ? 18.760  -3.244  9.752   1.00 0.00 ? 24  PHE A CZ   20 
ATOM 7441  H H    . PHE A 1 24  ? 20.529  1.362   9.142   1.00 0.00 ? 24  PHE A H    20 
ATOM 7442  H HA   . PHE A 1 24  ? 18.638  1.219   10.866  1.00 0.00 ? 24  PHE A HA   20 
ATOM 7443  H HB2  . PHE A 1 24  ? 21.452  0.364   11.354  1.00 0.00 ? 24  PHE A HB2  20 
ATOM 7444  H HB3  . PHE A 1 24  ? 20.297  0.204   12.680  1.00 0.00 ? 24  PHE A HB3  20 
ATOM 7445  H HD1  . PHE A 1 24  ? 17.944  -0.812  11.982  1.00 0.00 ? 24  PHE A HD1  20 
ATOM 7446  H HD2  . PHE A 1 24  ? 21.598  -1.370  9.803   1.00 0.00 ? 24  PHE A HD2  20 
ATOM 7447  H HE1  . PHE A 1 24  ? 16.991  -2.831  10.909  1.00 0.00 ? 24  PHE A HE1  20 
ATOM 7448  H HE2  . PHE A 1 24  ? 20.648  -3.398  8.738   1.00 0.00 ? 24  PHE A HE2  20 
ATOM 7449  H HZ   . PHE A 1 24  ? 18.347  -4.123  9.284   1.00 0.00 ? 24  PHE A HZ   20 
ATOM 7450  N N    . ARG A 1 25  ? 20.758  3.056   12.621  1.00 0.00 ? 25  ARG A N    20 
ATOM 7451  C CA   . ARG A 1 25  ? 20.771  4.050   13.734  1.00 0.00 ? 25  ARG A CA   20 
ATOM 7452  C C    . ARG A 1 25  ? 20.636  5.490   13.219  1.00 0.00 ? 25  ARG A C    20 
ATOM 7453  O O    . ARG A 1 25  ? 20.017  6.320   13.854  1.00 0.00 ? 25  ARG A O    20 
ATOM 7454  C CB   . ARG A 1 25  ? 22.080  3.918   14.515  1.00 0.00 ? 25  ARG A CB   20 
ATOM 7455  C CG   . ARG A 1 25  ? 21.901  4.523   15.909  1.00 0.00 ? 25  ARG A CG   20 
ATOM 7456  C CD   . ARG A 1 25  ? 22.916  3.908   16.873  1.00 0.00 ? 25  ARG A CD   20 
ATOM 7457  N NE   . ARG A 1 25  ? 23.897  4.950   17.293  1.00 0.00 ? 25  ARG A NE   20 
ATOM 7458  C CZ   . ARG A 1 25  ? 24.167  5.129   18.558  1.00 0.00 ? 25  ARG A CZ   20 
ATOM 7459  N NH1  . ARG A 1 25  ? 23.969  4.166   19.417  1.00 0.00 ? 25  ARG A NH1  20 
ATOM 7460  N NH2  . ARG A 1 25  ? 24.641  6.275   18.966  1.00 0.00 ? 25  ARG A NH2  20 
ATOM 7461  H H    . ARG A 1 25  ? 21.600  2.756   12.220  1.00 0.00 ? 25  ARG A H    20 
ATOM 7462  H HA   . ARG A 1 25  ? 19.949  3.835   14.397  1.00 0.00 ? 25  ARG A HA   20 
ATOM 7463  H HB2  . ARG A 1 25  ? 22.342  2.874   14.604  1.00 0.00 ? 25  ARG A HB2  20 
ATOM 7464  H HB3  . ARG A 1 25  ? 22.865  4.444   13.994  1.00 0.00 ? 25  ARG A HB3  20 
ATOM 7465  H HG2  . ARG A 1 25  ? 22.053  5.592   15.858  1.00 0.00 ? 25  ARG A HG2  20 
ATOM 7466  H HG3  . ARG A 1 25  ? 20.901  4.320   16.264  1.00 0.00 ? 25  ARG A HG3  20 
ATOM 7467  H HD2  . ARG A 1 25  ? 22.399  3.529   17.742  1.00 0.00 ? 25  ARG A HD2  20 
ATOM 7468  H HD3  . ARG A 1 25  ? 23.436  3.099   16.382  1.00 0.00 ? 25  ARG A HD3  20 
ATOM 7469  H HE   . ARG A 1 25  ? 24.342  5.501   16.616  1.00 0.00 ? 25  ARG A HE   20 
ATOM 7470  H HH11 . ARG A 1 25  ? 23.612  3.285   19.108  1.00 0.00 ? 25  ARG A HH11 20 
ATOM 7471  H HH12 . ARG A 1 25  ? 24.176  4.309   20.385  1.00 0.00 ? 25  ARG A HH12 20 
ATOM 7472  H HH21 . ARG A 1 25  ? 24.798  7.013   18.311  1.00 0.00 ? 25  ARG A HH21 20 
ATOM 7473  H HH22 . ARG A 1 25  ? 24.847  6.414   19.935  1.00 0.00 ? 25  ARG A HH22 20 
ATOM 7474  N N    . LYS A 1 26  ? 21.221  5.812   12.100  1.00 0.00 ? 26  LYS A N    20 
ATOM 7475  C CA   . LYS A 1 26  ? 21.125  7.218   11.605  1.00 0.00 ? 26  LYS A CA   20 
ATOM 7476  C C    . LYS A 1 26  ? 19.665  7.592   11.347  1.00 0.00 ? 26  LYS A C    20 
ATOM 7477  O O    . LYS A 1 26  ? 19.201  8.643   11.741  1.00 0.00 ? 26  LYS A O    20 
ATOM 7478  C CB   . LYS A 1 26  ? 21.896  7.354   10.296  1.00 0.00 ? 26  LYS A CB   20 
ATOM 7479  C CG   . LYS A 1 26  ? 22.481  8.764   10.190  1.00 0.00 ? 26  LYS A CG   20 
ATOM 7480  C CD   . LYS A 1 26  ? 21.834  9.500   9.015   1.00 0.00 ? 26  LYS A CD   20 
ATOM 7481  C CE   . LYS A 1 26  ? 21.975  11.009  9.219   1.00 0.00 ? 26  LYS A CE   20 
ATOM 7482  N NZ   . LYS A 1 26  ? 22.125  11.677  7.895   1.00 0.00 ? 26  LYS A NZ   20 
ATOM 7483  H H    . LYS A 1 26  ? 21.739  5.144   11.598  1.00 0.00 ? 26  LYS A H    20 
ATOM 7484  H HA   . LYS A 1 26  ? 21.545  7.889   12.339  1.00 0.00 ? 26  LYS A HA   20 
ATOM 7485  H HB2  . LYS A 1 26  ? 22.687  6.623   10.268  1.00 0.00 ? 26  LYS A HB2  20 
ATOM 7486  H HB3  . LYS A 1 26  ? 21.222  7.187   9.469   1.00 0.00 ? 26  LYS A HB3  20 
ATOM 7487  H HG2  . LYS A 1 26  ? 22.285  9.303   11.105  1.00 0.00 ? 26  LYS A HG2  20 
ATOM 7488  H HG3  . LYS A 1 26  ? 23.546  8.700   10.029  1.00 0.00 ? 26  LYS A HG3  20 
ATOM 7489  H HD2  . LYS A 1 26  ? 22.324  9.212   8.096   1.00 0.00 ? 26  LYS A HD2  20 
ATOM 7490  H HD3  . LYS A 1 26  ? 20.787  9.242   8.961   1.00 0.00 ? 26  LYS A HD3  20 
ATOM 7491  H HE2  . LYS A 1 26  ? 21.095  11.390  9.717   1.00 0.00 ? 26  LYS A HE2  20 
ATOM 7492  H HE3  . LYS A 1 26  ? 22.847  11.211  9.824   1.00 0.00 ? 26  LYS A HE3  20 
ATOM 7493  H HZ1  . LYS A 1 26  ? 21.689  11.086  7.158   1.00 0.00 ? 26  LYS A HZ1  20 
ATOM 7494  H HZ2  . LYS A 1 26  ? 21.655  12.604  7.919   1.00 0.00 ? 26  LYS A HZ2  20 
ATOM 7495  H HZ3  . LYS A 1 26  ? 23.134  11.808  7.685   1.00 0.00 ? 26  LYS A HZ3  20 
ATOM 7496  N N    . ASP A 1 27  ? 18.950  6.752   10.656  1.00 0.00 ? 27  ASP A N    20 
ATOM 7497  C CA   . ASP A 1 27  ? 17.534  7.061   10.328  1.00 0.00 ? 27  ASP A CA   20 
ATOM 7498  C C    . ASP A 1 27  ? 16.580  6.552   11.417  1.00 0.00 ? 27  ASP A C    20 
ATOM 7499  O O    . ASP A 1 27  ? 15.841  7.315   12.005  1.00 0.00 ? 27  ASP A O    20 
ATOM 7500  C CB   . ASP A 1 27  ? 17.194  6.383   9.007   1.00 0.00 ? 27  ASP A CB   20 
ATOM 7501  C CG   . ASP A 1 27  ? 17.477  7.340   7.848   1.00 0.00 ? 27  ASP A CG   20 
ATOM 7502  O OD1  . ASP A 1 27  ? 16.782  8.339   7.748   1.00 0.00 ? 27  ASP A OD1  20 
ATOM 7503  O OD2  . ASP A 1 27  ? 18.382  7.060   7.081   1.00 0.00 ? 27  ASP A OD2  20 
ATOM 7504  H H    . ASP A 1 27  ? 19.354  5.927   10.323  1.00 0.00 ? 27  ASP A H    20 
ATOM 7505  H HA   . ASP A 1 27  ? 17.416  8.128   10.218  1.00 0.00 ? 27  ASP A HA   20 
ATOM 7506  H HB2  . ASP A 1 27  ? 17.799  5.495   8.895   1.00 0.00 ? 27  ASP A HB2  20 
ATOM 7507  H HB3  . ASP A 1 27  ? 16.158  6.109   9.005   1.00 0.00 ? 27  ASP A HB3  20 
ATOM 7508  N N    . LEU A 1 28  ? 16.564  5.272   11.668  1.00 0.00 ? 28  LEU A N    20 
ATOM 7509  C CA   . LEU A 1 28  ? 15.621  4.730   12.696  1.00 0.00 ? 28  LEU A CA   20 
ATOM 7510  C C    . LEU A 1 28  ? 16.258  4.757   14.086  1.00 0.00 ? 28  LEU A C    20 
ATOM 7511  O O    . LEU A 1 28  ? 15.584  4.590   15.082  1.00 0.00 ? 28  LEU A O    20 
ATOM 7512  C CB   . LEU A 1 28  ? 15.269  3.284   12.346  1.00 0.00 ? 28  LEU A CB   20 
ATOM 7513  C CG   . LEU A 1 28  ? 14.761  3.216   10.907  1.00 0.00 ? 28  LEU A CG   20 
ATOM 7514  C CD1  . LEU A 1 28  ? 14.221  1.813   10.621  1.00 0.00 ? 28  LEU A CD1  20 
ATOM 7515  C CD2  . LEU A 1 28  ? 13.640  4.237   10.719  1.00 0.00 ? 28  LEU A CD2  20 
ATOM 7516  H H    . LEU A 1 28  ? 17.146  4.664   11.166  1.00 0.00 ? 28  LEU A H    20 
ATOM 7517  H HA   . LEU A 1 28  ? 14.719  5.323   12.704  1.00 0.00 ? 28  LEU A HA   20 
ATOM 7518  H HB2  . LEU A 1 28  ? 16.148  2.665   12.448  1.00 0.00 ? 28  LEU A HB2  20 
ATOM 7519  H HB3  . LEU A 1 28  ? 14.498  2.930   13.014  1.00 0.00 ? 28  LEU A HB3  20 
ATOM 7520  H HG   . LEU A 1 28  ? 15.573  3.438   10.230  1.00 0.00 ? 28  LEU A HG   20 
ATOM 7521  H HD11 . LEU A 1 28  ? 14.364  1.189   11.491  1.00 0.00 ? 28  LEU A HD11 20 
ATOM 7522  H HD12 . LEU A 1 28  ? 13.168  1.873   10.390  1.00 0.00 ? 28  LEU A HD12 20 
ATOM 7523  H HD13 . LEU A 1 28  ? 14.750  1.387   9.782   1.00 0.00 ? 28  LEU A HD13 20 
ATOM 7524  H HD21 . LEU A 1 28  ? 14.013  5.227   10.938  1.00 0.00 ? 28  LEU A HD21 20 
ATOM 7525  H HD22 . LEU A 1 28  ? 13.288  4.201   9.701   1.00 0.00 ? 28  LEU A HD22 20 
ATOM 7526  H HD23 . LEU A 1 28  ? 12.827  4.004   11.389  1.00 0.00 ? 28  LEU A HD23 20 
ATOM 7527  N N    . GLY A 1 29  ? 17.542  4.952   14.174  1.00 0.00 ? 29  GLY A N    20 
ATOM 7528  C CA   . GLY A 1 29  ? 18.185  4.968   15.519  1.00 0.00 ? 29  GLY A CA   20 
ATOM 7529  C C    . GLY A 1 29  ? 17.967  3.606   16.184  1.00 0.00 ? 29  GLY A C    20 
ATOM 7530  O O    . GLY A 1 29  ? 18.144  3.445   17.375  1.00 0.00 ? 29  GLY A O    20 
ATOM 7531  H H    . GLY A 1 29  ? 18.081  5.077   13.364  1.00 0.00 ? 29  GLY A H    20 
ATOM 7532  H HA2  . GLY A 1 29  ? 19.242  5.163   15.418  1.00 0.00 ? 29  GLY A HA2  20 
ATOM 7533  H HA3  . GLY A 1 29  ? 17.732  5.737   16.126  1.00 0.00 ? 29  GLY A HA3  20 
ATOM 7534  N N    . TRP A 1 30  ? 17.574  2.625   15.413  1.00 0.00 ? 30  TRP A N    20 
ATOM 7535  C CA   . TRP A 1 30  ? 17.328  1.269   15.976  1.00 0.00 ? 30  TRP A CA   20 
ATOM 7536  C C    . TRP A 1 30  ? 18.461  0.883   16.925  1.00 0.00 ? 30  TRP A C    20 
ATOM 7537  O O    . TRP A 1 30  ? 19.626  1.019   16.611  1.00 0.00 ? 30  TRP A O    20 
ATOM 7538  C CB   . TRP A 1 30  ? 17.256  0.259   14.832  1.00 0.00 ? 30  TRP A CB   20 
ATOM 7539  C CG   . TRP A 1 30  ? 15.851  0.186   14.328  1.00 0.00 ? 30  TRP A CG   20 
ATOM 7540  C CD1  . TRP A 1 30  ? 14.872  1.071   14.627  1.00 0.00 ? 30  TRP A CD1  20 
ATOM 7541  C CD2  . TRP A 1 30  ? 15.252  -0.807  13.451  1.00 0.00 ? 30  TRP A CD2  20 
ATOM 7542  N NE1  . TRP A 1 30  ? 13.709  0.683   13.987  1.00 0.00 ? 30  TRP A NE1  20 
ATOM 7543  C CE2  . TRP A 1 30  ? 13.893  -0.470  13.250  1.00 0.00 ? 30  TRP A CE2  20 
ATOM 7544  C CE3  . TRP A 1 30  ? 15.751  -1.958  12.815  1.00 0.00 ? 30  TRP A CE3  20 
ATOM 7545  C CZ2  . TRP A 1 30  ? 13.057  -1.246  12.447  1.00 0.00 ? 30  TRP A CZ2  20 
ATOM 7546  C CZ3  . TRP A 1 30  ? 14.912  -2.742  12.007  1.00 0.00 ? 30  TRP A CZ3  20 
ATOM 7547  C CH2  . TRP A 1 30  ? 13.569  -2.388  11.824  1.00 0.00 ? 30  TRP A CH2  20 
ATOM 7548  H H    . TRP A 1 30  ? 17.434  2.785   14.458  1.00 0.00 ? 30  TRP A H    20 
ATOM 7549  H HA   . TRP A 1 30  ? 16.393  1.266   16.514  1.00 0.00 ? 30  TRP A HA   20 
ATOM 7550  H HB2  . TRP A 1 30  ? 17.910  0.574   14.031  1.00 0.00 ? 30  TRP A HB2  20 
ATOM 7551  H HB3  . TRP A 1 30  ? 17.562  -0.713  15.188  1.00 0.00 ? 30  TRP A HB3  20 
ATOM 7552  H HD1  . TRP A 1 30  ? 14.981  1.939   15.261  1.00 0.00 ? 30  TRP A HD1  20 
ATOM 7553  H HE1  . TRP A 1 30  ? 12.851  1.154   14.039  1.00 0.00 ? 30  TRP A HE1  20 
ATOM 7554  H HE3  . TRP A 1 30  ? 16.786  -2.242  12.951  1.00 0.00 ? 30  TRP A HE3  20 
ATOM 7555  H HZ2  . TRP A 1 30  ? 12.023  -0.969  12.309  1.00 0.00 ? 30  TRP A HZ2  20 
ATOM 7556  H HZ3  . TRP A 1 30  ? 15.303  -3.624  11.525  1.00 0.00 ? 30  TRP A HZ3  20 
ATOM 7557  H HH2  . TRP A 1 30  ? 12.929  -2.995  11.202  1.00 0.00 ? 30  TRP A HH2  20 
ATOM 7558  N N    . LYS A 1 31  ? 18.121  0.407   18.090  1.00 0.00 ? 31  LYS A N    20 
ATOM 7559  C CA   . LYS A 1 31  ? 19.152  0.012   19.071  1.00 0.00 ? 31  LYS A CA   20 
ATOM 7560  C C    . LYS A 1 31  ? 19.123  -1.504  19.260  1.00 0.00 ? 31  LYS A C    20 
ATOM 7561  O O    . LYS A 1 31  ? 19.998  -2.079  19.877  1.00 0.00 ? 31  LYS A O    20 
ATOM 7562  C CB   . LYS A 1 31  ? 18.828  0.690   20.394  1.00 0.00 ? 31  LYS A CB   20 
ATOM 7563  C CG   . LYS A 1 31  ? 19.533  2.044   20.468  1.00 0.00 ? 31  LYS A CG   20 
ATOM 7564  C CD   . LYS A 1 31  ? 19.772  2.415   21.932  1.00 0.00 ? 31  LYS A CD   20 
ATOM 7565  C CE   . LYS A 1 31  ? 21.058  1.750   22.423  1.00 0.00 ? 31  LYS A CE   20 
ATOM 7566  N NZ   . LYS A 1 31  ? 22.201  2.688   22.246  1.00 0.00 ? 31  LYS A NZ   20 
ATOM 7567  H H    . LYS A 1 31  ? 17.177  0.312   18.325  1.00 0.00 ? 31  LYS A H    20 
ATOM 7568  H HA   . LYS A 1 31  ? 20.127  0.325   18.729  1.00 0.00 ? 31  LYS A HA   20 
ATOM 7569  H HB2  . LYS A 1 31  ? 17.759  0.835   20.463  1.00 0.00 ? 31  LYS A HB2  20 
ATOM 7570  H HB3  . LYS A 1 31  ? 19.154  0.065   21.201  1.00 0.00 ? 31  LYS A HB3  20 
ATOM 7571  H HG2  . LYS A 1 31  ? 20.481  1.984   19.951  1.00 0.00 ? 31  LYS A HG2  20 
ATOM 7572  H HG3  . LYS A 1 31  ? 18.916  2.798   20.003  1.00 0.00 ? 31  LYS A HG3  20 
ATOM 7573  H HD2  . LYS A 1 31  ? 19.864  3.489   22.020  1.00 0.00 ? 31  LYS A HD2  20 
ATOM 7574  H HD3  . LYS A 1 31  ? 18.941  2.075   22.531  1.00 0.00 ? 31  LYS A HD3  20 
ATOM 7575  H HE2  . LYS A 1 31  ? 20.957  1.497   23.468  1.00 0.00 ? 31  LYS A HE2  20 
ATOM 7576  H HE3  . LYS A 1 31  ? 21.238  0.851   21.852  1.00 0.00 ? 31  LYS A HE3  20 
ATOM 7577  H HZ1  . LYS A 1 31  ? 21.840  3.634   22.013  1.00 0.00 ? 31  LYS A HZ1  20 
ATOM 7578  H HZ2  . LYS A 1 31  ? 22.751  2.734   23.129  1.00 0.00 ? 31  LYS A HZ2  20 
ATOM 7579  H HZ3  . LYS A 1 31  ? 22.810  2.352   21.475  1.00 0.00 ? 31  LYS A HZ3  20 
ATOM 7580  N N    . TRP A 1 32  ? 18.118  -2.156  18.744  1.00 0.00 ? 32  TRP A N    20 
ATOM 7581  C CA   . TRP A 1 32  ? 18.031  -3.634  18.909  1.00 0.00 ? 32  TRP A CA   20 
ATOM 7582  C C    . TRP A 1 32  ? 18.811  -4.332  17.800  1.00 0.00 ? 32  TRP A C    20 
ATOM 7583  O O    . TRP A 1 32  ? 18.922  -5.540  17.779  1.00 0.00 ? 32  TRP A O    20 
ATOM 7584  C CB   . TRP A 1 32  ? 16.565  -4.073  18.863  1.00 0.00 ? 32  TRP A CB   20 
ATOM 7585  C CG   . TRP A 1 32  ? 16.056  -4.035  17.455  1.00 0.00 ? 32  TRP A CG   20 
ATOM 7586  C CD1  . TRP A 1 32  ? 15.675  -2.918  16.795  1.00 0.00 ? 32  TRP A CD1  20 
ATOM 7587  C CD2  . TRP A 1 32  ? 15.864  -5.141  16.524  1.00 0.00 ? 32  TRP A CD2  20 
ATOM 7588  N NE1  . TRP A 1 32  ? 15.243  -3.268  15.532  1.00 0.00 ? 32  TRP A NE1  20 
ATOM 7589  C CE2  . TRP A 1 32  ? 15.344  -4.626  15.314  1.00 0.00 ? 32  TRP A CE2  20 
ATOM 7590  C CE3  . TRP A 1 32  ? 16.085  -6.525  16.611  1.00 0.00 ? 32  TRP A CE3  20 
ATOM 7591  C CZ2  . TRP A 1 32  ? 15.052  -5.455  14.230  1.00 0.00 ? 32  TRP A CZ2  20 
ATOM 7592  C CZ3  . TRP A 1 32  ? 15.795  -7.364  15.523  1.00 0.00 ? 32  TRP A CZ3  20 
ATOM 7593  C CH2  . TRP A 1 32  ? 15.277  -6.829  14.335  1.00 0.00 ? 32  TRP A CH2  20 
ATOM 7594  H H    . TRP A 1 32  ? 17.416  -1.673  18.256  1.00 0.00 ? 32  TRP A H    20 
ATOM 7595  H HA   . TRP A 1 32  ? 18.451  -3.908  19.864  1.00 0.00 ? 32  TRP A HA   20 
ATOM 7596  H HB2  . TRP A 1 32  ? 16.482  -5.080  19.244  1.00 0.00 ? 32  TRP A HB2  20 
ATOM 7597  H HB3  . TRP A 1 32  ? 15.974  -3.409  19.475  1.00 0.00 ? 32  TRP A HB3  20 
ATOM 7598  H HD1  . TRP A 1 32  ? 15.696  -1.918  17.190  1.00 0.00 ? 32  TRP A HD1  20 
ATOM 7599  H HE1  . TRP A 1 32  ? 14.907  -2.643  14.860  1.00 0.00 ? 32  TRP A HE1  20 
ATOM 7600  H HE3  . TRP A 1 32  ? 16.488  -6.944  17.517  1.00 0.00 ? 32  TRP A HE3  20 
ATOM 7601  H HZ2  . TRP A 1 32  ? 14.654  -5.037  13.318  1.00 0.00 ? 32  TRP A HZ2  20 
ATOM 7602  H HZ3  . TRP A 1 32  ? 15.970  -8.428  15.605  1.00 0.00 ? 32  TRP A HZ3  20 
ATOM 7603  H HH2  . TRP A 1 32  ? 15.056  -7.476  13.500  1.00 0.00 ? 32  TRP A HH2  20 
ATOM 7604  N N    . ILE A 1 33  ? 19.352  -3.589  16.877  1.00 0.00 ? 33  ILE A N    20 
ATOM 7605  C CA   . ILE A 1 33  ? 20.120  -4.228  15.774  1.00 0.00 ? 33  ILE A CA   20 
ATOM 7606  C C    . ILE A 1 33  ? 21.543  -3.662  15.740  1.00 0.00 ? 33  ILE A C    20 
ATOM 7607  O O    . ILE A 1 33  ? 21.754  -2.466  15.790  1.00 0.00 ? 33  ILE A O    20 
ATOM 7608  C CB   . ILE A 1 33  ? 19.408  -3.963  14.441  1.00 0.00 ? 33  ILE A CB   20 
ATOM 7609  C CG1  . ILE A 1 33  ? 18.305  -5.003  14.257  1.00 0.00 ? 33  ILE A CG1  20 
ATOM 7610  C CG2  . ILE A 1 33  ? 20.397  -4.071  13.276  1.00 0.00 ? 33  ILE A CG2  20 
ATOM 7611  C CD1  . ILE A 1 33  ? 17.480  -4.668  13.017  1.00 0.00 ? 33  ILE A CD1  20 
ATOM 7612  H H    . ILE A 1 33  ? 19.251  -2.615  16.908  1.00 0.00 ? 33  ILE A H    20 
ATOM 7613  H HA   . ILE A 1 33  ? 20.165  -5.293  15.947  1.00 0.00 ? 33  ILE A HA   20 
ATOM 7614  H HB   . ILE A 1 33  ? 18.972  -2.975  14.454  1.00 0.00 ? 33  ILE A HB   20 
ATOM 7615  H HG12 . ILE A 1 33  ? 18.748  -5.976  14.137  1.00 0.00 ? 33  ILE A HG12 20 
ATOM 7616  H HG13 . ILE A 1 33  ? 17.667  -5.002  15.122  1.00 0.00 ? 33  ILE A HG13 20 
ATOM 7617  H HG21 . ILE A 1 33  ? 20.904  -5.023  13.321  1.00 0.00 ? 33  ILE A HG21 20 
ATOM 7618  H HG22 . ILE A 1 33  ? 19.864  -3.988  12.342  1.00 0.00 ? 33  ILE A HG22 20 
ATOM 7619  H HG23 . ILE A 1 33  ? 21.124  -3.274  13.348  1.00 0.00 ? 33  ILE A HG23 20 
ATOM 7620  H HD11 . ILE A 1 33  ? 18.101  -4.150  12.303  1.00 0.00 ? 33  ILE A HD11 20 
ATOM 7621  H HD12 . ILE A 1 33  ? 17.106  -5.580  12.576  1.00 0.00 ? 33  ILE A HD12 20 
ATOM 7622  H HD13 . ILE A 1 33  ? 16.652  -4.040  13.298  1.00 0.00 ? 33  ILE A HD13 20 
ATOM 7623  N N    . HIS A 1 34  ? 22.517  -4.523  15.646  1.00 0.00 ? 34  HIS A N    20 
ATOM 7624  C CA   . HIS A 1 34  ? 23.932  -4.062  15.597  1.00 0.00 ? 34  HIS A CA   20 
ATOM 7625  C C    . HIS A 1 34  ? 24.385  -3.993  14.135  1.00 0.00 ? 34  HIS A C    20 
ATOM 7626  O O    . HIS A 1 34  ? 24.881  -2.984  13.675  1.00 0.00 ? 34  HIS A O    20 
ATOM 7627  C CB   . HIS A 1 34  ? 24.811  -5.051  16.367  1.00 0.00 ? 34  HIS A CB   20 
ATOM 7628  C CG   . HIS A 1 34  ? 26.260  -4.795  16.056  1.00 0.00 ? 34  HIS A CG   20 
ATOM 7629  N ND1  . HIS A 1 34  ? 26.827  -3.534  16.156  1.00 0.00 ? 34  HIS A ND1  20 
ATOM 7630  C CD2  . HIS A 1 34  ? 27.272  -5.629  15.649  1.00 0.00 ? 34  HIS A CD2  20 
ATOM 7631  C CE1  . HIS A 1 34  ? 28.124  -3.645  15.817  1.00 0.00 ? 34  HIS A CE1  20 
ATOM 7632  N NE2  . HIS A 1 34  ? 28.448  -4.901  15.499  1.00 0.00 ? 34  HIS A NE2  20 
ATOM 7633  H H    . HIS A 1 34  ? 22.313  -5.480  15.603  1.00 0.00 ? 34  HIS A H    20 
ATOM 7634  H HA   . HIS A 1 34  ? 24.009  -3.083  16.046  1.00 0.00 ? 34  HIS A HA   20 
ATOM 7635  H HB2  . HIS A 1 34  ? 24.645  -4.930  17.427  1.00 0.00 ? 34  HIS A HB2  20 
ATOM 7636  H HB3  . HIS A 1 34  ? 24.556  -6.060  16.077  1.00 0.00 ? 34  HIS A HB3  20 
ATOM 7637  H HD1  . HIS A 1 34  ? 26.367  -2.712  16.426  1.00 0.00 ? 34  HIS A HD1  20 
ATOM 7638  H HD2  . HIS A 1 34  ? 27.170  -6.690  15.469  1.00 0.00 ? 34  HIS A HD2  20 
ATOM 7639  H HE1  . HIS A 1 34  ? 28.820  -2.818  15.803  1.00 0.00 ? 34  HIS A HE1  20 
ATOM 7640  N N    . GLU A 1 35  ? 24.211  -5.058  13.399  1.00 0.00 ? 35  GLU A N    20 
ATOM 7641  C CA   . GLU A 1 35  ? 24.625  -5.055  11.967  1.00 0.00 ? 35  GLU A CA   20 
ATOM 7642  C C    . GLU A 1 35  ? 23.452  -5.522  11.100  1.00 0.00 ? 35  GLU A C    20 
ATOM 7643  O O    . GLU A 1 35  ? 22.596  -6.250  11.561  1.00 0.00 ? 35  GLU A O    20 
ATOM 7644  C CB   . GLU A 1 35  ? 25.809  -6.005  11.769  1.00 0.00 ? 35  GLU A CB   20 
ATOM 7645  C CG   . GLU A 1 35  ? 26.838  -5.780  12.877  1.00 0.00 ? 35  GLU A CG   20 
ATOM 7646  C CD   . GLU A 1 35  ? 28.239  -5.716  12.268  1.00 0.00 ? 35  GLU A CD   20 
ATOM 7647  O OE1  . GLU A 1 35  ? 28.537  -4.726  11.618  1.00 0.00 ? 35  GLU A OE1  20 
ATOM 7648  O OE2  . GLU A 1 35  ? 28.993  -6.655  12.461  1.00 0.00 ? 35  GLU A OE2  20 
ATOM 7649  H H    . GLU A 1 35  ? 23.805  -5.860  13.788  1.00 0.00 ? 35  GLU A H    20 
ATOM 7650  H HA   . GLU A 1 35  ? 24.912  -4.054  11.676  1.00 0.00 ? 35  GLU A HA   20 
ATOM 7651  H HB2  . GLU A 1 35  ? 25.459  -7.026  11.803  1.00 0.00 ? 35  GLU A HB2  20 
ATOM 7652  H HB3  . GLU A 1 35  ? 26.267  -5.813  10.810  1.00 0.00 ? 35  GLU A HB3  20 
ATOM 7653  H HG2  . GLU A 1 35  ? 26.622  -4.853  13.386  1.00 0.00 ? 35  GLU A HG2  20 
ATOM 7654  H HG3  . GLU A 1 35  ? 26.792  -6.597  13.581  1.00 0.00 ? 35  GLU A HG3  20 
ATOM 7655  N N    . PRO A 1 36  ? 23.449  -5.090  9.865   1.00 0.00 ? 36  PRO A N    20 
ATOM 7656  C CA   . PRO A 1 36  ? 24.493  -4.206  9.316   1.00 0.00 ? 36  PRO A CA   20 
ATOM 7657  C C    . PRO A 1 36  ? 24.259  -2.763  9.768   1.00 0.00 ? 36  PRO A C    20 
ATOM 7658  O O    . PRO A 1 36  ? 23.278  -2.456  10.414  1.00 0.00 ? 36  PRO A O    20 
ATOM 7659  C CB   . PRO A 1 36  ? 24.312  -4.337  7.801   1.00 0.00 ? 36  PRO A CB   20 
ATOM 7660  C CG   . PRO A 1 36  ? 22.858  -4.816  7.576   1.00 0.00 ? 36  PRO A CG   20 
ATOM 7661  C CD   . PRO A 1 36  ? 22.393  -5.451  8.899   1.00 0.00 ? 36  PRO A CD   20 
ATOM 7662  H HA   . PRO A 1 36  ? 25.473  -4.542  9.602   1.00 0.00 ? 36  PRO A HA   20 
ATOM 7663  H HB2  . PRO A 1 36  ? 24.470  -3.378  7.325   1.00 0.00 ? 36  PRO A HB2  20 
ATOM 7664  H HB3  . PRO A 1 36  ? 25.001  -5.068  7.406   1.00 0.00 ? 36  PRO A HB3  20 
ATOM 7665  H HG2  . PRO A 1 36  ? 22.228  -3.975  7.322   1.00 0.00 ? 36  PRO A HG2  20 
ATOM 7666  H HG3  . PRO A 1 36  ? 22.829  -5.552  6.787   1.00 0.00 ? 36  PRO A HG3  20 
ATOM 7667  H HD2  . PRO A 1 36  ? 21.441  -5.037  9.201   1.00 0.00 ? 36  PRO A HD2  20 
ATOM 7668  H HD3  . PRO A 1 36  ? 22.328  -6.524  8.803   1.00 0.00 ? 36  PRO A HD3  20 
ATOM 7669  N N    . LYS A 1 37  ? 25.149  -1.876  9.424   1.00 0.00 ? 37  LYS A N    20 
ATOM 7670  C CA   . LYS A 1 37  ? 24.980  -0.459  9.819   1.00 0.00 ? 37  LYS A CA   20 
ATOM 7671  C C    . LYS A 1 37  ? 23.720  0.097   9.162   1.00 0.00 ? 37  LYS A C    20 
ATOM 7672  O O    . LYS A 1 37  ? 23.012  0.906   9.727   1.00 0.00 ? 37  LYS A O    20 
ATOM 7673  C CB   . LYS A 1 37  ? 26.193  0.323   9.328   1.00 0.00 ? 37  LYS A CB   20 
ATOM 7674  C CG   . LYS A 1 37  ? 27.267  0.345   10.416  1.00 0.00 ? 37  LYS A CG   20 
ATOM 7675  C CD   . LYS A 1 37  ? 28.510  1.067   9.893   1.00 0.00 ? 37  LYS A CD   20 
ATOM 7676  C CE   . LYS A 1 37  ? 29.740  0.184   10.108  1.00 0.00 ? 37  LYS A CE   20 
ATOM 7677  N NZ   . LYS A 1 37  ? 30.709  0.889   10.994  1.00 0.00 ? 37  LYS A NZ   20 
ATOM 7678  H H    . LYS A 1 37  ? 25.930  -2.138  8.898   1.00 0.00 ? 37  LYS A H    20 
ATOM 7679  H HA   . LYS A 1 37  ? 24.904  -0.380  10.892  1.00 0.00 ? 37  LYS A HA   20 
ATOM 7680  H HB2  . LYS A 1 37  ? 26.587  -0.155  8.441   1.00 0.00 ? 37  LYS A HB2  20 
ATOM 7681  H HB3  . LYS A 1 37  ? 25.896  1.323   9.089   1.00 0.00 ? 37  LYS A HB3  20 
ATOM 7682  H HG2  . LYS A 1 37  ? 26.887  0.863   11.285  1.00 0.00 ? 37  LYS A HG2  20 
ATOM 7683  H HG3  . LYS A 1 37  ? 27.528  -0.667  10.686  1.00 0.00 ? 37  LYS A HG3  20 
ATOM 7684  H HD2  . LYS A 1 37  ? 28.390  1.272   8.839   1.00 0.00 ? 37  LYS A HD2  20 
ATOM 7685  H HD3  . LYS A 1 37  ? 28.637  1.996   10.428  1.00 0.00 ? 37  LYS A HD3  20 
ATOM 7686  H HE2  . LYS A 1 37  ? 29.441  -0.746  10.568  1.00 0.00 ? 37  LYS A HE2  20 
ATOM 7687  H HE3  . LYS A 1 37  ? 30.206  -0.020  9.155   1.00 0.00 ? 37  LYS A HE3  20 
ATOM 7688  H HZ1  . LYS A 1 37  ? 30.982  1.793   10.561  1.00 0.00 ? 37  LYS A HZ1  20 
ATOM 7689  H HZ2  . LYS A 1 37  ? 30.266  1.066   11.919  1.00 0.00 ? 37  LYS A HZ2  20 
ATOM 7690  H HZ3  . LYS A 1 37  ? 31.556  0.299   11.122  1.00 0.00 ? 37  LYS A HZ3  20 
ATOM 7691  N N    . GLY A 1 38  ? 23.439  -0.336  7.967   1.00 0.00 ? 38  GLY A N    20 
ATOM 7692  C CA   . GLY A 1 38  ? 22.227  0.156   7.254   1.00 0.00 ? 38  GLY A CA   20 
ATOM 7693  C C    . GLY A 1 38  ? 21.914  -0.773  6.081   1.00 0.00 ? 38  GLY A C    20 
ATOM 7694  O O    . GLY A 1 38  ? 22.442  -1.863  5.983   1.00 0.00 ? 38  GLY A O    20 
ATOM 7695  H H    . GLY A 1 38  ? 24.032  -0.989  7.536   1.00 0.00 ? 38  GLY A H    20 
ATOM 7696  H HA2  . GLY A 1 38  ? 21.389  0.172   7.937   1.00 0.00 ? 38  GLY A HA2  20 
ATOM 7697  H HA3  . GLY A 1 38  ? 22.407  1.153   6.882   1.00 0.00 ? 38  GLY A HA3  20 
ATOM 7698  N N    . TYR A 1 39  ? 21.059  -0.354  5.187   1.00 0.00 ? 39  TYR A N    20 
ATOM 7699  C CA   . TYR A 1 39  ? 20.718  -1.220  4.023   1.00 0.00 ? 39  TYR A CA   20 
ATOM 7700  C C    . TYR A 1 39  ? 19.876  -0.426  3.020   1.00 0.00 ? 39  TYR A C    20 
ATOM 7701  O O    . TYR A 1 39  ? 19.394  0.650   3.315   1.00 0.00 ? 39  TYR A O    20 
ATOM 7702  C CB   . TYR A 1 39  ? 19.931  -2.441  4.510   1.00 0.00 ? 39  TYR A CB   20 
ATOM 7703  C CG   . TYR A 1 39  ? 18.510  -2.041  4.838   1.00 0.00 ? 39  TYR A CG   20 
ATOM 7704  C CD1  . TYR A 1 39  ? 18.248  -1.213  5.937   1.00 0.00 ? 39  TYR A CD1  20 
ATOM 7705  C CD2  . TYR A 1 39  ? 17.455  -2.501  4.042   1.00 0.00 ? 39  TYR A CD2  20 
ATOM 7706  C CE1  . TYR A 1 39  ? 16.931  -0.845  6.239   1.00 0.00 ? 39  TYR A CE1  20 
ATOM 7707  C CE2  . TYR A 1 39  ? 16.138  -2.134  4.344   1.00 0.00 ? 39  TYR A CE2  20 
ATOM 7708  C CZ   . TYR A 1 39  ? 15.876  -1.307  5.443   1.00 0.00 ? 39  TYR A CZ   20 
ATOM 7709  O OH   . TYR A 1 39  ? 14.578  -0.945  5.741   1.00 0.00 ? 39  TYR A OH   20 
ATOM 7710  H H    . TYR A 1 39  ? 20.643  0.528   5.282   1.00 0.00 ? 39  TYR A H    20 
ATOM 7711  H HA   . TYR A 1 39  ? 21.629  -1.550  3.544   1.00 0.00 ? 39  TYR A HA   20 
ATOM 7712  H HB2  . TYR A 1 39  ? 19.921  -3.194  3.736   1.00 0.00 ? 39  TYR A HB2  20 
ATOM 7713  H HB3  . TYR A 1 39  ? 20.403  -2.843  5.394   1.00 0.00 ? 39  TYR A HB3  20 
ATOM 7714  H HD1  . TYR A 1 39  ? 19.059  -0.856  6.551   1.00 0.00 ? 39  TYR A HD1  20 
ATOM 7715  H HD2  . TYR A 1 39  ? 17.658  -3.138  3.195   1.00 0.00 ? 39  TYR A HD2  20 
ATOM 7716  H HE1  . TYR A 1 39  ? 16.729  -0.208  7.086   1.00 0.00 ? 39  TYR A HE1  20 
ATOM 7717  H HE2  . TYR A 1 39  ? 15.325  -2.490  3.730   1.00 0.00 ? 39  TYR A HE2  20 
ATOM 7718  H HH   . TYR A 1 39  ? 13.990  -1.581  5.325   1.00 0.00 ? 39  TYR A HH   20 
ATOM 7719  N N    . HIS A 1 40  ? 19.692  -0.950  1.838   1.00 0.00 ? 40  HIS A N    20 
ATOM 7720  C CA   . HIS A 1 40  ? 18.878  -0.225  0.823   1.00 0.00 ? 40  HIS A CA   20 
ATOM 7721  C C    . HIS A 1 40  ? 17.396  -0.503  1.078   1.00 0.00 ? 40  HIS A C    20 
ATOM 7722  O O    . HIS A 1 40  ? 16.798  -1.362  0.461   1.00 0.00 ? 40  HIS A O    20 
ATOM 7723  C CB   . HIS A 1 40  ? 19.256  -0.713  -0.578  1.00 0.00 ? 40  HIS A CB   20 
ATOM 7724  C CG   . HIS A 1 40  ? 20.711  -0.428  -0.833  1.00 0.00 ? 40  HIS A CG   20 
ATOM 7725  N ND1  . HIS A 1 40  ? 21.720  -1.252  -0.356  1.00 0.00 ? 40  HIS A ND1  20 
ATOM 7726  C CD2  . HIS A 1 40  ? 21.343  0.583   -1.513  1.00 0.00 ? 40  HIS A CD2  20 
ATOM 7727  C CE1  . HIS A 1 40  ? 22.893  -0.726  -0.753  1.00 0.00 ? 40  HIS A CE1  20 
ATOM 7728  N NE2  . HIS A 1 40  ? 22.721  0.393   -1.461  1.00 0.00 ? 40  HIS A NE2  20 
ATOM 7729  H H    . HIS A 1 40  ? 20.086  -1.820  1.621   1.00 0.00 ? 40  HIS A H    20 
ATOM 7730  H HA   . HIS A 1 40  ? 19.068  0.837   0.899   1.00 0.00 ? 40  HIS A HA   20 
ATOM 7731  H HB2  . HIS A 1 40  ? 19.079  -1.776  -0.649  1.00 0.00 ? 40  HIS A HB2  20 
ATOM 7732  H HB3  . HIS A 1 40  ? 18.655  -0.197  -1.313  1.00 0.00 ? 40  HIS A HB3  20 
ATOM 7733  H HD1  . HIS A 1 40  ? 21.599  -2.069  0.173   1.00 0.00 ? 40  HIS A HD1  20 
ATOM 7734  H HD2  . HIS A 1 40  ? 20.846  1.402   -2.012  1.00 0.00 ? 40  HIS A HD2  20 
ATOM 7735  H HE1  . HIS A 1 40  ? 23.857  -1.157  -0.526  1.00 0.00 ? 40  HIS A HE1  20 
ATOM 7736  N N    . ALA A 1 41  ? 16.799  0.215   1.990   1.00 0.00 ? 41  ALA A N    20 
ATOM 7737  C CA   . ALA A 1 41  ? 15.358  -0.011  2.295   1.00 0.00 ? 41  ALA A CA   20 
ATOM 7738  C C    . ALA A 1 41  ? 14.500  0.400   1.096   1.00 0.00 ? 41  ALA A C    20 
ATOM 7739  O O    . ALA A 1 41  ? 13.554  -0.275  0.741   1.00 0.00 ? 41  ALA A O    20 
ATOM 7740  C CB   . ALA A 1 41  ? 14.965  0.816   3.520   1.00 0.00 ? 41  ALA A CB   20 
ATOM 7741  H H    . ALA A 1 41  ? 17.301  0.899   2.480   1.00 0.00 ? 41  ALA A H    20 
ATOM 7742  H HA   . ALA A 1 41  ? 15.197  -1.058  2.505   1.00 0.00 ? 41  ALA A HA   20 
ATOM 7743  H HB1  . ALA A 1 41  ? 15.763  0.782   4.248   1.00 0.00 ? 41  ALA A HB1  20 
ATOM 7744  H HB2  . ALA A 1 41  ? 14.793  1.839   3.223   1.00 0.00 ? 41  ALA A HB2  20 
ATOM 7745  H HB3  . ALA A 1 41  ? 14.064  0.410   3.956   1.00 0.00 ? 41  ALA A HB3  20 
ATOM 7746  N N    . ASN A 1 42  ? 14.817  1.498   0.468   1.00 0.00 ? 42  ASN A N    20 
ATOM 7747  C CA   . ASN A 1 42  ? 14.011  1.941   -0.706  1.00 0.00 ? 42  ASN A CA   20 
ATOM 7748  C C    . ASN A 1 42  ? 12.580  2.240   -0.260  1.00 0.00 ? 42  ASN A C    20 
ATOM 7749  O O    . ASN A 1 42  ? 12.230  2.063   0.891   1.00 0.00 ? 42  ASN A O    20 
ATOM 7750  C CB   . ASN A 1 42  ? 13.989  0.827   -1.756  1.00 0.00 ? 42  ASN A CB   20 
ATOM 7751  C CG   . ASN A 1 42  ? 15.095  1.071   -2.784  1.00 0.00 ? 42  ASN A CG   20 
ATOM 7752  O OD1  . ASN A 1 42  ? 15.748  2.097   -2.760  1.00 0.00 ? 42  ASN A OD1  20 
ATOM 7753  N ND2  . ASN A 1 42  ? 15.335  0.166   -3.694  1.00 0.00 ? 42  ASN A ND2  20 
ATOM 7754  H H    . ASN A 1 42  ? 15.583  2.032   0.767   1.00 0.00 ? 42  ASN A H    20 
ATOM 7755  H HA   . ASN A 1 42  ? 14.450  2.830   -1.133  1.00 0.00 ? 42  ASN A HA   20 
ATOM 7756  H HB2  . ASN A 1 42  ? 14.148  -0.126  -1.273  1.00 0.00 ? 42  ASN A HB2  20 
ATOM 7757  H HB3  . ASN A 1 42  ? 13.031  0.822   -2.254  1.00 0.00 ? 42  ASN A HB3  20 
ATOM 7758  H HD21 . ASN A 1 42  ? 14.809  -0.660  -3.713  1.00 0.00 ? 42  ASN A HD21 20 
ATOM 7759  H HD22 . ASN A 1 42  ? 16.041  0.314   -4.357  1.00 0.00 ? 42  ASN A HD22 20 
ATOM 7760  N N    . PHE A 1 43  ? 11.745  2.684   -1.160  1.00 0.00 ? 43  PHE A N    20 
ATOM 7761  C CA   . PHE A 1 43  ? 10.336  2.983   -0.780  1.00 0.00 ? 43  PHE A CA   20 
ATOM 7762  C C    . PHE A 1 43  ? 9.567   3.476   -2.006  1.00 0.00 ? 43  PHE A C    20 
ATOM 7763  O O    . PHE A 1 43  ? 10.019  3.341   -3.121  1.00 0.00 ? 43  PHE A O    20 
ATOM 7764  C CB   . PHE A 1 43  ? 10.312  4.042   0.326   1.00 0.00 ? 43  PHE A CB   20 
ATOM 7765  C CG   . PHE A 1 43  ? 10.650  5.404   -0.226  1.00 0.00 ? 43  PHE A CG   20 
ATOM 7766  C CD1  . PHE A 1 43  ? 11.784  5.595   -1.027  1.00 0.00 ? 43  PHE A CD1  20 
ATOM 7767  C CD2  . PHE A 1 43  ? 9.823   6.488   0.083   1.00 0.00 ? 43  PHE A CD2  20 
ATOM 7768  C CE1  . PHE A 1 43  ? 12.085  6.871   -1.516  1.00 0.00 ? 43  PHE A CE1  20 
ATOM 7769  C CE2  . PHE A 1 43  ? 10.124  7.760   -0.405  1.00 0.00 ? 43  PHE A CE2  20 
ATOM 7770  C CZ   . PHE A 1 43  ? 11.255  7.954   -1.206  1.00 0.00 ? 43  PHE A CZ   20 
ATOM 7771  H H    . PHE A 1 43  ? 12.042  2.813   -2.087  1.00 0.00 ? 43  PHE A H    20 
ATOM 7772  H HA   . PHE A 1 43  ? 9.871   2.078   -0.415  1.00 0.00 ? 43  PHE A HA   20 
ATOM 7773  H HB2  . PHE A 1 43  ? 9.326   4.079   0.759   1.00 0.00 ? 43  PHE A HB2  20 
ATOM 7774  H HB3  . PHE A 1 43  ? 11.028  3.779   1.090   1.00 0.00 ? 43  PHE A HB3  20 
ATOM 7775  H HD1  . PHE A 1 43  ? 12.430  4.760   -1.265  1.00 0.00 ? 43  PHE A HD1  20 
ATOM 7776  H HD2  . PHE A 1 43  ? 8.949   6.340   0.699   1.00 0.00 ? 43  PHE A HD2  20 
ATOM 7777  H HE1  . PHE A 1 43  ? 12.958  7.021   -2.133  1.00 0.00 ? 43  PHE A HE1  20 
ATOM 7778  H HE2  . PHE A 1 43  ? 9.484   8.591   -0.161  1.00 0.00 ? 43  PHE A HE2  20 
ATOM 7779  H HZ   . PHE A 1 43  ? 11.488  8.940   -1.582  1.00 0.00 ? 43  PHE A HZ   20 
ATOM 7780  N N    . CYS A 1 44  ? 8.400   4.029   -1.821  1.00 0.00 ? 44  CYS A N    20 
ATOM 7781  C CA   . CYS A 1 44  ? 7.620   4.503   -3.000  1.00 0.00 ? 44  CYS A CA   20 
ATOM 7782  C C    . CYS A 1 44  ? 6.911   5.816   -2.662  1.00 0.00 ? 44  CYS A C    20 
ATOM 7783  O O    . CYS A 1 44  ? 6.623   6.102   -1.517  1.00 0.00 ? 44  CYS A O    20 
ATOM 7784  C CB   . CYS A 1 44  ? 6.571   3.454   -3.388  1.00 0.00 ? 44  CYS A CB   20 
ATOM 7785  S SG   . CYS A 1 44  ? 7.180   1.792   -3.004  1.00 0.00 ? 44  CYS A SG   20 
ATOM 7786  H H    . CYS A 1 44  ? 8.035   4.121   -0.915  1.00 0.00 ? 44  CYS A H    20 
ATOM 7787  H HA   . CYS A 1 44  ? 8.292   4.661   -3.831  1.00 0.00 ? 44  CYS A HA   20 
ATOM 7788  H HB2  . CYS A 1 44  ? 5.660   3.637   -2.837  1.00 0.00 ? 44  CYS A HB2  20 
ATOM 7789  H HB3  . CYS A 1 44  ? 6.369   3.526   -4.445  1.00 0.00 ? 44  CYS A HB3  20 
ATOM 7790  N N    . LEU A 1 45  ? 6.621   6.615   -3.655  1.00 0.00 ? 45  LEU A N    20 
ATOM 7791  C CA   . LEU A 1 45  ? 5.925   7.907   -3.392  1.00 0.00 ? 45  LEU A CA   20 
ATOM 7792  C C    . LEU A 1 45  ? 4.969   8.219   -4.547  1.00 0.00 ? 45  LEU A C    20 
ATOM 7793  O O    . LEU A 1 45  ? 5.197   7.832   -5.676  1.00 0.00 ? 45  LEU A O    20 
ATOM 7794  C CB   . LEU A 1 45  ? 6.959   9.028   -3.268  1.00 0.00 ? 45  LEU A CB   20 
ATOM 7795  C CG   . LEU A 1 45  ? 7.689   8.902   -1.933  1.00 0.00 ? 45  LEU A CG   20 
ATOM 7796  C CD1  . LEU A 1 45  ? 8.650   10.080  -1.762  1.00 0.00 ? 45  LEU A CD1  20 
ATOM 7797  C CD2  . LEU A 1 45  ? 6.668   8.905   -0.793  1.00 0.00 ? 45  LEU A CD2  20 
ATOM 7798  H H    . LEU A 1 45  ? 6.860   6.363   -4.573  1.00 0.00 ? 45  LEU A H    20 
ATOM 7799  H HA   . LEU A 1 45  ? 5.364   7.832   -2.473  1.00 0.00 ? 45  LEU A HA   20 
ATOM 7800  H HB2  . LEU A 1 45  ? 7.671   8.952   -4.077  1.00 0.00 ? 45  LEU A HB2  20 
ATOM 7801  H HB3  . LEU A 1 45  ? 6.458   9.983   -3.315  1.00 0.00 ? 45  LEU A HB3  20 
ATOM 7802  H HG   . LEU A 1 45  ? 8.247   7.977   -1.915  1.00 0.00 ? 45  LEU A HG   20 
ATOM 7803  H HD11 . LEU A 1 45  ? 8.530   10.766  -2.587  1.00 0.00 ? 45  LEU A HD11 20 
ATOM 7804  H HD12 . LEU A 1 45  ? 8.431   10.591  -0.835  1.00 0.00 ? 45  LEU A HD12 20 
ATOM 7805  H HD13 . LEU A 1 45  ? 9.666   9.716   -1.740  1.00 0.00 ? 45  LEU A HD13 20 
ATOM 7806  H HD21 . LEU A 1 45  ? 5.697   9.177   -1.180  1.00 0.00 ? 45  LEU A HD21 20 
ATOM 7807  H HD22 . LEU A 1 45  ? 6.617   7.922   -0.352  1.00 0.00 ? 45  LEU A HD22 20 
ATOM 7808  H HD23 . LEU A 1 45  ? 6.970   9.621   -0.045  1.00 0.00 ? 45  LEU A HD23 20 
ATOM 7809  N N    . GLY A 1 46  ? 3.903   8.922   -4.272  1.00 0.00 ? 46  GLY A N    20 
ATOM 7810  C CA   . GLY A 1 46  ? 2.933   9.265   -5.353  1.00 0.00 ? 46  GLY A CA   20 
ATOM 7811  C C    . GLY A 1 46  ? 1.988   8.082   -5.599  1.00 0.00 ? 46  GLY A C    20 
ATOM 7812  O O    . GLY A 1 46  ? 2.384   6.940   -5.480  1.00 0.00 ? 46  GLY A O    20 
ATOM 7813  H H    . GLY A 1 46  ? 3.742   9.226   -3.355  1.00 0.00 ? 46  GLY A H    20 
ATOM 7814  H HA2  . GLY A 1 46  ? 2.360   10.131  -5.056  1.00 0.00 ? 46  GLY A HA2  20 
ATOM 7815  H HA3  . GLY A 1 46  ? 3.472   9.484   -6.262  1.00 0.00 ? 46  GLY A HA3  20 
ATOM 7816  N N    . PRO A 1 47  ? 0.763   8.398   -5.941  1.00 0.00 ? 47  PRO A N    20 
ATOM 7817  C CA   . PRO A 1 47  ? -0.272  7.386   -6.218  1.00 0.00 ? 47  PRO A CA   20 
ATOM 7818  C C    . PRO A 1 47  ? -0.084  6.802   -7.622  1.00 0.00 ? 47  PRO A C    20 
ATOM 7819  O O    . PRO A 1 47  ? 0.901   7.061   -8.284  1.00 0.00 ? 47  PRO A O    20 
ATOM 7820  C CB   . PRO A 1 47  ? -1.581  8.177   -6.127  1.00 0.00 ? 47  PRO A CB   20 
ATOM 7821  C CG   . PRO A 1 47  ? -1.212  9.660   -6.369  1.00 0.00 ? 47  PRO A CG   20 
ATOM 7822  C CD   . PRO A 1 47  ? 0.296   9.793   -6.081  1.00 0.00 ? 47  PRO A CD   20 
ATOM 7823  H HA   . PRO A 1 47  ? -0.257  6.607   -5.473  1.00 0.00 ? 47  PRO A HA   20 
ATOM 7824  H HB2  . PRO A 1 47  ? -2.273  7.833   -6.883  1.00 0.00 ? 47  PRO A HB2  20 
ATOM 7825  H HB3  . PRO A 1 47  ? -2.014  8.065   -5.146  1.00 0.00 ? 47  PRO A HB3  20 
ATOM 7826  H HG2  . PRO A 1 47  ? -1.421  9.930   -7.395  1.00 0.00 ? 47  PRO A HG2  20 
ATOM 7827  H HG3  . PRO A 1 47  ? -1.768  10.295  -5.697  1.00 0.00 ? 47  PRO A HG3  20 
ATOM 7828  H HD2  . PRO A 1 47  ? 0.796   10.281  -6.907  1.00 0.00 ? 47  PRO A HD2  20 
ATOM 7829  H HD3  . PRO A 1 47  ? 0.460   10.334  -5.163  1.00 0.00 ? 47  PRO A HD3  20 
ATOM 7830  N N    . CYS A 1 48  ? -1.020  6.014   -8.081  1.00 0.00 ? 48  CYS A N    20 
ATOM 7831  C CA   . CYS A 1 48  ? -0.885  5.418   -9.441  1.00 0.00 ? 48  CYS A CA   20 
ATOM 7832  C C    . CYS A 1 48  ? -2.260  5.295   -10.103 1.00 0.00 ? 48  CYS A C    20 
ATOM 7833  O O    . CYS A 1 48  ? -3.258  5.119   -9.432  1.00 0.00 ? 48  CYS A O    20 
ATOM 7834  C CB   . CYS A 1 48  ? -0.264  4.022   -9.337  1.00 0.00 ? 48  CYS A CB   20 
ATOM 7835  S SG   . CYS A 1 48  ? -0.830  3.206   -7.823  1.00 0.00 ? 48  CYS A SG   20 
ATOM 7836  H H    . CYS A 1 48  ? -1.807  5.816   -7.533  1.00 0.00 ? 48  CYS A H    20 
ATOM 7837  H HA   . CYS A 1 48  ? -0.251  6.047   -10.047 1.00 0.00 ? 48  CYS A HA   20 
ATOM 7838  H HB2  . CYS A 1 48  ? -0.563  3.434   -10.192 1.00 0.00 ? 48  CYS A HB2  20 
ATOM 7839  H HB3  . CYS A 1 48  ? 0.811   4.108   -9.319  1.00 0.00 ? 48  CYS A HB3  20 
ATOM 7840  N N    . PRO A 1 49  ? -2.261  5.370   -11.410 1.00 0.00 ? 49  PRO A N    20 
ATOM 7841  C CA   . PRO A 1 49  ? -3.491  5.248   -12.212 1.00 0.00 ? 49  PRO A CA   20 
ATOM 7842  C C    . PRO A 1 49  ? -3.917  3.767   -12.269 1.00 0.00 ? 49  PRO A C    20 
ATOM 7843  O O    . PRO A 1 49  ? -3.851  3.070   -11.277 1.00 0.00 ? 49  PRO A O    20 
ATOM 7844  C CB   . PRO A 1 49  ? -3.076  5.807   -13.583 1.00 0.00 ? 49  PRO A CB   20 
ATOM 7845  C CG   . PRO A 1 49  ? -1.538  5.690   -13.659 1.00 0.00 ? 49  PRO A CG   20 
ATOM 7846  C CD   . PRO A 1 49  ? -1.035  5.589   -12.207 1.00 0.00 ? 49  PRO A CD   20 
ATOM 7847  H HA   . PRO A 1 49  ? -4.278  5.852   -11.789 1.00 0.00 ? 49  PRO A HA   20 
ATOM 7848  H HB2  . PRO A 1 49  ? -3.531  5.241   -14.378 1.00 0.00 ? 49  PRO A HB2  20 
ATOM 7849  H HB3  . PRO A 1 49  ? -3.361  6.844   -13.660 1.00 0.00 ? 49  PRO A HB3  20 
ATOM 7850  H HG2  . PRO A 1 49  ? -1.262  4.805   -14.214 1.00 0.00 ? 49  PRO A HG2  20 
ATOM 7851  H HG3  . PRO A 1 49  ? -1.121  6.568   -14.128 1.00 0.00 ? 49  PRO A HG3  20 
ATOM 7852  H HD2  . PRO A 1 49  ? -0.357  4.754   -12.100 1.00 0.00 ? 49  PRO A HD2  20 
ATOM 7853  H HD3  . PRO A 1 49  ? -0.556  6.507   -11.908 1.00 0.00 ? 49  PRO A HD3  20 
ATOM 7854  N N    . TYR A 1 50  ? -4.359  3.272   -13.398 1.00 0.00 ? 50  TYR A N    20 
ATOM 7855  C CA   . TYR A 1 50  ? -4.785  1.839   -13.456 1.00 0.00 ? 50  TYR A CA   20 
ATOM 7856  C C    . TYR A 1 50  ? -3.647  0.968   -13.996 1.00 0.00 ? 50  TYR A C    20 
ATOM 7857  O O    . TYR A 1 50  ? -2.881  0.400   -13.246 1.00 0.00 ? 50  TYR A O    20 
ATOM 7858  C CB   . TYR A 1 50  ? -6.018  1.668   -14.362 1.00 0.00 ? 50  TYR A CB   20 
ATOM 7859  C CG   . TYR A 1 50  ? -6.317  2.951   -15.102 1.00 0.00 ? 50  TYR A CG   20 
ATOM 7860  C CD1  . TYR A 1 50  ? -6.873  4.034   -14.417 1.00 0.00 ? 50  TYR A CD1  20 
ATOM 7861  C CD2  . TYR A 1 50  ? -6.039  3.054   -16.470 1.00 0.00 ? 50  TYR A CD2  20 
ATOM 7862  C CE1  . TYR A 1 50  ? -7.150  5.225   -15.098 1.00 0.00 ? 50  TYR A CE1  20 
ATOM 7863  C CE2  . TYR A 1 50  ? -6.316  4.245   -17.152 1.00 0.00 ? 50  TYR A CE2  20 
ATOM 7864  C CZ   . TYR A 1 50  ? -6.872  5.331   -16.465 1.00 0.00 ? 50  TYR A CZ   20 
ATOM 7865  O OH   . TYR A 1 50  ? -7.146  6.505   -17.136 1.00 0.00 ? 50  TYR A OH   20 
ATOM 7866  H H    . TYR A 1 50  ? -4.419  3.832   -14.192 1.00 0.00 ? 50  TYR A H    20 
ATOM 7867  H HA   . TYR A 1 50  ? -5.036  1.508   -12.458 1.00 0.00 ? 50  TYR A HA   20 
ATOM 7868  H HB2  . TYR A 1 50  ? -5.829  0.881   -15.076 1.00 0.00 ? 50  TYR A HB2  20 
ATOM 7869  H HB3  . TYR A 1 50  ? -6.871  1.400   -13.755 1.00 0.00 ? 50  TYR A HB3  20 
ATOM 7870  H HD1  . TYR A 1 50  ? -7.087  3.952   -13.362 1.00 0.00 ? 50  TYR A HD1  20 
ATOM 7871  H HD2  . TYR A 1 50  ? -5.610  2.216   -17.000 1.00 0.00 ? 50  TYR A HD2  20 
ATOM 7872  H HE1  . TYR A 1 50  ? -7.583  6.059   -14.567 1.00 0.00 ? 50  TYR A HE1  20 
ATOM 7873  H HE2  . TYR A 1 50  ? -6.102  4.326   -18.207 1.00 0.00 ? 50  TYR A HE2  20 
ATOM 7874  H HH   . TYR A 1 50  ? -6.312  6.885   -17.421 1.00 0.00 ? 50  TYR A HH   20 
ATOM 7875  N N    . ILE A 1 51  ? -3.549  0.844   -15.294 1.00 0.00 ? 51  ILE A N    20 
ATOM 7876  C CA   . ILE A 1 51  ? -2.481  -0.006  -15.905 1.00 0.00 ? 51  ILE A CA   20 
ATOM 7877  C C    . ILE A 1 51  ? -1.175  0.098   -15.108 1.00 0.00 ? 51  ILE A C    20 
ATOM 7878  O O    . ILE A 1 51  ? -0.381  -0.821  -15.088 1.00 0.00 ? 51  ILE A O    20 
ATOM 7879  C CB   . ILE A 1 51  ? -2.231  0.451   -17.344 1.00 0.00 ? 51  ILE A CB   20 
ATOM 7880  C CG1  . ILE A 1 51  ? -2.173  1.979   -17.392 1.00 0.00 ? 51  ILE A CG1  20 
ATOM 7881  C CG2  . ILE A 1 51  ? -3.369  -0.044  -18.241 1.00 0.00 ? 51  ILE A CG2  20 
ATOM 7882  C CD1  . ILE A 1 51  ? -1.299  2.421   -18.566 1.00 0.00 ? 51  ILE A CD1  20 
ATOM 7883  H H    . ILE A 1 51  ? -4.193  1.303   -15.874 1.00 0.00 ? 51  ILE A H    20 
ATOM 7884  H HA   . ILE A 1 51  ? -2.810  -1.035  -15.913 1.00 0.00 ? 51  ILE A HA   20 
ATOM 7885  H HB   . ILE A 1 51  ? -1.294  0.041   -17.694 1.00 0.00 ? 51  ILE A HB   20 
ATOM 7886  H HG12 . ILE A 1 51  ? -3.172  2.374   -17.516 1.00 0.00 ? 51  ILE A HG12 20 
ATOM 7887  H HG13 . ILE A 1 51  ? -1.751  2.353   -16.470 1.00 0.00 ? 51  ILE A HG13 20 
ATOM 7888  H HG21 . ILE A 1 51  ? -4.022  -0.688  -17.672 1.00 0.00 ? 51  ILE A HG21 20 
ATOM 7889  H HG22 . ILE A 1 51  ? -3.929  0.803   -18.610 1.00 0.00 ? 51  ILE A HG22 20 
ATOM 7890  H HG23 . ILE A 1 51  ? -2.956  -0.594  -19.075 1.00 0.00 ? 51  ILE A HG23 20 
ATOM 7891  H HD11 . ILE A 1 51  ? -0.849  1.554   -19.026 1.00 0.00 ? 51  ILE A HD11 20 
ATOM 7892  H HD12 . ILE A 1 51  ? -1.906  2.940   -19.293 1.00 0.00 ? 51  ILE A HD12 20 
ATOM 7893  H HD13 . ILE A 1 51  ? -0.523  3.082   -18.209 1.00 0.00 ? 51  ILE A HD13 20 
ATOM 7894  N N    . TRP A 1 52  ? -0.939  1.205   -14.461 1.00 0.00 ? 52  TRP A N    20 
ATOM 7895  C CA   . TRP A 1 52  ? 0.323   1.360   -13.677 1.00 0.00 ? 52  TRP A CA   20 
ATOM 7896  C C    . TRP A 1 52  ? 0.451   0.240   -12.640 1.00 0.00 ? 52  TRP A C    20 
ATOM 7897  O O    . TRP A 1 52  ? 0.051   0.392   -11.504 1.00 0.00 ? 52  TRP A O    20 
ATOM 7898  C CB   . TRP A 1 52  ? 0.314   2.709   -12.967 1.00 0.00 ? 52  TRP A CB   20 
ATOM 7899  C CG   . TRP A 1 52  ? 1.683   3.306   -13.026 1.00 0.00 ? 52  TRP A CG   20 
ATOM 7900  C CD1  . TRP A 1 52  ? 2.295   3.931   -11.998 1.00 0.00 ? 52  TRP A CD1  20 
ATOM 7901  C CD2  . TRP A 1 52  ? 2.618   3.343   -14.144 1.00 0.00 ? 52  TRP A CD2  20 
ATOM 7902  N NE1  . TRP A 1 52  ? 3.545   4.355   -12.411 1.00 0.00 ? 52  TRP A NE1  20 
ATOM 7903  C CE2  . TRP A 1 52  ? 3.791   4.014   -13.726 1.00 0.00 ? 52  TRP A CE2  20 
ATOM 7904  C CE3  . TRP A 1 52  ? 2.562   2.866   -15.467 1.00 0.00 ? 52  TRP A CE3  20 
ATOM 7905  C CZ2  . TRP A 1 52  ? 4.872   4.205   -14.589 1.00 0.00 ? 52  TRP A CZ2  20 
ATOM 7906  C CZ3  . TRP A 1 52  ? 3.648   3.058   -16.338 1.00 0.00 ? 52  TRP A CZ3  20 
ATOM 7907  C CH2  . TRP A 1 52  ? 4.800   3.724   -15.899 1.00 0.00 ? 52  TRP A CH2  20 
ATOM 7908  H H    . TRP A 1 52  ? -1.587  1.939   -14.494 1.00 0.00 ? 52  TRP A H    20 
ATOM 7909  H HA   . TRP A 1 52  ? 1.168   1.322   -14.347 1.00 0.00 ? 52  TRP A HA   20 
ATOM 7910  H HB2  . TRP A 1 52  ? -0.388  3.367   -13.454 1.00 0.00 ? 52  TRP A HB2  20 
ATOM 7911  H HB3  . TRP A 1 52  ? 0.025   2.571   -11.936 1.00 0.00 ? 52  TRP A HB3  20 
ATOM 7912  H HD1  . TRP A 1 52  ? 1.874   4.076   -11.017 1.00 0.00 ? 52  TRP A HD1  20 
ATOM 7913  H HE1  . TRP A 1 52  ? 4.190   4.837   -11.854 1.00 0.00 ? 52  TRP A HE1  20 
ATOM 7914  H HE3  . TRP A 1 52  ? 1.680   2.351   -15.816 1.00 0.00 ? 52  TRP A HE3  20 
ATOM 7915  H HZ2  . TRP A 1 52  ? 5.758   4.718   -14.246 1.00 0.00 ? 52  TRP A HZ2  20 
ATOM 7916  H HZ3  . TRP A 1 52  ? 3.595   2.687   -17.351 1.00 0.00 ? 52  TRP A HZ3  20 
ATOM 7917  H HH2  . TRP A 1 52  ? 5.632   3.868   -16.573 1.00 0.00 ? 52  TRP A HH2  20 
ATOM 7918  N N    . SER A 1 53  ? 1.032   -0.870  -13.028 1.00 0.00 ? 53  SER A N    20 
ATOM 7919  C CA   . SER A 1 53  ? 1.226   -2.020  -12.088 1.00 0.00 ? 53  SER A CA   20 
ATOM 7920  C C    . SER A 1 53  ? 0.115   -2.073  -11.035 1.00 0.00 ? 53  SER A C    20 
ATOM 7921  O O    . SER A 1 53  ? 0.172   -1.397  -10.026 1.00 0.00 ? 53  SER A O    20 
ATOM 7922  C CB   . SER A 1 53  ? 2.577   -1.872  -11.386 1.00 0.00 ? 53  SER A CB   20 
ATOM 7923  O OG   . SER A 1 53  ? 2.456   -0.925  -10.333 1.00 0.00 ? 53  SER A OG   20 
ATOM 7924  H H    . SER A 1 53  ? 1.357   -0.943  -13.949 1.00 0.00 ? 53  SER A H    20 
ATOM 7925  H HA   . SER A 1 53  ? 1.224   -2.942  -12.651 1.00 0.00 ? 53  SER A HA   20 
ATOM 7926  H HB2  . SER A 1 53  ? 2.877   -2.821  -10.975 1.00 0.00 ? 53  SER A HB2  20 
ATOM 7927  H HB3  . SER A 1 53  ? 3.319   -1.540  -12.100 1.00 0.00 ? 53  SER A HB3  20 
ATOM 7928  H HG   . SER A 1 53  ? 1.957   -0.174  -10.665 1.00 0.00 ? 53  SER A HG   20 
ATOM 7929  N N    . LEU A 1 54  ? -0.887  -2.880  -11.249 1.00 0.00 ? 54  LEU A N    20 
ATOM 7930  C CA   . LEU A 1 54  ? -1.985  -2.981  -10.248 1.00 0.00 ? 54  LEU A CA   20 
ATOM 7931  C C    . LEU A 1 54  ? -1.794  -4.252  -9.417  1.00 0.00 ? 54  LEU A C    20 
ATOM 7932  O O    . LEU A 1 54  ? -1.583  -5.325  -9.947  1.00 0.00 ? 54  LEU A O    20 
ATOM 7933  C CB   . LEU A 1 54  ? -3.333  -3.031  -10.969 1.00 0.00 ? 54  LEU A CB   20 
ATOM 7934  C CG   . LEU A 1 54  ? -3.621  -1.661  -11.583 1.00 0.00 ? 54  LEU A CG   20 
ATOM 7935  C CD1  . LEU A 1 54  ? -4.726  -1.786  -12.634 1.00 0.00 ? 54  LEU A CD1  20 
ATOM 7936  C CD2  . LEU A 1 54  ? -4.074  -0.698  -10.483 1.00 0.00 ? 54  LEU A CD2  20 
ATOM 7937  H H    . LEU A 1 54  ? -0.911  -3.428  -12.062 1.00 0.00 ? 54  LEU A H    20 
ATOM 7938  H HA   . LEU A 1 54  ? -1.957  -2.119  -9.597  1.00 0.00 ? 54  LEU A HA   20 
ATOM 7939  H HB2  . LEU A 1 54  ? -3.297  -3.778  -11.751 1.00 0.00 ? 54  LEU A HB2  20 
ATOM 7940  H HB3  . LEU A 1 54  ? -4.111  -3.281  -10.265 1.00 0.00 ? 54  LEU A HB3  20 
ATOM 7941  H HG   . LEU A 1 54  ? -2.723  -1.284  -12.047 1.00 0.00 ? 54  LEU A HG   20 
ATOM 7942  H HD11 . LEU A 1 54  ? -5.127  -2.788  -12.618 1.00 0.00 ? 54  LEU A HD11 20 
ATOM 7943  H HD12 . LEU A 1 54  ? -5.513  -1.080  -12.414 1.00 0.00 ? 54  LEU A HD12 20 
ATOM 7944  H HD13 . LEU A 1 54  ? -4.317  -1.577  -13.612 1.00 0.00 ? 54  LEU A HD13 20 
ATOM 7945  H HD21 . LEU A 1 54  ? -3.313  -0.643  -9.718  1.00 0.00 ? 54  LEU A HD21 20 
ATOM 7946  H HD22 . LEU A 1 54  ? -4.229  0.284   -10.906 1.00 0.00 ? 54  LEU A HD22 20 
ATOM 7947  H HD23 . LEU A 1 54  ? -4.996  -1.054  -10.049 1.00 0.00 ? 54  LEU A HD23 20 
ATOM 7948  N N    . ASP A 1 55  ? -1.852  -4.139  -8.118  1.00 0.00 ? 55  ASP A N    20 
ATOM 7949  C CA   . ASP A 1 55  ? -1.660  -5.340  -7.256  1.00 0.00 ? 55  ASP A CA   20 
