data_1KMF
# 
_entry.id   1KMF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KMF         
RCSB  RCSB015108   
WWPDB D_1000015108 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1K3M 
_pdbx_database_related.details        '1K3M CONTAINS THE SAME SEQUENCE EXCEPT SUBSTITUTION OF ILE-A2-ALA' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KMF 
_pdbx_database_status.recvd_initial_deposition_date   2001-12-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xu, B.'            1 
'Hua, Q.X.'         2 
'Nakagawa, S.H.'    3 
'Jia, W.'           4 
'Chu, Y.C.'         5 
'Katsoyannis, P.G.' 6 
'Weiss, M.A.'       7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Chiral mutagenesis of insulin's hidden receptor-binding surface: structure of an allo-isoleucine(A2) analogue.
;
J.Mol.Biol.    316 435  441  2002 JMOBAK UK 0022-2836 0070 ? 11866509 10.1006/jmbi.2001.5377 
1       
;Critical Role of the A2 Amino Acid Residue in the Biological Activity of Insulin:  
[2-Glycine-A]- and [2-Alanine-A]insulins
;
Biochemistry   23  1405 1413 1984 BICHAW US 0006-2960 0033 ? ?        ?                      
2       
'Importance of Aliphatic Side-Chain Structure at Positions 2 and 3 of the Insulin A Chain in Insulin-Receptor Interactions'    
Biochemistry   31  3204 3214 1992 BICHAW US 0006-2960 0033 ? ?        ?                      
3       
;Mapping the Functional Surface of Insulin by Design:  
Structure and Function of a Novel A-Chain Analogue
;
J.Mol.Biol.    264 390  403  1996 JMOBAK UK 0022-2836 0070 ? ?        10.1006/jmbi.1996.0648 
4       'A Cavity-Forming Mutation in Insulin Induces Segmental Unfolding of a Surrounding alpha-Helix' 'Protein Sci.' 11  104  
116  2002 PRCIEI US 0961-8368 0795 ? ?        10.1110/ps.ps.32102    
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xu, B.'            1  
primary 'Hua, Q.X.'         2  
primary 'Nakagawa, S.H.'    3  
primary 'Jia, W.'           4  
primary 'Chu, Y.C.'         5  
primary 'Katsoyannis, P.G.' 6  
primary 'Weiss, M.A.'       7  
1       'Kitagawa, K.'      8  
1       'Ogawa, H.'         9  
1       'Burke, G.T.'       10 
1       'Chanley, J.D.'     11 
1       'Katsoyannis, P.G.' 12 
2       'Nakagawa, S.H.'    13 
2       'Tager, H.S.'       14 
3       'Hua, Q.X.'         15 
3       'Hu, S.Q.'          16 
3       'Frank, B.H.'       17 
3       'Jia, W.'           18 
3       'Chu, Y.C.'         19 
3       'Wang, S.H.'        20 
3       'Burke, G.T.'       21 
3       'Katsoyannis, P.G.' 22 
3       'Weiss, M.A.'       23 
4       'Xu, B.'            24 
4       'Hua, Q.X.'         25 
4       'Nakagawa, S.H.'    26 
4       'Jia, W.'           27 
4       'Chu, Y.C.'         28 
4       'Katsoyannis, P.G.' 29 
4       'Weiss, M.A.'       30 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn Insulin 2383.698 1 ? 'I2(IIL)'          ? ? 
2 polymer syn Insulin 3410.894 1 ? 'H10D, P28K, K29P' ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 'G(IIL)VEQCCTSICSLYQLENYCN'    GIVEQCCTSICSLYQLENYCN          A ? 
2 'polypeptide(L)' no no  FVNQHLCGSDLVEALYLVCGERGFFYTKPT FVNQHLCGSDLVEALYLVCGERGFFYTKPT B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  IIL n 
1 3  VAL n 
1 4  GLU n 
1 5  GLN n 
1 6  CYS n 
1 7  CYS n 
1 8  THR n 
1 9  SER n 
1 10 ILE n 
1 11 CYS n 
1 12 SER n 
1 13 LEU n 
1 14 TYR n 
1 15 GLN n 
1 16 LEU n 
1 17 GLU n 
1 18 ASN n 
1 19 TYR n 
1 20 CYS n 
1 21 ASN n 
2 1  PHE n 
2 2  VAL n 
2 3  ASN n 
2 4  GLN n 
2 5  HIS n 
2 6  LEU n 
2 7  CYS n 
2 8  GLY n 
2 9  SER n 
2 10 ASP n 
2 11 LEU n 
2 12 VAL n 
2 13 GLU n 
2 14 ALA n 
2 15 LEU n 
2 16 TYR n 
2 17 LEU n 
2 18 VAL n 
2 19 CYS n 
2 20 GLY n 
2 21 GLU n 
2 22 ARG n 
2 23 GLY n 
2 24 PHE n 
2 25 PHE n 
2 26 TYR n 
2 27 THR n 
2 28 LYS n 
2 29 PRO n 
2 30 THR n 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 
'The peptide was chemically synthesized. The sequence of the peptide is naturally found in Homo sapiens (human).' 
2 1 sample ? ? ? ? ? 
'The peptide was chemically synthesized. The sequence of the peptide is naturally found in Homo sapiens (human).' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP INS_HUMAN 1 GIVEQCCTSICSLYQLENYCN          87 P01308 ? 
2 UNP INS_HUMAN 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKT 25 P01308 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KMF A 1 ? 21 ? P01308 87 ? 107 ? 1 21 
2 2 1KMF B 1 ? 30 ? P01308 25 ? 54  ? 1 30 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1KMF IIL A 2  ? UNP P01308 ILE 88 ENGINEERED 2  1 
2 1KMF ASP B 10 ? UNP P01308 HIS 34 ENGINEERED 10 2 
2 1KMF LYS B 28 ? UNP P01308 PRO 52 ENGINEERED 28 3 
2 1KMF PRO B 29 ? UNP P01308 LYS 53 ENGINEERED 29 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?               'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?               'C6 H10 N3 O2 1' 156.162 
IIL 'L-peptide linking' n ISO-ISOLEUCINE  ALLO-ISOLEUCINE 'C6 H13 N O2'    131.173 
ILE 'L-peptide linking' y ISOLEUCINE      ?               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?               'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ?               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?               'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ?               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?               'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D NOESY' 
2 1 1 DQF-COSY   
3 1 2 '2D NOESY' 
4 1 2 DQF-COSY   
5 2 2 '2D NOESY' 
6 2 2 DQF-COSY   
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 298 ambient 7.0 ? ? K 
2 305 ambient 7.6 ? ? K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1.2 mM Allo-Ile-A2-DKP-insulin; 90% H2O, 10% D2O' '90% H2O/10% D2O' 
2 '1.2 mM Allo-Ile-A2-DKP-insulin; 100% D2O'         '100% D2O'        
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.field_strength    600 
# 
_pdbx_nmr_refine.entry_id           1KMF 
_pdbx_nmr_refine.method             'Distance geometry and simulated annealing' 
_pdbx_nmr_refine.details            
;The structure is based on a total of 599 restraints, 542 are NOE-derived distance constraints, 38 dihedral angle restraints, 19 distance restraints from hydrogen bonds.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1KMF 
_pdbx_nmr_details.text       'This structure was determined using standard 2D homonuclear techniques.' 
# 
_pdbx_nmr_ensemble.entry_id                                      1KMF 
_pdbx_nmr_ensemble.conformers_calculated_total_number            50 
_pdbx_nmr_ensemble.conformers_submitted_total_number             15 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1KMF 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
DGII   'InsightII 2000' refinement 'Molecular Simulations Inc.' 1 
X-PLOR 3.85             refinement Brunger                      2 
# 
_exptl.entry_id          1KMF 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.crystal_id             1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1KMF 
_struct.title                     
'NMR STRUCTURE OF HUMAN INSULIN MUTANT ILE-A2-ALLO-ILE, HIS-B10-ASP, PRO-B28-LYS, LYS-B29-PRO, 15 STRUCTURES' 
_struct.pdbx_descriptor           INSULIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KMF 
_struct_keywords.pdbx_keywords   'HORMONE/GROWTH FACTOR' 
_struct_keywords.text            'Hormone, Human insulin, Mutant, HORMONE-GROWTH FACTOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 IIL A 2  ? CYS A 7  ? IIL A 2  CYS A 7  1 ? 6  
HELX_P HELX_P2 2 SER A 12 ? CYS A 20 ? SER A 12 CYS A 20 1 ? 9  
HELX_P HELX_P3 3 SER B 9  ? CYS B 19 ? SER B 9  CYS B 19 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 6  SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6  A CYS 11 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf2 disulf ? ? A CYS 7  SG ? ? ? 1_555 B CYS 7  SG ? ? A CYS 7  B CYS 7  1_555 ? ? ? ? ? ? ? 2.016 ? 
disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 2.019 ? 
covale1 covale ? ? A GLY 1  C  ? ? ? 1_555 A IIL 2  N  ? ? A GLY 1  A IIL 2  1_555 ? ? ? ? ? ? ? 1.304 ? 
covale2 covale ? ? A IIL 2  C  ? ? ? 1_555 A VAL 3  N  ? ? A IIL 2  A VAL 3  1_555 ? ? ? ? ? ? ? 1.304 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_database_PDB_matrix.entry_id          1KMF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KMF 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . GLY A 1 1  ? -6.293  4.365   -0.087  1.00 0.00 ? 1  GLY A N    1  
ATOM   2     C CA   . GLY A 1 1  ? -5.782  2.952   -0.372  1.00 0.00 ? 1  GLY A CA   1  
ATOM   3     C C    . GLY A 1 1  ? -4.453  2.772   -1.023  1.00 0.00 ? 1  GLY A C    1  
ATOM   4     O O    . GLY A 1 1  ? -3.423  3.042   -0.438  1.00 0.00 ? 1  GLY A O    1  
ATOM   5     H H1   . GLY A 1 1  ? -6.984  4.333   0.690   1.00 0.00 ? 1  GLY A H1   1  
ATOM   6     H H2   . GLY A 1 1  ? -6.748  4.747   -0.941  1.00 0.00 ? 1  GLY A H2   1  
ATOM   7     H H3   . GLY A 1 1  ? -5.496  4.974   0.184   1.00 0.00 ? 1  GLY A H3   1  
ATOM   8     H HA2  . GLY A 1 1  ? -5.334  2.574   0.407   1.00 0.00 ? 1  GLY A HA2  1  
ATOM   9     H HA3  . GLY A 1 1  ? -6.701  2.322   -0.721  1.00 0.00 ? 1  GLY A HA3  1  
HETATM 10    N N    . IIL A 1 2  ? -4.439  2.313   -2.243  1.00 0.00 ? 2  IIL A N    1  
HETATM 11    C CA   . IIL A 1 2  ? -3.144  2.109   -2.950  1.00 0.00 ? 2  IIL A CA   1  
HETATM 12    C C    . IIL A 1 2  ? -3.121  2.956   -4.221  1.00 0.00 ? 2  IIL A C    1  
HETATM 13    O O    . IIL A 1 2  ? -2.096  3.467   -4.623  1.00 0.00 ? 2  IIL A O    1  
HETATM 14    C CB   . IIL A 1 2  ? -2.998  0.633   -3.322  1.00 0.00 ? 2  IIL A CB   1  
HETATM 15    C CG2  . IIL A 1 2  ? -1.713  0.434   -4.128  1.00 0.00 ? 2  IIL A CG2  1  
HETATM 16    C CG1  . IIL A 1 2  ? -4.201  0.204   -4.166  1.00 0.00 ? 2  IIL A CG1  1  
HETATM 17    C CD1  . IIL A 1 2  ? -4.050  -1.266  -4.560  1.00 0.00 ? 2  IIL A CD1  1  
HETATM 18    H H    . IIL A 1 2  ? -5.281  2.102   -2.696  1.00 0.00 ? 2  IIL A H    1  
HETATM 19    H HA   . IIL A 1 2  ? -2.329  2.402   -2.305  1.00 0.00 ? 2  IIL A HA   1  
HETATM 20    H HB   . IIL A 1 2  ? -2.957  0.034   -2.424  1.00 0.00 ? 2  IIL A HB   1  
HETATM 21    H HG21 . IIL A 1 2  ? -0.871  0.791   -3.554  1.00 0.00 ? 2  IIL A HG21 1  
HETATM 22    H HG22 . IIL A 1 2  ? -1.779  0.989   -5.053  1.00 0.00 ? 2  IIL A HG22 1  
HETATM 23    H HG23 . IIL A 1 2  ? -1.584  -0.615  -4.346  1.00 0.00 ? 2  IIL A HG23 1  
HETATM 24    H HG12 . IIL A 1 2  ? -4.251  0.809   -5.058  1.00 0.00 ? 2  IIL A HG12 1  
HETATM 25    H HG13 . IIL A 1 2  ? -5.107  0.331   -3.592  1.00 0.00 ? 2  IIL A HG13 1  
HETATM 26    H HD11 . IIL A 1 2  ? -4.866  -1.551  -5.207  1.00 0.00 ? 2  IIL A HD11 1  
HETATM 27    H HD12 . IIL A 1 2  ? -4.064  -1.881  -3.672  1.00 0.00 ? 2  IIL A HD12 1  
HETATM 28    H HD13 . IIL A 1 2  ? -3.114  -1.405  -5.079  1.00 0.00 ? 2  IIL A HD13 1  
ATOM   29    N N    . VAL A 1 3  ? -4.248  3.101   -4.860  1.00 0.00 ? 3  VAL A N    1  
ATOM   30    C CA   . VAL A 1 3  ? -4.299  3.906   -6.109  1.00 0.00 ? 3  VAL A CA   1  
ATOM   31    C C    . VAL A 1 3  ? -4.275  5.399   -5.768  1.00 0.00 ? 3  VAL A C    1  
ATOM   32    O O    . VAL A 1 3  ? -3.550  6.166   -6.364  1.00 0.00 ? 3  VAL A O    1  
ATOM   33    C CB   . VAL A 1 3  ? -5.587  3.578   -6.867  1.00 0.00 ? 3  VAL A CB   1  
ATOM   34    C CG1  . VAL A 1 3  ? -5.501  4.137   -8.287  1.00 0.00 ? 3  VAL A CG1  1  
ATOM   35    C CG2  . VAL A 1 3  ? -5.769  2.059   -6.929  1.00 0.00 ? 3  VAL A CG2  1  
ATOM   36    H H    . VAL A 1 3  ? -5.062  2.675   -4.520  1.00 0.00 ? 3  VAL A H    1  
ATOM   37    H HA   . VAL A 1 3  ? -3.447  3.665   -6.728  1.00 0.00 ? 3  VAL A HA   1  
ATOM   38    H HB   . VAL A 1 3  ? -6.429  4.023   -6.355  1.00 0.00 ? 3  VAL A HB   1  
ATOM   39    H HG11 . VAL A 1 3  ? -6.069  3.507   -8.957  1.00 0.00 ? 3  VAL A HG11 1  
ATOM   40    H HG12 . VAL A 1 3  ? -4.469  4.162   -8.603  1.00 0.00 ? 3  VAL A HG12 1  
ATOM   41    H HG13 . VAL A 1 3  ? -5.907  5.139   -8.304  1.00 0.00 ? 3  VAL A HG13 1  
ATOM   42    H HG21 . VAL A 1 3  ? -6.234  1.716   -6.017  1.00 0.00 ? 3  VAL A HG21 1  
ATOM   43    H HG22 . VAL A 1 3  ? -4.806  1.587   -7.042  1.00 0.00 ? 3  VAL A HG22 1  
ATOM   44    H HG23 . VAL A 1 3  ? -6.396  1.806   -7.771  1.00 0.00 ? 3  VAL A HG23 1  
ATOM   45    N N    . GLU A 1 4  ? -5.069  5.819   -4.821  1.00 0.00 ? 4  GLU A N    1  
ATOM   46    C CA   . GLU A 1 4  ? -5.096  7.267   -4.460  1.00 0.00 ? 4  GLU A CA   1  
ATOM   47    C C    . GLU A 1 4  ? -3.784  7.673   -3.783  1.00 0.00 ? 4  GLU A C    1  
ATOM   48    O O    . GLU A 1 4  ? -3.530  8.841   -3.568  1.00 0.00 ? 4  GLU A O    1  
ATOM   49    C CB   . GLU A 1 4  ? -6.258  7.533   -3.501  1.00 0.00 ? 4  GLU A CB   1  
ATOM   50    C CG   . GLU A 1 4  ? -7.569  7.086   -4.150  1.00 0.00 ? 4  GLU A CG   1  
ATOM   51    C CD   . GLU A 1 4  ? -8.717  7.267   -3.155  1.00 0.00 ? 4  GLU A CD   1  
ATOM   52    O OE1  . GLU A 1 4  ? -8.611  8.142   -2.312  1.00 0.00 ? 4  GLU A OE1  1  
ATOM   53    O OE2  . GLU A 1 4  ? -9.681  6.526   -3.252  1.00 0.00 ? 4  GLU A OE2  1  
ATOM   54    H H    . GLU A 1 4  ? -5.655  5.187   -4.355  1.00 0.00 ? 4  GLU A H    1  
ATOM   55    H HA   . GLU A 1 4  ? -5.233  7.856   -5.354  1.00 0.00 ? 4  GLU A HA   1  
ATOM   56    H HB2  . GLU A 1 4  ? -6.103  6.981   -2.584  1.00 0.00 ? 4  GLU A HB2  1  
ATOM   57    H HB3  . GLU A 1 4  ? -6.311  8.589   -3.281  1.00 0.00 ? 4  GLU A HB3  1  
ATOM   58    H HG2  . GLU A 1 4  ? -7.756  7.684   -5.031  1.00 0.00 ? 4  GLU A HG2  1  
ATOM   59    H HG3  . GLU A 1 4  ? -7.497  6.046   -4.429  1.00 0.00 ? 4  GLU A HG3  1  
ATOM   60    N N    . GLN A 1 5  ? -2.949  6.731   -3.435  1.00 0.00 ? 5  GLN A N    1  
ATOM   61    C CA   . GLN A 1 5  ? -1.671  7.097   -2.767  1.00 0.00 ? 5  GLN A CA   1  
ATOM   62    C C    . GLN A 1 5  ? -0.526  7.116   -3.786  1.00 0.00 ? 5  GLN A C    1  
ATOM   63    O O    . GLN A 1 5  ? 0.231   8.063   -3.854  1.00 0.00 ? 5  GLN A O    1  
ATOM   64    C CB   . GLN A 1 5  ? -1.365  6.089   -1.659  1.00 0.00 ? 5  GLN A CB   1  
ATOM   65    C CG   . GLN A 1 5  ? -0.438  6.737   -0.632  1.00 0.00 ? 5  GLN A CG   1  
ATOM   66    C CD   . GLN A 1 5  ? -0.748  6.183   0.760   1.00 0.00 ? 5  GLN A CD   1  
ATOM   67    O OE1  . GLN A 1 5  ? -0.274  5.126   1.125   1.00 0.00 ? 5  GLN A OE1  1  
ATOM   68    N NE2  . GLN A 1 5  ? -1.530  6.858   1.556   1.00 0.00 ? 5  GLN A NE2  1  
ATOM   69    H H    . GLN A 1 5  ? -3.164  5.793   -3.604  1.00 0.00 ? 5  GLN A H    1  
ATOM   70    H HA   . GLN A 1 5  ? -1.772  8.082   -2.333  1.00 0.00 ? 5  GLN A HA   1  
ATOM   71    H HB2  . GLN A 1 5  ? -2.285  5.790   -1.177  1.00 0.00 ? 5  GLN A HB2  1  
ATOM   72    H HB3  . GLN A 1 5  ? -0.881  5.221   -2.082  1.00 0.00 ? 5  GLN A HB3  1  
ATOM   73    H HG2  . GLN A 1 5  ? 0.588   6.520   -0.889  1.00 0.00 ? 5  GLN A HG2  1  
ATOM   74    H HG3  . GLN A 1 5  ? -0.594  7.805   -0.636  1.00 0.00 ? 5  GLN A HG3  1  
ATOM   75    H HE21 . GLN A 1 5  ? -1.913  7.710   1.263   1.00 0.00 ? 5  GLN A HE21 1  
ATOM   76    H HE22 . GLN A 1 5  ? -1.734  6.511   2.451   1.00 0.00 ? 5  GLN A HE22 1  
ATOM   77    N N    . CYS A 1 6  ? -0.385  6.089   -4.580  1.00 0.00 ? 6  CYS A N    1  
ATOM   78    C CA   . CYS A 1 6  ? 0.720   6.086   -5.580  1.00 0.00 ? 6  CYS A CA   1  
ATOM   79    C C    . CYS A 1 6  ? 0.283   6.877   -6.812  1.00 0.00 ? 6  CYS A C    1  
ATOM   80    O O    . CYS A 1 6  ? 1.091   7.256   -7.637  1.00 0.00 ? 6  CYS A O    1  
ATOM   81    C CB   . CYS A 1 6  ? 1.065   4.651   -5.980  1.00 0.00 ? 6  CYS A CB   1  
ATOM   82    S SG   . CYS A 1 6  ? 1.559   3.717   -4.510  1.00 0.00 ? 6  CYS A SG   1  
ATOM   83    H H    . CYS A 1 6  ? -1.001  5.328   -4.523  1.00 0.00 ? 6  CYS A H    1  
ATOM   84    H HA   . CYS A 1 6  ? 1.592   6.557   -5.147  1.00 0.00 ? 6  CYS A HA   1  
ATOM   85    H HB2  . CYS A 1 6  ? 0.206   4.185   -6.434  1.00 0.00 ? 6  CYS A HB2  1  
ATOM   86    H HB3  . CYS A 1 6  ? 1.882   4.663   -6.687  1.00 0.00 ? 6  CYS A HB3  1  
ATOM   87    N N    . CYS A 1 7  ? -0.989  7.144   -6.940  1.00 0.00 ? 7  CYS A N    1  
ATOM   88    C CA   . CYS A 1 7  ? -1.466  7.927   -8.114  1.00 0.00 ? 7  CYS A CA   1  
ATOM   89    C C    . CYS A 1 7  ? -1.536  9.403   -7.724  1.00 0.00 ? 7  CYS A C    1  
ATOM   90    O O    . CYS A 1 7  ? -1.643  10.274  -8.563  1.00 0.00 ? 7  CYS A O    1  
ATOM   91    C CB   . CYS A 1 7  ? -2.845  7.427   -8.555  1.00 0.00 ? 7  CYS A CB   1  
ATOM   92    S SG   . CYS A 1 7  ? -3.318  8.224   -10.109 1.00 0.00 ? 7  CYS A SG   1  
ATOM   93    H H    . CYS A 1 7  ? -1.626  6.840   -6.260  1.00 0.00 ? 7  CYS A H    1  
ATOM   94    H HA   . CYS A 1 7  ? -0.762  7.810   -8.920  1.00 0.00 ? 7  CYS A HA   1  
ATOM   95    H HB2  . CYS A 1 7  ? -2.813  6.358   -8.695  1.00 0.00 ? 7  CYS A HB2  1  
ATOM   96    H HB3  . CYS A 1 7  ? -3.570  7.667   -7.800  1.00 0.00 ? 7  CYS A HB3  1  
ATOM   97    N N    . THR A 1 8  ? -1.450  9.690   -6.453  1.00 0.00 ? 8  THR A N    1  
ATOM   98    C CA   . THR A 1 8  ? -1.478  11.109  -6.005  1.00 0.00 ? 8  THR A CA   1  
ATOM   99    C C    . THR A 1 8  ? -0.035  11.606  -5.935  1.00 0.00 ? 8  THR A C    1  
ATOM   100   O O    . THR A 1 8  ? 0.245   12.782  -6.059  1.00 0.00 ? 8  THR A O    1  
ATOM   101   C CB   . THR A 1 8  ? -2.126  11.204  -4.621  1.00 0.00 ? 8  THR A CB   1  
ATOM   102   O OG1  . THR A 1 8  ? -2.303  12.570  -4.277  1.00 0.00 ? 8  THR A OG1  1  
ATOM   103   C CG2  . THR A 1 8  ? -1.228  10.529  -3.583  1.00 0.00 ? 8  THR A CG2  1  
ATOM   104   H H    . THR A 1 8  ? -1.345  8.973   -5.794  1.00 0.00 ? 8  THR A H    1  
ATOM   105   H HA   . THR A 1 8  ? -2.036  11.704  -6.714  1.00 0.00 ? 8  THR A HA   1  
ATOM   106   H HB   . THR A 1 8  ? -3.083  10.707  -4.636  1.00 0.00 ? 8  THR A HB   1  
ATOM   107   H HG1  . THR A 1 8  ? -3.180  12.836  -4.563  1.00 0.00 ? 8  THR A HG1  1  
ATOM   108   H HG21 . THR A 1 8  ? -1.535  10.831  -2.592  1.00 0.00 ? 8  THR A HG21 1  
ATOM   109   H HG22 . THR A 1 8  ? -0.202  10.823  -3.746  1.00 0.00 ? 8  THR A HG22 1  
ATOM   110   H HG23 . THR A 1 8  ? -1.315  9.458   -3.675  1.00 0.00 ? 8  THR A HG23 1  
ATOM   111   N N    . SER A 1 9  ? 0.883   10.697  -5.749  1.00 0.00 ? 9  SER A N    1  
ATOM   112   C CA   . SER A 1 9  ? 2.322   11.066  -5.679  1.00 0.00 ? 9  SER A CA   1  
ATOM   113   C C    . SER A 1 9  ? 3.149   9.822   -6.006  1.00 0.00 ? 9  SER A C    1  
ATOM   114   O O    . SER A 1 9  ? 2.628   8.837   -6.490  1.00 0.00 ? 9  SER A O    1  
ATOM   115   C CB   . SER A 1 9  ? 2.662   11.556  -4.271  1.00 0.00 ? 9  SER A CB   1  
ATOM   116   O OG   . SER A 1 9  ? 1.802   12.635  -3.929  1.00 0.00 ? 9  SER A OG   1  
ATOM   117   H H    . SER A 1 9  ? 0.621   9.757   -5.663  1.00 0.00 ? 9  SER A H    1  
ATOM   118   H HA   . SER A 1 9  ? 2.535   11.844  -6.399  1.00 0.00 ? 9  SER A HA   1  
ATOM   119   H HB2  . SER A 1 9  ? 2.523   10.755  -3.564  1.00 0.00 ? 9  SER A HB2  1  
ATOM   120   H HB3  . SER A 1 9  ? 3.694   11.882  -4.244  1.00 0.00 ? 9  SER A HB3  1  
ATOM   121   H HG   . SER A 1 9  ? 1.070   12.282  -3.417  1.00 0.00 ? 9  SER A HG   1  
ATOM   122   N N    . ILE A 1 10 ? 4.425   9.845   -5.747  1.00 0.00 ? 10 ILE A N    1  
ATOM   123   C CA   . ILE A 1 10 ? 5.255   8.646   -6.052  1.00 0.00 ? 10 ILE A CA   1  
ATOM   124   C C    . ILE A 1 10 ? 5.495   7.849   -4.769  1.00 0.00 ? 10 ILE A C    1  
ATOM   125   O O    . ILE A 1 10 ? 6.122   8.321   -3.841  1.00 0.00 ? 10 ILE A O    1  
ATOM   126   C CB   . ILE A 1 10 ? 6.596   9.077   -6.647  1.00 0.00 ? 10 ILE A CB   1  
ATOM   127   C CG1  . ILE A 1 10 ? 6.348   9.802   -7.981  1.00 0.00 ? 10 ILE A CG1  1  
ATOM   128   C CG2  . ILE A 1 10 ? 7.463   7.834   -6.872  1.00 0.00 ? 10 ILE A CG2  1  
ATOM   129   C CD1  . ILE A 1 10 ? 7.581   9.689   -8.888  1.00 0.00 ? 10 ILE A CD1  1  
ATOM   130   H H    . ILE A 1 10 ? 4.836   10.643  -5.354  1.00 0.00 ? 10 ILE A H    1  
ATOM   131   H HA   . ILE A 1 10 ? 4.731   8.024   -6.765  1.00 0.00 ? 10 ILE A HA   1  
ATOM   132   H HB   . ILE A 1 10 ? 7.096   9.743   -5.959  1.00 0.00 ? 10 ILE A HB   1  
ATOM   133   H HG12 . ILE A 1 10 ? 5.498   9.358   -8.477  1.00 0.00 ? 10 ILE A HG12 1  
ATOM   134   H HG13 . ILE A 1 10 ? 6.144   10.845  -7.788  1.00 0.00 ? 10 ILE A HG13 1  
ATOM   135   H HG21 . ILE A 1 10 ? 8.473   8.136   -7.100  1.00 0.00 ? 10 ILE A HG21 1  
ATOM   136   H HG22 . ILE A 1 10 ? 7.064   7.261   -7.696  1.00 0.00 ? 10 ILE A HG22 1  
ATOM   137   H HG23 . ILE A 1 10 ? 7.461   7.227   -5.979  1.00 0.00 ? 10 ILE A HG23 1  
ATOM   138   H HD11 . ILE A 1 10 ? 7.468   10.347  -9.736  1.00 0.00 ? 10 ILE A HD11 1  
ATOM   139   H HD12 . ILE A 1 10 ? 7.678   8.670   -9.235  1.00 0.00 ? 10 ILE A HD12 1  
ATOM   140   H HD13 . ILE A 1 10 ? 8.466   9.965   -8.332  1.00 0.00 ? 10 ILE A HD13 1  
ATOM   141   N N    . CYS A 1 11 ? 5.003   6.641   -4.709  1.00 0.00 ? 11 CYS A N    1  
ATOM   142   C CA   . CYS A 1 11 ? 5.207   5.814   -3.487  1.00 0.00 ? 11 CYS A CA   1  
ATOM   143   C C    . CYS A 1 11 ? 6.353   4.829   -3.731  1.00 0.00 ? 11 CYS A C    1  
ATOM   144   O O    . CYS A 1 11 ? 7.278   5.111   -4.468  1.00 0.00 ? 11 CYS A O    1  
ATOM   145   C CB   . CYS A 1 11 ? 3.922   5.044   -3.166  1.00 0.00 ? 11 CYS A CB   1  
ATOM   146   S SG   . CYS A 1 11 ? 3.575   3.858   -4.490  1.00 0.00 ? 11 CYS A SG   1  
ATOM   147   H H    . CYS A 1 11 ? 4.502   6.278   -5.468  1.00 0.00 ? 11 CYS A H    1  
ATOM   148   H HA   . CYS A 1 11 ? 5.458   6.457   -2.657  1.00 0.00 ? 11 CYS A HA   1  
ATOM   149   H HB2  . CYS A 1 11 ? 4.043   4.516   -2.233  1.00 0.00 ? 11 CYS A HB2  1  
ATOM   150   H HB3  . CYS A 1 11 ? 3.100   5.739   -3.082  1.00 0.00 ? 11 CYS A HB3  1  
ATOM   151   N N    . SER A 1 12 ? 6.308   3.678   -3.117  1.00 0.00 ? 12 SER A N    1  
ATOM   152   C CA   . SER A 1 12 ? 7.404   2.687   -3.317  1.00 0.00 ? 12 SER A CA   1  
ATOM   153   C C    . SER A 1 12 ? 6.808   1.307   -3.602  1.00 0.00 ? 12 SER A C    1  
ATOM   154   O O    . SER A 1 12 ? 5.802   0.922   -3.037  1.00 0.00 ? 12 SER A O    1  
ATOM   155   C CB   . SER A 1 12 ? 8.266   2.619   -2.057  1.00 0.00 ? 12 SER A CB   1  
ATOM   156   O OG   . SER A 1 12 ? 7.510   3.082   -0.945  1.00 0.00 ? 12 SER A OG   1  
ATOM   157   H H    . SER A 1 12 ? 5.558   3.467   -2.523  1.00 0.00 ? 12 SER A H    1  
ATOM   158   H HA   . SER A 1 12 ? 8.014   2.993   -4.154  1.00 0.00 ? 12 SER A HA   1  
ATOM   159   H HB2  . SER A 1 12 ? 8.570   1.601   -1.880  1.00 0.00 ? 12 SER A HB2  1  
ATOM   160   H HB3  . SER A 1 12 ? 9.144   3.237   -2.191  1.00 0.00 ? 12 SER A HB3  1  
ATOM   161   H HG   . SER A 1 12 ? 8.004   2.882   -0.147  1.00 0.00 ? 12 SER A HG   1  
ATOM   162   N N    . LEU A 1 13 ? 7.426   0.555   -4.470  1.00 0.00 ? 13 LEU A N    1  
ATOM   163   C CA   . LEU A 1 13 ? 6.899   -0.801  -4.788  1.00 0.00 ? 13 LEU A CA   1  
ATOM   164   C C    . LEU A 1 13 ? 6.905   -1.654  -3.517  1.00 0.00 ? 13 LEU A C    1  
ATOM   165   O O    . LEU A 1 13 ? 6.286   -2.697  -3.457  1.00 0.00 ? 13 LEU A O    1  
ATOM   166   C CB   . LEU A 1 13 ? 7.776   -1.457  -5.854  1.00 0.00 ? 13 LEU A CB   1  
ATOM   167   C CG   . LEU A 1 13 ? 9.242   -1.142  -5.571  1.00 0.00 ? 13 LEU A CG   1  
ATOM   168   C CD1  . LEU A 1 13 ? 10.029  -2.447  -5.490  1.00 0.00 ? 13 LEU A CD1  1  
ATOM   169   C CD2  . LEU A 1 13 ? 9.805   -0.276  -6.700  1.00 0.00 ? 13 LEU A CD2  1  
ATOM   170   H H    . LEU A 1 13 ? 8.239   0.880   -4.911  1.00 0.00 ? 13 LEU A H    1  
ATOM   171   H HA   . LEU A 1 13 ? 5.890   -0.716  -5.159  1.00 0.00 ? 13 LEU A HA   1  
ATOM   172   H HB2  . LEU A 1 13 ? 7.626   -2.526  -5.834  1.00 0.00 ? 13 LEU A HB2  1  
ATOM   173   H HB3  . LEU A 1 13 ? 7.508   -1.073  -6.826  1.00 0.00 ? 13 LEU A HB3  1  
ATOM   174   H HG   . LEU A 1 13 ? 9.325   -0.613  -4.632  1.00 0.00 ? 13 LEU A HG   1  
ATOM   175   H HD11 . LEU A 1 13 ? 9.353   -3.280  -5.619  1.00 0.00 ? 13 LEU A HD11 1  
ATOM   176   H HD12 . LEU A 1 13 ? 10.508  -2.518  -4.526  1.00 0.00 ? 13 LEU A HD12 1  
ATOM   177   H HD13 . LEU A 1 13 ? 10.776  -2.466  -6.267  1.00 0.00 ? 13 LEU A HD13 1  
ATOM   178   H HD21 . LEU A 1 13 ? 9.499   0.750   -6.554  1.00 0.00 ? 13 LEU A HD21 1  
ATOM   179   H HD22 . LEU A 1 13 ? 9.430   -0.632  -7.648  1.00 0.00 ? 13 LEU A HD22 1  
ATOM   180   H HD23 . LEU A 1 13 ? 10.883  -0.334  -6.696  1.00 0.00 ? 13 LEU A HD23 1  
ATOM   181   N N    . TYR A 1 14 ? 7.589   -1.211  -2.493  1.00 0.00 ? 14 TYR A N    1  
ATOM   182   C CA   . TYR A 1 14 ? 7.615   -1.991  -1.227  1.00 0.00 ? 14 TYR A CA   1  
ATOM   183   C C    . TYR A 1 14 ? 6.210   -2.001  -0.650  1.00 0.00 ? 14 TYR A C    1  
ATOM   184   O O    . TYR A 1 14 ? 5.702   -3.017  -0.220  1.00 0.00 ? 14 TYR A O    1  
ATOM   185   C CB   . TYR A 1 14 ? 8.577   -1.333  -0.234  1.00 0.00 ? 14 TYR A CB   1  
ATOM   186   C CG   . TYR A 1 14 ? 9.934   -1.998  -0.325  1.00 0.00 ? 14 TYR A CG   1  
ATOM   187   C CD1  . TYR A 1 14 ? 10.140  -3.262  0.246   1.00 0.00 ? 14 TYR A CD1  1  
ATOM   188   C CD2  . TYR A 1 14 ? 10.992  -1.349  -0.981  1.00 0.00 ? 14 TYR A CD2  1  
ATOM   189   C CE1  . TYR A 1 14 ? 11.397  -3.874  0.164   1.00 0.00 ? 14 TYR A CE1  1  
ATOM   190   C CE2  . TYR A 1 14 ? 12.249  -1.962  -1.063  1.00 0.00 ? 14 TYR A CE2  1  
ATOM   191   C CZ   . TYR A 1 14 ? 12.452  -3.224  -0.492  1.00 0.00 ? 14 TYR A CZ   1  
ATOM   192   O OH   . TYR A 1 14 ? 13.691  -3.826  -0.572  1.00 0.00 ? 14 TYR A OH   1  
ATOM   193   H H    . TYR A 1 14 ? 8.069   -0.362  -2.555  1.00 0.00 ? 14 TYR A H    1  
ATOM   194   H HA   . TYR A 1 14 ? 7.928   -3.000  -1.429  1.00 0.00 ? 14 TYR A HA   1  
ATOM   195   H HB2  . TYR A 1 14 ? 8.670   -0.282  -0.467  1.00 0.00 ? 14 TYR A HB2  1  
ATOM   196   H HB3  . TYR A 1 14 ? 8.189   -1.444  0.769   1.00 0.00 ? 14 TYR A HB3  1  
ATOM   197   H HD1  . TYR A 1 14 ? 9.330   -3.766  0.750   1.00 0.00 ? 14 TYR A HD1  1  
ATOM   198   H HD2  . TYR A 1 14 ? 10.839  -0.377  -1.424  1.00 0.00 ? 14 TYR A HD2  1  
ATOM   199   H HE1  . TYR A 1 14 ? 11.554  -4.847  0.604   1.00 0.00 ? 14 TYR A HE1  1  
ATOM   200   H HE2  . TYR A 1 14 ? 13.062  -1.462  -1.568  1.00 0.00 ? 14 TYR A HE2  1  
ATOM   201   H HH   . TYR A 1 14 ? 14.036  -3.677  -1.455  1.00 0.00 ? 14 TYR A HH   1  
ATOM   202   N N    . GLN A 1 15 ? 5.570   -0.871  -0.668  1.00 0.00 ? 15 GLN A N    1  
ATOM   203   C CA   . GLN A 1 15 ? 4.180   -0.799  -0.155  1.00 0.00 ? 15 GLN A CA   1  
ATOM   204   C C    . GLN A 1 15 ? 3.265   -1.469  -1.178  1.00 0.00 ? 15 GLN A C    1  
ATOM   205   O O    . GLN A 1 15 ? 2.153   -1.859  -0.881  1.00 0.00 ? 15 GLN A O    1  
ATOM   206   C CB   . GLN A 1 15 ? 3.771   0.666   0.030   1.00 0.00 ? 15 GLN A CB   1  
ATOM   207   C CG   . GLN A 1 15 ? 4.662   1.316   1.090   1.00 0.00 ? 15 GLN A CG   1  
ATOM   208   C CD   . GLN A 1 15 ? 4.060   2.660   1.507   1.00 0.00 ? 15 GLN A CD   1  
ATOM   209   O OE1  . GLN A 1 15 ? 3.201   2.713   2.364   1.00 0.00 ? 15 GLN A OE1  1  
ATOM   210   N NE2  . GLN A 1 15 ? 4.479   3.754   0.933   1.00 0.00 ? 15 GLN A NE2  1  
ATOM   211   H H    . GLN A 1 15 ? 6.000   -0.076  -1.042  1.00 0.00 ? 15 GLN A H    1  
ATOM   212   H HA   . GLN A 1 15 ? 4.117   -1.319  0.788   1.00 0.00 ? 15 GLN A HA   1  
ATOM   213   H HB2  . GLN A 1 15 ? 3.881   1.192   -0.907  1.00 0.00 ? 15 GLN A HB2  1  
ATOM   214   H HB3  . GLN A 1 15 ? 2.740   0.713   0.351   1.00 0.00 ? 15 GLN A HB3  1  
ATOM   215   H HG2  . GLN A 1 15 ? 4.729   0.668   1.951   1.00 0.00 ? 15 GLN A HG2  1  
ATOM   216   H HG3  . GLN A 1 15 ? 5.648   1.477   0.682   1.00 0.00 ? 15 GLN A HG3  1  
ATOM   217   H HE21 . GLN A 1 15 ? 5.172   3.710   0.242   1.00 0.00 ? 15 GLN A HE21 1  
ATOM   218   H HE22 . GLN A 1 15 ? 4.101   4.620   1.194   1.00 0.00 ? 15 GLN A HE22 1  
ATOM   219   N N    . LEU A 1 16 ? 3.743   -1.614  -2.387  1.00 0.00 ? 16 LEU A N    1  
ATOM   220   C CA   . LEU A 1 16 ? 2.937   -2.267  -3.450  1.00 0.00 ? 16 LEU A CA   1  
ATOM   221   C C    . LEU A 1 16 ? 2.844   -3.764  -3.153  1.00 0.00 ? 16 LEU A C    1  
ATOM   222   O O    . LEU A 1 16 ? 1.982   -4.458  -3.653  1.00 0.00 ? 16 LEU A O    1  
ATOM   223   C CB   . LEU A 1 16 ? 3.641   -2.063  -4.791  1.00 0.00 ? 16 LEU A CB   1  
ATOM   224   C CG   . LEU A 1 16 ? 3.091   -0.818  -5.488  1.00 0.00 ? 16 LEU A CG   1  
ATOM   225   C CD1  . LEU A 1 16 ? 3.799   -0.633  -6.832  1.00 0.00 ? 16 LEU A CD1  1  
ATOM   226   C CD2  . LEU A 1 16 ? 1.589   -0.986  -5.721  1.00 0.00 ? 16 LEU A CD2  1  
ATOM   227   H H    . LEU A 1 16 ? 4.645   -1.298  -2.595  1.00 0.00 ? 16 LEU A H    1  
ATOM   228   H HA   . LEU A 1 16 ? 1.949   -1.835  -3.482  1.00 0.00 ? 16 LEU A HA   1  
ATOM   229   H HB2  . LEU A 1 16 ? 4.698   -1.943  -4.618  1.00 0.00 ? 16 LEU A HB2  1  
ATOM   230   H HB3  . LEU A 1 16 ? 3.480   -2.922  -5.416  1.00 0.00 ? 16 LEU A HB3  1  
ATOM   231   H HG   . LEU A 1 16 ? 3.269   0.050   -4.867  1.00 0.00 ? 16 LEU A HG   1  
ATOM   232   H HD11 . LEU A 1 16 ? 4.221   -1.577  -7.147  1.00 0.00 ? 16 LEU A HD11 1  
ATOM   233   H HD12 . LEU A 1 16 ? 4.587   0.097   -6.728  1.00 0.00 ? 16 LEU A HD12 1  
ATOM   234   H HD13 . LEU A 1 16 ? 3.087   -0.292  -7.570  1.00 0.00 ? 16 LEU A HD13 1  
ATOM   235   H HD21 . LEU A 1 16 ? 1.373   -0.873  -6.773  1.00 0.00 ? 16 LEU A HD21 1  
ATOM   236   H HD22 . LEU A 1 16 ? 1.051   -0.235  -5.160  1.00 0.00 ? 16 LEU A HD22 1  
ATOM   237   H HD23 . LEU A 1 16 ? 1.282   -1.967  -5.395  1.00 0.00 ? 16 LEU A HD23 1  
ATOM   238   N N    . GLU A 1 17 ? 3.737   -4.260  -2.344  1.00 0.00 ? 17 GLU A N    1  
ATOM   239   C CA   . GLU A 1 17 ? 3.725   -5.711  -2.006  1.00 0.00 ? 17 GLU A CA   1  
ATOM   240   C C    . GLU A 1 17 ? 2.596   -5.998  -1.018  1.00 0.00 ? 17 GLU A C    1  
ATOM   241   O O    . GLU A 1 17 ? 2.113   -7.109  -0.912  1.00 0.00 ? 17 GLU A O    1  
ATOM   242   C CB   . GLU A 1 17 ? 5.068   -6.088  -1.375  1.00 0.00 ? 17 GLU A CB   1  
ATOM   243   C CG   . GLU A 1 17 ? 6.207   -5.539  -2.234  1.00 0.00 ? 17 GLU A CG   1  
ATOM   244   C CD   . GLU A 1 17 ? 7.117   -6.687  -2.673  1.00 0.00 ? 17 GLU A CD   1  
ATOM   245   O OE1  . GLU A 1 17 ? 7.879   -7.162  -1.847  1.00 0.00 ? 17 GLU A OE1  1  
ATOM   246   O OE2  . GLU A 1 17 ? 7.035   -7.073  -3.827  1.00 0.00 ? 17 GLU A OE2  1  
ATOM   247   H H    . GLU A 1 17 ? 4.422   -3.676  -1.959  1.00 0.00 ? 17 GLU A H    1  
ATOM   248   H HA   . GLU A 1 17 ? 3.572   -6.287  -2.902  1.00 0.00 ? 17 GLU A HA   1  
ATOM   249   H HB2  . GLU A 1 17 ? 5.131   -5.668  -0.382  1.00 0.00 ? 17 GLU A HB2  1  
ATOM   250   H HB3  . GLU A 1 17 ? 5.150   -7.163  -1.319  1.00 0.00 ? 17 GLU A HB3  1  
ATOM   251   H HG2  . GLU A 1 17 ? 5.797   -5.049  -3.107  1.00 0.00 ? 17 GLU A HG2  1  
ATOM   252   H HG3  . GLU A 1 17 ? 6.780   -4.828  -1.659  1.00 0.00 ? 17 GLU A HG3  1  
ATOM   253   N N    . ASN A 1 18 ? 2.164   -5.001  -0.300  1.00 0.00 ? 18 ASN A N    1  
ATOM   254   C CA   . ASN A 1 18 ? 1.063   -5.209  0.679   1.00 0.00 ? 18 ASN A CA   1  
ATOM   255   C C    . ASN A 1 18 ? -0.270  -5.325  -0.067  1.00 0.00 ? 18 ASN A C    1  
ATOM   256   O O    . ASN A 1 18 ? -1.316  -5.473  0.534   1.00 0.00 ? 18 ASN A O    1  
ATOM   257   C CB   . ASN A 1 18 ? 1.012   -4.021  1.642   1.00 0.00 ? 18 ASN A CB   1  
ATOM   258   C CG   . ASN A 1 18 ? 1.696   -4.400  2.956   1.00 0.00 ? 18 ASN A CG   1  
ATOM   259   O OD1  . ASN A 1 18 ? 1.040   -4.748  3.919   1.00 0.00 ? 18 ASN A OD1  1  
ATOM   260   N ND2  . ASN A 1 18 ? 2.998   -4.349  3.040   1.00 0.00 ? 18 ASN A ND2  1  
ATOM   261   H H    . ASN A 1 18 ? 2.563   -4.115  -0.407  1.00 0.00 ? 18 ASN A H    1  
ATOM   262   H HA   . ASN A 1 18 ? 1.244   -6.116  1.236   1.00 0.00 ? 18 ASN A HA   1  
ATOM   263   H HB2  . ASN A 1 18 ? 1.523   -3.179  1.199   1.00 0.00 ? 18 ASN A HB2  1  
ATOM   264   H HB3  . ASN A 1 18 ? -0.015  -3.758  1.835   1.00 0.00 ? 18 ASN A HB3  1  
ATOM   265   H HD21 . ASN A 1 18 ? 3.528   -4.069  2.264   1.00 0.00 ? 18 ASN A HD21 1  
ATOM   266   H HD22 . ASN A 1 18 ? 3.446   -4.591  3.878   1.00 0.00 ? 18 ASN A HD22 1  
ATOM   267   N N    . TYR A 1 19 ? -0.243  -5.262  -1.372  1.00 0.00 ? 19 TYR A N    1  
ATOM   268   C CA   . TYR A 1 19 ? -1.501  -5.372  -2.154  1.00 0.00 ? 19 TYR A CA   1  
ATOM   269   C C    . TYR A 1 19 ? -1.440  -6.633  -3.014  1.00 0.00 ? 19 TYR A C    1  
ATOM   270   O O    . TYR A 1 19 ? -2.019  -6.702  -4.081  1.00 0.00 ? 19 TYR A O    1  
ATOM   271   C CB   . TYR A 1 19 ? -1.644  -4.143  -3.051  1.00 0.00 ? 19 TYR A CB   1  
ATOM   272   C CG   . TYR A 1 19 ? -1.584  -2.897  -2.201  1.00 0.00 ? 19 TYR A CG   1  
ATOM   273   C CD1  . TYR A 1 19 ? -2.388  -2.789  -1.059  1.00 0.00 ? 19 TYR A CD1  1  
ATOM   274   C CD2  . TYR A 1 19 ? -0.722  -1.849  -2.553  1.00 0.00 ? 19 TYR A CD2  1  
ATOM   275   C CE1  . TYR A 1 19 ? -2.332  -1.634  -0.268  1.00 0.00 ? 19 TYR A CE1  1  
ATOM   276   C CE2  . TYR A 1 19 ? -0.665  -0.693  -1.761  1.00 0.00 ? 19 TYR A CE2  1  
ATOM   277   C CZ   . TYR A 1 19 ? -1.471  -0.586  -0.620  1.00 0.00 ? 19 TYR A CZ   1  
ATOM   278   O OH   . TYR A 1 19 ? -1.417  0.553   0.158   1.00 0.00 ? 19 TYR A OH   1  
ATOM   279   H H    . TYR A 1 19 ? 0.608   -5.145  -1.840  1.00 0.00 ? 19 TYR A H    1  
ATOM   280   H HA   . TYR A 1 19 ? -2.344  -5.431  -1.482  1.00 0.00 ? 19 TYR A HA   1  
ATOM   281   H HB2  . TYR A 1 19 ? -0.840  -4.127  -3.772  1.00 0.00 ? 19 TYR A HB2  1  
ATOM   282   H HB3  . TYR A 1 19 ? -2.589  -4.182  -3.565  1.00 0.00 ? 19 TYR A HB3  1  
ATOM   283   H HD1  . TYR A 1 19 ? -3.052  -3.597  -0.789  1.00 0.00 ? 19 TYR A HD1  1  
ATOM   284   H HD2  . TYR A 1 19 ? -0.102  -1.933  -3.432  1.00 0.00 ? 19 TYR A HD2  1  
ATOM   285   H HE1  . TYR A 1 19 ? -2.952  -1.551  0.612   1.00 0.00 ? 19 TYR A HE1  1  
ATOM   286   H HE2  . TYR A 1 19 ? -0.002  0.114   -2.032  1.00 0.00 ? 19 TYR A HE2  1  
ATOM   287   H HH   . TYR A 1 19 ? -2.314  0.879   0.269   1.00 0.00 ? 19 TYR A HH   1  
ATOM   288   N N    . CYS A 1 20 ? -0.734  -7.631  -2.557  1.00 0.00 ? 20 CYS A N    1  
ATOM   289   C CA   . CYS A 1 20 ? -0.623  -8.889  -3.344  1.00 0.00 ? 20 CYS A CA   1  
ATOM   290   C C    . CYS A 1 20 ? -1.781  -9.826  -2.986  1.00 0.00 ? 20 CYS A C    1  
ATOM   291   O O    . CYS A 1 20 ? -2.888  -9.666  -3.463  1.00 0.00 ? 20 CYS A O    1  
ATOM   292   C CB   . CYS A 1 20 ? 0.713   -9.561  -3.027  1.00 0.00 ? 20 CYS A CB   1  
ATOM   293   S SG   . CYS A 1 20 ? 2.056   -8.590  -3.751  1.00 0.00 ? 20 CYS A SG   1  
ATOM   294   H H    . CYS A 1 20 ? -0.274  -7.550  -1.696  1.00 0.00 ? 20 CYS A H    1  
ATOM   295   H HA   . CYS A 1 20 ? -0.666  -8.659  -4.395  1.00 0.00 ? 20 CYS A HA   1  
ATOM   296   H HB2  . CYS A 1 20 ? 0.844   -9.618  -1.957  1.00 0.00 ? 20 CYS A HB2  1  
ATOM   297   H HB3  . CYS A 1 20 ? 0.723   -10.555 -3.444  1.00 0.00 ? 20 CYS A HB3  1  
ATOM   298   N N    . ASN A 1 21 ? -1.542  -10.803 -2.156  1.00 0.00 ? 21 ASN A N    1  
ATOM   299   C CA   . ASN A 1 21 ? -2.634  -11.743 -1.778  1.00 0.00 ? 21 ASN A CA   1  
ATOM   300   C C    . ASN A 1 21 ? -2.510  -12.100 -0.295  1.00 0.00 ? 21 ASN A C    1  
ATOM   301   O O    . ASN A 1 21 ? -1.391  -12.250 0.166   1.00 0.00 ? 21 ASN A O    1  
ATOM   302   C CB   . ASN A 1 21 ? -2.524  -13.016 -2.621  1.00 0.00 ? 21 ASN A CB   1  
ATOM   303   C CG   . ASN A 1 21 ? -3.397  -12.880 -3.869  1.00 0.00 ? 21 ASN A CG   1  
ATOM   304   O OD1  . ASN A 1 21 ? -3.731  -11.783 -4.275  1.00 0.00 ? 21 ASN A OD1  1  
ATOM   305   N ND2  . ASN A 1 21 ? -3.785  -13.954 -4.500  1.00 0.00 ? 21 ASN A ND2  1  
ATOM   306   O OXT  . ASN A 1 21 ? -3.537  -12.219 0.353   1.00 0.00 ? 21 ASN A OXT  1  
ATOM   307   H H    . ASN A 1 21 ? -0.646  -10.921 -1.781  1.00 0.00 ? 21 ASN A H    1  
ATOM   308   H HA   . ASN A 1 21 ? -3.590  -11.274 -1.956  1.00 0.00 ? 21 ASN A HA   1  
ATOM   309   H HB2  . ASN A 1 21 ? -1.495  -13.166 -2.914  1.00 0.00 ? 21 ASN A HB2  1  
ATOM   310   H HB3  . ASN A 1 21 ? -2.860  -13.863 -2.040  1.00 0.00 ? 21 ASN A HB3  1  
ATOM   311   H HD21 . ASN A 1 21 ? -3.517  -14.838 -4.173  1.00 0.00 ? 21 ASN A HD21 1  
ATOM   312   H HD22 . ASN A 1 21 ? -4.345  -13.877 -5.301  1.00 0.00 ? 21 ASN A HD22 1  
ATOM   313   N N    . PHE B 2 1  ? 12.968  1.641   -5.920  1.00 0.00 ? 1  PHE B N    1  
ATOM   314   C CA   . PHE B 2 1  ? 14.265  2.137   -6.462  1.00 0.00 ? 1  PHE B CA   1  
ATOM   315   C C    . PHE B 2 1  ? 14.007  2.989   -7.707  1.00 0.00 ? 1  PHE B C    1  
ATOM   316   O O    . PHE B 2 1  ? 14.885  3.198   -8.520  1.00 0.00 ? 1  PHE B O    1  
ATOM   317   C CB   . PHE B 2 1  ? 15.149  0.946   -6.835  1.00 0.00 ? 1  PHE B CB   1  
ATOM   318   C CG   . PHE B 2 1  ? 14.373  0.006   -7.733  1.00 0.00 ? 1  PHE B CG   1  
ATOM   319   C CD1  . PHE B 2 1  ? 13.579  -1.008  -7.176  1.00 0.00 ? 1  PHE B CD1  1  
ATOM   320   C CD2  . PHE B 2 1  ? 14.443  0.150   -9.127  1.00 0.00 ? 1  PHE B CD2  1  
ATOM   321   C CE1  . PHE B 2 1  ? 12.860  -1.875  -8.010  1.00 0.00 ? 1  PHE B CE1  1  
ATOM   322   C CE2  . PHE B 2 1  ? 13.723  -0.718  -9.960  1.00 0.00 ? 1  PHE B CE2  1  
ATOM   323   C CZ   . PHE B 2 1  ? 12.933  -1.729  -9.402  1.00 0.00 ? 1  PHE B CZ   1  
ATOM   324   H H1   . PHE B 2 1  ? 13.150  0.949   -5.166  1.00 0.00 ? 1  PHE B H1   1  
ATOM   325   H H2   . PHE B 2 1  ? 12.425  1.188   -6.684  1.00 0.00 ? 1  PHE B H2   1  
ATOM   326   H H3   . PHE B 2 1  ? 12.426  2.438   -5.534  1.00 0.00 ? 1  PHE B H3   1  
ATOM   327   H HA   . PHE B 2 1  ? 14.763  2.734   -5.712  1.00 0.00 ? 1  PHE B HA   1  
ATOM   328   H HB2  . PHE B 2 1  ? 16.029  1.301   -7.353  1.00 0.00 ? 1  PHE B HB2  1  
ATOM   329   H HB3  . PHE B 2 1  ? 15.447  0.424   -5.937  1.00 0.00 ? 1  PHE B HB3  1  
ATOM   330   H HD1  . PHE B 2 1  ? 13.519  -1.122  -6.105  1.00 0.00 ? 1  PHE B HD1  1  
ATOM   331   H HD2  . PHE B 2 1  ? 15.051  0.928   -9.560  1.00 0.00 ? 1  PHE B HD2  1  
ATOM   332   H HE1  . PHE B 2 1  ? 12.248  -2.655  -7.581  1.00 0.00 ? 1  PHE B HE1  1  
ATOM   333   H HE2  . PHE B 2 1  ? 13.779  -0.605  -11.033 1.00 0.00 ? 1  PHE B HE2  1  
ATOM   334   H HZ   . PHE B 2 1  ? 12.378  -2.398  -10.044 1.00 0.00 ? 1  PHE B HZ   1  
ATOM   335   N N    . VAL B 2 2  ? 12.808  3.481   -7.863  1.00 0.00 ? 2  VAL B N    1  
ATOM   336   C CA   . VAL B 2 2  ? 12.494  4.319   -9.054  1.00 0.00 ? 2  VAL B CA   1  
ATOM   337   C C    . VAL B 2 2  ? 11.765  5.591   -8.605  1.00 0.00 ? 2  VAL B C    1  
ATOM   338   O O    . VAL B 2 2  ? 11.467  5.766   -7.441  1.00 0.00 ? 2  VAL B O    1  
ATOM   339   C CB   . VAL B 2 2  ? 11.605  3.519   -10.014 1.00 0.00 ? 2  VAL B CB   1  
ATOM   340   C CG1  . VAL B 2 2  ? 10.174  3.465   -9.475  1.00 0.00 ? 2  VAL B CG1  1  
ATOM   341   C CG2  . VAL B 2 2  ? 11.607  4.192   -11.388 1.00 0.00 ? 2  VAL B CG2  1  
ATOM   342   H H    . VAL B 2 2  ? 12.114  3.301   -7.194  1.00 0.00 ? 2  VAL B H    1  
ATOM   343   H HA   . VAL B 2 2  ? 13.411  4.589   -9.555  1.00 0.00 ? 2  VAL B HA   1  
ATOM   344   H HB   . VAL B 2 2  ? 11.991  2.514   -10.104 1.00 0.00 ? 2  VAL B HB   1  
ATOM   345   H HG11 . VAL B 2 2  ? 10.165  3.790   -8.445  1.00 0.00 ? 2  VAL B HG11 1  
ATOM   346   H HG12 . VAL B 2 2  ? 9.805   2.453   -9.537  1.00 0.00 ? 2  VAL B HG12 1  
ATOM   347   H HG13 . VAL B 2 2  ? 9.544   4.115   -10.063 1.00 0.00 ? 2  VAL B HG13 1  
ATOM   348   H HG21 . VAL B 2 2  ? 12.565  4.660   -11.559 1.00 0.00 ? 2  VAL B HG21 1  
ATOM   349   H HG22 . VAL B 2 2  ? 10.829  4.941   -11.422 1.00 0.00 ? 2  VAL B HG22 1  
ATOM   350   H HG23 . VAL B 2 2  ? 11.426  3.450   -12.152 1.00 0.00 ? 2  VAL B HG23 1  
ATOM   351   N N    . ASN B 2 3  ? 11.477  6.479   -9.519  1.00 0.00 ? 3  ASN B N    1  
ATOM   352   C CA   . ASN B 2 3  ? 10.771  7.733   -9.141  1.00 0.00 ? 3  ASN B CA   1  
ATOM   353   C C    . ASN B 2 3  ? 9.712   8.051   -10.197 1.00 0.00 ? 3  ASN B C    1  
ATOM   354   O O    . ASN B 2 3  ? 9.483   9.194   -10.536 1.00 0.00 ? 3  ASN B O    1  
ATOM   355   C CB   . ASN B 2 3  ? 11.775  8.885   -9.062  1.00 0.00 ? 3  ASN B CB   1  
ATOM   356   C CG   . ASN B 2 3  ? 12.289  9.016   -7.627  1.00 0.00 ? 3  ASN B CG   1  
ATOM   357   O OD1  . ASN B 2 3  ? 11.915  8.248   -6.763  1.00 0.00 ? 3  ASN B OD1  1  
ATOM   358   N ND2  . ASN B 2 3  ? 13.137  9.962   -7.335  1.00 0.00 ? 3  ASN B ND2  1  
ATOM   359   H H    . ASN B 2 3  ? 11.723  6.324   -10.452 1.00 0.00 ? 3  ASN B H    1  
ATOM   360   H HA   . ASN B 2 3  ? 10.294  7.604   -8.180  1.00 0.00 ? 3  ASN B HA   1  
ATOM   361   H HB2  . ASN B 2 3  ? 12.604  8.687   -9.726  1.00 0.00 ? 3  ASN B HB2  1  
ATOM   362   H HB3  . ASN B 2 3  ? 11.291  9.805   -9.354  1.00 0.00 ? 3  ASN B HB3  1  
ATOM   363   H HD21 . ASN B 2 3  ? 13.439  10.582  -8.031  1.00 0.00 ? 3  ASN B HD21 1  
ATOM   364   H HD22 . ASN B 2 3  ? 13.472  10.055  -6.419  1.00 0.00 ? 3  ASN B HD22 1  
ATOM   365   N N    . GLN B 2 4  ? 9.061   7.045   -10.717 1.00 0.00 ? 4  GLN B N    1  
ATOM   366   C CA   . GLN B 2 4  ? 8.014   7.287   -11.743 1.00 0.00 ? 4  GLN B CA   1  
ATOM   367   C C    . GLN B 2 4  ? 6.646   7.308   -11.061 1.00 0.00 ? 4  GLN B C    1  
ATOM   368   O O    . GLN B 2 4  ? 6.409   6.601   -10.103 1.00 0.00 ? 4  GLN B O    1  
ATOM   369   C CB   . GLN B 2 4  ? 8.054   6.169   -12.787 1.00 0.00 ? 4  GLN B CB   1  
ATOM   370   C CG   . GLN B 2 4  ? 8.794   6.660   -14.032 1.00 0.00 ? 4  GLN B CG   1  
ATOM   371   C CD   . GLN B 2 4  ? 8.991   5.495   -15.004 1.00 0.00 ? 4  GLN B CD   1  
ATOM   372   O OE1  . GLN B 2 4  ? 8.114   5.186   -15.786 1.00 0.00 ? 4  GLN B OE1  1  
ATOM   373   N NE2  . GLN B 2 4  ? 10.116  4.833   -14.989 1.00 0.00 ? 4  GLN B NE2  1  
ATOM   374   H H    . GLN B 2 4  ? 9.259   6.131   -10.430 1.00 0.00 ? 4  GLN B H    1  
ATOM   375   H HA   . GLN B 2 4  ? 8.192   8.238   -12.225 1.00 0.00 ? 4  GLN B HA   1  
ATOM   376   H HB2  . GLN B 2 4  ? 8.568   5.312   -12.376 1.00 0.00 ? 4  GLN B HB2  1  
ATOM   377   H HB3  . GLN B 2 4  ? 7.048   5.891   -13.054 1.00 0.00 ? 4  GLN B HB3  1  
ATOM   378   H HG2  . GLN B 2 4  ? 8.216   7.437   -14.512 1.00 0.00 ? 4  GLN B HG2  1  
ATOM   379   H HG3  . GLN B 2 4  ? 9.758   7.054   -13.747 1.00 0.00 ? 4  GLN B HG3  1  
ATOM   380   H HE21 . GLN B 2 4  ? 10.824  5.083   -14.361 1.00 0.00 ? 4  GLN B HE21 1  
ATOM   381   H HE22 . GLN B 2 4  ? 10.252  4.085   -15.609 1.00 0.00 ? 4  GLN B HE22 1  
ATOM   382   N N    . HIS B 2 5  ? 5.747   8.121   -11.540 1.00 0.00 ? 5  HIS B N    1  
ATOM   383   C CA   . HIS B 2 5  ? 4.399   8.193   -10.911 1.00 0.00 ? 5  HIS B CA   1  
ATOM   384   C C    . HIS B 2 5  ? 3.606   6.922   -11.233 1.00 0.00 ? 5  HIS B C    1  
ATOM   385   O O    . HIS B 2 5  ? 3.609   6.440   -12.348 1.00 0.00 ? 5  HIS B O    1  
ATOM   386   C CB   . HIS B 2 5  ? 3.660   9.416   -11.454 1.00 0.00 ? 5  HIS B CB   1  
ATOM   387   C CG   . HIS B 2 5  ? 2.415   9.652   -10.646 1.00 0.00 ? 5  HIS B CG   1  
ATOM   388   N ND1  . HIS B 2 5  ? 2.373   9.382   -9.295  1.00 0.00 ? 5  HIS B ND1  1  
ATOM   389   C CD2  . HIS B 2 5  ? 1.187   10.131  -11.008 1.00 0.00 ? 5  HIS B CD2  1  
ATOM   390   C CE1  . HIS B 2 5  ? 1.138   9.699   -8.880  1.00 0.00 ? 5  HIS B CE1  1  
ATOM   391   N NE2  . HIS B 2 5  ? 0.378   10.162  -9.894  1.00 0.00 ? 5  HIS B NE2  1  
ATOM   392   H H    . HIS B 2 5  ? 5.960   8.689   -12.311 1.00 0.00 ? 5  HIS B H    1  
ATOM   393   H HA   . HIS B 2 5  ? 4.508   8.286   -9.841  1.00 0.00 ? 5  HIS B HA   1  
ATOM   394   H HB2  . HIS B 2 5  ? 4.302   10.282  -11.387 1.00 0.00 ? 5  HIS B HB2  1  
ATOM   395   H HB3  . HIS B 2 5  ? 3.393   9.246   -12.486 1.00 0.00 ? 5  HIS B HB3  1  
ATOM   396   H HD2  . HIS B 2 5  ? 0.900   10.436  -12.003 1.00 0.00 ? 5  HIS B HD2  1  
ATOM   397   H HE1  . HIS B 2 5  ? 0.795   9.598   -7.861  1.00 0.00 ? 5  HIS B HE1  1  
ATOM   398   H HE2  . HIS B 2 5  ? -0.555  10.459  -9.847  1.00 0.00 ? 5  HIS B HE2  1  
ATOM   399   N N    . LEU B 2 6  ? 2.921   6.380   -10.260 1.00 0.00 ? 6  LEU B N    1  
ATOM   400   C CA   . LEU B 2 6  ? 2.122   5.143   -10.504 1.00 0.00 ? 6  LEU B CA   1  
ATOM   401   C C    . LEU B 2 6  ? 0.634   5.490   -10.455 1.00 0.00 ? 6  LEU B C    1  
ATOM   402   O O    . LEU B 2 6  ? 0.154   6.051   -9.492  1.00 0.00 ? 6  LEU B O    1  
ATOM   403   C CB   . LEU B 2 6  ? 2.433   4.106   -9.421  1.00 0.00 ? 6  LEU B CB   1  
ATOM   404   C CG   . LEU B 2 6  ? 3.790   3.461   -9.697  1.00 0.00 ? 6  LEU B CG   1  
ATOM   405   C CD1  . LEU B 2 6  ? 3.706   2.617   -10.970 1.00 0.00 ? 6  LEU B CD1  1  
ATOM   406   C CD2  . LEU B 2 6  ? 4.844   4.552   -9.879  1.00 0.00 ? 6  LEU B CD2  1  
ATOM   407   H H    . LEU B 2 6  ? 2.929   6.789   -9.369  1.00 0.00 ? 6  LEU B H    1  
ATOM   408   H HA   . LEU B 2 6  ? 2.369   4.739   -11.472 1.00 0.00 ? 6  LEU B HA   1  
ATOM   409   H HB2  . LEU B 2 6  ? 2.454   4.590   -8.457  1.00 0.00 ? 6  LEU B HB2  1  
ATOM   410   H HB3  . LEU B 2 6  ? 1.668   3.344   -9.424  1.00 0.00 ? 6  LEU B HB3  1  
ATOM   411   H HG   . LEU B 2 6  ? 4.063   2.829   -8.864  1.00 0.00 ? 6  LEU B HG   1  
ATOM   412   H HD11 . LEU B 2 6  ? 3.657   1.571   -10.705 1.00 0.00 ? 6  LEU B HD11 1  
ATOM   413   H HD12 . LEU B 2 6  ? 4.580   2.795   -11.578 1.00 0.00 ? 6  LEU B HD12 1  
ATOM   414   H HD13 . LEU B 2 6  ? 2.820   2.890   -11.524 1.00 0.00 ? 6  LEU B HD13 1  
ATOM   415   H HD21 . LEU B 2 6  ? 4.802   4.927   -10.890 1.00 0.00 ? 6  LEU B HD21 1  
ATOM   416   H HD22 . LEU B 2 6  ? 5.824   4.142   -9.687  1.00 0.00 ? 6  LEU B HD22 1  
ATOM   417   H HD23 . LEU B 2 6  ? 4.649   5.359   -9.188  1.00 0.00 ? 6  LEU B HD23 1  
ATOM   418   N N    . CYS B 2 7  ? -0.104  5.166   -11.483 1.00 0.00 ? 7  CYS B N    1  
ATOM   419   C CA   . CYS B 2 7  ? -1.558  5.495   -11.479 1.00 0.00 ? 7  CYS B CA   1  
ATOM   420   C C    . CYS B 2 7  ? -2.358  4.335   -12.104 1.00 0.00 ? 7  CYS B C    1  
ATOM   421   O O    . CYS B 2 7  ? -2.575  3.319   -11.477 1.00 0.00 ? 7  CYS B O    1  
ATOM   422   C CB   . CYS B 2 7  ? -1.777  6.786   -12.281 1.00 0.00 ? 7  CYS B CB   1  
ATOM   423   S SG   . CYS B 2 7  ? -1.621  8.226   -11.198 1.00 0.00 ? 7  CYS B SG   1  
ATOM   424   H H    . CYS B 2 7  ? 0.297   4.716   -12.253 1.00 0.00 ? 7  CYS B H    1  
ATOM   425   H HA   . CYS B 2 7  ? -1.885  5.642   -10.458 1.00 0.00 ? 7  CYS B HA   1  
ATOM   426   H HB2  . CYS B 2 7  ? -1.030  6.856   -13.054 1.00 0.00 ? 7  CYS B HB2  1  
ATOM   427   H HB3  . CYS B 2 7  ? -2.761  6.775   -12.726 1.00 0.00 ? 7  CYS B HB3  1  
ATOM   428   N N    . GLY B 2 8  ? -2.807  4.471   -13.326 1.00 0.00 ? 8  GLY B N    1  
ATOM   429   C CA   . GLY B 2 8  ? -3.590  3.370   -13.956 1.00 0.00 ? 8  GLY B CA   1  
ATOM   430   C C    . GLY B 2 8  ? -2.656  2.220   -14.334 1.00 0.00 ? 8  GLY B C    1  
ATOM   431   O O    . GLY B 2 8  ? -2.092  1.558   -13.485 1.00 0.00 ? 8  GLY B O    1  
ATOM   432   H H    . GLY B 2 8  ? -2.636  5.290   -13.829 1.00 0.00 ? 8  GLY B H    1  
ATOM   433   H HA2  . GLY B 2 8  ? -4.334  3.015   -13.257 1.00 0.00 ? 8  GLY B HA2  1  
ATOM   434   H HA3  . GLY B 2 8  ? -4.076  3.739   -14.845 1.00 0.00 ? 8  GLY B HA3  1  
ATOM   435   N N    . SER B 2 9  ? -2.492  1.972   -15.605 1.00 0.00 ? 9  SER B N    1  
ATOM   436   C CA   . SER B 2 9  ? -1.600  0.860   -16.042 1.00 0.00 ? 9  SER B CA   1  
ATOM   437   C C    . SER B 2 9  ? -0.253  0.967   -15.328 1.00 0.00 ? 9  SER B C    1  
ATOM   438   O O    . SER B 2 9  ? 0.433   -0.014  -15.127 1.00 0.00 ? 9  SER B O    1  
ATOM   439   C CB   . SER B 2 9  ? -1.385  0.943   -17.554 1.00 0.00 ? 9  SER B CB   1  
ATOM   440   O OG   . SER B 2 9  ? -2.584  0.570   -18.220 1.00 0.00 ? 9  SER B OG   1  
ATOM   441   H H    . SER B 2 9  ? -2.959  2.516   -16.273 1.00 0.00 ? 9  SER B H    1  
ATOM   442   H HA   . SER B 2 9  ? -2.061  -0.085  -15.796 1.00 0.00 ? 9  SER B HA   1  
ATOM   443   H HB2  . SER B 2 9  ? -1.127  1.951   -17.829 1.00 0.00 ? 9  SER B HB2  1  
ATOM   444   H HB3  . SER B 2 9  ? -0.580  0.278   -17.839 1.00 0.00 ? 9  SER B HB3  1  
ATOM   445   H HG   . SER B 2 9  ? -2.395  0.508   -19.159 1.00 0.00 ? 9  SER B HG   1  
ATOM   446   N N    . ASP B 2 10 ? 0.133   2.151   -14.940 1.00 0.00 ? 10 ASP B N    1  
ATOM   447   C CA   . ASP B 2 10 ? 1.436   2.312   -14.237 1.00 0.00 ? 10 ASP B CA   1  
ATOM   448   C C    . ASP B 2 10 ? 1.368   1.619   -12.874 1.00 0.00 ? 10 ASP B C    1  
ATOM   449   O O    . ASP B 2 10 ? 2.149   0.735   -12.579 1.00 0.00 ? 10 ASP B O    1  
ATOM   450   C CB   . ASP B 2 10 ? 1.735   3.801   -14.047 1.00 0.00 ? 10 ASP B CB   1  
ATOM   451   C CG   . ASP B 2 10 ? 2.567   4.311   -15.225 1.00 0.00 ? 10 ASP B CG   1  
ATOM   452   O OD1  . ASP B 2 10 ? 3.367   3.545   -15.737 1.00 0.00 ? 10 ASP B OD1  1  
ATOM   453   O OD2  . ASP B 2 10 ? 2.391   5.460   -15.594 1.00 0.00 ? 10 ASP B OD2  1  
ATOM   454   H H    . ASP B 2 10 ? -0.434  2.933   -15.109 1.00 0.00 ? 10 ASP B H    1  
ATOM   455   H HA   . ASP B 2 10 ? 2.220   1.862   -14.830 1.00 0.00 ? 10 ASP B HA   1  
ATOM   456   H HB2  . ASP B 2 10 ? 0.806   4.349   -13.999 1.00 0.00 ? 10 ASP B HB2  1  
ATOM   457   H HB3  . ASP B 2 10 ? 2.287   3.941   -13.132 1.00 0.00 ? 10 ASP B HB3  1  
ATOM   458   N N    . LEU B 2 11 ? 0.442   2.007   -12.036 1.00 0.00 ? 11 LEU B N    1  
ATOM   459   C CA   . LEU B 2 11 ? 0.336   1.358   -10.697 1.00 0.00 ? 11 LEU B CA   1  
ATOM   460   C C    . LEU B 2 11 ? -0.033  -0.118  -10.882 1.00 0.00 ? 11 LEU B C    1  
ATOM   461   O O    . LEU B 2 11 ? 0.345   -0.968  -10.100 1.00 0.00 ? 11 LEU B O    1  
ATOM   462   C CB   . LEU B 2 11 ? -0.751  2.059   -9.866  1.00 0.00 ? 11 LEU B CB   1  
ATOM   463   C CG   . LEU B 2 11 ? -0.307  2.236   -8.402  1.00 0.00 ? 11 LEU B CG   1  
ATOM   464   C CD1  . LEU B 2 11 ? -1.539  2.208   -7.494  1.00 0.00 ? 11 LEU B CD1  1  
ATOM   465   C CD2  . LEU B 2 11 ? 0.636   1.108   -7.979  1.00 0.00 ? 11 LEU B CD2  1  
ATOM   466   H H    . LEU B 2 11 ? -0.183  2.719   -12.289 1.00 0.00 ? 11 LEU B H    1  
ATOM   467   H HA   . LEU B 2 11 ? 1.285   1.431   -10.190 1.00 0.00 ? 11 LEU B HA   1  
ATOM   468   H HB2  . LEU B 2 11 ? -0.943  3.029   -10.293 1.00 0.00 ? 11 LEU B HB2  1  
ATOM   469   H HB3  . LEU B 2 11 ? -1.657  1.474   -9.893  1.00 0.00 ? 11 LEU B HB3  1  
ATOM   470   H HG   . LEU B 2 11 ? 0.194   3.188   -8.293  1.00 0.00 ? 11 LEU B HG   1  
ATOM   471   H HD11 . LEU B 2 11 ? -2.433  2.198   -8.099  1.00 0.00 ? 11 LEU B HD11 1  
ATOM   472   H HD12 . LEU B 2 11 ? -1.541  3.083   -6.863  1.00 0.00 ? 11 LEU B HD12 1  
ATOM   473   H HD13 . LEU B 2 11 ? -1.511  1.320   -6.878  1.00 0.00 ? 11 LEU B HD13 1  
ATOM   474   H HD21 . LEU B 2 11 ? 1.622   1.297   -8.375  1.00 0.00 ? 11 LEU B HD21 1  
ATOM   475   H HD22 . LEU B 2 11 ? 0.265   0.170   -8.361  1.00 0.00 ? 11 LEU B HD22 1  
ATOM   476   H HD23 . LEU B 2 11 ? 0.682   1.066   -6.902  1.00 0.00 ? 11 LEU B HD23 1  
ATOM   477   N N    . VAL B 2 12 ? -0.765  -0.431  -11.917 1.00 0.00 ? 12 VAL B N    1  
ATOM   478   C CA   . VAL B 2 12 ? -1.151  -1.850  -12.150 1.00 0.00 ? 12 VAL B CA   1  
ATOM   479   C C    . VAL B 2 12 ? 0.074   -2.633  -12.624 1.00 0.00 ? 12 VAL B C    1  
ATOM   480   O O    . VAL B 2 12 ? 0.525   -3.549  -11.967 1.00 0.00 ? 12 VAL B O    1  
ATOM   481   C CB   . VAL B 2 12 ? -2.247  -1.908  -13.217 1.00 0.00 ? 12 VAL B CB   1  
ATOM   482   C CG1  . VAL B 2 12 ? -2.350  -3.328  -13.782 1.00 0.00 ? 12 VAL B CG1  1  
ATOM   483   C CG2  . VAL B 2 12 ? -3.587  -1.517  -12.593 1.00 0.00 ? 12 VAL B CG2  1  
ATOM   484   H H    . VAL B 2 12 ? -1.056  0.265   -12.544 1.00 0.00 ? 12 VAL B H    1  
ATOM   485   H HA   . VAL B 2 12 ? -1.517  -2.280  -11.229 1.00 0.00 ? 12 VAL B HA   1  
ATOM   486   H HB   . VAL B 2 12 ? -2.007  -1.219  -14.015 1.00 0.00 ? 12 VAL B HB   1  
ATOM   487   H HG11 . VAL B 2 12 ? -2.506  -4.027  -12.972 1.00 0.00 ? 12 VAL B HG11 1  
ATOM   488   H HG12 . VAL B 2 12 ? -1.437  -3.577  -14.301 1.00 0.00 ? 12 VAL B HG12 1  
ATOM   489   H HG13 . VAL B 2 12 ? -3.182  -3.384  -14.469 1.00 0.00 ? 12 VAL B HG13 1  
ATOM   490   H HG21 . VAL B 2 12 ? -4.272  -1.214  -13.371 1.00 0.00 ? 12 VAL B HG21 1  
ATOM   491   H HG22 . VAL B 2 12 ? -3.439  -0.699  -11.905 1.00 0.00 ? 12 VAL B HG22 1  
ATOM   492   H HG23 . VAL B 2 12 ? -3.998  -2.363  -12.062 1.00 0.00 ? 12 VAL B HG23 1  
ATOM   493   N N    . GLU B 2 13 ? 0.616   -2.279  -13.760 1.00 0.00 ? 13 GLU B N    1  
ATOM   494   C CA   . GLU B 2 13 ? 1.811   -3.005  -14.269 1.00 0.00 ? 13 GLU B CA   1  
ATOM   495   C C    . GLU B 2 13 ? 2.786   -3.224  -13.111 1.00 0.00 ? 13 GLU B C    1  
ATOM   496   O O    . GLU B 2 13 ? 3.548   -4.168  -13.096 1.00 0.00 ? 13 GLU B O    1  
ATOM   497   C CB   . GLU B 2 13 ? 2.488   -2.177  -15.364 1.00 0.00 ? 13 GLU B CB   1  
ATOM   498   C CG   . GLU B 2 13 ? 1.656   -2.248  -16.646 1.00 0.00 ? 13 GLU B CG   1  
ATOM   499   C CD   . GLU B 2 13 ? 2.588   -2.283  -17.859 1.00 0.00 ? 13 GLU B CD   1  
ATOM   500   O OE1  . GLU B 2 13 ? 3.707   -1.814  -17.736 1.00 0.00 ? 13 GLU B OE1  1  
ATOM   501   O OE2  . GLU B 2 13 ? 2.165   -2.776  -18.892 1.00 0.00 ? 13 GLU B OE2  1  
ATOM   502   H H    . GLU B 2 13 ? 0.235   -1.537  -14.276 1.00 0.00 ? 13 GLU B H    1  
ATOM   503   H HA   . GLU B 2 13 ? 1.510   -3.960  -14.671 1.00 0.00 ? 13 GLU B HA   1  
ATOM   504   H HB2  . GLU B 2 13 ? 2.568   -1.149  -15.041 1.00 0.00 ? 13 GLU B HB2  1  
ATOM   505   H HB3  . GLU B 2 13 ? 3.474   -2.571  -15.556 1.00 0.00 ? 13 GLU B HB3  1  
ATOM   506   H HG2  . GLU B 2 13 ? 1.049   -3.141  -16.632 1.00 0.00 ? 13 GLU B HG2  1  
ATOM   507   H HG3  . GLU B 2 13 ? 1.018   -1.379  -16.710 1.00 0.00 ? 13 GLU B HG3  1  
ATOM   508   N N    . ALA B 2 14 ? 2.754   -2.358  -12.134 1.00 0.00 ? 14 ALA B N    1  
ATOM   509   C CA   . ALA B 2 14 ? 3.666   -2.515  -10.968 1.00 0.00 ? 14 ALA B CA   1  
ATOM   510   C C    . ALA B 2 14 ? 3.261   -3.765  -10.184 1.00 0.00 ? 14 ALA B C    1  
ATOM   511   O O    . ALA B 2 14 ? 4.006   -4.721  -10.094 1.00 0.00 ? 14 ALA B O    1  
ATOM   512   C CB   . ALA B 2 14 ? 3.553   -1.286  -10.065 1.00 0.00 ? 14 ALA B CB   1  
ATOM   513   H H    . ALA B 2 14 ? 2.125   -1.608  -12.164 1.00 0.00 ? 14 ALA B H    1  
ATOM   514   H HA   . ALA B 2 14 ? 4.683   -2.619  -11.315 1.00 0.00 ? 14 ALA B HA   1  
ATOM   515   H HB1  . ALA B 2 14 ? 2.711   -1.404  -9.399  1.00 0.00 ? 14 ALA B HB1  1  
ATOM   516   H HB2  . ALA B 2 14 ? 3.413   -0.405  -10.673 1.00 0.00 ? 14 ALA B HB2  1  
ATOM   517   H HB3  . ALA B 2 14 ? 4.460   -1.183  -9.484  1.00 0.00 ? 14 ALA B HB3  1  
ATOM   518   N N    . LEU B 2 15 ? 2.081   -3.771  -9.624  1.00 0.00 ? 15 LEU B N    1  
ATOM   519   C CA   . LEU B 2 15 ? 1.632   -4.967  -8.859  1.00 0.00 ? 15 LEU B CA   1  
ATOM   520   C C    . LEU B 2 15 ? 1.935   -6.225  -9.675  1.00 0.00 ? 15 LEU B C    1  
ATOM   521   O O    . LEU B 2 15 ? 2.467   -7.196  -9.172  1.00 0.00 ? 15 LEU B O    1  
ATOM   522   C CB   . LEU B 2 15 ? 0.126   -4.873  -8.610  1.00 0.00 ? 15 LEU B CB   1  
ATOM   523   C CG   . LEU B 2 15 ? -0.158  -3.758  -7.604  1.00 0.00 ? 15 LEU B CG   1  
ATOM   524   C CD1  . LEU B 2 15 ? -1.551  -3.181  -7.862  1.00 0.00 ? 15 LEU B CD1  1  
ATOM   525   C CD2  . LEU B 2 15 ? -0.098  -4.325  -6.185  1.00 0.00 ? 15 LEU B CD2  1  
ATOM   526   H H    . LEU B 2 15 ? 1.487   -2.994  -9.713  1.00 0.00 ? 15 LEU B H    1  
ATOM   527   H HA   . LEU B 2 15 ? 2.154   -5.011  -7.914  1.00 0.00 ? 15 LEU B HA   1  
ATOM   528   H HB2  . LEU B 2 15 ? -0.377  -4.657  -9.541  1.00 0.00 ? 15 LEU B HB2  1  
ATOM   529   H HB3  . LEU B 2 15 ? -0.233  -5.811  -8.217  1.00 0.00 ? 15 LEU B HB3  1  
ATOM   530   H HG   . LEU B 2 15 ? 0.581   -2.977  -7.715  1.00 0.00 ? 15 LEU B HG   1  
ATOM   531   H HD11 . LEU B 2 15 ? -2.280  -3.729  -7.284  1.00 0.00 ? 15 LEU B HD11 1  
ATOM   532   H HD12 . LEU B 2 15 ? -1.786  -3.266  -8.912  1.00 0.00 ? 15 LEU B HD12 1  
ATOM   533   H HD13 . LEU B 2 15 ? -1.570  -2.141  -7.572  1.00 0.00 ? 15 LEU B HD13 1  
ATOM   534   H HD21 . LEU B 2 15 ? 0.244   -3.560  -5.505  1.00 0.00 ? 15 LEU B HD21 1  
ATOM   535   H HD22 . LEU B 2 15 ? 0.586   -5.161  -6.161  1.00 0.00 ? 15 LEU B HD22 1  
ATOM   536   H HD23 . LEU B 2 15 ? -1.083  -4.656  -5.889  1.00 0.00 ? 15 LEU B HD23 1  
ATOM   537   N N    . TYR B 2 16 ? 1.596   -6.210  -10.934 1.00 0.00 ? 16 TYR B N    1  
ATOM   538   C CA   . TYR B 2 16 ? 1.854   -7.394  -11.800 1.00 0.00 ? 16 TYR B CA   1  
ATOM   539   C C    . TYR B 2 16 ? 3.306   -7.853  -11.636 1.00 0.00 ? 16 TYR B C    1  
ATOM   540   O O    . TYR B 2 16 ? 3.577   -9.015  -11.407 1.00 0.00 ? 16 TYR B O    1  
ATOM   541   C CB   . TYR B 2 16 ? 1.610   -7.009  -13.262 1.00 0.00 ? 16 TYR B CB   1  
ATOM   542   C CG   . TYR B 2 16 ? 0.312   -7.626  -13.737 1.00 0.00 ? 16 TYR B CG   1  
ATOM   543   C CD1  . TYR B 2 16 ? 0.196   -9.019  -13.855 1.00 0.00 ? 16 TYR B CD1  1  
ATOM   544   C CD2  . TYR B 2 16 ? -0.777  -6.805  -14.063 1.00 0.00 ? 16 TYR B CD2  1  
ATOM   545   C CE1  . TYR B 2 16 ? -1.005  -9.589  -14.298 1.00 0.00 ? 16 TYR B CE1  1  
ATOM   546   C CE2  . TYR B 2 16 ? -1.979  -7.376  -14.505 1.00 0.00 ? 16 TYR B CE2  1  
ATOM   547   C CZ   . TYR B 2 16 ? -2.092  -8.767  -14.622 1.00 0.00 ? 16 TYR B CZ   1  
ATOM   548   O OH   . TYR B 2 16 ? -3.274  -9.329  -15.058 1.00 0.00 ? 16 TYR B OH   1  
ATOM   549   H H    . TYR B 2 16 ? 1.168   -5.414  -11.311 1.00 0.00 ? 16 TYR B H    1  
ATOM   550   H HA   . TYR B 2 16 ? 1.188   -8.197  -11.524 1.00 0.00 ? 16 TYR B HA   1  
ATOM   551   H HB2  . TYR B 2 16 ? 1.551   -5.932  -13.343 1.00 0.00 ? 16 TYR B HB2  1  
ATOM   552   H HB3  . TYR B 2 16 ? 2.426   -7.371  -13.870 1.00 0.00 ? 16 TYR B HB3  1  
ATOM   553   H HD1  . TYR B 2 16 ? 1.031   -9.655  -13.606 1.00 0.00 ? 16 TYR B HD1  1  
ATOM   554   H HD2  . TYR B 2 16 ? -0.694  -5.734  -13.973 1.00 0.00 ? 16 TYR B HD2  1  
ATOM   555   H HE1  . TYR B 2 16 ? -1.094  -10.660 -14.388 1.00 0.00 ? 16 TYR B HE1  1  
ATOM   556   H HE2  . TYR B 2 16 ? -2.817  -6.743  -14.756 1.00 0.00 ? 16 TYR B HE2  1  
ATOM   557   H HH   . TYR B 2 16 ? -3.676  -9.787  -14.316 1.00 0.00 ? 16 TYR B HH   1  
ATOM   558   N N    . LEU B 2 17 ? 4.243   -6.952  -11.758 1.00 0.00 ? 17 LEU B N    1  
ATOM   559   C CA   . LEU B 2 17 ? 5.676   -7.340  -11.619 1.00 0.00 ? 17 LEU B CA   1  
ATOM   560   C C    . LEU B 2 17 ? 6.077   -7.335  -10.142 1.00 0.00 ? 17 LEU B C    1  
ATOM   561   O O    . LEU B 2 17 ? 7.215   -7.588  -9.799  1.00 0.00 ? 17 LEU B O    1  
ATOM   562   C CB   . LEU B 2 17 ? 6.549   -6.345  -12.385 1.00 0.00 ? 17 LEU B CB   1  
ATOM   563   C CG   . LEU B 2 17 ? 7.525   -7.106  -13.283 1.00 0.00 ? 17 LEU B CG   1  
ATOM   564   C CD1  . LEU B 2 17 ? 8.355   -8.069  -12.433 1.00 0.00 ? 17 LEU B CD1  1  
ATOM   565   C CD2  . LEU B 2 17 ? 6.739   -7.900  -14.328 1.00 0.00 ? 17 LEU B CD2  1  
ATOM   566   H H    . LEU B 2 17 ? 4.003   -6.020  -11.950 1.00 0.00 ? 17 LEU B H    1  
ATOM   567   H HA   . LEU B 2 17 ? 5.819   -8.330  -12.026 1.00 0.00 ? 17 LEU B HA   1  
ATOM   568   H HB2  . LEU B 2 17 ? 5.922   -5.708  -12.993 1.00 0.00 ? 17 LEU B HB2  1  
ATOM   569   H HB3  . LEU B 2 17 ? 7.105   -5.740  -11.685 1.00 0.00 ? 17 LEU B HB3  1  
ATOM   570   H HG   . LEU B 2 17 ? 8.182   -6.406  -13.777 1.00 0.00 ? 17 LEU B HG   1  
ATOM   571   H HD11 . LEU B 2 17 ? 8.802   -7.531  -11.610 1.00 0.00 ? 17 LEU B HD11 1  
ATOM   572   H HD12 . LEU B 2 17 ? 9.133   -8.507  -13.042 1.00 0.00 ? 17 LEU B HD12 1  
ATOM   573   H HD13 . LEU B 2 17 ? 7.716   -8.851  -12.048 1.00 0.00 ? 17 LEU B HD13 1  
ATOM   574   H HD21 . LEU B 2 17 ? 6.028   -7.249  -14.816 1.00 0.00 ? 17 LEU B HD21 1  
ATOM   575   H HD22 . LEU B 2 17 ? 6.211   -8.709  -13.845 1.00 0.00 ? 17 LEU B HD22 1  
ATOM   576   H HD23 . LEU B 2 17 ? 7.421   -8.303  -15.063 1.00 0.00 ? 17 LEU B HD23 1  
ATOM   577   N N    . VAL B 2 18 ? 5.156   -7.051  -9.264  1.00 0.00 ? 18 VAL B N    1  
ATOM   578   C CA   . VAL B 2 18 ? 5.492   -7.032  -7.814  1.00 0.00 ? 18 VAL B CA   1  
ATOM   579   C C    . VAL B 2 18 ? 5.127   -8.379  -7.190  1.00 0.00 ? 18 VAL B C    1  
ATOM   580   O O    . VAL B 2 18 ? 5.960   -9.060  -6.622  1.00 0.00 ? 18 VAL B O    1  
ATOM   581   C CB   . VAL B 2 18 ? 4.698   -5.925  -7.123  1.00 0.00 ? 18 VAL B CB   1  
ATOM   582   C CG1  . VAL B 2 18 ? 4.941   -5.988  -5.617  1.00 0.00 ? 18 VAL B CG1  1  
ATOM   583   C CG2  . VAL B 2 18 ? 5.149   -4.566  -7.658  1.00 0.00 ? 18 VAL B CG2  1  
ATOM   584   H H    . VAL B 2 18 ? 4.243   -6.848  -9.556  1.00 0.00 ? 18 VAL B H    1  
ATOM   585   H HA   . VAL B 2 18 ? 6.550   -6.851  -7.690  1.00 0.00 ? 18 VAL B HA   1  
ATOM   586   H HB   . VAL B 2 18 ? 3.645   -6.060  -7.323  1.00 0.00 ? 18 VAL B HB   1  
ATOM   587   H HG11 . VAL B 2 18 ? 6.003   -6.042  -5.426  1.00 0.00 ? 18 VAL B HG11 1  
ATOM   588   H HG12 . VAL B 2 18 ? 4.457   -6.864  -5.212  1.00 0.00 ? 18 VAL B HG12 1  
ATOM   589   H HG13 . VAL B 2 18 ? 4.536   -5.103  -5.150  1.00 0.00 ? 18 VAL B HG13 1  
ATOM   590   H HG21 . VAL B 2 18 ? 5.901   -4.711  -8.418  1.00 0.00 ? 18 VAL B HG21 1  
ATOM   591   H HG22 . VAL B 2 18 ? 5.561   -3.980  -6.850  1.00 0.00 ? 18 VAL B HG22 1  
ATOM   592   H HG23 . VAL B 2 18 ? 4.302   -4.048  -8.083  1.00 0.00 ? 18 VAL B HG23 1  
ATOM   593   N N    . CYS B 2 19 ? 3.886   -8.765  -7.286  1.00 0.00 ? 19 CYS B N    1  
ATOM   594   C CA   . CYS B 2 19 ? 3.459   -10.064 -6.694  1.00 0.00 ? 19 CYS B CA   1  
ATOM   595   C C    . CYS B 2 19 ? 3.768   -11.204 -7.668  1.00 0.00 ? 19 CYS B C    1  
ATOM   596   O O    . CYS B 2 19 ? 4.606   -12.045 -7.406  1.00 0.00 ? 19 CYS B O    1  
ATOM   597   C CB   . CYS B 2 19 ? 1.957   -10.020 -6.409  1.00 0.00 ? 19 CYS B CB   1  
ATOM   598   S SG   . CYS B 2 19 ? 1.534   -8.413  -5.693  1.00 0.00 ? 19 CYS B SG   1  
ATOM   599   H H    . CYS B 2 19 ? 3.233   -8.196  -7.744  1.00 0.00 ? 19 CYS B H    1  
ATOM   600   H HA   . CYS B 2 19 ? 3.994   -10.229 -5.770  1.00 0.00 ? 19 CYS B HA   1  
ATOM   601   H HB2  . CYS B 2 19 ? 1.409   -10.162 -7.328  1.00 0.00 ? 19 CYS B HB2  1  
ATOM   602   H HB3  . CYS B 2 19 ? 1.700   -10.804 -5.712  1.00 0.00 ? 19 CYS B HB3  1  
ATOM   603   N N    . GLY B 2 20 ? 3.101   -11.244 -8.788  1.00 0.00 ? 20 GLY B N    1  
ATOM   604   C CA   . GLY B 2 20 ? 3.364   -12.335 -9.771  1.00 0.00 ? 20 GLY B CA   1  
ATOM   605   C C    . GLY B 2 20 ? 2.943   -13.677 -9.169  1.00 0.00 ? 20 GLY B C    1  
ATOM   606   O O    . GLY B 2 20 ? 1.975   -14.280 -9.588  1.00 0.00 ? 20 GLY B O    1  
ATOM   607   H H    . GLY B 2 20 ? 2.429   -10.558 -8.985  1.00 0.00 ? 20 GLY B H    1  
ATOM   608   H HA2  . GLY B 2 20 ? 2.799   -12.150 -10.673 1.00 0.00 ? 20 GLY B HA2  1  
ATOM   609   H HA3  . GLY B 2 20 ? 4.417   -12.363 -10.004 1.00 0.00 ? 20 GLY B HA3  1  
ATOM   610   N N    . GLU B 2 21 ? 3.664   -14.152 -8.190  1.00 0.00 ? 21 GLU B N    1  
ATOM   611   C CA   . GLU B 2 21 ? 3.304   -15.455 -7.563  1.00 0.00 ? 21 GLU B CA   1  
ATOM   612   C C    . GLU B 2 21 ? 2.014   -15.294 -6.758  1.00 0.00 ? 21 GLU B C    1  
ATOM   613   O O    . GLU B 2 21 ? 0.953   -15.713 -7.177  1.00 0.00 ? 21 GLU B O    1  
ATOM   614   C CB   . GLU B 2 21 ? 4.433   -15.905 -6.632  1.00 0.00 ? 21 GLU B CB   1  
ATOM   615   C CG   . GLU B 2 21 ? 5.100   -17.156 -7.205  1.00 0.00 ? 21 GLU B CG   1  
ATOM   616   C CD   . GLU B 2 21 ? 6.561   -17.207 -6.756  1.00 0.00 ? 21 GLU B CD   1  
ATOM   617   O OE1  . GLU B 2 21 ? 7.375   -16.545 -7.379  1.00 0.00 ? 21 GLU B OE1  1  
ATOM   618   O OE2  . GLU B 2 21 ? 6.841   -17.907 -5.797  1.00 0.00 ? 21 GLU B OE2  1  
ATOM   619   H H    . GLU B 2 21 ? 4.442   -13.651 -7.865  1.00 0.00 ? 21 GLU B H    1  
ATOM   620   H HA   . GLU B 2 21 ? 3.157   -16.196 -8.335  1.00 0.00 ? 21 GLU B HA   1  
ATOM   621   H HB2  . GLU B 2 21 ? 5.164   -15.114 -6.545  1.00 0.00 ? 21 GLU B HB2  1  
ATOM   622   H HB3  . GLU B 2 21 ? 4.027   -16.129 -5.657  1.00 0.00 ? 21 GLU B HB3  1  
ATOM   623   H HG2  . GLU B 2 21 ? 4.582   -18.035 -6.849  1.00 0.00 ? 21 GLU B HG2  1  
ATOM   624   H HG3  . GLU B 2 21 ? 5.057   -17.125 -8.283  1.00 0.00 ? 21 GLU B HG3  1  
ATOM   625   N N    . ARG B 2 22 ? 2.097   -14.689 -5.606  1.00 0.00 ? 22 ARG B N    1  
ATOM   626   C CA   . ARG B 2 22 ? 0.875   -14.500 -4.774  1.00 0.00 ? 22 ARG B CA   1  
ATOM   627   C C    . ARG B 2 22 ? -0.229  -13.876 -5.628  1.00 0.00 ? 22 ARG B C    1  
ATOM   628   O O    . ARG B 2 22 ? -1.403  -14.053 -5.370  1.00 0.00 ? 22 ARG B O    1  
ATOM   629   C CB   . ARG B 2 22 ? 1.197   -13.571 -3.602  1.00 0.00 ? 22 ARG B CB   1  
ATOM   630   C CG   . ARG B 2 22 ? 0.975   -14.313 -2.283  1.00 0.00 ? 22 ARG B CG   1  
ATOM   631   C CD   . ARG B 2 22 ? 2.209   -14.149 -1.393  1.00 0.00 ? 22 ARG B CD   1  
ATOM   632   N NE   . ARG B 2 22 ? 1.987   -14.854 -0.100  1.00 0.00 ? 22 ARG B NE   1  
ATOM   633   C CZ   . ARG B 2 22 ? 2.445   -14.341 1.010   1.00 0.00 ? 22 ARG B CZ   1  
ATOM   634   N NH1  . ARG B 2 22 ? 3.396   -13.448 0.972   1.00 0.00 ? 22 ARG B NH1  1  
ATOM   635   N NH2  . ARG B 2 22 ? 1.950   -14.718 2.158   1.00 0.00 ? 22 ARG B NH2  1  
ATOM   636   H H    . ARG B 2 22 ? 2.962   -14.359 -5.287  1.00 0.00 ? 22 ARG B H    1  
ATOM   637   H HA   . ARG B 2 22 ? 0.544   -15.457 -4.396  1.00 0.00 ? 22 ARG B HA   1  
ATOM   638   H HB2  . ARG B 2 22 ? 2.227   -13.253 -3.668  1.00 0.00 ? 22 ARG B HB2  1  
ATOM   639   H HB3  . ARG B 2 22 ? 0.549   -12.707 -3.639  1.00 0.00 ? 22 ARG B HB3  1  
ATOM   640   H HG2  . ARG B 2 22 ? 0.111   -13.903 -1.780  1.00 0.00 ? 22 ARG B HG2  1  
ATOM   641   H HG3  . ARG B 2 22 ? 0.814   -15.362 -2.481  1.00 0.00 ? 22 ARG B HG3  1  
ATOM   642   H HD2  . ARG B 2 22 ? 3.070   -14.571 -1.890  1.00 0.00 ? 22 ARG B HD2  1  
ATOM   643   H HD3  . ARG B 2 22 ? 2.381   -13.099 -1.206  1.00 0.00 ? 22 ARG B HD3  1  
ATOM   644   H HE   . ARG B 2 22 ? 1.498   -15.703 -0.082  1.00 0.00 ? 22 ARG B HE   1  
ATOM   645   H HH11 . ARG B 2 22 ? 3.774   -13.158 0.092   1.00 0.00 ? 22 ARG B HH11 1  
ATOM   646   H HH12 . ARG B 2 22 ? 3.747   -13.055 1.820   1.00 0.00 ? 22 ARG B HH12 1  
ATOM   647   H HH21 . ARG B 2 22 ? 1.220   -15.400 2.187   1.00 0.00 ? 22 ARG B HH21 1  
ATOM   648   H HH22 . ARG B 2 22 ? 2.301   -14.323 3.007   1.00 0.00 ? 22 ARG B HH22 1  
ATOM   649   N N    . GLY B 2 23 ? 0.137   -13.144 -6.644  1.00 0.00 ? 23 GLY B N    1  
ATOM   650   C CA   . GLY B 2 23 ? -0.890  -12.507 -7.513  1.00 0.00 ? 23 GLY B CA   1  
ATOM   651   C C    . GLY B 2 23 ? -1.323  -11.178 -6.893  1.00 0.00 ? 23 GLY B C    1  
ATOM   652   O O    . GLY B 2 23 ? -0.665  -10.645 -6.023  1.00 0.00 ? 23 GLY B O    1  
ATOM   653   H H    . GLY B 2 23 ? 1.089   -13.011 -6.835  1.00 0.00 ? 23 GLY B H    1  
ATOM   654   H HA2  . GLY B 2 23 ? -0.471  -12.330 -8.494  1.00 0.00 ? 23 GLY B HA2  1  
ATOM   655   H HA3  . GLY B 2 23 ? -1.746  -13.158 -7.598  1.00 0.00 ? 23 GLY B HA3  1  
ATOM   656   N N    . PHE B 2 24 ? -2.431  -10.645 -7.328  1.00 0.00 ? 24 PHE B N    1  
ATOM   657   C CA   . PHE B 2 24 ? -2.912  -9.350  -6.759  1.00 0.00 ? 24 PHE B CA   1  
ATOM   658   C C    . PHE B 2 24 ? -4.175  -8.902  -7.506  1.00 0.00 ? 24 PHE B C    1  
ATOM   659   O O    . PHE B 2 24 ? -4.464  -9.366  -8.590  1.00 0.00 ? 24 PHE B O    1  
ATOM   660   C CB   . PHE B 2 24 ? -1.799  -8.283  -6.875  1.00 0.00 ? 24 PHE B CB   1  
ATOM   661   C CG   . PHE B 2 24 ? -1.996  -7.413  -8.113  1.00 0.00 ? 24 PHE B CG   1  
ATOM   662   C CD1  . PHE B 2 24 ? -1.563  -7.864  -9.369  1.00 0.00 ? 24 PHE B CD1  1  
ATOM   663   C CD2  . PHE B 2 24 ? -2.617  -6.153  -8.004  1.00 0.00 ? 24 PHE B CD2  1  
ATOM   664   C CE1  . PHE B 2 24 ? -1.746  -7.067  -10.506 1.00 0.00 ? 24 PHE B CE1  1  
ATOM   665   C CE2  . PHE B 2 24 ? -2.798  -5.360  -9.144  1.00 0.00 ? 24 PHE B CE2  1  
ATOM   666   C CZ   . PHE B 2 24 ? -2.363  -5.816  -10.394 1.00 0.00 ? 24 PHE B CZ   1  
ATOM   667   H H    . PHE B 2 24 ? -2.951  -11.100 -8.026  1.00 0.00 ? 24 PHE B H    1  
ATOM   668   H HA   . PHE B 2 24 ? -3.156  -9.494  -5.717  1.00 0.00 ? 24 PHE B HA   1  
ATOM   669   H HB2  . PHE B 2 24 ? -1.823  -7.655  -5.996  1.00 0.00 ? 24 PHE B HB2  1  
ATOM   670   H HB3  . PHE B 2 24 ? -0.835  -8.779  -6.929  1.00 0.00 ? 24 PHE B HB3  1  
ATOM   671   H HD1  . PHE B 2 24 ? -1.088  -8.823  -9.462  1.00 0.00 ? 24 PHE B HD1  1  
ATOM   672   H HD2  . PHE B 2 24 ? -2.955  -5.792  -7.043  1.00 0.00 ? 24 PHE B HD2  1  
ATOM   673   H HE1  . PHE B 2 24 ? -1.411  -7.417  -11.471 1.00 0.00 ? 24 PHE B HE1  1  
ATOM   674   H HE2  . PHE B 2 24 ? -3.274  -4.394  -9.058  1.00 0.00 ? 24 PHE B HE2  1  
ATOM   675   H HZ   . PHE B 2 24 ? -2.504  -5.203  -11.271 1.00 0.00 ? 24 PHE B HZ   1  
ATOM   676   N N    . PHE B 2 25 ? -4.921  -7.999  -6.934  1.00 0.00 ? 25 PHE B N    1  
ATOM   677   C CA   . PHE B 2 25 ? -6.157  -7.518  -7.612  1.00 0.00 ? 25 PHE B CA   1  
ATOM   678   C C    . PHE B 2 25 ? -6.364  -6.037  -7.294  1.00 0.00 ? 25 PHE B C    1  
ATOM   679   O O    . PHE B 2 25 ? -6.480  -5.649  -6.149  1.00 0.00 ? 25 PHE B O    1  
ATOM   680   C CB   . PHE B 2 25 ? -7.362  -8.322  -7.117  1.00 0.00 ? 25 PHE B CB   1  
ATOM   681   C CG   . PHE B 2 25 ? -7.164  -8.691  -5.666  1.00 0.00 ? 25 PHE B CG   1  
ATOM   682   C CD1  . PHE B 2 25 ? -6.412  -9.824  -5.327  1.00 0.00 ? 25 PHE B CD1  1  
ATOM   683   C CD2  . PHE B 2 25 ? -7.734  -7.901  -4.658  1.00 0.00 ? 25 PHE B CD2  1  
ATOM   684   C CE1  . PHE B 2 25 ? -6.231  -10.166 -3.980  1.00 0.00 ? 25 PHE B CE1  1  
ATOM   685   C CE2  . PHE B 2 25 ? -7.551  -8.243  -3.313  1.00 0.00 ? 25 PHE B CE2  1  
ATOM   686   C CZ   . PHE B 2 25 ? -6.800  -9.376  -2.973  1.00 0.00 ? 25 PHE B CZ   1  
ATOM   687   H H    . PHE B 2 25 ? -4.668  -7.634  -6.061  1.00 0.00 ? 25 PHE B H    1  
ATOM   688   H HA   . PHE B 2 25 ? -6.055  -7.645  -8.679  1.00 0.00 ? 25 PHE B HA   1  
ATOM   689   H HB2  . PHE B 2 25 ? -8.257  -7.724  -7.217  1.00 0.00 ? 25 PHE B HB2  1  
ATOM   690   H HB3  . PHE B 2 25 ? -7.462  -9.220  -7.706  1.00 0.00 ? 25 PHE B HB3  1  
ATOM   691   H HD1  . PHE B 2 25 ? -5.974  -10.433 -6.104  1.00 0.00 ? 25 PHE B HD1  1  
ATOM   692   H HD2  . PHE B 2 25 ? -8.313  -7.028  -4.920  1.00 0.00 ? 25 PHE B HD2  1  
ATOM   693   H HE1  . PHE B 2 25 ? -5.652  -11.040 -3.718  1.00 0.00 ? 25 PHE B HE1  1  
ATOM   694   H HE2  . PHE B 2 25 ? -7.990  -7.635  -2.537  1.00 0.00 ? 25 PHE B HE2  1  
ATOM   695   H HZ   . PHE B 2 25 ? -6.660  -9.640  -1.935  1.00 0.00 ? 25 PHE B HZ   1  
ATOM   696   N N    . TYR B 2 26 ? -6.409  -5.207  -8.300  1.00 0.00 ? 26 TYR B N    1  
ATOM   697   C CA   . TYR B 2 26 ? -6.607  -3.750  -8.054  1.00 0.00 ? 26 TYR B CA   1  
ATOM   698   C C    . TYR B 2 26 ? -7.704  -3.559  -7.006  1.00 0.00 ? 26 TYR B C    1  
ATOM   699   O O    . TYR B 2 26 ? -8.673  -4.292  -6.967  1.00 0.00 ? 26 TYR B O    1  
ATOM   700   C CB   . TYR B 2 26 ? -7.017  -3.061  -9.357  1.00 0.00 ? 26 TYR B CB   1  
ATOM   701   C CG   . TYR B 2 26 ? -6.316  -1.729  -9.462  1.00 0.00 ? 26 TYR B CG   1  
ATOM   702   C CD1  . TYR B 2 26 ? -4.928  -1.651  -9.281  1.00 0.00 ? 26 TYR B CD1  1  
ATOM   703   C CD2  . TYR B 2 26 ? -7.052  -0.570  -9.737  1.00 0.00 ? 26 TYR B CD2  1  
ATOM   704   C CE1  . TYR B 2 26 ? -4.278  -0.414  -9.376  1.00 0.00 ? 26 TYR B CE1  1  
ATOM   705   C CE2  . TYR B 2 26 ? -6.402  0.668   -9.833  1.00 0.00 ? 26 TYR B CE2  1  
ATOM   706   C CZ   . TYR B 2 26 ? -5.014  0.746   -9.652  1.00 0.00 ? 26 TYR B CZ   1  
ATOM   707   O OH   . TYR B 2 26 ? -4.373  1.964   -9.744  1.00 0.00 ? 26 TYR B OH   1  
ATOM   708   H H    . TYR B 2 26 ? -6.313  -5.540  -9.216  1.00 0.00 ? 26 TYR B H    1  
ATOM   709   H HA   . TYR B 2 26 ? -5.686  -3.319  -7.692  1.00 0.00 ? 26 TYR B HA   1  
ATOM   710   H HB2  . TYR B 2 26 ? -6.739  -3.683  -10.195 1.00 0.00 ? 26 TYR B HB2  1  
ATOM   711   H HB3  . TYR B 2 26 ? -8.086  -2.907  -9.362  1.00 0.00 ? 26 TYR B HB3  1  
ATOM   712   H HD1  . TYR B 2 26 ? -4.361  -2.545  -9.069  1.00 0.00 ? 26 TYR B HD1  1  
ATOM   713   H HD2  . TYR B 2 26 ? -8.122  -0.629  -9.878  1.00 0.00 ? 26 TYR B HD2  1  
ATOM   714   H HE1  . TYR B 2 26 ? -3.208  -0.353  -9.238  1.00 0.00 ? 26 TYR B HE1  1  
ATOM   715   H HE2  . TYR B 2 26 ? -6.969  1.562   -10.045 1.00 0.00 ? 26 TYR B HE2  1  
ATOM   716   H HH   . TYR B 2 26 ? -3.881  1.980   -10.568 1.00 0.00 ? 26 TYR B HH   1  
ATOM   717   N N    . THR B 2 27 ? -7.559  -2.584  -6.152  1.00 0.00 ? 27 THR B N    1  
ATOM   718   C CA   . THR B 2 27 ? -8.594  -2.353  -5.107  1.00 0.00 ? 27 THR B CA   1  
ATOM   719   C C    . THR B 2 27 ? -9.221  -0.971  -5.301  1.00 0.00 ? 27 THR B C    1  
ATOM   720   O O    . THR B 2 27 ? -8.590  -0.055  -5.790  1.00 0.00 ? 27 THR B O    1  
ATOM   721   C CB   . THR B 2 27 ? -7.948  -2.434  -3.722  1.00 0.00 ? 27 THR B CB   1  
ATOM   722   O OG1  . THR B 2 27 ? -7.195  -1.253  -3.483  1.00 0.00 ? 27 THR B OG1  1  
ATOM   723   C CG2  . THR B 2 27 ? -7.025  -3.651  -3.658  1.00 0.00 ? 27 THR B CG2  1  
ATOM   724   H H    . THR B 2 27 ? -6.769  -2.004  -6.197  1.00 0.00 ? 27 THR B H    1  
ATOM   725   H HA   . THR B 2 27 ? -9.360  -3.109  -5.189  1.00 0.00 ? 27 THR B HA   1  
ATOM   726   H HB   . THR B 2 27 ? -8.716  -2.530  -2.971  1.00 0.00 ? 27 THR B HB   1  
ATOM   727   H HG1  . THR B 2 27 ? -6.438  -1.489  -2.942  1.00 0.00 ? 27 THR B HG1  1  
ATOM   728   H HG21 . THR B 2 27 ? -6.553  -3.797  -4.619  1.00 0.00 ? 27 THR B HG21 1  
ATOM   729   H HG22 . THR B 2 27 ? -7.602  -4.528  -3.403  1.00 0.00 ? 27 THR B HG22 1  
ATOM   730   H HG23 . THR B 2 27 ? -6.266  -3.489  -2.907  1.00 0.00 ? 27 THR B HG23 1  
ATOM   731   N N    . LYS B 2 28 ? -10.459 -0.816  -4.919  1.00 0.00 ? 28 LYS B N    1  
ATOM   732   C CA   . LYS B 2 28 ? -11.129 0.504   -5.078  1.00 0.00 ? 28 LYS B CA   1  
ATOM   733   C C    . LYS B 2 28 ? -11.872 0.853   -3.785  1.00 0.00 ? 28 LYS B C    1  
ATOM   734   O O    . LYS B 2 28 ? -13.072 0.691   -3.699  1.00 0.00 ? 28 LYS B O    1  
ATOM   735   C CB   . LYS B 2 28 ? -12.127 0.433   -6.237  1.00 0.00 ? 28 LYS B CB   1  
ATOM   736   C CG   . LYS B 2 28 ? -11.383 0.597   -7.564  1.00 0.00 ? 28 LYS B CG   1  
ATOM   737   C CD   . LYS B 2 28 ? -12.367 1.041   -8.647  1.00 0.00 ? 28 LYS B CD   1  
ATOM   738   C CE   . LYS B 2 28 ? -12.496 -0.057  -9.704  1.00 0.00 ? 28 LYS B CE   1  
ATOM   739   N NZ   . LYS B 2 28 ? -12.665 0.563   -11.048 1.00 0.00 ? 28 LYS B NZ   1  
ATOM   740   H H    . LYS B 2 28 ? -10.948 -1.569  -4.526  1.00 0.00 ? 28 LYS B H    1  
ATOM   741   H HA   . LYS B 2 28 ? -10.389 1.262   -5.285  1.00 0.00 ? 28 LYS B HA   1  
ATOM   742   H HB2  . LYS B 2 28 ? -12.629 -0.524  -6.221  1.00 0.00 ? 28 LYS B HB2  1  
ATOM   743   H HB3  . LYS B 2 28 ? -12.855 1.223   -6.135  1.00 0.00 ? 28 LYS B HB3  1  
ATOM   744   H HG2  . LYS B 2 28 ? -10.608 1.342   -7.452  1.00 0.00 ? 28 LYS B HG2  1  
ATOM   745   H HG3  . LYS B 2 28 ? -10.939 -0.345  -7.848  1.00 0.00 ? 28 LYS B HG3  1  
ATOM   746   H HD2  . LYS B 2 28 ? -13.332 1.229   -8.201  1.00 0.00 ? 28 LYS B HD2  1  
ATOM   747   H HD3  . LYS B 2 28 ? -12.005 1.945   -9.114  1.00 0.00 ? 28 LYS B HD3  1  
ATOM   748   H HE2  . LYS B 2 28 ? -11.606 -0.669  -9.698  1.00 0.00 ? 28 LYS B HE2  1  
ATOM   749   H HE3  . LYS B 2 28 ? -13.356 -0.671  -9.480  1.00 0.00 ? 28 LYS B HE3  1  
ATOM   750   H HZ1  . LYS B 2 28 ? -13.448 0.098   -11.550 1.00 0.00 ? 28 LYS B HZ1  1  
ATOM   751   H HZ2  . LYS B 2 28 ? -11.786 0.450   -11.594 1.00 0.00 ? 28 LYS B HZ2  1  
ATOM   752   H HZ3  . LYS B 2 28 ? -12.878 1.575   -10.939 1.00 0.00 ? 28 LYS B HZ3  1  
ATOM   753   N N    . PRO B 2 29 ? -11.130 1.324   -2.815  1.00 0.00 ? 29 PRO B N    1  
ATOM   754   C CA   . PRO B 2 29 ? -11.686 1.708   -1.505  1.00 0.00 ? 29 PRO B CA   1  
ATOM   755   C C    . PRO B 2 29 ? -12.385 3.065   -1.599  1.00 0.00 ? 29 PRO B C    1  
ATOM   756   O O    . PRO B 2 29 ? -11.883 3.995   -2.199  1.00 0.00 ? 29 PRO B O    1  
ATOM   757   C CB   . PRO B 2 29 ? -10.453 1.789   -0.602  1.00 0.00 ? 29 PRO B CB   1  
ATOM   758   C CG   . PRO B 2 29 ? -9.241  2.007   -1.538  1.00 0.00 ? 29 PRO B CG   1  
ATOM   759   C CD   . PRO B 2 29 ? -9.670  1.520   -2.934  1.00 0.00 ? 29 PRO B CD   1  