ATOM 7950  C C    . ASP A 1 55  ? -3.018  -5.943  -6.890  1.00 0.00 ? 55  ASP A C    20 
ATOM 7951  O O    . ASP A 1 55  ? -3.323  -7.067  -7.238  1.00 0.00 ? 55  ASP A O    20 
ATOM 7952  C CB   . ASP A 1 55  ? -0.924  -4.933  -5.979  1.00 0.00 ? 55  ASP A CB   20 
ATOM 7953  C CG   . ASP A 1 55  ? -0.370  -6.180  -5.289  1.00 0.00 ? 55  ASP A CG   20 
ATOM 7954  O OD1  . ASP A 1 55  ? 0.669   -6.658  -5.715  1.00 0.00 ? 55  ASP A OD1  20 
ATOM 7955  O OD2  . ASP A 1 55  ? -0.992  -6.637  -4.343  1.00 0.00 ? 55  ASP A OD2  20 
ATOM 7956  H H    . ASP A 1 55  ? -2.015  -3.262  -7.709  1.00 0.00 ? 55  ASP A H    20 
ATOM 7957  H HA   . ASP A 1 55  ? -1.074  -6.074  -7.789  1.00 0.00 ? 55  ASP A HA   20 
ATOM 7958  H HB2  . ASP A 1 55  ? -0.110  -4.269  -6.232  1.00 0.00 ? 55  ASP A HB2  20 
ATOM 7959  H HB3  . ASP A 1 55  ? -1.608  -4.429  -5.314  1.00 0.00 ? 55  ASP A HB3  20 
ATOM 7960  N N    . THR A 1 56  ? -3.835  -5.209  -6.185  1.00 0.00 ? 56  THR A N    20 
ATOM 7961  C CA   . THR A 1 56  ? -5.167  -5.747  -5.793  1.00 0.00 ? 56  THR A CA   20 
ATOM 7962  C C    . THR A 1 56  ? -6.218  -5.304  -6.813  1.00 0.00 ? 56  THR A C    20 
ATOM 7963  O O    . THR A 1 56  ? -6.016  -4.368  -7.560  1.00 0.00 ? 56  THR A O    20 
ATOM 7964  C CB   . THR A 1 56  ? -5.546  -5.214  -4.409  1.00 0.00 ? 56  THR A CB   20 
ATOM 7965  O OG1  . THR A 1 56  ? -6.007  -3.876  -4.530  1.00 0.00 ? 56  THR A OG1  20 
ATOM 7966  C CG2  . THR A 1 56  ? -4.322  -5.253  -3.493  1.00 0.00 ? 56  THR A CG2  20 
ATOM 7967  H H    . THR A 1 56  ? -3.570  -4.307  -5.910  1.00 0.00 ? 56  THR A H    20 
ATOM 7968  H HA   . THR A 1 56  ? -5.127  -6.826  -5.765  1.00 0.00 ? 56  THR A HA   20 
ATOM 7969  H HB   . THR A 1 56  ? -6.326  -5.828  -3.987  1.00 0.00 ? 56  THR A HB   20 
ATOM 7970  H HG1  . THR A 1 56  ? -5.739  -3.397  -3.741  1.00 0.00 ? 56  THR A HG1  20 
ATOM 7971  H HG21 . THR A 1 56  ? -3.518  -4.689  -3.942  1.00 0.00 ? 56  THR A HG21 20 
ATOM 7972  H HG22 . THR A 1 56  ? -4.576  -4.819  -2.536  1.00 0.00 ? 56  THR A HG22 20 
ATOM 7973  H HG23 . THR A 1 56  ? -4.010  -6.277  -3.352  1.00 0.00 ? 56  THR A HG23 20 
ATOM 7974  N N    . GLN A 1 57  ? -7.339  -5.971  -6.851  1.00 0.00 ? 57  GLN A N    20 
ATOM 7975  C CA   . GLN A 1 57  ? -8.401  -5.586  -7.822  1.00 0.00 ? 57  GLN A CA   20 
ATOM 7976  C C    . GLN A 1 57  ? -8.931  -4.197  -7.465  1.00 0.00 ? 57  GLN A C    20 
ATOM 7977  O O    . GLN A 1 57  ? -9.223  -3.393  -8.329  1.00 0.00 ? 57  GLN A O    20 
ATOM 7978  C CB   . GLN A 1 57  ? -9.544  -6.601  -7.760  1.00 0.00 ? 57  GLN A CB   20 
ATOM 7979  C CG   . GLN A 1 57  ? -10.221 -6.691  -9.129  1.00 0.00 ? 57  GLN A CG   20 
ATOM 7980  C CD   . GLN A 1 57  ? -9.938  -8.059  -9.749  1.00 0.00 ? 57  GLN A CD   20 
ATOM 7981  O OE1  . GLN A 1 57  ? -10.818 -8.680  -10.311 1.00 0.00 ? 57  GLN A OE1  20 
ATOM 7982  N NE2  . GLN A 1 57  ? -8.735  -8.561  -9.669  1.00 0.00 ? 57  GLN A NE2  20 
ATOM 7983  H H    . GLN A 1 57  ? -7.483  -6.723  -6.240  1.00 0.00 ? 57  GLN A H    20 
ATOM 7984  H HA   . GLN A 1 57  ? -7.988  -5.568  -8.820  1.00 0.00 ? 57  GLN A HA   20 
ATOM 7985  H HB2  . GLN A 1 57  ? -9.151  -7.569  -7.488  1.00 0.00 ? 57  GLN A HB2  20 
ATOM 7986  H HB3  . GLN A 1 57  ? -10.267 -6.286  -7.024  1.00 0.00 ? 57  GLN A HB3  20 
ATOM 7987  H HG2  . GLN A 1 57  ? -11.288 -6.561  -9.013  1.00 0.00 ? 57  GLN A HG2  20 
ATOM 7988  H HG3  . GLN A 1 57  ? -9.833  -5.918  -9.775  1.00 0.00 ? 57  GLN A HG3  20 
ATOM 7989  H HE21 . GLN A 1 57  ? -8.025  -8.061  -9.216  1.00 0.00 ? 57  GLN A HE21 20 
ATOM 7990  H HE22 . GLN A 1 57  ? -8.543  -9.438  -10.063 1.00 0.00 ? 57  GLN A HE22 20 
ATOM 7991  N N    . TYR A 1 58  ? -9.056  -3.905  -6.199  1.00 0.00 ? 58  TYR A N    20 
ATOM 7992  C CA   . TYR A 1 58  ? -9.563  -2.565  -5.794  1.00 0.00 ? 58  TYR A CA   20 
ATOM 7993  C C    . TYR A 1 58  ? -8.549  -1.494  -6.223  1.00 0.00 ? 58  TYR A C    20 
ATOM 7994  O O    . TYR A 1 58  ? -8.821  -0.311  -6.163  1.00 0.00 ? 58  TYR A O    20 
ATOM 7995  C CB   . TYR A 1 58  ? -9.773  -2.534  -4.266  1.00 0.00 ? 58  TYR A CB   20 
ATOM 7996  C CG   . TYR A 1 58  ? -9.568  -1.134  -3.739  1.00 0.00 ? 58  TYR A CG   20 
ATOM 7997  C CD1  . TYR A 1 58  ? -10.589 -0.184  -3.852  1.00 0.00 ? 58  TYR A CD1  20 
ATOM 7998  C CD2  . TYR A 1 58  ? -8.347  -0.785  -3.151  1.00 0.00 ? 58  TYR A CD2  20 
ATOM 7999  C CE1  . TYR A 1 58  ? -10.389 1.114   -3.373  1.00 0.00 ? 58  TYR A CE1  20 
ATOM 8000  C CE2  . TYR A 1 58  ? -8.148  0.513   -2.676  1.00 0.00 ? 58  TYR A CE2  20 
ATOM 8001  C CZ   . TYR A 1 58  ? -9.168  1.461   -2.787  1.00 0.00 ? 58  TYR A CZ   20 
ATOM 8002  O OH   . TYR A 1 58  ? -8.969  2.741   -2.321  1.00 0.00 ? 58  TYR A OH   20 
ATOM 8003  H H    . TYR A 1 58  ? -8.813  -4.565  -5.517  1.00 0.00 ? 58  TYR A H    20 
ATOM 8004  H HA   . TYR A 1 58  ? -10.506 -2.378  -6.288  1.00 0.00 ? 58  TYR A HA   20 
ATOM 8005  H HB2  . TYR A 1 58  ? -10.778 -2.856  -4.038  1.00 0.00 ? 58  TYR A HB2  20 
ATOM 8006  H HB3  . TYR A 1 58  ? -9.069  -3.200  -3.789  1.00 0.00 ? 58  TYR A HB3  20 
ATOM 8007  H HD1  . TYR A 1 58  ? -11.531 -0.454  -4.305  1.00 0.00 ? 58  TYR A HD1  20 
ATOM 8008  H HD2  . TYR A 1 58  ? -7.560  -1.519  -3.066  1.00 0.00 ? 58  TYR A HD2  20 
ATOM 8009  H HE1  . TYR A 1 58  ? -11.174 1.850   -3.459  1.00 0.00 ? 58  TYR A HE1  20 
ATOM 8010  H HE2  . TYR A 1 58  ? -7.205  0.783   -2.222  1.00 0.00 ? 58  TYR A HE2  20 
ATOM 8011  H HH   . TYR A 1 58  ? -9.643  3.304   -2.707  1.00 0.00 ? 58  TYR A HH   20 
ATOM 8012  N N    . SER A 1 59  ? -7.384  -1.896  -6.654  1.00 0.00 ? 59  SER A N    20 
ATOM 8013  C CA   . SER A 1 59  ? -6.366  -0.895  -7.081  1.00 0.00 ? 59  SER A CA   20 
ATOM 8014  C C    . SER A 1 59  ? -6.765  -0.307  -8.437  1.00 0.00 ? 59  SER A C    20 
ATOM 8015  O O    . SER A 1 59  ? -6.629  0.876   -8.674  1.00 0.00 ? 59  SER A O    20 
ATOM 8016  C CB   . SER A 1 59  ? -5.000  -1.571  -7.201  1.00 0.00 ? 59  SER A CB   20 
ATOM 8017  O OG   . SER A 1 59  ? -3.985  -0.649  -6.827  1.00 0.00 ? 59  SER A OG   20 
ATOM 8018  H H    . SER A 1 59  ? -7.180  -2.853  -6.695  1.00 0.00 ? 59  SER A H    20 
ATOM 8019  H HA   . SER A 1 59  ? -6.312  -0.102  -6.349  1.00 0.00 ? 59  SER A HA   20 
ATOM 8020  H HB2  . SER A 1 59  ? -4.960  -2.426  -6.547  1.00 0.00 ? 59  SER A HB2  20 
ATOM 8021  H HB3  . SER A 1 59  ? -4.847  -1.895  -8.222  1.00 0.00 ? 59  SER A HB3  20 
ATOM 8022  H HG   . SER A 1 59  ? -3.678  -0.207  -7.622  1.00 0.00 ? 59  SER A HG   20 
ATOM 8023  N N    . LYS A 1 60  ? -7.255  -1.124  -9.328  1.00 0.00 ? 60  LYS A N    20 
ATOM 8024  C CA   . LYS A 1 60  ? -7.662  -0.608  -10.665 1.00 0.00 ? 60  LYS A CA   20 
ATOM 8025  C C    . LYS A 1 60  ? -9.030  0.068   -10.554 1.00 0.00 ? 60  LYS A C    20 
ATOM 8026  O O    . LYS A 1 60  ? -9.359  0.956   -11.314 1.00 0.00 ? 60  LYS A O    20 
ATOM 8027  C CB   . LYS A 1 60  ? -7.744  -1.771  -11.658 1.00 0.00 ? 60  LYS A CB   20 
ATOM 8028  C CG   . LYS A 1 60  ? -8.971  -2.627  -11.343 1.00 0.00 ? 60  LYS A CG   20 
ATOM 8029  C CD   . LYS A 1 60  ? -8.720  -4.067  -11.796 1.00 0.00 ? 60  LYS A CD   20 
ATOM 8030  C CE   . LYS A 1 60  ? -8.756  -4.136  -13.324 1.00 0.00 ? 60  LYS A CE   20 
ATOM 8031  N NZ   . LYS A 1 60  ? -10.138 -3.846  -13.800 1.00 0.00 ? 60  LYS A NZ   20 
ATOM 8032  H H    . LYS A 1 60  ? -7.356  -2.076  -9.117  1.00 0.00 ? 60  LYS A H    20 
ATOM 8033  H HA   . LYS A 1 60  ? -6.933  0.109   -11.010 1.00 0.00 ? 60  LYS A HA   20 
ATOM 8034  H HB2  . LYS A 1 60  ? -7.823  -1.381  -12.662 1.00 0.00 ? 60  LYS A HB2  20 
ATOM 8035  H HB3  . LYS A 1 60  ? -6.853  -2.377  -11.576 1.00 0.00 ? 60  LYS A HB3  20 
ATOM 8036  H HG2  . LYS A 1 60  ? -9.158  -2.611  -10.279 1.00 0.00 ? 60  LYS A HG2  20 
ATOM 8037  H HG3  . LYS A 1 60  ? -9.830  -2.233  -11.866 1.00 0.00 ? 60  LYS A HG3  20 
ATOM 8038  H HD2  . LYS A 1 60  ? -7.752  -4.391  -11.442 1.00 0.00 ? 60  LYS A HD2  20 
ATOM 8039  H HD3  . LYS A 1 60  ? -9.486  -4.711  -11.391 1.00 0.00 ? 60  LYS A HD3  20 
ATOM 8040  H HE2  . LYS A 1 60  ? -8.073  -3.405  -13.733 1.00 0.00 ? 60  LYS A HE2  20 
ATOM 8041  H HE3  . LYS A 1 60  ? -8.462  -5.123  -13.647 1.00 0.00 ? 60  LYS A HE3  20 
ATOM 8042  H HZ1  . LYS A 1 60  ? -10.800 -3.912  -13.002 1.00 0.00 ? 60  LYS A HZ1  20 
ATOM 8043  H HZ2  . LYS A 1 60  ? -10.173 -2.889  -14.203 1.00 0.00 ? 60  LYS A HZ2  20 
ATOM 8044  H HZ3  . LYS A 1 60  ? -10.404 -4.536  -14.531 1.00 0.00 ? 60  LYS A HZ3  20 
ATOM 8045  N N    . VAL A 1 61  ? -9.830  -0.344  -9.607  1.00 0.00 ? 61  VAL A N    20 
ATOM 8046  C CA   . VAL A 1 61  ? -11.173 0.274   -9.442  1.00 0.00 ? 61  VAL A CA   20 
ATOM 8047  C C    . VAL A 1 61  ? -11.010 1.680   -8.858  1.00 0.00 ? 61  VAL A C    20 
ATOM 8048  O O    . VAL A 1 61  ? -11.602 2.630   -9.328  1.00 0.00 ? 61  VAL A O    20 
ATOM 8049  C CB   . VAL A 1 61  ? -12.009 -0.591  -8.491  1.00 0.00 ? 61  VAL A CB   20 
ATOM 8050  C CG1  . VAL A 1 61  ? -13.196 0.214   -7.962  1.00 0.00 ? 61  VAL A CG1  20 
ATOM 8051  C CG2  . VAL A 1 61  ? -12.529 -1.818  -9.244  1.00 0.00 ? 61  VAL A CG2  20 
ATOM 8052  H H    . VAL A 1 61  ? -9.545  -1.060  -9.002  1.00 0.00 ? 61  VAL A H    20 
ATOM 8053  H HA   . VAL A 1 61  ? -11.663 0.334   -10.401 1.00 0.00 ? 61  VAL A HA   20 
ATOM 8054  H HB   . VAL A 1 61  ? -11.395 -0.910  -7.662  1.00 0.00 ? 61  VAL A HB   20 
ATOM 8055  H HG11 . VAL A 1 61  ? -13.267 1.147   -8.503  1.00 0.00 ? 61  VAL A HG11 20 
ATOM 8056  H HG12 . VAL A 1 61  ? -14.105 -0.352  -8.101  1.00 0.00 ? 61  VAL A HG12 20 
ATOM 8057  H HG13 . VAL A 1 61  ? -13.053 0.417   -6.912  1.00 0.00 ? 61  VAL A HG13 20 
ATOM 8058  H HG21 . VAL A 1 61  ? -11.889 -2.016  -10.092 1.00 0.00 ? 61  VAL A HG21 20 
ATOM 8059  H HG22 . VAL A 1 61  ? -12.528 -2.672  -8.586  1.00 0.00 ? 61  VAL A HG22 20 
ATOM 8060  H HG23 . VAL A 1 61  ? -13.535 -1.629  -9.589  1.00 0.00 ? 61  VAL A HG23 20 
ATOM 8061  N N    . LEU A 1 62  ? -10.210 1.815   -7.837  1.00 0.00 ? 62  LEU A N    20 
ATOM 8062  C CA   . LEU A 1 62  ? -10.004 3.153   -7.219  1.00 0.00 ? 62  LEU A CA   20 
ATOM 8063  C C    . LEU A 1 62  ? -9.060  3.974   -8.102  1.00 0.00 ? 62  LEU A C    20 
ATOM 8064  O O    . LEU A 1 62  ? -9.138  5.184   -8.148  1.00 0.00 ? 62  LEU A O    20 
ATOM 8065  C CB   . LEU A 1 62  ? -9.403  2.966   -5.822  1.00 0.00 ? 62  LEU A CB   20 
ATOM 8066  C CG   . LEU A 1 62  ? -8.869  4.294   -5.272  1.00 0.00 ? 62  LEU A CG   20 
ATOM 8067  C CD1  . LEU A 1 62  ? -9.967  5.019   -4.489  1.00 0.00 ? 62  LEU A CD1  20 
ATOM 8068  C CD2  . LEU A 1 62  ? -7.696  4.001   -4.339  1.00 0.00 ? 62  LEU A CD2  20 
ATOM 8069  H H    . LEU A 1 62  ? -9.744  1.034   -7.475  1.00 0.00 ? 62  LEU A H    20 
ATOM 8070  H HA   . LEU A 1 62  ? -10.954 3.661   -7.140  1.00 0.00 ? 62  LEU A HA   20 
ATOM 8071  H HB2  . LEU A 1 62  ? -10.165 2.588   -5.159  1.00 0.00 ? 62  LEU A HB2  20 
ATOM 8072  H HB3  . LEU A 1 62  ? -8.594  2.253   -5.876  1.00 0.00 ? 62  LEU A HB3  20 
ATOM 8073  H HG   . LEU A 1 62  ? -8.534  4.920   -6.084  1.00 0.00 ? 62  LEU A HG   20 
ATOM 8074  H HD11 . LEU A 1 62  ? -10.856 4.411   -4.468  1.00 0.00 ? 62  LEU A HD11 20 
ATOM 8075  H HD12 . LEU A 1 62  ? -9.630  5.198   -3.477  1.00 0.00 ? 62  LEU A HD12 20 
ATOM 8076  H HD13 . LEU A 1 62  ? -10.187 5.964   -4.965  1.00 0.00 ? 62  LEU A HD13 20 
ATOM 8077  H HD21 . LEU A 1 62  ? -7.760  2.981   -3.993  1.00 0.00 ? 62  LEU A HD21 20 
ATOM 8078  H HD22 . LEU A 1 62  ? -6.772  4.141   -4.873  1.00 0.00 ? 62  LEU A HD22 20 
ATOM 8079  H HD23 . LEU A 1 62  ? -7.732  4.672   -3.493  1.00 0.00 ? 62  LEU A HD23 20 
ATOM 8080  N N    . ALA A 1 63  ? -8.173  3.328   -8.815  1.00 0.00 ? 63  ALA A N    20 
ATOM 8081  C CA   . ALA A 1 63  ? -7.244  4.086   -9.699  1.00 0.00 ? 63  ALA A CA   20 
ATOM 8082  C C    . ALA A 1 63  ? -8.074  4.900   -10.694 1.00 0.00 ? 63  ALA A C    20 
ATOM 8083  O O    . ALA A 1 63  ? -7.854  6.079   -10.883 1.00 0.00 ? 63  ALA A O    20 
ATOM 8084  C CB   . ALA A 1 63  ? -6.331  3.112   -10.452 1.00 0.00 ? 63  ALA A CB   20 
ATOM 8085  H H    . ALA A 1 63  ? -8.127  2.350   -8.774  1.00 0.00 ? 63  ALA A H    20 
ATOM 8086  H HA   . ALA A 1 63  ? -6.644  4.758   -9.101  1.00 0.00 ? 63  ALA A HA   20 
ATOM 8087  H HB1  . ALA A 1 63  ? -6.838  2.168   -10.582 1.00 0.00 ? 63  ALA A HB1  20 
ATOM 8088  H HB2  . ALA A 1 63  ? -6.084  3.524   -11.419 1.00 0.00 ? 63  ALA A HB2  20 
ATOM 8089  H HB3  . ALA A 1 63  ? -5.424  2.958   -9.885  1.00 0.00 ? 63  ALA A HB3  20 
ATOM 8090  N N    . LEU A 1 64  ? -9.043  4.282   -11.312 1.00 0.00 ? 64  LEU A N    20 
ATOM 8091  C CA   . LEU A 1 64  ? -9.908  5.023   -12.272 1.00 0.00 ? 64  LEU A CA   20 
ATOM 8092  C C    . LEU A 1 64  ? -10.840 5.927   -11.475 1.00 0.00 ? 64  LEU A C    20 
ATOM 8093  O O    . LEU A 1 64  ? -11.083 7.058   -11.826 1.00 0.00 ? 64  LEU A O    20 
ATOM 8094  C CB   . LEU A 1 64  ? -10.745 4.028   -13.078 1.00 0.00 ? 64  LEU A CB   20 
ATOM 8095  C CG   . LEU A 1 64  ? -9.849  3.310   -14.078 1.00 0.00 ? 64  LEU A CG   20 
ATOM 8096  C CD1  . LEU A 1 64  ? -10.459 1.955   -14.429 1.00 0.00 ? 64  LEU A CD1  20 
ATOM 8097  C CD2  . LEU A 1 64  ? -9.721  4.153   -15.348 1.00 0.00 ? 64  LEU A CD2  20 
ATOM 8098  H H    . LEU A 1 64  ? -9.215  3.334   -11.131 1.00 0.00 ? 64  LEU A H    20 
ATOM 8099  H HA   . LEU A 1 64  ? -9.297  5.619   -12.938 1.00 0.00 ? 64  LEU A HA   20 
ATOM 8100  H HB2  . LEU A 1 64  ? -11.185 3.305   -12.409 1.00 0.00 ? 64  LEU A HB2  20 
ATOM 8101  H HB3  . LEU A 1 64  ? -11.525 4.554   -13.606 1.00 0.00 ? 64  LEU A HB3  20 
ATOM 8102  H HG   . LEU A 1 64  ? -8.877  3.164   -13.637 1.00 0.00 ? 64  LEU A HG   20 
ATOM 8103  H HD11 . LEU A 1 64  ? -11.329 1.782   -13.813 1.00 0.00 ? 64  LEU A HD11 20 
ATOM 8104  H HD12 . LEU A 1 64  ? -10.747 1.949   -15.470 1.00 0.00 ? 64  LEU A HD12 20 
ATOM 8105  H HD13 . LEU A 1 64  ? -9.731  1.177   -14.252 1.00 0.00 ? 64  LEU A HD13 20 
ATOM 8106  H HD21 . LEU A 1 64  ? -9.528  5.181   -15.080 1.00 0.00 ? 64  LEU A HD21 20 
ATOM 8107  H HD22 . LEU A 1 64  ? -8.904  3.778   -15.948 1.00 0.00 ? 64  LEU A HD22 20 
ATOM 8108  H HD23 . LEU A 1 64  ? -10.639 4.094   -15.914 1.00 0.00 ? 64  LEU A HD23 20 
ATOM 8109  N N    . TYR A 1 65  ? -11.354 5.423   -10.393 1.00 0.00 ? 65  TYR A N    20 
ATOM 8110  C CA   . TYR A 1 65  ? -12.271 6.231   -9.543  1.00 0.00 ? 65  TYR A CA   20 
ATOM 8111  C C    . TYR A 1 65  ? -11.712 7.649   -9.390  1.00 0.00 ? 65  TYR A C    20 
ATOM 8112  O O    . TYR A 1 65  ? -12.411 8.628   -9.569  1.00 0.00 ? 65  TYR A O    20 
ATOM 8113  C CB   . TYR A 1 65  ? -12.376 5.570   -8.169  1.00 0.00 ? 65  TYR A CB   20 
ATOM 8114  C CG   . TYR A 1 65  ? -13.115 6.477   -7.220  1.00 0.00 ? 65  TYR A CG   20 
ATOM 8115  C CD1  . TYR A 1 65  ? -14.512 6.429   -7.155  1.00 0.00 ? 65  TYR A CD1  20 
ATOM 8116  C CD2  . TYR A 1 65  ? -12.403 7.360   -6.399  1.00 0.00 ? 65  TYR A CD2  20 
ATOM 8117  C CE1  . TYR A 1 65  ? -15.198 7.266   -6.266  1.00 0.00 ? 65  TYR A CE1  20 
ATOM 8118  C CE2  . TYR A 1 65  ? -13.088 8.197   -5.511  1.00 0.00 ? 65  TYR A CE2  20 
ATOM 8119  C CZ   . TYR A 1 65  ? -14.487 8.149   -5.444  1.00 0.00 ? 65  TYR A CZ   20 
ATOM 8120  O OH   . TYR A 1 65  ? -15.162 8.974   -4.568  1.00 0.00 ? 65  TYR A OH   20 
ATOM 8121  H H    . TYR A 1 65  ? -11.132 4.503   -10.135 1.00 0.00 ? 65  TYR A H    20 
ATOM 8122  H HA   . TYR A 1 65  ? -13.249 6.273   -10.000 1.00 0.00 ? 65  TYR A HA   20 
ATOM 8123  H HB2  . TYR A 1 65  ? -12.910 4.636   -8.259  1.00 0.00 ? 65  TYR A HB2  20 
ATOM 8124  H HB3  . TYR A 1 65  ? -11.385 5.381   -7.785  1.00 0.00 ? 65  TYR A HB3  20 
ATOM 8125  H HD1  . TYR A 1 65  ? -15.061 5.749   -7.793  1.00 0.00 ? 65  TYR A HD1  20 
ATOM 8126  H HD2  . TYR A 1 65  ? -11.322 7.394   -6.451  1.00 0.00 ? 65  TYR A HD2  20 
ATOM 8127  H HE1  . TYR A 1 65  ? -16.275 7.228   -6.212  1.00 0.00 ? 65  TYR A HE1  20 
ATOM 8128  H HE2  . TYR A 1 65  ? -12.540 8.879   -4.879  1.00 0.00 ? 65  TYR A HE2  20 
ATOM 8129  H HH   . TYR A 1 65  ? -14.549 9.645   -4.260  1.00 0.00 ? 65  TYR A HH   20 
ATOM 8130  N N    . ASN A 1 66  ? -10.455 7.762   -9.065  1.00 0.00 ? 66  ASN A N    20 
ATOM 8131  C CA   . ASN A 1 66  ? -9.830  9.104   -8.901  1.00 0.00 ? 66  ASN A CA   20 
ATOM 8132  C C    . ASN A 1 66  ? -9.608  9.730   -10.273 1.00 0.00 ? 66  ASN A C    20 
ATOM 8133  O O    . ASN A 1 66  ? -9.959  10.867  -10.522 1.00 0.00 ? 66  ASN A O    20 
ATOM 8134  C CB   . ASN A 1 66  ? -8.479  8.927   -8.226  1.00 0.00 ? 66  ASN A CB   20 
ATOM 8135  C CG   . ASN A 1 66  ? -8.136  10.169  -7.406  1.00 0.00 ? 66  ASN A CG   20 
ATOM 8136  O OD1  . ASN A 1 66  ? -8.833  10.501  -6.467  1.00 0.00 ? 66  ASN A OD1  20 
ATOM 8137  N ND2  . ASN A 1 66  ? -7.082  10.873  -7.718  1.00 0.00 ? 66  ASN A ND2  20 
ATOM 8138  H H    . ASN A 1 66  ? -9.914  6.958   -8.931  1.00 0.00 ? 66  ASN A H    20 
ATOM 8139  H HA   . ASN A 1 66  ? -10.462 9.738   -8.298  1.00 0.00 ? 66  ASN A HA   20 
ATOM 8140  H HB2  . ASN A 1 66  ? -8.513  8.063   -7.580  1.00 0.00 ? 66  ASN A HB2  20 
ATOM 8141  H HB3  . ASN A 1 66  ? -7.729  8.778   -8.985  1.00 0.00 ? 66  ASN A HB3  20 
ATOM 8142  H HD21 . ASN A 1 66  ? -6.519  10.602  -8.474  1.00 0.00 ? 66  ASN A HD21 20 
ATOM 8143  H HD22 . ASN A 1 66  ? -6.852  11.669  -7.197  1.00 0.00 ? 66  ASN A HD22 20 
ATOM 8144  N N    . GLN A 1 67  ? -9.024  8.982   -11.166 1.00 0.00 ? 67  GLN A N    20 
ATOM 8145  C CA   . GLN A 1 67  ? -8.759  9.498   -12.541 1.00 0.00 ? 67  GLN A CA   20 
ATOM 8146  C C    . GLN A 1 67  ? -10.068 9.935   -13.200 1.00 0.00 ? 67  GLN A C    20 
ATOM 8147  O O    . GLN A 1 67  ? -10.073 10.570  -14.236 1.00 0.00 ? 67  GLN A O    20 
ATOM 8148  C CB   . GLN A 1 67  ? -8.127  8.382   -13.371 1.00 0.00 ? 67  GLN A CB   20 
ATOM 8149  C CG   . GLN A 1 67  ? -6.604  8.443   -13.238 1.00 0.00 ? 67  GLN A CG   20 
ATOM 8150  C CD   . GLN A 1 67  ? -6.006  9.091   -14.488 1.00 0.00 ? 67  GLN A CD   20 
ATOM 8151  O OE1  . GLN A 1 67  ? -4.925  8.737   -14.912 1.00 0.00 ? 67  GLN A OE1  20 
ATOM 8152  N NE2  . GLN A 1 67  ? -6.671  10.033  -15.102 1.00 0.00 ? 67  GLN A NE2  20 
ATOM 8153  H H    . GLN A 1 67  ? -8.752  8.068   -10.928 1.00 0.00 ? 67  GLN A H    20 
ATOM 8154  H HA   . GLN A 1 67  ? -8.084  10.335  -12.488 1.00 0.00 ? 67  GLN A HA   20 
ATOM 8155  H HB2  . GLN A 1 67  ? -8.484  7.428   -13.010 1.00 0.00 ? 67  GLN A HB2  20 
ATOM 8156  H HB3  . GLN A 1 67  ? -8.404  8.498   -14.407 1.00 0.00 ? 67  GLN A HB3  20 
ATOM 8157  H HG2  . GLN A 1 67  ? -6.342  9.028   -12.368 1.00 0.00 ? 67  GLN A HG2  20 
ATOM 8158  H HG3  . GLN A 1 67  ? -6.211  7.443   -13.132 1.00 0.00 ? 67  GLN A HG3  20 
ATOM 8159  H HE21 . GLN A 1 67  ? -7.544  10.319  -14.760 1.00 0.00 ? 67  GLN A HE21 20 
ATOM 8160  H HE22 . GLN A 1 67  ? -6.296  10.454  -15.904 1.00 0.00 ? 67  GLN A HE22 20 
ATOM 8161  N N    . HIS A 1 68  ? -11.173 9.595   -12.611 1.00 0.00 ? 68  HIS A N    20 
ATOM 8162  C CA   . HIS A 1 68  ? -12.489 9.981   -13.200 1.00 0.00 ? 68  HIS A CA   20 
ATOM 8163  C C    . HIS A 1 68  ? -13.047 11.204  -12.472 1.00 0.00 ? 68  HIS A C    20 
ATOM 8164  O O    . HIS A 1 68  ? -13.655 12.070  -13.070 1.00 0.00 ? 68  HIS A O    20 
ATOM 8165  C CB   . HIS A 1 68  ? -13.471 8.819   -13.052 1.00 0.00 ? 68  HIS A CB   20 
ATOM 8166  C CG   . HIS A 1 68  ? -13.400 7.937   -14.266 1.00 0.00 ? 68  HIS A CG   20 
ATOM 8167  N ND1  . HIS A 1 68  ? -12.565 6.834   -14.339 1.00 0.00 ? 68  HIS A ND1  20 
ATOM 8168  C CD2  . HIS A 1 68  ? -14.065 7.982   -15.464 1.00 0.00 ? 68  HIS A CD2  20 
ATOM 8169  C CE1  . HIS A 1 68  ? -12.747 6.265   -15.544 1.00 0.00 ? 68  HIS A CE1  20 
ATOM 8170  N NE2  . HIS A 1 68  ? -13.653 6.926   -16.271 1.00 0.00 ? 68  HIS A NE2  20 
ATOM 8171  H H    . HIS A 1 68  ? -11.140 9.082   -11.782 1.00 0.00 ? 68  HIS A H    20 
ATOM 8172  H HA   . HIS A 1 68  ? -12.361 10.211  -14.246 1.00 0.00 ? 68  HIS A HA   20 
ATOM 8173  H HB2  . HIS A 1 68  ? -13.218 8.243   -12.174 1.00 0.00 ? 68  HIS A HB2  20 
ATOM 8174  H HB3  . HIS A 1 68  ? -14.472 9.208   -12.950 1.00 0.00 ? 68  HIS A HB3  20 
ATOM 8175  H HD1  . HIS A 1 68  ? -11.954 6.523   -13.639 1.00 0.00 ? 68  HIS A HD1  20 
ATOM 8176  H HD2  . HIS A 1 68  ? -14.800 8.725   -15.737 1.00 0.00 ? 68  HIS A HD2  20 
ATOM 8177  H HE1  . HIS A 1 68  ? -12.228 5.380   -15.880 1.00 0.00 ? 68  HIS A HE1  20 
ATOM 8178  N N    . ASN A 1 69  ? -12.856 11.279  -11.185 1.00 0.00 ? 69  ASN A N    20 
ATOM 8179  C CA   . ASN A 1 69  ? -13.388 12.442  -10.420 1.00 0.00 ? 69  ASN A CA   20 
ATOM 8180  C C    . ASN A 1 69  ? -12.298 13.515  -10.290 1.00 0.00 ? 69  ASN A C    20 
ATOM 8181  O O    . ASN A 1 69  ? -11.258 13.266  -9.713  1.00 0.00 ? 69  ASN A O    20 
ATOM 8182  C CB   . ASN A 1 69  ? -13.804 11.980  -9.022  1.00 0.00 ? 69  ASN A CB   20 
ATOM 8183  C CG   . ASN A 1 69  ? -15.026 11.066  -9.130  1.00 0.00 ? 69  ASN A CG   20 
ATOM 8184  O OD1  . ASN A 1 69  ? -14.961 10.014  -9.735  1.00 0.00 ? 69  ASN A OD1  20 
ATOM 8185  N ND2  . ASN A 1 69  ? -16.146 11.425  -8.565  1.00 0.00 ? 69  ASN A ND2  20 
ATOM 8186  H H    . ASN A 1 69  ? -12.372 10.565  -10.722 1.00 0.00 ? 69  ASN A H    20 
ATOM 8187  H HA   . ASN A 1 69  ? -14.245 12.845  -10.933 1.00 0.00 ? 69  ASN A HA   20 
ATOM 8188  H HB2  . ASN A 1 69  ? -12.988 11.438  -8.565  1.00 0.00 ? 69  ASN A HB2  20 
ATOM 8189  H HB3  . ASN A 1 69  ? -14.050 12.839  -8.417  1.00 0.00 ? 69  ASN A HB3  20 
ATOM 8190  H HD21 . ASN A 1 69  ? -16.197 12.274  -8.077  1.00 0.00 ? 69  ASN A HD21 20 
ATOM 8191  H HD22 . ASN A 1 69  ? -16.934 10.847  -8.627  1.00 0.00 ? 69  ASN A HD22 20 
ATOM 8192  N N    . PRO A 1 70  ? -12.568 14.682  -10.825 1.00 0.00 ? 70  PRO A N    20 
ATOM 8193  C CA   . PRO A 1 70  ? -11.624 15.812  -10.775 1.00 0.00 ? 70  PRO A CA   20 
ATOM 8194  C C    . PRO A 1 70  ? -11.662 16.470  -9.394  1.00 0.00 ? 70  PRO A C    20 
ATOM 8195  O O    . PRO A 1 70  ? -12.675 16.992  -8.972  1.00 0.00 ? 70  PRO A O    20 
ATOM 8196  C CB   . PRO A 1 70  ? -12.146 16.766  -11.852 1.00 0.00 ? 70  PRO A CB   20 
ATOM 8197  C CG   . PRO A 1 70  ? -13.639 16.419  -12.054 1.00 0.00 ? 70  PRO A CG   20 
ATOM 8198  C CD   . PRO A 1 70  ? -13.833 14.986  -11.526 1.00 0.00 ? 70  PRO A CD   20 
ATOM 8199  H HA   . PRO A 1 70  ? -10.625 15.487  -11.019 1.00 0.00 ? 70  PRO A HA   20 
ATOM 8200  H HB2  . PRO A 1 70  ? -12.040 17.791  -11.520 1.00 0.00 ? 70  PRO A HB2  20 
ATOM 8201  H HB3  . PRO A 1 70  ? -11.608 16.616  -12.775 1.00 0.00 ? 70  PRO A HB3  20 
ATOM 8202  H HG2  . PRO A 1 70  ? -14.258 17.110  -11.498 1.00 0.00 ? 70  PRO A HG2  20 
ATOM 8203  H HG3  . PRO A 1 70  ? -13.890 16.458  -13.103 1.00 0.00 ? 70  PRO A HG3  20 
ATOM 8204  H HD2  . PRO A 1 70  ? -14.668 14.947  -10.840 1.00 0.00 ? 70  PRO A HD2  20 
ATOM 8205  H HD3  . PRO A 1 70  ? -13.980 14.298  -12.343 1.00 0.00 ? 70  PRO A HD3  20 
ATOM 8206  N N    . GLY A 1 71  ? -10.569 16.445  -8.684  1.00 0.00 ? 71  GLY A N    20 
ATOM 8207  C CA   . GLY A 1 71  ? -10.546 17.065  -7.330  1.00 0.00 ? 71  GLY A CA   20 
ATOM 8208  C C    . GLY A 1 71  ? -10.671 15.967  -6.271  1.00 0.00 ? 71  GLY A C    20 
ATOM 8209  O O    . GLY A 1 71  ? -10.975 16.228  -5.125  1.00 0.00 ? 71  GLY A O    20 
ATOM 8210  H H    . GLY A 1 71  ? -9.763  16.015  -9.040  1.00 0.00 ? 71  GLY A H    20 
ATOM 8211  H HA2  . GLY A 1 71  ? -9.615  17.597  -7.192  1.00 0.00 ? 71  GLY A HA2  20 
ATOM 8212  H HA3  . GLY A 1 71  ? -11.374 17.750  -7.232  1.00 0.00 ? 71  GLY A HA3  20 
ATOM 8213  N N    . ALA A 1 72  ? -10.435 14.741  -6.650  1.00 0.00 ? 72  ALA A N    20 
ATOM 8214  C CA   . ALA A 1 72  ? -10.535 13.626  -5.674  1.00 0.00 ? 72  ALA A CA   20 
ATOM 8215  C C    . ALA A 1 72  ? -9.136  13.090  -5.386  1.00 0.00 ? 72  ALA A C    20 
ATOM 8216  O O    . ALA A 1 72  ? -8.382  12.772  -6.284  1.00 0.00 ? 72  ALA A O    20 
ATOM 8217  C CB   . ALA A 1 72  ? -11.397 12.505  -6.259  1.00 0.00 ? 72  ALA A CB   20 
ATOM 8218  H H    . ALA A 1 72  ? -10.188 14.554  -7.575  1.00 0.00 ? 72  ALA A H    20 
ATOM 8219  H HA   . ALA A 1 72  ? -10.981 13.985  -4.759  1.00 0.00 ? 72  ALA A HA   20 
ATOM 8220  H HB1  . ALA A 1 72  ? -11.251 12.459  -7.328  1.00 0.00 ? 72  ALA A HB1  20 
ATOM 8221  H HB2  . ALA A 1 72  ? -11.109 11.562  -5.815  1.00 0.00 ? 72  ALA A HB2  20 
ATOM 8222  H HB3  . ALA A 1 72  ? -12.436 12.701  -6.045  1.00 0.00 ? 72  ALA A HB3  20 
ATOM 8223  N N    . SER A 1 73  ? -8.786  12.988  -4.141  1.00 0.00 ? 73  SER A N    20 
ATOM 8224  C CA   . SER A 1 73  ? -7.437  12.470  -3.784  1.00 0.00 ? 73  SER A CA   20 
ATOM 8225  C C    . SER A 1 73  ? -7.577  11.073  -3.176  1.00 0.00 ? 73  SER A C    20 
ATOM 8226  O O    . SER A 1 73  ? -6.752  10.641  -2.397  1.00 0.00 ? 73  SER A O    20 
ATOM 8227  C CB   . SER A 1 73  ? -6.781  13.405  -2.768  1.00 0.00 ? 73  SER A CB   20 
ATOM 8228  O OG   . SER A 1 73  ? -6.617  14.691  -3.351  1.00 0.00 ? 73  SER A OG   20 
ATOM 8229  H H    . SER A 1 73  ? -9.412  13.252  -3.439  1.00 0.00 ? 73  SER A H    20 
ATOM 8230  H HA   . SER A 1 73  ? -6.824  12.416  -4.673  1.00 0.00 ? 73  SER A HA   20 
ATOM 8231  H HB2  . SER A 1 73  ? -7.408  13.488  -1.896  1.00 0.00 ? 73  SER A HB2  20 
ATOM 8232  H HB3  . SER A 1 73  ? -5.818  13.004  -2.479  1.00 0.00 ? 73  SER A HB3  20 
ATOM 8233  H HG   . SER A 1 73  ? -7.420  14.902  -3.833  1.00 0.00 ? 73  SER A HG   20 
ATOM 8234  N N    . ALA A 1 74  ? -8.619  10.366  -3.523  1.00 0.00 ? 74  ALA A N    20 
ATOM 8235  C CA   . ALA A 1 74  ? -8.814  9.000   -2.960  1.00 0.00 ? 74  ALA A CA   20 
ATOM 8236  C C    . ALA A 1 74  ? -8.052  7.978   -3.807  1.00 0.00 ? 74  ALA A C    20 
ATOM 8237  O O    . ALA A 1 74  ? -8.286  6.792   -3.719  1.00 0.00 ? 74  ALA A O    20 
ATOM 8238  C CB   . ALA A 1 74  ? -10.305 8.655   -2.962  1.00 0.00 ? 74  ALA A CB   20 
ATOM 8239  H H    . ALA A 1 74  ? -9.274  10.736  -4.151  1.00 0.00 ? 74  ALA A H    20 
ATOM 8240  H HA   . ALA A 1 74  ? -8.441  8.974   -1.946  1.00 0.00 ? 74  ALA A HA   20 
ATOM 8241  H HB1  . ALA A 1 74  ? -10.715 8.836   -3.944  1.00 0.00 ? 74  ALA A HB1  20 
ATOM 8242  H HB2  . ALA A 1 74  ? -10.433 7.613   -2.705  1.00 0.00 ? 74  ALA A HB2  20 
ATOM 8243  H HB3  . ALA A 1 74  ? -10.817 9.270   -2.237  1.00 0.00 ? 74  ALA A HB3  20 
ATOM 8244  N N    . ALA A 1 75  ? -7.138  8.429   -4.622  1.00 0.00 ? 75  ALA A N    20 
ATOM 8245  C CA   . ALA A 1 75  ? -6.357  7.482   -5.468  1.00 0.00 ? 75  ALA A CA   20 
ATOM 8246  C C    . ALA A 1 75  ? -5.800  6.362   -4.582  1.00 0.00 ? 75  ALA A C    20 
ATOM 8247  O O    . ALA A 1 75  ? -6.041  6.345   -3.391  1.00 0.00 ? 75  ALA A O    20 
ATOM 8248  C CB   . ALA A 1 75  ? -5.207  8.239   -6.134  1.00 0.00 ? 75  ALA A CB   20 
ATOM 8249  H H    . ALA A 1 75  ? -6.963  9.390   -4.676  1.00 0.00 ? 75  ALA A H    20 
ATOM 8250  H HA   . ALA A 1 75  ? -7.002  7.059   -6.226  1.00 0.00 ? 75  ALA A HA   20 
ATOM 8251  H HB1  . ALA A 1 75  ? -5.392  9.301   -6.075  1.00 0.00 ? 75  ALA A HB1  20 
ATOM 8252  H HB2  . ALA A 1 75  ? -4.281  8.005   -5.629  1.00 0.00 ? 75  ALA A HB2  20 
ATOM 8253  H HB3  . ALA A 1 75  ? -5.134  7.944   -7.171  1.00 0.00 ? 75  ALA A HB3  20 
ATOM 8254  N N    . PRO A 1 76  ? -5.074  5.453   -5.183  1.00 0.00 ? 76  PRO A N    20 
ATOM 8255  C CA   . PRO A 1 76  ? -4.484  4.316   -4.456  1.00 0.00 ? 76  PRO A CA   20 
ATOM 8256  C C    . PRO A 1 76  ? -3.250  4.767   -3.680  1.00 0.00 ? 76  PRO A C    20 
ATOM 8257  O O    . PRO A 1 76  ? -3.021  5.944   -3.486  1.00 0.00 ? 76  PRO A O    20 
ATOM 8258  C CB   . PRO A 1 76  ? -4.100  3.336   -5.563  1.00 0.00 ? 76  PRO A CB   20 
ATOM 8259  C CG   . PRO A 1 76  ? -3.954  4.176   -6.851  1.00 0.00 ? 76  PRO A CG   20 
ATOM 8260  C CD   . PRO A 1 76  ? -4.767  5.468   -6.629  1.00 0.00 ? 76  PRO A CD   20 
ATOM 8261  H HA   . PRO A 1 76  ? -5.209  3.865   -3.796  1.00 0.00 ? 76  PRO A HA   20 
ATOM 8262  H HB2  . PRO A 1 76  ? -3.162  2.854   -5.321  1.00 0.00 ? 76  PRO A HB2  20 
ATOM 8263  H HB3  . PRO A 1 76  ? -4.875  2.599   -5.696  1.00 0.00 ? 76  PRO A HB3  20 
ATOM 8264  H HG2  . PRO A 1 76  ? -2.911  4.416   -7.015  1.00 0.00 ? 76  PRO A HG2  20 
ATOM 8265  H HG3  . PRO A 1 76  ? -4.349  3.635   -7.695  1.00 0.00 ? 76  PRO A HG3  20 
ATOM 8266  H HD2  . PRO A 1 76  ? -4.172  6.330   -6.887  1.00 0.00 ? 76  PRO A HD2  20 
ATOM 8267  H HD3  . PRO A 1 76  ? -5.680  5.448   -7.204  1.00 0.00 ? 76  PRO A HD3  20 
ATOM 8268  N N    . CYS A 1 77  ? -2.451  3.841   -3.235  1.00 0.00 ? 77  CYS A N    20 
ATOM 8269  C CA   . CYS A 1 77  ? -1.233  4.222   -2.476  1.00 0.00 ? 77  CYS A CA   20 
ATOM 8270  C C    . CYS A 1 77  ? -0.062  3.344   -2.913  1.00 0.00 ? 77  CYS A C    20 
ATOM 8271  O O    . CYS A 1 77  ? 0.084   2.228   -2.469  1.00 0.00 ? 77  CYS A O    20 
ATOM 8272  C CB   . CYS A 1 77  ? -1.486  4.029   -0.980  1.00 0.00 ? 77  CYS A CB   20 
ATOM 8273  S SG   . CYS A 1 77  ? -0.963  5.513   -0.086  1.00 0.00 ? 77  CYS A SG   20 
ATOM 8274  H H    . CYS A 1 77  ? -2.652  2.896   -3.402  1.00 0.00 ? 77  CYS A H    20 
ATOM 8275  H HA   . CYS A 1 77  ? -0.998  5.258   -2.671  1.00 0.00 ? 77  CYS A HA   20 
ATOM 8276  H HB2  . CYS A 1 77  ? -2.539  3.860   -0.811  1.00 0.00 ? 77  CYS A HB2  20 
ATOM 8277  H HB3  . CYS A 1 77  ? -0.921  3.179   -0.627  1.00 0.00 ? 77  CYS A HB3  20 
ATOM 8278  N N    . CYS A 1 78  ? 0.772   3.842   -3.783  1.00 0.00 ? 78  CYS A N    20 
ATOM 8279  C CA   . CYS A 1 78  ? 1.943   3.038   -4.245  1.00 0.00 ? 78  CYS A CA   20 
ATOM 8280  C C    . CYS A 1 78  ? 2.707   2.506   -3.022  1.00 0.00 ? 78  CYS A C    20 
ATOM 8281  O O    . CYS A 1 78  ? 2.955   3.226   -2.075  1.00 0.00 ? 78  CYS A O    20 
ATOM 8282  C CB   . CYS A 1 78  ? 2.858   3.939   -5.079  1.00 0.00 ? 78  CYS A CB   20 
ATOM 8283  S SG   . CYS A 1 78  ? 4.266   2.985   -5.696  1.00 0.00 ? 78  CYS A SG   20 
ATOM 8284  H H    . CYS A 1 78  ? 0.630   4.746   -4.133  1.00 0.00 ? 78  CYS A H    20 
ATOM 8285  H HA   . CYS A 1 78  ? 1.599   2.211   -4.848  1.00 0.00 ? 78  CYS A HA   20 
ATOM 8286  H HB2  . CYS A 1 78  ? 2.303   4.340   -5.913  1.00 0.00 ? 78  CYS A HB2  20 
ATOM 8287  H HB3  . CYS A 1 78  ? 3.217   4.753   -4.466  1.00 0.00 ? 78  CYS A HB3  20 
ATOM 8288  N N    . VAL A 1 79  ? 3.075   1.247   -3.027  1.00 0.00 ? 79  VAL A N    20 
ATOM 8289  C CA   . VAL A 1 79  ? 3.811   0.672   -1.861  1.00 0.00 ? 79  VAL A CA   20 
ATOM 8290  C C    . VAL A 1 79  ? 4.836   -0.358  -2.363  1.00 0.00 ? 79  VAL A C    20 
ATOM 8291  O O    . VAL A 1 79  ? 4.973   -0.549  -3.549  1.00 0.00 ? 79  VAL A O    20 
ATOM 8292  C CB   . VAL A 1 79  ? 2.805   0.014   -0.899  1.00 0.00 ? 79  VAL A CB   20 
ATOM 8293  C CG1  . VAL A 1 79  ? 1.474   0.749   -0.981  1.00 0.00 ? 79  VAL A CG1  20 
ATOM 8294  C CG2  . VAL A 1 79  ? 2.576   -1.457  -1.273  1.00 0.00 ? 79  VAL A CG2  20 
ATOM 8295  H H    . VAL A 1 79  ? 2.863   0.681   -3.791  1.00 0.00 ? 79  VAL A H    20 
ATOM 8296  H HA   . VAL A 1 79  ? 4.326   1.465   -1.353  1.00 0.00 ? 79  VAL A HA   20 
ATOM 8297  H HB   . VAL A 1 79  ? 3.178   0.081   0.111   1.00 0.00 ? 79  VAL A HB   20 
ATOM 8298  H HG11 . VAL A 1 79  ? 1.656   1.810   -1.063  1.00 0.00 ? 79  VAL A HG11 20 
ATOM 8299  H HG12 . VAL A 1 79  ? 0.931   0.408   -1.851  1.00 0.00 ? 79  VAL A HG12 20 
ATOM 8300  H HG13 . VAL A 1 79  ? 0.899   0.548   -0.094  1.00 0.00 ? 79  VAL A HG13 20 
ATOM 8301  H HG21 . VAL A 1 79  ? 2.512   -1.547  -2.346  1.00 0.00 ? 79  VAL A HG21 20 
ATOM 8302  H HG22 . VAL A 1 79  ? 3.396   -2.054  -0.908  1.00 0.00 ? 79  VAL A HG22 20 
ATOM 8303  H HG23 . VAL A 1 79  ? 1.653   -1.800  -0.827  1.00 0.00 ? 79  VAL A HG23 20 
ATOM 8304  N N    . PRO A 1 80  ? 5.528   -0.993  -1.447  1.00 0.00 ? 80  PRO A N    20 
ATOM 8305  C CA   . PRO A 1 80  ? 6.544   -2.005  -1.787  1.00 0.00 ? 80  PRO A CA   20 
ATOM 8306  C C    . PRO A 1 80  ? 5.871   -3.343  -2.106  1.00 0.00 ? 80  PRO A C    20 
ATOM 8307  O O    . PRO A 1 80  ? 5.516   -4.097  -1.222  1.00 0.00 ? 80  PRO A O    20 
ATOM 8308  C CB   . PRO A 1 80  ? 7.391   -2.104  -0.515  1.00 0.00 ? 80  PRO A CB   20 
ATOM 8309  C CG   . PRO A 1 80  ? 6.501   -1.595  0.642   1.00 0.00 ? 80  PRO A CG   20 
ATOM 8310  C CD   . PRO A 1 80  ? 5.367   -0.769  0.004   1.00 0.00 ? 80  PRO A CD   20 
ATOM 8311  H HA   . PRO A 1 80  ? 7.154   -1.674  -2.611  1.00 0.00 ? 80  PRO A HA   20 
ATOM 8312  H HB2  . PRO A 1 80  ? 7.680   -3.131  -0.343  1.00 0.00 ? 80  PRO A HB2  20 
ATOM 8313  H HB3  . PRO A 1 80  ? 8.265   -1.478  -0.604  1.00 0.00 ? 80  PRO A HB3  20 
ATOM 8314  H HG2  . PRO A 1 80  ? 6.089   -2.434  1.187   1.00 0.00 ? 80  PRO A HG2  20 
ATOM 8315  H HG3  . PRO A 1 80  ? 7.077   -0.970  1.304   1.00 0.00 ? 80  PRO A HG3  20 
ATOM 8316  H HD2  . PRO A 1 80  ? 4.413   -1.139  0.344   1.00 0.00 ? 80  PRO A HD2  20 
ATOM 8317  H HD3  . PRO A 1 80  ? 5.479   0.278   0.237   1.00 0.00 ? 80  PRO A HD3  20 
ATOM 8318  N N    . GLN A 1 81  ? 5.686   -3.637  -3.364  1.00 0.00 ? 81  GLN A N    20 
ATOM 8319  C CA   . GLN A 1 81  ? 5.026   -4.917  -3.744  1.00 0.00 ? 81  GLN A CA   20 
ATOM 8320  C C    . GLN A 1 81  ? 5.874   -6.101  -3.277  1.00 0.00 ? 81  GLN A C    20 
ATOM 8321  O O    . GLN A 1 81  ? 5.515   -6.807  -2.355  1.00 0.00 ? 81  GLN A O    20 
ATOM 8322  C CB   . GLN A 1 81  ? 4.877   -4.975  -5.265  1.00 0.00 ? 81  GLN A CB   20 
ATOM 8323  C CG   . GLN A 1 81  ? 3.630   -5.788  -5.623  1.00 0.00 ? 81  GLN A CG   20 
ATOM 8324  C CD   . GLN A 1 81  ? 4.046   -7.071  -6.345  1.00 0.00 ? 81  GLN A CD   20 
ATOM 8325  O OE1  . GLN A 1 81  ? 3.986   -7.148  -7.555  1.00 0.00 ? 81  GLN A OE1  20 
ATOM 8326  N NE2  . GLN A 1 81  ? 4.468   -8.090  -5.647  1.00 0.00 ? 81  GLN A NE2  20 
ATOM 8327  H H    . GLN A 1 81  ? 5.974   -3.009  -4.059  1.00 0.00 ? 81  GLN A H    20 
ATOM 8328  H HA   . GLN A 1 81  ? 4.050   -4.970  -3.286  1.00 0.00 ? 81  GLN A HA   20 
ATOM 8329  H HB2  . GLN A 1 81  ? 4.781   -3.974  -5.655  1.00 0.00 ? 81  GLN A HB2  20 
ATOM 8330  H HB3  . GLN A 1 81  ? 5.747   -5.448  -5.695  1.00 0.00 ? 81  GLN A HB3  20 
ATOM 8331  H HG2  . GLN A 1 81  ? 3.094   -6.039  -4.720  1.00 0.00 ? 81  GLN A HG2  20 
ATOM 8332  H HG3  . GLN A 1 81  ? 2.994   -5.205  -6.270  1.00 0.00 ? 81  GLN A HG3  20 
ATOM 8333  H HE21 . GLN A 1 81  ? 4.516   -8.028  -4.670  1.00 0.00 ? 81  GLN A HE21 20 
ATOM 8334  H HE22 . GLN A 1 81  ? 4.735   -8.917  -6.100  1.00 0.00 ? 81  GLN A HE22 20 
ATOM 8335  N N    . ALA A 1 82  ? 6.993   -6.329  -3.908  1.00 0.00 ? 82  ALA A N    20 
ATOM 8336  C CA   . ALA A 1 82  ? 7.856   -7.472  -3.503  1.00 0.00 ? 82  ALA A CA   20 
ATOM 8337  C C    . ALA A 1 82  ? 8.974   -6.967  -2.592  1.00 0.00 ? 82  ALA A C    20 
ATOM 8338  O O    . ALA A 1 82  ? 9.853   -6.244  -3.015  1.00 0.00 ? 82  ALA A O    20 
ATOM 8339  C CB   . ALA A 1 82  ? 8.466   -8.116  -4.750  1.00 0.00 ? 82  ALA A CB   20 
ATOM 8340  H H    . ALA A 1 82  ? 7.264   -5.750  -4.651  1.00 0.00 ? 82  ALA A H    20 
ATOM 8341  H HA   . ALA A 1 82  ? 7.263   -8.202  -2.974  1.00 0.00 ? 82  ALA A HA   20 
ATOM 8342  H HB1  . ALA A 1 82  ? 8.932   -7.354  -5.356  1.00 0.00 ? 82  ALA A HB1  20 
ATOM 8343  H HB2  . ALA A 1 82  ? 9.206   -8.844  -4.453  1.00 0.00 ? 82  ALA A HB2  20 
ATOM 8344  H HB3  . ALA A 1 82  ? 7.689   -8.604  -5.319  1.00 0.00 ? 82  ALA A HB3  20 
ATOM 8345  N N    . LEU A 1 83  ? 8.948   -7.343  -1.344  1.00 0.00 ? 83  LEU A N    20 
ATOM 8346  C CA   . LEU A 1 83  ? 10.007  -6.887  -0.411  1.00 0.00 ? 83  LEU A CA   20 
ATOM 8347  C C    . LEU A 1 83  ? 11.144  -7.900  -0.406  1.00 0.00 ? 83  LEU A C    20 
ATOM 8348  O O    . LEU A 1 83  ? 11.224  -8.776  -1.242  1.00 0.00 ? 83  LEU A O    20 
ATOM 8349  C CB   . LEU A 1 83  ? 9.429   -6.780  1.003   1.00 0.00 ? 83  LEU A CB   20 
ATOM 8350  C CG   . LEU A 1 83  ? 8.454   -5.609  1.069   1.00 0.00 ? 83  LEU A CG   20 
ATOM 8351  C CD1  . LEU A 1 83  ? 7.360   -5.912  2.094   1.00 0.00 ? 83  LEU A CD1  20 
ATOM 8352  C CD2  . LEU A 1 83  ? 9.211   -4.352  1.493   1.00 0.00 ? 83  LEU A CD2  20 
ATOM 8353  H H    . LEU A 1 83  ? 8.234   -7.928  -1.021  1.00 0.00 ? 83  LEU A H    20 
ATOM 8354  H HA   . LEU A 1 83  ? 10.378  -5.923  -0.724  1.00 0.00 ? 83  LEU A HA   20 
ATOM 8355  H HB2  . LEU A 1 83  ? 8.915   -7.694  1.255   1.00 0.00 ? 83  LEU A HB2  20 
ATOM 8356  H HB3  . LEU A 1 83  ? 10.228  -6.614  1.708   1.00 0.00 ? 83  LEU A HB3  20 
ATOM 8357  H HG   . LEU A 1 83  ? 8.012   -5.456  0.098   1.00 0.00 ? 83  LEU A HG   20 
ATOM 8358  H HD11 . LEU A 1 83  ? 7.015   -6.926  1.964   1.00 0.00 ? 83  LEU A HD11 20 
ATOM 8359  H HD12 . LEU A 1 83  ? 7.757   -5.791  3.091   1.00 0.00 ? 83  LEU A HD12 20 
ATOM 8360  H HD13 . LEU A 1 83  ? 6.534   -5.231  1.951   1.00 0.00 ? 83  LEU A HD13 20 
ATOM 8361  H HD21 . LEU A 1 83  ? 9.863   -4.589  2.321   1.00 0.00 ? 83  LEU A HD21 20 
ATOM 8362  H HD22 . LEU A 1 83  ? 9.798   -3.991  0.663   1.00 0.00 ? 83  LEU A HD22 20 
ATOM 8363  H HD23 . LEU A 1 83  ? 8.507   -3.593  1.795   1.00 0.00 ? 83  LEU A HD23 20 
ATOM 8364  N N    . GLU A 1 84  ? 12.014  -7.783  0.546   1.00 0.00 ? 84  GLU A N    20 
ATOM 8365  C CA   . GLU A 1 84  ? 13.155  -8.728  0.650   1.00 0.00 ? 84  GLU A CA   20 
ATOM 8366  C C    . GLU A 1 84  ? 13.535  -8.857  2.124   1.00 0.00 ? 84  GLU A C    20 
ATOM 8367  O O    . GLU A 1 84  ? 13.187  -8.013  2.922   1.00 0.00 ? 84  GLU A O    20 
ATOM 8368  C CB   . GLU A 1 84  ? 14.345  -8.192  -0.149  1.00 0.00 ? 84  GLU A CB   20 
ATOM 8369  C CG   . GLU A 1 84  ? 14.317  -8.775  -1.563  1.00 0.00 ? 84  GLU A CG   20 
ATOM 8370  C CD   . GLU A 1 84  ? 14.895  -10.190 -1.545  1.00 0.00 ? 84  GLU A CD   20 
ATOM 8371  O OE1  . GLU A 1 84  ? 16.105  -10.314 -1.445  1.00 0.00 ? 84  GLU A OE1  20 
ATOM 8372  O OE2  . GLU A 1 84  ? 14.118  -11.128 -1.630  1.00 0.00 ? 84  GLU A OE2  20 
ATOM 8373  H H    . GLU A 1 84  ? 11.911  -7.070  1.206   1.00 0.00 ? 84  GLU A H    20 
ATOM 8374  H HA   . GLU A 1 84  ? 12.863  -9.695  0.264   1.00 0.00 ? 84  GLU A HA   20 
ATOM 8375  H HB2  . GLU A 1 84  ? 14.285  -7.114  -0.203  1.00 0.00 ? 84  GLU A HB2  20 
ATOM 8376  H HB3  . GLU A 1 84  ? 15.265  -8.477  0.338   1.00 0.00 ? 84  GLU A HB3  20 
ATOM 8377  H HG2  . GLU A 1 84  ? 13.296  -8.806  -1.918  1.00 0.00 ? 84  GLU A HG2  20 
ATOM 8378  H HG3  . GLU A 1 84  ? 14.908  -8.154  -2.220  1.00 0.00 ? 84  GLU A HG3  20 
ATOM 8379  N N    . PRO A 1 85  ? 14.236  -9.909  2.444   1.00 0.00 ? 85  PRO A N    20 
ATOM 8380  C CA   . PRO A 1 85  ? 14.671  -10.170 3.823   1.00 0.00 ? 85  PRO A CA   20 
ATOM 8381  C C    . PRO A 1 85  ? 15.821  -9.238  4.207   1.00 0.00 ? 85  PRO A C    20 
ATOM 8382  O O    . PRO A 1 85  ? 16.075  -8.248  3.548   1.00 0.00 ? 85  PRO A O    20 
ATOM 8383  C CB   . PRO A 1 85  ? 15.105  -11.636 3.795   1.00 0.00 ? 85  PRO A CB   20 
ATOM 8384  C CG   . PRO A 1 85  ? 15.411  -11.970 2.317   1.00 0.00 ? 85  PRO A CG   20 
ATOM 8385  C CD   . PRO A 1 85  ? 14.665  -10.926 1.466   1.00 0.00 ? 85  PRO A CD   20 
ATOM 8386  H HA   . PRO A 1 85  ? 13.845  -10.048 4.506   1.00 0.00 ? 85  PRO A HA   20 
ATOM 8387  H HB2  . PRO A 1 85  ? 15.992  -11.771 4.400   1.00 0.00 ? 85  PRO A HB2  20 
ATOM 8388  H HB3  . PRO A 1 85  ? 14.309  -12.268 4.154   1.00 0.00 ? 85  PRO A HB3  20 
ATOM 8389  H HG2  . PRO A 1 85  ? 16.473  -11.909 2.137   1.00 0.00 ? 85  PRO A HG2  20 
ATOM 8390  H HG3  . PRO A 1 85  ? 15.047  -12.957 2.080   1.00 0.00 ? 85  PRO A HG3  20 
ATOM 8391  H HD2  . PRO A 1 85  ? 15.332  -10.493 0.732   1.00 0.00 ? 85  PRO A HD2  20 
ATOM 8392  H HD3  . PRO A 1 85  ? 13.807  -11.369 0.987   1.00 0.00 ? 85  PRO A HD3  20 
ATOM 8393  N N    . LEU A 1 86  ? 16.499  -9.524  5.282   1.00 0.00 ? 86  LEU A N    20 
ATOM 8394  C CA   . LEU A 1 86  ? 17.605  -8.632  5.720   1.00 0.00 ? 86  LEU A CA   20 
ATOM 8395  C C    . LEU A 1 86  ? 18.477  -9.358  6.761   1.00 0.00 ? 86  LEU A C    20 
ATOM 8396  O O    . LEU A 1 86  ? 18.048  -9.587  7.870   1.00 0.00 ? 86  LEU A O    20 
ATOM 8397  C CB   . LEU A 1 86  ? 16.964  -7.356  6.303   1.00 0.00 ? 86  LEU A CB   20 
ATOM 8398  C CG   . LEU A 1 86  ? 17.785  -6.785  7.463   1.00 0.00 ? 86  LEU A CG   20 
ATOM 8399  C CD1  . LEU A 1 86  ? 19.135  -6.274  6.968   1.00 0.00 ? 86  LEU A CD1  20 
ATOM 8400  C CD2  . LEU A 1 86  ? 17.015  -5.629  8.104   1.00 0.00 ? 86  LEU A CD2  20 
ATOM 8401  H H    . LEU A 1 86  ? 16.265  -10.314 5.816   1.00 0.00 ? 86  LEU A H    20 
ATOM 8402  H HA   . LEU A 1 86  ? 18.205  -8.365  4.865   1.00 0.00 ? 86  LEU A HA   20 
ATOM 8403  H HB2  . LEU A 1 86  ? 16.895  -6.612  5.524   1.00 0.00 ? 86  LEU A HB2  20 
ATOM 8404  H HB3  . LEU A 1 86  ? 15.971  -7.590  6.651   1.00 0.00 ? 86  LEU A HB3  20 
ATOM 8405  H HG   . LEU A 1 86  ? 17.940  -7.556  8.195   1.00 0.00 ? 86  LEU A HG   20 
ATOM 8406  H HD11 . LEU A 1 86  ? 19.005  -5.775  6.021   1.00 0.00 ? 86  LEU A HD11 20 
ATOM 8407  H HD12 . LEU A 1 86  ? 19.538  -5.577  7.690   1.00 0.00 ? 86  LEU A HD12 20 
ATOM 8408  H HD13 . LEU A 1 86  ? 19.813  -7.105  6.853   1.00 0.00 ? 86  LEU A HD13 20 
ATOM 8409  H HD21 . LEU A 1 86  ? 15.957  -5.768  7.942   1.00 0.00 ? 86  LEU A HD21 20 
ATOM 8410  H HD22 . LEU A 1 86  ? 17.218  -5.606  9.164   1.00 0.00 ? 86  LEU A HD22 20 
ATOM 8411  H HD23 . LEU A 1 86  ? 17.328  -4.697  7.657   1.00 0.00 ? 86  LEU A HD23 20 
ATOM 8412  N N    . PRO A 1 87  ? 19.683  -9.697  6.369   1.00 0.00 ? 87  PRO A N    20 
ATOM 8413  C CA   . PRO A 1 87  ? 20.637  -10.393 7.253   1.00 0.00 ? 87  PRO A CA   20 
ATOM 8414  C C    . PRO A 1 87  ? 21.225  -9.404  8.257   1.00 0.00 ? 87  PRO A C    20 
ATOM 8415  O O    . PRO A 1 87  ? 21.969  -8.512  7.904   1.00 0.00 ? 87  PRO A O    20 
ATOM 8416  C CB   . PRO A 1 87  ? 21.709  -10.913 6.291   1.00 0.00 ? 87  PRO A CB   20 
ATOM 8417  C CG   . PRO A 1 87  ? 21.621  -10.029 5.025   1.00 0.00 ? 87  PRO A CG   20 
ATOM 8418  C CD   . PRO A 1 87  ? 20.210  -9.413  5.018   1.00 0.00 ? 87  PRO A CD   20 
ATOM 8419  H HA   . PRO A 1 87  ? 20.165  -11.219 7.762   1.00 0.00 ? 87  PRO A HA   20 
ATOM 8420  H HB2  . PRO A 1 87  ? 22.688  -10.822 6.744   1.00 0.00 ? 87  PRO A HB2  20 
ATOM 8421  H HB3  . PRO A 1 87  ? 21.512  -11.940 6.031   1.00 0.00 ? 87  PRO A HB3  20 
ATOM 8422  H HG2  . PRO A 1 87  ? 22.370  -9.249  5.065   1.00 0.00 ? 87  PRO A HG2  20 
ATOM 8423  H HG3  . PRO A 1 87  ? 21.761  -10.631 4.141   1.00 0.00 ? 87  PRO A HG3  20 
ATOM 8424  H HD2  . PRO A 1 87  ? 20.264  -8.347  4.846   1.00 0.00 ? 87  PRO A HD2  20 
ATOM 8425  H HD3  . PRO A 1 87  ? 19.593  -9.888  4.271   1.00 0.00 ? 87  PRO A HD3  20 
ATOM 8426  N N    . ILE A 1 88  ? 20.881  -9.545  9.505   1.00 0.00 ? 88  ILE A N    20 
ATOM 8427  C CA   . ILE A 1 88  ? 21.403  -8.599  10.527  1.00 0.00 ? 88  ILE A CA   20 
ATOM 8428  C C    . ILE A 1 88  ? 22.114  -9.360  11.639  1.00 0.00 ? 88  ILE A C    20 
ATOM 8429  O O    . ILE A 1 88  ? 22.473  -10.512 11.505  1.00 0.00 ? 88  ILE A O    20 
ATOM 8430  C CB   . ILE A 1 88  ? 20.234  -7.821  11.138  1.00 0.00 ? 88  ILE A CB   20 
ATOM 8431  C CG1  . ILE A 1 88  ? 19.505  -8.700  12.161  1.00 0.00 ? 88  ILE A CG1  20 
ATOM 8432  C CG2  . ILE A 1 88  ? 19.255  -7.433  10.039  1.00 0.00 ? 88  ILE A CG2  20 
ATOM 8433  C CD1  . ILE A 1 88  ? 18.201  -8.031  12.576  1.00 0.00 ? 88  ILE A CD1  20 
ATOM 8434  H H    . ILE A 1 88  ? 20.267  -10.263 9.769   1.00 0.00 ? 88  ILE A H    20 
ATOM 8435  H HA   . ILE A 1 88  ? 22.090  -7.908  10.064  1.00 0.00 ? 88  ILE A HA   20 
ATOM 8436  H HB   . ILE A 1 88  ? 20.605  -6.930  11.623  1.00 0.00 ? 88  ILE A HB   20 
ATOM 8437  H HG12 . ILE A 1 88  ? 19.298  -9.660  11.722  1.00 0.00 ? 88  ILE A HG12 20 
ATOM 8438  H HG13 . ILE A 1 88  ? 20.125  -8.833  13.028  1.00 0.00 ? 88  ILE A HG13 20 
ATOM 8439  H HG21 . ILE A 1 88  ? 19.688  -7.660  9.076   1.00 0.00 ? 88  ILE A HG21 20 
ATOM 8440  H HG22 . ILE A 1 88  ? 18.338  -7.993  10.162  1.00 0.00 ? 88  ILE A HG22 20 
ATOM 8441  H HG23 . ILE A 1 88  ? 19.043  -6.378  10.101  1.00 0.00 ? 88  ILE A HG23 20 
ATOM 8442  H HD11 . ILE A 1 88  ? 18.339  -6.962  12.595  1.00 0.00 ? 88  ILE A HD11 20 
ATOM 8443  H HD12 . ILE A 1 88  ? 17.426  -8.283  11.869  1.00 0.00 ? 88  ILE A HD12 20 
ATOM 8444  H HD13 . ILE A 1 88  ? 17.917  -8.376  13.559  1.00 0.00 ? 88  ILE A HD13 20 
ATOM 8445  N N    . VAL A 1 89  ? 22.275  -8.705  12.750  1.00 0.00 ? 89  VAL A N    20 
ATOM 8446  C CA   . VAL A 1 89  ? 22.920  -9.328  13.930  1.00 0.00 ? 89  VAL A CA   20 
ATOM 8447  C C    . VAL A 1 89  ? 22.599  -8.471  15.147  1.00 0.00 ? 89  VAL A C    20 
ATOM 8448  O O    . VAL A 1 89  ? 23.092  -7.370  15.282  1.00 0.00 ? 89  VAL A O    20 
ATOM 8449  C CB   . VAL A 1 89  ? 24.439  -9.379  13.761  1.00 0.00 ? 89  VAL A CB   20 
ATOM 8450  C CG1  . VAL A 1 89  ? 25.025  -10.268 14.856  1.00 0.00 ? 89  VAL A CG1  20 
ATOM 8451  C CG2  . VAL A 1 89  ? 24.804  -9.948  12.388  1.00 0.00 ? 89  VAL A CG2  20 
ATOM 8452  H H    . VAL A 1 89  ? 21.937  -7.790  12.815  1.00 0.00 ? 89  VAL A H    20 
ATOM 8453  H HA   . VAL A 1 89  ? 22.526  -10.323 14.071  1.00 0.00 ? 89  VAL A HA   20 
ATOM 8454  H HB   . VAL A 1 89  ? 24.842  -8.381  13.858  1.00 0.00 ? 89  VAL A HB   20 
ATOM 8455  H HG11 . VAL A 1 89  ? 24.277  -10.976 15.182  1.00 0.00 ? 89  VAL A HG11 20 
ATOM 8456  H HG12 . VAL A 1 89  ? 25.880  -10.800 14.469  1.00 0.00 ? 89  VAL A HG12 20 
ATOM 8457  H HG13 . VAL A 1 89  ? 25.329  -9.656  15.691  1.00 0.00 ? 89  VAL A HG13 20 
ATOM 8458  H HG21 . VAL A 1 89  ? 24.355  -10.922 12.271  1.00 0.00 ? 89  VAL A HG21 20 