ATOM   760   H HA   . PRO B 2 29 ? -12.363 0.952   -1.140  1.00 0.00 ? 29 PRO B HA   1  
ATOM   761   H HB2  . PRO B 2 29 ? -10.552 2.619   0.085   1.00 0.00 ? 29 PRO B HB2  1  
ATOM   762   H HB3  . PRO B 2 29 ? -10.331 0.867   -0.057  1.00 0.00 ? 29 PRO B HB3  1  
ATOM   763   H HG2  . PRO B 2 29 ? -8.985  3.057   -1.570  1.00 0.00 ? 29 PRO B HG2  1  
ATOM   764   H HG3  . PRO B 2 29 ? -8.397  1.429   -1.194  1.00 0.00 ? 29 PRO B HG3  1  
ATOM   765   H HD2  . PRO B 2 29 ? -9.445  2.270   -3.680  1.00 0.00 ? 29 PRO B HD2  1  
ATOM   766   H HD3  . PRO B 2 29 ? -9.188  0.586   -3.175  1.00 0.00 ? 29 PRO B HD3  1  
ATOM   767   N N    . THR B 2 30 ? -13.542 3.187   -1.009  1.00 0.00 ? 30 THR B N    1  
ATOM   768   C CA   . THR B 2 30 ? -14.272 4.483   -1.063  1.00 0.00 ? 30 THR B CA   1  
ATOM   769   C C    . THR B 2 30 ? -13.331 5.616   -0.649  1.00 0.00 ? 30 THR B C    1  
ATOM   770   O O    . THR B 2 30 ? -13.293 6.614   -1.350  1.00 0.00 ? 30 THR B O    1  
ATOM   771   C CB   . THR B 2 30 ? -15.464 4.434   -0.105  1.00 0.00 ? 30 THR B CB   1  
ATOM   772   O OG1  . THR B 2 30 ? -16.000 5.741   0.047   1.00 0.00 ? 30 THR B OG1  1  
ATOM   773   C CG2  . THR B 2 30 ? -15.006 3.905   1.254   1.00 0.00 ? 30 THR B CG2  1  
ATOM   774   O OXT  . THR B 2 30 ? -12.664 5.465   0.361   1.00 0.00 ? 30 THR B OXT  1  
ATOM   775   H H    . THR B 2 30 ? -13.930 2.425   -0.530  1.00 0.00 ? 30 THR B H    1  
ATOM   776   H HA   . THR B 2 30 ? -14.625 4.657   -2.069  1.00 0.00 ? 30 THR B HA   1  
ATOM   777   H HB   . THR B 2 30 ? -16.221 3.778   -0.505  1.00 0.00 ? 30 THR B HB   1  
ATOM   778   H HG1  . THR B 2 30 ? -16.837 5.775   -0.421  1.00 0.00 ? 30 THR B HG1  1  
ATOM   779   H HG21 . THR B 2 30 ? -15.725 3.189   1.623   1.00 0.00 ? 30 THR B HG21 1  
ATOM   780   H HG22 . THR B 2 30 ? -14.925 4.726   1.951   1.00 0.00 ? 30 THR B HG22 1  
ATOM   781   H HG23 . THR B 2 30 ? -14.044 3.427   1.148   1.00 0.00 ? 30 THR B HG23 1  
ATOM   782   N N    . GLY A 1 1  ? -6.925  4.531   0.405   1.00 0.00 ? 1  GLY A N    2  
ATOM   783   C CA   . GLY A 1 1  ? -6.305  3.163   0.120   1.00 0.00 ? 1  GLY A CA   2  
ATOM   784   C C    . GLY A 1 1  ? -4.966  3.087   -0.530  1.00 0.00 ? 1  GLY A C    2  
ATOM   785   O O    . GLY A 1 1  ? -3.952  3.359   0.081   1.00 0.00 ? 1  GLY A O    2  
ATOM   786   H H1   . GLY A 1 1  ? -7.901  4.406   0.744   1.00 0.00 ? 1  GLY A H1   2  
ATOM   787   H H2   . GLY A 1 1  ? -6.930  5.097   -0.467  1.00 0.00 ? 1  GLY A H2   2  
ATOM   788   H H3   . GLY A 1 1  ? -6.367  5.019   1.133   1.00 0.00 ? 1  GLY A H3   2  
ATOM   789   H HA2  . GLY A 1 1  ? -5.828  2.819   0.899   1.00 0.00 ? 1  GLY A HA2  2  
ATOM   790   H HA3  . GLY A 1 1  ? -7.172  2.463   -0.229  1.00 0.00 ? 1  GLY A HA3  2  
HETATM 791   N N    . IIL A 1 2  ? -4.924  2.715   -1.780  1.00 0.00 ? 2  IIL A N    2  
HETATM 792   C CA   . IIL A 1 2  ? -3.615  2.619   -2.485  1.00 0.00 ? 2  IIL A CA   2  
HETATM 793   C C    . IIL A 1 2  ? -3.683  3.404   -3.796  1.00 0.00 ? 2  IIL A C    2  
HETATM 794   O O    . IIL A 1 2  ? -2.789  4.159   -4.127  1.00 0.00 ? 2  IIL A O    2  
HETATM 795   C CB   . IIL A 1 2  ? -3.308  1.152   -2.792  1.00 0.00 ? 2  IIL A CB   2  
HETATM 796   C CG2  . IIL A 1 2  ? -1.956  1.053   -3.498  1.00 0.00 ? 2  IIL A CG2  2  
HETATM 797   C CG1  . IIL A 1 2  ? -4.400  0.585   -3.702  1.00 0.00 ? 2  IIL A CG1  2  
HETATM 798   C CD1  . IIL A 1 2  ? -4.290  -0.940  -3.741  1.00 0.00 ? 2  IIL A CD1  2  
HETATM 799   H H    . IIL A 1 2  ? -5.754  2.500   -2.256  1.00 0.00 ? 2  IIL A H    2  
HETATM 800   H HA   . IIL A 1 2  ? -2.836  3.028   -1.859  1.00 0.00 ? 2  IIL A HA   2  
HETATM 801   H HB   . IIL A 1 2  ? -3.278  0.587   -1.872  1.00 0.00 ? 2  IIL A HB   2  
HETATM 802   H HG21 . IIL A 1 2  ? -1.184  1.445   -2.852  1.00 0.00 ? 2  IIL A HG21 2  
HETATM 803   H HG22 . IIL A 1 2  ? -1.984  1.626   -4.413  1.00 0.00 ? 2  IIL A HG22 2  
HETATM 804   H HG23 . IIL A 1 2  ? -1.743  0.020   -3.727  1.00 0.00 ? 2  IIL A HG23 2  
HETATM 805   H HG12 . IIL A 1 2  ? -4.278  0.978   -4.700  1.00 0.00 ? 2  IIL A HG12 2  
HETATM 806   H HG13 . IIL A 1 2  ? -5.370  0.868   -3.319  1.00 0.00 ? 2  IIL A HG13 2  
HETATM 807   H HD11 . IIL A 1 2  ? -4.629  -1.301  -4.701  1.00 0.00 ? 2  IIL A HD11 2  
HETATM 808   H HD12 . IIL A 1 2  ? -4.904  -1.365  -2.960  1.00 0.00 ? 2  IIL A HD12 2  
HETATM 809   H HD13 . IIL A 1 2  ? -3.262  -1.232  -3.588  1.00 0.00 ? 2  IIL A HD13 2  
ATOM   810   N N    . VAL A 1 3  ? -4.734  3.227   -4.547  1.00 0.00 ? 3  VAL A N    2  
ATOM   811   C CA   . VAL A 1 3  ? -4.859  3.957   -5.838  1.00 0.00 ? 3  VAL A CA   2  
ATOM   812   C C    . VAL A 1 3  ? -4.770  5.463   -5.591  1.00 0.00 ? 3  VAL A C    2  
ATOM   813   O O    . VAL A 1 3  ? -4.087  6.175   -6.296  1.00 0.00 ? 3  VAL A O    2  
ATOM   814   C CB   . VAL A 1 3  ? -6.206  3.621   -6.481  1.00 0.00 ? 3  VAL A CB   2  
ATOM   815   C CG1  . VAL A 1 3  ? -6.300  4.289   -7.853  1.00 0.00 ? 3  VAL A CG1  2  
ATOM   816   C CG2  . VAL A 1 3  ? -6.322  2.104   -6.648  1.00 0.00 ? 3  VAL A CG2  2  
ATOM   817   H H    . VAL A 1 3  ? -5.441  2.611   -4.263  1.00 0.00 ? 3  VAL A H    2  
ATOM   818   H HA   . VAL A 1 3  ? -4.060  3.654   -6.500  1.00 0.00 ? 3  VAL A HA   2  
ATOM   819   H HB   . VAL A 1 3  ? -7.006  3.978   -5.850  1.00 0.00 ? 3  VAL A HB   2  
ATOM   820   H HG11 . VAL A 1 3  ? -7.335  4.339   -8.159  1.00 0.00 ? 3  VAL A HG11 2  
ATOM   821   H HG12 . VAL A 1 3  ? -5.739  3.712   -8.574  1.00 0.00 ? 3  VAL A HG12 2  
ATOM   822   H HG13 . VAL A 1 3  ? -5.893  5.287   -7.795  1.00 0.00 ? 3  VAL A HG13 2  
ATOM   823   H HG21 . VAL A 1 3  ? -6.129  1.840   -7.677  1.00 0.00 ? 3  VAL A HG21 2  
ATOM   824   H HG22 . VAL A 1 3  ? -7.319  1.786   -6.376  1.00 0.00 ? 3  VAL A HG22 2  
ATOM   825   H HG23 . VAL A 1 3  ? -5.602  1.615   -6.009  1.00 0.00 ? 3  VAL A HG23 2  
ATOM   826   N N    . GLU A 1 4  ? -5.457  5.956   -4.599  1.00 0.00 ? 4  GLU A N    2  
ATOM   827   C CA   . GLU A 1 4  ? -5.413  7.419   -4.316  1.00 0.00 ? 4  GLU A CA   2  
ATOM   828   C C    . GLU A 1 4  ? -4.070  7.791   -3.677  1.00 0.00 ? 4  GLU A C    2  
ATOM   829   O O    . GLU A 1 4  ? -3.802  8.946   -3.411  1.00 0.00 ? 4  GLU A O    2  
ATOM   830   C CB   . GLU A 1 4  ? -6.549  7.783   -3.358  1.00 0.00 ? 4  GLU A CB   2  
ATOM   831   C CG   . GLU A 1 4  ? -7.854  7.926   -4.144  1.00 0.00 ? 4  GLU A CG   2  
ATOM   832   C CD   . GLU A 1 4  ? -8.681  9.074   -3.561  1.00 0.00 ? 4  GLU A CD   2  
ATOM   833   O OE1  . GLU A 1 4  ? -8.281  9.604   -2.538  1.00 0.00 ? 4  GLU A OE1  2  
ATOM   834   O OE2  . GLU A 1 4  ? -9.699  9.401   -4.147  1.00 0.00 ? 4  GLU A OE2  2  
ATOM   835   H H    . GLU A 1 4  ? -6.006  5.366   -4.041  1.00 0.00 ? 4  GLU A H    2  
ATOM   836   H HA   . GLU A 1 4  ? -5.534  7.966   -5.239  1.00 0.00 ? 4  GLU A HA   2  
ATOM   837   H HB2  . GLU A 1 4  ? -6.658  7.005   -2.617  1.00 0.00 ? 4  GLU A HB2  2  
ATOM   838   H HB3  . GLU A 1 4  ? -6.322  8.718   -2.868  1.00 0.00 ? 4  GLU A HB3  2  
ATOM   839   H HG2  . GLU A 1 4  ? -7.627  8.133   -5.180  1.00 0.00 ? 4  GLU A HG2  2  
ATOM   840   H HG3  . GLU A 1 4  ? -8.418  7.008   -4.076  1.00 0.00 ? 4  GLU A HG3  2  
ATOM   841   N N    . GLN A 1 5  ? -3.227  6.828   -3.417  1.00 0.00 ? 5  GLN A N    2  
ATOM   842   C CA   . GLN A 1 5  ? -1.914  7.145   -2.784  1.00 0.00 ? 5  GLN A CA   2  
ATOM   843   C C    . GLN A 1 5  ? -0.784  7.041   -3.816  1.00 0.00 ? 5  GLN A C    2  
ATOM   844   O O    . GLN A 1 5  ? -0.045  7.981   -4.036  1.00 0.00 ? 5  GLN A O    2  
ATOM   845   C CB   . GLN A 1 5  ? -1.653  6.160   -1.643  1.00 0.00 ? 5  GLN A CB   2  
ATOM   846   C CG   . GLN A 1 5  ? -0.232  6.358   -1.109  1.00 0.00 ? 5  GLN A CG   2  
ATOM   847   C CD   . GLN A 1 5  ? -0.183  7.615   -0.237  1.00 0.00 ? 5  GLN A CD   2  
ATOM   848   O OE1  . GLN A 1 5  ? -0.979  7.773   0.667   1.00 0.00 ? 5  GLN A OE1  2  
ATOM   849   N NE2  . GLN A 1 5  ? 0.726   8.522   -0.471  1.00 0.00 ? 5  GLN A NE2  2  
ATOM   850   H H    . GLN A 1 5  ? -3.458  5.900   -3.629  1.00 0.00 ? 5  GLN A H    2  
ATOM   851   H HA   . GLN A 1 5  ? -1.943  8.150   -2.387  1.00 0.00 ? 5  GLN A HA   2  
ATOM   852   H HB2  . GLN A 1 5  ? -2.365  6.333   -0.850  1.00 0.00 ? 5  GLN A HB2  2  
ATOM   853   H HB3  . GLN A 1 5  ? -1.759  5.149   -2.009  1.00 0.00 ? 5  GLN A HB3  2  
ATOM   854   H HG2  . GLN A 1 5  ? 0.051   5.498   -0.519  1.00 0.00 ? 5  GLN A HG2  2  
ATOM   855   H HG3  . GLN A 1 5  ? 0.454   6.469   -1.934  1.00 0.00 ? 5  GLN A HG3  2  
ATOM   856   H HE21 . GLN A 1 5  ? 1.369   8.395   -1.200  1.00 0.00 ? 5  GLN A HE21 2  
ATOM   857   H HE22 . GLN A 1 5  ? 0.767   9.329   0.083   1.00 0.00 ? 5  GLN A HE22 2  
ATOM   858   N N    . CYS A 1 6  ? -0.629  5.904   -4.435  1.00 0.00 ? 6  CYS A N    2  
ATOM   859   C CA   . CYS A 1 6  ? 0.468   5.747   -5.433  1.00 0.00 ? 6  CYS A CA   2  
ATOM   860   C C    . CYS A 1 6  ? 0.115   6.494   -6.720  1.00 0.00 ? 6  CYS A C    2  
ATOM   861   O O    . CYS A 1 6  ? 0.961   6.722   -7.568  1.00 0.00 ? 6  CYS A O    2  
ATOM   862   C CB   . CYS A 1 6  ? 0.668   4.261   -5.741  1.00 0.00 ? 6  CYS A CB   2  
ATOM   863   S SG   . CYS A 1 6  ? 0.917   3.356   -4.193  1.00 0.00 ? 6  CYS A SG   2  
ATOM   864   H H    . CYS A 1 6  ? -1.224  5.151   -4.237  1.00 0.00 ? 6  CYS A H    2  
ATOM   865   H HA   . CYS A 1 6  ? 1.383   6.152   -5.026  1.00 0.00 ? 6  CYS A HA   2  
ATOM   866   H HB2  . CYS A 1 6  ? -0.203  3.878   -6.247  1.00 0.00 ? 6  CYS A HB2  2  
ATOM   867   H HB3  . CYS A 1 6  ? 1.534   4.137   -6.373  1.00 0.00 ? 6  CYS A HB3  2  
ATOM   868   N N    . CYS A 1 7  ? -1.124  6.879   -6.880  1.00 0.00 ? 7  CYS A N    2  
ATOM   869   C CA   . CYS A 1 7  ? -1.512  7.611   -8.117  1.00 0.00 ? 7  CYS A CA   2  
ATOM   870   C C    . CYS A 1 7  ? -1.578  9.111   -7.823  1.00 0.00 ? 7  CYS A C    2  
ATOM   871   O O    . CYS A 1 7  ? -1.506  9.930   -8.718  1.00 0.00 ? 7  CYS A O    2  
ATOM   872   C CB   . CYS A 1 7  ? -2.878  7.119   -8.607  1.00 0.00 ? 7  CYS A CB   2  
ATOM   873   S SG   . CYS A 1 7  ? -3.272  7.852   -10.218 1.00 0.00 ? 7  CYS A SG   2  
ATOM   874   H H    . CYS A 1 7  ? -1.792  6.689   -6.189  1.00 0.00 ? 7  CYS A H    2  
ATOM   875   H HA   . CYS A 1 7  ? -0.769  7.428   -8.874  1.00 0.00 ? 7  CYS A HA   2  
ATOM   876   H HB2  . CYS A 1 7  ? -2.860  6.044   -8.699  1.00 0.00 ? 7  CYS A HB2  2  
ATOM   877   H HB3  . CYS A 1 7  ? -3.633  7.404   -7.894  1.00 0.00 ? 7  CYS A HB3  2  
ATOM   878   N N    . THR A 1 8  ? -1.704  9.481   -6.577  1.00 0.00 ? 8  THR A N    2  
ATOM   879   C CA   . THR A 1 8  ? -1.760  10.930  -6.238  1.00 0.00 ? 8  THR A CA   2  
ATOM   880   C C    . THR A 1 8  ? -0.332  11.471  -6.175  1.00 0.00 ? 8  THR A C    2  
ATOM   881   O O    . THR A 1 8  ? -0.095  12.656  -6.299  1.00 0.00 ? 8  THR A O    2  
ATOM   882   C CB   . THR A 1 8  ? -2.444  11.120  -4.880  1.00 0.00 ? 8  THR A CB   2  
ATOM   883   O OG1  . THR A 1 8  ? -2.750  12.495  -4.697  1.00 0.00 ? 8  THR A OG1  2  
ATOM   884   C CG2  . THR A 1 8  ? -1.510  10.652  -3.764  1.00 0.00 ? 8  THR A CG2  2  
ATOM   885   H H    . THR A 1 8  ? -1.753  8.807   -5.867  1.00 0.00 ? 8  THR A H    2  
ATOM   886   H HA   . THR A 1 8  ? -2.313  11.459  -7.001  1.00 0.00 ? 8  THR A HA   2  
ATOM   887   H HB   . THR A 1 8  ? -3.353  10.540  -4.850  1.00 0.00 ? 8  THR A HB   2  
ATOM   888   H HG1  . THR A 1 8  ? -3.412  12.740  -5.348  1.00 0.00 ? 8  THR A HG1  2  
ATOM   889   H HG21 . THR A 1 8  ? -2.094  10.237  -2.955  1.00 0.00 ? 8  THR A HG21 2  
ATOM   890   H HG22 . THR A 1 8  ? -0.934  11.490  -3.400  1.00 0.00 ? 8  THR A HG22 2  
ATOM   891   H HG23 . THR A 1 8  ? -0.841  9.897   -4.148  1.00 0.00 ? 8  THR A HG23 2  
ATOM   892   N N    . SER A 1 9  ? 0.622   10.600  -5.988  1.00 0.00 ? 9  SER A N    2  
ATOM   893   C CA   . SER A 1 9  ? 2.042   11.039  -5.921  1.00 0.00 ? 9  SER A CA   2  
ATOM   894   C C    . SER A 1 9  ? 2.943   9.867   -6.312  1.00 0.00 ? 9  SER A C    2  
ATOM   895   O O    . SER A 1 9  ? 2.525   8.960   -7.003  1.00 0.00 ? 9  SER A O    2  
ATOM   896   C CB   . SER A 1 9  ? 2.374   11.482  -4.495  1.00 0.00 ? 9  SER A CB   2  
ATOM   897   O OG   . SER A 1 9  ? 1.213   12.039  -3.894  1.00 0.00 ? 9  SER A OG   2  
ATOM   898   H H    . SER A 1 9  ? 0.402   9.650   -5.895  1.00 0.00 ? 9  SER A H    2  
ATOM   899   H HA   . SER A 1 9  ? 2.200   11.863  -6.602  1.00 0.00 ? 9  SER A HA   2  
ATOM   900   H HB2  . SER A 1 9  ? 2.698   10.631  -3.920  1.00 0.00 ? 9  SER A HB2  2  
ATOM   901   H HB3  . SER A 1 9  ? 3.166   12.217  -4.523  1.00 0.00 ? 9  SER A HB3  2  
ATOM   902   H HG   . SER A 1 9  ? 1.484   12.805  -3.382  1.00 0.00 ? 9  SER A HG   2  
ATOM   903   N N    . ILE A 1 10 ? 4.171   9.871   -5.875  1.00 0.00 ? 10 ILE A N    2  
ATOM   904   C CA   . ILE A 1 10 ? 5.081   8.746   -6.226  1.00 0.00 ? 10 ILE A CA   2  
ATOM   905   C C    . ILE A 1 10 ? 4.908   7.624   -5.200  1.00 0.00 ? 10 ILE A C    2  
ATOM   906   O O    . ILE A 1 10 ? 4.668   7.865   -4.033  1.00 0.00 ? 10 ILE A O    2  
ATOM   907   C CB   . ILE A 1 10 ? 6.531   9.244   -6.233  1.00 0.00 ? 10 ILE A CB   2  
ATOM   908   C CG1  . ILE A 1 10 ? 6.796   9.987   -7.548  1.00 0.00 ? 10 ILE A CG1  2  
ATOM   909   C CG2  . ILE A 1 10 ? 7.491   8.054   -6.114  1.00 0.00 ? 10 ILE A CG2  2  
ATOM   910   C CD1  . ILE A 1 10 ? 8.301   10.158  -7.759  1.00 0.00 ? 10 ILE A CD1  2  
ATOM   911   H H    . ILE A 1 10 ? 4.493   10.608  -5.314  1.00 0.00 ? 10 ILE A H    2  
ATOM   912   H HA   . ILE A 1 10 ? 4.824   8.374   -7.208  1.00 0.00 ? 10 ILE A HA   2  
ATOM   913   H HB   . ILE A 1 10 ? 6.685   9.915   -5.400  1.00 0.00 ? 10 ILE A HB   2  
ATOM   914   H HG12 . ILE A 1 10 ? 6.380   9.421   -8.368  1.00 0.00 ? 10 ILE A HG12 2  
ATOM   915   H HG13 . ILE A 1 10 ? 6.327   10.959  -7.509  1.00 0.00 ? 10 ILE A HG13 2  
ATOM   916   H HG21 . ILE A 1 10 ? 8.508   8.416   -6.070  1.00 0.00 ? 10 ILE A HG21 2  
ATOM   917   H HG22 . ILE A 1 10 ? 7.374   7.410   -6.973  1.00 0.00 ? 10 ILE A HG22 2  
ATOM   918   H HG23 . ILE A 1 10 ? 7.267   7.499   -5.215  1.00 0.00 ? 10 ILE A HG23 2  
ATOM   919   H HD11 . ILE A 1 10 ? 8.767   10.448  -6.828  1.00 0.00 ? 10 ILE A HD11 2  
ATOM   920   H HD12 . ILE A 1 10 ? 8.475   10.923  -8.502  1.00 0.00 ? 10 ILE A HD12 2  
ATOM   921   H HD13 . ILE A 1 10 ? 8.726   9.224   -8.098  1.00 0.00 ? 10 ILE A HD13 2  
ATOM   922   N N    . CYS A 1 11 ? 5.019   6.396   -5.627  1.00 0.00 ? 11 CYS A N    2  
ATOM   923   C CA   . CYS A 1 11 ? 4.853   5.257   -4.682  1.00 0.00 ? 11 CYS A CA   2  
ATOM   924   C C    . CYS A 1 11 ? 6.053   4.317   -4.787  1.00 0.00 ? 11 CYS A C    2  
ATOM   925   O O    . CYS A 1 11 ? 6.744   4.284   -5.785  1.00 0.00 ? 11 CYS A O    2  
ATOM   926   C CB   . CYS A 1 11 ? 3.581   4.488   -5.039  1.00 0.00 ? 11 CYS A CB   2  
ATOM   927   S SG   . CYS A 1 11 ? 2.706   4.016   -3.527  1.00 0.00 ? 11 CYS A SG   2  
ATOM   928   H H    . CYS A 1 11 ? 5.206   6.224   -6.574  1.00 0.00 ? 11 CYS A H    2  
ATOM   929   H HA   . CYS A 1 11 ? 4.775   5.633   -3.672  1.00 0.00 ? 11 CYS A HA   2  
ATOM   930   H HB2  . CYS A 1 11 ? 2.941   5.113   -5.645  1.00 0.00 ? 11 CYS A HB2  2  
ATOM   931   H HB3  . CYS A 1 11 ? 3.844   3.599   -5.594  1.00 0.00 ? 11 CYS A HB3  2  
ATOM   932   N N    . SER A 1 12 ? 6.298   3.545   -3.766  1.00 0.00 ? 12 SER A N    2  
ATOM   933   C CA   . SER A 1 12 ? 7.446   2.597   -3.806  1.00 0.00 ? 12 SER A CA   2  
ATOM   934   C C    . SER A 1 12 ? 6.916   1.178   -4.012  1.00 0.00 ? 12 SER A C    2  
ATOM   935   O O    . SER A 1 12 ? 5.829   0.843   -3.585  1.00 0.00 ? 12 SER A O    2  
ATOM   936   C CB   . SER A 1 12 ? 8.216   2.671   -2.487  1.00 0.00 ? 12 SER A CB   2  
ATOM   937   O OG   . SER A 1 12 ? 7.333   3.083   -1.451  1.00 0.00 ? 12 SER A OG   2  
ATOM   938   H H    . SER A 1 12 ? 5.723   3.583   -2.973  1.00 0.00 ? 12 SER A H    2  
ATOM   939   H HA   . SER A 1 12 ? 8.101   2.861   -4.624  1.00 0.00 ? 12 SER A HA   2  
ATOM   940   H HB2  . SER A 1 12 ? 8.616   1.700   -2.247  1.00 0.00 ? 12 SER A HB2  2  
ATOM   941   H HB3  . SER A 1 12 ? 9.029   3.378   -2.585  1.00 0.00 ? 12 SER A HB3  2  
ATOM   942   H HG   . SER A 1 12 ? 7.862   3.443   -0.736  1.00 0.00 ? 12 SER A HG   2  
ATOM   943   N N    . LEU A 1 13 ? 7.673   0.339   -4.663  1.00 0.00 ? 13 LEU A N    2  
ATOM   944   C CA   . LEU A 1 13 ? 7.207   -1.056  -4.894  1.00 0.00 ? 13 LEU A CA   2  
ATOM   945   C C    . LEU A 1 13 ? 7.167   -1.808  -3.561  1.00 0.00 ? 13 LEU A C    2  
ATOM   946   O O    . LEU A 1 13 ? 6.510   -2.822  -3.431  1.00 0.00 ? 13 LEU A O    2  
ATOM   947   C CB   . LEU A 1 13 ? 8.166   -1.759  -5.858  1.00 0.00 ? 13 LEU A CB   2  
ATOM   948   C CG   . LEU A 1 13 ? 9.506   -2.027  -5.169  1.00 0.00 ? 13 LEU A CG   2  
ATOM   949   C CD1  . LEU A 1 13 ? 9.984   -3.431  -5.530  1.00 0.00 ? 13 LEU A CD1  2  
ATOM   950   C CD2  . LEU A 1 13 ? 10.541  -1.003  -5.643  1.00 0.00 ? 13 LEU A CD2  2  
ATOM   951   H H    . LEU A 1 13 ? 8.546   0.627   -5.001  1.00 0.00 ? 13 LEU A H    2  
ATOM   952   H HA   . LEU A 1 13 ? 6.214   -1.038  -5.325  1.00 0.00 ? 13 LEU A HA   2  
ATOM   953   H HB2  . LEU A 1 13 ? 7.731   -2.695  -6.173  1.00 0.00 ? 13 LEU A HB2  2  
ATOM   954   H HB3  . LEU A 1 13 ? 8.327   -1.132  -6.723  1.00 0.00 ? 13 LEU A HB3  2  
ATOM   955   H HG   . LEU A 1 13 ? 9.389   -1.952  -4.098  1.00 0.00 ? 13 LEU A HG   2  
ATOM   956   H HD11 . LEU A 1 13 ? 10.403  -3.422  -6.525  1.00 0.00 ? 13 LEU A HD11 2  
ATOM   957   H HD12 . LEU A 1 13 ? 9.148   -4.114  -5.498  1.00 0.00 ? 13 LEU A HD12 2  
ATOM   958   H HD13 . LEU A 1 13 ? 10.737  -3.747  -4.825  1.00 0.00 ? 13 LEU A HD13 2  
ATOM   959   H HD21 . LEU A 1 13 ? 10.258  -0.629  -6.614  1.00 0.00 ? 13 LEU A HD21 2  
ATOM   960   H HD22 . LEU A 1 13 ? 11.510  -1.475  -5.705  1.00 0.00 ? 13 LEU A HD22 2  
ATOM   961   H HD23 . LEU A 1 13 ? 10.584  -0.184  -4.940  1.00 0.00 ? 13 LEU A HD23 2  
ATOM   962   N N    . TYR A 1 14 ? 7.859   -1.317  -2.568  1.00 0.00 ? 14 TYR A N    2  
ATOM   963   C CA   . TYR A 1 14 ? 7.850   -2.002  -1.247  1.00 0.00 ? 14 TYR A CA   2  
ATOM   964   C C    . TYR A 1 14 ? 6.435   -1.955  -0.693  1.00 0.00 ? 14 TYR A C    2  
ATOM   965   O O    . TYR A 1 14 ? 5.929   -2.918  -0.152  1.00 0.00 ? 14 TYR A O    2  
ATOM   966   C CB   . TYR A 1 14 ? 8.808   -1.292  -0.289  1.00 0.00 ? 14 TYR A CB   2  
ATOM   967   C CG   . TYR A 1 14 ? 9.795   -2.296  0.271   1.00 0.00 ? 14 TYR A CG   2  
ATOM   968   C CD1  . TYR A 1 14 ? 9.467   -3.041  1.414   1.00 0.00 ? 14 TYR A CD1  2  
ATOM   969   C CD2  . TYR A 1 14 ? 11.039  -2.486  -0.352  1.00 0.00 ? 14 TYR A CD2  2  
ATOM   970   C CE1  . TYR A 1 14 ? 10.379  -3.970  1.931   1.00 0.00 ? 14 TYR A CE1  2  
ATOM   971   C CE2  . TYR A 1 14 ? 11.949  -3.415  0.168   1.00 0.00 ? 14 TYR A CE2  2  
ATOM   972   C CZ   . TYR A 1 14 ? 11.619  -4.158  1.308   1.00 0.00 ? 14 TYR A CZ   2  
ATOM   973   O OH   . TYR A 1 14 ? 12.517  -5.072  1.818   1.00 0.00 ? 14 TYR A OH   2  
ATOM   974   H H    . TYR A 1 14 ? 8.375   -0.495  -2.687  1.00 0.00 ? 14 TYR A H    2  
ATOM   975   H HA   . TYR A 1 14 ? 8.150   -3.027  -1.371  1.00 0.00 ? 14 TYR A HA   2  
ATOM   976   H HB2  . TYR A 1 14 ? 9.342   -0.517  -0.823  1.00 0.00 ? 14 TYR A HB2  2  
ATOM   977   H HB3  . TYR A 1 14 ? 8.246   -0.848  0.520   1.00 0.00 ? 14 TYR A HB3  2  
ATOM   978   H HD1  . TYR A 1 14 ? 8.513   -2.901  1.896   1.00 0.00 ? 14 TYR A HD1  2  
ATOM   979   H HD2  . TYR A 1 14 ? 11.296  -1.916  -1.232  1.00 0.00 ? 14 TYR A HD2  2  
ATOM   980   H HE1  . TYR A 1 14 ? 10.125  -4.543  2.810   1.00 0.00 ? 14 TYR A HE1  2  
ATOM   981   H HE2  . TYR A 1 14 ? 12.906  -3.561  -0.312  1.00 0.00 ? 14 TYR A HE2  2  
ATOM   982   H HH   . TYR A 1 14 ? 12.217  -5.951  1.573   1.00 0.00 ? 14 TYR A HH   2  
ATOM   983   N N    . GLN A 1 15 ? 5.785   -0.842  -0.852  1.00 0.00 ? 15 GLN A N    2  
ATOM   984   C CA   . GLN A 1 15 ? 4.387   -0.724  -0.367  1.00 0.00 ? 15 GLN A CA   2  
ATOM   985   C C    . GLN A 1 15 ? 3.479   -1.451  -1.356  1.00 0.00 ? 15 GLN A C    2  
ATOM   986   O O    . GLN A 1 15 ? 2.360   -1.813  -1.049  1.00 0.00 ? 15 GLN A O    2  
ATOM   987   C CB   . GLN A 1 15 ? 3.988   0.752   -0.288  1.00 0.00 ? 15 GLN A CB   2  
ATOM   988   C CG   . GLN A 1 15 ? 4.826   1.452   0.783   1.00 0.00 ? 15 GLN A CG   2  
ATOM   989   C CD   . GLN A 1 15 ? 3.983   2.532   1.463   1.00 0.00 ? 15 GLN A CD   2  
ATOM   990   O OE1  . GLN A 1 15 ? 3.571   2.375   2.596   1.00 0.00 ? 15 GLN A OE1  2  
ATOM   991   N NE2  . GLN A 1 15 ? 3.706   3.631   0.817   1.00 0.00 ? 15 GLN A NE2  2  
ATOM   992   H H    . GLN A 1 15 ? 6.214   -0.092  -1.310  1.00 0.00 ? 15 GLN A H    2  
ATOM   993   H HA   . GLN A 1 15 ? 4.306   -1.179  0.607   1.00 0.00 ? 15 GLN A HA   2  
ATOM   994   H HB2  . GLN A 1 15 ? 4.160   1.222   -1.245  1.00 0.00 ? 15 GLN A HB2  2  
ATOM   995   H HB3  . GLN A 1 15 ? 2.943   0.827   -0.031  1.00 0.00 ? 15 GLN A HB3  2  
ATOM   996   H HG2  . GLN A 1 15 ? 5.148   0.729   1.518   1.00 0.00 ? 15 GLN A HG2  2  
ATOM   997   H HG3  . GLN A 1 15 ? 5.690   1.909   0.323   1.00 0.00 ? 15 GLN A HG3  2  
ATOM   998   H HE21 . GLN A 1 15 ? 4.039   3.759   -0.097  1.00 0.00 ? 15 GLN A HE21 2  
ATOM   999   H HE22 . GLN A 1 15 ? 3.167   4.329   1.243   1.00 0.00 ? 15 GLN A HE22 2  
ATOM   1000  N N    . LEU A 1 16 ? 3.968   -1.672  -2.547  1.00 0.00 ? 16 LEU A N    2  
ATOM   1001  C CA   . LEU A 1 16 ? 3.167   -2.380  -3.575  1.00 0.00 ? 16 LEU A CA   2  
ATOM   1002  C C    . LEU A 1 16 ? 3.028   -3.848  -3.175  1.00 0.00 ? 16 LEU A C    2  
ATOM   1003  O O    . LEU A 1 16 ? 2.122   -4.539  -3.599  1.00 0.00 ? 16 LEU A O    2  
ATOM   1004  C CB   . LEU A 1 16 ? 3.894   -2.274  -4.916  1.00 0.00 ? 16 LEU A CB   2  
ATOM   1005  C CG   . LEU A 1 16 ? 3.396   -1.043  -5.678  1.00 0.00 ? 16 LEU A CG   2  
ATOM   1006  C CD1  . LEU A 1 16 ? 4.098   -0.962  -7.034  1.00 0.00 ? 16 LEU A CD1  2  
ATOM   1007  C CD2  . LEU A 1 16 ? 1.887   -1.157  -5.894  1.00 0.00 ? 16 LEU A CD2  2  
ATOM   1008  H H    . LEU A 1 16 ? 4.875   -1.374  -2.765  1.00 0.00 ? 16 LEU A H    2  
ATOM   1009  H HA   . LEU A 1 16 ? 2.191   -1.928  -3.652  1.00 0.00 ? 16 LEU A HA   2  
ATOM   1010  H HB2  . LEU A 1 16 ? 4.952   -2.184  -4.737  1.00 0.00 ? 16 LEU A HB2  2  
ATOM   1011  H HB3  . LEU A 1 16 ? 3.708   -3.157  -5.499  1.00 0.00 ? 16 LEU A HB3  2  
ATOM   1012  H HG   . LEU A 1 16 ? 3.614   -0.153  -5.108  1.00 0.00 ? 16 LEU A HG   2  
ATOM   1013  H HD11 . LEU A 1 16 ? 4.630   -1.883  -7.221  1.00 0.00 ? 16 LEU A HD11 2  
ATOM   1014  H HD12 . LEU A 1 16 ? 4.797   -0.138  -7.028  1.00 0.00 ? 16 LEU A HD12 2  
ATOM   1015  H HD13 . LEU A 1 16 ? 3.365   -0.805  -7.810  1.00 0.00 ? 16 LEU A HD13 2  
ATOM   1016  H HD21 . LEU A 1 16 ? 1.577   -2.180  -5.736  1.00 0.00 ? 16 LEU A HD21 2  
ATOM   1017  H HD22 . LEU A 1 16 ? 1.644   -0.859  -6.904  1.00 0.00 ? 16 LEU A HD22 2  
ATOM   1018  H HD23 . LEU A 1 16 ? 1.374   -0.514  -5.196  1.00 0.00 ? 16 LEU A HD23 2  
ATOM   1019  N N    . GLU A 1 17 ? 3.920   -4.325  -2.353  1.00 0.00 ? 17 GLU A N    2  
ATOM   1020  C CA   . GLU A 1 17 ? 3.849   -5.746  -1.911  1.00 0.00 ? 17 GLU A CA   2  
ATOM   1021  C C    . GLU A 1 17 ? 2.691   -5.910  -0.928  1.00 0.00 ? 17 GLU A C    2  
ATOM   1022  O O    . GLU A 1 17 ? 2.135   -6.979  -0.776  1.00 0.00 ? 17 GLU A O    2  
ATOM   1023  C CB   . GLU A 1 17 ? 5.158   -6.136  -1.221  1.00 0.00 ? 17 GLU A CB   2  
ATOM   1024  C CG   . GLU A 1 17 ? 6.283   -6.206  -2.256  1.00 0.00 ? 17 GLU A CG   2  
ATOM   1025  C CD   . GLU A 1 17 ? 7.551   -6.752  -1.597  1.00 0.00 ? 17 GLU A CD   2  
ATOM   1026  O OE1  . GLU A 1 17 ? 7.895   -6.269  -0.530  1.00 0.00 ? 17 GLU A OE1  2  
ATOM   1027  O OE2  . GLU A 1 17 ? 8.156   -7.642  -2.170  1.00 0.00 ? 17 GLU A OE2  2  
ATOM   1028  H H    . GLU A 1 17 ? 4.635   -3.744  -2.022  1.00 0.00 ? 17 GLU A H    2  
ATOM   1029  H HA   . GLU A 1 17 ? 3.686   -6.381  -2.766  1.00 0.00 ? 17 GLU A HA   2  
ATOM   1030  H HB2  . GLU A 1 17 ? 5.404   -5.397  -0.472  1.00 0.00 ? 17 GLU A HB2  2  
ATOM   1031  H HB3  . GLU A 1 17 ? 5.044   -7.101  -0.751  1.00 0.00 ? 17 GLU A HB3  2  
ATOM   1032  H HG2  . GLU A 1 17 ? 5.986   -6.859  -3.065  1.00 0.00 ? 17 GLU A HG2  2  
ATOM   1033  H HG3  . GLU A 1 17 ? 6.477   -5.218  -2.644  1.00 0.00 ? 17 GLU A HG3  2  
ATOM   1034  N N    . ASN A 1 18 ? 2.324   -4.852  -0.264  1.00 0.00 ? 18 ASN A N    2  
ATOM   1035  C CA   . ASN A 1 18 ? 1.201   -4.929  0.708   1.00 0.00 ? 18 ASN A CA   2  
ATOM   1036  C C    . ASN A 1 18 ? -0.123  -5.031  -0.051  1.00 0.00 ? 18 ASN A C    2  
ATOM   1037  O O    . ASN A 1 18 ? -1.176  -5.185  0.535   1.00 0.00 ? 18 ASN A O    2  
ATOM   1038  C CB   . ASN A 1 18 ? 1.196   -3.669  1.574   1.00 0.00 ? 18 ASN A CB   2  
ATOM   1039  C CG   . ASN A 1 18 ? 1.839   -3.973  2.928   1.00 0.00 ? 18 ASN A CG   2  
ATOM   1040  O OD1  . ASN A 1 18 ? 1.152   -4.171  3.910   1.00 0.00 ? 18 ASN A OD1  2  
ATOM   1041  N ND2  . ASN A 1 18 ? 3.140   -4.017  3.023   1.00 0.00 ? 18 ASN A ND2  2  
ATOM   1042  H H    . ASN A 1 18 ? 2.787   -4.002  -0.410  1.00 0.00 ? 18 ASN A H    2  
ATOM   1043  H HA   . ASN A 1 18 ? 1.327   -5.799  1.336   1.00 0.00 ? 18 ASN A HA   2  
ATOM   1044  H HB2  . ASN A 1 18 ? 1.755   -2.890  1.077   1.00 0.00 ? 18 ASN A HB2  2  
ATOM   1045  H HB3  . ASN A 1 18 ? 0.180   -3.341  1.726   1.00 0.00 ? 18 ASN A HB3  2  
ATOM   1046  H HD21 . ASN A 1 18 ? 3.694   -3.856  2.232   1.00 0.00 ? 18 ASN A HD21 2  
ATOM   1047  H HD22 . ASN A 1 18 ? 3.561   -4.210  3.886   1.00 0.00 ? 18 ASN A HD22 2  
ATOM   1048  N N    . TYR A 1 19 ? -0.080  -4.951  -1.354  1.00 0.00 ? 19 TYR A N    2  
ATOM   1049  C CA   . TYR A 1 19 ? -1.331  -5.044  -2.150  1.00 0.00 ? 19 TYR A CA   2  
ATOM   1050  C C    . TYR A 1 19 ? -1.282  -6.308  -3.007  1.00 0.00 ? 19 TYR A C    2  
ATOM   1051  O O    . TYR A 1 19 ? -1.858  -6.370  -4.076  1.00 0.00 ? 19 TYR A O    2  
ATOM   1052  C CB   . TYR A 1 19 ? -1.448  -3.819  -3.054  1.00 0.00 ? 19 TYR A CB   2  
ATOM   1053  C CG   . TYR A 1 19 ? -1.333  -2.562  -2.224  1.00 0.00 ? 19 TYR A CG   2  
ATOM   1054  C CD1  . TYR A 1 19 ? -2.177  -2.371  -1.122  1.00 0.00 ? 19 TYR A CD1  2  
ATOM   1055  C CD2  . TYR A 1 19 ? -0.381  -1.589  -2.555  1.00 0.00 ? 19 TYR A CD2  2  
ATOM   1056  C CE1  . TYR A 1 19 ? -2.071  -1.206  -0.352  1.00 0.00 ? 19 TYR A CE1  2  
ATOM   1057  C CE2  . TYR A 1 19 ? -0.275  -0.423  -1.784  1.00 0.00 ? 19 TYR A CE2  2  
ATOM   1058  C CZ   . TYR A 1 19 ? -1.120  -0.232  -0.683  1.00 0.00 ? 19 TYR A CZ   2  
ATOM   1059  O OH   . TYR A 1 19 ? -1.017  0.918   0.076   1.00 0.00 ? 19 TYR A OH   2  
ATOM   1060  H H    . TYR A 1 19 ? 0.777   -4.829  -1.811  1.00 0.00 ? 19 TYR A H    2  
ATOM   1061  H HA   . TYR A 1 19 ? -2.182  -5.088  -1.485  1.00 0.00 ? 19 TYR A HA   2  
ATOM   1062  H HB2  . TYR A 1 19 ? -0.658  -3.837  -3.790  1.00 0.00 ? 19 TYR A HB2  2  
ATOM   1063  H HB3  . TYR A 1 19 ? -2.402  -3.832  -3.553  1.00 0.00 ? 19 TYR A HB3  2  
ATOM   1064  H HD1  . TYR A 1 19 ? -2.910  -3.122  -0.867  1.00 0.00 ? 19 TYR A HD1  2  
ATOM   1065  H HD2  . TYR A 1 19 ? 0.270   -1.736  -3.404  1.00 0.00 ? 19 TYR A HD2  2  
ATOM   1066  H HE1  . TYR A 1 19 ? -2.723  -1.059  0.497   1.00 0.00 ? 19 TYR A HE1  2  
ATOM   1067  H HE2  . TYR A 1 19 ? 0.459   0.328   -2.039  1.00 0.00 ? 19 TYR A HE2  2  
ATOM   1068  H HH   . TYR A 1 19 ? -0.087  1.077   0.248   1.00 0.00 ? 19 TYR A HH   2  
ATOM   1069  N N    . CYS A 1 20 ? -0.591  -7.314  -2.548  1.00 0.00 ? 20 CYS A N    2  
ATOM   1070  C CA   . CYS A 1 20 ? -0.493  -8.574  -3.332  1.00 0.00 ? 20 CYS A CA   2  
ATOM   1071  C C    . CYS A 1 20 ? -1.616  -9.526  -2.915  1.00 0.00 ? 20 CYS A C    2  
ATOM   1072  O O    . CYS A 1 20 ? -2.724  -9.448  -3.406  1.00 0.00 ? 20 CYS A O    2  
ATOM   1073  C CB   . CYS A 1 20 ? 0.866   -9.224  -3.072  1.00 0.00 ? 20 CYS A CB   2  
ATOM   1074  S SG   . CYS A 1 20 ? 2.106   -8.491  -4.168  1.00 0.00 ? 20 CYS A SG   2  
ATOM   1075  H H    . CYS A 1 20 ? -0.132  -7.237  -1.686  1.00 0.00 ? 20 CYS A H    2  
ATOM   1076  H HA   . CYS A 1 20 ? -0.589  -8.352  -4.382  1.00 0.00 ? 20 CYS A HA   2  
ATOM   1077  H HB2  . CYS A 1 20 ? 1.153   -9.059  -2.044  1.00 0.00 ? 20 CYS A HB2  2  
ATOM   1078  H HB3  . CYS A 1 20 ? 0.800   -10.283 -3.261  1.00 0.00 ? 20 CYS A HB3  2  
ATOM   1079  N N    . ASN A 1 21 ? -1.338  -10.427 -2.015  1.00 0.00 ? 21 ASN A N    2  
ATOM   1080  C CA   . ASN A 1 21 ? -2.388  -11.384 -1.567  1.00 0.00 ? 21 ASN A CA   2  
ATOM   1081  C C    . ASN A 1 21 ? -2.185  -11.707 -0.086  1.00 0.00 ? 21 ASN A C    2  
ATOM   1082  O O    . ASN A 1 21 ? -1.667  -10.856 0.619   1.00 0.00 ? 21 ASN A O    2  
ATOM   1083  C CB   . ASN A 1 21 ? -2.287  -12.670 -2.390  1.00 0.00 ? 21 ASN A CB   2  
ATOM   1084  C CG   . ASN A 1 21 ? -3.229  -12.583 -3.594  1.00 0.00 ? 21 ASN A CG   2  
ATOM   1085  O OD1  . ASN A 1 21 ? -3.313  -11.557 -4.240  1.00 0.00 ? 21 ASN A OD1  2  
ATOM   1086  N ND2  . ASN A 1 21 ? -3.944  -13.623 -3.925  1.00 0.00 ? 21 ASN A ND2  2  
ATOM   1087  O OXT  . ASN A 1 21 ? -2.548  -12.800 0.318   1.00 0.00 ? 21 ASN A OXT  2  
ATOM   1088  H H    . ASN A 1 21 ? -0.439  -10.474 -1.632  1.00 0.00 ? 21 ASN A H    2  
ATOM   1089  H HA   . ASN A 1 21 ? -3.362  -10.940 -1.709  1.00 0.00 ? 21 ASN A HA   2  
ATOM   1090  H HB2  . ASN A 1 21 ? -1.271  -12.796 -2.735  1.00 0.00 ? 21 ASN A HB2  2  
ATOM   1091  H HB3  . ASN A 1 21 ? -2.567  -13.513 -1.777  1.00 0.00 ? 21 ASN A HB3  2  
ATOM   1092  H HD21 . ASN A 1 21 ? -3.875  -14.451 -3.406  1.00 0.00 ? 21 ASN A HD21 2  
ATOM   1093  H HD22 . ASN A 1 21 ? -4.550  -13.576 -4.693  1.00 0.00 ? 21 ASN A HD22 2  
ATOM   1094  N N    . PHE B 2 1  ? 8.047   1.653   -8.684  1.00 0.00 ? 1  PHE B N    2  
ATOM   1095  C CA   . PHE B 2 1  ? 9.363   0.974   -8.521  1.00 0.00 ? 1  PHE B CA   2  
ATOM   1096  C C    . PHE B 2 1  ? 10.257  1.809   -7.599  1.00 0.00 ? 1  PHE B C    2  
ATOM   1097  O O    . PHE B 2 1  ? 10.493  1.454   -6.461  1.00 0.00 ? 1  PHE B O    2  
ATOM   1098  C CB   . PHE B 2 1  ? 10.031  0.825   -9.890  1.00 0.00 ? 1  PHE B CB   2  
ATOM   1099  C CG   . PHE B 2 1  ? 10.859  -0.443  -9.916  1.00 0.00 ? 1  PHE B CG   2  
ATOM   1100  C CD1  . PHE B 2 1  ? 10.230  -1.692  -10.033 1.00 0.00 ? 1  PHE B CD1  2  
ATOM   1101  C CD2  . PHE B 2 1  ? 12.256  -0.370  -9.825  1.00 0.00 ? 1  PHE B CD2  2  
ATOM   1102  C CE1  . PHE B 2 1  ? 10.997  -2.864  -10.058 1.00 0.00 ? 1  PHE B CE1  2  
ATOM   1103  C CE2  . PHE B 2 1  ? 13.023  -1.543  -9.851  1.00 0.00 ? 1  PHE B CE2  2  
ATOM   1104  C CZ   . PHE B 2 1  ? 12.394  -2.789  -9.968  1.00 0.00 ? 1  PHE B CZ   2  
ATOM   1105  H H1   . PHE B 2 1  ? 7.429   1.411   -7.885  1.00 0.00 ? 1  PHE B H1   2  
ATOM   1106  H H2   . PHE B 2 1  ? 7.605   1.339   -9.573  1.00 0.00 ? 1  PHE B H2   2  
ATOM   1107  H H3   . PHE B 2 1  ? 8.188   2.682   -8.712  1.00 0.00 ? 1  PHE B H3   2  
ATOM   1108  H HA   . PHE B 2 1  ? 9.211   -0.003  -8.086  1.00 0.00 ? 1  PHE B HA   2  
ATOM   1109  H HB2  . PHE B 2 1  ? 9.269   0.777   -10.656 1.00 0.00 ? 1  PHE B HB2  2  
ATOM   1110  H HB3  . PHE B 2 1  ? 10.669  1.676   -10.074 1.00 0.00 ? 1  PHE B HB3  2  
ATOM   1111  H HD1  . PHE B 2 1  ? 9.155   -1.753  -10.101 1.00 0.00 ? 1  PHE B HD1  2  
ATOM   1112  H HD2  . PHE B 2 1  ? 12.743  0.588   -9.735  1.00 0.00 ? 1  PHE B HD2  2  
ATOM   1113  H HE1  . PHE B 2 1  ? 10.513  -3.824  -10.148 1.00 0.00 ? 1  PHE B HE1  2  
ATOM   1114  H HE2  . PHE B 2 1  ? 14.098  -1.487  -9.781  1.00 0.00 ? 1  PHE B HE2  2  
ATOM   1115  H HZ   . PHE B 2 1  ? 12.985  -3.692  -9.989  1.00 0.00 ? 1  PHE B HZ   2  
ATOM   1116  N N    . VAL B 2 2  ? 10.752  2.917   -8.079  1.00 0.00 ? 2  VAL B N    2  
ATOM   1117  C CA   . VAL B 2 2  ? 11.626  3.774   -7.230  1.00 0.00 ? 2  VAL B CA   2  
ATOM   1118  C C    . VAL B 2 2  ? 11.663  5.188   -7.812  1.00 0.00 ? 2  VAL B C    2  
ATOM   1119  O O    . VAL B 2 2  ? 11.961  5.382   -8.974  1.00 0.00 ? 2  VAL B O    2  
ATOM   1120  C CB   . VAL B 2 2  ? 13.041  3.193   -7.206  1.00 0.00 ? 2  VAL B CB   2  
ATOM   1121  C CG1  . VAL B 2 2  ? 13.588  3.123   -8.631  1.00 0.00 ? 2  VAL B CG1  2  
ATOM   1122  C CG2  . VAL B 2 2  ? 13.944  4.092   -6.358  1.00 0.00 ? 2  VAL B CG2  2  
ATOM   1123  H H    . VAL B 2 2  ? 10.547  3.187   -8.998  1.00 0.00 ? 2  VAL B H    2  
ATOM   1124  H HA   . VAL B 2 2  ? 11.232  3.807   -6.224  1.00 0.00 ? 2  VAL B HA   2  
ATOM   1125  H HB   . VAL B 2 2  ? 13.016  2.200   -6.781  1.00 0.00 ? 2  VAL B HB   2  
ATOM   1126  H HG11 . VAL B 2 2  ? 12.845  3.494   -9.321  1.00 0.00 ? 2  VAL B HG11 2  
ATOM   1127  H HG12 . VAL B 2 2  ? 13.826  2.098   -8.875  1.00 0.00 ? 2  VAL B HG12 2  
ATOM   1128  H HG13 . VAL B 2 2  ? 14.481  3.726   -8.704  1.00 0.00 ? 2  VAL B HG13 2  
ATOM   1129  H HG21 . VAL B 2 2  ? 13.334  4.754   -5.761  1.00 0.00 ? 2  VAL B HG21 2  
ATOM   1130  H HG22 . VAL B 2 2  ? 14.582  4.675   -7.005  1.00 0.00 ? 2  VAL B HG22 2  
ATOM   1131  H HG23 . VAL B 2 2  ? 14.553  3.480   -5.709  1.00 0.00 ? 2  VAL B HG23 2  
ATOM   1132  N N    . ASN B 2 3  ? 11.355  6.177   -7.020  1.00 0.00 ? 3  ASN B N    2  
ATOM   1133  C CA   . ASN B 2 3  ? 11.364  7.573   -7.540  1.00 0.00 ? 3  ASN B CA   2  
ATOM   1134  C C    . ASN B 2 3  ? 10.506  7.642   -8.805  1.00 0.00 ? 3  ASN B C    2  
ATOM   1135  O O    . ASN B 2 3  ? 10.645  8.538   -9.614  1.00 0.00 ? 3  ASN B O    2  
ATOM   1136  C CB   . ASN B 2 3  ? 12.801  7.984   -7.875  1.00 0.00 ? 3  ASN B CB   2  
ATOM   1137  C CG   . ASN B 2 3  ? 13.695  7.782   -6.649  1.00 0.00 ? 3  ASN B CG   2  
ATOM   1138  O OD1  . ASN B 2 3  ? 14.592  6.964   -6.667  1.00 0.00 ? 3  ASN B OD1  2  
ATOM   1139  N ND2  . ASN B 2 3  ? 13.484  8.497   -5.577  1.00 0.00 ? 3  ASN B ND2  2  
ATOM   1140  H H    . ASN B 2 3  ? 11.111  6.002   -6.087  1.00 0.00 ? 3  ASN B H    2  
ATOM   1141  H HA   . ASN B 2 3  ? 10.962  8.242   -6.792  1.00 0.00 ? 3  ASN B HA   2  
ATOM   1142  H HB2  . ASN B 2 3  ? 13.166  7.378   -8.691  1.00 0.00 ? 3  ASN B HB2  2  
ATOM   1143  H HB3  . ASN B 2 3  ? 12.820  9.025   -8.164  1.00 0.00 ? 3  ASN B HB3  2  
ATOM   1144  H HD21 . ASN B 2 3  ? 12.761  9.158   -5.561  1.00 0.00 ? 3  ASN B HD21 2  
ATOM   1145  H HD22 . ASN B 2 3  ? 14.053  8.374   -4.788  1.00 0.00 ? 3  ASN B HD22 2  
ATOM   1146  N N    . GLN B 2 4  ? 9.624   6.696   -8.983  1.00 0.00 ? 4  GLN B N    2  
ATOM   1147  C CA   . GLN B 2 4  ? 8.760   6.692   -10.190 1.00 0.00 ? 4  GLN B CA   2  
ATOM   1148  C C    . GLN B 2 4  ? 7.313   6.974   -9.783  1.00 0.00 ? 4  GLN B C    2  
ATOM   1149  O O    . GLN B 2 4  ? 6.832   6.484   -8.781  1.00 0.00 ? 4  GLN B O    2  
ATOM   1150  C CB   . GLN B 2 4  ? 8.844   5.316   -10.848 1.00 0.00 ? 4  GLN B CB   2  
ATOM   1151  C CG   . GLN B 2 4  ? 9.855   5.358   -11.994 1.00 0.00 ? 4  GLN B CG   2  
ATOM   1152  C CD   . GLN B 2 4  ? 10.029  3.951   -12.571 1.00 0.00 ? 4  GLN B CD   2  
ATOM   1153  O OE1  . GLN B 2 4  ? 10.536  3.068   -11.908 1.00 0.00 ? 4  GLN B OE1  2  
ATOM   1154  N NE2  . GLN B 2 4  ? 9.627   3.703   -13.788 1.00 0.00 ? 4  GLN B NE2  2  
ATOM   1155  H H    . GLN B 2 4  ? 9.532   5.981   -8.323  1.00 0.00 ? 4  GLN B H    2  
ATOM   1156  H HA   . GLN B 2 4  ? 9.098   7.447   -10.883 1.00 0.00 ? 4  GLN B HA   2  
ATOM   1157  H HB2  . GLN B 2 4  ? 9.159   4.587   -10.116 1.00 0.00 ? 4  GLN B HB2  2  
ATOM   1158  H HB3  . GLN B 2 4  ? 7.875   5.044   -11.232 1.00 0.00 ? 4  GLN B HB3  2  
ATOM   1159  H HG2  . GLN B 2 4  ? 9.499   6.025   -12.763 1.00 0.00 ? 4  GLN B HG2  2  
ATOM   1160  H HG3  . GLN B 2 4  ? 10.805  5.712   -11.621 1.00 0.00 ? 4  GLN B HG3  2  
ATOM   1161  H HE21 . GLN B 2 4  ? 9.220   4.414   -14.324 1.00 0.00 ? 4  GLN B HE21 2  
ATOM   1162  H HE22 . GLN B 2 4  ? 9.735   2.804   -14.165 1.00 0.00 ? 4  GLN B HE22 2  
ATOM   1163  N N    . HIS B 2 5  ? 6.613   7.758   -10.554 1.00 0.00 ? 5  HIS B N    2  
ATOM   1164  C CA   . HIS B 2 5  ? 5.197   8.068   -10.214 1.00 0.00 ? 5  HIS B CA   2  
ATOM   1165  C C    . HIS B 2 5  ? 4.309   6.884   -10.609 1.00 0.00 ? 5  HIS B C    2  
ATOM   1166  O O    . HIS B 2 5  ? 4.485   6.289   -11.653 1.00 0.00 ? 5  HIS B O    2  
ATOM   1167  C CB   . HIS B 2 5  ? 4.754   9.316   -10.976 1.00 0.00 ? 5  HIS B CB   2  
ATOM   1168  C CG   . HIS B 2 5  ? 3.565   9.926   -10.287 1.00 0.00 ? 5  HIS B CG   2  
ATOM   1169  N ND1  . HIS B 2 5  ? 2.321   9.336   -10.344 1.00 0.00 ? 5  HIS B ND1  2  
ATOM   1170  C CD2  . HIS B 2 5  ? 3.449   11.059  -9.532  1.00 0.00 ? 5  HIS B CD2  2  
ATOM   1171  C CE1  . HIS B 2 5  ? 1.495   10.115  -9.632  1.00 0.00 ? 5  HIS B CE1  2  
ATOM   1172  N NE2  . HIS B 2 5  ? 2.140   11.181  -9.116  1.00 0.00 ? 5  HIS B NE2  2  
ATOM   1173  H H    . HIS B 2 5  ? 7.018   8.141   -11.360 1.00 0.00 ? 5  HIS B H    2  
ATOM   1174  H HA   . HIS B 2 5  ? 5.112   8.244   -9.152  1.00 0.00 ? 5  HIS B HA   2  
ATOM   1175  H HB2  . HIS B 2 5  ? 5.563   10.032  -11.000 1.00 0.00 ? 5  HIS B HB2  2  
ATOM   1176  H HB3  . HIS B 2 5  ? 4.484   9.045   -11.985 1.00 0.00 ? 5  HIS B HB3  2  
ATOM   1177  H HD2  . HIS B 2 5  ? 4.250   11.744  -9.299  1.00 0.00 ? 5  HIS B HD2  2  
ATOM   1178  H HE1  . HIS B 2 5  ? 0.444   9.914   -9.488  1.00 0.00 ? 5  HIS B HE1  2  
ATOM   1179  H HE2  . HIS B 2 5  ? 1.760   11.893  -8.560  1.00 0.00 ? 5  HIS B HE2  2  
ATOM   1180  N N    . LEU B 2 6  ? 3.354   6.538   -9.787  1.00 0.00 ? 6  LEU B N    2  
ATOM   1181  C CA   . LEU B 2 6  ? 2.460   5.394   -10.125 1.00 0.00 ? 6  LEU B CA   2  
ATOM   1182  C C    . LEU B 2 6  ? 1.068   5.930   -10.453 1.00 0.00 ? 6  LEU B C    2  
ATOM   1183  O O    . LEU B 2 6  ? 0.774   7.079   -10.210 1.00 0.00 ? 6  LEU B O    2  
ATOM   1184  C CB   . LEU B 2 6  ? 2.363   4.451   -8.922  1.00 0.00 ? 6  LEU B CB   2  
ATOM   1185  C CG   . LEU B 2 6  ? 3.569   3.512   -8.901  1.00 0.00 ? 6  LEU B CG   2  
ATOM   1186  C CD1  . LEU B 2 6  ? 3.526   2.602   -10.126 1.00 0.00 ? 6  LEU B CD1  2  
ATOM   1187  C CD2  . LEU B 2 6  ? 4.855   4.337   -8.921  1.00 0.00 ? 6  LEU B CD2  2  
ATOM   1188  H H    . LEU B 2 6  ? 3.222   7.030   -8.948  1.00 0.00 ? 6  LEU B H    2  
ATOM   1189  H HA   . LEU B 2 6  ? 2.856   4.860   -10.975 1.00 0.00 ? 6  LEU B HA   2  
ATOM   1190  H HB2  . LEU B 2 6  ? 2.341   5.032   -8.011  1.00 0.00 ? 6  LEU B HB2  2  
ATOM   1191  H HB3  . LEU B 2 6  ? 1.457   3.868   -8.997  1.00 0.00 ? 6  LEU B HB3  2  
ATOM   1192  H HG   . LEU B 2 6  ? 3.539   2.909   -8.005  1.00 0.00 ? 6  LEU B HG   2  
ATOM   1193  H HD11 . LEU B 2 6  ? 4.372   2.814   -10.764 1.00 0.00 ? 6  LEU B HD11 2  
ATOM   1194  H HD12 . LEU B 2 6  ? 2.612   2.779   -10.671 1.00 0.00 ? 6  LEU B HD12 2  
ATOM   1195  H HD13 . LEU B 2 6  ? 3.562   1.569   -9.810  1.00 0.00 ? 6  LEU B HD13 2  
ATOM   1196  H HD21 . LEU B 2 6  ? 5.672   3.740   -8.541  1.00 0.00 ? 6  LEU B HD21 2  
ATOM   1197  H HD22 . LEU B 2 6  ? 4.731   5.212   -8.302  1.00 0.00 ? 6  LEU B HD22 2  
ATOM   1198  H HD23 . LEU B 2 6  ? 5.073   4.640   -9.934  1.00 0.00 ? 6  LEU B HD23 2  
ATOM   1199  N N    . CYS B 2 7  ? 0.210   5.101   -10.988 1.00 0.00 ? 7  CYS B N    2  
ATOM   1200  C CA   . CYS B 2 7  ? -1.178  5.550   -11.318 1.00 0.00 ? 7  CYS B CA   2  
ATOM   1201  C C    . CYS B 2 7  ? -1.893  4.442   -12.114 1.00 0.00 ? 7  CYS B C    2  
ATOM   1202  O O    . CYS B 2 7  ? -2.275  3.431   -11.561 1.00 0.00 ? 7  CYS B O    2  
ATOM   1203  C CB   . CYS B 2 7  ? -1.144  6.856   -12.131 1.00 0.00 ? 7  CYS B CB   2  
ATOM   1204  S SG   . CYS B 2 7  ? -1.484  8.274   -11.055 1.00 0.00 ? 7  CYS B SG   2  
ATOM   1205  H H    . CYS B 2 7  ? 0.475   4.174   -11.163 1.00 0.00 ? 7  CYS B H    2  
ATOM   1206  H HA   . CYS B 2 7  ? -1.715  5.716   -10.394 1.00 0.00 ? 7  CYS B HA   2  
ATOM   1207  H HB2  . CYS B 2 7  ? -0.171  6.975   -12.579 1.00 0.00 ? 7  CYS B HB2  2  
ATOM   1208  H HB3  . CYS B 2 7  ? -1.893  6.821   -12.904 1.00 0.00 ? 7  CYS B HB3  2  
ATOM   1209  N N    . GLY B 2 8  ? -2.077  4.611   -13.402 1.00 0.00 ? 8  GLY B N    2  
ATOM   1210  C CA   . GLY B 2 8  ? -2.773  3.559   -14.199 1.00 0.00 ? 8  GLY B CA   2  
ATOM   1211  C C    . GLY B 2 8  ? -1.817  2.399   -14.464 1.00 0.00 ? 8  GLY B C    2  
ATOM   1212  O O    . GLY B 2 8  ? -1.249  1.835   -13.551 1.00 0.00 ? 8  GLY B O    2  
ATOM   1213  H H    . GLY B 2 8  ? -1.760  5.420   -13.846 1.00 0.00 ? 8  GLY B H    2  
ATOM   1214  H HA2  . GLY B 2 8  ? -3.633  3.202   -13.651 1.00 0.00 ? 8  GLY B HA2  2  
ATOM   1215  H HA3  . GLY B 2 8  ? -3.095  3.976   -15.141 1.00 0.00 ? 8  GLY B HA3  2  
ATOM   1216  N N    . SER B 2 9  ? -1.632  2.043   -15.711 1.00 0.00 ? 9  SER B N    2  
ATOM   1217  C CA   . SER B 2 9  ? -0.704  0.923   -16.037 1.00 0.00 ? 9  SER B CA   2  
ATOM   1218  C C    . SER B 2 9  ? 0.541   1.042   -15.160 1.00 0.00 ? 9  SER B C    2  
ATOM   1219  O O    . SER B 2 9  ? 1.177   0.063   -14.828 1.00 0.00 ? 9  SER B O    2  
ATOM   1220  C CB   . SER B 2 9  ? -0.300  1.006   -17.509 1.00 0.00 ? 9  SER B CB   2  
ATOM   1221  O OG   . SER B 2 9  ? -1.016  0.028   -18.250 1.00 0.00 ? 9  SER B OG   2  
ATOM   1222  H H    . SER B 2 9  ? -2.100  2.516   -16.429 1.00 0.00 ? 9  SER B H    2  
ATOM   1223  H HA   . SER B 2 9  ? -1.193  -0.022  -15.848 1.00 0.00 ? 9  SER B HA   2  
ATOM   1224  H HB2  . SER B 2 9  ? -0.535  1.986   -17.894 1.00 0.00 ? 9  SER B HB2  2  
ATOM   1225  H HB3  . SER B 2 9  ? 0.765   0.834   -17.598 1.00 0.00 ? 9  SER B HB3  2  
ATOM   1226  H HG   . SER B 2 9  ? -0.409  -0.684  -18.465 1.00 0.00 ? 9  SER B HG   2  
ATOM   1227  N N    . ASP B 2 10 ? 0.879   2.240   -14.773 1.00 0.00 ? 10 ASP B N    2  
ATOM   1228  C CA   . ASP B 2 10 ? 2.068   2.434   -13.906 1.00 0.00 ? 10 ASP B CA   2  
ATOM   1229  C C    . ASP B 2 10 ? 1.846   1.702   -12.582 1.00 0.00 ? 10 ASP B C    2  
ATOM   1230  O O    . ASP B 2 10 ? 2.651   0.890   -12.169 1.00 0.00 ? 10 ASP B O    2  
ATOM   1231  C CB   . ASP B 2 10 ? 2.261   3.927   -13.638 1.00 0.00 ? 10 ASP B CB   2  
ATOM   1232  C CG   . ASP B 2 10 ? 2.970   4.572   -14.830 1.00 0.00 ? 10 ASP B CG   2  
ATOM   1233  O OD1  . ASP B 2 10 ? 2.310   4.808   -15.828 1.00 0.00 ? 10 ASP B OD1  2  
ATOM   1234  O OD2  . ASP B 2 10 ? 4.159   4.820   -14.724 1.00 0.00 ? 10 ASP B OD2  2  
ATOM   1235  H H    . ASP B 2 10 ? 0.343   3.014   -15.047 1.00 0.00 ? 10 ASP B H    2  
ATOM   1236  H HA   . ASP B 2 10 ? 2.944   2.037   -14.397 1.00 0.00 ? 10 ASP B HA   2  
ATOM   1237  H HB2  . ASP B 2 10 ? 1.297   4.394   -13.494 1.00 0.00 ? 10 ASP B HB2  2  
ATOM   1238  H HB3  . ASP B 2 10 ? 2.861   4.059   -12.750 1.00 0.00 ? 10 ASP B HB3  2  
ATOM   1239  N N    . LEU B 2 11 ? 0.761   1.980   -11.905 1.00 0.00 ? 11 LEU B N    2  
ATOM   1240  C CA   . LEU B 2 11 ? 0.512   1.292   -10.608 1.00 0.00 ? 11 LEU B CA   2  
ATOM   1241  C C    . LEU B 2 11 ? 0.047   -0.143  -10.876 1.00 0.00 ? 11 LEU B C    2  
ATOM   1242  O O    . LEU B 2 11 ? 0.295   -1.045  -10.098 1.00 0.00 ? 11 LEU B O    2  
ATOM   1243  C CB   . LEU B 2 11 ? -0.580  2.044   -9.821  1.00 0.00 ? 11 LEU B CB   2  
ATOM   1244  C CG   . LEU B 2 11 ? -0.258  2.152   -8.309  1.00 0.00 ? 11 LEU B CG   2  
ATOM   1245  C CD1  . LEU B 2 11 ? -1.476  1.699   -7.505  1.00 0.00 ? 11 LEU B CD1  2  
ATOM   1246  C CD2  . LEU B 2 11 ? 0.934   1.274   -7.912  1.00 0.00 ? 11 LEU B CD2  2  
ATOM   1247  H H    . LEU B 2 11 ? 0.119   2.638   -12.246 1.00 0.00 ? 11 LEU B H    2  
ATOM   1248  H HA   . LEU B 2 11 ? 1.429   1.273   -10.045 1.00 0.00 ? 11 LEU B HA   2  
ATOM   1249  H HB2  . LEU B 2 11 ? -0.680  3.038   -10.227 1.00 0.00 ? 11 LEU B HB2  2  
ATOM   1250  H HB3  . LEU B 2 11 ? -1.519  1.525   -9.940  1.00 0.00 ? 11 LEU B HB3  2  
ATOM   1251  H HG   . LEU B 2 11 ? -0.041  3.183   -8.069  1.00 0.00 ? 11 LEU B HG   2  
ATOM   1252  H HD11 . LEU B 2 11 ? -1.397  0.642   -7.299  1.00 0.00 ? 11 LEU B HD11 2  
ATOM   1253  H HD12 . LEU B 2 11 ? -2.374  1.889   -8.072  1.00 0.00 ? 11 LEU B HD12 2  
ATOM   1254  H HD13 . LEU B 2 11 ? -1.515  2.244   -6.573  1.00 0.00 ? 11 LEU B HD13 2  
ATOM   1255  H HD21 . LEU B 2 11 ? 0.847   0.311   -8.394  1.00 0.00 ? 11 LEU B HD21 2  
ATOM   1256  H HD22 . LEU B 2 11 ? 0.943   1.142   -6.840  1.00 0.00 ? 11 LEU B HD22 2  
ATOM   1257  H HD23 . LEU B 2 11 ? 1.851   1.751   -8.224  1.00 0.00 ? 11 LEU B HD23 2  
ATOM   1258  N N    . VAL B 2 12 ? -0.630  -0.361  -11.970 1.00 0.00 ? 12 VAL B N    2  
ATOM   1259  C CA   . VAL B 2 12 ? -1.115  -1.732  -12.285 1.00 0.00 ? 12 VAL B CA   2  
ATOM   1260  C C    . VAL B 2 12 ? 0.053   -2.587  -12.781 1.00 0.00 ? 12 VAL B C    2  
ATOM   1261  O O    . VAL B 2 12 ? 0.373   -3.607  -12.204 1.00 0.00 ? 12 VAL B O    2  
ATOM   1262  C CB   . VAL B 2 12 ? -2.198  -1.647  -13.364 1.00 0.00 ? 12 VAL B CB   2  
ATOM   1263  C CG1  . VAL B 2 12 ? -2.438  -3.030  -13.971 1.00 0.00 ? 12 VAL B CG1  2  
ATOM   1264  C CG2  . VAL B 2 12 ? -3.499  -1.136  -12.738 1.00 0.00 ? 12 VAL B CG2  2  
ATOM   1265  H H    . VAL B 2 12 ? -0.820  0.378   -12.586 1.00 0.00 ? 12 VAL B H    2  
ATOM   1266  H HA   . VAL B 2 12 ? -1.531  -2.179  -11.393 1.00 0.00 ? 12 VAL B HA   2  
ATOM   1267  H HB   . VAL B 2 12 ? -1.878  -0.964  -14.139 1.00 0.00 ? 12 VAL B HB   2  
ATOM   1268  H HG11 . VAL B 2 12 ? -2.820  -3.695  -13.210 1.00 0.00 ? 12 VAL B HG11 2  
ATOM   1269  H HG12 . VAL B 2 12 ? -1.508  -3.420  -14.357 1.00 0.00 ? 12 VAL B HG12 2  
ATOM   1270  H HG13 . VAL B 2 12 ? -3.157  -2.951  -14.774 1.00 0.00 ? 12 VAL B HG13 2  
ATOM   1271  H HG21 . VAL B 2 12 ? -3.884  -0.315  -13.325 1.00 0.00 ? 12 VAL B HG21 2  
ATOM   1272  H HG22 . VAL B 2 12 ? -3.305  -0.798  -11.731 1.00 0.00 ? 12 VAL B HG22 2  
ATOM   1273  H HG23 . VAL B 2 12 ? -4.225  -1.934  -12.716 1.00 0.00 ? 12 VAL B HG23 2  
ATOM   1274  N N    . GLU B 2 13 ? 0.699   -2.183  -13.841 1.00 0.00 ? 13 GLU B N    2  
ATOM   1275  C CA   . GLU B 2 13 ? 1.846   -2.985  -14.349 1.00 0.00 ? 13 GLU B CA   2  
ATOM   1276  C C    . GLU B 2 13 ? 2.791   -3.281  -13.186 1.00 0.00 ? 13 GLU B C    2  
ATOM   1277  O O    . GLU B 2 13 ? 3.503   -4.265  -13.182 1.00 0.00 ? 13 GLU B O    2  
ATOM   1278  C CB   . GLU B 2 13 ? 2.589   -2.204  -15.433 1.00 0.00 ? 13 GLU B CB   2  
ATOM   1279  C CG   . GLU B 2 13 ? 1.706   -2.104  -16.678 1.00 0.00 ? 13 GLU B CG   2  
ATOM   1280  C CD   . GLU B 2 13 ? 2.550   -2.374  -17.926 1.00 0.00 ? 13 GLU B CD   2  
ATOM   1281  O OE1  . GLU B 2 13 ? 3.521   -1.663  -18.126 1.00 0.00 ? 13 GLU B OE1  2  
ATOM   1282  O OE2  . GLU B 2 13 ? 2.211   -3.287  -18.660 1.00 0.00 ? 13 GLU B OE2  2  
ATOM   1283  H H    . GLU B 2 13 ? 0.435   -1.355  -14.295 1.00 0.00 ? 13 GLU B H    2  
ATOM   1284  H HA   . GLU B 2 13 ? 1.480   -3.914  -14.761 1.00 0.00 ? 13 GLU B HA   2  
ATOM   1285  H HB2  . GLU B 2 13 ? 2.820   -1.214  -15.070 1.00 0.00 ? 13 GLU B HB2  2  
ATOM   1286  H HB3  . GLU B 2 13 ? 3.504   -2.718  -15.685 1.00 0.00 ? 13 GLU B HB3  2  
ATOM   1287  H HG2  . GLU B 2 13 ? 0.912   -2.833  -16.615 1.00 0.00 ? 13 GLU B HG2  2  
ATOM   1288  H HG3  . GLU B 2 13 ? 1.283   -1.114  -16.740 1.00 0.00 ? 13 GLU B HG3  2  
ATOM   1289  N N    . ALA B 2 14 ? 2.794   -2.435  -12.191 1.00 0.00 ? 14 ALA B N    2  
ATOM   1290  C CA   . ALA B 2 14 ? 3.684   -2.664  -11.020 1.00 0.00 ? 14 ALA B CA   2  
ATOM   1291  C C    . ALA B 2 14 ? 3.211   -3.906  -10.262 1.00 0.00 ? 14 ALA B C    2  
ATOM   1292  O O    . ALA B 2 14 ? 3.938   -4.868  -10.116 1.00 0.00 ? 14 ALA B O    2  
ATOM   1293  C CB   . ALA B 2 14 ? 3.629   -1.449  -10.093 1.00 0.00 ? 14 ALA B CB   2  
ATOM   1294  H H    . ALA B 2 14 ? 2.206   -1.651  -12.214 1.00 0.00 ? 14 ALA B H    2  
ATOM   1295  H HA   . ALA B 2 14 ? 4.698   -2.813  -11.361 1.00 0.00 ? 14 ALA B HA   2  
ATOM   1296  H HB1  . ALA B 2 14 ? 2.627   -1.335  -9.705  1.00 0.00 ? 14 ALA B HB1  2  
ATOM   1297  H HB2  . ALA B 2 14 ? 3.904   -0.562  -10.644 1.00 0.00 ? 14 ALA B HB2  2  
ATOM   1298  H HB3  . ALA B 2 14 ? 4.318   -1.591  -9.274  1.00 0.00 ? 14 ALA B HB3  2  
ATOM   1299  N N    . LEU B 2 15 ? 1.995   -3.894  -9.780  1.00 0.00 ? 15 LEU B N    2  
ATOM   1300  C CA   . LEU B 2 15 ? 1.481   -5.080  -9.036  1.00 0.00 ? 15 LEU B CA   2  
ATOM   1301  C C    . LEU B 2 15 ? 1.694   -6.339  -9.878  1.00 0.00 ? 15 LEU B C    2  
ATOM   1302  O O    . LEU B 2 15 ? 2.235   -7.325  -9.418  1.00 0.00 ? 15 LEU B O    2  
ATOM   1303  C CB   . LEU B 2 15 ? -0.014  -4.904  -8.760  1.00 0.00 ? 15 LEU B CB   2  
ATOM   1304  C CG   . LEU B 2 15 ? -0.231  -3.703  -7.839  1.00 0.00 ? 15 LEU B CG   2  
ATOM   1305  C CD1  . LEU B 2 15 ? -1.544  -3.015  -8.209  1.00 0.00 ? 15 LEU B CD1  2  
ATOM   1306  C CD2  . LEU B 2 15 ? -0.299  -4.179  -6.385  1.00 0.00 ? 15 LEU B CD2  2  
ATOM   1307  H H    . LEU B 2 15 ? 1.421   -3.110  -9.912  1.00 0.00 ? 15 LEU B H    2  
ATOM   1308  H HA   . LEU B 2 15 ? 2.012   -5.177  -8.100  1.00 0.00 ? 15 LEU B HA   2  
ATOM   1309  H HB2  . LEU B 2 15 ? -0.535  -4.740  -9.692  1.00 0.00 ? 15 LEU B HB2  2  
ATOM   1310  H HB3  . LEU B 2 15 ? -0.400  -5.794  -8.285  1.00 0.00 ? 15 LEU B HB3  2  
ATOM   1311  H HG   . LEU B 2 15 ? 0.587   -3.008  -7.956  1.00 0.00 ? 15 LEU B HG   2  
ATOM   1312  H HD11 . LEU B 2 15 ? -1.414  -1.943  -8.163  1.00 0.00 ? 15 LEU B HD11 2  
ATOM   1313  H HD12 . LEU B 2 15 ? -2.315  -3.315  -7.514  1.00 0.00 ? 15 LEU B HD12 2  
ATOM   1314  H HD13 . LEU B 2 15 ? -1.830  -3.301  -9.210  1.00 0.00 ? 15 LEU B HD13 2  
ATOM   1315  H HD21 . LEU B 2 15 ? -0.718  -3.397  -5.771  1.00 0.00 ? 15 LEU B HD21 2  
ATOM   1316  H HD22 . LEU B 2 15 ? 0.695   -4.415  -6.038  1.00 0.00 ? 15 LEU B HD22 2  
ATOM   1317  H HD23 . LEU B 2 15 ? -0.921  -5.059  -6.324  1.00 0.00 ? 15 LEU B HD23 2  
ATOM   1318  N N    . TYR B 2 16 ? 1.269   -6.311  -11.111 1.00 0.00 ? 16 TYR B N    2  
ATOM   1319  C CA   . TYR B 2 16 ? 1.436   -7.501  -11.994 1.00 0.00 ? 16 TYR B CA   2  
ATOM   1320  C C    . TYR B 2 16 ? 2.886   -7.989  -11.938 1.00 0.00 ? 16 TYR B C    2  
ATOM   1321  O O    . TYR B 2 16 ? 3.162   -9.160  -12.109 1.00 0.00 ? 16 TYR B O    2  
ATOM   1322  C CB   . TYR B 2 16 ? 1.084   -7.117  -13.433 1.00 0.00 ? 16 TYR B CB   2  
ATOM   1323  C CG   . TYR B 2 16 ? -0.279  -7.675  -13.783 1.00 0.00 ? 16 TYR B CG   2  
ATOM   1324  C CD1  . TYR B 2 16 ? -0.459  -9.061  -13.915 1.00 0.00 ? 16 TYR B CD1  2  
ATOM   1325  C CD2  . TYR B 2 16 ? -1.366  -6.810  -13.974 1.00 0.00 ? 16 TYR B CD2  2  
ATOM   1326  C CE1  . TYR B 2 16 ? -1.721  -9.576  -14.237 1.00 0.00 ? 16 TYR B CE1  2  
ATOM   1327  C CE2  . TYR B 2 16 ? -2.628  -7.328  -14.296 1.00 0.00 ? 16 TYR B CE2  2  
ATOM   1328  C CZ   . TYR B 2 16 ? -2.804  -8.711  -14.427 1.00 0.00 ? 16 TYR B CZ   2  
ATOM   1329  O OH   . TYR B 2 16 ? -4.048  -9.220  -14.744 1.00 0.00 ? 16 TYR B OH   2  
ATOM   1330  H H    . TYR B 2 16 ? 0.833   -5.504  -11.458 1.00 0.00 ? 16 TYR B H    2  
ATOM   1331  H HA   . TYR B 2 16 ? 0.778   -8.290  -11.660 1.00 0.00 ? 16 TYR B HA   2  
ATOM   1332  H HB2  . TYR B 2 16 ? 1.071   -6.041  -13.524 1.00 0.00 ? 16 TYR B HB2  2  
ATOM   1333  H HB3  . TYR B 2 16 ? 1.826   -7.525  -14.105 1.00 0.00 ? 16 TYR B HB3  2  
ATOM   1334  H HD1  . TYR B 2 16 ? 0.374   -9.731  -13.768 1.00 0.00 ? 16 TYR B HD1  2  
ATOM   1335  H HD2  . TYR B 2 16 ? -1.233  -5.744  -13.872 1.00 0.00 ? 16 TYR B HD2  2  
ATOM   1336  H HE1  . TYR B 2 16 ? -1.858  -10.643 -14.338 1.00 0.00 ? 16 TYR B HE1  2  
ATOM   1337  H HE2  . TYR B 2 16 ? -3.463  -6.660  -14.442 1.00 0.00 ? 16 TYR B HE2  2  
ATOM   1338  H HH   . TYR B 2 16 ? -3.940  -10.147 -14.967 1.00 0.00 ? 16 TYR B HH   2  
ATOM   1339  N N    . LEU B 2 17 ? 3.815   -7.105  -11.702 1.00 0.00 ? 17 LEU B N    2  
ATOM   1340  C CA   . LEU B 2 17 ? 5.243   -7.529  -11.642 1.00 0.00 ? 17 LEU B CA   2  
ATOM   1341  C C    . LEU B 2 17 ? 5.698   -7.602  -10.184 1.00 0.00 ? 17 LEU B C    2  
ATOM   1342  O O    . LEU B 2 17 ? 6.734   -8.158  -9.874  1.00 0.00 ? 17 LEU B O    2  
ATOM   1343  C CB   . LEU B 2 17 ? 6.108   -6.515  -12.393 1.00 0.00 ? 17 LEU B CB   2  
ATOM   1344  C CG   . LEU B 2 17 ? 6.829   -7.216  -13.546 1.00 0.00 ? 17 LEU B CG   2  
ATOM   1345  C CD1  . LEU B 2 17 ? 7.687   -8.355  -12.994 1.00 0.00 ? 17 LEU B CD1  2  
ATOM   1346  C CD2  . LEU B 2 17 ? 5.797   -7.784  -14.523 1.00 0.00 ? 17 LEU B CD2  2  
ATOM   1347  H H    . LEU B 2 17 ? 3.576   -6.165  -11.569 1.00 0.00 ? 17 LEU B H    2  
ATOM   1348  H HA   . LEU B 2 17 ? 5.349   -8.501  -12.099 1.00 0.00 ? 17 LEU B HA   2  
ATOM   1349  H HB2  . LEU B 2 17 ? 5.481   -5.727  -12.785 1.00 0.00 ? 17 LEU B HB2  2  
ATOM   1350  H HB3  . LEU B 2 17 ? 6.837   -6.095  -11.718 1.00 0.00 ? 17 LEU B HB3  2  
ATOM   1351  H HG   . LEU B 2 17 ? 7.461   -6.506  -14.060 1.00 0.00 ? 17 LEU B HG   2  
ATOM   1352  H HD11 . LEU B 2 17 ? 7.209   -9.301  -13.204 1.00 0.00 ? 17 LEU B HD11 2  
ATOM   1353  H HD12 . LEU B 2 17 ? 7.797   -8.237  -11.926 1.00 0.00 ? 17 LEU B HD12 2  
ATOM   1354  H HD13 . LEU B 2 17 ? 8.661   -8.332  -13.461 1.00 0.00 ? 17 LEU B HD13 2  
ATOM   1355  H HD21 . LEU B 2 17 ? 5.683   -7.111  -15.359 1.00 0.00 ? 17 LEU B HD21 2  
ATOM   1356  H HD22 . LEU B 2 17 ? 4.848   -7.895  -14.019 1.00 0.00 ? 17 LEU B HD22 2  
ATOM   1357  H HD23 . LEU B 2 17 ? 6.130   -8.748  -14.879 1.00 0.00 ? 17 LEU B HD23 2  
ATOM   1358  N N    . VAL B 2 18 ? 4.936   -7.044  -9.286  1.00 0.00 ? 18 VAL B N    2  
ATOM   1359  C CA   . VAL B 2 18 ? 5.326   -7.080  -7.850  1.00 0.00 ? 18 VAL B CA   2  
ATOM   1360  C C    . VAL B 2 18 ? 5.039   -8.466  -7.277  1.00 0.00 ? 18 VAL B C    2  
ATOM   1361  O O    . VAL B 2 18 ? 5.918   -9.139  -6.776  1.00 0.00 ? 18 VAL B O    2  
ATOM   1362  C CB   . VAL B 2 18 ? 4.518   -6.037  -7.077  1.00 0.00 ? 18 VAL B CB   2  
ATOM   1363  C CG1  . VAL B 2 18 ? 4.839   -6.144  -5.587  1.00 0.00 ? 18 VAL B CG1  2  
ATOM   1364  C CG2  . VAL B 2 18 ? 4.882   -4.639  -7.577  1.00 0.00 ? 18 VAL B CG2  2  
ATOM   1365  H H    . VAL B 2 18 ? 4.106   -6.599  -9.557  1.00 0.00 ? 18 VAL B H    2  
ATOM   1366  H HA   . VAL B 2 18 ? 6.379   -6.861  -7.756  1.00 0.00 ? 18 VAL B HA   2  
ATOM   1367  H HB   . VAL B 2 18 ? 3.463   -6.213  -7.232  1.00 0.00 ? 18 VAL B HB   2  
ATOM   1368  H HG11 . VAL B 2 18 ? 4.501   -5.252  -5.081  1.00 0.00 ? 18 VAL B HG11 2  
ATOM   1369  H HG12 . VAL B 2 18 ? 5.906   -6.250  -5.457  1.00 0.00 ? 18 VAL B HG12 2  
ATOM   1370  H HG13 . VAL B 2 18 ? 4.337   -7.005  -5.172  1.00 0.00 ? 18 VAL B HG13 2  
ATOM   1371  H HG21 . VAL B 2 18 ? 3.979   -4.067  -7.738  1.00 0.00 ? 18 VAL B HG21 2  
ATOM   1372  H HG22 . VAL B 2 18 ? 5.428   -4.719  -8.505  1.00 0.00 ? 18 VAL B HG22 2  
ATOM   1373  H HG23 . VAL B 2 18 ? 5.495   -4.143  -6.840  1.00 0.00 ? 18 VAL B HG23 2  
ATOM   1374  N N    . CYS B 2 19 ? 3.811   -8.896  -7.340  1.00 0.00 ? 19 CYS B N    2  
ATOM   1375  C CA   . CYS B 2 19 ? 3.459   -10.237 -6.793  1.00 0.00 ? 19 CYS B CA   2  
ATOM   1376  C C    . CYS B 2 19 ? 3.890   -11.324 -7.782  1.00 0.00 ? 19 CYS B C    2  
ATOM   1377  O O    . CYS B 2 19 ? 4.759   -12.125 -7.498  1.00 0.00 ? 19 CYS B O    2  
ATOM   1378  C CB   . CYS B 2 19 ? 1.946   -10.320 -6.574  1.00 0.00 ? 19 CYS B CB   2  
ATOM   1379  S SG   . CYS B 2 19 ? 1.323   -8.714  -6.016  1.00 0.00 ? 19 CYS B SG   2  
ATOM   1380  H H    . CYS B 2 19 ? 3.116   -8.334  -7.743  1.00 0.00 ? 19 CYS B H    2  
ATOM   1381  H HA   . CYS B 2 19 ? 3.967   -10.386 -5.853  1.00 0.00 ? 19 CYS B HA   2  
ATOM   1382  H HB2  . CYS B 2 19 ? 1.463   -10.591 -7.501  1.00 0.00 ? 19 CYS B HB2  2  
ATOM   1383  H HB3  . CYS B 2 19 ? 1.733   -11.069 -5.825  1.00 0.00 ? 19 CYS B HB3  2  
ATOM   1384  N N    . GLY B 2 20 ? 3.288   -11.361 -8.938  1.00 0.00 ? 20 GLY B N    2  
ATOM   1385  C CA   . GLY B 2 20 ? 3.661   -12.400 -9.940  1.00 0.00 ? 20 GLY B CA   2  
ATOM   1386  C C    . GLY B 2 20 ? 2.875   -13.681 -9.658  1.00 0.00 ? 20 GLY B C    2  
ATOM   1387  O O    . GLY B 2 20 ? 1.803   -13.894 -10.190 1.00 0.00 ? 20 GLY B O    2  
ATOM   1388  H H    . GLY B 2 20 ? 2.587   -10.709 -9.148  1.00 0.00 ? 20 GLY B H    2  
ATOM   1389  H HA2  . GLY B 2 20 ? 3.430   -12.043 -10.933 1.00 0.00 ? 20 GLY B HA2  2  
ATOM   1390  H HA3  . GLY B 2 20 ? 4.718   -12.609 -9.867  1.00 0.00 ? 20 GLY B HA3  2  
ATOM   1391  N N    . GLU B 2 21 ? 3.394   -14.535 -8.819  1.00 0.00 ? 21 GLU B N    2  
ATOM   1392  C CA   . GLU B 2 21 ? 2.672   -15.798 -8.502  1.00 0.00 ? 21 GLU B CA   2  
ATOM   1393  C C    . GLU B 2 21 ? 1.560   -15.504 -7.494  1.00 0.00 ? 21 GLU B C    2  
ATOM   1394  O O    . GLU B 2 21 ? 0.402   -15.781 -7.733  1.00 0.00 ? 21 GLU B O    2  
ATOM   1395  C CB   . GLU B 2 21 ? 3.653   -16.809 -7.904  1.00 0.00 ? 21 GLU B CB   2  
ATOM   1396  C CG   . GLU B 2 21 ? 4.743   -17.127 -8.930  1.00 0.00 ? 21 GLU B CG   2  
ATOM   1397  C CD   . GLU B 2 21 ? 5.747   -18.109 -8.322  1.00 0.00 ? 21 GLU B CD   2  
ATOM   1398  O OE1  . GLU B 2 21 ? 6.221   -17.842 -7.230  1.00 0.00 ? 21 GLU B OE1  2  
ATOM   1399  O OE2  . GLU B 2 21 ? 6.026   -19.110 -8.961  1.00 0.00 ? 21 GLU B OE2  2  
ATOM   1400  H H    . GLU B 2 21 ? 4.257   -14.345 -8.397  1.00 0.00 ? 21 GLU B H    2  
ATOM   1401  H HA   . GLU B 2 21 ? 2.241   -16.204 -9.405  1.00 0.00 ? 21 GLU B HA   2  
ATOM   1402  H HB2  . GLU B 2 21 ? 4.103   -16.391 -7.015  1.00 0.00 ? 21 GLU B HB2  2  
ATOM   1403  H HB3  . GLU B 2 21 ? 3.125   -17.716 -7.650  1.00 0.00 ? 21 GLU B HB3  2  
ATOM   1404  H HG2  . GLU B 2 21 ? 4.294   -17.568 -9.808  1.00 0.00 ? 21 GLU B HG2  2  
ATOM   1405  H HG3  . GLU B 2 21 ? 5.255   -16.217 -9.205  1.00 0.00 ? 21 GLU B HG3  2  
ATOM   1406  N N    . ARG B 2 22 ? 1.901   -14.940 -6.367  1.00 0.00 ? 22 ARG B N    2  
ATOM   1407  C CA   . ARG B 2 22 ? 0.863   -14.625 -5.347  1.00 0.00 ? 22 ARG B CA   2  
ATOM   1408  C C    . ARG B 2 22 ? -0.326  -13.948 -6.031  1.00 0.00 ? 22 ARG B C    2  
ATOM   1409  O O    . ARG B 2 22 ? -1.466  -14.153 -5.664  1.00 0.00 ? 22 ARG B O    2  
ATOM   1410  C CB   . ARG B 2 22 ? 1.452   -13.687 -4.291  1.00 0.00 ? 22 ARG B CB   2  
ATOM   1411  C CG   . ARG B 2 22 ? 2.279   -14.499 -3.293  1.00 0.00 ? 22 ARG B CG   2  
ATOM   1412  C CD   . ARG B 2 22 ? 2.958   -13.553 -2.301  1.00 0.00 ? 22 ARG B CD   2  
ATOM   1413  N NE   . ARG B 2 22 ? 2.623   -13.969 -0.909  1.00 0.00 ? 22 ARG B NE   2  
ATOM   1414  C CZ   . ARG B 2 22 ? 2.024   -13.133 -0.107  1.00 0.00 ? 22 ARG B CZ   2  
ATOM   1415  N NH1  . ARG B 2 22 ? 2.667   -12.095 0.354   1.00 0.00 ? 22 ARG B NH1  2  
ATOM   1416  N NH2  . ARG B 2 22 ? 0.780   -13.336 0.235   1.00 0.00 ? 22 ARG B NH2  2  
ATOM   1417  H H    . ARG B 2 22 ? 2.841   -14.721 -6.194  1.00 0.00 ? 22 ARG B H    2  
ATOM   1418  H HA   . ARG B 2 22 ? 0.533   -15.538 -4.875  1.00 0.00 ? 22 ARG B HA   2  
ATOM   1419  H HB2  . ARG B 2 22 ? 2.083   -12.954 -4.773  1.00 0.00 ? 22 ARG B HB2  2  
ATOM   1420  H HB3  . ARG B 2 22 ? 0.652   -13.185 -3.768  1.00 0.00 ? 22 ARG B HB3  2  
ATOM   1421  H HG2  . ARG B 2 22 ? 1.631   -15.179 -2.759  1.00 0.00 ? 22 ARG B HG2  2  
ATOM   1422  H HG3  . ARG B 2 22 ? 3.033   -15.061 -3.824  1.00 0.00 ? 22 ARG B HG3  2  
ATOM   1423  H HD2  . ARG B 2 22 ? 4.028   -13.592 -2.440  1.00 0.00 ? 22 ARG B HD2  2  
ATOM   1424  H HD3  . ARG B 2 22 ? 2.609   -12.545 -2.469  1.00 0.00 ? 22 ARG B HD3  2  
ATOM   1425  H HE   . ARG B 2 22 ? 2.852   -14.869 -0.598  1.00 0.00 ? 22 ARG B HE   2  
ATOM   1426  H HH11 . ARG B 2 22 ? 3.620   -11.941 0.092   1.00 0.00 ? 22 ARG B HH11 2  
ATOM   1427  H HH12 . ARG B 2 22 ? 2.207   -11.454 0.967   1.00 0.00 ? 22 ARG B HH12 2  
ATOM   1428  H HH21 . ARG B 2 22 ? 0.288   -14.131 -0.118  1.00 0.00 ? 22 ARG B HH21 2  
ATOM   1429  H HH22 . ARG B 2 22 ? 0.321   -12.696 0.852   1.00 0.00 ? 22 ARG B HH22 2  
ATOM   1430  N N    . GLY B 2 23 ? -0.070  -13.144 -7.028  1.00 0.00 ? 23 GLY B N    2  
ATOM   1431  C CA   . GLY B 2 23 ? -1.186  -12.460 -7.737  1.00 0.00 ? 23 GLY B CA   2  
ATOM   1432  C C    . GLY B 2 23 ? -1.469  -11.112 -7.074  1.00 0.00 ? 23 GLY B C    2  
ATOM   1433  O O    . GLY B 2 23 ? -0.652  -10.581 -6.349  1.00 0.00 ? 23 GLY B O    2  
ATOM   1434  H H    . GLY B 2 23 ? 0.856   -12.995 -7.311  1.00 0.00 ? 23 GLY B H    2  
ATOM   1435  H HA2  . GLY B 2 23 ? -0.912  -12.304 -8.771  1.00 0.00 ? 23 GLY B HA2  2  
ATOM   1436  H HA3  . GLY B 2 23 ? -2.073  -13.074 -7.689  1.00 0.00 ? 23 GLY B HA3  2  
ATOM   1437  N N    . PHE B 2 24 ? -2.627  -10.559 -7.312  1.00 0.00 ? 24 PHE B N    2  
ATOM   1438  C CA   . PHE B 2 24 ? -2.975  -9.244  -6.693  1.00 0.00 ? 24 PHE B CA   2  
ATOM   1439  C C    . PHE B 2 24 ? -4.350  -8.793  -7.202  1.00 0.00 ? 24 PHE B C    2  
ATOM   1440  O O    . PHE B 2 24 ? -4.889  -9.354  -8.134  1.00 0.00 ? 24 PHE B O    2  
ATOM   1441  C CB   . PHE B 2 24 ? -1.890  -8.198  -7.038  1.00 0.00 ? 24 PHE B CB   2  
ATOM   1442  C CG   . PHE B 2 24 ? -2.294  -7.358  -8.246  1.00 0.00 ? 24 PHE B CG   2  
ATOM   1443  C CD1  . PHE B 2 24 ? -2.038  -7.820  -9.547  1.00 0.00 ? 24 PHE B CD1  2  
ATOM   1444  C CD2  . PHE B 2 24 ? -2.927  -6.114  -8.063  1.00 0.00 ? 24 PHE B CD2  2  
ATOM   1445  C CE1  . PHE B 2 24 ? -2.412  -7.047  -10.655 1.00 0.00 ? 24 PHE B CE1  2  
ATOM   1446  C CE2  . PHE B 2 24 ? -3.300  -5.345  -9.174  1.00 0.00 ? 24 PHE B CE2  2  
ATOM   1447  C CZ   . PHE B 2 24 ? -3.042  -5.812  -10.467 1.00 0.00 ? 24 PHE B CZ   2  
ATOM   1448  H H    . PHE B 2 24 ? -3.272  -11.015 -7.894  1.00 0.00 ? 24 PHE B H    2  
ATOM   1449  H HA   . PHE B 2 24 ? -3.021  -9.365  -5.620  1.00 0.00 ? 24 PHE B HA   2  
ATOM   1450  H HB2  . PHE B 2 24 ? -1.750  -7.546  -6.188  1.00 0.00 ? 24 PHE B HB2  2  
ATOM   1451  H HB3  . PHE B 2 24 ? -0.955  -8.712  -7.247  1.00 0.00 ? 24 PHE B HB3  2  
ATOM   1452  H HD1  . PHE B 2 24 ? -1.554  -8.767  -9.698  1.00 0.00 ? 24 PHE B HD1  2  
ATOM   1453  H HD2  . PHE B 2 24 ? -3.129  -5.746  -7.068  1.00 0.00 ? 24 PHE B HD2  2  
ATOM   1454  H HE1  . PHE B 2 24 ? -2.215  -7.406  -11.653 1.00 0.00 ? 24 PHE B HE1  2  
ATOM   1455  H HE2  . PHE B 2 24 ? -3.786  -4.392  -9.031  1.00 0.00 ? 24 PHE B HE2  2  
ATOM   1456  H HZ   . PHE B 2 24 ? -3.330  -5.217  -11.322 1.00 0.00 ? 24 PHE B HZ   2  
ATOM   1457  N N    . PHE B 2 25 ? -4.920  -7.788  -6.597  1.00 0.00 ? 25 PHE B N    2  
ATOM   1458  C CA   . PHE B 2 25 ? -6.257  -7.311  -7.052  1.00 0.00 ? 25 PHE B CA   2  
ATOM   1459  C C    . PHE B 2 25 ? -6.488  -5.880  -6.559  1.00 0.00 ? 25 PHE B C    2  
ATOM   1460  O O    . PHE B 2 25 ? -6.339  -5.584  -5.390  1.00 0.00 ? 25 PHE B O    2  
ATOM   1461  C CB   . PHE B 2 25 ? -7.344  -8.230  -6.488  1.00 0.00 ? 25 PHE B CB   2  
ATOM   1462  C CG   . PHE B 2 25 ? -7.506  -7.976  -5.007  1.00 0.00 ? 25 PHE B CG   2  
ATOM   1463  C CD1  . PHE B 2 25 ? -6.435  -8.206  -4.134  1.00 0.00 ? 25 PHE B CD1  2  
ATOM   1464  C CD2  . PHE B 2 25 ? -8.729  -7.508  -4.508  1.00 0.00 ? 25 PHE B CD2  2  
ATOM   1465  C CE1  . PHE B 2 25 ? -6.586  -7.969  -2.762  1.00 0.00 ? 25 PHE B CE1  2  
ATOM   1466  C CE2  . PHE B 2 25 ? -8.880  -7.271  -3.135  1.00 0.00 ? 25 PHE B CE2  2  
ATOM   1467  C CZ   . PHE B 2 25 ? -7.809  -7.501  -2.262  1.00 0.00 ? 25 PHE B CZ   2  
ATOM   1468  H H    . PHE B 2 25 ? -4.471  -7.347  -5.846  1.00 0.00 ? 25 PHE B H    2  
ATOM   1469  H HA   . PHE B 2 25 ? -6.296  -7.330  -8.131  1.00 0.00 ? 25 PHE B HA   2  
ATOM   1470  H HB2  . PHE B 2 25 ? -8.279  -8.032  -6.992  1.00 0.00 ? 25 PHE B HB2  2  
ATOM   1471  H HB3  . PHE B 2 25 ? -7.061  -9.260  -6.646  1.00 0.00 ? 25 PHE B HB3  2  
ATOM   1472  H HD1  . PHE B 2 25 ? -5.492  -8.567  -4.519  1.00 0.00 ? 25 PHE B HD1  2  
ATOM   1473  H HD2  . PHE B 2 25 ? -9.555  -7.331  -5.180  1.00 0.00 ? 25 PHE B HD2  2  
ATOM   1474  H HE1  . PHE B 2 25 ? -5.760  -8.146  -2.089  1.00 0.00 ? 25 PHE B HE1  2  
ATOM   1475  H HE2  . PHE B 2 25 ? -9.823  -6.910  -2.750  1.00 0.00 ? 25 PHE B HE2  2  
ATOM   1476  H HZ   . PHE B 2 25 ? -7.926  -7.317  -1.204  1.00 0.00 ? 25 PHE B HZ   2  
ATOM   1477  N N    . TYR B 2 26 ? -6.859  -4.992  -7.441  1.00 0.00 ? 26 TYR B N    2  
ATOM   1478  C CA   . TYR B 2 26 ? -7.105  -3.583  -7.022  1.00 0.00 ? 26 TYR B CA   2  
ATOM   1479  C C    . TYR B 2 26 ? -8.008  -3.576  -5.786  1.00 0.00 ? 26 TYR B C    2  
ATOM   1480  O O    . TYR B 2 26 ? -8.552  -4.591  -5.399  1.00 0.00 ? 26 TYR B O    2  
ATOM   1481  C CB   . TYR B 2 26 ? -7.797  -2.830  -8.162  1.00 0.00 ? 26 TYR B CB   2  
ATOM   1482  C CG   . TYR B 2 26 ? -6.900  -1.721  -8.660  1.00 0.00 ? 26 TYR B CG   2  
ATOM   1483  C CD1  . TYR B 2 26 ? -5.510  -1.893  -8.675  1.00 0.00 ? 26 TYR B CD1  2  
ATOM   1484  C CD2  . TYR B 2 26 ? -7.462  -0.517  -9.108  1.00 0.00 ? 26 TYR B CD2  2  
ATOM   1485  C CE1  . TYR B 2 26 ? -4.681  -0.862  -9.136  1.00 0.00 ? 26 TYR B CE1  2  
ATOM   1486  C CE2  . TYR B 2 26 ? -6.633  0.514   -9.570  1.00 0.00 ? 26 TYR B CE2  2  
ATOM   1487  C CZ   . TYR B 2 26 ? -5.243  0.342   -9.584  1.00 0.00 ? 26 TYR B CZ   2  
ATOM   1488  O OH   . TYR B 2 26 ? -4.426  1.357   -10.037 1.00 0.00 ? 26 TYR B OH   2  
ATOM   1489  H H    . TYR B 2 26 ? -6.977  -5.252  -8.379  1.00 0.00 ? 26 TYR B H    2  
ATOM   1490  H HA   . TYR B 2 26 ? -6.165  -3.105  -6.788  1.00 0.00 ? 26 TYR B HA   2  
ATOM   1491  H HB2  . TYR B 2 26 ? -8.004  -3.515  -8.972  1.00 0.00 ? 26 TYR B HB2  2  
ATOM   1492  H HB3  . TYR B 2 26 ? -8.722  -2.407  -7.803  1.00 0.00 ? 26 TYR B HB3  2  
ATOM   1493  H HD1  . TYR B 2 26 ? -5.076  -2.821  -8.330  1.00 0.00 ? 26 TYR B HD1  2  
ATOM   1494  H HD2  . TYR B 2 26 ? -8.533  -0.384  -9.097  1.00 0.00 ? 26 TYR B HD2  2  
ATOM   1495  H HE1  . TYR B 2 26 ? -3.609  -0.994  -9.148  1.00 0.00 ? 26 TYR B HE1  2  
ATOM   1496  H HE2  . TYR B 2 26 ? -7.066  1.441   -9.914  1.00 0.00 ? 26 TYR B HE2  2  
ATOM   1497  H HH   . TYR B 2 26 ? -3.964  1.726   -9.281  1.00 0.00 ? 26 TYR B HH   2  
ATOM   1498  N N    . THR B 2 27 ? -8.175  -2.440  -5.162  1.00 0.00 ? 27 THR B N    2  
ATOM   1499  C CA   . THR B 2 27 ? -9.045  -2.376  -3.954  1.00 0.00 ? 27 THR B CA   2  
ATOM   1500  C C    . THR B 2 27 ? -10.488 -2.114  -4.377  1.00 0.00 ? 27 THR B C    2  
ATOM   1501  O O    . THR B 2 27 ? -11.423 -2.611  -3.782  1.00 0.00 ? 27 THR B O    2  
ATOM   1502  C CB   . THR B 2 27 ? -8.571  -1.245  -3.037  1.00 0.00 ? 27 THR B CB   2  
ATOM   1503  O OG1  . THR B 2 27 ? -7.984  -0.216  -3.822  1.00 0.00 ? 27 THR B OG1  2  
ATOM   1504  C CG2  . THR B 2 27 ? -7.540  -1.786  -2.046  1.00 0.00 ? 27 THR B CG2  2  
ATOM   1505  H H    . THR B 2 27 ? -7.729  -1.631  -5.489  1.00 0.00 ? 27 THR B H    2  
ATOM   1506  H HA   . THR B 2 27 ? -8.993  -3.311  -3.427  1.00 0.00 ? 27 THR B HA   2  
ATOM   1507  H HB   . THR B 2 27 ? -9.413  -0.846  -2.493  1.00 0.00 ? 27 THR B HB   2  
ATOM   1508  H HG1  . THR B 2 27 ? -8.527  0.571   -3.733  1.00 0.00 ? 27 THR B HG1  2  
ATOM   1509  H HG21 . THR B 2 27 ? -7.094  -2.684  -2.446  1.00 0.00 ? 27 THR B HG21 2  
ATOM   1510  H HG22 . THR B 2 27 ? -8.027  -2.011  -1.108  1.00 0.00 ? 27 THR B HG22 2  
ATOM   1511  H HG23 . THR B 2 27 ? -6.772  -1.043  -1.884  1.00 0.00 ? 27 THR B HG23 2  
ATOM   1512  N N    . LYS B 2 28 ? -10.672 -1.335  -5.400  1.00 0.00 ? 28 LYS B N    2  
ATOM   1513  C CA   . LYS B 2 28 ? -12.053 -1.031  -5.871  1.00 0.00 ? 28 LYS B CA   2  
ATOM   1514  C C    . LYS B 2 28 ? -12.158 -1.329  -7.370  1.00 0.00 ? 28 LYS B C    2  
ATOM   1515  O O    . LYS B 2 28 ? -12.022 -0.441  -8.188  1.00 0.00 ? 28 LYS B O    2  
ATOM   1516  C CB   . LYS B 2 28 ? -12.364 0.445   -5.623  1.00 0.00 ? 28 LYS B CB   2  
ATOM   1517  C CG   . LYS B 2 28 ? -12.761 0.647   -4.159  1.00 0.00 ? 28 LYS B CG   2  
ATOM   1518  C CD   . LYS B 2 28 ? -13.912 1.653   -4.076  1.00 0.00 ? 28 LYS B CD   2  
ATOM   1519  C CE   . LYS B 2 28 ? -13.971 2.243   -2.666  1.00 0.00 ? 28 LYS B CE   2  
ATOM   1520  N NZ   . LYS B 2 28 ? -15.329 2.800   -2.418  1.00 0.00 ? 28 LYS B NZ   2  
ATOM   1521  H H    . LYS B 2 28 ? -9.900  -0.950  -5.859  1.00 0.00 ? 28 LYS B H    2  
ATOM   1522  H HA   . LYS B 2 28 ? -12.760 -1.645  -5.331  1.00 0.00 ? 28 LYS B HA   2  
ATOM   1523  H HB2  . LYS B 2 28 ? -11.491 1.040   -5.843  1.00 0.00 ? 28 LYS B HB2  2  
ATOM   1524  H HB3  . LYS B 2 28 ? -13.181 0.753   -6.260  1.00 0.00 ? 28 LYS B HB3  2  
ATOM   1525  H HG2  . LYS B 2 28 ? -13.076 -0.298  -3.738  1.00 0.00 ? 28 LYS B HG2  2  
ATOM   1526  H HG3  . LYS B 2 28 ? -11.915 1.024   -3.606  1.00 0.00 ? 28 LYS B HG3  2  
ATOM   1527  H HD2  . LYS B 2 28 ? -13.750 2.446   -4.792  1.00 0.00 ? 28 LYS B HD2  2  
ATOM   1528  H HD3  . LYS B 2 28 ? -14.843 1.155   -4.294  1.00 0.00 ? 28 LYS B HD3  2  
ATOM   1529  H HE2  . LYS B 2 28 ? -13.761 1.468   -1.943  1.00 0.00 ? 28 LYS B HE2  2  
ATOM   1530  H HE3  . LYS B 2 28 ? -13.236 3.030   -2.574  1.00 0.00 ? 28 LYS B HE3  2  
ATOM   1531  H HZ1  . LYS B 2 28 ? -15.878 2.787   -3.301  1.00 0.00 ? 28 LYS B HZ1  2  
ATOM   1532  H HZ2  . LYS B 2 28 ? -15.245 3.781   -2.077  1.00 0.00 ? 28 LYS B HZ2  2  
ATOM   1533  H HZ3  . LYS B 2 28 ? -15.816 2.225   -1.703  1.00 0.00 ? 28 LYS B HZ3  2  
ATOM   1534  N N    . PRO B 2 29 ? -12.400 -2.577  -7.684  1.00 0.00 ? 29 PRO B N    2  
ATOM   1535  C CA   . PRO B 2 29 ? -12.531 -3.033  -9.080  1.00 0.00 ? 29 PRO B CA   2  
ATOM   1536  C C    . PRO B 2 29 ? -13.906 -2.653  -9.636  1.00 0.00 ? 29 PRO B C    2  
ATOM   1537  O O    . PRO B 2 29 ? -14.902 -2.705  -8.944  1.00 0.00 ? 29 PRO B O    2  
ATOM   1538  C CB   . PRO B 2 29 ? -12.383 -4.553  -8.975  1.00 0.00 ? 29 PRO B CB   2  
ATOM   1539  C CG   . PRO B 2 29 ? -12.741 -4.927  -7.517  1.00 0.00 ? 29 PRO B CG   2  
ATOM   1540  C CD   . PRO B 2 29 ? -12.564 -3.646  -6.679  1.00 0.00 ? 29 PRO B CD   2  
ATOM   1541  H HA   . PRO B 2 29 ? -11.744 -2.626  -9.692  1.00 0.00 ? 29 PRO B HA   2  
ATOM   1542  H HB2  . PRO B 2 29 ? -13.061 -5.039  -9.665  1.00 0.00 ? 29 PRO B HB2  2  
ATOM   1543  H HB3  . PRO B 2 29 ? -11.365 -4.843  -9.186  1.00 0.00 ? 29 PRO B HB3  2  
ATOM   1544  H HG2  . PRO B 2 29 ? -13.766 -5.270  -7.464  1.00 0.00 ? 29 PRO B HG2  2  
ATOM   1545  H HG3  . PRO B 2 29 ? -12.075 -5.694  -7.156  1.00 0.00 ? 29 PRO B HG3  2  
ATOM   1546  H HD2  . PRO B 2 29 ? -13.441 -3.469  -6.071  1.00 0.00 ? 29 PRO B HD2  2  
ATOM   1547  H HD3  . PRO B 2 29 ? -11.681 -3.716  -6.061  1.00 0.00 ? 29 PRO B HD3  2  
ATOM   1548  N N    . THR B 2 30 ? -13.967 -2.272  -10.883 1.00 0.00 ? 30 THR B N    2  
ATOM   1549  C CA   . THR B 2 30 ? -15.278 -1.889  -11.480 1.00 0.00 ? 30 THR B CA   2  
ATOM   1550  C C    . THR B 2 30 ? -16.311 -2.975  -11.180 1.00 0.00 ? 30 THR B C    2  
ATOM   1551  O O    . THR B 2 30 ? -17.314 -2.656  -10.564 1.00 0.00 ? 30 THR B O    2  
ATOM   1552  C CB   . THR B 2 30 ? -15.125 -1.738  -12.996 1.00 0.00 ? 30 THR B CB   2  
ATOM   1553  O OG1  . THR B 2 30 ? -16.411 -1.695  -13.597 1.00 0.00 ? 30 THR B OG1  2  
ATOM   1554  C CG2  . THR B 2 30 ? -14.338 -2.925  -13.552 1.00 0.00 ? 30 THR B CG2  2  
ATOM   1555  O OXT  . THR B 2 30 ? -16.082 -4.108  -11.571 1.00 0.00 ? 30 THR B OXT  2  
ATOM   1556  H H    . THR B 2 30 ? -13.152 -2.236  -11.425 1.00 0.00 ? 30 THR B H    2  
ATOM   1557  H HA   . THR B 2 30 ? -15.606 -0.952  -11.056 1.00 0.00 ? 30 THR B HA   2  
ATOM   1558  H HB   . THR B 2 30 ? -14.594 -0.825  -13.215 1.00 0.00 ? 30 THR B HB   2  
ATOM   1559  H HG1  . THR B 2 30 ? -16.833 -2.545  -13.452 1.00 0.00 ? 30 THR B HG1  2  
ATOM   1560  H HG21 . THR B 2 30 ? -13.848 -3.445  -12.741 1.00 0.00 ? 30 THR B HG21 2  
ATOM   1561  H HG22 . THR B 2 30 ? -13.595 -2.569  -14.251 1.00 0.00 ? 30 THR B HG22 2  
ATOM   1562  H HG23 . THR B 2 30 ? -15.013 -3.599  -14.056 1.00 0.00 ? 30 THR B HG23 2  
ATOM   1563  N N    . GLY A 1 1  ? -7.467  3.866   0.417   1.00 0.00 ? 1  GLY A N    3  
ATOM   1564  C CA   . GLY A 1 1  ? -7.012  2.851   -0.632  1.00 0.00 ? 1  GLY A CA   3  
ATOM   1565  C C    . GLY A 1 1  ? -5.568  2.768   -0.990  1.00 0.00 ? 1  GLY A C    3  
ATOM   1566  O O    . GLY A 1 1  ? -4.708  3.188   -0.241  1.00 0.00 ? 1  GLY A O    3  
ATOM   1567  H H1   . GLY A 1 1  ? -8.301  3.497   0.918   1.00 0.00 ? 1  GLY A H1   3  
ATOM   1568  H H2   . GLY A 1 1  ? -7.712  4.762   -0.051  1.00 0.00 ? 1  GLY A H2   3  
ATOM   1569  H H3   . GLY A 1 1  ? -6.699  4.028   1.099   1.00 0.00 ? 1  GLY A H3   3  
ATOM   1570  H HA2  . GLY A 1 1  ? -6.855  1.974   -0.235  1.00 0.00 ? 1  GLY A HA2  3  
ATOM   1571  H HA3  . GLY A 1 1  ? -7.829  2.833   -1.466  1.00 0.00 ? 1  GLY A HA3  3  
HETATM 1572  N N    . IIL A 1 2  ? -5.260  2.228   -2.138  1.00 0.00 ? 2  IIL A N    3  
HETATM 1573  C CA   . IIL A 1 2  ? -3.834  2.118   -2.553  1.00 0.00 ? 2  IIL A CA   3  
HETATM 1574  C C    . IIL A 1 2  ? -3.625  2.886   -3.859  1.00 0.00 ? 2  IIL A C    3  
HETATM 1575  O O    . IIL A 1 2  ? -2.617  3.536   -4.055  1.00 0.00 ? 2  IIL A O    3  
HETATM 1576  C CB   . IIL A 1 2  ? -3.479  0.646   -2.768  1.00 0.00 ? 2  IIL A CB   3  
HETATM 1577  C CG2  . IIL A 1 2  ? -2.066  0.544   -3.346  1.00 0.00 ? 2  IIL A CG2  3  
HETATM 1578  C CG1  . IIL A 1 2  ? -4.477  0.023   -3.746  1.00 0.00 ? 2  IIL A CG1  3  
HETATM 1579  C CD1  . IIL A 1 2  ? -4.042  -1.404  -4.080  1.00 0.00 ? 2  IIL A CD1  3  
HETATM 1580  H H    . IIL A 1 2  ? -5.969  1.896   -2.729  1.00 0.00 ? 2  IIL A H    3  
HETATM 1581  H HA   . IIL A 1 2  ? -3.198  2.534   -1.783  1.00 0.00 ? 2  IIL A HA   3  
HETATM 1582  H HB   . IIL A 1 2  ? -3.521  0.120   -1.825  1.00 0.00 ? 2  IIL A HB   3  
HETATM 1583  H HG21 . IIL A 1 2  ? -1.432  1.283   -2.880  1.00 0.00 ? 2  IIL A HG21 3  
HETATM 1584  H HG22 . IIL A 1 2  ? -2.100  0.718   -4.412  1.00 0.00 ? 2  IIL A HG22 3  
HETATM 1585  H HG23 . IIL A 1 2  ? -1.669  -0.442  -3.156  1.00 0.00 ? 2  IIL A HG23 3  
HETATM 1586  H HG12 . IIL A 1 2  ? -4.507  0.609   -4.652  1.00 0.00 ? 2  IIL A HG12 3  
HETATM 1587  H HG13 . IIL A 1 2  ? -5.458  0.005   -3.295  1.00 0.00 ? 2  IIL A HG13 3  
HETATM 1588  H HD11 . IIL A 1 2  ? -3.230  -1.376  -4.791  1.00 0.00 ? 2  IIL A HD11 3  
HETATM 1589  H HD12 . IIL A 1 2  ? -4.875  -1.943  -4.506  1.00 0.00 ? 2  IIL A HD12 3  
HETATM 1590  H HD13 . IIL A 1 2  ? -3.715  -1.902  -3.179  1.00 0.00 ? 2  IIL A HD13 3  
ATOM   1591  N N    . VAL A 1 3  ? -4.570  2.813   -4.755  1.00 0.00 ? 3  VAL A N    3  
ATOM   1592  C CA   . VAL A 1 3  ? -4.429  3.535   -6.049  1.00 0.00 ? 3  VAL A CA   3  
ATOM   1593  C C    . VAL A 1 3  ? -4.287  5.035   -5.784  1.00 0.00 ? 3  VAL A C    3  
ATOM   1594  O O    . VAL A 1 3  ? -3.537  5.724   -6.443  1.00 0.00 ? 3  VAL A O    3  
ATOM   1595  C CB   . VAL A 1 3  ? -5.671  3.288   -6.904  1.00 0.00 ? 3  VAL A CB   3  
ATOM   1596  C CG1  . VAL A 1 3  ? -5.540  4.047   -8.225  1.00 0.00 ? 3  VAL A CG1  3  
ATOM   1597  C CG2  . VAL A 1 3  ? -5.808  1.790   -7.185  1.00 0.00 ? 3  VAL A CG2  3  
ATOM   1598  H H    . VAL A 1 3  ? -5.374  2.282   -4.577  1.00 0.00 ? 3  VAL A H    3  
ATOM   1599  H HA   . VAL A 1 3  ? -3.554  3.176   -6.570  1.00 0.00 ? 3  VAL A HA   3  
ATOM   1600  H HB   . VAL A 1 3  ? -6.546  3.638   -6.375  1.00 0.00 ? 3  VAL A HB   3  
ATOM   1601  H HG11 . VAL A 1 3  ? -5.809  5.082   -8.074  1.00 0.00 ? 3  VAL A HG11 3  
ATOM   1602  H HG12 . VAL A 1 3  ? -6.200  3.607   -8.959  1.00 0.00 ? 3  VAL A HG12 3  
ATOM   1603  H HG13 . VAL A 1 3  ? -4.520  3.987   -8.575  1.00 0.00 ? 3  VAL A HG13 3  
ATOM   1604  H HG21 . VAL A 1 3  ? -5.922  1.258   -6.253  1.00 0.00 ? 3  VAL A HG21 3  
ATOM   1605  H HG22 . VAL A 1 3  ? -4.923  1.437   -7.695  1.00 0.00 ? 3  VAL A HG22 3  
ATOM   1606  H HG23 . VAL A 1 3  ? -6.674  1.618   -7.808  1.00 0.00 ? 3  VAL A HG23 3  
ATOM   1607  N N    . GLU A 1 4  ? -5.008  5.546   -4.823  1.00 0.00 ? 4  GLU A N    3  
ATOM   1608  C CA   . GLU A 1 4  ? -4.925  7.002   -4.519  1.00 0.00 ? 4  GLU A CA   3  
ATOM   1609  C C    . GLU A 1 4  ? -3.614  7.313   -3.792  1.00 0.00 ? 4  GLU A C    3  
ATOM   1610  O O    . GLU A 1 4  ? -3.354  8.441   -3.424  1.00 0.00 ? 4  GLU A O    3  
ATOM   1611  C CB   . GLU A 1 4  ? -6.102  7.402   -3.626  1.00 0.00 ? 4  GLU A CB   3  