ATOM 8459  H HG22 . VAL A 1 89  ? 24.441  -9.288  11.616  1.00 0.00 ? 89  VAL A HG22 20 
ATOM 8460  H HG23 . VAL A 1 89  ? 25.877  -10.035 12.311  1.00 0.00 ? 89  VAL A HG23 20 
ATOM 8461  N N    . TYR A 1 90  ? 21.784  -8.954  16.034  1.00 0.00 ? 90  TYR A N    20 
ATOM 8462  C CA   . TYR A 1 90  ? 21.445  -8.143  17.230  1.00 0.00 ? 90  TYR A CA   20 
ATOM 8463  C C    . TYR A 1 90  ? 21.848  -8.899  18.491  1.00 0.00 ? 90  TYR A C    20 
ATOM 8464  O O    . TYR A 1 90  ? 22.483  -9.932  18.431  1.00 0.00 ? 90  TYR A O    20 
ATOM 8465  C CB   . TYR A 1 90  ? 19.945  -7.857  17.255  1.00 0.00 ? 90  TYR A CB   20 
ATOM 8466  C CG   . TYR A 1 90  ? 19.173  -9.065  16.781  1.00 0.00 ? 90  TYR A CG   20 
ATOM 8467  C CD1  . TYR A 1 90  ? 19.013  -9.295  15.411  1.00 0.00 ? 90  TYR A CD1  20 
ATOM 8468  C CD2  . TYR A 1 90  ? 18.610  -9.949  17.709  1.00 0.00 ? 90  TYR A CD2  20 
ATOM 8469  C CE1  . TYR A 1 90  ? 18.290  -10.409 14.965  1.00 0.00 ? 90  TYR A CE1  20 
ATOM 8470  C CE2  . TYR A 1 90  ? 17.888  -11.062 17.264  1.00 0.00 ? 90  TYR A CE2  20 
ATOM 8471  C CZ   . TYR A 1 90  ? 17.728  -11.292 15.893  1.00 0.00 ? 90  TYR A CZ   20 
ATOM 8472  O OH   . TYR A 1 90  ? 17.015  -12.391 15.456  1.00 0.00 ? 90  TYR A OH   20 
ATOM 8473  H H    . TYR A 1 90  ? 21.398  -9.845  15.914  1.00 0.00 ? 90  TYR A H    20 
ATOM 8474  H HA   . TYR A 1 90  ? 21.984  -7.206  17.184  1.00 0.00 ? 90  TYR A HA   20 
ATOM 8475  H HB2  . TYR A 1 90  ? 19.643  -7.608  18.260  1.00 0.00 ? 90  TYR A HB2  20 
ATOM 8476  H HB3  . TYR A 1 90  ? 19.737  -7.026  16.603  1.00 0.00 ? 90  TYR A HB3  20 
ATOM 8477  H HD1  . TYR A 1 90  ? 19.446  -8.612  14.698  1.00 0.00 ? 90  TYR A HD1  20 
ATOM 8478  H HD2  . TYR A 1 90  ? 18.733  -9.771  18.767  1.00 0.00 ? 90  TYR A HD2  20 
ATOM 8479  H HE1  . TYR A 1 90  ? 18.167  -10.586 13.906  1.00 0.00 ? 90  TYR A HE1  20 
ATOM 8480  H HE2  . TYR A 1 90  ? 17.451  -11.742 17.980  1.00 0.00 ? 90  TYR A HE2  20 
ATOM 8481  H HH   . TYR A 1 90  ? 17.216  -13.126 16.039  1.00 0.00 ? 90  TYR A HH   20 
ATOM 8482  N N    . TYR A 1 91  ? 21.495  -8.389  19.635  1.00 0.00 ? 91  TYR A N    20 
ATOM 8483  C CA   . TYR A 1 91  ? 21.874  -9.075  20.898  1.00 0.00 ? 91  TYR A CA   20 
ATOM 8484  C C    . TYR A 1 91  ? 20.658  -9.249  21.804  1.00 0.00 ? 91  TYR A C    20 
ATOM 8485  O O    . TYR A 1 91  ? 19.937  -8.312  22.085  1.00 0.00 ? 91  TYR A O    20 
ATOM 8486  C CB   . TYR A 1 91  ? 22.911  -8.235  21.633  1.00 0.00 ? 91  TYR A CB   20 
ATOM 8487  C CG   . TYR A 1 91  ? 24.291  -8.682  21.239  1.00 0.00 ? 91  TYR A CG   20 
ATOM 8488  C CD1  . TYR A 1 91  ? 24.910  -8.123  20.119  1.00 0.00 ? 91  TYR A CD1  20 
ATOM 8489  C CD2  . TYR A 1 91  ? 24.955  -9.647  22.001  1.00 0.00 ? 91  TYR A CD2  20 
ATOM 8490  C CE1  . TYR A 1 91  ? 26.201  -8.531  19.759  1.00 0.00 ? 91  TYR A CE1  20 
ATOM 8491  C CE2  . TYR A 1 91  ? 26.242  -10.054 21.647  1.00 0.00 ? 91  TYR A CE2  20 
ATOM 8492  C CZ   . TYR A 1 91  ? 26.869  -9.497  20.525  1.00 0.00 ? 91  TYR A CZ   20 
ATOM 8493  O OH   . TYR A 1 91  ? 28.141  -9.898  20.173  1.00 0.00 ? 91  TYR A OH   20 
ATOM 8494  H H    . TYR A 1 91  ? 20.997  -7.550  19.663  1.00 0.00 ? 91  TYR A H    20 
ATOM 8495  H HA   . TYR A 1 91  ? 22.295  -10.043 20.670  1.00 0.00 ? 91  TYR A HA   20 
ATOM 8496  H HB2  . TYR A 1 91  ? 22.782  -7.194  21.372  1.00 0.00 ? 91  TYR A HB2  20 
ATOM 8497  H HB3  . TYR A 1 91  ? 22.785  -8.358  22.698  1.00 0.00 ? 91  TYR A HB3  20 
ATOM 8498  H HD1  . TYR A 1 91  ? 24.387  -7.381  19.530  1.00 0.00 ? 91  TYR A HD1  20 
ATOM 8499  H HD2  . TYR A 1 91  ? 24.470  -10.080 22.860  1.00 0.00 ? 91  TYR A HD2  20 
ATOM 8500  H HE1  . TYR A 1 91  ? 26.682  -8.100  18.892  1.00 0.00 ? 91  TYR A HE1  20 
ATOM 8501  H HE2  . TYR A 1 91  ? 26.753  -10.798 22.241  1.00 0.00 ? 91  TYR A HE2  20 
ATOM 8502  H HH   . TYR A 1 91  ? 28.405  -10.603 20.769  1.00 0.00 ? 91  TYR A HH   20 
ATOM 8503  N N    . VAL A 1 92  ? 20.450  -10.437 22.294  1.00 0.00 ? 92  VAL A N    20 
ATOM 8504  C CA   . VAL A 1 92  ? 19.314  -10.677 23.220  1.00 0.00 ? 92  VAL A CA   20 
ATOM 8505  C C    . VAL A 1 92  ? 19.887  -10.812 24.624  1.00 0.00 ? 92  VAL A C    20 
ATOM 8506  O O    . VAL A 1 92  ? 20.298  -11.877 25.039  1.00 0.00 ? 92  VAL A O    20 
ATOM 8507  C CB   . VAL A 1 92  ? 18.585  -11.964 22.844  1.00 0.00 ? 92  VAL A CB   20 
ATOM 8508  C CG1  . VAL A 1 92  ? 17.113  -11.826 23.227  1.00 0.00 ? 92  VAL A CG1  20 
ATOM 8509  C CG2  . VAL A 1 92  ? 18.708  -12.205 21.339  1.00 0.00 ? 92  VAL A CG2  20 
ATOM 8510  H H    . VAL A 1 92  ? 21.063  -11.167 22.075  1.00 0.00 ? 92  VAL A H    20 
ATOM 8511  H HA   . VAL A 1 92  ? 18.630  -9.842  23.182  1.00 0.00 ? 92  VAL A HA   20 
ATOM 8512  H HB   . VAL A 1 92  ? 19.019  -12.794 23.383  1.00 0.00 ? 92  VAL A HB   20 
ATOM 8513  H HG11 . VAL A 1 92  ? 17.037  -11.340 24.189  1.00 0.00 ? 92  VAL A HG11 20 
ATOM 8514  H HG12 . VAL A 1 92  ? 16.603  -11.232 22.484  1.00 0.00 ? 92  VAL A HG12 20 
ATOM 8515  H HG13 . VAL A 1 92  ? 16.660  -12.803 23.281  1.00 0.00 ? 92  VAL A HG13 20 
ATOM 8516  H HG21 . VAL A 1 92  ? 18.531  -11.281 20.811  1.00 0.00 ? 92  VAL A HG21 20 
ATOM 8517  H HG22 . VAL A 1 92  ? 19.701  -12.565 21.113  1.00 0.00 ? 92  VAL A HG22 20 
ATOM 8518  H HG23 . VAL A 1 92  ? 17.980  -12.942 21.032  1.00 0.00 ? 92  VAL A HG23 20 
ATOM 8519  N N    . GLY A 1 93  ? 19.945  -9.735  25.346  1.00 0.00 ? 93  GLY A N    20 
ATOM 8520  C CA   . GLY A 1 93  ? 20.527  -9.793  26.714  1.00 0.00 ? 93  GLY A CA   20 
ATOM 8521  C C    . GLY A 1 93  ? 22.054  -9.834  26.592  1.00 0.00 ? 93  GLY A C    20 
ATOM 8522  O O    . GLY A 1 93  ? 22.726  -8.835  26.759  1.00 0.00 ? 93  GLY A O    20 
ATOM 8523  H H    . GLY A 1 93  ? 19.624  -8.886  24.982  1.00 0.00 ? 93  GLY A H    20 
ATOM 8524  H HA2  . GLY A 1 93  ? 20.227  -8.918  27.274  1.00 0.00 ? 93  GLY A HA2  20 
ATOM 8525  H HA3  . GLY A 1 93  ? 20.184  -10.683 27.219  1.00 0.00 ? 93  GLY A HA3  20 
ATOM 8526  N N    . ARG A 1 94  ? 22.605  -10.983 26.304  1.00 0.00 ? 94  ARG A N    20 
ATOM 8527  C CA   . ARG A 1 94  ? 24.091  -11.091 26.175  1.00 0.00 ? 94  ARG A CA   20 
ATOM 8528  C C    . ARG A 1 94  ? 24.473  -12.082 25.068  1.00 0.00 ? 94  ARG A C    20 
ATOM 8529  O O    . ARG A 1 94  ? 25.638  -12.280 24.785  1.00 0.00 ? 94  ARG A O    20 
ATOM 8530  C CB   . ARG A 1 94  ? 24.660  -11.593 27.494  1.00 0.00 ? 94  ARG A CB   20 
ATOM 8531  C CG   . ARG A 1 94  ? 24.215  -10.669 28.630  1.00 0.00 ? 94  ARG A CG   20 
ATOM 8532  C CD   . ARG A 1 94  ? 25.343  -10.540 29.655  1.00 0.00 ? 94  ARG A CD   20 
ATOM 8533  N NE   . ARG A 1 94  ? 25.277  -9.198  30.300  1.00 0.00 ? 94  ARG A NE   20 
ATOM 8534  C CZ   . ARG A 1 94  ? 26.366  -8.634  30.744  1.00 0.00 ? 94  ARG A CZ   20 
ATOM 8535  N NH1  . ARG A 1 94  ? 27.165  -8.018  29.917  1.00 0.00 ? 94  ARG A NH1  20 
ATOM 8536  N NH2  . ARG A 1 94  ? 26.654  -8.682  32.015  1.00 0.00 ? 94  ARG A NH2  20 
ATOM 8537  H H    . ARG A 1 94  ? 22.043  -11.774 26.185  1.00 0.00 ? 94  ARG A H    20 
ATOM 8538  H HA   . ARG A 1 94  ? 24.508  -10.124 25.945  1.00 0.00 ? 94  ARG A HA   20 
ATOM 8539  H HB2  . ARG A 1 94  ? 24.289  -12.592 27.673  1.00 0.00 ? 94  ARG A HB2  20 
ATOM 8540  H HB3  . ARG A 1 94  ? 25.738  -11.610 27.442  1.00 0.00 ? 94  ARG A HB3  20 
ATOM 8541  H HG2  . ARG A 1 94  ? 23.978  -9.694  28.229  1.00 0.00 ? 94  ARG A HG2  20 
ATOM 8542  H HG3  . ARG A 1 94  ? 23.341  -11.083 29.109  1.00 0.00 ? 94  ARG A HG3  20 
ATOM 8543  H HD2  . ARG A 1 94  ? 25.235  -11.307 30.407  1.00 0.00 ? 94  ARG A HD2  20 
ATOM 8544  H HD3  . ARG A 1 94  ? 26.295  -10.654 29.159  1.00 0.00 ? 94  ARG A HD3  20 
ATOM 8545  H HE   . ARG A 1 94  ? 24.414  -8.741  30.390  1.00 0.00 ? 94  ARG A HE   20 
ATOM 8546  H HH11 . ARG A 1 94  ? 26.943  -7.979  28.943  1.00 0.00 ? 94  ARG A HH11 20 
ATOM 8547  H HH12 . ARG A 1 94  ? 28.000  -7.584  30.257  1.00 0.00 ? 94  ARG A HH12 20 
ATOM 8548  H HH21 . ARG A 1 94  ? 26.042  -9.154  32.650  1.00 0.00 ? 94  ARG A HH21 20 
ATOM 8549  H HH22 . ARG A 1 94  ? 27.489  -8.249  32.356  1.00 0.00 ? 94  ARG A HH22 20 
ATOM 8550  N N    . LYS A 1 95  ? 23.519  -12.713 24.450  1.00 0.00 ? 95  LYS A N    20 
ATOM 8551  C CA   . LYS A 1 95  ? 23.853  -13.693 23.379  1.00 0.00 ? 95  LYS A CA   20 
ATOM 8552  C C    . LYS A 1 95  ? 23.655  -13.042 22.005  1.00 0.00 ? 95  LYS A C    20 
ATOM 8553  O O    . LYS A 1 95  ? 22.614  -12.481 21.739  1.00 0.00 ? 95  LYS A O    20 
ATOM 8554  C CB   . LYS A 1 95  ? 22.928  -14.904 23.499  1.00 0.00 ? 95  LYS A CB   20 
ATOM 8555  C CG   . LYS A 1 95  ? 23.091  -15.537 24.882  1.00 0.00 ? 95  LYS A CG   20 
ATOM 8556  C CD   . LYS A 1 95  ? 22.313  -16.852 24.938  1.00 0.00 ? 95  LYS A CD   20 
ATOM 8557  C CE   . LYS A 1 95  ? 22.720  -17.635 26.188  1.00 0.00 ? 95  LYS A CE   20 
ATOM 8558  N NZ   . LYS A 1 95  ? 24.117  -18.127 26.033  1.00 0.00 ? 95  LYS A NZ   20 
ATOM 8559  H H    . LYS A 1 95  ? 22.588  -12.552 24.690  1.00 0.00 ? 95  LYS A H    20 
ATOM 8560  H HA   . LYS A 1 95  ? 24.876  -14.011 23.492  1.00 0.00 ? 95  LYS A HA   20 
ATOM 8561  H HB2  . LYS A 1 95  ? 21.903  -14.588 23.365  1.00 0.00 ? 95  LYS A HB2  20 
ATOM 8562  H HB3  . LYS A 1 95  ? 23.183  -15.629 22.741  1.00 0.00 ? 95  LYS A HB3  20 
ATOM 8563  H HG2  . LYS A 1 95  ? 24.138  -15.728 25.069  1.00 0.00 ? 95  LYS A HG2  20 
ATOM 8564  H HG3  . LYS A 1 95  ? 22.709  -14.863 25.634  1.00 0.00 ? 95  LYS A HG3  20 
ATOM 8565  H HD2  . LYS A 1 95  ? 21.254  -16.642 24.972  1.00 0.00 ? 95  LYS A HD2  20 
ATOM 8566  H HD3  . LYS A 1 95  ? 22.535  -17.440 24.060  1.00 0.00 ? 95  LYS A HD3  20 
ATOM 8567  H HE2  . LYS A 1 95  ? 22.658  -16.989 27.052  1.00 0.00 ? 95  LYS A HE2  20 
ATOM 8568  H HE3  . LYS A 1 95  ? 22.054  -18.475 26.318  1.00 0.00 ? 95  LYS A HE3  20 
ATOM 8569  H HZ1  . LYS A 1 95  ? 24.583  -17.614 25.258  1.00 0.00 ? 95  LYS A HZ1  20 
ATOM 8570  H HZ2  . LYS A 1 95  ? 24.642  -17.965 26.916  1.00 0.00 ? 95  LYS A HZ2  20 
ATOM 8571  H HZ3  . LYS A 1 95  ? 24.105  -19.146 25.819  1.00 0.00 ? 95  LYS A HZ3  20 
ATOM 8572  N N    . PRO A 1 96  ? 24.655  -13.144 21.165  1.00 0.00 ? 96  PRO A N    20 
ATOM 8573  C CA   . PRO A 1 96  ? 24.598  -12.575 19.809  1.00 0.00 ? 96  PRO A CA   20 
ATOM 8574  C C    . PRO A 1 96  ? 23.768  -13.490 18.903  1.00 0.00 ? 96  PRO A C    20 
ATOM 8575  O O    . PRO A 1 96  ? 23.906  -14.697 18.942  1.00 0.00 ? 96  PRO A O    20 
ATOM 8576  C CB   . PRO A 1 96  ? 26.063  -12.551 19.367  1.00 0.00 ? 96  PRO A CB   20 
ATOM 8577  C CG   . PRO A 1 96  ? 26.796  -13.603 20.232  1.00 0.00 ? 96  PRO A CG   20 
ATOM 8578  C CD   . PRO A 1 96  ? 25.922  -13.830 21.481  1.00 0.00 ? 96  PRO A CD   20 
ATOM 8579  H HA   . PRO A 1 96  ? 24.196  -11.574 19.832  1.00 0.00 ? 96  PRO A HA   20 
ATOM 8580  H HB2  . PRO A 1 96  ? 26.137  -12.809 18.319  1.00 0.00 ? 96  PRO A HB2  20 
ATOM 8581  H HB3  . PRO A 1 96  ? 26.489  -11.577 19.543  1.00 0.00 ? 96  PRO A HB3  20 
ATOM 8582  H HG2  . PRO A 1 96  ? 26.901  -14.526 19.678  1.00 0.00 ? 96  PRO A HG2  20 
ATOM 8583  H HG3  . PRO A 1 96  ? 27.764  -13.232 20.527  1.00 0.00 ? 96  PRO A HG3  20 
ATOM 8584  H HD2  . PRO A 1 96  ? 25.756  -14.887 21.637  1.00 0.00 ? 96  PRO A HD2  20 
ATOM 8585  H HD3  . PRO A 1 96  ? 26.381  -13.385 22.350  1.00 0.00 ? 96  PRO A HD3  20 
ATOM 8586  N N    . LYS A 1 97  ? 22.904  -12.938 18.095  1.00 0.00 ? 97  LYS A N    20 
ATOM 8587  C CA   . LYS A 1 97  ? 22.074  -13.801 17.209  1.00 0.00 ? 97  LYS A CA   20 
ATOM 8588  C C    . LYS A 1 97  ? 21.908  -13.149 15.834  1.00 0.00 ? 97  LYS A C    20 
ATOM 8589  O O    . LYS A 1 97  ? 21.292  -12.111 15.699  1.00 0.00 ? 97  LYS A O    20 
ATOM 8590  C CB   . LYS A 1 97  ? 20.690  -13.995 17.837  1.00 0.00 ? 97  LYS A CB   20 
ATOM 8591  C CG   . LYS A 1 97  ? 20.832  -14.637 19.219  1.00 0.00 ? 97  LYS A CG   20 
ATOM 8592  C CD   . LYS A 1 97  ? 20.047  -15.950 19.255  1.00 0.00 ? 97  LYS A CD   20 
ATOM 8593  C CE   . LYS A 1 97  ? 19.716  -16.309 20.705  1.00 0.00 ? 97  LYS A CE   20 
ATOM 8594  N NZ   . LYS A 1 97  ? 18.687  -17.386 20.727  1.00 0.00 ? 97  LYS A NZ   20 
ATOM 8595  H H    . LYS A 1 97  ? 22.799  -11.965 18.076  1.00 0.00 ? 97  LYS A H    20 
ATOM 8596  H HA   . LYS A 1 97  ? 22.551  -14.763 17.095  1.00 0.00 ? 97  LYS A HA   20 
ATOM 8597  H HB2  . LYS A 1 97  ? 20.203  -13.036 17.935  1.00 0.00 ? 97  LYS A HB2  20 
ATOM 8598  H HB3  . LYS A 1 97  ? 20.095  -14.637 17.205  1.00 0.00 ? 97  LYS A HB3  20 
ATOM 8599  H HG2  . LYS A 1 97  ? 21.875  -14.834 19.420  1.00 0.00 ? 97  LYS A HG2  20 
ATOM 8600  H HG3  . LYS A 1 97  ? 20.442  -13.966 19.969  1.00 0.00 ? 97  LYS A HG3  20 
ATOM 8601  H HD2  . LYS A 1 97  ? 19.131  -15.836 18.694  1.00 0.00 ? 97  LYS A HD2  20 
ATOM 8602  H HD3  . LYS A 1 97  ? 20.642  -16.737 18.819  1.00 0.00 ? 97  LYS A HD3  20 
ATOM 8603  H HE2  . LYS A 1 97  ? 20.609  -16.654 21.203  1.00 0.00 ? 97  LYS A HE2  20 
ATOM 8604  H HE3  . LYS A 1 97  ? 19.335  -15.436 21.214  1.00 0.00 ? 97  LYS A HE3  20 
ATOM 8605  H HZ1  . LYS A 1 97  ? 19.009  -18.185 20.143  1.00 0.00 ? 97  LYS A HZ1  20 
ATOM 8606  H HZ2  . LYS A 1 97  ? 18.542  -17.707 21.706  1.00 0.00 ? 97  LYS A HZ2  20 
ATOM 8607  H HZ3  . LYS A 1 97  ? 17.791  -17.017 20.349  1.00 0.00 ? 97  LYS A HZ3  20 
ATOM 8608  N N    . VAL A 1 98  ? 22.431  -13.766 14.809  1.00 0.00 ? 98  VAL A N    20 
ATOM 8609  C CA   . VAL A 1 98  ? 22.280  -13.195 13.439  1.00 0.00 ? 98  VAL A CA   20 
ATOM 8610  C C    . VAL A 1 98  ? 20.988  -13.736 12.834  1.00 0.00 ? 98  VAL A C    20 
ATOM 8611  O O    . VAL A 1 98  ? 20.741  -14.925 12.851  1.00 0.00 ? 98  VAL A O    20 
ATOM 8612  C CB   . VAL A 1 98  ? 23.457  -13.624 12.562  1.00 0.00 ? 98  VAL A CB   20 
ATOM 8613  C CG1  . VAL A 1 98  ? 23.243  -13.106 11.138  1.00 0.00 ? 98  VAL A CG1  20 
ATOM 8614  C CG2  . VAL A 1 98  ? 24.754  -13.046 13.127  1.00 0.00 ? 98  VAL A CG2  20 
ATOM 8615  H H    . VAL A 1 98  ? 22.909  -14.612 14.936  1.00 0.00 ? 98  VAL A H    20 
ATOM 8616  H HA   . VAL A 1 98  ? 22.236  -12.118 13.494  1.00 0.00 ? 98  VAL A HA   20 
ATOM 8617  H HB   . VAL A 1 98  ? 23.517  -14.704 12.546  1.00 0.00 ? 98  VAL A HB   20 
ATOM 8618  H HG11 . VAL A 1 98  ? 22.242  -12.711 11.044  1.00 0.00 ? 98  VAL A HG11 20 
ATOM 8619  H HG12 . VAL A 1 98  ? 23.958  -12.325 10.927  1.00 0.00 ? 98  VAL A HG12 20 
ATOM 8620  H HG13 . VAL A 1 98  ? 23.377  -13.916 10.435  1.00 0.00 ? 98  VAL A HG13 20 
ATOM 8621  H HG21 . VAL A 1 98  ? 24.522  -12.345 13.914  1.00 0.00 ? 98  VAL A HG21 20 
ATOM 8622  H HG22 . VAL A 1 98  ? 25.361  -13.845 13.525  1.00 0.00 ? 98  VAL A HG22 20 
ATOM 8623  H HG23 . VAL A 1 98  ? 25.295  -12.540 12.341  1.00 0.00 ? 98  VAL A HG23 20 
ATOM 8624  N N    . GLU A 1 99  ? 20.151  -12.888 12.305  1.00 0.00 ? 99  GLU A N    20 
ATOM 8625  C CA   . GLU A 1 99  ? 18.888  -13.396 11.718  1.00 0.00 ? 99  GLU A CA   20 
ATOM 8626  C C    . GLU A 1 99  ? 18.709  -12.849 10.310  1.00 0.00 ? 99  GLU A C    20 
ATOM 8627  O O    . GLU A 1 99  ? 19.638  -12.384 9.680   1.00 0.00 ? 99  GLU A O    20 
ATOM 8628  C CB   . GLU A 1 99  ? 17.707  -12.952 12.575  1.00 0.00 ? 99  GLU A CB   20 
ATOM 8629  C CG   . GLU A 1 99  ? 16.943  -14.179 13.074  1.00 0.00 ? 99  GLU A CG   20 
ATOM 8630  C CD   . GLU A 1 99  ? 15.471  -14.064 12.673  1.00 0.00 ? 99  GLU A CD   20 
ATOM 8631  O OE1  . GLU A 1 99  ? 14.841  -13.102 13.079  1.00 0.00 ? 99  GLU A OE1  20 
ATOM 8632  O OE2  . GLU A 1 99  ? 15.000  -14.940 11.966  1.00 0.00 ? 99  GLU A OE2  20 
ATOM 8633  H H    . GLU A 1 99  ? 20.351  -11.926 12.296  1.00 0.00 ? 99  GLU A H    20 
ATOM 8634  H HA   . GLU A 1 99  ? 18.914  -14.473 11.682  1.00 0.00 ? 99  GLU A HA   20 
ATOM 8635  H HB2  . GLU A 1 99  ? 18.067  -12.385 13.414  1.00 0.00 ? 99  GLU A HB2  20 
ATOM 8636  H HB3  . GLU A 1 99  ? 17.050  -12.337 11.984  1.00 0.00 ? 99  GLU A HB3  20 
ATOM 8637  H HG2  . GLU A 1 99  ? 17.369  -15.070 12.634  1.00 0.00 ? 99  GLU A HG2  20 
ATOM 8638  H HG3  . GLU A 1 99  ? 17.017  -14.237 14.150  1.00 0.00 ? 99  GLU A HG3  20 
ATOM 8639  N N    . GLN A 1 100 ? 17.508  -12.902 9.824   1.00 0.00 ? 100 GLN A N    20 
ATOM 8640  C CA   . GLN A 1 100 ? 17.220  -12.392 8.461   1.00 0.00 ? 100 GLN A CA   20 
ATOM 8641  C C    . GLN A 1 100 ? 15.828  -11.771 8.464   1.00 0.00 ? 100 GLN A C    20 
ATOM 8642  O O    . GLN A 1 100 ? 14.854  -12.410 8.122   1.00 0.00 ? 100 GLN A O    20 
ATOM 8643  C CB   . GLN A 1 100 ? 17.243  -13.551 7.472   1.00 0.00 ? 100 GLN A CB   20 
ATOM 8644  C CG   . GLN A 1 100 ? 18.547  -14.337 7.624   1.00 0.00 ? 100 GLN A CG   20 
ATOM 8645  C CD   . GLN A 1 100 ? 18.298  -15.581 8.479   1.00 0.00 ? 100 GLN A CD   20 
ATOM 8646  O OE1  . GLN A 1 100 ? 18.655  -15.615 9.640   1.00 0.00 ? 100 GLN A OE1  20 
ATOM 8647  N NE2  . GLN A 1 100 ? 17.696  -16.612 7.951   1.00 0.00 ? 100 GLN A NE2  20 
ATOM 8648  H H    . GLN A 1 100 ? 16.785  -13.279 10.366  1.00 0.00 ? 100 GLN A H    20 
ATOM 8649  H HA   . GLN A 1 100 ? 17.954  -11.653 8.180   1.00 0.00 ? 100 GLN A HA   20 
ATOM 8650  H HB2  . GLN A 1 100 ? 16.405  -14.196 7.677   1.00 0.00 ? 100 GLN A HB2  20 
ATOM 8651  H HB3  . GLN A 1 100 ? 17.167  -13.169 6.465   1.00 0.00 ? 100 GLN A HB3  20 
ATOM 8652  H HG2  . GLN A 1 100 ? 18.902  -14.636 6.647   1.00 0.00 ? 100 GLN A HG2  20 
ATOM 8653  H HG3  . GLN A 1 100 ? 19.289  -13.717 8.102   1.00 0.00 ? 100 GLN A HG3  20 
ATOM 8654  H HE21 . GLN A 1 100 ? 17.409  -16.585 7.014   1.00 0.00 ? 100 GLN A HE21 20 
ATOM 8655  H HE22 . GLN A 1 100 ? 17.533  -17.413 8.491   1.00 0.00 ? 100 GLN A HE22 20 
ATOM 8656  N N    . LEU A 1 101 ? 15.724  -10.539 8.862   1.00 0.00 ? 101 LEU A N    20 
ATOM 8657  C CA   . LEU A 1 101 ? 14.391  -9.887  8.903   1.00 0.00 ? 101 LEU A CA   20 
ATOM 8658  C C    . LEU A 1 101 ? 13.632  -10.219 7.623   1.00 0.00 ? 101 LEU A C    20 
ATOM 8659  O O    . LEU A 1 101 ? 14.207  -10.373 6.564   1.00 0.00 ? 101 LEU A O    20 
ATOM 8660  C CB   . LEU A 1 101 ? 14.550  -8.373  9.039   1.00 0.00 ? 101 LEU A CB   20 
ATOM 8661  C CG   . LEU A 1 101 ? 15.385  -8.042  10.281  1.00 0.00 ? 101 LEU A CG   20 
ATOM 8662  C CD1  . LEU A 1 101 ? 15.136  -6.589  10.690  1.00 0.00 ? 101 LEU A CD1  20 
ATOM 8663  C CD2  . LEU A 1 101 ? 14.991  -8.966  11.435  1.00 0.00 ? 101 LEU A CD2  20 
ATOM 8664  H H    . LEU A 1 101 ? 16.518  -10.050 9.145   1.00 0.00 ? 101 LEU A H    20 
ATOM 8665  H HA   . LEU A 1 101 ? 13.837  -10.265 9.750   1.00 0.00 ? 101 LEU A HA   20 
ATOM 8666  H HB2  . LEU A 1 101 ? 15.046  -7.984  8.165   1.00 0.00 ? 101 LEU A HB2  20 
ATOM 8667  H HB3  . LEU A 1 101 ? 13.573  -7.922  9.132   1.00 0.00 ? 101 LEU A HB3  20 
ATOM 8668  H HG   . LEU A 1 101 ? 16.434  -8.174  10.053  1.00 0.00 ? 101 LEU A HG   20 
ATOM 8669  H HD11 . LEU A 1 101 ? 14.074  -6.417  10.783  1.00 0.00 ? 101 LEU A HD11 20 
ATOM 8670  H HD12 . LEU A 1 101 ? 15.616  -6.394  11.637  1.00 0.00 ? 101 LEU A HD12 20 
ATOM 8671  H HD13 . LEU A 1 101 ? 15.543  -5.929  9.938   1.00 0.00 ? 101 LEU A HD13 20 
ATOM 8672  H HD21 . LEU A 1 101 ? 15.102  -9.994  11.126  1.00 0.00 ? 101 LEU A HD21 20 
ATOM 8673  H HD22 . LEU A 1 101 ? 15.631  -8.774  12.283  1.00 0.00 ? 101 LEU A HD22 20 
ATOM 8674  H HD23 . LEU A 1 101 ? 13.962  -8.781  11.708  1.00 0.00 ? 101 LEU A HD23 20 
ATOM 8675  N N    . SER A 1 102 ? 12.346  -10.350 7.724   1.00 0.00 ? 102 SER A N    20 
ATOM 8676  C CA   . SER A 1 102 ? 11.534  -10.699 6.520   1.00 0.00 ? 102 SER A CA   20 
ATOM 8677  C C    . SER A 1 102 ? 10.857  -9.452  5.952   1.00 0.00 ? 102 SER A C    20 
ATOM 8678  O O    . SER A 1 102 ? 10.270  -8.671  6.673   1.00 0.00 ? 102 SER A O    20 
ATOM 8679  C CB   . SER A 1 102 ? 10.467  -11.722 6.910   1.00 0.00 ? 102 SER A CB   20 
ATOM 8680  O OG   . SER A 1 102 ? 11.068  -13.005 7.028   1.00 0.00 ? 102 SER A OG   20 
ATOM 8681  H H    . SER A 1 102 ? 11.915  -10.230 8.598   1.00 0.00 ? 102 SER A H    20 
ATOM 8682  H HA   . SER A 1 102 ? 12.179  -11.128 5.768   1.00 0.00 ? 102 SER A HA   20 
ATOM 8683  H HB2  . SER A 1 102 ? 10.029  -11.447 7.854   1.00 0.00 ? 102 SER A HB2  20 
ATOM 8684  H HB3  . SER A 1 102 ? 9.697   -11.743 6.150   1.00 0.00 ? 102 SER A HB3  20 
ATOM 8685  H HG   . SER A 1 102 ? 10.790  -13.533 6.278   1.00 0.00 ? 102 SER A HG   20 
ATOM 8686  N N    . ASN A 1 103 ? 10.923  -9.264  4.660   1.00 0.00 ? 103 ASN A N    20 
ATOM 8687  C CA   . ASN A 1 103 ? 10.268  -8.069  4.052   1.00 0.00 ? 103 ASN A CA   20 
ATOM 8688  C C    . ASN A 1 103 ? 10.867  -6.801  4.653   1.00 0.00 ? 103 ASN A C    20 
ATOM 8689  O O    . ASN A 1 103 ? 10.205  -5.790  4.785   1.00 0.00 ? 103 ASN A O    20 
ATOM 8690  C CB   . ASN A 1 103 ? 8.767   -8.109  4.347   1.00 0.00 ? 103 ASN A CB   20 
ATOM 8691  C CG   . ASN A 1 103 ? 8.051   -8.893  3.245   1.00 0.00 ? 103 ASN A CG   20 
ATOM 8692  O OD1  . ASN A 1 103 ? 6.866   -8.727  3.036   1.00 0.00 ? 103 ASN A OD1  20 
ATOM 8693  N ND2  . ASN A 1 103 ? 8.725   -9.751  2.527   1.00 0.00 ? 103 ASN A ND2  20 
ATOM 8694  H H    . ASN A 1 103 ? 11.400  -9.911  4.090   1.00 0.00 ? 103 ASN A H    20 
ATOM 8695  H HA   . ASN A 1 103 ? 10.425  -8.068  2.984   1.00 0.00 ? 103 ASN A HA   20 
ATOM 8696  H HB2  . ASN A 1 103 ? 8.600   -8.591  5.300   1.00 0.00 ? 103 ASN A HB2  20 
ATOM 8697  H HB3  . ASN A 1 103 ? 8.381   -7.102  4.379   1.00 0.00 ? 103 ASN A HB3  20 
ATOM 8698  H HD21 . ASN A 1 103 ? 9.680   -9.887  2.697   1.00 0.00 ? 103 ASN A HD21 20 
ATOM 8699  H HD22 . ASN A 1 103 ? 8.275   -10.256 1.819   1.00 0.00 ? 103 ASN A HD22 20 
ATOM 8700  N N    . MET A 1 104 ? 12.115  -6.843  5.015   1.00 0.00 ? 104 MET A N    20 
ATOM 8701  C CA   . MET A 1 104 ? 12.757  -5.640  5.603   1.00 0.00 ? 104 MET A CA   20 
ATOM 8702  C C    . MET A 1 104 ? 13.450  -4.855  4.490   1.00 0.00 ? 104 MET A C    20 
ATOM 8703  O O    . MET A 1 104 ? 14.309  -4.032  4.737   1.00 0.00 ? 104 MET A O    20 
ATOM 8704  C CB   . MET A 1 104 ? 13.788  -6.069  6.647   1.00 0.00 ? 104 MET A CB   20 
ATOM 8705  C CG   . MET A 1 104 ? 13.705  -5.138  7.855   1.00 0.00 ? 104 MET A CG   20 
ATOM 8706  S SD   . MET A 1 104 ? 14.641  -3.627  7.517   1.00 0.00 ? 104 MET A SD   20 
ATOM 8707  C CE   . MET A 1 104 ? 15.174  -3.316  9.217   1.00 0.00 ? 104 MET A CE   20 
ATOM 8708  H H    . MET A 1 104 ? 12.631  -7.667  4.900   1.00 0.00 ? 104 MET A H    20 
ATOM 8709  H HA   . MET A 1 104 ? 12.005  -5.020  6.069   1.00 0.00 ? 104 MET A HA   20 
ATOM 8710  H HB2  . MET A 1 104 ? 13.585  -7.084  6.958   1.00 0.00 ? 104 MET A HB2  20 
ATOM 8711  H HB3  . MET A 1 104 ? 14.778  -6.013  6.219   1.00 0.00 ? 104 MET A HB3  20 
ATOM 8712  H HG2  . MET A 1 104 ? 12.672  -4.886  8.046   1.00 0.00 ? 104 MET A HG2  20 
ATOM 8713  H HG3  . MET A 1 104 ? 14.121  -5.633  8.720   1.00 0.00 ? 104 MET A HG3  20 
ATOM 8714  H HE1  . MET A 1 104 ? 14.390  -3.618  9.898   1.00 0.00 ? 104 MET A HE1  20 
ATOM 8715  H HE2  . MET A 1 104 ? 16.067  -3.885  9.426   1.00 0.00 ? 104 MET A HE2  20 
ATOM 8716  H HE3  . MET A 1 104 ? 15.383  -2.263  9.342   1.00 0.00 ? 104 MET A HE3  20 
ATOM 8717  N N    . ILE A 1 105 ? 13.077  -5.102  3.264   1.00 0.00 ? 105 ILE A N    20 
ATOM 8718  C CA   . ILE A 1 105 ? 13.706  -4.370  2.132   1.00 0.00 ? 105 ILE A CA   20 
ATOM 8719  C C    . ILE A 1 105 ? 12.691  -4.218  1.004   1.00 0.00 ? 105 ILE A C    20 
ATOM 8720  O O    . ILE A 1 105 ? 11.673  -4.881  0.980   1.00 0.00 ? 105 ILE A O    20 
ATOM 8721  C CB   . ILE A 1 105 ? 14.915  -5.149  1.622   1.00 0.00 ? 105 ILE A CB   20 
ATOM 8722  C CG1  . ILE A 1 105 ? 15.978  -5.211  2.721   1.00 0.00 ? 105 ILE A CG1  20 
ATOM 8723  C CG2  . ILE A 1 105 ? 15.489  -4.445  0.391   1.00 0.00 ? 105 ILE A CG2  20 
ATOM 8724  C CD1  . ILE A 1 105 ? 17.280  -5.764  2.141   1.00 0.00 ? 105 ILE A CD1  20 
ATOM 8725  H H    . ILE A 1 105 ? 12.377  -5.769  3.087   1.00 0.00 ? 105 ILE A H    20 
ATOM 8726  H HA   . ILE A 1 105 ? 14.022  -3.391  2.467   1.00 0.00 ? 105 ILE A HA   20 
ATOM 8727  H HB   . ILE A 1 105 ? 14.610  -6.150  1.356   1.00 0.00 ? 105 ILE A HB   20 
ATOM 8728  H HG12 . ILE A 1 105 ? 16.148  -4.219  3.112   1.00 0.00 ? 105 ILE A HG12 20 
ATOM 8729  H HG13 . ILE A 1 105 ? 15.637  -5.858  3.516   1.00 0.00 ? 105 ILE A HG13 20 
ATOM 8730  H HG21 . ILE A 1 105 ? 15.668  -3.405  0.621   1.00 0.00 ? 105 ILE A HG21 20 
ATOM 8731  H HG22 . ILE A 1 105 ? 16.418  -4.915  0.106   1.00 0.00 ? 105 ILE A HG22 20 
ATOM 8732  H HG23 . ILE A 1 105 ? 14.785  -4.515  -0.425  1.00 0.00 ? 105 ILE A HG23 20 
ATOM 8733  H HD11 . ILE A 1 105 ? 17.066  -6.315  1.237   1.00 0.00 ? 105 ILE A HD11 20 
ATOM 8734  H HD12 . ILE A 1 105 ? 17.949  -4.947  1.917   1.00 0.00 ? 105 ILE A HD12 20 
ATOM 8735  H HD13 . ILE A 1 105 ? 17.744  -6.422  2.862   1.00 0.00 ? 105 ILE A HD13 20 
ATOM 8736  N N    . VAL A 1 106 ? 12.953  -3.349  0.070   1.00 0.00 ? 106 VAL A N    20 
ATOM 8737  C CA   . VAL A 1 106 ? 12.000  -3.152  -1.047  1.00 0.00 ? 106 VAL A CA   20 
ATOM 8738  C C    . VAL A 1 106 ? 12.674  -3.535  -2.369  1.00 0.00 ? 106 VAL A C    20 
ATOM 8739  O O    . VAL A 1 106 ? 13.804  -3.174  -2.629  1.00 0.00 ? 106 VAL A O    20 
ATOM 8740  C CB   . VAL A 1 106 ? 11.579  -1.684  -1.077  1.00 0.00 ? 106 VAL A CB   20 
ATOM 8741  C CG1  . VAL A 1 106 ? 10.951  -1.356  -2.428  1.00 0.00 ? 106 VAL A CG1  20 
ATOM 8742  C CG2  . VAL A 1 106 ? 10.560  -1.429  0.038   1.00 0.00 ? 106 VAL A CG2  20 
ATOM 8743  H H    . VAL A 1 106 ? 13.774  -2.820  0.107   1.00 0.00 ? 106 VAL A H    20 
ATOM 8744  H HA   . VAL A 1 106 ? 11.130  -3.774  -0.893  1.00 0.00 ? 106 VAL A HA   20 
ATOM 8745  H HB   . VAL A 1 106 ? 12.446  -1.059  -0.924  1.00 0.00 ? 106 VAL A HB   20 
ATOM 8746  H HG11 . VAL A 1 106 ? 10.705  -2.275  -2.939  1.00 0.00 ? 106 VAL A HG11 20 
ATOM 8747  H HG12 . VAL A 1 106 ? 10.056  -0.774  -2.277  1.00 0.00 ? 106 VAL A HG12 20 
ATOM 8748  H HG13 . VAL A 1 106 ? 11.656  -0.792  -3.022  1.00 0.00 ? 106 VAL A HG13 20 
ATOM 8749  H HG21 . VAL A 1 106 ? 9.839   -2.232  0.057   1.00 0.00 ? 106 VAL A HG21 20 
ATOM 8750  H HG22 . VAL A 1 106 ? 11.072  -1.383  0.989   1.00 0.00 ? 106 VAL A HG22 20 
ATOM 8751  H HG23 . VAL A 1 106 ? 10.054  -0.493  -0.143  1.00 0.00 ? 106 VAL A HG23 20 
ATOM 8752  N N    . ARG A 1 107 ? 11.983  -4.262  -3.206  1.00 0.00 ? 107 ARG A N    20 
ATOM 8753  C CA   . ARG A 1 107 ? 12.577  -4.666  -4.513  1.00 0.00 ? 107 ARG A CA   20 
ATOM 8754  C C    . ARG A 1 107 ? 11.753  -4.053  -5.645  1.00 0.00 ? 107 ARG A C    20 
ATOM 8755  O O    . ARG A 1 107 ? 12.207  -3.936  -6.767  1.00 0.00 ? 107 ARG A O    20 
ATOM 8756  C CB   . ARG A 1 107 ? 12.556  -6.191  -4.632  1.00 0.00 ? 107 ARG A CB   20 
ATOM 8757  C CG   . ARG A 1 107 ? 13.338  -6.618  -5.876  1.00 0.00 ? 107 ARG A CG   20 
ATOM 8758  C CD   . ARG A 1 107 ? 12.955  -8.049  -6.252  1.00 0.00 ? 107 ARG A CD   20 
ATOM 8759  N NE   . ARG A 1 107 ? 14.109  -8.717  -6.918  1.00 0.00 ? 107 ARG A NE   20 
ATOM 8760  C CZ   . ARG A 1 107 ? 15.141  -9.093  -6.213  1.00 0.00 ? 107 ARG A CZ   20 
ATOM 8761  N NH1  . ARG A 1 107 ? 15.000  -9.992  -5.277  1.00 0.00 ? 107 ARG A NH1  20 
ATOM 8762  N NH2  . ARG A 1 107 ? 16.314  -8.571  -6.445  1.00 0.00 ? 107 ARG A NH2  20 
ATOM 8763  H H    . ARG A 1 107 ? 11.071  -4.539  -2.976  1.00 0.00 ? 107 ARG A H    20 
ATOM 8764  H HA   . ARG A 1 107 ? 13.595  -4.311  -4.573  1.00 0.00 ? 107 ARG A HA   20 
ATOM 8765  H HB2  . ARG A 1 107 ? 13.009  -6.627  -3.754  1.00 0.00 ? 107 ARG A HB2  20 
ATOM 8766  H HB3  . ARG A 1 107 ? 11.535  -6.532  -4.717  1.00 0.00 ? 107 ARG A HB3  20 
ATOM 8767  H HG2  . ARG A 1 107 ? 13.102  -5.954  -6.695  1.00 0.00 ? 107 ARG A HG2  20 
ATOM 8768  H HG3  . ARG A 1 107 ? 14.397  -6.573  -5.668  1.00 0.00 ? 107 ARG A HG3  20 
ATOM 8769  H HD2  . ARG A 1 107 ? 12.689  -8.597  -5.360  1.00 0.00 ? 107 ARG A HD2  20 
ATOM 8770  H HD3  . ARG A 1 107 ? 12.111  -8.031  -6.927  1.00 0.00 ? 107 ARG A HD3  20 
ATOM 8771  H HE   . ARG A 1 107 ? 14.093  -8.873  -7.885  1.00 0.00 ? 107 ARG A HE   20 
ATOM 8772  H HH11 . ARG A 1 107 ? 14.102  -10.393 -5.099  1.00 0.00 ? 107 ARG A HH11 20 
ATOM 8773  H HH12 . ARG A 1 107 ? 15.791  -10.279 -4.737  1.00 0.00 ? 107 ARG A HH12 20 
ATOM 8774  H HH21 . ARG A 1 107 ? 16.421  -7.883  -7.163  1.00 0.00 ? 107 ARG A HH21 20 
ATOM 8775  H HH22 . ARG A 1 107 ? 17.105  -8.858  -5.906  1.00 0.00 ? 107 ARG A HH22 20 
ATOM 8776  N N    . SER A 1 108 ? 10.545  -3.657  -5.356  1.00 0.00 ? 108 SER A N    20 
ATOM 8777  C CA   . SER A 1 108 ? 9.682   -3.046  -6.405  1.00 0.00 ? 108 SER A CA   20 
ATOM 8778  C C    . SER A 1 108 ? 8.408   -2.518  -5.750  1.00 0.00 ? 108 SER A C    20 
ATOM 8779  O O    . SER A 1 108 ? 7.960   -3.029  -4.742  1.00 0.00 ? 108 SER A O    20 
ATOM 8780  C CB   . SER A 1 108 ? 9.317   -4.095  -7.453  1.00 0.00 ? 108 SER A CB   20 
ATOM 8781  O OG   . SER A 1 108 ? 8.431   -3.520  -8.404  1.00 0.00 ? 108 SER A OG   20 
ATOM 8782  H H    . SER A 1 108 ? 10.203  -3.760  -4.443  1.00 0.00 ? 108 SER A H    20 
ATOM 8783  H HA   . SER A 1 108 ? 10.210  -2.231  -6.876  1.00 0.00 ? 108 SER A HA   20 
ATOM 8784  H HB2  . SER A 1 108 ? 10.208  -4.428  -7.957  1.00 0.00 ? 108 SER A HB2  20 
ATOM 8785  H HB3  . SER A 1 108 ? 8.844   -4.937  -6.967  1.00 0.00 ? 108 SER A HB3  20 
ATOM 8786  H HG   . SER A 1 108 ? 8.563   -3.967  -9.242  1.00 0.00 ? 108 SER A HG   20 
ATOM 8787  N N    . CYS A 1 109 ? 7.823   -1.496  -6.305  1.00 0.00 ? 109 CYS A N    20 
ATOM 8788  C CA   . CYS A 1 109 ? 6.581   -0.939  -5.693  1.00 0.00 ? 109 CYS A CA   20 
ATOM 8789  C C    . CYS A 1 109 ? 5.344   -1.426  -6.460  1.00 0.00 ? 109 CYS A C    20 
ATOM 8790  O O    . CYS A 1 109 ? 5.440   -2.240  -7.357  1.00 0.00 ? 109 CYS A O    20 
ATOM 8791  C CB   . CYS A 1 109 ? 6.634   0.587   -5.729  1.00 0.00 ? 109 CYS A CB   20 
ATOM 8792  S SG   . CYS A 1 109 ? 8.025   1.164   -4.727  1.00 0.00 ? 109 CYS A SG   20 
ATOM 8793  H H    . CYS A 1 109 ? 8.205   -1.091  -7.112  1.00 0.00 ? 109 CYS A H    20 
ATOM 8794  H HA   . CYS A 1 109 ? 6.518   -1.270  -4.670  1.00 0.00 ? 109 CYS A HA   20 
ATOM 8795  H HB2  . CYS A 1 109 ? 6.760   0.921   -6.748  1.00 0.00 ? 109 CYS A HB2  20 
ATOM 8796  H HB3  . CYS A 1 109 ? 5.714   0.987   -5.330  1.00 0.00 ? 109 CYS A HB3  20 
ATOM 8797  N N    . LYS A 1 110 ? 4.180   -0.937  -6.107  1.00 0.00 ? 110 LYS A N    20 
ATOM 8798  C CA   . LYS A 1 110 ? 2.940   -1.373  -6.808  1.00 0.00 ? 110 LYS A CA   20 
ATOM 8799  C C    . LYS A 1 110 ? 1.782   -0.455  -6.392  1.00 0.00 ? 110 LYS A C    20 
ATOM 8800  O O    . LYS A 1 110 ? 1.938   0.748   -6.321  1.00 0.00 ? 110 LYS A O    20 
ATOM 8801  C CB   . LYS A 1 110 ? 2.630   -2.823  -6.425  1.00 0.00 ? 110 LYS A CB   20 
ATOM 8802  C CG   . LYS A 1 110 ? 2.531   -2.933  -4.901  1.00 0.00 ? 110 LYS A CG   20 
ATOM 8803  C CD   . LYS A 1 110 ? 1.453   -3.951  -4.525  1.00 0.00 ? 110 LYS A CD   20 
ATOM 8804  C CE   . LYS A 1 110 ? 1.649   -4.386  -3.071  1.00 0.00 ? 110 LYS A CE   20 
ATOM 8805  N NZ   . LYS A 1 110 ? 0.320   -4.584  -2.429  1.00 0.00 ? 110 LYS A NZ   20 
ATOM 8806  H H    . LYS A 1 110 ? 4.121   -0.282  -5.378  1.00 0.00 ? 110 LYS A H    20 
ATOM 8807  H HA   . LYS A 1 110 ? 3.088   -1.305  -7.876  1.00 0.00 ? 110 LYS A HA   20 
ATOM 8808  H HB2  . LYS A 1 110 ? 1.696   -3.126  -6.875  1.00 0.00 ? 110 LYS A HB2  20 
ATOM 8809  H HB3  . LYS A 1 110 ? 3.422   -3.463  -6.779  1.00 0.00 ? 110 LYS A HB3  20 
ATOM 8810  H HG2  . LYS A 1 110 ? 3.482   -3.251  -4.501  1.00 0.00 ? 110 LYS A HG2  20 
ATOM 8811  H HG3  . LYS A 1 110 ? 2.272   -1.970  -4.487  1.00 0.00 ? 110 LYS A HG3  20 
ATOM 8812  H HD2  . LYS A 1 110 ? 0.477   -3.500  -4.638  1.00 0.00 ? 110 LYS A HD2  20 
ATOM 8813  H HD3  . LYS A 1 110 ? 1.530   -4.813  -5.171  1.00 0.00 ? 110 LYS A HD3  20 
ATOM 8814  H HE2  . LYS A 1 110 ? 2.202   -5.314  -3.045  1.00 0.00 ? 110 LYS A HE2  20 
ATOM 8815  H HE3  . LYS A 1 110 ? 2.198   -3.625  -2.538  1.00 0.00 ? 110 LYS A HE3  20 
ATOM 8816  H HZ1  . LYS A 1 110 ? -0.336  -3.845  -2.755  1.00 0.00 ? 110 LYS A HZ1  20 
ATOM 8817  H HZ2  . LYS A 1 110 ? -0.056  -5.517  -2.688  1.00 0.00 ? 110 LYS A HZ2  20 
ATOM 8818  H HZ3  . LYS A 1 110 ? 0.423   -4.526  -1.396  1.00 0.00 ? 110 LYS A HZ3  20 
ATOM 8819  N N    . CYS A 1 111 ? 0.625   -0.996  -6.115  1.00 0.00 ? 111 CYS A N    20 
ATOM 8820  C CA   . CYS A 1 111 ? -0.513  -0.125  -5.712  1.00 0.00 ? 111 CYS A CA   20 
ATOM 8821  C C    . CYS A 1 111 ? -1.468  -0.910  -4.811  1.00 0.00 ? 111 CYS A C    20 
ATOM 8822  O O    . CYS A 1 111 ? -2.387  -1.555  -5.277  1.00 0.00 ? 111 CYS A O    20 
ATOM 8823  C CB   . CYS A 1 111 ? -1.263  0.334   -6.964  1.00 0.00 ? 111 CYS A CB   20 
ATOM 8824  S SG   . CYS A 1 111 ? -0.153  1.311   -8.007  1.00 0.00 ? 111 CYS A SG   20 
ATOM 8825  H H    . CYS A 1 111 ? 0.503   -1.963  -6.173  1.00 0.00 ? 111 CYS A H    20 
ATOM 8826  H HA   . CYS A 1 111 ? -0.138  0.736   -5.180  1.00 0.00 ? 111 CYS A HA   20 
ATOM 8827  H HB2  . CYS A 1 111 ? -1.608  -0.528  -7.514  1.00 0.00 ? 111 CYS A HB2  20 
ATOM 8828  H HB3  . CYS A 1 111 ? -2.110  0.937   -6.674  1.00 0.00 ? 111 CYS A HB3  20 
ATOM 8829  N N    . SER A 1 112 ? -1.265  -0.857  -3.522  1.00 0.00 ? 112 SER A N    20 
ATOM 8830  C CA   . SER A 1 112 ? -2.170  -1.596  -2.601  1.00 0.00 ? 112 SER A CA   20 
ATOM 8831  C C    . SER A 1 112 ? -3.398  -0.733  -2.302  1.00 0.00 ? 112 SER A C    20 
ATOM 8832  O O    . SER A 1 112 ? -3.225  0.459   -2.108  1.00 0.00 ? 112 SER A O    20 
ATOM 8833  C CB   . SER A 1 112 ? -1.432  -1.905  -1.298  1.00 0.00 ? 112 SER A CB   20 
ATOM 8834  O OG   . SER A 1 112 ? -2.086  -2.975  -0.629  1.00 0.00 ? 112 SER A OG   20 
ATOM 8835  O OXT  . SER A 1 112 ? -4.489  -1.278  -2.276  1.00 0.00 ? 112 SER A OXT  20 
ATOM 8836  H H    . SER A 1 112 ? -0.522  -0.328  -3.161  1.00 0.00 ? 112 SER A H    20 
ATOM 8837  H HA   . SER A 1 112 ? -2.483  -2.519  -3.067  1.00 0.00 ? 112 SER A HA   20 
ATOM 8838  H HB2  . SER A 1 112 ? -0.417  -2.190  -1.516  1.00 0.00 ? 112 SER A HB2  20 
ATOM 8839  H HB3  . SER A 1 112 ? -1.429  -1.024  -0.673  1.00 0.00 ? 112 SER A HB3  20 
ATOM 8840  H HG   . SER A 1 112 ? -2.249  -3.671  -1.271  1.00 0.00 ? 112 SER A HG   20 
ATOM 8841  N N    . ALA B 1 1   ? -6.767  0.831   16.076  1.00 0.00 ? 1   ALA B N    20 
ATOM 8842  C CA   . ALA B 1 1   ? -7.828  0.305   15.171  1.00 0.00 ? 1   ALA B CA   20 
ATOM 8843  C C    . ALA B 1 1   ? -7.859  1.131   13.884  1.00 0.00 ? 1   ALA B C    20 
ATOM 8844  O O    . ALA B 1 1   ? -8.012  2.336   13.912  1.00 0.00 ? 1   ALA B O    20 
ATOM 8845  C CB   . ALA B 1 1   ? -9.186  0.398   15.870  1.00 0.00 ? 1   ALA B CB   20 
ATOM 8846  H H1   . ALA B 1 1   ? -5.892  0.983   15.533  1.00 0.00 ? 1   ALA B H1   20 
ATOM 8847  H H2   . ALA B 1 1   ? -7.077  1.733   16.488  1.00 0.00 ? 1   ALA B H2   20 
ATOM 8848  H H3   . ALA B 1 1   ? -6.588  0.144   16.836  1.00 0.00 ? 1   ALA B H3   20 
ATOM 8849  H HA   . ALA B 1 1   ? -7.617  -0.727  14.932  1.00 0.00 ? 1   ALA B HA   20 
ATOM 8850  H HB1  . ALA B 1 1   ? -9.276  1.360   16.355  1.00 0.00 ? 1   ALA B HB1  20 
ATOM 8851  H HB2  . ALA B 1 1   ? -9.975  0.288   15.141  1.00 0.00 ? 1   ALA B HB2  20 
ATOM 8852  H HB3  . ALA B 1 1   ? -9.266  -0.385  16.608  1.00 0.00 ? 1   ALA B HB3  20 
ATOM 8853  N N    . LEU B 1 2   ? -7.716  0.493   12.754  1.00 0.00 ? 2   LEU B N    20 
ATOM 8854  C CA   . LEU B 1 2   ? -7.740  1.242   11.467  1.00 0.00 ? 2   LEU B CA   20 
ATOM 8855  C C    . LEU B 1 2   ? -8.760  0.607   10.528  1.00 0.00 ? 2   LEU B C    20 
ATOM 8856  O O    . LEU B 1 2   ? -8.471  0.308   9.386   1.00 0.00 ? 2   LEU B O    20 
ATOM 8857  C CB   . LEU B 1 2   ? -6.361  1.185   10.817  1.00 0.00 ? 2   LEU B CB   20 
ATOM 8858  C CG   . LEU B 1 2   ? -5.407  2.127   11.551  1.00 0.00 ? 2   LEU B CG   20 
ATOM 8859  C CD1  . LEU B 1 2   ? -4.086  2.218   10.784  1.00 0.00 ? 2   LEU B CD1  20 
ATOM 8860  C CD2  . LEU B 1 2   ? -6.037  3.519   11.644  1.00 0.00 ? 2   LEU B CD2  20 
ATOM 8861  H H    . LEU B 1 2   ? -7.595  -0.480  12.754  1.00 0.00 ? 2   LEU B H    20 
ATOM 8862  H HA   . LEU B 1 2   ? -8.011  2.271   11.651  1.00 0.00 ? 2   LEU B HA   20 
ATOM 8863  H HB2  . LEU B 1 2   ? -5.983  0.175   10.867  1.00 0.00 ? 2   LEU B HB2  20 
ATOM 8864  H HB3  . LEU B 1 2   ? -6.443  1.488   9.785   1.00 0.00 ? 2   LEU B HB3  20 
ATOM 8865  H HG   . LEU B 1 2   ? -5.219  1.747   12.545  1.00 0.00 ? 2   LEU B HG   20 
ATOM 8866  H HD11 . LEU B 1 2   ? -4.194  1.735   9.824   1.00 0.00 ? 2   LEU B HD11 20 
ATOM 8867  H HD12 . LEU B 1 2   ? -3.826  3.256   10.637  1.00 0.00 ? 2   LEU B HD12 20 
ATOM 8868  H HD13 . LEU B 1 2   ? -3.308  1.728   11.348  1.00 0.00 ? 2   LEU B HD13 20 
ATOM 8869  H HD21 . LEU B 1 2   ? -6.874  3.581   10.965  1.00 0.00 ? 2   LEU B HD21 20 
ATOM 8870  H HD22 . LEU B 1 2   ? -6.378  3.692   12.654  1.00 0.00 ? 2   LEU B HD22 20 
ATOM 8871  H HD23 . LEU B 1 2   ? -5.304  4.264   11.380  1.00 0.00 ? 2   LEU B HD23 20 
ATOM 8872  N N    . ASP B 1 3   ? -9.951  0.399   10.999  1.00 0.00 ? 3   ASP B N    20 
ATOM 8873  C CA   . ASP B 1 3   ? -10.997 -0.217  10.138  1.00 0.00 ? 3   ASP B CA   20 
ATOM 8874  C C    . ASP B 1 3   ? -12.013 0.848   9.728   1.00 0.00 ? 3   ASP B C    20 
ATOM 8875  O O    . ASP B 1 3   ? -11.884 2.009   10.064  1.00 0.00 ? 3   ASP B O    20 
ATOM 8876  C CB   . ASP B 1 3   ? -11.711 -1.330  10.908  1.00 0.00 ? 3   ASP B CB   20 
ATOM 8877  C CG   . ASP B 1 3   ? -11.771 -0.971  12.394  1.00 0.00 ? 3   ASP B CG   20 
ATOM 8878  O OD1  . ASP B 1 3   ? -10.807 -1.247  13.088  1.00 0.00 ? 3   ASP B OD1  20 
ATOM 8879  O OD2  . ASP B 1 3   ? -12.780 -0.428  12.812  1.00 0.00 ? 3   ASP B OD2  20 
ATOM 8880  H H    . ASP B 1 3   ? -10.159 0.649   11.921  1.00 0.00 ? 3   ASP B H    20 
ATOM 8881  H HA   . ASP B 1 3   ? -10.535 -0.631  9.254   1.00 0.00 ? 3   ASP B HA   20 
ATOM 8882  H HB2  . ASP B 1 3   ? -12.716 -1.444  10.523  1.00 0.00 ? 3   ASP B HB2  20 
ATOM 8883  H HB3  . ASP B 1 3   ? -11.173 -2.256  10.783  1.00 0.00 ? 3   ASP B HB3  20 
ATOM 8884  N N    . THR B 1 4   ? -13.021 0.459   9.000   1.00 0.00 ? 4   THR B N    20 
ATOM 8885  C CA   . THR B 1 4   ? -14.052 1.438   8.556   1.00 0.00 ? 4   THR B CA   20 
ATOM 8886  C C    . THR B 1 4   ? -15.054 1.699   9.685   1.00 0.00 ? 4   THR B C    20 
ATOM 8887  O O    . THR B 1 4   ? -16.080 2.317   9.482   1.00 0.00 ? 4   THR B O    20 
ATOM 8888  C CB   . THR B 1 4   ? -14.769 0.876   7.330   1.00 0.00 ? 4   THR B CB   20 
ATOM 8889  O OG1  . THR B 1 4   ? -15.742 -0.074  7.744   1.00 0.00 ? 4   THR B OG1  20 
ATOM 8890  C CG2  . THR B 1 4   ? -13.742 0.199   6.418   1.00 0.00 ? 4   THR B CG2  20 
ATOM 8891  H H    . THR B 1 4   ? -13.098 -0.482  8.738   1.00 0.00 ? 4   THR B H    20 
ATOM 8892  H HA   . THR B 1 4   ? -13.573 2.365   8.295   1.00 0.00 ? 4   THR B HA   20 
ATOM 8893  H HB   . THR B 1 4   ? -15.251 1.677   6.793   1.00 0.00 ? 4   THR B HB   20 
ATOM 8894  H HG1  . THR B 1 4   ? -16.534 0.405   8.001   1.00 0.00 ? 4   THR B HG1  20 
ATOM 8895  H HG21 . THR B 1 4   ? -12.747 0.506   6.708   1.00 0.00 ? 4   THR B HG21 20 
ATOM 8896  H HG22 . THR B 1 4   ? -13.828 -0.874  6.511   1.00 0.00 ? 4   THR B HG22 20 
ATOM 8897  H HG23 . THR B 1 4   ? -13.922 0.487   5.393   1.00 0.00 ? 4   THR B HG23 20 
ATOM 8898  N N    . ASN B 1 5   ? -14.761 1.251   10.875  1.00 0.00 ? 5   ASN B N    20 
ATOM 8899  C CA   . ASN B 1 5   ? -15.691 1.496   12.011  1.00 0.00 ? 5   ASN B CA   20 
ATOM 8900  C C    . ASN B 1 5   ? -15.163 2.674   12.832  1.00 0.00 ? 5   ASN B C    20 
ATOM 8901  O O    . ASN B 1 5   ? -15.890 3.589   13.166  1.00 0.00 ? 5   ASN B O    20 
ATOM 8902  C CB   . ASN B 1 5   ? -15.768 0.249   12.894  1.00 0.00 ? 5   ASN B CB   20 
ATOM 8903  C CG   . ASN B 1 5   ? -17.138 0.189   13.573  1.00 0.00 ? 5   ASN B CG   20 
ATOM 8904  O OD1  . ASN B 1 5   ? -18.138 -0.060  12.928  1.00 0.00 ? 5   ASN B OD1  20 
ATOM 8905  N ND2  . ASN B 1 5   ? -17.227 0.409   14.855  1.00 0.00 ? 5   ASN B ND2  20 
ATOM 8906  H H    . ASN B 1 5   ? -13.925 0.765   11.025  1.00 0.00 ? 5   ASN B H    20 
ATOM 8907  H HA   . ASN B 1 5   ? -16.673 1.733   11.630  1.00 0.00 ? 5   ASN B HA   20 
ATOM 8908  H HB2  . ASN B 1 5   ? -15.628 -0.632  12.285  1.00 0.00 ? 5   ASN B HB2  20 
ATOM 8909  H HB3  . ASN B 1 5   ? -14.997 0.292   13.649  1.00 0.00 ? 5   ASN B HB3  20 
ATOM 8910  H HD21 . ASN B 1 5   ? -16.421 0.611   15.376  1.00 0.00 ? 5   ASN B HD21 20 
ATOM 8911  H HD22 . ASN B 1 5   ? -18.101 0.375   15.299  1.00 0.00 ? 5   ASN B HD22 20 
ATOM 8912  N N    . TYR B 1 6   ? -13.898 2.659   13.156  1.00 0.00 ? 6   TYR B N    20 
ATOM 8913  C CA   . TYR B 1 6   ? -13.311 3.771   13.947  1.00 0.00 ? 6   TYR B CA   20 
ATOM 8914  C C    . TYR B 1 6   ? -12.855 4.886   13.001  1.00 0.00 ? 6   TYR B C    20 
ATOM 8915  O O    . TYR B 1 6   ? -12.666 6.017   13.405  1.00 0.00 ? 6   TYR B O    20 
ATOM 8916  C CB   . TYR B 1 6   ? -12.110 3.232   14.724  1.00 0.00 ? 6   TYR B CB   20 
ATOM 8917  C CG   . TYR B 1 6   ? -11.290 4.382   15.260  1.00 0.00 ? 6   TYR B CG   20 
ATOM 8918  C CD1  . TYR B 1 6   ? -11.761 5.138   16.339  1.00 0.00 ? 6   TYR B CD1  20 
ATOM 8919  C CD2  . TYR B 1 6   ? -10.058 4.689   14.672  1.00 0.00 ? 6   TYR B CD2  20 
ATOM 8920  C CE1  . TYR B 1 6   ? -10.998 6.205   16.831  1.00 0.00 ? 6   TYR B CE1  20 
ATOM 8921  C CE2  . TYR B 1 6   ? -9.294  5.755   15.164  1.00 0.00 ? 6   TYR B CE2  20 
ATOM 8922  C CZ   . TYR B 1 6   ? -9.764  6.513   16.244  1.00 0.00 ? 6   TYR B CZ   20 
ATOM 8923  O OH   . TYR B 1 6   ? -9.013  7.563   16.729  1.00 0.00 ? 6   TYR B OH   20 
ATOM 8924  H H    . TYR B 1 6   ? -13.328 1.913   12.877  1.00 0.00 ? 6   TYR B H    20 
ATOM 8925  H HA   . TYR B 1 6   ? -14.046 4.156   14.637  1.00 0.00 ? 6   TYR B HA   20 
ATOM 8926  H HB2  . TYR B 1 6   ? -12.459 2.621   15.540  1.00 0.00 ? 6   TYR B HB2  20 
ATOM 8927  H HB3  . TYR B 1 6   ? -11.497 2.634   14.067  1.00 0.00 ? 6   TYR B HB3  20 
ATOM 8928  H HD1  . TYR B 1 6   ? -12.711 4.900   16.793  1.00 0.00 ? 6   TYR B HD1  20 
ATOM 8929  H HD2  . TYR B 1 6   ? -9.697  4.103   13.839  1.00 0.00 ? 6   TYR B HD2  20 
ATOM 8930  H HE1  . TYR B 1 6   ? -11.361 6.789   17.664  1.00 0.00 ? 6   TYR B HE1  20 
ATOM 8931  H HE2  . TYR B 1 6   ? -8.343  5.991   14.711  1.00 0.00 ? 6   TYR B HE2  20 
ATOM 8932  H HH   . TYR B 1 6   ? -9.493  7.958   17.461  1.00 0.00 ? 6   TYR B HH   20 
ATOM 8933  N N    . CYS B 1 7   ? -12.673 4.576   11.747  1.00 0.00 ? 7   CYS B N    20 
ATOM 8934  C CA   . CYS B 1 7   ? -12.225 5.616   10.776  1.00 0.00 ? 7   CYS B CA   20 
ATOM 8935  C C    . CYS B 1 7   ? -13.422 6.464   10.344  1.00 0.00 ? 7   CYS B C    20 
ATOM 8936  O O    . CYS B 1 7   ? -13.270 7.498   9.723   1.00 0.00 ? 7   CYS B O    20 
ATOM 8937  C CB   . CYS B 1 7   ? -11.619 4.938   9.550   1.00 0.00 ? 7   CYS B CB   20 
ATOM 8938  S SG   . CYS B 1 7   ? -9.858  4.616   9.831   1.00 0.00 ? 7   CYS B SG   20 
ATOM 8939  H H    . CYS B 1 7   ? -12.828 3.657   11.442  1.00 0.00 ? 7   CYS B H    20 
ATOM 8940  H HA   . CYS B 1 7   ? -11.484 6.248   11.243  1.00 0.00 ? 7   CYS B HA   20 
ATOM 8941  H HB2  . CYS B 1 7   ? -12.132 4.005   9.368   1.00 0.00 ? 7   CYS B HB2  20 
ATOM 8942  H HB3  . CYS B 1 7   ? -11.734 5.581   8.690   1.00 0.00 ? 7   CYS B HB3  20 
ATOM 8943  N N    . PHE B 1 8   ? -14.610 6.034   10.663  1.00 0.00 ? 8   PHE B N    20 
ATOM 8944  C CA   . PHE B 1 8   ? -15.821 6.813   10.270  1.00 0.00 ? 8   PHE B CA   20 
ATOM 8945  C C    . PHE B 1 8   ? -16.078 7.926   11.292  1.00 0.00 ? 8   PHE B C    20 
ATOM 8946  O O    . PHE B 1 8   ? -17.201 8.166   11.690  1.00 0.00 ? 8   PHE B O    20 
ATOM 8947  C CB   . PHE B 1 8   ? -17.033 5.881   10.223  1.00 0.00 ? 8   PHE B CB   20 
ATOM 8948  C CG   . PHE B 1 8   ? -17.188 5.297   8.834   1.00 0.00 ? 8   PHE B CG   20 
ATOM 8949  C CD1  . PHE B 1 8   ? -16.127 5.349   7.919   1.00 0.00 ? 8   PHE B CD1  20 
ATOM 8950  C CD2  . PHE B 1 8   ? -18.401 4.702   8.463   1.00 0.00 ? 8   PHE B CD2  20 
ATOM 8951  C CE1  . PHE B 1 8   ? -16.281 4.808   6.637   1.00 0.00 ? 8   PHE B CE1  20 
ATOM 8952  C CE2  . PHE B 1 8   ? -18.554 4.161   7.182   1.00 0.00 ? 8   PHE B CE2  20 
ATOM 8953  C CZ   . PHE B 1 8   ? -17.493 4.214   6.268   1.00 0.00 ? 8   PHE B CZ   20 
ATOM 8954  H H    . PHE B 1 8   ? -14.707 5.194   11.159  1.00 0.00 ? 8   PHE B H    20 
ATOM 8955  H HA   . PHE B 1 8   ? -15.666 7.251   9.295   1.00 0.00 ? 8   PHE B HA   20 
ATOM 8956  H HB2  . PHE B 1 8   ? -16.894 5.081   10.934  1.00 0.00 ? 8   PHE B HB2  20 
ATOM 8957  H HB3  . PHE B 1 8   ? -17.923 6.437   10.478  1.00 0.00 ? 8   PHE B HB3  20 
ATOM 8958  H HD1  . PHE B 1 8   ? -15.192 5.807   8.203   1.00 0.00 ? 8   PHE B HD1  20 
ATOM 8959  H HD2  . PHE B 1 8   ? -19.219 4.662   9.167   1.00 0.00 ? 8   PHE B HD2  20 
ATOM 8960  H HE1  . PHE B 1 8   ? -15.464 4.848   5.932   1.00 0.00 ? 8   PHE B HE1  20 
ATOM 8961  H HE2  . PHE B 1 8   ? -19.489 3.703   6.897   1.00 0.00 ? 8   PHE B HE2  20 
ATOM 8962  H HZ   . PHE B 1 8   ? -17.611 3.796   5.279   1.00 0.00 ? 8   PHE B HZ   20 
ATOM 8963  N N    . SER B 1 9   ? -15.050 8.609   11.716  1.00 0.00 ? 9   SER B N    20 
ATOM 8964  C CA   . SER B 1 9   ? -15.237 9.706   12.706  1.00 0.00 ? 9   SER B CA   20 
ATOM 8965  C C    . SER B 1 9   ? -14.657 11.003  12.136  1.00 0.00 ? 9   SER B C    20 
ATOM 8966  O O    . SER B 1 9   ? -14.694 11.238  10.944  1.00 0.00 ? 9   SER B O    20 
ATOM 8967  C CB   . SER B 1 9   ? -14.515 9.349   14.006  1.00 0.00 ? 9   SER B CB   20 