ATOM   1612  C CG   . GLU A 1 4  ? -7.329  6.566   -3.992  1.00 0.00 ? 4  GLU A CG   3  
ATOM   1613  C CD   . GLU A 1 4  ? -8.568  7.462   -4.018  1.00 0.00 ? 4  GLU A CD   3  
ATOM   1614  O OE1  . GLU A 1 4  ? -8.471  8.556   -4.548  1.00 0.00 ? 4  GLU A OE1  3  
ATOM   1615  O OE2  . GLU A 1 4  ? -9.592  7.038   -3.510  1.00 0.00 ? 4  GLU A OE2  3  
ATOM   1616  H H    . GLU A 1 4  ? -5.610  4.971   -4.307  1.00 0.00 ? 4  GLU A H    3  
ATOM   1617  H HA   . GLU A 1 4  ? -4.966  7.564   -5.439  1.00 0.00 ? 4  GLU A HA   3  
ATOM   1618  H HB2  . GLU A 1 4  ? -5.843  7.230   -2.591  1.00 0.00 ? 4  GLU A HB2  3  
ATOM   1619  H HB3  . GLU A 1 4  ? -6.325  8.448   -3.772  1.00 0.00 ? 4  GLU A HB3  3  
ATOM   1620  H HG2  . GLU A 1 4  ? -7.183  6.121   -4.966  1.00 0.00 ? 4  GLU A HG2  3  
ATOM   1621  H HG3  . GLU A 1 4  ? -7.466  5.787   -3.256  1.00 0.00 ? 4  GLU A HG3  3  
ATOM   1622  N N    . GLN A 1 5  ? -2.785  6.329   -3.576  1.00 0.00 ? 5  GLN A N    3  
ATOM   1623  C CA   . GLN A 1 5  ? -1.500  6.590   -2.868  1.00 0.00 ? 5  GLN A CA   3  
ATOM   1624  C C    . GLN A 1 5  ? -0.342  6.584   -3.872  1.00 0.00 ? 5  GLN A C    3  
ATOM   1625  O O    . GLN A 1 5  ? 0.528   7.431   -3.827  1.00 0.00 ? 5  GLN A O    3  
ATOM   1626  C CB   . GLN A 1 5  ? -1.270  5.510   -1.807  1.00 0.00 ? 5  GLN A CB   3  
ATOM   1627  C CG   . GLN A 1 5  ? -2.171  5.784   -0.600  1.00 0.00 ? 5  GLN A CG   3  
ATOM   1628  C CD   . GLN A 1 5  ? -1.977  4.682   0.443   1.00 0.00 ? 5  GLN A CD   3  
ATOM   1629  O OE1  . GLN A 1 5  ? -2.924  4.255   1.075   1.00 0.00 ? 5  GLN A OE1  3  
ATOM   1630  N NE2  . GLN A 1 5  ? -0.782  4.203   0.655   1.00 0.00 ? 5  GLN A NE2  3  
ATOM   1631  H H    . GLN A 1 5  ? -3.006  5.422   -3.874  1.00 0.00 ? 5  GLN A H    3  
ATOM   1632  H HA   . GLN A 1 5  ? -1.550  7.557   -2.390  1.00 0.00 ? 5  GLN A HA   3  
ATOM   1633  H HB2  . GLN A 1 5  ? -1.508  4.541   -2.221  1.00 0.00 ? 5  GLN A HB2  3  
ATOM   1634  H HB3  . GLN A 1 5  ? -0.238  5.526   -1.492  1.00 0.00 ? 5  GLN A HB3  3  
ATOM   1635  H HG2  . GLN A 1 5  ? -1.912  6.740   -0.168  1.00 0.00 ? 5  GLN A HG2  3  
ATOM   1636  H HG3  . GLN A 1 5  ? -3.203  5.799   -0.917  1.00 0.00 ? 5  GLN A HG3  3  
ATOM   1637  H HE21 . GLN A 1 5  ? -0.018  4.548   0.146   1.00 0.00 ? 5  GLN A HE21 3  
ATOM   1638  H HE22 . GLN A 1 5  ? -0.648  3.497   1.322   1.00 0.00 ? 5  GLN A HE22 3  
ATOM   1639  N N    . CYS A 1 6  ? -0.322  5.648   -4.783  1.00 0.00 ? 6  CYS A N    3  
ATOM   1640  C CA   . CYS A 1 6  ? 0.782   5.613   -5.784  1.00 0.00 ? 6  CYS A CA   3  
ATOM   1641  C C    . CYS A 1 6  ? 0.371   6.445   -6.997  1.00 0.00 ? 6  CYS A C    3  
ATOM   1642  O O    . CYS A 1 6  ? 1.200   6.926   -7.749  1.00 0.00 ? 6  CYS A O    3  
ATOM   1643  C CB   . CYS A 1 6  ? 1.048   4.170   -6.213  1.00 0.00 ? 6  CYS A CB   3  
ATOM   1644  S SG   . CYS A 1 6  ? 1.938   3.304   -4.896  1.00 0.00 ? 6  CYS A SG   3  
ATOM   1645  H H    . CYS A 1 6  ? -1.034  4.974   -4.813  1.00 0.00 ? 6  CYS A H    3  
ATOM   1646  H HA   . CYS A 1 6  ? 1.678   6.032   -5.348  1.00 0.00 ? 6  CYS A HA   3  
ATOM   1647  H HB2  . CYS A 1 6  ? 0.109   3.673   -6.401  1.00 0.00 ? 6  CYS A HB2  3  
ATOM   1648  H HB3  . CYS A 1 6  ? 1.643   4.166   -7.115  1.00 0.00 ? 6  CYS A HB3  3  
ATOM   1649  N N    . CYS A 1 7  ? -0.908  6.631   -7.183  1.00 0.00 ? 7  CYS A N    3  
ATOM   1650  C CA   . CYS A 1 7  ? -1.386  7.445   -8.331  1.00 0.00 ? 7  CYS A CA   3  
ATOM   1651  C C    . CYS A 1 7  ? -1.337  8.917   -7.925  1.00 0.00 ? 7  CYS A C    3  
ATOM   1652  O O    . CYS A 1 7  ? -1.334  9.807   -8.754  1.00 0.00 ? 7  CYS A O    3  
ATOM   1653  C CB   . CYS A 1 7  ? -2.824  7.045   -8.678  1.00 0.00 ? 7  CYS A CB   3  
ATOM   1654  S SG   . CYS A 1 7  ? -3.400  7.952   -10.138 1.00 0.00 ? 7  CYS A SG   3  
ATOM   1655  H H    . CYS A 1 7  ? -1.554  6.241   -6.557  1.00 0.00 ? 7  CYS A H    3  
ATOM   1656  H HA   . CYS A 1 7  ? -0.742  7.280   -9.176  1.00 0.00 ? 7  CYS A HA   3  
ATOM   1657  H HB2  . CYS A 1 7  ? -2.861  5.985   -8.880  1.00 0.00 ? 7  CYS A HB2  3  
ATOM   1658  H HB3  . CYS A 1 7  ? -3.468  7.271   -7.841  1.00 0.00 ? 7  CYS A HB3  3  
ATOM   1659  N N    . THR A 1 8  ? -1.283  9.172   -6.647  1.00 0.00 ? 8  THR A N    3  
ATOM   1660  C CA   . THR A 1 8  ? -1.217  10.575  -6.160  1.00 0.00 ? 8  THR A CA   3  
ATOM   1661  C C    . THR A 1 8  ? 0.254   10.971  -6.008  1.00 0.00 ? 8  THR A C    3  
ATOM   1662  O O    . THR A 1 8  ? 0.623   12.118  -6.168  1.00 0.00 ? 8  THR A O    3  
ATOM   1663  C CB   . THR A 1 8  ? -1.928  10.668  -4.803  1.00 0.00 ? 8  THR A CB   3  
ATOM   1664  O OG1  . THR A 1 8  ? -2.236  12.027  -4.525  1.00 0.00 ? 8  THR A OG1  3  
ATOM   1665  C CG2  . THR A 1 8  ? -1.027  10.108  -3.702  1.00 0.00 ? 8  THR A CG2  3  
ATOM   1666  H H    . THR A 1 8  ? -1.277  8.434   -6.003  1.00 0.00 ? 8  THR A H    3  
ATOM   1667  H HA   . THR A 1 8  ? -1.699  11.230  -6.870  1.00 0.00 ? 8  THR A HA   3  
ATOM   1668  H HB   . THR A 1 8  ? -2.841  10.092  -4.837  1.00 0.00 ? 8  THR A HB   3  
ATOM   1669  H HG1  . THR A 1 8  ? -2.606  12.415  -5.321  1.00 0.00 ? 8  THR A HG1  3  
ATOM   1670  H HG21 . THR A 1 8  ? -1.635  9.769   -2.876  1.00 0.00 ? 8  THR A HG21 3  
ATOM   1671  H HG22 . THR A 1 8  ? -0.353  10.879  -3.360  1.00 0.00 ? 8  THR A HG22 3  
ATOM   1672  H HG23 . THR A 1 8  ? -0.456  9.278   -4.093  1.00 0.00 ? 8  THR A HG23 3  
ATOM   1673  N N    . SER A 1 9  ? 1.095   10.019  -5.705  1.00 0.00 ? 9  SER A N    3  
ATOM   1674  C CA   . SER A 1 9  ? 2.547   10.315  -5.543  1.00 0.00 ? 9  SER A CA   3  
ATOM   1675  C C    . SER A 1 9  ? 3.360   9.207   -6.217  1.00 0.00 ? 9  SER A C    3  
ATOM   1676  O O    . SER A 1 9  ? 2.851   8.456   -7.026  1.00 0.00 ? 9  SER A O    3  
ATOM   1677  C CB   . SER A 1 9  ? 2.892   10.367  -4.055  1.00 0.00 ? 9  SER A CB   3  
ATOM   1678  O OG   . SER A 1 9  ? 2.009   11.266  -3.399  1.00 0.00 ? 9  SER A OG   3  
ATOM   1679  H H    . SER A 1 9  ? 0.770   9.102   -5.585  1.00 0.00 ? 9  SER A H    3  
ATOM   1680  H HA   . SER A 1 9  ? 2.776   11.265  -6.003  1.00 0.00 ? 9  SER A HA   3  
ATOM   1681  H HB2  . SER A 1 9  ? 2.784   9.385   -3.625  1.00 0.00 ? 9  SER A HB2  3  
ATOM   1682  H HB3  . SER A 1 9  ? 3.915   10.698  -3.936  1.00 0.00 ? 9  SER A HB3  3  
ATOM   1683  H HG   . SER A 1 9  ? 2.453   12.113  -3.319  1.00 0.00 ? 9  SER A HG   3  
ATOM   1684  N N    . ILE A 1 10 ? 4.617   9.090   -5.886  1.00 0.00 ? 10 ILE A N    3  
ATOM   1685  C CA   . ILE A 1 10 ? 5.450   8.024   -6.509  1.00 0.00 ? 10 ILE A CA   3  
ATOM   1686  C C    . ILE A 1 10 ? 5.462   6.799   -5.600  1.00 0.00 ? 10 ILE A C    3  
ATOM   1687  O O    . ILE A 1 10 ? 5.707   5.693   -6.036  1.00 0.00 ? 10 ILE A O    3  
ATOM   1688  C CB   . ILE A 1 10 ? 6.883   8.528   -6.691  1.00 0.00 ? 10 ILE A CB   3  
ATOM   1689  C CG1  . ILE A 1 10 ? 6.914   9.558   -7.831  1.00 0.00 ? 10 ILE A CG1  3  
ATOM   1690  C CG2  . ILE A 1 10 ? 7.799   7.340   -7.015  1.00 0.00 ? 10 ILE A CG2  3  
ATOM   1691  C CD1  . ILE A 1 10 ? 8.315   9.629   -8.445  1.00 0.00 ? 10 ILE A CD1  3  
ATOM   1692  H H    . ILE A 1 10 ? 5.010   9.699   -5.227  1.00 0.00 ? 10 ILE A H    3  
ATOM   1693  H HA   . ILE A 1 10 ? 5.034   7.757   -7.469  1.00 0.00 ? 10 ILE A HA   3  
ATOM   1694  H HB   . ILE A 1 10 ? 7.216   8.995   -5.774  1.00 0.00 ? 10 ILE A HB   3  
ATOM   1695  H HG12 . ILE A 1 10 ? 6.204   9.270   -8.591  1.00 0.00 ? 10 ILE A HG12 3  
ATOM   1696  H HG13 . ILE A 1 10 ? 6.647   10.529  -7.442  1.00 0.00 ? 10 ILE A HG13 3  
ATOM   1697  H HG21 . ILE A 1 10 ? 8.806   7.695   -7.177  1.00 0.00 ? 10 ILE A HG21 3  
ATOM   1698  H HG22 . ILE A 1 10 ? 7.444   6.843   -7.905  1.00 0.00 ? 10 ILE A HG22 3  
ATOM   1699  H HG23 . ILE A 1 10 ? 7.793   6.646   -6.188  1.00 0.00 ? 10 ILE A HG23 3  
ATOM   1700  H HD11 . ILE A 1 10 ? 8.303   10.296  -9.293  1.00 0.00 ? 10 ILE A HD11 3  
ATOM   1701  H HD12 . ILE A 1 10 ? 8.615   8.644   -8.768  1.00 0.00 ? 10 ILE A HD12 3  
ATOM   1702  H HD13 . ILE A 1 10 ? 9.013   9.994   -7.707  1.00 0.00 ? 10 ILE A HD13 3  
ATOM   1703  N N    . CYS A 1 11 ? 5.212   7.002   -4.337  1.00 0.00 ? 11 CYS A N    3  
ATOM   1704  C CA   . CYS A 1 11 ? 5.213   5.867   -3.368  1.00 0.00 ? 11 CYS A CA   3  
ATOM   1705  C C    . CYS A 1 11 ? 6.360   4.910   -3.701  1.00 0.00 ? 11 CYS A C    3  
ATOM   1706  O O    . CYS A 1 11 ? 7.354   5.302   -4.281  1.00 0.00 ? 11 CYS A O    3  
ATOM   1707  C CB   . CYS A 1 11 ? 3.869   5.126   -3.437  1.00 0.00 ? 11 CYS A CB   3  
ATOM   1708  S SG   . CYS A 1 11 ? 3.789   4.112   -4.937  1.00 0.00 ? 11 CYS A SG   3  
ATOM   1709  H H    . CYS A 1 11 ? 5.030   7.911   -4.025  1.00 0.00 ? 11 CYS A H    3  
ATOM   1710  H HA   . CYS A 1 11 ? 5.353   6.254   -2.370  1.00 0.00 ? 11 CYS A HA   3  
ATOM   1711  H HB2  . CYS A 1 11 ? 3.767   4.489   -2.571  1.00 0.00 ? 11 CYS A HB2  3  
ATOM   1712  H HB3  . CYS A 1 11 ? 3.065   5.846   -3.448  1.00 0.00 ? 11 CYS A HB3  3  
ATOM   1713  N N    . SER A 1 12 ? 6.236   3.663   -3.343  1.00 0.00 ? 12 SER A N    3  
ATOM   1714  C CA   . SER A 1 12 ? 7.328   2.696   -3.645  1.00 0.00 ? 12 SER A CA   3  
ATOM   1715  C C    . SER A 1 12 ? 6.746   1.289   -3.796  1.00 0.00 ? 12 SER A C    3  
ATOM   1716  O O    . SER A 1 12 ? 5.738   0.953   -3.204  1.00 0.00 ? 12 SER A O    3  
ATOM   1717  C CB   . SER A 1 12 ? 8.348   2.707   -2.506  1.00 0.00 ? 12 SER A CB   3  
ATOM   1718  O OG   . SER A 1 12 ? 7.679   2.959   -1.278  1.00 0.00 ? 12 SER A OG   3  
ATOM   1719  H H    . SER A 1 12 ? 5.428   3.364   -2.875  1.00 0.00 ? 12 SER A H    3  
ATOM   1720  H HA   . SER A 1 12 ? 7.815   2.982   -4.565  1.00 0.00 ? 12 SER A HA   3  
ATOM   1721  H HB2  . SER A 1 12 ? 8.840   1.749   -2.453  1.00 0.00 ? 12 SER A HB2  3  
ATOM   1722  H HB3  . SER A 1 12 ? 9.085   3.476   -2.693  1.00 0.00 ? 12 SER A HB3  3  
ATOM   1723  H HG   . SER A 1 12 ? 7.481   3.897   -1.236  1.00 0.00 ? 12 SER A HG   3  
ATOM   1724  N N    . LEU A 1 13 ? 7.378   0.464   -4.583  1.00 0.00 ? 13 LEU A N    3  
ATOM   1725  C CA   . LEU A 1 13 ? 6.868   -0.919  -4.769  1.00 0.00 ? 13 LEU A CA   3  
ATOM   1726  C C    . LEU A 1 13 ? 6.898   -1.649  -3.426  1.00 0.00 ? 13 LEU A C    3  
ATOM   1727  O O    . LEU A 1 13 ? 6.282   -2.684  -3.257  1.00 0.00 ? 13 LEU A O    3  
ATOM   1728  C CB   . LEU A 1 13 ? 7.750   -1.656  -5.776  1.00 0.00 ? 13 LEU A CB   3  
ATOM   1729  C CG   . LEU A 1 13 ? 9.208   -1.573  -5.331  1.00 0.00 ? 13 LEU A CG   3  
ATOM   1730  C CD1  . LEU A 1 13 ? 9.773   -2.986  -5.188  1.00 0.00 ? 13 LEU A CD1  3  
ATOM   1731  C CD2  . LEU A 1 13 ? 10.017  -0.805  -6.378  1.00 0.00 ? 13 LEU A CD2  3  
ATOM   1732  H H    . LEU A 1 13 ? 8.190   0.755   -5.047  1.00 0.00 ? 13 LEU A H    3  
ATOM   1733  H HA   . LEU A 1 13 ? 5.852   -0.883  -5.139  1.00 0.00 ? 13 LEU A HA   3  
ATOM   1734  H HB2  . LEU A 1 13 ? 7.447   -2.692  -5.831  1.00 0.00 ? 13 LEU A HB2  3  
ATOM   1735  H HB3  . LEU A 1 13 ? 7.647   -1.198  -6.748  1.00 0.00 ? 13 LEU A HB3  3  
ATOM   1736  H HG   . LEU A 1 13 ? 9.267   -1.063  -4.380  1.00 0.00 ? 13 LEU A HG   3  
ATOM   1737  H HD11 . LEU A 1 13 ? 9.568   -3.356  -4.194  1.00 0.00 ? 13 LEU A HD11 3  
ATOM   1738  H HD12 . LEU A 1 13 ? 10.841  -2.964  -5.351  1.00 0.00 ? 13 LEU A HD12 3  
ATOM   1739  H HD13 . LEU A 1 13 ? 9.309   -3.634  -5.917  1.00 0.00 ? 13 LEU A HD13 3  
ATOM   1740  H HD21 . LEU A 1 13 ? 9.388   -0.589  -7.230  1.00 0.00 ? 13 LEU A HD21 3  
ATOM   1741  H HD22 . LEU A 1 13 ? 10.859  -1.402  -6.693  1.00 0.00 ? 13 LEU A HD22 3  
ATOM   1742  H HD23 . LEU A 1 13 ? 10.372  0.121   -5.950  1.00 0.00 ? 13 LEU A HD23 3  
ATOM   1743  N N    . TYR A 1 14 ? 7.599   -1.113  -2.460  1.00 0.00 ? 14 TYR A N    3  
ATOM   1744  C CA   . TYR A 1 14 ? 7.650   -1.772  -1.127  1.00 0.00 ? 14 TYR A CA   3  
ATOM   1745  C C    . TYR A 1 14 ? 6.245   -1.764  -0.543  1.00 0.00 ? 14 TYR A C    3  
ATOM   1746  O O    . TYR A 1 14 ? 5.784   -2.732  0.030   1.00 0.00 ? 14 TYR A O    3  
ATOM   1747  C CB   . TYR A 1 14 ? 8.599   -1.006  -0.203  1.00 0.00 ? 14 TYR A CB   3  
ATOM   1748  C CG   . TYR A 1 14 ? 10.031  -1.369  -0.538  1.00 0.00 ? 14 TYR A CG   3  
ATOM   1749  C CD1  . TYR A 1 14 ? 10.705  -0.693  -1.566  1.00 0.00 ? 14 TYR A CD1  3  
ATOM   1750  C CD2  . TYR A 1 14 ? 10.687  -2.383  0.177   1.00 0.00 ? 14 TYR A CD2  3  
ATOM   1751  C CE1  . TYR A 1 14 ? 12.028  -1.029  -1.877  1.00 0.00 ? 14 TYR A CE1  3  
ATOM   1752  C CE2  . TYR A 1 14 ? 12.010  -2.719  -0.136  1.00 0.00 ? 14 TYR A CE2  3  
ATOM   1753  C CZ   . TYR A 1 14 ? 12.681  -2.042  -1.163  1.00 0.00 ? 14 TYR A CZ   3  
ATOM   1754  O OH   . TYR A 1 14 ? 13.984  -2.374  -1.471  1.00 0.00 ? 14 TYR A OH   3  
ATOM   1755  H H    . TYR A 1 14 ? 8.078   -0.273  -2.609  1.00 0.00 ? 14 TYR A H    3  
ATOM   1756  H HA   . TYR A 1 14 ? 7.986   -2.787  -1.239  1.00 0.00 ? 14 TYR A HA   3  
ATOM   1757  H HB2  . TYR A 1 14 ? 8.452   0.056   -0.338  1.00 0.00 ? 14 TYR A HB2  3  
ATOM   1758  H HB3  . TYR A 1 14 ? 8.392   -1.270  0.824   1.00 0.00 ? 14 TYR A HB3  3  
ATOM   1759  H HD1  . TYR A 1 14 ? 10.204  0.087   -2.118  1.00 0.00 ? 14 TYR A HD1  3  
ATOM   1760  H HD2  . TYR A 1 14 ? 10.172  -2.906  0.969   1.00 0.00 ? 14 TYR A HD2  3  
ATOM   1761  H HE1  . TYR A 1 14 ? 12.546  -0.508  -2.669  1.00 0.00 ? 14 TYR A HE1  3  
ATOM   1762  H HE2  . TYR A 1 14 ? 12.514  -3.499  0.416   1.00 0.00 ? 14 TYR A HE2  3  
ATOM   1763  H HH   . TYR A 1 14 ? 14.526  -1.589  -1.357  1.00 0.00 ? 14 TYR A HH   3  
ATOM   1764  N N    . GLN A 1 15 ? 5.553   -0.678  -0.715  1.00 0.00 ? 15 GLN A N    3  
ATOM   1765  C CA   . GLN A 1 15 ? 4.163   -0.594  -0.205  1.00 0.00 ? 15 GLN A CA   3  
ATOM   1766  C C    . GLN A 1 15 ? 3.261   -1.369  -1.160  1.00 0.00 ? 15 GLN A C    3  
ATOM   1767  O O    . GLN A 1 15 ? 2.168   -1.774  -0.818  1.00 0.00 ? 15 GLN A O    3  
ATOM   1768  C CB   . GLN A 1 15 ? 3.718   0.870   -0.150  1.00 0.00 ? 15 GLN A CB   3  
ATOM   1769  C CG   . GLN A 1 15 ? 4.715   1.679   0.681   1.00 0.00 ? 15 GLN A CG   3  
ATOM   1770  C CD   . GLN A 1 15 ? 4.056   2.977   1.150   1.00 0.00 ? 15 GLN A CD   3  
ATOM   1771  O OE1  . GLN A 1 15 ? 4.504   4.055   0.813   1.00 0.00 ? 15 GLN A OE1  3  
ATOM   1772  N NE2  . GLN A 1 15 ? 3.003   2.921   1.919   1.00 0.00 ? 15 GLN A NE2  3  
ATOM   1773  H H    . GLN A 1 15 ? 5.947   0.074   -1.199  1.00 0.00 ? 15 GLN A H    3  
ATOM   1774  H HA   . GLN A 1 15 ? 4.113   -1.030  0.781   1.00 0.00 ? 15 GLN A HA   3  
ATOM   1775  H HB2  . GLN A 1 15 ? 3.675   1.270   -1.152  1.00 0.00 ? 15 GLN A HB2  3  
ATOM   1776  H HB3  . GLN A 1 15 ? 2.740   0.932   0.304   1.00 0.00 ? 15 GLN A HB3  3  
ATOM   1777  H HG2  . GLN A 1 15 ? 5.021   1.099   1.541   1.00 0.00 ? 15 GLN A HG2  3  
ATOM   1778  H HG3  . GLN A 1 15 ? 5.580   1.913   0.079   1.00 0.00 ? 15 GLN A HG3  3  
ATOM   1779  H HE21 . GLN A 1 15 ? 2.641   2.052   2.192   1.00 0.00 ? 15 GLN A HE21 3  
ATOM   1780  H HE22 . GLN A 1 15 ? 2.575   3.748   2.225   1.00 0.00 ? 15 GLN A HE22 3  
ATOM   1781  N N    . LEU A 1 16 ? 3.726   -1.585  -2.362  1.00 0.00 ? 16 LEU A N    3  
ATOM   1782  C CA   . LEU A 1 16 ? 2.927   -2.340  -3.359  1.00 0.00 ? 16 LEU A CA   3  
ATOM   1783  C C    . LEU A 1 16 ? 2.882   -3.813  -2.953  1.00 0.00 ? 16 LEU A C    3  
ATOM   1784  O O    . LEU A 1 16 ? 2.002   -4.553  -3.348  1.00 0.00 ? 16 LEU A O    3  
ATOM   1785  C CB   . LEU A 1 16 ? 3.597   -2.202  -4.725  1.00 0.00 ? 16 LEU A CB   3  
ATOM   1786  C CG   . LEU A 1 16 ? 3.052   -0.969  -5.446  1.00 0.00 ? 16 LEU A CG   3  
ATOM   1787  C CD1  . LEU A 1 16 ? 3.732   -0.827  -6.809  1.00 0.00 ? 16 LEU A CD1  3  
ATOM   1788  C CD2  . LEU A 1 16 ? 1.543   -1.124  -5.647  1.00 0.00 ? 16 LEU A CD2  3  
ATOM   1789  H H    . LEU A 1 16 ? 4.614   -1.253  -2.609  1.00 0.00 ? 16 LEU A H    3  
ATOM   1790  H HA   . LEU A 1 16 ? 1.926   -1.942  -3.400  1.00 0.00 ? 16 LEU A HA   3  
ATOM   1791  H HB2  . LEU A 1 16 ? 4.660   -2.099  -4.587  1.00 0.00 ? 16 LEU A HB2  3  
ATOM   1792  H HB3  . LEU A 1 16 ? 3.401   -3.077  -5.313  1.00 0.00 ? 16 LEU A HB3  3  
ATOM   1793  H HG   . LEU A 1 16 ? 3.252   -0.088  -4.852  1.00 0.00 ? 16 LEU A HG   3  
ATOM   1794  H HD11 . LEU A 1 16 ? 3.353   0.052   -7.311  1.00 0.00 ? 16 LEU A HD11 3  
ATOM   1795  H HD12 . LEU A 1 16 ? 3.522   -1.701  -7.408  1.00 0.00 ? 16 LEU A HD12 3  
ATOM   1796  H HD13 . LEU A 1 16 ? 4.798   -0.732  -6.672  1.00 0.00 ? 16 LEU A HD13 3  
ATOM   1797  H HD21 . LEU A 1 16 ? 1.261   -0.700  -6.600  1.00 0.00 ? 16 LEU A HD21 3  
ATOM   1798  H HD22 . LEU A 1 16 ? 1.020   -0.608  -4.855  1.00 0.00 ? 16 LEU A HD22 3  
ATOM   1799  H HD23 . LEU A 1 16 ? 1.283   -2.172  -5.628  1.00 0.00 ? 16 LEU A HD23 3  
ATOM   1800  N N    . GLU A 1 17 ? 3.828   -4.242  -2.165  1.00 0.00 ? 17 GLU A N    3  
ATOM   1801  C CA   . GLU A 1 17 ? 3.852   -5.665  -1.726  1.00 0.00 ? 17 GLU A CA   3  
ATOM   1802  C C    . GLU A 1 17 ? 2.684   -5.921  -0.777  1.00 0.00 ? 17 GLU A C    3  
ATOM   1803  O O    . GLU A 1 17 ? 2.121   -6.997  -0.740  1.00 0.00 ? 17 GLU A O    3  
ATOM   1804  C CB   . GLU A 1 17 ? 5.168   -5.955  -1.002  1.00 0.00 ? 17 GLU A CB   3  
ATOM   1805  C CG   . GLU A 1 17 ? 6.213   -6.437  -2.010  1.00 0.00 ? 17 GLU A CG   3  
ATOM   1806  C CD   . GLU A 1 17 ? 6.155   -7.962  -2.114  1.00 0.00 ? 17 GLU A CD   3  
ATOM   1807  O OE1  . GLU A 1 17 ? 6.115   -8.606  -1.079  1.00 0.00 ? 17 GLU A OE1  3  
ATOM   1808  O OE2  . GLU A 1 17 ? 6.150   -8.461  -3.228  1.00 0.00 ? 17 GLU A OE2  3  
ATOM   1809  H H    . GLU A 1 17 ? 4.524   -3.623  -1.861  1.00 0.00 ? 17 GLU A H    3  
ATOM   1810  H HA   . GLU A 1 17 ? 3.762   -6.306  -2.585  1.00 0.00 ? 17 GLU A HA   3  
ATOM   1811  H HB2  . GLU A 1 17 ? 5.521   -5.054  -0.521  1.00 0.00 ? 17 GLU A HB2  3  
ATOM   1812  H HB3  . GLU A 1 17 ? 5.009   -6.721  -0.258  1.00 0.00 ? 17 GLU A HB3  3  
ATOM   1813  H HG2  . GLU A 1 17 ? 6.009   -6.001  -2.977  1.00 0.00 ? 17 GLU A HG2  3  
ATOM   1814  H HG3  . GLU A 1 17 ? 7.198   -6.139  -1.680  1.00 0.00 ? 17 GLU A HG3  3  
ATOM   1815  N N    . ASN A 1 18 ? 2.317   -4.935  -0.014  1.00 0.00 ? 18 ASN A N    3  
ATOM   1816  C CA   . ASN A 1 18 ? 1.185   -5.104  0.936   1.00 0.00 ? 18 ASN A CA   3  
ATOM   1817  C C    . ASN A 1 18 ? -0.130  -5.152  0.155   1.00 0.00 ? 18 ASN A C    3  
ATOM   1818  O O    . ASN A 1 18 ? -1.183  -5.400  0.707   1.00 0.00 ? 18 ASN A O    3  
ATOM   1819  C CB   . ASN A 1 18 ? 1.161   -3.924  1.908   1.00 0.00 ? 18 ASN A CB   3  
ATOM   1820  C CG   . ASN A 1 18 ? 1.796   -4.342  3.235   1.00 0.00 ? 18 ASN A CG   3  
ATOM   1821  O OD1  . ASN A 1 18 ? 1.282   -4.034  4.292   1.00 0.00 ? 18 ASN A OD1  3  
ATOM   1822  N ND2  . ASN A 1 18 ? 2.901   -5.036  3.225   1.00 0.00 ? 18 ASN A ND2  3  
ATOM   1823  H H    . ASN A 1 18 ? 2.787   -4.079  -0.069  1.00 0.00 ? 18 ASN A H    3  
ATOM   1824  H HA   . ASN A 1 18 ? 1.312   -6.024  1.488   1.00 0.00 ? 18 ASN A HA   3  
ATOM   1825  H HB2  . ASN A 1 18 ? 1.718   -3.101  1.485   1.00 0.00 ? 18 ASN A HB2  3  
ATOM   1826  H HB3  . ASN A 1 18 ? 0.142   -3.619  2.078   1.00 0.00 ? 18 ASN A HB3  3  
ATOM   1827  H HD21 . ASN A 1 18 ? 3.317   -5.283  2.372   1.00 0.00 ? 18 ASN A HD21 3  
ATOM   1828  H HD22 . ASN A 1 18 ? 3.316   -5.309  4.070   1.00 0.00 ? 18 ASN A HD22 3  
ATOM   1829  N N    . TYR A 1 19 ? -0.077  -4.917  -1.129  1.00 0.00 ? 19 TYR A N    3  
ATOM   1830  C CA   . TYR A 1 19 ? -1.318  -4.947  -1.947  1.00 0.00 ? 19 TYR A CA   3  
ATOM   1831  C C    . TYR A 1 19 ? -1.213  -6.067  -2.986  1.00 0.00 ? 19 TYR A C    3  
ATOM   1832  O O    . TYR A 1 19 ? -1.685  -5.939  -4.099  1.00 0.00 ? 19 TYR A O    3  
ATOM   1833  C CB   . TYR A 1 19 ? -1.488  -3.602  -2.657  1.00 0.00 ? 19 TYR A CB   3  
ATOM   1834  C CG   . TYR A 1 19 ? -1.765  -2.524  -1.636  1.00 0.00 ? 19 TYR A CG   3  
ATOM   1835  C CD1  . TYR A 1 19 ? -3.017  -2.457  -1.010  1.00 0.00 ? 19 TYR A CD1  3  
ATOM   1836  C CD2  . TYR A 1 19 ? -0.771  -1.590  -1.315  1.00 0.00 ? 19 TYR A CD2  3  
ATOM   1837  C CE1  . TYR A 1 19 ? -3.275  -1.457  -0.062  1.00 0.00 ? 19 TYR A CE1  3  
ATOM   1838  C CE2  . TYR A 1 19 ? -1.029  -0.590  -0.367  1.00 0.00 ? 19 TYR A CE2  3  
ATOM   1839  C CZ   . TYR A 1 19 ? -2.280  -0.524  0.259   1.00 0.00 ? 19 TYR A CZ   3  
ATOM   1840  O OH   . TYR A 1 19 ? -2.533  0.461   1.193   1.00 0.00 ? 19 TYR A OH   3  
ATOM   1841  H H    . TYR A 1 19 ? 0.783   -4.719  -1.555  1.00 0.00 ? 19 TYR A H    3  
ATOM   1842  H HA   . TYR A 1 19 ? -2.167  -5.128  -1.308  1.00 0.00 ? 19 TYR A HA   3  
ATOM   1843  H HB2  . TYR A 1 19 ? -0.583  -3.363  -3.196  1.00 0.00 ? 19 TYR A HB2  3  
ATOM   1844  H HB3  . TYR A 1 19 ? -2.313  -3.663  -3.349  1.00 0.00 ? 19 TYR A HB3  3  
ATOM   1845  H HD1  . TYR A 1 19 ? -3.784  -3.177  -1.258  1.00 0.00 ? 19 TYR A HD1  3  
ATOM   1846  H HD2  . TYR A 1 19 ? 0.193   -1.641  -1.799  1.00 0.00 ? 19 TYR A HD2  3  
ATOM   1847  H HE1  . TYR A 1 19 ? -4.240  -1.405  0.420   1.00 0.00 ? 19 TYR A HE1  3  
ATOM   1848  H HE2  . TYR A 1 19 ? -0.262  0.129   -0.120  1.00 0.00 ? 19 TYR A HE2  3  
ATOM   1849  H HH   . TYR A 1 19 ? -1.828  1.110   1.138   1.00 0.00 ? 19 TYR A HH   3  
ATOM   1850  N N    . CYS A 1 20 ? -0.597  -7.163  -2.632  1.00 0.00 ? 20 CYS A N    3  
ATOM   1851  C CA   . CYS A 1 20 ? -0.462  -8.288  -3.600  1.00 0.00 ? 20 CYS A CA   3  
ATOM   1852  C C    . CYS A 1 20 ? -1.322  -9.467  -3.141  1.00 0.00 ? 20 CYS A C    3  
ATOM   1853  O O    . CYS A 1 20 ? -1.827  -10.230 -3.939  1.00 0.00 ? 20 CYS A O    3  
ATOM   1854  C CB   . CYS A 1 20 ? 1.003   -8.724  -3.678  1.00 0.00 ? 20 CYS A CB   3  
ATOM   1855  S SG   . CYS A 1 20 ? 1.922   -7.577  -4.734  1.00 0.00 ? 20 CYS A SG   3  
ATOM   1856  H H    . CYS A 1 20 ? -0.224  -7.246  -1.729  1.00 0.00 ? 20 CYS A H    3  
ATOM   1857  H HA   . CYS A 1 20 ? -0.793  -7.965  -4.572  1.00 0.00 ? 20 CYS A HA   3  
ATOM   1858  H HB2  . CYS A 1 20 ? 1.431   -8.722  -2.686  1.00 0.00 ? 20 CYS A HB2  3  
ATOM   1859  H HB3  . CYS A 1 20 ? 1.061   -9.719  -4.091  1.00 0.00 ? 20 CYS A HB3  3  
ATOM   1860  N N    . ASN A 1 21 ? -1.488  -9.616  -1.859  1.00 0.00 ? 21 ASN A N    3  
ATOM   1861  C CA   . ASN A 1 21 ? -2.314  -10.743 -1.334  1.00 0.00 ? 21 ASN A CA   3  
ATOM   1862  C C    . ASN A 1 21 ? -2.705  -10.457 0.117   1.00 0.00 ? 21 ASN A C    3  
ATOM   1863  O O    . ASN A 1 21 ? -3.764  -9.886  0.322   1.00 0.00 ? 21 ASN A O    3  
ATOM   1864  C CB   . ASN A 1 21 ? -1.510  -12.045 -1.400  1.00 0.00 ? 21 ASN A CB   3  
ATOM   1865  C CG   . ASN A 1 21 ? -1.946  -12.859 -2.620  1.00 0.00 ? 21 ASN A CG   3  
ATOM   1866  O OD1  . ASN A 1 21 ? -1.593  -12.539 -3.737  1.00 0.00 ? 21 ASN A OD1  3  
ATOM   1867  N ND2  . ASN A 1 21 ? -2.704  -13.908 -2.451  1.00 0.00 ? 21 ASN A ND2  3  
ATOM   1868  O OXT  . ASN A 1 21 ? -1.941  -10.816 0.997   1.00 0.00 ? 21 ASN A OXT  3  
ATOM   1869  H H    . ASN A 1 21 ? -1.069  -8.984  -1.240  1.00 0.00 ? 21 ASN A H    3  
ATOM   1870  H HA   . ASN A 1 21 ? -3.207  -10.841 -1.934  1.00 0.00 ? 21 ASN A HA   3  
ATOM   1871  H HB2  . ASN A 1 21 ? -0.457  -11.814 -1.478  1.00 0.00 ? 21 ASN A HB2  3  
ATOM   1872  H HB3  . ASN A 1 21 ? -1.686  -12.622 -0.504  1.00 0.00 ? 21 ASN A HB3  3  
ATOM   1873  H HD21 . ASN A 1 21 ? -2.989  -14.168 -1.550  1.00 0.00 ? 21 ASN A HD21 3  
ATOM   1874  H HD22 . ASN A 1 21 ? -2.987  -14.437 -3.226  1.00 0.00 ? 21 ASN A HD22 3  
ATOM   1875  N N    . PHE B 2 1  ? 15.168  3.130   -7.066  1.00 0.00 ? 1  PHE B N    3  
ATOM   1876  C CA   . PHE B 2 1  ? 14.392  1.965   -7.576  1.00 0.00 ? 1  PHE B CA   3  
ATOM   1877  C C    . PHE B 2 1  ? 13.206  2.465   -8.402  1.00 0.00 ? 1  PHE B C    3  
ATOM   1878  O O    . PHE B 2 1  ? 12.970  2.013   -9.505  1.00 0.00 ? 1  PHE B O    3  
ATOM   1879  C CB   . PHE B 2 1  ? 13.879  1.136   -6.396  1.00 0.00 ? 1  PHE B CB   3  
ATOM   1880  C CG   . PHE B 2 1  ? 14.194  -0.326  -6.631  1.00 0.00 ? 1  PHE B CG   3  
ATOM   1881  C CD1  . PHE B 2 1  ? 13.456  -1.065  -7.568  1.00 0.00 ? 1  PHE B CD1  3  
ATOM   1882  C CD2  . PHE B 2 1  ? 15.229  -0.946  -5.914  1.00 0.00 ? 1  PHE B CD2  3  
ATOM   1883  C CE1  . PHE B 2 1  ? 13.750  -2.417  -7.786  1.00 0.00 ? 1  PHE B CE1  3  
ATOM   1884  C CE2  . PHE B 2 1  ? 15.522  -2.299  -6.132  1.00 0.00 ? 1  PHE B CE2  3  
ATOM   1885  C CZ   . PHE B 2 1  ? 14.783  -3.033  -7.068  1.00 0.00 ? 1  PHE B CZ   3  
ATOM   1886  H H1   . PHE B 2 1  ? 14.528  3.935   -6.919  1.00 0.00 ? 1  PHE B H1   3  
ATOM   1887  H H2   . PHE B 2 1  ? 15.899  3.389   -7.760  1.00 0.00 ? 1  PHE B H2   3  
ATOM   1888  H H3   . PHE B 2 1  ? 15.619  2.879   -6.165  1.00 0.00 ? 1  PHE B H3   3  
ATOM   1889  H HA   . PHE B 2 1  ? 15.029  1.351   -8.196  1.00 0.00 ? 1  PHE B HA   3  
ATOM   1890  H HB2  . PHE B 2 1  ? 14.359  1.471   -5.487  1.00 0.00 ? 1  PHE B HB2  3  
ATOM   1891  H HB3  . PHE B 2 1  ? 12.810  1.266   -6.304  1.00 0.00 ? 1  PHE B HB3  3  
ATOM   1892  H HD1  . PHE B 2 1  ? 12.660  -0.593  -8.123  1.00 0.00 ? 1  PHE B HD1  3  
ATOM   1893  H HD2  . PHE B 2 1  ? 15.800  -0.383  -5.192  1.00 0.00 ? 1  PHE B HD2  3  
ATOM   1894  H HE1  . PHE B 2 1  ? 13.181  -2.985  -8.507  1.00 0.00 ? 1  PHE B HE1  3  
ATOM   1895  H HE2  . PHE B 2 1  ? 16.318  -2.775  -5.579  1.00 0.00 ? 1  PHE B HE2  3  
ATOM   1896  H HZ   . PHE B 2 1  ? 15.010  -4.077  -7.236  1.00 0.00 ? 1  PHE B HZ   3  
ATOM   1897  N N    . VAL B 2 2  ? 12.455  3.395   -7.879  1.00 0.00 ? 2  VAL B N    3  
ATOM   1898  C CA   . VAL B 2 2  ? 11.286  3.920   -8.638  1.00 0.00 ? 2  VAL B CA   3  
ATOM   1899  C C    . VAL B 2 2  ? 11.180  5.434   -8.435  1.00 0.00 ? 2  VAL B C    3  
ATOM   1900  O O    . VAL B 2 2  ? 10.802  5.906   -7.381  1.00 0.00 ? 2  VAL B O    3  
ATOM   1901  C CB   . VAL B 2 2  ? 10.007  3.247   -8.138  1.00 0.00 ? 2  VAL B CB   3  
ATOM   1902  C CG1  . VAL B 2 2  ? 8.907   3.394   -9.190  1.00 0.00 ? 2  VAL B CG1  3  
ATOM   1903  C CG2  . VAL B 2 2  ? 10.278  1.760   -7.892  1.00 0.00 ? 2  VAL B CG2  3  
ATOM   1904  H H    . VAL B 2 2  ? 12.660  3.747   -6.987  1.00 0.00 ? 2  VAL B H    3  
ATOM   1905  H HA   . VAL B 2 2  ? 11.416  3.709   -9.688  1.00 0.00 ? 2  VAL B HA   3  
ATOM   1906  H HB   . VAL B 2 2  ? 9.690   3.714   -7.216  1.00 0.00 ? 2  VAL B HB   3  
ATOM   1907  H HG11 . VAL B 2 2  ? 7.955   3.534   -8.700  1.00 0.00 ? 2  VAL B HG11 3  
ATOM   1908  H HG12 . VAL B 2 2  ? 8.870   2.505   -9.800  1.00 0.00 ? 2  VAL B HG12 3  
ATOM   1909  H HG13 . VAL B 2 2  ? 9.118   4.250   -9.815  1.00 0.00 ? 2  VAL B HG13 3  
ATOM   1910  H HG21 . VAL B 2 2  ? 10.377  1.250   -8.840  1.00 0.00 ? 2  VAL B HG21 3  
ATOM   1911  H HG22 . VAL B 2 2  ? 9.458   1.331   -7.336  1.00 0.00 ? 2  VAL B HG22 3  
ATOM   1912  H HG23 . VAL B 2 2  ? 11.193  1.650   -7.327  1.00 0.00 ? 2  VAL B HG23 3  
ATOM   1913  N N    . ASN B 2 3  ? 11.504  6.197   -9.442  1.00 0.00 ? 3  ASN B N    3  
ATOM   1914  C CA   . ASN B 2 3  ? 11.419  7.678   -9.320  1.00 0.00 ? 3  ASN B CA   3  
ATOM   1915  C C    . ASN B 2 3  ? 10.336  8.196   -10.267 1.00 0.00 ? 3  ASN B C    3  
ATOM   1916  O O    . ASN B 2 3  ? 10.206  9.383   -10.491 1.00 0.00 ? 3  ASN B O    3  
ATOM   1917  C CB   . ASN B 2 3  ? 12.767  8.298   -9.694  1.00 0.00 ? 3  ASN B CB   3  
ATOM   1918  C CG   . ASN B 2 3  ? 13.885  7.603   -8.915  1.00 0.00 ? 3  ASN B CG   3  
ATOM   1919  O OD1  . ASN B 2 3  ? 13.624  6.821   -8.024  1.00 0.00 ? 3  ASN B OD1  3  
ATOM   1920  N ND2  . ASN B 2 3  ? 15.129  7.856   -9.218  1.00 0.00 ? 3  ASN B ND2  3  
ATOM   1921  H H    . ASN B 2 3  ? 11.800  5.795   -10.283 1.00 0.00 ? 3  ASN B H    3  
ATOM   1922  H HA   . ASN B 2 3  ? 11.168  7.943   -8.303  1.00 0.00 ? 3  ASN B HA   3  
ATOM   1923  H HB2  . ASN B 2 3  ? 12.936  8.176   -10.755 1.00 0.00 ? 3  ASN B HB2  3  
ATOM   1924  H HB3  . ASN B 2 3  ? 12.761  9.350   -9.449  1.00 0.00 ? 3  ASN B HB3  3  
ATOM   1925  H HD21 . ASN B 2 3  ? 15.340  8.486   -9.938  1.00 0.00 ? 3  ASN B HD21 3  
ATOM   1926  H HD22 . ASN B 2 3  ? 15.852  7.416   -8.725  1.00 0.00 ? 3  ASN B HD22 3  
ATOM   1927  N N    . GLN B 2 4  ? 9.557   7.309   -10.827 1.00 0.00 ? 4  GLN B N    3  
ATOM   1928  C CA   . GLN B 2 4  ? 8.482   7.733   -11.759 1.00 0.00 ? 4  GLN B CA   3  
ATOM   1929  C C    . GLN B 2 4  ? 7.159   7.830   -10.996 1.00 0.00 ? 4  GLN B C    3  
ATOM   1930  O O    . GLN B 2 4  ? 7.040   7.363   -9.883  1.00 0.00 ? 4  GLN B O    3  
ATOM   1931  C CB   . GLN B 2 4  ? 8.349   6.687   -12.863 1.00 0.00 ? 4  GLN B CB   3  
ATOM   1932  C CG   . GLN B 2 4  ? 9.376   6.963   -13.962 1.00 0.00 ? 4  GLN B CG   3  
ATOM   1933  C CD   . GLN B 2 4  ? 10.652  6.171   -13.674 1.00 0.00 ? 4  GLN B CD   3  
ATOM   1934  O OE1  . GLN B 2 4  ? 11.669  6.739   -13.329 1.00 0.00 ? 4  GLN B OE1  3  
ATOM   1935  N NE2  . GLN B 2 4  ? 10.640  4.872   -13.801 1.00 0.00 ? 4  GLN B NE2  3  
ATOM   1936  H H    . GLN B 2 4  ? 9.678   6.359   -10.637 1.00 0.00 ? 4  GLN B H    3  
ATOM   1937  H HA   . GLN B 2 4  ? 8.728   8.692   -12.192 1.00 0.00 ? 4  GLN B HA   3  
ATOM   1938  H HB2  . GLN B 2 4  ? 8.522   5.705   -12.447 1.00 0.00 ? 4  GLN B HB2  3  
ATOM   1939  H HB3  . GLN B 2 4  ? 7.360   6.731   -13.275 1.00 0.00 ? 4  GLN B HB3  3  
ATOM   1940  H HG2  . GLN B 2 4  ? 8.970   6.659   -14.916 1.00 0.00 ? 4  GLN B HG2  3  
ATOM   1941  H HG3  . GLN B 2 4  ? 9.605   8.017   -13.986 1.00 0.00 ? 4  GLN B HG3  3  
ATOM   1942  H HE21 . GLN B 2 4  ? 9.819   4.413   -14.077 1.00 0.00 ? 4  GLN B HE21 3  
ATOM   1943  H HE22 . GLN B 2 4  ? 11.452  4.355   -13.619 1.00 0.00 ? 4  GLN B HE22 3  
ATOM   1944  N N    . HIS B 2 5  ? 6.164   8.428   -11.587 1.00 0.00 ? 5  HIS B N    3  
ATOM   1945  C CA   . HIS B 2 5  ? 4.851   8.549   -10.895 1.00 0.00 ? 5  HIS B CA   3  
ATOM   1946  C C    . HIS B 2 5  ? 3.969   7.353   -11.265 1.00 0.00 ? 5  HIS B C    3  
ATOM   1947  O O    . HIS B 2 5  ? 3.950   6.912   -12.397 1.00 0.00 ? 5  HIS B O    3  
ATOM   1948  C CB   . HIS B 2 5  ? 4.173   9.845   -11.339 1.00 0.00 ? 5  HIS B CB   3  
ATOM   1949  C CG   . HIS B 2 5  ? 2.881   10.025  -10.593 1.00 0.00 ? 5  HIS B CG   3  
ATOM   1950  N ND1  . HIS B 2 5  ? 1.692   10.247  -11.254 1.00 0.00 ? 5  HIS B ND1  3  
ATOM   1951  C CD2  . HIS B 2 5  ? 2.609   10.016  -9.253  1.00 0.00 ? 5  HIS B CD2  3  
ATOM   1952  C CE1  . HIS B 2 5  ? 0.743   10.364  -10.313 1.00 0.00 ? 5  HIS B CE1  3  
ATOM   1953  N NE2  . HIS B 2 5  ? 1.257   10.228  -9.073  1.00 0.00 ? 5  HIS B NE2  3  
ATOM   1954  H H    . HIS B 2 5  ? 6.277   8.798   -12.487 1.00 0.00 ? 5  HIS B H    3  
ATOM   1955  H HA   . HIS B 2 5  ? 5.004   8.568   -9.827  1.00 0.00 ? 5  HIS B HA   3  
ATOM   1956  H HB2  . HIS B 2 5  ? 4.828   10.679  -11.135 1.00 0.00 ? 5  HIS B HB2  3  
ATOM   1957  H HB3  . HIS B 2 5  ? 3.974   9.798   -12.398 1.00 0.00 ? 5  HIS B HB3  3  
ATOM   1958  H HD2  . HIS B 2 5  ? 3.332   9.870   -8.467  1.00 0.00 ? 5  HIS B HD2  3  
ATOM   1959  H HE1  . HIS B 2 5  ? -0.301  10.543  -10.521 1.00 0.00 ? 5  HIS B HE1  3  
ATOM   1960  H HE2  . HIS B 2 5  ? 0.772   10.271  -8.222  1.00 0.00 ? 5  HIS B HE2  3  
ATOM   1961  N N    . LEU B 2 6  ? 3.234   6.825   -10.322 1.00 0.00 ? 6  LEU B N    3  
ATOM   1962  C CA   . LEU B 2 6  ? 2.352   5.663   -10.630 1.00 0.00 ? 6  LEU B CA   3  
ATOM   1963  C C    . LEU B 2 6  ? 0.932   6.172   -10.860 1.00 0.00 ? 6  LEU B C    3  
ATOM   1964  O O    . LEU B 2 6  ? 0.662   7.337   -10.681 1.00 0.00 ? 6  LEU B O    3  
ATOM   1965  C CB   . LEU B 2 6  ? 2.355   4.691   -9.445  1.00 0.00 ? 6  LEU B CB   3  
ATOM   1966  C CG   . LEU B 2 6  ? 3.521   3.711   -9.580  1.00 0.00 ? 6  LEU B CG   3  
ATOM   1967  C CD1  . LEU B 2 6  ? 3.390   2.942   -10.894 1.00 0.00 ? 6  LEU B CD1  3  
ATOM   1968  C CD2  . LEU B 2 6  ? 4.839   4.485   -9.573  1.00 0.00 ? 6  LEU B CD2  3  
ATOM   1969  H H    . LEU B 2 6  ? 3.255   7.196   -9.414  1.00 0.00 ? 6  LEU B H    3  
ATOM   1970  H HA   . LEU B 2 6  ? 2.710   5.161   -11.516 1.00 0.00 ? 6  LEU B HA   3  
ATOM   1971  H HB2  . LEU B 2 6  ? 2.458   5.248   -8.524  1.00 0.00 ? 6  LEU B HB2  3  
ATOM   1972  H HB3  . LEU B 2 6  ? 1.426   4.141   -9.430  1.00 0.00 ? 6  LEU B HB3  3  
ATOM   1973  H HG   . LEU B 2 6  ? 3.504   3.016   -8.753  1.00 0.00 ? 6  LEU B HG   3  
ATOM   1974  H HD11 . LEU B 2 6  ? 3.252   1.891   -10.685 1.00 0.00 ? 6  LEU B HD11 3  
ATOM   1975  H HD12 . LEU B 2 6  ? 4.285   3.077   -11.482 1.00 0.00 ? 6  LEU B HD12 3  
ATOM   1976  H HD13 . LEU B 2 6  ? 2.539   3.314   -11.443 1.00 0.00 ? 6  LEU B HD13 3  
ATOM   1977  H HD21 . LEU B 2 6  ? 5.117   4.728   -10.588 1.00 0.00 ? 6  LEU B HD21 3  
ATOM   1978  H HD22 . LEU B 2 6  ? 5.610   3.879   -9.123  1.00 0.00 ? 6  LEU B HD22 3  
ATOM   1979  H HD23 . LEU B 2 6  ? 4.718   5.395   -9.006  1.00 0.00 ? 6  LEU B HD23 3  
ATOM   1980  N N    . CYS B 2 7  ? 0.028   5.306   -11.244 1.00 0.00 ? 7  CYS B N    3  
ATOM   1981  C CA   . CYS B 2 7  ? -1.387  5.733   -11.471 1.00 0.00 ? 7  CYS B CA   3  
ATOM   1982  C C    . CYS B 2 7  ? -2.141  4.621   -12.224 1.00 0.00 ? 7  CYS B C    3  
ATOM   1983  O O    . CYS B 2 7  ? -2.483  3.605   -11.649 1.00 0.00 ? 7  CYS B O    3  
ATOM   1984  C CB   . CYS B 2 7  ? -1.433  7.048   -12.269 1.00 0.00 ? 7  CYS B CB   3  
ATOM   1985  S SG   . CYS B 2 7  ? -1.721  8.445   -11.146 1.00 0.00 ? 7  CYS B SG   3  
ATOM   1986  H H    . CYS B 2 7  ? 0.279   4.368   -11.372 1.00 0.00 ? 7  CYS B H    3  
ATOM   1987  H HA   . CYS B 2 7  ? -1.860  5.885   -10.511 1.00 0.00 ? 7  CYS B HA   3  
ATOM   1988  H HB2  . CYS B 2 7  ? -0.495  7.191   -12.783 1.00 0.00 ? 7  CYS B HB2  3  
ATOM   1989  H HB3  . CYS B 2 7  ? -2.234  7.008   -12.989 1.00 0.00 ? 7  CYS B HB3  3  
ATOM   1990  N N    . GLY B 2 8  ? -2.408  4.791   -13.497 1.00 0.00 ? 8  GLY B N    3  
ATOM   1991  C CA   . GLY B 2 8  ? -3.149  3.736   -14.252 1.00 0.00 ? 8  GLY B CA   3  
ATOM   1992  C C    . GLY B 2 8  ? -2.257  2.517   -14.471 1.00 0.00 ? 8  GLY B C    3  
ATOM   1993  O O    . GLY B 2 8  ? -1.656  2.003   -13.549 1.00 0.00 ? 8  GLY B O    3  
ATOM   1994  H H    . GLY B 2 8  ? -2.126  5.604   -13.957 1.00 0.00 ? 8  GLY B H    3  
ATOM   1995  H HA2  . GLY B 2 8  ? -4.024  3.443   -13.690 1.00 0.00 ? 8  GLY B HA2  3  
ATOM   1996  H HA3  . GLY B 2 8  ? -3.454  4.129   -15.210 1.00 0.00 ? 8  GLY B HA3  3  
ATOM   1997  N N    . SER B 2 9  ? -2.170  2.050   -15.690 1.00 0.00 ? 9  SER B N    3  
ATOM   1998  C CA   . SER B 2 9  ? -1.320  0.861   -15.979 1.00 0.00 ? 9  SER B CA   3  
ATOM   1999  C C    . SER B 2 9  ? -0.012  0.976   -15.199 1.00 0.00 ? 9  SER B C    3  
ATOM   2000  O O    . SER B 2 9  ? 0.601   -0.010  -14.843 1.00 0.00 ? 9  SER B O    3  
ATOM   2001  C CB   . SER B 2 9  ? -1.017  0.802   -17.477 1.00 0.00 ? 9  SER B CB   3  
ATOM   2002  O OG   . SER B 2 9  ? -2.215  0.513   -18.186 1.00 0.00 ? 9  SER B OG   3  
ATOM   2003  H H    . SER B 2 9  ? -2.668  2.482   -16.414 1.00 0.00 ? 9  SER B H    3  
ATOM   2004  H HA   . SER B 2 9  ? -1.841  -0.037  -15.680 1.00 0.00 ? 9  SER B HA   3  
ATOM   2005  H HB2  . SER B 2 9  ? -0.631  1.753   -17.806 1.00 0.00 ? 9  SER B HB2  3  
ATOM   2006  H HB3  . SER B 2 9  ? -0.280  0.032   -17.664 1.00 0.00 ? 9  SER B HB3  3  
ATOM   2007  H HG   . SER B 2 9  ? -2.951  0.864   -17.679 1.00 0.00 ? 9  SER B HG   3  
ATOM   2008  N N    . ASP B 2 10 ? 0.418   2.177   -14.928 1.00 0.00 ? 10 ASP B N    3  
ATOM   2009  C CA   . ASP B 2 10 ? 1.681   2.359   -14.167 1.00 0.00 ? 10 ASP B CA   3  
ATOM   2010  C C    . ASP B 2 10 ? 1.543   1.712   -12.788 1.00 0.00 ? 10 ASP B C    3  
ATOM   2011  O O    . ASP B 2 10 ? 2.394   0.955   -12.364 1.00 0.00 ? 10 ASP B O    3  
ATOM   2012  C CB   . ASP B 2 10 ? 1.972   3.853   -14.007 1.00 0.00 ? 10 ASP B CB   3  
ATOM   2013  C CG   . ASP B 2 10 ? 2.457   4.424   -15.342 1.00 0.00 ? 10 ASP B CG   3  
ATOM   2014  O OD1  . ASP B 2 10 ? 3.440   3.919   -15.858 1.00 0.00 ? 10 ASP B OD1  3  
ATOM   2015  O OD2  . ASP B 2 10 ? 1.836   5.356   -15.826 1.00 0.00 ? 10 ASP B OD2  3  
ATOM   2016  H H    . ASP B 2 10 ? -0.094  2.959   -15.223 1.00 0.00 ? 10 ASP B H    3  
ATOM   2017  H HA   . ASP B 2 10 ? 2.493   1.891   -14.703 1.00 0.00 ? 10 ASP B HA   3  
ATOM   2018  H HB2  . ASP B 2 10 ? 1.072   4.366   -13.701 1.00 0.00 ? 10 ASP B HB2  3  
ATOM   2019  H HB3  . ASP B 2 10 ? 2.739   3.993   -13.260 1.00 0.00 ? 10 ASP B HB3  3  
ATOM   2020  N N    . LEU B 2 11 ? 0.483   2.002   -12.076 1.00 0.00 ? 11 LEU B N    3  
ATOM   2021  C CA   . LEU B 2 11 ? 0.320   1.393   -10.724 1.00 0.00 ? 11 LEU B CA   3  
ATOM   2022  C C    . LEU B 2 11 ? -0.066  -0.079  -10.876 1.00 0.00 ? 11 LEU B C    3  
ATOM   2023  O O    . LEU B 2 11 ? 0.259   -0.909  -10.046 1.00 0.00 ? 11 LEU B O    3  
ATOM   2024  C CB   . LEU B 2 11 ? -0.779  2.143   -9.949  1.00 0.00 ? 11 LEU B CB   3  
ATOM   2025  C CG   . LEU B 2 11 ? -0.559  2.101   -8.416  1.00 0.00 ? 11 LEU B CG   3  
ATOM   2026  C CD1  . LEU B 2 11 ? -1.680  1.290   -7.770  1.00 0.00 ? 11 LEU B CD1  3  
ATOM   2027  C CD2  . LEU B 2 11 ? 0.787   1.464   -8.041  1.00 0.00 ? 11 LEU B CD2  3  
ATOM   2028  H H    . LEU B 2 11 ? -0.196  2.616   -12.427 1.00 0.00 ? 11 LEU B H    3  
ATOM   2029  H HA   . LEU B 2 11 ? 1.258   1.466   -10.199 1.00 0.00 ? 11 LEU B HA   3  
ATOM   2030  H HB2  . LEU B 2 11 ? -0.794  3.170   -10.273 1.00 0.00 ? 11 LEU B HB2  3  
ATOM   2031  H HB3  . LEU B 2 11 ? -1.736  1.697   -10.172 1.00 0.00 ? 11 LEU B HB3  3  
ATOM   2032  H HG   . LEU B 2 11 ? -0.593  3.111   -8.031  1.00 0.00 ? 11 LEU B HG   3  
ATOM   2033  H HD11 . LEU B 2 11 ? -2.587  1.874   -7.760  1.00 0.00 ? 11 LEU B HD11 3  
ATOM   2034  H HD12 . LEU B 2 11 ? -1.403  1.035   -6.758  1.00 0.00 ? 11 LEU B HD12 3  
ATOM   2035  H HD13 . LEU B 2 11 ? -1.841  0.384   -8.338  1.00 0.00 ? 11 LEU B HD13 3  
ATOM   2036  H HD21 . LEU B 2 11 ? 1.591   2.127   -8.326  1.00 0.00 ? 11 LEU B HD21 3  
ATOM   2037  H HD22 . LEU B 2 11 ? 0.897   0.523   -8.558  1.00 0.00 ? 11 LEU B HD22 3  
ATOM   2038  H HD23 . LEU B 2 11 ? 0.821   1.295   -6.974  1.00 0.00 ? 11 LEU B HD23 3  
ATOM   2039  N N    . VAL B 2 12 ? -0.749  -0.413  -11.937 1.00 0.00 ? 12 VAL B N    3  
ATOM   2040  C CA   . VAL B 2 12 ? -1.147  -1.829  -12.146 1.00 0.00 ? 12 VAL B CA   3  
ATOM   2041  C C    . VAL B 2 12 ? 0.083   -2.619  -12.598 1.00 0.00 ? 12 VAL B C    3  
ATOM   2042  O O    . VAL B 2 12 ? 0.424   -3.636  -12.027 1.00 0.00 ? 12 VAL B O    3  
ATOM   2043  C CB   . VAL B 2 12 ? -2.253  -1.883  -13.208 1.00 0.00 ? 12 VAL B CB   3  
ATOM   2044  C CG1  . VAL B 2 12 ? -2.253  -3.243  -13.916 1.00 0.00 ? 12 VAL B CG1  3  
ATOM   2045  C CG2  . VAL B 2 12 ? -3.608  -1.670  -12.530 1.00 0.00 ? 12 VAL B CG2  3  
ATOM   2046  H H    . VAL B 2 12 ? -0.992  0.265   -12.602 1.00 0.00 ? 12 VAL B H    3  
ATOM   2047  H HA   . VAL B 2 12 ? -1.516  -2.239  -11.217 1.00 0.00 ? 12 VAL B HA   3  
ATOM   2048  H HB   . VAL B 2 12 ? -2.088  -1.098  -13.932 1.00 0.00 ? 12 VAL B HB   3  
ATOM   2049  H HG11 . VAL B 2 12 ? -1.774  -3.978  -13.283 1.00 0.00 ? 12 VAL B HG11 3  
ATOM   2050  H HG12 . VAL B 2 12 ? -1.715  -3.165  -14.848 1.00 0.00 ? 12 VAL B HG12 3  
ATOM   2051  H HG13 . VAL B 2 12 ? -3.271  -3.547  -14.111 1.00 0.00 ? 12 VAL B HG13 3  
ATOM   2052  H HG21 . VAL B 2 12 ? -3.566  -2.045  -11.517 1.00 0.00 ? 12 VAL B HG21 3  
ATOM   2053  H HG22 . VAL B 2 12 ? -4.373  -2.201  -13.077 1.00 0.00 ? 12 VAL B HG22 3  
ATOM   2054  H HG23 . VAL B 2 12 ? -3.842  -0.617  -12.514 1.00 0.00 ? 12 VAL B HG23 3  
ATOM   2055  N N    . GLU B 2 13 ? 0.762   -2.153  -13.610 1.00 0.00 ? 13 GLU B N    3  
ATOM   2056  C CA   . GLU B 2 13 ? 1.976   -2.876  -14.074 1.00 0.00 ? 13 GLU B CA   3  
ATOM   2057  C C    . GLU B 2 13 ? 2.863   -3.157  -12.862 1.00 0.00 ? 13 GLU B C    3  
ATOM   2058  O O    . GLU B 2 13 ? 3.507   -4.183  -12.773 1.00 0.00 ? 13 GLU B O    3  
ATOM   2059  C CB   . GLU B 2 13 ? 2.737   -2.014  -15.083 1.00 0.00 ? 13 GLU B CB   3  
ATOM   2060  C CG   . GLU B 2 13 ? 2.110   -2.175  -16.469 1.00 0.00 ? 13 GLU B CG   3  
ATOM   2061  C CD   . GLU B 2 13 ? 3.156   -1.871  -17.541 1.00 0.00 ? 13 GLU B CD   3  
ATOM   2062  O OE1  . GLU B 2 13 ? 4.044   -1.080  -17.267 1.00 0.00 ? 13 GLU B OE1  3  
ATOM   2063  O OE2  . GLU B 2 13 ? 3.052   -2.433  -18.619 1.00 0.00 ? 13 GLU B OE2  3  
ATOM   2064  H H    . GLU B 2 13 ? 0.482   -1.324  -14.052 1.00 0.00 ? 13 GLU B H    3  
ATOM   2065  H HA   . GLU B 2 13 ? 1.687   -3.809  -14.536 1.00 0.00 ? 13 GLU B HA   3  
ATOM   2066  H HB2  . GLU B 2 13 ? 2.686   -0.977  -14.781 1.00 0.00 ? 13 GLU B HB2  3  
ATOM   2067  H HB3  . GLU B 2 13 ? 3.769   -2.328  -15.120 1.00 0.00 ? 13 GLU B HB3  3  
ATOM   2068  H HG2  . GLU B 2 13 ? 1.755   -3.189  -16.588 1.00 0.00 ? 13 GLU B HG2  3  
ATOM   2069  H HG3  . GLU B 2 13 ? 1.282   -1.489  -16.571 1.00 0.00 ? 13 GLU B HG3  3  
ATOM   2070  N N    . ALA B 2 14 ? 2.886   -2.255  -11.917 1.00 0.00 ? 14 ALA B N    3  
ATOM   2071  C CA   . ALA B 2 14 ? 3.714   -2.472  -10.700 1.00 0.00 ? 14 ALA B CA   3  
ATOM   2072  C C    . ALA B 2 14 ? 3.223   -3.734  -9.993  1.00 0.00 ? 14 ALA B C    3  
ATOM   2073  O O    . ALA B 2 14 ? 3.947   -4.700  -9.851  1.00 0.00 ? 14 ALA B O    3  
ATOM   2074  C CB   . ALA B 2 14 ? 3.576   -1.270  -9.762  1.00 0.00 ? 14 ALA B CB   3  
ATOM   2075  H H    . ALA B 2 14 ? 2.349   -1.440  -12.004 1.00 0.00 ? 14 ALA B H    3  
ATOM   2076  H HA   . ALA B 2 14 ? 4.749   -2.595  -10.982 1.00 0.00 ? 14 ALA B HA   3  
ATOM   2077  H HB1  . ALA B 2 14 ? 3.530   -0.362  -10.345 1.00 0.00 ? 14 ALA B HB1  3  
ATOM   2078  H HB2  . ALA B 2 14 ? 4.428   -1.230  -9.100  1.00 0.00 ? 14 ALA B HB2  3  
ATOM   2079  H HB3  . ALA B 2 14 ? 2.671   -1.369  -9.179  1.00 0.00 ? 14 ALA B HB3  3  
ATOM   2080  N N    . LEU B 2 15 ? 1.991   -3.743  -9.558  1.00 0.00 ? 15 LEU B N    3  
ATOM   2081  C CA   . LEU B 2 15 ? 1.457   -4.956  -8.877  1.00 0.00 ? 15 LEU B CA   3  
ATOM   2082  C C    . LEU B 2 15 ? 1.698   -6.170  -9.774  1.00 0.00 ? 15 LEU B C    3  
ATOM   2083  O O    . LEU B 2 15 ? 2.196   -7.191  -9.341  1.00 0.00 ? 15 LEU B O    3  
ATOM   2084  C CB   . LEU B 2 15 ? -0.048  -4.794  -8.641  1.00 0.00 ? 15 LEU B CB   3  
ATOM   2085  C CG   . LEU B 2 15 ? -0.288  -3.753  -7.548  1.00 0.00 ? 15 LEU B CG   3  
ATOM   2086  C CD1  . LEU B 2 15 ? -1.702  -3.187  -7.687  1.00 0.00 ? 15 LEU B CD1  3  
ATOM   2087  C CD2  . LEU B 2 15 ? -0.139  -4.412  -6.176  1.00 0.00 ? 15 LEU B CD2  3  
ATOM   2088  H H    . LEU B 2 15 ? 1.416   -2.961  -9.689  1.00 0.00 ? 15 LEU B H    3  
ATOM   2089  H HA   . LEU B 2 15 ? 1.961   -5.095  -7.933  1.00 0.00 ? 15 LEU B HA   3  
ATOM   2090  H HB2  . LEU B 2 15 ? -0.523  -4.473  -9.556  1.00 0.00 ? 15 LEU B HB2  3  
ATOM   2091  H HB3  . LEU B 2 15 ? -0.465  -5.740  -8.330  1.00 0.00 ? 15 LEU B HB3  3  
ATOM   2092  H HG   . LEU B 2 15 ? 0.432   -2.953  -7.647  1.00 0.00 ? 15 LEU B HG   3  
ATOM   2093  H HD11 . LEU B 2 15 ? -1.786  -2.651  -8.621  1.00 0.00 ? 15 LEU B HD11 3  
ATOM   2094  H HD12 . LEU B 2 15 ? -1.903  -2.513  -6.866  1.00 0.00 ? 15 LEU B HD12 3  
ATOM   2095  H HD13 . LEU B 2 15 ? -2.417  -3.997  -7.671  1.00 0.00 ? 15 LEU B HD13 3  
ATOM   2096  H HD21 . LEU B 2 15 ? -0.412  -5.455  -6.247  1.00 0.00 ? 15 LEU B HD21 3  
ATOM   2097  H HD22 . LEU B 2 15 ? -0.787  -3.918  -5.468  1.00 0.00 ? 15 LEU B HD22 3  
ATOM   2098  H HD23 . LEU B 2 15 ? 0.887   -4.330  -5.847  1.00 0.00 ? 15 LEU B HD23 3  
ATOM   2099  N N    . TYR B 2 16 ? 1.348   -6.063  -11.026 1.00 0.00 ? 16 TYR B N    3  
ATOM   2100  C CA   . TYR B 2 16 ? 1.552   -7.202  -11.962 1.00 0.00 ? 16 TYR B CA   3  
ATOM   2101  C C    . TYR B 2 16 ? 3.040   -7.561  -12.010 1.00 0.00 ? 16 TYR B C    3  
ATOM   2102  O O    . TYR B 2 16 ? 3.407   -8.685  -12.289 1.00 0.00 ? 16 TYR B O    3  
ATOM   2103  C CB   . TYR B 2 16 ? 1.076   -6.800  -13.360 1.00 0.00 ? 16 TYR B CB   3  
ATOM   2104  C CG   . TYR B 2 16 ? 0.260   -7.926  -13.960 1.00 0.00 ? 16 TYR B CG   3  
ATOM   2105  C CD1  . TYR B 2 16 ? 0.611   -9.261  -13.710 1.00 0.00 ? 16 TYR B CD1  3  
ATOM   2106  C CD2  . TYR B 2 16 ? -0.849  -7.636  -14.770 1.00 0.00 ? 16 TYR B CD2  3  
ATOM   2107  C CE1  . TYR B 2 16 ? -0.144  -10.302 -14.269 1.00 0.00 ? 16 TYR B CE1  3  
ATOM   2108  C CE2  . TYR B 2 16 ? -1.602  -8.679  -15.327 1.00 0.00 ? 16 TYR B CE2  3  
ATOM   2109  C CZ   . TYR B 2 16 ? -1.249  -10.010 -15.077 1.00 0.00 ? 16 TYR B CZ   3  
ATOM   2110  O OH   . TYR B 2 16 ? -1.992  -11.035 -15.627 1.00 0.00 ? 16 TYR B OH   3  
ATOM   2111  H H    . TYR B 2 16 ? 0.949   -5.229  -11.351 1.00 0.00 ? 16 TYR B H    3  
ATOM   2112  H HA   . TYR B 2 16 ? 0.986   -8.055  -11.620 1.00 0.00 ? 16 TYR B HA   3  
ATOM   2113  H HB2  . TYR B 2 16 ? 0.468   -5.908  -13.288 1.00 0.00 ? 16 TYR B HB2  3  
ATOM   2114  H HB3  . TYR B 2 16 ? 1.933   -6.598  -13.988 1.00 0.00 ? 16 TYR B HB3  3  
ATOM   2115  H HD1  . TYR B 2 16 ? 1.461   -9.490  -13.087 1.00 0.00 ? 16 TYR B HD1  3  
ATOM   2116  H HD2  . TYR B 2 16 ? -1.124  -6.611  -14.964 1.00 0.00 ? 16 TYR B HD2  3  
ATOM   2117  H HE1  . TYR B 2 16 ? 0.127   -11.329 -14.075 1.00 0.00 ? 16 TYR B HE1  3  
ATOM   2118  H HE2  . TYR B 2 16 ? -2.455  -8.454  -15.951 1.00 0.00 ? 16 TYR B HE2  3  
ATOM   2119  H HH   . TYR B 2 16 ? -2.329  -11.577 -14.910 1.00 0.00 ? 16 TYR B HH   3  
ATOM   2120  N N    . LEU B 2 17 ? 3.900   -6.616  -11.738 1.00 0.00 ? 17 LEU B N    3  
ATOM   2121  C CA   . LEU B 2 17 ? 5.362   -6.907  -11.767 1.00 0.00 ? 17 LEU B CA   3  
ATOM   2122  C C    . LEU B 2 17 ? 5.860   -7.153  -10.344 1.00 0.00 ? 17 LEU B C    3  
ATOM   2123  O O    . LEU B 2 17 ? 6.944   -7.662  -10.133 1.00 0.00 ? 17 LEU B O    3  
ATOM   2124  C CB   . LEU B 2 17 ? 6.109   -5.714  -12.368 1.00 0.00 ? 17 LEU B CB   3  
ATOM   2125  C CG   . LEU B 2 17 ? 6.515   -6.035  -13.806 1.00 0.00 ? 17 LEU B CG   3  
ATOM   2126  C CD1  . LEU B 2 17 ? 6.953   -4.751  -14.512 1.00 0.00 ? 17 LEU B CD1  3  
ATOM   2127  C CD2  . LEU B 2 17 ? 7.679   -7.030  -13.797 1.00 0.00 ? 17 LEU B CD2  3  
ATOM   2128  H H    . LEU B 2 17 ? 3.584   -5.716  -11.514 1.00 0.00 ? 17 LEU B H    3  
ATOM   2129  H HA   . LEU B 2 17 ? 5.541   -7.785  -12.368 1.00 0.00 ? 17 LEU B HA   3  
ATOM   2130  H HB2  . LEU B 2 17 ? 5.465   -4.846  -12.360 1.00 0.00 ? 17 LEU B HB2  3  
ATOM   2131  H HB3  . LEU B 2 17 ? 6.993   -5.511  -11.782 1.00 0.00 ? 17 LEU B HB3  3  
ATOM   2132  H HG   . LEU B 2 17 ? 5.674   -6.466  -14.331 1.00 0.00 ? 17 LEU B HG   3  
ATOM   2133  H HD11 . LEU B 2 17 ? 6.910   -4.895  -15.582 1.00 0.00 ? 17 LEU B HD11 3  
ATOM   2134  H HD12 . LEU B 2 17 ? 7.965   -4.508  -14.224 1.00 0.00 ? 17 LEU B HD12 3  
ATOM   2135  H HD13 . LEU B 2 17 ? 6.294   -3.943  -14.231 1.00 0.00 ? 17 LEU B HD13 3  
ATOM   2136  H HD21 . LEU B 2 17 ? 7.556   -7.719  -12.974 1.00 0.00 ? 17 LEU B HD21 3  
ATOM   2137  H HD22 . LEU B 2 17 ? 8.609   -6.494  -13.683 1.00 0.00 ? 17 LEU B HD22 3  
ATOM   2138  H HD23 . LEU B 2 17 ? 7.691   -7.579  -14.727 1.00 0.00 ? 17 LEU B HD23 3  
ATOM   2139  N N    . VAL B 2 18 ? 5.078   -6.796  -9.366  1.00 0.00 ? 18 VAL B N    3  
ATOM   2140  C CA   . VAL B 2 18 ? 5.501   -7.005  -7.955  1.00 0.00 ? 18 VAL B CA   3  
ATOM   2141  C C    . VAL B 2 18 ? 4.879   -8.291  -7.418  1.00 0.00 ? 18 VAL B C    3  
ATOM   2142  O O    . VAL B 2 18 ? 5.552   -9.143  -6.873  1.00 0.00 ? 18 VAL B O    3  
ATOM   2143  C CB   . VAL B 2 18 ? 5.016   -5.829  -7.110  1.00 0.00 ? 18 VAL B CB   3  
ATOM   2144  C CG1  . VAL B 2 18 ? 5.416   -6.054  -5.655  1.00 0.00 ? 18 VAL B CG1  3  
ATOM   2145  C CG2  . VAL B 2 18 ? 5.652   -4.540  -7.625  1.00 0.00 ? 18 VAL B CG2  3  
ATOM   2146  H H    . VAL B 2 18 ? 4.210   -6.387  -9.557  1.00 0.00 ? 18 VAL B H    3  
ATOM   2147  H HA   . VAL B 2 18 ? 6.577   -7.070  -7.903  1.00 0.00 ? 18 VAL B HA   3  
ATOM   2148  H HB   . VAL B 2 18 ? 3.940   -5.755  -7.180  1.00 0.00 ? 18 VAL B HB   3  
ATOM   2149  H HG11 . VAL B 2 18 ? 5.964   -6.981  -5.572  1.00 0.00 ? 18 VAL B HG11 3  
ATOM   2150  H HG12 . VAL B 2 18 ? 4.528   -6.105  -5.042  1.00 0.00 ? 18 VAL B HG12 3  
ATOM   2151  H HG13 . VAL B 2 18 ? 6.037   -5.237  -5.323  1.00 0.00 ? 18 VAL B HG13 3  
ATOM   2152  H HG21 . VAL B 2 18 ? 5.982   -4.684  -8.643  1.00 0.00 ? 18 VAL B HG21 3  
ATOM   2153  H HG22 . VAL B 2 18 ? 6.497   -4.283  -7.004  1.00 0.00 ? 18 VAL B HG22 3  
ATOM   2154  H HG23 . VAL B 2 18 ? 4.924   -3.742  -7.591  1.00 0.00 ? 18 VAL B HG23 3  
ATOM   2155  N N    . CYS B 2 19 ? 3.592   -8.428  -7.559  1.00 0.00 ? 19 CYS B N    3  
ATOM   2156  C CA   . CYS B 2 19 ? 2.909   -9.648  -7.047  1.00 0.00 ? 19 CYS B CA   3  
ATOM   2157  C C    . CYS B 2 19 ? 3.266   -10.853 -7.920  1.00 0.00 ? 19 CYS B C    3  
ATOM   2158  O O    . CYS B 2 19 ? 3.889   -11.795 -7.469  1.00 0.00 ? 19 CYS B O    3  
ATOM   2159  C CB   . CYS B 2 19 ? 1.396   -9.427  -7.074  1.00 0.00 ? 19 CYS B CB   3  
ATOM   2160  S SG   . CYS B 2 19 ? 1.027   -7.737  -6.538  1.00 0.00 ? 19 CYS B SG   3  
ATOM   2161  H H    . CYS B 2 19 ? 3.071   -7.721  -7.995  1.00 0.00 ? 19 CYS B H    3  
ATOM   2162  H HA   . CYS B 2 19 ? 3.226   -9.834  -6.032  1.00 0.00 ? 19 CYS B HA   3  
ATOM   2163  H HB2  . CYS B 2 19 ? 1.028   -9.575  -8.078  1.00 0.00 ? 19 CYS B HB2  3  
ATOM   2164  H HB3  . CYS B 2 19 ? 0.917   -10.128 -6.406  1.00 0.00 ? 19 CYS B HB3  3  
ATOM   2165  N N    . GLY B 2 20 ? 2.875   -10.838 -9.164  1.00 0.00 ? 20 GLY B N    3  
ATOM   2166  C CA   . GLY B 2 20 ? 3.191   -11.989 -10.058 1.00 0.00 ? 20 GLY B CA   3  
ATOM   2167  C C    . GLY B 2 20 ? 2.306   -13.180 -9.681  1.00 0.00 ? 20 GLY B C    3  
ATOM   2168  O O    . GLY B 2 20 ? 1.160   -13.261 -10.072 1.00 0.00 ? 20 GLY B O    3  
ATOM   2169  H H    . GLY B 2 20 ? 2.371   -10.072 -9.510  1.00 0.00 ? 20 GLY B H    3  
ATOM   2170  H HA2  . GLY B 2 20 ? 3.006   -11.710 -11.085 1.00 0.00 ? 20 GLY B HA2  3  
ATOM   2171  H HA3  . GLY B 2 20 ? 4.228   -12.264 -9.939  1.00 0.00 ? 20 GLY B HA3  3  
ATOM   2172  N N    . GLU B 2 21 ? 2.830   -14.101 -8.919  1.00 0.00 ? 21 GLU B N    3  
ATOM   2173  C CA   . GLU B 2 21 ? 2.018   -15.283 -8.511  1.00 0.00 ? 21 GLU B CA   3  
ATOM   2174  C C    . GLU B 2 21 ? 0.868   -14.819 -7.618  1.00 0.00 ? 21 GLU B C    3  
ATOM   2175  O O    . GLU B 2 21 ? -0.273  -15.190 -7.809  1.00 0.00 ? 21 GLU B O    3  
ATOM   2176  C CB   . GLU B 2 21 ? 2.897   -16.257 -7.725  1.00 0.00 ? 21 GLU B CB   3  
ATOM   2177  C CG   . GLU B 2 21 ? 3.956   -16.857 -8.650  1.00 0.00 ? 21 GLU B CG   3  
ATOM   2178  C CD   . GLU B 2 21 ? 4.423   -18.200 -8.087  1.00 0.00 ? 21 GLU B CD   3  
ATOM   2179  O OE1  . GLU B 2 21 ? 4.926   -18.213 -6.975  1.00 0.00 ? 21 GLU B OE1  3  
ATOM   2180  O OE2  . GLU B 2 21 ? 4.271   -19.195 -8.776  1.00 0.00 ? 21 GLU B OE2  3  
ATOM   2181  H H    . GLU B 2 21 ? 3.756   -14.014 -8.611  1.00 0.00 ? 21 GLU B H    3  
ATOM   2182  H HA   . GLU B 2 21 ? 1.624   -15.774 -9.388  1.00 0.00 ? 21 GLU B HA   3  
ATOM   2183  H HB2  . GLU B 2 21 ? 3.381   -15.730 -6.915  1.00 0.00 ? 21 GLU B HB2  3  
ATOM   2184  H HB3  . GLU B 2 21 ? 2.284   -17.049 -7.322  1.00 0.00 ? 21 GLU B HB3  3  
ATOM   2185  H HG2  . GLU B 2 21 ? 3.534   -17.003 -9.633  1.00 0.00 ? 21 GLU B HG2  3  
ATOM   2186  H HG3  . GLU B 2 21 ? 4.798   -16.184 -8.715  1.00 0.00 ? 21 GLU B HG3  3  
ATOM   2187  N N    . ARG B 2 22 ? 1.171   -14.013 -6.637  1.00 0.00 ? 22 ARG B N    3  
ATOM   2188  C CA   . ARG B 2 22 ? 0.118   -13.511 -5.708  1.00 0.00 ? 22 ARG B CA   3  
ATOM   2189  C C    . ARG B 2 22 ? -1.163  -13.194 -6.483  1.00 0.00 ? 22 ARG B C    3  
ATOM   2190  O O    . ARG B 2 22 ? -2.257  -13.323 -5.971  1.00 0.00 ? 22 ARG B O    3  
ATOM   2191  C CB   . ARG B 2 22 ? 0.621   -12.242 -5.022  1.00 0.00 ? 22 ARG B CB   3  
ATOM   2192  C CG   . ARG B 2 22 ? 1.121   -12.586 -3.619  1.00 0.00 ? 22 ARG B CG   3  
ATOM   2193  C CD   . ARG B 2 22 ? 2.582   -13.033 -3.689  1.00 0.00 ? 22 ARG B CD   3  
ATOM   2194  N NE   . ARG B 2 22 ? 3.452   -11.988 -3.080  1.00 0.00 ? 22 ARG B NE   3  
ATOM   2195  C CZ   . ARG B 2 22 ? 4.353   -12.323 -2.196  1.00 0.00 ? 22 ARG B CZ   3  
ATOM   2196  N NH1  . ARG B 2 22 ? 5.418   -12.981 -2.566  1.00 0.00 ? 22 ARG B NH1  3  
ATOM   2197  N NH2  . ARG B 2 22 ? 4.189   -11.998 -0.943  1.00 0.00 ? 22 ARG B NH2  3  
ATOM   2198  H H    . ARG B 2 22 ? 2.103   -13.738 -6.509  1.00 0.00 ? 22 ARG B H    3  
ATOM   2199  H HA   . ARG B 2 22 ? -0.091  -14.262 -4.961  1.00 0.00 ? 22 ARG B HA   3  
ATOM   2200  H HB2  . ARG B 2 22 ? 1.430   -11.819 -5.600  1.00 0.00 ? 22 ARG B HB2  3  
ATOM   2201  H HB3  . ARG B 2 22 ? -0.184  -11.527 -4.950  1.00 0.00 ? 22 ARG B HB3  3  
ATOM   2202  H HG2  . ARG B 2 22 ? 1.040   -11.714 -2.987  1.00 0.00 ? 22 ARG B HG2  3  
ATOM   2203  H HG3  . ARG B 2 22 ? 0.522   -13.384 -3.208  1.00 0.00 ? 22 ARG B HG3  3  
ATOM   2204  H HD2  . ARG B 2 22 ? 2.701   -13.961 -3.148  1.00 0.00 ? 22 ARG B HD2  3  
ATOM   2205  H HD3  . ARG B 2 22 ? 2.865   -13.180 -4.721  1.00 0.00 ? 22 ARG B HD3  3  
ATOM   2206  H HE   . ARG B 2 22 ? 3.346   -11.049 -3.341  1.00 0.00 ? 22 ARG B HE   3  
ATOM   2207  H HH11 . ARG B 2 22 ? 5.543   -13.231 -3.526  1.00 0.00 ? 22 ARG B HH11 3  
ATOM   2208  H HH12 . ARG B 2 22 ? 6.108   -13.236 -1.888  1.00 0.00 ? 22 ARG B HH12 3  
ATOM   2209  H HH21 . ARG B 2 22 ? 3.374   -11.493 -0.659  1.00 0.00 ? 22 ARG B HH21 3  
ATOM   2210  H HH22 . ARG B 2 22 ? 4.879   -12.254 -0.265  1.00 0.00 ? 22 ARG B HH22 3  
ATOM   2211  N N    . GLY B 2 23 ? -1.039  -12.775 -7.711  1.00 0.00 ? 23 GLY B N    3  
ATOM   2212  C CA   . GLY B 2 23 ? -2.254  -12.444 -8.512  1.00 0.00 ? 23 GLY B CA   3  
ATOM   2213  C C    . GLY B 2 23 ? -2.568  -10.957 -8.356  1.00 0.00 ? 23 GLY B C    3  
ATOM   2214  O O    . GLY B 2 23 ? -2.872  -10.269 -9.308  1.00 0.00 ? 23 GLY B O    3  
ATOM   2215  H H    . GLY B 2 23 ? -0.148  -12.672 -8.105  1.00 0.00 ? 23 GLY B H    3  
ATOM   2216  H HA2  . GLY B 2 23 ? -2.074  -12.670 -9.552  1.00 0.00 ? 23 GLY B HA2  3  
ATOM   2217  H HA3  . GLY B 2 23 ? -3.091  -13.023 -8.153  1.00 0.00 ? 23 GLY B HA3  3  
ATOM   2218  N N    . PHE B 2 24 ? -2.484  -10.463 -7.155  1.00 0.00 ? 24 PHE B N    3  
ATOM   2219  C CA   . PHE B 2 24 ? -2.760  -9.018  -6.904  1.00 0.00 ? 24 PHE B CA   3  
ATOM   2220  C C    . PHE B 2 24 ? -4.180  -8.660  -7.363  1.00 0.00 ? 24 PHE B C    3  
ATOM   2221  O O    . PHE B 2 24 ? -4.538  -8.839  -8.510  1.00 0.00 ? 24 PHE B O    3  
ATOM   2222  C CB   . PHE B 2 24 ? -1.705  -8.163  -7.641  1.00 0.00 ? 24 PHE B CB   3  
ATOM   2223  C CG   . PHE B 2 24 ? -2.254  -7.597  -8.946  1.00 0.00 ? 24 PHE B CG   3  
ATOM   2224  C CD1  . PHE B 2 24 ? -3.195  -6.551  -8.922  1.00 0.00 ? 24 PHE B CD1  3  
ATOM   2225  C CD2  . PHE B 2 24 ? -1.820  -8.109  -10.178 1.00 0.00 ? 24 PHE B CD2  3  
ATOM   2226  C CE1  . PHE B 2 24 ? -3.694  -6.027  -10.121 1.00 0.00 ? 24 PHE B CE1  3  
ATOM   2227  C CE2  . PHE B 2 24 ? -2.322  -7.584  -11.376 1.00 0.00 ? 24 PHE B CE2  3  
ATOM   2228  C CZ   . PHE B 2 24 ? -3.259  -6.543  -11.347 1.00 0.00 ? 24 PHE B CZ   3  
ATOM   2229  H H    . PHE B 2 24 ? -2.231  -11.046 -6.410  1.00 0.00 ? 24 PHE B H    3  
ATOM   2230  H HA   . PHE B 2 24 ? -2.682  -8.830  -5.843  1.00 0.00 ? 24 PHE B HA   3  
ATOM   2231  H HB2  . PHE B 2 24 ? -1.410  -7.344  -7.001  1.00 0.00 ? 24 PHE B HB2  3  
ATOM   2232  H HB3  . PHE B 2 24 ? -0.835  -8.780  -7.848  1.00 0.00 ? 24 PHE B HB3  3  
ATOM   2233  H HD1  . PHE B 2 24 ? -3.538  -6.149  -7.981  1.00 0.00 ? 24 PHE B HD1  3  
ATOM   2234  H HD2  . PHE B 2 24 ? -1.102  -8.911  -10.205 1.00 0.00 ? 24 PHE B HD2  3  
ATOM   2235  H HE1  . PHE B 2 24 ? -4.416  -5.224  -10.100 1.00 0.00 ? 24 PHE B HE1  3  
ATOM   2236  H HE2  . PHE B 2 24 ? -1.986  -7.982  -12.322 1.00 0.00 ? 24 PHE B HE2  3  
ATOM   2237  H HZ   . PHE B 2 24 ? -3.644  -6.137  -12.270 1.00 0.00 ? 24 PHE B HZ   3  
ATOM   2238  N N    . PHE B 2 25 ? -4.980  -8.139  -6.473  1.00 0.00 ? 25 PHE B N    3  
ATOM   2239  C CA   . PHE B 2 25 ? -6.369  -7.747  -6.849  1.00 0.00 ? 25 PHE B CA   3  
ATOM   2240  C C    . PHE B 2 25 ? -6.587  -6.285  -6.453  1.00 0.00 ? 25 PHE B C    3  
ATOM   2241  O O    . PHE B 2 25 ? -6.636  -5.950  -5.286  1.00 0.00 ? 25 PHE B O    3  
ATOM   2242  C CB   . PHE B 2 25 ? -7.397  -8.631  -6.125  1.00 0.00 ? 25 PHE B CB   3  
ATOM   2243  C CG   . PHE B 2 25 ? -6.741  -9.372  -4.981  1.00 0.00 ? 25 PHE B CG   3  
ATOM   2244  C CD1  . PHE B 2 25 ? -6.172  -10.633 -5.198  1.00 0.00 ? 25 PHE B CD1  3  
ATOM   2245  C CD2  . PHE B 2 25 ? -6.702  -8.796  -3.704  1.00 0.00 ? 25 PHE B CD2  3  
ATOM   2246  C CE1  . PHE B 2 25 ? -5.565  -11.320 -4.139  1.00 0.00 ? 25 PHE B CE1  3  
ATOM   2247  C CE2  . PHE B 2 25 ? -6.095  -9.482  -2.644  1.00 0.00 ? 25 PHE B CE2  3  
ATOM   2248  C CZ   . PHE B 2 25 ? -5.526  -10.744 -2.862  1.00 0.00 ? 25 PHE B CZ   3  
ATOM   2249  H H    . PHE B 2 25 ? -4.663  -7.994  -5.558  1.00 0.00 ? 25 PHE B H    3  
ATOM   2250  H HA   . PHE B 2 25 ? -6.494  -7.850  -7.917  1.00 0.00 ? 25 PHE B HA   3  
ATOM   2251  H HB2  . PHE B 2 25 ? -8.192  -8.011  -5.738  1.00 0.00 ? 25 PHE B HB2  3  
ATOM   2252  H HB3  . PHE B 2 25 ? -7.808  -9.345  -6.822  1.00 0.00 ? 25 PHE B HB3  3  
ATOM   2253  H HD1  . PHE B 2 25 ? -6.202  -11.076 -6.182  1.00 0.00 ? 25 PHE B HD1  3  
ATOM   2254  H HD2  . PHE B 2 25 ? -7.141  -7.823  -3.537  1.00 0.00 ? 25 PHE B HD2  3  
ATOM   2255  H HE1  . PHE B 2 25 ? -5.125  -12.292 -4.306  1.00 0.00 ? 25 PHE B HE1  3  
ATOM   2256  H HE2  . PHE B 2 25 ? -6.065  -9.038  -1.661  1.00 0.00 ? 25 PHE B HE2  3  
ATOM   2257  H HZ   . PHE B 2 25 ? -5.057  -11.273 -2.045  1.00 0.00 ? 25 PHE B HZ   3  
ATOM   2258  N N    . TYR B 2 26 ? -6.702  -5.413  -7.419  1.00 0.00 ? 26 TYR B N    3  
ATOM   2259  C CA   . TYR B 2 26 ? -6.901  -3.967  -7.107  1.00 0.00 ? 26 TYR B CA   3  
ATOM   2260  C C    . TYR B 2 26 ? -7.870  -3.810  -5.933  1.00 0.00 ? 26 TYR B C    3  
ATOM   2261  O O    . TYR B 2 26 ? -9.062  -4.004  -6.068  1.00 0.00 ? 26 TYR B O    3  
ATOM   2262  C CB   . TYR B 2 26 ? -7.472  -3.255  -8.336  1.00 0.00 ? 26 TYR B CB   3  
ATOM   2263  C CG   . TYR B 2 26 ? -6.535  -2.149  -8.755  1.00 0.00 ? 26 TYR B CG   3  
ATOM   2264  C CD1  . TYR B 2 26 ? -5.149  -2.355  -8.708  1.00 0.00 ? 26 TYR B CD1  3  
ATOM   2265  C CD2  . TYR B 2 26 ? -7.047  -0.919  -9.187  1.00 0.00 ? 26 TYR B CD2  3  
ATOM   2266  C CE1  . TYR B 2 26 ? -4.277  -1.330  -9.095  1.00 0.00 ? 26 TYR B CE1  3  
ATOM   2267  C CE2  . TYR B 2 26 ? -6.174  0.106   -9.574  1.00 0.00 ? 26 TYR B CE2  3  
ATOM   2268  C CZ   . TYR B 2 26 ? -4.789  -0.099  -9.527  1.00 0.00 ? 26 TYR B CZ   3  
ATOM   2269  O OH   . TYR B 2 26 ? -3.929  0.911   -9.908  1.00 0.00 ? 26 TYR B OH   3  
ATOM   2270  H H    . TYR B 2 26 ? -6.647  -5.707  -8.352  1.00 0.00 ? 26 TYR B H    3  
ATOM   2271  H HA   . TYR B 2 26 ? -5.950  -3.524  -6.848  1.00 0.00 ? 26 TYR B HA   3  
ATOM   2272  H HB2  . TYR B 2 26 ? -7.580  -3.963  -9.145  1.00 0.00 ? 26 TYR B HB2  3  
ATOM   2273  H HB3  . TYR B 2 26 ? -8.437  -2.835  -8.094  1.00 0.00 ? 26 TYR B HB3  3  
ATOM   2274  H HD1  . TYR B 2 26 ? -4.755  -3.303  -8.374  1.00 0.00 ? 26 TYR B HD1  3  
ATOM   2275  H HD2  . TYR B 2 26 ? -8.115  -0.762  -9.224  1.00 0.00 ? 26 TYR B HD2  3  
ATOM   2276  H HE1  . TYR B 2 26 ? -3.210  -1.487  -9.059  1.00 0.00 ? 26 TYR B HE1  3  
ATOM   2277  H HE2  . TYR B 2 26 ? -6.568  1.054   -9.908  1.00 0.00 ? 26 TYR B HE2  3  
ATOM   2278  H HH   . TYR B 2 26 ? -3.212  0.516   -10.411 1.00 0.00 ? 26 TYR B HH   3  
ATOM   2279  N N    . THR B 2 27 ? -7.367  -3.455  -4.782  1.00 0.00 ? 27 THR B N    3  
ATOM   2280  C CA   . THR B 2 27 ? -8.256  -3.280  -3.600  1.00 0.00 ? 27 THR B CA   3  
ATOM   2281  C C    . THR B 2 27 ? -8.918  -1.903  -3.669  1.00 0.00 ? 27 THR B C    3  
ATOM   2282  O O    . THR B 2 27 ? -8.260  -0.896  -3.842  1.00 0.00 ? 27 THR B O    3  
ATOM   2283  C CB   . THR B 2 27 ? -7.428  -3.383  -2.316  1.00 0.00 ? 27 THR B CB   3  
ATOM   2284  O OG1  . THR B 2 27 ? -6.470  -2.334  -2.289  1.00 0.00 ? 27 THR B OG1  3  
ATOM   2285  C CG2  . THR B 2 27 ? -6.711  -4.733  -2.272  1.00 0.00 ? 27 THR B CG2  3  
ATOM   2286  H H    . THR B 2 27 ? -6.403  -3.301  -4.696  1.00 0.00 ? 27 THR B H    3  
ATOM   2287  H HA   . THR B 2 27 ? -9.016  -4.047  -3.602  1.00 0.00 ? 27 THR B HA   3  
ATOM   2288  H HB   . THR B 2 27 ? -8.079  -3.298  -1.459  1.00 0.00 ? 27 THR B HB   3  
ATOM   2289  H HG1  . THR B 2 27 ? -6.879  -1.570  -1.876  1.00 0.00 ? 27 THR B HG1  3  
ATOM   2290  H HG21 . THR B 2 27 ? -7.181  -5.367  -1.535  1.00 0.00 ? 27 THR B HG21 3  
ATOM   2291  H HG22 . THR B 2 27 ? -5.675  -4.581  -2.007  1.00 0.00 ? 27 THR B HG22 3  
ATOM   2292  H HG23 . THR B 2 27 ? -6.768  -5.203  -3.243  1.00 0.00 ? 27 THR B HG23 3  
ATOM   2293  N N    . LYS B 2 28 ? -10.214 -1.846  -3.538  1.00 0.00 ? 28 LYS B N    3  
ATOM   2294  C CA   . LYS B 2 28 ? -10.908 -0.530  -3.598  1.00 0.00 ? 28 LYS B CA   3  
ATOM   2295  C C    . LYS B 2 28 ? -12.241 -0.619  -2.849  1.00 0.00 ? 28 LYS B C    3  
ATOM   2296  O O    . LYS B 2 28 ? -13.256 -0.953  -3.429  1.00 0.00 ? 28 LYS B O    3  
ATOM   2297  C CB   . LYS B 2 28 ? -11.166 -0.154  -5.057  1.00 0.00 ? 28 LYS B CB   3  
ATOM   2298  C CG   . LYS B 2 28 ? -11.028 1.360   -5.222  1.00 0.00 ? 28 LYS B CG   3  
ATOM   2299  C CD   . LYS B 2 28 ? -11.748 1.802   -6.497  1.00 0.00 ? 28 LYS B CD   3  
ATOM   2300  C CE   . LYS B 2 28 ? -10.885 1.460   -7.712  1.00 0.00 ? 28 LYS B CE   3  
ATOM   2301  N NZ   . LYS B 2 28 ? -11.243 2.359   -8.845  1.00 0.00 ? 28 LYS B NZ   3  
ATOM   2302  H H    . LYS B 2 28 ? -10.731 -2.668  -3.400  1.00 0.00 ? 28 LYS B H    3  
ATOM   2303  H HA   . LYS B 2 28 ? -10.287 0.224   -3.137  1.00 0.00 ? 28 LYS B HA   3  
ATOM   2304  H HB2  . LYS B 2 28 ? -10.447 -0.654  -5.691  1.00 0.00 ? 28 LYS B HB2  3  
ATOM   2305  H HB3  . LYS B 2 28 ? -12.165 -0.455  -5.336  1.00 0.00 ? 28 LYS B HB3  3  
ATOM   2306  H HG2  . LYS B 2 28 ? -11.467 1.856   -4.368  1.00 0.00 ? 28 LYS B HG2  3  
ATOM   2307  H HG3  . LYS B 2 28 ? -9.982  1.621   -5.292  1.00 0.00 ? 28 LYS B HG3  3  
ATOM   2308  H HD2  . LYS B 2 28 ? -12.696 1.290   -6.571  1.00 0.00 ? 28 LYS B HD2  3  
ATOM   2309  H HD3  . LYS B 2 28 ? -11.916 2.868   -6.465  1.00 0.00 ? 28 LYS B HD3  3  
ATOM   2310  H HE2  . LYS B 2 28 ? -9.843  1.594   -7.462  1.00 0.00 ? 28 LYS B HE2  3  
ATOM   2311  H HE3  . LYS B 2 28 ? -11.057 0.434   -7.998  1.00 0.00 ? 28 LYS B HE3  3  
ATOM   2312  H HZ1  . LYS B 2 28 ? -11.498 3.297   -8.477  1.00 0.00 ? 28 LYS B HZ1  3  
ATOM   2313  H HZ2  . LYS B 2 28 ? -12.052 1.957   -9.363  1.00 0.00 ? 28 LYS B HZ2  3  
ATOM   2314  H HZ3  . LYS B 2 28 ? -10.429 2.451   -9.485  1.00 0.00 ? 28 LYS B HZ3  3  
ATOM   2315  N N    . PRO B 2 29 ? -12.193 -0.314  -1.578  1.00 0.00 ? 29 PRO B N    3  
ATOM   2316  C CA   . PRO B 2 29 ? -13.379 -0.346  -0.707  1.00 0.00 ? 29 PRO B CA   3  
ATOM   2317  C C    . PRO B 2 29 ? -14.237 0.904   -0.925  1.00 0.00 ? 29 PRO B C    3  
ATOM   2318  O O    . PRO B 2 29 ? -13.730 1.980   -1.174  1.00 0.00 ? 29 PRO B O    3  
ATOM   2319  C CB   . PRO B 2 29 ? -12.786 -0.364  0.704   1.00 0.00 ? 29 PRO B CB   3  
ATOM   2320  C CG   . PRO B 2 29 ? -11.359 0.223   0.586   1.00 0.00 ? 29 PRO B CG   3  
ATOM   2321  C CD   . PRO B 2 29 ? -10.947 0.089   -0.891  1.00 0.00 ? 29 PRO B CD   3  
ATOM   2322  H HA   . PRO B 2 29 ? -13.955 -1.240  -0.877  1.00 0.00 ? 29 PRO B HA   3  
ATOM   2323  H HB2  . PRO B 2 29 ? -13.388 0.244   1.366   1.00 0.00 ? 29 PRO B HB2  3  
ATOM   2324  H HB3  . PRO B 2 29 ? -12.733 -1.376  1.072   1.00 0.00 ? 29 PRO B HB3  3  
ATOM   2325  H HG2  . PRO B 2 29 ? -11.362 1.263   0.880   1.00 0.00 ? 29 PRO B HG2  3  
ATOM   2326  H HG3  . PRO B 2 29 ? -10.676 -0.337  1.206   1.00 0.00 ? 29 PRO B HG3  3  
ATOM   2327  H HD2  . PRO B 2 29 ? -10.593 1.038   -1.271  1.00 0.00 ? 29 PRO B HD2  3  
ATOM   2328  H HD3  . PRO B 2 29 ? -10.194 -0.674  -1.008  1.00 0.00 ? 29 PRO B HD3  3  
ATOM   2329  N N    . THR B 2 30 ? -15.531 0.770   -0.835  1.00 0.00 ? 30 THR B N    3  
ATOM   2330  C CA   . THR B 2 30 ? -16.418 1.950   -1.037  1.00 0.00 ? 30 THR B CA   3  
ATOM   2331  C C    . THR B 2 30 ? -16.203 2.948   0.102   1.00 0.00 ? 30 THR B C    3  
ATOM   2332  O O    . THR B 2 30 ? -16.105 4.131   -0.184  1.00 0.00 ? 30 THR B O    3  
ATOM   2333  C CB   . THR B 2 30 ? -17.880 1.495   -1.046  1.00 0.00 ? 30 THR B CB   3  
ATOM   2334  O OG1  . THR B 2 30 ? -18.729 2.634   -1.061  1.00 0.00 ? 30 THR B OG1  3  
ATOM   2335  C CG2  . THR B 2 30 ? -18.164 0.662   0.205   1.00 0.00 ? 30 THR B CG2  3  
ATOM   2336  O OXT  . THR B 2 30 ? -16.140 2.514   1.239   1.00 0.00 ? 30 THR B OXT  3  
ATOM   2337  H H    . THR B 2 30 ? -15.920 -0.107  -0.634  1.00 0.00 ? 30 THR B H    3  
ATOM   2338  H HA   . THR B 2 30 ? -16.182 2.422   -1.980  1.00 0.00 ? 30 THR B HA   3  
ATOM   2339  H HB   . THR B 2 30 ? -18.066 0.895   -1.923  1.00 0.00 ? 30 THR B HB   3  
ATOM   2340  H HG1  . THR B 2 30 ? -18.365 3.268   -1.683  1.00 0.00 ? 30 THR B HG1  3  
ATOM   2341  H HG21 . THR B 2 30 ? -19.010 1.080   0.731   1.00 0.00 ? 30 THR B HG21 3  
ATOM   2342  H HG22 . THR B 2 30 ? -17.297 0.672   0.849   1.00 0.00 ? 30 THR B HG22 3  
ATOM   2343  H HG23 . THR B 2 30 ? -18.387 -0.355  -0.083  1.00 0.00 ? 30 THR B HG23 3  
ATOM   2344  N N    . GLY A 1 1  ? -6.375  2.418   -0.611  1.00 0.00 ? 1  GLY A N    4  
ATOM   2345  C CA   . GLY A 1 1  ? -5.810  3.738   -1.135  1.00 0.00 ? 1  GLY A CA   4  
ATOM   2346  C C    . GLY A 1 1  ? -4.585  3.724   -1.986  1.00 0.00 ? 1  GLY A C    4  
ATOM   2347  O O    . GLY A 1 1  ? -4.100  4.754   -2.411  1.00 0.00 ? 1  GLY A O    4  
ATOM   2348  H H1   . GLY A 1 1  ? -5.610  1.862   -0.177  1.00 0.00 ? 1  GLY A H1   4  
ATOM   2349  H H2   . GLY A 1 1  ? -6.790  1.881   -1.399  1.00 0.00 ? 1  GLY A H2   4  
ATOM   2350  H H3   . GLY A 1 1  ? -7.107  2.612   0.101   1.00 0.00 ? 1  GLY A H3   4  
ATOM   2351  H HA2  . GLY A 1 1  ? -6.252  4.010   -1.961  1.00 0.00 ? 1  GLY A HA2  4  
ATOM   2352  H HA3  . GLY A 1 1  ? -5.924  4.522   -0.277  1.00 0.00 ? 1  GLY A HA3  4  
HETATM 2353  N N    . IIL A 1 2  ? -4.055  2.564   -2.255  1.00 0.00 ? 2  IIL A N    4  
HETATM 2354  C CA   . IIL A 1 2  ? -2.830  2.482   -3.098  1.00 0.00 ? 2  IIL A CA   4  
HETATM 2355  C C    . IIL A 1 2  ? -3.045  3.267   -4.394  1.00 0.00 ? 2  IIL A C    4  
HETATM 2356  O O    . IIL A 1 2  ? -2.170  3.972   -4.856  1.00 0.00 ? 2  IIL A O    4  
HETATM 2357  C CB   . IIL A 1 2  ? -2.541  1.015   -3.430  1.00 0.00 ? 2  IIL A CB   4  
HETATM 2358  C CG2  . IIL A 1 2  ? -1.215  0.913   -4.188  1.00 0.00 ? 2  IIL A CG2  4  
HETATM 2359  C CG1  . IIL A 1 2  ? -3.669  0.458   -4.299  1.00 0.00 ? 2  IIL A CG1  4  
HETATM 2360  C CD1  . IIL A 1 2  ? -3.585  -1.070  -4.325  1.00 0.00 ? 2  IIL A CD1  4  
HETATM 2361  H H    . IIL A 1 2  ? -4.462  1.746   -1.902  1.00 0.00 ? 2  IIL A H    4  
HETATM 2362  H HA   . IIL A 1 2  ? -1.993  2.899   -2.559  1.00 0.00 ? 2  IIL A HA   4  
HETATM 2363  H HB   . IIL A 1 2  ? -2.476  0.443   -2.516  1.00 0.00 ? 2  IIL A HB   4  
HETATM 2364  H HG21 . IIL A 1 2  ? -0.418  0.703   -3.491  1.00 0.00 ? 2  IIL A HG21 4  
HETATM 2365  H HG22 . IIL A 1 2  ? -1.016  1.847   -4.692  1.00 0.00 ? 2  IIL A HG22 4  
HETATM 2366  H HG23 . IIL A 1 2  ? -1.278  0.117   -4.914  1.00 0.00 ? 2  IIL A HG23 4  
HETATM 2367  H HG12 . IIL A 1 2  ? -3.571  0.839   -5.305  1.00 0.00 ? 2  IIL A HG12 4  
HETATM 2368  H HG13 . IIL A 1 2  ? -4.622  0.760   -3.889  1.00 0.00 ? 2  IIL A HG13 4  
HETATM 2369  H HD11 . IIL A 1 2  ? -4.448  -1.470  -4.839  1.00 0.00 ? 2  IIL A HD11 4  
HETATM 2370  H HD12 . IIL A 1 2  ? -3.563  -1.447  -3.313  1.00 0.00 ? 2  IIL A HD12 4  
HETATM 2371  H HD13 . IIL A 1 2  ? -2.686  -1.372  -4.841  1.00 0.00 ? 2  IIL A HD13 4  
ATOM   2372  N N    . VAL A 1 3  ? -4.202  3.150   -4.985  1.00 0.00 ? 3  VAL A N    4  
ATOM   2373  C CA   . VAL A 1 3  ? -4.469  3.889   -6.252  1.00 0.00 ? 3  VAL A CA   4  
ATOM   2374  C C    . VAL A 1 3  ? -4.527  5.390   -5.965  1.00 0.00 ? 3  VAL A C    4  
ATOM   2375  O O    . VAL A 1 3  ? -3.809  6.173   -6.556  1.00 0.00 ? 3  VAL A O    4  
ATOM   2376  C CB   . VAL A 1 3  ? -5.804  3.431   -6.839  1.00 0.00 ? 3  VAL A CB   4  
ATOM   2377  C CG1  . VAL A 1 3  ? -6.198  4.354   -7.992  1.00 0.00 ? 3  VAL A CG1  4  
ATOM   2378  C CG2  . VAL A 1 3  ? -5.669  1.998   -7.356  1.00 0.00 ? 3  VAL A CG2  4  
ATOM   2379  H H    . VAL A 1 3  ? -4.896  2.575   -4.599  1.00 0.00 ? 3  VAL A H    4  
ATOM   2380  H HA   . VAL A 1 3  ? -3.677  3.687   -6.958  1.00 0.00 ? 3  VAL A HA   4  
ATOM   2381  H HB   . VAL A 1 3  ? -6.565  3.468   -6.071  1.00 0.00 ? 3  VAL A HB   4  
ATOM   2382  H HG11 . VAL A 1 3  ? -5.311  4.662   -8.525  1.00 0.00 ? 3  VAL A HG11 4  
ATOM   2383  H HG12 . VAL A 1 3  ? -6.703  5.225   -7.600  1.00 0.00 ? 3  VAL A HG12 4  
ATOM   2384  H HG13 . VAL A 1 3  ? -6.858  3.828   -8.666  1.00 0.00 ? 3  VAL A HG13 4  
ATOM   2385  H HG21 . VAL A 1 3  ? -6.480  1.782   -8.037  1.00 0.00 ? 3  VAL A HG21 4  
ATOM   2386  H HG22 . VAL A 1 3  ? -5.703  1.309   -6.525  1.00 0.00 ? 3  VAL A HG22 4  
ATOM   2387  H HG23 . VAL A 1 3  ? -4.727  1.889   -7.874  1.00 0.00 ? 3  VAL A HG23 4  
ATOM   2388  N N    . GLU A 1 4  ? -5.378  5.801   -5.065  1.00 0.00 ? 4  GLU A N    4  
ATOM   2389  C CA   . GLU A 1 4  ? -5.482  7.252   -4.747  1.00 0.00 ? 4  GLU A CA   4  
ATOM   2390  C C    . GLU A 1 4  ? -4.227  7.707   -3.998  1.00 0.00 ? 4  GLU A C    4  
ATOM   2391  O O    . GLU A 1 4  ? -4.050  8.876   -3.720  1.00 0.00 ? 4  GLU A O    4  
ATOM   2392  C CB   . GLU A 1 4  ? -6.714  7.493   -3.872  1.00 0.00 ? 4  GLU A CB   4  
ATOM   2393  C CG   . GLU A 1 4  ? -7.977  7.378   -4.726  1.00 0.00 ? 4  GLU A CG   4  
ATOM   2394  C CD   . GLU A 1 4  ? -8.641  8.750   -4.845  1.00 0.00 ? 4  GLU A CD   4  
ATOM   2395  O OE1  . GLU A 1 4  ? -8.239  9.508   -5.713  1.00 0.00 ? 4  GLU A OE1  4  
ATOM   2396  O OE2  . GLU A 1 4  ? -9.540  9.021   -4.066  1.00 0.00 ? 4  GLU A OE2  4  
ATOM   2397  H H    . GLU A 1 4  ? -5.949  5.154   -4.601  1.00 0.00 ? 4  GLU A H    4  
ATOM   2398  H HA   . GLU A 1 4  ? -5.577  7.815   -5.663  1.00 0.00 ? 4  GLU A HA   4  
ATOM   2399  H HB2  . GLU A 1 4  ? -6.743  6.757   -3.081  1.00 0.00 ? 4  GLU A HB2  4  
ATOM   2400  H HB3  . GLU A 1 4  ? -6.662  8.482   -3.442  1.00 0.00 ? 4  GLU A HB3  4  
ATOM   2401  H HG2  . GLU A 1 4  ? -7.713  7.018   -5.711  1.00 0.00 ? 4  GLU A HG2  4  
ATOM   2402  H HG3  . GLU A 1 4  ? -8.664  6.686   -4.262  1.00 0.00 ? 4  GLU A HG3  4  
ATOM   2403  N N    . GLN A 1 5  ? -3.355  6.795   -3.664  1.00 0.00 ? 5  GLN A N    4  
ATOM   2404  C CA   . GLN A 1 5  ? -2.120  7.188   -2.932  1.00 0.00 ? 5  GLN A CA   4  
ATOM   2405  C C    . GLN A 1 5  ? -0.926  7.199   -3.895  1.00 0.00 ? 5  GLN A C    4  
ATOM   2406  O O    . GLN A 1 5  ? -0.250  8.199   -4.047  1.00 0.00 ? 5  GLN A O    4  
ATOM   2407  C CB   . GLN A 1 5  ? -1.860  6.190   -1.802  1.00 0.00 ? 5  GLN A CB   4  
ATOM   2408  C CG   . GLN A 1 5  ? -0.524  6.515   -1.137  1.00 0.00 ? 5  GLN A CG   4  
ATOM   2409  C CD   . GLN A 1 5  ? -0.654  7.818   -0.346  1.00 0.00 ? 5  GLN A CD   4  
ATOM   2410  O OE1  . GLN A 1 5  ? -1.442  7.910   0.574   1.00 0.00 ? 5  GLN A OE1  4  
ATOM   2411  N NE2  . GLN A 1 5  ? 0.091   8.840   -0.669  1.00 0.00 ? 5  GLN A NE2  4  
ATOM   2412  H H    . GLN A 1 5  ? -3.511  5.856   -3.892  1.00 0.00 ? 5  GLN A H    4  
ATOM   2413  H HA   . GLN A 1 5  ? -2.251  8.174   -2.513  1.00 0.00 ? 5  GLN A HA   4  
ATOM   2414  H HB2  . GLN A 1 5  ? -2.654  6.258   -1.071  1.00 0.00 ? 5  GLN A HB2  4  
ATOM   2415  H HB3  . GLN A 1 5  ? -1.826  5.189   -2.205  1.00 0.00 ? 5  GLN A HB3  4  
ATOM   2416  H HG2  . GLN A 1 5  ? -0.252  5.711   -0.468  1.00 0.00 ? 5  GLN A HG2  4  
ATOM   2417  H HG3  . GLN A 1 5  ? 0.236   6.628   -1.894  1.00 0.00 ? 5  GLN A HG3  4  
ATOM   2418  H HE21 . GLN A 1 5  ? 0.728   8.767   -1.411  1.00 0.00 ? 5  GLN A HE21 4  
ATOM   2419  H HE22 . GLN A 1 5  ? 0.015   9.679   -0.169  1.00 0.00 ? 5  GLN A HE22 4  
ATOM   2420  N N    . CYS A 1 6  ? -0.658  6.097   -4.544  1.00 0.00 ? 6  CYS A N    4  
ATOM   2421  C CA   . CYS A 1 6  ? 0.495   6.057   -5.487  1.00 0.00 ? 6  CYS A CA   4  
ATOM   2422  C C    . CYS A 1 6  ? 0.164   6.867   -6.742  1.00 0.00 ? 6  CYS A C    4  
ATOM   2423  O O    . CYS A 1 6  ? 1.017   7.111   -7.575  1.00 0.00 ? 6  CYS A O    4  
ATOM   2424  C CB   . CYS A 1 6  ? 0.798   4.607   -5.874  1.00 0.00 ? 6  CYS A CB   4  
ATOM   2425  S SG   . CYS A 1 6  ? 0.906   3.602   -4.374  1.00 0.00 ? 6  CYS A SG   4  
ATOM   2426  H H    . CYS A 1 6  ? -1.211  5.300   -4.410  1.00 0.00 ? 6  CYS A H    4  
ATOM   2427  H HA   . CYS A 1 6  ? 1.362   6.485   -5.007  1.00 0.00 ? 6  CYS A HA   4  
ATOM   2428  H HB2  . CYS A 1 6  ? 0.013   4.228   -6.510  1.00 0.00 ? 6  CYS A HB2  4  
ATOM   2429  H HB3  . CYS A 1 6  ? 1.740   4.565   -6.402  1.00 0.00 ? 6  CYS A HB3  4  
ATOM   2430  N N    . CYS A 1 7  ? -1.062  7.296   -6.883  1.00 0.00 ? 7  CYS A N    4  
ATOM   2431  C CA   . CYS A 1 7  ? -1.423  8.101   -8.082  1.00 0.00 ? 7  CYS A CA   4  
ATOM   2432  C C    . CYS A 1 7  ? -1.442  9.581   -7.699  1.00 0.00 ? 7  CYS A C    4  
ATOM   2433  O O    . CYS A 1 7  ? -1.359  10.453  -8.540  1.00 0.00 ? 7  CYS A O    4  
ATOM   2434  C CB   . CYS A 1 7  ? -2.787  7.661   -8.624  1.00 0.00 ? 7  CYS A CB   4  
ATOM   2435  S SG   . CYS A 1 7  ? -3.071  8.398   -10.255 1.00 0.00 ? 7  CYS A SG   4  
ATOM   2436  H H    . CYS A 1 7  ? -1.736  7.098   -6.200  1.00 0.00 ? 7  CYS A H    4  
ATOM   2437  H HA   . CYS A 1 7  ? -0.674  7.951   -8.835  1.00 0.00 ? 7  CYS A HA   4  
ATOM   2438  H HB2  . CYS A 1 7  ? -2.808  6.585   -8.711  1.00 0.00 ? 7  CYS A HB2  4  
ATOM   2439  H HB3  . CYS A 1 7  ? -3.559  7.977   -7.952  1.00 0.00 ? 7  CYS A HB3  4  
ATOM   2440  N N    . THR A 1 8  ? -1.504  9.871   -6.426  1.00 0.00 ? 8  THR A N    4  
ATOM   2441  C CA   . THR A 1 8  ? -1.469  11.295  -5.990  1.00 0.00 ? 8  THR A CA   4  
ATOM   2442  C C    . THR A 1 8  ? -0.001  11.725  -5.970  1.00 0.00 ? 8  THR A C    4  
ATOM   2443  O O    . THR A 1 8  ? 0.329   12.890  -6.061  1.00 0.00 ? 8  THR A O    4  
ATOM   2444  C CB   . THR A 1 8  ? -2.070  11.427  -4.586  1.00 0.00 ? 8  THR A CB   4  
ATOM   2445  O OG1  . THR A 1 8  ? -2.105  12.798  -4.215  1.00 0.00 ? 8  THR A OG1  4  
ATOM   2446  C CG2  . THR A 1 8  ? -1.217  10.648  -3.583  1.00 0.00 ? 8  THR A CG2  4  
ATOM   2447  H H    . THR A 1 8  ? -1.537  9.155   -5.760  1.00 0.00 ? 8  THR A H    4  
ATOM   2448  H HA   . THR A 1 8  ? -2.022  11.907  -6.688  1.00 0.00 ? 8  THR A HA   4  
ATOM   2449  H HB   . THR A 1 8  ? -3.073  11.028  -4.585  1.00 0.00 ? 8  THR A HB   4  
ATOM   2450  H HG1  . THR A 1 8  ? -2.779  13.231  -4.744  1.00 0.00 ? 8  THR A HG1  4  
ATOM   2451  H HG21 . THR A 1 8  ? -1.211  11.167  -2.636  1.00 0.00 ? 8  THR A HG21 4  
ATOM   2452  H HG22 . THR A 1 8  ? -0.207  10.566  -3.955  1.00 0.00 ? 8  THR A HG22 4  
ATOM   2453  H HG23 . THR A 1 8  ? -1.632  9.660   -3.449  1.00 0.00 ? 8  THR A HG23 4  
ATOM   2454  N N    . SER A 1 9  ? 0.877   10.762  -5.871  1.00 0.00 ? 9  SER A N    4  
ATOM   2455  C CA   . SER A 1 9  ? 2.339   11.040  -5.864  1.00 0.00 ? 9  SER A CA   4  
ATOM   2456  C C    . SER A 1 9  ? 3.047   9.778   -6.359  1.00 0.00 ? 9  SER A C    4  
ATOM   2457  O O    . SER A 1 9  ? 2.491   9.015   -7.123  1.00 0.00 ? 9  SER A O    4  
ATOM   2458  C CB   . SER A 1 9  ? 2.797   11.368  -4.442  1.00 0.00 ? 9  SER A CB   4  
ATOM   2459  O OG   . SER A 1 9  ? 1.989   12.413  -3.917  1.00 0.00 ? 9  SER A OG   4  
ATOM   2460  H H    . SER A 1 9  ? 0.569   9.833   -5.814  1.00 0.00 ? 9  SER A H    4  
ATOM   2461  H HA   . SER A 1 9  ? 2.559   11.866  -6.524  1.00 0.00 ? 9  SER A HA   4  
ATOM   2462  H HB2  . SER A 1 9  ? 2.697   10.496  -3.819  1.00 0.00 ? 9  SER A HB2  4  
ATOM   2463  H HB3  . SER A 1 9  ? 3.835   11.677  -4.463  1.00 0.00 ? 9  SER A HB3  4  
ATOM   2464  H HG   . SER A 1 9  ? 1.781   12.198  -3.005  1.00 0.00 ? 9  SER A HG   4  