ATOM 8968  O OG   . SER B 1 9   ? -15.181 9.965   15.098  1.00 0.00 ? 9   SER B OG   20 
ATOM 8969  H H    . SER B 1 9   ? -14.155 8.402   11.382  1.00 0.00 ? 9   SER B H    20 
ATOM 8970  H HA   . SER B 1 9   ? -16.291 9.838   12.903  1.00 0.00 ? 9   SER B HA   20 
ATOM 8971  H HB2  . SER B 1 9   ? -14.522 8.280   14.142  1.00 0.00 ? 9   SER B HB2  20 
ATOM 8972  H HB3  . SER B 1 9   ? -13.491 9.695   13.953  1.00 0.00 ? 9   SER B HB3  20 
ATOM 8973  H HG   . SER B 1 9   ? -16.102 9.695   15.074  1.00 0.00 ? 9   SER B HG   20 
ATOM 8974  N N    . SER B 1 10  ? -14.120 11.848  12.973  1.00 0.00 ? 10  SER B N    20 
ATOM 8975  C CA   . SER B 1 10  ? -13.539 13.126  12.470  1.00 0.00 ? 10  SER B CA   20 
ATOM 8976  C C    . SER B 1 10  ? -12.147 13.333  13.074  1.00 0.00 ? 10  SER B C    20 
ATOM 8977  O O    . SER B 1 10  ? -11.493 14.324  12.819  1.00 0.00 ? 10  SER B O    20 
ATOM 8978  C CB   . SER B 1 10  ? -14.445 14.291  12.869  1.00 0.00 ? 10  SER B CB   20 
ATOM 8979  O OG   . SER B 1 10  ? -14.265 15.361  11.949  1.00 0.00 ? 10  SER B OG   20 
ATOM 8980  H H    . SER B 1 10  ? -14.098 11.644  13.931  1.00 0.00 ? 10  SER B H    20 
ATOM 8981  H HA   . SER B 1 10  ? -13.461 13.085  11.393  1.00 0.00 ? 10  SER B HA   20 
ATOM 8982  H HB2  . SER B 1 10  ? -15.474 13.974  12.848  1.00 0.00 ? 10  SER B HB2  20 
ATOM 8983  H HB3  . SER B 1 10  ? -14.191 14.616  13.869  1.00 0.00 ? 10  SER B HB3  20 
ATOM 8984  H HG   . SER B 1 10  ? -14.760 16.117  12.275  1.00 0.00 ? 10  SER B HG   20 
ATOM 8985  N N    . THR B 1 11  ? -11.689 12.406  13.871  1.00 0.00 ? 11  THR B N    20 
ATOM 8986  C CA   . THR B 1 11  ? -10.341 12.555  14.488  1.00 0.00 ? 11  THR B CA   20 
ATOM 8987  C C    . THR B 1 11  ? -9.352  11.623  13.784  1.00 0.00 ? 11  THR B C    20 
ATOM 8988  O O    . THR B 1 11  ? -9.692  10.943  12.836  1.00 0.00 ? 11  THR B O    20 
ATOM 8989  C CB   . THR B 1 11  ? -10.416 12.192  15.972  1.00 0.00 ? 11  THR B CB   20 
ATOM 8990  O OG1  . THR B 1 11  ? -11.731 11.757  16.286  1.00 0.00 ? 11  THR B OG1  20 
ATOM 8991  C CG2  . THR B 1 11  ? -10.067 13.418  16.817  1.00 0.00 ? 11  THR B CG2  20 
ATOM 8992  H H    . THR B 1 11  ? -12.231 11.614  14.064  1.00 0.00 ? 11  THR B H    20 
ATOM 8993  H HA   . THR B 1 11  ? -10.009 13.577  14.384  1.00 0.00 ? 11  THR B HA   20 
ATOM 8994  H HB   . THR B 1 11  ? -9.713  11.402  16.186  1.00 0.00 ? 11  THR B HB   20 
ATOM 8995  H HG1  . THR B 1 11  ? -11.676 11.162  17.038  1.00 0.00 ? 11  THR B HG1  20 
ATOM 8996  H HG21 . THR B 1 11  ? -10.371 14.314  16.296  1.00 0.00 ? 11  THR B HG21 20 
ATOM 8997  H HG22 . THR B 1 11  ? -10.582 13.361  17.765  1.00 0.00 ? 11  THR B HG22 20 
ATOM 8998  H HG23 . THR B 1 11  ? -9.001  13.445  16.989  1.00 0.00 ? 11  THR B HG23 20 
ATOM 8999  N N    . GLU B 1 12  ? -8.130  11.585  14.241  1.00 0.00 ? 12  GLU B N    20 
ATOM 9000  C CA   . GLU B 1 12  ? -7.122  10.696  13.598  1.00 0.00 ? 12  GLU B CA   20 
ATOM 9001  C C    . GLU B 1 12  ? -6.936  11.110  12.136  1.00 0.00 ? 12  GLU B C    20 
ATOM 9002  O O    . GLU B 1 12  ? -7.853  11.048  11.342  1.00 0.00 ? 12  GLU B O    20 
ATOM 9003  C CB   . GLU B 1 12  ? -7.609  9.247   13.659  1.00 0.00 ? 12  GLU B CB   20 
ATOM 9004  C CG   . GLU B 1 12  ? -6.557  8.382   14.359  1.00 0.00 ? 12  GLU B CG   20 
ATOM 9005  C CD   . GLU B 1 12  ? -6.707  8.519   15.874  1.00 0.00 ? 12  GLU B CD   20 
ATOM 9006  O OE1  . GLU B 1 12  ? -7.312  9.487   16.305  1.00 0.00 ? 12  GLU B OE1  20 
ATOM 9007  O OE2  . GLU B 1 12  ? -6.215  7.653   16.579  1.00 0.00 ? 12  GLU B OE2  20 
ATOM 9008  H H    . GLU B 1 12  ? -7.875  12.142  15.007  1.00 0.00 ? 12  GLU B H    20 
ATOM 9009  H HA   . GLU B 1 12  ? -6.180  10.782  14.119  1.00 0.00 ? 12  GLU B HA   20 
ATOM 9010  H HB2  . GLU B 1 12  ? -8.537  9.202   14.212  1.00 0.00 ? 12  GLU B HB2  20 
ATOM 9011  H HB3  . GLU B 1 12  ? -7.769  8.877   12.658  1.00 0.00 ? 12  GLU B HB3  20 
ATOM 9012  H HG2  . GLU B 1 12  ? -6.695  7.349   14.074  1.00 0.00 ? 12  GLU B HG2  20 
ATOM 9013  H HG3  . GLU B 1 12  ? -5.571  8.708   14.065  1.00 0.00 ? 12  GLU B HG3  20 
ATOM 9014  N N    . LYS B 1 13  ? -5.755  11.533  11.775  1.00 0.00 ? 13  LYS B N    20 
ATOM 9015  C CA   . LYS B 1 13  ? -5.513  11.950  10.364  1.00 0.00 ? 13  LYS B CA   20 
ATOM 9016  C C    . LYS B 1 13  ? -4.410  11.083  9.756   1.00 0.00 ? 13  LYS B C    20 
ATOM 9017  O O    . LYS B 1 13  ? -3.723  11.487  8.838   1.00 0.00 ? 13  LYS B O    20 
ATOM 9018  C CB   . LYS B 1 13  ? -5.082  13.418  10.334  1.00 0.00 ? 13  LYS B CB   20 
ATOM 9019  C CG   . LYS B 1 13  ? -5.782  14.132  9.174   1.00 0.00 ? 13  LYS B CG   20 
ATOM 9020  C CD   . LYS B 1 13  ? -4.842  15.182  8.579   1.00 0.00 ? 13  LYS B CD   20 
ATOM 9021  C CE   . LYS B 1 13  ? -5.505  16.558  8.644   1.00 0.00 ? 13  LYS B CE   20 
ATOM 9022  N NZ   . LYS B 1 13  ? -4.459  17.618  8.587   1.00 0.00 ? 13  LYS B NZ   20 
ATOM 9023  H H    . LYS B 1 13  ? -5.027  11.575  12.430  1.00 0.00 ? 13  LYS B H    20 
ATOM 9024  H HA   . LYS B 1 13  ? -6.422  11.830  9.792   1.00 0.00 ? 13  LYS B HA   20 
ATOM 9025  H HB2  . LYS B 1 13  ? -5.354  13.892  11.266  1.00 0.00 ? 13  LYS B HB2  20 
ATOM 9026  H HB3  . LYS B 1 13  ? -4.013  13.477  10.197  1.00 0.00 ? 13  LYS B HB3  20 
ATOM 9027  H HG2  . LYS B 1 13  ? -6.045  13.410  8.415   1.00 0.00 ? 13  LYS B HG2  20 
ATOM 9028  H HG3  . LYS B 1 13  ? -6.676  14.617  9.537   1.00 0.00 ? 13  LYS B HG3  20 
ATOM 9029  H HD2  . LYS B 1 13  ? -3.919  15.199  9.141   1.00 0.00 ? 13  LYS B HD2  20 
ATOM 9030  H HD3  . LYS B 1 13  ? -4.631  14.935  7.549   1.00 0.00 ? 13  LYS B HD3  20 
ATOM 9031  H HE2  . LYS B 1 13  ? -6.180  16.673  7.809   1.00 0.00 ? 13  LYS B HE2  20 
ATOM 9032  H HE3  . LYS B 1 13  ? -6.058  16.648  9.568   1.00 0.00 ? 13  LYS B HE3  20 
ATOM 9033  H HZ1  . LYS B 1 13  ? -3.537  17.182  8.377   1.00 0.00 ? 13  LYS B HZ1  20 
ATOM 9034  H HZ2  . LYS B 1 13  ? -4.698  18.302  7.842   1.00 0.00 ? 13  LYS B HZ2  20 
ATOM 9035  H HZ3  . LYS B 1 13  ? -4.411  18.108  9.502   1.00 0.00 ? 13  LYS B HZ3  20 
ATOM 9036  N N    . ASN B 1 14  ? -4.232  9.891   10.259  1.00 0.00 ? 14  ASN B N    20 
ATOM 9037  C CA   . ASN B 1 14  ? -3.172  9.000   9.708   1.00 0.00 ? 14  ASN B CA   20 
ATOM 9038  C C    . ASN B 1 14  ? -3.820  7.895   8.871   1.00 0.00 ? 14  ASN B C    20 
ATOM 9039  O O    . ASN B 1 14  ? -4.917  8.045   8.372   1.00 0.00 ? 14  ASN B O    20 
ATOM 9040  C CB   . ASN B 1 14  ? -2.383  8.371   10.859  1.00 0.00 ? 14  ASN B CB   20 
ATOM 9041  C CG   . ASN B 1 14  ? -2.302  9.360   12.024  1.00 0.00 ? 14  ASN B CG   20 
ATOM 9042  O OD1  . ASN B 1 14  ? -2.625  9.023   13.146  1.00 0.00 ? 14  ASN B OD1  20 
ATOM 9043  N ND2  . ASN B 1 14  ? -1.883  10.576  11.803  1.00 0.00 ? 14  ASN B ND2  20 
ATOM 9044  H H    . ASN B 1 14  ? -4.795  9.583   10.999  1.00 0.00 ? 14  ASN B H    20 
ATOM 9045  H HA   . ASN B 1 14  ? -2.503  9.577   9.086   1.00 0.00 ? 14  ASN B HA   20 
ATOM 9046  H HB2  . ASN B 1 14  ? -2.882  7.469   11.186  1.00 0.00 ? 14  ASN B HB2  20 
ATOM 9047  H HB3  . ASN B 1 14  ? -1.386  8.130   10.524  1.00 0.00 ? 14  ASN B HB3  20 
ATOM 9048  H HD21 . ASN B 1 14  ? -1.623  10.847  10.897  1.00 0.00 ? 14  ASN B HD21 20 
ATOM 9049  H HD22 . ASN B 1 14  ? -1.828  11.218  12.540  1.00 0.00 ? 14  ASN B HD22 20 
ATOM 9050  N N    . CYS B 1 15  ? -3.151  6.786   8.716   1.00 0.00 ? 15  CYS B N    20 
ATOM 9051  C CA   . CYS B 1 15  ? -3.729  5.670   7.914   1.00 0.00 ? 15  CYS B CA   20 
ATOM 9052  C C    . CYS B 1 15  ? -5.143  5.365   8.416   1.00 0.00 ? 15  CYS B C    20 
ATOM 9053  O O    . CYS B 1 15  ? -5.336  4.553   9.298   1.00 0.00 ? 15  CYS B O    20 
ATOM 9054  C CB   . CYS B 1 15  ? -2.844  4.427   8.070   1.00 0.00 ? 15  CYS B CB   20 
ATOM 9055  S SG   . CYS B 1 15  ? -3.714  2.959   7.457   1.00 0.00 ? 15  CYS B SG   20 
ATOM 9056  H H    . CYS B 1 15  ? -2.267  6.686   9.128   1.00 0.00 ? 15  CYS B H    20 
ATOM 9057  H HA   . CYS B 1 15  ? -3.768  5.956   6.873   1.00 0.00 ? 15  CYS B HA   20 
ATOM 9058  H HB2  . CYS B 1 15  ? -1.932  4.562   7.510   1.00 0.00 ? 15  CYS B HB2  20 
ATOM 9059  H HB3  . CYS B 1 15  ? -2.603  4.290   9.114   1.00 0.00 ? 15  CYS B HB3  20 
ATOM 9060  N N    . CYS B 1 16  ? -6.131  6.010   7.860   1.00 0.00 ? 16  CYS B N    20 
ATOM 9061  C CA   . CYS B 1 16  ? -7.529  5.752   8.308   1.00 0.00 ? 16  CYS B CA   20 
ATOM 9062  C C    . CYS B 1 16  ? -8.424  5.541   7.086   1.00 0.00 ? 16  CYS B C    20 
ATOM 9063  O O    . CYS B 1 16  ? -8.556  6.407   6.243   1.00 0.00 ? 16  CYS B O    20 
ATOM 9064  C CB   . CYS B 1 16  ? -8.042  6.952   9.108   1.00 0.00 ? 16  CYS B CB   20 
ATOM 9065  S SG   . CYS B 1 16  ? -9.108  6.385   10.462  1.00 0.00 ? 16  CYS B SG   20 
ATOM 9066  H H    . CYS B 1 16  ? -5.956  6.660   7.149   1.00 0.00 ? 16  CYS B H    20 
ATOM 9067  H HA   . CYS B 1 16  ? -7.548  4.869   8.927   1.00 0.00 ? 16  CYS B HA   20 
ATOM 9068  H HB2  . CYS B 1 16  ? -7.204  7.495   9.516   1.00 0.00 ? 16  CYS B HB2  20 
ATOM 9069  H HB3  . CYS B 1 16  ? -8.606  7.603   8.455   1.00 0.00 ? 16  CYS B HB3  20 
ATOM 9070  N N    . VAL B 1 17  ? -9.044  4.400   6.989   1.00 0.00 ? 17  VAL B N    20 
ATOM 9071  C CA   . VAL B 1 17  ? -9.940  4.133   5.829   1.00 0.00 ? 17  VAL B CA   20 
ATOM 9072  C C    . VAL B 1 17  ? -11.003 5.239   5.758   1.00 0.00 ? 17  VAL B C    20 
ATOM 9073  O O    . VAL B 1 17  ? -11.230 5.952   6.713   1.00 0.00 ? 17  VAL B O    20 
ATOM 9074  C CB   . VAL B 1 17  ? -10.610 2.767   6.029   1.00 0.00 ? 17  VAL B CB   20 
ATOM 9075  C CG1  . VAL B 1 17  ? -11.723 2.885   7.063   1.00 0.00 ? 17  VAL B CG1  20 
ATOM 9076  C CG2  . VAL B 1 17  ? -11.209 2.270   4.714   1.00 0.00 ? 17  VAL B CG2  20 
ATOM 9077  H H    . VAL B 1 17  ? -8.927  3.718   7.683   1.00 0.00 ? 17  VAL B H    20 
ATOM 9078  H HA   . VAL B 1 17  ? -9.361  4.126   4.919   1.00 0.00 ? 17  VAL B HA   20 
ATOM 9079  H HB   . VAL B 1 17  ? -9.875  2.057   6.380   1.00 0.00 ? 17  VAL B HB   20 
ATOM 9080  H HG11 . VAL B 1 17  ? -11.713 3.873   7.491   1.00 0.00 ? 17  VAL B HG11 20 
ATOM 9081  H HG12 . VAL B 1 17  ? -12.675 2.708   6.586   1.00 0.00 ? 17  VAL B HG12 20 
ATOM 9082  H HG13 . VAL B 1 17  ? -11.568 2.154   7.841   1.00 0.00 ? 17  VAL B HG13 20 
ATOM 9083  H HG21 . VAL B 1 17  ? -11.796 3.056   4.266   1.00 0.00 ? 17  VAL B HG21 20 
ATOM 9084  H HG22 . VAL B 1 17  ? -10.416 1.983   4.042   1.00 0.00 ? 17  VAL B HG22 20 
ATOM 9085  H HG23 . VAL B 1 17  ? -11.841 1.417   4.909   1.00 0.00 ? 17  VAL B HG23 20 
ATOM 9086  N N    . ARG B 1 18  ? -11.656 5.389   4.640   1.00 0.00 ? 18  ARG B N    20 
ATOM 9087  C CA   . ARG B 1 18  ? -12.699 6.444   4.524   1.00 0.00 ? 18  ARG B CA   20 
ATOM 9088  C C    . ARG B 1 18  ? -13.814 5.941   3.608   1.00 0.00 ? 18  ARG B C    20 
ATOM 9089  O O    . ARG B 1 18  ? -13.582 5.160   2.708   1.00 0.00 ? 18  ARG B O    20 
ATOM 9090  C CB   . ARG B 1 18  ? -12.081 7.716   3.938   1.00 0.00 ? 18  ARG B CB   20 
ATOM 9091  C CG   . ARG B 1 18  ? -11.587 8.614   5.073   1.00 0.00 ? 18  ARG B CG   20 
ATOM 9092  C CD   . ARG B 1 18  ? -11.081 9.936   4.493   1.00 0.00 ? 18  ARG B CD   20 
ATOM 9093  N NE   . ARG B 1 18  ? -10.013 10.486  5.374   1.00 0.00 ? 18  ARG B NE   20 
ATOM 9094  C CZ   . ARG B 1 18  ? -10.308 11.382  6.275   1.00 0.00 ? 18  ARG B CZ   20 
ATOM 9095  N NH1  . ARG B 1 18  ? -11.345 11.212  7.049   1.00 0.00 ? 18  ARG B NH1  20 
ATOM 9096  N NH2  . ARG B 1 18  ? -9.566  12.448  6.402   1.00 0.00 ? 18  ARG B NH2  20 
ATOM 9097  H H    . ARG B 1 18  ? -11.464 4.811   3.878   1.00 0.00 ? 18  ARG B H    20 
ATOM 9098  H HA   . ARG B 1 18  ? -13.106 6.658   5.503   1.00 0.00 ? 18  ARG B HA   20 
ATOM 9099  H HB2  . ARG B 1 18  ? -11.250 7.450   3.302   1.00 0.00 ? 18  ARG B HB2  20 
ATOM 9100  H HB3  . ARG B 1 18  ? -12.825 8.245   3.361   1.00 0.00 ? 18  ARG B HB3  20 
ATOM 9101  H HG2  . ARG B 1 18  ? -12.400 8.807   5.758   1.00 0.00 ? 18  ARG B HG2  20 
ATOM 9102  H HG3  . ARG B 1 18  ? -10.783 8.122   5.598   1.00 0.00 ? 18  ARG B HG3  20 
ATOM 9103  H HD2  . ARG B 1 18  ? -10.681 9.765   3.505   1.00 0.00 ? 18  ARG B HD2  20 
ATOM 9104  H HD3  . ARG B 1 18  ? -11.898 10.640  4.435   1.00 0.00 ? 18  ARG B HD3  20 
ATOM 9105  H HE   . ARG B 1 18  ? -9.089  10.175  5.277   1.00 0.00 ? 18  ARG B HE   20 
ATOM 9106  H HH11 . ARG B 1 18  ? -11.913 10.396  6.951   1.00 0.00 ? 18  ARG B HH11 20 
ATOM 9107  H HH12 . ARG B 1 18  ? -11.571 11.899  7.740   1.00 0.00 ? 18  ARG B HH12 20 
ATOM 9108  H HH21 . ARG B 1 18  ? -8.771  12.577  5.809   1.00 0.00 ? 18  ARG B HH21 20 
ATOM 9109  H HH22 . ARG B 1 18  ? -9.792  13.136  7.092   1.00 0.00 ? 18  ARG B HH22 20 
ATOM 9110  N N    . GLN B 1 19  ? -15.023 6.374   3.827   1.00 0.00 ? 19  GLN B N    20 
ATOM 9111  C CA   . GLN B 1 19  ? -16.142 5.907   2.963   1.00 0.00 ? 19  GLN B CA   20 
ATOM 9112  C C    . GLN B 1 19  ? -15.845 6.263   1.508   1.00 0.00 ? 19  GLN B C    20 
ATOM 9113  O O    . GLN B 1 19  ? -15.433 7.363   1.197   1.00 0.00 ? 19  GLN B O    20 
ATOM 9114  C CB   . GLN B 1 19  ? -17.445 6.578   3.404   1.00 0.00 ? 19  GLN B CB   20 
ATOM 9115  C CG   . GLN B 1 19  ? -17.411 8.059   3.022   1.00 0.00 ? 19  GLN B CG   20 
ATOM 9116  C CD   . GLN B 1 19  ? -17.962 8.896   4.178   1.00 0.00 ? 19  GLN B CD   20 
ATOM 9117  O OE1  . GLN B 1 19  ? -17.362 8.967   5.233   1.00 0.00 ? 19  GLN B OE1  20 
ATOM 9118  N NE2  . GLN B 1 19  ? -19.088 9.539   4.024   1.00 0.00 ? 19  GLN B NE2  20 
ATOM 9119  H H    . GLN B 1 19  ? -15.196 7.001   4.560   1.00 0.00 ? 19  GLN B H    20 
ATOM 9120  H HA   . GLN B 1 19  ? -16.239 4.836   3.052   1.00 0.00 ? 19  GLN B HA   20 
ATOM 9121  H HB2  . GLN B 1 19  ? -18.280 6.097   2.916   1.00 0.00 ? 19  GLN B HB2  20 
ATOM 9122  H HB3  . GLN B 1 19  ? -17.551 6.487   4.475   1.00 0.00 ? 19  GLN B HB3  20 
ATOM 9123  H HG2  . GLN B 1 19  ? -16.393 8.355   2.815   1.00 0.00 ? 19  GLN B HG2  20 
ATOM 9124  H HG3  . GLN B 1 19  ? -18.019 8.218   2.144   1.00 0.00 ? 19  GLN B HG3  20 
ATOM 9125  H HE21 . GLN B 1 19  ? -19.572 9.482   3.174   1.00 0.00 ? 19  GLN B HE21 20 
ATOM 9126  H HE22 . GLN B 1 19  ? -19.449 10.079  4.758   1.00 0.00 ? 19  GLN B HE22 20 
ATOM 9127  N N    . LEU B 1 20  ? -16.045 5.336   0.612   1.00 0.00 ? 20  LEU B N    20 
ATOM 9128  C CA   . LEU B 1 20  ? -15.767 5.618   -0.822  1.00 0.00 ? 20  LEU B CA   20 
ATOM 9129  C C    . LEU B 1 20  ? -16.739 4.833   -1.701  1.00 0.00 ? 20  LEU B C    20 
ATOM 9130  O O    . LEU B 1 20  ? -16.339 4.162   -2.629  1.00 0.00 ? 20  LEU B O    20 
ATOM 9131  C CB   . LEU B 1 20  ? -14.338 5.197   -1.153  1.00 0.00 ? 20  LEU B CB   20 
ATOM 9132  C CG   . LEU B 1 20  ? -13.977 5.643   -2.572  1.00 0.00 ? 20  LEU B CG   20 
ATOM 9133  C CD1  . LEU B 1 20  ? -13.877 7.168   -2.621  1.00 0.00 ? 20  LEU B CD1  20 
ATOM 9134  C CD2  . LEU B 1 20  ? -12.633 5.033   -2.967  1.00 0.00 ? 20  LEU B CD2  20 
ATOM 9135  H H    . LEU B 1 20  ? -16.372 4.453   0.884   1.00 0.00 ? 20  LEU B H    20 
ATOM 9136  H HA   . LEU B 1 20  ? -15.881 6.674   -1.008  1.00 0.00 ? 20  LEU B HA   20 
ATOM 9137  H HB2  . LEU B 1 20  ? -13.663 5.657   -0.452  1.00 0.00 ? 20  LEU B HB2  20 
ATOM 9138  H HB3  . LEU B 1 20  ? -14.253 4.123   -1.083  1.00 0.00 ? 20  LEU B HB3  20 
ATOM 9139  H HG   . LEU B 1 20  ? -14.740 5.313   -3.261  1.00 0.00 ? 20  LEU B HG   20 
ATOM 9140  H HD11 . LEU B 1 20  ? -13.735 7.551   -1.621  1.00 0.00 ? 20  LEU B HD11 20 
ATOM 9141  H HD12 . LEU B 1 20  ? -13.038 7.452   -3.238  1.00 0.00 ? 20  LEU B HD12 20 
ATOM 9142  H HD13 . LEU B 1 20  ? -14.785 7.575   -3.038  1.00 0.00 ? 20  LEU B HD13 20 
ATOM 9143  H HD21 . LEU B 1 20  ? -12.544 4.047   -2.536  1.00 0.00 ? 20  LEU B HD21 20 
ATOM 9144  H HD22 . LEU B 1 20  ? -12.574 4.962   -4.043  1.00 0.00 ? 20  LEU B HD22 20 
ATOM 9145  H HD23 . LEU B 1 20  ? -11.832 5.659   -2.603  1.00 0.00 ? 20  LEU B HD23 20 
ATOM 9146  N N    . TYR B 1 21  ? -18.011 4.904   -1.429  1.00 0.00 ? 21  TYR B N    20 
ATOM 9147  C CA   . TYR B 1 21  ? -18.969 4.149   -2.280  1.00 0.00 ? 21  TYR B CA   20 
ATOM 9148  C C    . TYR B 1 21  ? -18.646 4.440   -3.742  1.00 0.00 ? 21  TYR B C    20 
ATOM 9149  O O    . TYR B 1 21  ? -18.388 5.568   -4.116  1.00 0.00 ? 21  TYR B O    20 
ATOM 9150  C CB   . TYR B 1 21  ? -20.404 4.582   -1.991  1.00 0.00 ? 21  TYR B CB   20 
ATOM 9151  C CG   . TYR B 1 21  ? -21.328 3.835   -2.924  1.00 0.00 ? 21  TYR B CG   20 
ATOM 9152  C CD1  . TYR B 1 21  ? -21.391 4.187   -4.279  1.00 0.00 ? 21  TYR B CD1  20 
ATOM 9153  C CD2  . TYR B 1 21  ? -22.112 2.785   -2.437  1.00 0.00 ? 21  TYR B CD2  20 
ATOM 9154  C CE1  . TYR B 1 21  ? -22.240 3.488   -5.146  1.00 0.00 ? 21  TYR B CE1  20 
ATOM 9155  C CE2  . TYR B 1 21  ? -22.962 2.085   -3.303  1.00 0.00 ? 21  TYR B CE2  20 
ATOM 9156  C CZ   . TYR B 1 21  ? -23.025 2.436   -4.658  1.00 0.00 ? 21  TYR B CZ   20 
ATOM 9157  O OH   . TYR B 1 21  ? -23.863 1.746   -5.511  1.00 0.00 ? 21  TYR B OH   20 
ATOM 9158  H H    . TYR B 1 21  ? -18.330 5.448   -0.678  1.00 0.00 ? 21  TYR B H    20 
ATOM 9159  H HA   . TYR B 1 21  ? -18.864 3.090   -2.091  1.00 0.00 ? 21  TYR B HA   20 
ATOM 9160  H HB2  . TYR B 1 21  ? -20.654 4.348   -0.966  1.00 0.00 ? 21  TYR B HB2  20 
ATOM 9161  H HB3  . TYR B 1 21  ? -20.505 5.644   -2.157  1.00 0.00 ? 21  TYR B HB3  20 
ATOM 9162  H HD1  . TYR B 1 21  ? -20.785 4.999   -4.655  1.00 0.00 ? 21  TYR B HD1  20 
ATOM 9163  H HD2  . TYR B 1 21  ? -22.060 2.513   -1.393  1.00 0.00 ? 21  TYR B HD2  20 
ATOM 9164  H HE1  . TYR B 1 21  ? -22.286 3.757   -6.194  1.00 0.00 ? 21  TYR B HE1  20 
ATOM 9165  H HE2  . TYR B 1 21  ? -23.568 1.274   -2.927  1.00 0.00 ? 21  TYR B HE2  20 
ATOM 9166  H HH   . TYR B 1 21  ? -24.073 2.323   -6.249  1.00 0.00 ? 21  TYR B HH   20 
ATOM 9167  N N    . ILE B 1 22  ? -18.652 3.442   -4.574  1.00 0.00 ? 22  ILE B N    20 
ATOM 9168  C CA   . ILE B 1 22  ? -18.339 3.680   -6.007  1.00 0.00 ? 22  ILE B CA   20 
ATOM 9169  C C    . ILE B 1 22  ? -19.444 3.092   -6.881  1.00 0.00 ? 22  ILE B C    20 
ATOM 9170  O O    . ILE B 1 22  ? -19.652 1.896   -6.916  1.00 0.00 ? 22  ILE B O    20 
ATOM 9171  C CB   . ILE B 1 22  ? -17.007 3.014   -6.357  1.00 0.00 ? 22  ILE B CB   20 
ATOM 9172  C CG1  . ILE B 1 22  ? -15.904 3.573   -5.454  1.00 0.00 ? 22  ILE B CG1  20 
ATOM 9173  C CG2  . ILE B 1 22  ? -16.664 3.301   -7.818  1.00 0.00 ? 22  ILE B CG2  20 
ATOM 9174  C CD1  . ILE B 1 22  ? -14.535 3.159   -5.999  1.00 0.00 ? 22  ILE B CD1  20 
ATOM 9175  H H    . ILE B 1 22  ? -18.859 2.538   -4.259  1.00 0.00 ? 22  ILE B H    20 
ATOM 9176  H HA   . ILE B 1 22  ? -18.265 4.743   -6.186  1.00 0.00 ? 22  ILE B HA   20 
ATOM 9177  H HB   . ILE B 1 22  ? -17.090 1.946   -6.209  1.00 0.00 ? 22  ILE B HB   20 
ATOM 9178  H HG12 . ILE B 1 22  ? -15.972 4.650   -5.429  1.00 0.00 ? 22  ILE B HG12 20 
ATOM 9179  H HG13 . ILE B 1 22  ? -16.024 3.181   -4.455  1.00 0.00 ? 22  ILE B HG13 20 
ATOM 9180  H HG21 . ILE B 1 22  ? -17.576 3.410   -8.386  1.00 0.00 ? 22  ILE B HG21 20 
ATOM 9181  H HG22 . ILE B 1 22  ? -16.091 4.212   -7.880  1.00 0.00 ? 22  ILE B HG22 20 
ATOM 9182  H HG23 . ILE B 1 22  ? -16.085 2.483   -8.220  1.00 0.00 ? 22  ILE B HG23 20 
ATOM 9183  H HD11 . ILE B 1 22  ? -14.649 2.298   -6.640  1.00 0.00 ? 22  ILE B HD11 20 
ATOM 9184  H HD12 . ILE B 1 22  ? -14.112 3.976   -6.565  1.00 0.00 ? 22  ILE B HD12 20 
ATOM 9185  H HD13 . ILE B 1 22  ? -13.880 2.913   -5.177  1.00 0.00 ? 22  ILE B HD13 20 
ATOM 9186  N N    . ASP B 1 23  ? -20.145 3.921   -7.605  1.00 0.00 ? 23  ASP B N    20 
ATOM 9187  C CA   . ASP B 1 23  ? -21.219 3.400   -8.490  1.00 0.00 ? 23  ASP B CA   20 
ATOM 9188  C C    . ASP B 1 23  ? -20.576 2.958   -9.800  1.00 0.00 ? 23  ASP B C    20 
ATOM 9189  O O    . ASP B 1 23  ? -20.312 3.755   -10.670 1.00 0.00 ? 23  ASP B O    20 
ATOM 9190  C CB   . ASP B 1 23  ? -22.259 4.491   -8.748  1.00 0.00 ? 23  ASP B CB   20 
ATOM 9191  C CG   . ASP B 1 23  ? -23.209 4.044   -9.860  1.00 0.00 ? 23  ASP B CG   20 
ATOM 9192  O OD1  . ASP B 1 23  ? -23.091 2.910   -10.295 1.00 0.00 ? 23  ASP B OD1  20 
ATOM 9193  O OD2  . ASP B 1 23  ? -24.044 4.840   -10.256 1.00 0.00 ? 23  ASP B OD2  20 
ATOM 9194  H H    . ASP B 1 23  ? -19.955 4.882   -7.575  1.00 0.00 ? 23  ASP B H    20 
ATOM 9195  H HA   . ASP B 1 23  ? -21.694 2.553   -8.024  1.00 0.00 ? 23  ASP B HA   20 
ATOM 9196  H HB2  . ASP B 1 23  ? -22.821 4.670   -7.843  1.00 0.00 ? 23  ASP B HB2  20 
ATOM 9197  H HB3  . ASP B 1 23  ? -21.760 5.397   -9.043  1.00 0.00 ? 23  ASP B HB3  20 
ATOM 9198  N N    . PHE B 1 24  ? -20.308 1.683   -9.903  1.00 0.00 ? 24  PHE B N    20 
ATOM 9199  C CA   . PHE B 1 24  ? -19.652 1.092   -11.116 1.00 0.00 ? 24  PHE B CA   20 
ATOM 9200  C C    . PHE B 1 24  ? -19.610 2.066   -12.297 1.00 0.00 ? 24  PHE B C    20 
ATOM 9201  O O    . PHE B 1 24  ? -18.557 2.357   -12.830 1.00 0.00 ? 24  PHE B O    20 
ATOM 9202  C CB   . PHE B 1 24  ? -20.424 -0.160  -11.537 1.00 0.00 ? 24  PHE B CB   20 
ATOM 9203  C CG   . PHE B 1 24  ? -19.873 -1.358  -10.806 1.00 0.00 ? 24  PHE B CG   20 
ATOM 9204  C CD1  . PHE B 1 24  ? -18.581 -1.815  -11.087 1.00 0.00 ? 24  PHE B CD1  20 
ATOM 9205  C CD2  . PHE B 1 24  ? -20.649 -2.007  -9.840  1.00 0.00 ? 24  PHE B CD2  20 
ATOM 9206  C CE1  . PHE B 1 24  ? -18.065 -2.920  -10.403 1.00 0.00 ? 24  PHE B CE1  20 
ATOM 9207  C CE2  . PHE B 1 24  ? -20.135 -3.114  -9.159  1.00 0.00 ? 24  PHE B CE2  20 
ATOM 9208  C CZ   . PHE B 1 24  ? -18.843 -3.571  -9.440  1.00 0.00 ? 24  PHE B CZ   20 
ATOM 9209  H H    . PHE B 1 24  ? -20.530 1.093   -9.151  1.00 0.00 ? 24  PHE B H    20 
ATOM 9210  H HA   . PHE B 1 24  ? -18.643 0.805   -10.863 1.00 0.00 ? 24  PHE B HA   20 
ATOM 9211  H HB2  . PHE B 1 24  ? -21.469 -0.037  -11.292 1.00 0.00 ? 24  PHE B HB2  20 
ATOM 9212  H HB3  . PHE B 1 24  ? -20.319 -0.308  -12.601 1.00 0.00 ? 24  PHE B HB3  20 
ATOM 9213  H HD1  . PHE B 1 24  ? -17.984 -1.316  -11.834 1.00 0.00 ? 24  PHE B HD1  20 
ATOM 9214  H HD2  . PHE B 1 24  ? -21.645 -1.653  -9.622  1.00 0.00 ? 24  PHE B HD2  20 
ATOM 9215  H HE1  . PHE B 1 24  ? -17.068 -3.273  -10.621 1.00 0.00 ? 24  PHE B HE1  20 
ATOM 9216  H HE2  . PHE B 1 24  ? -20.735 -3.619  -8.419  1.00 0.00 ? 24  PHE B HE2  20 
ATOM 9217  H HZ   . PHE B 1 24  ? -18.446 -4.424  -8.911  1.00 0.00 ? 24  PHE B HZ   20 
ATOM 9218  N N    . ARG B 1 25  ? -20.741 2.549   -12.735 1.00 0.00 ? 25  ARG B N    20 
ATOM 9219  C CA   . ARG B 1 25  ? -20.749 3.466   -13.912 1.00 0.00 ? 25  ARG B CA   20 
ATOM 9220  C C    . ARG B 1 25  ? -20.579 4.934   -13.498 1.00 0.00 ? 25  ARG B C    20 
ATOM 9221  O O    . ARG B 1 25  ? -19.944 5.703   -14.190 1.00 0.00 ? 25  ARG B O    20 
ATOM 9222  C CB   . ARG B 1 25  ? -22.075 3.307   -14.659 1.00 0.00 ? 25  ARG B CB   20 
ATOM 9223  C CG   . ARG B 1 25  ? -21.835 3.464   -16.161 1.00 0.00 ? 25  ARG B CG   20 
ATOM 9224  C CD   . ARG B 1 25  ? -23.142 3.222   -16.916 1.00 0.00 ? 25  ARG B CD   20 
ATOM 9225  N NE   . ARG B 1 25  ? -23.504 4.448   -17.681 1.00 0.00 ? 25  ARG B NE   20 
ATOM 9226  C CZ   . ARG B 1 25  ? -24.024 4.352   -18.875 1.00 0.00 ? 25  ARG B CZ   20 
ATOM 9227  N NH1  . ARG B 1 25  ? -23.631 3.408   -19.688 1.00 0.00 ? 25  ARG B NH1  20 
ATOM 9228  N NH2  . ARG B 1 25  ? -24.933 5.204   -19.259 1.00 0.00 ? 25  ARG B NH2  20 
ATOM 9229  H H    . ARG B 1 25  ? -21.583 2.288   -12.309 1.00 0.00 ? 25  ARG B H    20 
ATOM 9230  H HA   . ARG B 1 25  ? -19.944 3.189   -14.572 1.00 0.00 ? 25  ARG B HA   20 
ATOM 9231  H HB2  . ARG B 1 25  ? -22.486 2.328   -14.458 1.00 0.00 ? 25  ARG B HB2  20 
ATOM 9232  H HB3  . ARG B 1 25  ? -22.768 4.065   -14.327 1.00 0.00 ? 25  ARG B HB3  20 
ATOM 9233  H HG2  . ARG B 1 25  ? -21.477 4.462   -16.367 1.00 0.00 ? 25  ARG B HG2  20 
ATOM 9234  H HG3  . ARG B 1 25  ? -21.097 2.744   -16.484 1.00 0.00 ? 25  ARG B HG3  20 
ATOM 9235  H HD2  . ARG B 1 25  ? -23.018 2.393   -17.596 1.00 0.00 ? 25  ARG B HD2  20 
ATOM 9236  H HD3  . ARG B 1 25  ? -23.928 2.994   -16.211 1.00 0.00 ? 25  ARG B HD3  20 
ATOM 9237  H HE   . ARG B 1 25  ? -23.349 5.333   -17.287 1.00 0.00 ? 25  ARG B HE   20 
ATOM 9238  H HH11 . ARG B 1 25  ? -22.929 2.758   -19.401 1.00 0.00 ? 25  ARG B HH11 20 
ATOM 9239  H HH12 . ARG B 1 25  ? -24.034 3.337   -20.602 1.00 0.00 ? 25  ARG B HH12 20 
ATOM 9240  H HH21 . ARG B 1 25  ? -25.230 5.932   -18.639 1.00 0.00 ? 25  ARG B HH21 20 
ATOM 9241  H HH22 . ARG B 1 25  ? -25.332 5.132   -20.173 1.00 0.00 ? 25  ARG B HH22 20 
ATOM 9242  N N    . LYS B 1 26  ? -21.155 5.346   -12.404 1.00 0.00 ? 26  LYS B N    20 
ATOM 9243  C CA   . LYS B 1 26  ? -21.028 6.781   -12.006 1.00 0.00 ? 26  LYS B CA   20 
ATOM 9244  C C    . LYS B 1 26  ? -19.561 7.141   -11.775 1.00 0.00 ? 26  LYS B C    20 
ATOM 9245  O O    . LYS B 1 26  ? -19.076 8.153   -12.242 1.00 0.00 ? 26  LYS B O    20 
ATOM 9246  C CB   . LYS B 1 26  ? -21.794 7.021   -10.709 1.00 0.00 ? 26  LYS B CB   20 
ATOM 9247  C CG   . LYS B 1 26  ? -22.350 8.446   -10.699 1.00 0.00 ? 26  LYS B CG   20 
ATOM 9248  C CD   . LYS B 1 26  ? -21.663 9.256   -9.598  1.00 0.00 ? 26  LYS B CD   20 
ATOM 9249  C CE   . LYS B 1 26  ? -21.795 10.750  -9.904  1.00 0.00 ? 26  LYS B CE   20 
ATOM 9250  N NZ   . LYS B 1 26  ? -21.911 11.511  -8.629  1.00 0.00 ? 26  LYS B NZ   20 
ATOM 9251  H H    . LYS B 1 26  ? -21.686 4.726   -11.857 1.00 0.00 ? 26  LYS B H    20 
ATOM 9252  H HA   . LYS B 1 26  ? -21.436 7.409   -12.784 1.00 0.00 ? 26  LYS B HA   20 
ATOM 9253  H HB2  . LYS B 1 26  ? -22.599 6.311   -10.630 1.00 0.00 ? 26  LYS B HB2  20 
ATOM 9254  H HB3  . LYS B 1 26  ? -21.123 6.897   -9.873  1.00 0.00 ? 26  LYS B HB3  20 
ATOM 9255  H HG2  . LYS B 1 26  ? -22.166 8.910   -11.657 1.00 0.00 ? 26  LYS B HG2  20 
ATOM 9256  H HG3  . LYS B 1 26  ? -23.413 8.417   -10.511 1.00 0.00 ? 26  LYS B HG3  20 
ATOM 9257  H HD2  . LYS B 1 26  ? -22.131 9.040   -8.647  1.00 0.00 ? 26  LYS B HD2  20 
ATOM 9258  H HD3  . LYS B 1 26  ? -20.618 8.991   -9.553  1.00 0.00 ? 26  LYS B HD3  20 
ATOM 9259  H HE2  . LYS B 1 26  ? -20.923 11.084  -10.446 1.00 0.00 ? 26  LYS B HE2  20 
ATOM 9260  H HE3  . LYS B 1 26  ? -22.677 10.917  -10.505 1.00 0.00 ? 26  LYS B HE3  20 
ATOM 9261  H HZ1  . LYS B 1 26  ? -22.659 11.093  -8.042  1.00 0.00 ? 26  LYS B HZ1  20 
ATOM 9262  H HZ2  . LYS B 1 26  ? -21.007 11.469  -8.116  1.00 0.00 ? 26  LYS B HZ2  20 
ATOM 9263  H HZ3  . LYS B 1 26  ? -22.146 12.503  -8.838  1.00 0.00 ? 26  LYS B HZ3  20 
ATOM 9264  N N    . ASP B 1 27  ? -18.863 6.339   -11.027 1.00 0.00 ? 27  ASP B N    20 
ATOM 9265  C CA   . ASP B 1 27  ? -17.441 6.641   -10.720 1.00 0.00 ? 27  ASP B CA   20 
ATOM 9266  C C    . ASP B 1 27  ? -16.499 6.042   -11.772 1.00 0.00 ? 27  ASP B C    20 
ATOM 9267  O O    . ASP B 1 27  ? -15.750 6.751   -12.414 1.00 0.00 ? 27  ASP B O    20 
ATOM 9268  C CB   . ASP B 1 27  ? -17.115 6.048   -9.355  1.00 0.00 ? 27  ASP B CB   20 
ATOM 9269  C CG   . ASP B 1 27  ? -17.381 7.089   -8.266  1.00 0.00 ? 27  ASP B CG   20 
ATOM 9270  O OD1  . ASP B 1 27  ? -16.674 8.083   -8.239  1.00 0.00 ? 27  ASP B OD1  20 
ATOM 9271  O OD2  . ASP B 1 27  ? -18.285 6.873   -7.477  1.00 0.00 ? 27  ASP B OD2  20 
ATOM 9272  H H    . ASP B 1 27  ? -19.285 5.547   -10.637 1.00 0.00 ? 27  ASP B H    20 
ATOM 9273  H HA   . ASP B 1 27  ? -17.303 7.711   -10.683 1.00 0.00 ? 27  ASP B HA   20 
ATOM 9274  H HB2  . ASP B 1 27  ? -17.738 5.181   -9.184  1.00 0.00 ? 27  ASP B HB2  20 
ATOM 9275  H HB3  . ASP B 1 27  ? -16.085 5.756   -9.333  1.00 0.00 ? 27  ASP B HB3  20 
ATOM 9276  N N    . LEU B 1 28  ? -16.501 4.748   -11.933 1.00 0.00 ? 28  LEU B N    20 
ATOM 9277  C CA   . LEU B 1 28  ? -15.569 4.124   -12.921 1.00 0.00 ? 28  LEU B CA   20 
ATOM 9278  C C    . LEU B 1 28  ? -16.207 4.063   -14.309 1.00 0.00 ? 28  LEU B C    20 
ATOM 9279  O O    . LEU B 1 28  ? -15.538 3.809   -15.292 1.00 0.00 ? 28  LEU B O    20 
ATOM 9280  C CB   . LEU B 1 28  ? -15.234 2.701   -12.471 1.00 0.00 ? 28  LEU B CB   20 
ATOM 9281  C CG   . LEU B 1 28  ? -14.739 2.728   -11.027 1.00 0.00 ? 28  LEU B CG   20 
ATOM 9282  C CD1  . LEU B 1 28  ? -14.210 1.345   -10.642 1.00 0.00 ? 28  LEU B CD1  20 
ATOM 9283  C CD2  . LEU B 1 28  ? -13.615 3.756   -10.899 1.00 0.00 ? 28  LEU B CD2  20 
ATOM 9284  H H    . LEU B 1 28  ? -17.091 4.185   -11.386 1.00 0.00 ? 28  LEU B H    20 
ATOM 9285  H HA   . LEU B 1 28  ? -14.659 4.702   -12.972 1.00 0.00 ? 28  LEU B HA   20 
ATOM 9286  H HB2  . LEU B 1 28  ? -16.119 2.084   -12.538 1.00 0.00 ? 28  LEU B HB2  20 
ATOM 9287  H HB3  . LEU B 1 28  ? -14.463 2.294   -13.107 1.00 0.00 ? 28  LEU B HB3  20 
ATOM 9288  H HG   . LEU B 1 28  ? -15.556 2.999   -10.373 1.00 0.00 ? 28  LEU B HG   20 
ATOM 9289  H HD11 . LEU B 1 28  ? -14.294 0.679   -11.488 1.00 0.00 ? 28  LEU B HD11 20 
ATOM 9290  H HD12 . LEU B 1 28  ? -13.174 1.426   -10.349 1.00 0.00 ? 28  LEU B HD12 20 
ATOM 9291  H HD13 . LEU B 1 28  ? -14.787 0.955   -9.818  1.00 0.00 ? 28  LEU B HD13 20 
ATOM 9292  H HD21 . LEU B 1 28  ? -13.983 4.730   -11.186 1.00 0.00 ? 28  LEU B HD21 20 
ATOM 9293  H HD22 . LEU B 1 28  ? -13.270 3.787   -9.877  1.00 0.00 ? 28  LEU B HD22 20 
ATOM 9294  H HD23 . LEU B 1 28  ? -12.799 3.477   -11.546 1.00 0.00 ? 28  LEU B HD23 20 
ATOM 9295  N N    . GLY B 1 29  ? -17.487 4.279   -14.412 1.00 0.00 ? 29  GLY B N    20 
ATOM 9296  C CA   . GLY B 1 29  ? -18.129 4.212   -15.756 1.00 0.00 ? 29  GLY B CA   20 
ATOM 9297  C C    . GLY B 1 29  ? -17.934 2.805   -16.326 1.00 0.00 ? 29  GLY B C    20 
ATOM 9298  O O    . GLY B 1 29  ? -18.113 2.568   -17.504 1.00 0.00 ? 29  GLY B O    20 
ATOM 9299  H H    . GLY B 1 29  ? -18.021 4.475   -13.614 1.00 0.00 ? 29  GLY B H    20 
ATOM 9300  H HA2  . GLY B 1 29  ? -19.183 4.431   -15.669 1.00 0.00 ? 29  GLY B HA2  20 
ATOM 9301  H HA3  . GLY B 1 29  ? -17.665 4.930   -16.414 1.00 0.00 ? 29  GLY B HA3  20 
ATOM 9302  N N    . TRP B 1 30  ? -17.561 1.872   -15.491 1.00 0.00 ? 30  TRP B N    20 
ATOM 9303  C CA   . TRP B 1 30  ? -17.340 0.477   -15.962 1.00 0.00 ? 30  TRP B CA   20 
ATOM 9304  C C    . TRP B 1 30  ? -18.479 0.049   -16.885 1.00 0.00 ? 30  TRP B C    20 
ATOM 9305  O O    . TRP B 1 30  ? -19.642 0.229   -16.583 1.00 0.00 ? 30  TRP B O    20 
ATOM 9306  C CB   . TRP B 1 30  ? -17.283 -0.458  -14.755 1.00 0.00 ? 30  TRP B CB   20 
ATOM 9307  C CG   . TRP B 1 30  ? -15.881 -0.516  -14.243 1.00 0.00 ? 30  TRP B CG   20 
ATOM 9308  C CD1  . TRP B 1 30  ? -14.888 0.333   -14.598 1.00 0.00 ? 30  TRP B CD1  20 
ATOM 9309  C CD2  . TRP B 1 30  ? -15.298 -1.453  -13.295 1.00 0.00 ? 30  TRP B CD2  20 
ATOM 9310  N NE1  . TRP B 1 30  ? -13.733 -0.026  -13.928 1.00 0.00 ? 30  TRP B NE1  20 
ATOM 9311  C CE2  . TRP B 1 30  ? -13.935 -1.123  -13.114 1.00 0.00 ? 30  TRP B CE2  20 
ATOM 9312  C CE3  . TRP B 1 30  ? -15.816 -2.550  -12.582 1.00 0.00 ? 30  TRP B CE3  20 
ATOM 9313  C CZ2  . TRP B 1 30  ? -13.113 -1.852  -12.256 1.00 0.00 ? 30  TRP B CZ2  20 
ATOM 9314  C CZ3  . TRP B 1 30  ? -14.990 -3.287  -11.719 1.00 0.00 ? 30  TRP B CZ3  20 
ATOM 9315  C CH2  . TRP B 1 30  ? -13.642 -2.939  -11.556 1.00 0.00 ? 30  TRP B CH2  20 
ATOM 9316  H H    . TRP B 1 30  ? -17.418 2.091   -14.549 1.00 0.00 ? 30  TRP B H    20 
ATOM 9317  H HA   . TRP B 1 30  ? -16.404 0.422   -16.499 1.00 0.00 ? 30  TRP B HA   20 
ATOM 9318  H HB2  . TRP B 1 30  ? -17.936 -0.085  -13.979 1.00 0.00 ? 30  TRP B HB2  20 
ATOM 9319  H HB3  . TRP B 1 30  ? -17.600 -1.447  -15.049 1.00 0.00 ? 30  TRP B HB3  20 
ATOM 9320  H HD1  . TRP B 1 30  ? -14.982 1.157   -15.291 1.00 0.00 ? 30  TRP B HD1  20 
ATOM 9321  H HE1  . TRP B 1 30  ? -12.868 0.428   -14.009 1.00 0.00 ? 30  TRP B HE1  20 
ATOM 9322  H HE3  . TRP B 1 30  ? -16.855 -2.828  -12.701 1.00 0.00 ? 30  TRP B HE3  20 
ATOM 9323  H HZ2  . TRP B 1 30  ? -12.075 -1.580  -12.134 1.00 0.00 ? 30  TRP B HZ2  20 
ATOM 9324  H HZ3  . TRP B 1 30  ? -15.394 -4.128  -11.178 1.00 0.00 ? 30  TRP B HZ3  20 
ATOM 9325  H HH2  . TRP B 1 30  ? -13.013 -3.511  -10.890 1.00 0.00 ? 30  TRP B HH2  20 
ATOM 9326  N N    . LYS B 1 31  ? -18.147 -0.513  -18.012 1.00 0.00 ? 31  LYS B N    20 
ATOM 9327  C CA   . LYS B 1 31  ? -19.184 -0.955  -18.968 1.00 0.00 ? 31  LYS B CA   20 
ATOM 9328  C C    . LYS B 1 31  ? -19.185 -2.481  -19.049 1.00 0.00 ? 31  LYS B C    20 
ATOM 9329  O O    . LYS B 1 31  ? -20.071 -3.081  -19.626 1.00 0.00 ? 31  LYS B O    20 
ATOM 9330  C CB   . LYS B 1 31  ? -18.842 -0.381  -20.334 1.00 0.00 ? 31  LYS B CB   20 
ATOM 9331  C CG   . LYS B 1 31  ? -19.517 0.980   -20.508 1.00 0.00 ? 31  LYS B CG   20 
ATOM 9332  C CD   . LYS B 1 31  ? -19.744 1.250   -21.995 1.00 0.00 ? 31  LYS B CD   20 
ATOM 9333  C CE   . LYS B 1 31  ? -21.042 0.575   -22.443 1.00 0.00 ? 31  LYS B CE   20 
ATOM 9334  N NZ   . LYS B 1 31  ? -22.169 1.543   -22.331 1.00 0.00 ? 31  LYS B NZ   20 
ATOM 9335  H H    . LYS B 1 31  ? -17.205 -0.643  -18.238 1.00 0.00 ? 31  LYS B H    20 
ATOM 9336  H HA   . LYS B 1 31  ? -20.153 -0.600  -18.653 1.00 0.00 ? 31  LYS B HA   20 
ATOM 9337  H HB2  . LYS B 1 31  ? -17.770 -0.265  -20.411 1.00 0.00 ? 31  LYS B HB2  20 
ATOM 9338  H HB3  . LYS B 1 31  ? -19.181 -1.054  -21.096 1.00 0.00 ? 31  LYS B HB3  20 
ATOM 9339  H HG2  . LYS B 1 31  ? -20.467 0.978   -19.992 1.00 0.00 ? 31  LYS B HG2  20 
ATOM 9340  H HG3  . LYS B 1 31  ? -18.884 1.751   -20.097 1.00 0.00 ? 31  LYS B HG3  20 
ATOM 9341  H HD2  . LYS B 1 31  ? -19.816 2.316   -22.160 1.00 0.00 ? 31  LYS B HD2  20 
ATOM 9342  H HD3  . LYS B 1 31  ? -18.918 0.852   -22.565 1.00 0.00 ? 31  LYS B HD3  20 
ATOM 9343  H HE2  . LYS B 1 31  ? -20.945 0.252   -23.469 1.00 0.00 ? 31  LYS B HE2  20 
ATOM 9344  H HE3  . LYS B 1 31  ? -21.238 -0.280  -21.814 1.00 0.00 ? 31  LYS B HE3  20 
ATOM 9345  H HZ1  . LYS B 1 31  ? -21.838 2.408   -21.859 1.00 0.00 ? 31  LYS B HZ1  20 
ATOM 9346  H HZ2  . LYS B 1 31  ? -22.519 1.779   -23.282 1.00 0.00 ? 31  LYS B HZ2  20 
ATOM 9347  H HZ3  . LYS B 1 31  ? -22.936 1.119   -21.773 1.00 0.00 ? 31  LYS B HZ3  20 
ATOM 9348  N N    . TRP B 1 32  ? -18.192 -3.115  -18.489 1.00 0.00 ? 32  TRP B N    20 
ATOM 9349  C CA   . TRP B 1 32  ? -18.132 -4.601  -18.551 1.00 0.00 ? 32  TRP B CA   20 
ATOM 9350  C C    . TRP B 1 32  ? -18.923 -5.207  -17.395 1.00 0.00 ? 32  TRP B C    20 
ATOM 9351  O O    . TRP B 1 32  ? -19.051 -6.407  -17.287 1.00 0.00 ? 32  TRP B O    20 
ATOM 9352  C CB   . TRP B 1 32  ? -16.675 -5.062  -18.474 1.00 0.00 ? 32  TRP B CB   20 
ATOM 9353  C CG   . TRP B 1 32  ? -16.164 -4.935  -17.072 1.00 0.00 ? 32  TRP B CG   20 
ATOM 9354  C CD1  . TRP B 1 32  ? -15.761 -3.782  -16.490 1.00 0.00 ? 32  TRP B CD1  20 
ATOM 9355  C CD2  . TRP B 1 32  ? -15.992 -5.978  -16.066 1.00 0.00 ? 32  TRP B CD2  20 
ATOM 9356  N NE1  . TRP B 1 32  ? -15.337 -4.052  -15.205 1.00 0.00 ? 32  TRP B NE1  20 
ATOM 9357  C CE2  . TRP B 1 32  ? -15.463 -5.390  -14.894 1.00 0.00 ? 32  TRP B CE2  20 
ATOM 9358  C CE3  . TRP B 1 32  ? -16.237 -7.360  -16.060 1.00 0.00 ? 32  TRP B CE3  20 
ATOM 9359  C CZ2  . TRP B 1 32  ? -15.185 -6.147  -13.757 1.00 0.00 ? 32  TRP B CZ2  20 
ATOM 9360  C CZ3  . TRP B 1 32  ? -15.963 -8.129  -14.916 1.00 0.00 ? 32  TRP B CZ3  20 
ATOM 9361  C CH2  . TRP B 1 32  ? -15.435 -7.521  -13.766 1.00 0.00 ? 32  TRP B CH2  20 
ATOM 9362  H H    . TRP B 1 32  ? -17.481 -2.612  -18.036 1.00 0.00 ? 32  TRP B H    20 
ATOM 9363  H HA   . TRP B 1 32  ? -18.560 -4.932  -19.483 1.00 0.00 ? 32  TRP B HA   20 
ATOM 9364  H HB2  . TRP B 1 32  ? -16.609 -6.094  -18.785 1.00 0.00 ? 32  TRP B HB2  20 
ATOM 9365  H HB3  . TRP B 1 32  ? -16.072 -4.453  -19.131 1.00 0.00 ? 32  TRP B HB3  20 
ATOM 9366  H HD1  . TRP B 1 32  ? -15.766 -2.812  -16.954 1.00 0.00 ? 32  TRP B HD1  20 
ATOM 9367  H HE1  . TRP B 1 32  ? -14.990 -3.388  -14.578 1.00 0.00 ? 32  TRP B HE1  20 
ATOM 9368  H HE3  . TRP B 1 32  ? -16.648 -7.833  -16.935 1.00 0.00 ? 32  TRP B HE3  20 
ATOM 9369  H HZ2  . TRP B 1 32  ? -14.779 -5.675  -12.874 1.00 0.00 ? 32  TRP B HZ2  20 
ATOM 9370  H HZ3  . TRP B 1 32  ? -16.158 -9.193  -14.924 1.00 0.00 ? 32  TRP B HZ3  20 
ATOM 9371  H HH2  . TRP B 1 32  ? -15.226 -8.113  -12.889 1.00 0.00 ? 32  TRP B HH2  20 
ATOM 9372  N N    . ILE B 1 33  ? -19.455 -4.392  -16.529 1.00 0.00 ? 33  ILE B N    20 
ATOM 9373  C CA   . ILE B 1 33  ? -20.231 -4.939  -15.383 1.00 0.00 ? 33  ILE B CA   20 
ATOM 9374  C C    . ILE B 1 33  ? -21.644 -4.345  -15.385 1.00 0.00 ? 33  ILE B C    20 
ATOM 9375  O O    . ILE B 1 33  ? -21.831 -3.152  -15.504 1.00 0.00 ? 33  ILE B O    20 
ATOM 9376  C CB   . ILE B 1 33  ? -19.511 -4.597  -14.072 1.00 0.00 ? 33  ILE B CB   20 
ATOM 9377  C CG1  . ILE B 1 33  ? -18.426 -5.640  -13.818 1.00 0.00 ? 33  ILE B CG1  20 
ATOM 9378  C CG2  . ILE B 1 33  ? -20.498 -4.607  -12.901 1.00 0.00 ? 33  ILE B CG2  20 
ATOM 9379  C CD1  . ILE B 1 33  ? -17.600 -5.237  -12.602 1.00 0.00 ? 33  ILE B CD1  20 
ATOM 9380  H H    . ILE B 1 33  ? -19.340 -3.424  -16.629 1.00 0.00 ? 33  ILE B H    20 
ATOM 9381  H HA   . ILE B 1 33  ? -20.297 -6.013  -15.482 1.00 0.00 ? 33  ILE B HA   20 
ATOM 9382  H HB   . ILE B 1 33  ? -19.059 -3.619  -14.154 1.00 0.00 ? 33  ILE B HB   20 
ATOM 9383  H HG12 . ILE B 1 33  ? -18.885 -6.596  -13.639 1.00 0.00 ? 33  ILE B HG12 20 
ATOM 9384  H HG13 . ILE B 1 33  ? -17.786 -5.704  -14.681 1.00 0.00 ? 33  ILE B HG13 20 
ATOM 9385  H HG21 . ILE B 1 33  ? -21.378 -5.167  -13.179 1.00 0.00 ? 33  ILE B HG21 20 
ATOM 9386  H HG22 . ILE B 1 33  ? -20.033 -5.068  -12.043 1.00 0.00 ? 33  ILE B HG22 20 
ATOM 9387  H HG23 . ILE B 1 33  ? -20.779 -3.593  -12.659 1.00 0.00 ? 33  ILE B HG23 20 
ATOM 9388  H HD11 . ILE B 1 33  ? -18.212 -4.658  -11.930 1.00 0.00 ? 33  ILE B HD11 20 
ATOM 9389  H HD12 . ILE B 1 33  ? -17.248 -6.124  -12.096 1.00 0.00 ? 33  ILE B HD12 20 
ATOM 9390  H HD13 . ILE B 1 33  ? -16.757 -4.647  -12.920 1.00 0.00 ? 33  ILE B HD13 20 
ATOM 9391  N N    . HIS B 1 34  ? -22.633 -5.182  -15.244 1.00 0.00 ? 34  HIS B N    20 
ATOM 9392  C CA   . HIS B 1 34  ? -24.039 -4.691  -15.225 1.00 0.00 ? 34  HIS B CA   20 
ATOM 9393  C C    . HIS B 1 34  ? -24.489 -4.513  -13.772 1.00 0.00 ? 34  HIS B C    20 
ATOM 9394  O O    . HIS B 1 34  ? -24.961 -3.463  -13.382 1.00 0.00 ? 34  HIS B O    20 
ATOM 9395  C CB   . HIS B 1 34  ? -24.937 -5.716  -15.923 1.00 0.00 ? 34  HIS B CB   20 
ATOM 9396  C CG   . HIS B 1 34  ? -26.381 -5.409  -15.637 1.00 0.00 ? 34  HIS B CG   20 
ATOM 9397  N ND1  . HIS B 1 34  ? -26.921 -4.146  -15.825 1.00 0.00 ? 34  HIS B ND1  20 
ATOM 9398  C CD2  . HIS B 1 34  ? -27.411 -6.193  -15.180 1.00 0.00 ? 34  HIS B CD2  20 
ATOM 9399  C CE1  . HIS B 1 34  ? -28.222 -4.207  -15.486 1.00 0.00 ? 34  HIS B CE1  20 
ATOM 9400  N NE2  . HIS B 1 34  ? -28.573 -5.432  -15.086 1.00 0.00 ? 34  HIS B NE2  20 
ATOM 9401  H H    . HIS B 1 34  ? -22.449 -6.138  -15.146 1.00 0.00 ? 34  HIS B H    20 
ATOM 9402  H HA   . HIS B 1 34  ? -24.099 -3.745  -15.742 1.00 0.00 ? 34  HIS B HA   20 
ATOM 9403  H HB2  . HIS B 1 34  ? -24.766 -5.675  -16.989 1.00 0.00 ? 34  HIS B HB2  20 
ATOM 9404  H HB3  . HIS B 1 34  ? -24.703 -6.705  -15.560 1.00 0.00 ? 34  HIS B HB3  20 
ATOM 9405  H HD1  . HIS B 1 34  ? -26.443 -3.353  -16.145 1.00 0.00 ? 34  HIS B HD1  20 
ATOM 9406  H HD2  . HIS B 1 34  ? -27.330 -7.241  -14.929 1.00 0.00 ? 34  HIS B HD2  20 
ATOM 9407  H HE1  . HIS B 1 34  ? -28.900 -3.368  -15.533 1.00 0.00 ? 34  HIS B HE1  20 
ATOM 9408  N N    . GLU B 1 35  ? -24.340 -5.530  -12.966 1.00 0.00 ? 35  GLU B N    20 
ATOM 9409  C CA   . GLU B 1 35  ? -24.752 -5.419  -11.537 1.00 0.00 ? 35  GLU B CA   20 
ATOM 9410  C C    . GLU B 1 35  ? -23.586 -5.850  -10.640 1.00 0.00 ? 35  GLU B C    20 
ATOM 9411  O O    . GLU B 1 35  ? -22.745 -6.623  -11.051 1.00 0.00 ? 35  GLU B O    20 
ATOM 9412  C CB   . GLU B 1 35  ? -25.954 -6.330  -11.275 1.00 0.00 ? 35  GLU B CB   20 
ATOM 9413  C CG   . GLU B 1 35  ? -26.972 -6.179  -12.408 1.00 0.00 ? 35  GLU B CG   20 
ATOM 9414  C CD   . GLU B 1 35  ? -28.375 -6.031  -11.816 1.00 0.00 ? 35  GLU B CD   20 
ATOM 9415  O OE1  . GLU B 1 35  ? -28.650 -4.988  -11.249 1.00 0.00 ? 35  GLU B OE1  20 
ATOM 9416  O OE2  . GLU B 1 35  ? -29.150 -6.965  -11.942 1.00 0.00 ? 35  GLU B OE2  20 
ATOM 9417  H H    . GLU B 1 35  ? -23.953 -6.367  -13.300 1.00 0.00 ? 35  GLU B H    20 
ATOM 9418  H HA   . GLU B 1 35  ? -25.019 -4.397  -11.316 1.00 0.00 ? 35  GLU B HA   20 
ATOM 9419  H HB2  . GLU B 1 35  ? -25.622 -7.357  -11.224 1.00 0.00 ? 35  GLU B HB2  20 
ATOM 9420  H HB3  . GLU B 1 35  ? -26.417 -6.054  -10.339 1.00 0.00 ? 35  GLU B HB3  20 
ATOM 9421  H HG2  . GLU B 1 35  ? -26.731 -5.303  -12.992 1.00 0.00 ? 35  GLU B HG2  20 
ATOM 9422  H HG3  . GLU B 1 35  ? -26.940 -7.054  -13.040 1.00 0.00 ? 35  GLU B HG3  20 
ATOM 9423  N N    . PRO B 1 36  ? -23.575 -5.335  -9.438  1.00 0.00 ? 36  PRO B N    20 
ATOM 9424  C CA   . PRO B 1 36  ? -24.602 -4.397  -8.950  1.00 0.00 ? 36  PRO B CA   20 
ATOM 9425  C C    . PRO B 1 36  ? -24.341 -2.993  -9.496  1.00 0.00 ? 36  PRO B C    20 
ATOM 9426  O O    . PRO B 1 36  ? -23.349 -2.747  -10.151 1.00 0.00 ? 36  PRO B O    20 
ATOM 9427  C CB   . PRO B 1 36  ? -24.425 -4.432  -7.430  1.00 0.00 ? 36  PRO B CB   20 
ATOM 9428  C CG   . PRO B 1 36  ? -22.980 -4.922  -7.170  1.00 0.00 ? 36  PRO B CG   20 
ATOM 9429  C CD   . PRO B 1 36  ? -22.524 -5.649  -8.450  1.00 0.00 ? 36  PRO B CD   20 
ATOM 9430  H HA   . PRO B 1 36  ? -25.589 -4.733  -9.215  1.00 0.00 ? 36  PRO B HA   20 
ATOM 9431  H HB2  . PRO B 1 36  ? -24.564 -3.441  -7.019  1.00 0.00 ? 36  PRO B HB2  20 
ATOM 9432  H HB3  . PRO B 1 36  ? -25.127 -5.121  -6.988  1.00 0.00 ? 36  PRO B HB3  20 
ATOM 9433  H HG2  . PRO B 1 36  ? -22.334 -4.078  -6.970  1.00 0.00 ? 36  PRO B HG2  20 
ATOM 9434  H HG3  . PRO B 1 36  ? -22.965 -5.609  -6.337  1.00 0.00 ? 36  PRO B HG3  20 
ATOM 9435  H HD2  . PRO B 1 36  ? -21.567 -5.268  -8.779  1.00 0.00 ? 36  PRO B HD2  20 
ATOM 9436  H HD3  . PRO B 1 36  ? -22.475 -6.714  -8.284  1.00 0.00 ? 36  PRO B HD3  20 
ATOM 9437  N N    . LYS B 1 37  ? -25.220 -2.071  -9.225  1.00 0.00 ? 37  LYS B N    20 
ATOM 9438  C CA   . LYS B 1 37  ? -25.024 -0.687  -9.713  1.00 0.00 ? 37  LYS B CA   20 
ATOM 9439  C C    . LYS B 1 37  ? -23.752 -0.112  -9.095  1.00 0.00 ? 37  LYS B C    20 
ATOM 9440  O O    . LYS B 1 37  ? -23.028 0.640   -9.716  1.00 0.00 ? 37  LYS B O    20 
ATOM 9441  C CB   . LYS B 1 37  ? -26.222 0.148   -9.279  1.00 0.00 ? 37  LYS B CB   20 
ATOM 9442  C CG   . LYS B 1 37  ? -27.296 0.116   -10.369 1.00 0.00 ? 37  LYS B CG   20 
ATOM 9443  C CD   . LYS B 1 37  ? -28.505 0.939   -9.921  1.00 0.00 ? 37  LYS B CD   20 
ATOM 9444  C CE   . LYS B 1 37  ? -29.766 0.075   -9.992  1.00 0.00 ? 37  LYS B CE   20 
ATOM 9445  N NZ   . LYS B 1 37  ? -30.689 0.626   -11.024 1.00 0.00 ? 37  LYS B NZ   20 
ATOM 9446  H H    . LYS B 1 37  ? -26.009 -2.284  -8.690  1.00 0.00 ? 37  LYS B H    20 
ATOM 9447  H HA   . LYS B 1 37  ? -24.947 -0.683  -10.790 1.00 0.00 ? 37  LYS B HA   20 
ATOM 9448  H HB2  . LYS B 1 37  ? -26.626 -0.261  -8.363  1.00 0.00 ? 37  LYS B HB2  20 
ATOM 9449  H HB3  . LYS B 1 37  ? -25.908 1.157   -9.109  1.00 0.00 ? 37  LYS B HB3  20 
ATOM 9450  H HG2  . LYS B 1 37  ? -26.893 0.532   -11.281 1.00 0.00 ? 37  LYS B HG2  20 
ATOM 9451  H HG3  . LYS B 1 37  ? -27.602 -0.904  -10.543 1.00 0.00 ? 37  LYS B HG3  20 
ATOM 9452  H HD2  . LYS B 1 37  ? -28.355 1.276   -8.905  1.00 0.00 ? 37  LYS B HD2  20 
ATOM 9453  H HD3  . LYS B 1 37  ? -28.620 1.793   -10.571 1.00 0.00 ? 37  LYS B HD3  20 
ATOM 9454  H HE2  . LYS B 1 37  ? -29.494 -0.937  -10.255 1.00 0.00 ? 37  LYS B HE2  20 
ATOM 9455  H HE3  . LYS B 1 37  ? -30.257 0.077   -9.030  1.00 0.00 ? 37  LYS B HE3  20 
ATOM 9456  H HZ1  . LYS B 1 37  ? -30.309 1.525   -11.383 1.00 0.00 ? 37  LYS B HZ1  20 
ATOM 9457  H HZ2  . LYS B 1 37  ? -30.777 -0.051  -11.808 1.00 0.00 ? 37  LYS B HZ2  20 
ATOM 9458  H HZ3  . LYS B 1 37  ? -31.625 0.787   -10.602 1.00 0.00 ? 37  LYS B HZ3  20 
ATOM 9459  N N    . GLY B 1 38  ? -23.481 -0.464  -7.872  1.00 0.00 ? 38  GLY B N    20 
ATOM 9460  C CA   . GLY B 1 38  ? -22.258 0.053   -7.194  1.00 0.00 ? 38  GLY B CA   20 
ATOM 9461  C C    . GLY B 1 38  ? -21.961 -0.800  -5.960  1.00 0.00 ? 38  GLY B C    20 
ATOM 9462  O O    . GLY B 1 38  ? -22.508 -1.872  -5.790  1.00 0.00 ? 38  GLY B O    20 
ATOM 9463  H H    . GLY B 1 38  ? -24.086 -1.074  -7.398  1.00 0.00 ? 38  GLY B H    20 
ATOM 9464  H HA2  . GLY B 1 38  ? -21.421 0.005   -7.877  1.00 0.00 ? 38  GLY B HA2  20 
ATOM 9465  H HA3  . GLY B 1 38  ? -22.419 1.076   -6.891  1.00 0.00 ? 38  GLY B HA3  20 
ATOM 9466  N N    . TYR B 1 39  ? -21.099 -0.336  -5.096  1.00 0.00 ? 39  TYR B N    20 
ATOM 9467  C CA   . TYR B 1 39  ? -20.773 -1.127  -3.875  1.00 0.00 ? 39  TYR B CA   20 
ATOM 9468  C C    . TYR B 1 39  ? -19.917 -0.282  -2.928  1.00 0.00 ? 39  TYR B C    20 
ATOM 9469  O O    . TYR B 1 39  ? -19.416 0.762   -3.294  1.00 0.00 ? 39  TYR B O    20 
ATOM 9470  C CB   . TYR B 1 39  ? -20.006 -2.391  -4.278  1.00 0.00 ? 39  TYR B CB   20 
ATOM 9471  C CG   . TYR B 1 39  ? -18.579 -2.037  -4.631  1.00 0.00 ? 39  TYR B CG   20 
ATOM 9472  C CD1  . TYR B 1 39  ? -18.302 -1.285  -5.779  1.00 0.00 ? 39  TYR B CD1  20 
ATOM 9473  C CD2  . TYR B 1 39  ? -17.533 -2.463  -3.807  1.00 0.00 ? 39  TYR B CD2  20 
ATOM 9474  C CE1  . TYR B 1 39  ? -16.979 -0.962  -6.103  1.00 0.00 ? 39  TYR B CE1  20 
ATOM 9475  C CE2  . TYR B 1 39  ? -16.209 -2.140  -4.129  1.00 0.00 ? 39  TYR B CE2  20 
ATOM 9476  C CZ   . TYR B 1 39  ? -15.933 -1.389  -5.278  1.00 0.00 ? 39  TYR B CZ   20 
ATOM 9477  O OH   . TYR B 1 39  ? -14.629 -1.069  -5.596  1.00 0.00 ? 39  TYR B OH   20 