ATOM   2465  N N    . ILE A 1 10 ? 4.252   9.526   -5.931  1.00 0.00 ? 10 ILE A N    4  
ATOM   2466  C CA   . ILE A 1 10 ? 4.934   8.288   -6.391  1.00 0.00 ? 10 ILE A CA   4  
ATOM   2467  C C    . ILE A 1 10 ? 4.526   7.134   -5.463  1.00 0.00 ? 10 ILE A C    4  
ATOM   2468  O O    . ILE A 1 10 ? 3.387   7.045   -5.054  1.00 0.00 ? 10 ILE A O    4  
ATOM   2469  C CB   . ILE A 1 10 ? 6.452   8.492   -6.384  1.00 0.00 ? 10 ILE A CB   4  
ATOM   2470  C CG1  . ILE A 1 10 ? 6.774   9.895   -6.933  1.00 0.00 ? 10 ILE A CG1  4  
ATOM   2471  C CG2  . ILE A 1 10 ? 7.106   7.426   -7.272  1.00 0.00 ? 10 ILE A CG2  4  
ATOM   2472  C CD1  . ILE A 1 10 ? 8.185   9.920   -7.536  1.00 0.00 ? 10 ILE A CD1  4  
ATOM   2473  H H    . ILE A 1 10 ? 4.696   10.134  -5.303  1.00 0.00 ? 10 ILE A H    4  
ATOM   2474  H HA   . ILE A 1 10 ? 4.608   8.061   -7.395  1.00 0.00 ? 10 ILE A HA   4  
ATOM   2475  H HB   . ILE A 1 10 ? 6.822   8.403   -5.373  1.00 0.00 ? 10 ILE A HB   4  
ATOM   2476  H HG12 . ILE A 1 10 ? 6.054   10.153  -7.695  1.00 0.00 ? 10 ILE A HG12 4  
ATOM   2477  H HG13 . ILE A 1 10 ? 6.717   10.615  -6.129  1.00 0.00 ? 10 ILE A HG13 4  
ATOM   2478  H HG21 . ILE A 1 10 ? 8.014   7.076   -6.804  1.00 0.00 ? 10 ILE A HG21 4  
ATOM   2479  H HG22 . ILE A 1 10 ? 7.340   7.854   -8.234  1.00 0.00 ? 10 ILE A HG22 4  
ATOM   2480  H HG23 . ILE A 1 10 ? 6.425   6.598   -7.402  1.00 0.00 ? 10 ILE A HG23 4  
ATOM   2481  H HD11 . ILE A 1 10 ? 8.138   9.628   -8.577  1.00 0.00 ? 10 ILE A HD11 4  
ATOM   2482  H HD12 . ILE A 1 10 ? 8.815   9.228   -7.001  1.00 0.00 ? 10 ILE A HD12 4  
ATOM   2483  H HD13 . ILE A 1 10 ? 8.597   10.913  -7.460  1.00 0.00 ? 10 ILE A HD13 4  
ATOM   2484  N N    . CYS A 1 11 ? 5.426   6.247   -5.126  1.00 0.00 ? 11 CYS A N    4  
ATOM   2485  C CA   . CYS A 1 11 ? 5.048   5.114   -4.232  1.00 0.00 ? 11 CYS A CA   4  
ATOM   2486  C C    . CYS A 1 11 ? 6.179   4.087   -4.203  1.00 0.00 ? 11 CYS A C    4  
ATOM   2487  O O    . CYS A 1 11 ? 6.752   3.754   -5.221  1.00 0.00 ? 11 CYS A O    4  
ATOM   2488  C CB   . CYS A 1 11 ? 3.782   4.441   -4.769  1.00 0.00 ? 11 CYS A CB   4  
ATOM   2489  S SG   . CYS A 1 11 ? 2.559   4.294   -3.442  1.00 0.00 ? 11 CYS A SG   4  
ATOM   2490  H H    . CYS A 1 11 ? 6.341   6.321   -5.457  1.00 0.00 ? 11 CYS A H    4  
ATOM   2491  H HA   . CYS A 1 11 ? 4.867   5.484   -3.235  1.00 0.00 ? 11 CYS A HA   4  
ATOM   2492  H HB2  . CYS A 1 11 ? 3.372   5.031   -5.573  1.00 0.00 ? 11 CYS A HB2  4  
ATOM   2493  H HB3  . CYS A 1 11 ? 4.030   3.456   -5.138  1.00 0.00 ? 11 CYS A HB3  4  
ATOM   2494  N N    . SER A 1 12 ? 6.499   3.573   -3.047  1.00 0.00 ? 12 SER A N    4  
ATOM   2495  C CA   . SER A 1 12 ? 7.584   2.560   -2.965  1.00 0.00 ? 12 SER A CA   4  
ATOM   2496  C C    . SER A 1 12 ? 7.009   1.179   -3.273  1.00 0.00 ? 12 SER A C    4  
ATOM   2497  O O    . SER A 1 12 ? 5.962   0.804   -2.781  1.00 0.00 ? 12 SER A O    4  
ATOM   2498  C CB   . SER A 1 12 ? 8.189   2.558   -1.564  1.00 0.00 ? 12 SER A CB   4  
ATOM   2499  O OG   . SER A 1 12 ? 7.279   3.166   -0.656  1.00 0.00 ? 12 SER A OG   4  
ATOM   2500  H H    . SER A 1 12 ? 6.020   3.847   -2.238  1.00 0.00 ? 12 SER A H    4  
ATOM   2501  H HA   . SER A 1 12 ? 8.351   2.797   -3.687  1.00 0.00 ? 12 SER A HA   4  
ATOM   2502  H HB2  . SER A 1 12 ? 8.374   1.543   -1.251  1.00 0.00 ? 12 SER A HB2  4  
ATOM   2503  H HB3  . SER A 1 12 ? 9.122   3.103   -1.579  1.00 0.00 ? 12 SER A HB3  4  
ATOM   2504  H HG   . SER A 1 12 ? 7.388   2.745   0.201   1.00 0.00 ? 12 SER A HG   4  
ATOM   2505  N N    . LEU A 1 13 ? 7.686   0.419   -4.081  1.00 0.00 ? 13 LEU A N    4  
ATOM   2506  C CA   . LEU A 1 13 ? 7.178   -0.938  -4.415  1.00 0.00 ? 13 LEU A CA   4  
ATOM   2507  C C    . LEU A 1 13 ? 7.176   -1.796  -3.148  1.00 0.00 ? 13 LEU A C    4  
ATOM   2508  O O    . LEU A 1 13 ? 6.587   -2.857  -3.103  1.00 0.00 ? 13 LEU A O    4  
ATOM   2509  C CB   . LEU A 1 13 ? 8.067   -1.570  -5.487  1.00 0.00 ? 13 LEU A CB   4  
ATOM   2510  C CG   . LEU A 1 13 ? 9.364   -2.082  -4.868  1.00 0.00 ? 13 LEU A CG   4  
ATOM   2511  C CD1  . LEU A 1 13 ? 10.055  -2.997  -5.870  1.00 0.00 ? 13 LEU A CD1  4  
ATOM   2512  C CD2  . LEU A 1 13 ? 10.276  -0.899  -4.539  1.00 0.00 ? 13 LEU A CD2  4  
ATOM   2513  H H    . LEU A 1 13 ? 8.531   0.738   -4.463  1.00 0.00 ? 13 LEU A H    4  
ATOM   2514  H HA   . LEU A 1 13 ? 6.171   -0.859  -4.796  1.00 0.00 ? 13 LEU A HA   4  
ATOM   2515  H HB2  . LEU A 1 13 ? 7.541   -2.394  -5.947  1.00 0.00 ? 13 LEU A HB2  4  
ATOM   2516  H HB3  . LEU A 1 13 ? 8.300   -0.831  -6.240  1.00 0.00 ? 13 LEU A HB3  4  
ATOM   2517  H HG   . LEU A 1 13 ? 9.147   -2.637  -3.968  1.00 0.00 ? 13 LEU A HG   4  
ATOM   2518  H HD11 . LEU A 1 13 ? 11.121  -2.963  -5.713  1.00 0.00 ? 13 LEU A HD11 4  
ATOM   2519  H HD12 . LEU A 1 13 ? 9.825   -2.666  -6.873  1.00 0.00 ? 13 LEU A HD12 4  
ATOM   2520  H HD13 . LEU A 1 13 ? 9.700   -4.007  -5.734  1.00 0.00 ? 13 LEU A HD13 4  
ATOM   2521  H HD21 . LEU A 1 13 ? 10.068  -0.084  -5.216  1.00 0.00 ? 13 LEU A HD21 4  
ATOM   2522  H HD22 . LEU A 1 13 ? 11.308  -1.200  -4.646  1.00 0.00 ? 13 LEU A HD22 4  
ATOM   2523  H HD23 . LEU A 1 13 ? 10.098  -0.579  -3.523  1.00 0.00 ? 13 LEU A HD23 4  
ATOM   2524  N N    . TYR A 1 14 ? 7.822   -1.332  -2.109  1.00 0.00 ? 14 TYR A N    4  
ATOM   2525  C CA   . TYR A 1 14 ? 7.848   -2.109  -0.841  1.00 0.00 ? 14 TYR A CA   4  
ATOM   2526  C C    . TYR A 1 14 ? 6.429   -2.177  -0.298  1.00 0.00 ? 14 TYR A C    4  
ATOM   2527  O O    . TYR A 1 14 ? 5.964   -3.207  0.148   1.00 0.00 ? 14 TYR A O    4  
ATOM   2528  C CB   . TYR A 1 14 ? 8.760   -1.413  0.172   1.00 0.00 ? 14 TYR A CB   4  
ATOM   2529  C CG   . TYR A 1 14 ? 9.874   -2.353  0.581   1.00 0.00 ? 14 TYR A CG   4  
ATOM   2530  C CD1  . TYR A 1 14 ? 10.783  -2.825  -0.378  1.00 0.00 ? 14 TYR A CD1  4  
ATOM   2531  C CD2  . TYR A 1 14 ? 10.000  -2.757  1.918   1.00 0.00 ? 14 TYR A CD2  4  
ATOM   2532  C CE1  . TYR A 1 14 ? 11.814  -3.695  0.000   1.00 0.00 ? 14 TYR A CE1  4  
ATOM   2533  C CE2  . TYR A 1 14 ? 11.031  -3.628  2.295   1.00 0.00 ? 14 TYR A CE2  4  
ATOM   2534  C CZ   . TYR A 1 14 ? 11.938  -4.097  1.336   1.00 0.00 ? 14 TYR A CZ   4  
ATOM   2535  O OH   . TYR A 1 14 ? 12.953  -4.954  1.707   1.00 0.00 ? 14 TYR A OH   4  
ATOM   2536  H H    . TYR A 1 14 ? 8.279   -0.469  -2.160  1.00 0.00 ? 14 TYR A H    4  
ATOM   2537  H HA   . TYR A 1 14 ? 8.207   -3.104  -1.034  1.00 0.00 ? 14 TYR A HA   4  
ATOM   2538  H HB2  . TYR A 1 14 ? 9.181   -0.523  -0.277  1.00 0.00 ? 14 TYR A HB2  4  
ATOM   2539  H HB3  . TYR A 1 14 ? 8.183   -1.134  1.043   1.00 0.00 ? 14 TYR A HB3  4  
ATOM   2540  H HD1  . TYR A 1 14 ? 10.691  -2.519  -1.409  1.00 0.00 ? 14 TYR A HD1  4  
ATOM   2541  H HD2  . TYR A 1 14 ? 9.302   -2.398  2.659   1.00 0.00 ? 14 TYR A HD2  4  
ATOM   2542  H HE1  . TYR A 1 14 ? 12.513  -4.057  -0.740  1.00 0.00 ? 14 TYR A HE1  4  
ATOM   2543  H HE2  . TYR A 1 14 ? 11.127  -3.937  3.326   1.00 0.00 ? 14 TYR A HE2  4  
ATOM   2544  H HH   . TYR A 1 14 ? 12.589  -5.602  2.313   1.00 0.00 ? 14 TYR A HH   4  
ATOM   2545  N N    . GLN A 1 15 ? 5.732   -1.085  -0.360  1.00 0.00 ? 15 GLN A N    4  
ATOM   2546  C CA   . GLN A 1 15 ? 4.330   -1.070  0.124   1.00 0.00 ? 15 GLN A CA   4  
ATOM   2547  C C    . GLN A 1 15 ? 3.456   -1.733  -0.936  1.00 0.00 ? 15 GLN A C    4  
ATOM   2548  O O    . GLN A 1 15 ? 2.384   -2.233  -0.658  1.00 0.00 ? 15 GLN A O    4  
ATOM   2549  C CB   . GLN A 1 15 ? 3.872   0.374   0.340   1.00 0.00 ? 15 GLN A CB   4  
ATOM   2550  C CG   . GLN A 1 15 ? 4.854   1.089   1.269   1.00 0.00 ? 15 GLN A CG   4  
ATOM   2551  C CD   . GLN A 1 15 ? 4.382   2.524   1.502   1.00 0.00 ? 15 GLN A CD   4  
ATOM   2552  O OE1  . GLN A 1 15 ? 4.351   3.322   0.586   1.00 0.00 ? 15 GLN A OE1  4  
ATOM   2553  N NE2  . GLN A 1 15 ? 4.010   2.890   2.697   1.00 0.00 ? 15 GLN A NE2  4  
ATOM   2554  H H    . GLN A 1 15 ? 6.130   -0.277  -0.741  1.00 0.00 ? 15 GLN A H    4  
ATOM   2555  H HA   . GLN A 1 15 ? 4.262   -1.619  1.050   1.00 0.00 ? 15 GLN A HA   4  
ATOM   2556  H HB2  . GLN A 1 15 ? 3.837   0.887   -0.612  1.00 0.00 ? 15 GLN A HB2  4  
ATOM   2557  H HB3  . GLN A 1 15 ? 2.889   0.377   0.787   1.00 0.00 ? 15 GLN A HB3  4  
ATOM   2558  H HG2  . GLN A 1 15 ? 4.902   0.566   2.213   1.00 0.00 ? 15 GLN A HG2  4  
ATOM   2559  H HG3  . GLN A 1 15 ? 5.834   1.103   0.814   1.00 0.00 ? 15 GLN A HG3  4  
ATOM   2560  H HE21 . GLN A 1 15 ? 4.034   2.246   3.436   1.00 0.00 ? 15 GLN A HE21 4  
ATOM   2561  H HE22 . GLN A 1 15 ? 3.705   3.808   2.857   1.00 0.00 ? 15 GLN A HE22 4  
ATOM   2562  N N    . LEU A 1 16 ? 3.924   -1.752  -2.155  1.00 0.00 ? 16 LEU A N    4  
ATOM   2563  C CA   . LEU A 1 16 ? 3.148   -2.391  -3.248  1.00 0.00 ? 16 LEU A CA   4  
ATOM   2564  C C    . LEU A 1 16 ? 2.986   -3.875  -2.932  1.00 0.00 ? 16 LEU A C    4  
ATOM   2565  O O    . LEU A 1 16 ? 2.083   -4.533  -3.410  1.00 0.00 ? 16 LEU A O    4  
ATOM   2566  C CB   . LEU A 1 16 ? 3.915   -2.224  -4.560  1.00 0.00 ? 16 LEU A CB   4  
ATOM   2567  C CG   . LEU A 1 16 ? 3.373   -1.012  -5.321  1.00 0.00 ? 16 LEU A CG   4  
ATOM   2568  C CD1  . LEU A 1 16 ? 4.105   -0.870  -6.657  1.00 0.00 ? 16 LEU A CD1  4  
ATOM   2569  C CD2  . LEU A 1 16 ? 1.879   -1.204  -5.586  1.00 0.00 ? 16 LEU A CD2  4  
ATOM   2570  H H    . LEU A 1 16 ? 4.796   -1.353  -2.350  1.00 0.00 ? 16 LEU A H    4  
ATOM   2571  H HA   . LEU A 1 16 ? 2.179   -1.927  -3.328  1.00 0.00 ? 16 LEU A HA   4  
ATOM   2572  H HB2  . LEU A 1 16 ? 4.959   -2.077  -4.342  1.00 0.00 ? 16 LEU A HB2  4  
ATOM   2573  H HB3  . LEU A 1 16 ? 3.799   -3.106  -5.162  1.00 0.00 ? 16 LEU A HB3  4  
ATOM   2574  H HG   . LEU A 1 16 ? 3.526   -0.119  -4.733  1.00 0.00 ? 16 LEU A HG   4  
ATOM   2575  H HD11 . LEU A 1 16 ? 5.166   -0.782  -6.478  1.00 0.00 ? 16 LEU A HD11 4  
ATOM   2576  H HD12 . LEU A 1 16 ? 3.750   0.012   -7.168  1.00 0.00 ? 16 LEU A HD12 4  
ATOM   2577  H HD13 . LEU A 1 16 ? 3.913   -1.741  -7.266  1.00 0.00 ? 16 LEU A HD13 4  
ATOM   2578  H HD21 . LEU A 1 16 ? 1.677   -2.250  -5.760  1.00 0.00 ? 16 LEU A HD21 4  
ATOM   2579  H HD22 . LEU A 1 16 ? 1.592   -0.632  -6.455  1.00 0.00 ? 16 LEU A HD22 4  
ATOM   2580  H HD23 . LEU A 1 16 ? 1.317   -0.866  -4.729  1.00 0.00 ? 16 LEU A HD23 4  
ATOM   2581  N N    . GLU A 1 17 ? 3.859   -4.402  -2.119  1.00 0.00 ? 17 GLU A N    4  
ATOM   2582  C CA   . GLU A 1 17 ? 3.766   -5.842  -1.755  1.00 0.00 ? 17 GLU A CA   4  
ATOM   2583  C C    . GLU A 1 17 ? 2.582   -6.048  -0.814  1.00 0.00 ? 17 GLU A C    4  
ATOM   2584  O O    . GLU A 1 17 ? 2.008   -7.117  -0.744  1.00 0.00 ? 17 GLU A O    4  
ATOM   2585  C CB   . GLU A 1 17 ? 5.056   -6.276  -1.058  1.00 0.00 ? 17 GLU A CB   4  
ATOM   2586  C CG   . GLU A 1 17 ? 5.942   -7.033  -2.048  1.00 0.00 ? 17 GLU A CG   4  
ATOM   2587  C CD   . GLU A 1 17 ? 5.731   -8.538  -1.873  1.00 0.00 ? 17 GLU A CD   4  
ATOM   2588  O OE1  . GLU A 1 17 ? 4.946   -8.911  -1.017  1.00 0.00 ? 17 GLU A OE1  4  
ATOM   2589  O OE2  . GLU A 1 17 ? 6.357   -9.292  -2.599  1.00 0.00 ? 17 GLU A OE2  4  
ATOM   2590  H H    . GLU A 1 17 ? 4.574   -3.846  -1.747  1.00 0.00 ? 17 GLU A H    4  
ATOM   2591  H HA   . GLU A 1 17 ? 3.622   -6.430  -2.647  1.00 0.00 ? 17 GLU A HA   4  
ATOM   2592  H HB2  . GLU A 1 17 ? 5.580   -5.403  -0.696  1.00 0.00 ? 17 GLU A HB2  4  
ATOM   2593  H HB3  . GLU A 1 17 ? 4.816   -6.921  -0.225  1.00 0.00 ? 17 GLU A HB3  4  
ATOM   2594  H HG2  . GLU A 1 17 ? 5.680   -6.747  -3.056  1.00 0.00 ? 17 GLU A HG2  4  
ATOM   2595  H HG3  . GLU A 1 17 ? 6.977   -6.793  -1.862  1.00 0.00 ? 17 GLU A HG3  4  
ATOM   2596  N N    . ASN A 1 18 ? 2.211   -5.030  -0.094  1.00 0.00 ? 18 ASN A N    4  
ATOM   2597  C CA   . ASN A 1 18 ? 1.062   -5.154  0.840   1.00 0.00 ? 18 ASN A CA   4  
ATOM   2598  C C    . ASN A 1 18 ? -0.238  -5.215  0.033   1.00 0.00 ? 18 ASN A C    4  
ATOM   2599  O O    . ASN A 1 18 ? -1.309  -5.406  0.575   1.00 0.00 ? 18 ASN A O    4  
ATOM   2600  C CB   . ASN A 1 18 ? 1.033   -3.940  1.770   1.00 0.00 ? 18 ASN A CB   4  
ATOM   2601  C CG   . ASN A 1 18 ? 1.655   -4.316  3.117   1.00 0.00 ? 18 ASN A CG   4  
ATOM   2602  O OD1  . ASN A 1 18 ? 2.405   -5.266  3.208   1.00 0.00 ? 18 ASN A OD1  4  
ATOM   2603  N ND2  . ASN A 1 18 ? 1.374   -3.604  4.175   1.00 0.00 ? 18 ASN A ND2  4  
ATOM   2604  H H    . ASN A 1 18 ? 2.687   -4.179  -0.174  1.00 0.00 ? 18 ASN A H    4  
ATOM   2605  H HA   . ASN A 1 18 ? 1.167   -6.055  1.425   1.00 0.00 ? 18 ASN A HA   4  
ATOM   2606  H HB2  . ASN A 1 18 ? 1.596   -3.132  1.325   1.00 0.00 ? 18 ASN A HB2  4  
ATOM   2607  H HB3  . ASN A 1 18 ? 0.013   -3.627  1.921   1.00 0.00 ? 18 ASN A HB3  4  
ATOM   2608  H HD21 . ASN A 1 18 ? 0.769   -2.836  4.103   1.00 0.00 ? 18 ASN A HD21 4  
ATOM   2609  H HD22 . ASN A 1 18 ? 1.768   -3.837  5.041   1.00 0.00 ? 18 ASN A HD22 4  
ATOM   2610  N N    . TYR A 1 19 ? -0.150  -5.058  -1.260  1.00 0.00 ? 19 TYR A N    4  
ATOM   2611  C CA   . TYR A 1 19 ? -1.371  -5.110  -2.106  1.00 0.00 ? 19 TYR A CA   4  
ATOM   2612  C C    . TYR A 1 19 ? -1.277  -6.312  -3.046  1.00 0.00 ? 19 TYR A C    4  
ATOM   2613  O O    . TYR A 1 19 ? -1.861  -6.329  -4.111  1.00 0.00 ? 19 TYR A O    4  
ATOM   2614  C CB   . TYR A 1 19 ? -1.472  -3.826  -2.930  1.00 0.00 ? 19 TYR A CB   4  
ATOM   2615  C CG   . TYR A 1 19 ? -1.712  -2.656  -2.009  1.00 0.00 ? 19 TYR A CG   4  
ATOM   2616  C CD1  . TYR A 1 19 ? -2.912  -2.563  -1.293  1.00 0.00 ? 19 TYR A CD1  4  
ATOM   2617  C CD2  . TYR A 1 19 ? -0.735  -1.660  -1.870  1.00 0.00 ? 19 TYR A CD2  4  
ATOM   2618  C CE1  . TYR A 1 19 ? -3.137  -1.476  -0.439  1.00 0.00 ? 19 TYR A CE1  4  
ATOM   2619  C CE2  . TYR A 1 19 ? -0.960  -0.573  -1.016  1.00 0.00 ? 19 TYR A CE2  4  
ATOM   2620  C CZ   . TYR A 1 19 ? -2.161  -0.481  -0.300  1.00 0.00 ? 19 TYR A CZ   4  
ATOM   2621  O OH   . TYR A 1 19 ? -2.383  0.591   0.541   1.00 0.00 ? 19 TYR A OH   4  
ATOM   2622  H H    . TYR A 1 19 ? 0.724   -4.908  -1.676  1.00 0.00 ? 19 TYR A H    4  
ATOM   2623  H HA   . TYR A 1 19 ? -2.244  -5.208  -1.480  1.00 0.00 ? 19 TYR A HA   4  
ATOM   2624  H HB2  . TYR A 1 19 ? -0.551  -3.675  -3.473  1.00 0.00 ? 19 TYR A HB2  4  
ATOM   2625  H HB3  . TYR A 1 19 ? -2.290  -3.910  -3.626  1.00 0.00 ? 19 TYR A HB3  4  
ATOM   2626  H HD1  . TYR A 1 19 ? -3.666  -3.331  -1.400  1.00 0.00 ? 19 TYR A HD1  4  
ATOM   2627  H HD2  . TYR A 1 19 ? 0.190   -1.732  -2.422  1.00 0.00 ? 19 TYR A HD2  4  
ATOM   2628  H HE1  . TYR A 1 19 ? -4.063  -1.405  0.113   1.00 0.00 ? 19 TYR A HE1  4  
ATOM   2629  H HE2  . TYR A 1 19 ? -0.207  0.194   -0.909  1.00 0.00 ? 19 TYR A HE2  4  
ATOM   2630  H HH   . TYR A 1 19 ? -3.321  0.616   0.748   1.00 0.00 ? 19 TYR A HH   4  
ATOM   2631  N N    . CYS A 1 20 ? -0.540  -7.316  -2.659  1.00 0.00 ? 20 CYS A N    4  
ATOM   2632  C CA   . CYS A 1 20 ? -0.402  -8.517  -3.529  1.00 0.00 ? 20 CYS A CA   4  
ATOM   2633  C C    . CYS A 1 20 ? -1.495  -9.530  -3.177  1.00 0.00 ? 20 CYS A C    4  
ATOM   2634  O O    . CYS A 1 20 ? -2.620  -9.419  -3.621  1.00 0.00 ? 20 CYS A O    4  
ATOM   2635  C CB   . CYS A 1 20 ? 0.978   -9.139  -3.312  1.00 0.00 ? 20 CYS A CB   4  
ATOM   2636  S SG   . CYS A 1 20 ? 2.183   -8.313  -4.379  1.00 0.00 ? 20 CYS A SG   4  
ATOM   2637  H H    . CYS A 1 20 ? -0.075  -7.279  -1.797  1.00 0.00 ? 20 CYS A H    4  
ATOM   2638  H HA   . CYS A 1 20 ? -0.505  -8.227  -4.560  1.00 0.00 ? 20 CYS A HA   4  
ATOM   2639  H HB2  . CYS A 1 20 ? 1.269   -9.020  -2.280  1.00 0.00 ? 20 CYS A HB2  4  
ATOM   2640  H HB3  . CYS A 1 20 ? 0.940   -10.190 -3.558  1.00 0.00 ? 20 CYS A HB3  4  
ATOM   2641  N N    . ASN A 1 21 ? -1.177  -10.517 -2.386  1.00 0.00 ? 21 ASN A N    4  
ATOM   2642  C CA   . ASN A 1 21 ? -2.202  -11.530 -2.013  1.00 0.00 ? 21 ASN A CA   4  
ATOM   2643  C C    . ASN A 1 21 ? -1.635  -12.456 -0.933  1.00 0.00 ? 21 ASN A C    4  
ATOM   2644  O O    . ASN A 1 21 ? -0.640  -12.089 -0.330  1.00 0.00 ? 21 ASN A O    4  
ATOM   2645  C CB   . ASN A 1 21 ? -2.576  -12.352 -3.246  1.00 0.00 ? 21 ASN A CB   4  
ATOM   2646  C CG   . ASN A 1 21 ? -3.881  -11.816 -3.836  1.00 0.00 ? 21 ASN A CG   4  
ATOM   2647  O OD1  . ASN A 1 21 ? -4.560  -11.021 -3.216  1.00 0.00 ? 21 ASN A OD1  4  
ATOM   2648  N ND2  . ASN A 1 21 ? -4.263  -12.218 -5.017  1.00 0.00 ? 21 ASN A ND2  4  
ATOM   2649  O OXT  . ASN A 1 21 ? -2.206  -13.515 -0.729  1.00 0.00 ? 21 ASN A OXT  4  
ATOM   2650  H H    . ASN A 1 21 ? -0.267  -10.593 -2.037  1.00 0.00 ? 21 ASN A H    4  
ATOM   2651  H HA   . ASN A 1 21 ? -3.080  -11.031 -1.632  1.00 0.00 ? 21 ASN A HA   4  
ATOM   2652  H HB2  . ASN A 1 21 ? -1.788  -12.275 -3.982  1.00 0.00 ? 21 ASN A HB2  4  
ATOM   2653  H HB3  . ASN A 1 21 ? -2.708  -13.384 -2.964  1.00 0.00 ? 21 ASN A HB3  4  
ATOM   2654  H HD21 . ASN A 1 21 ? -3.716  -12.858 -5.517  1.00 0.00 ? 21 ASN A HD21 4  
ATOM   2655  H HD22 . ASN A 1 21 ? -5.097  -11.880 -5.403  1.00 0.00 ? 21 ASN A HD22 4  
ATOM   2656  N N    . PHE B 2 1  ? 15.972  1.875   -4.965  1.00 0.00 ? 1  PHE B N    4  
ATOM   2657  C CA   . PHE B 2 1  ? 15.900  1.533   -6.416  1.00 0.00 ? 1  PHE B CA   4  
ATOM   2658  C C    . PHE B 2 1  ? 15.467  2.771   -7.208  1.00 0.00 ? 1  PHE B C    4  
ATOM   2659  O O    . PHE B 2 1  ? 16.290  3.530   -7.680  1.00 0.00 ? 1  PHE B O    4  
ATOM   2660  C CB   . PHE B 2 1  ? 14.895  0.389   -6.655  1.00 0.00 ? 1  PHE B CB   4  
ATOM   2661  C CG   . PHE B 2 1  ? 14.197  0.011   -5.361  1.00 0.00 ? 1  PHE B CG   4  
ATOM   2662  C CD1  . PHE B 2 1  ? 13.286  0.896   -4.765  1.00 0.00 ? 1  PHE B CD1  4  
ATOM   2663  C CD2  . PHE B 2 1  ? 14.467  -1.225  -4.755  1.00 0.00 ? 1  PHE B CD2  4  
ATOM   2664  C CE1  . PHE B 2 1  ? 12.646  0.545   -3.569  1.00 0.00 ? 1  PHE B CE1  4  
ATOM   2665  C CE2  . PHE B 2 1  ? 13.826  -1.574  -3.559  1.00 0.00 ? 1  PHE B CE2  4  
ATOM   2666  C CZ   . PHE B 2 1  ? 12.916  -0.691  -2.967  1.00 0.00 ? 1  PHE B CZ   4  
ATOM   2667  H H1   . PHE B 2 1  ? 16.086  1.003   -4.408  1.00 0.00 ? 1  PHE B H1   4  
ATOM   2668  H H2   . PHE B 2 1  ? 15.098  2.359   -4.678  1.00 0.00 ? 1  PHE B H2   4  
ATOM   2669  H H3   . PHE B 2 1  ? 16.786  2.499   -4.797  1.00 0.00 ? 1  PHE B H3   4  
ATOM   2670  H HA   . PHE B 2 1  ? 16.878  1.222   -6.755  1.00 0.00 ? 1  PHE B HA   4  
ATOM   2671  H HB2  . PHE B 2 1  ? 14.160  0.702   -7.383  1.00 0.00 ? 1  PHE B HB2  4  
ATOM   2672  H HB3  . PHE B 2 1  ? 15.425  -0.472  -7.039  1.00 0.00 ? 1  PHE B HB3  4  
ATOM   2673  H HD1  . PHE B 2 1  ? 13.076  1.849   -5.226  1.00 0.00 ? 1  PHE B HD1  4  
ATOM   2674  H HD2  . PHE B 2 1  ? 15.167  -1.908  -5.209  1.00 0.00 ? 1  PHE B HD2  4  
ATOM   2675  H HE1  . PHE B 2 1  ? 11.945  1.226   -3.112  1.00 0.00 ? 1  PHE B HE1  4  
ATOM   2676  H HE2  . PHE B 2 1  ? 14.035  -2.527  -3.095  1.00 0.00 ? 1  PHE B HE2  4  
ATOM   2677  H HZ   . PHE B 2 1  ? 12.423  -0.961  -2.045  1.00 0.00 ? 1  PHE B HZ   4  
ATOM   2678  N N    . VAL B 2 2  ? 14.187  2.986   -7.354  1.00 0.00 ? 2  VAL B N    4  
ATOM   2679  C CA   . VAL B 2 2  ? 13.708  4.178   -8.112  1.00 0.00 ? 2  VAL B CA   4  
ATOM   2680  C C    . VAL B 2 2  ? 12.396  4.674   -7.500  1.00 0.00 ? 2  VAL B C    4  
ATOM   2681  O O    . VAL B 2 2  ? 11.836  4.048   -6.621  1.00 0.00 ? 2  VAL B O    4  
ATOM   2682  C CB   . VAL B 2 2  ? 13.469  3.793   -9.575  1.00 0.00 ? 2  VAL B CB   4  
ATOM   2683  C CG1  . VAL B 2 2  ? 14.810  3.630   -10.296 1.00 0.00 ? 2  VAL B CG1  4  
ATOM   2684  C CG2  . VAL B 2 2  ? 12.697  2.474   -9.633  1.00 0.00 ? 2  VAL B CG2  4  
ATOM   2685  H H    . VAL B 2 2  ? 13.538  2.366   -6.961  1.00 0.00 ? 2  VAL B H    4  
ATOM   2686  H HA   . VAL B 2 2  ? 14.450  4.962   -8.060  1.00 0.00 ? 2  VAL B HA   4  
ATOM   2687  H HB   . VAL B 2 2  ? 12.894  4.570   -10.060 1.00 0.00 ? 2  VAL B HB   4  
ATOM   2688  H HG11 . VAL B 2 2  ? 15.614  3.884   -9.623  1.00 0.00 ? 2  VAL B HG11 4  
ATOM   2689  H HG12 . VAL B 2 2  ? 14.839  4.285   -11.154 1.00 0.00 ? 2  VAL B HG12 4  
ATOM   2690  H HG13 . VAL B 2 2  ? 14.921  2.606   -10.619 1.00 0.00 ? 2  VAL B HG13 4  
ATOM   2691  H HG21 . VAL B 2 2  ? 12.854  2.007   -10.594 1.00 0.00 ? 2  VAL B HG21 4  
ATOM   2692  H HG22 . VAL B 2 2  ? 11.643  2.666   -9.493  1.00 0.00 ? 2  VAL B HG22 4  
ATOM   2693  H HG23 . VAL B 2 2  ? 13.049  1.817   -8.852  1.00 0.00 ? 2  VAL B HG23 4  
ATOM   2694  N N    . ASN B 2 3  ? 11.898  5.792   -7.956  1.00 0.00 ? 3  ASN B N    4  
ATOM   2695  C CA   . ASN B 2 3  ? 10.627  6.323   -7.406  1.00 0.00 ? 3  ASN B CA   4  
ATOM   2696  C C    . ASN B 2 3  ? 9.790   6.868   -8.564  1.00 0.00 ? 3  ASN B C    4  
ATOM   2697  O O    . ASN B 2 3  ? 9.525   8.049   -8.651  1.00 0.00 ? 3  ASN B O    4  
ATOM   2698  C CB   . ASN B 2 3  ? 10.943  7.444   -6.414  1.00 0.00 ? 3  ASN B CB   4  
ATOM   2699  C CG   . ASN B 2 3  ? 10.898  6.896   -4.986  1.00 0.00 ? 3  ASN B CG   4  
ATOM   2700  O OD1  . ASN B 2 3  ? 9.908   6.325   -4.573  1.00 0.00 ? 3  ASN B OD1  4  
ATOM   2701  N ND2  . ASN B 2 3  ? 11.935  7.049   -4.209  1.00 0.00 ? 3  ASN B ND2  4  
ATOM   2702  H H    . ASN B 2 3  ? 12.358  6.286   -8.665  1.00 0.00 ? 3  ASN B H    4  
ATOM   2703  H HA   . ASN B 2 3  ? 10.086  5.532   -6.905  1.00 0.00 ? 3  ASN B HA   4  
ATOM   2704  H HB2  . ASN B 2 3  ? 11.930  7.834   -6.618  1.00 0.00 ? 3  ASN B HB2  4  
ATOM   2705  H HB3  . ASN B 2 3  ? 10.219  8.232   -6.517  1.00 0.00 ? 3  ASN B HB3  4  
ATOM   2706  H HD21 . ASN B 2 3  ? 12.733  7.510   -4.543  1.00 0.00 ? 3  ASN B HD21 4  
ATOM   2707  H HD22 . ASN B 2 3  ? 11.916  6.704   -3.293  1.00 0.00 ? 3  ASN B HD22 4  
ATOM   2708  N N    . GLN B 2 4  ? 9.386   6.015   -9.468  1.00 0.00 ? 4  GLN B N    4  
ATOM   2709  C CA   . GLN B 2 4  ? 8.582   6.480   -10.631 1.00 0.00 ? 4  GLN B CA   4  
ATOM   2710  C C    . GLN B 2 4  ? 7.121   6.654   -10.217 1.00 0.00 ? 4  GLN B C    4  
ATOM   2711  O O    . GLN B 2 4  ? 6.559   5.832   -9.523  1.00 0.00 ? 4  GLN B O    4  
ATOM   2712  C CB   . GLN B 2 4  ? 8.679   5.450   -11.757 1.00 0.00 ? 4  GLN B CB   4  
ATOM   2713  C CG   . GLN B 2 4  ? 9.694   5.928   -12.798 1.00 0.00 ? 4  GLN B CG   4  
ATOM   2714  C CD   . GLN B 2 4  ? 9.717   4.959   -13.981 1.00 0.00 ? 4  GLN B CD   4  
ATOM   2715  O OE1  . GLN B 2 4  ? 10.771  4.603   -14.468 1.00 0.00 ? 4  GLN B OE1  4  
ATOM   2716  N NE2  . GLN B 2 4  ? 8.591   4.513   -14.467 1.00 0.00 ? 4  GLN B NE2  4  
ATOM   2717  H H    . GLN B 2 4  ? 9.621   5.067   -9.386  1.00 0.00 ? 4  GLN B H    4  
ATOM   2718  H HA   . GLN B 2 4  ? 8.971   7.426   -10.978 1.00 0.00 ? 4  GLN B HA   4  
ATOM   2719  H HB2  . GLN B 2 4  ? 9.000   4.501   -11.350 1.00 0.00 ? 4  GLN B HB2  4  
ATOM   2720  H HB3  . GLN B 2 4  ? 7.713   5.334   -12.223 1.00 0.00 ? 4  GLN B HB3  4  
ATOM   2721  H HG2  . GLN B 2 4  ? 9.414   6.914   -13.144 1.00 0.00 ? 4  GLN B HG2  4  
ATOM   2722  H HG3  . GLN B 2 4  ? 10.674  5.970   -12.350 1.00 0.00 ? 4  GLN B HG3  4  
ATOM   2723  H HE21 . GLN B 2 4  ? 7.740   4.800   -14.075 1.00 0.00 ? 4  GLN B HE21 4  
ATOM   2724  H HE22 . GLN B 2 4  ? 8.597   3.892   -15.225 1.00 0.00 ? 4  GLN B HE22 4  
ATOM   2725  N N    . HIS B 2 5  ? 6.505   7.724   -10.637 1.00 0.00 ? 5  HIS B N    4  
ATOM   2726  C CA   . HIS B 2 5  ? 5.082   7.966   -10.271 1.00 0.00 ? 5  HIS B CA   4  
ATOM   2727  C C    . HIS B 2 5  ? 4.218   6.793   -10.744 1.00 0.00 ? 5  HIS B C    4  
ATOM   2728  O O    . HIS B 2 5  ? 4.422   6.247   -11.809 1.00 0.00 ? 5  HIS B O    4  
ATOM   2729  C CB   . HIS B 2 5  ? 4.605   9.256   -10.939 1.00 0.00 ? 5  HIS B CB   4  
ATOM   2730  C CG   . HIS B 2 5  ? 3.391   9.776   -10.222 1.00 0.00 ? 5  HIS B CG   4  
ATOM   2731  N ND1  . HIS B 2 5  ? 2.227   9.042   -10.157 1.00 0.00 ? 5  HIS B ND1  4  
ATOM   2732  C CD2  . HIS B 2 5  ? 3.177   10.947  -9.549  1.00 0.00 ? 5  HIS B CD2  4  
ATOM   2733  C CE1  . HIS B 2 5  ? 1.350   9.776   -9.456  1.00 0.00 ? 5  HIS B CE1  4  
ATOM   2734  N NE2  . HIS B 2 5  ? 1.887   10.949  -9.064  1.00 0.00 ? 5  HIS B NE2  4  
ATOM   2735  H H    . HIS B 2 5  ? 6.984   8.375   -11.193 1.00 0.00 ? 5  HIS B H    4  
ATOM   2736  H HA   . HIS B 2 5  ? 4.998   8.066   -9.201  1.00 0.00 ? 5  HIS B HA   4  
ATOM   2737  H HB2  . HIS B 2 5  ? 5.392   9.995   -10.897 1.00 0.00 ? 5  HIS B HB2  4  
ATOM   2738  H HB3  . HIS B 2 5  ? 4.356   9.056   -11.969 1.00 0.00 ? 5  HIS B HB3  4  
ATOM   2739  H HD2  . HIS B 2 5  ? 3.899   11.739  -9.419  1.00 0.00 ? 5  HIS B HD2  4  
ATOM   2740  H HE1  . HIS B 2 5  ? 0.341   9.466   -9.236  1.00 0.00 ? 5  HIS B HE1  4  
ATOM   2741  H HE2  . HIS B 2 5  ? 1.450   11.656  -8.543  1.00 0.00 ? 5  HIS B HE2  4  
ATOM   2742  N N    . LEU B 2 6  ? 3.249   6.405   -9.956  1.00 0.00 ? 6  LEU B N    4  
ATOM   2743  C CA   . LEU B 2 6  ? 2.366   5.271   -10.354 1.00 0.00 ? 6  LEU B CA   4  
ATOM   2744  C C    . LEU B 2 6  ? 0.927   5.774   -10.472 1.00 0.00 ? 6  LEU B C    4  
ATOM   2745  O O    . LEU B 2 6  ? 0.573   6.772   -9.891  1.00 0.00 ? 6  LEU B O    4  
ATOM   2746  C CB   . LEU B 2 6  ? 2.424   4.182   -9.279  1.00 0.00 ? 6  LEU B CB   4  
ATOM   2747  C CG   . LEU B 2 6  ? 3.531   3.184   -9.612  1.00 0.00 ? 6  LEU B CG   4  
ATOM   2748  C CD1  . LEU B 2 6  ? 3.275   2.584   -10.993 1.00 0.00 ? 6  LEU B CD1  4  
ATOM   2749  C CD2  . LEU B 2 6  ? 4.878   3.900   -9.613  1.00 0.00 ? 6  LEU B CD2  4  
ATOM   2750  H H    . LEU B 2 6  ? 3.101   6.862   -9.103  1.00 0.00 ? 6  LEU B H    4  
ATOM   2751  H HA   . LEU B 2 6  ? 2.691   4.868   -11.301 1.00 0.00 ? 6  LEU B HA   4  
ATOM   2752  H HB2  . LEU B 2 6  ? 2.626   4.637   -8.320  1.00 0.00 ? 6  LEU B HB2  4  
ATOM   2753  H HB3  . LEU B 2 6  ? 1.477   3.667   -9.239  1.00 0.00 ? 6  LEU B HB3  4  
ATOM   2754  H HG   . LEU B 2 6  ? 3.540   2.396   -8.873  1.00 0.00 ? 6  LEU B HG   4  
ATOM   2755  H HD11 . LEU B 2 6  ? 4.126   2.775   -11.631 1.00 0.00 ? 6  LEU B HD11 4  
ATOM   2756  H HD12 . LEU B 2 6  ? 2.395   3.037   -11.422 1.00 0.00 ? 6  LEU B HD12 4  
ATOM   2757  H HD13 . LEU B 2 6  ? 3.126   1.520   -10.900 1.00 0.00 ? 6  LEU B HD13 4  
ATOM   2758  H HD21 . LEU B 2 6  ? 4.867   4.690   -8.876  1.00 0.00 ? 6  LEU B HD21 4  
ATOM   2759  H HD22 . LEU B 2 6  ? 5.061   4.322   -10.590 1.00 0.00 ? 6  LEU B HD22 4  
ATOM   2760  H HD23 . LEU B 2 6  ? 5.660   3.195   -9.373  1.00 0.00 ? 6  LEU B HD23 4  
ATOM   2761  N N    . CYS B 2 7  ? 0.091   5.084   -11.204 1.00 0.00 ? 7  CYS B N    4  
ATOM   2762  C CA   . CYS B 2 7  ? -1.331  5.528   -11.333 1.00 0.00 ? 7  CYS B CA   4  
ATOM   2763  C C    . CYS B 2 7  ? -2.167  4.388   -11.948 1.00 0.00 ? 7  CYS B C    4  
ATOM   2764  O O    . CYS B 2 7  ? -2.429  3.395   -11.300 1.00 0.00 ? 7  CYS B O    4  
ATOM   2765  C CB   . CYS B 2 7  ? -1.409  6.786   -12.214 1.00 0.00 ? 7  CYS B CB   4  
ATOM   2766  S SG   . CYS B 2 7  ? -1.285  8.274   -11.190 1.00 0.00 ? 7  CYS B SG   4  
ATOM   2767  H H    . CYS B 2 7  ? 0.394   4.272   -11.657 1.00 0.00 ? 7  CYS B H    4  
ATOM   2768  H HA   . CYS B 2 7  ? -1.718  5.755   -10.349 1.00 0.00 ? 7  CYS B HA   4  
ATOM   2769  H HB2  . CYS B 2 7  ? -0.596  6.779   -12.918 1.00 0.00 ? 7  CYS B HB2  4  
ATOM   2770  H HB3  . CYS B 2 7  ? -2.348  6.799   -12.745 1.00 0.00 ? 7  CYS B HB3  4  
ATOM   2771  N N    . GLY B 2 8  ? -2.589  4.508   -13.185 1.00 0.00 ? 8  GLY B N    4  
ATOM   2772  C CA   . GLY B 2 8  ? -3.405  3.421   -13.802 1.00 0.00 ? 8  GLY B CA   4  
ATOM   2773  C C    . GLY B 2 8  ? -2.504  2.252   -14.201 1.00 0.00 ? 8  GLY B C    4  
ATOM   2774  O O    . GLY B 2 8  ? -1.834  1.665   -13.376 1.00 0.00 ? 8  GLY B O    4  
ATOM   2775  H H    . GLY B 2 8  ? -2.375  5.305   -13.707 1.00 0.00 ? 8  GLY B H    4  
ATOM   2776  H HA2  . GLY B 2 8  ? -4.144  3.079   -13.090 1.00 0.00 ? 8  GLY B HA2  4  
ATOM   2777  H HA3  . GLY B 2 8  ? -3.904  3.801   -14.680 1.00 0.00 ? 8  GLY B HA3  4  
ATOM   2778  N N    . SER B 2 9  ? -2.489  1.908   -15.463 1.00 0.00 ? 9  SER B N    4  
ATOM   2779  C CA   . SER B 2 9  ? -1.636  0.773   -15.921 1.00 0.00 ? 9  SER B CA   4  
ATOM   2780  C C    . SER B 2 9  ? -0.277  0.849   -15.228 1.00 0.00 ? 9  SER B C    4  
ATOM   2781  O O    . SER B 2 9  ? 0.371   -0.152  -14.992 1.00 0.00 ? 9  SER B O    4  
ATOM   2782  C CB   . SER B 2 9  ? -1.441  0.858   -17.436 1.00 0.00 ? 9  SER B CB   4  
ATOM   2783  O OG   . SER B 2 9  ? -2.335  -0.045  -18.074 1.00 0.00 ? 9  SER B OG   4  
ATOM   2784  H H    . SER B 2 9  ? -3.043  2.395   -16.110 1.00 0.00 ? 9  SER B H    4  
ATOM   2785  H HA   . SER B 2 9  ? -2.115  -0.162  -15.671 1.00 0.00 ? 9  SER B HA   4  
ATOM   2786  H HB2  . SER B 2 9  ? -1.648  1.859   -17.773 1.00 0.00 ? 9  SER B HB2  4  
ATOM   2787  H HB3  . SER B 2 9  ? -0.418  0.601   -17.681 1.00 0.00 ? 9  SER B HB3  4  
ATOM   2788  H HG   . SER B 2 9  ? -2.158  -0.023  -19.016 1.00 0.00 ? 9  SER B HG   4  
ATOM   2789  N N    . ASP B 2 10 ? 0.158   2.032   -14.895 1.00 0.00 ? 10 ASP B N    4  
ATOM   2790  C CA   . ASP B 2 10 ? 1.470   2.176   -14.212 1.00 0.00 ? 10 ASP B CA   4  
ATOM   2791  C C    . ASP B 2 10 ? 1.409   1.499   -12.843 1.00 0.00 ? 10 ASP B C    4  
ATOM   2792  O O    . ASP B 2 10 ? 2.195   0.622   -12.540 1.00 0.00 ? 10 ASP B O    4  
ATOM   2793  C CB   . ASP B 2 10 ? 1.789   3.661   -14.031 1.00 0.00 ? 10 ASP B CB   4  
ATOM   2794  C CG   . ASP B 2 10 ? 2.160   4.272   -15.382 1.00 0.00 ? 10 ASP B CG   4  
ATOM   2795  O OD1  . ASP B 2 10 ? 3.173   3.872   -15.933 1.00 0.00 ? 10 ASP B OD1  4  
ATOM   2796  O OD2  . ASP B 2 10 ? 1.426   5.130   -15.844 1.00 0.00 ? 10 ASP B OD2  4  
ATOM   2797  H H    . ASP B 2 10 ? -0.382  2.825   -15.092 1.00 0.00 ? 10 ASP B H    4  
ATOM   2798  H HA   . ASP B 2 10 ? 2.242   1.713   -14.807 1.00 0.00 ? 10 ASP B HA   4  
ATOM   2799  H HB2  . ASP B 2 10 ? 0.924   4.169   -13.630 1.00 0.00 ? 10 ASP B HB2  4  
ATOM   2800  H HB3  . ASP B 2 10 ? 2.619   3.772   -13.348 1.00 0.00 ? 10 ASP B HB3  4  
ATOM   2801  N N    . LEU B 2 11 ? 0.487   1.899   -12.008 1.00 0.00 ? 11 LEU B N    4  
ATOM   2802  C CA   . LEU B 2 11 ? 0.393   1.275   -10.659 1.00 0.00 ? 11 LEU B CA   4  
ATOM   2803  C C    . LEU B 2 11 ? -0.019  -0.188  -10.815 1.00 0.00 ? 11 LEU B C    4  
ATOM   2804  O O    . LEU B 2 11 ? 0.306   -1.029  -10.000 1.00 0.00 ? 11 LEU B O    4  
ATOM   2805  C CB   . LEU B 2 11 ? -0.658  2.023   -9.817  1.00 0.00 ? 11 LEU B CB   4  
ATOM   2806  C CG   . LEU B 2 11 ? -0.326  2.015   -8.302  1.00 0.00 ? 11 LEU B CG   4  
ATOM   2807  C CD1  . LEU B 2 11 ? -1.468  1.342   -7.541  1.00 0.00 ? 11 LEU B CD1  4  
ATOM   2808  C CD2  . LEU B 2 11 ? 0.975   1.259   -8.003  1.00 0.00 ? 11 LEU B CD2  4  
ATOM   2809  H H    . LEU B 2 11 ? -0.137  2.609   -12.267 1.00 0.00 ? 11 LEU B H    4  
ATOM   2810  H HA   . LEU B 2 11 ? 1.356   1.330   -10.182 1.00 0.00 ? 11 LEU B HA   4  
ATOM   2811  H HB2  . LEU B 2 11 ? -0.711  3.043   -10.157 1.00 0.00 ? 11 LEU B HB2  4  
ATOM   2812  H HB3  . LEU B 2 11 ? -1.621  1.558   -9.964  1.00 0.00 ? 11 LEU B HB3  4  
ATOM   2813  H HG   . LEU B 2 11 ? -0.232  3.036   -7.960  1.00 0.00 ? 11 LEU B HG   4  
ATOM   2814  H HD11 . LEU B 2 11 ? -2.380  1.897   -7.695  1.00 0.00 ? 11 LEU B HD11 4  
ATOM   2815  H HD12 . LEU B 2 11 ? -1.233  1.321   -6.487  1.00 0.00 ? 11 LEU B HD12 4  
ATOM   2816  H HD13 . LEU B 2 11 ? -1.596  0.333   -7.901  1.00 0.00 ? 11 LEU B HD13 4  
ATOM   2817  H HD21 . LEU B 2 11 ? 1.061   1.100   -6.939  1.00 0.00 ? 11 LEU B HD21 4  
ATOM   2818  H HD22 . LEU B 2 11 ? 1.817   1.843   -8.348  1.00 0.00 ? 11 LEU B HD22 4  
ATOM   2819  H HD23 . LEU B 2 11 ? 0.964   0.308   -8.512  1.00 0.00 ? 11 LEU B HD23 4  
ATOM   2820  N N    . VAL B 2 12 ? -0.726  -0.497  -11.865 1.00 0.00 ? 12 VAL B N    4  
ATOM   2821  C CA   . VAL B 2 12 ? -1.156  -1.902  -12.087 1.00 0.00 ? 12 VAL B CA   4  
ATOM   2822  C C    . VAL B 2 12 ? 0.029   -2.696  -12.641 1.00 0.00 ? 12 VAL B C    4  
ATOM   2823  O O    . VAL B 2 12 ? 0.404   -3.720  -12.107 1.00 0.00 ? 12 VAL B O    4  
ATOM   2824  C CB   . VAL B 2 12 ? -2.323  -1.911  -13.081 1.00 0.00 ? 12 VAL B CB   4  
ATOM   2825  C CG1  . VAL B 2 12 ? -2.430  -3.279  -13.763 1.00 0.00 ? 12 VAL B CG1  4  
ATOM   2826  C CG2  . VAL B 2 12 ? -3.624  -1.618  -12.330 1.00 0.00 ? 12 VAL B CG2  4  
ATOM   2827  H H    . VAL B 2 12 ? -0.969  0.196   -12.513 1.00 0.00 ? 12 VAL B H    4  
ATOM   2828  H HA   . VAL B 2 12 ? -1.472  -2.334  -11.149 1.00 0.00 ? 12 VAL B HA   4  
ATOM   2829  H HB   . VAL B 2 12 ? -2.160  -1.147  -13.828 1.00 0.00 ? 12 VAL B HB   4  
ATOM   2830  H HG11 . VAL B 2 12 ? -2.443  -4.056  -13.012 1.00 0.00 ? 12 VAL B HG11 4  
ATOM   2831  H HG12 . VAL B 2 12 ? -1.581  -3.423  -14.416 1.00 0.00 ? 12 VAL B HG12 4  
ATOM   2832  H HG13 . VAL B 2 12 ? -3.341  -3.323  -14.342 1.00 0.00 ? 12 VAL B HG13 4  
ATOM   2833  H HG21 . VAL B 2 12 ? -4.449  -2.089  -12.842 1.00 0.00 ? 12 VAL B HG21 4  
ATOM   2834  H HG22 . VAL B 2 12 ? -3.785  -0.550  -12.294 1.00 0.00 ? 12 VAL B HG22 4  
ATOM   2835  H HG23 . VAL B 2 12 ? -3.554  -2.005  -11.325 1.00 0.00 ? 12 VAL B HG23 4  
ATOM   2836  N N    . GLU B 2 13 ? 0.629   -2.228  -13.701 1.00 0.00 ? 13 GLU B N    4  
ATOM   2837  C CA   . GLU B 2 13 ? 1.793   -2.959  -14.270 1.00 0.00 ? 13 GLU B CA   4  
ATOM   2838  C C    . GLU B 2 13 ? 2.759   -3.300  -13.135 1.00 0.00 ? 13 GLU B C    4  
ATOM   2839  O O    . GLU B 2 13 ? 3.375   -4.347  -13.122 1.00 0.00 ? 13 GLU B O    4  
ATOM   2840  C CB   . GLU B 2 13 ? 2.500   -2.081  -15.305 1.00 0.00 ? 13 GLU B CB   4  
ATOM   2841  C CG   . GLU B 2 13 ? 1.802   -2.231  -16.659 1.00 0.00 ? 13 GLU B CG   4  
ATOM   2842  C CD   . GLU B 2 13 ? 2.843   -2.181  -17.779 1.00 0.00 ? 13 GLU B CD   4  
ATOM   2843  O OE1  . GLU B 2 13 ? 4.021   -2.233  -17.469 1.00 0.00 ? 13 GLU B OE1  4  
ATOM   2844  O OE2  . GLU B 2 13 ? 2.443   -2.092  -18.928 1.00 0.00 ? 13 GLU B OE2  4  
ATOM   2845  H H    . GLU B 2 13 ? 0.319   -1.396  -14.116 1.00 0.00 ? 13 GLU B H    4  
ATOM   2846  H HA   . GLU B 2 13 ? 1.453   -3.871  -14.739 1.00 0.00 ? 13 GLU B HA   4  
ATOM   2847  H HB2  . GLU B 2 13 ? 2.460   -1.049  -14.989 1.00 0.00 ? 13 GLU B HB2  4  
ATOM   2848  H HB3  . GLU B 2 13 ? 3.531   -2.392  -15.397 1.00 0.00 ? 13 GLU B HB3  4  
ATOM   2849  H HG2  . GLU B 2 13 ? 1.281   -3.176  -16.691 1.00 0.00 ? 13 GLU B HG2  4  
ATOM   2850  H HG3  . GLU B 2 13 ? 1.096   -1.425  -16.790 1.00 0.00 ? 13 GLU B HG3  4  
ATOM   2851  N N    . ALA B 2 14 ? 2.885   -2.425  -12.174 1.00 0.00 ? 14 ALA B N    4  
ATOM   2852  C CA   . ALA B 2 14 ? 3.800   -2.701  -11.033 1.00 0.00 ? 14 ALA B CA   4  
ATOM   2853  C C    . ALA B 2 14 ? 3.265   -3.901  -10.250 1.00 0.00 ? 14 ALA B C    4  
ATOM   2854  O O    . ALA B 2 14 ? 3.897   -4.936  -10.176 1.00 0.00 ? 14 ALA B O    4  
ATOM   2855  C CB   . ALA B 2 14 ? 3.863   -1.475  -10.118 1.00 0.00 ? 14 ALA B CB   4  
ATOM   2856  H H    . ALA B 2 14 ? 2.372   -1.591  -12.200 1.00 0.00 ? 14 ALA B H    4  
ATOM   2857  H HA   . ALA B 2 14 ? 4.788   -2.925  -11.408 1.00 0.00 ? 14 ALA B HA   4  
ATOM   2858  H HB1  . ALA B 2 14 ? 3.625   -0.589  -10.688 1.00 0.00 ? 14 ALA B HB1  4  
ATOM   2859  H HB2  . ALA B 2 14 ? 4.857   -1.383  -9.708  1.00 0.00 ? 14 ALA B HB2  4  
ATOM   2860  H HB3  . ALA B 2 14 ? 3.150   -1.588  -9.315  1.00 0.00 ? 14 ALA B HB3  4  
ATOM   2861  N N    . LEU B 2 15 ? 2.099   -3.774  -9.673  1.00 0.00 ? 15 LEU B N    4  
ATOM   2862  C CA   . LEU B 2 15 ? 1.520   -4.912  -8.907  1.00 0.00 ? 15 LEU B CA   4  
ATOM   2863  C C    . LEU B 2 15 ? 1.718   -6.204  -9.702  1.00 0.00 ? 15 LEU B C    4  
ATOM   2864  O O    . LEU B 2 15 ? 2.106   -7.224  -9.168  1.00 0.00 ? 15 LEU B O    4  
ATOM   2865  C CB   . LEU B 2 15 ? 0.025   -4.670  -8.691  1.00 0.00 ? 15 LEU B CB   4  
ATOM   2866  C CG   . LEU B 2 15 ? -0.169  -3.590  -7.627  1.00 0.00 ? 15 LEU B CG   4  
ATOM   2867  C CD1  . LEU B 2 15 ? -1.549  -2.949  -7.795  1.00 0.00 ? 15 LEU B CD1  4  
ATOM   2868  C CD2  . LEU B 2 15 ? -0.067  -4.223  -6.237  1.00 0.00 ? 15 LEU B CD2  4  
ATOM   2869  H H    . LEU B 2 15 ? 1.601   -2.932  -9.750  1.00 0.00 ? 15 LEU B H    4  
ATOM   2870  H HA   . LEU B 2 15 ? 2.016   -4.995  -7.951  1.00 0.00 ? 15 LEU B HA   4  
ATOM   2871  H HB2  . LEU B 2 15 ? -0.423  -4.346  -9.620  1.00 0.00 ? 15 LEU B HB2  4  
ATOM   2872  H HB3  . LEU B 2 15 ? -0.444  -5.585  -8.366  1.00 0.00 ? 15 LEU B HB3  4  
ATOM   2873  H HG   . LEU B 2 15 ? 0.594   -2.834  -7.738  1.00 0.00 ? 15 LEU B HG   4  
ATOM   2874  H HD11 . LEU B 2 15 ? -1.950  -3.208  -8.764  1.00 0.00 ? 15 LEU B HD11 4  
ATOM   2875  H HD12 . LEU B 2 15 ? -1.458  -1.876  -7.719  1.00 0.00 ? 15 LEU B HD12 4  
ATOM   2876  H HD13 . LEU B 2 15 ? -2.211  -3.312  -7.022  1.00 0.00 ? 15 LEU B HD13 4  
ATOM   2877  H HD21 . LEU B 2 15 ? -0.302  -5.275  -6.303  1.00 0.00 ? 15 LEU B HD21 4  
ATOM   2878  H HD22 . LEU B 2 15 ? -0.763  -3.739  -5.569  1.00 0.00 ? 15 LEU B HD22 4  
ATOM   2879  H HD23 . LEU B 2 15 ? 0.938   -4.102  -5.861  1.00 0.00 ? 15 LEU B HD23 4  
ATOM   2880  N N    . TYR B 2 16 ? 1.454   -6.162  -10.980 1.00 0.00 ? 16 TYR B N    4  
ATOM   2881  C CA   . TYR B 2 16 ? 1.627   -7.381  -11.821 1.00 0.00 ? 16 TYR B CA   4  
ATOM   2882  C C    . TYR B 2 16 ? 3.066   -7.886  -11.694 1.00 0.00 ? 16 TYR B C    4  
ATOM   2883  O O    . TYR B 2 16 ? 3.308   -9.005  -11.287 1.00 0.00 ? 16 TYR B O    4  
ATOM   2884  C CB   . TYR B 2 16 ? 1.339   -7.031  -13.284 1.00 0.00 ? 16 TYR B CB   4  
ATOM   2885  C CG   . TYR B 2 16 ? 0.133   -7.809  -13.765 1.00 0.00 ? 16 TYR B CG   4  
ATOM   2886  C CD1  . TYR B 2 16 ? 0.115   -9.210  -13.677 1.00 0.00 ? 16 TYR B CD1  4  
ATOM   2887  C CD2  . TYR B 2 16 ? -0.972  -7.130  -14.301 1.00 0.00 ? 16 TYR B CD2  4  
ATOM   2888  C CE1  . TYR B 2 16 ? -1.003  -9.927  -14.126 1.00 0.00 ? 16 TYR B CE1  4  
ATOM   2889  C CE2  . TYR B 2 16 ? -2.089  -7.848  -14.748 1.00 0.00 ? 16 TYR B CE2  4  
ATOM   2890  C CZ   . TYR B 2 16 ? -2.105  -9.245  -14.661 1.00 0.00 ? 16 TYR B CZ   4  
ATOM   2891  O OH   . TYR B 2 16 ? -3.206  -9.953  -15.103 1.00 0.00 ? 16 TYR B OH   4  
ATOM   2892  H H    . TYR B 2 16 ? 1.144   -5.327  -11.387 1.00 0.00 ? 16 TYR B H    4  
ATOM   2893  H HA   . TYR B 2 16 ? 0.944   -8.149  -11.492 1.00 0.00 ? 16 TYR B HA   4  
ATOM   2894  H HB2  . TYR B 2 16 ? 1.144   -5.971  -13.367 1.00 0.00 ? 16 TYR B HB2  4  
ATOM   2895  H HB3  . TYR B 2 16 ? 2.197   -7.285  -13.889 1.00 0.00 ? 16 TYR B HB3  4  
ATOM   2896  H HD1  . TYR B 2 16 ? 0.961   -9.736  -13.266 1.00 0.00 ? 16 TYR B HD1  4  
ATOM   2897  H HD2  . TYR B 2 16 ? -0.963  -6.053  -14.368 1.00 0.00 ? 16 TYR B HD2  4  
ATOM   2898  H HE1  . TYR B 2 16 ? -1.016  -11.004 -14.059 1.00 0.00 ? 16 TYR B HE1  4  
ATOM   2899  H HE2  . TYR B 2 16 ? -2.938  -7.323  -15.160 1.00 0.00 ? 16 TYR B HE2  4  
ATOM   2900  H HH   . TYR B 2 16 ? -3.375  -9.699  -16.014 1.00 0.00 ? 16 TYR B HH   4  
ATOM   2901  N N    . LEU B 2 17 ? 4.023   -7.069  -12.041 1.00 0.00 ? 17 LEU B N    4  
ATOM   2902  C CA   . LEU B 2 17 ? 5.446   -7.503  -11.942 1.00 0.00 ? 17 LEU B CA   4  
ATOM   2903  C C    . LEU B 2 17 ? 5.864   -7.554  -10.472 1.00 0.00 ? 17 LEU B C    4  
ATOM   2904  O O    . LEU B 2 17 ? 6.889   -8.108  -10.126 1.00 0.00 ? 17 LEU B O    4  
ATOM   2905  C CB   . LEU B 2 17 ? 6.335   -6.511  -12.696 1.00 0.00 ? 17 LEU B CB   4  
ATOM   2906  C CG   . LEU B 2 17 ? 6.935   -7.196  -13.924 1.00 0.00 ? 17 LEU B CG   4  
ATOM   2907  C CD1  . LEU B 2 17 ? 7.343   -6.138  -14.950 1.00 0.00 ? 17 LEU B CD1  4  
ATOM   2908  C CD2  . LEU B 2 17 ? 8.167   -8.000  -13.506 1.00 0.00 ? 17 LEU B CD2  4  
ATOM   2909  H H    . LEU B 2 17 ? 3.807   -6.171  -12.368 1.00 0.00 ? 17 LEU B H    4  
ATOM   2910  H HA   . LEU B 2 17 ? 5.553   -8.484  -12.380 1.00 0.00 ? 17 LEU B HA   4  
ATOM   2911  H HB2  . LEU B 2 17 ? 5.743   -5.664  -13.007 1.00 0.00 ? 17 LEU B HB2  4  
ATOM   2912  H HB3  . LEU B 2 17 ? 7.131   -6.176  -12.048 1.00 0.00 ? 17 LEU B HB3  4  
ATOM   2913  H HG   . LEU B 2 17 ? 6.202   -7.858  -14.362 1.00 0.00 ? 17 LEU B HG   4  
ATOM   2914  H HD11 . LEU B 2 17 ? 7.816   -6.618  -15.794 1.00 0.00 ? 17 LEU B HD11 4  
ATOM   2915  H HD12 . LEU B 2 17 ? 8.036   -5.446  -14.496 1.00 0.00 ? 17 LEU B HD12 4  
ATOM   2916  H HD13 . LEU B 2 17 ? 6.466   -5.603  -15.283 1.00 0.00 ? 17 LEU B HD13 4  
ATOM   2917  H HD21 . LEU B 2 17 ? 8.916   -7.331  -13.110 1.00 0.00 ? 17 LEU B HD21 4  
ATOM   2918  H HD22 . LEU B 2 17 ? 8.567   -8.520  -14.365 1.00 0.00 ? 17 LEU B HD22 4  
ATOM   2919  H HD23 . LEU B 2 17 ? 7.889   -8.719  -12.750 1.00 0.00 ? 17 LEU B HD23 4  
ATOM   2920  N N    . VAL B 2 18 ? 5.077   -6.983  -9.602  1.00 0.00 ? 18 VAL B N    4  
ATOM   2921  C CA   . VAL B 2 18 ? 5.428   -7.002  -8.154  1.00 0.00 ? 18 VAL B CA   4  
ATOM   2922  C C    . VAL B 2 18 ? 5.108   -8.381  -7.576  1.00 0.00 ? 18 VAL B C    4  
ATOM   2923  O O    . VAL B 2 18 ? 5.980   -9.088  -7.110  1.00 0.00 ? 18 VAL B O    4  
ATOM   2924  C CB   . VAL B 2 18 ? 4.610   -5.941  -7.420  1.00 0.00 ? 18 VAL B CB   4  
ATOM   2925  C CG1  . VAL B 2 18 ? 4.839   -6.069  -5.913  1.00 0.00 ? 18 VAL B CG1  4  
ATOM   2926  C CG2  . VAL B 2 18 ? 5.049   -4.550  -7.885  1.00 0.00 ? 18 VAL B CG2  4  
ATOM   2927  H H    . VAL B 2 18 ? 4.255   -6.543  -9.901  1.00 0.00 ? 18 VAL B H    4  
ATOM   2928  H HA   . VAL B 2 18 ? 6.481   -6.794  -8.035  1.00 0.00 ? 18 VAL B HA   4  
ATOM   2929  H HB   . VAL B 2 18 ? 3.562   -6.080  -7.637  1.00 0.00 ? 18 VAL B HB   4  
ATOM   2930  H HG11 . VAL B 2 18 ? 5.888   -5.924  -5.695  1.00 0.00 ? 18 VAL B HG11 4  
ATOM   2931  H HG12 . VAL B 2 18 ? 4.537   -7.053  -5.587  1.00 0.00 ? 18 VAL B HG12 4  
ATOM   2932  H HG13 . VAL B 2 18 ? 4.257   -5.322  -5.396  1.00 0.00 ? 18 VAL B HG13 4  
ATOM   2933  H HG21 . VAL B 2 18 ? 5.688   -4.107  -7.137  1.00 0.00 ? 18 VAL B HG21 4  
ATOM   2934  H HG22 . VAL B 2 18 ? 4.178   -3.929  -8.031  1.00 0.00 ? 18 VAL B HG22 4  
ATOM   2935  H HG23 . VAL B 2 18 ? 5.590   -4.638  -8.815  1.00 0.00 ? 18 VAL B HG23 4  
ATOM   2936  N N    . CYS B 2 19 ? 3.862   -8.769  -7.606  1.00 0.00 ? 19 CYS B N    4  
ATOM   2937  C CA   . CYS B 2 19 ? 3.483   -10.105 -7.061  1.00 0.00 ? 19 CYS B CA   4  
ATOM   2938  C C    . CYS B 2 19 ? 3.837   -11.183 -8.090  1.00 0.00 ? 19 CYS B C    4  
ATOM   2939  O O    . CYS B 2 19 ? 4.713   -11.996 -7.874  1.00 0.00 ? 19 CYS B O    4  
ATOM   2940  C CB   . CYS B 2 19 ? 1.977   -10.144 -6.779  1.00 0.00 ? 19 CYS B CB   4  
ATOM   2941  S SG   . CYS B 2 19 ? 1.412   -8.511  -6.236  1.00 0.00 ? 19 CYS B SG   4  
ATOM   2942  H H    . CYS B 2 19 ? 3.177   -8.184  -7.990  1.00 0.00 ? 19 CYS B H    4  
ATOM   2943  H HA   . CYS B 2 19 ? 4.028   -10.288 -6.146  1.00 0.00 ? 19 CYS B HA   4  
ATOM   2944  H HB2  . CYS B 2 19 ? 1.448   -10.425 -7.676  1.00 0.00 ? 19 CYS B HB2  4  
ATOM   2945  H HB3  . CYS B 2 19 ? 1.776   -10.869 -6.002  1.00 0.00 ? 19 CYS B HB3  4  
ATOM   2946  N N    . GLY B 2 20 ? 3.167   -11.189 -9.210  1.00 0.00 ? 20 GLY B N    4  
ATOM   2947  C CA   . GLY B 2 20 ? 3.471   -12.206 -10.257 1.00 0.00 ? 20 GLY B CA   4  
ATOM   2948  C C    . GLY B 2 20 ? 2.855   -13.554 -9.874  1.00 0.00 ? 20 GLY B C    4  
ATOM   2949  O O    . GLY B 2 20 ? 2.032   -14.094 -10.586 1.00 0.00 ? 20 GLY B O    4  
ATOM   2950  H H    . GLY B 2 20 ? 2.469   -10.519 -9.368  1.00 0.00 ? 20 GLY B H    4  
ATOM   2951  H HA2  . GLY B 2 20 ? 3.060   -11.880 -11.202 1.00 0.00 ? 20 GLY B HA2  4  
ATOM   2952  H HA3  . GLY B 2 20 ? 4.540   -12.317 -10.350 1.00 0.00 ? 20 GLY B HA3  4  
ATOM   2953  N N    . GLU B 2 21 ? 3.252   -14.108 -8.761  1.00 0.00 ? 21 GLU B N    4  
ATOM   2954  C CA   . GLU B 2 21 ? 2.695   -15.427 -8.345  1.00 0.00 ? 21 GLU B CA   4  
ATOM   2955  C C    . GLU B 2 21 ? 1.436   -15.217 -7.500  1.00 0.00 ? 21 GLU B C    4  
ATOM   2956  O O    . GLU B 2 21 ? 0.328   -15.377 -7.972  1.00 0.00 ? 21 GLU B O    4  
ATOM   2957  C CB   . GLU B 2 21 ? 3.740   -16.185 -7.523  1.00 0.00 ? 21 GLU B CB   4  
ATOM   2958  C CG   . GLU B 2 21 ? 4.997   -16.397 -8.369  1.00 0.00 ? 21 GLU B CG   4  
ATOM   2959  C CD   . GLU B 2 21 ? 6.235   -16.325 -7.472  1.00 0.00 ? 21 GLU B CD   4  
ATOM   2960  O OE1  . GLU B 2 21 ? 6.238   -15.510 -6.564  1.00 0.00 ? 21 GLU B OE1  4  
ATOM   2961  O OE2  . GLU B 2 21 ? 7.159   -17.086 -7.709  1.00 0.00 ? 21 GLU B OE2  4  
ATOM   2962  H H    . GLU B 2 21 ? 3.923   -13.661 -8.202  1.00 0.00 ? 21 GLU B H    4  
ATOM   2963  H HA   . GLU B 2 21 ? 2.443   -16.003 -9.224  1.00 0.00 ? 21 GLU B HA   4  
ATOM   2964  H HB2  . GLU B 2 21 ? 3.989   -15.612 -6.642  1.00 0.00 ? 21 GLU B HB2  4  
ATOM   2965  H HB3  . GLU B 2 21 ? 3.341   -17.144 -7.228  1.00 0.00 ? 21 GLU B HB3  4  
ATOM   2966  H HG2  . GLU B 2 21 ? 4.951   -17.367 -8.843  1.00 0.00 ? 21 GLU B HG2  4  
ATOM   2967  H HG3  . GLU B 2 21 ? 5.057   -15.628 -9.124  1.00 0.00 ? 21 GLU B HG3  4  
ATOM   2968  N N    . ARG B 2 22 ? 1.598   -14.867 -6.254  1.00 0.00 ? 22 ARG B N    4  
ATOM   2969  C CA   . ARG B 2 22 ? 0.413   -14.652 -5.373  1.00 0.00 ? 22 ARG B CA   4  
ATOM   2970  C C    . ARG B 2 22 ? -0.672  -13.887 -6.136  1.00 0.00 ? 22 ARG B C    4  
ATOM   2971  O O    . ARG B 2 22 ? -1.850  -14.061 -5.895  1.00 0.00 ? 22 ARG B O    4  
ATOM   2972  C CB   . ARG B 2 22 ? 0.834   -13.847 -4.143  1.00 0.00 ? 22 ARG B CB   4  
ATOM   2973  C CG   . ARG B 2 22 ? 1.927   -14.605 -3.390  1.00 0.00 ? 22 ARG B CG   4  
ATOM   2974  C CD   . ARG B 2 22 ? 3.116   -13.676 -3.148  1.00 0.00 ? 22 ARG B CD   4  
ATOM   2975  N NE   . ARG B 2 22 ? 3.553   -13.788 -1.729  1.00 0.00 ? 22 ARG B NE   4  
ATOM   2976  C CZ   . ARG B 2 22 ? 3.825   -12.711 -1.046  1.00 0.00 ? 22 ARG B CZ   4  
ATOM   2977  N NH1  . ARG B 2 22 ? 4.973   -12.111 -1.202  1.00 0.00 ? 22 ARG B NH1  4  
ATOM   2978  N NH2  . ARG B 2 22 ? 2.947   -12.232 -0.207  1.00 0.00 ? 22 ARG B NH2  4  
ATOM   2979  H H    . ARG B 2 22 ? 2.502   -14.748 -5.893  1.00 0.00 ? 22 ARG B H    4  
ATOM   2980  H HA   . ARG B 2 22 ? 0.023   -15.609 -5.058  1.00 0.00 ? 22 ARG B HA   4  
ATOM   2981  H HB2  . ARG B 2 22 ? 1.212   -12.884 -4.457  1.00 0.00 ? 22 ARG B HB2  4  
ATOM   2982  H HB3  . ARG B 2 22 ? -0.017  -13.708 -3.495  1.00 0.00 ? 22 ARG B HB3  4  
ATOM   2983  H HG2  . ARG B 2 22 ? 1.539   -14.950 -2.442  1.00 0.00 ? 22 ARG B HG2  4  
ATOM   2984  H HG3  . ARG B 2 22 ? 2.250   -15.453 -3.977  1.00 0.00 ? 22 ARG B HG3  4  
ATOM   2985  H HD2  . ARG B 2 22 ? 3.931   -13.954 -3.800  1.00 0.00 ? 22 ARG B HD2  4  
ATOM   2986  H HD3  . ARG B 2 22 ? 2.823   -12.657 -3.355  1.00 0.00 ? 22 ARG B HD3  4  
ATOM   2987  H HE   . ARG B 2 22 ? 3.638   -14.669 -1.310  1.00 0.00 ? 22 ARG B HE   4  
ATOM   2988  H HH11 . ARG B 2 22 ? 5.644   -12.478 -1.846  1.00 0.00 ? 22 ARG B HH11 4  
ATOM   2989  H HH12 . ARG B 2 22 ? 5.182   -11.286 -0.678  1.00 0.00 ? 22 ARG B HH12 4  
ATOM   2990  H HH21 . ARG B 2 22 ? 2.067   -12.691 -0.089  1.00 0.00 ? 22 ARG B HH21 4  
ATOM   2991  H HH22 . ARG B 2 22 ? 3.155   -11.406 0.317   1.00 0.00 ? 22 ARG B HH22 4  
ATOM   2992  N N    . GLY B 2 23 ? -0.287  -13.043 -7.052  1.00 0.00 ? 23 GLY B N    4  
ATOM   2993  C CA   . GLY B 2 23 ? -1.302  -12.272 -7.824  1.00 0.00 ? 23 GLY B CA   4  
ATOM   2994  C C    . GLY B 2 23 ? -1.585  -10.944 -7.121  1.00 0.00 ? 23 GLY B C    4  
ATOM   2995  O O    . GLY B 2 23 ? -0.785  -10.453 -6.349  1.00 0.00 ? 23 GLY B O    4  
ATOM   2996  H H    . GLY B 2 23 ? 0.667   -12.916 -7.233  1.00 0.00 ? 23 GLY B H    4  
ATOM   2997  H HA2  . GLY B 2 23 ? -0.927  -12.081 -8.820  1.00 0.00 ? 23 GLY B HA2  4  
ATOM   2998  H HA3  . GLY B 2 23 ? -2.216  -12.843 -7.887  1.00 0.00 ? 23 GLY B HA3  4  
ATOM   2999  N N    . PHE B 2 24 ? -2.725  -10.362 -7.379  1.00 0.00 ? 24 PHE B N    4  
ATOM   3000  C CA   . PHE B 2 24 ? -3.073  -9.064  -6.726  1.00 0.00 ? 24 PHE B CA   4  
ATOM   3001  C C    . PHE B 2 24 ? -4.418  -8.567  -7.271  1.00 0.00 ? 24 PHE B C    4  
ATOM   3002  O O    . PHE B 2 24 ? -4.907  -9.049  -8.274  1.00 0.00 ? 24 PHE B O    4  
ATOM   3003  C CB   . PHE B 2 24 ? -1.955  -8.029  -6.992  1.00 0.00 ? 24 PHE B CB   4  
ATOM   3004  C CG   . PHE B 2 24 ? -2.301  -7.140  -8.182  1.00 0.00 ? 24 PHE B CG   4  
ATOM   3005  C CD1  . PHE B 2 24 ? -3.219  -6.083  -8.032  1.00 0.00 ? 24 PHE B CD1  4  
ATOM   3006  C CD2  . PHE B 2 24 ? -1.712  -7.373  -9.435  1.00 0.00 ? 24 PHE B CD2  4  
ATOM   3007  C CE1  . PHE B 2 24 ? -3.542  -5.273  -9.128  1.00 0.00 ? 24 PHE B CE1  4  
ATOM   3008  C CE2  . PHE B 2 24 ? -2.037  -6.558  -10.528 1.00 0.00 ? 24 PHE B CE2  4  
ATOM   3009  C CZ   . PHE B 2 24 ? -2.952  -5.510  -10.374 1.00 0.00 ? 24 PHE B CZ   4  
ATOM   3010  H H    . PHE B 2 24 ? -3.357  -10.785 -8.000  1.00 0.00 ? 24 PHE B H    4  
ATOM   3011  H HA   . PHE B 2 24 ? -3.163  -9.221  -5.660  1.00 0.00 ? 24 PHE B HA   4  
ATOM   3012  H HB2  . PHE B 2 24 ? -1.834  -7.410  -6.114  1.00 0.00 ? 24 PHE B HB2  4  
ATOM   3013  H HB3  . PHE B 2 24 ? -1.024  -8.553  -7.185  1.00 0.00 ? 24 PHE B HB3  4  
ATOM   3014  H HD1  . PHE B 2 24 ? -3.677  -5.892  -7.074  1.00 0.00 ? 24 PHE B HD1  4  
ATOM   3015  H HD2  . PHE B 2 24 ? -1.007  -8.174  -9.560  1.00 0.00 ? 24 PHE B HD2  4  
ATOM   3016  H HE1  . PHE B 2 24 ? -4.246  -4.463  -9.009  1.00 0.00 ? 24 PHE B HE1  4  
ATOM   3017  H HE2  . PHE B 2 24 ? -1.582  -6.740  -11.490 1.00 0.00 ? 24 PHE B HE2  4  
ATOM   3018  H HZ   . PHE B 2 24 ? -3.201  -4.883  -11.217 1.00 0.00 ? 24 PHE B HZ   4  
ATOM   3019  N N    . PHE B 2 25 ? -5.017  -7.607  -6.620  1.00 0.00 ? 25 PHE B N    4  
ATOM   3020  C CA   . PHE B 2 25 ? -6.325  -7.087  -7.107  1.00 0.00 ? 25 PHE B CA   4  
ATOM   3021  C C    . PHE B 2 25 ? -6.367  -5.566  -6.937  1.00 0.00 ? 25 PHE B C    4  
ATOM   3022  O O    . PHE B 2 25 ? -6.237  -5.050  -5.846  1.00 0.00 ? 25 PHE B O    4  
ATOM   3023  C CB   . PHE B 2 25 ? -7.459  -7.724  -6.301  1.00 0.00 ? 25 PHE B CB   4  
ATOM   3024  C CG   . PHE B 2 25 ? -7.485  -7.140  -4.907  1.00 0.00 ? 25 PHE B CG   4  
ATOM   3025  C CD1  . PHE B 2 25 ? -6.491  -7.489  -3.981  1.00 0.00 ? 25 PHE B CD1  4  
ATOM   3026  C CD2  . PHE B 2 25 ? -8.501  -6.248  -4.540  1.00 0.00 ? 25 PHE B CD2  4  
ATOM   3027  C CE1  . PHE B 2 25 ? -6.515  -6.946  -2.690  1.00 0.00 ? 25 PHE B CE1  4  
ATOM   3028  C CE2  . PHE B 2 25 ? -8.525  -5.706  -3.248  1.00 0.00 ? 25 PHE B CE2  4  
ATOM   3029  C CZ   . PHE B 2 25 ? -7.533  -6.055  -2.323  1.00 0.00 ? 25 PHE B CZ   4  
ATOM   3030  H H    . PHE B 2 25 ? -4.608  -7.230  -5.814  1.00 0.00 ? 25 PHE B H    4  
ATOM   3031  H HA   . PHE B 2 25 ? -6.444  -7.335  -8.152  1.00 0.00 ? 25 PHE B HA   4  
ATOM   3032  H HB2  . PHE B 2 25 ? -8.403  -7.528  -6.789  1.00 0.00 ? 25 PHE B HB2  4  
ATOM   3033  H HB3  . PHE B 2 25 ? -7.302  -8.791  -6.239  1.00 0.00 ? 25 PHE B HB3  4  
ATOM   3034  H HD1  . PHE B 2 25 ? -5.707  -8.176  -4.265  1.00 0.00 ? 25 PHE B HD1  4  
ATOM   3035  H HD2  . PHE B 2 25 ? -9.266  -5.979  -5.253  1.00 0.00 ? 25 PHE B HD2  4  
ATOM   3036  H HE1  . PHE B 2 25 ? -5.750  -7.215  -1.976  1.00 0.00 ? 25 PHE B HE1  4  
ATOM   3037  H HE2  . PHE B 2 25 ? -9.309  -5.018  -2.965  1.00 0.00 ? 25 PHE B HE2  4  
ATOM   3038  H HZ   . PHE B 2 25 ? -7.551  -5.637  -1.328  1.00 0.00 ? 25 PHE B HZ   4  
ATOM   3039  N N    . TYR B 2 26 ? -6.551  -4.845  -8.009  1.00 0.00 ? 26 TYR B N    4  
ATOM   3040  C CA   . TYR B 2 26 ? -6.604  -3.361  -7.907  1.00 0.00 ? 26 TYR B CA   4  
ATOM   3041  C C    . TYR B 2 26 ? -7.689  -2.960  -6.905  1.00 0.00 ? 26 TYR B C    4  
ATOM   3042  O O    . TYR B 2 26 ? -8.742  -3.561  -6.844  1.00 0.00 ? 26 TYR B O    4  
ATOM   3043  C CB   . TYR B 2 26 ? -6.934  -2.768  -9.278  1.00 0.00 ? 26 TYR B CB   4  
ATOM   3044  C CG   . TYR B 2 26 ? -6.097  -1.533  -9.511  1.00 0.00 ? 26 TYR B CG   4  
ATOM   3045  C CD1  . TYR B 2 26 ? -4.716  -1.568  -9.274  1.00 0.00 ? 26 TYR B CD1  4  
ATOM   3046  C CD2  . TYR B 2 26 ? -6.702  -0.353  -9.960  1.00 0.00 ? 26 TYR B CD2  4  
ATOM   3047  C CE1  . TYR B 2 26 ? -3.940  -0.421  -9.489  1.00 0.00 ? 26 TYR B CE1  4  
ATOM   3048  C CE2  . TYR B 2 26 ? -5.926  0.794   -10.176 1.00 0.00 ? 26 TYR B CE2  4  
ATOM   3049  C CZ   . TYR B 2 26 ? -4.545  0.759   -9.940  1.00 0.00 ? 26 TYR B CZ   4  
ATOM   3050  O OH   . TYR B 2 26 ? -3.780  1.887   -10.152 1.00 0.00 ? 26 TYR B OH   4  
ATOM   3051  H H    . TYR B 2 26 ? -6.656  -5.281  -8.881  1.00 0.00 ? 26 TYR B H    4  
ATOM   3052  H HA   . TYR B 2 26 ? -5.647  -2.987  -7.573  1.00 0.00 ? 26 TYR B HA   4  
ATOM   3053  H HB2  . TYR B 2 26 ? -6.721  -3.497  -10.046 1.00 0.00 ? 26 TYR B HB2  4  
ATOM   3054  H HB3  . TYR B 2 26 ? -7.981  -2.503  -9.313  1.00 0.00 ? 26 TYR B HB3  4  
ATOM   3055  H HD1  . TYR B 2 26 ? -4.251  -2.479  -8.927  1.00 0.00 ? 26 TYR B HD1  4  
ATOM   3056  H HD2  . TYR B 2 26 ? -7.766  -0.326  -10.142 1.00 0.00 ? 26 TYR B HD2  4  
ATOM   3057  H HE1  . TYR B 2 26 ? -2.876  -0.448  -9.308  1.00 0.00 ? 26 TYR B HE1  4  
ATOM   3058  H HE2  . TYR B 2 26 ? -6.392  1.704   -10.522 1.00 0.00 ? 26 TYR B HE2  4  
ATOM   3059  H HH   . TYR B 2 26 ? -3.999  2.528   -9.471  1.00 0.00 ? 26 TYR B HH   4  
ATOM   3060  N N    . THR B 2 27 ? -7.441  -1.948  -6.119  1.00 0.00 ? 27 THR B N    4  
ATOM   3061  C CA   . THR B 2 27 ? -8.461  -1.511  -5.126  1.00 0.00 ? 27 THR B CA   4  
ATOM   3062  C C    . THR B 2 27 ? -9.299  -0.380  -5.725  1.00 0.00 ? 27 THR B C    4  
ATOM   3063  O O    . THR B 2 27 ? -8.908  0.249   -6.689  1.00 0.00 ? 27 THR B O    4  
ATOM   3064  C CB   . THR B 2 27 ? -7.762  -1.013  -3.858  1.00 0.00 ? 27 THR B CB   4  
ATOM   3065  O OG1  . THR B 2 27 ? -6.589  -0.297  -4.216  1.00 0.00 ? 27 THR B OG1  4  
ATOM   3066  C CG2  . THR B 2 27 ? -7.386  -2.205  -2.976  1.00 0.00 ? 27 THR B CG2  4  
ATOM   3067  H H    . THR B 2 27 ? -6.585  -1.475  -6.184  1.00 0.00 ? 27 THR B H    4  
ATOM   3068  H HA   . THR B 2 27 ? -9.104  -2.343  -4.879  1.00 0.00 ? 27 THR B HA   4  
ATOM   3069  H HB   . THR B 2 27 ? -8.427  -0.363  -3.311  1.00 0.00 ? 27 THR B HB   4  
ATOM   3070  H HG1  . THR B 2 27 ? -6.606  0.549   -3.762  1.00 0.00 ? 27 THR B HG1  4  
ATOM   3071  H HG21 . THR B 2 27 ? -6.510  -1.960  -2.394  1.00 0.00 ? 27 THR B HG21 4  
ATOM   3072  H HG22 . THR B 2 27 ? -7.175  -3.062  -3.600  1.00 0.00 ? 27 THR B HG22 4  
ATOM   3073  H HG23 . THR B 2 27 ? -8.206  -2.435  -2.313  1.00 0.00 ? 27 THR B HG23 4  
ATOM   3074  N N    . LYS B 2 28 ? -10.447 -0.115  -5.165  1.00 0.00 ? 28 LYS B N    4  
ATOM   3075  C CA   . LYS B 2 28 ? -11.307 0.975   -5.706  1.00 0.00 ? 28 LYS B CA   4  
ATOM   3076  C C    . LYS B 2 28 ? -12.351 1.371   -4.657  1.00 0.00 ? 28 LYS B C    4  
ATOM   3077  O O    . LYS B 2 28 ? -13.526 1.123   -4.831  1.00 0.00 ? 28 LYS B O    4  
ATOM   3078  C CB   . LYS B 2 28 ? -12.018 0.483   -6.970  1.00 0.00 ? 28 LYS B CB   4  
ATOM   3079  C CG   . LYS B 2 28 ? -12.422 1.684   -7.829  1.00 0.00 ? 28 LYS B CG   4  
ATOM   3080  C CD   . LYS B 2 28 ? -11.176 2.299   -8.469  1.00 0.00 ? 28 LYS B CD   4  
ATOM   3081  C CE   . LYS B 2 28 ? -11.328 3.821   -8.526  1.00 0.00 ? 28 LYS B CE   4  
ATOM   3082  N NZ   . LYS B 2 28 ? -10.055 4.464   -8.095  1.00 0.00 ? 28 LYS B NZ   4  
ATOM   3083  H H    . LYS B 2 28 ? -10.745 -0.635  -4.389  1.00 0.00 ? 28 LYS B H    4  
ATOM   3084  H HA   . LYS B 2 28 ? -10.694 1.831   -5.948  1.00 0.00 ? 28 LYS B HA   4  
ATOM   3085  H HB2  . LYS B 2 28 ? -11.352 -0.156  -7.533  1.00 0.00 ? 28 LYS B HB2  4  
ATOM   3086  H HB3  . LYS B 2 28 ? -12.902 -0.071  -6.692  1.00 0.00 ? 28 LYS B HB3  4  
ATOM   3087  H HG2  . LYS B 2 28 ? -13.102 1.359   -8.603  1.00 0.00 ? 28 LYS B HG2  4  
ATOM   3088  H HG3  . LYS B 2 28 ? -12.908 2.423   -7.209  1.00 0.00 ? 28 LYS B HG3  4  
ATOM   3089  H HD2  . LYS B 2 28 ? -10.306 2.046   -7.880  1.00 0.00 ? 28 LYS B HD2  4  
ATOM   3090  H HD3  . LYS B 2 28 ? -11.057 1.914   -9.470  1.00 0.00 ? 28 LYS B HD3  4  
ATOM   3091  H HE2  . LYS B 2 28 ? -11.559 4.121   -9.538  1.00 0.00 ? 28 LYS B HE2  4  
ATOM   3092  H HE3  . LYS B 2 28 ? -12.128 4.127   -7.868  1.00 0.00 ? 28 LYS B HE3  4  
ATOM   3093  H HZ1  . LYS B 2 28 ? -9.912  4.305   -7.078  1.00 0.00 ? 28 LYS B HZ1  4  
ATOM   3094  H HZ2  . LYS B 2 28 ? -10.103 5.486   -8.284  1.00 0.00 ? 28 LYS B HZ2  4  
ATOM   3095  H HZ3  . LYS B 2 28 ? -9.261  4.049   -8.623  1.00 0.00 ? 28 LYS B HZ3  4  
ATOM   3096  N N    . PRO B 2 29 ? -11.883 1.978   -3.595  1.00 0.00 ? 29 PRO B N    4  
ATOM   3097  C CA   . PRO B 2 29 ? -12.751 2.424   -2.491  1.00 0.00 ? 29 PRO B CA   4  
ATOM   3098  C C    . PRO B 2 29 ? -13.466 3.725   -2.866  1.00 0.00 ? 29 PRO B C    4  
ATOM   3099  O O    . PRO B 2 29 ? -12.854 4.678   -3.307  1.00 0.00 ? 29 PRO B O    4  
ATOM   3100  C CB   . PRO B 2 29 ? -11.773 2.651   -1.337  1.00 0.00 ? 29 PRO B CB   4  
ATOM   3101  C CG   . PRO B 2 29 ? -10.382 2.874   -1.980  1.00 0.00 ? 29 PRO B CG   4  
ATOM   3102  C CD   . PRO B 2 29 ? -10.450 2.273   -3.397  1.00 0.00 ? 29 PRO B CD   4  
ATOM   3103  H HA   . PRO B 2 29 ? -13.461 1.658   -2.229  1.00 0.00 ? 29 PRO B HA   4  
ATOM   3104  H HB2  . PRO B 2 29 ? -12.067 3.524   -0.770  1.00 0.00 ? 29 PRO B HB2  4  
ATOM   3105  H HB3  . PRO B 2 29 ? -11.743 1.783   -0.698  1.00 0.00 ? 29 PRO B HB3  4  
ATOM   3106  H HG2  . PRO B 2 29 ? -10.165 3.932   -2.032  1.00 0.00 ? 29 PRO B HG2  4  
ATOM   3107  H HG3  . PRO B 2 29 ? -9.623  2.366   -1.406  1.00 0.00 ? 29 PRO B HG3  4  
ATOM   3108  H HD2  . PRO B 2 29 ? -10.105 2.992   -4.128  1.00 0.00 ? 29 PRO B HD2  4  
ATOM   3109  H HD3  . PRO B 2 29 ? -9.871  1.365   -3.453  1.00 0.00 ? 29 PRO B HD3  4  
ATOM   3110  N N    . THR B 2 30 ? -14.759 3.771   -2.693  1.00 0.00 ? 30 THR B N    4  
ATOM   3111  C CA   . THR B 2 30 ? -15.513 5.009   -3.036  1.00 0.00 ? 30 THR B CA   4  
ATOM   3112  C C    . THR B 2 30 ? -15.161 6.115   -2.038  1.00 0.00 ? 30 THR B C    4  
ATOM   3113  O O    . THR B 2 30 ? -14.398 5.842   -1.126  1.00 0.00 ? 30 THR B O    4  
ATOM   3114  C CB   . THR B 2 30 ? -17.016 4.723   -2.972  1.00 0.00 ? 30 THR B CB   4  
ATOM   3115  O OG1  . THR B 2 30 ? -17.734 5.939   -3.125  1.00 0.00 ? 30 THR B OG1  4  
ATOM   3116  C CG2  . THR B 2 30 ? -17.360 4.088   -1.624  1.00 0.00 ? 30 THR B CG2  4  
ATOM   3117  O OXT  . THR B 2 30 ? -15.660 7.215   -2.204  1.00 0.00 ? 30 THR B OXT  4  
ATOM   3118  H H    . THR B 2 30 ? -15.233 2.993   -2.335  1.00 0.00 ? 30 THR B H    4  
ATOM   3119  H HA   . THR B 2 30 ? -15.248 5.327   -4.034  1.00 0.00 ? 30 THR B HA   4  
ATOM   3120  H HB   . THR B 2 30 ? -17.285 4.041   -3.764  1.00 0.00 ? 30 THR B HB   4  
ATOM   3121  H HG1  . THR B 2 30 ? -17.590 6.469   -2.337  1.00 0.00 ? 30 THR B HG1  4  
ATOM   3122  H HG21 . THR B 2 30 ? -16.560 4.275   -0.924  1.00 0.00 ? 30 THR B HG21 4  
ATOM   3123  H HG22 . THR B 2 30 ? -17.488 3.024   -1.750  1.00 0.00 ? 30 THR B HG22 4  
ATOM   3124  H HG23 . THR B 2 30 ? -18.276 4.519   -1.248  1.00 0.00 ? 30 THR B HG23 4  
ATOM   3125  N N    . GLY A 1 1  ? -6.972  1.681   -0.326  1.00 0.00 ? 1  GLY A N    5  
ATOM   3126  C CA   . GLY A 1 1  ? -5.988  2.842   -0.198  1.00 0.00 ? 1  GLY A CA   5  
ATOM   3127  C C    . GLY A 1 1  ? -4.673  2.768   -0.896  1.00 0.00 ? 1  GLY A C    5  
ATOM   3128  O O    . GLY A 1 1  ? -3.630  2.921   -0.293  1.00 0.00 ? 1  GLY A O    5  
ATOM   3129  H H1   . GLY A 1 1  ? -7.833  1.895   0.217   1.00 0.00 ? 1  GLY A H1   5  
ATOM   3130  H H2   . GLY A 1 1  ? -6.534  0.813   0.044   1.00 0.00 ? 1  GLY A H2   5  
ATOM   3131  H H3   . GLY A 1 1  ? -7.220  1.545   -1.327  1.00 0.00 ? 1  GLY A H3   5  
ATOM   3132  H HA2  . GLY A 1 1  ? -6.176  3.540   -0.852  1.00 0.00 ? 1  GLY A HA2  5  
ATOM   3133  H HA3  . GLY A 1 1  ? -6.051  3.221   0.904   1.00 0.00 ? 1  GLY A HA3  5  
HETATM 3134  N N    . IIL A 1 2  ? -4.685  2.531   -2.179  1.00 0.00 ? 2  IIL A N    5  
HETATM 3135  C CA   . IIL A 1 2  ? -3.404  2.445   -2.935  1.00 0.00 ? 2  IIL A CA   5  
HETATM 3136  C C    . IIL A 1 2  ? -3.527  3.235   -4.238  1.00 0.00 ? 2  IIL A C    5  
HETATM 3137  O O    . IIL A 1 2  ? -2.630  3.956   -4.627  1.00 0.00 ? 2  IIL A O    5  
HETATM 3138  C CB   . IIL A 1 2  ? -3.098  0.979   -3.254  1.00 0.00 ? 2  IIL A CB   5  
HETATM 3139  C CG2  . IIL A 1 2  ? -1.871  0.903   -4.164  1.00 0.00 ? 2  IIL A CG2  5  
HETATM 3140  C CG1  . IIL A 1 2  ? -4.301  0.352   -3.963  1.00 0.00 ? 2  IIL A CG1  5  
HETATM 3141  C CD1  . IIL A 1 2  ? -4.279  -1.165  -3.761  1.00 0.00 ? 2  IIL A CD1  5  
HETATM 3142  H H    . IIL A 1 2  ? -5.539  2.410   -2.647  1.00 0.00 ? 2  IIL A H    5  
HETATM 3143  H HA   . IIL A 1 2  ? -2.604  2.857   -2.337  1.00 0.00 ? 2  IIL A HA   5  
HETATM 3144  H HB   . IIL A 1 2  ? -2.900  0.441   -2.338  1.00 0.00 ? 2  IIL A HB   5  
HETATM 3145  H HG21 . IIL A 1 2  ? -2.107  1.337   -5.124  1.00 0.00 ? 2  IIL A HG21 5  
HETATM 3146  H HG22 . IIL A 1 2  ? -1.585  -0.130  -4.296  1.00 0.00 ? 2  IIL A HG22 5  
HETATM 3147  H HG23 . IIL A 1 2  ? -1.055  1.448   -3.713  1.00 0.00 ? 2  IIL A HG23 5  
HETATM 3148  H HG12 . IIL A 1 2  ? -4.254  0.574   -5.019  1.00 0.00 ? 2  IIL A HG12 5  
HETATM 3149  H HG13 . IIL A 1 2  ? -5.214  0.757   -3.550  1.00 0.00 ? 2  IIL A HG13 5  
HETATM 3150  H HD11 . IIL A 1 2  ? -4.741  -1.410  -2.817  1.00 0.00 ? 2  IIL A HD11 5  
HETATM 3151  H HD12 . IIL A 1 2  ? -3.257  -1.513  -3.764  1.00 0.00 ? 2  IIL A HD12 5  
HETATM 3152  H HD13 . IIL A 1 2  ? -4.824  -1.642  -4.564  1.00 0.00 ? 2  IIL A HD13 5  
ATOM   3153  N N    . VAL A 1 3  ? -4.632  3.103   -4.918  1.00 0.00 ? 3  VAL A N    5  
ATOM   3154  C CA   . VAL A 1 3  ? -4.816  3.843   -6.199  1.00 0.00 ? 3  VAL A CA   5  
ATOM   3155  C C    . VAL A 1 3  ? -4.720  5.348   -5.946  1.00 0.00 ? 3  VAL A C    5  
ATOM   3156  O O    . VAL A 1 3  ? -4.053  6.065   -6.663  1.00 0.00 ? 3  VAL A O    5  
ATOM   3157  C CB   . VAL A 1 3  ? -6.187  3.510   -6.784  1.00 0.00 ? 3  VAL A CB   5  
ATOM   3158  C CG1  . VAL A 1 3  ? -6.405  4.314   -8.066  1.00 0.00 ? 3  VAL A CG1  5  
ATOM   3159  C CG2  . VAL A 1 3  ? -6.249  2.017   -7.106  1.00 0.00 ? 3  VAL A CG2  5  
ATOM   3160  H H    . VAL A 1 3  ? -5.344  2.515   -4.589  1.00 0.00 ? 3  VAL A H    5  
ATOM   3161  H HA   . VAL A 1 3  ? -4.046  3.547   -6.897  1.00 0.00 ? 3  VAL A HA   5  
ATOM   3162  H HB   . VAL A 1 3  ? -6.954  3.758   -6.066  1.00 0.00 ? 3  VAL A HB   5  
ATOM   3163  H HG11 . VAL A 1 3  ? -6.124  3.715   -8.918  1.00 0.00 ? 3  VAL A HG11 5  
ATOM   3164  H HG12 . VAL A 1 3  ? -5.799  5.207   -8.038  1.00 0.00 ? 3  VAL A HG12 5  
ATOM   3165  H HG13 . VAL A 1 3  ? -7.447  4.588   -8.145  1.00 0.00 ? 3  VAL A HG13 5  
ATOM   3166  H HG21 . VAL A 1 3  ? -5.555  1.483   -6.474  1.00 0.00 ? 3  VAL A HG21 5  
ATOM   3167  H HG22 . VAL A 1 3  ? -5.985  1.861   -8.141  1.00 0.00 ? 3  VAL A HG22 5  
ATOM   3168  H HG23 . VAL A 1 3  ? -7.250  1.652   -6.930  1.00 0.00 ? 3  VAL A HG23 5  
ATOM   3169  N N    . GLU A 1 4  ? -5.379  5.836   -4.930  1.00 0.00 ? 4  GLU A N    5  
ATOM   3170  C CA   . GLU A 1 4  ? -5.321  7.296   -4.639  1.00 0.00 ? 4  GLU A CA   5  
ATOM   3171  C C    . GLU A 1 4  ? -4.041  7.614   -3.861  1.00 0.00 ? 4  GLU A C    5  
ATOM   3172  O O    . GLU A 1 4  ? -3.854  8.714   -3.384  1.00 0.00 ? 4  GLU A O    5  
ATOM   3173  C CB   . GLU A 1 4  ? -6.537  7.701   -3.800  1.00 0.00 ? 4  GLU A CB   5  
ATOM   3174  C CG   . GLU A 1 4  ? -7.811  7.148   -4.442  1.00 0.00 ? 4  GLU A CG   5  
ATOM   3175  C CD   . GLU A 1 4  ? -8.191  8.007   -5.650  1.00 0.00 ? 4  GLU A CD   5  
ATOM   3176  O OE1  . GLU A 1 4  ? -7.965  9.204   -5.597  1.00 0.00 ? 4  GLU A OE1  5  
ATOM   3177  O OE2  . GLU A 1 4  ? -8.705  7.452   -6.608  1.00 0.00 ? 4  GLU A OE2  5  
ATOM   3178  H H    . GLU A 1 4  ? -5.912  5.243   -4.360  1.00 0.00 ? 4  GLU A H    5  
ATOM   3179  H HA   . GLU A 1 4  ? -5.325  7.849   -5.567  1.00 0.00 ? 4  GLU A HA   5  
ATOM   3180  H HB2  . GLU A 1 4  ? -6.433  7.302   -2.802  1.00 0.00 ? 4  GLU A HB2  5  
ATOM   3181  H HB3  . GLU A 1 4  ? -6.599  8.778   -3.753  1.00 0.00 ? 4  GLU A HB3  5  
ATOM   3182  H HG2  . GLU A 1 4  ? -7.640  6.130   -4.762  1.00 0.00 ? 4  GLU A HG2  5  
ATOM   3183  H HG3  . GLU A 1 4  ? -8.615  7.171   -3.721  1.00 0.00 ? 4  GLU A HG3  5  
ATOM   3184  N N    . GLN A 1 5  ? -3.160  6.659   -3.727  1.00 0.00 ? 5  GLN A N    5  
ATOM   3185  C CA   . GLN A 1 5  ? -1.899  6.917   -2.976  1.00 0.00 ? 5  GLN A CA   5  
ATOM   3186  C C    . GLN A 1 5  ? -0.730  7.057   -3.959  1.00 0.00 ? 5  GLN A C    5  
ATOM   3187  O O    . GLN A 1 5  ? -0.161  8.121   -4.106  1.00 0.00 ? 5  GLN A O    5  
ATOM   3188  C CB   . GLN A 1 5  ? -1.635  5.755   -2.011  1.00 0.00 ? 5  GLN A CB   5  
ATOM   3189  C CG   . GLN A 1 5  ? -0.189  5.816   -1.510  1.00 0.00 ? 5  GLN A CG   5  
ATOM   3190  C CD   . GLN A 1 5  ? -0.131  5.327   -0.063  1.00 0.00 ? 5  GLN A CD   5  
ATOM   3191  O OE1  . GLN A 1 5  ? -0.730  4.326   0.277   1.00 0.00 ? 5  GLN A OE1  5  
ATOM   3192  N NE2  . GLN A 1 5  ? 0.571   5.995   0.811   1.00 0.00 ? 5  GLN A NE2  5  
ATOM   3193  H H    . GLN A 1 5  ? -3.328  5.776   -4.116  1.00 0.00 ? 5  GLN A H    5  
ATOM   3194  H HA   . GLN A 1 5  ? -2.001  7.833   -2.414  1.00 0.00 ? 5  GLN A HA   5  
ATOM   3195  H HB2  . GLN A 1 5  ? -2.309  5.830   -1.168  1.00 0.00 ? 5  GLN A HB2  5  
ATOM   3196  H HB3  . GLN A 1 5  ? -1.799  4.818   -2.520  1.00 0.00 ? 5  GLN A HB3  5  
ATOM   3197  H HG2  . GLN A 1 5  ? 0.432   5.186   -2.131  1.00 0.00 ? 5  GLN A HG2  5  
ATOM   3198  H HG3  . GLN A 1 5  ? 0.166   6.833   -1.560  1.00 0.00 ? 5  GLN A HG3  5  
ATOM   3199  H HE21 . GLN A 1 5  ? 1.054   6.802   0.537   1.00 0.00 ? 5  GLN A HE21 5  
ATOM   3200  H HE22 . GLN A 1 5  ? 0.614   5.690   1.741   1.00 0.00 ? 5  GLN A HE22 5  
ATOM   3201  N N    . CYS A 1 6  ? -0.364  6.001   -4.638  1.00 0.00 ? 6  CYS A N    5  
ATOM   3202  C CA   . CYS A 1 6  ? 0.767   6.100   -5.604  1.00 0.00 ? 6  CYS A CA   5  
ATOM   3203  C C    . CYS A 1 6  ? 0.322   6.913   -6.820  1.00 0.00 ? 6  CYS A C    5  
ATOM   3204  O O    . CYS A 1 6  ? 1.126   7.304   -7.644  1.00 0.00 ? 6  CYS A O    5  
ATOM   3205  C CB   . CYS A 1 6  ? 1.192   4.703   -6.055  1.00 0.00 ? 6  CYS A CB   5  
ATOM   3206  S SG   . CYS A 1 6  ? 1.629   3.705   -4.608  1.00 0.00 ? 6  CYS A SG   5  
ATOM   3207  H H    . CYS A 1 6  ? -0.830  5.149   -4.515  1.00 0.00 ? 6  CYS A H    5  
ATOM   3208  H HA   . CYS A 1 6  ? 1.602   6.595   -5.129  1.00 0.00 ? 6  CYS A HA   5  
ATOM   3209  H HB2  . CYS A 1 6  ? 0.378   4.233   -6.583  1.00 0.00 ? 6  CYS A HB2  5  
ATOM   3210  H HB3  . CYS A 1 6  ? 2.048   4.781   -6.709  1.00 0.00 ? 6  CYS A HB3  5  
ATOM   3211  N N    . CYS A 1 7  ? -0.952  7.174   -6.937  1.00 0.00 ? 7  CYS A N    5  
ATOM   3212  C CA   . CYS A 1 7  ? -1.439  7.968   -8.096  1.00 0.00 ? 7  CYS A CA   5  
ATOM   3213  C C    . CYS A 1 7  ? -1.510  9.439   -7.692  1.00 0.00 ? 7  CYS A C    5  
ATOM   3214  O O    . CYS A 1 7  ? -1.551  10.324  -8.524  1.00 0.00 ? 7  CYS A O    5  
ATOM   3215  C CB   . CYS A 1 7  ? -2.814  7.457   -8.537  1.00 0.00 ? 7  CYS A CB   5  
ATOM   3216  S SG   . CYS A 1 7  ? -3.249  8.167   -10.144 1.00 0.00 ? 7  CYS A SG   5  
ATOM   3217  H H    . CYS A 1 7  ? -1.584  6.853   -6.259  1.00 0.00 ? 7  CYS A H    5  
ATOM   3218  H HA   . CYS A 1 7  ? -0.740  7.867   -8.904  1.00 0.00 ? 7  CYS A HA   5  
ATOM   3219  H HB2  . CYS A 1 7  ? -2.790  6.379   -8.617  1.00 0.00 ? 7  CYS A HB2  5  
ATOM   3220  H HB3  . CYS A 1 7  ? -3.551  7.741   -7.812  1.00 0.00 ? 7  CYS A HB3  5  
ATOM   3221  N N    . THR A 1 8  ? -1.486  9.707   -6.416  1.00 0.00 ? 8  THR A N    5  
ATOM   3222  C CA   . THR A 1 8  ? -1.509  11.118  -5.947  1.00 0.00 ? 8  THR A CA   5  
ATOM   3223  C C    . THR A 1 8  ? -0.064  11.620  -5.902  1.00 0.00 ? 8  THR A C    5  
ATOM   3224  O O    . THR A 1 8  ? 0.203   12.806  -5.909  1.00 0.00 ? 8  THR A O    5  
ATOM   3225  C CB   . THR A 1 8  ? -2.123  11.184  -4.546  1.00 0.00 ? 8  THR A CB   5  
ATOM   3226  O OG1  . THR A 1 8  ? -2.290  12.544  -4.167  1.00 0.00 ? 8  THR A OG1  5  
ATOM   3227  C CG2  . THR A 1 8  ? -1.201  10.483  -3.547  1.00 0.00 ? 8  THR A CG2  5  
ATOM   3228  H H    . THR A 1 8  ? -1.424  8.976   -5.765  1.00 0.00 ? 8  THR A H    5  
ATOM   3229  H HA   . THR A 1 8  ? -2.085  11.723  -6.633  1.00 0.00 ? 8  THR A HA   5  
ATOM   3230  H HB   . THR A 1 8  ? -3.082  10.689  -4.549  1.00 0.00 ? 8  THR A HB   5  
ATOM   3231  H HG1  . THR A 1 8  ? -3.052  12.892  -4.638  1.00 0.00 ? 8  THR A HG1  5  
ATOM   3232  H HG21 . THR A 1 8  ? -1.021  11.134  -2.704  1.00 0.00 ? 8  THR A HG21 5  
ATOM   3233  H HG22 . THR A 1 8  ? -0.263  10.247  -4.025  1.00 0.00 ? 8  THR A HG22 5  
ATOM   3234  H HG23 . THR A 1 8  ? -1.669  9.572   -3.203  1.00 0.00 ? 8  THR A HG23 5  
ATOM   3235  N N    . SER A 1 9  ? 0.869   10.705  -5.861  1.00 0.00 ? 9  SER A N    5  
ATOM   3236  C CA   . SER A 1 9  ? 2.309   11.077  -5.820  1.00 0.00 ? 9  SER A CA   5  
ATOM   3237  C C    . SER A 1 9  ? 3.138   9.808   -6.036  1.00 0.00 ? 9  SER A C    5  
ATOM   3238  O O    . SER A 1 9  ? 2.645   8.820   -6.542  1.00 0.00 ? 9  SER A O    5  
ATOM   3239  C CB   . SER A 1 9  ? 2.641   11.685  -4.457  1.00 0.00 ? 9  SER A CB   5  
ATOM   3240  O OG   . SER A 1 9  ? 1.923   12.902  -4.300  1.00 0.00 ? 9  SER A OG   5  
ATOM   3241  H H    . SER A 1 9  ? 0.618   9.758   -5.860  1.00 0.00 ? 9  SER A H    5  
ATOM   3242  H HA   . SER A 1 9  ? 2.524   11.790  -6.602  1.00 0.00 ? 9  SER A HA   5  
ATOM   3243  H HB2  . SER A 1 9  ? 2.355   11.000  -3.677  1.00 0.00 ? 9  SER A HB2  5  
ATOM   3244  H HB3  . SER A 1 9  ? 3.704   11.873  -4.397  1.00 0.00 ? 9  SER A HB3  5  
ATOM   3245  H HG   . SER A 1 9  ? 1.765   13.268  -5.173  1.00 0.00 ? 9  SER A HG   5  
ATOM   3246  N N    . ILE A 1 10 ? 4.385   9.812   -5.653  1.00 0.00 ? 10 ILE A N    5  
ATOM   3247  C CA   . ILE A 1 10 ? 5.213   8.588   -5.840  1.00 0.00 ? 10 ILE A CA   5  
ATOM   3248  C C    . ILE A 1 10 ? 5.328   7.844   -4.508  1.00 0.00 ? 10 ILE A C    5  
ATOM   3249  O O    . ILE A 1 10 ? 5.638   8.424   -3.486  1.00 0.00 ? 10 ILE A O    5  
ATOM   3250  C CB   . ILE A 1 10 ? 6.611   8.968   -6.332  1.00 0.00 ? 10 ILE A CB   5  
ATOM   3251  C CG1  . ILE A 1 10 ? 6.503   9.655   -7.702  1.00 0.00 ? 10 ILE A CG1  5  
ATOM   3252  C CG2  . ILE A 1 10 ? 7.456   7.697   -6.452  1.00 0.00 ? 10 ILE A CG2  5  
ATOM   3253  C CD1  . ILE A 1 10 ? 7.849   9.581   -8.433  1.00 0.00 ? 10 ILE A CD1  5  
ATOM   3254  H H    . ILE A 1 10 ? 4.772   10.612  -5.239  1.00 0.00 ? 10 ILE A H    5  
ATOM   3255  H HA   . ILE A 1 10 ? 4.739   7.946   -6.569  1.00 0.00 ? 10 ILE A HA   5  
ATOM   3256  H HB   . ILE A 1 10 ? 7.071   9.641   -5.622  1.00 0.00 ? 10 ILE A HB   5  
ATOM   3257  H HG12 . ILE A 1 10 ? 5.746   9.160   -8.293  1.00 0.00 ? 10 ILE A HG12 5  
ATOM   3258  H HG13 . ILE A 1 10 ? 6.229   10.690  -7.564  1.00 0.00 ? 10 ILE A HG13 5  
ATOM   3259  H HG21 . ILE A 1 10 ? 7.428   7.156   -5.518  1.00 0.00 ? 10 ILE A HG21 5  
ATOM   3260  H HG22 . ILE A 1 10 ? 8.477   7.964   -6.684  1.00 0.00 ? 10 ILE A HG22 5  
ATOM   3261  H HG23 . ILE A 1 10 ? 7.060   7.075   -7.241  1.00 0.00 ? 10 ILE A HG23 5  
ATOM   3262  H HD11 . ILE A 1 10 ? 7.818   10.202  -9.315  1.00 0.00 ? 10 ILE A HD11 5  
ATOM   3263  H HD12 . ILE A 1 10 ? 8.043   8.559   -8.720  1.00 0.00 ? 10 ILE A HD12 5  
ATOM   3264  H HD13 . ILE A 1 10 ? 8.636   9.924   -7.776  1.00 0.00 ? 10 ILE A HD13 5  
ATOM   3265  N N    . CYS A 1 11 ? 5.081   6.561   -4.512  1.00 0.00 ? 11 CYS A N    5  
ATOM   3266  C CA   . CYS A 1 11 ? 5.178   5.780   -3.246  1.00 0.00 ? 11 CYS A CA   5  
ATOM   3267  C C    . CYS A 1 11 ? 6.397   4.849   -3.319  1.00 0.00 ? 11 CYS A C    5  
ATOM   3268  O O    . CYS A 1 11 ? 7.462   5.252   -3.744  1.00 0.00 ? 11 CYS A O    5  
ATOM   3269  C CB   . CYS A 1 11 ? 3.895   4.966   -3.052  1.00 0.00 ? 11 CYS A CB   5  
ATOM   3270  S SG   . CYS A 1 11 ? 3.639   3.880   -4.477  1.00 0.00 ? 11 CYS A SG   5  
ATOM   3271  H H    . CYS A 1 11 ? 4.833   6.113   -5.347  1.00 0.00 ? 11 CYS A H    5  
ATOM   3272  H HA   . CYS A 1 11 ? 5.299   6.462   -2.417  1.00 0.00 ? 11 CYS A HA   5  
ATOM   3273  H HB2  . CYS A 1 11 ? 3.977   4.372   -2.155  1.00 0.00 ? 11 CYS A HB2  5  
ATOM   3274  H HB3  . CYS A 1 11 ? 3.056   5.639   -2.958  1.00 0.00 ? 11 CYS A HB3  5  
ATOM   3275  N N    . SER A 1 12 ? 6.264   3.614   -2.908  1.00 0.00 ? 12 SER A N    5  
ATOM   3276  C CA   . SER A 1 12 ? 7.433   2.690   -2.961  1.00 0.00 ? 12 SER A CA   5  
ATOM   3277  C C    . SER A 1 12 ? 6.962   1.275   -3.309  1.00 0.00 ? 12 SER A C    5  
ATOM   3278  O O    . SER A 1 12 ? 5.917   0.834   -2.875  1.00 0.00 ? 12 SER A O    5  
ATOM   3279  C CB   . SER A 1 12 ? 8.125   2.673   -1.598  1.00 0.00 ? 12 SER A CB   5  
ATOM   3280  O OG   . SER A 1 12 ? 7.212   3.118   -0.602  1.00 0.00 ? 12 SER A OG   5  
ATOM   3281  H H    . SER A 1 12 ? 5.407   3.296   -2.562  1.00 0.00 ? 12 SER A H    5  
ATOM   3282  H HA   . SER A 1 12 ? 8.129   3.033   -3.713  1.00 0.00 ? 12 SER A HA   5  
ATOM   3283  H HB2  . SER A 1 12 ? 8.444   1.672   -1.364  1.00 0.00 ? 12 SER A HB2  5  
ATOM   3284  H HB3  . SER A 1 12 ? 8.988   3.326   -1.625  1.00 0.00 ? 12 SER A HB3  5  
ATOM   3285  H HG   . SER A 1 12 ? 7.077   2.398   0.019   1.00 0.00 ? 12 SER A HG   5  
ATOM   3286  N N    . LEU A 1 13 ? 7.730   0.560   -4.085  1.00 0.00 ? 13 LEU A N    5  
ATOM   3287  C CA   . LEU A 1 13 ? 7.334   -0.829  -4.452  1.00 0.00 ? 13 LEU A CA   5  
ATOM   3288  C C    . LEU A 1 13 ? 7.259   -1.679  -3.181  1.00 0.00 ? 13 LEU A C    5  
ATOM   3289  O O    . LEU A 1 13 ? 6.682   -2.748  -3.170  1.00 0.00 ? 13 LEU A O    5  
ATOM   3290  C CB   . LEU A 1 13 ? 8.381   -1.418  -5.401  1.00 0.00 ? 13 LEU A CB   5  
ATOM   3291  C CG   . LEU A 1 13 ? 7.765   -2.571  -6.194  1.00 0.00 ? 13 LEU A CG   5  
ATOM   3292  C CD1  . LEU A 1 13 ? 8.468   -2.688  -7.546  1.00 0.00 ? 13 LEU A CD1  5  
ATOM   3293  C CD2  . LEU A 1 13 ? 7.943   -3.875  -5.416  1.00 0.00 ? 13 LEU A CD2  5  
ATOM   3294  H H    . LEU A 1 13 ? 8.573   0.931   -4.419  1.00 0.00 ? 13 LEU A H    5  
ATOM   3295  H HA   . LEU A 1 13 ? 6.367   -0.814  -4.940  1.00 0.00 ? 13 LEU A HA   5  
ATOM   3296  H HB2  . LEU A 1 13 ? 8.719   -0.652  -6.083  1.00 0.00 ? 13 LEU A HB2  5  
ATOM   3297  H HB3  . LEU A 1 13 ? 9.219   -1.786  -4.828  1.00 0.00 ? 13 LEU A HB3  5  
ATOM   3298  H HG   . LEU A 1 13 ? 6.713   -2.381  -6.351  1.00 0.00 ? 13 LEU A HG   5  
ATOM   3299  H HD11 . LEU A 1 13 ? 8.780   -1.708  -7.876  1.00 0.00 ? 13 LEU A HD11 5  
ATOM   3300  H HD12 . LEU A 1 13 ? 7.789   -3.113  -8.270  1.00 0.00 ? 13 LEU A HD12 5  
ATOM   3301  H HD13 . LEU A 1 13 ? 9.334   -3.327  -7.447  1.00 0.00 ? 13 LEU A HD13 5  
ATOM   3302  H HD21 . LEU A 1 13 ? 8.729   -4.461  -5.870  1.00 0.00 ? 13 LEU A HD21 5  
ATOM   3303  H HD22 . LEU A 1 13 ? 7.020   -4.435  -5.435  1.00 0.00 ? 13 LEU A HD22 5  
ATOM   3304  H HD23 . LEU A 1 13 ? 8.206   -3.651  -4.393  1.00 0.00 ? 13 LEU A HD23 5  
ATOM   3305  N N    . TYR A 1 14 ? 7.830   -1.205  -2.105  1.00 0.00 ? 14 TYR A N    5  
ATOM   3306  C CA   . TYR A 1 14 ? 7.783   -1.979  -0.836  1.00 0.00 ? 14 TYR A CA   5  
ATOM   3307  C C    . TYR A 1 14 ? 6.338   -2.050  -0.373  1.00 0.00 ? 14 TYR A C    5  
ATOM   3308  O O    . TYR A 1 14 ? 5.841   -3.091  0.009   1.00 0.00 ? 14 TYR A O    5  
ATOM   3309  C CB   . TYR A 1 14 ? 8.637   -1.282  0.224   1.00 0.00 ? 14 TYR A CB   5  
ATOM   3310  C CG   . TYR A 1 14 ? 10.080  -1.267  -0.231  1.00 0.00 ? 14 TYR A CG   5  
ATOM   3311  C CD1  . TYR A 1 14 ? 10.828  -2.454  -0.235  1.00 0.00 ? 14 TYR A CD1  5  
ATOM   3312  C CD2  . TYR A 1 14 ? 10.670  -0.068  -0.656  1.00 0.00 ? 14 TYR A CD2  5  
ATOM   3313  C CE1  . TYR A 1 14 ? 12.163  -2.440  -0.661  1.00 0.00 ? 14 TYR A CE1  5  
ATOM   3314  C CE2  . TYR A 1 14 ? 12.005  -0.056  -1.082  1.00 0.00 ? 14 TYR A CE2  5  
ATOM   3315  C CZ   . TYR A 1 14 ? 12.750  -1.242  -1.085  1.00 0.00 ? 14 TYR A CZ   5  
ATOM   3316  O OH   . TYR A 1 14 ? 14.065  -1.230  -1.503  1.00 0.00 ? 14 TYR A OH   5  