ATOM 9478  H H    . TYR B 1 39  ? -20.668 0.531   -5.249  1.00 0.00 ? 39  TYR B H    20 
ATOM 9479  H HA   . TYR B 1 39  ? -21.689 -1.407  -3.376  1.00 0.00 ? 39  TYR B HA   20 
ATOM 9480  H HB2  . TYR B 1 39  ? -20.009 -3.090  -3.456  1.00 0.00 ? 39  TYR B HB2  20 
ATOM 9481  H HB3  . TYR B 1 39  ? -20.485 -2.843  -5.135  1.00 0.00 ? 39  TYR B HB3  20 
ATOM 9482  H HD1  . TYR B 1 39  ? -19.107 -0.956  -6.416  1.00 0.00 ? 39  TYR B HD1  20 
ATOM 9483  H HD2  . TYR B 1 39  ? -17.747 -3.043  -2.920  1.00 0.00 ? 39  TYR B HD2  20 
ATOM 9484  H HE1  . TYR B 1 39  ? -16.766 -0.381  -6.989  1.00 0.00 ? 39  TYR B HE1  20 
ATOM 9485  H HE2  . TYR B 1 39  ? -15.402 -2.469  -3.492  1.00 0.00 ? 39  TYR B HE2  20 
ATOM 9486  H HH   . TYR B 1 39  ? -14.105 -1.871  -5.537  1.00 0.00 ? 39  TYR B HH   20 
ATOM 9487  N N    . HIS B 1 40  ? -19.743 -0.726  -1.713  1.00 0.00 ? 40  HIS B N    20 
ATOM 9488  C CA   . HIS B 1 40  ? -18.916 0.050   -0.748  1.00 0.00 ? 40  HIS B CA   20 
ATOM 9489  C C    . HIS B 1 40  ? -17.438 -0.271  -0.981  1.00 0.00 ? 40  HIS B C    20 
ATOM 9490  O O    . HIS B 1 40  ? -16.858 -1.097  -0.305  1.00 0.00 ? 40  HIS B O    20 
ATOM 9491  C CB   . HIS B 1 40  ? -19.302 -0.333  0.682   1.00 0.00 ? 40  HIS B CB   20 
ATOM 9492  C CG   . HIS B 1 40  ? -20.748 0.002   0.918   1.00 0.00 ? 40  HIS B CG   20 
ATOM 9493  N ND1  . HIS B 1 40  ? -21.778 -0.822  0.491   1.00 0.00 ? 40  HIS B ND1  20 
ATOM 9494  C CD2  . HIS B 1 40  ? -21.354 1.068   1.537   1.00 0.00 ? 40  HIS B CD2  20 
ATOM 9495  C CE1  . HIS B 1 40  ? -22.937 -0.245  0.855   1.00 0.00 ? 40  HIS B CE1  20 
ATOM 9496  N NE2  . HIS B 1 40  ? -22.736 0.910   1.496   1.00 0.00 ? 40  HIS B NE2  20 
ATOM 9497  H H    . HIS B 1 40  ? -20.153 -1.573  -1.437  1.00 0.00 ? 40  HIS B H    20 
ATOM 9498  H HA   . HIS B 1 40  ? -19.085 1.108   -0.898  1.00 0.00 ? 40  HIS B HA   20 
ATOM 9499  H HB2  . HIS B 1 40  ? -19.149 -1.393  0.823   1.00 0.00 ? 40  HIS B HB2  20 
ATOM 9500  H HB3  . HIS B 1 40  ? -18.686 0.215   1.379   1.00 0.00 ? 40  HIS B HB3  20 
ATOM 9501  H HD1  . HIS B 1 40  ? -21.679 -1.670  0.011   1.00 0.00 ? 40  HIS B HD1  20 
ATOM 9502  H HD2  . HIS B 1 40  ? -20.837 1.901   1.987   1.00 0.00 ? 40  HIS B HD2  20 
ATOM 9503  H HE1  . HIS B 1 40  ? -23.912 -0.663  0.653   1.00 0.00 ? 40  HIS B HE1  20 
ATOM 9504  N N    . ALA B 1 41  ? -16.826 0.370   -1.939  1.00 0.00 ? 41  ALA B N    20 
ATOM 9505  C CA   . ALA B 1 41  ? -15.388 0.095   -2.222  1.00 0.00 ? 41  ALA B CA   20 
ATOM 9506  C C    . ALA B 1 41  ? -14.525 0.572   -1.052  1.00 0.00 ? 41  ALA B C    20 
ATOM 9507  O O    . ALA B 1 41  ? -13.595 -0.096  -0.647  1.00 0.00 ? 41  ALA B O    20 
ATOM 9508  C CB   . ALA B 1 41  ? -14.975 0.831   -3.499  1.00 0.00 ? 41  ALA B CB   20 
ATOM 9509  H H    . ALA B 1 41  ? -17.314 1.028   -2.476  1.00 0.00 ? 41  ALA B H    20 
ATOM 9510  H HA   . ALA B 1 41  ? -15.248 -0.966  -2.359  1.00 0.00 ? 41  ALA B HA   20 
ATOM 9511  H HB1  . ALA B 1 41  ? -15.830 0.923   -4.155  1.00 0.00 ? 41  ALA B HB1  20 
ATOM 9512  H HB2  . ALA B 1 41  ? -14.608 1.813   -3.247  1.00 0.00 ? 41  ALA B HB2  20 
ATOM 9513  H HB3  . ALA B 1 41  ? -14.196 0.272   -3.999  1.00 0.00 ? 41  ALA B HB3  20 
ATOM 9514  N N    . ASN B 1 42  ? -14.821 1.718   -0.503  1.00 0.00 ? 42  ASN B N    20 
ATOM 9515  C CA   . ASN B 1 42  ? -14.010 2.224   0.641   1.00 0.00 ? 42  ASN B CA   20 
ATOM 9516  C C    . ASN B 1 42  ? -12.571 2.464   0.178   1.00 0.00 ? 42  ASN B C    20 
ATOM 9517  O O    . ASN B 1 42  ? -12.222 2.198   -0.956  1.00 0.00 ? 42  ASN B O    20 
ATOM 9518  C CB   . ASN B 1 42  ? -14.013 1.187   1.765   1.00 0.00 ? 42  ASN B CB   20 
ATOM 9519  C CG   . ASN B 1 42  ? -15.117 1.523   2.770   1.00 0.00 ? 42  ASN B CG   20 
ATOM 9520  O OD1  . ASN B 1 42  ? -15.749 2.556   2.671   1.00 0.00 ? 42  ASN B OD1  20 
ATOM 9521  N ND2  . ASN B 1 42  ? -15.378 0.689   3.739   1.00 0.00 ? 42  ASN B ND2  20 
ATOM 9522  H H    . ASN B 1 42  ? -15.575 2.244   -0.842  1.00 0.00 ? 42  ASN B H    20 
ATOM 9523  H HA   . ASN B 1 42  ? -14.432 3.151   1.002   1.00 0.00 ? 42  ASN B HA   20 
ATOM 9524  H HB2  . ASN B 1 42  ? -14.190 0.206   1.348   1.00 0.00 ? 42  ASN B HB2  20 
ATOM 9525  H HB3  . ASN B 1 42  ? -13.056 1.196   2.267   1.00 0.00 ? 42  ASN B HB3  20 
ATOM 9526  H HD21 . ASN B 1 42  ? -14.868 -0.144  3.819   1.00 0.00 ? 42  ASN B HD21 20 
ATOM 9527  H HD22 . ASN B 1 42  ? -16.083 0.896   4.388   1.00 0.00 ? 42  ASN B HD22 20 
ATOM 9528  N N    . PHE B 1 43  ? -11.731 2.957   1.046   1.00 0.00 ? 43  PHE B N    20 
ATOM 9529  C CA   . PHE B 1 43  ? -10.315 3.203   0.652   1.00 0.00 ? 43  PHE B CA   20 
ATOM 9530  C C    . PHE B 1 43  ? -9.539  3.761   1.844   1.00 0.00 ? 43  PHE B C    20 
ATOM 9531  O O    . PHE B 1 43  ? -9.995  3.709   2.965   1.00 0.00 ? 43  PHE B O    20 
ATOM 9532  C CB   . PHE B 1 43  ? -10.265 4.187   -0.521  1.00 0.00 ? 43  PHE B CB   20 
ATOM 9533  C CG   . PHE B 1 43  ? -10.585 5.589   -0.064  1.00 0.00 ? 43  PHE B CG   20 
ATOM 9534  C CD1  . PHE B 1 43  ? -11.719 5.851   0.716   1.00 0.00 ? 43  PHE B CD1  20 
ATOM 9535  C CD2  . PHE B 1 43  ? -9.741  6.637   -0.442  1.00 0.00 ? 43  PHE B CD2  20 
ATOM 9536  C CE1  . PHE B 1 43  ? -12.003 7.162   1.115   1.00 0.00 ? 43  PHE B CE1  20 
ATOM 9537  C CE2  . PHE B 1 43  ? -10.022 7.944   -0.043  1.00 0.00 ? 43  PHE B CE2  20 
ATOM 9538  C CZ   . PHE B 1 43  ? -11.155 8.209   0.736   1.00 0.00 ? 43  PHE B CZ   20 
ATOM 9539  H H    . PHE B 1 43  ? -12.029 3.161   1.959   1.00 0.00 ? 43  PHE B H    20 
ATOM 9540  H HA   . PHE B 1 43  ? -9.869  2.267   0.349   1.00 0.00 ? 43  PHE B HA   20 
ATOM 9541  H HB2  . PHE B 1 43  ? -9.274  4.181   -0.944  1.00 0.00 ? 43  PHE B HB2  20 
ATOM 9542  H HB3  . PHE B 1 43  ? -10.978 3.885   -1.274  1.00 0.00 ? 43  PHE B HB3  20 
ATOM 9543  H HD1  . PHE B 1 43  ? -12.379 5.045   1.006   1.00 0.00 ? 43  PHE B HD1  20 
ATOM 9544  H HD2  . PHE B 1 43  ? -8.865  6.435   -1.043  1.00 0.00 ? 43  PHE B HD2  20 
ATOM 9545  H HE1  . PHE B 1 43  ? -12.876 7.365   1.716   1.00 0.00 ? 43  PHE B HE1  20 
ATOM 9546  H HE2  . PHE B 1 43  ? -9.369  8.748   -0.339  1.00 0.00 ? 43  PHE B HE2  20 
ATOM 9547  H HZ   . PHE B 1 43  ? -11.374 9.221   1.044   1.00 0.00 ? 43  PHE B HZ   20 
ATOM 9548  N N    . CYS B 1 44  ? -8.363  4.278   1.624   1.00 0.00 ? 44  CYS B N    20 
ATOM 9549  C CA   . CYS B 1 44  ? -7.574  4.815   2.769   1.00 0.00 ? 44  CYS B CA   20 
ATOM 9550  C C    . CYS B 1 44  ? -6.839  6.087   2.343   1.00 0.00 ? 44  CYS B C    20 
ATOM 9551  O O    . CYS B 1 44  ? -6.548  6.289   1.181   1.00 0.00 ? 44  CYS B O    20 
ATOM 9552  C CB   . CYS B 1 44  ? -6.547  3.774   3.228   1.00 0.00 ? 44  CYS B CB   20 
ATOM 9553  S SG   . CYS B 1 44  ? -7.196  2.102   2.967   1.00 0.00 ? 44  CYS B SG   20 
ATOM 9554  H H    . CYS B 1 44  ? -7.997  4.303   0.715   1.00 0.00 ? 44  CYS B H    20 
ATOM 9555  H HA   . CYS B 1 44  ? -8.243  5.043   3.587   1.00 0.00 ? 44  CYS B HA   20 
ATOM 9556  H HB2  . CYS B 1 44  ? -5.636  3.895   2.662   1.00 0.00 ? 44  CYS B HB2  20 
ATOM 9557  H HB3  . CYS B 1 44  ? -6.339  3.917   4.278   1.00 0.00 ? 44  CYS B HB3  20 
ATOM 9558  N N    . LEU B 1 45  ? -6.533  6.947   3.278   1.00 0.00 ? 45  LEU B N    20 
ATOM 9559  C CA   . LEU B 1 45  ? -5.811  8.203   2.927   1.00 0.00 ? 45  LEU B CA   20 
ATOM 9560  C C    . LEU B 1 45  ? -4.847  8.576   4.058   1.00 0.00 ? 45  LEU B C    20 
ATOM 9561  O O    . LEU B 1 45  ? -5.077  8.269   5.210   1.00 0.00 ? 45  LEU B O    20 
ATOM 9562  C CB   . LEU B 1 45  ? -6.823  9.332   2.728   1.00 0.00 ? 45  LEU B CB   20 
ATOM 9563  C CG   . LEU B 1 45  ? -7.550  9.134   1.399   1.00 0.00 ? 45  LEU B CG   20 
ATOM 9564  C CD1  . LEU B 1 45  ? -8.478  10.323  1.144   1.00 0.00 ? 45  LEU B CD1  20 
ATOM 9565  C CD2  . LEU B 1 45  ? -6.525  9.037   0.268   1.00 0.00 ? 45  LEU B CD2  20 
ATOM 9566  H H    . LEU B 1 45  ? -6.776  6.764   4.210   1.00 0.00 ? 45  LEU B H    20 
ATOM 9567  H HA   . LEU B 1 45  ? -5.255  8.054   2.015   1.00 0.00 ? 45  LEU B HA   20 
ATOM 9568  H HB2  . LEU B 1 45  ? -7.539  9.321   3.536   1.00 0.00 ? 45  LEU B HB2  20 
ATOM 9569  H HB3  . LEU B 1 45  ? -6.305  10.280  2.716   1.00 0.00 ? 45  LEU B HB3  20 
ATOM 9570  H HG   . LEU B 1 45  ? -8.133  8.225   1.440   1.00 0.00 ? 45  LEU B HG   20 
ATOM 9571  H HD11 . LEU B 1 45  ? -8.344  11.058  1.924   1.00 0.00 ? 45  LEU B HD11 20 
ATOM 9572  H HD12 . LEU B 1 45  ? -8.241  10.766  0.188   1.00 0.00 ? 45  LEU B HD12 20 
ATOM 9573  H HD13 . LEU B 1 45  ? -9.504  9.985   1.140   1.00 0.00 ? 45  LEU B HD13 20 
ATOM 9574  H HD21 . LEU B 1 45  ? -5.551  9.322   0.639   1.00 0.00 ? 45  LEU B HD21 20 
ATOM 9575  H HD22 . LEU B 1 45  ? -6.487  8.022   -0.097  1.00 0.00 ? 45  LEU B HD22 20 
ATOM 9576  H HD23 . LEU B 1 45  ? -6.811  9.699   -0.534  1.00 0.00 ? 45  LEU B HD23 20 
ATOM 9577  N N    . GLY B 1 46  ? -3.770  9.240   3.733   1.00 0.00 ? 46  GLY B N    20 
ATOM 9578  C CA   . GLY B 1 46  ? -2.790  9.639   4.787   1.00 0.00 ? 46  GLY B CA   20 
ATOM 9579  C C    . GLY B 1 46  ? -1.871  8.457   5.118   1.00 0.00 ? 46  GLY B C    20 
ATOM 9580  O O    . GLY B 1 46  ? -2.292  7.318   5.081   1.00 0.00 ? 46  GLY B O    20 
ATOM 9581  H H    . GLY B 1 46  ? -3.607  9.480   2.797   1.00 0.00 ? 46  GLY B H    20 
ATOM 9582  H HA2  . GLY B 1 46  ? -2.198  10.468  4.427   1.00 0.00 ? 46  GLY B HA2  20 
ATOM 9583  H HA3  . GLY B 1 46  ? -3.322  9.937   5.677   1.00 0.00 ? 46  GLY B HA3  20 
ATOM 9584  N N    . PRO B 1 47  ? -0.638  8.769   5.435   1.00 0.00 ? 47  PRO B N    20 
ATOM 9585  C CA   . PRO B 1 47  ? 0.376   7.756   5.784   1.00 0.00 ? 47  PRO B CA   20 
ATOM 9586  C C    . PRO B 1 47  ? 0.177   7.276   7.226   1.00 0.00 ? 47  PRO B C    20 
ATOM 9587  O O    . PRO B 1 47  ? -0.802  7.601   7.867   1.00 0.00 ? 47  PRO B O    20 
ATOM 9588  C CB   . PRO B 1 47  ? 1.701   8.509   5.637   1.00 0.00 ? 47  PRO B CB   20 
ATOM 9589  C CG   . PRO B 1 47  ? 1.366   10.013  5.775   1.00 0.00 ? 47  PRO B CG   20 
ATOM 9590  C CD   . PRO B 1 47  ? -0.139  10.158  5.474   1.00 0.00 ? 47  PRO B CD   20 
ATOM 9591  H HA   . PRO B 1 47  ? 0.342   6.927   5.096   1.00 0.00 ? 47  PRO B HA   20 
ATOM 9592  H HB2  . PRO B 1 47  ? 2.388   8.204   6.416   1.00 0.00 ? 47  PRO B HB2  20 
ATOM 9593  H HB3  . PRO B 1 47  ? 2.130   8.319   4.667   1.00 0.00 ? 47  PRO B HB3  20 
ATOM 9594  H HG2  . PRO B 1 47  ? 1.580   10.349  6.781   1.00 0.00 ? 47  PRO B HG2  20 
ATOM 9595  H HG3  . PRO B 1 47  ? 1.937   10.587  5.062   1.00 0.00 ? 47  PRO B HG3  20 
ATOM 9596  H HD2  . PRO B 1 47  ? -0.628  10.718  6.260   1.00 0.00 ? 47  PRO B HD2  20 
ATOM 9597  H HD3  . PRO B 1 47  ? -0.289  10.635  4.517   1.00 0.00 ? 47  PRO B HD3  20 
ATOM 9598  N N    . CYS B 1 48  ? 1.096   6.502   7.738   1.00 0.00 ? 48  CYS B N    20 
ATOM 9599  C CA   . CYS B 1 48  ? 0.949   6.004   9.136   1.00 0.00 ? 48  CYS B CA   20 
ATOM 9600  C C    . CYS B 1 48  ? 2.322   5.903   9.809   1.00 0.00 ? 48  CYS B C    20 
ATOM 9601  O O    . CYS B 1 48  ? 3.317   5.663   9.155   1.00 0.00 ? 48  CYS B O    20 
ATOM 9602  C CB   . CYS B 1 48  ? 0.303   4.617   9.127   1.00 0.00 ? 48  CYS B CB   20 
ATOM 9603  S SG   . CYS B 1 48  ? 0.849   3.689   7.671   1.00 0.00 ? 48  CYS B SG   20 
ATOM 9604  H H    . CYS B 1 48  ? 1.877   6.250   7.206   1.00 0.00 ? 48  CYS B H    20 
ATOM 9605  H HA   . CYS B 1 48  ? 0.326   6.686   9.695   1.00 0.00 ? 48  CYS B HA   20 
ATOM 9606  H HB2  . CYS B 1 48  ? 0.593   4.082   10.020  1.00 0.00 ? 48  CYS B HB2  20 
ATOM 9607  H HB3  . CYS B 1 48  ? -0.770  4.722   9.105   1.00 0.00 ? 48  CYS B HB3  20 
ATOM 9608  N N    . PRO B 1 49  ? 2.322   6.067   11.108  1.00 0.00 ? 49  PRO B N    20 
ATOM 9609  C CA   . PRO B 1 49  ? 3.547   5.979   11.920  1.00 0.00 ? 49  PRO B CA   20 
ATOM 9610  C C    . PRO B 1 49  ? 3.947   4.498   12.080  1.00 0.00 ? 49  PRO B C    20 
ATOM 9611  O O    . PRO B 1 49  ? 3.870   3.735   11.138  1.00 0.00 ? 49  PRO B O    20 
ATOM 9612  C CB   . PRO B 1 49  ? 3.138   6.638   13.249  1.00 0.00 ? 49  PRO B CB   20 
ATOM 9613  C CG   . PRO B 1 49  ? 1.597   6.552   13.326  1.00 0.00 ? 49  PRO B CG   20 
ATOM 9614  C CD   . PRO B 1 49  ? 1.098   6.361   11.883  1.00 0.00 ? 49  PRO B CD   20 
ATOM 9615  H HA   . PRO B 1 49  ? 4.345   6.538   11.460  1.00 0.00 ? 49  PRO B HA   20 
ATOM 9616  H HB2  . PRO B 1 49  ? 3.582   6.122   14.082  1.00 0.00 ? 49  PRO B HB2  20 
ATOM 9617  H HB3  . PRO B 1 49  ? 3.440   7.673   13.253  1.00 0.00 ? 49  PRO B HB3  20 
ATOM 9618  H HG2  . PRO B 1 49  ? 1.306   5.713   13.940  1.00 0.00 ? 49  PRO B HG2  20 
ATOM 9619  H HG3  . PRO B 1 49  ? 1.196   7.467   13.733  1.00 0.00 ? 49  PRO B HG3  20 
ATOM 9620  H HD2  . PRO B 1 49  ? 0.405   5.534   11.829  1.00 0.00 ? 49  PRO B HD2  20 
ATOM 9621  H HD3  . PRO B 1 49  ? 0.636   7.266   11.519  1.00 0.00 ? 49  PRO B HD3  20 
ATOM 9622  N N    . TYR B 1 50  ? 4.380   4.075   13.241  1.00 0.00 ? 50  TYR B N    20 
ATOM 9623  C CA   . TYR B 1 50  ? 4.782   2.642   13.396  1.00 0.00 ? 50  TYR B CA   20 
ATOM 9624  C C    . TYR B 1 50  ? 3.629   1.829   13.993  1.00 0.00 ? 50  TYR B C    20 
ATOM 9625  O O    . TYR B 1 50  ? 2.857   1.221   13.281  1.00 0.00 ? 50  TYR B O    20 
ATOM 9626  C CB   . TYR B 1 50  ? 6.011   2.512   14.313  1.00 0.00 ? 50  TYR B CB   20 
ATOM 9627  C CG   . TYR B 1 50  ? 6.333   3.836   14.965  1.00 0.00 ? 50  TYR B CG   20 
ATOM 9628  C CD1  . TYR B 1 50  ? 6.911   4.860   14.211  1.00 0.00 ? 50  TYR B CD1  20 
ATOM 9629  C CD2  . TYR B 1 50  ? 6.051   4.037   16.322  1.00 0.00 ? 50  TYR B CD2  20 
ATOM 9630  C CE1  . TYR B 1 50  ? 7.211   6.088   14.811  1.00 0.00 ? 50  TYR B CE1  20 
ATOM 9631  C CE2  . TYR B 1 50  ? 6.350   5.265   16.923  1.00 0.00 ? 50  TYR B CE2  20 
ATOM 9632  C CZ   . TYR B 1 50  ? 6.931   6.291   16.167  1.00 0.00 ? 50  TYR B CZ   20 
ATOM 9633  O OH   . TYR B 1 50  ? 7.226   7.503   16.760  1.00 0.00 ? 50  TYR B OH   20 
ATOM 9634  H H    . TYR B 1 50  ? 4.449   4.687   13.995  1.00 0.00 ? 50  TYR B H    20 
ATOM 9635  H HA   . TYR B 1 50  ? 5.027   2.241   12.423  1.00 0.00 ? 50  TYR B HA   20 
ATOM 9636  H HB2  . TYR B 1 50  ? 5.807   1.780   15.080  1.00 0.00 ? 50  TYR B HB2  20 
ATOM 9637  H HB3  . TYR B 1 50  ? 6.858   2.188   13.728  1.00 0.00 ? 50  TYR B HB3  20 
ATOM 9638  H HD1  . TYR B 1 50  ? 7.127   4.702   13.165  1.00 0.00 ? 50  TYR B HD1  20 
ATOM 9639  H HD2  . TYR B 1 50  ? 5.603   3.245   16.904  1.00 0.00 ? 50  TYR B HD2  20 
ATOM 9640  H HE1  . TYR B 1 50  ? 7.663   6.875   14.227  1.00 0.00 ? 50  TYR B HE1  20 
ATOM 9641  H HE2  . TYR B 1 50  ? 6.133   5.422   17.969  1.00 0.00 ? 50  TYR B HE2  20 
ATOM 9642  H HH   . TYR B 1 50  ? 6.680   7.589   17.545  1.00 0.00 ? 50  TYR B HH   20 
ATOM 9643  N N    . ILE B 1 51  ? 3.526   1.798   15.294  1.00 0.00 ? 51  ILE B N    20 
ATOM 9644  C CA   . ILE B 1 51  ? 2.444   1.009   15.959  1.00 0.00 ? 51  ILE B CA   20 
ATOM 9645  C C    . ILE B 1 51  ? 1.139   1.084   15.157  1.00 0.00 ? 51  ILE B C    20 
ATOM 9646  O O    . ILE B 1 51  ? 0.327   0.182   15.203  1.00 0.00 ? 51  ILE B O    20 
ATOM 9647  C CB   . ILE B 1 51  ? 2.204   1.564   17.363  1.00 0.00 ? 51  ILE B CB   20 
ATOM 9648  C CG1  . ILE B 1 51  ? 2.150   3.092   17.303  1.00 0.00 ? 51  ILE B CG1  20 
ATOM 9649  C CG2  . ILE B 1 51  ? 3.343   1.131   18.288  1.00 0.00 ? 51  ILE B CG2  20 
ATOM 9650  C CD1  . ILE B 1 51  ? 1.318   3.621   18.473  1.00 0.00 ? 51  ILE B CD1  20 
ATOM 9651  H H    . ILE B 1 51  ? 4.174   2.287   15.843  1.00 0.00 ? 51  ILE B H    20 
ATOM 9652  H HA   . ILE B 1 51  ? 2.755   -0.023  16.034  1.00 0.00 ? 51  ILE B HA   20 
ATOM 9653  H HB   . ILE B 1 51  ? 1.267   1.183   17.745  1.00 0.00 ? 51  ILE B HB   20 
ATOM 9654  H HG12 . ILE B 1 51  ? 3.152   3.489   17.364  1.00 0.00 ? 51  ILE B HG12 20 
ATOM 9655  H HG13 . ILE B 1 51  ? 1.696   3.399   16.373  1.00 0.00 ? 51  ILE B HG13 20 
ATOM 9656  H HG21 . ILE B 1 51  ? 3.964   0.408   17.780  1.00 0.00 ? 51  ILE B HG21 20 
ATOM 9657  H HG22 . ILE B 1 51  ? 3.938   1.991   18.555  1.00 0.00 ? 51  ILE B HG22 20 
ATOM 9658  H HG23 . ILE B 1 51  ? 2.931   0.686   19.183  1.00 0.00 ? 51  ILE B HG23 20 
ATOM 9659  H HD11 . ILE B 1 51  ? 1.684   3.196   19.395  1.00 0.00 ? 51  ILE B HD11 20 
ATOM 9660  H HD12 . ILE B 1 51  ? 1.398   4.697   18.514  1.00 0.00 ? 51  ILE B HD12 20 
ATOM 9661  H HD13 . ILE B 1 51  ? 0.284   3.342   18.334  1.00 0.00 ? 51  ILE B HD13 20 
ATOM 9662  N N    . TRP B 1 52  ? 0.924   2.146   14.433  1.00 0.00 ? 52  TRP B N    20 
ATOM 9663  C CA   . TRP B 1 52  ? -0.336  2.273   13.643  1.00 0.00 ? 52  TRP B CA   20 
ATOM 9664  C C    . TRP B 1 52  ? -0.487  1.090   12.681  1.00 0.00 ? 52  TRP B C    20 
ATOM 9665  O O    . TRP B 1 52  ? -0.087  1.160   11.538  1.00 0.00 ? 52  TRP B O    20 
ATOM 9666  C CB   . TRP B 1 52  ? -0.302  3.570   12.844  1.00 0.00 ? 52  TRP B CB   20 
ATOM 9667  C CG   . TRP B 1 52  ? -1.659  4.195   12.856  1.00 0.00 ? 52  TRP B CG   20 
ATOM 9668  C CD1  . TRP B 1 52  ? -2.256  4.760   11.786  1.00 0.00 ? 52  TRP B CD1  20 
ATOM 9669  C CD2  . TRP B 1 52  ? -2.596  4.326   13.966  1.00 0.00 ? 52  TRP B CD2  20 
ATOM 9670  N NE1  . TRP B 1 52  ? -3.499  5.235   12.163  1.00 0.00 ? 52  TRP B NE1  20 
ATOM 9671  C CE2  . TRP B 1 52  ? -3.756  4.989   13.497  1.00 0.00 ? 52  TRP B CE2  20 
ATOM 9672  C CE3  . TRP B 1 52  ? -2.554  3.939   15.317  1.00 0.00 ? 52  TRP B CE3  20 
ATOM 9673  C CZ2  . TRP B 1 52  ? -4.835  5.258   14.341  1.00 0.00 ? 52  TRP B CZ2  20 
ATOM 9674  C CZ3  . TRP B 1 52  ? -3.639  4.208   16.168  1.00 0.00 ? 52  TRP B CZ3  20 
ATOM 9675  C CH2  . TRP B 1 52  ? -4.778  4.865   15.680  1.00 0.00 ? 52  TRP B CH2  20 
ATOM 9676  H H    . TRP B 1 52  ? 1.587   2.868   14.414  1.00 0.00 ? 52  TRP B H    20 
ATOM 9677  H HA   . TRP B 1 52  ? -1.180  2.295   14.313  1.00 0.00 ? 52  TRP B HA   20 
ATOM 9678  H HB2  . TRP B 1 52  ? 0.410   4.246   13.287  1.00 0.00 ? 52  TRP B HB2  20 
ATOM 9679  H HB3  . TRP B 1 52  ? -0.013  3.358   11.825  1.00 0.00 ? 52  TRP B HB3  20 
ATOM 9680  H HD1  . TRP B 1 52  ? -1.830  4.830   10.799  1.00 0.00 ? 52  TRP B HD1  20 
ATOM 9681  H HE1  . TRP B 1 52  ? -4.133  5.690   11.572  1.00 0.00 ? 52  TRP B HE1  20 
ATOM 9682  H HE3  . TRP B 1 52  ? -1.683  3.433   15.705  1.00 0.00 ? 52  TRP B HE3  20 
ATOM 9683  H HZ2  . TRP B 1 52  ? -5.711  5.764   13.960  1.00 0.00 ? 52  TRP B HZ2  20 
ATOM 9684  H HZ3  . TRP B 1 52  ? -3.597  3.906   17.205  1.00 0.00 ? 52  TRP B HZ3  20 
ATOM 9685  H HH2  . TRP B 1 52  ? -5.608  5.070   16.339  1.00 0.00 ? 52  TRP B HH2  20 
ATOM 9686  N N    . SER B 1 53  ? -1.086  0.018   13.143  1.00 0.00 ? 53  SER B N    20 
ATOM 9687  C CA   . SER B 1 53  ? -1.305  -1.187  12.280  1.00 0.00 ? 53  SER B CA   20 
ATOM 9688  C C    . SER B 1 53  ? -0.192  -1.331  11.235  1.00 0.00 ? 53  SER B C    20 
ATOM 9689  O O    . SER B 1 53  ? -0.231  -0.719  10.187  1.00 0.00 ? 53  SER B O    20 
ATOM 9690  C CB   . SER B 1 53  ? -2.651  -1.056  11.568  1.00 0.00 ? 53  SER B CB   20 
ATOM 9691  O OG   . SER B 1 53  ? -2.510  -0.183  10.455  1.00 0.00 ? 53  SER B OG   20 
ATOM 9692  H H    . SER B 1 53  ? -1.410  0.010   14.067  1.00 0.00 ? 53  SER B H    20 
ATOM 9693  H HA   . SER B 1 53  ? -1.321  -2.070  12.903  1.00 0.00 ? 53  SER B HA   20 
ATOM 9694  H HB2  . SER B 1 53  ? -2.972  -2.024  11.220  1.00 0.00 ? 53  SER B HB2  20 
ATOM 9695  H HB3  . SER B 1 53  ? -3.386  -0.662  12.258  1.00 0.00 ? 53  SER B HB3  20 
ATOM 9696  H HG   . SER B 1 53  ? -1.938  0.542   10.718  1.00 0.00 ? 53  SER B HG   20 
ATOM 9697  N N    . LEU B 1 54  ? 0.790   -2.147  11.504  1.00 0.00 ? 54  LEU B N    20 
ATOM 9698  C CA   . LEU B 1 54  ? 1.888   -2.335  10.514  1.00 0.00 ? 54  LEU B CA   20 
ATOM 9699  C C    . LEU B 1 54  ? 1.677   -3.657  9.775   1.00 0.00 ? 54  LEU B C    20 
ATOM 9700  O O    . LEU B 1 54  ? 1.450   -4.687  10.378  1.00 0.00 ? 54  LEU B O    20 
ATOM 9701  C CB   . LEU B 1 54  ? 3.234   -2.356  11.239  1.00 0.00 ? 54  LEU B CB   20 
ATOM 9702  C CG   . LEU B 1 54  ? 3.528   -0.957  11.782  1.00 0.00 ? 54  LEU B CG   20 
ATOM 9703  C CD1  . LEU B 1 54  ? 4.653   -1.029  12.817  1.00 0.00 ? 54  LEU B CD1  20 
ATOM 9704  C CD2  . LEU B 1 54  ? 3.953   -0.044  10.631  1.00 0.00 ? 54  LEU B CD2  20 
ATOM 9705  H H    . LEU B 1 54  ? 0.800   -2.643  12.348  1.00 0.00 ? 54  LEU B H    20 
ATOM 9706  H HA   . LEU B 1 54  ? 1.874   -1.520  9.805   1.00 0.00 ? 54  LEU B HA   20 
ATOM 9707  H HB2  . LEU B 1 54  ? 3.193   -3.061  12.057  1.00 0.00 ? 54  LEU B HB2  20 
ATOM 9708  H HB3  . LEU B 1 54  ? 4.013   -2.643  10.550  1.00 0.00 ? 54  LEU B HB3  20 
ATOM 9709  H HG   . LEU B 1 54  ? 2.637   -0.562  12.247  1.00 0.00 ? 54  LEU B HG   20 
ATOM 9710  H HD11 . LEU B 1 54  ? 5.007   -2.046  12.895  1.00 0.00 ? 54  LEU B HD11 20 
ATOM 9711  H HD12 . LEU B 1 54  ? 5.465   -0.387  12.510  1.00 0.00 ? 54  LEU B HD12 20 
ATOM 9712  H HD13 . LEU B 1 54  ? 4.280   -0.703  13.777  1.00 0.00 ? 54  LEU B HD13 20 
ATOM 9713  H HD21 . LEU B 1 54  ? 3.824   -0.564  9.693   1.00 0.00 ? 54  LEU B HD21 20 
ATOM 9714  H HD22 . LEU B 1 54  ? 3.343   0.848   10.635  1.00 0.00 ? 54  LEU B HD22 20 
ATOM 9715  H HD23 . LEU B 1 54  ? 4.991   0.229   10.752  1.00 0.00 ? 54  LEU B HD23 20 
ATOM 9716  N N    . ASP B 1 55  ? 1.734   -3.633  8.471   1.00 0.00 ? 55  ASP B N    20 
ATOM 9717  C CA   . ASP B 1 55  ? 1.522   -4.887  7.695   1.00 0.00 ? 55  ASP B CA   20 
ATOM 9718  C C    . ASP B 1 55  ? 2.869   -5.537  7.369   1.00 0.00 ? 55  ASP B C    20 
ATOM 9719  O O    . ASP B 1 55  ? 3.153   -6.641  7.791   1.00 0.00 ? 55  ASP B O    20 
ATOM 9720  C CB   . ASP B 1 55  ? 0.787   -4.557  6.394   1.00 0.00 ? 55  ASP B CB   20 
ATOM 9721  C CG   . ASP B 1 55  ? 0.216   -5.840  5.789   1.00 0.00 ? 55  ASP B CG   20 
ATOM 9722  O OD1  . ASP B 1 55  ? -0.834  -6.268  6.239   1.00 0.00 ? 55  ASP B OD1  20 
ATOM 9723  O OD2  . ASP B 1 55  ? 0.838   -6.375  4.885   1.00 0.00 ? 55  ASP B OD2  20 
ATOM 9724  H H    . ASP B 1 55  ? 1.909   -2.790  8.003   1.00 0.00 ? 55  ASP B H    20 
ATOM 9725  H HA   . ASP B 1 55  ? 0.926   -5.573  8.278   1.00 0.00 ? 55  ASP B HA   20 
ATOM 9726  H HB2  . ASP B 1 55  ? -0.017  -3.868  6.602   1.00 0.00 ? 55  ASP B HB2  20 
ATOM 9727  H HB3  . ASP B 1 55  ? 1.477   -4.108  5.694   1.00 0.00 ? 55  ASP B HB3  20 
ATOM 9728  N N    . THR B 1 56  ? 3.699   -4.867  6.619   1.00 0.00 ? 56  THR B N    20 
ATOM 9729  C CA   . THR B 1 56  ? 5.022   -5.457  6.267   1.00 0.00 ? 56  THR B CA   20 
ATOM 9730  C C    . THR B 1 56  ? 6.082   -4.966  7.253   1.00 0.00 ? 56  THR B C    20 
ATOM 9731  O O    . THR B 1 56  ? 5.899   -3.978  7.936   1.00 0.00 ? 56  THR B O    20 
ATOM 9732  C CB   . THR B 1 56  ? 5.409   -5.030  4.848   1.00 0.00 ? 56  THR B CB   20 
ATOM 9733  O OG1  . THR B 1 56  ? 5.876   -3.689  4.870   1.00 0.00 ? 56  THR B OG1  20 
ATOM 9734  C CG2  . THR B 1 56  ? 4.188   -5.133  3.932   1.00 0.00 ? 56  THR B CG2  20 
ATOM 9735  H H    . THR B 1 56  ? 3.452   -3.980  6.285   1.00 0.00 ? 56  THR B H    20 
ATOM 9736  H HA   . THR B 1 56  ? 4.959   -6.534  6.313   1.00 0.00 ? 56  THR B HA   20 
ATOM 9737  H HB   . THR B 1 56  ? 6.187   -5.678  4.477   1.00 0.00 ? 56  THR B HB   20 
ATOM 9738  H HG1  . THR B 1 56  ? 6.456   -3.564  4.115   1.00 0.00 ? 56  THR B HG1  20 
ATOM 9739  H HG21 . THR B 1 56  ? 3.314   -4.773  4.455   1.00 0.00 ? 56  THR B HG21 20 
ATOM 9740  H HG22 . THR B 1 56  ? 4.350   -4.535  3.048   1.00 0.00 ? 56  THR B HG22 20 
ATOM 9741  H HG23 . THR B 1 56  ? 4.038   -6.164  3.647   1.00 0.00 ? 56  THR B HG23 20 
ATOM 9742  N N    . GLN B 1 57  ? 7.191   -5.651  7.334   1.00 0.00 ? 57  GLN B N    20 
ATOM 9743  C CA   . GLN B 1 57  ? 8.262   -5.222  8.276   1.00 0.00 ? 57  GLN B CA   20 
ATOM 9744  C C    . GLN B 1 57  ? 8.821   -3.870  7.828   1.00 0.00 ? 57  GLN B C    20 
ATOM 9745  O O    . GLN B 1 57  ? 9.134   -3.018  8.636   1.00 0.00 ? 57  GLN B O    20 
ATOM 9746  C CB   . GLN B 1 57  ? 9.384   -6.263  8.286   1.00 0.00 ? 57  GLN B CB   20 
ATOM 9747  C CG   . GLN B 1 57  ? 10.063  -6.267  9.657   1.00 0.00 ? 57  GLN B CG   20 
ATOM 9748  C CD   . GLN B 1 57  ? 9.742   -7.574  10.384  1.00 0.00 ? 57  GLN B CD   20 
ATOM 9749  O OE1  . GLN B 1 57  ? 10.609  -8.177  10.986  1.00 0.00 ? 57  GLN B OE1  20 
ATOM 9750  N NE2  . GLN B 1 57  ? 8.524   -8.041  10.356  1.00 0.00 ? 57  GLN B NE2  20 
ATOM 9751  H H    . GLN B 1 57  ? 7.319   -6.445  6.775   1.00 0.00 ? 57  GLN B H    20 
ATOM 9752  H HA   . GLN B 1 57  ? 7.849   -5.127  9.271   1.00 0.00 ? 57  GLN B HA   20 
ATOM 9753  H HB2  . GLN B 1 57  ? 8.969   -7.241  8.086   1.00 0.00 ? 57  GLN B HB2  20 
ATOM 9754  H HB3  . GLN B 1 57  ? 10.111  -6.016  7.527   1.00 0.00 ? 57  GLN B HB3  20 
ATOM 9755  H HG2  . GLN B 1 57  ? 11.132  -6.178  9.530   1.00 0.00 ? 57  GLN B HG2  20 
ATOM 9756  H HG3  . GLN B 1 57  ? 9.700   -5.434  10.241  1.00 0.00 ? 57  GLN B HG3  20 
ATOM 9757  H HE21 . GLN B 1 57  ? 7.824   -7.555  9.871   1.00 0.00 ? 57  GLN B HE21 20 
ATOM 9758  H HE22 . GLN B 1 57  ? 8.308   -8.878  10.820  1.00 0.00 ? 57  GLN B HE22 20 
ATOM 9759  N N    . TYR B 1 58  ? 8.945   -3.663  6.544   1.00 0.00 ? 58  TYR B N    20 
ATOM 9760  C CA   . TYR B 1 58  ? 9.480   -2.363  6.050   1.00 0.00 ? 58  TYR B CA   20 
ATOM 9761  C C    . TYR B 1 58  ? 8.487   -1.246  6.406   1.00 0.00 ? 58  TYR B C    20 
ATOM 9762  O O    . TYR B 1 58  ? 8.780   -0.077  6.261   1.00 0.00 ? 58  TYR B O    20 
ATOM 9763  C CB   . TYR B 1 58  ? 9.689   -2.437  4.523   1.00 0.00 ? 58  TYR B CB   20 
ATOM 9764  C CG   . TYR B 1 58  ? 9.511   -1.070  3.904   1.00 0.00 ? 58  TYR B CG   20 
ATOM 9765  C CD1  . TYR B 1 58  ? 10.553  -0.138  3.946   1.00 0.00 ? 58  TYR B CD1  20 
ATOM 9766  C CD2  . TYR B 1 58  ? 8.294   -0.733  3.301   1.00 0.00 ? 58  TYR B CD2  20 
ATOM 9767  C CE1  . TYR B 1 58  ? 10.378  1.130   3.383   1.00 0.00 ? 58  TYR B CE1  20 
ATOM 9768  C CE2  . TYR B 1 58  ? 8.118   0.534   2.741   1.00 0.00 ? 58  TYR B CE2  20 
ATOM 9769  C CZ   . TYR B 1 58  ? 9.160   1.465   2.782   1.00 0.00 ? 58  TYR B CZ   20 
ATOM 9770  O OH   . TYR B 1 58  ? 8.987   2.714   2.231   1.00 0.00 ? 58  TYR B OH   20 
ATOM 9771  H H    . TYR B 1 58  ? 8.685   -4.361  5.906   1.00 0.00 ? 58  TYR B H    20 
ATOM 9772  H HA   . TYR B 1 58  ? 10.426  -2.163  6.531   1.00 0.00 ? 58  TYR B HA   20 
ATOM 9773  H HB2  . TYR B 1 58  ? 10.688  -2.793  4.317   1.00 0.00 ? 58  TYR B HB2  20 
ATOM 9774  H HB3  . TYR B 1 58  ? 8.973   -3.119  4.089   1.00 0.00 ? 58  TYR B HB3  20 
ATOM 9775  H HD1  . TYR B 1 58  ? 11.493  -0.400  4.411   1.00 0.00 ? 58  TYR B HD1  20 
ATOM 9776  H HD2  . TYR B 1 58  ? 7.489   -1.454  3.270   1.00 0.00 ? 58  TYR B HD2  20 
ATOM 9777  H HE1  . TYR B 1 58  ? 11.181  1.851   3.414   1.00 0.00 ? 58  TYR B HE1  20 
ATOM 9778  H HE2  . TYR B 1 58  ? 7.179   0.796   2.276   1.00 0.00 ? 58  TYR B HE2  20 
ATOM 9779  H HH   . TYR B 1 58  ? 8.211   2.686   1.667   1.00 0.00 ? 58  TYR B HH   20 
ATOM 9780  N N    . SER B 1 59  ? 7.318   -1.596  6.865   1.00 0.00 ? 59  SER B N    20 
ATOM 9781  C CA   . SER B 1 59  ? 6.318   -0.551  7.224   1.00 0.00 ? 59  SER B CA   20 
ATOM 9782  C C    . SER B 1 59  ? 6.727   0.118   8.538   1.00 0.00 ? 59  SER B C    20 
ATOM 9783  O O    . SER B 1 59  ? 6.616   1.318   8.696   1.00 0.00 ? 59  SER B O    20 
ATOM 9784  C CB   . SER B 1 59  ? 4.941   -1.195  7.384   1.00 0.00 ? 59  SER B CB   20 
ATOM 9785  O OG   . SER B 1 59  ? 3.938   -0.249  7.032   1.00 0.00 ? 59  SER B OG   20 
ATOM 9786  H H    . SER B 1 59  ? 7.096   -2.545  6.974   1.00 0.00 ? 59  SER B H    20 
ATOM 9787  H HA   . SER B 1 59  ? 6.279   0.192   6.440   1.00 0.00 ? 59  SER B HA   20 
ATOM 9788  H HB2  . SER B 1 59  ? 4.863   -2.050  6.735   1.00 0.00 ? 59  SER B HB2  20 
ATOM 9789  H HB3  . SER B 1 59  ? 4.809   -1.511  8.411   1.00 0.00 ? 59  SER B HB3  20 
ATOM 9790  H HG   . SER B 1 59  ? 4.054   0.526   7.586   1.00 0.00 ? 59  SER B HG   20 
ATOM 9791  N N    . LYS B 1 60  ? 7.204   -0.647  9.484   1.00 0.00 ? 60  LYS B N    20 
ATOM 9792  C CA   . LYS B 1 60  ? 7.621   -0.049  10.783  1.00 0.00 ? 60  LYS B CA   20 
ATOM 9793  C C    . LYS B 1 60  ? 9.002   0.592   10.626  1.00 0.00 ? 60  LYS B C    20 
ATOM 9794  O O    . LYS B 1 60  ? 9.352   1.516   11.332  1.00 0.00 ? 60  LYS B O    20 
ATOM 9795  C CB   . LYS B 1 60  ? 7.681   -1.140  11.855  1.00 0.00 ? 60  LYS B CB   20 
ATOM 9796  C CG   . LYS B 1 60  ? 8.893   -2.040  11.605  1.00 0.00 ? 60  LYS B CG   20 
ATOM 9797  C CD   . LYS B 1 60  ? 8.616   -3.437  12.167  1.00 0.00 ? 60  LYS B CD   20 
ATOM 9798  C CE   . LYS B 1 60  ? 8.645   -3.389  13.695  1.00 0.00 ? 60  LYS B CE   20 
ATOM 9799  N NZ   . LYS B 1 60  ? 10.039  -3.131  14.158  1.00 0.00 ? 60  LYS B NZ   20 
ATOM 9800  H H    . LYS B 1 60  ? 7.288   -1.612  9.338   1.00 0.00 ? 60  LYS B H    20 
ATOM 9801  H HA   . LYS B 1 60  ? 6.906   0.706   11.077  1.00 0.00 ? 60  LYS B HA   20 
ATOM 9802  H HB2  . LYS B 1 60  ? 7.768   -0.682  12.830  1.00 0.00 ? 60  LYS B HB2  20 
ATOM 9803  H HB3  . LYS B 1 60  ? 6.780   -1.733  11.816  1.00 0.00 ? 60  LYS B HB3  20 
ATOM 9804  H HG2  . LYS B 1 60  ? 9.078   -2.108  10.543  1.00 0.00 ? 60  LYS B HG2  20 
ATOM 9805  H HG3  . LYS B 1 60  ? 9.760   -1.623  12.096  1.00 0.00 ? 60  LYS B HG3  20 
ATOM 9806  H HD2  . LYS B 1 60  ? 7.643   -3.771  11.834  1.00 0.00 ? 60  LYS B HD2  20 
ATOM 9807  H HD3  . LYS B 1 60  ? 9.371   -4.123  11.815  1.00 0.00 ? 60  LYS B HD3  20 
ATOM 9808  H HE2  . LYS B 1 60  ? 7.999   -2.596  14.043  1.00 0.00 ? 60  LYS B HE2  20 
ATOM 9809  H HE3  . LYS B 1 60  ? 8.303   -4.333  14.092  1.00 0.00 ? 60  LYS B HE3  20 
ATOM 9810  H HZ1  . LYS B 1 60  ? 10.685  -3.814  13.712  1.00 0.00 ? 60  LYS B HZ1  20 
ATOM 9811  H HZ2  . LYS B 1 60  ? 10.320  -2.167  13.892  1.00 0.00 ? 60  LYS B HZ2  20 
ATOM 9812  H HZ3  . LYS B 1 60  ? 10.084  -3.234  15.192  1.00 0.00 ? 60  LYS B HZ3  20 
ATOM 9813  N N    . VAL B 1 61  ? 9.787   0.108   9.702   1.00 0.00 ? 61  VAL B N    20 
ATOM 9814  C CA   . VAL B 1 61  ? 11.141  0.689   9.495   1.00 0.00 ? 61  VAL B CA   20 
ATOM 9815  C C    . VAL B 1 61  ? 11.004  2.055   8.817   1.00 0.00 ? 61  VAL B C    20 
ATOM 9816  O O    . VAL B 1 61  ? 11.617  3.022   9.219   1.00 0.00 ? 61  VAL B O    20 
ATOM 9817  C CB   . VAL B 1 61  ? 11.959  -0.254  8.607   1.00 0.00 ? 61  VAL B CB   20 
ATOM 9818  C CG1  . VAL B 1 61  ? 13.160  0.490   8.023   1.00 0.00 ? 61  VAL B CG1  20 
ATOM 9819  C CG2  . VAL B 1 61  ? 12.455  -1.433  9.444   1.00 0.00 ? 61  VAL B CG2  20 
ATOM 9820  H H    . VAL B 1 61  ? 9.486   -0.635  9.142   1.00 0.00 ? 61  VAL B H    20 
ATOM 9821  H HA   . VAL B 1 61  ? 11.634  0.806   10.448  1.00 0.00 ? 61  VAL B HA   20 
ATOM 9822  H HB   . VAL B 1 61  ? 11.337  -0.619  7.802   1.00 0.00 ? 61  VAL B HB   20 
ATOM 9823  H HG11 . VAL B 1 61  ? 13.250  1.455   8.499   1.00 0.00 ? 61  VAL B HG11 20 
ATOM 9824  H HG12 . VAL B 1 61  ? 14.057  -0.084  8.196   1.00 0.00 ? 61  VAL B HG12 20 
ATOM 9825  H HG13 . VAL B 1 61  ? 13.017  0.625   6.961   1.00 0.00 ? 61  VAL B HG13 20 
ATOM 9826  H HG21 . VAL B 1 61  ? 11.945  -1.440  10.395  1.00 0.00 ? 61  VAL B HG21 20 
ATOM 9827  H HG22 . VAL B 1 61  ? 12.254  -2.357  8.921   1.00 0.00 ? 61  VAL B HG22 20 
ATOM 9828  H HG23 . VAL B 1 61  ? 13.519  -1.336  9.607   1.00 0.00 ? 61  VAL B HG23 20 
ATOM 9829  N N    . LEU B 1 62  ? 10.204  2.135   7.791   1.00 0.00 ? 62  LEU B N    20 
ATOM 9830  C CA   . LEU B 1 62  ? 10.022  3.432   7.084   1.00 0.00 ? 62  LEU B CA   20 
ATOM 9831  C C    . LEU B 1 62  ? 9.090   4.328   7.905   1.00 0.00 ? 62  LEU B C    20 
ATOM 9832  O O    . LEU B 1 62  ? 9.180   5.538   7.856   1.00 0.00 ? 62  LEU B O    20 
ATOM 9833  C CB   . LEU B 1 62  ? 9.423   3.158   5.699   1.00 0.00 ? 62  LEU B CB   20 
ATOM 9834  C CG   . LEU B 1 62  ? 8.913   4.453   5.055   1.00 0.00 ? 62  LEU B CG   20 
ATOM 9835  C CD1  . LEU B 1 62  ? 10.025  5.106   4.226   1.00 0.00 ? 62  LEU B CD1  20 
ATOM 9836  C CD2  . LEU B 1 62  ? 7.739   4.112   4.139   1.00 0.00 ? 62  LEU B CD2  20 
ATOM 9837  H H    . LEU B 1 62  ? 9.721   1.341   7.485   1.00 0.00 ? 62  LEU B H    20 
ATOM 9838  H HA   . LEU B 1 62  ? 10.983  3.917   6.972   1.00 0.00 ? 62  LEU B HA   20 
ATOM 9839  H HB2  . LEU B 1 62  ? 10.181  2.723   5.068   1.00 0.00 ? 62  LEU B HB2  20 
ATOM 9840  H HB3  . LEU B 1 62  ? 8.602   2.464   5.799   1.00 0.00 ? 62  LEU B HB3  20 
ATOM 9841  H HG   . LEU B 1 62  ? 8.584   5.140   5.820   1.00 0.00 ? 62  LEU B HG   20 
ATOM 9842  H HD11 . LEU B 1 62  ? 10.906  4.485   4.251   1.00 0.00 ? 62  LEU B HD11 20 
ATOM 9843  H HD12 . LEU B 1 62  ? 9.692   5.219   3.204   1.00 0.00 ? 62  LEU B HD12 20 
ATOM 9844  H HD13 . LEU B 1 62  ? 10.256  6.079   4.636   1.00 0.00 ? 62  LEU B HD13 20 
ATOM 9845  H HD21 . LEU B 1 62  ? 7.773   3.063   3.888   1.00 0.00 ? 62  LEU B HD21 20 
ATOM 9846  H HD22 . LEU B 1 62  ? 6.816   4.329   4.647   1.00 0.00 ? 62  LEU B HD22 20 
ATOM 9847  H HD23 . LEU B 1 62  ? 7.804   4.702   3.236   1.00 0.00 ? 62  LEU B HD23 20 
ATOM 9848  N N    . ALA B 1 63  ? 8.203   3.747   8.668   1.00 0.00 ? 63  ALA B N    20 
ATOM 9849  C CA   . ALA B 1 63  ? 7.284   4.582   9.496   1.00 0.00 ? 63  ALA B CA   20 
ATOM 9850  C C    . ALA B 1 63  ? 8.128   5.447   10.433  1.00 0.00 ? 63  ALA B C    20 
ATOM 9851  O O    . ALA B 1 63  ? 7.928   6.640   10.542  1.00 0.00 ? 63  ALA B O    20 
ATOM 9852  C CB   . ALA B 1 63  ? 6.355   3.677   10.314  1.00 0.00 ? 63  ALA B CB   20 
ATOM 9853  H H    . ALA B 1 63  ? 8.147   2.770   8.705   1.00 0.00 ? 63  ALA B H    20 
ATOM 9854  H HA   . ALA B 1 63  ? 6.697   5.219   8.852   1.00 0.00 ? 63  ALA B HA   20 
ATOM 9855  H HB1  . ALA B 1 63  ? 6.844   2.734   10.504  1.00 0.00 ? 63  ALA B HB1  20 
ATOM 9856  H HB2  . ALA B 1 63  ? 6.116   4.157   11.251  1.00 0.00 ? 63  ALA B HB2  20 
ATOM 9857  H HB3  . ALA B 1 63  ? 5.443   3.503   9.759   1.00 0.00 ? 63  ALA B HB3  20 
ATOM 9858  N N    . LEU B 1 64  ? 9.088   4.856   11.092  1.00 0.00 ? 64  LEU B N    20 
ATOM 9859  C CA   . LEU B 1 64  ? 9.967   5.645   11.998  1.00 0.00 ? 64  LEU B CA   20 
ATOM 9860  C C    . LEU B 1 64  ? 10.917  6.472   11.140  1.00 0.00 ? 64  LEU B C    20 
ATOM 9861  O O    . LEU B 1 64  ? 11.187  7.618   11.415  1.00 0.00 ? 64  LEU B O    20 
ATOM 9862  C CB   . LEU B 1 64  ? 10.787  4.695   12.872  1.00 0.00 ? 64  LEU B CB   20 
ATOM 9863  C CG   . LEU B 1 64  ? 9.884   4.068   13.926  1.00 0.00 ? 64  LEU B CG   20 
ATOM 9864  C CD1  . LEU B 1 64  ? 10.480  2.736   14.378  1.00 0.00 ? 64  LEU B CD1  20 
ATOM 9865  C CD2  . LEU B 1 64  ? 9.772   5.008   15.128  1.00 0.00 ? 64  LEU B CD2  20 
ATOM 9866  H H    . LEU B 1 64  ? 9.244   3.896   10.973  1.00 0.00 ? 64  LEU B H    20 
ATOM 9867  H HA   . LEU B 1 64  ? 9.369   6.298   12.621  1.00 0.00 ? 64  LEU B HA   20 
ATOM 9868  H HB2  . LEU B 1 64  ? 11.210  3.916   12.255  1.00 0.00 ? 64  LEU B HB2  20 
ATOM 9869  H HB3  . LEU B 1 64  ? 11.580  5.242   13.357  1.00 0.00 ? 64  LEU B HB3  20 
ATOM 9870  H HG   . LEU B 1 64  ? 8.909   3.901   13.500  1.00 0.00 ? 64  LEU B HG   20 
ATOM 9871  H HD11 . LEU B 1 64  ? 11.086  2.326   13.584  1.00 0.00 ? 64  LEU B HD11 20 
ATOM 9872  H HD12 . LEU B 1 64  ? 11.093  2.896   15.253  1.00 0.00 ? 64  LEU B HD12 20 
ATOM 9873  H HD13 . LEU B 1 64  ? 9.684   2.048   14.616  1.00 0.00 ? 64  LEU B HD13 20 
ATOM 9874  H HD21 . LEU B 1 64  ? 9.639   6.022   14.780  1.00 0.00 ? 64  LEU B HD21 20 
ATOM 9875  H HD22 . LEU B 1 64  ? 8.924   4.722   15.732  1.00 0.00 ? 64  LEU B HD22 20 
ATOM 9876  H HD23 . LEU B 1 64  ? 10.674  4.946   15.719  1.00 0.00 ? 64  LEU B HD23 20 
ATOM 9877  N N    . TYR B 1 65  ? 11.419  5.883   10.095  1.00 0.00 ? 65  TYR B N    20 
ATOM 9878  C CA   . TYR B 1 65  ? 12.354  6.612   9.192   1.00 0.00 ? 65  TYR B CA   20 
ATOM 9879  C C    . TYR B 1 65  ? 11.821  8.026   8.940   1.00 0.00 ? 65  TYR B C    20 
ATOM 9880  O O    . TYR B 1 65  ? 12.538  9.001   9.040   1.00 0.00 ? 65  TYR B O    20 
ATOM 9881  C CB   . TYR B 1 65  ? 12.450  5.855   7.866   1.00 0.00 ? 65  TYR B CB   20 
ATOM 9882  C CG   . TYR B 1 65  ? 13.203  6.683   6.857   1.00 0.00 ? 65  TYR B CG   20 
ATOM 9883  C CD1  . TYR B 1 65  ? 14.599  6.604   6.787   1.00 0.00 ? 65  TYR B CD1  20 
ATOM 9884  C CD2  . TYR B 1 65  ? 12.502  7.526   5.984   1.00 0.00 ? 65  TYR B CD2  20 
ATOM 9885  C CE1  . TYR B 1 65  ? 15.295  7.370   5.844   1.00 0.00 ? 65  TYR B CE1  20 
ATOM 9886  C CE2  . TYR B 1 65  ? 13.199  8.289   5.040   1.00 0.00 ? 65  TYR B CE2  20 
ATOM 9887  C CZ   . TYR B 1 65  ? 14.595  8.210   4.970   1.00 0.00 ? 65  TYR B CZ   20 
ATOM 9888  O OH   . TYR B 1 65  ? 15.283  8.964   4.041   1.00 0.00 ? 65  TYR B OH   20 
ATOM 9889  H H    . TYR B 1 65  ? 11.177  4.953   9.902   1.00 0.00 ? 65  TYR B H    20 
ATOM 9890  H HA   . TYR B 1 65  ? 13.330  6.668   9.648   1.00 0.00 ? 65  TYR B HA   20 
ATOM 9891  H HB2  . TYR B 1 65  ? 12.969  4.921   8.021   1.00 0.00 ? 65  TYR B HB2  20 
ATOM 9892  H HB3  . TYR B 1 65  ? 11.456  5.655   7.494   1.00 0.00 ? 65  TYR B HB3  20 
ATOM 9893  H HD1  . TYR B 1 65  ? 15.140  5.953   7.465   1.00 0.00 ? 65  TYR B HD1  20 
ATOM 9894  H HD2  . TYR B 1 65  ? 11.424  7.585   6.038   1.00 0.00 ? 65  TYR B HD2  20 
ATOM 9895  H HE1  . TYR B 1 65  ? 16.371  7.308   5.787   1.00 0.00 ? 65  TYR B HE1  20 
ATOM 9896  H HE2  . TYR B 1 65  ? 12.660  8.939   4.367   1.00 0.00 ? 65  TYR B HE2  20 
ATOM 9897  H HH   . TYR B 1 65  ? 14.641  9.358   3.445   1.00 0.00 ? 65  TYR B HH   20 
ATOM 9898  N N    . ASN B 1 66  ? 10.562  8.139   8.615   1.00 0.00 ? 66  ASN B N    20 
ATOM 9899  C CA   . ASN B 1 66  ? 9.963   9.478   8.357   1.00 0.00 ? 66  ASN B CA   20 
ATOM 9900  C C    . ASN B 1 66  ? 9.752   10.201  9.683   1.00 0.00 ? 66  ASN B C    20 
ATOM 9901  O O    . ASN B 1 66  ? 10.125  11.346  9.854   1.00 0.00 ? 66  ASN B O    20 
ATOM 9902  C CB   . ASN B 1 66  ? 8.609   9.282   7.692   1.00 0.00 ? 66  ASN B CB   20 
ATOM 9903  C CG   . ASN B 1 66  ? 8.292   10.473  6.788   1.00 0.00 ? 66  ASN B CG   20 
ATOM 9904  O OD1  . ASN B 1 66  ? 9.000   10.731  5.835   1.00 0.00 ? 66  ASN B OD1  20 
ATOM 9905  N ND2  . ASN B 1 66  ? 7.249   11.213  7.048   1.00 0.00 ? 66  ASN B ND2  20 
ATOM 9906  H H    . ASN B 1 66  ? 10.004  7.338   8.544   1.00 0.00 ? 66  ASN B H    20 
ATOM 9907  H HA   . ASN B 1 66  ? 10.608  10.059  7.714   1.00 0.00 ? 66  ASN B HA   20 
ATOM 9908  H HB2  . ASN B 1 66  ? 8.626   8.377   7.107   1.00 0.00 ? 66  ASN B HB2  20 
ATOM 9909  H HB3  . ASN B 1 66  ? 7.855   9.200   8.459   1.00 0.00 ? 66  ASN B HB3  20 
ATOM 9910  H HD21 . ASN B 1 66  ? 6.678   11.003  7.816   1.00 0.00 ? 66  ASN B HD21 20 
ATOM 9911  H HD22 . ASN B 1 66  ? 7.035   11.978  6.474   1.00 0.00 ? 66  ASN B HD22 20 
ATOM 9912  N N    . GLN B 1 67  ? 9.151   9.528   10.624  1.00 0.00 ? 67  GLN B N    20 
ATOM 9913  C CA   . GLN B 1 67  ? 8.896   10.143  11.959  1.00 0.00 ? 67  GLN B CA   20 
ATOM 9914  C C    . GLN B 1 67  ? 10.214  10.601  12.590  1.00 0.00 ? 67  GLN B C    20 
ATOM 9915  O O    . GLN B 1 67  ? 10.230  11.305  13.579  1.00 0.00 ? 67  GLN B O    20 
ATOM 9916  C CB   . GLN B 1 67  ? 8.244   9.098   12.863  1.00 0.00 ? 67  GLN B CB   20 
ATOM 9917  C CG   . GLN B 1 67  ? 6.722   9.180   12.726  1.00 0.00 ? 67  GLN B CG   20 
ATOM 9918  C CD   . GLN B 1 67  ? 6.140   9.920   13.931  1.00 0.00 ? 67  GLN B CD   20 
ATOM 9919  O OE1  . GLN B 1 67  ? 5.057   9.609   14.385  1.00 0.00 ? 67  GLN B OE1  20 
ATOM 9920  N NE2  . GLN B 1 67  ? 6.818   10.896  14.471  1.00 0.00 ? 67  GLN B NE2  20 
ATOM 9921  H H    . GLN B 1 67  ? 8.863   8.606   10.449  1.00 0.00 ? 67  GLN B H    20 
ATOM 9922  H HA   . GLN B 1 67  ? 8.238   10.986  11.849  1.00 0.00 ? 67  GLN B HA   20 
ATOM 9923  H HB2  . GLN B 1 67  ? 8.582   8.115   12.568  1.00 0.00 ? 67  GLN B HB2  20 
ATOM 9924  H HB3  . GLN B 1 67  ? 8.523   9.279   13.889  1.00 0.00 ? 67  GLN B HB3  20 
ATOM 9925  H HG2  . GLN B 1 67  ? 6.471   9.711   11.819  1.00 0.00 ? 67  GLN B HG2  20 
ATOM 9926  H HG3  . GLN B 1 67  ? 6.309   8.183   12.685  1.00 0.00 ? 67  GLN B HG3  20 
ATOM 9927  H HE21 . GLN B 1 67  ? 7.691   11.148  14.106  1.00 0.00 ? 67  GLN B HE21 20 
ATOM 9928  H HE22 . GLN B 1 67  ? 6.453   11.377  15.244  1.00 0.00 ? 67  GLN B HE22 20 
ATOM 9929  N N    . HIS B 1 68  ? 11.313  10.199  12.028  1.00 0.00 ? 68  HIS B N    20 
ATOM 9930  C CA   . HIS B 1 68  ? 12.635  10.599  12.591  1.00 0.00 ? 68  HIS B CA   20 
ATOM 9931  C C    . HIS B 1 68  ? 13.217  11.760  11.781  1.00 0.00 ? 68  HIS B C    20 
ATOM 9932  O O    . HIS B 1 68  ? 13.839  12.654  12.319  1.00 0.00 ? 68  HIS B O    20 
ATOM 9933  C CB   . HIS B 1 68  ? 13.597  9.412   12.525  1.00 0.00 ? 68  HIS B CB   20 
ATOM 9934  C CG   . HIS B 1 68  ? 13.510  8.619   13.798  1.00 0.00 ? 68  HIS B CG   20 
ATOM 9935  N ND1  . HIS B 1 68  ? 12.652  7.541   13.946  1.00 0.00 ? 68  HIS B ND1  20 
ATOM 9936  C CD2  . HIS B 1 68  ? 14.181  8.731   14.988  1.00 0.00 ? 68  HIS B CD2  20 
ATOM 9937  C CE1  . HIS B 1 68  ? 12.826  7.052   15.187  1.00 0.00 ? 68  HIS B CE1  20 
ATOM 9938  N NE2  . HIS B 1 68  ? 13.748  7.741   15.866  1.00 0.00 ? 68  HIS B NE2  20 
ATOM 9939  H H    . HIS B 1 68  ? 11.270  9.630   11.236  1.00 0.00 ? 68  HIS B H    20 
ATOM 9940  H HA   . HIS B 1 68  ? 12.511  10.905  13.618  1.00 0.00 ? 68  HIS B HA   20 
ATOM 9941  H HB2  . HIS B 1 68  ? 13.333  8.782   11.688  1.00 0.00 ? 68  HIS B HB2  20 
ATOM 9942  H HB3  . HIS B 1 68  ? 14.604  9.776   12.396  1.00 0.00 ? 68  HIS B HB3  20 
ATOM 9943  H HD1  . HIS B 1 68  ? 12.031  7.198   13.272  1.00 0.00 ? 68  HIS B HD1  20 
ATOM 9944  H HD2  . HIS B 1 68  ? 14.933  9.473   15.208  1.00 0.00 ? 68  HIS B HD2  20 
ATOM 9945  H HE1  . HIS B 1 68  ? 12.290  6.203   15.584  1.00 0.00 ? 68  HIS B HE1  20 
ATOM 9946  N N    . ASN B 1 69  ? 13.029  11.748  10.492  1.00 0.00 ? 69  ASN B N    20 
ATOM 9947  C CA   . ASN B 1 69  ? 13.581  12.845  9.650   1.00 0.00 ? 69  ASN B CA   20 
ATOM 9948  C C    . ASN B 1 69  ? 12.513  13.928  9.446   1.00 0.00 ? 69  ASN B C    20 
ATOM 9949  O O    . ASN B 1 69  ? 11.468  13.659  8.887   1.00 0.00 ? 69  ASN B O    20 
ATOM 9950  C CB   . ASN B 1 69  ? 13.989  12.278  8.288   1.00 0.00 ? 69  ASN B CB   20 
ATOM 9951  C CG   . ASN B 1 69  ? 15.192  11.348  8.461   1.00 0.00 ? 69  ASN B CG   20 
ATOM 9952  O OD1  . ASN B 1 69  ? 15.108  10.350  9.148   1.00 0.00 ? 69  ASN B OD1  20 
ATOM 9953  N ND2  . ASN B 1 69  ? 16.315  11.637  7.862   1.00 0.00 ? 69  ASN B ND2  20 
ATOM 9954  H H    . ASN B 1 69  ? 12.532  11.012  10.078  1.00 0.00 ? 69  ASN B H    20 
ATOM 9955  H HA   . ASN B 1 69  ? 14.447  13.265  10.135  1.00 0.00 ? 69  ASN B HA   20 
ATOM 9956  H HB2  . ASN B 1 69  ? 13.161  11.724  7.868   1.00 0.00 ? 69  ASN B HB2  20 
ATOM 9957  H HB3  . ASN B 1 69  ? 14.254  13.088  7.625   1.00 0.00 ? 69  ASN B HB3  20 
ATOM 9958  H HD21 . ASN B 1 69  ? 16.382  12.441  7.307   1.00 0.00 ? 69  ASN B HD21 20 
ATOM 9959  H HD22 . ASN B 1 69  ? 17.091  11.047  7.966   1.00 0.00 ? 69  ASN B HD22 20 
ATOM 9960  N N    . PRO B 1 70  ? 12.805  15.123  9.900   1.00 0.00 ? 70  PRO B N    20 
ATOM 9961  C CA   . PRO B 1 70  ? 11.882  16.263  9.773   1.00 0.00 ? 70  PRO B CA   20 
ATOM 9962  C C    . PRO B 1 70  ? 11.933  16.826  8.350   1.00 0.00 ? 70  PRO B C    20 
ATOM 9963  O O    . PRO B 1 70  ? 12.957  17.293  7.894   1.00 0.00 ? 70  PRO B O    20 
ATOM 9964  C CB   . PRO B 1 70  ? 12.423  17.279  10.783  1.00 0.00 ? 70  PRO B CB   20 
ATOM 9965  C CG   . PRO B 1 70  ? 13.909  16.919  11.010  1.00 0.00 ? 70  PRO B CG   20 
ATOM 9966  C CD   . PRO B 1 70  ? 14.077  15.449  10.580  1.00 0.00 ? 70  PRO B CD   20 
ATOM 9967  H HA   . PRO B 1 70  ? 10.878  15.976  10.038  1.00 0.00 ? 70  PRO B HA   20 
ATOM 9968  H HB2  . PRO B 1 70  ? 12.336  18.281  10.381  1.00 0.00 ? 70  PRO B HB2  20 
ATOM 9969  H HB3  . PRO B 1 70  ? 11.884  17.202  11.714  1.00 0.00 ? 70  PRO B HB3  20 
ATOM 9970  H HG2  . PRO B 1 70  ? 14.541  17.558  10.407  1.00 0.00 ? 70  PRO B HG2  20 
ATOM 9971  H HG3  . PRO B 1 70  ? 14.163  17.024  12.052  1.00 0.00 ? 70  PRO B HG3  20 
ATOM 9972  H HD2  . PRO B 1 70  ? 14.910  15.348  9.898   1.00 0.00 ? 70  PRO B HD2  20 
ATOM 9973  H HD3  . PRO B 1 70  ? 14.211  14.816  11.443  1.00 0.00 ? 70  PRO B HD3  20 
ATOM 9974  N N    . GLY B 1 71  ? 10.837  16.779  7.645   1.00 0.00 ? 71  GLY B N    20 
ATOM 9975  C CA   . GLY B 1 71  ? 10.826  17.304  6.251   1.00 0.00 ? 71  GLY B CA   20 
ATOM 9976  C C    . GLY B 1 71  ? 10.933  16.135  5.271   1.00 0.00 ? 71  GLY B C    20 
ATOM 9977  O O    . GLY B 1 71  ? 11.241  16.312  4.109   1.00 0.00 ? 71  GLY B O    20 
ATOM 9978  H H    . GLY B 1 71  ? 10.022  16.394  8.032   1.00 0.00 ? 71  GLY B H    20 
ATOM 9979  H HA2  . GLY B 1 71  ? 9.904   17.842  6.077   1.00 0.00 ? 71  GLY B HA2  20 
ATOM 9980  H HA3  . GLY B 1 71  ? 11.664  17.968  6.109   1.00 0.00 ? 71  GLY B HA3  20 
ATOM 9981  N N    . ALA B 1 72  ? 10.675  14.942  5.733   1.00 0.00 ? 72  ALA B N    20 
ATOM 9982  C CA   . ALA B 1 72  ? 10.755  13.760  4.838   1.00 0.00 ? 72  ALA B CA   20 
ATOM 9983  C C    . ALA B 1 72  ? 9.346   13.231  4.587   1.00 0.00 ? 72  ALA B C    20 
ATOM 9984  O O    . ALA B 1 72  ? 8.588   12.992  5.505   1.00 0.00 ? 72  ALA B O    20 
ATOM 9985  C CB   . ALA B 1 72  ? 11.595  12.666  5.499   1.00 0.00 ? 72  ALA B CB   20 
ATOM 9986  H H    . ALA B 1 72  ? 10.426  14.824  6.669   1.00 0.00 ? 72  ALA B H    20 