ATOM   3317  H H    . TYR A 1 14 ? 8.280   -0.336  -2.131  1.00 0.00 ? 14 TYR A H    5  
ATOM   3318  H HA   . TYR A 1 14 ? 8.154   -2.973  -1.007  1.00 0.00 ? 14 TYR A HA   5  
ATOM   3319  H HB2  . TYR A 1 14 ? 8.286   -0.268  0.358   1.00 0.00 ? 14 TYR A HB2  5  
ATOM   3320  H HB3  . TYR A 1 14 ? 8.558   -1.816  1.161   1.00 0.00 ? 14 TYR A HB3  5  
ATOM   3321  H HD1  . TYR A 1 14 ? 10.378  -3.378  0.090   1.00 0.00 ? 14 TYR A HD1  5  
ATOM   3322  H HD2  . TYR A 1 14 ? 10.098  0.846   -0.655  1.00 0.00 ? 14 TYR A HD2  5  
ATOM   3323  H HE1  . TYR A 1 14 ? 12.737  -3.354  -0.663  1.00 0.00 ? 14 TYR A HE1  5  
ATOM   3324  H HE2  . TYR A 1 14 ? 12.458  0.868   -1.411  1.00 0.00 ? 14 TYR A HE2  5  
ATOM   3325  H HH   . TYR A 1 14 ? 14.548  -1.880  -0.987  1.00 0.00 ? 14 TYR A HH   5  
ATOM   3326  N N    . GLN A 1 15 ? 5.656   -0.950  -0.432  1.00 0.00 ? 15 GLN A N    5  
ATOM   3327  C CA   . GLN A 1 15 ? 4.230   -0.939  -0.026  1.00 0.00 ? 15 GLN A CA   5  
ATOM   3328  C C    . GLN A 1 15 ? 3.420   -1.632  -1.121  1.00 0.00 ? 15 GLN A C    5  
ATOM   3329  O O    . GLN A 1 15 ? 2.312   -2.084  -0.907  1.00 0.00 ? 15 GLN A O    5  
ATOM   3330  C CB   . GLN A 1 15 ? 3.749   0.504   0.139   1.00 0.00 ? 15 GLN A CB   5  
ATOM   3331  C CG   . GLN A 1 15 ? 4.586   1.200   1.215   1.00 0.00 ? 15 GLN A CG   5  
ATOM   3332  C CD   . GLN A 1 15 ? 4.084   2.633   1.404   1.00 0.00 ? 15 GLN A CD   5  
ATOM   3333  O OE1  . GLN A 1 15 ? 4.279   3.475   0.551   1.00 0.00 ? 15 GLN A OE1  5  
ATOM   3334  N NE2  . GLN A 1 15 ? 3.442   2.946   2.496   1.00 0.00 ? 15 GLN A NE2  5  
ATOM   3335  H H    . GLN A 1 15 ? 6.081   -0.134  -0.763  1.00 0.00 ? 15 GLN A H    5  
ATOM   3336  H HA   . GLN A 1 15 ? 4.117   -1.472  0.905   1.00 0.00 ? 15 GLN A HA   5  
ATOM   3337  H HB2  . GLN A 1 15 ? 3.859   1.029   -0.799  1.00 0.00 ? 15 GLN A HB2  5  
ATOM   3338  H HB3  . GLN A 1 15 ? 2.712   0.507   0.435   1.00 0.00 ? 15 GLN A HB3  5  
ATOM   3339  H HG2  . GLN A 1 15 ? 4.495   0.660   2.146   1.00 0.00 ? 15 GLN A HG2  5  
ATOM   3340  H HG3  . GLN A 1 15 ? 5.621   1.220   0.909   1.00 0.00 ? 15 GLN A HG3  5  
ATOM   3341  H HE21 . GLN A 1 15 ? 3.285   2.266   3.184   1.00 0.00 ? 15 GLN A HE21 5  
ATOM   3342  H HE22 . GLN A 1 15 ? 3.116   3.861   2.627   1.00 0.00 ? 15 GLN A HE22 5  
ATOM   3343  N N    . LEU A 1 16 ? 3.980   -1.723  -2.297  1.00 0.00 ? 16 LEU A N    5  
ATOM   3344  C CA   . LEU A 1 16 ? 3.277   -2.387  -3.423  1.00 0.00 ? 16 LEU A CA   5  
ATOM   3345  C C    . LEU A 1 16 ? 3.122   -3.876  -3.112  1.00 0.00 ? 16 LEU A C    5  
ATOM   3346  O O    . LEU A 1 16 ? 2.242   -4.542  -3.619  1.00 0.00 ? 16 LEU A O    5  
ATOM   3347  C CB   . LEU A 1 16 ? 4.112   -2.214  -4.691  1.00 0.00 ? 16 LEU A CB   5  
ATOM   3348  C CG   . LEU A 1 16 ? 3.589   -1.024  -5.497  1.00 0.00 ? 16 LEU A CG   5  
ATOM   3349  C CD1  . LEU A 1 16 ? 4.354   -0.926  -6.818  1.00 0.00 ? 16 LEU A CD1  5  
ATOM   3350  C CD2  . LEU A 1 16 ? 2.101   -1.223  -5.785  1.00 0.00 ? 16 LEU A CD2  5  
ATOM   3351  H H    . LEU A 1 16 ? 4.876   -1.355  -2.438  1.00 0.00 ? 16 LEU A H    5  
ATOM   3352  H HA   . LEU A 1 16 ? 2.306   -1.941  -3.562  1.00 0.00 ? 16 LEU A HA   5  
ATOM   3353  H HB2  . LEU A 1 16 ? 5.139   -2.038  -4.416  1.00 0.00 ? 16 LEU A HB2  5  
ATOM   3354  H HB3  . LEU A 1 16 ? 4.054   -3.106  -5.289  1.00 0.00 ? 16 LEU A HB3  5  
ATOM   3355  H HG   . LEU A 1 16 ? 3.731   -0.115  -4.930  1.00 0.00 ? 16 LEU A HG   5  
ATOM   3356  H HD11 . LEU A 1 16 ? 3.812   -0.288  -7.501  1.00 0.00 ? 16 LEU A HD11 5  
ATOM   3357  H HD12 . LEU A 1 16 ? 4.456   -1.911  -7.250  1.00 0.00 ? 16 LEU A HD12 5  
ATOM   3358  H HD13 . LEU A 1 16 ? 5.334   -0.509  -6.637  1.00 0.00 ? 16 LEU A HD13 5  
ATOM   3359  H HD21 . LEU A 1 16 ? 1.519   -0.663  -5.069  1.00 0.00 ? 16 LEU A HD21 5  
ATOM   3360  H HD22 . LEU A 1 16 ? 1.856   -2.272  -5.707  1.00 0.00 ? 16 LEU A HD22 5  
ATOM   3361  H HD23 . LEU A 1 16 ? 1.878   -0.875  -6.783  1.00 0.00 ? 16 LEU A HD23 5  
ATOM   3362  N N    . GLU A 1 17 ? 3.976   -4.398  -2.280  1.00 0.00 ? 17 GLU A N    5  
ATOM   3363  C CA   . GLU A 1 17 ? 3.893   -5.844  -1.927  1.00 0.00 ? 17 GLU A CA   5  
ATOM   3364  C C    . GLU A 1 17 ? 2.733   -6.067  -0.958  1.00 0.00 ? 17 GLU A C    5  
ATOM   3365  O O    . GLU A 1 17 ? 2.165   -7.138  -0.886  1.00 0.00 ? 17 GLU A O    5  
ATOM   3366  C CB   . GLU A 1 17 ? 5.202   -6.283  -1.267  1.00 0.00 ? 17 GLU A CB   5  
ATOM   3367  C CG   . GLU A 1 17 ? 6.139   -6.864  -2.327  1.00 0.00 ? 17 GLU A CG   5  
ATOM   3368  C CD   . GLU A 1 17 ? 5.976   -8.385  -2.377  1.00 0.00 ? 17 GLU A CD   5  
ATOM   3369  O OE1  . GLU A 1 17 ? 4.990   -8.837  -2.934  1.00 0.00 ? 17 GLU A OE1  5  
ATOM   3370  O OE2  . GLU A 1 17 ? 6.841   -9.070  -1.857  1.00 0.00 ? 17 GLU A OE2  5  
ATOM   3371  H H    . GLU A 1 17 ? 4.676   -3.836  -1.886  1.00 0.00 ? 17 GLU A H    5  
ATOM   3372  H HA   . GLU A 1 17 ? 3.728   -6.422  -2.821  1.00 0.00 ? 17 GLU A HA   5  
ATOM   3373  H HB2  . GLU A 1 17 ? 5.672   -5.429  -0.799  1.00 0.00 ? 17 GLU A HB2  5  
ATOM   3374  H HB3  . GLU A 1 17 ? 4.994   -7.035  -0.520  1.00 0.00 ? 17 GLU A HB3  5  
ATOM   3375  H HG2  . GLU A 1 17 ? 5.896   -6.443  -3.292  1.00 0.00 ? 17 GLU A HG2  5  
ATOM   3376  H HG3  . GLU A 1 17 ? 7.160   -6.622  -2.076  1.00 0.00 ? 17 GLU A HG3  5  
ATOM   3377  N N    . ASN A 1 18 ? 2.378   -5.060  -0.216  1.00 0.00 ? 18 ASN A N    5  
ATOM   3378  C CA   . ASN A 1 18 ? 1.255   -5.201  0.751   1.00 0.00 ? 18 ASN A CA   5  
ATOM   3379  C C    . ASN A 1 18 ? -0.074  -5.201  -0.007  1.00 0.00 ? 18 ASN A C    5  
ATOM   3380  O O    . ASN A 1 18 ? -1.131  -5.350  0.575   1.00 0.00 ? 18 ASN A O    5  
ATOM   3381  C CB   . ASN A 1 18 ? 1.285   -4.029  1.730   1.00 0.00 ? 18 ASN A CB   5  
ATOM   3382  C CG   . ASN A 1 18 ? 1.927   -4.475  3.044   1.00 0.00 ? 18 ASN A CG   5  
ATOM   3383  O OD1  . ASN A 1 18 ? 1.244   -4.690  4.025   1.00 0.00 ? 18 ASN A OD1  5  
ATOM   3384  N ND2  . ASN A 1 18 ? 3.222   -4.627  3.105   1.00 0.00 ? 18 ASN A ND2  5  
ATOM   3385  H H    . ASN A 1 18 ? 2.851   -4.207  -0.295  1.00 0.00 ? 18 ASN A H    5  
ATOM   3386  H HA   . ASN A 1 18 ? 1.362   -6.128  1.295   1.00 0.00 ? 18 ASN A HA   5  
ATOM   3387  H HB2  . ASN A 1 18 ? 1.861   -3.219  1.304   1.00 0.00 ? 18 ASN A HB2  5  
ATOM   3388  H HB3  . ASN A 1 18 ? 0.278   -3.693  1.919   1.00 0.00 ? 18 ASN A HB3  5  
ATOM   3389  H HD21 . ASN A 1 18 ? 3.773   -4.456  2.313   1.00 0.00 ? 18 ASN A HD21 5  
ATOM   3390  H HD22 . ASN A 1 18 ? 3.644   -4.910  3.943   1.00 0.00 ? 18 ASN A HD22 5  
ATOM   3391  N N    . TYR A 1 19 ? -0.032  -5.035  -1.301  1.00 0.00 ? 19 TYR A N    5  
ATOM   3392  C CA   . TYR A 1 19 ? -1.291  -5.024  -2.095  1.00 0.00 ? 19 TYR A CA   5  
ATOM   3393  C C    . TYR A 1 19 ? -1.338  -6.269  -2.981  1.00 0.00 ? 19 TYR A C    5  
ATOM   3394  O O    . TYR A 1 19 ? -1.969  -6.281  -4.020  1.00 0.00 ? 19 TYR A O    5  
ATOM   3395  C CB   . TYR A 1 19 ? -1.324  -3.770  -2.970  1.00 0.00 ? 19 TYR A CB   5  
ATOM   3396  C CG   . TYR A 1 19 ? -1.237  -2.541  -2.096  1.00 0.00 ? 19 TYR A CG   5  
ATOM   3397  C CD1  . TYR A 1 19 ? -2.022  -2.447  -0.938  1.00 0.00 ? 19 TYR A CD1  5  
ATOM   3398  C CD2  . TYR A 1 19 ? -0.372  -1.494  -2.443  1.00 0.00 ? 19 TYR A CD2  5  
ATOM   3399  C CE1  . TYR A 1 19 ? -1.940  -1.306  -0.127  1.00 0.00 ? 19 TYR A CE1  5  
ATOM   3400  C CE2  . TYR A 1 19 ? -0.291  -0.353  -1.631  1.00 0.00 ? 19 TYR A CE2  5  
ATOM   3401  C CZ   . TYR A 1 19 ? -1.075  -0.260  -0.475  1.00 0.00 ? 19 TYR A CZ   5  
ATOM   3402  O OH   . TYR A 1 19 ? -0.995  0.863   0.324   1.00 0.00 ? 19 TYR A OH   5  
ATOM   3403  H H    . TYR A 1 19 ? 0.828   -4.918  -1.754  1.00 0.00 ? 19 TYR A H    5  
ATOM   3404  H HA   . TYR A 1 19 ? -2.139  -5.023  -1.427  1.00 0.00 ? 19 TYR A HA   5  
ATOM   3405  H HB2  . TYR A 1 19 ? -0.488  -3.785  -3.654  1.00 0.00 ? 19 TYR A HB2  5  
ATOM   3406  H HB3  . TYR A 1 19 ? -2.246  -3.747  -3.529  1.00 0.00 ? 19 TYR A HB3  5  
ATOM   3407  H HD1  . TYR A 1 19 ? -2.688  -3.253  -0.671  1.00 0.00 ? 19 TYR A HD1  5  
ATOM   3408  H HD2  . TYR A 1 19 ? 0.232   -1.566  -3.335  1.00 0.00 ? 19 TYR A HD2  5  
ATOM   3409  H HE1  . TYR A 1 19 ? -2.544  -1.234  0.765   1.00 0.00 ? 19 TYR A HE1  5  
ATOM   3410  H HE2  . TYR A 1 19 ? 0.376   0.453   -1.899  1.00 0.00 ? 19 TYR A HE2  5  
ATOM   3411  H HH   . TYR A 1 19 ? -0.313  0.711   0.983   1.00 0.00 ? 19 TYR A HH   5  
ATOM   3412  N N    . CYS A 1 20 ? -0.671  -7.318  -2.580  1.00 0.00 ? 20 CYS A N    5  
ATOM   3413  C CA   . CYS A 1 20 ? -0.672  -8.560  -3.401  1.00 0.00 ? 20 CYS A CA   5  
ATOM   3414  C C    . CYS A 1 20 ? -1.691  -9.554  -2.835  1.00 0.00 ? 20 CYS A C    5  
ATOM   3415  O O    . CYS A 1 20 ? -2.865  -9.498  -3.145  1.00 0.00 ? 20 CYS A O    5  
ATOM   3416  C CB   . CYS A 1 20 ? 0.725   -9.182  -3.376  1.00 0.00 ? 20 CYS A CB   5  
ATOM   3417  S SG   . CYS A 1 20 ? 1.891   -8.081  -4.218  1.00 0.00 ? 20 CYS A SG   5  
ATOM   3418  H H    . CYS A 1 20 ? -0.167  -7.284  -1.741  1.00 0.00 ? 20 CYS A H    5  
ATOM   3419  H HA   . CYS A 1 20 ? -0.937  -8.320  -4.415  1.00 0.00 ? 20 CYS A HA   5  
ATOM   3420  H HB2  . CYS A 1 20 ? 1.040   -9.324  -2.353  1.00 0.00 ? 20 CYS A HB2  5  
ATOM   3421  H HB3  . CYS A 1 20 ? 0.703   -10.134 -3.882  1.00 0.00 ? 20 CYS A HB3  5  
ATOM   3422  N N    . ASN A 1 21 ? -1.253  -10.462 -2.009  1.00 0.00 ? 21 ASN A N    5  
ATOM   3423  C CA   . ASN A 1 21 ? -2.197  -11.459 -1.426  1.00 0.00 ? 21 ASN A CA   5  
ATOM   3424  C C    . ASN A 1 21 ? -1.586  -12.056 -0.157  1.00 0.00 ? 21 ASN A C    5  
ATOM   3425  O O    . ASN A 1 21 ? -0.835  -13.009 -0.276  1.00 0.00 ? 21 ASN A O    5  
ATOM   3426  C CB   . ASN A 1 21 ? -2.453  -12.576 -2.441  1.00 0.00 ? 21 ASN A CB   5  
ATOM   3427  C CG   . ASN A 1 21 ? -3.773  -12.311 -3.169  1.00 0.00 ? 21 ASN A CG   5  
ATOM   3428  O OD1  . ASN A 1 21 ? -3.797  -11.639 -4.180  1.00 0.00 ? 21 ASN A OD1  5  
ATOM   3429  N ND2  . ASN A 1 21 ? -4.878  -12.816 -2.693  1.00 0.00 ? 21 ASN A ND2  5  
ATOM   3430  O OXT  . ASN A 1 21 ? -1.881  -11.549 0.913   1.00 0.00 ? 21 ASN A OXT  5  
ATOM   3431  H H    . ASN A 1 21 ? -0.304  -10.491 -1.774  1.00 0.00 ? 21 ASN A H    5  
ATOM   3432  H HA   . ASN A 1 21 ? -3.129  -10.973 -1.184  1.00 0.00 ? 21 ASN A HA   5  
ATOM   3433  H HB2  . ASN A 1 21 ? -1.645  -12.604 -3.157  1.00 0.00 ? 21 ASN A HB2  5  
ATOM   3434  H HB3  . ASN A 1 21 ? -2.513  -13.524 -1.926  1.00 0.00 ? 21 ASN A HB3  5  
ATOM   3435  H HD21 . ASN A 1 21 ? -4.858  -13.357 -1.877  1.00 0.00 ? 21 ASN A HD21 5  
ATOM   3436  H HD22 . ASN A 1 21 ? -5.727  -12.651 -3.151  1.00 0.00 ? 21 ASN A HD22 5  
ATOM   3437  N N    . PHE B 2 1  ? 13.460  1.631   -4.245  1.00 0.00 ? 1  PHE B N    5  
ATOM   3438  C CA   . PHE B 2 1  ? 13.313  0.678   -5.380  1.00 0.00 ? 1  PHE B CA   5  
ATOM   3439  C C    . PHE B 2 1  ? 12.793  1.426   -6.609  1.00 0.00 ? 1  PHE B C    5  
ATOM   3440  O O    . PHE B 2 1  ? 13.302  1.273   -7.701  1.00 0.00 ? 1  PHE B O    5  
ATOM   3441  C CB   . PHE B 2 1  ? 12.321  -0.423  -5.002  1.00 0.00 ? 1  PHE B CB   5  
ATOM   3442  C CG   . PHE B 2 1  ? 12.504  -1.601  -5.934  1.00 0.00 ? 1  PHE B CG   5  
ATOM   3443  C CD1  . PHE B 2 1  ? 13.608  -2.451  -5.783  1.00 0.00 ? 1  PHE B CD1  5  
ATOM   3444  C CD2  . PHE B 2 1  ? 11.573  -1.841  -6.957  1.00 0.00 ? 1  PHE B CD2  5  
ATOM   3445  C CE1  . PHE B 2 1  ? 13.781  -3.538  -6.649  1.00 0.00 ? 1  PHE B CE1  5  
ATOM   3446  C CE2  . PHE B 2 1  ? 11.747  -2.928  -7.823  1.00 0.00 ? 1  PHE B CE2  5  
ATOM   3447  C CZ   . PHE B 2 1  ? 12.851  -3.777  -7.669  1.00 0.00 ? 1  PHE B CZ   5  
ATOM   3448  H H1   . PHE B 2 1  ? 14.468  1.760   -4.028  1.00 0.00 ? 1  PHE B H1   5  
ATOM   3449  H H2   . PHE B 2 1  ? 12.970  1.254   -3.409  1.00 0.00 ? 1  PHE B H2   5  
ATOM   3450  H H3   . PHE B 2 1  ? 13.046  2.549   -4.506  1.00 0.00 ? 1  PHE B H3   5  
ATOM   3451  H HA   . PHE B 2 1  ? 14.272  0.236   -5.607  1.00 0.00 ? 1  PHE B HA   5  
ATOM   3452  H HB2  . PHE B 2 1  ? 12.500  -0.734  -3.982  1.00 0.00 ? 1  PHE B HB2  5  
ATOM   3453  H HB3  . PHE B 2 1  ? 11.312  -0.044  -5.090  1.00 0.00 ? 1  PHE B HB3  5  
ATOM   3454  H HD1  . PHE B 2 1  ? 14.327  -2.269  -4.999  1.00 0.00 ? 1  PHE B HD1  5  
ATOM   3455  H HD2  . PHE B 2 1  ? 10.722  -1.189  -7.078  1.00 0.00 ? 1  PHE B HD2  5  
ATOM   3456  H HE1  . PHE B 2 1  ? 14.632  -4.192  -6.530  1.00 0.00 ? 1  PHE B HE1  5  
ATOM   3457  H HE2  . PHE B 2 1  ? 11.029  -3.113  -8.609  1.00 0.00 ? 1  PHE B HE2  5  
ATOM   3458  H HZ   . PHE B 2 1  ? 12.986  -4.615  -8.337  1.00 0.00 ? 1  PHE B HZ   5  
ATOM   3459  N N    . VAL B 2 2  ? 11.781  2.233   -6.439  1.00 0.00 ? 2  VAL B N    5  
ATOM   3460  C CA   . VAL B 2 2  ? 11.229  2.986   -7.599  1.00 0.00 ? 2  VAL B CA   5  
ATOM   3461  C C    . VAL B 2 2  ? 11.206  4.481   -7.274  1.00 0.00 ? 2  VAL B C    5  
ATOM   3462  O O    . VAL B 2 2  ? 11.467  4.891   -6.160  1.00 0.00 ? 2  VAL B O    5  
ATOM   3463  C CB   . VAL B 2 2  ? 9.806   2.502   -7.893  1.00 0.00 ? 2  VAL B CB   5  
ATOM   3464  C CG1  . VAL B 2 2  ? 8.846   3.045   -6.832  1.00 0.00 ? 2  VAL B CG1  5  
ATOM   3465  C CG2  . VAL B 2 2  ? 9.373   3.003   -9.271  1.00 0.00 ? 2  VAL B CG2  5  
ATOM   3466  H H    . VAL B 2 2  ? 11.385  2.340   -5.550  1.00 0.00 ? 2  VAL B H    5  
ATOM   3467  H HA   . VAL B 2 2  ? 11.852  2.817   -8.465  1.00 0.00 ? 2  VAL B HA   5  
ATOM   3468  H HB   . VAL B 2 2  ? 9.785   1.421   -7.877  1.00 0.00 ? 2  VAL B HB   5  
ATOM   3469  H HG11 . VAL B 2 2  ? 9.411   3.508   -6.038  1.00 0.00 ? 2  VAL B HG11 5  
ATOM   3470  H HG12 . VAL B 2 2  ? 8.257   2.234   -6.430  1.00 0.00 ? 2  VAL B HG12 5  
ATOM   3471  H HG13 . VAL B 2 2  ? 8.190   3.777   -7.281  1.00 0.00 ? 2  VAL B HG13 5  
ATOM   3472  H HG21 . VAL B 2 2  ? 8.824   2.225   -9.781  1.00 0.00 ? 2  VAL B HG21 5  
ATOM   3473  H HG22 . VAL B 2 2  ? 10.246  3.265   -9.850  1.00 0.00 ? 2  VAL B HG22 5  
ATOM   3474  H HG23 . VAL B 2 2  ? 8.743   3.872   -9.156  1.00 0.00 ? 2  VAL B HG23 5  
ATOM   3475  N N    . ASN B 2 3  ? 10.892  5.298   -8.240  1.00 0.00 ? 3  ASN B N    5  
ATOM   3476  C CA   . ASN B 2 3  ? 10.847  6.764   -7.997  1.00 0.00 ? 3  ASN B CA   5  
ATOM   3477  C C    . ASN B 2 3  ? 10.032  7.428   -9.107  1.00 0.00 ? 3  ASN B C    5  
ATOM   3478  O O    . ASN B 2 3  ? 10.170  8.605   -9.374  1.00 0.00 ? 3  ASN B O    5  
ATOM   3479  C CB   . ASN B 2 3  ? 12.270  7.326   -8.002  1.00 0.00 ? 3  ASN B CB   5  
ATOM   3480  C CG   . ASN B 2 3  ? 12.780  7.437   -6.563  1.00 0.00 ? 3  ASN B CG   5  
ATOM   3481  O OD1  . ASN B 2 3  ? 12.465  8.380   -5.866  1.00 0.00 ? 3  ASN B OD1  5  
ATOM   3482  N ND2  . ASN B 2 3  ? 13.558  6.505   -6.087  1.00 0.00 ? 3  ASN B ND2  5  
ATOM   3483  H H    . ASN B 2 3  ? 10.685  4.946   -9.129  1.00 0.00 ? 3  ASN B H    5  
ATOM   3484  H HA   . ASN B 2 3  ? 10.384  6.958   -7.041  1.00 0.00 ? 3  ASN B HA   5  
ATOM   3485  H HB2  . ASN B 2 3  ? 12.914  6.666   -8.564  1.00 0.00 ? 3  ASN B HB2  5  
ATOM   3486  H HB3  . ASN B 2 3  ? 12.270  8.304   -8.458  1.00 0.00 ? 3  ASN B HB3  5  
ATOM   3487  H HD21 . ASN B 2 3  ? 13.812  5.743   -6.648  1.00 0.00 ? 3  ASN B HD21 5  
ATOM   3488  H HD22 . ASN B 2 3  ? 13.890  6.567   -5.166  1.00 0.00 ? 3  ASN B HD22 5  
ATOM   3489  N N    . GLN B 2 4  ? 9.179   6.680   -9.755  1.00 0.00 ? 4  GLN B N    5  
ATOM   3490  C CA   . GLN B 2 4  ? 8.354   7.261   -10.845 1.00 0.00 ? 4  GLN B CA   5  
ATOM   3491  C C    . GLN B 2 4  ? 6.903   7.369   -10.371 1.00 0.00 ? 4  GLN B C    5  
ATOM   3492  O O    . GLN B 2 4  ? 6.525   6.800   -9.367  1.00 0.00 ? 4  GLN B O    5  
ATOM   3493  C CB   . GLN B 2 4  ? 8.431   6.347   -12.068 1.00 0.00 ? 4  GLN B CB   5  
ATOM   3494  C CG   . GLN B 2 4  ? 9.448   6.906   -13.064 1.00 0.00 ? 4  GLN B CG   5  
ATOM   3495  C CD   . GLN B 2 4  ? 9.548   5.971   -14.270 1.00 0.00 ? 4  GLN B CD   5  
ATOM   3496  O OE1  . GLN B 2 4  ? 9.989   4.846   -14.144 1.00 0.00 ? 4  GLN B OE1  5  
ATOM   3497  N NE2  . GLN B 2 4  ? 9.157   6.393   -15.441 1.00 0.00 ? 4  GLN B NE2  5  
ATOM   3498  H H    . GLN B 2 4  ? 9.080   5.735   -9.526  1.00 0.00 ? 4  GLN B H    5  
ATOM   3499  H HA   . GLN B 2 4  ? 8.729   8.241   -11.100 1.00 0.00 ? 4  GLN B HA   5  
ATOM   3500  H HB2  . GLN B 2 4  ? 8.736   5.358   -11.757 1.00 0.00 ? 4  GLN B HB2  5  
ATOM   3501  H HB3  . GLN B 2 4  ? 7.462   6.293   -12.535 1.00 0.00 ? 4  GLN B HB3  5  
ATOM   3502  H HG2  . GLN B 2 4  ? 9.131   7.886   -13.390 1.00 0.00 ? 4  GLN B HG2  5  
ATOM   3503  H HG3  . GLN B 2 4  ? 10.414  6.982   -12.588 1.00 0.00 ? 4  GLN B HG3  5  
ATOM   3504  H HE21 . GLN B 2 4  ? 8.803   7.301   -15.542 1.00 0.00 ? 4  GLN B HE21 5  
ATOM   3505  H HE22 . GLN B 2 4  ? 9.215   5.800   -16.219 1.00 0.00 ? 4  GLN B HE22 5  
ATOM   3506  N N    . HIS B 2 5  ? 6.088   8.100   -11.080 1.00 0.00 ? 5  HIS B N    5  
ATOM   3507  C CA   . HIS B 2 5  ? 4.666   8.247   -10.662 1.00 0.00 ? 5  HIS B CA   5  
ATOM   3508  C C    . HIS B 2 5  ? 3.863   7.019   -11.104 1.00 0.00 ? 5  HIS B C    5  
ATOM   3509  O O    . HIS B 2 5  ? 3.935   6.592   -12.239 1.00 0.00 ? 5  HIS B O    5  
ATOM   3510  C CB   . HIS B 2 5  ? 4.079   9.501   -11.309 1.00 0.00 ? 5  HIS B CB   5  
ATOM   3511  C CG   . HIS B 2 5  ? 2.992   10.057  -10.435 1.00 0.00 ? 5  HIS B CG   5  
ATOM   3512  N ND1  . HIS B 2 5  ? 2.354   11.240  -10.744 1.00 0.00 ? 5  HIS B ND1  5  
ATOM   3513  C CD2  . HIS B 2 5  ? 2.445   9.589   -9.273  1.00 0.00 ? 5  HIS B CD2  5  
ATOM   3514  C CE1  . HIS B 2 5  ? 1.451   11.454  -9.777  1.00 0.00 ? 5  HIS B CE1  5  
ATOM   3515  N NE2  . HIS B 2 5  ? 1.470   10.470  -8.854  1.00 0.00 ? 5  HIS B NE2  5  
ATOM   3516  H H    . HIS B 2 5  ? 6.414   8.555   -11.885 1.00 0.00 ? 5  HIS B H    5  
ATOM   3517  H HA   . HIS B 2 5  ? 4.616   8.341   -9.588  1.00 0.00 ? 5  HIS B HA   5  
ATOM   3518  H HB2  . HIS B 2 5  ? 4.858   10.241  -11.429 1.00 0.00 ? 5  HIS B HB2  5  
ATOM   3519  H HB3  . HIS B 2 5  ? 3.672   9.249   -12.274 1.00 0.00 ? 5  HIS B HB3  5  
ATOM   3520  H HD2  . HIS B 2 5  ? 2.729   8.677   -8.766  1.00 0.00 ? 5  HIS B HD2  5  
ATOM   3521  H HE1  . HIS B 2 5  ? 0.791   12.307  -9.740  1.00 0.00 ? 5  HIS B HE1  5  
ATOM   3522  H HE2  . HIS B 2 5  ? 0.909   10.396  -8.054  1.00 0.00 ? 5  HIS B HE2  5  
ATOM   3523  N N    . LEU B 2 6  ? 3.093   6.453   -10.214 1.00 0.00 ? 6  LEU B N    5  
ATOM   3524  C CA   . LEU B 2 6  ? 2.278   5.256   -10.579 1.00 0.00 ? 6  LEU B CA   5  
ATOM   3525  C C    . LEU B 2 6  ? 0.797   5.635   -10.549 1.00 0.00 ? 6  LEU B C    5  
ATOM   3526  O O    . LEU B 2 6  ? 0.397   6.508   -9.815  1.00 0.00 ? 6  LEU B O    5  
ATOM   3527  C CB   . LEU B 2 6  ? 2.532   4.136   -9.567  1.00 0.00 ? 6  LEU B CB   5  
ATOM   3528  C CG   . LEU B 2 6  ? 3.874   3.465   -9.864  1.00 0.00 ? 6  LEU B CG   5  
ATOM   3529  C CD1  . LEU B 2 6  ? 3.776   2.679   -11.172 1.00 0.00 ? 6  LEU B CD1  5  
ATOM   3530  C CD2  . LEU B 2 6  ? 4.966   4.531   -9.992  1.00 0.00 ? 6  LEU B CD2  5  
ATOM   3531  H H    . LEU B 2 6  ? 3.047   6.817   -9.305  1.00 0.00 ? 6  LEU B H    5  
ATOM   3532  H HA   . LEU B 2 6  ? 2.549   4.920   -11.569 1.00 0.00 ? 6  LEU B HA   5  
ATOM   3533  H HB2  . LEU B 2 6  ? 2.549   4.551   -8.569  1.00 0.00 ? 6  LEU B HB2  5  
ATOM   3534  H HB3  . LEU B 2 6  ? 1.742   3.403   -9.637  1.00 0.00 ? 6  LEU B HB3  5  
ATOM   3535  H HG   . LEU B 2 6  ? 4.123   2.789   -9.058  1.00 0.00 ? 6  LEU B HG   5  
ATOM   3536  H HD11 . LEU B 2 6  ? 4.700   2.777   -11.723 1.00 0.00 ? 6  LEU B HD11 5  
ATOM   3537  H HD12 . LEU B 2 6  ? 2.961   3.066   -11.765 1.00 0.00 ? 6  LEU B HD12 5  
ATOM   3538  H HD13 . LEU B 2 6  ? 3.597   1.636   -10.953 1.00 0.00 ? 6  LEU B HD13 5  
ATOM   3539  H HD21 . LEU B 2 6  ? 4.776   5.327   -9.288  1.00 0.00 ? 6  LEU B HD21 5  
ATOM   3540  H HD22 . LEU B 2 6  ? 4.964   4.930   -10.995 1.00 0.00 ? 6  LEU B HD22 5  
ATOM   3541  H HD23 . LEU B 2 6  ? 5.927   4.087   -9.782  1.00 0.00 ? 6  LEU B HD23 5  
ATOM   3542  N N    . CYS B 2 7  ? -0.021  4.990   -11.337 1.00 0.00 ? 7  CYS B N    5  
ATOM   3543  C CA   . CYS B 2 7  ? -1.476  5.330   -11.338 1.00 0.00 ? 7  CYS B CA   5  
ATOM   3544  C C    . CYS B 2 7  ? -2.288  4.142   -11.894 1.00 0.00 ? 7  CYS B C    5  
ATOM   3545  O O    . CYS B 2 7  ? -2.490  3.154   -11.219 1.00 0.00 ? 7  CYS B O    5  
ATOM   3546  C CB   . CYS B 2 7  ? -1.703  6.577   -12.205 1.00 0.00 ? 7  CYS B CB   5  
ATOM   3547  S SG   . CYS B 2 7  ? -1.538  8.075   -11.208 1.00 0.00 ? 7  CYS B SG   5  
ATOM   3548  H H    . CYS B 2 7  ? 0.320   4.286   -11.924 1.00 0.00 ? 7  CYS B H    5  
ATOM   3549  H HA   . CYS B 2 7  ? -1.793  5.532   -10.322 1.00 0.00 ? 7  CYS B HA   5  
ATOM   3550  H HB2  . CYS B 2 7  ? -0.966  6.604   -12.991 1.00 0.00 ? 7  CYS B HB2  5  
ATOM   3551  H HB3  . CYS B 2 7  ? -2.692  6.542   -12.638 1.00 0.00 ? 7  CYS B HB3  5  
ATOM   3552  N N    . GLY B 2 8  ? -2.761  4.218   -13.114 1.00 0.00 ? 8  GLY B N    5  
ATOM   3553  C CA   . GLY B 2 8  ? -3.550  3.084   -13.672 1.00 0.00 ? 8  GLY B CA   5  
ATOM   3554  C C    . GLY B 2 8  ? -2.596  1.985   -14.141 1.00 0.00 ? 8  GLY B C    5  
ATOM   3555  O O    . GLY B 2 8  ? -1.943  1.337   -13.348 1.00 0.00 ? 8  GLY B O    5  
ATOM   3556  H H    . GLY B 2 8  ? -2.601  5.011   -13.660 1.00 0.00 ? 8  GLY B H    5  
ATOM   3557  H HA2  . GLY B 2 8  ? -4.207  2.692   -12.908 1.00 0.00 ? 8  GLY B HA2  5  
ATOM   3558  H HA3  . GLY B 2 8  ? -4.136  3.430   -14.509 1.00 0.00 ? 8  GLY B HA3  5  
ATOM   3559  N N    . SER B 2 9  ? -2.507  1.772   -15.425 1.00 0.00 ? 9  SER B N    5  
ATOM   3560  C CA   . SER B 2 9  ? -1.590  0.717   -15.939 1.00 0.00 ? 9  SER B CA   5  
ATOM   3561  C C    . SER B 2 9  ? -0.210  0.896   -15.304 1.00 0.00 ? 9  SER B C    5  
ATOM   3562  O O    . SER B 2 9  ? 0.562   -0.036  -15.199 1.00 0.00 ? 9  SER B O    5  
ATOM   3563  C CB   . SER B 2 9  ? -1.473  0.838   -17.458 1.00 0.00 ? 9  SER B CB   5  
ATOM   3564  O OG   . SER B 2 9  ? -1.248  -0.450  -18.016 1.00 0.00 ? 9  SER B OG   5  
ATOM   3565  H H    . SER B 2 9  ? -3.039  2.307   -16.049 1.00 0.00 ? 9  SER B H    5  
ATOM   3566  H HA   . SER B 2 9  ? -1.982  -0.256  -15.683 1.00 0.00 ? 9  SER B HA   5  
ATOM   3567  H HB2  . SER B 2 9  ? -2.387  1.245   -17.860 1.00 0.00 ? 9  SER B HB2  5  
ATOM   3568  H HB3  . SER B 2 9  ? -0.651  1.497   -17.703 1.00 0.00 ? 9  SER B HB3  5  
ATOM   3569  H HG   . SER B 2 9  ? -0.303  -0.555  -18.147 1.00 0.00 ? 9  SER B HG   5  
ATOM   3570  N N    . ASP B 2 10 ? 0.104   2.088   -14.875 1.00 0.00 ? 10 ASP B N    5  
ATOM   3571  C CA   . ASP B 2 10 ? 1.430   2.327   -14.244 1.00 0.00 ? 10 ASP B CA   5  
ATOM   3572  C C    . ASP B 2 10 ? 1.470   1.639   -12.877 1.00 0.00 ? 10 ASP B C    5  
ATOM   3573  O O    . ASP B 2 10 ? 2.348   0.845   -12.595 1.00 0.00 ? 10 ASP B O    5  
ATOM   3574  C CB   . ASP B 2 10 ? 1.649   3.832   -14.072 1.00 0.00 ? 10 ASP B CB   5  
ATOM   3575  C CG   . ASP B 2 10 ? 2.062   4.443   -15.411 1.00 0.00 ? 10 ASP B CG   5  
ATOM   3576  O OD1  . ASP B 2 10 ? 2.988   3.926   -16.015 1.00 0.00 ? 10 ASP B OD1  5  
ATOM   3577  O OD2  . ASP B 2 10 ? 1.447   5.418   -15.810 1.00 0.00 ? 10 ASP B OD2  5  
ATOM   3578  H H    . ASP B 2 10 ? -0.536  2.825   -14.967 1.00 0.00 ? 10 ASP B H    5  
ATOM   3579  H HA   . ASP B 2 10 ? 2.207   1.920   -14.874 1.00 0.00 ? 10 ASP B HA   5  
ATOM   3580  H HB2  . ASP B 2 10 ? 0.731   4.291   -13.733 1.00 0.00 ? 10 ASP B HB2  5  
ATOM   3581  H HB3  . ASP B 2 10 ? 2.427   4.002   -13.344 1.00 0.00 ? 10 ASP B HB3  5  
ATOM   3582  N N    . LEU B 2 11 ? 0.520   1.926   -12.027 1.00 0.00 ? 11 LEU B N    5  
ATOM   3583  C CA   . LEU B 2 11 ? 0.506   1.276   -10.688 1.00 0.00 ? 11 LEU B CA   5  
ATOM   3584  C C    . LEU B 2 11 ? 0.145   -0.199  -10.872 1.00 0.00 ? 11 LEU B C    5  
ATOM   3585  O O    . LEU B 2 11 ? 0.593   -1.058  -10.139 1.00 0.00 ? 11 LEU B O    5  
ATOM   3586  C CB   . LEU B 2 11 ? -0.534  1.964   -9.791  1.00 0.00 ? 11 LEU B CB   5  
ATOM   3587  C CG   . LEU B 2 11 ? -0.015  2.137   -8.352  1.00 0.00 ? 11 LEU B CG   5  
ATOM   3588  C CD1  . LEU B 2 11 ? -1.189  2.019   -7.381  1.00 0.00 ? 11 LEU B CD1  5  
ATOM   3589  C CD2  . LEU B 2 11 ? 1.016   1.060   -8.006  1.00 0.00 ? 11 LEU B CD2  5  
ATOM   3590  H H    . LEU B 2 11 ? -0.187  2.558   -12.273 1.00 0.00 ? 11 LEU B H    5  
ATOM   3591  H HA   . LEU B 2 11 ? 1.487   1.355   -10.241 1.00 0.00 ? 11 LEU B HA   5  
ATOM   3592  H HB2  . LEU B 2 11 ? -0.753  2.935   -10.199 1.00 0.00 ? 11 LEU B HB2  5  
ATOM   3593  H HB3  . LEU B 2 11 ? -1.438  1.374   -9.772  1.00 0.00 ? 11 LEU B HB3  5  
ATOM   3594  H HG   . LEU B 2 11 ? 0.434   3.115   -8.250  1.00 0.00 ? 11 LEU B HG   5  
ATOM   3595  H HD11 . LEU B 2 11 ? -1.258  1.002   -7.022  1.00 0.00 ? 11 LEU B HD11 5  
ATOM   3596  H HD12 . LEU B 2 11 ? -2.105  2.282   -7.890  1.00 0.00 ? 11 LEU B HD12 5  
ATOM   3597  H HD13 . LEU B 2 11 ? -1.036  2.687   -6.547  1.00 0.00 ? 11 LEU B HD13 5  
ATOM   3598  H HD21 . LEU B 2 11 ? 0.694   0.114   -8.410  1.00 0.00 ? 11 LEU B HD21 5  
ATOM   3599  H HD22 . LEU B 2 11 ? 1.107   0.984   -6.934  1.00 0.00 ? 11 LEU B HD22 5  
ATOM   3600  H HD23 . LEU B 2 11 ? 1.971   1.330   -8.433  1.00 0.00 ? 11 LEU B HD23 5  
ATOM   3601  N N    . VAL B 2 12 ? -0.649  -0.501  -11.866 1.00 0.00 ? 12 VAL B N    5  
ATOM   3602  C CA   . VAL B 2 12 ? -1.020  -1.918  -12.113 1.00 0.00 ? 12 VAL B CA   5  
ATOM   3603  C C    . VAL B 2 12 ? 0.205   -2.642  -12.671 1.00 0.00 ? 12 VAL B C    5  
ATOM   3604  O O    . VAL B 2 12 ? 0.545   -3.728  -12.247 1.00 0.00 ? 12 VAL B O    5  
ATOM   3605  C CB   . VAL B 2 12 ? -2.170  -1.978  -13.126 1.00 0.00 ? 12 VAL B CB   5  
ATOM   3606  C CG1  . VAL B 2 12 ? -2.250  -3.378  -13.744 1.00 0.00 ? 12 VAL B CG1  5  
ATOM   3607  C CG2  . VAL B 2 12 ? -3.490  -1.666  -12.417 1.00 0.00 ? 12 VAL B CG2  5  
ATOM   3608  H H    . VAL B 2 12 ? -0.985  0.205   -12.458 1.00 0.00 ? 12 VAL B H    5  
ATOM   3609  H HA   . VAL B 2 12 ? -1.325  -2.381  -11.186 1.00 0.00 ? 12 VAL B HA   5  
ATOM   3610  H HB   . VAL B 2 12 ? -1.998  -1.250  -13.905 1.00 0.00 ? 12 VAL B HB   5  
ATOM   3611  H HG11 . VAL B 2 12 ? -1.981  -4.115  -13.001 1.00 0.00 ? 12 VAL B HG11 5  
ATOM   3612  H HG12 . VAL B 2 12 ? -1.566  -3.443  -14.578 1.00 0.00 ? 12 VAL B HG12 5  
ATOM   3613  H HG13 . VAL B 2 12 ? -3.257  -3.564  -14.088 1.00 0.00 ? 12 VAL B HG13 5  
ATOM   3614  H HG21 . VAL B 2 12 ? -3.723  -2.461  -11.724 1.00 0.00 ? 12 VAL B HG21 5  
ATOM   3615  H HG22 . VAL B 2 12 ? -4.281  -1.585  -13.149 1.00 0.00 ? 12 VAL B HG22 5  
ATOM   3616  H HG23 . VAL B 2 12 ? -3.400  -0.734  -11.880 1.00 0.00 ? 12 VAL B HG23 5  
ATOM   3617  N N    . GLU B 2 13 ? 0.880   -2.037  -13.609 1.00 0.00 ? 13 GLU B N    5  
ATOM   3618  C CA   . GLU B 2 13 ? 2.092   -2.679  -14.183 1.00 0.00 ? 13 GLU B CA   5  
ATOM   3619  C C    . GLU B 2 13 ? 3.004   -3.107  -13.034 1.00 0.00 ? 13 GLU B C    5  
ATOM   3620  O O    . GLU B 2 13 ? 3.715   -4.089  -13.121 1.00 0.00 ? 13 GLU B O    5  
ATOM   3621  C CB   . GLU B 2 13 ? 2.827   -1.679  -15.079 1.00 0.00 ? 13 GLU B CB   5  
ATOM   3622  C CG   . GLU B 2 13 ? 2.273   -1.764  -16.502 1.00 0.00 ? 13 GLU B CG   5  
ATOM   3623  C CD   . GLU B 2 13 ? 3.416   -2.043  -17.479 1.00 0.00 ? 13 GLU B CD   5  
ATOM   3624  O OE1  . GLU B 2 13 ? 4.289   -1.198  -17.596 1.00 0.00 ? 13 GLU B OE1  5  
ATOM   3625  O OE2  . GLU B 2 13 ? 3.401   -3.096  -18.093 1.00 0.00 ? 13 GLU B OE2  5  
ATOM   3626  H H    . GLU B 2 13 ? 0.596   -1.154  -13.928 1.00 0.00 ? 13 GLU B H    5  
ATOM   3627  H HA   . GLU B 2 13 ? 1.806   -3.545  -14.761 1.00 0.00 ? 13 GLU B HA   5  
ATOM   3628  H HB2  . GLU B 2 13 ? 2.684   -0.680  -14.694 1.00 0.00 ? 13 GLU B HB2  5  
ATOM   3629  H HB3  . GLU B 2 13 ? 3.881   -1.912  -15.091 1.00 0.00 ? 13 GLU B HB3  5  
ATOM   3630  H HG2  . GLU B 2 13 ? 1.547   -2.562  -16.558 1.00 0.00 ? 13 GLU B HG2  5  
ATOM   3631  H HG3  . GLU B 2 13 ? 1.801   -0.828  -16.761 1.00 0.00 ? 13 GLU B HG3  5  
ATOM   3632  N N    . ALA B 2 14 ? 2.977   -2.379  -11.950 1.00 0.00 ? 14 ALA B N    5  
ATOM   3633  C CA   . ALA B 2 14 ? 3.828   -2.745  -10.786 1.00 0.00 ? 14 ALA B CA   5  
ATOM   3634  C C    . ALA B 2 14 ? 3.262   -4.003  -10.130 1.00 0.00 ? 14 ALA B C    5  
ATOM   3635  O O    . ALA B 2 14 ? 3.879   -5.048  -10.137 1.00 0.00 ? 14 ALA B O    5  
ATOM   3636  C CB   . ALA B 2 14 ? 3.828   -1.599  -9.772  1.00 0.00 ? 14 ALA B CB   5  
ATOM   3637  H H    . ALA B 2 14 ? 2.389   -1.597  -11.900 1.00 0.00 ? 14 ALA B H    5  
ATOM   3638  H HA   . ALA B 2 14 ? 4.838   -2.933  -11.118 1.00 0.00 ? 14 ALA B HA   5  
ATOM   3639  H HB1  . ALA B 2 14 ? 4.733   -1.637  -9.186  1.00 0.00 ? 14 ALA B HB1  5  
ATOM   3640  H HB2  . ALA B 2 14 ? 2.972   -1.696  -9.119  1.00 0.00 ? 14 ALA B HB2  5  
ATOM   3641  H HB3  . ALA B 2 14 ? 3.776   -0.655  -10.294 1.00 0.00 ? 14 ALA B HB3  5  
ATOM   3642  N N    . LEU B 2 15 ? 2.088   -3.916  -9.568  1.00 0.00 ? 15 LEU B N    5  
ATOM   3643  C CA   . LEU B 2 15 ? 1.482   -5.112  -8.917  1.00 0.00 ? 15 LEU B CA   5  
ATOM   3644  C C    . LEU B 2 15 ? 1.651   -6.328  -9.830  1.00 0.00 ? 15 LEU B C    5  
ATOM   3645  O O    . LEU B 2 15 ? 2.012   -7.403  -9.391  1.00 0.00 ? 15 LEU B O    5  
ATOM   3646  C CB   . LEU B 2 15 ? -0.009  -4.862  -8.681  1.00 0.00 ? 15 LEU B CB   5  
ATOM   3647  C CG   . LEU B 2 15 ? -0.186  -3.873  -7.526  1.00 0.00 ? 15 LEU B CG   5  
ATOM   3648  C CD1  . LEU B 2 15 ? -1.610  -3.314  -7.545  1.00 0.00 ? 15 LEU B CD1  5  
ATOM   3649  C CD2  . LEU B 2 15 ? 0.060   -4.593  -6.198  1.00 0.00 ? 15 LEU B CD2  5  
ATOM   3650  H H    . LEU B 2 15 ? 1.602   -3.065  -9.577  1.00 0.00 ? 15 LEU B H    5  
ATOM   3651  H HA   . LEU B 2 15 ? 1.972   -5.297  -7.973  1.00 0.00 ? 15 LEU B HA   5  
ATOM   3652  H HB2  . LEU B 2 15 ? -0.451  -4.452  -9.577  1.00 0.00 ? 15 LEU B HB2  5  
ATOM   3653  H HB3  . LEU B 2 15 ? -0.495  -5.793  -8.433  1.00 0.00 ? 15 LEU B HB3  5  
ATOM   3654  H HG   . LEU B 2 15 ? 0.521   -3.064  -7.635  1.00 0.00 ? 15 LEU B HG   5  
ATOM   3655  H HD11 . LEU B 2 15 ? -1.572  -2.235  -7.567  1.00 0.00 ? 15 LEU B HD11 5  
ATOM   3656  H HD12 . LEU B 2 15 ? -2.136  -3.639  -6.660  1.00 0.00 ? 15 LEU B HD12 5  
ATOM   3657  H HD13 . LEU B 2 15 ? -2.126  -3.674  -8.424  1.00 0.00 ? 15 LEU B HD13 5  
ATOM   3658  H HD21 . LEU B 2 15 ? 0.530   -3.913  -5.502  1.00 0.00 ? 15 LEU B HD21 5  
ATOM   3659  H HD22 . LEU B 2 15 ? 0.706   -5.442  -6.363  1.00 0.00 ? 15 LEU B HD22 5  
ATOM   3660  H HD23 . LEU B 2 15 ? -0.882  -4.930  -5.791  1.00 0.00 ? 15 LEU B HD23 5  
ATOM   3661  N N    . TYR B 2 16 ? 1.389   -6.165  -11.097 1.00 0.00 ? 16 TYR B N    5  
ATOM   3662  C CA   . TYR B 2 16 ? 1.526   -7.305  -12.047 1.00 0.00 ? 16 TYR B CA   5  
ATOM   3663  C C    . TYR B 2 16 ? 2.943   -7.887  -11.973 1.00 0.00 ? 16 TYR B C    5  
ATOM   3664  O O    . TYR B 2 16 ? 3.125   -9.087  -11.912 1.00 0.00 ? 16 TYR B O    5  
ATOM   3665  C CB   . TYR B 2 16 ? 1.253   -6.811  -13.469 1.00 0.00 ? 16 TYR B CB   5  
ATOM   3666  C CG   . TYR B 2 16 ? -0.018  -7.446  -13.990 1.00 0.00 ? 16 TYR B CG   5  
ATOM   3667  C CD1  . TYR B 2 16 ? -0.111  -8.842  -14.108 1.00 0.00 ? 16 TYR B CD1  5  
ATOM   3668  C CD2  . TYR B 2 16 ? -1.107  -6.642  -14.360 1.00 0.00 ? 16 TYR B CD2  5  
ATOM   3669  C CE1  . TYR B 2 16 ? -1.287  -9.428  -14.592 1.00 0.00 ? 16 TYR B CE1  5  
ATOM   3670  C CE2  . TYR B 2 16 ? -2.282  -7.231  -14.843 1.00 0.00 ? 16 TYR B CE2  5  
ATOM   3671  C CZ   . TYR B 2 16 ? -2.372  -8.623  -14.959 1.00 0.00 ? 16 TYR B CZ   5  
ATOM   3672  O OH   . TYR B 2 16 ? -3.530  -9.204  -15.436 1.00 0.00 ? 16 TYR B OH   5  
ATOM   3673  H H    . TYR B 2 16 ? 1.096   -5.289  -11.423 1.00 0.00 ? 16 TYR B H    5  
ATOM   3674  H HA   . TYR B 2 16 ? 0.810   -8.072  -11.792 1.00 0.00 ? 16 TYR B HA   5  
ATOM   3675  H HB2  . TYR B 2 16 ? 1.143   -5.735  -13.459 1.00 0.00 ? 16 TYR B HB2  5  
ATOM   3676  H HB3  . TYR B 2 16 ? 2.081   -7.081  -14.109 1.00 0.00 ? 16 TYR B HB3  5  
ATOM   3677  H HD1  . TYR B 2 16 ? 0.723   -9.464  -13.825 1.00 0.00 ? 16 TYR B HD1  5  
ATOM   3678  H HD2  . TYR B 2 16 ? -1.041  -5.569  -14.270 1.00 0.00 ? 16 TYR B HD2  5  
ATOM   3679  H HE1  . TYR B 2 16 ? -1.357  -10.503 -14.682 1.00 0.00 ? 16 TYR B HE1  5  
ATOM   3680  H HE2  . TYR B 2 16 ? -3.120  -6.611  -15.126 1.00 0.00 ? 16 TYR B HE2  5  
ATOM   3681  H HH   . TYR B 2 16 ? -4.271  -8.657  -15.162 1.00 0.00 ? 16 TYR B HH   5  
ATOM   3682  N N    . LEU B 2 17 ? 3.947   -7.051  -11.987 1.00 0.00 ? 17 LEU B N    5  
ATOM   3683  C CA   . LEU B 2 17 ? 5.346   -7.567  -11.927 1.00 0.00 ? 17 LEU B CA   5  
ATOM   3684  C C    . LEU B 2 17 ? 5.817   -7.629  -10.471 1.00 0.00 ? 17 LEU B C    5  
ATOM   3685  O O    . LEU B 2 17 ? 6.854   -8.182  -10.169 1.00 0.00 ? 17 LEU B O    5  
ATOM   3686  C CB   . LEU B 2 17 ? 6.266   -6.636  -12.720 1.00 0.00 ? 17 LEU B CB   5  
ATOM   3687  C CG   . LEU B 2 17 ? 6.924   -7.415  -13.859 1.00 0.00 ? 17 LEU B CG   5  
ATOM   3688  C CD1  . LEU B 2 17 ? 7.088   -6.504  -15.078 1.00 0.00 ? 17 LEU B CD1  5  
ATOM   3689  C CD2  . LEU B 2 17 ? 8.299   -7.912  -13.408 1.00 0.00 ? 17 LEU B CD2  5  
ATOM   3690  H H    . LEU B 2 17 ? 3.783   -6.087  -12.043 1.00 0.00 ? 17 LEU B H    5  
ATOM   3691  H HA   . LEU B 2 17 ? 5.382   -8.557  -12.356 1.00 0.00 ? 17 LEU B HA   5  
ATOM   3692  H HB2  . LEU B 2 17 ? 5.689   -5.820  -13.127 1.00 0.00 ? 17 LEU B HB2  5  
ATOM   3693  H HB3  . LEU B 2 17 ? 7.031   -6.244  -12.066 1.00 0.00 ? 17 LEU B HB3  5  
ATOM   3694  H HG   . LEU B 2 17 ? 6.304   -8.260  -14.123 1.00 0.00 ? 17 LEU B HG   5  
ATOM   3695  H HD11 . LEU B 2 17 ? 7.937   -5.852  -14.930 1.00 0.00 ? 17 LEU B HD11 5  
ATOM   3696  H HD12 . LEU B 2 17 ? 6.196   -5.908  -15.203 1.00 0.00 ? 17 LEU B HD12 5  
ATOM   3697  H HD13 . LEU B 2 17 ? 7.246   -7.106  -15.961 1.00 0.00 ? 17 LEU B HD13 5  
ATOM   3698  H HD21 . LEU B 2 17 ? 8.184   -8.831  -12.851 1.00 0.00 ? 17 LEU B HD21 5  
ATOM   3699  H HD22 . LEU B 2 17 ? 8.763   -7.167  -12.778 1.00 0.00 ? 17 LEU B HD22 5  
ATOM   3700  H HD23 . LEU B 2 17 ? 8.920   -8.091  -14.272 1.00 0.00 ? 17 LEU B HD23 5  
ATOM   3701  N N    . VAL B 2 18 ? 5.064   -7.063  -9.569  1.00 0.00 ? 18 VAL B N    5  
ATOM   3702  C CA   . VAL B 2 18 ? 5.471   -7.088  -8.136  1.00 0.00 ? 18 VAL B CA   5  
ATOM   3703  C C    . VAL B 2 18 ? 5.023   -8.402  -7.501  1.00 0.00 ? 18 VAL B C    5  
ATOM   3704  O O    . VAL B 2 18 ? 5.822   -9.172  -7.005  1.00 0.00 ? 18 VAL B O    5  
ATOM   3705  C CB   . VAL B 2 18 ? 4.809   -5.924  -7.402  1.00 0.00 ? 18 VAL B CB   5  
ATOM   3706  C CG1  . VAL B 2 18 ? 5.078   -6.048  -5.901  1.00 0.00 ? 18 VAL B CG1  5  
ATOM   3707  C CG2  . VAL B 2 18 ? 5.383   -4.604  -7.915  1.00 0.00 ? 18 VAL B CG2  5  
ATOM   3708  H H    . VAL B 2 18 ? 4.231   -6.620  -9.834  1.00 0.00 ? 18 VAL B H    5  
ATOM   3709  H HA   . VAL B 2 18 ? 6.544   -6.998  -8.064  1.00 0.00 ? 18 VAL B HA   5  
ATOM   3710  H HB   . VAL B 2 18 ? 3.742   -5.948  -7.578  1.00 0.00 ? 18 VAL B HB   5  
ATOM   3711  H HG11 . VAL B 2 18 ? 4.373   -6.741  -5.466  1.00 0.00 ? 18 VAL B HG11 5  
ATOM   3712  H HG12 . VAL B 2 18 ? 4.966   -5.081  -5.435  1.00 0.00 ? 18 VAL B HG12 5  
ATOM   3713  H HG13 . VAL B 2 18 ? 6.084   -6.410  -5.745  1.00 0.00 ? 18 VAL B HG13 5  
ATOM   3714  H HG21 . VAL B 2 18 ? 6.004   -4.793  -8.777  1.00 0.00 ? 18 VAL B HG21 5  
ATOM   3715  H HG22 . VAL B 2 18 ? 5.976   -4.144  -7.138  1.00 0.00 ? 18 VAL B HG22 5  
ATOM   3716  H HG23 . VAL B 2 18 ? 4.574   -3.944  -8.191  1.00 0.00 ? 18 VAL B HG23 5  
ATOM   3717  N N    . CYS B 2 19 ? 3.747   -8.660  -7.507  1.00 0.00 ? 19 CYS B N    5  
ATOM   3718  C CA   . CYS B 2 19 ? 3.234   -9.920  -6.900  1.00 0.00 ? 19 CYS B CA   5  
ATOM   3719  C C    . CYS B 2 19 ? 3.543   -11.095 -7.829  1.00 0.00 ? 19 CYS B C    5  
ATOM   3720  O O    . CYS B 2 19 ? 4.309   -11.979 -7.495  1.00 0.00 ? 19 CYS B O    5  
ATOM   3721  C CB   . CYS B 2 19 ? 1.722   -9.808  -6.698  1.00 0.00 ? 19 CYS B CB   5  
ATOM   3722  S SG   . CYS B 2 19 ? 1.309   -8.132  -6.151  1.00 0.00 ? 19 CYS B SG   5  
ATOM   3723  H H    . CYS B 2 19 ? 3.122   -8.022  -7.911  1.00 0.00 ? 19 CYS B H    5  
ATOM   3724  H HA   . CYS B 2 19 ? 3.714   -10.081 -5.945  1.00 0.00 ? 19 CYS B HA   5  
ATOM   3725  H HB2  . CYS B 2 19 ? 1.219   -10.016 -7.632  1.00 0.00 ? 19 CYS B HB2  5  
ATOM   3726  H HB3  . CYS B 2 19 ? 1.404   -10.521 -5.952  1.00 0.00 ? 19 CYS B HB3  5  
ATOM   3727  N N    . GLY B 2 20 ? 2.953   -11.114 -8.993  1.00 0.00 ? 20 GLY B N    5  
ATOM   3728  C CA   . GLY B 2 20 ? 3.215   -12.232 -9.943  1.00 0.00 ? 20 GLY B CA   5  
ATOM   3729  C C    . GLY B 2 20 ? 2.697   -13.541 -9.345  1.00 0.00 ? 20 GLY B C    5  
ATOM   3730  O O    . GLY B 2 20 ? 2.792   -13.770 -8.156  1.00 0.00 ? 20 GLY B O    5  
ATOM   3731  H H    . GLY B 2 20 ? 2.340   -10.392 -9.243  1.00 0.00 ? 20 GLY B H    5  
ATOM   3732  H HA2  . GLY B 2 20 ? 2.708   -12.035 -10.878 1.00 0.00 ? 20 GLY B HA2  5  
ATOM   3733  H HA3  . GLY B 2 20 ? 4.277   -12.315 -10.117 1.00 0.00 ? 20 GLY B HA3  5  
ATOM   3734  N N    . GLU B 2 21 ? 2.147   -14.398 -10.162 1.00 0.00 ? 21 GLU B N    5  
ATOM   3735  C CA   . GLU B 2 21 ? 1.620   -15.696 -9.647  1.00 0.00 ? 21 GLU B CA   5  
ATOM   3736  C C    . GLU B 2 21 ? 0.436   -15.436 -8.712  1.00 0.00 ? 21 GLU B C    5  
ATOM   3737  O O    . GLU B 2 21 ? -0.685  -15.809 -8.998  1.00 0.00 ? 21 GLU B O    5  
ATOM   3738  C CB   . GLU B 2 21 ? 2.722   -16.437 -8.884  1.00 0.00 ? 21 GLU B CB   5  
ATOM   3739  C CG   . GLU B 2 21 ? 3.910   -16.688 -9.814  1.00 0.00 ? 21 GLU B CG   5  
ATOM   3740  C CD   . GLU B 2 21 ? 4.282   -18.171 -9.782  1.00 0.00 ? 21 GLU B CD   5  
ATOM   3741  O OE1  . GLU B 2 21 ? 4.706   -18.632 -8.734  1.00 0.00 ? 21 GLU B OE1  5  
ATOM   3742  O OE2  . GLU B 2 21 ? 4.139   -18.820 -10.804 1.00 0.00 ? 21 GLU B OE2  5  
ATOM   3743  H H    . GLU B 2 21 ? 2.081   -14.191 -11.117 1.00 0.00 ? 21 GLU B H    5  
ATOM   3744  H HA   . GLU B 2 21 ? 1.292   -16.302 -10.479 1.00 0.00 ? 21 GLU B HA   5  
ATOM   3745  H HB2  . GLU B 2 21 ? 3.043   -15.841 -8.041  1.00 0.00 ? 21 GLU B HB2  5  
ATOM   3746  H HB3  . GLU B 2 21 ? 2.340   -17.383 -8.530  1.00 0.00 ? 21 GLU B HB3  5  
ATOM   3747  H HG2  . GLU B 2 21 ? 3.644   -16.404 -10.822 1.00 0.00 ? 21 GLU B HG2  5  
ATOM   3748  H HG3  . GLU B 2 21 ? 4.755   -16.100 -9.487  1.00 0.00 ? 21 GLU B HG3  5  
ATOM   3749  N N    . ARG B 2 22 ? 0.673   -14.802 -7.597  1.00 0.00 ? 22 ARG B N    5  
ATOM   3750  C CA   . ARG B 2 22 ? -0.442  -14.528 -6.645  1.00 0.00 ? 22 ARG B CA   5  
ATOM   3751  C C    . ARG B 2 22 ? -1.626  -13.914 -7.397  1.00 0.00 ? 22 ARG B C    5  
ATOM   3752  O O    . ARG B 2 22 ? -2.770  -14.221 -7.123  1.00 0.00 ? 22 ARG B O    5  
ATOM   3753  C CB   . ARG B 2 22 ? 0.033   -13.558 -5.560  1.00 0.00 ? 22 ARG B CB   5  
ATOM   3754  C CG   . ARG B 2 22 ? 0.205   -14.314 -4.241  1.00 0.00 ? 22 ARG B CG   5  
ATOM   3755  C CD   . ARG B 2 22 ? 1.483   -13.846 -3.546  1.00 0.00 ? 22 ARG B CD   5  
ATOM   3756  N NE   . ARG B 2 22 ? 1.129   -12.985 -2.382  1.00 0.00 ? 22 ARG B NE   5  
ATOM   3757  C CZ   . ARG B 2 22 ? 2.046   -12.641 -1.520  1.00 0.00 ? 22 ARG B CZ   5  
ATOM   3758  N NH1  . ARG B 2 22 ? 3.191   -12.172 -1.937  1.00 0.00 ? 22 ARG B NH1  5  
ATOM   3759  N NH2  . ARG B 2 22 ? 1.821   -12.766 -0.241  1.00 0.00 ? 22 ARG B NH2  5  
ATOM   3760  H H    . ARG B 2 22 ? 1.584   -14.511 -7.381  1.00 0.00 ? 22 ARG B H    5  
ATOM   3761  H HA   . ARG B 2 22 ? -0.754  -15.453 -6.184  1.00 0.00 ? 22 ARG B HA   5  
ATOM   3762  H HB2  . ARG B 2 22 ? 0.978   -13.123 -5.852  1.00 0.00 ? 22 ARG B HB2  5  
ATOM   3763  H HB3  . ARG B 2 22 ? -0.699  -12.775 -5.429  1.00 0.00 ? 22 ARG B HB3  5  
ATOM   3764  H HG2  . ARG B 2 22 ? -0.645  -14.120 -3.602  1.00 0.00 ? 22 ARG B HG2  5  
ATOM   3765  H HG3  . ARG B 2 22 ? 0.271   -15.373 -4.439  1.00 0.00 ? 22 ARG B HG3  5  
ATOM   3766  H HD2  . ARG B 2 22 ? 2.042   -14.705 -3.202  1.00 0.00 ? 22 ARG B HD2  5  
ATOM   3767  H HD3  . ARG B 2 22 ? 2.087   -13.281 -4.241  1.00 0.00 ? 22 ARG B HD3  5  
ATOM   3768  H HE   . ARG B 2 22 ? 0.206   -12.678 -2.264  1.00 0.00 ? 22 ARG B HE   5  
ATOM   3769  H HH11 . ARG B 2 22 ? 3.365   -12.076 -2.916  1.00 0.00 ? 22 ARG B HH11 5  
ATOM   3770  H HH12 . ARG B 2 22 ? 3.893   -11.908 -1.276  1.00 0.00 ? 22 ARG B HH12 5  
ATOM   3771  H HH21 . ARG B 2 22 ? 0.944   -13.125 0.080   1.00 0.00 ? 22 ARG B HH21 5  
ATOM   3772  H HH22 . ARG B 2 22 ? 2.523   -12.500 0.418   1.00 0.00 ? 22 ARG B HH22 5  
ATOM   3773  N N    . GLY B 2 23 ? -1.368  -13.051 -8.342  1.00 0.00 ? 23 GLY B N    5  
ATOM   3774  C CA   . GLY B 2 23 ? -2.488  -12.427 -9.102  1.00 0.00 ? 23 GLY B CA   5  
ATOM   3775  C C    . GLY B 2 23 ? -2.822  -11.064 -8.499  1.00 0.00 ? 23 GLY B C    5  
ATOM   3776  O O    . GLY B 2 23 ? -3.414  -10.219 -9.138  1.00 0.00 ? 23 GLY B O    5  
ATOM   3777  H H    . GLY B 2 23 ? -0.440  -12.815 -8.552  1.00 0.00 ? 23 GLY B H    5  
ATOM   3778  H HA2  . GLY B 2 23 ? -2.197  -12.303 -10.132 1.00 0.00 ? 23 GLY B HA2  5  
ATOM   3779  H HA3  . GLY B 2 23 ? -3.356  -13.063 -9.043  1.00 0.00 ? 23 GLY B HA3  5  
ATOM   3780  N N    . PHE B 2 24 ? -2.447  -10.857 -7.269  1.00 0.00 ? 24 PHE B N    5  
ATOM   3781  C CA   . PHE B 2 24 ? -2.733  -9.557  -6.588  1.00 0.00 ? 24 PHE B CA   5  
ATOM   3782  C C    . PHE B 2 24 ? -4.179  -9.127  -6.869  1.00 0.00 ? 24 PHE B C    5  
ATOM   3783  O O    . PHE B 2 24 ? -4.945  -9.853  -7.473  1.00 0.00 ? 24 PHE B O    5  
ATOM   3784  C CB   . PHE B 2 24 ? -1.735  -8.487  -7.070  1.00 0.00 ? 24 PHE B CB   5  
ATOM   3785  C CG   . PHE B 2 24 ? -2.232  -7.799  -8.335  1.00 0.00 ? 24 PHE B CG   5  
ATOM   3786  C CD1  . PHE B 2 24 ? -3.069  -6.672  -8.246  1.00 0.00 ? 24 PHE B CD1  5  
ATOM   3787  C CD2  . PHE B 2 24 ? -1.845  -8.276  -9.597  1.00 0.00 ? 24 PHE B CD2  5  
ATOM   3788  C CE1  . PHE B 2 24 ? -3.514  -6.033  -9.411  1.00 0.00 ? 24 PHE B CE1  5  
ATOM   3789  C CE2  . PHE B 2 24 ? -2.294  -7.635  -10.759 1.00 0.00 ? 24 PHE B CE2  5  
ATOM   3790  C CZ   . PHE B 2 24 ? -3.127  -6.515  -10.667 1.00 0.00 ? 24 PHE B CZ   5  
ATOM   3791  H H    . PHE B 2 24 ? -1.978  -11.566 -6.787  1.00 0.00 ? 24 PHE B H    5  
ATOM   3792  H HA   . PHE B 2 24 ? -2.613  -9.691  -5.523  1.00 0.00 ? 24 PHE B HA   5  
ATOM   3793  H HB2  . PHE B 2 24 ? -1.611  -7.747  -6.293  1.00 0.00 ? 24 PHE B HB2  5  
ATOM   3794  H HB3  . PHE B 2 24 ? -0.778  -8.962  -7.266  1.00 0.00 ? 24 PHE B HB3  5  
ATOM   3795  H HD1  . PHE B 2 24 ? -3.374  -6.293  -7.283  1.00 0.00 ? 24 PHE B HD1  5  
ATOM   3796  H HD2  . PHE B 2 24 ? -1.206  -9.139  -9.676  1.00 0.00 ? 24 PHE B HD2  5  
ATOM   3797  H HE1  . PHE B 2 24 ? -4.156  -5.168  -9.340  1.00 0.00 ? 24 PHE B HE1  5  
ATOM   3798  H HE2  . PHE B 2 24 ? -1.995  -8.007  -11.729 1.00 0.00 ? 24 PHE B HE2  5  
ATOM   3799  H HZ   . PHE B 2 24 ? -3.469  -6.019  -11.564 1.00 0.00 ? 24 PHE B HZ   5  
ATOM   3800  N N    . PHE B 2 25 ? -4.569  -7.961  -6.429  1.00 0.00 ? 25 PHE B N    5  
ATOM   3801  C CA   . PHE B 2 25 ? -5.974  -7.517  -6.683  1.00 0.00 ? 25 PHE B CA   5  
ATOM   3802  C C    . PHE B 2 25 ? -6.119  -5.995  -6.534  1.00 0.00 ? 25 PHE B C    5  
ATOM   3803  O O    . PHE B 2 25 ? -6.070  -5.452  -5.449  1.00 0.00 ? 25 PHE B O    5  
ATOM   3804  C CB   . PHE B 2 25 ? -6.941  -8.226  -5.725  1.00 0.00 ? 25 PHE B CB   5  
ATOM   3805  C CG   . PHE B 2 25 ? -6.424  -8.236  -4.295  1.00 0.00 ? 25 PHE B CG   5  
ATOM   3806  C CD1  . PHE B 2 25 ? -5.346  -7.425  -3.898  1.00 0.00 ? 25 PHE B CD1  5  
ATOM   3807  C CD2  . PHE B 2 25 ? -7.047  -9.070  -3.355  1.00 0.00 ? 25 PHE B CD2  5  
ATOM   3808  C CE1  . PHE B 2 25 ? -4.899  -7.454  -2.570  1.00 0.00 ? 25 PHE B CE1  5  
ATOM   3809  C CE2  . PHE B 2 25 ? -6.598  -9.095  -2.029  1.00 0.00 ? 25 PHE B CE2  5  
ATOM   3810  C CZ   . PHE B 2 25 ? -5.525  -8.288  -1.636  1.00 0.00 ? 25 PHE B CZ   5  
ATOM   3811  H H    . PHE B 2 25 ? -3.945  -7.389  -5.940  1.00 0.00 ? 25 PHE B H    5  
ATOM   3812  H HA   . PHE B 2 25 ? -6.238  -7.786  -7.695  1.00 0.00 ? 25 PHE B HA   5  
ATOM   3813  H HB2  . PHE B 2 25 ? -7.894  -7.719  -5.747  1.00 0.00 ? 25 PHE B HB2  5  
ATOM   3814  H HB3  . PHE B 2 25 ? -7.078  -9.246  -6.057  1.00 0.00 ? 25 PHE B HB3  5  
ATOM   3815  H HD1  . PHE B 2 25 ? -4.860  -6.783  -4.607  1.00 0.00 ? 25 PHE B HD1  5  
ATOM   3816  H HD2  . PHE B 2 25 ? -7.875  -9.694  -3.654  1.00 0.00 ? 25 PHE B HD2  5  
ATOM   3817  H HE1  . PHE B 2 25 ? -4.070  -6.831  -2.267  1.00 0.00 ? 25 PHE B HE1  5  
ATOM   3818  H HE2  . PHE B 2 25 ? -7.082  -9.737  -1.307  1.00 0.00 ? 25 PHE B HE2  5  
ATOM   3819  H HZ   . PHE B 2 25 ? -5.180  -8.308  -0.613  1.00 0.00 ? 25 PHE B HZ   5  
ATOM   3820  N N    . TYR B 2 26 ? -6.321  -5.304  -7.622  1.00 0.00 ? 26 TYR B N    5  
ATOM   3821  C CA   . TYR B 2 26 ? -6.487  -3.825  -7.542  1.00 0.00 ? 26 TYR B CA   5  
ATOM   3822  C C    . TYR B 2 26 ? -7.700  -3.494  -6.670  1.00 0.00 ? 26 TYR B C    5  
ATOM   3823  O O    . TYR B 2 26 ? -8.769  -4.047  -6.839  1.00 0.00 ? 26 TYR B O    5  
ATOM   3824  C CB   . TYR B 2 26 ? -6.705  -3.257  -8.948  1.00 0.00 ? 26 TYR B CB   5  
ATOM   3825  C CG   . TYR B 2 26 ? -5.920  -1.976  -9.104  1.00 0.00 ? 26 TYR B CG   5  
ATOM   3826  C CD1  . TYR B 2 26 ? -4.615  -1.888  -8.603  1.00 0.00 ? 26 TYR B CD1  5  
ATOM   3827  C CD2  . TYR B 2 26 ? -6.499  -0.876  -9.749  1.00 0.00 ? 26 TYR B CD2  5  
ATOM   3828  C CE1  . TYR B 2 26 ? -3.887  -0.700  -8.748  1.00 0.00 ? 26 TYR B CE1  5  
ATOM   3829  C CE2  . TYR B 2 26 ? -5.771  0.314   -9.894  1.00 0.00 ? 26 TYR B CE2  5  
ATOM   3830  C CZ   . TYR B 2 26 ? -4.465  0.401   -9.393  1.00 0.00 ? 26 TYR B CZ   5  
ATOM   3831  O OH   . TYR B 2 26 ? -3.748  1.572   -9.535  1.00 0.00 ? 26 TYR B OH   5  
ATOM   3832  H H    . TYR B 2 26 ? -6.376  -5.757  -8.490  1.00 0.00 ? 26 TYR B H    5  
ATOM   3833  H HA   . TYR B 2 26 ? -5.602  -3.386  -7.108  1.00 0.00 ? 26 TYR B HA   5  
ATOM   3834  H HB2  . TYR B 2 26 ? -6.371  -3.976  -9.682  1.00 0.00 ? 26 TYR B HB2  5  
ATOM   3835  H HB3  . TYR B 2 26 ? -7.755  -3.054  -9.095  1.00 0.00 ? 26 TYR B HB3  5  
ATOM   3836  H HD1  . TYR B 2 26 ? -4.168  -2.736  -8.106  1.00 0.00 ? 26 TYR B HD1  5  
ATOM   3837  H HD2  . TYR B 2 26 ? -7.505  -0.943  -10.135 1.00 0.00 ? 26 TYR B HD2  5  
ATOM   3838  H HE1  . TYR B 2 26 ? -2.881  -0.632  -8.361  1.00 0.00 ? 26 TYR B HE1  5  
ATOM   3839  H HE2  . TYR B 2 26 ? -6.217  1.162   -10.392 1.00 0.00 ? 26 TYR B HE2  5  
ATOM   3840  H HH   . TYR B 2 26 ? -4.374  2.287   -9.665  1.00 0.00 ? 26 TYR B HH   5  
ATOM   3841  N N    . THR B 2 27 ? -7.544  -2.595  -5.737  1.00 0.00 ? 27 THR B N    5  
ATOM   3842  C CA   . THR B 2 27 ? -8.688  -2.227  -4.854  1.00 0.00 ? 27 THR B CA   5  
ATOM   3843  C C    . THR B 2 27 ? -9.542  -1.161  -5.544  1.00 0.00 ? 27 THR B C    5  
ATOM   3844  O O    . THR B 2 27 ? -9.299  -0.795  -6.677  1.00 0.00 ? 27 THR B O    5  
ATOM   3845  C CB   . THR B 2 27 ? -8.153  -1.674  -3.531  1.00 0.00 ? 27 THR B CB   5  
ATOM   3846  O OG1  . THR B 2 27 ? -7.086  -0.773  -3.795  1.00 0.00 ? 27 THR B OG1  5  
ATOM   3847  C CG2  . THR B 2 27 ? -7.647  -2.825  -2.662  1.00 0.00 ? 27 THR B CG2  5  
ATOM   3848  H H    . THR B 2 27 ? -6.674  -2.159  -5.619  1.00 0.00 ? 27 THR B H    5  
ATOM   3849  H HA   . THR B 2 27 ? -9.291  -3.102  -4.662  1.00 0.00 ? 27 THR B HA   5  
ATOM   3850  H HB   . THR B 2 27 ? -8.943  -1.157  -3.011  1.00 0.00 ? 27 THR B HB   5  
ATOM   3851  H HG1  . THR B 2 27 ? -7.138  -0.056  -3.158  1.00 0.00 ? 27 THR B HG1  5  
ATOM   3852  H HG21 . THR B 2 27 ? -8.101  -2.765  -1.684  1.00 0.00 ? 27 THR B HG21 5  
ATOM   3853  H HG22 . THR B 2 27 ? -6.573  -2.759  -2.564  1.00 0.00 ? 27 THR B HG22 5  
ATOM   3854  H HG23 . THR B 2 27 ? -7.908  -3.767  -3.123  1.00 0.00 ? 27 THR B HG23 5  
ATOM   3855  N N    . LYS B 2 28 ? -10.540 -0.657  -4.870  1.00 0.00 ? 28 LYS B N    5  
ATOM   3856  C CA   . LYS B 2 28 ? -11.407 0.385   -5.489  1.00 0.00 ? 28 LYS B CA   5  
ATOM   3857  C C    . LYS B 2 28 ? -12.118 1.182   -4.390  1.00 0.00 ? 28 LYS B C    5  
ATOM   3858  O O    . LYS B 2 28 ? -13.268 0.931   -4.090  1.00 0.00 ? 28 LYS B O    5  
ATOM   3859  C CB   . LYS B 2 28 ? -12.446 -0.283  -6.390  1.00 0.00 ? 28 LYS B CB   5  
ATOM   3860  C CG   . LYS B 2 28 ? -12.262 0.207   -7.827  1.00 0.00 ? 28 LYS B CG   5  
ATOM   3861  C CD   . LYS B 2 28 ? -12.903 -0.790  -8.793  1.00 0.00 ? 28 LYS B CD   5  
ATOM   3862  C CE   . LYS B 2 28 ? -13.207 -0.093  -10.121 1.00 0.00 ? 28 LYS B CE   5  
ATOM   3863  N NZ   . LYS B 2 28 ? -14.643 -0.294  -10.468 1.00 0.00 ? 28 LYS B NZ   5  
ATOM   3864  H H    . LYS B 2 28 ? -10.720 -0.965  -3.956  1.00 0.00 ? 28 LYS B H    5  
ATOM   3865  H HA   . LYS B 2 28 ? -10.798 1.054   -6.078  1.00 0.00 ? 28 LYS B HA   5  
ATOM   3866  H HB2  . LYS B 2 28 ? -12.319 -1.356  -6.356  1.00 0.00 ? 28 LYS B HB2  5  
ATOM   3867  H HB3  . LYS B 2 28 ? -13.439 -0.028  -6.049  1.00 0.00 ? 28 LYS B HB3  5  
ATOM   3868  H HG2  . LYS B 2 28 ? -12.732 1.174   -7.940  1.00 0.00 ? 28 LYS B HG2  5  
ATOM   3869  H HG3  . LYS B 2 28 ? -11.208 0.290   -8.045  1.00 0.00 ? 28 LYS B HG3  5  
ATOM   3870  H HD2  . LYS B 2 28 ? -12.222 -1.611  -8.967  1.00 0.00 ? 28 LYS B HD2  5  
ATOM   3871  H HD3  . LYS B 2 28 ? -13.820 -1.167  -8.368  1.00 0.00 ? 28 LYS B HD3  5  
ATOM   3872  H HE2  . LYS B 2 28 ? -13.004 0.964   -10.028 1.00 0.00 ? 28 LYS B HE2  5  
ATOM   3873  H HE3  . LYS B 2 28 ? -12.586 -0.512  -10.898 1.00 0.00 ? 28 LYS B HE3  5  
ATOM   3874  H HZ1  . LYS B 2 28 ? -14.862 0.219   -11.345 1.00 0.00 ? 28 LYS B HZ1  5  
ATOM   3875  H HZ2  . LYS B 2 28 ? -15.239 0.068   -9.696  1.00 0.00 ? 28 LYS B HZ2  5  
ATOM   3876  H HZ3  . LYS B 2 28 ? -14.828 -1.307  -10.606 1.00 0.00 ? 28 LYS B HZ3  5  
ATOM   3877  N N    . PRO B 2 29 ? -11.404 2.121   -3.824  1.00 0.00 ? 29 PRO B N    5  
ATOM   3878  C CA   . PRO B 2 29 ? -11.927 2.981   -2.749  1.00 0.00 ? 29 PRO B CA   5  
ATOM   3879  C C    . PRO B 2 29 ? -12.804 4.092   -3.335  1.00 0.00 ? 29 PRO B C    5  
ATOM   3880  O O    . PRO B 2 29 ? -12.520 4.632   -4.385  1.00 0.00 ? 29 PRO B O    5  
ATOM   3881  C CB   . PRO B 2 29 ? -10.665 3.565   -2.111  1.00 0.00 ? 29 PRO B CB   5  
ATOM   3882  C CG   . PRO B 2 29 ? -9.552  3.474   -3.182  1.00 0.00 ? 29 PRO B CG   5  
ATOM   3883  C CD   . PRO B 2 29 ? -10.005 2.409   -4.200  1.00 0.00 ? 29 PRO B CD   5  
ATOM   3884  H HA   . PRO B 2 29 ? -12.474 2.401   -2.025  1.00 0.00 ? 29 PRO B HA   5  
ATOM   3885  H HB2  . PRO B 2 29 ? -10.834 4.596   -1.832  1.00 0.00 ? 29 PRO B HB2  5  
ATOM   3886  H HB3  . PRO B 2 29 ? -10.384 2.985   -1.246  1.00 0.00 ? 29 PRO B HB3  5  
ATOM   3887  H HG2  . PRO B 2 29 ? -9.432  4.431   -3.672  1.00 0.00 ? 29 PRO B HG2  5  
ATOM   3888  H HG3  . PRO B 2 29 ? -8.623  3.170   -2.726  1.00 0.00 ? 29 PRO B HG3  5  
ATOM   3889  H HD2  . PRO B 2 29 ? -9.955  2.804   -5.206  1.00 0.00 ? 29 PRO B HD2  5  
ATOM   3890  H HD3  . PRO B 2 29 ? -9.404  1.519   -4.111  1.00 0.00 ? 29 PRO B HD3  5  
ATOM   3891  N N    . THR B 2 30 ? -13.867 4.438   -2.661  1.00 0.00 ? 30 THR B N    5  
ATOM   3892  C CA   . THR B 2 30 ? -14.757 5.514   -3.178  1.00 0.00 ? 30 THR B CA   5  
ATOM   3893  C C    . THR B 2 30 ? -13.946 6.795   -3.377  1.00 0.00 ? 30 THR B C    5  
ATOM   3894  O O    . THR B 2 30 ? -14.505 7.756   -3.880  1.00 0.00 ? 30 THR B O    5  
ATOM   3895  C CB   . THR B 2 30 ? -15.882 5.772   -2.172  1.00 0.00 ? 30 THR B CB   5  
ATOM   3896  O OG1  . THR B 2 30 ? -16.612 6.925   -2.568  1.00 0.00 ? 30 THR B OG1  5  
ATOM   3897  C CG2  . THR B 2 30 ? -15.285 5.997   -0.782  1.00 0.00 ? 30 THR B CG2  5  
ATOM   3898  O OXT  . THR B 2 30 ? -12.779 6.794   -3.023  1.00 0.00 ? 30 THR B OXT  5  
ATOM   3899  H H    . THR B 2 30 ? -14.077 3.991   -1.815  1.00 0.00 ? 30 THR B H    5  
ATOM   3900  H HA   . THR B 2 30 ? -15.182 5.208   -4.122  1.00 0.00 ? 30 THR B HA   5  
ATOM   3901  H HB   . THR B 2 30 ? -16.542 4.920   -2.142  1.00 0.00 ? 30 THR B HB   5  
ATOM   3902  H HG1  . THR B 2 30 ? -16.620 6.957   -3.527  1.00 0.00 ? 30 THR B HG1  5  
ATOM   3903  H HG21 . THR B 2 30 ? -14.211 6.078   -0.860  1.00 0.00 ? 30 THR B HG21 5  
ATOM   3904  H HG22 . THR B 2 30 ? -15.537 5.163   -0.144  1.00 0.00 ? 30 THR B HG22 5  
ATOM   3905  H HG23 . THR B 2 30 ? -15.684 6.908   -0.360  1.00 0.00 ? 30 THR B HG23 5  
ATOM   3906  N N    . GLY A 1 1  ? -6.836  4.223   -0.894  1.00 0.00 ? 1  GLY A N    6  
ATOM   3907  C CA   . GLY A 1 1  ? -6.209  2.965   -1.496  1.00 0.00 ? 1  GLY A CA   6  
ATOM   3908  C C    . GLY A 1 1  ? -4.870  3.051   -2.147  1.00 0.00 ? 1  GLY A C    6  
ATOM   3909  O O    . GLY A 1 1  ? -4.262  4.101   -2.206  1.00 0.00 ? 1  GLY A O    6  
ATOM   3910  H H1   . GLY A 1 1  ? -6.122  4.732   -0.334  1.00 0.00 ? 1  GLY A H1   6  
ATOM   3911  H H2   . GLY A 1 1  ? -7.632  3.954   -0.280  1.00 0.00 ? 1  GLY A H2   6  
ATOM   3912  H H3   . GLY A 1 1  ? -7.180  4.838   -1.658  1.00 0.00 ? 1  GLY A H3   6  
ATOM   3913  H HA2  . GLY A 1 1  ? -5.728  2.452   -0.820  1.00 0.00 ? 1  GLY A HA2  6  
ATOM   3914  H HA3  . GLY A 1 1  ? -7.071  2.360   -1.997  1.00 0.00 ? 1  GLY A HA3  6  
HETATM 3915  N N    . IIL A 1 2  ? -4.374  1.952   -2.647  1.00 0.00 ? 2  IIL A N    6  
HETATM 3916  C CA   . IIL A 1 2  ? -3.038  1.967   -3.308  1.00 0.00 ? 2  IIL A CA   6  
HETATM 3917  C C    . IIL A 1 2  ? -3.102  2.801   -4.591  1.00 0.00 ? 2  IIL A C    6  
HETATM 3918  O O    . IIL A 1 2  ? -2.093  3.251   -5.097  1.00 0.00 ? 2  IIL A O    6  
HETATM 3919  C CB   . IIL A 1 2  ? -2.625  0.535   -3.654  1.00 0.00 ? 2  IIL A CB   6  
HETATM 3920  C CG2  . IIL A 1 2  ? -1.172  0.528   -4.135  1.00 0.00 ? 2  IIL A CG2  6  
HETATM 3921  C CG1  . IIL A 1 2  ? -3.533  -0.002  -4.764  1.00 0.00 ? 2  IIL A CG1  6  
HETATM 3922  C CD1  . IIL A 1 2  ? -4.270  -1.245  -4.263  1.00 0.00 ? 2  IIL A CD1  6  
HETATM 3923  H H    . IIL A 1 2  ? -4.879  1.115   -2.586  1.00 0.00 ? 2  IIL A H    6  
HETATM 3924  H HA   . IIL A 1 2  ? -2.311  2.398   -2.635  1.00 0.00 ? 2  IIL A HA   6  
HETATM 3925  H HB   . IIL A 1 2  ? -2.717  -0.090  -2.779  1.00 0.00 ? 2  IIL A HB   6  
HETATM 3926  H HG21 . IIL A 1 2  ? -0.658  -0.321  -3.711  1.00 0.00 ? 2  IIL A HG21 6  
HETATM 3927  H HG22 . IIL A 1 2  ? -0.684  1.439   -3.820  1.00 0.00 ? 2  IIL A HG22 6  
HETATM 3928  H HG23 . IIL A 1 2  ? -1.150  0.461   -5.212  1.00 0.00 ? 2  IIL A HG23 6  
HETATM 3929  H HG12 . IIL A 1 2  ? -2.935  -0.263  -5.624  1.00 0.00 ? 2  IIL A HG12 6  
HETATM 3930  H HG13 . IIL A 1 2  ? -4.251  0.757   -5.040  1.00 0.00 ? 2  IIL A HG13 6  
HETATM 3931  H HD11 . IIL A 1 2  ? -5.300  -1.207  -4.587  1.00 0.00 ? 2  IIL A HD11 6  
HETATM 3932  H HD12 . IIL A 1 2  ? -4.234  -1.275  -3.184  1.00 0.00 ? 2  IIL A HD12 6  
HETATM 3933  H HD13 . IIL A 1 2  ? -3.799  -2.130  -4.664  1.00 0.00 ? 2  IIL A HD13 6  
ATOM   3934  N N    . VAL A 1 3  ? -4.274  3.004   -5.125  1.00 0.00 ? 3  VAL A N    6  
ATOM   3935  C CA   . VAL A 1 3  ? -4.391  3.803   -6.377  1.00 0.00 ? 3  VAL A CA   6  
ATOM   3936  C C    . VAL A 1 3  ? -4.415  5.295   -6.038  1.00 0.00 ? 3  VAL A C    6  
ATOM   3937  O O    . VAL A 1 3  ? -3.769  6.096   -6.683  1.00 0.00 ? 3  VAL A O    6  
ATOM   3938  C CB   . VAL A 1 3  ? -5.683  3.424   -7.102  1.00 0.00 ? 3  VAL A CB   6  
ATOM   3939  C CG1  . VAL A 1 3  ? -5.856  4.316   -8.332  1.00 0.00 ? 3  VAL A CG1  6  
ATOM   3940  C CG2  . VAL A 1 3  ? -5.608  1.962   -7.543  1.00 0.00 ? 3  VAL A CG2  6  
ATOM   3941  H H    . VAL A 1 3  ? -5.077  2.629   -4.707  1.00 0.00 ? 3  VAL A H    6  
ATOM   3942  H HA   . VAL A 1 3  ? -3.547  3.593   -7.016  1.00 0.00 ? 3  VAL A HA   6  
ATOM   3943  H HB   . VAL A 1 3  ? -6.524  3.561   -6.437  1.00 0.00 ? 3  VAL A HB   6  
ATOM   3944  H HG11 . VAL A 1 3  ? -6.895  4.327   -8.626  1.00 0.00 ? 3  VAL A HG11 6  
ATOM   3945  H HG12 . VAL A 1 3  ? -5.257  3.931   -9.143  1.00 0.00 ? 3  VAL A HG12 6  
ATOM   3946  H HG13 . VAL A 1 3  ? -5.538  5.320   -8.096  1.00 0.00 ? 3  VAL A HG13 6  
ATOM   3947  H HG21 . VAL A 1 3  ? -5.575  1.324   -6.671  1.00 0.00 ? 3  VAL A HG21 6  
ATOM   3948  H HG22 . VAL A 1 3  ? -4.718  1.808   -8.134  1.00 0.00 ? 3  VAL A HG22 6  
ATOM   3949  H HG23 . VAL A 1 3  ? -6.479  1.718   -8.133  1.00 0.00 ? 3  VAL A HG23 6  
ATOM   3950  N N    . GLU A 1 4  ? -5.156  5.677   -5.035  1.00 0.00 ? 4  GLU A N    6  
ATOM   3951  C CA   . GLU A 1 4  ? -5.215  7.120   -4.669  1.00 0.00 ? 4  GLU A CA   6  
ATOM   3952  C C    . GLU A 1 4  ? -3.954  7.506   -3.892  1.00 0.00 ? 4  GLU A C    6  
ATOM   3953  O O    . GLU A 1 4  ? -3.789  8.639   -3.484  1.00 0.00 ? 4  GLU A O    6  
ATOM   3954  C CB   . GLU A 1 4  ? -6.449  7.378   -3.800  1.00 0.00 ? 4  GLU A CB   6  
ATOM   3955  C CG   . GLU A 1 4  ? -7.712  7.269   -4.658  1.00 0.00 ? 4  GLU A CG   6  
ATOM   3956  C CD   . GLU A 1 4  ? -8.408  8.630   -4.720  1.00 0.00 ? 4  GLU A CD   6  
ATOM   3957  O OE1  . GLU A 1 4  ? -7.862  9.525   -5.343  1.00 0.00 ? 4  GLU A OE1  6  
ATOM   3958  O OE2  . GLU A 1 4  ? -9.475  8.755   -4.140  1.00 0.00 ? 4  GLU A OE2  6  
ATOM   3959  H H    . GLU A 1 4  ? -5.674  5.019   -4.526  1.00 0.00 ? 4  GLU A H    6  
ATOM   3960  H HA   . GLU A 1 4  ? -5.278  7.715   -5.568  1.00 0.00 ? 4  GLU A HA   6  
ATOM   3961  H HB2  . GLU A 1 4  ? -6.489  6.648   -3.005  1.00 0.00 ? 4  GLU A HB2  6  
ATOM   3962  H HB3  . GLU A 1 4  ? -6.389  8.369   -3.377  1.00 0.00 ? 4  GLU A HB3  6  
ATOM   3963  H HG2  . GLU A 1 4  ? -7.443  6.957   -5.656  1.00 0.00 ? 4  GLU A HG2  6  
ATOM   3964  H HG3  . GLU A 1 4  ? -8.383  6.544   -4.221  1.00 0.00 ? 4  GLU A HG3  6  
ATOM   3965  N N    . GLN A 1 5  ? -3.062  6.577   -3.682  1.00 0.00 ? 5  GLN A N    6  
ATOM   3966  C CA   . GLN A 1 5  ? -1.817  6.900   -2.932  1.00 0.00 ? 5  GLN A CA   6  
ATOM   3967  C C    . GLN A 1 5  ? -0.629  6.973   -3.900  1.00 0.00 ? 5  GLN A C    6  
ATOM   3968  O O    . GLN A 1 5  ? 0.182   7.877   -3.830  1.00 0.00 ? 5  GLN A O    6  
ATOM   3969  C CB   . GLN A 1 5  ? -1.562  5.825   -1.871  1.00 0.00 ? 5  GLN A CB   6  
ATOM   3970  C CG   . GLN A 1 5  ? -2.480  6.065   -0.671  1.00 0.00 ? 5  GLN A CG   6  
ATOM   3971  C CD   . GLN A 1 5  ? -1.703  6.790   0.429   1.00 0.00 ? 5  GLN A CD   6  
ATOM   3972  O OE1  . GLN A 1 5  ? -0.927  7.682   0.153   1.00 0.00 ? 5  GLN A OE1  6  
ATOM   3973  N NE2  . GLN A 1 5  ? -1.878  6.441   1.676   1.00 0.00 ? 5  GLN A NE2  6  
ATOM   3974  H H    . GLN A 1 5  ? -3.210  5.667   -4.018  1.00 0.00 ? 5  GLN A H    6  
ATOM   3975  H HA   . GLN A 1 5  ? -1.936  7.857   -2.446  1.00 0.00 ? 5  GLN A HA   6  
ATOM   3976  H HB2  . GLN A 1 5  ? -1.764  4.849   -2.288  1.00 0.00 ? 5  GLN A HB2  6  
ATOM   3977  H HB3  . GLN A 1 5  ? -0.533  5.872   -1.547  1.00 0.00 ? 5  GLN A HB3  6  
ATOM   3978  H HG2  . GLN A 1 5  ? -3.322  6.668   -0.977  1.00 0.00 ? 5  GLN A HG2  6  
ATOM   3979  H HG3  . GLN A 1 5  ? -2.835  5.117   -0.293  1.00 0.00 ? 5  GLN A HG3  6  
ATOM   3980  H HE21 . GLN A 1 5  ? -2.504  5.722   1.900   1.00 0.00 ? 5  GLN A HE21 6  
ATOM   3981  H HE22 . GLN A 1 5  ? -1.385  6.901   2.387   1.00 0.00 ? 5  GLN A HE22 6  
ATOM   3982  N N    . CYS A 1 6  ? -0.516  6.035   -4.805  1.00 0.00 ? 6  CYS A N    6  
ATOM   3983  C CA   . CYS A 1 6  ? 0.625   6.068   -5.762  1.00 0.00 ? 6  CYS A CA   6  
ATOM   3984  C C    . CYS A 1 6  ? 0.294   7.012   -6.918  1.00 0.00 ? 6  CYS A C    6  
ATOM   3985  O O    . CYS A 1 6  ? 1.171   7.493   -7.609  1.00 0.00 ? 6  CYS A O    6  
ATOM   3986  C CB   . CYS A 1 6  ? 0.891   4.665   -6.307  1.00 0.00 ? 6  CYS A CB   6  
ATOM   3987  S SG   . CYS A 1 6  ? 1.779   3.691   -5.068  1.00 0.00 ? 6  CYS A SG   6  
ATOM   3988  H H    . CYS A 1 6  ? -1.178  5.314   -4.856  1.00 0.00 ? 6  CYS A H    6  
ATOM   3989  H HA   . CYS A 1 6  ? 1.509   6.427   -5.252  1.00 0.00 ? 6  CYS A HA   6  
ATOM   3990  H HB2  . CYS A 1 6  ? -0.042  4.182   -6.546  1.00 0.00 ? 6  CYS A HB2  6  
ATOM   3991  H HB3  . CYS A 1 6  ? 1.486   4.738   -7.197  1.00 0.00 ? 6  CYS A HB3  6  
ATOM   3992  N N    . CYS A 1 7  ? -0.964  7.288   -7.131  1.00 0.00 ? 7  CYS A N    6  
ATOM   3993  C CA   . CYS A 1 7  ? -1.343  8.209   -8.237  1.00 0.00 ? 7  CYS A CA   6  
ATOM   3994  C C    . CYS A 1 7  ? -1.474  9.624   -7.678  1.00 0.00 ? 7  CYS A C    6  
ATOM   3995  O O    . CYS A 1 7  ? -1.397  10.599  -8.398  1.00 0.00 ? 7  CYS A O    6  
ATOM   3996  C CB   . CYS A 1 7  ? -2.669  7.758   -8.858  1.00 0.00 ? 7  CYS A CB   6  
ATOM   3997  S SG   . CYS A 1 7  ? -2.904  8.566   -10.462 1.00 0.00 ? 7  CYS A SG   6  
ATOM   3998  H H    . CYS A 1 7  ? -1.657  6.894   -6.560  1.00 0.00 ? 7  CYS A H    6  
ATOM   3999  H HA   . CYS A 1 7  ? -0.571  8.199   -8.987  1.00 0.00 ? 7  CYS A HA   6  
ATOM   4000  H HB2  . CYS A 1 7  ? -2.654  6.686   -8.995  1.00 0.00 ? 7  CYS A HB2  6  
ATOM   4001  H HB3  . CYS A 1 7  ? -3.481  8.023   -8.201  1.00 0.00 ? 7  CYS A HB3  6  
ATOM   4002  N N    . THR A 1 8  ? -1.643  9.744   -6.390  1.00 0.00 ? 8  THR A N    6  
ATOM   4003  C CA   . THR A 1 8  ? -1.746  11.095  -5.776  1.00 0.00 ? 8  THR A CA   6  
ATOM   4004  C C    . THR A 1 8  ? -0.328  11.623  -5.558  1.00 0.00 ? 8  THR A C    6  
ATOM   4005  O O    . THR A 1 8  ? -0.100  12.811  -5.447  1.00 0.00 ? 8  THR A O    6  
ATOM   4006  C CB   . THR A 1 8  ? -2.476  10.999  -4.434  1.00 0.00 ? 8  THR A CB   6  
ATOM   4007  O OG1  . THR A 1 8  ? -2.717  12.307  -3.933  1.00 0.00 ? 8  THR A OG1  6  
ATOM   4008  C CG2  . THR A 1 8  ? -1.619  10.218  -3.439  1.00 0.00 ? 8  THR A CG2  6  
ATOM   4009  H H    . THR A 1 8  ? -1.682  8.944   -5.823  1.00 0.00 ? 8  THR A H    6  
ATOM   4010  H HA   . THR A 1 8  ? -2.283  11.756  -6.440  1.00 0.00 ? 8  THR A HA   6  
ATOM   4011  H HB   . THR A 1 8  ? -3.416  10.487  -4.572  1.00 0.00 ? 8  THR A HB   6  
ATOM   4012  H HG1  . THR A 1 8  ? -1.909  12.815  -4.027  1.00 0.00 ? 8  THR A HG1  6  
ATOM   4013  H HG21 . THR A 1 8  ? -1.590  9.177   -3.728  1.00 0.00 ? 8  THR A HG21 6  
ATOM   4014  H HG22 . THR A 1 8  ? -2.045  10.305  -2.451  1.00 0.00 ? 8  THR A HG22 6  
ATOM   4015  H HG23 . THR A 1 8  ? -0.616  10.618  -3.436  1.00 0.00 ? 8  THR A HG23 6  
ATOM   4016  N N    . SER A 1 9  ? 0.627   10.732  -5.507  1.00 0.00 ? 9  SER A N    6  
ATOM   4017  C CA   . SER A 1 9  ? 2.044   11.146  -5.312  1.00 0.00 ? 9  SER A CA   6  
ATOM   4018  C C    . SER A 1 9  ? 2.948   9.958   -5.645  1.00 0.00 ? 9  SER A C    6  
ATOM   4019  O O    . SER A 1 9  ? 2.492   8.941   -6.130  1.00 0.00 ? 9  SER A O    6  
ATOM   4020  C CB   . SER A 1 9  ? 2.260   11.562  -3.858  1.00 0.00 ? 9  SER A CB   6  
ATOM   4021  O OG   . SER A 1 9  ? 1.353   12.606  -3.530  1.00 0.00 ? 9  SER A OG   6  
ATOM   4022  H H    . SER A 1 9  ? 0.411   9.782   -5.608  1.00 0.00 ? 9  SER A H    6  
ATOM   4023  H HA   . SER A 1 9  ? 2.275   11.973  -5.967  1.00 0.00 ? 9  SER A HA   6  
ATOM   4024  H HB2  . SER A 1 9  ? 2.084   10.720  -3.211  1.00 0.00 ? 9  SER A HB2  6  
ATOM   4025  H HB3  . SER A 1 9  ? 3.278   11.902  -3.731  1.00 0.00 ? 9  SER A HB3  6  
ATOM   4026  H HG   . SER A 1 9  ? 1.862   13.409  -3.392  1.00 0.00 ? 9  SER A HG   6  
ATOM   4027  N N    . ILE A 1 10 ? 4.222   10.066  -5.390  1.00 0.00 ? 10 ILE A N    6  
ATOM   4028  C CA   . ILE A 1 10 ? 5.132   8.925   -5.697  1.00 0.00 ? 10 ILE A CA   6  
ATOM   4029  C C    . ILE A 1 10 ? 5.095   7.926   -4.534  1.00 0.00 ? 10 ILE A C    6  
ATOM   4030  O O    . ILE A 1 10 ? 4.746   8.262   -3.420  1.00 0.00 ? 10 ILE A O    6  
ATOM   4031  C CB   . ILE A 1 10 ? 6.568   9.443   -5.903  1.00 0.00 ? 10 ILE A CB   6  
ATOM   4032  C CG1  . ILE A 1 10 ? 6.749   9.869   -7.366  1.00 0.00 ? 10 ILE A CG1  6  
ATOM   4033  C CG2  . ILE A 1 10 ? 7.579   8.335   -5.570  1.00 0.00 ? 10 ILE A CG2  6  
ATOM   4034  C CD1  . ILE A 1 10 ? 8.244   10.005  -7.686  1.00 0.00 ? 10 ILE A CD1  6  
ATOM   4035  H H    . ILE A 1 10 ? 4.578   10.889  -4.995  1.00 0.00 ? 10 ILE A H    6  
ATOM   4036  H HA   . ILE A 1 10 ? 4.795   8.434   -6.599  1.00 0.00 ? 10 ILE A HA   6  
ATOM   4037  H HB   . ILE A 1 10 ? 6.739   10.290  -5.256  1.00 0.00 ? 10 ILE A HB   6  
ATOM   4038  H HG12 . ILE A 1 10 ? 6.308   9.126   -8.015  1.00 0.00 ? 10 ILE A HG12 6  
ATOM   4039  H HG13 . ILE A 1 10 ? 6.262   10.819  -7.526  1.00 0.00 ? 10 ILE A HG13 6  
ATOM   4040  H HG21 . ILE A 1 10 ? 7.436   8.014   -4.549  1.00 0.00 ? 10 ILE A HG21 6  
ATOM   4041  H HG22 . ILE A 1 10 ? 8.582   8.715   -5.691  1.00 0.00 ? 10 ILE A HG22 6  
ATOM   4042  H HG23 . ILE A 1 10 ? 7.428   7.499   -6.236  1.00 0.00 ? 10 ILE A HG23 6  
ATOM   4043  H HD11 . ILE A 1 10 ? 8.717   10.627  -6.940  1.00 0.00 ? 10 ILE A HD11 6  
ATOM   4044  H HD12 . ILE A 1 10 ? 8.365   10.455  -8.660  1.00 0.00 ? 10 ILE A HD12 6  
ATOM   4045  H HD13 . ILE A 1 10 ? 8.703   9.028   -7.682  1.00 0.00 ? 10 ILE A HD13 6  
ATOM   4046  N N    . CYS A 1 11 ? 5.469   6.703   -4.790  1.00 0.00 ? 11 CYS A N    6  
ATOM   4047  C CA   . CYS A 1 11 ? 5.476   5.676   -3.712  1.00 0.00 ? 11 CYS A CA   6  
ATOM   4048  C C    . CYS A 1 11 ? 6.573   4.652   -4.019  1.00 0.00 ? 11 CYS A C    6  
ATOM   4049  O O    . CYS A 1 11 ? 7.511   4.940   -4.736  1.00 0.00 ? 11 CYS A O    6  
ATOM   4050  C CB   . CYS A 1 11 ? 4.110   4.986   -3.645  1.00 0.00 ? 11 CYS A CB   6  
ATOM   4051  S SG   . CYS A 1 11 ? 3.703   4.280   -5.261  1.00 0.00 ? 11 CYS A SG   6  
ATOM   4052  H H    . CYS A 1 11 ? 5.756   6.461   -5.696  1.00 0.00 ? 11 CYS A H    6  
ATOM   4053  H HA   . CYS A 1 11 ? 5.687   6.152   -2.765  1.00 0.00 ? 11 CYS A HA   6  
ATOM   4054  H HB2  . CYS A 1 11 ? 4.137   4.200   -2.906  1.00 0.00 ? 11 CYS A HB2  6  
ATOM   4055  H HB3  . CYS A 1 11 ? 3.357   5.709   -3.370  1.00 0.00 ? 11 CYS A HB3  6  
ATOM   4056  N N    . SER A 1 12 ? 6.477   3.466   -3.487  1.00 0.00 ? 12 SER A N    6  
ATOM   4057  C CA   . SER A 1 12 ? 7.531   2.452   -3.762  1.00 0.00 ? 12 SER A CA   6  
ATOM   4058  C C    . SER A 1 12 ? 6.896   1.073   -3.946  1.00 0.00 ? 12 SER A C    6  
ATOM   4059  O O    . SER A 1 12 ? 5.811   0.801   -3.466  1.00 0.00 ? 12 SER A O    6  
ATOM   4060  C CB   . SER A 1 12 ? 8.511   2.404   -2.590  1.00 0.00 ? 12 SER A CB   6  
ATOM   4061  O OG   . SER A 1 12 ? 7.788   2.515   -1.371  1.00 0.00 ? 12 SER A OG   6  
ATOM   4062  H H    . SER A 1 12 ? 5.720   3.245   -2.905  1.00 0.00 ? 12 SER A H    6  
ATOM   4063  H HA   . SER A 1 12 ? 8.064   2.723   -4.662  1.00 0.00 ? 12 SER A HA   6  
ATOM   4064  H HB2  . SER A 1 12 ? 9.043   1.467   -2.603  1.00 0.00 ? 12 SER A HB2  6  
ATOM   4065  H HB3  . SER A 1 12 ? 9.216   3.219   -2.679  1.00 0.00 ? 12 SER A HB3  6  
ATOM   4066  H HG   . SER A 1 12 ? 7.401   1.659   -1.178  1.00 0.00 ? 12 SER A HG   6  
ATOM   4067  N N    . LEU A 1 13 ? 7.576   0.196   -4.633  1.00 0.00 ? 13 LEU A N    6  
ATOM   4068  C CA   . LEU A 1 13 ? 7.024   -1.172  -4.843  1.00 0.00 ? 13 LEU A CA   6  
ATOM   4069  C C    . LEU A 1 13 ? 7.021   -1.909  -3.504  1.00 0.00 ? 13 LEU A C    6  
ATOM   4070  O O    . LEU A 1 13 ? 6.352   -2.909  -3.336  1.00 0.00 ? 13 LEU A O    6  
ATOM   4071  C CB   . LEU A 1 13 ? 7.892   -1.950  -5.843  1.00 0.00 ? 13 LEU A CB   6  
ATOM   4072  C CG   . LEU A 1 13 ? 8.606   -0.983  -6.792  1.00 0.00 ? 13 LEU A CG   6  
ATOM   4073  C CD1  . LEU A 1 13 ? 10.020  -0.710  -6.274  1.00 0.00 ? 13 LEU A CD1  6  
ATOM   4074  C CD2  . LEU A 1 13 ? 8.692   -1.605  -8.187  1.00 0.00 ? 13 LEU A CD2  6  
ATOM   4075  H H    . LEU A 1 13 ? 8.450   0.438   -4.998  1.00 0.00 ? 13 LEU A H    6  
ATOM   4076  H HA   . LEU A 1 13 ? 6.009   -1.100  -5.221  1.00 0.00 ? 13 LEU A HA   6  
ATOM   4077  H HB2  . LEU A 1 13 ? 8.627   -2.529  -5.303  1.00 0.00 ? 13 LEU A HB2  6  
ATOM   4078  H HB3  . LEU A 1 13 ? 7.265   -2.615  -6.418  1.00 0.00 ? 13 LEU A HB3  6  
ATOM   4079  H HG   . LEU A 1 13 ? 8.055   -0.054  -6.840  1.00 0.00 ? 13 LEU A HG   6  
ATOM   4080  H HD11 . LEU A 1 13 ? 10.731  -1.290  -6.844  1.00 0.00 ? 13 LEU A HD11 6  
ATOM   4081  H HD12 . LEU A 1 13 ? 10.083  -0.986  -5.232  1.00 0.00 ? 13 LEU A HD12 6  
ATOM   4082  H HD13 . LEU A 1 13 ? 10.246  0.341   -6.381  1.00 0.00 ? 13 LEU A HD13 6  
ATOM   4083  H HD21 . LEU A 1 13 ? 8.937   -2.653  -8.100  1.00 0.00 ? 13 LEU A HD21 6  
ATOM   4084  H HD22 . LEU A 1 13 ? 9.459   -1.101  -8.758  1.00 0.00 ? 13 LEU A HD22 6  
ATOM   4085  H HD23 . LEU A 1 13 ? 7.742   -1.497  -8.688  1.00 0.00 ? 13 LEU A HD23 6  
ATOM   4086  N N    . TYR A 1 14 ? 7.760   -1.417  -2.543  1.00 0.00 ? 14 TYR A N    6  
ATOM   4087  C CA   . TYR A 1 14 ? 7.788   -2.083  -1.214  1.00 0.00 ? 14 TYR A CA   6  
ATOM   4088  C C    . TYR A 1 14 ? 6.389   -2.020  -0.623  1.00 0.00 ? 14 TYR A C    6  
ATOM   4089  O O    . TYR A 1 14 ? 5.900   -2.965  -0.039  1.00 0.00 ? 14 TYR A O    6  
ATOM   4090  C CB   . TYR A 1 14 ? 8.773   -1.361  -0.292  1.00 0.00 ? 14 TYR A CB   6  
ATOM   4091  C CG   . TYR A 1 14 ? 10.189  -1.618  -0.768  1.00 0.00 ? 14 TYR A CG   6  
ATOM   4092  C CD1  . TYR A 1 14 ? 10.854  -2.795  -0.393  1.00 0.00 ? 14 TYR A CD1  6  
ATOM   4093  C CD2  . TYR A 1 14 ? 10.838  -0.680  -1.585  1.00 0.00 ? 14 TYR A CD2  6  
ATOM   4094  C CE1  . TYR A 1 14 ? 12.164  -3.032  -0.833  1.00 0.00 ? 14 TYR A CE1  6  
ATOM   4095  C CE2  . TYR A 1 14 ? 12.148  -0.919  -2.024  1.00 0.00 ? 14 TYR A CE2  6  
ATOM   4096  C CZ   . TYR A 1 14 ? 12.810  -2.094  -1.648  1.00 0.00 ? 14 TYR A CZ   6  
ATOM   4097  O OH   . TYR A 1 14 ? 14.099  -2.327  -2.081  1.00 0.00 ? 14 TYR A OH   6  
ATOM   4098  H H    . TYR A 1 14 ? 8.283   -0.605  -2.694  1.00 0.00 ? 14 TYR A H    6  
ATOM   4099  H HA   . TYR A 1 14 ? 8.083   -3.110  -1.331  1.00 0.00 ? 14 TYR A HA   6  
ATOM   4100  H HB2  . TYR A 1 14 ? 8.570   -0.299  -0.311  1.00 0.00 ? 14 TYR A HB2  6  
ATOM   4101  H HB3  . TYR A 1 14 ? 8.658   -1.731  0.716   1.00 0.00 ? 14 TYR A HB3  6  
ATOM   4102  H HD1  . TYR A 1 14 ? 10.359  -3.520  0.235   1.00 0.00 ? 14 TYR A HD1  6  
ATOM   4103  H HD2  . TYR A 1 14 ? 10.330  0.226   -1.878  1.00 0.00 ? 14 TYR A HD2  6  
ATOM   4104  H HE1  . TYR A 1 14 ? 12.675  -3.939  -0.544  1.00 0.00 ? 14 TYR A HE1  6  
ATOM   4105  H HE2  . TYR A 1 14 ? 12.646  -0.196  -2.652  1.00 0.00 ? 14 TYR A HE2  6  
ATOM   4106  H HH   . TYR A 1 14 ? 14.160  -2.048  -2.997  1.00 0.00 ? 14 TYR A HH   6  
ATOM   4107  N N    . GLN A 1 15 ? 5.735   -0.912  -0.800  1.00 0.00 ? 15 GLN A N    6  
ATOM   4108  C CA   . GLN A 1 15 ? 4.352   -0.775  -0.282  1.00 0.00 ? 15 GLN A CA   6  
ATOM   4109  C C    . GLN A 1 15 ? 3.418   -1.520  -1.234  1.00 0.00 ? 15 GLN A C    6  
ATOM   4110  O O    . GLN A 1 15 ? 2.317   -1.894  -0.884  1.00 0.00 ? 15 GLN A O    6  
ATOM   4111  C CB   . GLN A 1 15 ? 3.958   0.702   -0.229  1.00 0.00 ? 15 GLN A CB   6  
ATOM   4112  C CG   . GLN A 1 15 ? 4.968   1.472   0.622   1.00 0.00 ? 15 GLN A CG   6  
ATOM   4113  C CD   . GLN A 1 15 ? 4.383   2.834   0.999   1.00 0.00 ? 15 GLN A CD   6  
ATOM   4114  O OE1  . GLN A 1 15 ? 3.842   2.999   2.074   1.00 0.00 ? 15 GLN A OE1  6  
ATOM   4115  N NE2  . GLN A 1 15 ? 4.467   3.824   0.152   1.00 0.00 ? 15 GLN A NE2  6  
ATOM   4116  H H    . GLN A 1 15 ? 6.152   -0.176  -1.293  1.00 0.00 ? 15 GLN A H    6  
ATOM   4117  H HA   . GLN A 1 15 ? 4.291   -1.208  0.703   1.00 0.00 ? 15 GLN A HA   6  
ATOM   4118  H HB2  . GLN A 1 15 ? 3.947   1.106   -1.231  1.00 0.00 ? 15 GLN A HB2  6  
ATOM   4119  H HB3  . GLN A 1 15 ? 2.976   0.796   0.208   1.00 0.00 ? 15 GLN A HB3  6  
ATOM   4120  H HG2  . GLN A 1 15 ? 5.185   0.911   1.519   1.00 0.00 ? 15 GLN A HG2  6  
ATOM   4121  H HG3  . GLN A 1 15 ? 5.878   1.617   0.058   1.00 0.00 ? 15 GLN A HG3  6  
ATOM   4122  H HE21 . GLN A 1 15 ? 4.902   3.690   -0.716  1.00 0.00 ? 15 GLN A HE21 6  
ATOM   4123  H HE22 . GLN A 1 15 ? 4.095   4.699   0.383   1.00 0.00 ? 15 GLN A HE22 6  
ATOM   4124  N N    . LEU A 1 16 ? 3.866   -1.739  -2.440  1.00 0.00 ? 16 LEU A N    6  
ATOM   4125  C CA   . LEU A 1 16 ? 3.037   -2.463  -3.434  1.00 0.00 ? 16 LEU A CA   6  
ATOM   4126  C C    . LEU A 1 16 ? 2.983   -3.945  -3.058  1.00 0.00 ? 16 LEU A C    6  
ATOM   4127  O O    . LEU A 1 16 ? 2.120   -4.678  -3.497  1.00 0.00 ? 16 LEU A O    6  
ATOM   4128  C CB   . LEU A 1 16 ? 3.680   -2.301  -4.810  1.00 0.00 ? 16 LEU A CB   6  
ATOM   4129  C CG   . LEU A 1 16 ? 3.194   -1.000  -5.450  1.00 0.00 ? 16 LEU A CG   6  
ATOM   4130  C CD1  . LEU A 1 16 ? 3.867   -0.810  -6.811  1.00 0.00 ? 16 LEU A CD1  6  
ATOM   4131  C CD2  . LEU A 1 16 ? 1.676   -1.064  -5.638  1.00 0.00 ? 16 LEU A CD2  6  
ATOM   4132  H H    . LEU A 1 16 ? 4.760   -1.432  -2.694  1.00 0.00 ? 16 LEU A H    6  
ATOM   4133  H HA   . LEU A 1 16 ? 2.040   -2.053  -3.446  1.00 0.00 ? 16 LEU A HA   6  
ATOM   4134  H HB2  . LEU A 1 16 ? 4.751   -2.272  -4.700  1.00 0.00 ? 16 LEU A HB2  6  
ATOM   4135  H HB3  . LEU A 1 16 ? 3.411   -3.130  -5.435  1.00 0.00 ? 16 LEU A HB3  6  
ATOM   4136  H HG   . LEU A 1 16 ? 3.447   -0.169  -4.808  1.00 0.00 ? 16 LEU A HG   6  
ATOM   4137  H HD11 . LEU A 1 16 ? 3.882   -1.751  -7.340  1.00 0.00 ? 16 LEU A HD11 6  
ATOM   4138  H HD12 . LEU A 1 16 ? 4.879   -0.462  -6.666  1.00 0.00 ? 16 LEU A HD12 6  
ATOM   4139  H HD13 . LEU A 1 16 ? 3.315   -0.082  -7.386  1.00 0.00 ? 16 LEU A HD13 6  
ATOM   4140  H HD21 . LEU A 1 16 ? 1.404   -0.555  -6.551  1.00 0.00 ? 16 LEU A HD21 6  
ATOM   4141  H HD22 . LEU A 1 16 ? 1.188   -0.587  -4.800  1.00 0.00 ? 16 LEU A HD22 6  
ATOM   4142  H HD23 . LEU A 1 16 ? 1.364   -2.096  -5.695  1.00 0.00 ? 16 LEU A HD23 6  
ATOM   4143  N N    . GLU A 1 17 ? 3.901   -4.385  -2.243  1.00 0.00 ? 17 GLU A N    6  
ATOM   4144  C CA   . GLU A 1 17 ? 3.911   -5.816  -1.829  1.00 0.00 ? 17 GLU A CA   6  
ATOM   4145  C C    . GLU A 1 17 ? 2.777   -6.060  -0.833  1.00 0.00 ? 17 GLU A C    6  
ATOM   4146  O O    . GLU A 1 17 ? 2.285   -7.161  -0.691  1.00 0.00 ? 17 GLU A O    6  
ATOM   4147  C CB   . GLU A 1 17 ? 5.250   -6.150  -1.165  1.00 0.00 ? 17 GLU A CB   6  
ATOM   4148  C CG   . GLU A 1 17 ? 6.290   -6.475  -2.238  1.00 0.00 ? 17 GLU A CG   6  
ATOM   4149  C CD   . GLU A 1 17 ? 6.078   -7.905  -2.739  1.00 0.00 ? 17 GLU A CD   6  
ATOM   4150  O OE1  . GLU A 1 17 ? 5.817   -8.766  -1.916  1.00 0.00 ? 17 GLU A OE1  6  
ATOM   4151  O OE2  . GLU A 1 17 ? 6.181   -8.113  -3.937  1.00 0.00 ? 17 GLU A OE2  6  
ATOM   4152  H H    . GLU A 1 17 ? 4.584   -3.772  -1.902  1.00 0.00 ? 17 GLU A H    6  
ATOM   4153  H HA   . GLU A 1 17 ? 3.770   -6.443  -2.693  1.00 0.00 ? 17 GLU A HA   6  
ATOM   4154  H HB2  . GLU A 1 17 ? 5.584   -5.300  -0.585  1.00 0.00 ? 17 GLU A HB2  6  
ATOM   4155  H HB3  . GLU A 1 17 ? 5.127   -7.003  -0.515  1.00 0.00 ? 17 GLU A HB3  6  
ATOM   4156  H HG2  . GLU A 1 17 ? 6.186   -5.784  -3.062  1.00 0.00 ? 17 GLU A HG2  6  
ATOM   4157  H HG3  . GLU A 1 17 ? 7.281   -6.387  -1.817  1.00 0.00 ? 17 GLU A HG3  6  
ATOM   4158  N N    . ASN A 1 18 ? 2.360   -5.036  -0.146  1.00 0.00 ? 18 ASN A N    6  
ATOM   4159  C CA   . ASN A 1 18 ? 1.259   -5.196  0.842   1.00 0.00 ? 18 ASN A CA   6  
ATOM   4160  C C    . ASN A 1 18 ? -0.079  -5.288  0.106   1.00 0.00 ? 18 ASN A C    6  
ATOM   4161  O O    . ASN A 1 18 ? -1.124  -5.406  0.713   1.00 0.00 ? 18 ASN A O    6  
ATOM   4162  C CB   . ASN A 1 18 ? 1.247   -3.991  1.781   1.00 0.00 ? 18 ASN A CB   6  
ATOM   4163  C CG   . ASN A 1 18 ? 1.965   -4.353  3.082   1.00 0.00 ? 18 ASN A CG   6  
ATOM   4164  O OD1  . ASN A 1 18 ? 1.644   -3.833  4.133   1.00 0.00 ? 18 ASN A OD1  6  
ATOM   4165  N ND2  . ASN A 1 18 ? 2.933   -5.229  3.057   1.00 0.00 ? 18 ASN A ND2  6  
ATOM   4166  H H    . ASN A 1 18 ? 2.773   -4.159  -0.281  1.00 0.00 ? 18 ASN A H    6  
ATOM   4167  H HA   . ASN A 1 18 ? 1.418   -6.098  1.415   1.00 0.00 ? 18 ASN A HA   6  
ATOM   4168  H HB2  . ASN A 1 18 ? 1.752   -3.160  1.308   1.00 0.00 ? 18 ASN A HB2  6  
ATOM   4169  H HB3  . ASN A 1 18 ? 0.229   -3.716  1.998   1.00 0.00 ? 18 ASN A HB3  6  
ATOM   4170  H HD21 . ASN A 1 18 ? 3.192   -5.647  2.210   1.00 0.00 ? 18 ASN A HD21 6  
ATOM   4171  H HD22 . ASN A 1 18 ? 3.400   -5.468  3.885   1.00 0.00 ? 18 ASN A HD22 6  
ATOM   4172  N N    . TYR A 1 19 ? -0.056  -5.242  -1.199  1.00 0.00 ? 19 TYR A N    6  
ATOM   4173  C CA   . TYR A 1 19 ? -1.323  -5.333  -1.973  1.00 0.00 ? 19 TYR A CA   6  
ATOM   4174  C C    . TYR A 1 19 ? -1.281  -6.588  -2.845  1.00 0.00 ? 19 TYR A C    6  
ATOM   4175  O O    . TYR A 1 19 ? -1.980  -6.697  -3.833  1.00 0.00 ? 19 TYR A O    6  
ATOM   4176  C CB   . TYR A 1 19 ? -1.467  -4.097  -2.863  1.00 0.00 ? 19 TYR A CB   6  
ATOM   4177  C CG   . TYR A 1 19 ? -1.652  -2.869  -2.002  1.00 0.00 ? 19 TYR A CG   6  
ATOM   4178  C CD1  . TYR A 1 19 ? -2.936  -2.498  -1.576  1.00 0.00 ? 19 TYR A CD1  6  
ATOM   4179  C CD2  . TYR A 1 19 ? -0.542  -2.100  -1.629  1.00 0.00 ? 19 TYR A CD2  6  
ATOM   4180  C CE1  . TYR A 1 19 ? -3.107  -1.358  -0.779  1.00 0.00 ? 19 TYR A CE1  6  
ATOM   4181  C CE2  . TYR A 1 19 ? -0.713  -0.960  -0.832  1.00 0.00 ? 19 TYR A CE2  6  
ATOM   4182  C CZ   . TYR A 1 19 ? -1.996  -0.590  -0.406  1.00 0.00 ? 19 TYR A CZ   6  
ATOM   4183  O OH   . TYR A 1 19 ? -2.166  0.533   0.379   1.00 0.00 ? 19 TYR A OH   6  
ATOM   4184  H H    . TYR A 1 19 ? 0.796   -5.152  -1.672  1.00 0.00 ? 19 TYR A H    6  
ATOM   4185  H HA   . TYR A 1 19 ? -2.160  -5.391  -1.294  1.00 0.00 ? 19 TYR A HA   6  
ATOM   4186  H HB2  . TYR A 1 19 ? -0.577  -3.981  -3.465  1.00 0.00 ? 19 TYR A HB2  6  
ATOM   4187  H HB3  . TYR A 1 19 ? -2.323  -4.217  -3.507  1.00 0.00 ? 19 TYR A HB3  6  
ATOM   4188  H HD1  . TYR A 1 19 ? -3.792  -3.090  -1.863  1.00 0.00 ? 19 TYR A HD1  6  
ATOM   4189  H HD2  . TYR A 1 19 ? 0.447   -2.386  -1.957  1.00 0.00 ? 19 TYR A HD2  6  
ATOM   4190  H HE1  . TYR A 1 19 ? -4.096  -1.073  -0.452  1.00 0.00 ? 19 TYR A HE1  6  
ATOM   4191  H HE2  . TYR A 1 19 ? 0.143   -0.367  -0.545  1.00 0.00 ? 19 TYR A HE2  6  
ATOM   4192  H HH   . TYR A 1 19 ? -2.669  0.279   1.156   1.00 0.00 ? 19 TYR A HH   6  
ATOM   4193  N N    . CYS A 1 20 ? -0.459  -7.537  -2.486  1.00 0.00 ? 20 CYS A N    6  
ATOM   4194  C CA   . CYS A 1 20 ? -0.360  -8.787  -3.291  1.00 0.00 ? 20 CYS A CA   6  
ATOM   4195  C C    . CYS A 1 20 ? -1.611  -9.643  -3.070  1.00 0.00 ? 20 CYS A C    6  
ATOM   4196  O O    . CYS A 1 20 ? -2.628  -9.446  -3.707  1.00 0.00 ? 20 CYS A O    6  
ATOM   4197  C CB   . CYS A 1 20 ? 0.885   -9.569  -2.864  1.00 0.00 ? 20 CYS A CB   6  
ATOM   4198  S SG   . CYS A 1 20 ? 2.373   -8.621  -3.269  1.00 0.00 ? 20 CYS A SG   6  
ATOM   4199  H H    . CYS A 1 20 ? 0.097   -7.426  -1.687  1.00 0.00 ? 20 CYS A H    6  
ATOM   4200  H HA   . CYS A 1 20 ? -0.281  -8.535  -4.335  1.00 0.00 ? 20 CYS A HA   6  
ATOM   4201  H HB2  . CYS A 1 20 ? 0.851   -9.744  -1.799  1.00 0.00 ? 20 CYS A HB2  6  
ATOM   4202  H HB3  . CYS A 1 20 ? 0.909   -10.515 -3.382  1.00 0.00 ? 20 CYS A HB3  6  
ATOM   4203  N N    . ASN A 1 21 ? -1.546  -10.591 -2.177  1.00 0.00 ? 21 ASN A N    6  
ATOM   4204  C CA   . ASN A 1 21 ? -2.730  -11.458 -1.920  1.00 0.00 ? 21 ASN A CA   6  
ATOM   4205  C C    . ASN A 1 21 ? -2.750  -11.874 -0.447  1.00 0.00 ? 21 ASN A C    6  
ATOM   4206  O O    . ASN A 1 21 ? -3.356  -12.890 -0.148  1.00 0.00 ? 21 ASN A O    6  
ATOM   4207  C CB   . ASN A 1 21 ? -2.646  -12.709 -2.798  1.00 0.00 ? 21 ASN A CB   6  
ATOM   4208  C CG   . ASN A 1 21 ? -3.500  -12.512 -4.052  1.00 0.00 ? 21 ASN A CG   6  
ATOM   4209  O OD1  . ASN A 1 21 ? -3.444  -11.476 -4.684  1.00 0.00 ? 21 ASN A OD1  6  
ATOM   4210  N ND2  . ASN A 1 21 ? -4.294  -13.472 -4.441  1.00 0.00 ? 21 ASN A ND2  6  
ATOM   4211  O OXT  . ASN A 1 21 ? -2.160  -11.170 0.355   1.00 0.00 ? 21 ASN A OXT  6  
ATOM   4212  H H    . ASN A 1 21 ? -0.718  -10.733 -1.677  1.00 0.00 ? 21 ASN A H    6  
ATOM   4213  H HA   . ASN A 1 21 ? -3.633  -10.914 -2.153  1.00 0.00 ? 21 ASN A HA   6  
ATOM   4214  H HB2  . ASN A 1 21 ? -1.618  -12.878 -3.085  1.00 0.00 ? 21 ASN A HB2  6  
ATOM   4215  H HB3  . ASN A 1 21 ? -3.012  -13.562 -2.246  1.00 0.00 ? 21 ASN A HB3  6  
ATOM   4216  H HD21 . ASN A 1 21 ? -4.339  -14.308 -3.931  1.00 0.00 ? 21 ASN A HD21 6  
ATOM   4217  H HD22 . ASN A 1 21 ? -4.845  -13.357 -5.243  1.00 0.00 ? 21 ASN A HD22 6  
ATOM   4218  N N    . PHE B 2 1  ? 16.618  1.196   -5.950  1.00 0.00 ? 1  PHE B N    6  
ATOM   4219  C CA   . PHE B 2 1  ? 15.606  1.570   -6.978  1.00 0.00 ? 1  PHE B CA   6  
ATOM   4220  C C    . PHE B 2 1  ? 15.493  3.096   -7.048  1.00 0.00 ? 1  PHE B C    6  
ATOM   4221  O O    . PHE B 2 1  ? 16.347  3.814   -6.569  1.00 0.00 ? 1  PHE B O    6  
ATOM   4222  C CB   . PHE B 2 1  ? 14.248  0.973   -6.598  1.00 0.00 ? 1  PHE B CB   6  
ATOM   4223  C CG   . PHE B 2 1  ? 13.909  -0.164  -7.541  1.00 0.00 ? 1  PHE B CG   6  
ATOM   4224  C CD1  . PHE B 2 1  ? 13.312  0.105   -8.784  1.00 0.00 ? 1  PHE B CD1  6  
ATOM   4225  C CD2  . PHE B 2 1  ? 14.193  -1.489  -7.177  1.00 0.00 ? 1  PHE B CD2  6  
ATOM   4226  C CE1  . PHE B 2 1  ? 13.002  -0.950  -9.654  1.00 0.00 ? 1  PHE B CE1  6  
ATOM   4227  C CE2  . PHE B 2 1  ? 13.881  -2.540  -8.049  1.00 0.00 ? 1  PHE B CE2  6  
ATOM   4228  C CZ   . PHE B 2 1  ? 13.286  -2.270  -9.287  1.00 0.00 ? 1  PHE B CZ   6  
ATOM   4229  H H1   . PHE B 2 1  ? 17.564  1.189   -6.380  1.00 0.00 ? 1  PHE B H1   6  
ATOM   4230  H H2   . PHE B 2 1  ? 16.398  0.249   -5.577  1.00 0.00 ? 1  PHE B H2   6  
ATOM   4231  H H3   . PHE B 2 1  ? 16.597  1.887   -5.174  1.00 0.00 ? 1  PHE B H3   6  
ATOM   4232  H HA   . PHE B 2 1  ? 15.912  1.187   -7.940  1.00 0.00 ? 1  PHE B HA   6  
ATOM   4233  H HB2  . PHE B 2 1  ? 14.292  0.602   -5.584  1.00 0.00 ? 1  PHE B HB2  6  
ATOM   4234  H HB3  . PHE B 2 1  ? 13.489  1.739   -6.666  1.00 0.00 ? 1  PHE B HB3  6  
ATOM   4235  H HD1  . PHE B 2 1  ? 13.092  1.120   -9.070  1.00 0.00 ? 1  PHE B HD1  6  
ATOM   4236  H HD2  . PHE B 2 1  ? 14.652  -1.701  -6.223  1.00 0.00 ? 1  PHE B HD2  6  
ATOM   4237  H HE1  . PHE B 2 1  ? 12.541  -0.741  -10.610 1.00 0.00 ? 1  PHE B HE1  6  
ATOM   4238  H HE2  . PHE B 2 1  ? 14.100  -3.558  -7.766  1.00 0.00 ? 1  PHE B HE2  6  
ATOM   4239  H HZ   . PHE B 2 1  ? 13.045  -3.081  -9.959  1.00 0.00 ? 1  PHE B HZ   6  
ATOM   4240  N N    . VAL B 2 2  ? 14.444  3.595   -7.644  1.00 0.00 ? 2  VAL B N    6  
ATOM   4241  C CA   . VAL B 2 2  ? 14.274  5.075   -7.747  1.00 0.00 ? 2  VAL B CA   6  
ATOM   4242  C C    . VAL B 2 2  ? 12.845  5.450   -7.350  1.00 0.00 ? 2  VAL B C    6  
ATOM   4243  O O    . VAL B 2 2  ? 12.090  4.631   -6.863  1.00 0.00 ? 2  VAL B O    6  
ATOM   4244  C CB   . VAL B 2 2  ? 14.538  5.538   -9.187  1.00 0.00 ? 2  VAL B CB   6  
ATOM   4245  C CG1  . VAL B 2 2  ? 15.934  6.159   -9.276  1.00 0.00 ? 2  VAL B CG1  6  
ATOM   4246  C CG2  . VAL B 2 2  ? 14.452  4.346   -10.146 1.00 0.00 ? 2  VAL B CG2  6  
ATOM   4247  H H    . VAL B 2 2  ? 13.766  2.998   -8.023  1.00 0.00 ? 2  VAL B H    6  
ATOM   4248  H HA   . VAL B 2 2  ? 14.969  5.561   -7.080  1.00 0.00 ? 2  VAL B HA   6  
ATOM   4249  H HB   . VAL B 2 2  ? 13.800  6.279   -9.464  1.00 0.00 ? 2  VAL B HB   6  
ATOM   4250  H HG11 . VAL B 2 2  ? 16.337  6.285   -8.281  1.00 0.00 ? 2  VAL B HG11 6  
ATOM   4251  H HG12 . VAL B 2 2  ? 15.870  7.122   -9.763  1.00 0.00 ? 2  VAL B HG12 6  
ATOM   4252  H HG13 . VAL B 2 2  ? 16.581  5.510   -9.847  1.00 0.00 ? 2  VAL B HG13 6  
ATOM   4253  H HG21 . VAL B 2 2  ? 14.529  4.698   -11.165 1.00 0.00 ? 2  VAL B HG21 6  
ATOM   4254  H HG22 . VAL B 2 2  ? 13.508  3.842   -10.009 1.00 0.00 ? 2  VAL B HG22 6  
ATOM   4255  H HG23 . VAL B 2 2  ? 15.260  3.660   -9.941  1.00 0.00 ? 2  VAL B HG23 6  
ATOM   4256  N N    . ASN B 2 3  ? 12.464  6.682   -7.554  1.00 0.00 ? 3  ASN B N    6  
ATOM   4257  C CA   . ASN B 2 3  ? 11.085  7.108   -7.190  1.00 0.00 ? 3  ASN B CA   6  
ATOM   4258  C C    . ASN B 2 3  ? 10.284  7.372   -8.464  1.00 0.00 ? 3  ASN B C    6  
ATOM   4259  O O    . ASN B 2 3  ? 10.369  8.431   -9.054  1.00 0.00 ? 3  ASN B O    6  
ATOM   4260  C CB   . ASN B 2 3  ? 11.153  8.386   -6.354  1.00 0.00 ? 3  ASN B CB   6  
ATOM   4261  C CG   . ASN B 2 3  ? 11.222  8.023   -4.870  1.00 0.00 ? 3  ASN B CG   6  
ATOM   4262  O OD1  . ASN B 2 3  ? 10.301  7.439   -4.333  1.00 0.00 ? 3  ASN B OD1  6  
ATOM   4263  N ND2  . ASN B 2 3  ? 12.281  8.345   -4.180  1.00 0.00 ? 3  ASN B ND2  6  
ATOM   4264  H H    . ASN B 2 3  ? 13.085  7.328   -7.949  1.00 0.00 ? 3  ASN B H    6  
ATOM   4265  H HA   . ASN B 2 3  ? 10.607  6.327   -6.617  1.00 0.00 ? 3  ASN B HA   6  
ATOM   4266  H HB2  . ASN B 2 3  ? 12.034  8.949   -6.629  1.00 0.00 ? 3  ASN B HB2  6  
ATOM   4267  H HB3  . ASN B 2 3  ? 10.272  8.984   -6.536  1.00 0.00 ? 3  ASN B HB3  6  
ATOM   4268  H HD21 . ASN B 2 3  ? 13.024  8.817   -4.613  1.00 0.00 ? 3  ASN B HD21 6  
ATOM   4269  H HD22 . ASN B 2 3  ? 12.334  8.118   -3.228  1.00 0.00 ? 3  ASN B HD22 6  
ATOM   4270  N N    . GLN B 2 4  ? 9.509   6.416   -8.899  1.00 0.00 ? 4  GLN B N    6  
ATOM   4271  C CA   . GLN B 2 4  ? 8.709   6.611   -10.137 1.00 0.00 ? 4  GLN B CA   6  
ATOM   4272  C C    . GLN B 2 4  ? 7.247   6.861   -9.770  1.00 0.00 ? 4  GLN B C    6  
ATOM   4273  O O    . GLN B 2 4  ? 6.706   6.243   -8.874  1.00 0.00 ? 4  GLN B O    6  
ATOM   4274  C CB   . GLN B 2 4  ? 8.804   5.353   -11.000 1.00 0.00 ? 4  GLN B CB   6  
ATOM   4275  C CG   . GLN B 2 4  ? 9.826   5.571   -12.117 1.00 0.00 ? 4  GLN B CG   6  
ATOM   4276  C CD   . GLN B 2 4  ? 9.650   4.488   -13.184 1.00 0.00 ? 4  GLN B CD   6  
ATOM   4277  O OE1  . GLN B 2 4  ? 9.752   3.313   -12.895 1.00 0.00 ? 4  GLN B OE1  6  
ATOM   4278  N NE2  . GLN B 2 4  ? 9.388   4.838   -14.413 1.00 0.00 ? 4  GLN B NE2  6  
ATOM   4279  H H    . GLN B 2 4  ? 9.457   5.567   -8.414  1.00 0.00 ? 4  GLN B H    6  
ATOM   4280  H HA   . GLN B 2 4  ? 9.094   7.456   -10.687 1.00 0.00 ? 4  GLN B HA   6  
ATOM   4281  H HB2  . GLN B 2 4  ? 9.113   4.520   -10.387 1.00 0.00 ? 4  GLN B HB2  6  
ATOM   4282  H HB3  . GLN B 2 4  ? 7.839   5.143   -11.433 1.00 0.00 ? 4  GLN B HB3  6  
ATOM   4283  H HG2  . GLN B 2 4  ? 9.674   6.545   -12.561 1.00 0.00 ? 4  GLN B HG2  6  
ATOM   4284  H HG3  . GLN B 2 4  ? 10.823  5.512   -11.709 1.00 0.00 ? 4  GLN B HG3  6  
ATOM   4285  H HE21 . GLN B 2 4  ? 9.305   5.786   -14.646 1.00 0.00 ? 4  GLN B HE21 6  
ATOM   4286  H HE22 . GLN B 2 4  ? 9.274   4.151   -15.103 1.00 0.00 ? 4  GLN B HE22 6  
ATOM   4287  N N    . HIS B 2 5  ? 6.598   7.756   -10.460 1.00 0.00 ? 5  HIS B N    6  
ATOM   4288  C CA   . HIS B 2 5  ? 5.169   8.040   -10.154 1.00 0.00 ? 5  HIS B CA   6  
ATOM   4289  C C    . HIS B 2 5  ? 4.305   6.898   -10.691 1.00 0.00 ? 5  HIS B C    6  
ATOM   4290  O O    . HIS B 2 5  ? 4.532   6.389   -11.771 1.00 0.00 ? 5  HIS B O    6  
ATOM   4291  C CB   . HIS B 2 5  ? 4.754   9.353   -10.818 1.00 0.00 ? 5  HIS B CB   6  
ATOM   4292  C CG   . HIS B 2 5  ? 3.554   9.914   -10.109 1.00 0.00 ? 5  HIS B CG   6  
ATOM   4293  N ND1  . HIS B 2 5  ? 2.527   10.521  -10.799 1.00 0.00 ? 5  HIS B ND1  6  
ATOM   4294  C CD2  . HIS B 2 5  ? 3.230   9.948   -8.780  1.00 0.00 ? 5  HIS B CD2  6  
ATOM   4295  C CE1  . HIS B 2 5  ? 1.622   10.902  -9.886  1.00 0.00 ? 5  HIS B CE1  6  
ATOM   4296  N NE2  . HIS B 2 5  ? 2.009   10.573  -8.636  1.00 0.00 ? 5  HIS B NE2  6  
ATOM   4297  H H    . HIS B 2 5  ? 7.050   8.241   -11.183 1.00 0.00 ? 5  HIS B H    6  
ATOM   4298  H HA   . HIS B 2 5  ? 5.038   8.118   -9.084  1.00 0.00 ? 5  HIS B HA   6  
ATOM   4299  H HB2  . HIS B 2 5  ? 5.570   10.058  -10.761 1.00 0.00 ? 5  HIS B HB2  6  
ATOM   4300  H HB3  . HIS B 2 5  ? 4.508   9.170   -11.854 1.00 0.00 ? 5  HIS B HB3  6  
ATOM   4301  H HD2  . HIS B 2 5  ? 3.831   9.551   -7.976  1.00 0.00 ? 5  HIS B HD2  6  
ATOM   4302  H HE1  . HIS B 2 5  ? 0.697   11.409  -10.121 1.00 0.00 ? 5  HIS B HE1  6  
ATOM   4303  H HE2  . HIS B 2 5  ? 1.524   10.742  -7.801  1.00 0.00 ? 5  HIS B HE2  6  
ATOM   4304  N N    . LEU B 2 6  ? 3.318   6.487   -9.944  1.00 0.00 ? 6  LEU B N    6  
ATOM   4305  C CA   . LEU B 2 6  ? 2.443   5.373   -10.409 1.00 0.00 ? 6  LEU B CA   6  
ATOM   4306  C C    . LEU B 2 6  ? 1.005   5.874   -10.538 1.00 0.00 ? 6  LEU B C    6  
ATOM   4307  O O    . LEU B 2 6  ? 0.632   6.860   -9.942  1.00 0.00 ? 6  LEU B O    6  
ATOM   4308  C CB   . LEU B 2 6  ? 2.490   4.238   -9.383  1.00 0.00 ? 6  LEU B CB   6  
ATOM   4309  C CG   . LEU B 2 6  ? 3.576   3.231   -9.756  1.00 0.00 ? 6  LEU B CG   6  
ATOM   4310  C CD1  . LEU B 2 6  ? 3.394   2.787   -11.204 1.00 0.00 ? 6  LEU B CD1  6  
ATOM   4311  C CD2  . LEU B 2 6  ? 4.942   3.889   -9.590  1.00 0.00 ? 6  LEU B CD2  6  
ATOM   4312  H H    . LEU B 2 6  ? 3.154   6.908   -9.075  1.00 0.00 ? 6  LEU B H    6  
ATOM   4313  H HA   . LEU B 2 6  ? 2.788   5.016   -11.366 1.00 0.00 ? 6  LEU B HA   6  
ATOM   4314  H HB2  . LEU B 2 6  ? 2.717   4.651   -8.415  1.00 0.00 ? 6  LEU B HB2  6  
ATOM   4315  H HB3  . LEU B 2 6  ? 1.533   3.740   -9.349  1.00 0.00 ? 6  LEU B HB3  6  
ATOM   4316  H HG   . LEU B 2 6  ? 3.508   2.372   -9.105  1.00 0.00 ? 6  LEU B HG   6  
ATOM   4317  H HD11 . LEU B 2 6  ? 4.207   3.168   -11.803 1.00 0.00 ? 6  LEU B HD11 6  
ATOM   4318  H HD12 . LEU B 2 6  ? 2.457   3.173   -11.580 1.00 0.00 ? 6  LEU B HD12 6  
ATOM   4319  H HD13 . LEU B 2 6  ? 3.385   1.710   -11.250 1.00 0.00 ? 6  LEU B HD13 6  
ATOM   4320  H HD21 . LEU B 2 6  ? 5.641   3.169   -9.194  1.00 0.00 ? 6  LEU B HD21 6  
ATOM   4321  H HD22 . LEU B 2 6  ? 4.857   4.722   -8.908  1.00 0.00 ? 6  LEU B HD22 6  
ATOM   4322  H HD23 . LEU B 2 6  ? 5.289   4.242   -10.549 1.00 0.00 ? 6  LEU B HD23 6  
ATOM   4323  N N    . CYS B 2 7  ? 0.192   5.198   -11.305 1.00 0.00 ? 7  CYS B N    6  
ATOM   4324  C CA   . CYS B 2 7  ? -1.226  5.635   -11.459 1.00 0.00 ? 7  CYS B CA   6  
ATOM   4325  C C    . CYS B 2 7  ? -2.059  4.475   -12.034 1.00 0.00 ? 7  CYS B C    6  
ATOM   4326  O O    . CYS B 2 7  ? -2.324  3.506   -11.351 1.00 0.00 ? 7  CYS B O    6  
ATOM   4327  C CB   . CYS B 2 7  ? -1.289  6.861   -12.381 1.00 0.00 ? 7  CYS B CB   6  
ATOM   4328  S SG   . CYS B 2 7  ? -1.124  8.372   -11.398 1.00 0.00 ? 7  CYS B SG   6  
ATOM   4329  H H    . CYS B 2 7  ? 0.513   4.401   -11.773 1.00 0.00 ? 7  CYS B H    6  
ATOM   4330  H HA   . CYS B 2 7  ? -1.617  5.902   -10.487 1.00 0.00 ? 7  CYS B HA   6  
ATOM   4331  H HB2  . CYS B 2 7  ? -0.483  6.816   -13.095 1.00 0.00 ? 7  CYS B HB2  6  
ATOM   4332  H HB3  . CYS B 2 7  ? -2.234  6.875   -12.901 1.00 0.00 ? 7  CYS B HB3  6  
ATOM   4333  N N    . GLY B 2 8  ? -2.481  4.552   -13.274 1.00 0.00 ? 8  GLY B N    6  
ATOM   4334  C CA   . GLY B 2 8  ? -3.296  3.443   -13.851 1.00 0.00 ? 8  GLY B CA   6  
ATOM   4335  C C    . GLY B 2 8  ? -2.390  2.282   -14.264 1.00 0.00 ? 8  GLY B C    6  
ATOM   4336  O O    . GLY B 2 8  ? -1.739  1.670   -13.442 1.00 0.00 ? 8  GLY B O    6  
ATOM   4337  H H    . GLY B 2 8  ? -2.266  5.329   -13.824 1.00 0.00 ? 8  GLY B H    6  
ATOM   4338  H HA2  . GLY B 2 8  ? -4.004  3.099   -13.110 1.00 0.00 ? 8  GLY B HA2  6  
ATOM   4339  H HA3  . GLY B 2 8  ? -3.830  3.804   -14.717 1.00 0.00 ? 8  GLY B HA3  6  
ATOM   4340  N N    . SER B 2 9  ? -2.354  1.970   -15.533 1.00 0.00 ? 9  SER B N    6  
ATOM   4341  C CA   . SER B 2 9  ? -1.497  0.843   -16.006 1.00 0.00 ? 9  SER B CA   6  
ATOM   4342  C C    . SER B 2 9  ? -0.154  0.886   -15.279 1.00 0.00 ? 9  SER B C    6  
ATOM   4343  O O    . SER B 2 9  ? 0.474   -0.128  -15.052 1.00 0.00 ? 9  SER B O    6  
ATOM   4344  C CB   . SER B 2 9  ? -1.265  0.977   -17.512 1.00 0.00 ? 9  SER B CB   6  
ATOM   4345  O OG   . SER B 2 9  ? -2.051  0.011   -18.197 1.00 0.00 ? 9  SER B OG   6  
ATOM   4346  H H    . SER B 2 9  ? -2.894  2.475   -16.177 1.00 0.00 ? 9  SER B H    6  
ATOM   4347  H HA   . SER B 2 9  ? -1.988  -0.095  -15.797 1.00 0.00 ? 9  SER B HA   6  
ATOM   4348  H HB2  . SER B 2 9  ? -1.552  1.963   -17.836 1.00 0.00 ? 9  SER B HB2  6  
ATOM   4349  H HB3  . SER B 2 9  ? -0.216  0.821   -17.728 1.00 0.00 ? 9  SER B HB3  6  
ATOM   4350  H HG   . SER B 2 9  ? -1.826  -0.856  -17.851 1.00 0.00 ? 9  SER B HG   6  
ATOM   4351  N N    . ASP B 2 10 ? 0.287   2.054   -14.909 1.00 0.00 ? 10 ASP B N    6  
ATOM   4352  C CA   . ASP B 2 10 ? 1.585   2.163   -14.193 1.00 0.00 ? 10 ASP B CA   6  
ATOM   4353  C C    . ASP B 2 10 ? 1.462   1.492   -12.825 1.00 0.00 ? 10 ASP B C    6  
ATOM   4354  O O    . ASP B 2 10 ? 2.183   0.566   -12.512 1.00 0.00 ? 10 ASP B O    6  
ATOM   4355  C CB   . ASP B 2 10 ? 1.943   3.639   -14.008 1.00 0.00 ? 10 ASP B CB   6  
ATOM   4356  C CG   . ASP B 2 10 ? 2.316   4.247   -15.361 1.00 0.00 ? 10 ASP B CG   6  
ATOM   4357  O OD1  . ASP B 2 10 ? 1.419   4.463   -16.158 1.00 0.00 ? 10 ASP B OD1  6  
ATOM   4358  O OD2  . ASP B 2 10 ? 3.492   4.486   -15.575 1.00 0.00 ? 10 ASP B OD2  6  
ATOM   4359  H H    . ASP B 2 10 ? -0.238  2.859   -15.099 1.00 0.00 ? 10 ASP B H    6  
ATOM   4360  H HA   . ASP B 2 10 ? 2.357   1.674   -14.767 1.00 0.00 ? 10 ASP B HA   6  
ATOM   4361  H HB2  . ASP B 2 10 ? 1.093   4.167   -13.597 1.00 0.00 ? 10 ASP B HB2  6  
ATOM   4362  H HB3  . ASP B 2 10 ? 2.781   3.724   -13.333 1.00 0.00 ? 10 ASP B HB3  6  
ATOM   4363  N N    . LEU B 2 11 ? 0.554   1.952   -12.007 1.00 0.00 ? 11 LEU B N    6  
ATOM   4364  C CA   . LEU B 2 11 ? 0.394   1.340   -10.659 1.00 0.00 ? 11 LEU B CA   6  
ATOM   4365  C C    . LEU B 2 11 ? -0.056  -0.110  -10.819 1.00 0.00 ? 11 LEU B C    6  
ATOM   4366  O O    . LEU B 2 11 ? 0.205   -0.952  -9.980  1.00 0.00 ? 11 LEU B O    6  
ATOM   4367  C CB   . LEU B 2 11 ? -0.665  2.131   -9.868  1.00 0.00 ? 11 LEU B CB   6  
ATOM   4368  C CG   . LEU B 2 11 ? -0.464  2.021   -8.338  1.00 0.00 ? 11 LEU B CG   6  
ATOM   4369  C CD1  . LEU B 2 11 ? -1.515  1.076   -7.762  1.00 0.00 ? 11 LEU B CD1  6  
ATOM   4370  C CD2  . LEU B 2 11 ? 0.932   1.491   -7.978  1.00 0.00 ? 11 LEU B CD2  6  
ATOM   4371  H H    . LEU B 2 11 ? -0.019  2.699   -12.278 1.00 0.00 ? 11 LEU B H    6  
ATOM   4372  H HA   . LEU B 2 11 ? 1.339   1.372   -10.148 1.00 0.00 ? 11 LEU B HA   6  
ATOM   4373  H HB2  . LEU B 2 11 ? -0.612  3.167   -10.159 1.00 0.00 ? 11 LEU B HB2  6  
ATOM   4374  H HB3  . LEU B 2 11 ? -1.645  1.751   -10.119 1.00 0.00 ? 11 LEU B HB3  6  
ATOM   4375  H HG   . LEU B 2 11 ? -0.597  3.001   -7.898  1.00 0.00 ? 11 LEU B HG   6  
ATOM   4376  H HD11 . LEU B 2 11 ? -2.403  1.108   -8.376  1.00 0.00 ? 11 LEU B HD11 6  
ATOM   4377  H HD12 . LEU B 2 11 ? -1.760  1.382   -6.756  1.00 0.00 ? 11 LEU B HD12 6  
ATOM   4378  H HD13 . LEU B 2 11 ? -1.124  0.070   -7.746  1.00 0.00 ? 11 LEU B HD13 6  
ATOM   4379  H HD21 . LEU B 2 11 ? 1.681   2.198   -8.301  1.00 0.00 ? 11 LEU B HD21 6  
ATOM   4380  H HD22 . LEU B 2 11 ? 1.094   0.544   -8.472  1.00 0.00 ? 11 LEU B HD22 6  
ATOM   4381  H HD23 . LEU B 2 11 ? 1.000   1.356   -6.909  1.00 0.00 ? 11 LEU B HD23 6  
ATOM   4382  N N    . VAL B 2 12 ? -0.719  -0.409  -11.900 1.00 0.00 ? 12 VAL B N    6  
ATOM   4383  C CA   . VAL B 2 12 ? -1.180  -1.800  -12.133 1.00 0.00 ? 12 VAL B CA   6  
ATOM   4384  C C    . VAL B 2 12 ? 0.015   -2.640  -12.588 1.00 0.00 ? 12 VAL B C    6  
ATOM   4385  O O    . VAL B 2 12 ? 0.249   -3.723  -12.088 1.00 0.00 ? 12 VAL B O    6  
ATOM   4386  C CB   . VAL B 2 12 ? -2.276  -1.779  -13.205 1.00 0.00 ? 12 VAL B CB   6  
ATOM   4387  C CG1  . VAL B 2 12 ? -2.345  -3.129  -13.927 1.00 0.00 ? 12 VAL B CG1  6  
ATOM   4388  C CG2  . VAL B 2 12 ? -3.623  -1.491  -12.537 1.00 0.00 ? 12 VAL B CG2  6  
ATOM   4389  H H    . VAL B 2 12 ? -0.907  0.284   -12.568 1.00 0.00 ? 12 VAL B H    6  
ATOM   4390  H HA   . VAL B 2 12 ? -1.579  -2.207  -11.215 1.00 0.00 ? 12 VAL B HA   6  
ATOM   4391  H HB   . VAL B 2 12 ? -2.056  -0.996  -13.919 1.00 0.00 ? 12 VAL B HB   6  
ATOM   4392  H HG11 . VAL B 2 12 ? -3.065  -3.073  -14.729 1.00 0.00 ? 12 VAL B HG11 6  
ATOM   4393  H HG12 . VAL B 2 12 ? -2.643  -3.896  -13.228 1.00 0.00 ? 12 VAL B HG12 6  
ATOM   4394  H HG13 . VAL B 2 12 ? -1.373  -3.370  -14.332 1.00 0.00 ? 12 VAL B HG13 6  
ATOM   4395  H HG21 . VAL B 2 12 ? -3.522  -0.637  -11.886 1.00 0.00 ? 12 VAL B HG21 6  
ATOM   4396  H HG22 . VAL B 2 12 ? -3.928  -2.350  -11.959 1.00 0.00 ? 12 VAL B HG22 6  
ATOM   4397  H HG23 . VAL B 2 12 ? -4.363  -1.282  -13.294 1.00 0.00 ? 12 VAL B HG23 6  
ATOM   4398  N N    . GLU B 2 13 ? 0.784   -2.144  -13.518 1.00 0.00 ? 13 GLU B N    6  
ATOM   4399  C CA   . GLU B 2 13 ? 1.969   -2.917  -13.975 1.00 0.00 ? 13 GLU B CA   6  
ATOM   4400  C C    . GLU B 2 13 ? 2.877   -3.158  -12.771 1.00 0.00 ? 13 GLU B C    6  
ATOM   4401  O O    . GLU B 2 13 ? 3.588   -4.141  -12.699 1.00 0.00 ? 13 GLU B O    6  
ATOM   4402  C CB   . GLU B 2 13 ? 2.724   -2.125  -15.046 1.00 0.00 ? 13 GLU B CB   6  
ATOM   4403  C CG   . GLU B 2 13 ? 2.033   -2.310  -16.399 1.00 0.00 ? 13 GLU B CG   6  
ATOM   4404  C CD   . GLU B 2 13 ? 3.085   -2.557  -17.482 1.00 0.00 ? 13 GLU B CD   6  
ATOM   4405  O OE1  . GLU B 2 13 ? 4.260   -2.535  -17.153 1.00 0.00 ? 13 GLU B OE1  6  
ATOM   4406  O OE2  . GLU B 2 13 ? 2.698   -2.763  -18.619 1.00 0.00 ? 13 GLU B OE2  6  
ATOM   4407  H H    . GLU B 2 13 ? 0.590   -1.264  -13.902 1.00 0.00 ? 13 GLU B H    6  
ATOM   4408  H HA   . GLU B 2 13 ? 1.648   -3.865  -14.382 1.00 0.00 ? 13 GLU B HA   6  
ATOM   4409  H HB2  . GLU B 2 13 ? 2.730   -1.077  -14.782 1.00 0.00 ? 13 GLU B HB2  6  
ATOM   4410  H HB3  . GLU B 2 13 ? 3.740   -2.485  -15.109 1.00 0.00 ? 13 GLU B HB3  6  
ATOM   4411  H HG2  . GLU B 2 13 ? 1.363   -3.155  -16.346 1.00 0.00 ? 13 GLU B HG2  6  
ATOM   4412  H HG3  . GLU B 2 13 ? 1.472   -1.419  -16.641 1.00 0.00 ? 13 GLU B HG3  6  
ATOM   4413  N N    . ALA B 2 14 ? 2.847   -2.268  -11.815 1.00 0.00 ? 14 ALA B N    6  
ATOM   4414  C CA   . ALA B 2 14 ? 3.693   -2.448  -10.604 1.00 0.00 ? 14 ALA B CA   6  
ATOM   4415  C C    . ALA B 2 14 ? 3.219   -3.693  -9.857  1.00 0.00 ? 14 ALA B C    6  
ATOM   4416  O O    . ALA B 2 14 ? 3.973   -4.621  -9.637  1.00 0.00 ? 14 ALA B O    6  
ATOM   4417  C CB   . ALA B 2 14 ? 3.561   -1.223  -9.699  1.00 0.00 ? 14 ALA B CB   6  
ATOM   4418  H H    . ALA B 2 14 ? 2.256   -1.489  -11.889 1.00 0.00 ? 14 ALA B H    6  
ATOM   4419  H HA   . ALA B 2 14 ? 4.725   -2.573  -10.900 1.00 0.00 ? 14 ALA B HA   6  
ATOM   4420  H HB1  . ALA B 2 14 ? 4.467   -1.100  -9.124  1.00 0.00 ? 14 ALA B HB1  6  
ATOM   4421  H HB2  . ALA B 2 14 ? 2.726   -1.359  -9.028  1.00 0.00 ? 14 ALA B HB2  6  
ATOM   4422  H HB3  . ALA B 2 14 ? 3.397   -0.343  -10.304 1.00 0.00 ? 14 ALA B HB3  6  
ATOM   4423  N N    . LEU B 2 15 ? 1.970   -3.731  -9.477  1.00 0.00 ? 15 LEU B N    6  
ATOM   4424  C CA   . LEU B 2 15 ? 1.453   -4.929  -8.761  1.00 0.00 ? 15 LEU B CA   6  
ATOM   4425  C C    . LEU B 2 15 ? 1.763   -6.167  -9.601  1.00 0.00 ? 15 LEU B C    6  
ATOM   4426  O O    . LEU B 2 15 ? 2.250   -7.165  -9.107  1.00 0.00 ? 15 LEU B O    6  
ATOM   4427  C CB   . LEU B 2 15 ? -0.062  -4.808  -8.584  1.00 0.00 ? 15 LEU B CB   6  
ATOM   4428  C CG   . LEU B 2 15 ? -0.378  -3.708  -7.570  1.00 0.00 ? 15 LEU B CG   6  
ATOM   4429  C CD1  . LEU B 2 15 ? -1.805  -3.208  -7.796  1.00 0.00 ? 15 LEU B CD1  6  
ATOM   4430  C CD2  . LEU B 2 15 ? -0.257  -4.270  -6.151  1.00 0.00 ? 15 LEU B CD2  6  
ATOM   4431  H H    . LEU B 2 15 ? 1.372   -2.979  -9.672  1.00 0.00 ? 15 LEU B H    6  
ATOM   4432  H HA   . LEU B 2 15 ? 1.930   -5.013  -7.796  1.00 0.00 ? 15 LEU B HA   6  
ATOM   4433  H HB2  . LEU B 2 15 ? -0.515  -4.563  -9.534  1.00 0.00 ? 15 LEU B HB2  6  
ATOM   4434  H HB3  . LEU B 2 15 ? -0.458  -5.747  -8.230  1.00 0.00 ? 15 LEU B HB3  6  
ATOM   4435  H HG   . LEU B 2 15 ? 0.315   -2.890  -7.697  1.00 0.00 ? 15 LEU B HG   6  
ATOM   4436  H HD11 . LEU B 2 15 ? -1.784  -2.156  -8.041  1.00 0.00 ? 15 LEU B HD11 6  
ATOM   4437  H HD12 . LEU B 2 15 ? -2.386  -3.357  -6.898  1.00 0.00 ? 15 LEU B HD12 6  
ATOM   4438  H HD13 . LEU B 2 15 ? -2.253  -3.759  -8.611  1.00 0.00 ? 15 LEU B HD13 6  
ATOM   4439  H HD21 . LEU B 2 15 ? -1.114  -4.892  -5.935  1.00 0.00 ? 15 LEU B HD21 6  
ATOM   4440  H HD22 . LEU B 2 15 ? -0.217  -3.455  -5.443  1.00 0.00 ? 15 LEU B HD22 6  
ATOM   4441  H HD23 . LEU B 2 15 ? 0.645   -4.859  -6.073  1.00 0.00 ? 15 LEU B HD23 6  
ATOM   4442  N N    . TYR B 2 16 ? 1.487   -6.102  -10.875 1.00 0.00 ? 16 TYR B N    6  
ATOM   4443  C CA   . TYR B 2 16 ? 1.765   -7.263  -11.764 1.00 0.00 ? 16 TYR B CA   6  
ATOM   4444  C C    . TYR B 2 16 ? 3.229   -7.683  -11.613 1.00 0.00 ? 16 TYR B C    6  
ATOM   4445  O O    . TYR B 2 16 ? 3.536   -8.848  -11.450 1.00 0.00 ? 16 TYR B O    6  
ATOM   4446  C CB   . TYR B 2 16 ? 1.497   -6.863  -13.218 1.00 0.00 ? 16 TYR B CB   6  
ATOM   4447  C CG   . TYR B 2 16 ? 0.363   -7.697  -13.777 1.00 0.00 ? 16 TYR B CG   6  
ATOM   4448  C CD1  . TYR B 2 16 ? 0.397   -9.096  -13.668 1.00 0.00 ? 16 TYR B CD1  6  
ATOM   4449  C CD2  . TYR B 2 16 ? -0.725  -7.073  -14.407 1.00 0.00 ? 16 TYR B CD2  6  
ATOM   4450  C CE1  . TYR B 2 16 ? -0.652  -9.865  -14.187 1.00 0.00 ? 16 TYR B CE1  6  
ATOM   4451  C CE2  . TYR B 2 16 ? -1.773  -7.845  -14.925 1.00 0.00 ? 16 TYR B CE2  6  
ATOM   4452  C CZ   . TYR B 2 16 ? -1.736  -9.240  -14.815 1.00 0.00 ? 16 TYR B CZ   6  
ATOM   4453  O OH   . TYR B 2 16 ? -2.769  -10.000 -15.327 1.00 0.00 ? 16 TYR B OH   6  
ATOM   4454  H H    . TYR B 2 16 ? 1.098   -5.284  -11.247 1.00 0.00 ? 16 TYR B H    6  
ATOM   4455  H HA   . TYR B 2 16 ? 1.122   -8.087  -11.494 1.00 0.00 ? 16 TYR B HA   6  
ATOM   4456  H HB2  . TYR B 2 16 ? 1.231   -5.814  -13.258 1.00 0.00 ? 16 TYR B HB2  6  
ATOM   4457  H HB3  . TYR B 2 16 ? 2.389   -7.028  -13.805 1.00 0.00 ? 16 TYR B HB3  6  
ATOM   4458  H HD1  . TYR B 2 16 ? 1.232   -9.581  -13.184 1.00 0.00 ? 16 TYR B HD1  6  
ATOM   4459  H HD2  . TYR B 2 16 ? -0.756  -5.998  -14.491 1.00 0.00 ? 16 TYR B HD2  6  
ATOM   4460  H HE1  . TYR B 2 16 ? -0.626  -10.942 -14.104 1.00 0.00 ? 16 TYR B HE1  6  
ATOM   4461  H HE2  . TYR B 2 16 ? -2.610  -7.364  -15.409 1.00 0.00 ? 16 TYR B HE2  6  
ATOM   4462  H HH   . TYR B 2 16 ? -2.997  -9.647  -16.190 1.00 0.00 ? 16 TYR B HH   6  
ATOM   4463  N N    . LEU B 2 17 ? 4.137   -6.745  -11.669 1.00 0.00 ? 17 LEU B N    6  
ATOM   4464  C CA   . LEU B 2 17 ? 5.581   -7.094  -11.532 1.00 0.00 ? 17 LEU B CA   6  
ATOM   4465  C C    . LEU B 2 17 ? 5.917   -7.328  -10.061 1.00 0.00 ? 17 LEU B C    6  
ATOM   4466  O O    . LEU B 2 17 ? 6.877   -7.994  -9.729  1.00 0.00 ? 17 LEU B O    6  
ATOM   4467  C CB   . LEU B 2 17 ? 6.442   -5.951  -12.077 1.00 0.00 ? 17 LEU B CB   6  
ATOM   4468  C CG   . LEU B 2 17 ? 6.951   -6.309  -13.474 1.00 0.00 ? 17 LEU B CG   6  
ATOM   4469  C CD1  . LEU B 2 17 ? 7.715   -7.635  -13.418 1.00 0.00 ? 17 LEU B CD1  6  
ATOM   4470  C CD2  . LEU B 2 17 ? 5.762   -6.446  -14.429 1.00 0.00 ? 17 LEU B CD2  6  
ATOM   4471  H H    . LEU B 2 17 ? 3.870   -5.812  -11.805 1.00 0.00 ? 17 LEU B H    6  
ATOM   4472  H HA   . LEU B 2 17 ? 5.782   -7.994  -12.087 1.00 0.00 ? 17 LEU B HA   6  
ATOM   4473  H HB2  . LEU B 2 17 ? 5.848   -5.050  -12.130 1.00 0.00 ? 17 LEU B HB2  6  
ATOM   4474  H HB3  . LEU B 2 17 ? 7.283   -5.789  -11.420 1.00 0.00 ? 17 LEU B HB3  6  
ATOM   4475  H HG   . LEU B 2 17 ? 7.610   -5.530  -13.828 1.00 0.00 ? 17 LEU B HG   6  
ATOM   4476  H HD11 . LEU B 2 17 ? 8.533   -7.608  -14.122 1.00 0.00 ? 17 LEU B HD11 6  
ATOM   4477  H HD12 . LEU B 2 17 ? 7.047   -8.445  -13.674 1.00 0.00 ? 17 LEU B HD12 6  
ATOM   4478  H HD13 . LEU B 2 17 ? 8.101   -7.786  -12.422 1.00 0.00 ? 17 LEU B HD13 6  
ATOM   4479  H HD21 . LEU B 2 17 ? 5.730   -7.452  -14.822 1.00 0.00 ? 17 LEU B HD21 6  
ATOM   4480  H HD22 . LEU B 2 17 ? 5.871   -5.745  -15.243 1.00 0.00 ? 17 LEU B HD22 6  
ATOM   4481  H HD23 . LEU B 2 17 ? 4.847   -6.239  -13.896 1.00 0.00 ? 17 LEU B HD23 6  
ATOM   4482  N N    . VAL B 2 18 ? 5.133   -6.785  -9.178  1.00 0.00 ? 18 VAL B N    6  
ATOM   4483  C CA   . VAL B 2 18 ? 5.401   -6.975  -7.728  1.00 0.00 ? 18 VAL B CA   6  
ATOM   4484  C C    . VAL B 2 18 ? 4.807   -8.304  -7.275  1.00 0.00 ? 18 VAL B C    6  
ATOM   4485  O O    . VAL B 2 18 ? 5.493   -9.167  -6.764  1.00 0.00 ? 18 VAL B O    6  
ATOM   4486  C CB   . VAL B 2 18 ? 4.738   -5.849  -6.936  1.00 0.00 ? 18 VAL B CB   6  
ATOM   4487  C CG1  . VAL B 2 18 ? 4.790   -6.176  -5.442  1.00 0.00 ? 18 VAL B CG1  6  
ATOM   4488  C CG2  . VAL B 2 18 ? 5.475   -4.536  -7.203  1.00 0.00 ? 18 VAL B CG2  6  
ATOM   4489  H H    . VAL B 2 18 ? 4.363   -6.254  -9.470  1.00 0.00 ? 18 VAL B H    6  
ATOM   4490  H HA   . VAL B 2 18 ? 6.466   -6.969  -7.548  1.00 0.00 ? 18 VAL B HA   6  
ATOM   4491  H HB   . VAL B 2 18 ? 3.707   -5.754  -7.245  1.00 0.00 ? 18 VAL B HB   6  
ATOM   4492  H HG11 . VAL B 2 18 ? 4.180   -5.471  -4.898  1.00 0.00 ? 18 VAL B HG11 6  
ATOM   4493  H HG12 . VAL B 2 18 ? 5.810   -6.115  -5.096  1.00 0.00 ? 18 VAL B HG12 6  
ATOM   4494  H HG13 . VAL B 2 18 ? 4.416   -7.175  -5.278  1.00 0.00 ? 18 VAL B HG13 6  
ATOM   4495  H HG21 . VAL B 2 18 ? 6.378   -4.502  -6.610  1.00 0.00 ? 18 VAL B HG21 6  
ATOM   4496  H HG22 . VAL B 2 18 ? 4.838   -3.706  -6.937  1.00 0.00 ? 18 VAL B HG22 6  
ATOM   4497  H HG23 . VAL B 2 18 ? 5.730   -4.473  -8.251  1.00 0.00 ? 18 VAL B HG23 6  
ATOM   4498  N N    . CYS B 2 19 ? 3.528   -8.463  -7.450  1.00 0.00 ? 19 CYS B N    6  
ATOM   4499  C CA   . CYS B 2 19 ? 2.867   -9.723  -7.022  1.00 0.00 ? 19 CYS B CA   6  
ATOM   4500  C C    . CYS B 2 19 ? 2.368   -10.481 -8.257  1.00 0.00 ? 19 CYS B C    6  
ATOM   4501  O O    . CYS B 2 19 ? 1.185   -10.699 -8.425  1.00 0.00 ? 19 CYS B O    6  
ATOM   4502  C CB   . CYS B 2 19 ? 1.676   -9.390  -6.119  1.00 0.00 ? 19 CYS B CB   6  
ATOM   4503  S SG   . CYS B 2 19 ? 2.033   -7.915  -5.131  1.00 0.00 ? 19 CYS B SG   6  
ATOM   4504  H H    . CYS B 2 19 ? 3.000   -7.747  -7.857  1.00 0.00 ? 19 CYS B H    6  
ATOM   4505  H HA   . CYS B 2 19 ? 3.573   -10.331 -6.478  1.00 0.00 ? 19 CYS B HA   6  
ATOM   4506  H HB2  . CYS B 2 19 ? 0.806   -9.206  -6.731  1.00 0.00 ? 19 CYS B HB2  6  
ATOM   4507  H HB3  . CYS B 2 19 ? 1.482   -10.223 -5.464  1.00 0.00 ? 19 CYS B HB3  6  
ATOM   4508  N N    . GLY B 2 20 ? 3.257   -10.874 -9.127  1.00 0.00 ? 20 GLY B N    6  
ATOM   4509  C CA   . GLY B 2 20 ? 2.828   -11.607 -10.354 1.00 0.00 ? 20 GLY B CA   6  
ATOM   4510  C C    . GLY B 2 20 ? 2.274   -12.984 -9.980  1.00 0.00 ? 20 GLY B C    6  
ATOM   4511  O O    . GLY B 2 20 ? 1.205   -13.371 -10.410 1.00 0.00 ? 20 GLY B O    6  
ATOM   4512  H H    . GLY B 2 20 ? 4.207   -10.683 -8.978  1.00 0.00 ? 20 GLY B H    6  
ATOM   4513  H HA2  . GLY B 2 20 ? 2.063   -11.037 -10.861 1.00 0.00 ? 20 GLY B HA2  6  
ATOM   4514  H HA3  . GLY B 2 20 ? 3.675   -11.732 -11.011 1.00 0.00 ? 20 GLY B HA3  6  
ATOM   4515  N N    . GLU B 2 21 ? 2.995   -13.731 -9.191  1.00 0.00 ? 21 GLU B N    6  
ATOM   4516  C CA   . GLU B 2 21 ? 2.513   -15.088 -8.800  1.00 0.00 ? 21 GLU B CA   6  
ATOM   4517  C C    . GLU B 2 21 ? 1.322   -14.964 -7.843  1.00 0.00 ? 21 GLU B C    6  
ATOM   4518  O O    . GLU B 2 21 ? 0.188   -15.185 -8.219  1.00 0.00 ? 21 GLU B O    6  
ATOM   4519  C CB   . GLU B 2 21 ? 3.646   -15.846 -8.106  1.00 0.00 ? 21 GLU B CB   6  
ATOM   4520  C CG   . GLU B 2 21 ? 4.865   -15.907 -9.030  1.00 0.00 ? 21 GLU B CG   6  
ATOM   4521  C CD   . GLU B 2 21 ? 4.594   -16.889 -10.171 1.00 0.00 ? 21 GLU B CD   6  
ATOM   4522  O OE1  . GLU B 2 21 ? 4.559   -18.080 -9.905  1.00 0.00 ? 21 GLU B OE1  6  
ATOM   4523  O OE2  . GLU B 2 21 ? 4.429   -16.435 -11.291 1.00 0.00 ? 21 GLU B OE2  6  
ATOM   4524  H H    . GLU B 2 21 ? 3.857   -13.404 -8.860  1.00 0.00 ? 21 GLU B H    6  
ATOM   4525  H HA   . GLU B 2 21 ? 2.208   -15.629 -9.683  1.00 0.00 ? 21 GLU B HA   6  
ATOM   4526  H HB2  . GLU B 2 21 ? 3.913   -15.336 -7.192  1.00 0.00 ? 21 GLU B HB2  6  
ATOM   4527  H HB3  . GLU B 2 21 ? 3.322   -16.850 -7.877  1.00 0.00 ? 21 GLU B HB3  6  
ATOM   4528  H HG2  . GLU B 2 21 ? 5.055   -14.924 -9.439  1.00 0.00 ? 21 GLU B HG2  6  
ATOM   4529  H HG3  . GLU B 2 21 ? 5.727   -16.237 -8.470  1.00 0.00 ? 21 GLU B HG3  6  
ATOM   4530  N N    . ARG B 2 22 ? 1.576   -14.616 -6.610  1.00 0.00 ? 22 ARG B N    6  
ATOM   4531  C CA   . ARG B 2 22 ? 0.469   -14.479 -5.619  1.00 0.00 ? 22 ARG B CA   6  
ATOM   4532  C C    . ARG B 2 22 ? -0.739  -13.803 -6.275  1.00 0.00 ? 22 ARG B C    6  
ATOM   4533  O O    . ARG B 2 22 ? -1.869  -14.013 -5.882  1.00 0.00 ? 22 ARG B O    6  
ATOM   4534  C CB   . ARG B 2 22 ? 0.947   -13.624 -4.443  1.00 0.00 ? 22 ARG B CB   6  
ATOM   4535  C CG   . ARG B 2 22 ? 1.275   -14.523 -3.250  1.00 0.00 ? 22 ARG B CG   6  
ATOM   4536  C CD   . ARG B 2 22 ? 2.466   -13.938 -2.486  1.00 0.00 ? 22 ARG B CD   6  
ATOM   4537  N NE   . ARG B 2 22 ? 2.146   -13.885 -1.032  1.00 0.00 ? 22 ARG B NE   6  
ATOM   4538  C CZ   . ARG B 2 22 ? 3.097   -13.674 -0.162  1.00 0.00 ? 22 ARG B CZ   6  
ATOM   4539  N NH1  . ARG B 2 22 ? 3.978   -14.606 0.080   1.00 0.00 ? 22 ARG B NH1  6  
ATOM   4540  N NH2  . ARG B 2 22 ? 3.168   -12.531 0.463   1.00 0.00 ? 22 ARG B NH2  6  
ATOM   4541  H H    . ARG B 2 22 ? 2.500   -14.449 -6.332  1.00 0.00 ? 22 ARG B H    6  
ATOM   4542  H HA   . ARG B 2 22 ? 0.182   -15.456 -5.259  1.00 0.00 ? 22 ARG B HA   6  
ATOM   4543  H HB2  . ARG B 2 22 ? 1.832   -13.077 -4.736  1.00 0.00 ? 22 ARG B HB2  6  
ATOM   4544  H HB3  . ARG B 2 22 ? 0.171   -12.928 -4.165  1.00 0.00 ? 22 ARG B HB3  6  
ATOM   4545  H HG2  . ARG B 2 22 ? 0.418   -14.578 -2.594  1.00 0.00 ? 22 ARG B HG2  6  
ATOM   4546  H HG3  . ARG B 2 22 ? 1.526   -15.513 -3.600  1.00 0.00 ? 22 ARG B HG3  6  
ATOM   4547  H HD2  . ARG B 2 22 ? 3.334   -14.561 -2.640  1.00 0.00 ? 22 ARG B HD2  6  
ATOM   4548  H HD3  . ARG B 2 22 ? 2.669   -12.940 -2.847  1.00 0.00 ? 22 ARG B HD3  6  
ATOM   4549  H HE   . ARG B 2 22 ? 1.222   -14.006 -0.728  1.00 0.00 ? 22 ARG B HE   6  
ATOM   4550  H HH11 . ARG B 2 22 ? 3.926   -15.482 -0.400  1.00 0.00 ? 22 ARG B HH11 6  
ATOM   4551  H HH12 . ARG B 2 22 ? 4.706   -14.445 0.748   1.00 0.00 ? 22 ARG B HH12 6  
ATOM   4552  H HH21 . ARG B 2 22 ? 2.494   -11.816 0.277   1.00 0.00 ? 22 ARG B HH21 6  
ATOM   4553  H HH22 . ARG B 2 22 ? 3.896   -12.370 1.130   1.00 0.00 ? 22 ARG B HH22 6  
ATOM   4554  N N    . GLY B 2 23 ? -0.508  -12.987 -7.266  1.00 0.00 ? 23 GLY B N    6  
ATOM   4555  C CA   . GLY B 2 23 ? -1.642  -12.295 -7.939  1.00 0.00 ? 23 GLY B CA   6  
ATOM   4556  C C    . GLY B 2 23 ? -1.835  -10.917 -7.309  1.00 0.00 ? 23 GLY B C    6  
ATOM   4557  O O    . GLY B 2 23 ? -0.922  -10.360 -6.735  1.00 0.00 ? 23 GLY B O    6  
ATOM   4558  H H    . GLY B 2 23 ? 0.411   -12.826 -7.564  1.00 0.00 ? 23 GLY B H    6  
ATOM   4559  H HA2  . GLY B 2 23 ? -1.423  -12.186 -8.992  1.00 0.00 ? 23 GLY B HA2  6  
ATOM   4560  H HA3  . GLY B 2 23 ? -2.545  -12.874 -7.816  1.00 0.00 ? 23 GLY B HA3  6  
ATOM   4561  N N    . PHE B 2 24 ? -3.019  -10.373 -7.395  1.00 0.00 ? 24 PHE B N    6  
ATOM   4562  C CA   . PHE B 2 24 ? -3.277  -9.026  -6.787  1.00 0.00 ? 24 PHE B CA   6  
ATOM   4563  C C    . PHE B 2 24 ? -4.694  -8.562  -7.142  1.00 0.00 ? 24 PHE B C    6  
ATOM   4564  O O    . PHE B 2 24 ? -5.351  -9.134  -7.989  1.00 0.00 ? 24 PHE B O    6  
ATOM   4565  C CB   . PHE B 2 24 ? -2.244  -7.992  -7.293  1.00 0.00 ? 24 PHE B CB   6  
ATOM   4566  C CG   . PHE B 2 24 ? -2.681  -7.386  -8.622  1.00 0.00 ? 24 PHE B CG   6  
ATOM   4567  C CD1  . PHE B 2 24 ? -3.593  -6.310  -8.649  1.00 0.00 ? 24 PHE B CD1  6  
ATOM   4568  C CD2  . PHE B 2 24 ? -2.179  -7.895  -9.831  1.00 0.00 ? 24 PHE B CD2  6  
ATOM   4569  C CE1  . PHE B 2 24 ? -3.989  -5.758  -9.874  1.00 0.00 ? 24 PHE B CE1  6  
ATOM   4570  C CE2  . PHE B 2 24 ? -2.580  -7.339  -11.051 1.00 0.00 ? 24 PHE B CE2  6  
ATOM   4571  C CZ   . PHE B 2 24 ? -3.484  -6.273  -11.073 1.00 0.00 ? 24 PHE B CZ   6  
ATOM   4572  H H    . PHE B 2 24 ? -3.746  -10.860 -7.846  1.00 0.00 ? 24 PHE B H    6  
ATOM   4573  H HA   . PHE B 2 24 ? -3.196  -9.107  -5.712  1.00 0.00 ? 24 PHE B HA   6  
ATOM   4574  H HB2  . PHE B 2 24 ? -2.152  -7.202  -6.562  1.00 0.00 ? 24 PHE B HB2  6  
ATOM   4575  H HB3  . PHE B 2 24 ? -1.281  -8.474  -7.414  1.00 0.00 ? 24 PHE B HB3  6  
ATOM   4576  H HD1  . PHE B 2 24 ? -3.984  -5.901  -7.729  1.00 0.00 ? 24 PHE B HD1  6  
ATOM   4577  H HD2  . PHE B 2 24 ? -1.480  -8.710  -9.822  1.00 0.00 ? 24 PHE B HD2  6  
ATOM   4578  H HE1  . PHE B 2 24 ? -4.688  -4.934  -9.893  1.00 0.00 ? 24 PHE B HE1  6  
ATOM   4579  H HE2  . PHE B 2 24 ? -2.190  -7.735  -11.978 1.00 0.00 ? 24 PHE B HE2  6  
ATOM   4580  H HZ   . PHE B 2 24 ? -3.792  -5.846  -12.016 1.00 0.00 ? 24 PHE B HZ   6  
ATOM   4581  N N    . PHE B 2 25 ? -5.166  -7.529  -6.500  1.00 0.00 ? 25 PHE B N    6  
ATOM   4582  C CA   . PHE B 2 25 ? -6.535  -7.027  -6.799  1.00 0.00 ? 25 PHE B CA   6  
ATOM   4583  C C    . PHE B 2 25 ? -6.543  -5.497  -6.721  1.00 0.00 ? 25 PHE B C    6  
ATOM   4584  O O    . PHE B 2 25 ? -6.335  -4.916  -5.674  1.00 0.00 ? 25 PHE B O    6  
ATOM   4585  C CB   . PHE B 2 25 ? -7.525  -7.608  -5.784  1.00 0.00 ? 25 PHE B CB   6  
ATOM   4586  C CG   . PHE B 2 25 ? -7.355  -6.922  -4.448  1.00 0.00 ? 25 PHE B CG   6  
ATOM   4587  C CD1  . PHE B 2 25 ? -6.378  -7.366  -3.547  1.00 0.00 ? 25 PHE B CD1  6  
ATOM   4588  C CD2  . PHE B 2 25 ? -8.178  -5.839  -4.110  1.00 0.00 ? 25 PHE B CD2  6  
ATOM   4589  C CE1  . PHE B 2 25 ? -6.225  -6.728  -2.308  1.00 0.00 ? 25 PHE B CE1  6  
ATOM   4590  C CE2  . PHE B 2 25 ? -8.025  -5.202  -2.871  1.00 0.00 ? 25 PHE B CE2  6  
ATOM   4591  C CZ   . PHE B 2 25 ? -7.049  -5.645  -1.971  1.00 0.00 ? 25 PHE B CZ   6  
ATOM   4592  H H    . PHE B 2 25 ? -4.617  -7.081  -5.822  1.00 0.00 ? 25 PHE B H    6  
ATOM   4593  H HA   . PHE B 2 25 ? -6.819  -7.335  -7.795  1.00 0.00 ? 25 PHE B HA   6  
ATOM   4594  H HB2  . PHE B 2 25 ? -8.533  -7.457  -6.141  1.00 0.00 ? 25 PHE B HB2  6  
ATOM   4595  H HB3  . PHE B 2 25 ? -7.339  -8.666  -5.669  1.00 0.00 ? 25 PHE B HB3  6  
ATOM   4596  H HD1  . PHE B 2 25 ? -5.742  -8.200  -3.806  1.00 0.00 ? 25 PHE B HD1  6  
ATOM   4597  H HD2  . PHE B 2 25 ? -8.932  -5.496  -4.804  1.00 0.00 ? 25 PHE B HD2  6  
ATOM   4598  H HE1  . PHE B 2 25 ? -5.472  -7.070  -1.613  1.00 0.00 ? 25 PHE B HE1  6  
ATOM   4599  H HE2  . PHE B 2 25 ? -8.660  -4.368  -2.612  1.00 0.00 ? 25 PHE B HE2  6  
ATOM   4600  H HZ   . PHE B 2 25 ? -6.930  -5.153  -1.017  1.00 0.00 ? 25 PHE B HZ   6  
ATOM   4601  N N    . TYR B 2 26 ? -6.773  -4.840  -7.824  1.00 0.00 ? 26 TYR B N    6  
ATOM   4602  C CA   . TYR B 2 26 ? -6.785  -3.350  -7.816  1.00 0.00 ? 26 TYR B CA   6  
ATOM   4603  C C    . TYR B 2 26 ? -7.846  -2.845  -6.836  1.00 0.00 ? 26 TYR B C    6  
ATOM   4604  O O    . TYR B 2 26 ? -8.881  -3.456  -6.652  1.00 0.00 ? 26 TYR B O    6  
ATOM   4605  C CB   . TYR B 2 26 ? -7.102  -2.840  -9.222  1.00 0.00 ? 26 TYR B CB   6  
ATOM   4606  C CG   . TYR B 2 26 ? -6.210  -1.665  -9.543  1.00 0.00 ? 26 TYR B CG   6  
ATOM   4607  C CD1  . TYR B 2 26 ? -4.846  -1.713  -9.224  1.00 0.00 ? 26 TYR B CD1  6  
ATOM   4608  C CD2  . TYR B 2 26 ? -6.746  -0.526  -10.159 1.00 0.00 ? 26 TYR B CD2  6  
ATOM   4609  C CE1  . TYR B 2 26 ? -4.018  -0.621  -9.522  1.00 0.00 ? 26 TYR B CE1  6  
ATOM   4610  C CE2  . TYR B 2 26 ? -5.918  0.565   -10.456 1.00 0.00 ? 26 TYR B CE2  6  
ATOM   4611  C CZ   . TYR B 2 26 ? -4.555  0.517   -10.137 1.00 0.00 ? 26 TYR B CZ   6  
ATOM   4612  O OH   . TYR B 2 26 ? -3.740  1.591   -10.432 1.00 0.00 ? 26 TYR B OH   6  
ATOM   4613  H H    . TYR B 2 26 ? -6.931  -5.327  -8.660  1.00 0.00 ? 26 TYR B H    6  
ATOM   4614  H HA   . TYR B 2 26 ? -5.815  -2.986  -7.513  1.00 0.00 ? 26 TYR B HA   6  
ATOM   4615  H HB2  . TYR B 2 26 ? -6.929  -3.630  -9.938  1.00 0.00 ? 26 TYR B HB2  6  
ATOM   4616  H HB3  . TYR B 2 26 ? -8.135  -2.530  -9.269  1.00 0.00 ? 26 TYR B HB3  6  
ATOM   4617  H HD1  . TYR B 2 26 ? -4.433  -2.591  -8.749  1.00 0.00 ? 26 TYR B HD1  6  
ATOM   4618  H HD2  . TYR B 2 26 ? -7.797  -0.490  -10.403 1.00 0.00 ? 26 TYR B HD2  6  
ATOM   4619  H HE1  . TYR B 2 26 ? -2.968  -0.658  -9.275  1.00 0.00 ? 26 TYR B HE1  6  
ATOM   4620  H HE2  . TYR B 2 26 ? -6.332  1.442   -10.930 1.00 0.00 ? 26 TYR B HE2  6  
ATOM   4621  H HH   . TYR B 2 26 ? -3.447  1.498   -11.341 1.00 0.00 ? 26 TYR B HH   6  
ATOM   4622  N N    . THR B 2 27 ? -7.594  -1.731  -6.201  1.00 0.00 ? 27 THR B N    6  
ATOM   4623  C CA   . THR B 2 27 ? -8.583  -1.181  -5.230  1.00 0.00 ? 27 THR B CA   6  
ATOM   4624  C C    . THR B 2 27 ? -9.664  -0.404  -5.986  1.00 0.00 ? 27 THR B C    6  
ATOM   4625  O O    . THR B 2 27 ? -9.495  -0.040  -7.133  1.00 0.00 ? 27 THR B O    6  
ATOM   4626  C CB   . THR B 2 27 ? -7.868  -0.240  -4.258  1.00 0.00 ? 27 THR B CB   6  
ATOM   4627  O OG1  . THR B 2 27 ? -6.776  0.380   -4.920  1.00 0.00 ? 27 THR B OG1  6  
ATOM   4628  C CG2  . THR B 2 27 ? -7.353  -1.035  -3.056  1.00 0.00 ? 27 THR B CG2  6  
ATOM   4629  H H    . THR B 2 27 ? -6.753  -1.257  -6.363  1.00 0.00 ? 27 THR B H    6  
ATOM   4630  H HA   . THR B 2 27 ? -9.038  -1.991  -4.681  1.00 0.00 ? 27 THR B HA   6  
ATOM   4631  H HB   . THR B 2 27 ? -8.557  0.516   -3.914  1.00 0.00 ? 27 THR B HB   6  
ATOM   4632  H HG1  . THR B 2 27 ? -7.130  0.955   -5.602  1.00 0.00 ? 27 THR B HG1  6  
ATOM   4633  H HG21 . THR B 2 27 ? -8.186  -1.338  -2.440  1.00 0.00 ? 27 THR B HG21 6  
ATOM   4634  H HG22 . THR B 2 27 ? -6.681  -0.417  -2.478  1.00 0.00 ? 27 THR B HG22 6  
ATOM   4635  H HG23 . THR B 2 27 ? -6.826  -1.911  -3.404  1.00 0.00 ? 27 THR B HG23 6  
ATOM   4636  N N    . LYS B 2 28 ? -10.775 -0.147  -5.350  1.00 0.00 ? 28 LYS B N    6  
ATOM   4637  C CA   . LYS B 2 28 ? -11.867 0.607   -6.027  1.00 0.00 ? 28 LYS B CA   6  
ATOM   4638  C C    . LYS B 2 28 ? -12.688 1.362   -4.977  1.00 0.00 ? 28 LYS B C    6  
ATOM   4639  O O    . LYS B 2 28 ? -13.816 1.008   -4.702  1.00 0.00 ? 28 LYS B O    6  
ATOM   4640  C CB   . LYS B 2 28 ? -12.774 -0.372  -6.776  1.00 0.00 ? 28 LYS B CB   6  
ATOM   4641  C CG   . LYS B 2 28 ? -13.502 0.365   -7.902  1.00 0.00 ? 28 LYS B CG   6  
ATOM   4642  C CD   . LYS B 2 28 ? -13.504 -0.499  -9.165  1.00 0.00 ? 28 LYS B CD   6  
ATOM   4643  C CE   . LYS B 2 28 ? -14.935 -0.633  -9.690  1.00 0.00 ? 28 LYS B CE   6  
ATOM   4644  N NZ   . LYS B 2 28 ? -15.018 -1.803  -10.608 1.00 0.00 ? 28 LYS B NZ   6  
ATOM   4645  H H    . LYS B 2 28 ? -10.889 -0.450  -4.425  1.00 0.00 ? 28 LYS B H    6  
ATOM   4646  H HA   . LYS B 2 28 ? -11.441 1.311   -6.726  1.00 0.00 ? 28 LYS B HA   6  
ATOM   4647  H HB2  . LYS B 2 28 ? -12.176 -1.170  -7.194  1.00 0.00 ? 28 LYS B HB2  6  
ATOM   4648  H HB3  . LYS B 2 28 ? -13.499 -0.786  -6.092  1.00 0.00 ? 28 LYS B HB3  6  
ATOM   4649  H HG2  . LYS B 2 28 ? -14.519 0.567   -7.600  1.00 0.00 ? 28 LYS B HG2  6  
ATOM   4650  H HG3  . LYS B 2 28 ? -12.996 1.297   -8.107  1.00 0.00 ? 28 LYS B HG3  6  
ATOM   4651  H HD2  . LYS B 2 28 ? -12.885 -0.035  -9.918  1.00 0.00 ? 28 LYS B HD2  6  
ATOM   4652  H HD3  . LYS B 2 28 ? -13.116 -1.478  -8.931  1.00 0.00 ? 28 LYS B HD3  6  
ATOM   4653  H HE2  . LYS B 2 28 ? -15.611 -0.778  -8.860  1.00 0.00 ? 28 LYS B HE2  6  
ATOM   4654  H HE3  . LYS B 2 28 ? -15.207 0.265   -10.224 1.00 0.00 ? 28 LYS B HE3  6  
ATOM   4655  H HZ1  . LYS B 2 28 ? -14.621 -2.642  -10.140 1.00 0.00 ? 28 LYS B HZ1  6  
ATOM   4656  H HZ2  . LYS B 2 28 ? -14.480 -1.602  -11.476 1.00 0.00 ? 28 LYS B HZ2  6  
ATOM   4657  H HZ3  . LYS B 2 28 ? -16.012 -1.983  -10.852 1.00 0.00 ? 28 LYS B HZ3  6  
ATOM   4658  N N    . PRO B 2 29 ? -12.088 2.384   -4.418  1.00 0.00 ? 29 PRO B N    6  
ATOM   4659  C CA   . PRO B 2 29 ? -12.733 3.216   -3.388  1.00 0.00 ? 29 PRO B CA   6  
ATOM   4660  C C    . PRO B 2 29 ? -13.705 4.207   -4.031  1.00 0.00 ? 29 PRO B C    6  
ATOM   4661  O O    . PRO B 2 29 ? -13.473 4.706   -5.114  1.00 0.00 ? 29 PRO B O    6  
ATOM   4662  C CB   . PRO B 2 29 ? -11.558 3.953   -2.738  1.00 0.00 ? 29 PRO B CB   6  
ATOM   4663  C CG   . PRO B 2 29 ? -10.412 3.948   -3.777  1.00 0.00 ? 29 PRO B CG   6  
ATOM   4664  C CD   . PRO B 2 29 ? -10.715 2.804   -4.763  1.00 0.00 ? 29 PRO B CD   6  
ATOM   4665  H HA   . PRO B 2 29 ? -13.236 2.604   -2.657  1.00 0.00 ? 29 PRO B HA   6  
ATOM   4666  H HB2  . PRO B 2 29 ? -11.845 4.968   -2.500  1.00 0.00 ? 29 PRO B HB2  6  
ATOM   4667  H HB3  . PRO B 2 29 ? -11.242 3.435   -1.846  1.00 0.00 ? 29 PRO B HB3  6  
ATOM   4668  H HG2  . PRO B 2 29 ? -10.386 4.894   -4.301  1.00 0.00 ? 29 PRO B HG2  6  
ATOM   4669  H HG3  . PRO B 2 29 ? -9.466  3.767   -3.288  1.00 0.00 ? 29 PRO B HG3  6  
ATOM   4670  H HD2  . PRO B 2 29 ? -10.669 3.162   -5.783  1.00 0.00 ? 29 PRO B HD2  6  
ATOM   4671  H HD3  . PRO B 2 29 ? -10.028 1.985   -4.617  1.00 0.00 ? 29 PRO B HD3  6  
ATOM   4672  N N    . THR B 2 30 ? -14.790 4.498   -3.370  1.00 0.00 ? 30 THR B N    6  
ATOM   4673  C CA   . THR B 2 30 ? -15.776 5.458   -3.939  1.00 0.00 ? 30 THR B CA   6  
ATOM   4674  C C    . THR B 2 30 ? -15.302 6.889   -3.676  1.00 0.00 ? 30 THR B C    6  
ATOM   4675  O O    . THR B 2 30 ? -14.714 7.115   -2.632  1.00 0.00 ? 30 THR B O    6  
ATOM   4676  C CB   . THR B 2 30 ? -17.136 5.238   -3.276  1.00 0.00 ? 30 THR B CB   6  
ATOM   4677  O OG1  . THR B 2 30 ? -18.065 6.187   -3.783  1.00 0.00 ? 30 THR B OG1  6  
ATOM   4678  C CG2  . THR B 2 30 ? -17.000 5.407   -1.762  1.00 0.00 ? 30 THR B CG2  6  
ATOM   4679  O OXT  . THR B 2 30 ? -15.536 7.734   -4.525  1.00 0.00 ? 30 THR B OXT  6  
ATOM   4680  H H    . THR B 2 30 ? -14.958 4.085   -2.497  1.00 0.00 ? 30 THR B H    6  
ATOM   4681  H HA   . THR B 2 30 ? -15.863 5.296   -5.003  1.00 0.00 ? 30 THR B HA   6  
ATOM   4682  H HB   . THR B 2 30 ? -17.485 4.241   -3.493  1.00 0.00 ? 30 THR B HB   6  
ATOM   4683  H HG1  . THR B 2 30 ? -17.846 6.354   -4.702  1.00 0.00 ? 30 THR B HG1  6  
ATOM   4684  H HG21 . THR B 2 30 ? -15.959 5.534   -1.507  1.00 0.00 ? 30 THR B HG21 6  
ATOM   4685  H HG22 . THR B 2 30 ? -17.387 4.529   -1.267  1.00 0.00 ? 30 THR B HG22 6  
ATOM   4686  H HG23 . THR B 2 30 ? -17.559 6.275   -1.445  1.00 0.00 ? 30 THR B HG23 6  
ATOM   4687  N N    . GLY A 1 1  ? -6.400  4.202   -0.241  1.00 0.00 ? 1  GLY A N    7  
ATOM   4688  C CA   . GLY A 1 1  ? -5.946  3.013   -1.086  1.00 0.00 ? 1  GLY A CA   7  
ATOM   4689  C C    . GLY A 1 1  ? -4.586  3.029   -1.697  1.00 0.00 ? 1  GLY A C    7  
ATOM   4690  O O    . GLY A 1 1  ? -3.757  3.852   -1.365  1.00 0.00 ? 1  GLY A O    7  
ATOM   4691  H H1   . GLY A 1 1  ? -6.157  5.088   -0.730  1.00 0.00 ? 1  GLY A H1   7  
ATOM   4692  H H2   . GLY A 1 1  ? -5.923  4.174   0.682   1.00 0.00 ? 1  GLY A H2   7  
ATOM   4693  H H3   . GLY A 1 1  ? -7.429  4.157   -0.102  1.00 0.00 ? 1  GLY A H3   7  
ATOM   4694  H HA2  . GLY A 1 1  ? -5.571  2.305   -0.529  1.00 0.00 ? 1  GLY A HA2  7  
ATOM   4695  H HA3  . GLY A 1 1  ? -6.870  2.663   -1.707  1.00 0.00 ? 1  GLY A HA3  7  
HETATM 4696  N N    . IIL A 1 2  ? -4.318  2.127   -2.601  1.00 0.00 ? 2  IIL A N    7  
HETATM 4697  C CA   . IIL A 1 2  ? -2.975  2.094   -3.245  1.00 0.00 ? 2  IIL A CA   7  
HETATM 4698  C C    . IIL A 1 2  ? -2.983  2.978   -4.495  1.00 0.00 ? 2  IIL A C    7  
HETATM 4699  O O    . IIL A 1 2  ? -2.026  3.671   -4.782  1.00 0.00 ? 2  IIL A O    7  
HETATM 4700  C CB   . IIL A 1 2  ? -2.630  0.656   -3.639  1.00 0.00 ? 2  IIL A CB   7  
HETATM 4701  C CG2  . IIL A 1 2  ? -1.230  0.616   -4.249  1.00 0.00 ? 2  IIL A CG2  7  
HETATM 4702  C CG1  . IIL A 1 2  ? -3.648  0.146   -4.662  1.00 0.00 ? 2  IIL A CG1  7  
HETATM 4703  C CD1  . IIL A 1 2  ? -3.692  -1.382  -4.618  1.00 0.00 ? 2  IIL A CD1  7  
HETATM 4704  H H    . IIL A 1 2  ? -5.000  1.470   -2.855  1.00 0.00 ? 2  IIL A H    7  
HETATM 4705  H HA   . IIL A 1 2  ? -2.235  2.463   -2.550  1.00 0.00 ? 2  IIL A HA   7  
HETATM 4706  H HB   . IIL A 1 2  ? -2.657  0.025   -2.764  1.00 0.00 ? 2  IIL A HB   7  
HETATM 4707  H HG21 . IIL A 1 2  ? -1.305  0.638   -5.326  1.00 0.00 ? 2  IIL A HG21 7  
HETATM 4708  H HG22 . IIL A 1 2  ? -0.728  -0.289  -3.942  1.00 0.00 ? 2  IIL A HG22 7  
HETATM 4709  H HG23 . IIL A 1 2  ? -0.664  1.473   -3.911  1.00 0.00 ? 2  IIL A HG23 7  
HETATM 4710  H HG12 . IIL A 1 2  ? -3.357  0.467   -5.651  1.00 0.00 ? 2  IIL A HG12 7  
HETATM 4711  H HG13 . IIL A 1 2  ? -4.625  0.542   -4.427  1.00 0.00 ? 2  IIL A HG13 7  
HETATM 4712  H HD11 . IIL A 1 2  ? -4.192  -1.702  -3.715  1.00 0.00 ? 2  IIL A HD11 7  
HETATM 4713  H HD12 . IIL A 1 2  ? -2.685  -1.772  -4.629  1.00 0.00 ? 2  IIL A HD12 7  
HETATM 4714  H HD13 . IIL A 1 2  ? -4.231  -1.751  -5.478  1.00 0.00 ? 2  IIL A HD13 7  
ATOM   4715  N N    . VAL A 1 3  ? -4.053  2.960   -5.241  1.00 0.00 ? 3  VAL A N    7  
ATOM   4716  C CA   . VAL A 1 3  ? -4.117  3.799   -6.470  1.00 0.00 ? 3  VAL A CA   7  
ATOM   4717  C C    . VAL A 1 3  ? -4.240  5.272   -6.080  1.00 0.00 ? 3  VAL A C    7  
ATOM   4718  O O    . VAL A 1 3  ? -3.708  6.144   -6.737  1.00 0.00 ? 3  VAL A O    7  
ATOM   4719  C CB   . VAL A 1 3  ? -5.333  3.390   -7.301  1.00 0.00 ? 3  VAL A CB   7  
ATOM   4720  C CG1  . VAL A 1 3  ? -5.331  4.161   -8.621  1.00 0.00 ? 3  VAL A CG1  7  
ATOM   4721  C CG2  . VAL A 1 3  ? -5.273  1.887   -7.588  1.00 0.00 ? 3  VAL A CG2  7  
ATOM   4722  H H    . VAL A 1 3  ? -4.814  2.395   -4.993  1.00 0.00 ? 3  VAL A H    7  
ATOM   4723  H HA   . VAL A 1 3  ? -3.219  3.653   -7.051  1.00 0.00 ? 3  VAL A HA   7  
ATOM   4724  H HB   . VAL A 1 3  ? -6.237  3.619   -6.752  1.00 0.00 ? 3  VAL A HB   7  
ATOM   4725  H HG11 . VAL A 1 3  ? -4.571  4.928   -8.586  1.00 0.00 ? 3  VAL A HG11 7  
ATOM   4726  H HG12 . VAL A 1 3  ? -6.297  4.617   -8.772  1.00 0.00 ? 3  VAL A HG12 7  
ATOM   4727  H HG13 . VAL A 1 3  ? -5.121  3.482   -9.434  1.00 0.00 ? 3  VAL A HG13 7  
ATOM   4728  H HG21 . VAL A 1 3  ? -5.107  1.351   -6.665  1.00 0.00 ? 3  VAL A HG21 7  
ATOM   4729  H HG22 . VAL A 1 3  ? -4.464  1.685   -8.273  1.00 0.00 ? 3  VAL A HG22 7  
ATOM   4730  H HG23 . VAL A 1 3  ? -6.206  1.568   -8.028  1.00 0.00 ? 3  VAL A HG23 7  
ATOM   4731  N N    . GLU A 1 4  ? -4.941  5.560   -5.017  1.00 0.00 ? 4  GLU A N    7  
ATOM   4732  C CA   . GLU A 1 4  ? -5.097  6.980   -4.592  1.00 0.00 ? 4  GLU A CA   7  
ATOM   4733  C C    . GLU A 1 4  ? -3.836  7.443   -3.859  1.00 0.00 ? 4  GLU A C    7  
ATOM   4734  O O    . GLU A 1 4  ? -3.714  8.591   -3.484  1.00 0.00 ? 4  GLU A O    7  
ATOM   4735  C CB   . GLU A 1 4  ? -6.301  7.106   -3.655  1.00 0.00 ? 4  GLU A CB   7  
ATOM   4736  C CG   . GLU A 1 4  ? -7.427  6.191   -4.140  1.00 0.00 ? 4  GLU A CG   7  
ATOM   4737  C CD   . GLU A 1 4  ? -8.777  6.773   -3.715  1.00 0.00 ? 4  GLU A CD   7  
ATOM   4738  O OE1  . GLU A 1 4  ? -8.883  7.987   -3.656  1.00 0.00 ? 4  GLU A OE1  7  
ATOM   4739  O OE2  . GLU A 1 4  ? -9.679  5.995   -3.454  1.00 0.00 ? 4  GLU A OE2  7  
ATOM   4740  H H    . GLU A 1 4  ? -5.366  4.843   -4.501  1.00 0.00 ? 4  GLU A H    7  
ATOM   4741  H HA   . GLU A 1 4  ? -5.254  7.599   -5.462  1.00 0.00 ? 4  GLU A HA   7  
ATOM   4742  H HB2  . GLU A 1 4  ? -6.010  6.820   -2.654  1.00 0.00 ? 4  GLU A HB2  7  
ATOM   4743  H HB3  . GLU A 1 4  ? -6.648  8.128   -3.650  1.00 0.00 ? 4  GLU A HB3  7  
ATOM   4744  H HG2  . GLU A 1 4  ? -7.389  6.116   -5.217  1.00 0.00 ? 4  GLU A HG2  7  
ATOM   4745  H HG3  . GLU A 1 4  ? -7.308  5.210   -3.706  1.00 0.00 ? 4  GLU A HG3  7  
ATOM   4746  N N    . GLN A 1 5  ? -2.896  6.561   -3.646  1.00 0.00 ? 5  GLN A N    7  
ATOM   4747  C CA   . GLN A 1 5  ? -1.651  6.967   -2.933  1.00 0.00 ? 5  GLN A CA   7  
ATOM   4748  C C    . GLN A 1 5  ? -0.497  7.099   -3.931  1.00 0.00 ? 5  GLN A C    7  
ATOM   4749  O O    . GLN A 1 5  ? 0.296   8.015   -3.855  1.00 0.00 ? 5  GLN A O    7  
ATOM   4750  C CB   . GLN A 1 5  ? -1.300  5.917   -1.876  1.00 0.00 ? 5  GLN A CB   7  
ATOM   4751  C CG   . GLN A 1 5  ? -2.062  6.220   -0.585  1.00 0.00 ? 5  GLN A CG   7  
ATOM   4752  C CD   . GLN A 1 5  ? -1.475  7.470   0.074   1.00 0.00 ? 5  GLN A CD   7  
ATOM   4753  O OE1  . GLN A 1 5  ? -2.203  8.334   0.520   1.00 0.00 ? 5  GLN A OE1  7  
ATOM   4754  N NE2  . GLN A 1 5  ? -0.180  7.602   0.156   1.00 0.00 ? 5  GLN A NE2  7  
ATOM   4755  H H    . GLN A 1 5  ? -3.009  5.637   -3.953  1.00 0.00 ? 5  GLN A H    7  
ATOM   4756  H HA   . GLN A 1 5  ? -1.814  7.920   -2.450  1.00 0.00 ? 5  GLN A HA   7  
ATOM   4757  H HB2  . GLN A 1 5  ? -1.574  4.937   -2.236  1.00 0.00 ? 5  GLN A HB2  7  
ATOM   4758  H HB3  . GLN A 1 5  ? -0.238  5.945   -1.679  1.00 0.00 ? 5  GLN A HB3  7  
ATOM   4759  H HG2  . GLN A 1 5  ? -3.104  6.388   -0.814  1.00 0.00 ? 5  GLN A HG2  7  
ATOM   4760  H HG3  . GLN A 1 5  ? -1.974  5.383   0.091   1.00 0.00 ? 5  GLN A HG3  7  
ATOM   4761  H HE21 . GLN A 1 5  ? 0.409   6.905   -0.203  1.00 0.00 ? 5  GLN A HE21 7  
ATOM   4762  H HE22 . GLN A 1 5  ? 0.205   8.399   0.577   1.00 0.00 ? 5  GLN A HE22 7  
ATOM   4763  N N    . CYS A 1 6  ? -0.396  6.199   -4.872  1.00 0.00 ? 6  CYS A N    7  
ATOM   4764  C CA   . CYS A 1 6  ? 0.709   6.293   -5.867  1.00 0.00 ? 6  CYS A CA   7  
ATOM   4765  C C    . CYS A 1 6  ? 0.267   7.194   -7.019  1.00 0.00 ? 6  CYS A C    7  
ATOM   4766  O O    . CYS A 1 6  ? 1.077   7.715   -7.761  1.00 0.00 ? 6  CYS A O    7  
ATOM   4767  C CB   . CYS A 1 6  ? 1.047   4.901   -6.401  1.00 0.00 ? 6  CYS A CB   7  
ATOM   4768  S SG   . CYS A 1 6  ? 1.434   3.803   -5.016  1.00 0.00 ? 6  CYS A SG   7  
ATOM   4769  H H    . CYS A 1 6  ? -1.045  5.466   -4.927  1.00 0.00 ? 6  CYS A H    7  
ATOM   4770  H HA   . CYS A 1 6  ? 1.581   6.719   -5.394  1.00 0.00 ? 6  CYS A HA   7  
ATOM   4771  H HB2  . CYS A 1 6  ? 0.203   4.510   -6.948  1.00 0.00 ? 6  CYS A HB2  7  
ATOM   4772  H HB3  . CYS A 1 6  ? 1.902   4.966   -7.058  1.00 0.00 ? 6  CYS A HB3  7  
ATOM   4773  N N    . CYS A 1 7  ? -1.014  7.394   -7.166  1.00 0.00 ? 7  CYS A N    7  
ATOM   4774  C CA   . CYS A 1 7  ? -1.506  8.275   -8.258  1.00 0.00 ? 7  CYS A CA   7  
ATOM   4775  C C    . CYS A 1 7  ? -1.631  9.698   -7.714  1.00 0.00 ? 7  CYS A C    7  
ATOM   4776  O O    . CYS A 1 7  ? -1.680  10.659  -8.456  1.00 0.00 ? 7  CYS A O    7  
ATOM   4777  C CB   . CYS A 1 7  ? -2.860  7.767   -8.762  1.00 0.00 ? 7  CYS A CB   7  
ATOM   4778  S SG   . CYS A 1 7  ? -3.228  8.499   -10.377 1.00 0.00 ? 7  CYS A SG   7  
ATOM   4779  H H    . CYS A 1 7  ? -1.651  6.973   -6.551  1.00 0.00 ? 7  CYS A H    7  
ATOM   4780  H HA   . CYS A 1 7  ? -0.794  8.271   -9.065  1.00 0.00 ? 7  CYS A HA   7  
ATOM   4781  H HB2  . CYS A 1 7  ? -2.828  6.692   -8.855  1.00 0.00 ? 7  CYS A HB2  7  
ATOM   4782  H HB3  . CYS A 1 7  ? -3.630  8.041   -8.062  1.00 0.00 ? 7  CYS A HB3  7  
ATOM   4783  N N    . THR A 1 8  ? -1.648  9.837   -6.416  1.00 0.00 ? 8  THR A N    7  
ATOM   4784  C CA   . THR A 1 8  ? -1.728  11.192  -5.809  1.00 0.00 ? 8  THR A CA   7  
ATOM   4785  C C    . THR A 1 8  ? -0.299  11.677  -5.564  1.00 0.00 ? 8  THR A C    7  
ATOM   4786  O O    . THR A 1 8  ? -0.025  12.858  -5.495  1.00 0.00 ? 8  THR A O    7  
ATOM   4787  C CB   . THR A 1 8  ? -2.487  11.117  -4.478  1.00 0.00 ? 8  THR A CB   7  
ATOM   4788  O OG1  . THR A 1 8  ? -2.852  12.428  -4.069  1.00 0.00 ? 8  THR A OG1  7  
ATOM   4789  C CG2  . THR A 1 8  ? -1.600  10.475  -3.408  1.00 0.00 ? 8  THR A CG2  7  
ATOM   4790  H H    . THR A 1 8  ? -1.582  9.048   -5.840  1.00 0.00 ? 8  THR A H    7  
ATOM   4791  H HA   . THR A 1 8  ? -2.233  11.868  -6.484  1.00 0.00 ? 8  THR A HA   7  
ATOM   4792  H HB   . THR A 1 8  ? -3.377  10.519  -4.606  1.00 0.00 ? 8  THR A HB   7  
ATOM   4793  H HG1  . THR A 1 8  ? -2.992  12.956  -4.857  1.00 0.00 ? 8  THR A HG1  7  
ATOM   4794  H HG21 . THR A 1 8  ? -2.131  10.451  -2.468  1.00 0.00 ? 8  THR A HG21 7  
ATOM   4795  H HG22 . THR A 1 8  ? -0.696  11.053  -3.296  1.00 0.00 ? 8  THR A HG22 7  
ATOM   4796  H HG23 . THR A 1 8  ? -1.349  9.467   -3.705  1.00 0.00 ? 8  THR A HG23 7  
ATOM   4797  N N    . SER A 1 9  ? 0.614   10.751  -5.443  1.00 0.00 ? 9  SER A N    7  
ATOM   4798  C CA   . SER A 1 9  ? 2.040   11.107  -5.212  1.00 0.00 ? 9  SER A CA   7  
ATOM   4799  C C    . SER A 1 9  ? 2.906   9.907   -5.602  1.00 0.00 ? 9  SER A C    7  
ATOM   4800  O O    . SER A 1 9  ? 2.435   8.969   -6.216  1.00 0.00 ? 9  SER A O    7  
ATOM   4801  C CB   . SER A 1 9  ? 2.253   11.439  -3.735  1.00 0.00 ? 9  SER A CB   7  
ATOM   4802  O OG   . SER A 1 9  ? 1.368   12.485  -3.356  1.00 0.00 ? 9  SER A OG   7  
ATOM   4803  H H    . SER A 1 9  ? 0.356   9.808   -5.511  1.00 0.00 ? 9  SER A H    7  
ATOM   4804  H HA   . SER A 1 9  ? 2.305   11.960  -5.820  1.00 0.00 ? 9  SER A HA   7  
ATOM   4805  H HB2  . SER A 1 9  ? 2.052   10.568  -3.136  1.00 0.00 ? 9  SER A HB2  7  
ATOM   4806  H HB3  . SER A 1 9  ? 3.279   11.749  -3.582  1.00 0.00 ? 9  SER A HB3  7  
ATOM   4807  H HG   . SER A 1 9  ? 0.777   12.143  -2.680  1.00 0.00 ? 9  SER A HG   7  
ATOM   4808  N N    . ILE A 1 10 ? 4.162   9.916   -5.256  1.00 0.00 ? 10 ILE A N    7  
ATOM   4809  C CA   . ILE A 1 10 ? 5.032   8.762   -5.618  1.00 0.00 ? 10 ILE A CA   7  
ATOM   4810  C C    . ILE A 1 10 ? 5.184   7.834   -4.411  1.00 0.00 ? 10 ILE A C    7  
ATOM   4811  O O    . ILE A 1 10 ? 5.538   8.257   -3.329  1.00 0.00 ? 10 ILE A O    7  
ATOM   4812  C CB   . ILE A 1 10 ? 6.408   9.269   -6.053  1.00 0.00 ? 10 ILE A CB   7  
ATOM   4813  C CG1  . ILE A 1 10 ? 6.226   10.335  -7.144  1.00 0.00 ? 10 ILE A CG1  7  
ATOM   4814  C CG2  . ILE A 1 10 ? 7.227   8.096   -6.600  1.00 0.00 ? 10 ILE A CG2  7  
ATOM   4815  C CD1  . ILE A 1 10 ? 7.522   10.498  -7.941  1.00 0.00 ? 10 ILE A CD1  7  
ATOM   4816  H H    . ILE A 1 10 ? 4.532   10.677  -4.759  1.00 0.00 ? 10 ILE A H    7  
ATOM   4817  H HA   . ILE A 1 10 ? 4.579   8.216   -6.432  1.00 0.00 ? 10 ILE A HA   7  
ATOM   4818  H HB   . ILE A 1 10 ? 6.918   9.700   -5.204  1.00 0.00 ? 10 ILE A HB   7  
ATOM   4819  H HG12 . ILE A 1 10 ? 5.431   10.034  -7.810  1.00 0.00 ? 10 ILE A HG12 7  
ATOM   4820  H HG13 . ILE A 1 10 ? 5.968   11.278  -6.683  1.00 0.00 ? 10 ILE A HG13 7  
ATOM   4821  H HG21 . ILE A 1 10 ? 8.279   8.292   -6.451  1.00 0.00 ? 10 ILE A HG21 7  
ATOM   4822  H HG22 . ILE A 1 10 ? 7.030   7.978   -7.655  1.00 0.00 ? 10 ILE A HG22 7  
ATOM   4823  H HG23 . ILE A 1 10 ? 6.952   7.191   -6.079  1.00 0.00 ? 10 ILE A HG23 7  
ATOM   4824  H HD11 . ILE A 1 10 ? 8.317   10.805  -7.278  1.00 0.00 ? 10 ILE A HD11 7  
ATOM   4825  H HD12 . ILE A 1 10 ? 7.382   11.244  -8.708  1.00 0.00 ? 10 ILE A HD12 7  
ATOM   4826  H HD13 . ILE A 1 10 ? 7.779   9.555   -8.398  1.00 0.00 ? 10 ILE A HD13 7  
ATOM   4827  N N    . CYS A 1 11 ? 4.913   6.569   -4.590  1.00 0.00 ? 11 CYS A N    7  
ATOM   4828  C CA   . CYS A 1 11 ? 5.035   5.609   -3.455  1.00 0.00 ? 11 CYS A CA   7  
ATOM   4829  C C    . CYS A 1 11 ? 6.205   4.656   -3.712  1.00 0.00 ? 11 CYS A C    7  
ATOM   4830  O O    . CYS A 1 11 ? 7.073   4.927   -4.518  1.00 0.00 ? 11 CYS A O    7  
ATOM   4831  C CB   . CYS A 1 11 ? 3.740   4.805   -3.330  1.00 0.00 ? 11 CYS A CB   7  
ATOM   4832  S SG   . CYS A 1 11 ? 3.448   3.890   -4.865  1.00 0.00 ? 11 CYS A SG   7  
ATOM   4833  H H    . CYS A 1 11 ? 4.626   6.249   -5.470  1.00 0.00 ? 11 CYS A H    7  
ATOM   4834  H HA   . CYS A 1 11 ? 5.211   6.155   -2.540  1.00 0.00 ? 11 CYS A HA   7  
ATOM   4835  H HB2  . CYS A 1 11 ? 3.826   4.110   -2.507  1.00 0.00 ? 11 CYS A HB2  7  
ATOM   4836  H HB3  . CYS A 1 11 ? 2.915   5.478   -3.148  1.00 0.00 ? 11 CYS A HB3  7  
ATOM   4837  N N    . SER A 1 12 ? 6.237   3.542   -3.031  1.00 0.00 ? 12 SER A N    7  
ATOM   4838  C CA   . SER A 1 12 ? 7.354   2.575   -3.236  1.00 0.00 ? 12 SER A CA   7  
ATOM   4839  C C    . SER A 1 12 ? 6.785   1.184   -3.533  1.00 0.00 ? 12 SER A C    7  
ATOM   4840  O O    . SER A 1 12 ? 5.664   0.870   -3.183  1.00 0.00 ? 12 SER A O    7  
ATOM   4841  C CB   . SER A 1 12 ? 8.211   2.514   -1.969  1.00 0.00 ? 12 SER A CB   7  
ATOM   4842  O OG   . SER A 1 12 ? 7.457   3.001   -0.867  1.00 0.00 ? 12 SER A OG   7  
ATOM   4843  H H    . SER A 1 12 ? 5.530   3.343   -2.384  1.00 0.00 ? 12 SER A H    7  
ATOM   4844  H HA   . SER A 1 12 ? 7.962   2.900   -4.066  1.00 0.00 ? 12 SER A HA   7  
ATOM   4845  H HB2  . SER A 1 12 ? 8.500   1.495   -1.778  1.00 0.00 ? 12 SER A HB2  7  
ATOM   4846  H HB3  . SER A 1 12 ? 9.098   3.118   -2.108  1.00 0.00 ? 12 SER A HB3  7  
ATOM   4847  H HG   . SER A 1 12 ? 8.029   3.006   -0.096  1.00 0.00 ? 12 SER A HG   7  
ATOM   4848  N N    . LEU A 1 13 ? 7.555   0.346   -4.173  1.00 0.00 ? 13 LEU A N    7  
ATOM   4849  C CA   . LEU A 1 13 ? 7.065   -1.024  -4.492  1.00 0.00 ? 13 LEU A CA   7  
ATOM   4850  C C    . LEU A 1 13 ? 6.972   -1.842  -3.203  1.00 0.00 ? 13 LEU A C    7  
ATOM   4851  O O    . LEU A 1 13 ? 6.232   -2.803  -3.122  1.00 0.00 ? 13 LEU A O    7  
ATOM   4852  C CB   . LEU A 1 13 ? 8.041   -1.705  -5.452  1.00 0.00 ? 13 LEU A CB   7  
ATOM   4853  C CG   . LEU A 1 13 ? 8.636   -0.665  -6.399  1.00 0.00 ? 13 LEU A CG   7  
ATOM   4854  C CD1  . LEU A 1 13 ? 10.043  -0.292  -5.929  1.00 0.00 ? 13 LEU A CD1  7  
ATOM   4855  C CD2  . LEU A 1 13 ? 8.708   -1.248  -7.812  1.00 0.00 ? 13 LEU A CD2  7  
ATOM   4856  H H    . LEU A 1 13 ? 8.457   0.618   -4.443  1.00 0.00 ? 13 LEU A H    7  
ATOM   4857  H HA   . LEU A 1 13 ? 6.087   -0.960  -4.955  1.00 0.00 ? 13 LEU A HA   7  
ATOM   4858  H HB2  . LEU A 1 13 ? 8.835   -2.172  -4.886  1.00 0.00 ? 13 LEU A HB2  7  
ATOM   4859  H HB3  . LEU A 1 13 ? 7.518   -2.454  -6.027  1.00 0.00 ? 13 LEU A HB3  7  
ATOM   4860  H HG   . LEU A 1 13 ? 8.012   0.218   -6.402  1.00 0.00 ? 13 LEU A HG   7  
ATOM   4861  H HD11 . LEU A 1 13 ? 10.185  0.775   -6.023  1.00 0.00 ? 13 LEU A HD11 7  
ATOM   4862  H HD12 . LEU A 1 13 ? 10.774  -0.807  -6.536  1.00 0.00 ? 13 LEU A HD12 7  
ATOM   4863  H HD13 . LEU A 1 13 ? 10.165  -0.581  -4.895  1.00 0.00 ? 13 LEU A HD13 7  
ATOM   4864  H HD21 . LEU A 1 13 ? 8.233   -2.218  -7.824  1.00 0.00 ? 13 LEU A HD21 7  
ATOM   4865  H HD22 . LEU A 1 13 ? 9.741   -1.351  -8.106  1.00 0.00 ? 13 LEU A HD22 7  
ATOM   4866  H HD23 . LEU A 1 13 ? 8.199   -0.589  -8.500  1.00 0.00 ? 13 LEU A HD23 7  
ATOM   4867  N N    . TYR A 1 14 ? 7.707   -1.467  -2.189  1.00 0.00 ? 14 TYR A N    7  
ATOM   4868  C CA   . TYR A 1 14 ? 7.641   -2.227  -0.911  1.00 0.00 ? 14 TYR A CA   7  
ATOM   4869  C C    . TYR A 1 14 ? 6.210   -2.167  -0.408  1.00 0.00 ? 14 TYR A C    7  
ATOM   4870  O O    . TYR A 1 14 ? 5.670   -3.127  0.105   1.00 0.00 ? 14 TYR A O    7  
ATOM   4871  C CB   . TYR A 1 14 ? 8.580   -1.598  0.119   1.00 0.00 ? 14 TYR A CB   7  
ATOM   4872  C CG   . TYR A 1 14 ? 10.007  -1.688  -0.380  1.00 0.00 ? 14 TYR A CG   7  
ATOM   4873  C CD1  . TYR A 1 14 ? 10.563  -2.936  -0.704  1.00 0.00 ? 14 TYR A CD1  7  
ATOM   4874  C CD2  . TYR A 1 14 ? 10.778  -0.525  -0.517  1.00 0.00 ? 14 TYR A CD2  7  
ATOM   4875  C CE1  . TYR A 1 14 ? 11.884  -3.017  -1.164  1.00 0.00 ? 14 TYR A CE1  7  
ATOM   4876  C CE2  . TYR A 1 14 ? 12.098  -0.607  -0.978  1.00 0.00 ? 14 TYR A CE2  7  
ATOM   4877  C CZ   . TYR A 1 14 ? 12.652  -1.854  -1.301  1.00 0.00 ? 14 TYR A CZ   7  
ATOM   4878  O OH   . TYR A 1 14 ? 13.953  -1.933  -1.754  1.00 0.00 ? 14 TYR A OH   7  
ATOM   4879  H H    . TYR A 1 14 ? 8.288   -0.686  -2.264  1.00 0.00 ? 14 TYR A H    7  
ATOM   4880  H HA   . TYR A 1 14 ? 7.920   -3.251  -1.086  1.00 0.00 ? 14 TYR A HA   7  
ATOM   4881  H HB2  . TYR A 1 14 ? 8.311   -0.560  0.265   1.00 0.00 ? 14 TYR A HB2  7  
ATOM   4882  H HB3  . TYR A 1 14 ? 8.491   -2.126  1.057   1.00 0.00 ? 14 TYR A HB3  7  
ATOM   4883  H HD1  . TYR A 1 14 ? 9.975   -3.835  -0.599  1.00 0.00 ? 14 TYR A HD1  7  
ATOM   4884  H HD2  . TYR A 1 14 ? 10.354  0.436   -0.270  1.00 0.00 ? 14 TYR A HD2  7  
ATOM   4885  H HE1  . TYR A 1 14 ? 12.311  -3.978  -1.413  1.00 0.00 ? 14 TYR A HE1  7  
ATOM   4886  H HE2  . TYR A 1 14 ? 12.690  0.289   -1.084  1.00 0.00 ? 14 TYR A HE2  7  
ATOM   4887  H HH   . TYR A 1 14 ? 14.390  -2.643  -1.276  1.00 0.00 ? 14 TYR A HH   7  
ATOM   4888  N N    . GLN A 1 15 ? 5.584   -1.043  -0.584  1.00 0.00 ? 15 GLN A N    7  
ATOM   4889  C CA   . GLN A 1 15 ? 4.173   -0.905  -0.153  1.00 0.00 ? 15 GLN A CA   7  
ATOM   4890  C C    . GLN A 1 15 ? 3.294   -1.595  -1.193  1.00 0.00 ? 15 GLN A C    7  
ATOM   4891  O O    . GLN A 1 15 ? 2.167   -1.967  -0.932  1.00 0.00 ? 15 GLN A O    7  
ATOM   4892  C CB   . GLN A 1 15 ? 3.803   0.578   -0.061  1.00 0.00 ? 15 GLN A CB   7  
ATOM   4893  C CG   . GLN A 1 15 ? 4.594   1.229   1.076   1.00 0.00 ? 15 GLN A CG   7  
ATOM   4894  C CD   . GLN A 1 15 ? 3.709   2.249   1.795   1.00 0.00 ? 15 GLN A CD   7  
ATOM   4895  O OE1  . GLN A 1 15 ? 2.593   1.946   2.166   1.00 0.00 ? 15 GLN A OE1  7  
ATOM   4896  N NE2  . GLN A 1 15 ? 4.164   3.453   2.008   1.00 0.00 ? 15 GLN A NE2  7  
ATOM   4897  H H    . GLN A 1 15 ? 6.041   -0.298  -1.021  1.00 0.00 ? 15 GLN A H    7  
ATOM   4898  H HA   . GLN A 1 15 ? 4.043   -1.375  0.808   1.00 0.00 ? 15 GLN A HA   7  
ATOM   4899  H HB2  . GLN A 1 15 ? 4.041   1.068   -0.993  1.00 0.00 ? 15 GLN A HB2  7  
ATOM   4900  H HB3  . GLN A 1 15 ? 2.747   0.674   0.138   1.00 0.00 ? 15 GLN A HB3  7  
ATOM   4901  H HG2  . GLN A 1 15 ? 4.911   0.468   1.775   1.00 0.00 ? 15 GLN A HG2  7  
ATOM   4902  H HG3  . GLN A 1 15 ? 5.461   1.728   0.671   1.00 0.00 ? 15 GLN A HG3  7  
ATOM   4903  H HE21 . GLN A 1 15 ? 5.065   3.696   1.708   1.00 0.00 ? 15 GLN A HE21 7  
ATOM   4904  H HE22 . GLN A 1 15 ? 3.606   4.114   2.467   1.00 0.00 ? 15 GLN A HE22 7  
ATOM   4905  N N    . LEU A 1 16 ? 3.820   -1.780  -2.374  1.00 0.00 ? 16 LEU A N    7  
ATOM   4906  C CA   . LEU A 1 16 ? 3.051   -2.455  -3.448  1.00 0.00 ? 16 LEU A CA   7  
ATOM   4907  C C    . LEU A 1 16 ? 2.948   -3.946  -3.122  1.00 0.00 ? 16 LEU A C    7  
ATOM   4908  O O    . LEU A 1 16 ? 2.081   -4.644  -3.610  1.00 0.00 ? 16 LEU A O    7  
ATOM   4909  C CB   . LEU A 1 16 ? 3.792   -2.265  -4.772  1.00 0.00 ? 16 LEU A CB   7  
ATOM   4910  C CG   . LEU A 1 16 ? 3.280   -1.006  -5.476  1.00 0.00 ? 16 LEU A CG   7  
ATOM   4911  C CD1  . LEU A 1 16 ? 3.971   -0.855  -6.833  1.00 0.00 ? 16 LEU A CD1  7  
ATOM   4912  C CD2  . LEU A 1 16 ? 1.772   -1.122  -5.688  1.00 0.00 ? 16 LEU A CD2  7  
ATOM   4913  H H    . LEU A 1 16 ? 4.735   -1.478  -2.554  1.00 0.00 ? 16 LEU A H    7  
ATOM   4914  H HA   . LEU A 1 16 ? 2.064   -2.026  -3.516  1.00 0.00 ? 16 LEU A HA   7  
ATOM   4915  H HB2  . LEU A 1 16 ? 4.846   -2.165  -4.574  1.00 0.00 ? 16 LEU A HB2  7  
ATOM   4916  H HB3  . LEU A 1 16 ? 3.631   -3.118  -5.403  1.00 0.00 ? 16 LEU A HB3  7  
ATOM   4917  H HG   . LEU A 1 16 ? 3.494   -0.140  -4.866  1.00 0.00 ? 16 LEU A HG   7  
ATOM   4918  H HD11 . LEU A 1 16 ? 4.688   -1.652  -6.964  1.00 0.00 ? 16 LEU A HD11 7  
ATOM   4919  H HD12 . LEU A 1 16 ? 4.480   0.096   -6.874  1.00 0.00 ? 16 LEU A HD12 7  
ATOM   4920  H HD13 . LEU A 1 16 ? 3.232   -0.902  -7.620  1.00 0.00 ? 16 LEU A HD13 7  
ATOM   4921  H HD21 . LEU A 1 16 ? 1.505   -0.664  -6.629  1.00 0.00 ? 16 LEU A HD21 7  
ATOM   4922  H HD22 . LEU A 1 16 ? 1.255   -0.618  -4.884  1.00 0.00 ? 16 LEU A HD22 7  
ATOM   4923  H HD23 . LEU A 1 16 ? 1.490   -2.164  -5.700  1.00 0.00 ? 16 LEU A HD23 7  
ATOM   4924  N N    . GLU A 1 17 ? 3.829   -4.433  -2.292  1.00 0.00 ? 17 GLU A N    7  
ATOM   4925  C CA   . GLU A 1 17 ? 3.797   -5.876  -1.918  1.00 0.00 ? 17 GLU A CA   7  
ATOM   4926  C C    . GLU A 1 17 ? 2.664   -6.111  -0.920  1.00 0.00 ? 17 GLU A C    7  
ATOM   4927  O O    . GLU A 1 17 ? 2.131   -7.198  -0.810  1.00 0.00 ? 17 GLU A O    7  
ATOM   4928  C CB   . GLU A 1 17 ? 5.130   -6.266  -1.274  1.00 0.00 ? 17 GLU A CB   7  
ATOM   4929  C CG   . GLU A 1 17 ? 6.108   -6.735  -2.352  1.00 0.00 ? 17 GLU A CG   7  
ATOM   4930  C CD   . GLU A 1 17 ? 7.018   -7.824  -1.777  1.00 0.00 ? 17 GLU A CD   7  
ATOM   4931  O OE1  . GLU A 1 17 ? 7.333   -7.744  -0.601  1.00 0.00 ? 17 GLU A OE1  7  
ATOM   4932  O OE2  . GLU A 1 17 ? 7.382   -8.719  -2.522  1.00 0.00 ? 17 GLU A OE2  7  
ATOM   4933  H H    . GLU A 1 17 ? 4.514   -3.844  -1.912  1.00 0.00 ? 17 GLU A H    7  
ATOM   4934  H HA   . GLU A 1 17 ? 3.630   -6.473  -2.798  1.00 0.00 ? 17 GLU A HA   7  
ATOM   4935  H HB2  . GLU A 1 17 ? 5.544   -5.410  -0.760  1.00 0.00 ? 17 GLU A HB2  7  
ATOM   4936  H HB3  . GLU A 1 17 ? 4.967   -7.065  -0.566  1.00 0.00 ? 17 GLU A HB3  7  
ATOM   4937  H HG2  . GLU A 1 17 ? 5.556   -7.133  -3.191  1.00 0.00 ? 17 GLU A HG2  7  
ATOM   4938  H HG3  . GLU A 1 17 ? 6.712   -5.902  -2.679  1.00 0.00 ? 17 GLU A HG3  7  
ATOM   4939  N N    . ASN A 1 18 ? 2.294   -5.098  -0.192  1.00 0.00 ? 18 ASN A N    7  
ATOM   4940  C CA   . ASN A 1 18 ? 1.198   -5.250  0.802   1.00 0.00 ? 18 ASN A CA   7  
ATOM   4941  C C    . ASN A 1 18 ? -0.145  -5.342  0.073   1.00 0.00 ? 18 ASN A C    7  
ATOM   4942  O O    . ASN A 1 18 ? -1.180  -5.526  0.681   1.00 0.00 ? 18 ASN A O    7  
ATOM   4943  C CB   . ASN A 1 18 ? 1.193   -4.039  1.735   1.00 0.00 ? 18 ASN A CB   7  
ATOM   4944  C CG   . ASN A 1 18 ? 1.897   -4.400  3.045   1.00 0.00 ? 18 ASN A CG   7  
ATOM   4945  O OD1  . ASN A 1 18 ? 3.102   -4.293  3.149   1.00 0.00 ? 18 ASN A OD1  7  
ATOM   4946  N ND2  . ASN A 1 18 ? 1.191   -4.829  4.055   1.00 0.00 ? 18 ASN A ND2  7  
ATOM   4947  H H    . ASN A 1 18 ? 2.738   -4.233  -0.300  1.00 0.00 ? 18 ASN A H    7  
ATOM   4948  H HA   . ASN A 1 18 ? 1.358   -6.149  1.380   1.00 0.00 ? 18 ASN A HA   7  
ATOM   4949  H HB2  . ASN A 1 18 ? 1.711   -3.218  1.261   1.00 0.00 ? 18 ASN A HB2  7  
ATOM   4950  H HB3  . ASN A 1 18 ? 0.176   -3.750  1.944   1.00 0.00 ? 18 ASN A HB3  7  
ATOM   4951  H HD21 . ASN A 1 18 ? 0.218   -4.916  3.971   1.00 0.00 ? 18 ASN A HD21 7  
ATOM   4952  H HD22 . ASN A 1 18 ? 1.633   -5.063  4.898   1.00 0.00 ? 18 ASN A HD22 7  
ATOM   4953  N N    . TYR A 1 19 ? -0.133  -5.221  -1.227  1.00 0.00 ? 19 TYR A N    7  
ATOM   4954  C CA   . TYR A 1 19 ? -1.405  -5.307  -1.997  1.00 0.00 ? 19 TYR A CA   7  
ATOM   4955  C C    . TYR A 1 19 ? -1.381  -6.575  -2.848  1.00 0.00 ? 19 TYR A C    7  
ATOM   4956  O O    . TYR A 1 19 ? -1.953  -6.634  -3.918  1.00 0.00 ? 19 TYR A O    7  
ATOM   4957  C CB   . TYR A 1 19 ? -1.535  -4.083  -2.905  1.00 0.00 ? 19 TYR A CB   7  
ATOM   4958  C CG   . TYR A 1 19 ? -1.743  -2.851  -2.058  1.00 0.00 ? 19 TYR A CG   7  
ATOM   4959  C CD1  . TYR A 1 19 ? -3.028  -2.519  -1.605  1.00 0.00 ? 19 TYR A CD1  7  
ATOM   4960  C CD2  . TYR A 1 19 ? -0.651  -2.040  -1.722  1.00 0.00 ? 19 TYR A CD2  7  
ATOM   4961  C CE1  . TYR A 1 19 ? -3.219  -1.376  -0.818  1.00 0.00 ? 19 TYR A CE1  7  
ATOM   4962  C CE2  . TYR A 1 19 ? -0.843  -0.896  -0.936  1.00 0.00 ? 19 TYR A CE2  7  
ATOM   4963  C CZ   . TYR A 1 19 ? -2.126  -0.564  -0.484  1.00 0.00 ? 19 TYR A CZ   7  
ATOM   4964  O OH   . TYR A 1 19 ? -2.315  0.564   0.290   1.00 0.00 ? 19 TYR A OH   7  
ATOM   4965  H H    . TYR A 1 19 ? 0.713   -5.079  -1.700  1.00 0.00 ? 19 TYR A H    7  
ATOM   4966  H HA   . TYR A 1 19 ? -2.240  -5.345  -1.315  1.00 0.00 ? 19 TYR A HA   7  
ATOM   4967  H HB2  . TYR A 1 19 ? -0.635  -3.971  -3.490  1.00 0.00 ? 19 TYR A HB2  7  
ATOM   4968  H HB3  . TYR A 1 19 ? -2.381  -4.212  -3.564  1.00 0.00 ? 19 TYR A HB3  7  
ATOM   4969  H HD1  . TYR A 1 19 ? -3.869  -3.145  -1.863  1.00 0.00 ? 19 TYR A HD1  7  
ATOM   4970  H HD2  . TYR A 1 19 ? 0.338   -2.295  -2.071  1.00 0.00 ? 19 TYR A HD2  7  
ATOM   4971  H HE1  . TYR A 1 19 ? -4.209  -1.120  -0.469  1.00 0.00 ? 19 TYR A HE1  7  
ATOM   4972  H HE2  . TYR A 1 19 ? 0.000   -0.272  -0.676  1.00 0.00 ? 19 TYR A HE2  7  
ATOM   4973  H HH   . TYR A 1 19 ? -2.259  0.302   1.212   1.00 0.00 ? 19 TYR A HH   7  
ATOM   4974  N N    . CYS A 1 20 ? -0.711  -7.590  -2.377  1.00 0.00 ? 20 CYS A N    7  
ATOM   4975  C CA   . CYS A 1 20 ? -0.632  -8.858  -3.148  1.00 0.00 ? 20 CYS A CA   7  
ATOM   4976  C C    . CYS A 1 20 ? -1.767  -9.792  -2.720  1.00 0.00 ? 20 CYS A C    7  
ATOM   4977  O O    . CYS A 1 20 ? -2.874  -9.701  -3.213  1.00 0.00 ? 20 CYS A O    7  
ATOM   4978  C CB   . CYS A 1 20 ? 0.728   -9.512  -2.888  1.00 0.00 ? 20 CYS A CB   7  
ATOM   4979  S SG   . CYS A 1 20 ? 2.040   -8.369  -3.381  1.00 0.00 ? 20 CYS A SG   7  
ATOM   4980  H H    . CYS A 1 20 ? -0.253  -7.514  -1.514  1.00 0.00 ? 20 CYS A H    7  
ATOM   4981  H HA   . CYS A 1 20 ? -0.727  -8.645  -4.199  1.00 0.00 ? 20 CYS A HA   7  
ATOM   4982  H HB2  . CYS A 1 20 ? 0.827   -9.736  -1.837  1.00 0.00 ? 20 CYS A HB2  7  
ATOM   4983  H HB3  . CYS A 1 20 ? 0.809   -10.421 -3.463  1.00 0.00 ? 20 CYS A HB3  7  
ATOM   4984  N N    . ASN A 1 21 ? -1.509  -10.685 -1.808  1.00 0.00 ? 21 ASN A N    7  
ATOM   4985  C CA   . ASN A 1 21 ? -2.581  -11.615 -1.354  1.00 0.00 ? 21 ASN A CA   7  
ATOM   4986  C C    . ASN A 1 21 ? -2.188  -12.231 -0.010  1.00 0.00 ? 21 ASN A C    7  
ATOM   4987  O O    . ASN A 1 21 ? -1.198  -12.944 0.025   1.00 0.00 ? 21 ASN A O    7  
ATOM   4988  C CB   . ASN A 1 21 ? -2.765  -12.724 -2.391  1.00 0.00 ? 21 ASN A CB   7  
ATOM   4989  C CG   . ASN A 1 21 ? -3.888  -12.336 -3.354  1.00 0.00 ? 21 ASN A CG   7  
ATOM   4990  O OD1  . ASN A 1 21 ? -4.921  -11.853 -2.939  1.00 0.00 ? 21 ASN A OD1  7  
ATOM   4991  N ND2  . ASN A 1 21 ? -3.725  -12.527 -4.634  1.00 0.00 ? 21 ASN A ND2  7  
ATOM   4992  O OXT  . ASN A 1 21 ? -2.882  -11.978 0.960   1.00 0.00 ? 21 ASN A OXT  7  
ATOM   4993  H H    . ASN A 1 21 ? -0.615  -10.745 -1.421  1.00 0.00 ? 21 ASN A H    7  
ATOM   4994  H HA   . ASN A 1 21 ? -3.506  -11.070 -1.242  1.00 0.00 ? 21 ASN A HA   7  
ATOM   4995  H HB2  . ASN A 1 21 ? -1.846  -12.858 -2.942  1.00 0.00 ? 21 ASN A HB2  7  
ATOM   4996  H HB3  . ASN A 1 21 ? -3.026  -13.645 -1.892  1.00 0.00 ? 21 ASN A HB3  7  
ATOM   4997  H HD21 . ASN A 1 21 ? -2.891  -12.917 -4.967  1.00 0.00 ? 21 ASN A HD21 7  
ATOM   4998  H HD22 . ASN A 1 21 ? -4.435  -12.280 -5.261  1.00 0.00 ? 21 ASN A HD22 7  
ATOM   4999  N N    . PHE B 2 1  ? 15.179  3.346   -5.435  1.00 0.00 ? 1  PHE B N    7  
ATOM   5000  C CA   . PHE B 2 1  ? 14.751  2.483   -6.572  1.00 0.00 ? 1  PHE B CA   7  
ATOM   5001  C C    . PHE B 2 1  ? 13.535  3.104   -7.256  1.00 0.00 ? 1  PHE B C    7  
ATOM   5002  O O    . PHE B 2 1  ? 13.511  3.289   -8.457  1.00 0.00 ? 1  PHE B O    7  
ATOM   5003  C CB   . PHE B 2 1  ? 14.381  1.094   -6.050  1.00 0.00 ? 1  PHE B CB   7  
ATOM   5004  C CG   . PHE B 2 1  ? 13.852  0.257   -7.195  1.00 0.00 ? 1  PHE B CG   7  
ATOM   5005  C CD1  . PHE B 2 1  ? 12.516  0.386   -7.603  1.00 0.00 ? 1  PHE B CD1  7  
ATOM   5006  C CD2  . PHE B 2 1  ? 14.699  -0.644  -7.856  1.00 0.00 ? 1  PHE B CD2  7  
ATOM   5007  C CE1  . PHE B 2 1  ? 12.030  -0.387  -8.667  1.00 0.00 ? 1  PHE B CE1  7  
ATOM   5008  C CE2  . PHE B 2 1  ? 14.211  -1.416  -8.919  1.00 0.00 ? 1  PHE B CE2  7  
ATOM   5009  C CZ   . PHE B 2 1  ? 12.878  -1.286  -9.325  1.00 0.00 ? 1  PHE B CZ   7  
ATOM   5010  H H1   . PHE B 2 1  ? 15.113  4.346   -5.715  1.00 0.00 ? 1  PHE B H1   7  
ATOM   5011  H H2   . PHE B 2 1  ? 16.162  3.121   -5.180  1.00 0.00 ? 1  PHE B H2   7  
ATOM   5012  H H3   . PHE B 2 1  ? 14.559  3.176   -4.619  1.00 0.00 ? 1  PHE B H3   7  
ATOM   5013  H HA   . PHE B 2 1  ? 15.560  2.396   -7.283  1.00 0.00 ? 1  PHE B HA   7  
ATOM   5014  H HB2  . PHE B 2 1  ? 15.258  0.622   -5.627  1.00 0.00 ? 1  PHE B HB2  7  
ATOM   5015  H HB3  . PHE B 2 1  ? 13.620  1.187   -5.289  1.00 0.00 ? 1  PHE B HB3  7  
ATOM   5016  H HD1  . PHE B 2 1  ? 11.859  1.079   -7.099  1.00 0.00 ? 1  PHE B HD1  7  
ATOM   5017  H HD2  . PHE B 2 1  ? 15.727  -0.746  -7.547  1.00 0.00 ? 1  PHE B HD2  7  
ATOM   5018  H HE1  . PHE B 2 1  ? 11.001  -0.286  -8.981  1.00 0.00 ? 1  PHE B HE1  7  
ATOM   5019  H HE2  . PHE B 2 1  ? 14.865  -2.111  -9.427  1.00 0.00 ? 1  PHE B HE2  7  
ATOM   5020  H HZ   . PHE B 2 1  ? 12.502  -1.881  -10.145 1.00 0.00 ? 1  PHE B HZ   7  
ATOM   5021  N N    . VAL B 2 2  ? 12.521  3.425   -6.502  1.00 0.00 ? 2  VAL B N    7  