ATOM 9987  H HA   . ALA B 1 72  ? 11.207  14.046  3.900   1.00 0.00 ? 72  ALA B HA   20 
ATOM 9988  H HB1  . ALA B 1 72  ? 12.586  13.044  5.699   1.00 0.00 ? 72  ALA B HB1  20 
ATOM 9989  H HB2  . ALA B 1 72  ? 11.130  12.367  6.427   1.00 0.00 ? 72  ALA B HB2  20 
ATOM 9990  H HB3  . ALA B 1 72  ? 11.661  11.814  4.838   1.00 0.00 ? 72  ALA B HB3  20 
ATOM 9991  N N    . SER B 1 73  ? 8.992   13.049  3.352   1.00 0.00 ? 73  SER B N    20 
ATOM 9992  C CA   . SER B 1 73  ? 7.631   12.533  3.033   1.00 0.00 ? 73  SER B CA   20 
ATOM 9993  C C    . SER B 1 73  ? 7.743   11.098  2.521   1.00 0.00 ? 73  SER B C    20 
ATOM 9994  O O    . SER B 1 73  ? 6.904   10.625  1.781   1.00 0.00 ? 73  SER B O    20 
ATOM 9995  C CB   . SER B 1 73  ? 6.991   13.411  1.955   1.00 0.00 ? 73  SER B CB   20 
ATOM 9996  O OG   . SER B 1 73  ? 6.852   14.736  2.450   1.00 0.00 ? 73  SER B OG   20 
ATOM 9997  H H    . SER B 1 73  ? 9.622   13.252  2.633   1.00 0.00 ? 73  SER B H    20 
ATOM 9998  H HA   . SER B 1 73  ? 7.020   12.553  3.923   1.00 0.00 ? 73  SER B HA   20 
ATOM 9999  H HB2  . SER B 1 73  ? 7.618   13.423  1.079   1.00 0.00 ? 73  SER B HB2  20 
ATOM 10000 H HB3  . SER B 1 73  ? 6.021   13.008  1.695   1.00 0.00 ? 73  SER B HB3  20 
ATOM 10001 H HG   . SER B 1 73  ? 5.925   14.880  2.654   1.00 0.00 ? 73  SER B HG   20 
ATOM 10002 N N    . ALA B 1 74  ? 8.776   10.398  2.909   1.00 0.00 ? 74  ALA B N    20 
ATOM 10003 C CA   . ALA B 1 74  ? 8.944   8.993   2.440   1.00 0.00 ? 74  ALA B CA   20 
ATOM 10004 C C    . ALA B 1 74  ? 8.163   8.045   3.353   1.00 0.00 ? 74  ALA B C    20 
ATOM 10005 O O    . ALA B 1 74  ? 8.374   6.849   3.343   1.00 0.00 ? 74  ALA B O    20 
ATOM 10006 C CB   . ALA B 1 74  ? 10.428  8.621   2.467   1.00 0.00 ? 74  ALA B CB   20 
ATOM 10007 H H    . ALA B 1 74  ? 9.442   10.799  3.505   1.00 0.00 ? 74  ALA B H    20 
ATOM 10008 H HA   . ALA B 1 74  ? 8.571   8.905   1.432   1.00 0.00 ? 74  ALA B HA   20 
ATOM 10009 H HB1  . ALA B 1 74  ? 10.880  9.004   3.371   1.00 0.00 ? 74  ALA B HB1  20 
ATOM 10010 H HB2  . ALA B 1 74  ? 10.531  7.546   2.441   1.00 0.00 ? 74  ALA B HB2  20 
ATOM 10011 H HB3  . ALA B 1 74  ? 10.923  9.050   1.608   1.00 0.00 ? 74  ALA B HB3  20 
ATOM 10012 N N    . ALA B 1 75  ? 7.259   8.566   4.139   1.00 0.00 ? 75  ALA B N    20 
ATOM 10013 C CA   . ALA B 1 75  ? 6.463   7.690   5.046   1.00 0.00 ? 75  ALA B CA   20 
ATOM 10014 C C    . ALA B 1 75  ? 5.881   6.525   4.238   1.00 0.00 ? 75  ALA B C    20 
ATOM 10015 O O    . ALA B 1 75  ? 6.121   6.422   3.051   1.00 0.00 ? 75  ALA B O    20 
ATOM 10016 C CB   . ALA B 1 75  ? 5.330   8.512   5.665   1.00 0.00 ? 75  ALA B CB   20 
ATOM 10017 H H    . ALA B 1 75  ? 7.104   9.532   4.130   1.00 0.00 ? 75  ALA B H    20 
ATOM 10018 H HA   . ALA B 1 75  ? 7.102   7.306   5.829   1.00 0.00 ? 75  ALA B HA   20 
ATOM 10019 H HB1  . ALA B 1 75  ? 5.502   9.562   5.477   1.00 0.00 ? 75  ALA B HB1  20 
ATOM 10020 H HB2  . ALA B 1 75  ? 4.389   8.217   5.223   1.00 0.00 ? 75  ALA B HB2  20 
ATOM 10021 H HB3  . ALA B 1 75  ? 5.298   8.337   6.729   1.00 0.00 ? 75  ALA B HB3  20 
ATOM 10022 N N    . PRO B 1 76  ? 5.137   5.672   4.898   1.00 0.00 ? 76  PRO B N    20 
ATOM 10023 C CA   . PRO B 1 76  ? 4.526   4.501   4.249   1.00 0.00 ? 76  PRO B CA   20 
ATOM 10024 C C    . PRO B 1 76  ? 3.301   4.923   3.441   1.00 0.00 ? 76  PRO B C    20 
ATOM 10025 O O    . PRO B 1 76  ? 3.096   6.089   3.167   1.00 0.00 ? 76  PRO B O    20 
ATOM 10026 C CB   . PRO B 1 76  ? 4.122   3.605   5.420   1.00 0.00 ? 76  PRO B CB   20 
ATOM 10027 C CG   . PRO B 1 76  ? 3.995   4.532   6.649   1.00 0.00 ? 76  PRO B CG   20 
ATOM 10028 C CD   . PRO B 1 76  ? 4.831   5.792   6.340   1.00 0.00 ? 76  PRO B CD   20 
ATOM 10029 H HA   . PRO B 1 76  ? 5.241   3.993   3.623   1.00 0.00 ? 76  PRO B HA   20 
ATOM 10030 H HB2  . PRO B 1 76  ? 3.175   3.127   5.211   1.00 0.00 ? 76  PRO B HB2  20 
ATOM 10031 H HB3  . PRO B 1 76  ? 4.884   2.863   5.602   1.00 0.00 ? 76  PRO B HB3  20 
ATOM 10032 H HG2  . PRO B 1 76  ? 2.957   4.799   6.798   1.00 0.00 ? 76  PRO B HG2  20 
ATOM 10033 H HG3  . PRO B 1 76  ? 4.382   4.041   7.526   1.00 0.00 ? 76  PRO B HG3  20 
ATOM 10034 H HD2  . PRO B 1 76  ? 4.250   6.680   6.538   1.00 0.00 ? 76  PRO B HD2  20 
ATOM 10035 H HD3  . PRO B 1 76  ? 5.743   5.793   6.917   1.00 0.00 ? 76  PRO B HD3  20 
ATOM 10036 N N    . CYS B 1 77  ? 2.485   3.984   3.058   1.00 0.00 ? 77  CYS B N    20 
ATOM 10037 C CA   . CYS B 1 77  ? 1.275   4.336   2.271   1.00 0.00 ? 77  CYS B CA   20 
ATOM 10038 C C    . CYS B 1 77  ? 0.088   3.513   2.765   1.00 0.00 ? 77  CYS B C    20 
ATOM 10039 O O    . CYS B 1 77  ? -0.080  2.373   2.395   1.00 0.00 ? 77  CYS B O    20 
ATOM 10040 C CB   . CYS B 1 77  ? 1.525   4.037   0.791   1.00 0.00 ? 77  CYS B CB   20 
ATOM 10041 S SG   . CYS B 1 77  ? 1.053   5.475   -0.203  1.00 0.00 ? 77  CYS B SG   20 
ATOM 10042 H H    . CYS B 1 77  ? 2.668   3.049   3.288   1.00 0.00 ? 77  CYS B H    20 
ATOM 10043 H HA   . CYS B 1 77  ? 1.060   5.388   2.393   1.00 0.00 ? 77  CYS B HA   20 
ATOM 10044 H HB2  . CYS B 1 77  ? 2.573   3.822   0.639   1.00 0.00 ? 77  CYS B HB2  20 
ATOM 10045 H HB3  . CYS B 1 77  ? 0.936   3.183   0.492   1.00 0.00 ? 77  CYS B HB3  20 
ATOM 10046 N N    . CYS B 1 78  ? -0.736  4.081   3.601   1.00 0.00 ? 78  CYS B N    20 
ATOM 10047 C CA   . CYS B 1 78  ? -1.921  3.334   4.115   1.00 0.00 ? 78  CYS B CA   20 
ATOM 10048 C C    . CYS B 1 78  ? -2.697  2.735   2.932   1.00 0.00 ? 78  CYS B C    20 
ATOM 10049 O O    . CYS B 1 78  ? -2.933  3.396   1.939   1.00 0.00 ? 78  CYS B O    20 
ATOM 10050 C CB   . CYS B 1 78  ? -2.818  4.307   4.886   1.00 0.00 ? 78  CYS B CB   20 
ATOM 10051 S SG   . CYS B 1 78  ? -4.246  3.424   5.563   1.00 0.00 ? 78  CYS B SG   20 
ATOM 10052 H H    . CYS B 1 78  ? -0.573  5.005   3.891   1.00 0.00 ? 78  CYS B H    20 
ATOM 10053 H HA   . CYS B 1 78  ? -1.594  2.542   4.773   1.00 0.00 ? 78  CYS B HA   20 
ATOM 10054 H HB2  . CYS B 1 78  ? -2.255  4.750   5.694   1.00 0.00 ? 78  CYS B HB2  20 
ATOM 10055 H HB3  . CYS B 1 78  ? -3.160  5.084   4.219   1.00 0.00 ? 78  CYS B HB3  20 
ATOM 10056 N N    . VAL B 1 79  ? -3.088  1.487   3.021   1.00 0.00 ? 79  VAL B N    20 
ATOM 10057 C CA   . VAL B 1 79  ? -3.838  0.850   1.896   1.00 0.00 ? 79  VAL B CA   20 
ATOM 10058 C C    . VAL B 1 79  ? -4.880  -0.126  2.465   1.00 0.00 ? 79  VAL B C    20 
ATOM 10059 O O    . VAL B 1 79  ? -5.014  -0.238  3.661   1.00 0.00 ? 79  VAL B O    20 
ATOM 10060 C CB   . VAL B 1 79  ? -2.845  0.113   0.978   1.00 0.00 ? 79  VAL B CB   20 
ATOM 10061 C CG1  . VAL B 1 79  ? -1.501  0.829   1.011   1.00 0.00 ? 79  VAL B CG1  20 
ATOM 10062 C CG2  . VAL B 1 79  ? -2.643  -1.333  1.448   1.00 0.00 ? 79  VAL B CG2  20 
ATOM 10063 H H    . VAL B 1 79  ? -2.887  0.970   3.821   1.00 0.00 ? 79  VAL B H    20 
ATOM 10064 H HA   . VAL B 1 79  ? -4.340  1.617   1.337   1.00 0.00 ? 79  VAL B HA   20 
ATOM 10065 H HB   . VAL B 1 79  ? -3.219  0.121   -0.034  1.00 0.00 ? 79  VAL B HB   20 
ATOM 10066 H HG11 . VAL B 1 79  ? -1.663  1.895   1.027   1.00 0.00 ? 79  VAL B HG11 20 
ATOM 10067 H HG12 . VAL B 1 79  ? -0.962  0.533   1.900   1.00 0.00 ? 79  VAL B HG12 20 
ATOM 10068 H HG13 . VAL B 1 79  ? -0.932  0.564   0.138   1.00 0.00 ? 79  VAL B HG13 20 
ATOM 10069 H HG21 . VAL B 1 79  ? -2.580  -1.355  2.526   1.00 0.00 ? 79  VAL B HG21 20 
ATOM 10070 H HG22 . VAL B 1 79  ? -3.475  -1.939  1.124   1.00 0.00 ? 79  VAL B HG22 20 
ATOM 10071 H HG23 . VAL B 1 79  ? -1.727  -1.723  1.027   1.00 0.00 ? 79  VAL B HG23 20 
ATOM 10072 N N    . PRO B 1 80  ? -5.587  -0.806  1.593   1.00 0.00 ? 80  PRO B N    20 
ATOM 10073 C CA   . PRO B 1 80  ? -6.620  -1.774  2.001   1.00 0.00 ? 80  PRO B CA   20 
ATOM 10074 C C    . PRO B 1 80  ? -5.971  -3.101  2.407   1.00 0.00 ? 80  PRO B C    20 
ATOM 10075 O O    . PRO B 1 80  ? -5.632  -3.920  1.575   1.00 0.00 ? 80  PRO B O    20 
ATOM 10076 C CB   . PRO B 1 80  ? -7.472  -1.941  0.741   1.00 0.00 ? 80  PRO B CB   20 
ATOM 10077 C CG   . PRO B 1 80  ? -6.578  -1.523  -0.449  1.00 0.00 ? 80  PRO B CG   20 
ATOM 10078 C CD   . PRO B 1 80  ? -5.428  -0.677  0.131   1.00 0.00 ? 80  PRO B CD   20 
ATOM 10079 H HA   . PRO B 1 80  ? -7.222  -1.379  2.802   1.00 0.00 ? 80  PRO B HA   20 
ATOM 10080 H HB2  . PRO B 1 80  ? -7.780  -2.972  0.636   1.00 0.00 ? 80  PRO B HB2  20 
ATOM 10081 H HB3  . PRO B 1 80  ? -8.335  -1.296  0.789   1.00 0.00 ? 80  PRO B HB3  20 
ATOM 10082 H HG2  . PRO B 1 80  ? -6.182  -2.402  -0.939  1.00 0.00 ? 80  PRO B HG2  20 
ATOM 10083 H HG3  . PRO B 1 80  ? -7.146  -0.932  -1.149  1.00 0.00 ? 80  PRO B HG3  20 
ATOM 10084 H HD2  . PRO B 1 80  ? -4.481  -1.083  -0.186  1.00 0.00 ? 80  PRO B HD2  20 
ATOM 10085 H HD3  . PRO B 1 80  ? -5.525  0.355   -0.168  1.00 0.00 ? 80  PRO B HD3  20 
ATOM 10086 N N    . GLN B 1 81  ? -5.791  -3.313  3.682   1.00 0.00 ? 81  GLN B N    20 
ATOM 10087 C CA   . GLN B 1 81  ? -5.156  -4.578  4.151   1.00 0.00 ? 81  GLN B CA   20 
ATOM 10088 C C    . GLN B 1 81  ? -6.027  -5.776  3.767   1.00 0.00 ? 81  GLN B C    20 
ATOM 10089 O O    . GLN B 1 81  ? -5.684  -6.551  2.898   1.00 0.00 ? 81  GLN B O    20 
ATOM 10090 C CB   . GLN B 1 81  ? -5.006  -4.532  5.672   1.00 0.00 ? 81  GLN B CB   20 
ATOM 10091 C CG   . GLN B 1 81  ? -3.780  -5.349  6.089   1.00 0.00 ? 81  GLN B CG   20 
ATOM 10092 C CD   . GLN B 1 81  ? -4.229  -6.570  6.894   1.00 0.00 ? 81  GLN B CD   20 
ATOM 10093 O OE1  . GLN B 1 81  ? -4.181  -6.562  8.108   1.00 0.00 ? 81  GLN B OE1  20 
ATOM 10094 N NE2  . GLN B 1 81  ? -4.667  -7.626  6.266   1.00 0.00 ? 81  GLN B NE2  20 
ATOM 10095 H H    . GLN B 1 81  ? -6.067  -2.635  4.332   1.00 0.00 ? 81  GLN B H    20 
ATOM 10096 H HA   . GLN B 1 81  ? -4.182  -4.682  3.698   1.00 0.00 ? 81  GLN B HA   20 
ATOM 10097 H HB2  . GLN B 1 81  ? -4.884  -3.508  5.989   1.00 0.00 ? 81  GLN B HB2  20 
ATOM 10098 H HB3  . GLN B 1 81  ? -5.887  -4.950  6.134   1.00 0.00 ? 81  GLN B HB3  20 
ATOM 10099 H HG2  . GLN B 1 81  ? -3.248  -5.674  5.207   1.00 0.00 ? 81  GLN B HG2  20 
ATOM 10100 H HG3  . GLN B 1 81  ? -3.131  -4.738  6.698   1.00 0.00 ? 81  GLN B HG3  20 
ATOM 10101 H HE21 . GLN B 1 81  ? -4.707  -7.631  5.286   1.00 0.00 ? 81  GLN B HE21 20 
ATOM 10102 H HE22 . GLN B 1 81  ? -4.956  -8.413  6.772   1.00 0.00 ? 81  GLN B HE22 20 
ATOM 10103 N N    . ALA B 1 82  ? -7.151  -5.937  4.412   1.00 0.00 ? 82  ALA B N    20 
ATOM 10104 C CA   . ALA B 1 82  ? -8.036  -7.088  4.086   1.00 0.00 ? 82  ALA B CA   20 
ATOM 10105 C C    . ALA B 1 82  ? -9.143  -6.627  3.140   1.00 0.00 ? 82  ALA B C    20 
ATOM 10106 O O    . ALA B 1 82  ? -10.008 -5.859  3.509   1.00 0.00 ? 82  ALA B O    20 
ATOM 10107 C CB   . ALA B 1 82  ? -8.661  -7.631  5.374   1.00 0.00 ? 82  ALA B CB   20 
ATOM 10108 H H    . ALA B 1 82  ? -7.409  -5.302  5.113   1.00 0.00 ? 82  ALA B H    20 
ATOM 10109 H HA   . ALA B 1 82  ? -7.456  -7.866  3.612   1.00 0.00 ? 82  ALA B HA   20 
ATOM 10110 H HB1  . ALA B 1 82  ? -7.949  -7.548  6.182   1.00 0.00 ? 82  ALA B HB1  20 
ATOM 10111 H HB2  . ALA B 1 82  ? -9.546  -7.061  5.613   1.00 0.00 ? 82  ALA B HB2  20 
ATOM 10112 H HB3  . ALA B 1 82  ? -8.928  -8.669  5.234   1.00 0.00 ? 82  ALA B HB3  20 
ATOM 10113 N N    . LEU B 1 83  ? -9.125  -7.091  1.922   1.00 0.00 ? 83  LEU B N    20 
ATOM 10114 C CA   . LEU B 1 83  ? -10.174 -6.681  0.956   1.00 0.00 ? 83  LEU B CA   20 
ATOM 10115 C C    . LEU B 1 83  ? -11.331 -7.669  1.018   1.00 0.00 ? 83  LEU B C    20 
ATOM 10116 O O    . LEU B 1 83  ? -11.427 -8.487  1.912   1.00 0.00 ? 83  LEU B O    20 
ATOM 10117 C CB   . LEU B 1 83  ? -9.593  -6.680  -0.460  1.00 0.00 ? 83  LEU B CB   20 
ATOM 10118 C CG   . LEU B 1 83  ? -8.592  -5.541  -0.599  1.00 0.00 ? 83  LEU B CG   20 
ATOM 10119 C CD1  . LEU B 1 83  ? -7.500  -5.937  -1.594  1.00 0.00 ? 83  LEU B CD1  20 
ATOM 10120 C CD2  . LEU B 1 83  ? -9.319  -4.299  -1.113  1.00 0.00 ? 83  LEU B CD2  20 
ATOM 10121 H H    . LEU B 1 83  ? -8.423  -7.711  1.642   1.00 0.00 ? 83  LEU B H    20 
ATOM 10122 H HA   . LEU B 1 83  ? -10.528 -5.690  1.202   1.00 0.00 ? 83  LEU B HA   20 
ATOM 10123 H HB2  . LEU B 1 83  ? -9.102  -7.621  -0.650  1.00 0.00 ? 83  LEU B HB2  20 
ATOM 10124 H HB3  . LEU B 1 83  ? -10.388 -6.543  -1.177  1.00 0.00 ? 83  LEU B HB3  20 
ATOM 10125 H HG   . LEU B 1 83  ? -8.152  -5.332  0.362   1.00 0.00 ? 83  LEU B HG   20 
ATOM 10126 H HD11 . LEU B 1 83  ? -7.195  -6.956  -1.407  1.00 0.00 ? 83  LEU B HD11 20 
ATOM 10127 H HD12 . LEU B 1 83  ? -7.882  -5.855  -2.601  1.00 0.00 ? 83  LEU B HD12 20 
ATOM 10128 H HD13 . LEU B 1 83  ? -6.650  -5.280  -1.477  1.00 0.00 ? 83  LEU B HD13 20 
ATOM 10129 H HD21 . LEU B 1 83  ? -9.975  -4.578  -1.925  1.00 0.00 ? 83  LEU B HD21 20 
ATOM 10130 H HD22 . LEU B 1 83  ? -9.898  -3.865  -0.313  1.00 0.00 ? 83  LEU B HD22 20 
ATOM 10131 H HD23 . LEU B 1 83  ? -8.595  -3.579  -1.467  1.00 0.00 ? 83  LEU B HD23 20 
ATOM 10132 N N    . GLU B 1 84  ? -12.199 -7.602  0.061   1.00 0.00 ? 84  GLU B N    20 
ATOM 10133 C CA   . GLU B 1 84  ? -13.357 -8.530  0.021   1.00 0.00 ? 84  GLU B CA   20 
ATOM 10134 C C    . GLU B 1 84  ? -13.740 -8.754  -1.441  1.00 0.00 ? 84  GLU B C    20 
ATOM 10135 O O    . GLU B 1 84  ? -13.374 -7.973  -2.296  1.00 0.00 ? 84  GLU B O    20 
ATOM 10136 C CB   . GLU B 1 84  ? -14.538 -7.917  0.780   1.00 0.00 ? 84  GLU B CB   20 
ATOM 10137 C CG   . GLU B 1 84  ? -14.521 -8.402  2.230   1.00 0.00 ? 84  GLU B CG   20 
ATOM 10138 C CD   . GLU B 1 84  ? -15.127 -9.804  2.310   1.00 0.00 ? 84  GLU B CD   20 
ATOM 10139 O OE1  . GLU B 1 84  ? -16.337 -9.913  2.201   1.00 0.00 ? 84  GLU B OE1  20 
ATOM 10140 O OE2  . GLU B 1 84  ? -14.369 -10.747 2.477   1.00 0.00 ? 84  GLU B OE2  20 
ATOM 10141 H H    . GLU B 1 84  ? -12.083 -6.937  -0.646  1.00 0.00 ? 84  GLU B H    20 
ATOM 10142 H HA   . GLU B 1 84  ? -13.082 -9.473  0.472   1.00 0.00 ? 84  GLU B HA   20 
ATOM 10143 H HB2  . GLU B 1 84  ? -14.456 -6.840  0.759   1.00 0.00 ? 84  GLU B HB2  20 
ATOM 10144 H HB3  . GLU B 1 84  ? -15.463 -8.218  0.312   1.00 0.00 ? 84  GLU B HB3  20 
ATOM 10145 H HG2  . GLU B 1 84  ? -13.502 -8.429  2.589   1.00 0.00 ? 84  GLU B HG2  20 
ATOM 10146 H HG3  . GLU B 1 84  ? -15.100 -7.727  2.842   1.00 0.00 ? 84  GLU B HG3  20 
ATOM 10147 N N    . PRO B 1 85  ? -14.460 -9.810  -1.688  1.00 0.00 ? 85  PRO B N    20 
ATOM 10148 C CA   . PRO B 1 85  ? -14.900 -10.158 -3.047  1.00 0.00 ? 85  PRO B CA   20 
ATOM 10149 C C    . PRO B 1 85  ? -16.031 -9.231  -3.495  1.00 0.00 ? 85  PRO B C    20 
ATOM 10150 O O    . PRO B 1 85  ? -16.264 -8.194  -2.907  1.00 0.00 ? 85  PRO B O    20 
ATOM 10151 C CB   . PRO B 1 85  ? -15.365 -11.610 -2.917  1.00 0.00 ? 85  PRO B CB   20 
ATOM 10152 C CG   . PRO B 1 85  ? -15.677 -11.834 -1.420  1.00 0.00 ? 85  PRO B CG   20 
ATOM 10153 C CD   . PRO B 1 85  ? -14.911 -10.748 -0.643  1.00 0.00 ? 85  PRO B CD   20 
ATOM 10154 H HA   . PRO B 1 85  ? -14.073 -10.100 -3.735  1.00 0.00 ? 85  PRO B HA   20 
ATOM 10155 H HB2  . PRO B 1 85  ? -16.253 -11.769 -3.513  1.00 0.00 ? 85  PRO B HB2  20 
ATOM 10156 H HB3  . PRO B 1 85  ? -14.580 -12.282 -3.228  1.00 0.00 ? 85  PRO B HB3  20 
ATOM 10157 H HG2  . PRO B 1 85  ? -16.737 -11.739 -1.247  1.00 0.00 ? 85  PRO B HG2  20 
ATOM 10158 H HG3  . PRO B 1 85  ? -15.333 -12.809 -1.114  1.00 0.00 ? 85  PRO B HG3  20 
ATOM 10159 H HD2  . PRO B 1 85  ? -15.568 -10.252 0.057   1.00 0.00 ? 85  PRO B HD2  20 
ATOM 10160 H HD3  . PRO B 1 85  ? -14.061 -11.174 -0.133  1.00 0.00 ? 85  PRO B HD3  20 
ATOM 10161 N N    . LEU B 1 86  ? -16.715 -9.578  -4.548  1.00 0.00 ? 86  LEU B N    20 
ATOM 10162 C CA   . LEU B 1 86  ? -17.803 -8.694  -5.047  1.00 0.00 ? 86  LEU B CA   20 
ATOM 10163 C C    . LEU B 1 86  ? -18.688 -9.472  -6.039  1.00 0.00 ? 86  LEU B C    20 
ATOM 10164 O O    . LEU B 1 86  ? -18.263 -9.783  -7.129  1.00 0.00 ? 86  LEU B O    20 
ATOM 10165 C CB   . LEU B 1 86  ? -17.135 -7.473  -5.712  1.00 0.00 ? 86  LEU B CB   20 
ATOM 10166 C CG   . LEU B 1 86  ? -17.942 -6.964  -6.911  1.00 0.00 ? 86  LEU B CG   20 
ATOM 10167 C CD1  . LEU B 1 86  ? -19.282 -6.394  -6.456  1.00 0.00 ? 86  LEU B CD1  20 
ATOM 10168 C CD2  . LEU B 1 86  ? -17.148 -5.870  -7.623  1.00 0.00 ? 86  LEU B CD2  20 
ATOM 10169 H H    . LEU B 1 86  ? -16.499 -10.407 -5.026  1.00 0.00 ? 86  LEU B H    20 
ATOM 10170 H HA   . LEU B 1 86  ? -18.397 -8.360  -4.212  1.00 0.00 ? 86  LEU B HA   20 
ATOM 10171 H HB2  . LEU B 1 86  ? -17.054 -6.680  -4.984  1.00 0.00 ? 86  LEU B HB2  20 
ATOM 10172 H HB3  . LEU B 1 86  ? -16.147 -7.748  -6.041  1.00 0.00 ? 86  LEU B HB3  20 
ATOM 10173 H HG   . LEU B 1 86  ? -18.110 -7.779  -7.588  1.00 0.00 ? 86  LEU B HG   20 
ATOM 10174 H HD11 . LEU B 1 86  ? -19.141 -5.812  -5.559  1.00 0.00 ? 86  LEU B HD11 20 
ATOM 10175 H HD12 . LEU B 1 86  ? -19.683 -5.762  -7.237  1.00 0.00 ? 86  LEU B HD12 20 
ATOM 10176 H HD13 . LEU B 1 86  ? -19.970 -7.202  -6.261  1.00 0.00 ? 86  LEU B HD13 20 
ATOM 10177 H HD21 . LEU B 1 86  ? -16.094 -6.010  -7.437  1.00 0.00 ? 86  LEU B HD21 20 
ATOM 10178 H HD22 . LEU B 1 86  ? -17.336 -5.922  -8.685  1.00 0.00 ? 86  LEU B HD22 20 
ATOM 10179 H HD23 . LEU B 1 86  ? -17.453 -4.902  -7.251  1.00 0.00 ? 86  LEU B HD23 20 
ATOM 10180 N N    . PRO B 1 87  ? -19.901 -9.762  -5.626  1.00 0.00 ? 87  PRO B N    20 
ATOM 10181 C CA   . PRO B 1 87  ? -20.869 -10.498 -6.461  1.00 0.00 ? 87  PRO B CA   20 
ATOM 10182 C C    . PRO B 1 87  ? -21.436 -9.568  -7.533  1.00 0.00 ? 87  PRO B C    20 
ATOM 10183 O O    . PRO B 1 87  ? -22.157 -8.634  -7.241  1.00 0.00 ? 87  PRO B O    20 
ATOM 10184 C CB   . PRO B 1 87  ? -21.951 -10.930 -5.469  1.00 0.00 ? 87  PRO B CB   20 
ATOM 10185 C CG   . PRO B 1 87  ? -21.845 -9.967  -4.262  1.00 0.00 ? 87  PRO B CG   20 
ATOM 10186 C CD   . PRO B 1 87  ? -20.423 -9.378  -4.296  1.00 0.00 ? 87  PRO B CD   20 
ATOM 10187 H HA   . PRO B 1 87  ? -20.411 -11.365 -6.914  1.00 0.00 ? 87  PRO B HA   20 
ATOM 10188 H HB2  . PRO B 1 87  ? -22.928 -10.851 -5.927  1.00 0.00 ? 87  PRO B HB2  20 
ATOM 10189 H HB3  . PRO B 1 87  ? -21.773 -11.942 -5.141  1.00 0.00 ? 87  PRO B HB3  20 
ATOM 10190 H HG2  . PRO B 1 87  ? -22.579 -9.179  -4.354  1.00 0.00 ? 87  PRO B HG2  20 
ATOM 10191 H HG3  . PRO B 1 87  ? -21.993 -10.509 -3.341  1.00 0.00 ? 87  PRO B HG3  20 
ATOM 10192 H HD2  . PRO B 1 87  ? -20.459 -8.301  -4.197  1.00 0.00 ? 87  PRO B HD2  20 
ATOM 10193 H HD3  . PRO B 1 87  ? -19.813 -9.812  -3.519  1.00 0.00 ? 87  PRO B HD3  20 
ATOM 10194 N N    . ILE B 1 88  ? -21.099 -9.804  -8.769  1.00 0.00 ? 88  ILE B N    20 
ATOM 10195 C CA   . ILE B 1 88  ? -21.602 -8.920  -9.854  1.00 0.00 ? 88  ILE B CA   20 
ATOM 10196 C C    . ILE B 1 88  ? -22.327 -9.739  -10.914 1.00 0.00 ? 88  ILE B C    20 
ATOM 10197 O O    . ILE B 1 88  ? -22.708 -10.872 -10.704 1.00 0.00 ? 88  ILE B O    20 
ATOM 10198 C CB   . ILE B 1 88  ? -20.414 -8.208  -10.511 1.00 0.00 ? 88  ILE B CB   20 
ATOM 10199 C CG1  . ILE B 1 88  ? -19.707 -9.164  -11.478 1.00 0.00 ? 88  ILE B CG1  20 
ATOM 10200 C CG2  . ILE B 1 88  ? -19.426 -7.781  -9.436  1.00 0.00 ? 88  ILE B CG2  20 
ATOM 10201 C CD1  . ILE B 1 88  ? -18.386 -8.551  -11.931 1.00 0.00 ? 88  ILE B CD1  20 
ATOM 10202 H H    . ILE B 1 88  ? -20.504 -10.554 -8.982  1.00 0.00 ? 88  ILE B H    20 
ATOM 10203 H HA   . ILE B 1 88  ? -22.274 -8.185  -9.439  1.00 0.00 ? 88  ILE B HA   20 
ATOM 10204 H HB   . ILE B 1 88  ? -20.764 -7.339  -11.049 1.00 0.00 ? 88  ILE B HB   20 
ATOM 10205 H HG12 . ILE B 1 88  ? -19.522 -10.100 -10.981 1.00 0.00 ? 88  ILE B HG12 20 
ATOM 10206 H HG13 . ILE B 1 88  ? -20.329 -9.335  -12.336 1.00 0.00 ? 88  ILE B HG13 20 
ATOM 10207 H HG21 . ILE B 1 88  ? -19.110 -8.651  -8.878  1.00 0.00 ? 88  ILE B HG21 20 
ATOM 10208 H HG22 . ILE B 1 88  ? -18.566 -7.321  -9.900  1.00 0.00 ? 88  ILE B HG22 20 
ATOM 10209 H HG23 . ILE B 1 88  ? -19.899 -7.078  -8.770  1.00 0.00 ? 88  ILE B HG23 20 
ATOM 10210 H HD11 . ILE B 1 88  ? -18.502 -7.482  -12.024 1.00 0.00 ? 88  ILE B HD11 20 
ATOM 10211 H HD12 . ILE B 1 88  ? -17.620 -8.770  -11.202 1.00 0.00 ? 88  ILE B HD12 20 
ATOM 10212 H HD13 . ILE B 1 88  ? -18.106 -8.970  -12.886 1.00 0.00 ? 88  ILE B HD13 20 
ATOM 10213 N N    . VAL B 1 89  ? -22.473 -9.158  -12.067 1.00 0.00 ? 89  VAL B N    20 
ATOM 10214 C CA   . VAL B 1 89  ? -23.130 -9.848  -13.203 1.00 0.00 ? 89  VAL B CA   20 
ATOM 10215 C C    . VAL B 1 89  ? -22.791 -9.083  -14.476 1.00 0.00 ? 89  VAL B C    20 
ATOM 10216 O O    . VAL B 1 89  ? -23.260 -7.984  -14.688 1.00 0.00 ? 89  VAL B O    20 
ATOM 10217 C CB   . VAL B 1 89  ? -24.649 -9.856  -13.035 1.00 0.00 ? 89  VAL B CB   20 
ATOM 10218 C CG1  . VAL B 1 89  ? -25.252 -10.806 -14.068 1.00 0.00 ? 89  VAL B CG1  20 
ATOM 10219 C CG2  . VAL B 1 89  ? -25.028 -10.320 -11.628 1.00 0.00 ? 89  VAL B CG2  20 
ATOM 10220 H H    . VAL B 1 89  ? -22.117 -8.256  -12.193 1.00 0.00 ? 89  VAL B H    20 
ATOM 10221 H HA   . VAL B 1 89  ? -22.756 -10.857 -13.275 1.00 0.00 ? 89  VAL B HA   20 
ATOM 10222 H HB   . VAL B 1 89  ? -25.032 -8.859  -13.203 1.00 0.00 ? 89  VAL B HB   20 
ATOM 10223 H HG11 . VAL B 1 89  ? -24.519 -11.555 -14.337 1.00 0.00 ? 89  VAL B HG11 20 
ATOM 10224 H HG12 . VAL B 1 89  ? -26.122 -11.288 -13.650 1.00 0.00 ? 89  VAL B HG12 20 
ATOM 10225 H HG13 . VAL B 1 89  ? -25.534 -10.249 -14.949 1.00 0.00 ? 89  VAL B HG13 20 
ATOM 10226 H HG21 . VAL B 1 89  ? -24.598 -11.291 -11.442 1.00 0.00 ? 89  VAL B HG21 20 
ATOM 10227 H HG22 . VAL B 1 89  ? -24.653 -9.615  -10.903 1.00 0.00 ? 89  VAL B HG22 20 
ATOM 10228 H HG23 . VAL B 1 89  ? -26.103 -10.382 -11.547 1.00 0.00 ? 89  VAL B HG23 20 
ATOM 10229 N N    . TYR B 1 90  ? -21.985 -9.643  -15.325 1.00 0.00 ? 90  TYR B N    20 
ATOM 10230 C CA   . TYR B 1 90  ? -21.629 -8.923  -16.574 1.00 0.00 ? 90  TYR B CA   20 
ATOM 10231 C C    . TYR B 1 90  ? -22.047 -9.756  -17.781 1.00 0.00 ? 90  TYR B C    20 
ATOM 10232 O O    . TYR B 1 90  ? -22.702 -10.769 -17.651 1.00 0.00 ? 90  TYR B O    20 
ATOM 10233 C CB   . TYR B 1 90  ? -20.123 -8.669  -16.616 1.00 0.00 ? 90  TYR B CB   20 
ATOM 10234 C CG   . TYR B 1 90  ? -19.377 -9.857  -16.058 1.00 0.00 ? 90  TYR B CG   20 
ATOM 10235 C CD1  . TYR B 1 90  ? -19.222 -9.994  -14.676 1.00 0.00 ? 90  TYR B CD1  20 
ATOM 10236 C CD2  . TYR B 1 90  ? -18.833 -10.814 -16.923 1.00 0.00 ? 90  TYR B CD2  20 
ATOM 10237 C CE1  . TYR B 1 90  ? -18.521 -11.088 -14.153 1.00 0.00 ? 90  TYR B CE1  20 
ATOM 10238 C CE2  . TYR B 1 90  ? -18.134 -11.908 -16.400 1.00 0.00 ? 90  TYR B CE2  20 
ATOM 10239 C CZ   . TYR B 1 90  ? -17.978 -12.045 -15.016 1.00 0.00 ? 90  TYR B CZ   20 
ATOM 10240 O OH   . TYR B 1 90  ? -17.288 -13.125 -14.503 1.00 0.00 ? 90  TYR B OH   20 
ATOM 10241 H H    . TYR B 1 90  ? -21.617 -10.531 -15.143 1.00 0.00 ? 90  TYR B H    20 
ATOM 10242 H HA   . TYR B 1 90  ? -22.149 -7.973  -16.592 1.00 0.00 ? 90  TYR B HA   20 
ATOM 10243 H HB2  . TYR B 1 90  ? -19.816 -8.495  -17.636 1.00 0.00 ? 90  TYR B HB2  20 
ATOM 10244 H HB3  . TYR B 1 90  ? -19.899 -7.800  -16.022 1.00 0.00 ? 90  TYR B HB3  20 
ATOM 10245 H HD1  . TYR B 1 90  ? -19.639 -9.253  -14.014 1.00 0.00 ? 90  TYR B HD1  20 
ATOM 10246 H HD2  . TYR B 1 90  ? -18.953 -10.709 -17.990 1.00 0.00 ? 90  TYR B HD2  20 
ATOM 10247 H HE1  . TYR B 1 90  ? -18.401 -11.192 -13.083 1.00 0.00 ? 90  TYR B HE1  20 
ATOM 10248 H HE2  . TYR B 1 90  ? -17.712 -12.645 -17.065 1.00 0.00 ? 90  TYR B HE2  20 
ATOM 10249 H HH   . TYR B 1 90  ? -16.529 -12.789 -14.020 1.00 0.00 ? 90  TYR B HH   20 
ATOM 10250 N N    . TYR B 1 91  ? -21.686 -9.330  -18.957 1.00 0.00 ? 91  TYR B N    20 
ATOM 10251 C CA   . TYR B 1 91  ? -22.077 -10.093 -20.169 1.00 0.00 ? 91  TYR B CA   20 
ATOM 10252 C C    . TYR B 1 91  ? -20.864 -10.352 -21.060 1.00 0.00 ? 91  TYR B C    20 
ATOM 10253 O O    . TYR B 1 91  ? -20.125 -9.451  -21.403 1.00 0.00 ? 91  TYR B O    20 
ATOM 10254 C CB   . TYR B 1 91  ? -23.097 -9.284  -20.960 1.00 0.00 ? 91  TYR B CB   20 
ATOM 10255 C CG   . TYR B 1 91  ? -24.485 -9.678  -20.540 1.00 0.00 ? 91  TYR B CG   20 
ATOM 10256 C CD1  . TYR B 1 91  ? -25.096 -9.031  -19.466 1.00 0.00 ? 91  TYR B CD1  20 
ATOM 10257 C CD2  . TYR B 1 91  ? -25.165 -10.683 -21.236 1.00 0.00 ? 91  TYR B CD2  20 
ATOM 10258 C CE1  . TYR B 1 91  ? -26.394 -9.389  -19.080 1.00 0.00 ? 91  TYR B CE1  20 
ATOM 10259 C CE2  . TYR B 1 91  ? -26.460 -11.041 -20.858 1.00 0.00 ? 91  TYR B CE2  20 
ATOM 10260 C CZ   . TYR B 1 91  ? -27.078 -10.396 -19.778 1.00 0.00 ? 91  TYR B CZ   20 
ATOM 10261 O OH   . TYR B 1 91  ? -28.357 -10.748 -19.403 1.00 0.00 ? 91  TYR B OH   20 
ATOM 10262 H H    . TYR B 1 91  ? -21.171 -8.505  -19.041 1.00 0.00 ? 91  TYR B H    20 
ATOM 10263 H HA   . TYR B 1 91  ? -22.518 -11.035 -19.877 1.00 0.00 ? 91  TYR B HA   20 
ATOM 10264 H HB2  . TYR B 1 91  ? -22.947 -8.232  -20.768 1.00 0.00 ? 91  TYR B HB2  20 
ATOM 10265 H HB3  . TYR B 1 91  ? -22.971 -9.479  -22.015 1.00 0.00 ? 91  TYR B HB3  20 
ATOM 10266 H HD1  . TYR B 1 91  ? -24.562 -8.257  -18.929 1.00 0.00 ? 91  TYR B HD1  20 
ATOM 10267 H HD2  . TYR B 1 91  ? -24.686 -11.185 -22.061 1.00 0.00 ? 91  TYR B HD2  20 
ATOM 10268 H HE1  . TYR B 1 91  ? -26.869 -8.891  -18.249 1.00 0.00 ? 91  TYR B HE1  20 
ATOM 10269 H HE2  . TYR B 1 91  ? -26.982 -11.817 -21.400 1.00 0.00 ? 91  TYR B HE2  20 
ATOM 10270 H HH   . TYR B 1 91  ? -28.406 -11.707 -19.380 1.00 0.00 ? 91  TYR B HH   20 
ATOM 10271 N N    . VAL B 1 92  ? -20.681 -11.575 -21.468 1.00 0.00 ? 92  VAL B N    20 
ATOM 10272 C CA   . VAL B 1 92  ? -19.549 -11.899 -22.373 1.00 0.00 ? 92  VAL B CA   20 
ATOM 10273 C C    . VAL B 1 92  ? -20.124 -12.119 -23.765 1.00 0.00 ? 92  VAL B C    20 
ATOM 10274 O O    . VAL B 1 92  ? -20.553 -13.202 -24.110 1.00 0.00 ? 92  VAL B O    20 
ATOM 10275 C CB   . VAL B 1 92  ? -18.846 -13.171 -21.909 1.00 0.00 ? 92  VAL B CB   20 
ATOM 10276 C CG1  . VAL B 1 92  ? -17.372 -13.087 -22.298 1.00 0.00 ? 92  VAL B CG1  20 
ATOM 10277 C CG2  . VAL B 1 92  ? -18.975 -13.306 -20.391 1.00 0.00 ? 92  VAL B CG2  20 
ATOM 10278 H H    . VAL B 1 92  ? -21.308 -12.276 -21.200 1.00 0.00 ? 92  VAL B H    20 
ATOM 10279 H HA   . VAL B 1 92  ? -18.849 -11.077 -22.392 1.00 0.00 ? 92  VAL B HA   20 
ATOM 10280 H HB   . VAL B 1 92  ? -19.297 -14.027 -22.391 1.00 0.00 ? 92  VAL B HB   20 
ATOM 10281 H HG11 . VAL B 1 92  ? -17.291 -12.790 -23.333 1.00 0.00 ? 92  VAL B HG11 20 
ATOM 10282 H HG12 . VAL B 1 92  ? -16.877 -12.356 -21.675 1.00 0.00 ? 92  VAL B HG12 20 
ATOM 10283 H HG13 . VAL B 1 92  ? -16.907 -14.051 -22.161 1.00 0.00 ? 92  VAL B HG13 20 
ATOM 10284 H HG21 . VAL B 1 92  ? -20.020 -13.350 -20.122 1.00 0.00 ? 92  VAL B HG21 20 
ATOM 10285 H HG22 . VAL B 1 92  ? -18.481 -14.210 -20.067 1.00 0.00 ? 92  VAL B HG22 20 
ATOM 10286 H HG23 . VAL B 1 92  ? -18.516 -12.453 -19.914 1.00 0.00 ? 92  VAL B HG23 20 
ATOM 10287 N N    . GLY B 1 93  ? -20.164 -11.092 -24.560 1.00 0.00 ? 93  GLY B N    20 
ATOM 10288 C CA   . GLY B 1 93  ? -20.746 -11.231 -25.921 1.00 0.00 ? 93  GLY B CA   20 
ATOM 10289 C C    . GLY B 1 93  ? -22.273 -11.236 -25.800 1.00 0.00 ? 93  GLY B C    20 
ATOM 10290 O O    . GLY B 1 93  ? -22.927 -10.240 -26.035 1.00 0.00 ? 93  GLY B O    20 
ATOM 10291 H H    . GLY B 1 93  ? -19.827 -10.226 -24.253 1.00 0.00 ? 93  GLY B H    20 
ATOM 10292 H HA2  . GLY B 1 93  ? -20.430 -10.401 -26.537 1.00 0.00 ? 93  GLY B HA2  20 
ATOM 10293 H HA3  . GLY B 1 93  ? -20.419 -12.159 -26.363 1.00 0.00 ? 93  GLY B HA3  20 
ATOM 10294 N N    . ARG B 1 94  ? -22.845 -12.354 -25.436 1.00 0.00 ? 94  ARG B N    20 
ATOM 10295 C CA   . ARG B 1 94  ? -24.332 -12.426 -25.303 1.00 0.00 ? 94  ARG B CA   20 
ATOM 10296 C C    . ARG B 1 94  ? -24.733 -13.331 -24.131 1.00 0.00 ? 94  ARG B C    20 
ATOM 10297 O O    . ARG B 1 94  ? -25.901 -13.488 -23.837 1.00 0.00 ? 94  ARG B O    20 
ATOM 10298 C CB   . ARG B 1 94  ? -24.907 -13.009 -26.586 1.00 0.00 ? 94  ARG B CB   20 
ATOM 10299 C CG   . ARG B 1 94  ? -24.440 -12.179 -27.783 1.00 0.00 ? 94  ARG B CG   20 
ATOM 10300 C CD   . ARG B 1 94  ? -25.561 -12.102 -28.823 1.00 0.00 ? 94  ARG B CD   20 
ATOM 10301 N NE   . ARG B 1 94  ? -25.475 -10.805 -29.550 1.00 0.00 ? 94  ARG B NE   20 
ATOM 10302 C CZ   . ARG B 1 94  ? -26.557 -10.247 -30.019 1.00 0.00 ? 94  ARG B CZ   20 
ATOM 10303 N NH1  . ARG B 1 94  ? -27.334 -9.560  -29.228 1.00 0.00 ? 94  ARG B NH1  20 
ATOM 10304 N NH2  . ARG B 1 94  ? -26.863 -10.377 -31.282 1.00 0.00 ? 94  ARG B NH2  20 
ATOM 10305 H H    . ARG B 1 94  ? -22.297 -13.144 -25.262 1.00 0.00 ? 94  ARG B H    20 
ATOM 10306 H HA   . ARG B 1 94  ? -24.733 -11.438 -25.144 1.00 0.00 ? 94  ARG B HA   20 
ATOM 10307 H HB2  . ARG B 1 94  ? -24.557 -14.027 -26.692 1.00 0.00 ? 94  ARG B HB2  20 
ATOM 10308 H HB3  . ARG B 1 94  ? -25.986 -13.000 -26.538 1.00 0.00 ? 94  ARG B HB3  20 
ATOM 10309 H HG2  . ARG B 1 94  ? -24.186 -11.182 -27.452 1.00 0.00 ? 94  ARG B HG2  20 
ATOM 10310 H HG3  . ARG B 1 94  ? -23.572 -12.643 -28.227 1.00 0.00 ? 94  ARG B HG3  20 
ATOM 10311 H HD2  . ARG B 1 94  ? -25.456 -12.916 -29.524 1.00 0.00 ? 94  ARG B HD2  20 
ATOM 10312 H HD3  . ARG B 1 94  ? -26.517 -12.175 -28.326 1.00 0.00 ? 94  ARG B HD3  20 
ATOM 10313 H HE   . ARG B 1 94  ? -24.606 -10.370 -29.675 1.00 0.00 ? 94  ARG B HE   20 
ATOM 10314 H HH11 . ARG B 1 94  ? -27.100 -9.461  -28.260 1.00 0.00 ? 94  ARG B HH11 20 
ATOM 10315 H HH12 . ARG B 1 94  ? -28.164 -9.134  -29.587 1.00 0.00 ? 94  ARG B HH12 20 
ATOM 10316 H HH21 . ARG B 1 94  ? -26.266 -10.904 -31.889 1.00 0.00 ? 94  ARG B HH21 20 
ATOM 10317 H HH22 . ARG B 1 94  ? -27.691 -9.950  -31.642 1.00 0.00 ? 94  ARG B HH22 20 
ATOM 10318 N N    . LYS B 1 95  ? -23.790 -13.934 -23.468 1.00 0.00 ? 95  LYS B N    20 
ATOM 10319 C CA   . LYS B 1 95  ? -24.144 -14.831 -22.331 1.00 0.00 ? 95  LYS B CA   20 
ATOM 10320 C C    . LYS B 1 95  ? -23.934 -14.092 -21.005 1.00 0.00 ? 95  LYS B C    20 
ATOM 10321 O O    . LYS B 1 95  ? -22.883 -13.533 -20.775 1.00 0.00 ? 95  LYS B O    20 
ATOM 10322 C CB   . LYS B 1 95  ? -23.241 -16.065 -22.365 1.00 0.00 ? 95  LYS B CB   20 
ATOM 10323 C CG   . LYS B 1 95  ? -23.406 -16.783 -23.705 1.00 0.00 ? 95  LYS B CG   20 
ATOM 10324 C CD   . LYS B 1 95  ? -22.654 -18.115 -23.668 1.00 0.00 ? 95  LYS B CD   20 
ATOM 10325 C CE   . LYS B 1 95  ? -23.067 -18.968 -24.869 1.00 0.00 ? 95  LYS B CE   20 
ATOM 10326 N NZ   . LYS B 1 95  ? -24.472 -19.432 -24.687 1.00 0.00 ? 95  LYS B NZ   20 
ATOM 10327 H H    . LYS B 1 95  ? -22.856 -13.807 -23.717 1.00 0.00 ? 95  LYS B H    20 
ATOM 10328 H HA   . LYS B 1 95  ? -25.173 -15.137 -22.425 1.00 0.00 ? 95  LYS B HA   20 
ATOM 10329 H HB2  . LYS B 1 95  ? -22.212 -15.761 -22.241 1.00 0.00 ? 95  LYS B HB2  20 
ATOM 10330 H HB3  . LYS B 1 95  ? -23.517 -16.734 -21.564 1.00 0.00 ? 95  LYS B HB3  20 
ATOM 10331 H HG2  . LYS B 1 95  ? -24.454 -16.965 -23.890 1.00 0.00 ? 95  LYS B HG2  20 
ATOM 10332 H HG3  . LYS B 1 95  ? -23.002 -16.166 -24.495 1.00 0.00 ? 95  LYS B HG3  20 
ATOM 10333 H HD2  . LYS B 1 95  ? -21.590 -17.928 -23.706 1.00 0.00 ? 95  LYS B HD2  20 
ATOM 10334 H HD3  . LYS B 1 95  ? -22.895 -18.639 -22.756 1.00 0.00 ? 95  LYS B HD3  20 
ATOM 10335 H HE2  . LYS B 1 95  ? -22.996 -18.379 -25.770 1.00 0.00 ? 95  LYS B HE2  20 
ATOM 10336 H HE3  . LYS B 1 95  ? -22.412 -19.824 -24.945 1.00 0.00 ? 95  LYS B HE3  20 
ATOM 10337 H HZ1  . LYS B 1 95  ? -24.984 -18.756 -24.083 1.00 0.00 ? 95  LYS B HZ1  20 
ATOM 10338 H HZ2  . LYS B 1 95  ? -24.939 -19.494 -25.613 1.00 0.00 ? 95  LYS B HZ2  20 
ATOM 10339 H HZ3  . LYS B 1 95  ? -24.472 -20.369 -24.237 1.00 0.00 ? 95  LYS B HZ3  20 
ATOM 10340 N N    . PRO B 1 96  ? -24.936 -14.117 -20.162 1.00 0.00 ? 96  PRO B N    20 
ATOM 10341 C CA   . PRO B 1 96  ? -24.870 -13.459 -18.847 1.00 0.00 ? 96  PRO B CA   20 
ATOM 10342 C C    . PRO B 1 96  ? -24.056 -14.326 -17.880 1.00 0.00 ? 96  PRO B C    20 
ATOM 10343 O O    . PRO B 1 96  ? -24.214 -15.530 -17.838 1.00 0.00 ? 96  PRO B O    20 
ATOM 10344 C CB   . PRO B 1 96  ? -26.335 -13.379 -18.409 1.00 0.00 ? 96  PRO B CB   20 
ATOM 10345 C CG   . PRO B 1 96  ? -27.084 -14.475 -19.202 1.00 0.00 ? 96  PRO B CG   20 
ATOM 10346 C CD   . PRO B 1 96  ? -26.217 -14.800 -20.433 1.00 0.00 ? 96  PRO B CD   20 
ATOM 10347 H HA   . PRO B 1 96  ? -24.449 -12.469 -18.937 1.00 0.00 ? 96  PRO B HA   20 
ATOM 10348 H HB2  . PRO B 1 96  ? -26.413 -13.563 -17.347 1.00 0.00 ? 96  PRO B HB2  20 
ATOM 10349 H HB3  . PRO B 1 96  ? -26.743 -12.411 -18.652 1.00 0.00 ? 96  PRO B HB3  20 
ATOM 10350 H HG2  . PRO B 1 96  ? -27.205 -15.357 -18.587 1.00 0.00 ? 96  PRO B HG2  20 
ATOM 10351 H HG3  . PRO B 1 96  ? -28.047 -14.108 -19.521 1.00 0.00 ? 96  PRO B HG3  20 
ATOM 10352 H HD2  . PRO B 1 96  ? -26.069 -15.868 -20.519 1.00 0.00 ? 96  PRO B HD2  20 
ATOM 10353 H HD3  . PRO B 1 96  ? -26.668 -14.405 -21.329 1.00 0.00 ? 96  PRO B HD3  20 
ATOM 10354 N N    . LYS B 1 97  ? -23.183 -13.736 -17.109 1.00 0.00 ? 97  LYS B N    20 
ATOM 10355 C CA   . LYS B 1 97  ? -22.367 -14.551 -16.165 1.00 0.00 ? 97  LYS B CA   20 
ATOM 10356 C C    . LYS B 1 97  ? -22.190 -13.811 -14.837 1.00 0.00 ? 97  LYS B C    20 
ATOM 10357 O O    . LYS B 1 97  ? -21.558 -12.776 -14.772 1.00 0.00 ? 97  LYS B O    20 
ATOM 10358 C CB   . LYS B 1 97  ? -20.988 -14.810 -16.778 1.00 0.00 ? 97  LYS B CB   20 
ATOM 10359 C CG   . LYS B 1 97  ? -21.143 -15.549 -18.110 1.00 0.00 ? 97  LYS B CG   20 
ATOM 10360 C CD   . LYS B 1 97  ? -20.372 -16.870 -18.051 1.00 0.00 ? 97  LYS B CD   20 
ATOM 10361 C CE   . LYS B 1 97  ? -20.076 -17.353 -19.472 1.00 0.00 ? 97  LYS B CE   20 
ATOM 10362 N NZ   . LYS B 1 97  ? -19.031 -18.415 -19.427 1.00 0.00 ? 97  LYS B NZ   20 
ATOM 10363 H H    . LYS B 1 97  ? -23.061 -12.765 -17.155 1.00 0.00 ? 97  LYS B H    20 
ATOM 10364 H HA   . LYS B 1 97  ? -22.860 -15.495 -15.987 1.00 0.00 ? 97  LYS B HA   20 
ATOM 10365 H HB2  . LYS B 1 97  ? -20.488 -13.867 -16.947 1.00 0.00 ? 97  LYS B HB2  20 
ATOM 10366 H HB3  . LYS B 1 97  ? -20.401 -15.411 -16.102 1.00 0.00 ? 97  LYS B HB3  20 
ATOM 10367 H HG2  . LYS B 1 97  ? -22.188 -15.747 -18.293 1.00 0.00 ? 97  LYS B HG2  20 
ATOM 10368 H HG3  . LYS B 1 97  ? -20.746 -14.939 -18.908 1.00 0.00 ? 97  LYS B HG3  20 
ATOM 10369 H HD2  . LYS B 1 97  ? -19.443 -16.722 -17.520 1.00 0.00 ? 97  LYS B HD2  20 
ATOM 10370 H HD3  . LYS B 1 97  ? -20.967 -17.610 -17.537 1.00 0.00 ? 97  LYS B HD3  20 
ATOM 10371 H HE2  . LYS B 1 97  ? -20.978 -17.754 -19.911 1.00 0.00 ? 97  LYS B HE2  20 
ATOM 10372 H HE3  . LYS B 1 97  ? -19.723 -16.525 -20.068 1.00 0.00 ? 97  LYS B HE3  20 
ATOM 10373 H HZ1  . LYS B 1 97  ? -18.770 -18.604 -18.439 1.00 0.00 ? 97  LYS B HZ1  20 
ATOM 10374 H HZ2  . LYS B 1 97  ? -19.403 -19.285 -19.862 1.00 0.00 ? 97  LYS B HZ2  20 
ATOM 10375 H HZ3  . LYS B 1 97  ? -18.191 -18.097 -19.951 1.00 0.00 ? 97  LYS B HZ3  20 
ATOM 10376 N N    . VAL B 1 98  ? -22.723 -14.348 -13.773 1.00 0.00 ? 98  VAL B N    20 
ATOM 10377 C CA   . VAL B 1 98  ? -22.562 -13.690 -12.446 1.00 0.00 ? 98  VAL B CA   20 
ATOM 10378 C C    . VAL B 1 98  ? -21.280 -14.212 -11.802 1.00 0.00 ? 98  VAL B C    20 
ATOM 10379 O O    . VAL B 1 98  ? -21.059 -15.404 -11.732 1.00 0.00 ? 98  VAL B O    20 
ATOM 10380 C CB   . VAL B 1 98  ? -23.748 -14.034 -11.545 1.00 0.00 ? 98  VAL B CB   20 
ATOM 10381 C CG1  . VAL B 1 98  ? -23.523 -13.433 -10.155 1.00 0.00 ? 98  VAL B CG1  20 
ATOM 10382 C CG2  . VAL B 1 98  ? -25.031 -13.461 -12.146 1.00 0.00 ? 98  VAL B CG2  20 
ATOM 10383 H H    . VAL B 1 98  ? -23.214 -15.193 -13.844 1.00 0.00 ? 98  VAL B H    20 
ATOM 10384 H HA   . VAL B 1 98  ? -22.497 -12.619 -12.574 1.00 0.00 ? 98  VAL B HA   20 
ATOM 10385 H HB   . VAL B 1 98  ? -23.836 -15.108 -11.461 1.00 0.00 ? 98  VAL B HB   20 
ATOM 10386 H HG11 . VAL B 1 98  ? -22.585 -12.896 -10.142 1.00 0.00 ? 98  VAL B HG11 20 
ATOM 10387 H HG12 . VAL B 1 98  ? -24.329 -12.753 -9.921  1.00 0.00 ? 98  VAL B HG12 20 
ATOM 10388 H HG13 . VAL B 1 98  ? -23.494 -14.224 -9.419  1.00 0.00 ? 98  VAL B HG13 20 
ATOM 10389 H HG21 . VAL B 1 98  ? -24.781 -12.812 -12.971 1.00 0.00 ? 98  VAL B HG21 20 
ATOM 10390 H HG22 . VAL B 1 98  ? -25.655 -14.268 -12.499 1.00 0.00 ? 98  VAL B HG22 20 
ATOM 10391 H HG23 . VAL B 1 98  ? -25.562 -12.899 -11.393 1.00 0.00 ? 98  VAL B HG23 20 
ATOM 10392 N N    . GLU B 1 99  ? -20.427 -13.345 -11.335 1.00 0.00 ? 99  GLU B N    20 
ATOM 10393 C CA   . GLU B 1 99  ? -19.172 -13.835 -10.711 1.00 0.00 ? 99  GLU B CA   20 
ATOM 10394 C C    . GLU B 1 99  ? -18.982 -13.193 -9.345  1.00 0.00 ? 99  GLU B C    20 
ATOM 10395 O O    . GLU B 1 99  ? -19.902 -12.667 -8.750  1.00 0.00 ? 99  GLU B O    20 
ATOM 10396 C CB   . GLU B 1 99  ? -17.984 -13.472 -11.596 1.00 0.00 ? 99  GLU B CB   20 
ATOM 10397 C CG   . GLU B 1 99  ? -17.245 -14.745 -12.013 1.00 0.00 ? 99  GLU B CG   20 
ATOM 10398 C CD   . GLU B 1 99  ? -15.771 -14.632 -11.619 1.00 0.00 ? 99  GLU B CD   20 
ATOM 10399 O OE1  . GLU B 1 99  ? -15.116 -13.725 -12.104 1.00 0.00 ? 99  GLU B OE1  20 
ATOM 10400 O OE2  . GLU B 1 99  ? -15.322 -15.457 -10.838 1.00 0.00 ? 99  GLU B OE2  20 
ATOM 10401 H H    . GLU B 1 99  ? -20.606 -12.381 -11.396 1.00 0.00 ? 99  GLU B H    20 
ATOM 10402 H HA   . GLU B 1 99  ? -19.218 -14.906 -10.602 1.00 0.00 ? 99  GLU B HA   20 
ATOM 10403 H HB2  . GLU B 1 99  ? -18.334 -12.955 -12.471 1.00 0.00 ? 99  GLU B HB2  20 
ATOM 10404 H HB3  . GLU B 1 99  ? -17.314 -12.833 -11.048 1.00 0.00 ? 99  GLU B HB3  20 
ATOM 10405 H HG2  . GLU B 1 99  ? -17.688 -15.597 -11.516 1.00 0.00 ? 99  GLU B HG2  20 
ATOM 10406 H HG3  . GLU B 1 99  ? -17.321 -14.872 -13.082 1.00 0.00 ? 99  GLU B HG3  20 
ATOM 10407 N N    . GLN B 1 100 ? -17.783 -13.237 -8.854  1.00 0.00 ? 100 GLN B N    20 
ATOM 10408 C CA   . GLN B 1 100 ? -17.485 -12.640 -7.529  1.00 0.00 ? 100 GLN B CA   20 
ATOM 10409 C C    . GLN B 1 100 ? -16.081 -12.047 -7.573  1.00 0.00 ? 100 GLN B C    20 
ATOM 10410 O O    . GLN B 1 100 ? -15.119 -12.681 -7.189  1.00 0.00 ? 100 GLN B O    20 
ATOM 10411 C CB   . GLN B 1 100 ? -17.530 -13.726 -6.462  1.00 0.00 ? 100 GLN B CB   20 
ATOM 10412 C CG   . GLN B 1 100 ? -18.850 -14.496 -6.561  1.00 0.00 ? 100 GLN B CG   20 
ATOM 10413 C CD   . GLN B 1 100 ? -18.625 -15.799 -7.329  1.00 0.00 ? 100 GLN B CD   20 
ATOM 10414 O OE1  . GLN B 1 100 ? -18.975 -15.903 -8.488  1.00 0.00 ? 100 GLN B OE1  20 
ATOM 10415 N NE2  . GLN B 1 100 ? -18.053 -16.806 -6.727  1.00 0.00 ? 100 GLN B NE2  20 
ATOM 10416 H H    . GLN B 1 100 ? -17.068 -13.667 -9.367  1.00 0.00 ? 100 GLN B H    20 
ATOM 10417 H HA   . GLN B 1 100 ? -18.205 -11.869 -7.301  1.00 0.00 ? 100 GLN B HA   20 
ATOM 10418 H HB2  . GLN B 1 100 ? -16.706 -14.401 -6.621  1.00 0.00 ? 100 GLN B HB2  20 
ATOM 10419 H HB3  . GLN B 1 100 ? -17.448 -13.277 -5.484  1.00 0.00 ? 100 GLN B HB3  20 
ATOM 10420 H HG2  . GLN B 1 100 ? -19.211 -14.719 -5.567  1.00 0.00 ? 100 GLN B HG2  20 
ATOM 10421 H HG3  . GLN B 1 100 ? -19.579 -13.894 -7.082  1.00 0.00 ? 100 GLN B HG3  20 
ATOM 10422 H HE21 . GLN B 1 100 ? -17.771 -16.723 -5.792  1.00 0.00 ? 100 GLN B HE21 20 
ATOM 10423 H HE22 . GLN B 1 100 ? -17.905 -17.646 -7.210  1.00 0.00 ? 100 GLN B HE22 20 
ATOM 10424 N N    . LEU B 1 101 ? -15.954 -10.847 -8.052  1.00 0.00 ? 101 LEU B N    20 
ATOM 10425 C CA   . LEU B 1 101 ? -14.609 -10.225 -8.135  1.00 0.00 ? 101 LEU B CA   20 
ATOM 10426 C C    . LEU B 1 101 ? -13.854 -10.486 -6.835  1.00 0.00 ? 101 LEU B C    20 
ATOM 10427 O O    . LEU B 1 101 ? -14.432 -10.562 -5.769  1.00 0.00 ? 101 LEU B O    20 
ATOM 10428 C CB   . LEU B 1 101 ? -14.737 -8.720  -8.369  1.00 0.00 ? 101 LEU B CB   20 
ATOM 10429 C CG   . LEU B 1 101 ? -15.562 -8.453  -9.633  1.00 0.00 ? 101 LEU B CG   20 
ATOM 10430 C CD1  . LEU B 1 101 ? -15.270 -7.039  -10.141 1.00 0.00 ? 101 LEU B CD1  20 
ATOM 10431 C CD2  . LEU B 1 101 ? -15.194 -9.466  -10.720 1.00 0.00 ? 101 LEU B CD2  20 
ATOM 10432 H H    . LEU B 1 101 ? -16.738 -10.363 -8.366  1.00 0.00 ? 101 LEU B H    20 
ATOM 10433 H HA   . LEU B 1 101 ? -14.063 -10.668 -8.956  1.00 0.00 ? 101 LEU B HA   20 
ATOM 10434 H HB2  . LEU B 1 101 ? -15.228 -8.267  -7.524  1.00 0.00 ? 101 LEU B HB2  20 
ATOM 10435 H HB3  . LEU B 1 101 ? -13.752 -8.295  -8.486  1.00 0.00 ? 101 LEU B HB3  20 
ATOM 10436 H HG   . LEU B 1 101 ? -16.613 -8.539  -9.400  1.00 0.00 ? 101 LEU B HG   20 
ATOM 10437 H HD11 . LEU B 1 101 ? -14.202 -6.900  -10.223 1.00 0.00 ? 101 LEU B HD11 20 
ATOM 10438 H HD12 . LEU B 1 101 ? -15.727 -6.903  -11.109 1.00 0.00 ? 101 LEU B HD12 20 
ATOM 10439 H HD13 . LEU B 1 101 ? -15.675 -6.317  -9.448  1.00 0.00 ? 101 LEU B HD13 20 
ATOM 10440 H HD21 . LEU B 1 101 ? -15.344 -10.467 -10.342 1.00 0.00 ? 101 LEU B HD21 20 
ATOM 10441 H HD22 . LEU B 1 101 ? -15.822 -9.309  -11.584 1.00 0.00 ? 101 LEU B HD22 20 
ATOM 10442 H HD23 . LEU B 1 101 ? -14.159 -9.337  -10.997 1.00 0.00 ? 101 LEU B HD23 20 
ATOM 10443 N N    . SER B 1 102 ? -12.570 -10.645 -6.926  1.00 0.00 ? 102 SER B N    20 
ATOM 10444 C CA   . SER B 1 102 ? -11.764 -10.928 -5.701  1.00 0.00 ? 102 SER B CA   20 
ATOM 10445 C C    . SER B 1 102 ? -11.064 -9.659  -5.216  1.00 0.00 ? 102 SER B C    20 
ATOM 10446 O O    . SER B 1 102 ? -10.454 -8.941  -5.985  1.00 0.00 ? 102 SER B O    20 
ATOM 10447 C CB   . SER B 1 102 ? -10.715 -11.993 -6.021  1.00 0.00 ? 102 SER B CB   20 
ATOM 10448 O OG   . SER B 1 102 ? -11.338 -13.270 -6.059  1.00 0.00 ? 102 SER B OG   20 
ATOM 10449 H H    . SER B 1 102 ? -12.137 -10.589 -7.806  1.00 0.00 ? 102 SER B H    20 
ATOM 10450 H HA   . SER B 1 102 ? -12.416 -11.296 -4.923  1.00 0.00 ? 102 SER B HA   20 
ATOM 10451 H HB2  . SER B 1 102 ? -10.271 -11.786 -6.980  1.00 0.00 ? 102 SER B HB2  20 
ATOM 10452 H HB3  . SER B 1 102 ? -9.945  -11.978 -5.260  1.00 0.00 ? 102 SER B HB3  20 
ATOM 10453 H HG   . SER B 1 102 ? -11.205 -13.639 -6.935  1.00 0.00 ? 102 SER B HG   20 
ATOM 10454 N N    . ASN B 1 103 ? -11.133 -9.379  -3.940  1.00 0.00 ? 103 ASN B N    20 
ATOM 10455 C CA   . ASN B 1 103 ? -10.455 -8.159  -3.413  1.00 0.00 ? 103 ASN B CA   20 
ATOM 10456 C C    . ASN B 1 103 ? -11.027 -6.923  -4.101  1.00 0.00 ? 103 ASN B C    20 
ATOM 10457 O O    . ASN B 1 103 ? -10.344 -5.938  -4.303  1.00 0.00 ? 103 ASN B O    20 
ATOM 10458 C CB   . ASN B 1 103 ? -8.955  -8.248  -3.698  1.00 0.00 ? 103 ASN B CB   20 
ATOM 10459 C CG   . ASN B 1 103 ? -8.255  -8.978  -2.549  1.00 0.00 ? 103 ASN B CG   20 
ATOM 10460 O OD1  . ASN B 1 103 ? -7.065  -8.830  -2.356  1.00 0.00 ? 103 ASN B OD1  20 
ATOM 10461 N ND2  . ASN B 1 103 ? -8.948  -9.764  -1.773  1.00 0.00 ? 103 ASN B ND2  20 
ATOM 10462 H H    . ASN B 1 103 ? -11.627 -9.975  -3.329  1.00 0.00 ? 103 ASN B H    20 
ATOM 10463 H HA   . ASN B 1 103 ? -10.615 -8.082  -2.347  1.00 0.00 ? 103 ASN B HA   20 
ATOM 10464 H HB2  . ASN B 1 103 ? -8.795  -8.790  -4.619  1.00 0.00 ? 103 ASN B HB2  20 
ATOM 10465 H HB3  . ASN B 1 103 ? -8.548  -7.253  -3.791  1.00 0.00 ? 103 ASN B HB3  20 
ATOM 10466 H HD21 . ASN B 1 103 ? -9.908  -9.884  -1.928  1.00 0.00 ? 103 ASN B HD21 20 
ATOM 10467 H HD22 . ASN B 1 103 ? -8.509  -10.235 -1.034  1.00 0.00 ? 103 ASN B HD22 20 
ATOM 10468 N N    . MET B 1 104 ? -12.277 -6.965  -4.460  1.00 0.00 ? 104 MET B N    20 
ATOM 10469 C CA   . MET B 1 104 ? -12.895 -5.793  -5.130  1.00 0.00 ? 104 MET B CA   20 
ATOM 10470 C C    . MET B 1 104 ? -13.575 -4.920  -4.077  1.00 0.00 ? 104 MET B C    20 
ATOM 10471 O O    . MET B 1 104 ? -14.417 -4.098  -4.384  1.00 0.00 ? 104 MET B O    20 
ATOM 10472 C CB   . MET B 1 104 ? -13.934 -6.274  -6.145  1.00 0.00 ? 104 MET B CB   20 
ATOM 10473 C CG   . MET B 1 104 ? -13.830 -5.432  -7.414  1.00 0.00 ? 104 MET B CG   20 
ATOM 10474 S SD   . MET B 1 104 ? -14.729 -3.879  -7.180  1.00 0.00 ? 104 MET B SD   20 
ATOM 10475 C CE   . MET B 1 104 ? -15.259 -3.670  -8.895  1.00 0.00 ? 104 MET B CE   20 
ATOM 10476 H H    . MET B 1 104 ? -12.809 -7.768  -4.287  1.00 0.00 ? 104 MET B H    20 
ATOM 10477 H HA   . MET B 1 104 ? -12.132 -5.221  -5.637  1.00 0.00 ? 104 MET B HA   20 
ATOM 10478 H HB2  . MET B 1 104 ? -13.750 -7.312  -6.382  1.00 0.00 ? 104 MET B HB2  20 
ATOM 10479 H HB3  . MET B 1 104 ? -14.923 -6.170  -5.725  1.00 0.00 ? 104 MET B HB3  20 
ATOM 10480 H HG2  . MET B 1 104 ? -12.792 -5.220  -7.623  1.00 0.00 ? 104 MET B HG2  20 
ATOM 10481 H HG3  . MET B 1 104 ? -14.260 -5.975  -8.243  1.00 0.00 ? 104 MET B HG3  20 
ATOM 10482 H HE1  . MET B 1 104 ? -14.474 -4.012  -9.557  1.00 0.00 ? 104 MET B HE1  20 
ATOM 10483 H HE2  . MET B 1 104 ? -16.158 -4.246  -9.067  1.00 0.00 ? 104 MET B HE2  20 
ATOM 10484 H HE3  . MET B 1 104 ? -15.459 -2.628  -9.088  1.00 0.00 ? 104 MET B HE3  20 
ATOM 10485 N N    . ILE B 1 105 ? -13.209 -5.089  -2.836  1.00 0.00 ? 105 ILE B N    20 
ATOM 10486 C CA   . ILE B 1 105 ? -13.825 -4.267  -1.758  1.00 0.00 ? 105 ILE B CA   20 
ATOM 10487 C C    . ILE B 1 105 ? -12.805 -4.057  -0.642  1.00 0.00 ? 105 ILE B C    20 
ATOM 10488 O O    . ILE B 1 105 ? -11.797 -4.732  -0.574  1.00 0.00 ? 105 ILE B O    20 
ATOM 10489 C CB   . ILE B 1 105 ? -15.049 -4.986  -1.195  1.00 0.00 ? 105 ILE B CB   20 
ATOM 10490 C CG1  . ILE B 1 105 ? -16.111 -5.107  -2.290  1.00 0.00 ? 105 ILE B CG1  20 
ATOM 10491 C CG2  . ILE B 1 105 ? -15.610 -4.183  -0.021  1.00 0.00 ? 105 ILE B CG2  20 
ATOM 10492 C CD1  . ILE B 1 105 ? -17.423 -5.596  -1.676  1.00 0.00 ? 105 ILE B CD1  20 
ATOM 10493 H H    . ILE B 1 105 ? -12.523 -5.756  -2.611  1.00 0.00 ? 105 ILE B H    20 
ATOM 10494 H HA   . ILE B 1 105 ? -14.122 -3.310  -2.160  1.00 0.00 ? 105 ILE B HA   20 
ATOM 10495 H HB   . ILE B 1 105 ? -14.763 -5.971  -0.857  1.00 0.00 ? 105 ILE B HB   20 