ATOM   5022  C CA   . VAL B 2 2  ? 11.304  4.033   -7.108  1.00 0.00 ? 2  VAL B CA   7  
ATOM   5023  C C    . VAL B 2 2  ? 11.555  5.523   -7.353  1.00 0.00 ? 2  VAL B C    7  
ATOM   5024  O O    . VAL B 2 2  ? 12.559  6.065   -6.938  1.00 0.00 ? 2  VAL B O    7  
ATOM   5025  C CB   . VAL B 2 2  ? 10.121  3.851   -6.154  1.00 0.00 ? 2  VAL B CB   7  
ATOM   5026  C CG1  . VAL B 2 2  ? 10.271  4.798   -4.962  1.00 0.00 ? 2  VAL B CG1  7  
ATOM   5027  C CG2  . VAL B 2 2  ? 8.816   4.160   -6.892  1.00 0.00 ? 2  VAL B CG2  7  
ATOM   5028  H H    . VAL B 2 2  ? 12.560  3.265   -5.535  1.00 0.00 ? 2  VAL B H    7  
ATOM   5029  H HA   . VAL B 2 2  ? 11.089  3.545   -8.047  1.00 0.00 ? 2  VAL B HA   7  
ATOM   5030  H HB   . VAL B 2 2  ? 10.101  2.830   -5.800  1.00 0.00 ? 2  VAL B HB   7  
ATOM   5031  H HG11 . VAL B 2 2  ? 9.711   5.702   -5.147  1.00 0.00 ? 2  VAL B HG11 7  
ATOM   5032  H HG12 . VAL B 2 2  ? 11.314  5.041   -4.826  1.00 0.00 ? 2  VAL B HG12 7  
ATOM   5033  H HG13 . VAL B 2 2  ? 9.893   4.316   -4.071  1.00 0.00 ? 2  VAL B HG13 7  
ATOM   5034  H HG21 . VAL B 2 2  ? 8.851   3.727   -7.881  1.00 0.00 ? 2  VAL B HG21 7  
ATOM   5035  H HG22 . VAL B 2 2  ? 8.692   5.230   -6.971  1.00 0.00 ? 2  VAL B HG22 7  
ATOM   5036  H HG23 . VAL B 2 2  ? 7.985   3.741   -6.344  1.00 0.00 ? 2  VAL B HG23 7  
ATOM   5037  N N    . ASN B 2 3  ? 10.654  6.186   -8.030  1.00 0.00 ? 3  ASN B N    7  
ATOM   5038  C CA   . ASN B 2 3  ? 10.843  7.642   -8.308  1.00 0.00 ? 3  ASN B CA   7  
ATOM   5039  C C    . ASN B 2 3  ? 9.831   8.106   -9.362  1.00 0.00 ? 3  ASN B C    7  
ATOM   5040  O O    . ASN B 2 3  ? 9.526   9.277   -9.463  1.00 0.00 ? 3  ASN B O    7  
ATOM   5041  C CB   . ASN B 2 3  ? 12.260  7.889   -8.832  1.00 0.00 ? 3  ASN B CB   7  
ATOM   5042  C CG   . ASN B 2 3  ? 13.141  8.426   -7.702  1.00 0.00 ? 3  ASN B CG   7  
ATOM   5043  O OD1  . ASN B 2 3  ? 12.745  9.317   -6.977  1.00 0.00 ? 3  ASN B OD1  7  
ATOM   5044  N ND2  . ASN B 2 3  ? 14.330  7.918   -7.524  1.00 0.00 ? 3  ASN B ND2  7  
ATOM   5045  H H    . ASN B 2 3  ? 9.853   5.727   -8.355  1.00 0.00 ? 3  ASN B H    7  
ATOM   5046  H HA   . ASN B 2 3  ? 10.695  8.203   -7.398  1.00 0.00 ? 3  ASN B HA   7  
ATOM   5047  H HB2  . ASN B 2 3  ? 12.673  6.961   -9.201  1.00 0.00 ? 3  ASN B HB2  7  
ATOM   5048  H HB3  . ASN B 2 3  ? 12.227  8.611   -9.633  1.00 0.00 ? 3  ASN B HB3  7  
ATOM   5049  H HD21 . ASN B 2 3  ? 14.649  7.200   -8.110  1.00 0.00 ? 3  ASN B HD21 7  
ATOM   5050  H HD22 . ASN B 2 3  ? 14.903  8.253   -6.803  1.00 0.00 ? 3  ASN B HD22 7  
ATOM   5051  N N    . GLN B 2 4  ? 9.316   7.204   -10.155 1.00 0.00 ? 4  GLN B N    7  
ATOM   5052  C CA   . GLN B 2 4  ? 8.334   7.602   -11.198 1.00 0.00 ? 4  GLN B CA   7  
ATOM   5053  C C    . GLN B 2 4  ? 6.928   7.635   -10.594 1.00 0.00 ? 4  GLN B C    7  
ATOM   5054  O O    . GLN B 2 4  ? 6.660   7.017   -9.583  1.00 0.00 ? 4  GLN B O    7  
ATOM   5055  C CB   . GLN B 2 4  ? 8.378   6.582   -12.334 1.00 0.00 ? 4  GLN B CB   7  
ATOM   5056  C CG   . GLN B 2 4  ? 9.329   7.070   -13.428 1.00 0.00 ? 4  GLN B CG   7  
ATOM   5057  C CD   . GLN B 2 4  ? 10.615  6.243   -13.391 1.00 0.00 ? 4  GLN B CD   7  
ATOM   5058  O OE1  . GLN B 2 4  ? 10.633  5.107   -13.823 1.00 0.00 ? 4  GLN B OE1  7  
ATOM   5059  N NE2  . GLN B 2 4  ? 11.700  6.767   -12.890 1.00 0.00 ? 4  GLN B NE2  7  
ATOM   5060  H H    . GLN B 2 4  ? 9.579   6.266   -10.072 1.00 0.00 ? 4  GLN B H    7  
ATOM   5061  H HA   . GLN B 2 4  ? 8.587   8.580   -11.579 1.00 0.00 ? 4  GLN B HA   7  
ATOM   5062  H HB2  . GLN B 2 4  ? 8.727   5.634   -11.950 1.00 0.00 ? 4  GLN B HB2  7  
ATOM   5063  H HB3  . GLN B 2 4  ? 7.390   6.460   -12.745 1.00 0.00 ? 4  GLN B HB3  7  
ATOM   5064  H HG2  . GLN B 2 4  ? 8.855   6.957   -14.390 1.00 0.00 ? 4  GLN B HG2  7  
ATOM   5065  H HG3  . GLN B 2 4  ? 9.567   8.110   -13.262 1.00 0.00 ? 4  GLN B HG3  7  
ATOM   5066  H HE21 . GLN B 2 4  ? 11.686  7.683   -12.542 1.00 0.00 ? 4  GLN B HE21 7  
ATOM   5067  H HE22 . GLN B 2 4  ? 12.529  6.244   -12.861 1.00 0.00 ? 4  GLN B HE22 7  
ATOM   5068  N N    . HIS B 2 5  ? 6.027   8.353   -11.207 1.00 0.00 ? 5  HIS B N    7  
ATOM   5069  C CA   . HIS B 2 5  ? 4.638   8.428   -10.669 1.00 0.00 ? 5  HIS B CA   7  
ATOM   5070  C C    . HIS B 2 5  ? 3.846   7.198   -11.121 1.00 0.00 ? 5  HIS B C    7  
ATOM   5071  O O    . HIS B 2 5  ? 4.021   6.703   -12.216 1.00 0.00 ? 5  HIS B O    7  
ATOM   5072  C CB   . HIS B 2 5  ? 3.958   9.694   -11.198 1.00 0.00 ? 5  HIS B CB   7  
ATOM   5073  C CG   . HIS B 2 5  ? 2.893   10.142  -10.235 1.00 0.00 ? 5  HIS B CG   7  
ATOM   5074  N ND1  . HIS B 2 5  ? 1.715   10.705  -10.678 1.00 0.00 ? 5  HIS B ND1  7  
ATOM   5075  C CD2  . HIS B 2 5  ? 2.840   10.107  -8.868  1.00 0.00 ? 5  HIS B CD2  7  
ATOM   5076  C CE1  . HIS B 2 5  ? 0.992   10.995  -9.588  1.00 0.00 ? 5  HIS B CE1  7  
ATOM   5077  N NE2  . HIS B 2 5  ? 1.639   10.647  -8.456  1.00 0.00 ? 5  HIS B NE2  7  
ATOM   5078  H H    . HIS B 2 5  ? 6.264   8.845   -12.021 1.00 0.00 ? 5  HIS B H    7  
ATOM   5079  H HA   . HIS B 2 5  ? 4.670   8.460   -9.590  1.00 0.00 ? 5  HIS B HA   7  
ATOM   5080  H HB2  . HIS B 2 5  ? 4.694   10.478  -11.308 1.00 0.00 ? 5  HIS B HB2  7  
ATOM   5081  H HB3  . HIS B 2 5  ? 3.510   9.488   -12.158 1.00 0.00 ? 5  HIS B HB3  7  
ATOM   5082  H HD2  . HIS B 2 5  ? 3.612   9.724   -8.217  1.00 0.00 ? 5  HIS B HD2  7  
ATOM   5083  H HE1  . HIS B 2 5  ? 0.013   11.452  -9.613  1.00 0.00 ? 5  HIS B HE1  7  
ATOM   5084  H HE2  . HIS B 2 5  ? 1.322   10.756  -7.536  1.00 0.00 ? 5  HIS B HE2  7  
ATOM   5085  N N    . LEU B 2 6  ? 2.976   6.704   -10.284 1.00 0.00 ? 6  LEU B N    7  
ATOM   5086  C CA   . LEU B 2 6  ? 2.172   5.507   -10.663 1.00 0.00 ? 6  LEU B CA   7  
ATOM   5087  C C    . LEU B 2 6  ? 0.690   5.878   -10.663 1.00 0.00 ? 6  LEU B C    7  
ATOM   5088  O O    . LEU B 2 6  ? 0.276   6.788   -9.980  1.00 0.00 ? 6  LEU B O    7  
ATOM   5089  C CB   . LEU B 2 6  ? 2.424   4.386   -9.649  1.00 0.00 ? 6  LEU B CB   7  
ATOM   5090  C CG   . LEU B 2 6  ? 3.511   3.437   -10.172 1.00 0.00 ? 6  LEU B CG   7  
ATOM   5091  C CD1  . LEU B 2 6  ? 4.600   4.229   -10.902 1.00 0.00 ? 6  LEU B CD1  7  
ATOM   5092  C CD2  . LEU B 2 6  ? 4.137   2.694   -8.992  1.00 0.00 ? 6  LEU B CD2  7  
ATOM   5093  H H    . LEU B 2 6  ? 2.849   7.121   -9.406  1.00 0.00 ? 6  LEU B H    7  
ATOM   5094  H HA   . LEU B 2 6  ? 2.462   5.175   -11.648 1.00 0.00 ? 6  LEU B HA   7  
ATOM   5095  H HB2  . LEU B 2 6  ? 2.746   4.818   -8.713  1.00 0.00 ? 6  LEU B HB2  7  
ATOM   5096  H HB3  . LEU B 2 6  ? 1.511   3.832   -9.494  1.00 0.00 ? 6  LEU B HB3  7  
ATOM   5097  H HG   . LEU B 2 6  ? 3.067   2.725   -10.854 1.00 0.00 ? 6  LEU B HG   7  
ATOM   5098  H HD11 . LEU B 2 6  ? 4.777   5.159   -10.383 1.00 0.00 ? 6  LEU B HD11 7  
ATOM   5099  H HD12 . LEU B 2 6  ? 4.278   4.436   -11.912 1.00 0.00 ? 6  LEU B HD12 7  
ATOM   5100  H HD13 . LEU B 2 6  ? 5.511   3.651   -10.926 1.00 0.00 ? 6  LEU B HD13 7  
ATOM   5101  H HD21 . LEU B 2 6  ? 3.796   3.135   -8.068  1.00 0.00 ? 6  LEU B HD21 7  
ATOM   5102  H HD22 . LEU B 2 6  ? 5.212   2.766   -9.051  1.00 0.00 ? 6  LEU B HD22 7  
ATOM   5103  H HD23 . LEU B 2 6  ? 3.844   1.655   -9.024  1.00 0.00 ? 6  LEU B HD23 7  
ATOM   5104  N N    . CYS B 2 7  ? -0.112  5.185   -11.423 1.00 0.00 ? 7  CYS B N    7  
ATOM   5105  C CA   . CYS B 2 7  ? -1.565  5.510   -11.464 1.00 0.00 ? 7  CYS B CA   7  
ATOM   5106  C C    . CYS B 2 7  ? -2.337  4.289   -11.999 1.00 0.00 ? 7  CYS B C    7  
ATOM   5107  O O    . CYS B 2 7  ? -2.446  3.283   -11.327 1.00 0.00 ? 7  CYS B O    7  
ATOM   5108  C CB   . CYS B 2 7  ? -1.783  6.729   -12.371 1.00 0.00 ? 7  CYS B CB   7  
ATOM   5109  S SG   . CYS B 2 7  ? -1.524  8.255   -11.432 1.00 0.00 ? 7  CYS B SG   7  
ATOM   5110  H H    . CYS B 2 7  ? 0.241   4.453   -11.968 1.00 0.00 ? 7  CYS B H    7  
ATOM   5111  H HA   . CYS B 2 7  ? -1.907  5.739   -10.462 1.00 0.00 ? 7  CYS B HA   7  
ATOM   5112  H HB2  . CYS B 2 7  ? -1.076  6.700   -13.184 1.00 0.00 ? 7  CYS B HB2  7  
ATOM   5113  H HB3  . CYS B 2 7  ? -2.789  6.715   -12.764 1.00 0.00 ? 7  CYS B HB3  7  
ATOM   5114  N N    . GLY B 2 8  ? -2.873  4.350   -13.195 1.00 0.00 ? 8  GLY B N    7  
ATOM   5115  C CA   . GLY B 2 8  ? -3.621  3.179   -13.732 1.00 0.00 ? 8  GLY B CA   7  
ATOM   5116  C C    . GLY B 2 8  ? -2.638  2.092   -14.170 1.00 0.00 ? 8  GLY B C    7  
ATOM   5117  O O    . GLY B 2 8  ? -2.128  1.339   -13.364 1.00 0.00 ? 8  GLY B O    7  
ATOM   5118  H H    . GLY B 2 8  ? -2.785  5.156   -13.737 1.00 0.00 ? 8  GLY B H    7  
ATOM   5119  H HA2  . GLY B 2 8  ? -4.273  2.787   -12.967 1.00 0.00 ? 8  GLY B HA2  7  
ATOM   5120  H HA3  . GLY B 2 8  ? -4.210  3.488   -14.582 1.00 0.00 ? 8  GLY B HA3  7  
ATOM   5121  N N    . SER B 2 9  ? -2.377  2.000   -15.444 1.00 0.00 ? 9  SER B N    7  
ATOM   5122  C CA   . SER B 2 9  ? -1.436  0.958   -15.943 1.00 0.00 ? 9  SER B CA   7  
ATOM   5123  C C    . SER B 2 9  ? -0.115  1.030   -15.169 1.00 0.00 ? 9  SER B C    7  
ATOM   5124  O O    . SER B 2 9  ? 0.455   0.020   -14.808 1.00 0.00 ? 9  SER B O    7  
ATOM   5125  C CB   . SER B 2 9  ? -1.163  1.188   -17.431 1.00 0.00 ? 9  SER B CB   7  
ATOM   5126  O OG   . SER B 2 9  ? -2.163  0.529   -18.198 1.00 0.00 ? 9  SER B OG   7  
ATOM   5127  H H    . SER B 2 9  ? -2.807  2.614   -16.074 1.00 0.00 ? 9  SER B H    7  
ATOM   5128  H HA   . SER B 2 9  ? -1.877  -0.018  -15.809 1.00 0.00 ? 9  SER B HA   7  
ATOM   5129  H HB2  . SER B 2 9  ? -1.192  2.243   -17.646 1.00 0.00 ? 9  SER B HB2  7  
ATOM   5130  H HB3  . SER B 2 9  ? -0.187  0.798   -17.682 1.00 0.00 ? 9  SER B HB3  7  
ATOM   5131  H HG   . SER B 2 9  ? -1.794  0.336   -19.064 1.00 0.00 ? 9  SER B HG   7  
ATOM   5132  N N    . ASP B 2 10 ? 0.380   2.212   -14.918 1.00 0.00 ? 10 ASP B N    7  
ATOM   5133  C CA   . ASP B 2 10 ? 1.669   2.334   -14.177 1.00 0.00 ? 10 ASP B CA   7  
ATOM   5134  C C    . ASP B 2 10 ? 1.546   1.663   -12.806 1.00 0.00 ? 10 ASP B C    7  
ATOM   5135  O O    . ASP B 2 10 ? 2.378   0.866   -12.422 1.00 0.00 ? 10 ASP B O    7  
ATOM   5136  C CB   . ASP B 2 10 ? 2.022   3.811   -13.991 1.00 0.00 ? 10 ASP B CB   7  
ATOM   5137  C CG   . ASP B 2 10 ? 2.336   4.439   -15.350 1.00 0.00 ? 10 ASP B CG   7  
ATOM   5138  O OD1  . ASP B 2 10 ? 2.942   3.764   -16.166 1.00 0.00 ? 10 ASP B OD1  7  
ATOM   5139  O OD2  . ASP B 2 10 ? 1.968   5.584   -15.550 1.00 0.00 ? 10 ASP B OD2  7  
ATOM   5140  H H    . ASP B 2 10 ? -0.089  3.016   -15.222 1.00 0.00 ? 10 ASP B H    7  
ATOM   5141  H HA   . ASP B 2 10 ? 2.450   1.848   -14.741 1.00 0.00 ? 10 ASP B HA   7  
ATOM   5142  H HB2  . ASP B 2 10 ? 1.190   4.328   -13.539 1.00 0.00 ? 10 ASP B HB2  7  
ATOM   5143  H HB3  . ASP B 2 10 ? 2.887   3.896   -13.351 1.00 0.00 ? 10 ASP B HB3  7  
ATOM   5144  N N    . LEU B 2 11 ? 0.522   1.979   -12.059 1.00 0.00 ? 11 LEU B N    7  
ATOM   5145  C CA   . LEU B 2 11 ? 0.370   1.352   -10.715 1.00 0.00 ? 11 LEU B CA   7  
ATOM   5146  C C    . LEU B 2 11 ? -0.101  -0.092  -10.886 1.00 0.00 ? 11 LEU B C    7  
ATOM   5147  O O    . LEU B 2 11 ? 0.183   -0.952  -10.074 1.00 0.00 ? 11 LEU B O    7  
ATOM   5148  C CB   . LEU B 2 11 ? -0.665  2.140   -9.893  1.00 0.00 ? 11 LEU B CB   7  
ATOM   5149  C CG   . LEU B 2 11 ? -0.387  2.084   -8.369  1.00 0.00 ? 11 LEU B CG   7  
ATOM   5150  C CD1  . LEU B 2 11 ? -1.506  1.306   -7.680  1.00 0.00 ? 11 LEU B CD1  7  
ATOM   5151  C CD2  . LEU B 2 11 ? 0.951   1.404   -8.052  1.00 0.00 ? 11 LEU B CD2  7  
ATOM   5152  H H    . LEU B 2 11 ? -0.142  2.626   -12.377 1.00 0.00 ? 11 LEU B H    7  
ATOM   5153  H HA   . LEU B 2 11 ? 1.325   1.363   -10.219 1.00 0.00 ? 11 LEU B HA   7  
ATOM   5154  H HB2  . LEU B 2 11 ? -0.654  3.168   -10.213 1.00 0.00 ? 11 LEU B HB2  7  
ATOM   5155  H HB3  . LEU B 2 11 ? -1.647  1.730   -10.079 1.00 0.00 ? 11 LEU B HB3  7  
ATOM   5156  H HG   . LEU B 2 11 ? -0.373  3.092   -7.982  1.00 0.00 ? 11 LEU B HG   7  
ATOM   5157  H HD11 . LEU B 2 11 ? -2.370  1.270   -8.326  1.00 0.00 ? 11 LEU B HD11 7  
ATOM   5158  H HD12 . LEU B 2 11 ? -1.768  1.797   -6.754  1.00 0.00 ? 11 LEU B HD12 7  
ATOM   5159  H HD13 . LEU B 2 11 ? -1.170  0.300   -7.473  1.00 0.00 ? 11 LEU B HD13 7  
ATOM   5160  H HD21 . LEU B 2 11 ? 1.756   1.980   -8.482  1.00 0.00 ? 11 LEU B HD21 7  
ATOM   5161  H HD22 . LEU B 2 11 ? 0.955   0.409   -8.469  1.00 0.00 ? 11 LEU B HD22 7  
ATOM   5162  H HD23 . LEU B 2 11 ? 1.079   1.348   -6.981  1.00 0.00 ? 11 LEU B HD23 7  
ATOM   5163  N N    . VAL B 2 12 ? -0.816  -0.364  -11.942 1.00 0.00 ? 12 VAL B N    7  
ATOM   5164  C CA   . VAL B 2 12 ? -1.303  -1.748  -12.172 1.00 0.00 ? 12 VAL B CA   7  
ATOM   5165  C C    . VAL B 2 12 ? -0.142  -2.595  -12.696 1.00 0.00 ? 12 VAL B C    7  
ATOM   5166  O O    . VAL B 2 12 ? 0.207   -3.607  -12.124 1.00 0.00 ? 12 VAL B O    7  
ATOM   5167  C CB   . VAL B 2 12 ? -2.446  -1.710  -13.191 1.00 0.00 ? 12 VAL B CB   7  
ATOM   5168  C CG1  . VAL B 2 12 ? -2.594  -3.072  -13.877 1.00 0.00 ? 12 VAL B CG1  7  
ATOM   5169  C CG2  . VAL B 2 12 ? -3.751  -1.363  -12.471 1.00 0.00 ? 12 VAL B CG2  7  
ATOM   5170  H H    . VAL B 2 12 ? -1.027  0.341   -12.589 1.00 0.00 ? 12 VAL B H    7  
ATOM   5171  H HA   . VAL B 2 12 ? -1.658  -2.164  -11.240 1.00 0.00 ? 12 VAL B HA   7  
ATOM   5172  H HB   . VAL B 2 12 ? -2.235  -0.952  -13.932 1.00 0.00 ? 12 VAL B HB   7  
ATOM   5173  H HG11 . VAL B 2 12 ? -2.052  -3.065  -14.812 1.00 0.00 ? 12 VAL B HG11 7  
ATOM   5174  H HG12 . VAL B 2 12 ? -3.639  -3.266  -14.070 1.00 0.00 ? 12 VAL B HG12 7  
ATOM   5175  H HG13 . VAL B 2 12 ? -2.197  -3.844  -13.235 1.00 0.00 ? 12 VAL B HG13 7  
ATOM   5176  H HG21 . VAL B 2 12 ? -3.586  -0.519  -11.817 1.00 0.00 ? 12 VAL B HG21 7  
ATOM   5177  H HG22 . VAL B 2 12 ? -4.077  -2.212  -11.888 1.00 0.00 ? 12 VAL B HG22 7  
ATOM   5178  H HG23 . VAL B 2 12 ? -4.508  -1.112  -13.199 1.00 0.00 ? 12 VAL B HG23 7  
ATOM   5179  N N    . GLU B 2 13 ? 0.472   -2.181  -13.771 1.00 0.00 ? 13 GLU B N    7  
ATOM   5180  C CA   . GLU B 2 13 ? 1.619   -2.960  -14.306 1.00 0.00 ? 13 GLU B CA   7  
ATOM   5181  C C    . GLU B 2 13 ? 2.601   -3.216  -13.165 1.00 0.00 ? 13 GLU B C    7  
ATOM   5182  O O    . GLU B 2 13 ? 3.379   -4.149  -13.194 1.00 0.00 ? 13 GLU B O    7  
ATOM   5183  C CB   . GLU B 2 13 ? 2.313   -2.168  -15.415 1.00 0.00 ? 13 GLU B CB   7  
ATOM   5184  C CG   . GLU B 2 13 ? 1.482   -2.255  -16.697 1.00 0.00 ? 13 GLU B CG   7  
ATOM   5185  C CD   . GLU B 2 13 ? 2.394   -2.614  -17.872 1.00 0.00 ? 13 GLU B CD   7  
ATOM   5186  O OE1  . GLU B 2 13 ? 3.004   -3.669  -17.822 1.00 0.00 ? 13 GLU B OE1  7  
ATOM   5187  O OE2  . GLU B 2 13 ? 2.467   -1.826  -18.801 1.00 0.00 ? 13 GLU B OE2  7  
ATOM   5188  H H    . GLU B 2 13 ? 0.188   -1.355  -14.214 1.00 0.00 ? 13 GLU B H    7  
ATOM   5189  H HA   . GLU B 2 13 ? 1.266   -3.903  -14.699 1.00 0.00 ? 13 GLU B HA   7  
ATOM   5190  H HB2  . GLU B 2 13 ? 2.407   -1.134  -15.115 1.00 0.00 ? 13 GLU B HB2  7  
ATOM   5191  H HB3  . GLU B 2 13 ? 3.293   -2.582  -15.595 1.00 0.00 ? 13 GLU B HB3  7  
ATOM   5192  H HG2  . GLU B 2 13 ? 0.724   -3.017  -16.583 1.00 0.00 ? 13 GLU B HG2  7  
ATOM   5193  H HG3  . GLU B 2 13 ? 1.011   -1.303  -16.887 1.00 0.00 ? 13 GLU B HG3  7  
ATOM   5194  N N    . ALA B 2 14 ? 2.559   -2.393  -12.151 1.00 0.00 ? 14 ALA B N    7  
ATOM   5195  C CA   . ALA B 2 14 ? 3.476   -2.586  -10.996 1.00 0.00 ? 14 ALA B CA   7  
ATOM   5196  C C    . ALA B 2 14 ? 3.037   -3.828  -10.219 1.00 0.00 ? 14 ALA B C    7  
ATOM   5197  O O    . ALA B 2 14 ? 3.748   -4.807  -10.150 1.00 0.00 ? 14 ALA B O    7  
ATOM   5198  C CB   . ALA B 2 14 ? 3.413   -1.359  -10.085 1.00 0.00 ? 14 ALA B CB   7  
ATOM   5199  H H    . ALA B 2 14 ? 1.918   -1.653  -12.148 1.00 0.00 ? 14 ALA B H    7  
ATOM   5200  H HA   . ALA B 2 14 ? 4.485   -2.721  -11.354 1.00 0.00 ? 14 ALA B HA   7  
ATOM   5201  H HB1  . ALA B 2 14 ? 3.694   -0.480  -10.645 1.00 0.00 ? 14 ALA B HB1  7  
ATOM   5202  H HB2  . ALA B 2 14 ? 4.093   -1.492  -9.256  1.00 0.00 ? 14 ALA B HB2  7  
ATOM   5203  H HB3  . ALA B 2 14 ? 2.407   -1.240  -9.710  1.00 0.00 ? 14 ALA B HB3  7  
ATOM   5204  N N    . LEU B 2 15 ? 1.864   -3.800  -9.643  1.00 0.00 ? 15 LEU B N    7  
ATOM   5205  C CA   . LEU B 2 15 ? 1.386   -4.991  -8.885  1.00 0.00 ? 15 LEU B CA   7  
ATOM   5206  C C    . LEU B 2 15 ? 1.634   -6.249  -9.719  1.00 0.00 ? 15 LEU B C    7  
ATOM   5207  O O    . LEU B 2 15 ? 2.169   -7.230  -9.242  1.00 0.00 ? 15 LEU B O    7  
ATOM   5208  C CB   . LEU B 2 15 ? -0.112  -4.850  -8.606  1.00 0.00 ? 15 LEU B CB   7  
ATOM   5209  C CG   . LEU B 2 15 ? -0.343  -3.720  -7.601  1.00 0.00 ? 15 LEU B CG   7  
ATOM   5210  C CD1  . LEU B 2 15 ? -1.705  -3.073  -7.860  1.00 0.00 ? 15 LEU B CD1  7  
ATOM   5211  C CD2  . LEU B 2 15 ? -0.315  -4.290  -6.181  1.00 0.00 ? 15 LEU B CD2  7  
ATOM   5212  H H    . LEU B 2 15 ? 1.296   -3.004  -9.717  1.00 0.00 ? 15 LEU B H    7  
ATOM   5213  H HA   . LEU B 2 15 ? 1.925   -5.066  -7.950  1.00 0.00 ? 15 LEU B HA   7  
ATOM   5214  H HB2  . LEU B 2 15 ? -0.628  -4.623  -9.528  1.00 0.00 ? 15 LEU B HB2  7  
ATOM   5215  H HB3  . LEU B 2 15 ? -0.492  -5.775  -8.199  1.00 0.00 ? 15 LEU B HB3  7  
ATOM   5216  H HG   . LEU B 2 15 ? 0.435   -2.977  -7.708  1.00 0.00 ? 15 LEU B HG   7  
ATOM   5217  H HD11 . LEU B 2 15 ? -2.293  -3.096  -6.955  1.00 0.00 ? 15 LEU B HD11 7  
ATOM   5218  H HD12 . LEU B 2 15 ? -2.220  -3.618  -8.639  1.00 0.00 ? 15 LEU B HD12 7  
ATOM   5219  H HD13 . LEU B 2 15 ? -1.563  -2.049  -8.171  1.00 0.00 ? 15 LEU B HD13 7  
ATOM   5220  H HD21 . LEU B 2 15 ? -0.446  -3.489  -5.469  1.00 0.00 ? 15 LEU B HD21 7  
ATOM   5221  H HD22 . LEU B 2 15 ? 0.633   -4.777  -6.008  1.00 0.00 ? 15 LEU B HD22 7  
ATOM   5222  H HD23 . LEU B 2 15 ? -1.115  -5.007  -6.066  1.00 0.00 ? 15 LEU B HD23 7  
ATOM   5223  N N    . TYR B 2 16 ? 1.251   -6.225  -10.967 1.00 0.00 ? 16 TYR B N    7  
ATOM   5224  C CA   . TYR B 2 16 ? 1.463   -7.413  -11.841 1.00 0.00 ? 16 TYR B CA   7  
ATOM   5225  C C    . TYR B 2 16 ? 2.935   -7.833  -11.795 1.00 0.00 ? 16 TYR B C    7  
ATOM   5226  O O    . TYR B 2 16 ? 3.261   -8.998  -11.911 1.00 0.00 ? 16 TYR B O    7  
ATOM   5227  C CB   . TYR B 2 16 ? 1.085   -7.057  -13.281 1.00 0.00 ? 16 TYR B CB   7  
ATOM   5228  C CG   . TYR B 2 16 ? -0.138  -7.849  -13.695 1.00 0.00 ? 16 TYR B CG   7  
ATOM   5229  C CD1  . TYR B 2 16 ? -0.179  -9.237  -13.494 1.00 0.00 ? 16 TYR B CD1  7  
ATOM   5230  C CD2  . TYR B 2 16 ? -1.233  -7.197  -14.283 1.00 0.00 ? 16 TYR B CD2  7  
ATOM   5231  C CE1  . TYR B 2 16 ? -1.309  -9.969  -13.879 1.00 0.00 ? 16 TYR B CE1  7  
ATOM   5232  C CE2  . TYR B 2 16 ? -2.362  -7.932  -14.668 1.00 0.00 ? 16 TYR B CE2  7  
ATOM   5233  C CZ   . TYR B 2 16 ? -2.399  -9.317  -14.466 1.00 0.00 ? 16 TYR B CZ   7  
ATOM   5234  O OH   . TYR B 2 16 ? -3.512  -10.040 -14.847 1.00 0.00 ? 16 TYR B OH   7  
ATOM   5235  H H    . TYR B 2 16 ? 0.823   -5.420  -11.330 1.00 0.00 ? 16 TYR B H    7  
ATOM   5236  H HA   . TYR B 2 16 ? 0.844   -8.229  -11.497 1.00 0.00 ? 16 TYR B HA   7  
ATOM   5237  H HB2  . TYR B 2 16 ? 0.872   -5.999  -13.345 1.00 0.00 ? 16 TYR B HB2  7  
ATOM   5238  H HB3  . TYR B 2 16 ? 1.908   -7.297  -13.938 1.00 0.00 ? 16 TYR B HB3  7  
ATOM   5239  H HD1  . TYR B 2 16 ? 0.661   -9.742  -13.041 1.00 0.00 ? 16 TYR B HD1  7  
ATOM   5240  H HD2  . TYR B 2 16 ? -1.207  -6.129  -14.440 1.00 0.00 ? 16 TYR B HD2  7  
ATOM   5241  H HE1  . TYR B 2 16 ? -1.338  -11.037 -13.723 1.00 0.00 ? 16 TYR B HE1  7  
ATOM   5242  H HE2  . TYR B 2 16 ? -3.205  -7.429  -15.120 1.00 0.00 ? 16 TYR B HE2  7  
ATOM   5243  H HH   . TYR B 2 16 ? -4.036  -10.214 -14.063 1.00 0.00 ? 16 TYR B HH   7  
ATOM   5244  N N    . LEU B 2 17 ? 3.829   -6.893  -11.635 1.00 0.00 ? 17 LEU B N    7  
ATOM   5245  C CA   . LEU B 2 17 ? 5.279   -7.238  -11.592 1.00 0.00 ? 17 LEU B CA   7  
ATOM   5246  C C    . LEU B 2 17 ? 5.755   -7.309  -10.140 1.00 0.00 ? 17 LEU B C    7  
ATOM   5247  O O    . LEU B 2 17 ? 6.695   -8.008  -9.815  1.00 0.00 ? 17 LEU B O    7  
ATOM   5248  C CB   . LEU B 2 17 ? 6.080   -6.165  -12.335 1.00 0.00 ? 17 LEU B CB   7  
ATOM   5249  C CG   . LEU B 2 17 ? 6.616   -6.737  -13.649 1.00 0.00 ? 17 LEU B CG   7  
ATOM   5250  C CD1  . LEU B 2 17 ? 5.487   -6.802  -14.679 1.00 0.00 ? 17 LEU B CD1  7  
ATOM   5251  C CD2  . LEU B 2 17 ? 7.734   -5.836  -14.179 1.00 0.00 ? 17 LEU B CD2  7  
ATOM   5252  H H    . LEU B 2 17 ? 3.545   -5.959  -11.548 1.00 0.00 ? 17 LEU B H    7  
ATOM   5253  H HA   . LEU B 2 17 ? 5.433   -8.192  -12.066 1.00 0.00 ? 17 LEU B HA   7  
ATOM   5254  H HB2  . LEU B 2 17 ? 5.440   -5.320  -12.545 1.00 0.00 ? 17 LEU B HB2  7  
ATOM   5255  H HB3  . LEU B 2 17 ? 6.908   -5.844  -11.721 1.00 0.00 ? 17 LEU B HB3  7  
ATOM   5256  H HG   . LEU B 2 17 ? 7.002   -7.731  -13.476 1.00 0.00 ? 17 LEU B HG   7  
ATOM   5257  H HD11 . LEU B 2 17 ? 5.279   -5.809  -15.049 1.00 0.00 ? 17 LEU B HD11 7  
ATOM   5258  H HD12 . LEU B 2 17 ? 4.599   -7.206  -14.215 1.00 0.00 ? 17 LEU B HD12 7  
ATOM   5259  H HD13 . LEU B 2 17 ? 5.785   -7.437  -15.500 1.00 0.00 ? 17 LEU B HD13 7  
ATOM   5260  H HD21 . LEU B 2 17 ? 7.302   -4.998  -14.704 1.00 0.00 ? 17 LEU B HD21 7  
ATOM   5261  H HD22 . LEU B 2 17 ? 8.361   -6.400  -14.853 1.00 0.00 ? 17 LEU B HD22 7  
ATOM   5262  H HD23 . LEU B 2 17 ? 8.328   -5.476  -13.352 1.00 0.00 ? 17 LEU B HD23 7  
ATOM   5263  N N    . VAL B 2 18 ? 5.116   -6.586  -9.268  1.00 0.00 ? 18 VAL B N    7  
ATOM   5264  C CA   . VAL B 2 18 ? 5.526   -6.600  -7.837  1.00 0.00 ? 18 VAL B CA   7  
ATOM   5265  C C    . VAL B 2 18 ? 5.458   -8.029  -7.297  1.00 0.00 ? 18 VAL B C    7  
ATOM   5266  O O    . VAL B 2 18 ? 6.462   -8.626  -6.964  1.00 0.00 ? 18 VAL B O    7  
ATOM   5267  C CB   . VAL B 2 18 ? 4.582   -5.709  -7.028  1.00 0.00 ? 18 VAL B CB   7  
ATOM   5268  C CG1  . VAL B 2 18 ? 4.848   -5.908  -5.535  1.00 0.00 ? 18 VAL B CG1  7  
ATOM   5269  C CG2  . VAL B 2 18 ? 4.824   -4.245  -7.398  1.00 0.00 ? 18 VAL B CG2  7  
ATOM   5270  H H    . VAL B 2 18 ? 4.365   -6.031  -9.557  1.00 0.00 ? 18 VAL B H    7  
ATOM   5271  H HA   . VAL B 2 18 ? 6.536   -6.230  -7.747  1.00 0.00 ? 18 VAL B HA   7  
ATOM   5272  H HB   . VAL B 2 18 ? 3.559   -5.976  -7.249  1.00 0.00 ? 18 VAL B HB   7  
ATOM   5273  H HG11 . VAL B 2 18 ? 5.907   -6.041  -5.373  1.00 0.00 ? 18 VAL B HG11 7  
ATOM   5274  H HG12 . VAL B 2 18 ? 4.317   -6.781  -5.188  1.00 0.00 ? 18 VAL B HG12 7  
ATOM   5275  H HG13 . VAL B 2 18 ? 4.507   -5.039  -4.990  1.00 0.00 ? 18 VAL B HG13 7  
ATOM   5276  H HG21 . VAL B 2 18 ? 5.423   -3.774  -6.633  1.00 0.00 ? 18 VAL B HG21 7  
ATOM   5277  H HG22 . VAL B 2 18 ? 3.877   -3.733  -7.478  1.00 0.00 ? 18 VAL B HG22 7  
ATOM   5278  H HG23 . VAL B 2 18 ? 5.343   -4.193  -8.344  1.00 0.00 ? 18 VAL B HG23 7  
ATOM   5279  N N    . CYS B 2 19 ? 4.281   -8.581  -7.203  1.00 0.00 ? 19 CYS B N    7  
ATOM   5280  C CA   . CYS B 2 19 ? 4.152   -9.969  -6.679  1.00 0.00 ? 19 CYS B CA   7  
ATOM   5281  C C    . CYS B 2 19 ? 3.928   -10.942 -7.837  1.00 0.00 ? 19 CYS B C    7  
ATOM   5282  O O    . CYS B 2 19 ? 4.847   -11.585 -8.307  1.00 0.00 ? 19 CYS B O    7  
ATOM   5283  C CB   . CYS B 2 19 ? 2.966   -10.042 -5.717  1.00 0.00 ? 19 CYS B CB   7  
ATOM   5284  S SG   . CYS B 2 19 ? 3.511   -9.574  -4.058  1.00 0.00 ? 19 CYS B SG   7  
ATOM   5285  H H    . CYS B 2 19 ? 3.481   -8.081  -7.473  1.00 0.00 ? 19 CYS B H    7  
ATOM   5286  H HA   . CYS B 2 19 ? 5.054   -10.240 -6.152  1.00 0.00 ? 19 CYS B HA   7  
ATOM   5287  H HB2  . CYS B 2 19 ? 2.192   -9.364  -6.048  1.00 0.00 ? 19 CYS B HB2  7  
ATOM   5288  H HB3  . CYS B 2 19 ? 2.579   -11.050 -5.699  1.00 0.00 ? 19 CYS B HB3  7  
ATOM   5289  N N    . GLY B 2 20 ? 2.714   -11.063 -8.298  1.00 0.00 ? 20 GLY B N    7  
ATOM   5290  C CA   . GLY B 2 20 ? 2.434   -12.002 -9.421  1.00 0.00 ? 20 GLY B CA   7  
ATOM   5291  C C    . GLY B 2 20 ? 2.096   -13.379 -8.849  1.00 0.00 ? 20 GLY B C    7  
ATOM   5292  O O    . GLY B 2 20 ? 0.968   -13.825 -8.906  1.00 0.00 ? 20 GLY B O    7  
ATOM   5293  H H    . GLY B 2 20 ? 1.985   -10.540 -7.903  1.00 0.00 ? 20 GLY B H    7  
ATOM   5294  H HA2  . GLY B 2 20 ? 1.599   -11.634 -10.000 1.00 0.00 ? 20 GLY B HA2  7  
ATOM   5295  H HA3  . GLY B 2 20 ? 3.306   -12.081 -10.051 1.00 0.00 ? 20 GLY B HA3  7  
ATOM   5296  N N    . GLU B 2 21 ? 3.065   -14.055 -8.291  1.00 0.00 ? 21 GLU B N    7  
ATOM   5297  C CA   . GLU B 2 21 ? 2.793   -15.400 -7.708  1.00 0.00 ? 21 GLU B CA   7  
ATOM   5298  C C    . GLU B 2 21 ? 1.652   -15.287 -6.698  1.00 0.00 ? 21 GLU B C    7  
ATOM   5299  O O    . GLU B 2 21 ? 0.574   -15.807 -6.901  1.00 0.00 ? 21 GLU B O    7  
ATOM   5300  C CB   . GLU B 2 21 ? 4.048   -15.914 -6.997  1.00 0.00 ? 21 GLU B CB   7  
ATOM   5301  C CG   . GLU B 2 21 ? 5.171   -16.114 -8.016  1.00 0.00 ? 21 GLU B CG   7  
ATOM   5302  C CD   . GLU B 2 21 ? 6.520   -16.112 -7.293  1.00 0.00 ? 21 GLU B CD   7  
ATOM   5303  O OE1  . GLU B 2 21 ? 6.922   -17.165 -6.829  1.00 0.00 ? 21 GLU B OE1  7  
ATOM   5304  O OE2  . GLU B 2 21 ? 7.127   -15.056 -7.216  1.00 0.00 ? 21 GLU B OE2  7  
ATOM   5305  H H    . GLU B 2 21 ? 3.967   -13.676 -8.250  1.00 0.00 ? 21 GLU B H    7  
ATOM   5306  H HA   . GLU B 2 21 ? 2.514   -16.086 -8.495  1.00 0.00 ? 21 GLU B HA   7  
ATOM   5307  H HB2  . GLU B 2 21 ? 4.358   -15.194 -6.254  1.00 0.00 ? 21 GLU B HB2  7  
ATOM   5308  H HB3  . GLU B 2 21 ? 3.828   -16.856 -6.518  1.00 0.00 ? 21 GLU B HB3  7  
ATOM   5309  H HG2  . GLU B 2 21 ? 5.035   -17.058 -8.521  1.00 0.00 ? 21 GLU B HG2  7  
ATOM   5310  H HG3  . GLU B 2 21 ? 5.150   -15.312 -8.738  1.00 0.00 ? 21 GLU B HG3  7  
ATOM   5311  N N    . ARG B 2 22 ? 1.882   -14.605 -5.609  1.00 0.00 ? 22 ARG B N    7  
ATOM   5312  C CA   . ARG B 2 22 ? 0.813   -14.451 -4.583  1.00 0.00 ? 22 ARG B CA   7  
ATOM   5313  C C    . ARG B 2 22 ? -0.433  -13.849 -5.238  1.00 0.00 ? 22 ARG B C    7  
ATOM   5314  O O    . ARG B 2 22 ? -1.546  -14.092 -4.816  1.00 0.00 ? 22 ARG B O    7  
ATOM   5315  C CB   . ARG B 2 22 ? 1.305   -13.520 -3.474  1.00 0.00 ? 22 ARG B CB   7  
ATOM   5316  C CG   . ARG B 2 22 ? 2.037   -14.337 -2.407  1.00 0.00 ? 22 ARG B CG   7  
ATOM   5317  C CD   . ARG B 2 22 ? 2.747   -13.390 -1.438  1.00 0.00 ? 22 ARG B CD   7  
ATOM   5318  N NE   . ARG B 2 22 ? 1.933   -13.248 -0.198  1.00 0.00 ? 22 ARG B NE   7  
ATOM   5319  C CZ   . ARG B 2 22 ? 2.465   -12.738 0.881   1.00 0.00 ? 22 ARG B CZ   7  
ATOM   5320  N NH1  . ARG B 2 22 ? 3.052   -11.574 0.830   1.00 0.00 ? 22 ARG B NH1  7  
ATOM   5321  N NH2  . ARG B 2 22 ? 2.411   -13.394 2.007   1.00 0.00 ? 22 ARG B NH2  7  
ATOM   5322  H H    . ARG B 2 22 ? 2.760   -14.193 -5.467  1.00 0.00 ? 22 ARG B H    7  
ATOM   5323  H HA   . ARG B 2 22 ? 0.572   -15.416 -4.165  1.00 0.00 ? 22 ARG B HA   7  
ATOM   5324  H HB2  . ARG B 2 22 ? 1.980   -12.787 -3.893  1.00 0.00 ? 22 ARG B HB2  7  
ATOM   5325  H HB3  . ARG B 2 22 ? 0.462   -13.018 -3.025  1.00 0.00 ? 22 ARG B HB3  7  
ATOM   5326  H HG2  . ARG B 2 22 ? 1.323   -14.941 -1.864  1.00 0.00 ? 22 ARG B HG2  7  
ATOM   5327  H HG3  . ARG B 2 22 ? 2.765   -14.977 -2.880  1.00 0.00 ? 22 ARG B HG3  7  
ATOM   5328  H HD2  . ARG B 2 22 ? 3.717   -13.791 -1.188  1.00 0.00 ? 22 ARG B HD2  7  
ATOM   5329  H HD3  . ARG B 2 22 ? 2.867   -12.422 -1.903  1.00 0.00 ? 22 ARG B HD3  7  
ATOM   5330  H HE   . ARG B 2 22 ? 0.997   -13.538 -0.191  1.00 0.00 ? 22 ARG B HE   7  
ATOM   5331  H HH11 . ARG B 2 22 ? 3.093   -11.070 -0.033  1.00 0.00 ? 22 ARG B HH11 7  
ATOM   5332  H HH12 . ARG B 2 22 ? 3.458   -11.183 1.657   1.00 0.00 ? 22 ARG B HH12 7  
ATOM   5333  H HH21 . ARG B 2 22 ? 1.962   -14.287 2.046   1.00 0.00 ? 22 ARG B HH21 7  
ATOM   5334  H HH22 . ARG B 2 22 ? 2.821   -13.004 2.832   1.00 0.00 ? 22 ARG B HH22 7  
ATOM   5335  N N    . GLY B 2 23 ? -0.252  -13.067 -6.266  1.00 0.00 ? 23 GLY B N    7  
ATOM   5336  C CA   . GLY B 2 23 ? -1.425  -12.451 -6.951  1.00 0.00 ? 23 GLY B CA   7  
ATOM   5337  C C    . GLY B 2 23 ? -1.608  -11.011 -6.468  1.00 0.00 ? 23 GLY B C    7  
ATOM   5338  O O    . GLY B 2 23 ? -0.727  -10.431 -5.865  1.00 0.00 ? 23 GLY B O    7  
ATOM   5339  H H    . GLY B 2 23 ? 0.655   -12.885 -6.590  1.00 0.00 ? 23 GLY B H    7  
ATOM   5340  H HA2  . GLY B 2 23 ? -1.257  -12.454 -8.018  1.00 0.00 ? 23 GLY B HA2  7  
ATOM   5341  H HA3  . GLY B 2 23 ? -2.313  -13.019 -6.726  1.00 0.00 ? 23 GLY B HA3  7  
ATOM   5342  N N    . PHE B 2 24 ? -2.750  -10.433 -6.726  1.00 0.00 ? 24 PHE B N    7  
ATOM   5343  C CA   . PHE B 2 24 ? -2.996  -9.030  -6.283  1.00 0.00 ? 24 PHE B CA   7  
ATOM   5344  C C    . PHE B 2 24 ? -4.367  -8.574  -6.799  1.00 0.00 ? 24 PHE B C    7  
ATOM   5345  O O    . PHE B 2 24 ? -4.809  -8.982  -7.854  1.00 0.00 ? 24 PHE B O    7  
ATOM   5346  C CB   . PHE B 2 24 ? -1.873  -8.111  -6.819  1.00 0.00 ? 24 PHE B CB   7  
ATOM   5347  C CG   . PHE B 2 24 ? -2.311  -7.383  -8.087  1.00 0.00 ? 24 PHE B CG   7  
ATOM   5348  C CD1  . PHE B 2 24 ? -3.211  -6.303  -8.005  1.00 0.00 ? 24 PHE B CD1  7  
ATOM   5349  C CD2  . PHE B 2 24 ? -1.823  -7.784  -9.340  1.00 0.00 ? 24 PHE B CD2  7  
ATOM   5350  C CE1  . PHE B 2 24 ? -3.615  -5.636  -9.169  1.00 0.00 ? 24 PHE B CE1  7  
ATOM   5351  C CE2  . PHE B 2 24 ? -2.231  -7.113  -10.501 1.00 0.00 ? 24 PHE B CE2  7  
ATOM   5352  C CZ   . PHE B 2 24 ? -3.125  -6.041  -10.415 1.00 0.00 ? 24 PHE B CZ   7  
ATOM   5353  H H    . PHE B 2 24 ? -3.447  -10.925 -7.210  1.00 0.00 ? 24 PHE B H    7  
ATOM   5354  H HA   . PHE B 2 24 ? -2.997  -8.995  -5.203  1.00 0.00 ? 24 PHE B HA   7  
ATOM   5355  H HB2  . PHE B 2 24 ? -1.625  -7.381  -6.062  1.00 0.00 ? 24 PHE B HB2  7  
ATOM   5356  H HB3  . PHE B 2 24 ? -0.994  -8.714  -7.030  1.00 0.00 ? 24 PHE B HB3  7  
ATOM   5357  H HD1  . PHE B 2 24 ? -3.593  -5.983  -7.047  1.00 0.00 ? 24 PHE B HD1  7  
ATOM   5358  H HD2  . PHE B 2 24 ? -1.134  -8.606  -9.413  1.00 0.00 ? 24 PHE B HD2  7  
ATOM   5359  H HE1  . PHE B 2 24 ? -4.306  -4.809  -9.103  1.00 0.00 ? 24 PHE B HE1  7  
ATOM   5360  H HE2  . PHE B 2 24 ? -1.853  -7.425  -11.465 1.00 0.00 ? 24 PHE B HE2  7  
ATOM   5361  H HZ   . PHE B 2 24 ? -3.439  -5.525  -11.311 1.00 0.00 ? 24 PHE B HZ   7  
ATOM   5362  N N    . PHE B 2 25 ? -5.043  -7.733  -6.066  1.00 0.00 ? 25 PHE B N    7  
ATOM   5363  C CA   . PHE B 2 25 ? -6.377  -7.264  -6.527  1.00 0.00 ? 25 PHE B CA   7  
ATOM   5364  C C    . PHE B 2 25 ? -6.476  -5.744  -6.358  1.00 0.00 ? 25 PHE B C    7  
ATOM   5365  O O    . PHE B 2 25 ? -6.225  -5.209  -5.297  1.00 0.00 ? 25 PHE B O    7  
ATOM   5366  C CB   . PHE B 2 25 ? -7.476  -7.961  -5.714  1.00 0.00 ? 25 PHE B CB   7  
ATOM   5367  C CG   . PHE B 2 25 ? -7.653  -7.280  -4.375  1.00 0.00 ? 25 PHE B CG   7  
ATOM   5368  C CD1  . PHE B 2 25 ? -6.889  -7.686  -3.272  1.00 0.00 ? 25 PHE B CD1  7  
ATOM   5369  C CD2  . PHE B 2 25 ? -8.589  -6.247  -4.237  1.00 0.00 ? 25 PHE B CD2  7  
ATOM   5370  C CE1  . PHE B 2 25 ? -7.061  -7.057  -2.032  1.00 0.00 ? 25 PHE B CE1  7  
ATOM   5371  C CE2  . PHE B 2 25 ? -8.763  -5.619  -2.998  1.00 0.00 ? 25 PHE B CE2  7  
ATOM   5372  C CZ   . PHE B 2 25 ? -7.999  -6.025  -1.894  1.00 0.00 ? 25 PHE B CZ   7  
ATOM   5373  H H    . PHE B 2 25 ? -4.674  -7.412  -5.216  1.00 0.00 ? 25 PHE B H    7  
ATOM   5374  H HA   . PHE B 2 25 ? -6.497  -7.512  -7.571  1.00 0.00 ? 25 PHE B HA   7  
ATOM   5375  H HB2  . PHE B 2 25 ? -8.406  -7.917  -6.261  1.00 0.00 ? 25 PHE B HB2  7  
ATOM   5376  H HB3  . PHE B 2 25 ? -7.202  -8.994  -5.556  1.00 0.00 ? 25 PHE B HB3  7  
ATOM   5377  H HD1  . PHE B 2 25 ? -6.167  -8.482  -3.379  1.00 0.00 ? 25 PHE B HD1  7  
ATOM   5378  H HD2  . PHE B 2 25 ? -9.177  -5.935  -5.087  1.00 0.00 ? 25 PHE B HD2  7  
ATOM   5379  H HE1  . PHE B 2 25 ? -6.474  -7.368  -1.182  1.00 0.00 ? 25 PHE B HE1  7  
ATOM   5380  H HE2  . PHE B 2 25 ? -9.485  -4.824  -2.891  1.00 0.00 ? 25 PHE B HE2  7  
ATOM   5381  H HZ   . PHE B 2 25 ? -8.134  -5.540  -0.938  1.00 0.00 ? 25 PHE B HZ   7  
ATOM   5382  N N    . TYR B 2 26 ? -6.844  -5.050  -7.400  1.00 0.00 ? 26 TYR B N    7  
ATOM   5383  C CA   . TYR B 2 26 ? -6.964  -3.568  -7.307  1.00 0.00 ? 26 TYR B CA   7  
ATOM   5384  C C    . TYR B 2 26 ? -7.895  -3.203  -6.148  1.00 0.00 ? 26 TYR B C    7  
ATOM   5385  O O    . TYR B 2 26 ? -8.920  -3.824  -5.944  1.00 0.00 ? 26 TYR B O    7  
ATOM   5386  C CB   . TYR B 2 26 ? -7.545  -3.026  -8.614  1.00 0.00 ? 26 TYR B CB   7  
ATOM   5387  C CG   . TYR B 2 26 ? -6.669  -1.911  -9.133  1.00 0.00 ? 26 TYR B CG   7  
ATOM   5388  C CD1  . TYR B 2 26 ? -5.275  -2.057  -9.131  1.00 0.00 ? 26 TYR B CD1  7  
ATOM   5389  C CD2  . TYR B 2 26 ? -7.251  -0.732  -9.617  1.00 0.00 ? 26 TYR B CD2  7  
ATOM   5390  C CE1  . TYR B 2 26 ? -4.463  -1.022  -9.614  1.00 0.00 ? 26 TYR B CE1  7  
ATOM   5391  C CE2  . TYR B 2 26 ? -6.439  0.302   -10.099 1.00 0.00 ? 26 TYR B CE2  7  
ATOM   5392  C CZ   . TYR B 2 26 ? -5.045  0.157   -10.099 1.00 0.00 ? 26 TYR B CZ   7  
ATOM   5393  O OH   . TYR B 2 26 ? -4.246  1.176   -10.574 1.00 0.00 ? 26 TYR B OH   7  
ATOM   5394  H H    . TYR B 2 26 ? -7.044  -5.505  -8.244  1.00 0.00 ? 26 TYR B H    7  
ATOM   5395  H HA   . TYR B 2 26 ? -5.989  -3.136  -7.138  1.00 0.00 ? 26 TYR B HA   7  
ATOM   5396  H HB2  . TYR B 2 26 ? -7.587  -3.821  -9.345  1.00 0.00 ? 26 TYR B HB2  7  
ATOM   5397  H HB3  . TYR B 2 26 ? -8.540  -2.648  -8.437  1.00 0.00 ? 26 TYR B HB3  7  
ATOM   5398  H HD1  . TYR B 2 26 ? -4.827  -2.966  -8.758  1.00 0.00 ? 26 TYR B HD1  7  
ATOM   5399  H HD2  . TYR B 2 26 ? -8.325  -0.621  -9.617  1.00 0.00 ? 26 TYR B HD2  7  
ATOM   5400  H HE1  . TYR B 2 26 ? -3.389  -1.133  -9.613  1.00 0.00 ? 26 TYR B HE1  7  
ATOM   5401  H HE2  . TYR B 2 26 ? -6.887  1.212   -10.471 1.00 0.00 ? 26 TYR B HE2  7  
ATOM   5402  H HH   . TYR B 2 26 ? -4.732  1.634   -11.265 1.00 0.00 ? 26 TYR B HH   7  
ATOM   5403  N N    . THR B 2 27 ? -7.550  -2.198  -5.390  1.00 0.00 ? 27 THR B N    7  
ATOM   5404  C CA   . THR B 2 27 ? -8.419  -1.795  -4.249  1.00 0.00 ? 27 THR B CA   7  
ATOM   5405  C C    . THR B 2 27 ? -9.380  -0.698  -4.710  1.00 0.00 ? 27 THR B C    7  
ATOM   5406  O O    . THR B 2 27 ? -9.060  0.100   -5.567  1.00 0.00 ? 27 THR B O    7  
ATOM   5407  C CB   . THR B 2 27 ? -7.551  -1.267  -3.104  1.00 0.00 ? 27 THR B CB   7  
ATOM   5408  O OG1  . THR B 2 27 ? -6.613  -0.330  -3.616  1.00 0.00 ? 27 THR B OG1  7  
ATOM   5409  C CG2  . THR B 2 27 ? -6.806  -2.430  -2.447  1.00 0.00 ? 27 THR B CG2  7  
ATOM   5410  H H    . THR B 2 27 ? -6.721  -1.708  -5.572  1.00 0.00 ? 27 THR B H    7  
ATOM   5411  H HA   . THR B 2 27 ? -8.984  -2.649  -3.908  1.00 0.00 ? 27 THR B HA   7  
ATOM   5412  H HB   . THR B 2 27 ? -8.178  -0.785  -2.370  1.00 0.00 ? 27 THR B HB   7  
ATOM   5413  H HG1  . THR B 2 27 ? -5.873  -0.820  -3.981  1.00 0.00 ? 27 THR B HG1  7  
ATOM   5414  H HG21 . THR B 2 27 ? -6.844  -2.318  -1.373  1.00 0.00 ? 27 THR B HG21 7  
ATOM   5415  H HG22 . THR B 2 27 ? -5.776  -2.428  -2.773  1.00 0.00 ? 27 THR B HG22 7  
ATOM   5416  H HG23 . THR B 2 27 ? -7.273  -3.361  -2.728  1.00 0.00 ? 27 THR B HG23 7  
ATOM   5417  N N    . LYS B 2 28 ? -10.559 -0.653  -4.151  1.00 0.00 ? 28 LYS B N    7  
ATOM   5418  C CA   . LYS B 2 28 ? -11.540 0.392   -4.565  1.00 0.00 ? 28 LYS B CA   7  
ATOM   5419  C C    . LYS B 2 28 ? -12.167 1.041   -3.325  1.00 0.00 ? 28 LYS B C    7  
ATOM   5420  O O    . LYS B 2 28 ? -13.363 0.970   -3.131  1.00 0.00 ? 28 LYS B O    7  
ATOM   5421  C CB   . LYS B 2 28 ? -12.641 -0.255  -5.409  1.00 0.00 ? 28 LYS B CB   7  
ATOM   5422  C CG   . LYS B 2 28 ? -12.853 0.558   -6.688  1.00 0.00 ? 28 LYS B CG   7  
ATOM   5423  C CD   . LYS B 2 28 ? -14.327 0.955   -6.802  1.00 0.00 ? 28 LYS B CD   7  
ATOM   5424  C CE   . LYS B 2 28 ? -15.104 -0.156  -7.511  1.00 0.00 ? 28 LYS B CE   7  
ATOM   5425  N NZ   . LYS B 2 28 ? -15.983 -0.851  -6.530  1.00 0.00 ? 28 LYS B NZ   7  
ATOM   5426  H H    . LYS B 2 28 ? -10.801 -1.307  -3.463  1.00 0.00 ? 28 LYS B H    7  
ATOM   5427  H HA   . LYS B 2 28 ? -11.036 1.146   -5.150  1.00 0.00 ? 28 LYS B HA   7  
ATOM   5428  H HB2  . LYS B 2 28 ? -12.349 -1.263  -5.667  1.00 0.00 ? 28 LYS B HB2  7  
ATOM   5429  H HB3  . LYS B 2 28 ? -13.559 -0.280  -4.843  1.00 0.00 ? 28 LYS B HB3  7  
ATOM   5430  H HG2  . LYS B 2 28 ? -12.242 1.449   -6.655  1.00 0.00 ? 28 LYS B HG2  7  
ATOM   5431  H HG3  . LYS B 2 28 ? -12.576 -0.038  -7.544  1.00 0.00 ? 28 LYS B HG3  7  
ATOM   5432  H HD2  . LYS B 2 28 ? -14.736 1.106   -5.813  1.00 0.00 ? 28 LYS B HD2  7  
ATOM   5433  H HD3  . LYS B 2 28 ? -14.411 1.869   -7.369  1.00 0.00 ? 28 LYS B HD3  7  
ATOM   5434  H HE2  . LYS B 2 28 ? -15.708 0.272   -8.297  1.00 0.00 ? 28 LYS B HE2  7  
ATOM   5435  H HE3  . LYS B 2 28 ? -14.408 -0.864  -7.938  1.00 0.00 ? 28 LYS B HE3  7  
ATOM   5436  H HZ1  . LYS B 2 28 ? -15.896 -1.880  -6.654  1.00 0.00 ? 28 LYS B HZ1  7  
ATOM   5437  H HZ2  . LYS B 2 28 ? -16.971 -0.565  -6.688  1.00 0.00 ? 28 LYS B HZ2  7  
ATOM   5438  H HZ3  . LYS B 2 28 ? -15.697 -0.596  -5.564  1.00 0.00 ? 28 LYS B HZ3  7  
ATOM   5439  N N    . PRO B 2 29 ? -11.337 1.662   -2.526  1.00 0.00 ? 29 PRO B N    7  
ATOM   5440  C CA   . PRO B 2 29 ? -11.778 2.342   -1.296  1.00 0.00 ? 29 PRO B CA   7  
ATOM   5441  C C    . PRO B 2 29 ? -12.382 3.708   -1.631  1.00 0.00 ? 29 PRO B C    7  
ATOM   5442  O O    . PRO B 2 29 ? -11.796 4.501   -2.341  1.00 0.00 ? 29 PRO B O    7  
ATOM   5443  C CB   . PRO B 2 29 ? -10.487 2.501   -0.491  1.00 0.00 ? 29 PRO B CB   7  
ATOM   5444  C CG   . PRO B 2 29 ? -9.325  2.434   -1.512  1.00 0.00 ? 29 PRO B CG   7  
ATOM   5445  C CD   . PRO B 2 29 ? -9.882  1.740   -2.770  1.00 0.00 ? 29 PRO B CD   7  
ATOM   5446  H HA   . PRO B 2 29 ? -12.481 1.733   -0.752  1.00 0.00 ? 29 PRO B HA   7  
ATOM   5447  H HB2  . PRO B 2 29 ? -10.485 3.456   0.019   1.00 0.00 ? 29 PRO B HB2  7  
ATOM   5448  H HB3  . PRO B 2 29 ? -10.392 1.698   0.223   1.00 0.00 ? 29 PRO B HB3  7  
ATOM   5449  H HG2  . PRO B 2 29 ? -8.989  3.432   -1.755  1.00 0.00 ? 29 PRO B HG2  7  
ATOM   5450  H HG3  . PRO B 2 29 ? -8.510  1.854   -1.107  1.00 0.00 ? 29 PRO B HG3  7  
ATOM   5451  H HD2  . PRO B 2 29 ? -9.674  2.331   -3.651  1.00 0.00 ? 29 PRO B HD2  7  
ATOM   5452  H HD3  . PRO B 2 29 ? -9.467  0.749   -2.870  1.00 0.00 ? 29 PRO B HD3  7  
ATOM   5453  N N    . THR B 2 30 ? -13.552 3.988   -1.125  1.00 0.00 ? 30 THR B N    7  
ATOM   5454  C CA   . THR B 2 30 ? -14.196 5.301   -1.414  1.00 0.00 ? 30 THR B CA   7  
ATOM   5455  C C    . THR B 2 30 ? -13.311 6.432   -0.886  1.00 0.00 ? 30 THR B C    7  
ATOM   5456  O O    . THR B 2 30 ? -12.313 6.723   -1.523  1.00 0.00 ? 30 THR B O    7  
ATOM   5457  C CB   . THR B 2 30 ? -15.563 5.359   -0.728  1.00 0.00 ? 30 THR B CB   7  
ATOM   5458  O OG1  . THR B 2 30 ? -16.149 6.635   -0.949  1.00 0.00 ? 30 THR B OG1  7  
ATOM   5459  C CG2  . THR B 2 30 ? -15.392 5.127   0.774   1.00 0.00 ? 30 THR B CG2  7  
ATOM   5460  O OXT  . THR B 2 30 ? -13.648 6.987   0.147   1.00 0.00 ? 30 THR B OXT  7  
ATOM   5461  H H    . THR B 2 30 ? -14.008 3.334   -0.556  1.00 0.00 ? 30 THR B H    7  
ATOM   5462  H HA   . THR B 2 30 ? -14.324 5.412   -2.481  1.00 0.00 ? 30 THR B HA   7  
ATOM   5463  H HB   . THR B 2 30 ? -16.203 4.592   -1.135  1.00 0.00 ? 30 THR B HB   7  
ATOM   5464  H HG1  . THR B 2 30 ? -16.044 6.854   -1.877  1.00 0.00 ? 30 THR B HG1  7  
ATOM   5465  H HG21 . THR B 2 30 ? -15.765 4.147   1.031   1.00 0.00 ? 30 THR B HG21 7  
ATOM   5466  H HG22 . THR B 2 30 ? -15.944 5.877   1.320   1.00 0.00 ? 30 THR B HG22 7  
ATOM   5467  H HG23 . THR B 2 30 ? -14.345 5.192   1.031   1.00 0.00 ? 30 THR B HG23 7  
ATOM   5468  N N    . GLY A 1 1  ? -7.258  2.857   -0.528  1.00 0.00 ? 1  GLY A N    8  
ATOM   5469  C CA   . GLY A 1 1  ? -6.759  3.787   -1.635  1.00 0.00 ? 1  GLY A CA   8  
ATOM   5470  C C    . GLY A 1 1  ? -5.380  3.607   -2.172  1.00 0.00 ? 1  GLY A C    8  
ATOM   5471  O O    . GLY A 1 1  ? -4.712  4.556   -2.529  1.00 0.00 ? 1  GLY A O    8  
ATOM   5472  H H1   . GLY A 1 1  ? -8.278  2.694   -0.646  1.00 0.00 ? 1  GLY A H1   8  
ATOM   5473  H H2   . GLY A 1 1  ? -7.082  3.297   0.399   1.00 0.00 ? 1  GLY A H2   8  
ATOM   5474  H H3   . GLY A 1 1  ? -6.753  1.950   -0.583  1.00 0.00 ? 1  GLY A H3   8  
ATOM   5475  H HA2  . GLY A 1 1  ? -7.028  3.469   -2.515  1.00 0.00 ? 1  GLY A HA2  8  
ATOM   5476  H HA3  . GLY A 1 1  ? -7.164  4.854   -1.391  1.00 0.00 ? 1  GLY A HA3  8  
HETATM 5477  N N    . IIL A 1 2  ? -4.917  2.388   -2.243  1.00 0.00 ? 2  IIL A N    8  
HETATM 5478  C CA   . IIL A 1 2  ? -3.545  2.145   -2.771  1.00 0.00 ? 2  IIL A CA   8  
HETATM 5479  C C    . IIL A 1 2  ? -3.359  2.922   -4.076  1.00 0.00 ? 2  IIL A C    8  
HETATM 5480  O O    . IIL A 1 2  ? -2.305  3.462   -4.346  1.00 0.00 ? 2  IIL A O    8  
HETATM 5481  C CB   . IIL A 1 2  ? -3.357  0.648   -3.034  1.00 0.00 ? 2  IIL A CB   8  
HETATM 5482  C CG2  . IIL A 1 2  ? -2.106  0.428   -3.886  1.00 0.00 ? 2  IIL A CG2  8  
HETATM 5483  C CG1  . IIL A 1 2  ? -4.580  0.105   -3.773  1.00 0.00 ? 2  IIL A CG1  8  
HETATM 5484  C CD1  . IIL A 1 2  ? -4.308  -1.332  -4.221  1.00 0.00 ? 2  IIL A CD1  8  
HETATM 5485  H H    . IIL A 1 2  ? -5.470  1.635   -1.951  1.00 0.00 ? 2  IIL A H    8  
HETATM 5486  H HA   . IIL A 1 2  ? -2.816  2.478   -2.048  1.00 0.00 ? 2  IIL A HA   8  
HETATM 5487  H HB   . IIL A 1 2  ? -3.246  0.127   -2.094  1.00 0.00 ? 2  IIL A HB   8  
HETATM 5488  H HG21 . IIL A 1 2  ? -1.950  -0.631  -4.032  1.00 0.00 ? 2  IIL A HG21 8  
HETATM 5489  H HG22 . IIL A 1 2  ? -1.248  0.852   -3.384  1.00 0.00 ? 2  IIL A HG22 8  
HETATM 5490  H HG23 . IIL A 1 2  ? -2.234  0.908   -4.845  1.00 0.00 ? 2  IIL A HG23 8  
HETATM 5491  H HG12 . IIL A 1 2  ? -4.781  0.717   -4.639  1.00 0.00 ? 2  IIL A HG12 8  
HETATM 5492  H HG13 . IIL A 1 2  ? -5.436  0.121   -3.113  1.00 0.00 ? 2  IIL A HG13 8  
HETATM 5493  H HD11 . IIL A 1 2  ? -3.844  -1.323  -5.197  1.00 0.00 ? 2  IIL A HD11 8  
HETATM 5494  H HD12 . IIL A 1 2  ? -5.239  -1.877  -4.270  1.00 0.00 ? 2  IIL A HD12 8  
HETATM 5495  H HD13 . IIL A 1 2  ? -3.647  -1.811  -3.514  1.00 0.00 ? 2  IIL A HD13 8  
ATOM   5496  N N    . VAL A 1 3  ? -4.378  2.983   -4.890  1.00 0.00 ? 3  VAL A N    8  
ATOM   5497  C CA   . VAL A 1 3  ? -4.262  3.723   -6.175  1.00 0.00 ? 3  VAL A CA   8  
ATOM   5498  C C    . VAL A 1 3  ? -4.354  5.226   -5.909  1.00 0.00 ? 3  VAL A C    8  
ATOM   5499  O O    . VAL A 1 3  ? -3.627  6.014   -6.478  1.00 0.00 ? 3  VAL A O    8  
ATOM   5500  C CB   . VAL A 1 3  ? -5.397  3.300   -7.106  1.00 0.00 ? 3  VAL A CB   8  
ATOM   5501  C CG1  . VAL A 1 3  ? -5.196  3.940   -8.479  1.00 0.00 ? 3  VAL A CG1  8  
ATOM   5502  C CG2  . VAL A 1 3  ? -5.398  1.777   -7.250  1.00 0.00 ? 3  VAL A CG2  8  
ATOM   5503  H H    . VAL A 1 3  ? -5.220  2.541   -4.655  1.00 0.00 ? 3  VAL A H    8  
ATOM   5504  H HA   . VAL A 1 3  ? -3.312  3.497   -6.638  1.00 0.00 ? 3  VAL A HA   8  
ATOM   5505  H HB   . VAL A 1 3  ? -6.342  3.625   -6.692  1.00 0.00 ? 3  VAL A HB   8  
ATOM   5506  H HG11 . VAL A 1 3  ? -5.308  5.010   -8.396  1.00 0.00 ? 3  VAL A HG11 8  
ATOM   5507  H HG12 . VAL A 1 3  ? -5.931  3.551   -9.167  1.00 0.00 ? 3  VAL A HG12 8  
ATOM   5508  H HG13 . VAL A 1 3  ? -4.205  3.708   -8.840  1.00 0.00 ? 3  VAL A HG13 8  
ATOM   5509  H HG21 . VAL A 1 3  ? -4.421  1.444   -7.568  1.00 0.00 ? 3  VAL A HG21 8  
ATOM   5510  H HG22 . VAL A 1 3  ? -6.134  1.486   -7.985  1.00 0.00 ? 3  VAL A HG22 8  
ATOM   5511  H HG23 . VAL A 1 3  ? -5.641  1.325   -6.299  1.00 0.00 ? 3  VAL A HG23 8  
ATOM   5512  N N    . GLU A 1 4  ? -5.247  5.631   -5.047  1.00 0.00 ? 4  GLU A N    8  
ATOM   5513  C CA   . GLU A 1 4  ? -5.385  7.083   -4.746  1.00 0.00 ? 4  GLU A CA   8  
ATOM   5514  C C    . GLU A 1 4  ? -4.197  7.546   -3.898  1.00 0.00 ? 4  GLU A C    8  
ATOM   5515  O O    . GLU A 1 4  ? -4.054  8.715   -3.601  1.00 0.00 ? 4  GLU A O    8  
ATOM   5516  C CB   . GLU A 1 4  ? -6.688  7.323   -3.978  1.00 0.00 ? 4  GLU A CB   8  
ATOM   5517  C CG   . GLU A 1 4  ? -7.842  7.483   -4.970  1.00 0.00 ? 4  GLU A CG   8  
ATOM   5518  C CD   . GLU A 1 4  ? -8.361  8.922   -4.926  1.00 0.00 ? 4  GLU A CD   8  
ATOM   5519  O OE1  . GLU A 1 4  ? -7.544  9.825   -4.849  1.00 0.00 ? 4  GLU A OE1  8  
ATOM   5520  O OE2  . GLU A 1 4  ? -9.568  9.097   -4.969  1.00 0.00 ? 4  GLU A OE2  8  
ATOM   5521  H H    . GLU A 1 4  ? -5.825  4.981   -4.598  1.00 0.00 ? 4  GLU A H    8  
ATOM   5522  H HA   . GLU A 1 4  ? -5.406  7.642   -5.670  1.00 0.00 ? 4  GLU A HA   8  
ATOM   5523  H HB2  . GLU A 1 4  ? -6.882  6.480   -3.330  1.00 0.00 ? 4  GLU A HB2  8  
ATOM   5524  H HB3  . GLU A 1 4  ? -6.597  8.221   -3.385  1.00 0.00 ? 4  GLU A HB3  8  
ATOM   5525  H HG2  . GLU A 1 4  ? -7.492  7.257   -5.968  1.00 0.00 ? 4  GLU A HG2  8  
ATOM   5526  H HG3  . GLU A 1 4  ? -8.640  6.807   -4.706  1.00 0.00 ? 4  GLU A HG3  8  
ATOM   5527  N N    . GLN A 1 5  ? -3.340  6.641   -3.509  1.00 0.00 ? 5  GLN A N    8  
ATOM   5528  C CA   . GLN A 1 5  ? -2.165  7.038   -2.684  1.00 0.00 ? 5  GLN A CA   8  
ATOM   5529  C C    . GLN A 1 5  ? -0.902  7.035   -3.552  1.00 0.00 ? 5  GLN A C    8  
ATOM   5530  O O    . GLN A 1 5  ? -0.115  7.962   -3.516  1.00 0.00 ? 5  GLN A O    8  
ATOM   5531  C CB   . GLN A 1 5  ? -1.996  6.057   -1.521  1.00 0.00 ? 5  GLN A CB   8  
ATOM   5532  C CG   . GLN A 1 5  ? -1.424  6.795   -0.310  1.00 0.00 ? 5  GLN A CG   8  
ATOM   5533  C CD   . GLN A 1 5  ? -0.309  5.957   0.317   1.00 0.00 ? 5  GLN A CD   8  
ATOM   5534  O OE1  . GLN A 1 5  ? -0.546  5.194   1.233   1.00 0.00 ? 5  GLN A OE1  8  
ATOM   5535  N NE2  . GLN A 1 5  ? 0.909   6.068   -0.140  1.00 0.00 ? 5  GLN A NE2  8  
ATOM   5536  H H    . GLN A 1 5  ? -3.469  5.702   -3.758  1.00 0.00 ? 5  GLN A H    8  
ATOM   5537  H HA   . GLN A 1 5  ? -2.324  8.032   -2.292  1.00 0.00 ? 5  GLN A HA   8  
ATOM   5538  H HB2  . GLN A 1 5  ? -2.957  5.634   -1.263  1.00 0.00 ? 5  GLN A HB2  8  
ATOM   5539  H HB3  . GLN A 1 5  ? -1.321  5.266   -1.810  1.00 0.00 ? 5  GLN A HB3  8  
ATOM   5540  H HG2  . GLN A 1 5  ? -1.027  7.749   -0.625  1.00 0.00 ? 5  GLN A HG2  8  
ATOM   5541  H HG3  . GLN A 1 5  ? -2.206  6.952   0.418   1.00 0.00 ? 5  GLN A HG3  8  
ATOM   5542  H HE21 . GLN A 1 5  ? 1.101   6.684   -0.878  1.00 0.00 ? 5  GLN A HE21 8  
ATOM   5543  H HE22 . GLN A 1 5  ? 1.631   5.534   0.254   1.00 0.00 ? 5  GLN A HE22 8  
ATOM   5544  N N    . CYS A 1 6  ? -0.695  6.009   -4.337  1.00 0.00 ? 6  CYS A N    8  
ATOM   5545  C CA   . CYS A 1 6  ? 0.522   5.974   -5.197  1.00 0.00 ? 6  CYS A CA   8  
ATOM   5546  C C    . CYS A 1 6  ? 0.273   6.800   -6.458  1.00 0.00 ? 6  CYS A C    8  
ATOM   5547  O O    . CYS A 1 6  ? 1.186   7.107   -7.201  1.00 0.00 ? 6  CYS A O    8  
ATOM   5548  C CB   . CYS A 1 6  ? 0.853   4.531   -5.584  1.00 0.00 ? 6  CYS A CB   8  
ATOM   5549  S SG   . CYS A 1 6  ? 0.961   3.521   -4.087  1.00 0.00 ? 6  CYS A SG   8  
ATOM   5550  H H    . CYS A 1 6  ? -1.336  5.268   -4.364  1.00 0.00 ? 6  CYS A H    8  
ATOM   5551  H HA   . CYS A 1 6  ? 1.351   6.399   -4.652  1.00 0.00 ? 6  CYS A HA   8  
ATOM   5552  H HB2  . CYS A 1 6  ? 0.084   4.141   -6.231  1.00 0.00 ? 6  CYS A HB2  8  
ATOM   5553  H HB3  . CYS A 1 6  ? 1.802   4.507   -6.101  1.00 0.00 ? 6  CYS A HB3  8  
ATOM   5554  N N    . CYS A 1 7  ? -0.955  7.170   -6.700  1.00 0.00 ? 7  CYS A N    8  
ATOM   5555  C CA   . CYS A 1 7  ? -1.255  7.986   -7.906  1.00 0.00 ? 7  CYS A CA   8  
ATOM   5556  C C    . CYS A 1 7  ? -1.289  9.465   -7.511  1.00 0.00 ? 7  CYS A C    8  
ATOM   5557  O O    . CYS A 1 7  ? -1.280  10.343  -8.349  1.00 0.00 ? 7  CYS A O    8  
ATOM   5558  C CB   . CYS A 1 7  ? -2.602  7.561   -8.499  1.00 0.00 ? 7  CYS A CB   8  
ATOM   5559  S SG   . CYS A 1 7  ? -2.855  8.381   -10.092 1.00 0.00 ? 7  CYS A SG   8  
ATOM   5560  H H    . CYS A 1 7  ? -1.676  6.918   -6.086  1.00 0.00 ? 7  CYS A H    8  
ATOM   5561  H HA   . CYS A 1 7  ? -0.478  7.835   -8.634  1.00 0.00 ? 7  CYS A HA   8  
ATOM   5562  H HB2  . CYS A 1 7  ? -2.610  6.491   -8.640  1.00 0.00 ? 7  CYS A HB2  8  
ATOM   5563  H HB3  . CYS A 1 7  ? -3.393  7.837   -7.827  1.00 0.00 ? 7  CYS A HB3  8  
ATOM   5564  N N    . THR A 1 8  ? -1.302  9.743   -6.235  1.00 0.00 ? 8  THR A N    8  
ATOM   5565  C CA   . THR A 1 8  ? -1.305  11.160  -5.778  1.00 0.00 ? 8  THR A CA   8  
ATOM   5566  C C    . THR A 1 8  ? 0.138   11.569  -5.474  1.00 0.00 ? 8  THR A C    8  
ATOM   5567  O O    . THR A 1 8  ? 0.486   12.732  -5.487  1.00 0.00 ? 8  THR A O    8  
ATOM   5568  C CB   . THR A 1 8  ? -2.157  11.293  -4.511  1.00 0.00 ? 8  THR A CB   8  
ATOM   5569  O OG1  . THR A 1 8  ? -2.405  12.667  -4.251  1.00 0.00 ? 8  THR A OG1  8  
ATOM   5570  C CG2  . THR A 1 8  ? -1.416  10.673  -3.323  1.00 0.00 ? 8  THR A CG2  8  
ATOM   5571  H H    . THR A 1 8  ? -1.290  9.018   -5.576  1.00 0.00 ? 8  THR A H    8  
ATOM   5572  H HA   . THR A 1 8  ? -1.706  11.793  -6.556  1.00 0.00 ? 8  THR A HA   8  
ATOM   5573  H HB   . THR A 1 8  ? -3.095  10.778  -4.652  1.00 0.00 ? 8  THR A HB   8  
ATOM   5574  H HG1  . THR A 1 8  ? -2.395  13.135  -5.090  1.00 0.00 ? 8  THR A HG1  8  
ATOM   5575  H HG21 . THR A 1 8  ? -0.616  10.045  -3.686  1.00 0.00 ? 8  THR A HG21 8  
ATOM   5576  H HG22 . THR A 1 8  ? -2.104  10.079  -2.740  1.00 0.00 ? 8  THR A HG22 8  
ATOM   5577  H HG23 . THR A 1 8  ? -1.005  11.459  -2.706  1.00 0.00 ? 8  THR A HG23 8  
ATOM   5578  N N    . SER A 1 9  ? 0.978   10.604  -5.211  1.00 0.00 ? 9  SER A N    8  
ATOM   5579  C CA   . SER A 1 9  ? 2.408   10.903  -4.914  1.00 0.00 ? 9  SER A CA   8  
ATOM   5580  C C    . SER A 1 9  ? 3.288   9.921   -5.692  1.00 0.00 ? 9  SER A C    8  
ATOM   5581  O O    . SER A 1 9  ? 2.923   9.461   -6.754  1.00 0.00 ? 9  SER A O    8  
ATOM   5582  C CB   . SER A 1 9  ? 2.662   10.743  -3.415  1.00 0.00 ? 9  SER A CB   8  
ATOM   5583  O OG   . SER A 1 9  ? 1.560   11.276  -2.692  1.00 0.00 ? 9  SER A OG   8  
ATOM   5584  H H    . SER A 1 9  ? 0.668   9.674   -5.215  1.00 0.00 ? 9  SER A H    8  
ATOM   5585  H HA   . SER A 1 9  ? 2.637   11.915  -5.215  1.00 0.00 ? 9  SER A HA   8  
ATOM   5586  H HB2  . SER A 1 9  ? 2.771   9.699   -3.175  1.00 0.00 ? 9  SER A HB2  8  
ATOM   5587  H HB3  . SER A 1 9  ? 3.570   11.268  -3.146  1.00 0.00 ? 9  SER A HB3  8  
ATOM   5588  H HG   . SER A 1 9  ? 1.181   10.569  -2.165  1.00 0.00 ? 9  SER A HG   8  
ATOM   5589  N N    . ILE A 1 10 ? 4.441   9.591   -5.177  1.00 0.00 ? 10 ILE A N    8  
ATOM   5590  C CA   . ILE A 1 10 ? 5.328   8.637   -5.897  1.00 0.00 ? 10 ILE A CA   8  
ATOM   5591  C C    . ILE A 1 10 ? 4.960   7.202   -5.513  1.00 0.00 ? 10 ILE A C    8  
ATOM   5592  O O    . ILE A 1 10 ? 4.465   6.440   -6.318  1.00 0.00 ? 10 ILE A O    8  
ATOM   5593  C CB   . ILE A 1 10 ? 6.787   8.914   -5.522  1.00 0.00 ? 10 ILE A CB   8  
ATOM   5594  C CG1  . ILE A 1 10 ? 7.258   10.189  -6.260  1.00 0.00 ? 10 ILE A CG1  8  
ATOM   5595  C CG2  . ILE A 1 10 ? 7.655   7.702   -5.900  1.00 0.00 ? 10 ILE A CG2  8  
ATOM   5596  C CD1  . ILE A 1 10 ? 8.501   9.913   -7.118  1.00 0.00 ? 10 ILE A CD1  8  
ATOM   5597  H H    . ILE A 1 10 ? 4.724   9.970   -4.319  1.00 0.00 ? 10 ILE A H    8  
ATOM   5598  H HA   . ILE A 1 10 ? 5.202   8.761   -6.955  1.00 0.00 ? 10 ILE A HA   8  
ATOM   5599  H HB   . ILE A 1 10 ? 6.852   9.075   -4.455  1.00 0.00 ? 10 ILE A HB   8  
ATOM   5600  H HG12 . ILE A 1 10 ? 6.461   10.544  -6.896  1.00 0.00 ? 10 ILE A HG12 8  
ATOM   5601  H HG13 . ILE A 1 10 ? 7.493   10.952  -5.531  1.00 0.00 ? 10 ILE A HG13 8  
ATOM   5602  H HG21 . ILE A 1 10 ? 7.253   6.812   -5.438  1.00 0.00 ? 10 ILE A HG21 8  
ATOM   5603  H HG22 . ILE A 1 10 ? 8.662   7.861   -5.555  1.00 0.00 ? 10 ILE A HG22 8  
ATOM   5604  H HG23 . ILE A 1 10 ? 7.656   7.582   -6.973  1.00 0.00 ? 10 ILE A HG23 8  
ATOM   5605  H HD11 . ILE A 1 10 ? 9.262   9.449   -6.510  1.00 0.00 ? 10 ILE A HD11 8  
ATOM   5606  H HD12 . ILE A 1 10 ? 8.877   10.842  -7.519  1.00 0.00 ? 10 ILE A HD12 8  
ATOM   5607  H HD13 . ILE A 1 10 ? 8.237   9.251   -7.931  1.00 0.00 ? 10 ILE A HD13 8  
ATOM   5608  N N    . CYS A 1 11 ? 5.221   6.835   -4.292  1.00 0.00 ? 11 CYS A N    8  
ATOM   5609  C CA   . CYS A 1 11 ? 4.914   5.448   -3.831  1.00 0.00 ? 11 CYS A CA   8  
ATOM   5610  C C    . CYS A 1 11 ? 6.026   4.508   -4.296  1.00 0.00 ? 11 CYS A C    8  
ATOM   5611  O O    . CYS A 1 11 ? 6.547   4.639   -5.387  1.00 0.00 ? 11 CYS A O    8  
ATOM   5612  C CB   . CYS A 1 11 ? 3.581   4.982   -4.419  1.00 0.00 ? 11 CYS A CB   8  
ATOM   5613  S SG   . CYS A 1 11 ? 2.545   4.295   -3.102  1.00 0.00 ? 11 CYS A SG   8  
ATOM   5614  H H    . CYS A 1 11 ? 5.634   7.474   -3.679  1.00 0.00 ? 11 CYS A H    8  
ATOM   5615  H HA   . CYS A 1 11 ? 4.858   5.432   -2.753  1.00 0.00 ? 11 CYS A HA   8  
ATOM   5616  H HB2  . CYS A 1 11 ? 3.077   5.821   -4.875  1.00 0.00 ? 11 CYS A HB2  8  
ATOM   5617  H HB3  . CYS A 1 11 ? 3.763   4.224   -5.166  1.00 0.00 ? 11 CYS A HB3  8  
ATOM   5618  N N    . SER A 1 12 ? 6.400   3.561   -3.480  1.00 0.00 ? 12 SER A N    8  
ATOM   5619  C CA   . SER A 1 12 ? 7.481   2.620   -3.883  1.00 0.00 ? 12 SER A CA   8  
ATOM   5620  C C    . SER A 1 12 ? 6.906   1.210   -4.041  1.00 0.00 ? 12 SER A C    8  
ATOM   5621  O O    . SER A 1 12 ? 5.805   0.923   -3.614  1.00 0.00 ? 12 SER A O    8  
ATOM   5622  C CB   . SER A 1 12 ? 8.572   2.608   -2.812  1.00 0.00 ? 12 SER A CB   8  
ATOM   5623  O OG   . SER A 1 12 ? 7.975   2.424   -1.535  1.00 0.00 ? 12 SER A OG   8  
ATOM   5624  H H    . SER A 1 12 ? 5.971   3.471   -2.604  1.00 0.00 ? 12 SER A H    8  
ATOM   5625  H HA   . SER A 1 12 ? 7.904   2.943   -4.822  1.00 0.00 ? 12 SER A HA   8  
ATOM   5626  H HB2  . SER A 1 12 ? 9.256   1.798   -3.003  1.00 0.00 ? 12 SER A HB2  8  
ATOM   5627  H HB3  . SER A 1 12 ? 9.112   3.545   -2.838  1.00 0.00 ? 12 SER A HB3  8  
ATOM   5628  H HG   . SER A 1 12 ? 7.260   1.792   -1.630  1.00 0.00 ? 12 SER A HG   8  
ATOM   5629  N N    . LEU A 1 13 ? 7.652   0.327   -4.646  1.00 0.00 ? 13 LEU A N    8  
ATOM   5630  C CA   . LEU A 1 13 ? 7.155   -1.069  -4.828  1.00 0.00 ? 13 LEU A CA   8  
ATOM   5631  C C    . LEU A 1 13 ? 7.052   -1.737  -3.455  1.00 0.00 ? 13 LEU A C    8  
ATOM   5632  O O    . LEU A 1 13 ? 6.393   -2.746  -3.294  1.00 0.00 ? 13 LEU A O    8  
ATOM   5633  C CB   . LEU A 1 13 ? 8.125   -1.871  -5.708  1.00 0.00 ? 13 LEU A CB   8  
ATOM   5634  C CG   . LEU A 1 13 ? 8.896   -0.933  -6.640  1.00 0.00 ? 13 LEU A CG   8  
ATOM   5635  C CD1  . LEU A 1 13 ? 10.254  -0.596  -6.017  1.00 0.00 ? 13 LEU A CD1  8  
ATOM   5636  C CD2  . LEU A 1 13 ? 9.116   -1.622  -7.986  1.00 0.00 ? 13 LEU A CD2  8  
ATOM   5637  H H    . LEU A 1 13 ? 8.537   0.583   -4.973  1.00 0.00 ? 13 LEU A H    8  
ATOM   5638  H HA   . LEU A 1 13 ? 6.177   -1.048  -5.293  1.00 0.00 ? 13 LEU A HA   8  
ATOM   5639  H HB2  . LEU A 1 13 ? 8.823   -2.403  -5.078  1.00 0.00 ? 13 LEU A HB2  8  
ATOM   5640  H HB3  . LEU A 1 13 ? 7.566   -2.581  -6.299  1.00 0.00 ? 13 LEU A HB3  8  
ATOM   5641  H HG   . LEU A 1 13 ? 8.330   -0.024  -6.785  1.00 0.00 ? 13 LEU A HG   8  
ATOM   5642  H HD11 . LEU A 1 13 ? 10.231  -0.823  -4.962  1.00 0.00 ? 13 LEU A HD11 8  
ATOM   5643  H HD12 . LEU A 1 13 ? 10.463  0.454   -6.156  1.00 0.00 ? 13 LEU A HD12 8  
ATOM   5644  H HD13 . LEU A 1 13 ? 11.024  -1.184  -6.495  1.00 0.00 ? 13 LEU A HD13 8  
ATOM   5645  H HD21 . LEU A 1 13 ? 9.376   -0.883  -8.731  1.00 0.00 ? 13 LEU A HD21 8  
ATOM   5646  H HD22 . LEU A 1 13 ? 8.211   -2.131  -8.283  1.00 0.00 ? 13 LEU A HD22 8  
ATOM   5647  H HD23 . LEU A 1 13 ? 9.919   -2.339  -7.897  1.00 0.00 ? 13 LEU A HD23 8  
ATOM   5648  N N    . TYR A 1 14 ? 7.692   -1.177  -2.462  1.00 0.00 ? 14 TYR A N    8  
ATOM   5649  C CA   . TYR A 1 14 ? 7.619   -1.777  -1.103  1.00 0.00 ? 14 TYR A CA   8  
ATOM   5650  C C    . TYR A 1 14 ? 6.183   -1.678  -0.616  1.00 0.00 ? 14 TYR A C    8  
ATOM   5651  O O    . TYR A 1 14 ? 5.628   -2.610  -0.067  1.00 0.00 ? 14 TYR A O    8  
ATOM   5652  C CB   . TYR A 1 14 ? 8.547   -1.015  -0.152  1.00 0.00 ? 14 TYR A CB   8  
ATOM   5653  C CG   . TYR A 1 14 ? 9.996   -1.339  -0.474  1.00 0.00 ? 14 TYR A CG   8  
ATOM   5654  C CD1  . TYR A 1 14 ? 10.323  -2.076  -1.625  1.00 0.00 ? 14 TYR A CD1  8  
ATOM   5655  C CD2  . TYR A 1 14 ? 11.017  -0.897  0.381   1.00 0.00 ? 14 TYR A CD2  8  
ATOM   5656  C CE1  . TYR A 1 14 ? 11.661  -2.370  -1.916  1.00 0.00 ? 14 TYR A CE1  8  
ATOM   5657  C CE2  . TYR A 1 14 ? 12.356  -1.192  0.088   1.00 0.00 ? 14 TYR A CE2  8  
ATOM   5658  C CZ   . TYR A 1 14 ? 12.677  -1.928  -1.059  1.00 0.00 ? 14 TYR A CZ   8  
ATOM   5659  O OH   . TYR A 1 14 ? 13.995  -2.217  -1.346  1.00 0.00 ? 14 TYR A OH   8  
ATOM   5660  H H    . TYR A 1 14 ? 8.208   -0.360  -2.609  1.00 0.00 ? 14 TYR A H    8  
ATOM   5661  H HA   . TYR A 1 14 ? 7.912   -2.809  -1.150  1.00 0.00 ? 14 TYR A HA   8  
ATOM   5662  H HB2  . TYR A 1 14 ? 8.380   0.048   -0.266  1.00 0.00 ? 14 TYR A HB2  8  
ATOM   5663  H HB3  . TYR A 1 14 ? 8.331   -1.303  0.866   1.00 0.00 ? 14 TYR A HB3  8  
ATOM   5664  H HD1  . TYR A 1 14 ? 9.542   -2.420  -2.287  1.00 0.00 ? 14 TYR A HD1  8  
ATOM   5665  H HD2  . TYR A 1 14 ? 10.773  -0.331  1.266   1.00 0.00 ? 14 TYR A HD2  8  
ATOM   5666  H HE1  . TYR A 1 14 ? 11.910  -2.937  -2.800  1.00 0.00 ? 14 TYR A HE1  8  
ATOM   5667  H HE2  . TYR A 1 14 ? 13.139  -0.852  0.747   1.00 0.00 ? 14 TYR A HE2  8  
ATOM   5668  H HH   . TYR A 1 14 ? 14.042  -2.517  -2.257  1.00 0.00 ? 14 TYR A HH   8  
ATOM   5669  N N    . GLN A 1 15 ? 5.569   -0.558  -0.844  1.00 0.00 ? 15 GLN A N    8  
ATOM   5670  C CA   . GLN A 1 15 ? 4.154   -0.391  -0.430  1.00 0.00 ? 15 GLN A CA   8  
ATOM   5671  C C    . GLN A 1 15 ? 3.283   -1.187  -1.401  1.00 0.00 ? 15 GLN A C    8  
ATOM   5672  O O    . GLN A 1 15 ? 2.140   -1.495  -1.129  1.00 0.00 ? 15 GLN A O    8  
ATOM   5673  C CB   . GLN A 1 15 ? 3.775   1.090   -0.488  1.00 0.00 ? 15 GLN A CB   8  
ATOM   5674  C CG   . GLN A 1 15 ? 4.603   1.871   0.534   1.00 0.00 ? 15 GLN A CG   8  
ATOM   5675  C CD   . GLN A 1 15 ? 3.986   3.256   0.738   1.00 0.00 ? 15 GLN A CD   8  
ATOM   5676  O OE1  . GLN A 1 15 ? 4.146   4.133   -0.087  1.00 0.00 ? 15 GLN A OE1  8  
ATOM   5677  N NE2  . GLN A 1 15 ? 3.286   3.493   1.813   1.00 0.00 ? 15 GLN A NE2  8  
ATOM   5678  H H    . GLN A 1 15 ? 6.036   0.164   -1.308  1.00 0.00 ? 15 GLN A H    8  
ATOM   5679  H HA   . GLN A 1 15 ? 4.024   -0.766  0.572   1.00 0.00 ? 15 GLN A HA   8  
ATOM   5680  H HB2  . GLN A 1 15 ? 3.971   1.472   -1.479  1.00 0.00 ? 15 GLN A HB2  8  
ATOM   5681  H HB3  . GLN A 1 15 ? 2.725   1.201   -0.259  1.00 0.00 ? 15 GLN A HB3  8  
ATOM   5682  H HG2  . GLN A 1 15 ? 4.613   1.336   1.472   1.00 0.00 ? 15 GLN A HG2  8  
ATOM   5683  H HG3  . GLN A 1 15 ? 5.614   1.978   0.170   1.00 0.00 ? 15 GLN A HG3  8  
ATOM   5684  H HE21 . GLN A 1 15 ? 3.156   2.787   2.480   1.00 0.00 ? 15 GLN A HE21 8  
ATOM   5685  H HE22 . GLN A 1 15 ? 2.886   4.378   1.952   1.00 0.00 ? 15 GLN A HE22 8  
ATOM   5686  N N    . LEU A 1 16 ? 3.833   -1.526  -2.538  1.00 0.00 ? 16 LEU A N    8  
ATOM   5687  C CA   . LEU A 1 16 ? 3.072   -2.305  -3.547  1.00 0.00 ? 16 LEU A CA   8  
ATOM   5688  C C    . LEU A 1 16 ? 2.926   -3.749  -3.068  1.00 0.00 ? 16 LEU A C    8  
ATOM   5689  O O    . LEU A 1 16 ? 1.961   -4.422  -3.371  1.00 0.00 ? 16 LEU A O    8  
ATOM   5690  C CB   . LEU A 1 16 ? 3.851   -2.284  -4.863  1.00 0.00 ? 16 LEU A CB   8  
ATOM   5691  C CG   . LEU A 1 16 ? 3.372   -1.121  -5.732  1.00 0.00 ? 16 LEU A CG   8  
ATOM   5692  C CD1  . LEU A 1 16 ? 4.081   -1.175  -7.087  1.00 0.00 ? 16 LEU A CD1  8  
ATOM   5693  C CD2  . LEU A 1 16 ? 1.862   -1.233  -5.944  1.00 0.00 ? 16 LEU A CD2  8  
ATOM   5694  H H    . LEU A 1 16 ? 4.757   -1.267  -2.728  1.00 0.00 ? 16 LEU A H    8  
ATOM   5695  H HA   . LEU A 1 16 ? 2.101   -1.868  -3.691  1.00 0.00 ? 16 LEU A HA   8  
ATOM   5696  H HB2  . LEU A 1 16 ? 4.900   -2.163  -4.650  1.00 0.00 ? 16 LEU A HB2  8  
ATOM   5697  H HB3  . LEU A 1 16 ? 3.701   -3.209  -5.386  1.00 0.00 ? 16 LEU A HB3  8  
ATOM   5698  H HG   . LEU A 1 16 ? 3.600   -0.186  -5.244  1.00 0.00 ? 16 LEU A HG   8  
ATOM   5699  H HD11 . LEU A 1 16 ? 3.489   -0.654  -7.825  1.00 0.00 ? 16 LEU A HD11 8  
ATOM   5700  H HD12 . LEU A 1 16 ? 4.205   -2.205  -7.388  1.00 0.00 ? 16 LEU A HD12 8  
ATOM   5701  H HD13 . LEU A 1 16 ? 5.049   -0.706  -7.005  1.00 0.00 ? 16 LEU A HD13 8  
ATOM   5702  H HD21 . LEU A 1 16 ? 1.494   -2.122  -5.454  1.00 0.00 ? 16 LEU A HD21 8  
ATOM   5703  H HD22 . LEU A 1 16 ? 1.651   -1.292  -7.002  1.00 0.00 ? 16 LEU A HD22 8  
ATOM   5704  H HD23 . LEU A 1 16 ? 1.375   -0.364  -5.529  1.00 0.00 ? 16 LEU A HD23 8  
ATOM   5705  N N    . GLU A 1 17 ? 3.882   -4.224  -2.323  1.00 0.00 ? 17 GLU A N    8  
ATOM   5706  C CA   . GLU A 1 17 ? 3.814   -5.625  -1.818  1.00 0.00 ? 17 GLU A CA   8  
ATOM   5707  C C    . GLU A 1 17 ? 2.655   -5.755  -0.832  1.00 0.00 ? 17 GLU A C    8  
ATOM   5708  O O    . GLU A 1 17 ? 2.110   -6.824  -0.635  1.00 0.00 ? 17 GLU A O    8  
ATOM   5709  C CB   . GLU A 1 17 ? 5.127   -5.980  -1.114  1.00 0.00 ? 17 GLU A CB   8  
ATOM   5710  C CG   . GLU A 1 17 ? 6.245   -6.107  -2.149  1.00 0.00 ? 17 GLU A CG   8  
ATOM   5711  C CD   . GLU A 1 17 ? 7.596   -5.860  -1.476  1.00 0.00 ? 17 GLU A CD   8  
ATOM   5712  O OE1  . GLU A 1 17 ? 8.024   -6.716  -0.718  1.00 0.00 ? 17 GLU A OE1  8  
ATOM   5713  O OE2  . GLU A 1 17 ? 8.181   -4.820  -1.728  1.00 0.00 ? 17 GLU A OE2  8  
ATOM   5714  H H    . GLU A 1 17 ? 4.647   -3.657  -2.098  1.00 0.00 ? 17 GLU A H    8  
ATOM   5715  H HA   . GLU A 1 17 ? 3.657   -6.296  -2.645  1.00 0.00 ? 17 GLU A HA   8  
ATOM   5716  H HB2  . GLU A 1 17 ? 5.377   -5.202  -0.405  1.00 0.00 ? 17 GLU A HB2  8  
ATOM   5717  H HB3  . GLU A 1 17 ? 5.014   -6.919  -0.592  1.00 0.00 ? 17 GLU A HB3  8  
ATOM   5718  H HG2  . GLU A 1 17 ? 6.229   -7.100  -2.575  1.00 0.00 ? 17 GLU A HG2  8  
ATOM   5719  H HG3  . GLU A 1 17 ? 6.097   -5.378  -2.932  1.00 0.00 ? 17 GLU A HG3  8  
ATOM   5720  N N    . ASN A 1 18 ? 2.272   -4.675  -0.216  1.00 0.00 ? 18 ASN A N    8  
ATOM   5721  C CA   . ASN A 1 18 ? 1.145   -4.728  0.755   1.00 0.00 ? 18 ASN A CA   8  
ATOM   5722  C C    . ASN A 1 18 ? -0.176  -4.871  -0.005  1.00 0.00 ? 18 ASN A C    8  
ATOM   5723  O O    . ASN A 1 18 ? -1.236  -4.959  0.585   1.00 0.00 ? 18 ASN A O    8  
ATOM   5724  C CB   . ASN A 1 18 ? 1.126   -3.440  1.579   1.00 0.00 ? 18 ASN A CB   8  
ATOM   5725  C CG   . ASN A 1 18 ? 1.773   -3.693  2.942   1.00 0.00 ? 18 ASN A CG   8  
ATOM   5726  O OD1  . ASN A 1 18 ? 2.936   -4.034  3.023   1.00 0.00 ? 18 ASN A OD1  8  
ATOM   5727  N ND2  . ASN A 1 18 ? 1.061   -3.541  4.026   1.00 0.00 ? 18 ASN A ND2  8  
ATOM   5728  H H    . ASN A 1 18 ? 2.722   -3.825  -0.397  1.00 0.00 ? 18 ASN A H    8  
ATOM   5729  H HA   . ASN A 1 18 ? 1.276   -5.575  1.413   1.00 0.00 ? 18 ASN A HA   8  
ATOM   5730  H HB2  . ASN A 1 18 ? 1.678   -2.672  1.056   1.00 0.00 ? 18 ASN A HB2  8  
ATOM   5731  H HB3  . ASN A 1 18 ? 0.107   -3.118  1.719   1.00 0.00 ? 18 ASN A HB3  8  
ATOM   5732  H HD21 . ASN A 1 18 ? 0.122   -3.267  3.962   1.00 0.00 ? 18 ASN A HD21 8  
ATOM   5733  H HD22 . ASN A 1 18 ? 1.466   -3.698  4.905   1.00 0.00 ? 18 ASN A HD22 8  
ATOM   5734  N N    . TYR A 1 19 ? -0.124  -4.894  -1.309  1.00 0.00 ? 19 TYR A N    8  
ATOM   5735  C CA   . TYR A 1 19 ? -1.368  -5.029  -2.105  1.00 0.00 ? 19 TYR A CA   8  
ATOM   5736  C C    . TYR A 1 19 ? -1.260  -6.262  -3.005  1.00 0.00 ? 19 TYR A C    8  
ATOM   5737  O O    . TYR A 1 19 ? -1.802  -6.300  -4.092  1.00 0.00 ? 19 TYR A O    8  
ATOM   5738  C CB   . TYR A 1 19 ? -1.543  -3.779  -2.967  1.00 0.00 ? 19 TYR A CB   8  
ATOM   5739  C CG   . TYR A 1 19 ? -1.522  -2.556  -2.083  1.00 0.00 ? 19 TYR A CG   8  
ATOM   5740  C CD1  . TYR A 1 19 ? -2.412  -2.455  -1.006  1.00 0.00 ? 19 TYR A CD1  8  
ATOM   5741  C CD2  . TYR A 1 19 ? -0.610  -1.523  -2.337  1.00 0.00 ? 19 TYR A CD2  8  
ATOM   5742  C CE1  . TYR A 1 19 ? -2.391  -1.323  -0.182  1.00 0.00 ? 19 TYR A CE1  8  
ATOM   5743  C CE2  . TYR A 1 19 ? -0.588  -0.389  -1.513  1.00 0.00 ? 19 TYR A CE2  8  
ATOM   5744  C CZ   . TYR A 1 19 ? -1.479  -0.290  -0.436  1.00 0.00 ? 19 TYR A CZ   8  
ATOM   5745  O OH   . TYR A 1 19 ? -1.459  0.826   0.376   1.00 0.00 ? 19 TYR A OH   8  
ATOM   5746  H H    . TYR A 1 19 ? 0.737   -4.821  -1.767  1.00 0.00 ? 19 TYR A H    8  
ATOM   5747  H HA   . TYR A 1 19 ? -2.215  -5.135  -1.443  1.00 0.00 ? 19 TYR A HA   8  
ATOM   5748  H HB2  . TYR A 1 19 ? -0.738  -3.720  -3.684  1.00 0.00 ? 19 TYR A HB2  8  
ATOM   5749  H HB3  . TYR A 1 19 ? -2.484  -3.832  -3.486  1.00 0.00 ? 19 TYR A HB3  8  
ATOM   5750  H HD1  . TYR A 1 19 ? -3.114  -3.252  -0.809  1.00 0.00 ? 19 TYR A HD1  8  
ATOM   5751  H HD2  . TYR A 1 19 ? 0.076   -1.600  -3.167  1.00 0.00 ? 19 TYR A HD2  8  
ATOM   5752  H HE1  . TYR A 1 19 ? -3.078  -1.245  0.648   1.00 0.00 ? 19 TYR A HE1  8  
ATOM   5753  H HE2  . TYR A 1 19 ? 0.114   0.407   -1.709  1.00 0.00 ? 19 TYR A HE2  8  
ATOM   5754  H HH   . TYR A 1 19 ? -1.906  0.604   1.197   1.00 0.00 ? 19 TYR A HH   8  
ATOM   5755  N N    . CYS A 1 20 ? -0.560  -7.270  -2.560  1.00 0.00 ? 20 CYS A N    8  
ATOM   5756  C CA   . CYS A 1 20 ? -0.414  -8.499  -3.388  1.00 0.00 ? 20 CYS A CA   8  
ATOM   5757  C C    . CYS A 1 20 ? -1.577  -9.452  -3.104  1.00 0.00 ? 20 CYS A C    8  
ATOM   5758  O O    . CYS A 1 20 ? -2.639  -9.339  -3.681  1.00 0.00 ? 20 CYS A O    8  
ATOM   5759  C CB   . CYS A 1 20 ? 0.912   -9.186  -3.052  1.00 0.00 ? 20 CYS A CB   8  
ATOM   5760  S SG   . CYS A 1 20 ? 2.251   -8.410  -3.991  1.00 0.00 ? 20 CYS A SG   8  
ATOM   5761  H H    . CYS A 1 20 ? -0.130  -7.219  -1.680  1.00 0.00 ? 20 CYS A H    8  
ATOM   5762  H HA   . CYS A 1 20 ? -0.423  -8.231  -4.431  1.00 0.00 ? 20 CYS A HA   8  
ATOM   5763  H HB2  . CYS A 1 20 ? 1.110   -9.089  -1.995  1.00 0.00 ? 20 CYS A HB2  8  
ATOM   5764  H HB3  . CYS A 1 20 ? 0.851   -10.232 -3.312  1.00 0.00 ? 20 CYS A HB3  8  
ATOM   5765  N N    . ASN A 1 21 ? -1.386  -10.391 -2.220  1.00 0.00 ? 21 ASN A N    8  
ATOM   5766  C CA   . ASN A 1 21 ? -2.480  -11.350 -1.901  1.00 0.00 ? 21 ASN A CA   8  
ATOM   5767  C C    . ASN A 1 21 ? -2.596  -11.503 -0.383  1.00 0.00 ? 21 ASN A C    8  
ATOM   5768  O O    . ASN A 1 21 ? -1.567  -11.521 0.271   1.00 0.00 ? 21 ASN A O    8  
ATOM   5769  C CB   . ASN A 1 21 ? -2.166  -12.709 -2.529  1.00 0.00 ? 21 ASN A CB   8  
ATOM   5770  C CG   . ASN A 1 21 ? -2.904  -12.841 -3.862  1.00 0.00 ? 21 ASN A CG   8  
ATOM   5771  O OD1  . ASN A 1 21 ? -3.924  -13.496 -3.943  1.00 0.00 ? 21 ASN A OD1  8  
ATOM   5772  N ND2  . ASN A 1 21 ? -2.429  -12.241 -4.918  1.00 0.00 ? 21 ASN A ND2  8  
ATOM   5773  O OXT  . ASN A 1 21 ? -3.712  -11.601 0.098   1.00 0.00 ? 21 ASN A OXT  8  
ATOM   5774  H H    . ASN A 1 21 ? -0.522  -10.465 -1.767  1.00 0.00 ? 21 ASN A H    8  
ATOM   5775  H HA   . ASN A 1 21 ? -3.413  -10.976 -2.298  1.00 0.00 ? 21 ASN A HA   8  
ATOM   5776  H HB2  . ASN A 1 21 ? -1.101  -12.790 -2.696  1.00 0.00 ? 21 ASN A HB2  8  
ATOM   5777  H HB3  . ASN A 1 21 ? -2.487  -13.496 -1.863  1.00 0.00 ? 21 ASN A HB3  8  
ATOM   5778  H HD21 . ASN A 1 21 ? -1.606  -11.712 -4.854  1.00 0.00 ? 21 ASN A HD21 8  
ATOM   5779  H HD22 . ASN A 1 21 ? -2.894  -12.318 -5.778  1.00 0.00 ? 21 ASN A HD22 8  
ATOM   5780  N N    . PHE B 2 1  ? 17.068  1.457   -5.504  1.00 0.00 ? 1  PHE B N    8  
ATOM   5781  C CA   . PHE B 2 1  ? 15.846  1.552   -6.350  1.00 0.00 ? 1  PHE B CA   8  
ATOM   5782  C C    . PHE B 2 1  ? 15.636  3.004   -6.788  1.00 0.00 ? 1  PHE B C    8  
ATOM   5783  O O    . PHE B 2 1  ? 16.542  3.814   -6.739  1.00 0.00 ? 1  PHE B O    8  
ATOM   5784  C CB   . PHE B 2 1  ? 14.630  1.081   -5.549  1.00 0.00 ? 1  PHE B CB   8  
ATOM   5785  C CG   . PHE B 2 1  ? 14.033  -0.139  -6.218  1.00 0.00 ? 1  PHE B CG   8  
ATOM   5786  C CD1  . PHE B 2 1  ? 13.822  -0.146  -7.605  1.00 0.00 ? 1  PHE B CD1  8  
ATOM   5787  C CD2  . PHE B 2 1  ? 13.691  -1.266  -5.454  1.00 0.00 ? 1  PHE B CD2  8  
ATOM   5788  C CE1  . PHE B 2 1  ? 13.272  -1.276  -8.224  1.00 0.00 ? 1  PHE B CE1  8  
ATOM   5789  C CE2  . PHE B 2 1  ? 13.142  -2.395  -6.076  1.00 0.00 ? 1  PHE B CE2  8  
ATOM   5790  C CZ   . PHE B 2 1  ? 12.932  -2.399  -7.461  1.00 0.00 ? 1  PHE B CZ   8  
ATOM   5791  H H1   . PHE B 2 1  ? 17.091  2.251   -4.833  1.00 0.00 ? 1  PHE B H1   8  
ATOM   5792  H H2   . PHE B 2 1  ? 17.914  1.489   -6.110  1.00 0.00 ? 1  PHE B H2   8  
ATOM   5793  H H3   . PHE B 2 1  ? 17.055  0.561   -4.975  1.00 0.00 ? 1  PHE B H3   8  
ATOM   5794  H HA   . PHE B 2 1  ? 15.964  0.928   -7.224  1.00 0.00 ? 1  PHE B HA   8  
ATOM   5795  H HB2  . PHE B 2 1  ? 14.940  0.830   -4.542  1.00 0.00 ? 1  PHE B HB2  8  
ATOM   5796  H HB3  . PHE B 2 1  ? 13.894  1.871   -5.512  1.00 0.00 ? 1  PHE B HB3  8  
ATOM   5797  H HD1  . PHE B 2 1  ? 14.083  0.717   -8.196  1.00 0.00 ? 1  PHE B HD1  8  
ATOM   5798  H HD2  . PHE B 2 1  ? 13.852  -1.266  -4.387  1.00 0.00 ? 1  PHE B HD2  8  
ATOM   5799  H HE1  . PHE B 2 1  ? 13.111  -1.280  -9.292  1.00 0.00 ? 1  PHE B HE1  8  
ATOM   5800  H HE2  . PHE B 2 1  ? 12.880  -3.262  -5.488  1.00 0.00 ? 1  PHE B HE2  8  
ATOM   5801  H HZ   . PHE B 2 1  ? 12.508  -3.269  -7.940  1.00 0.00 ? 1  PHE B HZ   8  
ATOM   5802  N N    . VAL B 2 2  ? 14.450  3.340   -7.220  1.00 0.00 ? 2  VAL B N    8  
ATOM   5803  C CA   . VAL B 2 2  ? 14.187  4.738   -7.663  1.00 0.00 ? 2  VAL B CA   8  
ATOM   5804  C C    . VAL B 2 2  ? 12.766  5.146   -7.260  1.00 0.00 ? 2  VAL B C    8  
ATOM   5805  O O    . VAL B 2 2  ? 11.891  4.317   -7.110  1.00 0.00 ? 2  VAL B O    8  
ATOM   5806  C CB   . VAL B 2 2  ? 14.329  4.823   -9.183  1.00 0.00 ? 2  VAL B CB   8  
ATOM   5807  C CG1  . VAL B 2 2  ? 13.493  3.723   -9.836  1.00 0.00 ? 2  VAL B CG1  8  
ATOM   5808  C CG2  . VAL B 2 2  ? 13.838  6.190   -9.665  1.00 0.00 ? 2  VAL B CG2  8  
ATOM   5809  H H    . VAL B 2 2  ? 13.735  2.672   -7.254  1.00 0.00 ? 2  VAL B H    8  
ATOM   5810  H HA   . VAL B 2 2  ? 14.898  5.404   -7.197  1.00 0.00 ? 2  VAL B HA   8  
ATOM   5811  H HB   . VAL B 2 2  ? 15.367  4.695   -9.454  1.00 0.00 ? 2  VAL B HB   8  
ATOM   5812  H HG11 . VAL B 2 2  ? 13.336  3.961   -10.877 1.00 0.00 ? 2  VAL B HG11 8  
ATOM   5813  H HG12 . VAL B 2 2  ? 12.539  3.651   -9.335  1.00 0.00 ? 2  VAL B HG12 8  
ATOM   5814  H HG13 . VAL B 2 2  ? 14.014  2.780   -9.757  1.00 0.00 ? 2  VAL B HG13 8  
ATOM   5815  H HG21 . VAL B 2 2  ? 14.306  6.428   -10.610 1.00 0.00 ? 2  VAL B HG21 8  
ATOM   5816  H HG22 . VAL B 2 2  ? 14.094  6.943   -8.936  1.00 0.00 ? 2  VAL B HG22 8  
ATOM   5817  H HG23 . VAL B 2 2  ? 12.765  6.162   -9.793  1.00 0.00 ? 2  VAL B HG23 8  
ATOM   5818  N N    . ASN B 2 3  ? 12.533  6.419   -7.087  1.00 0.00 ? 3  ASN B N    8  
ATOM   5819  C CA   . ASN B 2 3  ? 11.174  6.886   -6.699  1.00 0.00 ? 3  ASN B CA   8  
ATOM   5820  C C    . ASN B 2 3  ? 10.342  7.111   -7.965  1.00 0.00 ? 3  ASN B C    8  
ATOM   5821  O O    . ASN B 2 3  ? 10.383  8.167   -8.565  1.00 0.00 ? 3  ASN B O    8  
ATOM   5822  C CB   . ASN B 2 3  ? 11.300  8.198   -5.920  1.00 0.00 ? 3  ASN B CB   8  
ATOM   5823  C CG   . ASN B 2 3  ? 12.524  8.131   -5.004  1.00 0.00 ? 3  ASN B CG   8  
ATOM   5824  O OD1  . ASN B 2 3  ? 12.963  7.060   -4.636  1.00 0.00 ? 3  ASN B OD1  8  
ATOM   5825  N ND2  . ASN B 2 3  ? 13.099  9.238   -4.620  1.00 0.00 ? 3  ASN B ND2  8  
ATOM   5826  H H    . ASN B 2 3  ? 13.252  7.070   -7.216  1.00 0.00 ? 3  ASN B H    8  
ATOM   5827  H HA   . ASN B 2 3  ? 10.697  6.141   -6.079  1.00 0.00 ? 3  ASN B HA   8  
ATOM   5828  H HB2  . ASN B 2 3  ? 11.413  9.019   -6.614  1.00 0.00 ? 3  ASN B HB2  8  
ATOM   5829  H HB3  . ASN B 2 3  ? 10.416  8.352   -5.323  1.00 0.00 ? 3  ASN B HB3  8  
ATOM   5830  H HD21 . ASN B 2 3  ? 12.746  10.103  -4.918  1.00 0.00 ? 3  ASN B HD21 8  
ATOM   5831  H HD22 . ASN B 2 3  ? 13.883  9.205   -4.033  1.00 0.00 ? 3  ASN B HD22 8  
ATOM   5832  N N    . GLN B 2 4  ? 9.599   6.123   -8.382  1.00 0.00 ? 4  GLN B N    8  
ATOM   5833  C CA   . GLN B 2 4  ? 8.780   6.274   -9.616  1.00 0.00 ? 4  GLN B CA   8  
ATOM   5834  C C    . GLN B 2 4  ? 7.325   6.572   -9.254  1.00 0.00 ? 4  GLN B C    8  
ATOM   5835  O O    . GLN B 2 4  ? 6.820   6.132   -8.240  1.00 0.00 ? 4  GLN B O    8  
ATOM   5836  C CB   . GLN B 2 4  ? 8.842   4.978   -10.421 1.00 0.00 ? 4  GLN B CB   8  
ATOM   5837  C CG   . GLN B 2 4  ? 9.846   5.133   -11.564 1.00 0.00 ? 4  GLN B CG   8  
ATOM   5838  C CD   . GLN B 2 4  ? 9.502   4.145   -12.680 1.00 0.00 ? 4  GLN B CD   8  
ATOM   5839  O OE1  . GLN B 2 4  ? 10.214  3.184   -12.896 1.00 0.00 ? 4  GLN B OE1  8  
ATOM   5840  N NE2  . GLN B 2 4  ? 8.432   4.340   -13.401 1.00 0.00 ? 4  GLN B NE2  8  
ATOM   5841  H H    . GLN B 2 4  ? 9.588   5.275   -7.890  1.00 0.00 ? 4  GLN B H    8  
ATOM   5842  H HA   . GLN B 2 4  ? 9.175   7.084   -10.211 1.00 0.00 ? 4  GLN B HA   8  
ATOM   5843  H HB2  . GLN B 2 4  ? 9.151   4.169   -9.775  1.00 0.00 ? 4  GLN B HB2  8  
ATOM   5844  H HB3  . GLN B 2 4  ? 7.868   4.761   -10.827 1.00 0.00 ? 4  GLN B HB3  8  
ATOM   5845  H HG2  . GLN B 2 4  ? 9.800   6.142   -11.947 1.00 0.00 ? 4  GLN B HG2  8  
ATOM   5846  H HG3  . GLN B 2 4  ? 10.841  4.930   -11.199 1.00 0.00 ? 4  GLN B HG3  8  
ATOM   5847  H HE21 . GLN B 2 4  ? 7.858   5.115   -13.226 1.00 0.00 ? 4  GLN B HE21 8  
ATOM   5848  H HE22 . GLN B 2 4  ? 8.203   3.712   -14.117 1.00 0.00 ? 4  GLN B HE22 8  
ATOM   5849  N N    . HIS B 2 5  ? 6.646   7.310   -10.088 1.00 0.00 ? 5  HIS B N    8  
ATOM   5850  C CA   . HIS B 2 5  ? 5.220   7.640   -9.816  1.00 0.00 ? 5  HIS B CA   8  
ATOM   5851  C C    . HIS B 2 5  ? 4.337   6.492   -10.320 1.00 0.00 ? 5  HIS B C    8  
ATOM   5852  O O    . HIS B 2 5  ? 4.563   5.947   -11.383 1.00 0.00 ? 5  HIS B O    8  
ATOM   5853  C CB   . HIS B 2 5  ? 4.862   8.933   -10.551 1.00 0.00 ? 5  HIS B CB   8  
ATOM   5854  C CG   . HIS B 2 5  ? 3.628   9.540   -9.947  1.00 0.00 ? 5  HIS B CG   8  
ATOM   5855  N ND1  . HIS B 2 5  ? 2.503   8.785   -9.696  1.00 0.00 ? 5  HIS B ND1  8  
ATOM   5856  C CD2  . HIS B 2 5  ? 3.356   10.823  -9.557  1.00 0.00 ? 5  HIS B CD2  8  
ATOM   5857  C CE1  . HIS B 2 5  ? 1.592   9.617   -9.172  1.00 0.00 ? 5  HIS B CE1  8  
ATOM   5858  N NE2  . HIS B 2 5  ? 2.068   10.874  -9.069  1.00 0.00 ? 5  HIS B NE2  8  
ATOM   5859  H H    . HIS B 2 5  ? 7.076   7.646   -10.902 1.00 0.00 ? 5  HIS B H    8  
ATOM   5860  H HA   . HIS B 2 5  ? 5.073   7.772   -8.755  1.00 0.00 ? 5  HIS B HA   8  
ATOM   5861  H HB2  . HIS B 2 5  ? 5.683   9.631   -10.466 1.00 0.00 ? 5  HIS B HB2  8  
ATOM   5862  H HB3  . HIS B 2 5  ? 4.683   8.717   -11.592 1.00 0.00 ? 5  HIS B HB3  8  
ATOM   5863  H HD2  . HIS B 2 5  ? 4.036   11.658  -9.623  1.00 0.00 ? 5  HIS B HD2  8  
ATOM   5864  H HE1  . HIS B 2 5  ? 0.600   9.319   -8.874  1.00 0.00 ? 5  HIS B HE1  8  
ATOM   5865  H HE2  . HIS B 2 5  ? 1.597   11.659  -8.721  1.00 0.00 ? 5  HIS B HE2  8  
ATOM   5866  N N    . LEU B 2 6  ? 3.338   6.112   -9.567  1.00 0.00 ? 6  LEU B N    8  
ATOM   5867  C CA   . LEU B 2 6  ? 2.458   4.991   -10.012 1.00 0.00 ? 6  LEU B CA   8  
ATOM   5868  C C    . LEU B 2 6  ? 1.007   5.469   -10.099 1.00 0.00 ? 6  LEU B C    8  
ATOM   5869  O O    . LEU B 2 6  ? 0.519   6.146   -9.221  1.00 0.00 ? 6  LEU B O    8  
ATOM   5870  C CB   . LEU B 2 6  ? 2.547   3.846   -8.999  1.00 0.00 ? 6  LEU B CB   8  
ATOM   5871  C CG   . LEU B 2 6  ? 3.796   3.011   -9.271  1.00 0.00 ? 6  LEU B CG   8  
ATOM   5872  C CD1  . LEU B 2 6  ? 3.659   2.318   -10.626 1.00 0.00 ? 6  LEU B CD1  8  
ATOM   5873  C CD2  . LEU B 2 6  ? 5.021   3.924   -9.287  1.00 0.00 ? 6  LEU B CD2  8  
ATOM   5874  H H    . LEU B 2 6  ? 3.174   6.556   -8.709  1.00 0.00 ? 6  LEU B H    8  