ATOM 10496 H HG12 . ILE B 1 105 ? -16.263 -4.142  -2.750  1.00 0.00 ? 105 ILE B HG12 20 
ATOM 10497 H HG13 . ILE B 1 105 ? -15.780 -5.814  -3.036  1.00 0.00 ? 105 ILE B HG13 20 
ATOM 10498 H HG21 . ILE B 1 105 ? -15.786 -3.164  -0.331  1.00 0.00 ? 105 ILE B HG21 20 
ATOM 10499 H HG22 . ILE B 1 105 ? -16.538 -4.625  0.308   1.00 0.00 ? 105 ILE B HG22 20 
ATOM 10500 H HG23 . ILE B 1 105 ? -14.899 -4.193  0.793   1.00 0.00 ? 105 ILE B HG23 20 
ATOM 10501 H HD11 . ILE B 1 105 ? -17.241 -6.497  -1.108  1.00 0.00 ? 105 ILE B HD11 20 
ATOM 10502 H HD12 . ILE B 1 105 ? -17.822 -4.833  -1.024  1.00 0.00 ? 105 ILE B HD12 20 
ATOM 10503 H HD13 . ILE B 1 105 ? -18.133 -5.805  -2.463  1.00 0.00 ? 105 ILE B HD13 20 
ATOM 10504 N N    . VAL B 1 106 ? -13.053 -3.124  0.232   1.00 0.00 ? 106 VAL B N    20 
ATOM 10505 C CA   . VAL B 1 106 ? -12.095 -2.870  1.335   1.00 0.00 ? 106 VAL B CA   20 
ATOM 10506 C C    . VAL B 1 106 ? -12.776 -3.150  2.679   1.00 0.00 ? 106 VAL B C    20 
ATOM 10507 O O    . VAL B 1 106 ? -13.900 -2.752  2.912   1.00 0.00 ? 106 VAL B O    20 
ATOM 10508 C CB   . VAL B 1 106 ? -11.649 -1.410  1.267   1.00 0.00 ? 106 VAL B CB   20 
ATOM 10509 C CG1  . VAL B 1 106 ? -11.017 -1.004  2.596   1.00 0.00 ? 106 VAL B CG1  20 
ATOM 10510 C CG2  . VAL B 1 106 ? -10.626 -1.246  0.141   1.00 0.00 ? 106 VAL B CG2  20 
ATOM 10511 H H    . VAL B 1 106 ? -13.867 -2.586  0.160   1.00 0.00 ? 106 VAL B H    20 
ATOM 10512 H HA   . VAL B 1 106 ? -11.237 -3.515  1.224   1.00 0.00 ? 106 VAL B HA   20 
ATOM 10513 H HB   . VAL B 1 106 ? -12.506 -0.781  1.071   1.00 0.00 ? 106 VAL B HB   20 
ATOM 10514 H HG11 . VAL B 1 106 ? -10.807 -1.890  3.176   1.00 0.00 ? 106 VAL B HG11 20 
ATOM 10515 H HG12 . VAL B 1 106 ? -10.101 -0.468  2.409   1.00 0.00 ? 106 VAL B HG12 20 
ATOM 10516 H HG13 . VAL B 1 106 ? -11.704 -0.371  3.140   1.00 0.00 ? 106 VAL B HG13 20 
ATOM 10517 H HG21 . VAL B 1 106 ? -9.920  -2.063  0.173   1.00 0.00 ? 106 VAL B HG21 20 
ATOM 10518 H HG22 . VAL B 1 106 ? -11.135 -1.249  -0.812  1.00 0.00 ? 106 VAL B HG22 20 
ATOM 10519 H HG23 . VAL B 1 106 ? -10.098 -0.311  0.264   1.00 0.00 ? 106 VAL B HG23 20 
ATOM 10520 N N    . ARG B 1 107 ? -12.100 -3.831  3.562   1.00 0.00 ? 107 ARG B N    20 
ATOM 10521 C CA   . ARG B 1 107 ? -12.701 -4.135  4.892   1.00 0.00 ? 107 ARG B CA   20 
ATOM 10522 C C    . ARG B 1 107 ? -11.863 -3.466  5.983   1.00 0.00 ? 107 ARG B C    20 
ATOM 10523 O O    . ARG B 1 107 ? -12.308 -3.275  7.097   1.00 0.00 ? 107 ARG B O    20 
ATOM 10524 C CB   . ARG B 1 107 ? -12.713 -5.650  5.109   1.00 0.00 ? 107 ARG B CB   20 
ATOM 10525 C CG   . ARG B 1 107 ? -13.367 -5.969  6.454   1.00 0.00 ? 107 ARG B CG   20 
ATOM 10526 C CD   . ARG B 1 107 ? -13.142 -7.444  6.791   1.00 0.00 ? 107 ARG B CD   20 
ATOM 10527 N NE   . ARG B 1 107 ? -14.320 -7.969  7.535   1.00 0.00 ? 107 ARG B NE   20 
ATOM 10528 C CZ   . ARG B 1 107 ? -15.364 -8.402  6.882   1.00 0.00 ? 107 ARG B CZ   20 
ATOM 10529 N NH1  . ARG B 1 107 ? -15.238 -9.377  6.024   1.00 0.00 ? 107 ARG B NH1  20 
ATOM 10530 N NH2  . ARG B 1 107 ? -16.534 -7.861  7.088   1.00 0.00 ? 107 ARG B NH2  20 
ATOM 10531 H H    . ARG B 1 107 ? -11.193 -4.140  3.354   1.00 0.00 ? 107 ARG B H    20 
ATOM 10532 H HA   . ARG B 1 107 ? -13.711 -3.756  4.928   1.00 0.00 ? 107 ARG B HA   20 
ATOM 10533 H HB2  . ARG B 1 107 ? -13.273 -6.122  4.315   1.00 0.00 ? 107 ARG B HB2  20 
ATOM 10534 H HB3  . ARG B 1 107 ? -11.700 -6.022  5.106   1.00 0.00 ? 107 ARG B HB3  20 
ATOM 10535 H HG2  . ARG B 1 107 ? -12.928 -5.351  7.224   1.00 0.00 ? 107 ARG B HG2  20 
ATOM 10536 H HG3  . ARG B 1 107 ? -14.427 -5.773  6.396   1.00 0.00 ? 107 ARG B HG3  20 
ATOM 10537 H HD2  . ARG B 1 107 ? -13.014 -8.006  5.877   1.00 0.00 ? 107 ARG B HD2  20 
ATOM 10538 H HD3  . ARG B 1 107 ? -12.257 -7.543  7.402   1.00 0.00 ? 107 ARG B HD3  20 
ATOM 10539 H HE   . ARG B 1 107 ? -14.312 -7.990  8.515   1.00 0.00 ? 107 ARG B HE   20 
ATOM 10540 H HH11 . ARG B 1 107 ? -14.342 -9.792  5.865   1.00 0.00 ? 107 ARG B HH11 20 
ATOM 10541 H HH12 . ARG B 1 107 ? -16.037 -9.709  5.523   1.00 0.00 ? 107 ARG B HH12 20 
ATOM 10542 H HH21 . ARG B 1 107 ? -16.629 -7.114  7.746   1.00 0.00 ? 107 ARG B HH21 20 
ATOM 10543 H HH22 . ARG B 1 107 ? -17.333 -8.193  6.588   1.00 0.00 ? 107 ARG B HH22 20 
ATOM 10544 N N    . SER B 1 108 ? -10.650 -3.107  5.664   1.00 0.00 ? 108 SER B N    20 
ATOM 10545 C CA   . SER B 1 108 ? -9.772  -2.445  6.668   1.00 0.00 ? 108 SER B CA   20 
ATOM 10546 C C    . SER B 1 108 ? -8.490  -1.982  5.979   1.00 0.00 ? 108 SER B C    20 
ATOM 10547 O O    . SER B 1 108 ? -8.059  -2.558  5.000   1.00 0.00 ? 108 SER B O    20 
ATOM 10548 C CB   . SER B 1 108 ? -9.422  -3.431  7.780   1.00 0.00 ? 108 SER B CB   20 
ATOM 10549 O OG   . SER B 1 108 ? -8.545  -2.803  8.706   1.00 0.00 ? 108 SER B OG   20 
ATOM 10550 H H    . SER B 1 108 ? -10.316 -3.270  4.757   1.00 0.00 ? 108 SER B H    20 
ATOM 10551 H HA   . SER B 1 108 ? -10.285 -1.592  7.089   1.00 0.00 ? 108 SER B HA   20 
ATOM 10552 H HB2  . SER B 1 108 ? -10.320 -3.734  8.292   1.00 0.00 ? 108 SER B HB2  20 
ATOM 10553 H HB3  . SER B 1 108 ? -8.944  -4.301  7.350   1.00 0.00 ? 108 SER B HB3  20 
ATOM 10554 H HG   . SER B 1 108 ? -8.422  -3.398  9.449   1.00 0.00 ? 108 SER B HG   20 
ATOM 10555 N N    . CYS B 1 109 ? -7.881  -0.942  6.473   1.00 0.00 ? 109 CYS B N    20 
ATOM 10556 C CA   . CYS B 1 109 ? -6.629  -0.447  5.827   1.00 0.00 ? 109 CYS B CA   20 
ATOM 10557 C C    . CYS B 1 109 ? -5.403  -0.906  6.626   1.00 0.00 ? 109 CYS B C    20 
ATOM 10558 O O    . CYS B 1 109 ? -5.516  -1.651  7.580   1.00 0.00 ? 109 CYS B O    20 
ATOM 10559 C CB   . CYS B 1 109 ? -6.654  1.079   5.761   1.00 0.00 ? 109 CYS B CB   20 
ATOM 10560 S SG   . CYS B 1 109 ? -8.042  1.616   4.734   1.00 0.00 ? 109 CYS B SG   20 
ATOM 10561 H H    . CYS B 1 109 ? -8.249  -0.484  7.259   1.00 0.00 ? 109 CYS B H    20 
ATOM 10562 H HA   . CYS B 1 109 ? -6.573  -0.847  4.827   1.00 0.00 ? 109 CYS B HA   20 
ATOM 10563 H HB2  . CYS B 1 109 ? -6.764  1.481   6.758   1.00 0.00 ? 109 CYS B HB2  20 
ATOM 10564 H HB3  . CYS B 1 109 ? -5.730  1.433   5.330   1.00 0.00 ? 109 CYS B HB3  20 
ATOM 10565 N N    . LYS B 1 110 ? -4.230  -0.467  6.240   1.00 0.00 ? 110 LYS B N    20 
ATOM 10566 C CA   . LYS B 1 110 ? -2.998  -0.878  6.972   1.00 0.00 ? 110 LYS B CA   20 
ATOM 10567 C C    . LYS B 1 110 ? -1.824  -0.011  6.498   1.00 0.00 ? 110 LYS B C    20 
ATOM 10568 O O    . LYS B 1 110 ? -1.956  1.188   6.349   1.00 0.00 ? 110 LYS B O    20 
ATOM 10569 C CB   . LYS B 1 110 ? -2.715  -2.355  6.686   1.00 0.00 ? 110 LYS B CB   20 
ATOM 10570 C CG   . LYS B 1 110 ? -2.620  -2.569  5.174   1.00 0.00 ? 110 LYS B CG   20 
ATOM 10571 C CD   . LYS B 1 110 ? -1.572  -3.640  4.868   1.00 0.00 ? 110 LYS B CD   20 
ATOM 10572 C CE   . LYS B 1 110 ? -1.786  -4.173  3.450   1.00 0.00 ? 110 LYS B CE   20 
ATOM 10573 N NZ   . LYS B 1 110 ? -0.466  -4.395  2.798   1.00 0.00 ? 110 LYS B NZ   20 
ATOM 10574 H H    . LYS B 1 110 ? -4.157  0.133   5.467   1.00 0.00 ? 110 LYS B H    20 
ATOM 10575 H HA   . LYS B 1 110 ? -3.146  -0.736  8.032   1.00 0.00 ? 110 LYS B HA   20 
ATOM 10576 H HB2  . LYS B 1 110 ? -1.787  -2.645  7.156   1.00 0.00 ? 110 LYS B HB2  20 
ATOM 10577 H HB3  . LYS B 1 110 ? -3.518  -2.956  7.083   1.00 0.00 ? 110 LYS B HB3  20 
ATOM 10578 H HG2  . LYS B 1 110 ? -3.580  -2.886  4.794   1.00 0.00 ? 110 LYS B HG2  20 
ATOM 10579 H HG3  . LYS B 1 110 ? -2.334  -1.643  4.697   1.00 0.00 ? 110 LYS B HG3  20 
ATOM 10580 H HD2  . LYS B 1 110 ? -0.584  -3.209  4.945   1.00 0.00 ? 110 LYS B HD2  20 
ATOM 10581 H HD3  . LYS B 1 110 ? -1.668  -4.451  5.573   1.00 0.00 ? 110 LYS B HD3  20 
ATOM 10582 H HE2  . LYS B 1 110 ? -2.327  -5.106  3.495   1.00 0.00 ? 110 LYS B HE2  20 
ATOM 10583 H HE3  . LYS B 1 110 ? -2.354  -3.454  2.877   1.00 0.00 ? 110 LYS B HE3  20 
ATOM 10584 H HZ1  . LYS B 1 110 ? 0.223   -3.710  3.168   1.00 0.00 ? 110 LYS B HZ1  20 
ATOM 10585 H HZ2  . LYS B 1 110 ? -0.135  -5.359  3.002   1.00 0.00 ? 110 LYS B HZ2  20 
ATOM 10586 H HZ3  . LYS B 1 110 ? -0.562  -4.271  1.769   1.00 0.00 ? 110 LYS B HZ3  20 
ATOM 10587 N N    . CYS B 1 111 ? -0.677  -0.590  6.258   1.00 0.00 ? 111 CYS B N    20 
ATOM 10588 C CA   . CYS B 1 111 ? 0.479   0.229   5.799   1.00 0.00 ? 111 CYS B CA   20 
ATOM 10589 C C    . CYS B 1 111 ? 1.416   -0.630  4.950   1.00 0.00 ? 111 CYS B C    20 
ATOM 10590 O O    . CYS B 1 111 ? 2.323   -1.261  5.457   1.00 0.00 ? 111 CYS B O    20 
ATOM 10591 C CB   . CYS B 1 111 ? 1.238   0.758   7.018   1.00 0.00 ? 111 CYS B CB   20 
ATOM 10592 S SG   . CYS B 1 111 ? 0.146   1.823   7.991   1.00 0.00 ? 111 CYS B SG   20 
ATOM 10593 H H    . CYS B 1 111 ? -0.572  -1.554  6.379   1.00 0.00 ? 111 CYS B H    20 
ATOM 10594 H HA   . CYS B 1 111 ? 0.119   1.060   5.211   1.00 0.00 ? 111 CYS B HA   20 
ATOM 10595 H HB2  . CYS B 1 111 ? 1.566   -0.073  7.625   1.00 0.00 ? 111 CYS B HB2  20 
ATOM 10596 H HB3  . CYS B 1 111 ? 2.096   1.324   6.689   1.00 0.00 ? 111 CYS B HB3  20 
ATOM 10597 N N    . SER B 1 112 ? 1.212   -0.657  3.661   1.00 0.00 ? 112 SER B N    20 
ATOM 10598 C CA   . SER B 1 112 ? 2.100   -1.473  2.788   1.00 0.00 ? 112 SER B CA   20 
ATOM 10599 C C    . SER B 1 112 ? 3.345   -0.658  2.434   1.00 0.00 ? 112 SER B C    20 
ATOM 10600 O O    . SER B 1 112 ? 3.199   0.523   2.161   1.00 0.00 ? 112 SER B O    20 
ATOM 10601 C CB   . SER B 1 112 ? 1.353   -1.845  1.509   1.00 0.00 ? 112 SER B CB   20 
ATOM 10602 O OG   . SER B 1 112 ? 1.991   -2.958  0.898   1.00 0.00 ? 112 SER B OG   20 
ATOM 10603 O OXT  . SER B 1 112 ? 4.424   -1.226  2.444   1.00 0.00 ? 112 SER B OXT  20 
ATOM 10604 H H    . SER B 1 112 ? 0.477   -0.140  3.267   1.00 0.00 ? 112 SER B H    20 
ATOM 10605 H HA   . SER B 1 112 ? 2.394   -2.372  3.310   1.00 0.00 ? 112 SER B HA   20 
ATOM 10606 H HB2  . SER B 1 112 ? 0.335   -2.106  1.746   1.00 0.00 ? 112 SER B HB2  20 
ATOM 10607 H HB3  . SER B 1 112 ? 1.355   -1.000  0.834   1.00 0.00 ? 112 SER B HB3  20 
ATOM 10608 H HG   . SER B 1 112 ? 2.938   -2.800  0.913   1.00 0.00 ? 112 SER B HG   20 
ATOM 10609 N N    . ALA A 1 1   ? 6.928   -2.621  -15.268 1.00 0.00 ? 1   ALA A N    21 
ATOM 10610 C CA   . ALA A 1 1   ? 8.206   -2.746  -14.512 1.00 0.00 ? 1   ALA A CA   21 
ATOM 10611 C C    . ALA A 1 1   ? 8.240   -1.705  -13.391 1.00 0.00 ? 1   ALA A C    21 
ATOM 10612 O O    . ALA A 1 1   ? 8.542   -0.550  -13.612 1.00 0.00 ? 1   ALA A O    21 
ATOM 10613 C CB   . ALA A 1 1   ? 9.385   -2.513  -15.460 1.00 0.00 ? 1   ALA A CB   21 
ATOM 10614 H H1   . ALA A 1 1   ? 6.164   -2.352  -14.617 1.00 0.00 ? 1   ALA A H1   21 
ATOM 10615 H H2   . ALA A 1 1   ? 7.032   -1.892  -16.004 1.00 0.00 ? 1   ALA A H2   21 
ATOM 10616 H H3   . ALA A 1 1   ? 6.697   -3.532  -15.713 1.00 0.00 ? 1   ALA A H3   21 
ATOM 10617 H HA   . ALA A 1 1   ? 8.277   -3.736  -14.086 1.00 0.00 ? 1   ALA A HA   21 
ATOM 10618 H HB1  . ALA A 1 1   ? 9.272   -1.555  -15.945 1.00 0.00 ? 1   ALA A HB1  21 
ATOM 10619 H HB2  . ALA A 1 1   ? 10.307  -2.527  -14.899 1.00 0.00 ? 1   ALA A HB2  21 
ATOM 10620 H HB3  . ALA A 1 1   ? 9.406   -3.294  -16.206 1.00 0.00 ? 1   ALA A HB3  21 
ATOM 10621 N N    . LEU A 1 2   ? 7.933   -2.105  -12.187 1.00 0.00 ? 2   LEU A N    21 
ATOM 10622 C CA   . LEU A 1 2   ? 7.948   -1.138  -11.054 1.00 0.00 ? 2   LEU A CA   21 
ATOM 10623 C C    . LEU A 1 2   ? 8.972   -1.585  -10.015 1.00 0.00 ? 2   LEU A C    21 
ATOM 10624 O O    . LEU A 1 2   ? 8.667   -1.742  -8.849  1.00 0.00 ? 2   LEU A O    21 
ATOM 10625 C CB   . LEU A 1 2   ? 6.571   -1.087  -10.403 1.00 0.00 ? 2   LEU A CB   21 
ATOM 10626 C CG   . LEU A 1 2   ? 5.554   -0.522  -11.396 1.00 0.00 ? 2   LEU A CG   21 
ATOM 10627 C CD1  . LEU A 1 2   ? 4.253   -0.192  -10.662 1.00 0.00 ? 2   LEU A CD1  21 
ATOM 10628 C CD2  . LEU A 1 2   ? 6.117   0.751   -12.033 1.00 0.00 ? 2   LEU A CD2  21 
ATOM 10629 H H    . LEU A 1 2   ? 7.693   -3.042  -12.028 1.00 0.00 ? 2   LEU A H    21 
ATOM 10630 H HA   . LEU A 1 2   ? 8.211   -0.155  -11.419 1.00 0.00 ? 2   LEU A HA   21 
ATOM 10631 H HB2  . LEU A 1 2   ? 6.277   -2.084  -10.110 1.00 0.00 ? 2   LEU A HB2  21 
ATOM 10632 H HB3  . LEU A 1 2   ? 6.614   -0.453  -9.532  1.00 0.00 ? 2   LEU A HB3  21 
ATOM 10633 H HG   . LEU A 1 2   ? 5.357   -1.254  -12.165 1.00 0.00 ? 2   LEU A HG   21 
ATOM 10634 H HD11 . LEU A 1 2   ? 4.404   -0.295  -9.598  1.00 0.00 ? 2   LEU A HD11 21 
ATOM 10635 H HD12 . LEU A 1 2   ? 3.960   0.824   -10.887 1.00 0.00 ? 2   LEU A HD12 21 
ATOM 10636 H HD13 . LEU A 1 2   ? 3.477   -0.869  -10.983 1.00 0.00 ? 2   LEU A HD13 21 
ATOM 10637 H HD21 . LEU A 1 2   ? 6.841   1.197   -11.366 1.00 0.00 ? 2   LEU A HD21 21 
ATOM 10638 H HD22 . LEU A 1 2   ? 6.594   0.505   -12.970 1.00 0.00 ? 2   LEU A HD22 21 
ATOM 10639 H HD23 . LEU A 1 2   ? 5.313   1.450   -12.211 1.00 0.00 ? 2   LEU A HD23 21 
ATOM 10640 N N    . ASP A 1 3   ? 10.186  -1.789  -10.428 1.00 0.00 ? 3   ASP A N    21 
ATOM 10641 C CA   . ASP A 1 3   ? 11.237  -2.227  -9.469  1.00 0.00 ? 3   ASP A CA   21 
ATOM 10642 C C    . ASP A 1 3   ? 12.205  -1.072  -9.212  1.00 0.00 ? 3   ASP A C    21 
ATOM 10643 O O    . ASP A 1 3   ? 12.050  0.013   -9.737  1.00 0.00 ? 3   ASP A O    21 
ATOM 10644 C CB   . ASP A 1 3   ? 12.007  -3.414  -10.053 1.00 0.00 ? 3   ASP A CB   21 
ATOM 10645 C CG   . ASP A 1 3   ? 12.053  -3.301  -11.579 1.00 0.00 ? 3   ASP A CG   21 
ATOM 10646 O OD1  . ASP A 1 3   ? 11.073  -3.663  -12.209 1.00 0.00 ? 3   ASP A OD1  21 
ATOM 10647 O OD2  . ASP A 1 3   ? 13.067  -2.858  -12.090 1.00 0.00 ? 3   ASP A OD2  21 
ATOM 10648 H H    . ASP A 1 3   ? 10.405  -1.655  -11.371 1.00 0.00 ? 3   ASP A H    21 
ATOM 10649 H HA   . ASP A 1 3   ? 10.774  -2.522  -8.539  1.00 0.00 ? 3   ASP A HA   21 
ATOM 10650 H HB2  . ASP A 1 3   ? 13.015  -3.415  -9.661  1.00 0.00 ? 3   ASP A HB2  21 
ATOM 10651 H HB3  . ASP A 1 3   ? 11.514  -4.333  -9.776  1.00 0.00 ? 3   ASP A HB3  21 
ATOM 10652 N N    . THR A 1 4   ? 13.201  -1.300  -8.403  1.00 0.00 ? 4   THR A N    21 
ATOM 10653 C CA   . THR A 1 4   ? 14.183  -0.222  -8.102  1.00 0.00 ? 4   THR A CA   21 
ATOM 10654 C C    . THR A 1 4   ? 15.182  -0.094  -9.254  1.00 0.00 ? 4   THR A C    21 
ATOM 10655 O O    . THR A 1 4   ? 16.127  0.666   -9.186  1.00 0.00 ? 4   THR A O    21 
ATOM 10656 C CB   . THR A 1 4   ? 14.918  -0.567  -6.806  1.00 0.00 ? 4   THR A CB   21 
ATOM 10657 O OG1  . THR A 1 4   ? 15.984  -1.462  -7.090  1.00 0.00 ? 4   THR A OG1  21 
ATOM 10658 C CG2  . THR A 1 4   ? 13.937  -1.224  -5.831  1.00 0.00 ? 4   THR A CG2  21 
ATOM 10659 H H    . THR A 1 4   ? 13.302  -2.182  -7.989  1.00 0.00 ? 4   THR A H    21 
ATOM 10660 H HA   . THR A 1 4   ? 13.664  0.714   -7.980  1.00 0.00 ? 4   THR A HA   21 
ATOM 10661 H HB   . THR A 1 4   ? 15.311  0.335   -6.362  1.00 0.00 ? 4   THR A HB   21 
ATOM 10662 H HG1  . THR A 1 4   ? 16.742  -1.195  -6.566  1.00 0.00 ? 4   THR A HG1  21 
ATOM 10663 H HG21 . THR A 1 4   ? 12.933  -1.146  -6.223  1.00 0.00 ? 4   THR A HG21 21 
ATOM 10664 H HG22 . THR A 1 4   ? 14.193  -2.266  -5.708  1.00 0.00 ? 4   THR A HG22 21 
ATOM 10665 H HG23 . THR A 1 4   ? 13.988  -0.726  -4.875  1.00 0.00 ? 4   THR A HG23 21 
ATOM 10666 N N    . ASN A 1 5   ? 14.974  -0.821  -10.318 1.00 0.00 ? 5   ASN A N    21 
ATOM 10667 C CA   . ASN A 1 5   ? 15.902  -0.727  -11.477 1.00 0.00 ? 5   ASN A CA   21 
ATOM 10668 C C    . ASN A 1 5   ? 15.324  0.257   -12.497 1.00 0.00 ? 5   ASN A C    21 
ATOM 10669 O O    . ASN A 1 5   ? 16.016  1.110   -13.016 1.00 0.00 ? 5   ASN A O    21 
ATOM 10670 C CB   . ASN A 1 5   ? 16.054  -2.105  -12.124 1.00 0.00 ? 5   ASN A CB   21 
ATOM 10671 C CG   . ASN A 1 5   ? 17.494  -2.290  -12.602 1.00 0.00 ? 5   ASN A CG   21 
ATOM 10672 O OD1  . ASN A 1 5   ? 18.414  -1.747  -12.022 1.00 0.00 ? 5   ASN A OD1  21 
ATOM 10673 N ND2  . ASN A 1 5   ? 17.732  -3.041  -13.642 1.00 0.00 ? 5   ASN A ND2  21 
ATOM 10674 H H    . ASN A 1 5   ? 14.200  -1.421  -10.358 1.00 0.00 ? 5   ASN A H    21 
ATOM 10675 H HA   . ASN A 1 5   ? 16.866  -0.376  -11.142 1.00 0.00 ? 5   ASN A HA   21 
ATOM 10676 H HB2  . ASN A 1 5   ? 15.811  -2.870  -11.401 1.00 0.00 ? 5   ASN A HB2  21 
ATOM 10677 H HB3  . ASN A 1 5   ? 15.384  -2.182  -12.968 1.00 0.00 ? 5   ASN A HB3  21 
ATOM 10678 H HD21 . ASN A 1 5   ? 16.991  -3.480  -14.110 1.00 0.00 ? 5   ASN A HD21 21 
ATOM 10679 H HD22 . ASN A 1 5   ? 18.652  -3.166  -13.957 1.00 0.00 ? 5   ASN A HD22 21 
ATOM 10680 N N    . TYR A 1 6   ? 14.055  0.143   -12.785 1.00 0.00 ? 6   TYR A N    21 
ATOM 10681 C CA   . TYR A 1 6   ? 13.420  1.063   -13.763 1.00 0.00 ? 6   TYR A CA   21 
ATOM 10682 C C    . TYR A 1 6   ? 12.917  2.314   -13.038 1.00 0.00 ? 6   TYR A C    21 
ATOM 10683 O O    . TYR A 1 6   ? 12.651  3.331   -13.647 1.00 0.00 ? 6   TYR A O    21 
ATOM 10684 C CB   . TYR A 1 6   ? 12.244  0.344   -14.418 1.00 0.00 ? 6   TYR A CB   21 
ATOM 10685 C CG   . TYR A 1 6   ? 11.414  1.332   -15.199 1.00 0.00 ? 6   TYR A CG   21 
ATOM 10686 C CD1  . TYR A 1 6   ? 11.805  1.716   -16.487 1.00 0.00 ? 6   TYR A CD1  21 
ATOM 10687 C CD2  . TYR A 1 6   ? 10.252  1.866   -14.632 1.00 0.00 ? 6   TYR A CD2  21 
ATOM 10688 C CE1  . TYR A 1 6   ? 11.033  2.634   -17.209 1.00 0.00 ? 6   TYR A CE1  21 
ATOM 10689 C CE2  . TYR A 1 6   ? 9.479   2.784   -15.353 1.00 0.00 ? 6   TYR A CE2  21 
ATOM 10690 C CZ   . TYR A 1 6   ? 9.869   3.169   -16.641 1.00 0.00 ? 6   TYR A CZ   21 
ATOM 10691 O OH   . TYR A 1 6   ? 9.107   4.073   -17.353 1.00 0.00 ? 6   TYR A OH   21 
ATOM 10692 H H    . TYR A 1 6   ? 13.516  -0.552  -12.355 1.00 0.00 ? 6   TYR A H    21 
ATOM 10693 H HA   . TYR A 1 6   ? 14.140  1.344   -14.518 1.00 0.00 ? 6   TYR A HA   21 
ATOM 10694 H HB2  . TYR A 1 6   ? 12.617  -0.422  -15.081 1.00 0.00 ? 6   TYR A HB2  21 
ATOM 10695 H HB3  . TYR A 1 6   ? 11.632  -0.112  -13.655 1.00 0.00 ? 6   TYR A HB3  21 
ATOM 10696 H HD1  . TYR A 1 6   ? 12.703  1.304   -16.924 1.00 0.00 ? 6   TYR A HD1  21 
ATOM 10697 H HD2  . TYR A 1 6   ? 9.951   1.569   -13.637 1.00 0.00 ? 6   TYR A HD2  21 
ATOM 10698 H HE1  . TYR A 1 6   ? 11.334  2.930   -18.203 1.00 0.00 ? 6   TYR A HE1  21 
ATOM 10699 H HE2  . TYR A 1 6   ? 8.582   3.196   -14.915 1.00 0.00 ? 6   TYR A HE2  21 
ATOM 10700 H HH   . TYR A 1 6   ? 8.593   3.585   -17.999 1.00 0.00 ? 6   TYR A HH   21 
ATOM 10701 N N    . CYS A 1 7   ? 12.778  2.245   -11.742 1.00 0.00 ? 7   CYS A N    21 
ATOM 10702 C CA   . CYS A 1 7   ? 12.287  3.430   -10.981 1.00 0.00 ? 7   CYS A CA   21 
ATOM 10703 C C    . CYS A 1 7   ? 13.452  4.381   -10.704 1.00 0.00 ? 7   CYS A C    21 
ATOM 10704 O O    . CYS A 1 7   ? 13.261  5.511   -10.299 1.00 0.00 ? 7   CYS A O    21 
ATOM 10705 C CB   . CYS A 1 7   ? 11.677  2.967   -9.658  1.00 0.00 ? 7   CYS A CB   21 
ATOM 10706 S SG   . CYS A 1 7   ? 9.987   2.388   -9.951  1.00 0.00 ? 7   CYS A SG   21 
ATOM 10707 H H    . CYS A 1 7   ? 12.995  1.415   -11.269 1.00 0.00 ? 7   CYS A H    21 
ATOM 10708 H HA   . CYS A 1 7   ? 11.536  3.943   -11.562 1.00 0.00 ? 7   CYS A HA   21 
ATOM 10709 H HB2  . CYS A 1 7   ? 12.271  2.161   -9.249  1.00 0.00 ? 7   CYS A HB2  21 
ATOM 10710 H HB3  . CYS A 1 7   ? 11.660  3.791   -8.960  1.00 0.00 ? 7   CYS A HB3  21 
ATOM 10711 N N    . PHE A 1 8   ? 14.658  3.936   -10.922 1.00 0.00 ? 8   PHE A N    21 
ATOM 10712 C CA   . PHE A 1 8   ? 15.835  4.817   -10.676 1.00 0.00 ? 8   PHE A CA   21 
ATOM 10713 C C    . PHE A 1 8   ? 16.089  5.697   -11.902 1.00 0.00 ? 8   PHE A C    21 
ATOM 10714 O O    . PHE A 1 8   ? 17.212  5.882   -12.323 1.00 0.00 ? 8   PHE A O    21 
ATOM 10715 C CB   . PHE A 1 8   ? 17.070  3.955   -10.407 1.00 0.00 ? 8   PHE A CB   21 
ATOM 10716 C CG   . PHE A 1 8   ? 17.197  3.686   -8.925  1.00 0.00 ? 8   PHE A CG   21 
ATOM 10717 C CD1  . PHE A 1 8   ? 16.078  3.792   -8.089  1.00 0.00 ? 8   PHE A CD1  21 
ATOM 10718 C CD2  . PHE A 1 8   ? 18.440  3.330   -8.385  1.00 0.00 ? 8   PHE A CD2  21 
ATOM 10719 C CE1  . PHE A 1 8   ? 16.202  3.544   -6.717  1.00 0.00 ? 8   PHE A CE1  21 
ATOM 10720 C CE2  . PHE A 1 8   ? 18.563  3.081   -7.014  1.00 0.00 ? 8   PHE A CE2  21 
ATOM 10721 C CZ   . PHE A 1 8   ? 17.444  3.188   -6.179  1.00 0.00 ? 8   PHE A CZ   21 
ATOM 10722 H H    . PHE A 1 8   ? 14.790  3.022   -11.250 1.00 0.00 ? 8   PHE A H    21 
ATOM 10723 H HA   . PHE A 1 8   ? 15.641  5.444   -9.817  1.00 0.00 ? 8   PHE A HA   21 
ATOM 10724 H HB2  . PHE A 1 8   ? 16.972  3.019   -10.936 1.00 0.00 ? 8   PHE A HB2  21 
ATOM 10725 H HB3  . PHE A 1 8   ? 17.951  4.473   -10.754 1.00 0.00 ? 8   PHE A HB3  21 
ATOM 10726 H HD1  . PHE A 1 8   ? 15.119  4.066   -8.503  1.00 0.00 ? 8   PHE A HD1  21 
ATOM 10727 H HD2  . PHE A 1 8   ? 19.303  3.247   -9.029  1.00 0.00 ? 8   PHE A HD2  21 
ATOM 10728 H HE1  . PHE A 1 8   ? 15.339  3.626   -6.073  1.00 0.00 ? 8   PHE A HE1  21 
ATOM 10729 H HE2  . PHE A 1 8   ? 19.522  2.806   -6.599  1.00 0.00 ? 8   PHE A HE2  21 
ATOM 10730 H HZ   . PHE A 1 8   ? 17.540  2.996   -5.121  1.00 0.00 ? 8   PHE A HZ   21 
ATOM 10731 N N    . SER A 1 9   ? 15.053  6.244   -12.477 1.00 0.00 ? 9   SER A N    21 
ATOM 10732 C CA   . SER A 1 9   ? 15.234  7.113   -13.673 1.00 0.00 ? 9   SER A CA   21 
ATOM 10733 C C    . SER A 1 9   ? 14.900  8.561   -13.304 1.00 0.00 ? 9   SER A C    21 
ATOM 10734 O O    . SER A 1 9   ? 15.015  8.963   -12.164 1.00 0.00 ? 9   SER A O    21 
ATOM 10735 C CB   . SER A 1 9   ? 14.304  6.645   -14.792 1.00 0.00 ? 9   SER A CB   21 
ATOM 10736 O OG   . SER A 1 9   ? 15.030  6.586   -16.013 1.00 0.00 ? 9   SER A OG   21 
ATOM 10737 H H    . SER A 1 9   ? 14.155  6.085   -12.121 1.00 0.00 ? 9   SER A H    21 
ATOM 10738 H HA   . SER A 1 9   ? 16.260  7.056   -14.009 1.00 0.00 ? 9   SER A HA   21 
ATOM 10739 H HB2  . SER A 1 9   ? 13.924  5.664   -14.558 1.00 0.00 ? 9   SER A HB2  21 
ATOM 10740 H HB3  . SER A 1 9   ? 13.477  7.337   -14.885 1.00 0.00 ? 9   SER A HB3  21 
ATOM 10741 H HG   . SER A 1 9   ? 15.492  7.421   -16.123 1.00 0.00 ? 9   SER A HG   21 
ATOM 10742 N N    . SER A 1 10  ? 14.483  9.347   -14.260 1.00 0.00 ? 10  SER A N    21 
ATOM 10743 C CA   . SER A 1 10  ? 14.142  10.766  -13.958 1.00 0.00 ? 10  SER A CA   21 
ATOM 10744 C C    . SER A 1 10  ? 12.716  11.062  -14.425 1.00 0.00 ? 10  SER A C    21 
ATOM 10745 O O    . SER A 1 10  ? 12.178  12.123  -14.175 1.00 0.00 ? 10  SER A O    21 
ATOM 10746 C CB   . SER A 1 10  ? 15.118  11.692  -14.685 1.00 0.00 ? 10  SER A CB   21 
ATOM 10747 O OG   . SER A 1 10  ? 14.730  13.043  -14.473 1.00 0.00 ? 10  SER A OG   21 
ATOM 10748 H H    . SER A 1 10  ? 14.396  9.005   -15.174 1.00 0.00 ? 10  SER A H    21 
ATOM 10749 H HA   . SER A 1 10  ? 14.212  10.932  -12.895 1.00 0.00 ? 10  SER A HA   21 
ATOM 10750 H HB2  . SER A 1 10  ? 16.113  11.544  -14.297 1.00 0.00 ? 10  SER A HB2  21 
ATOM 10751 H HB3  . SER A 1 10  ? 15.109  11.465  -15.742 1.00 0.00 ? 10  SER A HB3  21 
ATOM 10752 H HG   . SER A 1 10  ? 14.955  13.543  -15.261 1.00 0.00 ? 10  SER A HG   21 
ATOM 10753 N N    . THR A 1 11  ? 12.100  10.134  -15.102 1.00 0.00 ? 11  THR A N    21 
ATOM 10754 C CA   . THR A 1 11  ? 10.710  10.362  -15.585 1.00 0.00 ? 11  THR A CA   21 
ATOM 10755 C C    . THR A 1 11  ? 9.746   9.447   -14.829 1.00 0.00 ? 11  THR A C    21 
ATOM 10756 O O    . THR A 1 11  ? 10.148  8.646   -14.010 1.00 0.00 ? 11  THR A O    21 
ATOM 10757 C CB   . THR A 1 11  ? 10.631  10.055  -17.083 1.00 0.00 ? 11  THR A CB   21 
ATOM 10758 O OG1  . THR A 1 11  ? 9.323   9.604   -17.406 1.00 0.00 ? 11  THR A OG1  21 
ATOM 10759 C CG2  . THR A 1 11  ? 11.649  8.972   -17.446 1.00 0.00 ? 11  THR A CG2  21 
ATOM 10760 H H    . THR A 1 11  ? 12.551  9.288   -15.294 1.00 0.00 ? 11  THR A H    21 
ATOM 10761 H HA   . THR A 1 11  ? 10.435  11.392  -15.415 1.00 0.00 ? 11  THR A HA   21 
ATOM 10762 H HB   . THR A 1 11  ? 10.849  10.949  -17.642 1.00 0.00 ? 11  THR A HB   21 
ATOM 10763 H HG1  . THR A 1 11  ? 9.053   10.032  -18.221 1.00 0.00 ? 11  THR A HG1  21 
ATOM 10764 H HG21 . THR A 1 11  ? 12.640  9.305   -17.176 1.00 0.00 ? 11  THR A HG21 21 
ATOM 10765 H HG22 . THR A 1 11  ? 11.415  8.064   -16.910 1.00 0.00 ? 11  THR A HG22 21 
ATOM 10766 H HG23 . THR A 1 11  ? 11.610  8.783   -18.509 1.00 0.00 ? 11  THR A HG23 21 
ATOM 10767 N N    . GLU A 1 12  ? 8.476   9.562   -15.101 1.00 0.00 ? 12  GLU A N    21 
ATOM 10768 C CA   . GLU A 1 12  ? 7.482   8.701   -14.401 1.00 0.00 ? 12  GLU A CA   21 
ATOM 10769 C C    . GLU A 1 12  ? 7.459   9.050   -12.912 1.00 0.00 ? 12  GLU A C    21 
ATOM 10770 O O    . GLU A 1 12  ? 8.487   9.131   -12.268 1.00 0.00 ? 12  GLU A O    21 
ATOM 10771 C CB   . GLU A 1 12  ? 7.869   7.231   -14.575 1.00 0.00 ? 12  GLU A CB   21 
ATOM 10772 C CG   . GLU A 1 12  ? 6.953   6.582   -15.614 1.00 0.00 ? 12  GLU A CG   21 
ATOM 10773 C CD   . GLU A 1 12  ? 7.154   7.264   -16.968 1.00 0.00 ? 12  GLU A CD   21 
ATOM 10774 O OE1  . GLU A 1 12  ? 8.134   6.955   -17.624 1.00 0.00 ? 12  GLU A OE1  21 
ATOM 10775 O OE2  . GLU A 1 12  ? 6.324   8.083   -17.325 1.00 0.00 ? 12  GLU A OE2  21 
ATOM 10776 H H    . GLU A 1 12  ? 8.176   10.217  -15.767 1.00 0.00 ? 12  GLU A H    21 
ATOM 10777 H HA   . GLU A 1 12  ? 6.502   8.868   -14.824 1.00 0.00 ? 12  GLU A HA   21 
ATOM 10778 H HB2  . GLU A 1 12  ? 8.895   7.166   -14.905 1.00 0.00 ? 12  GLU A HB2  21 
ATOM 10779 H HB3  . GLU A 1 12  ? 7.761   6.718   -13.632 1.00 0.00 ? 12  GLU A HB3  21 
ATOM 10780 H HG2  . GLU A 1 12  ? 7.193   5.532   -15.698 1.00 0.00 ? 12  GLU A HG2  21 
ATOM 10781 H HG3  . GLU A 1 12  ? 5.925   6.693   -15.306 1.00 0.00 ? 12  GLU A HG3  21 
ATOM 10782 N N    . LYS A 1 13  ? 6.295   9.256   -12.361 1.00 0.00 ? 13  LYS A N    21 
ATOM 10783 C CA   . LYS A 1 13  ? 6.206   9.600   -10.914 1.00 0.00 ? 13  LYS A CA   21 
ATOM 10784 C C    . LYS A 1 13  ? 5.090   8.780   -10.261 1.00 0.00 ? 13  LYS A C    21 
ATOM 10785 O O    . LYS A 1 13  ? 4.751   8.983   -9.113  1.00 0.00 ? 13  LYS A O    21 
ATOM 10786 C CB   . LYS A 1 13  ? 5.899   11.090  -10.764 1.00 0.00 ? 13  LYS A CB   21 
ATOM 10787 C CG   . LYS A 1 13  ? 4.874   11.509  -11.820 1.00 0.00 ? 13  LYS A CG   21 
ATOM 10788 C CD   . LYS A 1 13  ? 4.042   12.679  -11.292 1.00 0.00 ? 13  LYS A CD   21 
ATOM 10789 C CE   . LYS A 1 13  ? 4.136   13.854  -12.267 1.00 0.00 ? 13  LYS A CE   21 
ATOM 10790 N NZ   . LYS A 1 13  ? 2.828   14.028  -12.960 1.00 0.00 ? 13  LYS A NZ   21 
ATOM 10791 H H    . LYS A 1 13  ? 5.480   9.185   -12.898 1.00 0.00 ? 13  LYS A H    21 
ATOM 10792 H HA   . LYS A 1 13  ? 7.147   9.376   -10.432 1.00 0.00 ? 13  LYS A HA   21 
ATOM 10793 H HB2  . LYS A 1 13  ? 5.497   11.278  -9.778  1.00 0.00 ? 13  LYS A HB2  21 
ATOM 10794 H HB3  . LYS A 1 13  ? 6.805   11.661  -10.898 1.00 0.00 ? 13  LYS A HB3  21 
ATOM 10795 H HG2  . LYS A 1 13  ? 5.389   11.809  -12.721 1.00 0.00 ? 13  LYS A HG2  21 
ATOM 10796 H HG3  . LYS A 1 13  ? 4.223   10.676  -12.039 1.00 0.00 ? 13  LYS A HG3  21 
ATOM 10797 H HD2  . LYS A 1 13  ? 3.011   12.372  -11.195 1.00 0.00 ? 13  LYS A HD2  21 
ATOM 10798 H HD3  . LYS A 1 13  ? 4.421   12.984  -10.328 1.00 0.00 ? 13  LYS A HD3  21 
ATOM 10799 H HE2  . LYS A 1 13  ? 4.378   14.755  -11.723 1.00 0.00 ? 13  LYS A HE2  21 
ATOM 10800 H HE3  . LYS A 1 13  ? 4.907   13.655  -12.997 1.00 0.00 ? 13  LYS A HE3  21 
ATOM 10801 H HZ1  . LYS A 1 13  ? 2.086   13.527  -12.431 1.00 0.00 ? 13  LYS A HZ1  21 
ATOM 10802 H HZ2  . LYS A 1 13  ? 2.595   15.041  -13.012 1.00 0.00 ? 13  LYS A HZ2  21 
ATOM 10803 H HZ3  . LYS A 1 13  ? 2.890   13.641  -13.923 1.00 0.00 ? 13  LYS A HZ3  21 
ATOM 10804 N N    . ASN A 1 14  ? 4.516   7.856   -10.983 1.00 0.00 ? 14  ASN A N    21 
ATOM 10805 C CA   . ASN A 1 14  ? 3.422   7.028   -10.400 1.00 0.00 ? 14  ASN A CA   21 
ATOM 10806 C C    . ASN A 1 14  ? 4.021   5.994   -9.445  1.00 0.00 ? 14  ASN A C    21 
ATOM 10807 O O    . ASN A 1 14  ? 5.125   6.145   -8.965  1.00 0.00 ? 14  ASN A O    21 
ATOM 10808 C CB   . ASN A 1 14  ? 2.668   6.308   -11.522 1.00 0.00 ? 14  ASN A CB   21 
ATOM 10809 C CG   . ASN A 1 14  ? 2.684   7.167   -12.788 1.00 0.00 ? 14  ASN A CG   21 
ATOM 10810 O OD1  . ASN A 1 14  ? 3.572   7.044   -13.608 1.00 0.00 ? 14  ASN A OD1  21 
ATOM 10811 N ND2  . ASN A 1 14  ? 1.732   8.038   -12.984 1.00 0.00 ? 14  ASN A ND2  21 
ATOM 10812 H H    . ASN A 1 14  ? 4.803   7.708   -11.908 1.00 0.00 ? 14  ASN A H    21 
ATOM 10813 H HA   . ASN A 1 14  ? 2.738   7.665   -9.858  1.00 0.00 ? 14  ASN A HA   21 
ATOM 10814 H HB2  . ASN A 1 14  ? 3.146   5.360   -11.724 1.00 0.00 ? 14  ASN A HB2  21 
ATOM 10815 H HB3  . ASN A 1 14  ? 1.646   6.139   -11.218 1.00 0.00 ? 14  ASN A HB3  21 
ATOM 10816 H HD21 . ASN A 1 14  ? 1.016   8.138   -12.323 1.00 0.00 ? 14  ASN A HD21 21 
ATOM 10817 H HD22 . ASN A 1 14  ? 1.733   8.593   -13.792 1.00 0.00 ? 14  ASN A HD22 21 
ATOM 10818 N N    . CYS A 1 15  ? 3.298   4.942   -9.171  1.00 0.00 ? 15  CYS A N    21 
ATOM 10819 C CA   . CYS A 1 15  ? 3.822   3.891   -8.252  1.00 0.00 ? 15  CYS A CA   21 
ATOM 10820 C C    . CYS A 1 15  ? 5.217   3.466   -8.715  1.00 0.00 ? 15  CYS A C    21 
ATOM 10821 O O    . CYS A 1 15  ? 5.370   2.548   -9.498  1.00 0.00 ? 15  CYS A O    21 
ATOM 10822 C CB   . CYS A 1 15  ? 2.868   2.689   -8.276  1.00 0.00 ? 15  CYS A CB   21 
ATOM 10823 S SG   . CYS A 1 15  ? 3.692   1.204   -7.635  1.00 0.00 ? 15  CYS A SG   21 
ATOM 10824 H H    . CYS A 1 15  ? 2.410   4.841   -9.572  1.00 0.00 ? 15  CYS A H    21 
ATOM 10825 H HA   . CYS A 1 15  ? 3.879   4.286   -7.247  1.00 0.00 ? 15  CYS A HA   21 
ATOM 10826 H HB2  . CYS A 1 15  ? 2.001   2.905   -7.674  1.00 0.00 ? 15  CYS A HB2  21 
ATOM 10827 H HB3  . CYS A 1 15  ? 2.554   2.508   -9.292  1.00 0.00 ? 15  CYS A HB3  21 
ATOM 10828 N N    . CYS A 1 16  ? 6.236   4.122   -8.235  1.00 0.00 ? 16  CYS A N    21 
ATOM 10829 C CA   . CYS A 1 16  ? 7.619   3.755   -8.644  1.00 0.00 ? 16  CYS A CA   21 
ATOM 10830 C C    . CYS A 1 16  ? 8.520   3.753   -7.410  1.00 0.00 ? 16  CYS A C    21 
ATOM 10831 O O    . CYS A 1 16  ? 8.637   4.742   -6.713  1.00 0.00 ? 16  CYS A O    21 
ATOM 10832 C CB   . CYS A 1 16  ? 8.143   4.773   -9.658  1.00 0.00 ? 16  CYS A CB   21 
ATOM 10833 S SG   . CYS A 1 16  ? 9.103   3.918   -10.933 1.00 0.00 ? 16  CYS A SG   21 
ATOM 10834 H H    . CYS A 1 16  ? 6.090   4.857   -7.604  1.00 0.00 ? 16  CYS A H    21 
ATOM 10835 H HA   . CYS A 1 16  ? 7.613   2.771   -9.089  1.00 0.00 ? 16  CYS A HA   21 
ATOM 10836 H HB2  . CYS A 1 16  ? 7.310   5.284   -10.118 1.00 0.00 ? 16  CYS A HB2  21 
ATOM 10837 H HB3  . CYS A 1 16  ? 8.772   5.491   -9.154  1.00 0.00 ? 16  CYS A HB3  21 
ATOM 10838 N N    . VAL A 1 17  ? 9.153   2.648   -7.129  1.00 0.00 ? 17  VAL A N    21 
ATOM 10839 C CA   . VAL A 1 17  ? 10.041  2.587   -5.939  1.00 0.00 ? 17  VAL A CA   21 
ATOM 10840 C C    . VAL A 1 17  ? 11.190  3.588   -6.105  1.00 0.00 ? 17  VAL A C    21 
ATOM 10841 O O    . VAL A 1 17  ? 12.050  3.429   -6.947  1.00 0.00 ? 17  VAL A O    21 
ATOM 10842 C CB   . VAL A 1 17  ? 10.606  1.173   -5.800  1.00 0.00 ? 17  VAL A CB   21 
ATOM 10843 C CG1  . VAL A 1 17  ? 11.627  0.920   -6.901  1.00 0.00 ? 17  VAL A CG1  21 
ATOM 10844 C CG2  . VAL A 1 17  ? 11.291  1.028   -4.444  1.00 0.00 ? 17  VAL A CG2  21 
ATOM 10845 H H    . VAL A 1 17  ? 9.042   1.860   -7.700  1.00 0.00 ? 17  VAL A H    21 
ATOM 10846 H HA   . VAL A 1 17  ? 9.473   2.835   -5.057  1.00 0.00 ? 17  VAL A HA   21 
ATOM 10847 H HB   . VAL A 1 17  ? 9.806   0.454   -5.882  1.00 0.00 ? 17  VAL A HB   21 
ATOM 10848 H HG11 . VAL A 1 17  ? 11.350  1.478   -7.782  1.00 0.00 ? 17  VAL A HG11 21 
ATOM 10849 H HG12 . VAL A 1 17  ? 12.602  1.238   -6.562  1.00 0.00 ? 17  VAL A HG12 21 
ATOM 10850 H HG13 . VAL A 1 17  ? 11.651  -0.134  -7.134  1.00 0.00 ? 17  VAL A HG13 21 
ATOM 10851 H HG21 . VAL A 1 17  ? 11.782  1.956   -4.190  1.00 0.00 ? 17  VAL A HG21 21 
ATOM 10852 H HG22 . VAL A 1 17  ? 10.555  0.790   -3.693  1.00 0.00 ? 17  VAL A HG22 21 
ATOM 10853 H HG23 . VAL A 1 17  ? 12.024  0.236   -4.496  1.00 0.00 ? 17  VAL A HG23 21 
ATOM 10854 N N    . ARG A 1 18  ? 11.211  4.622   -5.311  1.00 0.00 ? 18  ARG A N    21 
ATOM 10855 C CA   . ARG A 1 18  ? 12.303  5.627   -5.433  1.00 0.00 ? 18  ARG A CA   21 
ATOM 10856 C C    . ARG A 1 18  ? 13.414  5.305   -4.432  1.00 0.00 ? 18  ARG A C    21 
ATOM 10857 O O    . ARG A 1 18  ? 13.224  4.551   -3.498  1.00 0.00 ? 18  ARG A O    21 
ATOM 10858 C CB   . ARG A 1 18  ? 11.746  7.022   -5.143  1.00 0.00 ? 18  ARG A CB   21 
ATOM 10859 C CG   . ARG A 1 18  ? 10.992  7.538   -6.369  1.00 0.00 ? 18  ARG A CG   21 
ATOM 10860 C CD   . ARG A 1 18  ? 9.955   8.571   -5.929  1.00 0.00 ? 18  ARG A CD   21 
ATOM 10861 N NE   . ARG A 1 18  ? 8.843   8.613   -6.920  1.00 0.00 ? 18  ARG A NE   21 
ATOM 10862 C CZ   . ARG A 1 18  ? 8.772   9.593   -7.778  1.00 0.00 ? 18  ARG A CZ   21 
ATOM 10863 N NH1  . ARG A 1 18  ? 9.792   9.863   -8.546  1.00 0.00 ? 18  ARG A NH1  21 
ATOM 10864 N NH2  . ARG A 1 18  ? 7.680   10.303  -7.869  1.00 0.00 ? 18  ARG A NH2  21 
ATOM 10865 H H    . ARG A 1 18  ? 10.508  4.739   -4.637  1.00 0.00 ? 18  ARG A H    21 
ATOM 10866 H HA   . ARG A 1 18  ? 12.704  5.603   -6.436  1.00 0.00 ? 18  ARG A HA   21 
ATOM 10867 H HB2  . ARG A 1 18  ? 11.071  6.971   -4.303  1.00 0.00 ? 18  ARG A HB2  21 
ATOM 10868 H HB3  . ARG A 1 18  ? 12.559  7.695   -4.914  1.00 0.00 ? 18  ARG A HB3  21 
ATOM 10869 H HG2  . ARG A 1 18  ? 11.691  7.997   -7.055  1.00 0.00 ? 18  ARG A HG2  21 
ATOM 10870 H HG3  . ARG A 1 18  ? 10.494  6.716   -6.859  1.00 0.00 ? 18  ARG A HG3  21 
ATOM 10871 H HD2  . ARG A 1 18  ? 9.562   8.295   -4.960  1.00 0.00 ? 18  ARG A HD2  21 
ATOM 10872 H HD3  . ARG A 1 18  ? 10.419  9.544   -5.866  1.00 0.00 ? 18  ARG A HD3  21 
ATOM 10873 H HE   . ARG A 1 18  ? 8.165   7.905   -6.927  1.00 0.00 ? 18  ARG A HE   21 
ATOM 10874 H HH11 . ARG A 1 18  ? 10.628  9.319   -8.476  1.00 0.00 ? 18  ARG A HH11 21 
ATOM 10875 H HH12 . ARG A 1 18  ? 9.738   10.613  -9.204  1.00 0.00 ? 18  ARG A HH12 21 
ATOM 10876 H HH21 . ARG A 1 18  ? 6.899   10.096  -7.280  1.00 0.00 ? 18  ARG A HH21 21 
ATOM 10877 H HH22 . ARG A 1 18  ? 7.626   11.054  -8.526  1.00 0.00 ? 18  ARG A HH22 21 
ATOM 10878 N N    . GLN A 1 19  ? 14.576  5.870   -4.620  1.00 0.00 ? 19  GLN A N    21 
ATOM 10879 C CA   . GLN A 1 19  ? 15.700  5.600   -3.680  1.00 0.00 ? 19  GLN A CA   21 
ATOM 10880 C C    . GLN A 1 19  ? 15.352  6.164   -2.303  1.00 0.00 ? 19  GLN A C    21 
ATOM 10881 O O    . GLN A 1 19  ? 14.765  7.222   -2.186  1.00 0.00 ? 19  GLN A O    21 
ATOM 10882 C CB   . GLN A 1 19  ? 16.974  6.267   -4.202  1.00 0.00 ? 19  GLN A CB   21 
ATOM 10883 C CG   . GLN A 1 19  ? 16.747  7.775   -4.331  1.00 0.00 ? 19  GLN A CG   21 
ATOM 10884 C CD   . GLN A 1 19  ? 16.535  8.136   -5.802  1.00 0.00 ? 19  GLN A CD   21 
ATOM 10885 O OE1  . GLN A 1 19  ? 16.309  7.272   -6.625  1.00 0.00 ? 19  GLN A OE1  21 
ATOM 10886 N NE2  . GLN A 1 19  ? 16.600  9.386   -6.171  1.00 0.00 ? 19  GLN A NE2  21 
ATOM 10887 H H    . GLN A 1 19  ? 14.707  6.476   -5.379  1.00 0.00 ? 19  GLN A H    21 
ATOM 10888 H HA   . GLN A 1 19  ? 15.858  4.535   -3.600  1.00 0.00 ? 19  GLN A HA   21 
ATOM 10889 H HB2  . GLN A 1 19  ? 17.785  6.082   -3.513  1.00 0.00 ? 19  GLN A HB2  21 
ATOM 10890 H HB3  . GLN A 1 19  ? 17.223  5.860   -5.170  1.00 0.00 ? 19  GLN A HB3  21 
ATOM 10891 H HG2  . GLN A 1 19  ? 15.875  8.059   -3.760  1.00 0.00 ? 19  GLN A HG2  21 
ATOM 10892 H HG3  . GLN A 1 19  ? 17.611  8.303   -3.954  1.00 0.00 ? 19  GLN A HG3  21 
ATOM 10893 H HE21 . GLN A 1 19  ? 16.782  10.084  -5.507  1.00 0.00 ? 19  GLN A HE21 21 
ATOM 10894 H HE22 . GLN A 1 19  ? 16.465  9.628   -7.111  1.00 0.00 ? 19  GLN A HE22 21 
ATOM 10895 N N    . LEU A 1 20  ? 15.705  5.469   -1.258  1.00 0.00 ? 20  LEU A N    21 
ATOM 10896 C CA   . LEU A 1 20  ? 15.385  5.974   0.105   1.00 0.00 ? 20  LEU A CA   21 
ATOM 10897 C C    . LEU A 1 20  ? 16.459  5.531   1.093   1.00 0.00 ? 20  LEU A C    21 
ATOM 10898 O O    . LEU A 1 20  ? 16.155  5.055   2.169   1.00 0.00 ? 20  LEU A O    21 
ATOM 10899 C CB   . LEU A 1 20  ? 14.039  5.416   0.558   1.00 0.00 ? 20  LEU A CB   21 
ATOM 10900 C CG   . LEU A 1 20  ? 13.598  6.123   1.840   1.00 0.00 ? 20  LEU A CG   21 
ATOM 10901 C CD1  . LEU A 1 20  ? 13.551  7.632   1.602   1.00 0.00 ? 20  LEU A CD1  21 
ATOM 10902 C CD2  . LEU A 1 20  ? 12.207  5.631   2.242   1.00 0.00 ? 20  LEU A CD2  21 
ATOM 10903 H H    . LEU A 1 20  ? 16.174  4.617   -1.368  1.00 0.00 ? 20  LEU A H    21 
ATOM 10904 H HA   . LEU A 1 20  ? 15.335  7.052   0.086   1.00 0.00 ? 20  LEU A HA   21 
ATOM 10905 H HB2  . LEU A 1 20  ? 13.309  5.580   -0.214  1.00 0.00 ? 20  LEU A HB2  21 
ATOM 10906 H HB3  . LEU A 1 20  ? 14.133  4.357   0.746   1.00 0.00 ? 20  LEU A HB3  21 
ATOM 10907 H HG   . LEU A 1 20  ? 14.301  5.905   2.631   1.00 0.00 ? 20  LEU A HG   21 
ATOM 10908 H HD11 . LEU A 1 20  ? 13.261  7.827   0.580   1.00 0.00 ? 20  LEU A HD11 21 
ATOM 10909 H HD12 . LEU A 1 20  ? 12.833  8.080   2.272   1.00 0.00 ? 20  LEU A HD12 21 
ATOM 10910 H HD13 . LEU A 1 20  ? 14.528  8.055   1.785   1.00 0.00 ? 20  LEU A HD13 21 
ATOM 10911 H HD21 . LEU A 1 20  ? 12.211  4.553   2.309   1.00 0.00 ? 20  LEU A HD21 21 
ATOM 10912 H HD22 . LEU A 1 20  ? 11.942  6.050   3.201   1.00 0.00 ? 20  LEU A HD22 21 
ATOM 10913 H HD23 . LEU A 1 20  ? 11.488  5.944   1.501   1.00 0.00 ? 20  LEU A HD23 21 
ATOM 10914 N N    . TYR A 1 21  ? 17.709  5.680   0.754   1.00 0.00 ? 21  TYR A N    21 
ATOM 10915 C CA   . TYR A 1 21  ? 18.770  5.259   1.709   1.00 0.00 ? 21  TYR A CA   21 
ATOM 10916 C C    . TYR A 1 21  ? 18.415  5.793   3.095   1.00 0.00 ? 21  TYR A C    21 
ATOM 10917 O O    . TYR A 1 21  ? 18.039  6.938   3.251   1.00 0.00 ? 21  TYR A O    21 
ATOM 10918 C CB   . TYR A 1 21  ? 20.126  5.826   1.289   1.00 0.00 ? 21  TYR A CB   21 
ATOM 10919 C CG   . TYR A 1 21  ? 21.142  5.486   2.355   1.00 0.00 ? 21  TYR A CG   21 
ATOM 10920 C CD1  . TYR A 1 21  ? 21.141  6.180   3.573   1.00 0.00 ? 21  TYR A CD1  21 
ATOM 10921 C CD2  . TYR A 1 21  ? 22.081  4.474   2.128   1.00 0.00 ? 21  TYR A CD2  21 
ATOM 10922 C CE1  . TYR A 1 21  ? 22.078  5.861   4.563   1.00 0.00 ? 21  TYR A CE1  21 
ATOM 10923 C CE2  . TYR A 1 21  ? 23.019  4.154   3.117   1.00 0.00 ? 21  TYR A CE2  21 
ATOM 10924 C CZ   . TYR A 1 21  ? 23.017  4.846   4.335   1.00 0.00 ? 21  TYR A CZ   21 
ATOM 10925 O OH   . TYR A 1 21  ? 23.942  4.531   5.310   1.00 0.00 ? 21  TYR A OH   21 
ATOM 10926 H H    . TYR A 1 21  ? 17.946  6.067   -0.117  1.00 0.00 ? 21  TYR A H    21 
ATOM 10927 H HA   . TYR A 1 21  ? 18.821  4.181   1.739   1.00 0.00 ? 21  TYR A HA   21 
ATOM 10928 H HB2  . TYR A 1 21  ? 20.425  5.388   0.347   1.00 0.00 ? 21  TYR A HB2  21 
ATOM 10929 H HB3  . TYR A 1 21  ? 20.056  6.897   1.185   1.00 0.00 ? 21  TYR A HB3  21 
ATOM 10930 H HD1  . TYR A 1 21  ? 20.416  6.960   3.748   1.00 0.00 ? 21  TYR A HD1  21 
ATOM 10931 H HD2  . TYR A 1 21  ? 22.080  3.938   1.189   1.00 0.00 ? 21  TYR A HD2  21 
ATOM 10932 H HE1  . TYR A 1 21  ? 22.074  6.395   5.505   1.00 0.00 ? 21  TYR A HE1  21 
ATOM 10933 H HE2  . TYR A 1 21  ? 23.743  3.372   2.943   1.00 0.00 ? 21  TYR A HE2  21 
ATOM 10934 H HH   . TYR A 1 21  ? 24.283  3.653   5.121   1.00 0.00 ? 21  TYR A HH   21 
ATOM 10935 N N    . ILE A 1 22  ? 18.528  4.977   4.100   1.00 0.00 ? 22  ILE A N    21 
ATOM 10936 C CA   . ILE A 1 22  ? 18.193  5.445   5.469   1.00 0.00 ? 22  ILE A CA   21 
ATOM 10937 C C    . ILE A 1 22  ? 19.405  5.270   6.380   1.00 0.00 ? 22  ILE A C    21 
ATOM 10938 O O    . ILE A 1 22  ? 19.846  4.166   6.636   1.00 0.00 ? 22  ILE A O    21 
ATOM 10939 C CB   . ILE A 1 22  ? 17.023  4.624   6.013   1.00 0.00 ? 22  ILE A CB   21 
ATOM 10940 C CG1  . ILE A 1 22  ? 15.794  4.840   5.127   1.00 0.00 ? 22  ILE A CG1  21 
ATOM 10941 C CG2  . ILE A 1 22  ? 16.705  5.068   7.441   1.00 0.00 ? 22  ILE A CG2  21 
ATOM 10942 C CD1  . ILE A 1 22  ? 14.568  4.209   5.790   1.00 0.00 ? 22  ILE A CD1  21 
ATOM 10943 H H    . ILE A 1 22  ? 18.831  4.057   3.955   1.00 0.00 ? 22  ILE A H    21 
ATOM 10944 H HA   . ILE A 1 22  ? 17.915  6.488   5.436   1.00 0.00 ? 22  ILE A HA   21 
ATOM 10945 H HB   . ILE A 1 22  ? 17.289  3.575   6.013   1.00 0.00 ? 22  ILE A HB   21 
ATOM 10946 H HG12 . ILE A 1 22  ? 15.628  5.899   4.995   1.00 0.00 ? 22  ILE A HG12 21 
ATOM 10947 H HG13 . ILE A 1 22  ? 15.958  4.378   4.165   1.00 0.00 ? 22  ILE A HG13 21 
ATOM 10948 H HG21 . ILE A 1 22  ? 17.463  5.759   7.781   1.00 0.00 ? 22  ILE A HG21 21 
ATOM 10949 H HG22 . ILE A 1 22  ? 15.741  5.555   7.461   1.00 0.00 ? 22  ILE A HG22 21 
ATOM 10950 H HG23 . ILE A 1 22  ? 16.687  4.206   8.092   1.00 0.00 ? 22  ILE A HG23 21 
ATOM 10951 H HD11 . ILE A 1 22  ? 14.866  3.318   6.323   1.00 0.00 ? 22  ILE A HD11 21 
ATOM 10952 H HD12 . ILE A 1 22  ? 14.132  4.913   6.483   1.00 0.00 ? 22  ILE A HD12 21 
ATOM 10953 H HD13 . ILE A 1 22  ? 13.843  3.950   5.033   1.00 0.00 ? 22  ILE A HD13 21 
ATOM 10954 N N    . ASP A 1 23  ? 19.943  6.345   6.883   1.00 0.00 ? 23  ASP A N    21 
ATOM 10955 C CA   . ASP A 1 23  ? 21.116  6.228   7.788   1.00 0.00 ? 23  ASP A CA   21 
ATOM 10956 C C    . ASP A 1 23  ? 20.603  5.944   9.195   1.00 0.00 ? 23  ASP A C    21 
ATOM 10957 O O    . ASP A 1 23  ? 20.269  6.841   9.935   1.00 0.00 ? 23  ASP A O    21 
ATOM 10958 C CB   . ASP A 1 23  ? 21.919  7.527   7.771   1.00 0.00 ? 23  ASP A CB   21 
ATOM 10959 C CG   . ASP A 1 23  ? 23.164  7.369   8.647   1.00 0.00 ? 23  ASP A CG   21 
ATOM 10960 O OD1  . ASP A 1 23  ? 24.033  6.599   8.272   1.00 0.00 ? 23  ASP A OD1  21 
ATOM 10961 O OD2  . ASP A 1 23  ? 23.229  8.020   9.676   1.00 0.00 ? 23  ASP A OD2  21 
ATOM 10962 H H    . ASP A 1 23  ? 19.569  7.227   6.674   1.00 0.00 ? 23  ASP A H    21 
ATOM 10963 H HA   . ASP A 1 23  ? 21.743  5.412   7.467   1.00 0.00 ? 23  ASP A HA   21 
ATOM 10964 H HB2  . ASP A 1 23  ? 22.217  7.754   6.759   1.00 0.00 ? 23  ASP A HB2  21 
ATOM 10965 H HB3  . ASP A 1 23  ? 21.311  8.325   8.153   1.00 0.00 ? 23  ASP A HB3  21 
ATOM 10966 N N    . PHE A 1 24  ? 20.524  4.684   9.532   1.00 0.00 ? 24  PHE A N    21 
ATOM 10967 C CA   . PHE A 1 24  ? 20.017  4.239   10.871  1.00 0.00 ? 24  PHE A CA   21 
ATOM 10968 C C    . PHE A 1 24  ? 19.909  5.393   11.874  1.00 0.00 ? 24  PHE A C    21 
ATOM 10969 O O    . PHE A 1 24  ? 18.860  5.634   12.439  1.00 0.00 ? 24  PHE A O    21 
ATOM 10970 C CB   . PHE A 1 24  ? 20.972  3.185   11.436  1.00 0.00 ? 24  PHE A CB   21 
ATOM 10971 C CG   . PHE A 1 24  ? 20.583  1.823   10.919  1.00 0.00 ? 24  PHE A CG   21 
ATOM 10972 C CD1  . PHE A 1 24  ? 19.390  1.229   11.346  1.00 0.00 ? 24  PHE A CD1  21 
ATOM 10973 C CD2  . PHE A 1 24  ? 21.411  1.154   10.011  1.00 0.00 ? 24  PHE A CD2  21 
ATOM 10974 C CE1  . PHE A 1 24  ? 19.025  -0.032  10.864  1.00 0.00 ? 24  PHE A CE1  21 
ATOM 10975 C CE2  . PHE A 1 24  ? 21.046  -0.109  9.532   1.00 0.00 ? 24  PHE A CE2  21 
ATOM 10976 C CZ   . PHE A 1 24  ? 19.854  -0.701  9.958   1.00 0.00 ? 24  PHE A CZ   21 
ATOM 10977 H H    . PHE A 1 24  ? 20.792  4.004   8.879   1.00 0.00 ? 24  PHE A H    21 
ATOM 10978 H HA   . PHE A 1 24  ? 19.043  3.790   10.747  1.00 0.00 ? 24  PHE A HA   21 
ATOM 10979 H HB2  . PHE A 1 24  ? 21.982  3.413   11.126  1.00 0.00 ? 24  PHE A HB2  21 
ATOM 10980 H HB3  . PHE A 1 24  ? 20.917  3.190   12.514  1.00 0.00 ? 24  PHE A HB3  21 
ATOM 10981 H HD1  . PHE A 1 24  ? 18.752  1.744   12.047  1.00 0.00 ? 24  PHE A HD1  21 
ATOM 10982 H HD2  . PHE A 1 24  ? 22.332  1.611   9.682   1.00 0.00 ? 24  PHE A HD2  21 
ATOM 10983 H HE1  . PHE A 1 24  ? 18.105  -0.491  11.192  1.00 0.00 ? 24  PHE A HE1  21 
ATOM 10984 H HE2  . PHE A 1 24  ? 21.685  -0.628  8.834   1.00 0.00 ? 24  PHE A HE2  21 
ATOM 10985 H HZ   . PHE A 1 24  ? 19.574  -1.672  9.586   1.00 0.00 ? 24  PHE A HZ   21 
ATOM 10986 N N    . ARG A 1 25  ? 20.984  6.087   12.128  1.00 0.00 ? 25  ARG A N    21 
ATOM 10987 C CA   . ARG A 1 25  ? 20.938  7.189   13.132  1.00 0.00 ? 25  ARG A CA   21 
ATOM 10988 C C    . ARG A 1 25  ? 20.466  8.513   12.516  1.00 0.00 ? 25  ARG A C    21 
ATOM 10989 O O    . ARG A 1 25  ? 19.744  9.265   13.140  1.00 0.00 ? 25  ARG A O    21 
ATOM 10990 C CB   . ARG A 1 25  ? 22.336  7.384   13.722  1.00 0.00 ? 25  ARG A CB   21 
ATOM 10991 C CG   . ARG A 1 25  ? 22.219  7.974   15.129  1.00 0.00 ? 25  ARG A CG   21 
ATOM 10992 C CD   . ARG A 1 25  ? 22.670  9.436   15.109  1.00 0.00 ? 25  ARG A CD   21 
ATOM 10993 N NE   . ARG A 1 25  ? 23.569  9.694   16.267  1.00 0.00 ? 25  ARG A NE   21 
ATOM 10994 C CZ   . ARG A 1 25  ? 23.175  10.471  17.239  1.00 0.00 ? 25  ARG A CZ   21 
ATOM 10995 N NH1  . ARG A 1 25  ? 22.382  10.005  18.165  1.00 0.00 ? 25  ARG A NH1  21 
ATOM 10996 N NH2  . ARG A 1 25  ? 23.573  11.712  17.285  1.00 0.00 ? 25  ARG A NH2  21 
ATOM 10997 H H    . ARG A 1 25  ? 21.826  5.865   11.680  1.00 0.00 ? 25  ARG A H    21 
ATOM 10998 H HA   . ARG A 1 25  ? 20.264  6.908   13.925  1.00 0.00 ? 25  ARG A HA   21 
ATOM 10999 H HB2  . ARG A 1 25  ? 22.841  6.430   13.772  1.00 0.00 ? 25  ARG A HB2  21 
ATOM 11000 H HB3  . ARG A 1 25  ? 22.900  8.059   13.096  1.00 0.00 ? 25  ARG A HB3  21 
ATOM 11001 H HG2  . ARG A 1 25  ? 21.191  7.918   15.458  1.00 0.00 ? 25  ARG A HG2  21 
ATOM 11002 H HG3  . ARG A 1 25  ? 22.846  7.415   15.807  1.00 0.00 ? 25  ARG A HG3  21 
ATOM 11003 H HD2  . ARG A 1 25  ? 23.201  9.636   14.189  1.00 0.00 ? 25  ARG A HD2  21 
ATOM 11004 H HD3  . ARG A 1 25  ? 21.805  10.080  15.172  1.00 0.00 ? 25  ARG A HD3  21 
ATOM 11005 H HE   . ARG A 1 25  ? 24.457  9.281   16.300  1.00 0.00 ? 25  ARG A HE   21 
ATOM 11006 H HH11 . ARG A 1 25  ? 22.076  9.053   18.130  1.00 0.00 ? 25  ARG A HH11 21 
ATOM 11007 H HH12 . ARG A 1 25  ? 22.080  10.600  18.910  1.00 0.00 ? 25  ARG A HH12 21 
ATOM 11008 H HH21 . ARG A 1 25  ? 24.181  12.069  16.576  1.00 0.00 ? 25  ARG A HH21 21 
ATOM 11009 H HH22 . ARG A 1 25  ? 23.270  12.308  18.030  1.00 0.00 ? 25  ARG A HH22 21 
ATOM 11010 N N    . LYS A 1 26  ? 20.889  8.831   11.324  1.00 0.00 ? 26  LYS A N    21 
ATOM 11011 C CA   . LYS A 1 26  ? 20.477  10.134  10.718  1.00 0.00 ? 26  LYS A CA   21 
ATOM 11012 C C    . LYS A 1 26  ? 18.964  10.180  10.505  1.00 0.00 ? 26  LYS A C    21 
ATOM 11013 O O    . LYS A 1 26  ? 18.308  11.149  10.833  1.00 0.00 ? 26  LYS A O    21 
ATOM 11014 C CB   . LYS A 1 26  ? 21.160  10.300  9.363   1.00 0.00 ? 26  LYS A CB   21 
ATOM 11015 C CG   . LYS A 1 26  ? 21.440  11.783  9.104   1.00 0.00 ? 26  LYS A CG   21 
ATOM 11016 C CD   . LYS A 1 26  ? 20.452  12.322  8.066   1.00 0.00 ? 26  LYS A CD   21 
ATOM 11017 C CE   . LYS A 1 26  ? 20.488  11.445  6.813   1.00 0.00 ? 26  LYS A CE   21 
ATOM 11018 N NZ   . LYS A 1 26  ? 19.980  12.223  5.649   1.00 0.00 ? 26  LYS A NZ   21 
ATOM 11019 H H    . LYS A 1 26  ? 21.494  8.229   10.837  1.00 0.00 ? 26  LYS A H    21 
ATOM 11020 H HA   . LYS A 1 26  ? 20.774  10.943  11.369  1.00 0.00 ? 26  LYS A HA   21 
ATOM 11021 H HB2  . LYS A 1 26  ? 22.084  9.746   9.357   1.00 0.00 ? 26  LYS A HB2  21 
ATOM 11022 H HB3  . LYS A 1 26  ? 20.510  9.921   8.590   1.00 0.00 ? 26  LYS A HB3  21 
ATOM 11023 H HG2  . LYS A 1 26  ? 21.329  12.336  10.026  1.00 0.00 ? 26  LYS A HG2  21 
ATOM 11024 H HG3  . LYS A 1 26  ? 22.447  11.900  8.733   1.00 0.00 ? 26  LYS A HG3  21 
ATOM 11025 H HD2  . LYS A 1 26  ? 19.456  12.316  8.481   1.00 0.00 ? 26  LYS A HD2  21 
ATOM 11026 H HD3  . LYS A 1 26  ? 20.725  13.332  7.802   1.00 0.00 ? 26  LYS A HD3  21 
ATOM 11027 H HE2  . LYS A 1 26  ? 21.503  11.131  6.622   1.00 0.00 ? 26  LYS A HE2  21 
ATOM 11028 H HE3  . LYS A 1 26  ? 19.864  10.576  6.964   1.00 0.00 ? 26  LYS A HE3  21 
ATOM 11029 H HZ1  . LYS A 1 26  ? 20.200  13.231  5.783   1.00 0.00 ? 26  LYS A HZ1  21 
ATOM 11030 H HZ2  . LYS A 1 26  ? 20.435  11.881  4.778   1.00 0.00 ? 26  LYS A HZ2  21 
ATOM 11031 H HZ3  . LYS A 1 26  ? 18.950  12.103  5.574   1.00 0.00 ? 26  LYS A HZ3  21 
ATOM 11032 N N    . ASP A 1 27  ? 18.413  9.158   9.917   1.00 0.00 ? 27  ASP A N    21 
ATOM 11033 C CA   . ASP A 1 27  ? 16.955  9.155   9.631   1.00 0.00 ? 27  ASP A CA   21 
ATOM 11034 C C    . ASP A 1 27  ? 16.148  8.571   10.797  1.00 0.00 ? 27  ASP A C    21 
ATOM 11035 O O    . ASP A 1 27  ? 15.280  9.224   11.343  1.00 0.00 ? 27  ASP A O    21 
ATOM 11036 C CB   . ASP A 1 27  ? 16.718  8.316   8.382   1.00 0.00 ? 27  ASP A CB   21 
ATOM 11037 C CG   . ASP A 1 27  ? 16.779  9.213   7.147   1.00 0.00 ? 27  ASP A CG   21 
ATOM 11038 O OD1  . ASP A 1 27  ? 15.914  10.062  7.011   1.00 0.00 ? 27  ASP A OD1  21 
ATOM 11039 O OD2  . ASP A 1 27  ? 17.692  9.037   6.355   1.00 0.00 ? 27  ASP A OD2  21 
ATOM 11040 H H    . ASP A 1 27  ? 18.964  8.405   9.628   1.00 0.00 ? 27  ASP A H    21 
ATOM 11041 H HA   . ASP A 1 27  ? 16.627  10.166  9.443   1.00 0.00 ? 27  ASP A HA   21 
ATOM 11042 H HB2  . ASP A 1 27  ? 17.482  7.555   8.313   1.00 0.00 ? 27  ASP A HB2  21 
ATOM 11043 H HB3  . ASP A 1 27  ? 15.756  7.849   8.443   1.00 0.00 ? 27  ASP A HB3  21 
ATOM 11044 N N    . LEU A 1 28  ? 16.392  7.344   11.167  1.00 0.00 ? 28  LEU A N    21 
ATOM 11045 C CA   . LEU A 1 28  ? 15.594  6.737   12.274  1.00 0.00 ? 28  LEU A CA   21 
ATOM 11046 C C    . LEU A 1 28  ? 16.242  7.016   13.629  1.00 0.00 ? 28  LEU A C    21 
ATOM 11047 O O    . LEU A 1 28  ? 15.620  6.862   14.661  1.00 0.00 ? 28  LEU A O    21 
ATOM 11048 C CB   . LEU A 1 28  ? 15.513  5.222   12.075  1.00 0.00 ? 28  LEU A CB   21 
ATOM 11049 C CG   . LEU A 1 28  ? 14.949  4.916   10.692  1.00 0.00 ? 28  LEU A CG   21 
ATOM 11050 C CD1  . LEU A 1 28  ? 14.772  3.406   10.536  1.00 0.00 ? 28  LEU A CD1  21 
ATOM 11051 C CD2  . LEU A 1 28  ? 13.593  5.604   10.533  1.00 0.00 ? 28  LEU A CD2  21 
ATOM 11052 H H    . LEU A 1 28  ? 17.075  6.815   10.703  1.00 0.00 ? 28  LEU A H    21 
ATOM 11053 H HA   . LEU A 1 28  ? 14.598  7.150   12.265  1.00 0.00 ? 28  LEU A HA   21 
ATOM 11054 H HB2  . LEU A 1 28  ? 16.501  4.796   12.163  1.00 0.00 ? 28  LEU A HB2  21 
ATOM 11055 H HB3  . LEU A 1 28  ? 14.868  4.794   12.828  1.00 0.00 ? 28  LEU A HB3  21 
ATOM 11056 H HG   . LEU A 1 28  ? 15.631  5.281   9.937   1.00 0.00 ? 28  LEU A HG   21 
ATOM 11057 H HD11 . LEU A 1 28  ? 15.207  2.903   11.387  1.00 0.00 ? 28  LEU A HD11 21 
ATOM 11058 H HD12 . LEU A 1 28  ? 13.718  3.171   10.480  1.00 0.00 ? 28  LEU A HD12 21 
ATOM 11059 H HD13 . LEU A 1 28  ? 15.262  3.077   9.633   1.00 0.00 ? 28  LEU A HD13 21 
ATOM 11060 H HD21 . LEU A 1 28  ? 13.316  6.074   11.465  1.00 0.00 ? 28  LEU A HD21 21 
ATOM 11061 H HD22 . LEU A 1 28  ? 13.661  6.352   9.760   1.00 0.00 ? 28  LEU A HD22 21 
ATOM 11062 H HD23 . LEU A 1 28  ? 12.847  4.872   10.263  1.00 0.00 ? 28  LEU A HD23 21 
ATOM 11063 N N    . GLY A 1 29  ? 17.482  7.406   13.649  1.00 0.00 ? 29  GLY A N    21 
ATOM 11064 C CA   . GLY A 1 29  ? 18.137  7.663   14.962  1.00 0.00 ? 29  GLY A CA   21 
ATOM 11065 C C    . GLY A 1 29  ? 18.177  6.351   15.751  1.00 0.00 ? 29  GLY A C    21 
ATOM 11066 O O    . GLY A 1 29  ? 18.425  6.334   16.941  1.00 0.00 ? 29  GLY A O    21 
ATOM 11067 H H    . GLY A 1 29  ? 17.982  7.514   12.813  1.00 0.00 ? 29  GLY A H    21 
ATOM 11068 H HA2  . GLY A 1 29  ? 19.140  8.029   14.804  1.00 0.00 ? 29  GLY A HA2  21 
ATOM 11069 H HA3  . GLY A 1 29  ? 17.567  8.394   15.513  1.00 0.00 ? 29  GLY A HA3  21 
ATOM 11070 N N    . TRP A 1 30  ? 17.922  5.250   15.091  1.00 0.00 ? 30  TRP A N    21 
ATOM 11071 C CA   . TRP A 1 30  ? 17.929  3.931   15.782  1.00 0.00 ? 30  TRP A CA   21 
ATOM 11072 C C    . TRP A 1 30  ? 19.147  3.832   16.700  1.00 0.00 ? 30  TRP A C    21 
ATOM 11073 O O    . TRP A 1 30  ? 20.272  4.027   16.284  1.00 0.00 ? 30  TRP A O    21 
ATOM 11074 C CB   . TRP A 1 30  ? 17.989  2.816   14.737  1.00 0.00 ? 30  TRP A CB   21 
ATOM 11075 C CG   . TRP A 1 30  ? 16.600  2.454   14.317  1.00 0.00 ? 30  TRP A CG   21 
ATOM 11076 C CD1  . TRP A 1 30  ? 15.495  3.187   14.578  1.00 0.00 ? 30  TRP A CD1  21 
ATOM 11077 C CD2  . TRP A 1 30  ? 16.152  1.284   13.573  1.00 0.00 ? 30  TRP A CD2  21 
ATOM 11078 N NE1  . TRP A 1 30  ? 14.395  2.542   14.041  1.00 0.00 ? 30  TRP A NE1  21 
ATOM 11079 C CE2  . TRP A 1 30  ? 14.749  1.365   13.412  1.00 0.00 ? 30  TRP A CE2  21 
ATOM 11080 C CE3  . TRP A 1 30  ? 16.820  0.174   13.029  1.00 0.00 ? 30  TRP A CE3  21 
ATOM 11081 C CZ2  . TRP A 1 30  ? 14.032  0.378   12.735  1.00 0.00 ? 30  TRP A CZ2  21 
ATOM 11082 C CZ3  . TRP A 1 30  ? 16.102  -0.824  12.346  1.00 0.00 ? 30  TRP A CZ3  21 
ATOM 11083 C CH2  . TRP A 1 30  ? 14.710  -0.721  12.201  1.00 0.00 ? 30  TRP A CH2  21 
ATOM 11084 H H    . TRP A 1 30  ? 17.719  5.292   14.136  1.00 0.00 ? 30  TRP A H    21 
ATOM 11085 H HA   . TRP A 1 30  ? 17.029  3.825   16.368  1.00 0.00 ? 30  TRP A HA   21 
ATOM 11086 H HB2  . TRP A 1 30  ? 18.547  3.156   13.878  1.00 0.00 ? 30  TRP A HB2  21 
ATOM 11087 H HB3  . TRP A 1 30  ? 18.474  1.950   15.162  1.00 0.00 ? 30  TRP A HB3  21 
ATOM 11088 H HD1  . TRP A 1 30  ? 15.474  4.122   15.116  1.00 0.00 ? 30  TRP A HD1  21 
ATOM 11089 H HE1  . TRP A 1 30  ? 13.471  2.864   14.090  1.00 0.00 ? 30  TRP A HE1  21 
ATOM 11090 H HE3  . TRP A 1 30  ? 17.892  0.088   13.135  1.00 0.00 ? 30  TRP A HE3  21 
ATOM 11091 H HZ2  . TRP A 1 30  ? 12.961  0.461   12.625  1.00 0.00 ? 30  TRP A HZ2  21 
ATOM 11092 H HZ3  . TRP A 1 30  ? 16.624  -1.675  11.934  1.00 0.00 ? 30  TRP A HZ3  21 
ATOM 11093 H HH2  . TRP A 1 30  ? 14.164  -1.490  11.676  1.00 0.00 ? 30  TRP A HH2  21 
ATOM 11094 N N    . LYS A 1 31  ? 18.926  3.531   17.949  1.00 0.00 ? 31  LYS A N    21 
ATOM 11095 C CA   . LYS A 1 31  ? 20.050  3.418   18.905  1.00 0.00 ? 31  LYS A CA   21 
ATOM 11096 C C    . LYS A 1 31  ? 20.310  1.945   19.218  1.00 0.00 ? 31  LYS A C    21 
ATOM 11097 O O    . LYS A 1 31  ? 21.306  1.598   19.825  1.00 0.00 ? 31  LYS A O    21 
ATOM 11098 C CB   . LYS A 1 31  ? 19.664  4.142   20.186  1.00 0.00 ? 31  LYS A CB   21 
ATOM 11099 C CG   . LYS A 1 31  ? 20.126  5.599   20.117  1.00 0.00 ? 31  LYS A CG   21 
ATOM 11100 C CD   . LYS A 1 31  ? 18.994  6.517   20.578  1.00 0.00 ? 31  LYS A CD   21 
ATOM 11101 C CE   . LYS A 1 31  ? 19.116  6.772   22.081  1.00 0.00 ? 31  LYS A CE   21 
ATOM 11102 N NZ   . LYS A 1 31  ? 17.791  6.561   22.731  1.00 0.00 ? 31  LYS A NZ   21 
ATOM 11103 H H    . LYS A 1 31  ? 18.014  3.382   18.265  1.00 0.00 ? 31  LYS A H    21 
ATOM 11104 H HA   . LYS A 1 31  ? 20.937  3.867   18.485  1.00 0.00 ? 31  LYS A HA   21 
ATOM 11105 H HB2  . LYS A 1 31  ? 18.590  4.108   20.300  1.00 0.00 ? 31  LYS A HB2  21 
ATOM 11106 H HB3  . LYS A 1 31  ? 20.126  3.655   21.022  1.00 0.00 ? 31  LYS A HB3  21 
ATOM 11107 H HG2  . LYS A 1 31  ? 20.984  5.734   20.759  1.00 0.00 ? 31  LYS A HG2  21 
ATOM 11108 H HG3  . LYS A 1 31  ? 20.394  5.844   19.101  1.00 0.00 ? 31  LYS A HG3  21 
ATOM 11109 H HD2  . LYS A 1 31  ? 19.055  7.456   20.049  1.00 0.00 ? 31  LYS A HD2  21 
ATOM 11110 H HD3  . LYS A 1 31  ? 18.043  6.049   20.371  1.00 0.00 ? 31  LYS A HD3  21 
ATOM 11111 H HE2  . LYS A 1 31  ? 19.836  6.087   22.504  1.00 0.00 ? 31  LYS A HE2  21 
ATOM 11112 H HE3  . LYS A 1 31  ? 19.442  7.787   22.250  1.00 0.00 ? 31  LYS A HE3  21 
ATOM 11113 H HZ1  . LYS A 1 31  ? 17.042  6.949   22.123  1.00 0.00 ? 31  LYS A HZ1  21 
ATOM 11114 H HZ2  . LYS A 1 31  ? 17.632  5.542   22.870  1.00 0.00 ? 31  LYS A HZ2  21 
ATOM 11115 H HZ3  . LYS A 1 31  ? 17.774  7.045   23.649  1.00 0.00 ? 31  LYS A HZ3  21 
ATOM 11116 N N    . TRP A 1 32  ? 19.422  1.074   18.823  1.00 0.00 ? 32  TRP A N    21 
ATOM 11117 C CA   . TRP A 1 32  ? 19.629  -0.371  19.118  1.00 0.00 ? 32  TRP A CA   21 
ATOM 11118 C C    . TRP A 1 32  ? 20.484  -1.011  18.028  1.00 0.00 ? 32  TRP A C    21 
ATOM 11119 O O    . TRP A 1 32  ? 20.811  -2.176  18.095  1.00 0.00 ? 32  TRP A O    21 
ATOM 11120 C CB   . TRP A 1 32  ? 18.276  -1.082  19.201  1.00 0.00 ? 32  TRP A CB   21 
ATOM 11121 C CG   . TRP A 1 32  ? 17.715  -1.291  17.829  1.00 0.00 ? 32  TRP A CG   21 
ATOM 11122 C CD1  . TRP A 1 32  ? 17.091  -0.346  17.093  1.00 0.00 ? 32  TRP A CD1  21 
ATOM 11123 C CD2  . TRP A 1 32  ? 17.713  -2.503  17.020  1.00 0.00 ? 32  TRP A CD2  21 
ATOM 11124 N NE1  . TRP A 1 32  ? 16.689  -0.903  15.896  1.00 0.00 ? 32  TRP A NE1  21 
ATOM 11125 C CE2  . TRP A 1 32  ? 17.051  -2.231  15.802  1.00 0.00 ? 32  TRP A CE2  21 
ATOM 11126 C CE3  . TRP A 1 32  ? 18.213  -3.801  17.225  1.00 0.00 ? 32  TRP A CE3  21 
ATOM 11127 C CZ2  . TRP A 1 32  ? 16.887  -3.210  14.823  1.00 0.00 ? 32  TRP A CZ2  21 
ATOM 11128 C CZ3  . TRP A 1 32  ? 18.053  -4.790  16.243  1.00 0.00 ? 32  TRP A CZ3  21 
ATOM 11129 C CH2  . TRP A 1 32  ? 17.388  -4.495  15.043  1.00 0.00 ? 32  TRP A CH2  21 
ATOM 11130 H H    . TRP A 1 32  ? 18.621  1.370   18.342  1.00 0.00 ? 32  TRP A H    21 
ATOM 11131 H HA   . TRP A 1 32  ? 20.136  -0.466  20.065  1.00 0.00 ? 32  TRP A HA   21 
ATOM 11132 H HB2  . TRP A 1 32  ? 18.405  -2.038  19.684  1.00 0.00 ? 32  TRP A HB2  21 
ATOM 11133 H HB3  . TRP A 1 32  ? 17.592  -0.480  19.779  1.00 0.00 ? 32  TRP A HB3  21 
ATOM 11134 H HD1  . TRP A 1 32  ? 16.928  0.674   17.391  1.00 0.00 ? 32  TRP A HD1  21 
ATOM 11135 H HE1  . TRP A 1 32  ? 16.208  -0.428  15.190  1.00 0.00 ? 32  TRP A HE1  21 
ATOM 11136 H HE3  . TRP A 1 32  ? 18.731  -4.033  18.139  1.00 0.00 ? 32  TRP A HE3  21 
ATOM 11137 H HZ2  . TRP A 1 32  ? 16.375  -2.978  13.901  1.00 0.00 ? 32  TRP A HZ2  21 
ATOM 11138 H HZ3  . TRP A 1 32  ? 18.443  -5.786  16.415  1.00 0.00 ? 32  TRP A HZ3  21 
ATOM 11139 H HH2  . TRP A 1 32  ? 17.268  -5.257  14.290  1.00 0.00 ? 32  TRP A HH2  21 
ATOM 11140 N N    . ILE A 1 33  ? 20.849  -0.262  17.026  1.00 0.00 ? 33  ILE A N    21 
ATOM 11141 C CA   . ILE A 1 33  ? 21.685  -0.839  15.939  1.00 0.00 ? 33  ILE A CA   21 
ATOM 11142 C C    . ILE A 1 33  ? 22.956  -0.001  15.778  1.00 0.00 ? 33  ILE A C    21 
ATOM 11143 O O    . ILE A 1 33  ? 22.910  1.209   15.682  1.00 0.00 ? 33  ILE A O    21 
ATOM 11144 C CB   . ILE A 1 33  ? 20.878  -0.851  14.633  1.00 0.00 ? 33  ILE A CB   21 
ATOM 11145 C CG1  . ILE A 1 33  ? 20.002  -2.102  14.613  1.00 0.00 ? 33  ILE A CG1  21 
ATOM 11146 C CG2  . ILE A 1 33  ? 21.816  -0.873  13.422  1.00 0.00 ? 33  ILE A CG2  21 
ATOM 11147 C CD1  . ILE A 1 33  ? 19.081  -2.069  13.397  1.00 0.00 ? 33  ILE A CD1  21 
ATOM 11148 H H    . ILE A 1 33  ? 20.576  0.678   16.989  1.00 0.00 ? 33  ILE A H    21 
ATOM 11149 H HA   . ILE A 1 33  ? 21.955  -1.853  16.201  1.00 0.00 ? 33  ILE A HA   21 
ATOM 11150 H HB   . ILE A 1 33  ? 20.251  0.027   14.588  1.00 0.00 ? 33  ILE A HB   21 
ATOM 11151 H HG12 . ILE A 1 33  ? 20.629  -2.977  14.565  1.00 0.00 ? 33  ILE A HG12 21 
ATOM 11152 H HG13 . ILE A 1 33  ? 19.409  -2.136  15.512  1.00 0.00 ? 33  ILE A HG13 21 
ATOM 11153 H HG21 . ILE A 1 33  ? 22.780  -1.256  13.721  1.00 0.00 ? 33  ILE A HG21 21 
ATOM 11154 H HG22 . ILE A 1 33  ? 21.398  -1.509  12.655  1.00 0.00 ? 33  ILE A HG22 21 
ATOM 11155 H HG23 . ILE A 1 33  ? 21.928  0.130   13.037  1.00 0.00 ? 33  ILE A HG23 21 
ATOM 11156 H HD11 . ILE A 1 33  ? 19.535  -1.477  12.618  1.00 0.00 ? 33  ILE A HD11 21 
ATOM 11157 H HD12 . ILE A 1 33  ? 18.921  -3.074  13.040  1.00 0.00 ? 33  ILE A HD12 21 
ATOM 11158 H HD13 . ILE A 1 33  ? 18.136  -1.633  13.677  1.00 0.00 ? 33  ILE A HD13 21 
ATOM 11159 N N    . HIS A 1 34  ? 24.092  -0.641  15.750  1.00 0.00 ? 34  HIS A N    21 
ATOM 11160 C CA   . HIS A 1 34  ? 25.373  0.105   15.599  1.00 0.00 ? 34  HIS A CA   21 
ATOM 11161 C C    . HIS A 1 34  ? 25.772  0.139   14.121  1.00 0.00 ? 34  HIS A C    21 
ATOM 11162 O O    . HIS A 1 34  ? 26.122  1.173   13.588  1.00 0.00 ? 34  HIS A O    21 
ATOM 11163 C CB   . HIS A 1 34  ? 26.463  -0.596  16.420  1.00 0.00 ? 34  HIS A CB   21 
ATOM 11164 C CG   . HIS A 1 34  ? 27.822  -0.117  15.984  1.00 0.00 ? 34  HIS A CG   21 
ATOM 11165 N ND1  . HIS A 1 34  ? 28.211  1.209   16.096  1.00 0.00 ? 34  HIS A ND1  21 
ATOM 11166 C CD2  . HIS A 1 34  ? 28.893  -0.777  15.432  1.00 0.00 ? 34  HIS A CD2  21 
ATOM 11167 C CE1  . HIS A 1 34  ? 29.467  1.304   15.623  1.00 0.00 ? 34  HIS A CE1  21 
ATOM 11168 N NE2  . HIS A 1 34  ? 29.930  0.122   15.206  1.00 0.00 ? 34  HIS A NE2  21 
ATOM 11169 H H    . HIS A 1 34  ? 24.103  -1.617  15.832  1.00 0.00 ? 34  HIS A H    21 
ATOM 11170 H HA   . HIS A 1 34  ? 25.244  1.115   15.962  1.00 0.00 ? 34  HIS A HA   21 
ATOM 11171 H HB2  . HIS A 1 34  ? 26.323  -0.371  17.467  1.00 0.00 ? 34  HIS A HB2  21 
ATOM 11172 H HB3  . HIS A 1 34  ? 26.393  -1.663  16.269  1.00 0.00 ? 34  HIS A HB3  21 
ATOM 11173 H HD1  . HIS A 1 34  ? 27.669  1.943   16.454  1.00 0.00 ? 34  HIS A HD1  21 
ATOM 11174 H HD2  . HIS A 1 34  ? 28.923  -1.834  15.209  1.00 0.00 ? 34  HIS A HD2  21 
ATOM 11175 H HE1  . HIS A 1 34  ? 30.032  2.223   15.585  1.00 0.00 ? 34  HIS A HE1  21 
ATOM 11176 N N    . GLU A 1 35  ? 25.727  -0.982  13.456  1.00 0.00 ? 35  GLU A N    21 
ATOM 11177 C CA   . GLU A 1 35  ? 26.108  -1.008  12.015  1.00 0.00 ? 35  GLU A CA   21 
ATOM 11178 C C    . GLU A 1 35  ? 25.067  -1.802  11.220  1.00 0.00 ? 35  GLU A C    21 
ATOM 11179 O O    . GLU A 1 35  ? 24.363  -2.625  11.771  1.00 0.00 ? 35  GLU A O    21 
ATOM 11180 C CB   . GLU A 1 35  ? 27.479  -1.672  11.864  1.00 0.00 ? 35  GLU A CB   21 
ATOM 11181 C CG   . GLU A 1 35  ? 28.574  -0.682  12.266  1.00 0.00 ? 35  GLU A CG   21 
ATOM 11182 C CD   . GLU A 1 35  ? 29.358  -0.256  11.023  1.00 0.00 ? 35  GLU A CD   21 
ATOM 11183 O OE1  . GLU A 1 35  ? 28.949  0.700   10.386  1.00 0.00 ? 35  GLU A OE1  21 
ATOM 11184 O OE2  . GLU A 1 35  ? 30.357  -0.893  10.730  1.00 0.00 ? 35  GLU A OE2  21 
ATOM 11185 H H    . GLU A 1 35  ? 25.444  -1.807  13.904  1.00 0.00 ? 35  GLU A H    21 
ATOM 11186 H HA   . GLU A 1 35  ? 26.155  0.003   11.638  1.00 0.00 ? 35  GLU A HA   21 
ATOM 11187 H HB2  . GLU A 1 35  ? 27.529  -2.543  12.501  1.00 0.00 ? 35  GLU A HB2  21 
ATOM 11188 H HB3  . GLU A 1 35  ? 27.624  -1.968  10.836  1.00 0.00 ? 35  GLU A HB3  21 
ATOM 11189 H HG2  . GLU A 1 35  ? 28.124  0.188   12.723  1.00 0.00 ? 35  GLU A HG2  21 
ATOM 11190 H HG3  . GLU A 1 35  ? 29.245  -1.152  12.969  1.00 0.00 ? 35  GLU A HG3  21 
ATOM 11191 N N    . PRO A 1 36  ? 25.009  -1.530  9.941   1.00 0.00 ? 36  PRO A N    21 
ATOM 11192 C CA   . PRO A 1 36  ? 25.872  -0.528  9.289   1.00 0.00 ? 36  PRO A CA   21 
ATOM 11193 C C    . PRO A 1 36  ? 25.345  0.883   9.555   1.00 0.00 ? 36  PRO A C    21 
ATOM 11194 O O    . PRO A 1 36  ? 24.305  1.064   10.159  1.00 0.00 ? 36  PRO A O    21 
ATOM 11195 C CB   . PRO A 1 36  ? 25.764  -0.876  7.802   1.00 0.00 ? 36  PRO A CB   21 
ATOM 11196 C CG   . PRO A 1 36  ? 24.439  -1.657  7.632   1.00 0.00 ? 36  PRO A CG   21 
ATOM 11197 C CD   . PRO A 1 36  ? 24.068  -2.205  9.023   1.00 0.00 ? 36  PRO A CD   21 
ATOM 11198 H HA   . PRO A 1 36  ? 26.892  -0.626  9.618   1.00 0.00 ? 36  PRO A HA   21 
ATOM 11199 H HB2  . PRO A 1 36  ? 25.745  0.030   7.211   1.00 0.00 ? 36  PRO A HB2  21 
ATOM 11200 H HB3  . PRO A 1 36  ? 26.593  -1.499  7.505   1.00 0.00 ? 36  PRO A HB3  21 
ATOM 11201 H HG2  . PRO A 1 36  ? 23.663  -0.995  7.273   1.00 0.00 ? 36  PRO A HG2  21 
ATOM 11202 H HG3  . PRO A 1 36  ? 24.577  -2.477  6.944   1.00 0.00 ? 36  PRO A HG3  21 
ATOM 11203 H HD2  . PRO A 1 36  ? 23.046  -1.949  9.269   1.00 0.00 ? 36  PRO A HD2  21 
ATOM 11204 H HD3  . PRO A 1 36  ? 24.213  -3.272  9.060   1.00 0.00 ? 36  PRO A HD3  21 
ATOM 11205 N N    . LYS A 1 37  ? 26.047  1.882   9.101   1.00 0.00 ? 37  LYS A N    21 
ATOM 11206 C CA   . LYS A 1 37  ? 25.589  3.273   9.312   1.00 0.00 ? 37  LYS A CA   21 
ATOM 11207 C C    . LYS A 1 37  ? 24.175  3.424   8.756   1.00 0.00 ? 37  LYS A C    21 
ATOM 11208 O O    . LYS A 1 37  ? 23.352  4.137   9.296   1.00 0.00 ? 37  LYS A O    21 
ATOM 11209 C CB   . LYS A 1 37  ? 26.533  4.203   8.563   1.00 0.00 ? 37  LYS A CB   21 
ATOM 11210 C CG   . LYS A 1 37  ? 27.672  4.635   9.488   1.00 0.00 ? 37  LYS A CG   21 
ATOM 11211 C CD   . LYS A 1 37  ? 28.951  4.830   8.667   1.00 0.00 ? 37  LYS A CD   21 
ATOM 11212 C CE   . LYS A 1 37  ? 30.131  5.117   9.602   1.00 0.00 ? 37  LYS A CE   21 
ATOM 11213 N NZ   . LYS A 1 37  ? 29.638  5.743   10.864  1.00 0.00 ? 37  LYS A NZ   21 
ATOM 11214 H H    . LYS A 1 37  ? 26.875  1.718   8.609   1.00 0.00 ? 37  LYS A H    21 
ATOM 11215 H HA   . LYS A 1 37  ? 25.600  3.510   10.364  1.00 0.00 ? 37  LYS A HA   21 
ATOM 11216 H HB2  . LYS A 1 37  ? 26.940  3.682   7.707   1.00 0.00 ? 37  LYS A HB2  21 
ATOM 11217 H HB3  . LYS A 1 37  ? 25.991  5.063   8.229   1.00 0.00 ? 37  LYS A HB3  21 
ATOM 11218 H HG2  . LYS A 1 37  ? 27.409  5.564   9.972   1.00 0.00 ? 37  LYS A HG2  21 
ATOM 11219 H HG3  . LYS A 1 37  ? 27.839  3.873   10.234  1.00 0.00 ? 37  LYS A HG3  21 
ATOM 11220 H HD2  . LYS A 1 37  ? 29.152  3.933   8.099   1.00 0.00 ? 37  LYS A HD2  21 
ATOM 11221 H HD3  . LYS A 1 37  ? 28.820  5.662   7.992   1.00 0.00 ? 37  LYS A HD3  21 
ATOM 11222 H HE2  . LYS A 1 37  ? 30.638  4.194   9.836   1.00 0.00 ? 37  LYS A HE2  21 
ATOM 11223 H HE3  . LYS A 1 37  ? 30.820  5.792   9.113   1.00 0.00 ? 37  LYS A HE3  21 
ATOM 11224 H HZ1  . LYS A 1 37  ? 28.973  6.510   10.634  1.00 0.00 ? 37  LYS A HZ1  21 
ATOM 11225 H HZ2  . LYS A 1 37  ? 29.153  5.026   11.440  1.00 0.00 ? 37  LYS A HZ2  21 
ATOM 11226 H HZ3  . LYS A 1 37  ? 30.441  6.129   11.398  1.00 0.00 ? 37  LYS A HZ3  21 
ATOM 11227 N N    . GLY A 1 38  ? 23.892  2.753   7.678   1.00 0.00 ? 38  GLY A N    21 
ATOM 11228 C CA   . GLY A 1 38  ? 22.535  2.843   7.071   1.00 0.00 ? 38  GLY A CA   21 
ATOM 11229 C C    . GLY A 1 38  ? 22.373  1.733   6.032   1.00 0.00 ? 38  GLY A C    21 
ATOM 11230 O O    . GLY A 1 38  ? 22.953  0.671   6.152   1.00 0.00 ? 38  GLY A O    21 
ATOM 11231 H H    . GLY A 1 38  ? 24.577  2.185   7.267   1.00 0.00 ? 38  GLY A H    21 
ATOM 11232 H HA2  . GLY A 1 38  ? 21.786  2.730   7.842   1.00 0.00 ? 38  GLY A HA2  21 
ATOM 11233 H HA3  . GLY A 1 38  ? 22.417  3.801   6.590   1.00 0.00 ? 38  GLY A HA3  21 
ATOM 11234 N N    . TYR A 1 39  ? 21.594  1.967   5.013   1.00 0.00 ? 39  TYR A N    21 
ATOM 11235 C CA   . TYR A 1 39  ? 21.400  0.921   3.970   1.00 0.00 ? 39  TYR A CA   21 
ATOM 11236 C C    . TYR A 1 39  ? 20.427  1.435   2.906   1.00 0.00 ? 39  TYR A C    21 
ATOM 11237 O O    . TYR A 1 39  ? 19.889  2.518   3.017   1.00 0.00 ? 39  TYR A O    21 
ATOM 11238 C CB   . TYR A 1 39  ? 20.834  -0.345  4.617   1.00 0.00 ? 39  TYR A CB   21 
ATOM 11239 C CG   . TYR A 1 39  ? 19.386  -0.126  4.986   1.00 0.00 ? 39  TYR A CG   21 
ATOM 11240 C CD1  . TYR A 1 39  ? 19.046  0.788   5.990   1.00 0.00 ? 39  TYR A CD1  21 
ATOM 11241 C CD2  . TYR A 1 39  ? 18.386  -0.840  4.322   1.00 0.00 ? 39  TYR A CD2  21 
ATOM 11242 C CE1  . TYR A 1 39  ? 17.703  0.985   6.331   1.00 0.00 ? 39  TYR A CE1  21 
ATOM 11243 C CE2  . TYR A 1 39  ? 17.043  -0.643  4.661   1.00 0.00 ? 39  TYR A CE2  21 
ATOM 11244 C CZ   . TYR A 1 39  ? 16.701  0.270   5.666   1.00 0.00 ? 39  TYR A CZ   21 
ATOM 11245 O OH   . TYR A 1 39  ? 15.377  0.464   5.999   1.00 0.00 ? 39  TYR A OH   21 
ATOM 11246 H H    . TYR A 1 39  ? 21.136  2.829   4.934   1.00 0.00 ? 39  TYR A H    21 
ATOM 11247 H HA   . TYR A 1 39  ? 22.349  0.694   3.507   1.00 0.00 ? 39  TYR A HA   21 
ATOM 11248 H HB2  . TYR A 1 39  ? 20.907  -1.168  3.921   1.00 0.00 ? 39  TYR A HB2  21 
ATOM 11249 H HB3  . TYR A 1 39  ? 21.399  -0.578  5.507   1.00 0.00 ? 39  TYR A HB3  21 
ATOM 11250 H HD1  . TYR A 1 39  ? 19.817  1.340   6.503   1.00 0.00 ? 39  TYR A HD1  21 
ATOM 11251 H HD2  . TYR A 1 39  ? 18.649  -1.544  3.546   1.00 0.00 ? 39  TYR A HD2  21 
ATOM 11252 H HE1  . TYR A 1 39  ? 17.439  1.690   7.105   1.00 0.00 ? 39  TYR A HE1  21 
ATOM 11253 H HE2  . TYR A 1 39  ? 16.272  -1.193  4.148   1.00 0.00 ? 39  TYR A HE2  21 
ATOM 11254 H HH   . TYR A 1 39  ? 15.291  1.346   6.368   1.00 0.00 ? 39  TYR A HH   21 
ATOM 11255 N N    . HIS A 1 40  ? 20.193  0.666   1.879   1.00 0.00 ? 40  HIS A N    21 
ATOM 11256 C CA   . HIS A 1 40  ? 19.250  1.113   0.816   1.00 0.00 ? 40  HIS A CA   21 
ATOM 11257 C C    . HIS A 1 40  ? 17.834  0.666   1.182   1.00 0.00 ? 40  HIS A C    21 
ATOM 11258 O O    . HIS A 1 40  ? 17.340  -0.329  0.689   1.00 0.00 ? 40  HIS A O    21 
ATOM 11259 C CB   . HIS A 1 40  ? 19.655  0.491   -0.522  1.00 0.00 ? 40  HIS A CB   21 
ATOM 11260 C CG   . HIS A 1 40  ? 21.039  0.951   -0.890  1.00 0.00 ? 40  HIS A CG   21 
ATOM 11261 N ND1  . HIS A 1 40  ? 22.170  0.486   -0.239  1.00 0.00 ? 40  HIS A ND1  21 
ATOM 11262 C CD2  . HIS A 1 40  ? 21.489  1.835   -1.840  1.00 0.00 ? 40  HIS A CD2  21 
ATOM 11263 C CE1  . HIS A 1 40  ? 23.236  1.086   -0.800  1.00 0.00 ? 40  HIS A CE1  21 
ATOM 11264 N NE2  . HIS A 1 40  ? 22.877  1.918   -1.781  1.00 0.00 ? 40  HIS A NE2  21 
ATOM 11265 H H    . HIS A 1 40  ? 20.634  -0.207  1.808   1.00 0.00 ? 40  HIS A H    21 
ATOM 11266 H HA   . HIS A 1 40  ? 19.281  2.191   0.738   1.00 0.00 ? 40  HIS A HA   21 
ATOM 11267 H HB2  . HIS A 1 40  ? 19.644  -0.586  -0.436  1.00 0.00 ? 40  HIS A HB2  21 
ATOM 11268 H HB3  . HIS A 1 40  ? 18.958  0.798   -1.288  1.00 0.00 ? 40  HIS A HB3  21 
ATOM 11269 H HD1  . HIS A 1 40  ? 22.190  -0.162  0.496   1.00 0.00 ? 40  HIS A HD1  21 
ATOM 11270 H HD2  . HIS A 1 40  ? 20.862  2.381   -2.528  1.00 0.00 ? 40  HIS A HD2  21 
ATOM 11271 H HE1  . HIS A 1 40  ? 24.258  0.914   -0.493  1.00 0.00 ? 40  HIS A HE1  21 
ATOM 11272 N N    . ALA A 1 41  ? 17.181  1.386   2.052   1.00 0.00 ? 41  ALA A N    21 
ATOM 11273 C CA   . ALA A 1 41  ? 15.801  0.997   2.459   1.00 0.00 ? 41  ALA A CA   21 
ATOM 11274 C C    . ALA A 1 41  ? 14.849  1.133   1.269   1.00 0.00 ? 41  ALA A C    21 
ATOM 11275 O O    . ALA A 1 41  ? 13.931  0.352   1.109   1.00 0.00 ? 41  ALA A O    21 
ATOM 11276 C CB   . ALA A 1 41  ? 15.334  1.901   3.601   1.00 0.00 ? 41  ALA A CB   21 
ATOM 11277 H H    . ALA A 1 41  ? 17.601  2.181   2.443   1.00 0.00 ? 41  ALA A H    21 
ATOM 11278 H HA   . ALA A 1 41  ? 15.804  -0.029  2.793   1.00 0.00 ? 41  ALA A HA   21 
ATOM 11279 H HB1  . ALA A 1 41  ? 16.185  2.194   4.200   1.00 0.00 ? 41  ALA A HB1  21 
ATOM 11280 H HB2  . ALA A 1 41  ? 14.862  2.783   3.194   1.00 0.00 ? 41  ALA A HB2  21 
ATOM 11281 H HB3  . ALA A 1 41  ? 14.627  1.367   4.219   1.00 0.00 ? 41  ALA A HB3  21 
ATOM 11282 N N    . ASN A 1 42  ? 15.056  2.110   0.433   1.00 0.00 ? 42  ASN A N    21 
ATOM 11283 C CA   . ASN A 1 42  ? 14.156  2.280   -0.742  1.00 0.00 ? 42  ASN A CA   21 
ATOM 11284 C C    . ASN A 1 42  ? 12.717  2.461   -0.259  1.00 0.00 ? 42  ASN A C    21 
ATOM 11285 O O    . ASN A 1 42  ? 12.435  2.392   0.920   1.00 0.00 ? 42  ASN A O    21 
ATOM 11286 C CB   . ASN A 1 42  ? 14.237  1.034   -1.626  1.00 0.00 ? 42  ASN A CB   21 
ATOM 11287 C CG   . ASN A 1 42  ? 15.364  1.202   -2.646  1.00 0.00 ? 42  ASN A CG   21 
ATOM 11288 O OD1  . ASN A 1 42  ? 15.303  2.064   -3.500  1.00 0.00 ? 42  ASN A OD1  21 
ATOM 11289 N ND2  . ASN A 1 42  ? 16.399  0.407   -2.596  1.00 0.00 ? 42  ASN A ND2  21 
ATOM 11290 H H    . ASN A 1 42  ? 15.802  2.730   0.575   1.00 0.00 ? 42  ASN A H    21 
ATOM 11291 H HA   . ASN A 1 42  ? 14.460  3.146   -1.310  1.00 0.00 ? 42  ASN A HA   21 
ATOM 11292 H HB2  . ASN A 1 42  ? 14.433  0.168   -1.009  1.00 0.00 ? 42  ASN A HB2  21 
ATOM 11293 H HB3  . ASN A 1 42  ? 13.299  0.899   -2.145  1.00 0.00 ? 42  ASN A HB3  21 
ATOM 11294 H HD21 . ASN A 1 42  ? 16.448  -0.289  -1.907  1.00 0.00 ? 42  ASN A HD21 21 
ATOM 11295 H HD22 . ASN A 1 42  ? 17.126  0.507   -3.245  1.00 0.00 ? 42  ASN A HD22 21 
ATOM 11296 N N    . PHE A 1 43  ? 11.801  2.681   -1.164  1.00 0.00 ? 43  PHE A N    21 
ATOM 11297 C CA   . PHE A 1 43  ? 10.377  2.856   -0.760  1.00 0.00 ? 43  PHE A CA   21 
ATOM 11298 C C    . PHE A 1 43  ? 9.532   3.133   -2.001  1.00 0.00 ? 43  PHE A C    21 
ATOM 11299 O O    . PHE A 1 43  ? 10.043  3.209   -3.099  1.00 0.00 ? 43  PHE A O    21 
ATOM 11300 C CB   . PHE A 1 43  ? 10.247  4.010   0.240   1.00 0.00 ? 43  PHE A CB   21 
ATOM 11301 C CG   . PHE A 1 43  ? 10.367  5.344   -0.455  1.00 0.00 ? 43  PHE A CG   21 
ATOM 11302 C CD1  . PHE A 1 43  ? 11.374  5.569   -1.400  1.00 0.00 ? 43  PHE A CD1  21 
ATOM 11303 C CD2  . PHE A 1 43  ? 9.474   6.369   -0.130  1.00 0.00 ? 43  PHE A CD2  21 
ATOM 11304 C CE1  . PHE A 1 43  ? 11.487  6.820   -2.016  1.00 0.00 ? 43  PHE A CE1  21 
ATOM 11305 C CE2  . PHE A 1 43  ? 9.586   7.615   -0.749  1.00 0.00 ? 43  PHE A CE2  21 
ATOM 11306 C CZ   . PHE A 1 43  ? 10.592  7.842   -1.691  1.00 0.00 ? 43  PHE A CZ   21 
ATOM 11307 H H    . PHE A 1 43  ? 12.050  2.722   -2.115  1.00 0.00 ? 43  PHE A H    21 
ATOM 11308 H HA   . PHE A 1 43  ? 10.030  1.944   -0.296  1.00 0.00 ? 43  PHE A HA   21 
ATOM 11309 H HB2  . PHE A 1 43  ? 9.284   3.953   0.722   1.00 0.00 ? 43  PHE A HB2  21 
ATOM 11310 H HB3  . PHE A 1 43  ? 11.023  3.925   0.987   1.00 0.00 ? 43  PHE A HB3  21 
ATOM 11311 H HD1  . PHE A 1 43  ? 12.068  4.782   -1.650  1.00 0.00 ? 43  PHE A HD1  21 
ATOM 11312 H HD2  . PHE A 1 43  ? 8.694   6.196   0.597   1.00 0.00 ? 43  PHE A HD2  21 
ATOM 11313 H HE1  . PHE A 1 43  ? 12.263  6.996   -2.742  1.00 0.00 ? 43  PHE A HE1  21 
ATOM 11314 H HE2  . PHE A 1 43  ? 8.897   8.401   -0.496  1.00 0.00 ? 43  PHE A HE2  21 
ATOM 11315 H HZ   . PHE A 1 43  ? 10.678  8.807   -2.167  1.00 0.00 ? 43  PHE A HZ   21 
ATOM 11316 N N    . CYS A 1 44  ? 8.243   3.261   -1.845  1.00 0.00 ? 44  CYS A N    21 
ATOM 11317 C CA   . CYS A 1 44  ? 7.379   3.500   -3.037  1.00 0.00 ? 44  CYS A CA   21 
ATOM 11318 C C    . CYS A 1 44  ? 6.588   4.801   -2.870  1.00 0.00 ? 44  CYS A C    21 
ATOM 11319 O O    . CYS A 1 44  ? 6.151   5.141   -1.789  1.00 0.00 ? 44  CYS A O    21 
ATOM 11320 C CB   . CYS A 1 44  ? 6.388   2.341   -3.196  1.00 0.00 ? 44  CYS A CB   21 
ATOM 11321 S SG   . CYS A 1 44  ? 7.100   0.809   -2.541  1.00 0.00 ? 44  CYS A SG   21 
ATOM 11322 H H    . CYS A 1 44  ? 7.843   3.178   -0.955  1.00 0.00 ? 44  CYS A H    21 
ATOM 11323 H HA   . CYS A 1 44  ? 7.997   3.566   -3.921  1.00 0.00 ? 44  CYS A HA   21 
ATOM 11324 H HB2  . CYS A 1 44  ? 5.479   2.571   -2.661  1.00 0.00 ? 44  CYS A HB2  21 
ATOM 11325 H HB3  . CYS A 1 44  ? 6.162   2.210   -4.243  1.00 0.00 ? 44  CYS A HB3  21 
ATOM 11326 N N    . LEU A 1 45  ? 6.389   5.521   -3.943  1.00 0.00 ? 45  LEU A N    21 
ATOM 11327 C CA   . LEU A 1 45  ? 5.612   6.789   -3.862  1.00 0.00 ? 45  LEU A CA   21 
ATOM 11328 C C    . LEU A 1 45  ? 4.717   6.909   -5.097  1.00 0.00 ? 45  LEU A C    21 
ATOM 11329 O O    . LEU A 1 45  ? 4.724   6.059   -5.966  1.00 0.00 ? 45  LEU A O    21 
ATOM 11330 C CB   . LEU A 1 45  ? 6.569   7.981   -3.819  1.00 0.00 ? 45  LEU A CB   21 
ATOM 11331 C CG   . LEU A 1 45  ? 7.184   8.104   -2.429  1.00 0.00 ? 45  LEU A CG   21 
ATOM 11332 C CD1  . LEU A 1 45  ? 7.931   9.434   -2.332  1.00 0.00 ? 45  LEU A CD1  21 
ATOM 11333 C CD2  . LEU A 1 45  ? 6.084   8.061   -1.366  1.00 0.00 ? 45  LEU A CD2  21 
ATOM 11334 H H    . LEU A 1 45  ? 6.744   5.220   -4.805  1.00 0.00 ? 45  LEU A H    21 
ATOM 11335 H HA   . LEU A 1 45  ? 5.000   6.781   -2.974  1.00 0.00 ? 45  LEU A HA   21 
ATOM 11336 H HB2  . LEU A 1 45  ? 7.357   7.836   -4.543  1.00 0.00 ? 45  LEU A HB2  21 
ATOM 11337 H HB3  . LEU A 1 45  ? 6.027   8.886   -4.051  1.00 0.00 ? 45  LEU A HB3  21 
ATOM 11338 H HG   . LEU A 1 45  ? 7.874   7.289   -2.271  1.00 0.00 ? 45  LEU A HG   21 
ATOM 11339 H HD11 . LEU A 1 45  ? 7.443   10.166  -2.958  1.00 0.00 ? 45  LEU A HD11 21 
ATOM 11340 H HD12 . LEU A 1 45  ? 7.928   9.776   -1.308  1.00 0.00 ? 45  LEU A HD12 21 
ATOM 11341 H HD13 . LEU A 1 45  ? 8.950   9.299   -2.664  1.00 0.00 ? 45  LEU A HD13 21 
ATOM 11342 H HD21 . LEU A 1 45  ? 5.134   8.299   -1.821  1.00 0.00 ? 45  LEU A HD21 21 
ATOM 11343 H HD22 . LEU A 1 45  ? 6.039   7.071   -0.935  1.00 0.00 ? 45  LEU A HD22 21 
ATOM 11344 H HD23 . LEU A 1 45  ? 6.303   8.780   -0.592  1.00 0.00 ? 45  LEU A HD23 21 
ATOM 11345 N N    . GLY A 1 46  ? 3.947   7.958   -5.185  1.00 0.00 ? 46  GLY A N    21 
ATOM 11346 C CA   . GLY A 1 46  ? 3.056   8.133   -6.367  1.00 0.00 ? 46  GLY A CA   21 
ATOM 11347 C C    . GLY A 1 46  ? 1.890   7.141   -6.288  1.00 0.00 ? 46  GLY A C    21 
ATOM 11348 O O    . GLY A 1 46  ? 2.037   6.053   -5.767  1.00 0.00 ? 46  GLY A O    21 
ATOM 11349 H H    . GLY A 1 46  ? 3.957   8.634   -4.476  1.00 0.00 ? 46  GLY A H    21 
ATOM 11350 H HA2  . GLY A 1 46  ? 2.671   9.142   -6.380  1.00 0.00 ? 46  GLY A HA2  21 
ATOM 11351 H HA3  . GLY A 1 46  ? 3.617   7.949   -7.270  1.00 0.00 ? 46  GLY A HA3  21 
ATOM 11352 N N    . PRO A 1 47  ? 0.763   7.554   -6.811  1.00 0.00 ? 47  PRO A N    21 
ATOM 11353 C CA   . PRO A 1 47  ? -0.460  6.730   -6.822  1.00 0.00 ? 47  PRO A CA   21 
ATOM 11354 C C    . PRO A 1 47  ? -0.390  5.677   -7.932  1.00 0.00 ? 47  PRO A C    21 
ATOM 11355 O O    . PRO A 1 47  ? 0.673   5.332   -8.410  1.00 0.00 ? 47  PRO A O    21 
ATOM 11356 C CB   . PRO A 1 47  ? -1.572  7.747   -7.104  1.00 0.00 ? 47  PRO A CB   21 
ATOM 11357 C CG   . PRO A 1 47  ? -0.895  8.957   -7.790  1.00 0.00 ? 47  PRO A CG   21 
ATOM 11358 C CD   . PRO A 1 47  ? 0.603   8.882   -7.438  1.00 0.00 ? 47  PRO A CD   21 
ATOM 11359 H HA   . PRO A 1 47  ? -0.620  6.266   -5.864  1.00 0.00 ? 47  PRO A HA   21 
ATOM 11360 H HB2  . PRO A 1 47  ? -2.314  7.313   -7.759  1.00 0.00 ? 47  PRO A HB2  21 
ATOM 11361 H HB3  . PRO A 1 47  ? -2.029  8.062   -6.180  1.00 0.00 ? 47  PRO A HB3  21 
ATOM 11362 H HG2  . PRO A 1 47  ? -1.030  8.897   -8.861  1.00 0.00 ? 47  PRO A HG2  21 
ATOM 11363 H HG3  . PRO A 1 47  ? -1.311  9.878   -7.414  1.00 0.00 ? 47  PRO A HG3  21 
ATOM 11364 H HD2  . PRO A 1 47  ? 1.204   8.956   -8.334  1.00 0.00 ? 47  PRO A HD2  21 
ATOM 11365 H HD3  . PRO A 1 47  ? 0.867   9.659   -6.738  1.00 0.00 ? 47  PRO A HD3  21 
ATOM 11366 N N    . CYS A 1 48  ? -1.518  5.168   -8.345  1.00 0.00 ? 48  CYS A N    21 
ATOM 11367 C CA   . CYS A 1 48  ? -1.526  4.139   -9.425  1.00 0.00 ? 48  CYS A CA   21 
ATOM 11368 C C    . CYS A 1 48  ? -2.760  4.351   -10.312 1.00 0.00 ? 48  CYS A C    21 
ATOM 11369 O O    . CYS A 1 48  ? -3.874  4.315   -9.828  1.00 0.00 ? 48  CYS A O    21 
ATOM 11370 C CB   . CYS A 1 48  ? -1.599  2.739   -8.805  1.00 0.00 ? 48  CYS A CB   21 
ATOM 11371 S SG   . CYS A 1 48  ? -0.476  2.627   -7.391  1.00 0.00 ? 48  CYS A SG   21 
ATOM 11372 H H    . CYS A 1 48  ? -2.360  5.465   -7.946  1.00 0.00 ? 48  CYS A H    21 
ATOM 11373 H HA   . CYS A 1 48  ? -0.626  4.227   -10.012 1.00 0.00 ? 48  CYS A HA   21 
ATOM 11374 H HB2  . CYS A 1 48  ? -2.609  2.544   -8.476  1.00 0.00 ? 48  CYS A HB2  21 
ATOM 11375 H HB3  . CYS A 1 48  ? -1.317  2.005   -9.547  1.00 0.00 ? 48  CYS A HB3  21 
ATOM 11376 N N    . PRO A 1 49  ? -2.534  4.557   -11.586 1.00 0.00 ? 49  PRO A N    21 
ATOM 11377 C CA   . PRO A 1 49  ? -3.627  4.765   -12.551 1.00 0.00 ? 49  PRO A CA   21 
ATOM 11378 C C    . PRO A 1 49  ? -4.358  3.431   -12.816 1.00 0.00 ? 49  PRO A C    21 
ATOM 11379 O O    . PRO A 1 49  ? -4.813  2.790   -11.890 1.00 0.00 ? 49  PRO A O    21 
ATOM 11380 C CB   . PRO A 1 49  ? -2.912  5.336   -13.786 1.00 0.00 ? 49  PRO A CB   21 
ATOM 11381 C CG   . PRO A 1 49  ? -1.435  4.904   -13.672 1.00 0.00 ? 49  PRO A CG   21 
ATOM 11382 C CD   . PRO A 1 49  ? -1.183  4.602   -12.181 1.00 0.00 ? 49  PRO A CD   21 
ATOM 11383 H HA   . PRO A 1 49  ? -4.322  5.494   -12.166 1.00 0.00 ? 49  PRO A HA   21 
ATOM 11384 H HB2  . PRO A 1 49  ? -3.348  4.951   -14.692 1.00 0.00 ? 49  PRO A HB2  21 
ATOM 11385 H HB3  . PRO A 1 49  ? -2.971  6.412   -13.779 1.00 0.00 ? 49  PRO A HB3  21 
ATOM 11386 H HG2  . PRO A 1 49  ? -1.264  4.022   -14.271 1.00 0.00 ? 49  PRO A HG2  21 
ATOM 11387 H HG3  . PRO A 1 49  ? -0.788  5.704   -13.996 1.00 0.00 ? 49  PRO A HG3  21 
ATOM 11388 H HD2  . PRO A 1 49  ? -0.686  3.652   -12.065 1.00 0.00 ? 49  PRO A HD2  21 
ATOM 11389 H HD3  . PRO A 1 49  ? -0.604  5.390   -11.728 1.00 0.00 ? 49  PRO A HD3  21 
ATOM 11390 N N    . TYR A 1 50  ? -4.512  3.007   -14.047 1.00 0.00 ? 50  TYR A N    21 
ATOM 11391 C CA   . TYR A 1 50  ? -5.254  1.731   -14.292 1.00 0.00 ? 50  TYR A CA   21 
ATOM 11392 C C    . TYR A 1 50  ? -4.299  0.560   -14.568 1.00 0.00 ? 50  TYR A C    21 
ATOM 11393 O O    . TYR A 1 50  ? -4.085  -0.289  -13.726 1.00 0.00 ? 50  TYR A O    21 
ATOM 11394 C CB   . TYR A 1 50  ? -6.208  1.898   -15.486 1.00 0.00 ? 50  TYR A CB   21 
ATOM 11395 C CG   . TYR A 1 50  ? -6.417  3.365   -15.792 1.00 0.00 ? 50  TYR A CG   21 
ATOM 11396 C CD1  . TYR A 1 50  ? -6.970  4.211   -14.824 1.00 0.00 ? 50  TYR A CD1  21 
ATOM 11397 C CD2  . TYR A 1 50  ? -6.053  3.876   -17.044 1.00 0.00 ? 50  TYR A CD2  21 
ATOM 11398 C CE1  . TYR A 1 50  ? -7.161  5.569   -15.108 1.00 0.00 ? 50  TYR A CE1  21 
ATOM 11399 C CE2  . TYR A 1 50  ? -6.244  5.234   -17.327 1.00 0.00 ? 50  TYR A CE2  21 
ATOM 11400 C CZ   . TYR A 1 50  ? -6.798  6.080   -16.359 1.00 0.00 ? 50  TYR A CZ   21 
ATOM 11401 O OH   . TYR A 1 50  ? -6.985  7.419   -16.639 1.00 0.00 ? 50  TYR A OH   21 
ATOM 11402 H H    . TYR A 1 50  ? -4.172  3.523   -14.799 1.00 0.00 ? 50  TYR A H    21 
ATOM 11403 H HA   . TYR A 1 50  ? -5.840  1.500   -13.414 1.00 0.00 ? 50  TYR A HA   21 
ATOM 11404 H HB2  . TYR A 1 50  ? -5.790  1.409   -16.352 1.00 0.00 ? 50  TYR A HB2  21 
ATOM 11405 H HB3  . TYR A 1 50  ? -7.160  1.446   -15.249 1.00 0.00 ? 50  TYR A HB3  21 
ATOM 11406 H HD1  . TYR A 1 50  ? -7.251  3.816   -13.859 1.00 0.00 ? 50  TYR A HD1  21 
ATOM 11407 H HD2  . TYR A 1 50  ? -5.626  3.223   -17.791 1.00 0.00 ? 50  TYR A HD2  21 
ATOM 11408 H HE1  . TYR A 1 50  ? -7.589  6.221   -14.361 1.00 0.00 ? 50  TYR A HE1  21 
ATOM 11409 H HE2  . TYR A 1 50  ? -5.964  5.628   -18.293 1.00 0.00 ? 50  TYR A HE2  21 
ATOM 11410 H HH   . TYR A 1 50  ? -7.754  7.497   -17.209 1.00 0.00 ? 50  TYR A HH   21 
ATOM 11411 N N    . ILE A 1 51  ? -3.763  0.481   -15.758 1.00 0.00 ? 51  ILE A N    21 
ATOM 11412 C CA   . ILE A 1 51  ? -2.868  -0.666  -16.113 1.00 0.00 ? 51  ILE A CA   21 
ATOM 11413 C C    . ILE A 1 51  ? -1.529  -0.604  -15.371 1.00 0.00 ? 51  ILE A C    21 
ATOM 11414 O O    . ILE A 1 51  ? -0.667  -1.433  -15.582 1.00 0.00 ? 51  ILE A O    21 
ATOM 11415 C CB   . ILE A 1 51  ? -2.593  -0.636  -17.615 1.00 0.00 ? 51  ILE A CB   21 
ATOM 11416 C CG1  . ILE A 1 51  ? -1.910  0.687   -17.972 1.00 0.00 ? 51  ILE A CG1  21 
ATOM 11417 C CG2  . ILE A 1 51  ? -3.912  -0.753  -18.381 1.00 0.00 ? 51  ILE A CG2  21 
ATOM 11418 C CD1  . ILE A 1 51  ? -0.984  0.479   -19.171 1.00 0.00 ? 51  ILE A CD1  21 
ATOM 11419 H H    . ILE A 1 51  ? -3.974  1.157   -16.433 1.00 0.00 ? 51  ILE A H    21 
ATOM 11420 H HA   . ILE A 1 51  ? -3.366  -1.593  -15.867 1.00 0.00 ? 51  ILE A HA   21 
ATOM 11421 H HB   . ILE A 1 51  ? -1.948  -1.460  -17.880 1.00 0.00 ? 51  ILE A HB   21 
ATOM 11422 H HG12 . ILE A 1 51  ? -2.661  1.423   -18.222 1.00 0.00 ? 51  ILE A HG12 21 
ATOM 11423 H HG13 . ILE A 1 51  ? -1.332  1.033   -17.129 1.00 0.00 ? 51  ILE A HG13 21 
ATOM 11424 H HG21 . ILE A 1 51  ? -4.726  -0.876  -17.682 1.00 0.00 ? 51  ILE A HG21 21 
ATOM 11425 H HG22 . ILE A 1 51  ? -4.071  0.142   -18.964 1.00 0.00 ? 51  ILE A HG22 21 
ATOM 11426 H HG23 . ILE A 1 51  ? -3.872  -1.608  -19.039 1.00 0.00 ? 51  ILE A HG23 21 
ATOM 11427 H HD11 . ILE A 1 51  ? -1.407  -0.264  -19.830 1.00 0.00 ? 51  ILE A HD11 21 
ATOM 11428 H HD12 . ILE A 1 51  ? -0.870  1.411   -19.704 1.00 0.00 ? 51  ILE A HD12 21 
ATOM 11429 H HD13 . ILE A 1 51  ? -0.017  0.143   -18.823 1.00 0.00 ? 51  ILE A HD13 21 
ATOM 11430 N N    . TRP A 1 52  ? -1.328  0.355   -14.518 1.00 0.00 ? 52  TRP A N    21 
ATOM 11431 C CA   . TRP A 1 52  ? -0.023  0.427   -13.800 1.00 0.00 ? 52  TRP A CA   21 
ATOM 11432 C C    . TRP A 1 52  ? 0.047   -0.663  -12.728 1.00 0.00 ? 52  TRP A C    21 
ATOM 11433 O O    . TRP A 1 52  ? -0.225  -0.425  -11.569 1.00 0.00 ? 52  TRP A O    21 
ATOM 11434 C CB   . TRP A 1 52  ? 0.129   1.792   -13.144 1.00 0.00 ? 52  TRP A CB   21 
ATOM 11435 C CG   . TRP A 1 52  ? 1.578   2.149   -13.079 1.00 0.00 ? 52  TRP A CG   21 
ATOM 11436 C CD1  . TRP A 1 52  ? 2.234   2.511   -11.957 1.00 0.00 ? 52  TRP A CD1  21 
ATOM 11437 C CD2  . TRP A 1 52  ? 2.558   2.182   -14.158 1.00 0.00 ? 52  TRP A CD2  21 
ATOM 11438 N NE1  . TRP A 1 52  ? 3.557   2.765   -12.273 1.00 0.00 ? 52  TRP A NE1  21 
ATOM 11439 C CE2  . TRP A 1 52  ? 3.806   2.576   -13.617 1.00 0.00 ? 52  TRP A CE2  21 
ATOM 11440 C CE3  . TRP A 1 52  ? 2.487   1.912   -15.538 1.00 0.00 ? 52  TRP A CE3  21 
ATOM 11441 C CZ2  . TRP A 1 52  ? 4.944   2.696   -14.417 1.00 0.00 ? 52  TRP A CZ2  21 
ATOM 11442 C CZ3  . TRP A 1 52  ? 3.631   2.032   -16.345 1.00 0.00 ? 52  TRP A CZ3  21 
ATOM 11443 C CH2  . TRP A 1 52  ? 4.856   2.424   -15.785 1.00 0.00 ? 52  TRP A CH2  21 
ATOM 11444 H H    . TRP A 1 52  ? -2.022  1.027   -14.354 1.00 0.00 ? 52  TRP A H    21 
ATOM 11445 H HA   . TRP A 1 52  ? 0.781   0.282   -14.506 1.00 0.00 ? 52  TRP A HA   21 
ATOM 11446 H HB2  . TRP A 1 52  ? -0.397  2.530   -13.727 1.00 0.00 ? 52  TRP A HB2  21 
ATOM 11447 H HB3  . TRP A 1 52  ? -0.279  1.762   -12.145 1.00 0.00 ? 52  TRP A HB3  21 
ATOM 11448 H HD1  . TRP A 1 52  ? 1.796   2.589   -10.974 1.00 0.00 ? 52  TRP A HD1  21 
ATOM 11449 H HE1  . TRP A 1 52  ? 4.246   3.045   -11.635 1.00 0.00 ? 52  TRP A HE1  21 
ATOM 11450 H HE3  . TRP A 1 52  ? 1.548   1.609   -15.980 1.00 0.00 ? 52  TRP A HE3  21 
ATOM 11451 H HZ2  . TRP A 1 52  ? 5.886   2.997   -13.982 1.00 0.00 ? 52  TRP A HZ2  21 
ATOM 11452 H HZ3  . TRP A 1 52  ? 3.567   1.822   -17.401 1.00 0.00 ? 52  TRP A HZ3  21 
ATOM 11453 H HH2  . TRP A 1 52  ? 5.732   2.514   -16.411 1.00 0.00 ? 52  TRP A HH2  21 
ATOM 11454 N N    . SER A 1 53  ? 0.422   -1.854  -13.112 1.00 0.00 ? 53  SER A N    21 
ATOM 11455 C CA   . SER A 1 53  ? 0.526   -2.968  -12.126 1.00 0.00 ? 53  SER A CA   21 
ATOM 11456 C C    . SER A 1 53  ? -0.644  -2.906  -11.142 1.00 0.00 ? 53  SER A C    21 
ATOM 11457 O O    . SER A 1 53  ? -0.578  -2.243  -10.126 1.00 0.00 ? 53  SER A O    21 
ATOM 11458 C CB   . SER A 1 53  ? 1.841   -2.843  -11.357 1.00 0.00 ? 53  SER A CB   21 
ATOM 11459 O OG   . SER A 1 53  ? 2.184   -4.107  -10.804 1.00 0.00 ? 53  SER A OG   21 
ATOM 11460 H H    . SER A 1 53  ? 0.644   -2.016  -14.052 1.00 0.00 ? 53  SER A H    21 
ATOM 11461 H HA   . SER A 1 53  ? 0.506   -3.912  -12.647 1.00 0.00 ? 53  SER A HA   21 
ATOM 11462 H HB2  . SER A 1 53  ? 2.623   -2.524  -12.026 1.00 0.00 ? 53  SER A HB2  21 
ATOM 11463 H HB3  . SER A 1 53  ? 1.728   -2.112  -10.567 1.00 0.00 ? 53  SER A HB3  21 
ATOM 11464 H HG   . SER A 1 53  ? 2.242   -4.008  -9.852  1.00 0.00 ? 53  SER A HG   21 
ATOM 11465 N N    . LEU A 1 54  ? -1.712  -3.598  -11.429 1.00 0.00 ? 54  LEU A N    21 
ATOM 11466 C CA   . LEU A 1 54  ? -2.878  -3.583  -10.503 1.00 0.00 ? 54  LEU A CA   21 
ATOM 11467 C C    . LEU A 1 54  ? -2.841  -4.840  -9.634  1.00 0.00 ? 54  LEU A C    21 
ATOM 11468 O O    . LEU A 1 54  ? -2.689  -5.942  -10.124 1.00 0.00 ? 54  LEU A O    21 
ATOM 11469 C CB   . LEU A 1 54  ? -4.175  -3.551  -11.311 1.00 0.00 ? 54  LEU A CB   21 
ATOM 11470 C CG   . LEU A 1 54  ? -4.339  -2.174  -11.956 1.00 0.00 ? 54  LEU A CG   21 
ATOM 11471 C CD1  . LEU A 1 54  ? -5.593  -2.160  -12.832 1.00 0.00 ? 54  LEU A CD1  21 
ATOM 11472 C CD2  . LEU A 1 54  ? -4.473  -1.114  -10.860 1.00 0.00 ? 54  LEU A CD2  21 
ATOM 11473 H H    . LEU A 1 54  ? -1.744  -4.131  -12.251 1.00 0.00 ? 54  LEU A H    21 
ATOM 11474 H HA   . LEU A 1 54  ? -2.824  -2.708  -9.872  1.00 0.00 ? 54  LEU A HA   21 
ATOM 11475 H HB2  . LEU A 1 54  ? -4.139  -4.309  -12.082 1.00 0.00 ? 54  LEU A HB2  21 
ATOM 11476 H HB3  . LEU A 1 54  ? -5.012  -3.743  -10.656 1.00 0.00 ? 54  LEU A HB3  21 
ATOM 11477 H HG   . LEU A 1 54  ? -3.473  -1.957  -12.564 1.00 0.00 ? 54  LEU A HG   21 
ATOM 11478 H HD11 . LEU A 1 54  ? -6.251  -2.960  -12.530 1.00 0.00 ? 54  LEU A HD11 21 
ATOM 11479 H HD12 . LEU A 1 54  ? -6.100  -1.214  -12.720 1.00 0.00 ? 54  LEU A HD12 21 
ATOM 11480 H HD13 . LEU A 1 54  ? -5.310  -2.298  -13.866 1.00 0.00 ? 54  LEU A HD13 21 
ATOM 11481 H HD21 . LEU A 1 54  ? -5.248  -1.408  -10.167 1.00 0.00 ? 54  LEU A HD21 21 
ATOM 11482 H HD22 . LEU A 1 54  ? -3.535  -1.019  -10.333 1.00 0.00 ? 54  LEU A HD22 21 
ATOM 11483 H HD23 . LEU A 1 54  ? -4.732  -0.165  -11.307 1.00 0.00 ? 54  LEU A HD23 21 
ATOM 11484 N N    . ASP A 1 55  ? -2.966  -4.685  -8.345  1.00 0.00 ? 55  ASP A N    21 
ATOM 11485 C CA   . ASP A 1 55  ? -2.924  -5.872  -7.445  1.00 0.00 ? 55  ASP A CA   21 
ATOM 11486 C C    . ASP A 1 55  ? -4.347  -6.365  -7.170  1.00 0.00 ? 55  ASP A C    21 
ATOM 11487 O O    . ASP A 1 55  ? -4.743  -7.425  -7.615  1.00 0.00 ? 55  ASP A O    21 
ATOM 11488 C CB   . ASP A 1 55  ? -2.256  -5.485  -6.124  1.00 0.00 ? 55  ASP A CB   21 
ATOM 11489 C CG   . ASP A 1 55  ? -1.654  -6.731  -5.473  1.00 0.00 ? 55  ASP A CG   21 
ATOM 11490 O OD1  . ASP A 1 55  ? -1.073  -7.529  -6.190  1.00 0.00 ? 55  ASP A OD1  21 
ATOM 11491 O OD2  . ASP A 1 55  ? -1.782  -6.866  -4.267  1.00 0.00 ? 55  ASP A OD2  21 
ATOM 11492 H H    . ASP A 1 55  ? -3.079  -3.788  -7.969  1.00 0.00 ? 55  ASP A H    21 
ATOM 11493 H HA   . ASP A 1 55  ? -2.356  -6.660  -7.917  1.00 0.00 ? 55  ASP A HA   21 
ATOM 11494 H HB2  . ASP A 1 55  ? -1.475  -4.763  -6.315  1.00 0.00 ? 55  ASP A HB2  21 
ATOM 11495 H HB3  . ASP A 1 55  ? -2.991  -5.054  -5.461  1.00 0.00 ? 55  ASP A HB3  21 
ATOM 11496 N N    . THR A 1 56  ? -5.114  -5.613  -6.432  1.00 0.00 ? 56  THR A N    21 
ATOM 11497 C CA   . THR A 1 56  ? -6.505  -6.048  -6.123  1.00 0.00 ? 56  THR A CA   21 
ATOM 11498 C C    . THR A 1 56  ? -7.481  -5.425  -7.123  1.00 0.00 ? 56  THR A C    21 
ATOM 11499 O O    . THR A 1 56  ? -7.166  -4.465  -7.798  1.00 0.00 ? 56  THR A O    21 
ATOM 11500 C CB   . THR A 1 56  ? -6.876  -5.602  -4.707  1.00 0.00 ? 56  THR A CB   21 
ATOM 11501 O OG1  . THR A 1 56  ? -7.411  -4.286  -4.750  1.00 0.00 ? 56  THR A OG1  21 
ATOM 11502 C CG2  . THR A 1 56  ? -5.630  -5.620  -3.819  1.00 0.00 ? 56  THR A CG2  21 
ATOM 11503 H H    . THR A 1 56  ? -4.776  -4.765  -6.077  1.00 0.00 ? 56  THR A H    21 
ATOM 11504 H HA   . THR A 1 56  ? -6.566  -7.124  -6.186  1.00 0.00 ? 56  THR A HA   21 
ATOM 11505 H HB   . THR A 1 56  ? -7.612  -6.277  -4.301  1.00 0.00 ? 56  THR A HB   21 
ATOM 11506 H HG1  . THR A 1 56  ? -6.916  -3.787  -5.404  1.00 0.00 ? 56  THR A HG1  21 
ATOM 11507 H HG21 . THR A 1 56  ? -5.136  -6.576  -3.911  1.00 0.00 ? 56  THR A HG21 21 
ATOM 11508 H HG22 . THR A 1 56  ? -4.956  -4.836  -4.128  1.00 0.00 ? 56  THR A HG22 21 
ATOM 11509 H HG23 . THR A 1 56  ? -5.918  -5.461  -2.790  1.00 0.00 ? 56  THR A HG23 21 
ATOM 11510 N N    . GLN A 1 57  ? -8.666  -5.966  -7.221  1.00 0.00 ? 57  GLN A N    21 
ATOM 11511 C CA   . GLN A 1 57  ? -9.666  -5.410  -8.175  1.00 0.00 ? 57  GLN A CA   21 
ATOM 11512 C C    . GLN A 1 57  ? -10.025 -3.981  -7.763  1.00 0.00 ? 57  GLN A C    21 
ATOM 11513 O O    . GLN A 1 57  ? -10.307 -3.138  -8.591  1.00 0.00 ? 57  GLN A O    21 
ATOM 11514 C CB   . GLN A 1 57  ? -10.926 -6.277  -8.155  1.00 0.00 ? 57  GLN A CB   21 
ATOM 11515 C CG   .