ATOM   5875  H HA   . LEU B 2 6  ? 2.783   4.641   -10.979 1.00 0.00 ? 6  LEU B HA   8  
ATOM   5876  H HB2  . LEU B 2 6  ? 2.596   4.252   -7.999  1.00 0.00 ? 6  LEU B HB2  8  
ATOM   5877  H HB3  . LEU B 2 6  ? 1.675   3.220   -9.092  1.00 0.00 ? 6  LEU B HB3  8  
ATOM   5878  H HG   . LEU B 2 6  ? 3.908   2.267   -8.496  1.00 0.00 ? 6  LEU B HG   8  
ATOM   5879  H HD11 . LEU B 2 6  ? 3.396   1.281   -10.475 1.00 0.00 ? 6  LEU B HD11 8  
ATOM   5880  H HD12 . LEU B 2 6  ? 4.595   2.378   -11.159 1.00 0.00 ? 6  LEU B HD12 8  
ATOM   5881  H HD13 . LEU B 2 6  ? 2.885   2.805   -11.199 1.00 0.00 ? 6  LEU B HD13 8  
ATOM   5882  H HD21 . LEU B 2 6  ? 4.843   4.773   -8.645  1.00 0.00 ? 6  LEU B HD21 8  
ATOM   5883  H HD22 . LEU B 2 6  ? 5.203   4.265   -10.295 1.00 0.00 ? 6  LEU B HD22 8  
ATOM   5884  H HD23 . LEU B 2 6  ? 5.881   3.377   -8.931  1.00 0.00 ? 6  LEU B HD23 8  
ATOM   5885  N N    . CYS B 2 7  ? 0.309   5.115   -11.148 1.00 0.00 ? 7  CYS B N    8  
ATOM   5886  C CA   . CYS B 2 7  ? -1.113  5.550   -11.276 1.00 0.00 ? 7  CYS B CA   8  
ATOM   5887  C C    . CYS B 2 7  ? -1.935  4.443   -11.967 1.00 0.00 ? 7  CYS B C    8  
ATOM   5888  O O    . CYS B 2 7  ? -2.238  3.429   -11.373 1.00 0.00 ? 7  CYS B O    8  
ATOM   5889  C CB   . CYS B 2 7  ? -1.179  6.849   -12.091 1.00 0.00 ? 7  CYS B CB   8  
ATOM   5890  S SG   . CYS B 2 7  ? -1.051  8.279   -10.993 1.00 0.00 ? 7  CYS B SG   8  
ATOM   5891  H H    . CYS B 2 7  ? 0.718   4.560   -11.845 1.00 0.00 ? 7  CYS B H    8  
ATOM   5892  H HA   . CYS B 2 7  ? -1.518  5.725   -10.287 1.00 0.00 ? 7  CYS B HA   8  
ATOM   5893  H HB2  . CYS B 2 7  ? -0.359  6.874   -12.790 1.00 0.00 ? 7  CYS B HB2  8  
ATOM   5894  H HB3  . CYS B 2 7  ? -2.114  6.894   -12.628 1.00 0.00 ? 7  CYS B HB3  8  
ATOM   5895  N N    . GLY B 2 8  ? -2.302  4.618   -13.213 1.00 0.00 ? 8  GLY B N    8  
ATOM   5896  C CA   . GLY B 2 8  ? -3.101  3.567   -13.903 1.00 0.00 ? 8  GLY B CA   8  
ATOM   5897  C C    . GLY B 2 8  ? -2.208  2.369   -14.220 1.00 0.00 ? 8  GLY B C    8  
ATOM   5898  O O    . GLY B 2 8  ? -1.617  1.774   -13.341 1.00 0.00 ? 8  GLY B O    8  
ATOM   5899  H H    . GLY B 2 8  ? -2.060  5.431   -13.694 1.00 0.00 ? 8  GLY B H    8  
ATOM   5900  H HA2  . GLY B 2 8  ? -3.913  3.252   -13.262 1.00 0.00 ? 8  GLY B HA2  8  
ATOM   5901  H HA3  . GLY B 2 8  ? -3.501  3.965   -14.823 1.00 0.00 ? 8  GLY B HA3  8  
ATOM   5902  N N    . SER B 2 9  ? -2.103  2.011   -15.471 1.00 0.00 ? 9  SER B N    8  
ATOM   5903  C CA   . SER B 2 9  ? -1.248  0.851   -15.847 1.00 0.00 ? 9  SER B CA   8  
ATOM   5904  C C    . SER B 2 9  ? 0.066   0.918   -15.070 1.00 0.00 ? 9  SER B C    8  
ATOM   5905  O O    . SER B 2 9  ? 0.624   -0.090  -14.685 1.00 0.00 ? 9  SER B O    8  
ATOM   5906  C CB   . SER B 2 9  ? -0.958  0.896   -17.347 1.00 0.00 ? 9  SER B CB   8  
ATOM   5907  O OG   . SER B 2 9  ? -1.301  -0.355  -17.928 1.00 0.00 ? 9  SER B OG   8  
ATOM   5908  H H    . SER B 2 9  ? -2.590  2.504   -16.164 1.00 0.00 ? 9  SER B H    8  
ATOM   5909  H HA   . SER B 2 9  ? -1.762  -0.069  -15.607 1.00 0.00 ? 9  SER B HA   8  
ATOM   5910  H HB2  . SER B 2 9  ? -1.547  1.673   -17.806 1.00 0.00 ? 9  SER B HB2  8  
ATOM   5911  H HB3  . SER B 2 9  ? 0.092   1.103   -17.504 1.00 0.00 ? 9  SER B HB3  8  
ATOM   5912  H HG   . SER B 2 9  ? -1.021  -0.342  -18.847 1.00 0.00 ? 9  SER B HG   8  
ATOM   5913  N N    . ASP B 2 10 ? 0.562   2.101   -14.831 1.00 0.00 ? 10 ASP B N    8  
ATOM   5914  C CA   . ASP B 2 10 ? 1.836   2.230   -14.074 1.00 0.00 ? 10 ASP B CA   8  
ATOM   5915  C C    . ASP B 2 10 ? 1.691   1.533   -12.720 1.00 0.00 ? 10 ASP B C    8  
ATOM   5916  O O    . ASP B 2 10 ? 2.481   0.680   -12.365 1.00 0.00 ? 10 ASP B O    8  
ATOM   5917  C CB   . ASP B 2 10 ? 2.155   3.710   -13.858 1.00 0.00 ? 10 ASP B CB   8  
ATOM   5918  C CG   . ASP B 2 10 ? 2.759   4.292   -15.138 1.00 0.00 ? 10 ASP B CG   8  
ATOM   5919  O OD1  . ASP B 2 10 ? 3.535   3.596   -15.773 1.00 0.00 ? 10 ASP B OD1  8  
ATOM   5920  O OD2  . ASP B 2 10 ? 2.435   5.422   -15.462 1.00 0.00 ? 10 ASP B OD2  8  
ATOM   5921  H H    . ASP B 2 10 ? 0.095   2.902   -15.146 1.00 0.00 ? 10 ASP B H    8  
ATOM   5922  H HA   . ASP B 2 10 ? 2.636   1.767   -14.632 1.00 0.00 ? 10 ASP B HA   8  
ATOM   5923  H HB2  . ASP B 2 10 ? 1.248   4.243   -13.613 1.00 0.00 ? 10 ASP B HB2  8  
ATOM   5924  H HB3  . ASP B 2 10 ? 2.864   3.812   -13.050 1.00 0.00 ? 10 ASP B HB3  8  
ATOM   5925  N N    . LEU B 2 11 ? 0.690   1.885   -11.958 1.00 0.00 ? 11 LEU B N    8  
ATOM   5926  C CA   . LEU B 2 11 ? 0.508   1.235   -10.629 1.00 0.00 ? 11 LEU B CA   8  
ATOM   5927  C C    . LEU B 2 11 ? 0.041   -0.209  -10.840 1.00 0.00 ? 11 LEU B C    8  
ATOM   5928  O O    . LEU B 2 11 ? 0.318   -1.088  -10.047 1.00 0.00 ? 11 LEU B O    8  
ATOM   5929  C CB   . LEU B 2 11 ? -0.547  2.011   -9.818  1.00 0.00 ? 11 LEU B CB   8  
ATOM   5930  C CG   . LEU B 2 11 ? -0.199  2.088   -8.312  1.00 0.00 ? 11 LEU B CG   8  
ATOM   5931  C CD1  . LEU B 2 11 ? -1.449  1.783   -7.489  1.00 0.00 ? 11 LEU B CD1  8  
ATOM   5932  C CD2  . LEU B 2 11 ? 0.890   1.081   -7.932  1.00 0.00 ? 11 LEU B CD2  8  
ATOM   5933  H H    . LEU B 2 11 ? 0.062   2.575   -12.258 1.00 0.00 ? 11 LEU B H    8  
ATOM   5934  H HA   . LEU B 2 11 ? 1.450   1.237   -10.106 1.00 0.00 ? 11 LEU B HA   8  
ATOM   5935  H HB2  . LEU B 2 11 ? -0.610  3.013   -10.208 1.00 0.00 ? 11 LEU B HB2  8  
ATOM   5936  H HB3  . LEU B 2 11 ? -1.507  1.529   -9.933  1.00 0.00 ? 11 LEU B HB3  8  
ATOM   5937  H HG   . LEU B 2 11 ? 0.139   3.088   -8.079  1.00 0.00 ? 11 LEU B HG   8  
ATOM   5938  H HD11 . LEU B 2 11 ? -2.328  2.032   -8.063  1.00 0.00 ? 11 LEU B HD11 8  
ATOM   5939  H HD12 . LEU B 2 11 ? -1.432  2.368   -6.581  1.00 0.00 ? 11 LEU B HD12 8  
ATOM   5940  H HD13 . LEU B 2 11 ? -1.467  0.733   -7.239  1.00 0.00 ? 11 LEU B HD13 8  
ATOM   5941  H HD21 . LEU B 2 11 ? 0.666   0.126   -8.378  1.00 0.00 ? 11 LEU B HD21 8  
ATOM   5942  H HD22 . LEU B 2 11 ? 0.926   0.980   -6.858  1.00 0.00 ? 11 LEU B HD22 8  
ATOM   5943  H HD23 . LEU B 2 11 ? 1.846   1.433   -8.292  1.00 0.00 ? 11 LEU B HD23 8  
ATOM   5944  N N    . VAL B 2 12 ? -0.661  -0.462  -11.913 1.00 0.00 ? 12 VAL B N    8  
ATOM   5945  C CA   . VAL B 2 12 ? -1.138  -1.847  -12.181 1.00 0.00 ? 12 VAL B CA   8  
ATOM   5946  C C    . VAL B 2 12 ? 0.041   -2.697  -12.659 1.00 0.00 ? 12 VAL B C    8  
ATOM   5947  O O    . VAL B 2 12 ? 0.447   -3.634  -12.000 1.00 0.00 ? 12 VAL B O    8  
ATOM   5948  C CB   . VAL B 2 12 ? -2.231  -1.805  -13.258 1.00 0.00 ? 12 VAL B CB   8  
ATOM   5949  C CG1  . VAL B 2 12 ? -2.383  -3.183  -13.912 1.00 0.00 ? 12 VAL B CG1  8  
ATOM   5950  C CG2  . VAL B 2 12 ? -3.559  -1.406  -12.615 1.00 0.00 ? 12 VAL B CG2  8  
ATOM   5951  H H    . VAL B 2 12 ? -0.867  0.258   -12.546 1.00 0.00 ? 12 VAL B H    8  
ATOM   5952  H HA   . VAL B 2 12 ? -1.540  -2.271  -11.273 1.00 0.00 ? 12 VAL B HA   8  
ATOM   5953  H HB   . VAL B 2 12 ? -1.963  -1.077  -14.009 1.00 0.00 ? 12 VAL B HB   8  
ATOM   5954  H HG11 . VAL B 2 12 ? -3.284  -3.202  -14.507 1.00 0.00 ? 12 VAL B HG11 8  
ATOM   5955  H HG12 . VAL B 2 12 ? -2.443  -3.942  -13.145 1.00 0.00 ? 12 VAL B HG12 8  
ATOM   5956  H HG13 . VAL B 2 12 ? -1.530  -3.378  -14.543 1.00 0.00 ? 12 VAL B HG13 8  
ATOM   5957  H HG21 . VAL B 2 12 ? -3.697  -1.962  -11.699 1.00 0.00 ? 12 VAL B HG21 8  
ATOM   5958  H HG22 . VAL B 2 12 ? -4.369  -1.626  -13.295 1.00 0.00 ? 12 VAL B HG22 8  
ATOM   5959  H HG23 . VAL B 2 12 ? -3.550  -0.349  -12.396 1.00 0.00 ? 12 VAL B HG23 8  
ATOM   5960  N N    . GLU B 2 13 ? 0.597   -2.376  -13.796 1.00 0.00 ? 13 GLU B N    8  
ATOM   5961  C CA   . GLU B 2 13 ? 1.753   -3.167  -14.302 1.00 0.00 ? 13 GLU B CA   8  
ATOM   5962  C C    . GLU B 2 13 ? 2.728   -3.404  -13.148 1.00 0.00 ? 13 GLU B C    8  
ATOM   5963  O O    . GLU B 2 13 ? 3.452   -4.380  -13.123 1.00 0.00 ? 13 GLU B O    8  
ATOM   5964  C CB   . GLU B 2 13 ? 2.454   -2.396  -15.422 1.00 0.00 ? 13 GLU B CB   8  
ATOM   5965  C CG   . GLU B 2 13 ? 1.718   -2.638  -16.743 1.00 0.00 ? 13 GLU B CG   8  
ATOM   5966  C CD   . GLU B 2 13 ? 2.693   -2.471  -17.910 1.00 0.00 ? 13 GLU B CD   8  
ATOM   5967  O OE1  . GLU B 2 13 ? 3.664   -1.752  -17.747 1.00 0.00 ? 13 GLU B OE1  8  
ATOM   5968  O OE2  . GLU B 2 13 ? 2.449   -3.064  -18.948 1.00 0.00 ? 13 GLU B OE2  8  
ATOM   5969  H H    . GLU B 2 13 ? 0.260   -1.614  -14.312 1.00 0.00 ? 13 GLU B H    8  
ATOM   5970  H HA   . GLU B 2 13 ? 1.402   -4.118  -14.679 1.00 0.00 ? 13 GLU B HA   8  
ATOM   5971  H HB2  . GLU B 2 13 ? 2.446   -1.341  -15.193 1.00 0.00 ? 13 GLU B HB2  8  
ATOM   5972  H HB3  . GLU B 2 13 ? 3.474   -2.740  -15.513 1.00 0.00 ? 13 GLU B HB3  8  
ATOM   5973  H HG2  . GLU B 2 13 ? 1.314   -3.640  -16.751 1.00 0.00 ? 13 GLU B HG2  8  
ATOM   5974  H HG3  . GLU B 2 13 ? 0.914   -1.925  -16.843 1.00 0.00 ? 13 GLU B HG3  8  
ATOM   5975  N N    . ALA B 2 14 ? 2.740   -2.522  -12.186 1.00 0.00 ? 14 ALA B N    8  
ATOM   5976  C CA   . ALA B 2 14 ? 3.654   -2.699  -11.025 1.00 0.00 ? 14 ALA B CA   8  
ATOM   5977  C C    . ALA B 2 14 ? 3.221   -3.938  -10.242 1.00 0.00 ? 14 ALA B C    8  
ATOM   5978  O O    . ALA B 2 14 ? 3.957   -4.898  -10.124 1.00 0.00 ? 14 ALA B O    8  
ATOM   5979  C CB   . ALA B 2 14 ? 3.578   -1.468  -10.118 1.00 0.00 ? 14 ALA B CB   8  
ATOM   5980  H H    . ALA B 2 14 ? 2.139   -1.749  -12.222 1.00 0.00 ? 14 ALA B H    8  
ATOM   5981  H HA   . ALA B 2 14 ? 4.667   -2.828  -11.377 1.00 0.00 ? 14 ALA B HA   8  
ATOM   5982  H HB1  . ALA B 2 14 ? 4.503   -1.364  -9.573  1.00 0.00 ? 14 ALA B HB1  8  
ATOM   5983  H HB2  . ALA B 2 14 ? 2.760   -1.584  -9.422  1.00 0.00 ? 14 ALA B HB2  8  
ATOM   5984  H HB3  . ALA B 2 14 ? 3.414   -0.586  -10.721 1.00 0.00 ? 14 ALA B HB3  8  
ATOM   5985  N N    . LEU B 2 15 ? 2.027   -3.931  -9.714  1.00 0.00 ? 15 LEU B N    8  
ATOM   5986  C CA   . LEU B 2 15 ? 1.547   -5.115  -8.950  1.00 0.00 ? 15 LEU B CA   8  
ATOM   5987  C C    . LEU B 2 15 ? 1.769   -6.375  -9.787  1.00 0.00 ? 15 LEU B C    8  
ATOM   5988  O O    . LEU B 2 15 ? 2.282   -7.370  -9.314  1.00 0.00 ? 15 LEU B O    8  
ATOM   5989  C CB   . LEU B 2 15 ? 0.055   -4.955  -8.657  1.00 0.00 ? 15 LEU B CB   8  
ATOM   5990  C CG   . LEU B 2 15 ? -0.149  -3.802  -7.674  1.00 0.00 ? 15 LEU B CG   8  
ATOM   5991  C CD1  . LEU B 2 15 ? -1.502  -3.138  -7.935  1.00 0.00 ? 15 LEU B CD1  8  
ATOM   5992  C CD2  . LEU B 2 15 ? -0.115  -4.342  -6.243  1.00 0.00 ? 15 LEU B CD2  8  
ATOM   5993  H H    . LEU B 2 15 ? 1.443   -3.151  -9.828  1.00 0.00 ? 15 LEU B H    8  
ATOM   5994  H HA   . LEU B 2 15 ? 2.092   -5.195  -8.022  1.00 0.00 ? 15 LEU B HA   8  
ATOM   5995  H HB2  . LEU B 2 15 ? -0.471  -4.745  -9.577  1.00 0.00 ? 15 LEU B HB2  8  
ATOM   5996  H HB3  . LEU B 2 15 ? -0.326  -5.868  -8.225  1.00 0.00 ? 15 LEU B HB3  8  
ATOM   5997  H HG   . LEU B 2 15 ? 0.639   -3.075  -7.805  1.00 0.00 ? 15 LEU B HG   8  
ATOM   5998  H HD11 . LEU B 2 15 ? -1.665  -2.354  -7.210  1.00 0.00 ? 15 LEU B HD11 8  
ATOM   5999  H HD12 . LEU B 2 15 ? -2.287  -3.874  -7.853  1.00 0.00 ? 15 LEU B HD12 8  
ATOM   6000  H HD13 . LEU B 2 15 ? -1.509  -2.714  -8.929  1.00 0.00 ? 15 LEU B HD13 8  
ATOM   6001  H HD21 . LEU B 2 15 ? 0.703   -5.039  -6.142  1.00 0.00 ? 15 LEU B HD21 8  
ATOM   6002  H HD22 . LEU B 2 15 ? -1.046  -4.843  -6.025  1.00 0.00 ? 15 LEU B HD22 8  
ATOM   6003  H HD23 . LEU B 2 15 ? 0.024   -3.523  -5.553  1.00 0.00 ? 15 LEU B HD23 8  
ATOM   6004  N N    . TYR B 2 16 ? 1.384   -6.335  -11.032 1.00 0.00 ? 16 TYR B N    8  
ATOM   6005  C CA   . TYR B 2 16 ? 1.563   -7.521  -11.918 1.00 0.00 ? 16 TYR B CA   8  
ATOM   6006  C C    . TYR B 2 16 ? 2.999   -8.042  -11.807 1.00 0.00 ? 16 TYR B C    8  
ATOM   6007  O O    . TYR B 2 16 ? 3.227   -9.219  -11.611 1.00 0.00 ? 16 TYR B O    8  
ATOM   6008  C CB   . TYR B 2 16 ? 1.283   -7.111  -13.366 1.00 0.00 ? 16 TYR B CB   8  
ATOM   6009  C CG   . TYR B 2 16 ? 0.099   -7.894  -13.895 1.00 0.00 ? 16 TYR B CG   8  
ATOM   6010  C CD1  . TYR B 2 16 ? 0.220   -9.269  -14.141 1.00 0.00 ? 16 TYR B CD1  8  
ATOM   6011  C CD2  . TYR B 2 16 ? -1.120  -7.245  -14.140 1.00 0.00 ? 16 TYR B CD2  8  
ATOM   6012  C CE1  . TYR B 2 16 ? -0.875  -9.994  -14.631 1.00 0.00 ? 16 TYR B CE1  8  
ATOM   6013  C CE2  . TYR B 2 16 ? -2.214  -7.970  -14.630 1.00 0.00 ? 16 TYR B CE2  8  
ATOM   6014  C CZ   . TYR B 2 16 ? -2.091  -9.344  -14.875 1.00 0.00 ? 16 TYR B CZ   8  
ATOM   6015  O OH   . TYR B 2 16 ? -3.170  -10.057 -15.358 1.00 0.00 ? 16 TYR B OH   8  
ATOM   6016  H H    . TYR B 2 16 ? 0.972   -5.520  -11.386 1.00 0.00 ? 16 TYR B H    8  
ATOM   6017  H HA   . TYR B 2 16 ? 0.873   -8.298  -11.625 1.00 0.00 ? 16 TYR B HA   8  
ATOM   6018  H HB2  . TYR B 2 16 ? 1.064   -6.052  -13.403 1.00 0.00 ? 16 TYR B HB2  8  
ATOM   6019  H HB3  . TYR B 2 16 ? 2.154   -7.318  -13.973 1.00 0.00 ? 16 TYR B HB3  8  
ATOM   6020  H HD1  . TYR B 2 16 ? 1.156   -9.773  -13.953 1.00 0.00 ? 16 TYR B HD1  8  
ATOM   6021  H HD2  . TYR B 2 16 ? -1.218  -6.187  -13.951 1.00 0.00 ? 16 TYR B HD2  8  
ATOM   6022  H HE1  . TYR B 2 16 ? -0.781  -11.053 -14.821 1.00 0.00 ? 16 TYR B HE1  8  
ATOM   6023  H HE2  . TYR B 2 16 ? -3.152  -7.470  -14.819 1.00 0.00 ? 16 TYR B HE2  8  
ATOM   6024  H HH   . TYR B 2 16 ? -3.560  -9.555  -16.076 1.00 0.00 ? 16 TYR B HH   8  
ATOM   6025  N N    . LEU B 2 17 ? 3.969   -7.178  -11.938 1.00 0.00 ? 17 LEU B N    8  
ATOM   6026  C CA   . LEU B 2 17 ? 5.386   -7.633  -11.846 1.00 0.00 ? 17 LEU B CA   8  
ATOM   6027  C C    . LEU B 2 17 ? 5.825   -7.673  -10.380 1.00 0.00 ? 17 LEU B C    8  
ATOM   6028  O O    . LEU B 2 17 ? 6.844   -8.244  -10.045 1.00 0.00 ? 17 LEU B O    8  
ATOM   6029  C CB   . LEU B 2 17 ? 6.284   -6.667  -12.623 1.00 0.00 ? 17 LEU B CB   8  
ATOM   6030  C CG   . LEU B 2 17 ? 6.910   -7.400  -13.812 1.00 0.00 ? 17 LEU B CG   8  
ATOM   6031  C CD1  . LEU B 2 17 ? 6.704   -6.576  -15.085 1.00 0.00 ? 17 LEU B CD1  8  
ATOM   6032  C CD2  . LEU B 2 17 ? 8.408   -7.588  -13.562 1.00 0.00 ? 17 LEU B CD2  8  
ATOM   6033  H H    . LEU B 2 17 ? 3.767   -6.234  -12.101 1.00 0.00 ? 17 LEU B H    8  
ATOM   6034  H HA   . LEU B 2 17 ? 5.472   -8.622  -12.271 1.00 0.00 ? 17 LEU B HA   8  
ATOM   6035  H HB2  . LEU B 2 17 ? 5.692   -5.836  -12.982 1.00 0.00 ? 17 LEU B HB2  8  
ATOM   6036  H HB3  . LEU B 2 17 ? 7.065   -6.301  -11.975 1.00 0.00 ? 17 LEU B HB3  8  
ATOM   6037  H HG   . LEU B 2 17 ? 6.437   -8.364  -13.928 1.00 0.00 ? 17 LEU B HG   8  
ATOM   6038  H HD11 . LEU B 2 17 ? 5.667   -6.628  -15.384 1.00 0.00 ? 17 LEU B HD11 8  
ATOM   6039  H HD12 . LEU B 2 17 ? 7.326   -6.972  -15.874 1.00 0.00 ? 17 LEU B HD12 8  
ATOM   6040  H HD13 . LEU B 2 17 ? 6.973   -5.547  -14.896 1.00 0.00 ? 17 LEU B HD13 8  
ATOM   6041  H HD21 . LEU B 2 17 ? 8.739   -6.891  -12.806 1.00 0.00 ? 17 LEU B HD21 8  
ATOM   6042  H HD22 . LEU B 2 17 ? 8.952   -7.408  -14.479 1.00 0.00 ? 17 LEU B HD22 8  
ATOM   6043  H HD23 . LEU B 2 17 ? 8.593   -8.599  -13.227 1.00 0.00 ? 17 LEU B HD23 8  
ATOM   6044  N N    . VAL B 2 18 ? 5.067   -7.074  -9.505  1.00 0.00 ? 18 VAL B N    8  
ATOM   6045  C CA   . VAL B 2 18 ? 5.447   -7.083  -8.065  1.00 0.00 ? 18 VAL B CA   8  
ATOM   6046  C C    . VAL B 2 18 ? 5.109   -8.444  -7.459  1.00 0.00 ? 18 VAL B C    8  
ATOM   6047  O O    . VAL B 2 18 ? 5.962   -9.135  -6.940  1.00 0.00 ? 18 VAL B O    8  
ATOM   6048  C CB   . VAL B 2 18 ? 4.672   -5.995  -7.325  1.00 0.00 ? 18 VAL B CB   8  
ATOM   6049  C CG1  . VAL B 2 18 ? 4.967   -6.086  -5.828  1.00 0.00 ? 18 VAL B CG1  8  
ATOM   6050  C CG2  . VAL B 2 18 ? 5.101   -4.623  -7.844  1.00 0.00 ? 18 VAL B CG2  8  
ATOM   6051  H H    . VAL B 2 18 ? 4.249   -6.619  -9.793  1.00 0.00 ? 18 VAL B H    8  
ATOM   6052  H HA   . VAL B 2 18 ? 6.508   -6.899  -7.970  1.00 0.00 ? 18 VAL B HA   8  
ATOM   6053  H HB   . VAL B 2 18 ? 3.613   -6.132  -7.492  1.00 0.00 ? 18 VAL B HB   8  
ATOM   6054  H HG11 . VAL B 2 18 ? 4.317   -6.821  -5.376  1.00 0.00 ? 18 VAL B HG11 8  
ATOM   6055  H HG12 . VAL B 2 18 ? 4.796   -5.123  -5.368  1.00 0.00 ? 18 VAL B HG12 8  
ATOM   6056  H HG13 . VAL B 2 18 ? 5.996   -6.377  -5.681  1.00 0.00 ? 18 VAL B HG13 8  
ATOM   6057  H HG21 . VAL B 2 18 ? 5.741   -4.147  -7.118  1.00 0.00 ? 18 VAL B HG21 8  
ATOM   6058  H HG22 . VAL B 2 18 ? 4.226   -4.012  -8.010  1.00 0.00 ? 18 VAL B HG22 8  
ATOM   6059  H HG23 . VAL B 2 18 ? 5.637   -4.743  -8.775  1.00 0.00 ? 18 VAL B HG23 8  
ATOM   6060  N N    . CYS B 2 19 ? 3.865   -8.830  -7.516  1.00 0.00 ? 19 CYS B N    8  
ATOM   6061  C CA   . CYS B 2 19 ? 3.466   -10.145 -6.938  1.00 0.00 ? 19 CYS B CA   8  
ATOM   6062  C C    . CYS B 2 19 ? 3.637   -11.242 -7.990  1.00 0.00 ? 19 CYS B C    8  
ATOM   6063  O O    . CYS B 2 19 ? 4.427   -12.151 -7.827  1.00 0.00 ? 19 CYS B O    8  
ATOM   6064  C CB   . CYS B 2 19 ? 1.999   -10.091 -6.497  1.00 0.00 ? 19 CYS B CB   8  
ATOM   6065  S SG   . CYS B 2 19 ? 1.594   -8.429  -5.902  1.00 0.00 ? 19 CYS B SG   8  
ATOM   6066  H H    . CYS B 2 19 ? 3.193   -8.253  -7.936  1.00 0.00 ? 19 CYS B H    8  
ATOM   6067  H HA   . CYS B 2 19 ? 4.089   -10.365 -6.085  1.00 0.00 ? 19 CYS B HA   8  
ATOM   6068  H HB2  . CYS B 2 19 ? 1.364   -10.336 -7.335  1.00 0.00 ? 19 CYS B HB2  8  
ATOM   6069  H HB3  . CYS B 2 19 ? 1.838   -10.806 -5.703  1.00 0.00 ? 19 CYS B HB3  8  
ATOM   6070  N N    . GLY B 2 20 ? 2.903   -11.168 -9.067  1.00 0.00 ? 20 GLY B N    8  
ATOM   6071  C CA   . GLY B 2 20 ? 3.026   -12.214 -10.121 1.00 0.00 ? 20 GLY B CA   8  
ATOM   6072  C C    . GLY B 2 20 ? 2.454   -13.532 -9.594  1.00 0.00 ? 20 GLY B C    8  
ATOM   6073  O O    . GLY B 2 20 ? 1.263   -13.765 -9.640  1.00 0.00 ? 20 GLY B O    8  
ATOM   6074  H H    . GLY B 2 20 ? 2.270   -10.429 -9.180  1.00 0.00 ? 20 GLY B H    8  
ATOM   6075  H HA2  . GLY B 2 20 ? 2.477   -11.906 -11.000 1.00 0.00 ? 20 GLY B HA2  8  
ATOM   6076  H HA3  . GLY B 2 20 ? 4.066   -12.352 -10.374 1.00 0.00 ? 20 GLY B HA3  8  
ATOM   6077  N N    . GLU B 2 21 ? 3.295   -14.392 -9.088  1.00 0.00 ? 21 GLU B N    8  
ATOM   6078  C CA   . GLU B 2 21 ? 2.800   -15.692 -8.552  1.00 0.00 ? 21 GLU B CA   8  
ATOM   6079  C C    . GLU B 2 21 ? 1.539   -15.455 -7.720  1.00 0.00 ? 21 GLU B C    8  
ATOM   6080  O O    . GLU B 2 21 ? 0.431   -15.601 -8.197  1.00 0.00 ? 21 GLU B O    8  
ATOM   6081  C CB   . GLU B 2 21 ? 3.873   -16.329 -7.662  1.00 0.00 ? 21 GLU B CB   8  
ATOM   6082  C CG   . GLU B 2 21 ? 4.748   -15.239 -7.038  1.00 0.00 ? 21 GLU B CG   8  
ATOM   6083  C CD   . GLU B 2 21 ? 5.167   -15.666 -5.631  1.00 0.00 ? 21 GLU B CD   8  
ATOM   6084  O OE1  . GLU B 2 21 ? 5.991   -16.558 -5.525  1.00 0.00 ? 21 GLU B OE1  8  
ATOM   6085  O OE2  . GLU B 2 21 ? 4.654   -15.095 -4.682  1.00 0.00 ? 21 GLU B OE2  8  
ATOM   6086  H H    . GLU B 2 21 ? 4.251   -14.182 -9.058  1.00 0.00 ? 21 GLU B H    8  
ATOM   6087  H HA   . GLU B 2 21 ? 2.571   -16.358 -9.372  1.00 0.00 ? 21 GLU B HA   8  
ATOM   6088  H HB2  . GLU B 2 21 ? 3.397   -16.898 -6.878  1.00 0.00 ? 21 GLU B HB2  8  
ATOM   6089  H HB3  . GLU B 2 21 ? 4.488   -16.984 -8.255  1.00 0.00 ? 21 GLU B HB3  8  
ATOM   6090  H HG2  . GLU B 2 21 ? 5.628   -15.092 -7.648  1.00 0.00 ? 21 GLU B HG2  8  
ATOM   6091  H HG3  . GLU B 2 21 ? 4.190   -14.317 -6.982  1.00 0.00 ? 21 GLU B HG3  8  
ATOM   6092  N N    . ARG B 2 22 ? 1.710   -15.090 -6.478  1.00 0.00 ? 22 ARG B N    8  
ATOM   6093  C CA   . ARG B 2 22 ? 0.537   -14.838 -5.589  1.00 0.00 ? 22 ARG B CA   8  
ATOM   6094  C C    . ARG B 2 22 ? -0.575  -14.138 -6.374  1.00 0.00 ? 22 ARG B C    8  
ATOM   6095  O O    . ARG B 2 22 ? -1.746  -14.317 -6.103  1.00 0.00 ? 22 ARG B O    8  
ATOM   6096  C CB   . ARG B 2 22 ? 0.968   -13.946 -4.423  1.00 0.00 ? 22 ARG B CB   8  
ATOM   6097  C CG   . ARG B 2 22 ? 2.026   -14.670 -3.589  1.00 0.00 ? 22 ARG B CG   8  
ATOM   6098  C CD   . ARG B 2 22 ? 3.117   -13.679 -3.179  1.00 0.00 ? 22 ARG B CD   8  
ATOM   6099  N NE   . ARG B 2 22 ? 2.503   -12.545 -2.432  1.00 0.00 ? 22 ARG B NE   8  
ATOM   6100  C CZ   . ARG B 2 22 ? 2.972   -12.203 -1.264  1.00 0.00 ? 22 ARG B CZ   8  
ATOM   6101  N NH1  . ARG B 2 22 ? 4.198   -11.766 -1.157  1.00 0.00 ? 22 ARG B NH1  8  
ATOM   6102  N NH2  . ARG B 2 22 ? 2.218   -12.299 -0.204  1.00 0.00 ? 22 ARG B NH2  8  
ATOM   6103  H H    . ARG B 2 22 ? 2.618   -14.986 -6.126  1.00 0.00 ? 22 ARG B H    8  
ATOM   6104  H HA   . ARG B 2 22 ? 0.169   -15.777 -5.203  1.00 0.00 ? 22 ARG B HA   8  
ATOM   6105  H HB2  . ARG B 2 22 ? 1.381   -13.026 -4.809  1.00 0.00 ? 22 ARG B HB2  8  
ATOM   6106  H HB3  . ARG B 2 22 ? 0.112   -13.725 -3.803  1.00 0.00 ? 22 ARG B HB3  8  
ATOM   6107  H HG2  . ARG B 2 22 ? 1.564   -15.085 -2.705  1.00 0.00 ? 22 ARG B HG2  8  
ATOM   6108  H HG3  . ARG B 2 22 ? 2.464   -15.464 -4.174  1.00 0.00 ? 22 ARG B HG3  8  
ATOM   6109  H HD2  . ARG B 2 22 ? 3.836   -14.179 -2.546  1.00 0.00 ? 22 ARG B HD2  8  
ATOM   6110  H HD3  . ARG B 2 22 ? 3.613   -13.304 -4.061  1.00 0.00 ? 22 ARG B HD3  8  
ATOM   6111  H HE   . ARG B 2 22 ? 1.748   -12.056 -2.820  1.00 0.00 ? 22 ARG B HE   8  
ATOM   6112  H HH11 . ARG B 2 22 ? 4.776   -11.693 -1.970  1.00 0.00 ? 22 ARG B HH11 8  
ATOM   6113  H HH12 . ARG B 2 22 ? 4.557   -11.503 -0.261  1.00 0.00 ? 22 ARG B HH12 8  
ATOM   6114  H HH21 . ARG B 2 22 ? 1.280   -12.634 -0.287  1.00 0.00 ? 22 ARG B HH21 8  
ATOM   6115  H HH22 . ARG B 2 22 ? 2.578   -12.037 0.692   1.00 0.00 ? 22 ARG B HH22 8  
ATOM   6116  N N    . GLY B 2 23 ? -0.219  -13.339 -7.341  1.00 0.00 ? 23 GLY B N    8  
ATOM   6117  C CA   . GLY B 2 23 ? -1.257  -12.627 -8.138  1.00 0.00 ? 23 GLY B CA   8  
ATOM   6118  C C    . GLY B 2 23 ? -1.522  -11.256 -7.515  1.00 0.00 ? 23 GLY B C    8  
ATOM   6119  O O    . GLY B 2 23 ? -0.662  -10.676 -6.885  1.00 0.00 ? 23 GLY B O    8  
ATOM   6120  H H    . GLY B 2 23 ? 0.729   -13.205 -7.544  1.00 0.00 ? 23 GLY B H    8  
ATOM   6121  H HA2  . GLY B 2 23 ? -0.907  -12.502 -9.154  1.00 0.00 ? 23 GLY B HA2  8  
ATOM   6122  H HA3  . GLY B 2 23 ? -2.170  -13.202 -8.139  1.00 0.00 ? 23 GLY B HA3  8  
ATOM   6123  N N    . PHE B 2 24 ? -2.709  -10.738 -7.678  1.00 0.00 ? 24 PHE B N    8  
ATOM   6124  C CA   . PHE B 2 24 ? -3.027  -9.403  -7.086  1.00 0.00 ? 24 PHE B CA   8  
ATOM   6125  C C    . PHE B 2 24 ? -4.445  -8.985  -7.492  1.00 0.00 ? 24 PHE B C    8  
ATOM   6126  O O    . PHE B 2 24 ? -4.955  -9.393  -8.515  1.00 0.00 ? 24 PHE B O    8  
ATOM   6127  C CB   . PHE B 2 24 ? -1.990  -8.359  -7.561  1.00 0.00 ? 24 PHE B CB   8  
ATOM   6128  C CG   . PHE B 2 24 ? -2.499  -7.581  -8.771  1.00 0.00 ? 24 PHE B CG   8  
ATOM   6129  C CD1  . PHE B 2 24 ? -2.467  -8.160  -10.049 1.00 0.00 ? 24 PHE B CD1  8  
ATOM   6130  C CD2  . PHE B 2 24 ? -3.004  -6.274  -8.614  1.00 0.00 ? 24 PHE B CD2  8  
ATOM   6131  C CE1  . PHE B 2 24 ? -2.934  -7.444  -11.159 1.00 0.00 ? 24 PHE B CE1  8  
ATOM   6132  C CE2  . PHE B 2 24 ? -3.469  -5.563  -9.728  1.00 0.00 ? 24 PHE B CE2  8  
ATOM   6133  C CZ   . PHE B 2 24 ? -3.434  -6.148  -10.999 1.00 0.00 ? 24 PHE B CZ   8  
ATOM   6134  H H    . PHE B 2 24 ? -3.394  -11.231 -8.182  1.00 0.00 ? 24 PHE B H    8  
ATOM   6135  H HA   . PHE B 2 24 ? -2.981  -9.481  -6.008  1.00 0.00 ? 24 PHE B HA   8  
ATOM   6136  H HB2  . PHE B 2 24 ? -1.797  -7.666  -6.755  1.00 0.00 ? 24 PHE B HB2  8  
ATOM   6137  H HB3  . PHE B 2 24 ? -1.066  -8.867  -7.818  1.00 0.00 ? 24 PHE B HB3  8  
ATOM   6138  H HD1  . PHE B 2 24 ? -2.084  -9.156  -10.180 1.00 0.00 ? 24 PHE B HD1  8  
ATOM   6139  H HD2  . PHE B 2 24 ? -3.035  -5.816  -7.637  1.00 0.00 ? 24 PHE B HD2  8  
ATOM   6140  H HE1  . PHE B 2 24 ? -2.907  -7.894  -12.141 1.00 0.00 ? 24 PHE B HE1  8  
ATOM   6141  H HE2  . PHE B 2 24 ? -3.856  -4.562  -9.604  1.00 0.00 ? 24 PHE B HE2  8  
ATOM   6142  H HZ   . PHE B 2 24 ? -3.793  -5.597  -11.856 1.00 0.00 ? 24 PHE B HZ   8  
ATOM   6143  N N    . PHE B 2 25 ? -5.082  -8.169  -6.695  1.00 0.00 ? 25 PHE B N    8  
ATOM   6144  C CA   . PHE B 2 25 ? -6.462  -7.719  -7.035  1.00 0.00 ? 25 PHE B CA   8  
ATOM   6145  C C    . PHE B 2 25 ? -6.554  -6.201  -6.864  1.00 0.00 ? 25 PHE B C    8  
ATOM   6146  O O    . PHE B 2 25 ? -6.644  -5.692  -5.765  1.00 0.00 ? 25 PHE B O    8  
ATOM   6147  C CB   . PHE B 2 25 ? -7.475  -8.403  -6.109  1.00 0.00 ? 25 PHE B CB   8  
ATOM   6148  C CG   . PHE B 2 25 ? -6.824  -8.720  -4.783  1.00 0.00 ? 25 PHE B CG   8  
ATOM   6149  C CD1  . PHE B 2 25 ? -6.750  -7.739  -3.786  1.00 0.00 ? 25 PHE B CD1  8  
ATOM   6150  C CD2  . PHE B 2 25 ? -6.295  -9.997  -4.550  1.00 0.00 ? 25 PHE B CD2  8  
ATOM   6151  C CE1  . PHE B 2 25 ? -6.146  -8.033  -2.557  1.00 0.00 ? 25 PHE B CE1  8  
ATOM   6152  C CE2  . PHE B 2 25 ? -5.691  -10.292 -3.320  1.00 0.00 ? 25 PHE B CE2  8  
ATOM   6153  C CZ   . PHE B 2 25 ? -5.617  -9.309  -2.323  1.00 0.00 ? 25 PHE B CZ   8  
ATOM   6154  H H    . PHE B 2 25 ? -4.650  -7.850  -5.875  1.00 0.00 ? 25 PHE B H    8  
ATOM   6155  H HA   . PHE B 2 25 ? -6.681  -7.978  -8.060  1.00 0.00 ? 25 PHE B HA   8  
ATOM   6156  H HB2  . PHE B 2 25 ? -8.316  -7.744  -5.948  1.00 0.00 ? 25 PHE B HB2  8  
ATOM   6157  H HB3  . PHE B 2 25 ? -7.819  -9.318  -6.568  1.00 0.00 ? 25 PHE B HB3  8  
ATOM   6158  H HD1  . PHE B 2 25 ? -7.158  -6.754  -3.965  1.00 0.00 ? 25 PHE B HD1  8  
ATOM   6159  H HD2  . PHE B 2 25 ? -6.352  -10.754 -5.318  1.00 0.00 ? 25 PHE B HD2  8  
ATOM   6160  H HE1  . PHE B 2 25 ? -6.089  -7.277  -1.789  1.00 0.00 ? 25 PHE B HE1  8  
ATOM   6161  H HE2  . PHE B 2 25 ? -5.284  -11.275 -3.139  1.00 0.00 ? 25 PHE B HE2  8  
ATOM   6162  H HZ   . PHE B 2 25 ? -5.152  -9.536  -1.376  1.00 0.00 ? 25 PHE B HZ   8  
ATOM   6163  N N    . TYR B 2 26 ? -6.526  -5.474  -7.949  1.00 0.00 ? 26 TYR B N    8  
ATOM   6164  C CA   . TYR B 2 26 ? -6.604  -3.989  -7.855  1.00 0.00 ? 26 TYR B CA   8  
ATOM   6165  C C    . TYR B 2 26 ? -7.729  -3.588  -6.899  1.00 0.00 ? 26 TYR B C    8  
ATOM   6166  O O    . TYR B 2 26 ? -8.704  -4.294  -6.738  1.00 0.00 ? 26 TYR B O    8  
ATOM   6167  C CB   . TYR B 2 26 ? -6.885  -3.405  -9.241  1.00 0.00 ? 26 TYR B CB   8  
ATOM   6168  C CG   . TYR B 2 26 ? -6.107  -2.123  -9.413  1.00 0.00 ? 26 TYR B CG   8  
ATOM   6169  C CD1  . TYR B 2 26 ? -4.749  -2.078  -9.071  1.00 0.00 ? 26 TYR B CD1  8  
ATOM   6170  C CD2  . TYR B 2 26 ? -6.742  -0.979  -9.913  1.00 0.00 ? 26 TYR B CD2  8  
ATOM   6171  C CE1  . TYR B 2 26 ? -4.026  -0.888  -9.229  1.00 0.00 ? 26 TYR B CE1  8  
ATOM   6172  C CE2  . TYR B 2 26 ? -6.019  0.211   -10.072 1.00 0.00 ? 26 TYR B CE2  8  
ATOM   6173  C CZ   . TYR B 2 26 ? -4.661  0.257   -9.729  1.00 0.00 ? 26 TYR B CZ   8  
ATOM   6174  O OH   . TYR B 2 26 ? -3.949  1.428   -9.885  1.00 0.00 ? 26 TYR B OH   8  
ATOM   6175  H H    . TYR B 2 26 ? -6.449  -5.905  -8.824  1.00 0.00 ? 26 TYR B H    8  
ATOM   6176  H HA   . TYR B 2 26 ? -5.665  -3.602  -7.487  1.00 0.00 ? 26 TYR B HA   8  
ATOM   6177  H HB2  . TYR B 2 26 ? -6.585  -4.115  -9.998  1.00 0.00 ? 26 TYR B HB2  8  
ATOM   6178  H HB3  . TYR B 2 26 ? -7.941  -3.200  -9.339  1.00 0.00 ? 26 TYR B HB3  8  
ATOM   6179  H HD1  . TYR B 2 26 ? -4.259  -2.959  -8.684  1.00 0.00 ? 26 TYR B HD1  8  
ATOM   6180  H HD2  . TYR B 2 26 ? -7.789  -1.014  -10.177 1.00 0.00 ? 26 TYR B HD2  8  
ATOM   6181  H HE1  . TYR B 2 26 ? -2.979  -0.852  -8.965  1.00 0.00 ? 26 TYR B HE1  8  
ATOM   6182  H HE2  . TYR B 2 26 ? -6.508  1.093   -10.457 1.00 0.00 ? 26 TYR B HE2  8  
ATOM   6183  H HH   . TYR B 2 26 ? -3.326  1.304   -10.605 1.00 0.00 ? 26 TYR B HH   8  
ATOM   6184  N N    . THR B 2 27 ? -7.601  -2.453  -6.267  1.00 0.00 ? 27 THR B N    8  
ATOM   6185  C CA   . THR B 2 27 ? -8.661  -1.998  -5.324  1.00 0.00 ? 27 THR B CA   8  
ATOM   6186  C C    . THR B 2 27 ? -9.010  -0.539  -5.622  1.00 0.00 ? 27 THR B C    8  
ATOM   6187  O O    . THR B 2 27 ? -8.207  0.206   -6.146  1.00 0.00 ? 27 THR B O    8  
ATOM   6188  C CB   . THR B 2 27 ? -8.149  -2.115  -3.886  1.00 0.00 ? 27 THR B CB   8  
ATOM   6189  O OG1  . THR B 2 27 ? -7.196  -1.089  -3.641  1.00 0.00 ? 27 THR B OG1  8  
ATOM   6190  C CG2  . THR B 2 27 ? -7.495  -3.483  -3.684  1.00 0.00 ? 27 THR B CG2  8  
ATOM   6191  H H    . THR B 2 27 ? -6.807  -1.898  -6.415  1.00 0.00 ? 27 THR B H    8  
ATOM   6192  H HA   . THR B 2 27 ? -9.541  -2.612  -5.445  1.00 0.00 ? 27 THR B HA   8  
ATOM   6193  H HB   . THR B 2 27 ? -8.975  -2.012  -3.200  1.00 0.00 ? 27 THR B HB   8  
ATOM   6194  H HG1  . THR B 2 27 ? -6.743  -1.296  -2.821  1.00 0.00 ? 27 THR B HG1  8  
ATOM   6195  H HG21 . THR B 2 27 ? -8.253  -4.252  -3.706  1.00 0.00 ? 27 THR B HG21 8  
ATOM   6196  H HG22 . THR B 2 27 ? -6.990  -3.503  -2.730  1.00 0.00 ? 27 THR B HG22 8  
ATOM   6197  H HG23 . THR B 2 27 ? -6.779  -3.660  -4.474  1.00 0.00 ? 27 THR B HG23 8  
ATOM   6198  N N    . LYS B 2 28 ? -10.202 -0.124  -5.295  1.00 0.00 ? 28 LYS B N    8  
ATOM   6199  C CA   . LYS B 2 28 ? -10.596 1.287   -5.564  1.00 0.00 ? 28 LYS B CA   8  
ATOM   6200  C C    . LYS B 2 28 ? -10.553 1.543   -7.073  1.00 0.00 ? 28 LYS B C    8  
ATOM   6201  O O    . LYS B 2 28 ? -9.683  2.241   -7.557  1.00 0.00 ? 28 LYS B O    8  
ATOM   6202  C CB   . LYS B 2 28 ? -9.622  2.233   -4.858  1.00 0.00 ? 28 LYS B CB   8  
ATOM   6203  C CG   . LYS B 2 28 ? -10.005 3.683   -5.163  1.00 0.00 ? 28 LYS B CG   8  
ATOM   6204  C CD   . LYS B 2 28 ? -11.080 4.146   -4.179  1.00 0.00 ? 28 LYS B CD   8  
ATOM   6205  C CE   . LYS B 2 28 ? -10.444 4.423   -2.815  1.00 0.00 ? 28 LYS B CE   8  
ATOM   6206  N NZ   . LYS B 2 28 ? -11.087 3.562   -1.782  1.00 0.00 ? 28 LYS B NZ   8  
ATOM   6207  H H    . LYS B 2 28 ? -10.839 -0.739  -4.875  1.00 0.00 ? 28 LYS B H    8  
ATOM   6208  H HA   . LYS B 2 28 ? -11.597 1.459   -5.198  1.00 0.00 ? 28 LYS B HA   8  
ATOM   6209  H HB2  . LYS B 2 28 ? -9.667  2.065   -3.791  1.00 0.00 ? 28 LYS B HB2  8  
ATOM   6210  H HB3  . LYS B 2 28 ? -8.618  2.046   -5.210  1.00 0.00 ? 28 LYS B HB3  8  
ATOM   6211  H HG2  . LYS B 2 28 ? -9.131  4.314   -5.068  1.00 0.00 ? 28 LYS B HG2  8  
ATOM   6212  H HG3  . LYS B 2 28 ? -10.388 3.750   -6.170  1.00 0.00 ? 28 LYS B HG3  8  
ATOM   6213  H HD2  . LYS B 2 28 ? -11.544 5.049   -4.551  1.00 0.00 ? 28 LYS B HD2  8  
ATOM   6214  H HD3  . LYS B 2 28 ? -11.828 3.374   -4.075  1.00 0.00 ? 28 LYS B HD3  8  
ATOM   6215  H HE2  . LYS B 2 28 ? -9.387  4.203   -2.859  1.00 0.00 ? 28 LYS B HE2  8  
ATOM   6216  H HE3  . LYS B 2 28 ? -10.586 5.462   -2.556  1.00 0.00 ? 28 LYS B HE3  8  
ATOM   6217  H HZ1  . LYS B 2 28 ? -11.575 2.770   -2.246  1.00 0.00 ? 28 LYS B HZ1  8  
ATOM   6218  H HZ2  . LYS B 2 28 ? -11.775 4.125   -1.241  1.00 0.00 ? 28 LYS B HZ2  8  
ATOM   6219  H HZ3  . LYS B 2 28 ? -10.361 3.190   -1.139  1.00 0.00 ? 28 LYS B HZ3  8  
ATOM   6220  N N    . PRO B 2 29 ? -11.497 0.965   -7.772  1.00 0.00 ? 29 PRO B N    8  
ATOM   6221  C CA   . PRO B 2 29 ? -11.599 1.106   -9.235  1.00 0.00 ? 29 PRO B CA   8  
ATOM   6222  C C    . PRO B 2 29 ? -12.198 2.467   -9.602  1.00 0.00 ? 29 PRO B C    8  
ATOM   6223  O O    . PRO B 2 29 ? -13.169 2.907   -9.019  1.00 0.00 ? 29 PRO B O    8  
ATOM   6224  C CB   . PRO B 2 29 ? -12.538 -0.034  -9.640  1.00 0.00 ? 29 PRO B CB   8  
ATOM   6225  C CG   . PRO B 2 29 ? -13.354 -0.397  -8.376  1.00 0.00 ? 29 PRO B CG   8  
ATOM   6226  C CD   . PRO B 2 29 ? -12.548 0.119   -7.169  1.00 0.00 ? 29 PRO B CD   8  
ATOM   6227  H HA   . PRO B 2 29 ? -10.636 0.974   -9.700  1.00 0.00 ? 29 PRO B HA   8  
ATOM   6228  H HB2  . PRO B 2 29 ? -13.198 0.295   -10.432 1.00 0.00 ? 29 PRO B HB2  8  
ATOM   6229  H HB3  . PRO B 2 29 ? -11.966 -0.890  -9.961  1.00 0.00 ? 29 PRO B HB3  8  
ATOM   6230  H HG2  . PRO B 2 29 ? -14.323 0.084   -8.412  1.00 0.00 ? 29 PRO B HG2  8  
ATOM   6231  H HG3  . PRO B 2 29 ? -13.472 -1.466  -8.306  1.00 0.00 ? 29 PRO B HG3  8  
ATOM   6232  H HD2  . PRO B 2 29 ? -13.181 0.704   -6.515  1.00 0.00 ? 29 PRO B HD2  8  
ATOM   6233  H HD3  . PRO B 2 29 ? -12.102 -0.703  -6.631  1.00 0.00 ? 29 PRO B HD3  8  
ATOM   6234  N N    . THR B 2 30 ? -11.625 3.138   -10.564 1.00 0.00 ? 30 THR B N    8  
ATOM   6235  C CA   . THR B 2 30 ? -12.161 4.468   -10.966 1.00 0.00 ? 30 THR B CA   8  
ATOM   6236  C C    . THR B 2 30 ? -13.654 4.346   -11.279 1.00 0.00 ? 30 THR B C    8  
ATOM   6237  O O    . THR B 2 30 ? -14.348 5.342   -11.159 1.00 0.00 ? 30 THR B O    8  
ATOM   6238  C CB   . THR B 2 30 ? -11.420 4.960   -12.212 1.00 0.00 ? 30 THR B CB   8  
ATOM   6239  O OG1  . THR B 2 30 ? -12.129 6.051   -12.784 1.00 0.00 ? 30 THR B OG1  8  
ATOM   6240  C CG2  . THR B 2 30 ? -11.320 3.824   -13.230 1.00 0.00 ? 30 THR B CG2  8  
ATOM   6241  O OXT  . THR B 2 30 ? -14.077 3.259   -11.635 1.00 0.00 ? 30 THR B OXT  8  
ATOM   6242  H H    . THR B 2 30 ? -10.842 2.767   -11.021 1.00 0.00 ? 30 THR B H    8  
ATOM   6243  H HA   . THR B 2 30 ? -12.018 5.174   -10.161 1.00 0.00 ? 30 THR B HA   8  
ATOM   6244  H HB   . THR B 2 30 ? -10.426 5.280   -11.937 1.00 0.00 ? 30 THR B HB   8  
ATOM   6245  H HG1  . THR B 2 30 ? -12.232 6.726   -12.109 1.00 0.00 ? 30 THR B HG1  8  
ATOM   6246  H HG21 . THR B 2 30 ? -12.010 3.037   -12.961 1.00 0.00 ? 30 THR B HG21 8  
ATOM   6247  H HG22 . THR B 2 30 ? -10.313 3.433   -13.236 1.00 0.00 ? 30 THR B HG22 8  
ATOM   6248  H HG23 . THR B 2 30 ? -11.567 4.198   -14.213 1.00 0.00 ? 30 THR B HG23 8  
ATOM   6249  N N    . GLY A 1 1  ? -7.036  4.579   -1.323  1.00 0.00 ? 1  GLY A N    9  
ATOM   6250  C CA   . GLY A 1 1  ? -5.746  4.036   -0.708  1.00 0.00 ? 1  GLY A CA   9  
ATOM   6251  C C    . GLY A 1 1  ? -4.510  3.966   -1.540  1.00 0.00 ? 1  GLY A C    9  
ATOM   6252  O O    . GLY A 1 1  ? -3.851  4.960   -1.776  1.00 0.00 ? 1  GLY A O    9  
ATOM   6253  H H1   . GLY A 1 1  ? -7.022  4.423   -2.351  1.00 0.00 ? 1  GLY A H1   9  
ATOM   6254  H H2   . GLY A 1 1  ? -7.111  5.598   -1.127  1.00 0.00 ? 1  GLY A H2   9  
ATOM   6255  H H3   . GLY A 1 1  ? -7.852  4.085   -0.908  1.00 0.00 ? 1  GLY A H3   9  
ATOM   6256  H HA2  . GLY A 1 1  ? -5.259  4.735   -0.232  1.00 0.00 ? 1  GLY A HA2  9  
ATOM   6257  H HA3  . GLY A 1 1  ? -6.047  3.143   -0.020  1.00 0.00 ? 1  GLY A HA3  9  
HETATM 6258  N N    . IIL A 1 2  ? -4.163  2.797   -2.006  1.00 0.00 ? 2  IIL A N    9  
HETATM 6259  C CA   . IIL A 1 2  ? -2.938  2.662   -2.843  1.00 0.00 ? 2  IIL A CA   9  
HETATM 6260  C C    . IIL A 1 2  ? -3.152  3.368   -4.184  1.00 0.00 ? 2  IIL A C    9  
HETATM 6261  O O    . IIL A 1 2  ? -2.244  3.944   -4.746  1.00 0.00 ? 2  IIL A O    9  
HETATM 6262  C CB   . IIL A 1 2  ? -2.652  1.178   -3.088  1.00 0.00 ? 2  IIL A CB   9  
HETATM 6263  C CG2  . IIL A 1 2  ? -1.321  1.030   -3.828  1.00 0.00 ? 2  IIL A CG2  9  
HETATM 6264  C CG1  . IIL A 1 2  ? -3.778  0.578   -3.933  1.00 0.00 ? 2  IIL A CG1  9  
HETATM 6265  C CD1  . IIL A 1 2  ? -3.874  -0.925  -3.660  1.00 0.00 ? 2  IIL A CD1  9  
HETATM 6266  H H    . IIL A 1 2  ? -4.708  2.009   -1.804  1.00 0.00 ? 2  IIL A H    9  
HETATM 6267  H HA   . IIL A 1 2  ? -2.099  3.110   -2.331  1.00 0.00 ? 2  IIL A HA   9  
HETATM 6268  H HB   . IIL A 1 2  ? -2.598  0.660   -2.142  1.00 0.00 ? 2  IIL A HB   9  
HETATM 6269  H HG21 . IIL A 1 2  ? -1.369  1.562   -4.766  1.00 0.00 ? 2  IIL A HG21 9  
HETATM 6270  H HG22 . IIL A 1 2  ? -1.129  -0.016  -4.017  1.00 0.00 ? 2  IIL A HG22 9  
HETATM 6271  H HG23 . IIL A 1 2  ? -0.526  1.438   -3.221  1.00 0.00 ? 2  IIL A HG23 9  
HETATM 6272  H HG12 . IIL A 1 2  ? -3.568  0.738   -4.980  1.00 0.00 ? 2  IIL A HG12 9  
HETATM 6273  H HG13 . IIL A 1 2  ? -4.713  1.053   -3.676  1.00 0.00 ? 2  IIL A HG13 9  
HETATM 6274  H HD11 . IIL A 1 2  ? -4.516  -1.384  -4.396  1.00 0.00 ? 2  IIL A HD11 9  
HETATM 6275  H HD12 . IIL A 1 2  ? -4.285  -1.085  -2.674  1.00 0.00 ? 2  IIL A HD12 9  
HETATM 6276  H HD13 . IIL A 1 2  ? -2.889  -1.364  -3.715  1.00 0.00 ? 2  IIL A HD13 9  
ATOM   6277  N N    . VAL A 1 3  ? -4.349  3.324   -4.701  1.00 0.00 ? 3  VAL A N    9  
ATOM   6278  C CA   . VAL A 1 3  ? -4.626  3.987   -6.005  1.00 0.00 ? 3  VAL A CA   9  
ATOM   6279  C C    . VAL A 1 3  ? -4.701  5.503   -5.810  1.00 0.00 ? 3  VAL A C    9  
ATOM   6280  O O    . VAL A 1 3  ? -4.315  6.267   -6.670  1.00 0.00 ? 3  VAL A O    9  
ATOM   6281  C CB   . VAL A 1 3  ? -5.961  3.482   -6.553  1.00 0.00 ? 3  VAL A CB   9  
ATOM   6282  C CG1  . VAL A 1 3  ? -6.239  4.139   -7.904  1.00 0.00 ? 3  VAL A CG1  9  
ATOM   6283  C CG2  . VAL A 1 3  ? -5.898  1.963   -6.727  1.00 0.00 ? 3  VAL A CG2  9  
ATOM   6284  H H    . VAL A 1 3  ? -5.067  2.851   -4.231  1.00 0.00 ? 3  VAL A H    9  
ATOM   6285  H HA   . VAL A 1 3  ? -3.837  3.751   -6.704  1.00 0.00 ? 3  VAL A HA   9  
ATOM   6286  H HB   . VAL A 1 3  ? -6.750  3.735   -5.860  1.00 0.00 ? 3  VAL A HB   9  
ATOM   6287  H HG11 . VAL A 1 3  ? -5.484  4.884   -8.105  1.00 0.00 ? 3  VAL A HG11 9  
ATOM   6288  H HG12 . VAL A 1 3  ? -7.212  4.608   -7.882  1.00 0.00 ? 3  VAL A HG12 9  
ATOM   6289  H HG13 . VAL A 1 3  ? -6.220  3.387   -8.680  1.00 0.00 ? 3  VAL A HG13 9  
ATOM   6290  H HG21 . VAL A 1 3  ? -5.784  1.494   -5.761  1.00 0.00 ? 3  VAL A HG21 9  
ATOM   6291  H HG22 . VAL A 1 3  ? -5.056  1.707   -7.353  1.00 0.00 ? 3  VAL A HG22 9  
ATOM   6292  H HG23 . VAL A 1 3  ? -6.810  1.617   -7.190  1.00 0.00 ? 3  VAL A HG23 9  
ATOM   6293  N N    . GLU A 1 4  ? -5.205  5.945   -4.692  1.00 0.00 ? 4  GLU A N    9  
ATOM   6294  C CA   . GLU A 1 4  ? -5.315  7.413   -4.454  1.00 0.00 ? 4  GLU A CA   9  
ATOM   6295  C C    . GLU A 1 4  ? -3.995  7.959   -3.903  1.00 0.00 ? 4  GLU A C    9  
ATOM   6296  O O    . GLU A 1 4  ? -3.787  9.155   -3.846  1.00 0.00 ? 4  GLU A O    9  
ATOM   6297  C CB   . GLU A 1 4  ? -6.435  7.681   -3.446  1.00 0.00 ? 4  GLU A CB   9  
ATOM   6298  C CG   . GLU A 1 4  ? -7.696  6.926   -3.870  1.00 0.00 ? 4  GLU A CG   9  
ATOM   6299  C CD   . GLU A 1 4  ? -8.741  7.920   -4.379  1.00 0.00 ? 4  GLU A CD   9  
ATOM   6300  O OE1  . GLU A 1 4  ? -8.700  8.243   -5.556  1.00 0.00 ? 4  GLU A OE1  9  
ATOM   6301  O OE2  . GLU A 1 4  ? -9.565  8.341   -3.584  1.00 0.00 ? 4  GLU A OE2  9  
ATOM   6302  H H    . GLU A 1 4  ? -5.520  5.313   -4.012  1.00 0.00 ? 4  GLU A H    9  
ATOM   6303  H HA   . GLU A 1 4  ? -5.546  7.909   -5.384  1.00 0.00 ? 4  GLU A HA   9  
ATOM   6304  H HB2  . GLU A 1 4  ? -6.126  7.346   -2.466  1.00 0.00 ? 4  GLU A HB2  9  
ATOM   6305  H HB3  . GLU A 1 4  ? -6.645  8.739   -3.415  1.00 0.00 ? 4  GLU A HB3  9  
ATOM   6306  H HG2  . GLU A 1 4  ? -7.449  6.227   -4.657  1.00 0.00 ? 4  GLU A HG2  9  
ATOM   6307  H HG3  . GLU A 1 4  ? -8.096  6.388   -3.024  1.00 0.00 ? 4  GLU A HG3  9  
ATOM   6308  N N    . GLN A 1 5  ? -3.104  7.102   -3.488  1.00 0.00 ? 5  GLN A N    9  
ATOM   6309  C CA   . GLN A 1 5  ? -1.808  7.592   -2.936  1.00 0.00 ? 5  GLN A CA   9  
ATOM   6310  C C    . GLN A 1 5  ? -0.682  7.362   -3.947  1.00 0.00 ? 5  GLN A C    9  
ATOM   6311  O O    . GLN A 1 5  ? 0.187   8.193   -4.118  1.00 0.00 ? 5  GLN A O    9  
ATOM   6312  C CB   . GLN A 1 5  ? -1.491  6.842   -1.642  1.00 0.00 ? 5  GLN A CB   9  
ATOM   6313  C CG   . GLN A 1 5  ? -0.947  7.824   -0.604  1.00 0.00 ? 5  GLN A CG   9  
ATOM   6314  C CD   . GLN A 1 5  ? 0.446   8.293   -1.027  1.00 0.00 ? 5  GLN A CD   9  
ATOM   6315  O OE1  . GLN A 1 5  ? 0.586   9.037   -1.977  1.00 0.00 ? 5  GLN A OE1  9  
ATOM   6316  N NE2  . GLN A 1 5  ? 1.488   7.886   -0.358  1.00 0.00 ? 5  GLN A NE2  9  
ATOM   6317  H H    . GLN A 1 5  ? -3.286  6.141   -3.533  1.00 0.00 ? 5  GLN A H    9  
ATOM   6318  H HA   . GLN A 1 5  ? -1.888  8.649   -2.727  1.00 0.00 ? 5  GLN A HA   9  
ATOM   6319  H HB2  . GLN A 1 5  ? -2.392  6.380   -1.263  1.00 0.00 ? 5  GLN A HB2  9  
ATOM   6320  H HB3  . GLN A 1 5  ? -0.751  6.081   -1.837  1.00 0.00 ? 5  GLN A HB3  9  
ATOM   6321  H HG2  . GLN A 1 5  ? -1.610  8.674   -0.534  1.00 0.00 ? 5  GLN A HG2  9  
ATOM   6322  H HG3  . GLN A 1 5  ? -0.884  7.334   0.356   1.00 0.00 ? 5  GLN A HG3  9  
ATOM   6323  H HE21 . GLN A 1 5  ? 1.375   7.286   0.409   1.00 0.00 ? 5  GLN A HE21 9  
ATOM   6324  H HE22 . GLN A 1 5  ? 2.384   8.181   -0.621  1.00 0.00 ? 5  GLN A HE22 9  
ATOM   6325  N N    . CYS A 1 6  ? -0.682  6.239   -4.612  1.00 0.00 ? 6  CYS A N    9  
ATOM   6326  C CA   . CYS A 1 6  ? 0.399   5.964   -5.600  1.00 0.00 ? 6  CYS A CA   9  
ATOM   6327  C C    . CYS A 1 6  ? 0.080   6.670   -6.919  1.00 0.00 ? 6  CYS A C    9  
ATOM   6328  O O    . CYS A 1 6  ? 0.965   7.032   -7.669  1.00 0.00 ? 6  CYS A O    9  
ATOM   6329  C CB   . CYS A 1 6  ? 0.504   4.458   -5.835  1.00 0.00 ? 6  CYS A CB   9  
ATOM   6330  S SG   . CYS A 1 6  ? 0.699   3.613   -4.246  1.00 0.00 ? 6  CYS A SG   9  
ATOM   6331  H H    . CYS A 1 6  ? -1.386  5.576   -4.458  1.00 0.00 ? 6  CYS A H    9  
ATOM   6332  H HA   . CYS A 1 6  ? 1.339   6.334   -5.215  1.00 0.00 ? 6  CYS A HA   9  
ATOM   6333  H HB2  . CYS A 1 6  ? -0.393  4.109   -6.321  1.00 0.00 ? 6  CYS A HB2  9  
ATOM   6334  H HB3  . CYS A 1 6  ? 1.358   4.249   -6.462  1.00 0.00 ? 6  CYS A HB3  9  
ATOM   6335  N N    . CYS A 1 7  ? -1.176  6.874   -7.207  1.00 0.00 ? 7  CYS A N    9  
ATOM   6336  C CA   . CYS A 1 7  ? -1.539  7.564   -8.476  1.00 0.00 ? 7  CYS A CA   9  
ATOM   6337  C C    . CYS A 1 7  ? -1.493  9.076   -8.246  1.00 0.00 ? 7  CYS A C    9  
ATOM   6338  O O    . CYS A 1 7  ? -1.209  9.844   -9.143  1.00 0.00 ? 7  CYS A O    9  
ATOM   6339  C CB   . CYS A 1 7  ? -2.948  7.142   -8.904  1.00 0.00 ? 7  CYS A CB   9  
ATOM   6340  S SG   . CYS A 1 7  ? -3.333  7.778   -10.561 1.00 0.00 ? 7  CYS A SG   9  
ATOM   6341  H H    . CYS A 1 7  ? -1.876  6.577   -6.590  1.00 0.00 ? 7  CYS A H    9  
ATOM   6342  H HA   . CYS A 1 7  ? -0.829  7.292   -9.239  1.00 0.00 ? 7  CYS A HA   9  
ATOM   6343  H HB2  . CYS A 1 7  ? -3.010  6.064   -8.913  1.00 0.00 ? 7  CYS A HB2  9  
ATOM   6344  H HB3  . CYS A 1 7  ? -3.664  7.533   -8.197  1.00 0.00 ? 7  CYS A HB3  9  
ATOM   6345  N N    . THR A 1 8  ? -1.763  9.506   -7.042  1.00 0.00 ? 8  THR A N    9  
ATOM   6346  C CA   . THR A 1 8  ? -1.726  10.965  -6.743  1.00 0.00 ? 8  THR A CA   9  
ATOM   6347  C C    . THR A 1 8  ? -0.268  11.412  -6.608  1.00 0.00 ? 8  THR A C    9  
ATOM   6348  O O    . THR A 1 8  ? 0.064   12.562  -6.820  1.00 0.00 ? 8  THR A O    9  
ATOM   6349  C CB   . THR A 1 8  ? -2.467  11.238  -5.429  1.00 0.00 ? 8  THR A CB   9  
ATOM   6350  O OG1  . THR A 1 8  ? -2.694  12.635  -5.294  1.00 0.00 ? 8  THR A OG1  9  
ATOM   6351  C CG2  . THR A 1 8  ? -1.628  10.742  -4.250  1.00 0.00 ? 8  THR A CG2  9  
ATOM   6352  H H    . THR A 1 8  ? -1.981  8.866   -6.332  1.00 0.00 ? 8  THR A H    9  
ATOM   6353  H HA   . THR A 1 8  ? -2.198  11.511  -7.546  1.00 0.00 ? 8  THR A HA   9  
ATOM   6354  H HB   . THR A 1 8  ? -3.412  10.718  -5.433  1.00 0.00 ? 8  THR A HB   9  
ATOM   6355  H HG1  . THR A 1 8  ? -2.786  13.007  -6.174  1.00 0.00 ? 8  THR A HG1  9  
ATOM   6356  H HG21 . THR A 1 8  ? -0.758  11.373  -4.138  1.00 0.00 ? 8  THR A HG21 9  
ATOM   6357  H HG22 . THR A 1 8  ? -1.314  9.725   -4.434  1.00 0.00 ? 8  THR A HG22 9  
ATOM   6358  H HG23 . THR A 1 8  ? -2.218  10.780  -3.347  1.00 0.00 ? 8  THR A HG23 9  
ATOM   6359  N N    . SER A 1 9  ? 0.605   10.506  -6.254  1.00 0.00 ? 9  SER A N    9  
ATOM   6360  C CA   . SER A 1 9  ? 2.043   10.871  -6.102  1.00 0.00 ? 9  SER A CA   9  
ATOM   6361  C C    . SER A 1 9  ? 2.913   9.654   -6.429  1.00 0.00 ? 9  SER A C    9  
ATOM   6362  O O    . SER A 1 9  ? 2.446   8.679   -6.980  1.00 0.00 ? 9  SER A O    9  
ATOM   6363  C CB   . SER A 1 9  ? 2.303   11.313  -4.663  1.00 0.00 ? 9  SER A CB   9  
ATOM   6364  O OG   . SER A 1 9  ? 1.226   12.129  -4.221  1.00 0.00 ? 9  SER A OG   9  
ATOM   6365  H H    . SER A 1 9  ? 0.314   9.586   -6.087  1.00 0.00 ? 9  SER A H    9  
ATOM   6366  H HA   . SER A 1 9  ? 2.283   11.679  -6.778  1.00 0.00 ? 9  SER A HA   9  
ATOM   6367  H HB2  . SER A 1 9  ? 2.377   10.448  -4.025  1.00 0.00 ? 9  SER A HB2  9  
ATOM   6368  H HB3  . SER A 1 9  ? 3.231   11.869  -4.621  1.00 0.00 ? 9  SER A HB3  9  
ATOM   6369  H HG   . SER A 1 9  ? 1.056   12.787  -4.899  1.00 0.00 ? 9  SER A HG   9  
ATOM   6370  N N    . ILE A 1 10 ? 4.174   9.700   -6.093  1.00 0.00 ? 10 ILE A N    9  
ATOM   6371  C CA   . ILE A 1 10 ? 5.066   8.541   -6.385  1.00 0.00 ? 10 ILE A CA   9  
ATOM   6372  C C    . ILE A 1 10 ? 4.871   7.471   -5.306  1.00 0.00 ? 10 ILE A C    9  
ATOM   6373  O O    . ILE A 1 10 ? 4.624   7.772   -4.155  1.00 0.00 ? 10 ILE A O    9  
ATOM   6374  C CB   . ILE A 1 10 ? 6.529   9.016   -6.409  1.00 0.00 ? 10 ILE A CB   9  
ATOM   6375  C CG1  . ILE A 1 10 ? 6.847   9.595   -7.788  1.00 0.00 ? 10 ILE A CG1  9  
ATOM   6376  C CG2  . ILE A 1 10 ? 7.479   7.844   -6.130  1.00 0.00 ? 10 ILE A CG2  9  
ATOM   6377  C CD1  . ILE A 1 10 ? 8.327   9.977   -7.854  1.00 0.00 ? 10 ILE A CD1  9  
ATOM   6378  H H    . ILE A 1 10 ? 4.534   10.494  -5.647  1.00 0.00 ? 10 ILE A H    9  
ATOM   6379  H HA   . ILE A 1 10 ? 4.808   8.127   -7.349  1.00 0.00 ? 10 ILE A HA   9  
ATOM   6380  H HB   . ILE A 1 10 ? 6.670   9.779   -5.657  1.00 0.00 ? 10 ILE A HB   9  
ATOM   6381  H HG12 . ILE A 1 10 ? 6.632   8.856   -8.547  1.00 0.00 ? 10 ILE A HG12 9  
ATOM   6382  H HG13 . ILE A 1 10 ? 6.243   10.473  -7.959  1.00 0.00 ? 10 ILE A HG13 9  
ATOM   6383  H HG21 . ILE A 1 10 ? 8.489   8.215   -6.045  1.00 0.00 ? 10 ILE A HG21 9  
ATOM   6384  H HG22 . ILE A 1 10 ? 7.424   7.133   -6.941  1.00 0.00 ? 10 ILE A HG22 9  
ATOM   6385  H HG23 . ILE A 1 10 ? 7.196   7.359   -5.207  1.00 0.00 ? 10 ILE A HG23 9  
ATOM   6386  H HD11 . ILE A 1 10 ? 8.564   10.328  -8.847  1.00 0.00 ? 10 ILE A HD11 9  
ATOM   6387  H HD12 . ILE A 1 10 ? 8.933   9.113   -7.623  1.00 0.00 ? 10 ILE A HD12 9  
ATOM   6388  H HD13 . ILE A 1 10 ? 8.529   10.759  -7.138  1.00 0.00 ? 10 ILE A HD13 9  
ATOM   6389  N N    . CYS A 1 11 ? 4.981   6.224   -5.674  1.00 0.00 ? 11 CYS A N    9  
ATOM   6390  C CA   . CYS A 1 11 ? 4.804   5.132   -4.676  1.00 0.00 ? 11 CYS A CA   9  
ATOM   6391  C C    . CYS A 1 11 ? 6.007   4.189   -4.739  1.00 0.00 ? 11 CYS A C    9  
ATOM   6392  O O    . CYS A 1 11 ? 6.831   4.280   -5.627  1.00 0.00 ? 11 CYS A O    9  
ATOM   6393  C CB   . CYS A 1 11 ? 3.530   4.351   -5.001  1.00 0.00 ? 11 CYS A CB   9  
ATOM   6394  S SG   . CYS A 1 11 ? 2.464   4.294   -3.539  1.00 0.00 ? 11 CYS A SG   9  
ATOM   6395  H H    . CYS A 1 11 ? 5.181   6.005   -6.608  1.00 0.00 ? 11 CYS A H    9  
ATOM   6396  H HA   . CYS A 1 11 ? 4.727   5.555   -3.685  1.00 0.00 ? 11 CYS A HA   9  
ATOM   6397  H HB2  . CYS A 1 11 ? 3.005   4.842   -5.808  1.00 0.00 ? 11 CYS A HB2  9  
ATOM   6398  H HB3  . CYS A 1 11 ? 3.788   3.347   -5.298  1.00 0.00 ? 11 CYS A HB3  9  
ATOM   6399  N N    . SER A 1 12 ? 6.115   3.284   -3.805  1.00 0.00 ? 12 SER A N    9  
ATOM   6400  C CA   . SER A 1 12 ? 7.265   2.337   -3.820  1.00 0.00 ? 12 SER A CA   9  
ATOM   6401  C C    . SER A 1 12 ? 6.746   0.907   -3.976  1.00 0.00 ? 12 SER A C    9  
ATOM   6402  O O    . SER A 1 12 ? 5.617   0.603   -3.640  1.00 0.00 ? 12 SER A O    9  
ATOM   6403  C CB   . SER A 1 12 ? 8.046   2.454   -2.510  1.00 0.00 ? 12 SER A CB   9  
ATOM   6404  O OG   . SER A 1 12 ? 7.135   2.654   -1.437  1.00 0.00 ? 12 SER A OG   9  
ATOM   6405  H H    . SER A 1 12 ? 5.440   3.225   -3.098  1.00 0.00 ? 12 SER A H    9  
ATOM   6406  H HA   . SER A 1 12 ? 7.916   2.576   -4.649  1.00 0.00 ? 12 SER A HA   9  
ATOM   6407  H HB2  . SER A 1 12 ? 8.602   1.548   -2.339  1.00 0.00 ? 12 SER A HB2  9  
ATOM   6408  H HB3  . SER A 1 12 ? 8.731   3.289   -2.575  1.00 0.00 ? 12 SER A HB3  9  
ATOM   6409  H HG   . SER A 1 12 ? 7.218   1.910   -0.836  1.00 0.00 ? 12 SER A HG   9  
ATOM   6410  N N    . LEU A 1 13 ? 7.562   0.024   -4.478  1.00 0.00 ? 13 LEU A N    9  
ATOM   6411  C CA   . LEU A 1 13 ? 7.110   -1.387  -4.648  1.00 0.00 ? 13 LEU A CA   9  
ATOM   6412  C C    . LEU A 1 13 ? 7.005   -2.044  -3.270  1.00 0.00 ? 13 LEU A C    9  
ATOM   6413  O O    . LEU A 1 13 ? 6.369   -3.066  -3.107  1.00 0.00 ? 13 LEU A O    9  
ATOM   6414  C CB   . LEU A 1 13 ? 8.113   -2.177  -5.503  1.00 0.00 ? 13 LEU A CB   9  
ATOM   6415  C CG   . LEU A 1 13 ? 8.925   -1.231  -6.392  1.00 0.00 ? 13 LEU A CG   9  
ATOM   6416  C CD1  . LEU A 1 13 ? 10.245  -0.885  -5.697  1.00 0.00 ? 13 LEU A CD1  9  
ATOM   6417  C CD2  . LEU A 1 13 ? 9.222   -1.918  -7.726  1.00 0.00 ? 13 LEU A CD2  9  
ATOM   6418  H H    . LEU A 1 13 ? 8.470   0.288   -4.735  1.00 0.00 ? 13 LEU A H    9  
ATOM   6419  H HA   . LEU A 1 13 ? 6.138   -1.396  -5.129  1.00 0.00 ? 13 LEU A HA   9  
ATOM   6420  H HB2  . LEU A 1 13 ? 8.783   -2.721  -4.855  1.00 0.00 ? 13 LEU A HB2  9  
ATOM   6421  H HB3  . LEU A 1 13 ? 7.575   -2.875  -6.126  1.00 0.00 ? 13 LEU A HB3  9  
ATOM   6422  H HG   . LEU A 1 13 ? 8.361   -0.326  -6.567  1.00 0.00 ? 13 LEU A HG   9  
ATOM   6423  H HD11 . LEU A 1 13 ? 10.220  -1.245  -4.679  1.00 0.00 ? 13 LEU A HD11 9  
ATOM   6424  H HD12 . LEU A 1 13 ? 10.382  0.186   -5.697  1.00 0.00 ? 13 LEU A HD12 9  
ATOM   6425  H HD13 . LEU A 1 13 ? 11.063  -1.352  -6.226  1.00 0.00 ? 13 LEU A HD13 9  
ATOM   6426  H HD21 . LEU A 1 13 ? 8.587   -1.502  -8.495  1.00 0.00 ? 13 LEU A HD21 9  
ATOM   6427  H HD22 . LEU A 1 13 ? 9.029   -2.977  -7.636  1.00 0.00 ? 13 LEU A HD22 9  
ATOM   6428  H HD23 . LEU A 1 13 ? 10.257  -1.763  -7.989  1.00 0.00 ? 13 LEU A HD23 9  
ATOM   6429  N N    . TYR A 1 14 ? 7.620   -1.461  -2.273  1.00 0.00 ? 14 TYR A N    9  
ATOM   6430  C CA   . TYR A 1 14 ? 7.547   -2.053  -0.910  1.00 0.00 ? 14 TYR A CA   9  
ATOM   6431  C C    . TYR A 1 14 ? 6.098   -2.028  -0.454  1.00 0.00 ? 14 TYR A C    9  
ATOM   6432  O O    . TYR A 1 14 ? 5.591   -2.973  0.117   1.00 0.00 ? 14 TYR A O    9  
ATOM   6433  C CB   . TYR A 1 14 ? 8.405   -1.232  0.058   1.00 0.00 ? 14 TYR A CB   9  
ATOM   6434  C CG   . TYR A 1 14 ? 9.879   -1.478  -0.215  1.00 0.00 ? 14 TYR A CG   9  
ATOM   6435  C CD1  . TYR A 1 14 ? 10.286  -2.140  -1.385  1.00 0.00 ? 14 TYR A CD1  9  
ATOM   6436  C CD2  . TYR A 1 14 ? 10.840  -1.041  0.708   1.00 0.00 ? 14 TYR A CD2  9  
ATOM   6437  C CE1  . TYR A 1 14 ? 11.647  -2.361  -1.628  1.00 0.00 ? 14 TYR A CE1  9  
ATOM   6438  C CE2  . TYR A 1 14 ? 12.201  -1.262  0.463   1.00 0.00 ? 14 TYR A CE2  9  
ATOM   6439  C CZ   . TYR A 1 14 ? 12.604  -1.922  -0.705  1.00 0.00 ? 14 TYR A CZ   9  
ATOM   6440  O OH   . TYR A 1 14 ? 13.946  -2.141  -0.945  1.00 0.00 ? 14 TYR A OH   9  
ATOM   6441  H H    . TYR A 1 14 ? 8.120   -0.636  -2.421  1.00 0.00 ? 14 TYR A H    9  
ATOM   6442  H HA   . TYR A 1 14 ? 7.897   -3.068  -0.938  1.00 0.00 ? 14 TYR A HA   9  
ATOM   6443  H HB2  . TYR A 1 14 ? 8.185   -0.181  -0.073  1.00 0.00 ? 14 TYR A HB2  9  
ATOM   6444  H HB3  . TYR A 1 14 ? 8.174   -1.520  1.073   1.00 0.00 ? 14 TYR A HB3  9  
ATOM   6445  H HD1  . TYR A 1 14 ? 9.552   -2.480  -2.098  1.00 0.00 ? 14 TYR A HD1  9  
ATOM   6446  H HD2  . TYR A 1 14 ? 10.533  -0.531  1.608   1.00 0.00 ? 14 TYR A HD2  9  
ATOM   6447  H HE1  . TYR A 1 14 ? 11.959  -2.871  -2.527  1.00 0.00 ? 14 TYR A HE1  9  
ATOM   6448  H HE2  . TYR A 1 14 ? 12.940  -0.924  1.174   1.00 0.00 ? 14 TYR A HE2  9  
ATOM   6449  H HH   . TYR A 1 14 ? 14.344  -2.462  -0.134  1.00 0.00 ? 14 TYR A HH   9  
ATOM   6450  N N    . GLN A 1 15 ? 5.424   -0.953  -0.726  1.00 0.00 ? 15 GLN A N    9  
ATOM   6451  C CA   . GLN A 1 15 ? 3.996   -0.855  -0.337  1.00 0.00 ? 15 GLN A CA   9  
ATOM   6452  C C    . GLN A 1 15 ? 3.174   -1.656  -1.344  1.00 0.00 ? 15 GLN A C    9  
ATOM   6453  O O    . GLN A 1 15 ? 2.053   -2.048  -1.084  1.00 0.00 ? 15 GLN A O    9  
ATOM   6454  C CB   . GLN A 1 15 ? 3.554   0.611   -0.350  1.00 0.00 ? 15 GLN A CB   9  
ATOM   6455  C CG   . GLN A 1 15 ? 4.179   1.342   0.839   1.00 0.00 ? 15 GLN A CG   9  
ATOM   6456  C CD   . GLN A 1 15 ? 3.199   2.392   1.370   1.00 0.00 ? 15 GLN A CD   9  
ATOM   6457  O OE1  . GLN A 1 15 ? 2.890   2.410   2.545   1.00 0.00 ? 15 GLN A OE1  9  
ATOM   6458  N NE2  . GLN A 1 15 ? 2.698   3.273   0.550   1.00 0.00 ? 15 GLN A NE2  9  
ATOM   6459  H H    . GLN A 1 15 ? 5.858   -0.217  -1.201  1.00 0.00 ? 15 GLN A H    9  
ATOM   6460  H HA   . GLN A 1 15 ? 3.865   -1.268  0.650   1.00 0.00 ? 15 GLN A HA   9  
ATOM   6461  H HB2  . GLN A 1 15 ? 3.878   1.076   -1.271  1.00 0.00 ? 15 GLN A HB2  9  
ATOM   6462  H HB3  . GLN A 1 15 ? 2.478   0.663   -0.280  1.00 0.00 ? 15 GLN A HB3  9  
ATOM   6463  H HG2  . GLN A 1 15 ? 4.403   0.630   1.622   1.00 0.00 ? 15 GLN A HG2  9  
ATOM   6464  H HG3  . GLN A 1 15 ? 5.090   1.829   0.525   1.00 0.00 ? 15 GLN A HG3  9  
ATOM   6465  H HE21 . GLN A 1 15 ? 2.948   3.259   -0.398  1.00 0.00 ? 15 GLN A HE21 9  
ATOM   6466  H HE22 . GLN A 1 15 ? 2.070   3.949   0.881   1.00 0.00 ? 15 GLN A HE22 9  
ATOM   6467  N N    . LEU A 1 16 ? 3.738   -1.912  -2.494  1.00 0.00 ? 16 LEU A N    9  
ATOM   6468  C CA   . LEU A 1 16 ? 3.019   -2.693  -3.529  1.00 0.00 ? 16 LEU A CA   9  
ATOM   6469  C C    . LEU A 1 16 ? 3.013   -4.168  -3.126  1.00 0.00 ? 16 LEU A C    9  
ATOM   6470  O O    . LEU A 1 16 ? 2.224   -4.954  -3.610  1.00 0.00 ? 16 LEU A O    9  
ATOM   6471  C CB   . LEU A 1 16 ? 3.747   -2.522  -4.861  1.00 0.00 ? 16 LEU A CB   9  
ATOM   6472  C CG   . LEU A 1 16 ? 3.299   -1.217  -5.523  1.00 0.00 ? 16 LEU A CG   9  
ATOM   6473  C CD1  . LEU A 1 16 ? 3.918   -1.094  -6.916  1.00 0.00 ? 16 LEU A CD1  9  
ATOM   6474  C CD2  . LEU A 1 16 ? 1.777   -1.211  -5.650  1.00 0.00 ? 16 LEU A CD2  9  
ATOM   6475  H H    . LEU A 1 16 ? 4.645   -1.593  -2.677  1.00 0.00 ? 16 LEU A H    9  
ATOM   6476  H HA   . LEU A 1 16 ? 2.006   -2.336  -3.617  1.00 0.00 ? 16 LEU A HA   9  
ATOM   6477  H HB2  . LEU A 1 16 ? 4.809   -2.492  -4.681  1.00 0.00 ? 16 LEU A HB2  9  
ATOM   6478  H HB3  . LEU A 1 16 ? 3.521   -3.347  -5.505  1.00 0.00 ? 16 LEU A HB3  9  
ATOM   6479  H HG   . LEU A 1 16 ? 3.614   -0.380  -4.915  1.00 0.00 ? 16 LEU A HG   9  
ATOM   6480  H HD11 . LEU A 1 16 ? 4.198   -2.074  -7.273  1.00 0.00 ? 16 LEU A HD11 9  
ATOM   6481  H HD12 . LEU A 1 16 ? 4.794   -0.464  -6.866  1.00 0.00 ? 16 LEU A HD12 9  
ATOM   6482  H HD13 . LEU A 1 16 ? 3.198   -0.656  -7.591  1.00 0.00 ? 16 LEU A HD13 9  
ATOM   6483  H HD21 . LEU A 1 16 ? 1.361   -0.494  -4.960  1.00 0.00 ? 16 LEU A HD21 9  
ATOM   6484  H HD22 . LEU A 1 16 ? 1.395   -2.196  -5.422  1.00 0.00 ? 16 LEU A HD22 9  
ATOM   6485  H HD23 . LEU A 1 16 ? 1.502   -0.944  -6.659  1.00 0.00 ? 16 LEU A HD23 9  
ATOM   6486  N N    . GLU A 1 17 ? 3.886   -4.544  -2.233  1.00 0.00 ? 17 GLU A N    9  
ATOM   6487  C CA   . GLU A 1 17 ? 3.932   -5.964  -1.784  1.00 0.00 ? 17 GLU A CA   9  
ATOM   6488  C C    . GLU A 1 17 ? 2.784   -6.216  -0.812  1.00 0.00 ? 17 GLU A C    9  
ATOM   6489  O O    . GLU A 1 17 ? 2.274   -7.315  -0.703  1.00 0.00 ? 17 GLU A O    9  
ATOM   6490  C CB   . GLU A 1 17 ? 5.264   -6.237  -1.084  1.00 0.00 ? 17 GLU A CB   9  
ATOM   6491  C CG   . GLU A 1 17 ? 6.362   -6.435  -2.130  1.00 0.00 ? 17 GLU A CG   9  
ATOM   6492  C CD   . GLU A 1 17 ? 7.388   -7.440  -1.606  1.00 0.00 ? 17 GLU A CD   9  
ATOM   6493  O OE1  . GLU A 1 17 ? 7.629   -7.442  -0.410  1.00 0.00 ? 17 GLU A OE1  9  
ATOM   6494  O OE2  . GLU A 1 17 ? 7.915   -8.192  -2.409  1.00 0.00 ? 17 GLU A OE2  9  
ATOM   6495  H H    . GLU A 1 17 ? 4.507   -3.889  -1.851  1.00 0.00 ? 17 GLU A H    9  
ATOM   6496  H HA   . GLU A 1 17 ? 3.829   -6.613  -2.636  1.00 0.00 ? 17 GLU A HA   9  
ATOM   6497  H HB2  . GLU A 1 17 ? 5.516   -5.399  -0.450  1.00 0.00 ? 17 GLU A HB2  9  
ATOM   6498  H HB3  . GLU A 1 17 ? 5.177   -7.130  -0.483  1.00 0.00 ? 17 GLU A HB3  9  
ATOM   6499  H HG2  . GLU A 1 17 ? 5.924   -6.808  -3.045  1.00 0.00 ? 17 GLU A HG2  9  
ATOM   6500  H HG3  . GLU A 1 17 ? 6.851   -5.491  -2.322  1.00 0.00 ? 17 GLU A HG3  9  
ATOM   6501  N N    . ASN A 1 18 ? 2.371   -5.203  -0.107  1.00 0.00 ? 18 ASN A N    9  
ATOM   6502  C CA   . ASN A 1 18 ? 1.253   -5.371  0.858   1.00 0.00 ? 18 ASN A CA   9  
ATOM   6503  C C    . ASN A 1 18 ? -0.073  -5.406  0.095   1.00 0.00 ? 18 ASN A C    9  
ATOM   6504  O O    . ASN A 1 18 ? -1.129  -5.580  0.672   1.00 0.00 ? 18 ASN A O    9  
ATOM   6505  C CB   . ASN A 1 18 ? 1.252   -4.196  1.836   1.00 0.00 ? 18 ASN A CB   9  
ATOM   6506  C CG   . ASN A 1 18 ? 1.921   -4.621  3.145   1.00 0.00 ? 18 ASN A CG   9  
ATOM   6507  O OD1  . ASN A 1 18 ? 1.855   -5.773  3.529   1.00 0.00 ? 18 ASN A OD1  9  
ATOM   6508  N ND2  . ASN A 1 18 ? 2.566   -3.735  3.853   1.00 0.00 ? 18 ASN A ND2  9  
ATOM   6509  H H    . ASN A 1 18 ? 2.796   -4.329  -0.218  1.00 0.00 ? 18 ASN A H    9  
ATOM   6510  H HA   . ASN A 1 18 ? 1.382   -6.294  1.403   1.00 0.00 ? 18 ASN A HA   9  
ATOM   6511  H HB2  . ASN A 1 18 ? 1.795   -3.368  1.404   1.00 0.00 ? 18 ASN A HB2  9  
ATOM   6512  H HB3  . ASN A 1 18 ? 0.236   -3.895  2.034   1.00 0.00 ? 18 ASN A HB3  9  
ATOM   6513  H HD21 . ASN A 1 18 ? 2.620   -2.807  3.544   1.00 0.00 ? 18 ASN A HD21 9  
ATOM   6514  H HD22 . ASN A 1 18 ? 2.998   -3.998  4.692   1.00 0.00 ? 18 ASN A HD22 9  
ATOM   6515  N N    . TYR A 1 19 ? -0.026  -5.246  -1.200  1.00 0.00 ? 19 TYR A N    9  
ATOM   6516  C CA   . TYR A 1 19 ? -1.278  -5.272  -2.004  1.00 0.00 ? 19 TYR A CA   9  
ATOM   6517  C C    . TYR A 1 19 ? -1.255  -6.490  -2.924  1.00 0.00 ? 19 TYR A C    9  
ATOM   6518  O O    . TYR A 1 19 ? -1.978  -6.563  -3.897  1.00 0.00 ? 19 TYR A O    9  
ATOM   6519  C CB   . TYR A 1 19 ? -1.366  -3.997  -2.841  1.00 0.00 ? 19 TYR A CB   9  
ATOM   6520  C CG   . TYR A 1 19 ? -1.526  -2.807  -1.925  1.00 0.00 ? 19 TYR A CG   9  
ATOM   6521  C CD1  . TYR A 1 19 ? -2.500  -2.824  -0.918  1.00 0.00 ? 19 TYR A CD1  9  
ATOM   6522  C CD2  . TYR A 1 19 ? -0.698  -1.687  -2.082  1.00 0.00 ? 19 TYR A CD2  9  
ATOM   6523  C CE1  . TYR A 1 19 ? -2.646  -1.721  -0.067  1.00 0.00 ? 19 TYR A CE1  9  
ATOM   6524  C CE2  . TYR A 1 19 ? -0.845  -0.583  -1.231  1.00 0.00 ? 19 TYR A CE2  9  
ATOM   6525  C CZ   . TYR A 1 19 ? -1.819  -0.600  -0.223  1.00 0.00 ? 19 TYR A CZ   9  
ATOM   6526  O OH   . TYR A 1 19 ? -1.964  0.487   0.614   1.00 0.00 ? 19 TYR A OH   9  
ATOM   6527  H H    . TYR A 1 19 ? 0.834   -5.109  -1.647  1.00 0.00 ? 19 TYR A H    9  
ATOM   6528  H HA   . TYR A 1 19 ? -2.131  -5.332  -1.345  1.00 0.00 ? 19 TYR A HA   9  
ATOM   6529  H HB2  . TYR A 1 19 ? -0.463  -3.886  -3.423  1.00 0.00 ? 19 TYR A HB2  9  
ATOM   6530  H HB3  . TYR A 1 19 ? -2.216  -4.058  -3.502  1.00 0.00 ? 19 TYR A HB3  9  
ATOM   6531  H HD1  . TYR A 1 19 ? -3.137  -3.687  -0.798  1.00 0.00 ? 19 TYR A HD1  9  
ATOM   6532  H HD2  . TYR A 1 19 ? 0.052   -1.674  -2.858  1.00 0.00 ? 19 TYR A HD2  9  
ATOM   6533  H HE1  . TYR A 1 19 ? -3.397  -1.733  0.710   1.00 0.00 ? 19 TYR A HE1  9  
ATOM   6534  H HE2  . TYR A 1 19 ? -0.208  0.280   -1.352  1.00 0.00 ? 19 TYR A HE2  9  
ATOM   6535  H HH   . TYR A 1 19 ? -2.085  0.159   1.508   1.00 0.00 ? 19 TYR A HH   9  
ATOM   6536  N N    . CYS A 1 20 ? -0.423  -7.448  -2.622  1.00 0.00 ? 20 CYS A N    9  
ATOM   6537  C CA   . CYS A 1 20 ? -0.342  -8.665  -3.475  1.00 0.00 ? 20 CYS A CA   9  
ATOM   6538  C C    . CYS A 1 20 ? -1.508  -9.600  -3.150  1.00 0.00 ? 20 CYS A C    9  
ATOM   6539  O O    . CYS A 1 20 ? -2.586  -9.478  -3.699  1.00 0.00 ? 20 CYS A O    9  
ATOM   6540  C CB   . CYS A 1 20 ? 0.983   -9.382  -3.207  1.00 0.00 ? 20 CYS A CB   9  
ATOM   6541  S SG   . CYS A 1 20 ? 2.278   -8.665  -4.249  1.00 0.00 ? 20 CYS A SG   9  
ATOM   6542  H H    . CYS A 1 20 ? 0.152   -7.366  -1.833  1.00 0.00 ? 20 CYS A H    9  
ATOM   6543  H HA   . CYS A 1 20 ? -0.391  -8.382  -4.512  1.00 0.00 ? 20 CYS A HA   9  
ATOM   6544  H HB2  . CYS A 1 20 ? 1.252   -9.266  -2.168  1.00 0.00 ? 20 CYS A HB2  9  
ATOM   6545  H HB3  . CYS A 1 20 ? 0.877   -10.432 -3.436  1.00 0.00 ? 20 CYS A HB3  9  
ATOM   6546  N N    . ASN A 1 21 ? -1.301  -10.532 -2.266  1.00 0.00 ? 21 ASN A N    9  
ATOM   6547  C CA   . ASN A 1 21 ? -2.395  -11.477 -1.907  1.00 0.00 ? 21 ASN A CA   9  
ATOM   6548  C C    . ASN A 1 21 ? -2.264  -11.877 -0.437  1.00 0.00 ? 21 ASN A C    9  
ATOM   6549  O O    . ASN A 1 21 ? -1.400  -11.332 0.231   1.00 0.00 ? 21 ASN A O    9  
ATOM   6550  C CB   . ASN A 1 21 ? -2.297  -12.726 -2.784  1.00 0.00 ? 21 ASN A CB   9  
ATOM   6551  C CG   . ASN A 1 21 ? -3.310  -12.628 -3.926  1.00 0.00 ? 21 ASN A CG   9  
ATOM   6552  O OD1  . ASN A 1 21 ? -4.015  -11.645 -4.044  1.00 0.00 ? 21 ASN A OD1  9  
ATOM   6553  N ND2  . ASN A 1 21 ? -3.415  -13.611 -4.778  1.00 0.00 ? 21 ASN A ND2  9  
ATOM   6554  O OXT  . ASN A 1 21 ? -3.029  -12.723 -0.003  1.00 0.00 ? 21 ASN A OXT  9  
ATOM   6555  H H    . ASN A 1 21 ? -0.425  -10.613 -1.838  1.00 0.00 ? 21 ASN A H    9  
ATOM   6556  H HA   . ASN A 1 21 ? -3.350  -10.999 -2.067  1.00 0.00 ? 21 ASN A HA   9  
ATOM   6557  H HB2  . ASN A 1 21 ? -1.300  -12.802 -3.192  1.00 0.00 ? 21 ASN A HB2  9  
ATOM   6558  H HB3  . ASN A 1 21 ? -2.512  -13.601 -2.190  1.00 0.00 ? 21 ASN A HB3  9  
ATOM   6559  H HD21 . ASN A 1 21 ? -2.846  -14.404 -4.683  1.00 0.00 ? 21 ASN A HD21 9  
ATOM   6560  H HD22 . ASN A 1 21 ? -4.061  -13.557 -5.512  1.00 0.00 ? 21 ASN A HD22 9  
ATOM   6561  N N    . PHE B 2 1  ? 17.081  1.878   -5.804  1.00 0.00 ? 1  PHE B N    9  
ATOM   6562  C CA   . PHE B 2 1  ? 16.050  1.896   -6.880  1.00 0.00 ? 1  PHE B CA   9  
ATOM   6563  C C    . PHE B 2 1  ? 15.576  3.332   -7.107  1.00 0.00 ? 1  PHE B C    9  
ATOM   6564  O O    . PHE B 2 1  ? 15.979  4.246   -6.415  1.00 0.00 ? 1  PHE B O    9  
ATOM   6565  C CB   . PHE B 2 1  ? 14.860  1.028   -6.466  1.00 0.00 ? 1  PHE B CB   9  
ATOM   6566  C CG   . PHE B 2 1  ? 14.070  0.636   -7.698  1.00 0.00 ? 1  PHE B CG   9  
ATOM   6567  C CD1  . PHE B 2 1  ? 14.714  -0.001  -8.770  1.00 0.00 ? 1  PHE B CD1  9  
ATOM   6568  C CD2  . PHE B 2 1  ? 12.696  0.909   -7.771  1.00 0.00 ? 1  PHE B CD2  9  
ATOM   6569  C CE1  . PHE B 2 1  ? 13.984  -0.362  -9.911  1.00 0.00 ? 1  PHE B CE1  9  
ATOM   6570  C CE2  . PHE B 2 1  ? 11.968  0.546   -8.913  1.00 0.00 ? 1  PHE B CE2  9  
ATOM   6571  C CZ   . PHE B 2 1  ? 12.613  -0.090  -9.982  1.00 0.00 ? 1  PHE B CZ   9  
ATOM   6572  H H1   . PHE B 2 1  ? 18.008  2.126   -6.206  1.00 0.00 ? 1  PHE B H1   9  
ATOM   6573  H H2   . PHE B 2 1  ? 17.128  0.928   -5.383  1.00 0.00 ? 1  PHE B H2   9  
ATOM   6574  H H3   . PHE B 2 1  ? 16.829  2.571   -5.070  1.00 0.00 ? 1  PHE B H3   9  
ATOM   6575  H HA   . PHE B 2 1  ? 16.477  1.510   -7.793  1.00 0.00 ? 1  PHE B HA   9  
ATOM   6576  H HB2  . PHE B 2 1  ? 15.220  0.139   -5.966  1.00 0.00 ? 1  PHE B HB2  9  
ATOM   6577  H HB3  . PHE B 2 1  ? 14.225  1.586   -5.791  1.00 0.00 ? 1  PHE B HB3  9  
ATOM   6578  H HD1  . PHE B 2 1  ? 15.770  -0.211  -8.719  1.00 0.00 ? 1  PHE B HD1  9  
ATOM   6579  H HD2  . PHE B 2 1  ? 12.197  1.399   -6.950  1.00 0.00 ? 1  PHE B HD2  9  
ATOM   6580  H HE1  . PHE B 2 1  ? 14.481  -0.853  -10.735 1.00 0.00 ? 1  PHE B HE1  9  
ATOM   6581  H HE2  . PHE B 2 1  ? 10.911  0.755   -8.968  1.00 0.00 ? 1  PHE B HE2  9  
ATOM   6582  H HZ   . PHE B 2 1  ? 12.052  -0.370  -10.860 1.00 0.00 ? 1  PHE B HZ   9  
ATOM   6583  N N    . VAL B 2 2  ? 14.721  3.539   -8.071  1.00 0.00 ? 2  VAL B N    9  
ATOM   6584  C CA   . VAL B 2 2  ? 14.222  4.917   -8.339  1.00 0.00 ? 2  VAL B CA   9  
ATOM   6585  C C    . VAL B 2 2  ? 12.716  4.980   -8.075  1.00 0.00 ? 2  VAL B C    9  
ATOM   6586  O O    . VAL B 2 2  ? 12.010  4.000   -8.213  1.00 0.00 ? 2  VAL B O    9  
ATOM   6587  C CB   . VAL B 2 2  ? 14.501  5.289   -9.796  1.00 0.00 ? 2  VAL B CB   9  
ATOM   6588  C CG1  . VAL B 2 2  ? 13.869  4.246   -10.720 1.00 0.00 ? 2  VAL B CG1  9  
ATOM   6589  C CG2  . VAL B 2 2  ? 13.899  6.663   -10.092 1.00 0.00 ? 2  VAL B CG2  9  
ATOM   6590  H H    . VAL B 2 2  ? 14.408  2.789   -8.618  1.00 0.00 ? 2  VAL B H    9  
ATOM   6591  H HA   . VAL B 2 2  ? 14.730  5.615   -7.689  1.00 0.00 ? 2  VAL B HA   9  
ATOM   6592  H HB   . VAL B 2 2  ? 15.569  5.317   -9.962  1.00 0.00 ? 2  VAL B HB   9  
ATOM   6593  H HG11 . VAL B 2 2  ? 12.793  4.303   -10.647 1.00 0.00 ? 2  VAL B HG11 9  
ATOM   6594  H HG12 . VAL B 2 2  ? 14.198  3.259   -10.428 1.00 0.00 ? 2  VAL B HG12 9  
ATOM   6595  H HG13 . VAL B 2 2  ? 14.171  4.439   -11.740 1.00 0.00 ? 2  VAL B HG13 9  
ATOM   6596  H HG21 . VAL B 2 2  ? 13.831  7.231   -9.175  1.00 0.00 ? 2  VAL B HG21 9  
ATOM   6597  H HG22 . VAL B 2 2  ? 12.912  6.541   -10.513 1.00 0.00 ? 2  VAL B HG22 9  
ATOM   6598  H HG23 . VAL B 2 2  ? 14.528  7.189   -10.794 1.00 0.00 ? 2  VAL B HG23 9  
ATOM   6599  N N    . ASN B 2 3  ? 12.221  6.125   -7.693  1.00 0.00 ? 3  ASN B N    9  
ATOM   6600  C CA   . ASN B 2 3  ? 10.763  6.255   -7.416  1.00 0.00 ? 3  ASN B CA   9  
ATOM   6601  C C    . ASN B 2 3  ? 10.070  6.908   -8.614  1.00 0.00 ? 3  ASN B C    9  
ATOM   6602  O O    . ASN B 2 3  ? 10.258  8.076   -8.891  1.00 0.00 ? 3  ASN B O    9  
ATOM   6603  C CB   . ASN B 2 3  ? 10.553  7.122   -6.171  1.00 0.00 ? 3  ASN B CB   9  
ATOM   6604  C CG   . ASN B 2 3  ? 11.738  6.956   -5.217  1.00 0.00 ? 3  ASN B CG   9  
ATOM   6605  O OD1  . ASN B 2 3  ? 12.693  7.704   -5.281  1.00 0.00 ? 3  ASN B OD1  9  
ATOM   6606  N ND2  . ASN B 2 3  ? 11.716  5.999   -4.329  1.00 0.00 ? 3  ASN B ND2  9  
ATOM   6607  H H    . ASN B 2 3  ? 12.809  6.901   -7.588  1.00 0.00 ? 3  ASN B H    9  
ATOM   6608  H HA   . ASN B 2 3  ? 10.337  5.277   -7.247  1.00 0.00 ? 3  ASN B HA   9  
ATOM   6609  H HB2  . ASN B 2 3  ? 10.469  8.158   -6.464  1.00 0.00 ? 3  ASN B HB2  9  
ATOM   6610  H HB3  . ASN B 2 3  ? 9.648   6.815   -5.669  1.00 0.00 ? 3  ASN B HB3  9  
ATOM   6611  H HD21 . ASN B 2 3  ? 10.944  5.396   -4.277  1.00 0.00 ? 3  ASN B HD21 9  
ATOM   6612  H HD22 . ASN B 2 3  ? 12.469  5.885   -3.714  1.00 0.00 ? 3  ASN B HD22 9  
ATOM   6613  N N    . GLN B 2 4  ? 9.269   6.163   -9.327  1.00 0.00 ? 4  GLN B N    9  
ATOM   6614  C CA   . GLN B 2 4  ? 8.563   6.739   -10.503 1.00 0.00 ? 4  GLN B CA   9  
ATOM   6615  C C    . GLN B 2 4  ? 7.089   6.957   -10.162 1.00 0.00 ? 4  GLN B C    9  
ATOM   6616  O O    . GLN B 2 4  ? 6.482   6.175   -9.457  1.00 0.00 ? 4  GLN B O    9  
ATOM   6617  C CB   . GLN B 2 4  ? 8.677   5.775   -11.684 1.00 0.00 ? 4  GLN B CB   9  
ATOM   6618  C CG   . GLN B 2 4  ? 9.767   6.262   -12.637 1.00 0.00 ? 4  GLN B CG   9  
ATOM   6619  C CD   . GLN B 2 4  ? 9.911   5.275   -13.797 1.00 0.00 ? 4  GLN B CD   9  
ATOM   6620  O OE1  . GLN B 2 4  ? 9.431   4.161   -13.725 1.00 0.00 ? 4  GLN B OE1  9  
ATOM   6621  N NE2  . GLN B 2 4  ? 10.556  5.639   -14.872 1.00 0.00 ? 4  GLN B NE2  9  
ATOM   6622  H H    . GLN B 2 4  ? 9.130   5.224   -9.089  1.00 0.00 ? 4  GLN B H    9  
ATOM   6623  H HA   . GLN B 2 4  ? 9.016   7.684   -10.766 1.00 0.00 ? 4  GLN B HA   9  
ATOM   6624  H HB2  . GLN B 2 4  ? 8.929   4.789   -11.320 1.00 0.00 ? 4  GLN B HB2  9  
ATOM   6625  H HB3  . GLN B 2 4  ? 7.734   5.734   -12.205 1.00 0.00 ? 4  GLN B HB3  9  
ATOM   6626  H HG2  . GLN B 2 4  ? 9.497   7.235   -13.022 1.00 0.00 ? 4  GLN B HG2  9  
ATOM   6627  H HG3  . GLN B 2 4  ? 10.705  6.333   -12.108 1.00 0.00 ? 4  GLN B HG3  9  
ATOM   6628  H HE21 . GLN B 2 4  ? 10.942  6.538   -14.932 1.00 0.00 ? 4  GLN B HE21 9  
ATOM   6629  H HE22 . GLN B 2 4  ? 10.654  5.013   -15.620 1.00 0.00 ? 4  GLN B HE22 9  
ATOM   6630  N N    . HIS B 2 5  ? 6.509   8.014   -10.661 1.00 0.00 ? 5  HIS B N    9  
ATOM   6631  C CA   . HIS B 2 5  ? 5.075   8.288   -10.371 1.00 0.00 ? 5  HIS B CA   9  
ATOM   6632  C C    . HIS B 2 5  ? 4.239   7.051   -10.704 1.00 0.00 ? 5  HIS B C    9  
ATOM   6633  O O    . HIS B 2 5  ? 4.427   6.418   -11.723 1.00 0.00 ? 5  HIS B O    9  
ATOM   6634  C CB   . HIS B 2 5  ? 4.604   9.468   -11.224 1.00 0.00 ? 5  HIS B CB   9  
ATOM   6635  C CG   . HIS B 2 5  ? 3.180   9.807   -10.879 1.00 0.00 ? 5  HIS B CG   9  
ATOM   6636  N ND1  . HIS B 2 5  ? 2.201   9.875   -11.849 1.00 0.00 ? 5  HIS B ND1  9  
ATOM   6637  C CD2  . HIS B 2 5  ? 2.589   10.097  -9.681  1.00 0.00 ? 5  HIS B CD2  9  
ATOM   6638  C CE1  . HIS B 2 5  ? 1.061   10.200  -11.222 1.00 0.00 ? 5  HIS B CE1  9  
ATOM   6639  N NE2  . HIS B 2 5  ? 1.250   10.347  -9.895  1.00 0.00 ? 5  HIS B NE2  9  
ATOM   6640  H H    . HIS B 2 5  ? 7.020   8.629   -11.227 1.00 0.00 ? 5  HIS B H    9  
ATOM   6641  H HA   . HIS B 2 5  ? 4.957   8.530   -9.326  1.00 0.00 ? 5  HIS B HA   9  
ATOM   6642  H HB2  . HIS B 2 5  ? 5.235   10.323  -11.030 1.00 0.00 ? 5  HIS B HB2  9  
ATOM   6643  H HB3  . HIS B 2 5  ? 4.669   9.203   -12.268 1.00 0.00 ? 5  HIS B HB3  9  
ATOM   6644  H HD2  . HIS B 2 5  ? 3.089   10.125  -8.724  1.00 0.00 ? 5  HIS B HD2  9  
ATOM   6645  H HE1  . HIS B 2 5  ? 0.111   10.329  -11.718 1.00 0.00 ? 5  HIS B HE1  9  
ATOM   6646  H HE2  . HIS B 2 5  ? 0.576   10.581  -9.222  1.00 0.00 ? 5  HIS B HE2  9  
ATOM   6647  N N    . LEU B 2 6  ? 3.314   6.709   -9.851  1.00 0.00 ? 6  LEU B N    9  
ATOM   6648  C CA   . LEU B 2 6  ? 2.460   5.520   -10.114 1.00 0.00 ? 6  LEU B CA   9  
ATOM   6649  C C    . LEU B 2 6  ? 1.071   5.990   -10.543 1.00 0.00 ? 6  LEU B C    9  
ATOM   6650  O O    . LEU B 2 6  ? 0.785   7.166   -10.537 1.00 0.00 ? 6  LEU B O    9  
ATOM   6651  C CB   . LEU B 2 6  ? 2.339   4.688   -8.834  1.00 0.00 ? 6  LEU B CB   9  
ATOM   6652  C CG   . LEU B 2 6  ? 3.397   3.583   -8.837  1.00 0.00 ? 6  LEU B CG   9  
ATOM   6653  C CD1  . LEU B 2 6  ? 3.253   2.746   -10.107 1.00 0.00 ? 6  LEU B CD1  9  
ATOM   6654  C CD2  . LEU B 2 6  ? 4.789   4.211   -8.798  1.00 0.00 ? 6  LEU B CD2  9  
ATOM   6655  H H    . LEU B 2 6  ? 3.178   7.238   -9.038  1.00 0.00 ? 6  LEU B H    9  
ATOM   6656  H HA   . LEU B 2 6  ? 2.899   4.920   -10.898 1.00 0.00 ? 6  LEU B HA   9  
ATOM   6657  H HB2  . LEU B 2 6  ? 2.487   5.327   -7.975  1.00 0.00 ? 6  LEU B HB2  9  
ATOM   6658  H HB3  . LEU B 2 6  ? 1.357   4.241   -8.786  1.00 0.00 ? 6  LEU B HB3  9  
ATOM   6659  H HG   . LEU B 2 6  ? 3.260   2.951   -7.972  1.00 0.00 ? 6  LEU B HG   9  
ATOM   6660  H HD11 . LEU B 2 6  ? 4.124   2.886   -10.730 1.00 0.00 ? 6  LEU B HD11 9  
ATOM   6661  H HD12 . LEU B 2 6  ? 2.371   3.060   -10.643 1.00 0.00 ? 6  LEU B HD12 9  
ATOM   6662  H HD13 . LEU B 2 6  ? 3.162   1.704   -9.842  1.00 0.00 ? 6  LEU B HD13 9  
ATOM   6663  H HD21 . LEU B 2 6  ? 4.700   5.276   -8.640  1.00 0.00 ? 6  LEU B HD21 9  
ATOM   6664  H HD22 . LEU B 2 6  ? 5.293   4.028   -9.736  1.00 0.00 ? 6  LEU B HD22 9  
ATOM   6665  H HD23 . LEU B 2 6  ? 5.358   3.773   -7.992  1.00 0.00 ? 6  LEU B HD23 9  
ATOM   6666  N N    . CYS B 2 7  ? 0.212   5.078   -10.912 1.00 0.00 ? 7  CYS B N    9  
ATOM   6667  C CA   . CYS B 2 7  ? -1.169  5.458   -11.340 1.00 0.00 ? 7  CYS B CA   9  
ATOM   6668  C C    . CYS B 2 7  ? -1.832  4.257   -12.029 1.00 0.00 ? 7  CYS B C    9  
ATOM   6669  O O    . CYS B 2 7  ? -1.426  3.134   -11.835 1.00 0.00 ? 7  CYS B O    9  
ATOM   6670  C CB   . CYS B 2 7  ? -1.108  6.655   -12.301 1.00 0.00 ? 7  CYS B CB   9  
ATOM   6671  S SG   . CYS B 2 7  ? -1.546  8.178   -11.419 1.00 0.00 ? 7  CYS B SG   9  
ATOM   6672  H H    . CYS B 2 7  ? 0.477   4.135   -10.905 1.00 0.00 ? 7  CYS B H    9  
ATOM   6673  H HA   . CYS B 2 7  ? -1.742  5.724   -10.465 1.00 0.00 ? 7  CYS B HA   9  
ATOM   6674  H HB2  . CYS B 2 7  ? -0.106  6.747   -12.692 1.00 0.00 ? 7  CYS B HB2  9  
ATOM   6675  H HB3  . CYS B 2 7  ? -1.795  6.502   -13.118 1.00 0.00 ? 7  CYS B HB3  9  
ATOM   6676  N N    . GLY B 2 8  ? -2.857  4.482   -12.813 1.00 0.00 ? 8  GLY B N    9  
ATOM   6677  C CA   . GLY B 2 8  ? -3.556  3.351   -13.502 1.00 0.00 ? 8  GLY B CA   9  
ATOM   6678  C C    . GLY B 2 8  ? -2.562  2.255   -13.906 1.00 0.00 ? 8  GLY B C    9  
ATOM   6679  O O    . GLY B 2 8  ? -2.204  1.402   -13.117 1.00 0.00 ? 8  GLY B O    9  
ATOM   6680  H H    . GLY B 2 8  ? -3.180  5.397   -12.942 1.00 0.00 ? 8  GLY B H    9  
ATOM   6681  H HA2  . GLY B 2 8  ? -4.295  2.932   -12.838 1.00 0.00 ? 8  GLY B HA2  9  
ATOM   6682  H HA3  . GLY B 2 8  ? -4.047  3.725   -14.389 1.00 0.00 ? 8  GLY B HA3  9  
ATOM   6683  N N    . SER B 2 9  ? -2.127  2.264   -15.132 1.00 0.00 ? 9  SER B N    9  
ATOM   6684  C CA   . SER B 2 9  ? -1.170  1.215   -15.593 1.00 0.00 ? 9  SER B CA   9  
ATOM   6685  C C    . SER B 2 9  ? 0.085   1.230   -14.717 1.00 0.00 ? 9  SER B C    9  
ATOM   6686  O O    . SER B 2 9  ? 0.492   0.218   -14.187 1.00 0.00 ? 9  SER B O    9  
ATOM   6687  C CB   . SER B 2 9  ? -0.776  1.488   -17.045 1.00 0.00 ? 9  SER B CB   9  
ATOM   6688  O OG   . SER B 2 9  ? -1.417  0.542   -17.890 1.00 0.00 ? 9  SER B OG   9  
ATOM   6689  H H    . SER B 2 9  ? -2.438  2.951   -15.755 1.00 0.00 ? 9  SER B H    9  
ATOM   6690  H HA   . SER B 2 9  ? -1.641  0.246   -15.527 1.00 0.00 ? 9  SER B HA   9  
ATOM   6691  H HB2  . SER B 2 9  ? -1.085  2.481   -17.325 1.00 0.00 ? 9  SER B HB2  9  
ATOM   6692  H HB3  . SER B 2 9  ? 0.299   1.405   -17.146 1.00 0.00 ? 9  SER B HB3  9  
ATOM   6693  H HG   . SER B 2 9  ? -1.900  1.027   -18.564 1.00 0.00 ? 9  SER B HG   9  
ATOM   6694  N N    . ASP B 2 10 ? 0.705   2.365   -14.569 1.00 0.00 ? 10 ASP B N    9  
ATOM   6695  C CA   . ASP B 2 10 ? 1.940   2.440   -13.737 1.00 0.00 ? 10 ASP B CA   9  
ATOM   6696  C C    . ASP B 2 10 ? 1.737   1.695   -12.414 1.00 0.00 ? 10 ASP B C    9  
ATOM   6697  O O    . ASP B 2 10 ? 2.588   0.940   -11.983 1.00 0.00 ? 10 ASP B O    9  
ATOM   6698  C CB   . ASP B 2 10 ? 2.269   3.906   -13.447 1.00 0.00 ? 10 ASP B CB   9  
ATOM   6699  C CG   . ASP B 2 10 ? 2.618   4.618   -14.756 1.00 0.00 ? 10 ASP B CG   9  
ATOM   6700  O OD1  . ASP B 2 10 ? 3.399   4.069   -15.514 1.00 0.00 ? 10 ASP B OD1  9  
ATOM   6701  O OD2  . ASP B 2 10 ? 2.098   5.699   -14.977 1.00 0.00 ? 10 ASP B OD2  9  
ATOM   6702  H H    . ASP B 2 10 ? 0.364   3.170   -15.012 1.00 0.00 ? 10 ASP B H    9  
ATOM   6703  H HA   . ASP B 2 10 ? 2.762   1.993   -14.275 1.00 0.00 ? 10 ASP B HA   9  
ATOM   6704  H HB2  . ASP B 2 10 ? 1.412   4.385   -12.993 1.00 0.00 ? 10 ASP B HB2  9  
ATOM   6705  H HB3  . ASP B 2 10 ? 3.111   3.960   -12.775 1.00 0.00 ? 10 ASP B HB3  9  
ATOM   6706  N N    . LEU B 2 11 ? 0.629   1.909   -11.755 1.00 0.00 ? 11 LEU B N    9  
ATOM   6707  C CA   . LEU B 2 11 ? 0.396   1.222   -10.450 1.00 0.00 ? 11 LEU B CA   9  
ATOM   6708  C C    . LEU B 2 11 ? -0.101  -0.200  -10.700 1.00 0.00 ? 11 LEU B C    9  
ATOM   6709  O O    . LEU B 2 11 ? 0.133   -1.096  -9.913  1.00 0.00 ? 11 LEU B O    9  
ATOM   6710  C CB   . LEU B 2 11 ? -0.658  2.002   -9.637  1.00 0.00 ? 11 LEU B CB   9  
ATOM   6711  C CG   . LEU B 2 11 ? -0.421  1.918   -8.111  1.00 0.00 ? 11 LEU B CG   9  
ATOM   6712  C CD1  . LEU B 2 11 ? -1.494  1.035   -7.478  1.00 0.00 ? 11 LEU B CD1  9  
ATOM   6713  C CD2  . LEU B 2 11 ? 0.958   1.344   -7.775  1.00 0.00 ? 11 LEU B CD2  9  
ATOM   6714  H H    . LEU B 2 11 ? -0.042  2.528   -12.112 1.00 0.00 ? 11 LEU B H    9  
ATOM   6715  H HA   . LEU B 2 11 ? 1.324   1.186   -9.911  1.00 0.00 ? 11 LEU B HA   9  
ATOM   6716  H HB2  . LEU B 2 11 ? -0.632  3.037   -9.934  1.00 0.00 ? 11 LEU B HB2  9  
ATOM   6717  H HB3  . LEU B 2 11 ? -1.637  1.603   -9.859  1.00 0.00 ? 11 LEU B HB3  9  
ATOM   6718  H HG   . LEU B 2 11 ? -0.499  2.909   -7.695  1.00 0.00 ? 11 LEU B HG   9  
ATOM   6719  H HD11 . LEU B 2 11 ? -2.158  1.646   -6.885  1.00 0.00 ? 11 LEU B HD11 9  
ATOM   6720  H HD12 . LEU B 2 11 ? -1.025  0.296   -6.845  1.00 0.00 ? 11 LEU B HD12 9  
ATOM   6721  H HD13 . LEU B 2 11 ? -2.058  0.540   -8.254  1.00 0.00 ? 11 LEU B HD13 9  
ATOM   6722  H HD21 . LEU B 2 11 ? 1.103   1.358   -6.706  1.00 0.00 ? 11 LEU B HD21 9  
ATOM   6723  H HD22 . LEU B 2 11 ? 1.719   1.945   -8.252  1.00 0.00 ? 11 LEU B HD22 9  
ATOM   6724  H HD23 . LEU B 2 11 ? 1.020   0.330   -8.137  1.00 0.00 ? 11 LEU B HD23 9  
ATOM   6725  N N    . VAL B 2 12 ? -0.777  -0.420  -11.791 1.00 0.00 ? 12 VAL B N    9  
ATOM   6726  C CA   . VAL B 2 12 ? -1.275  -1.787  -12.086 1.00 0.00 ? 12 VAL B CA   9  
ATOM   6727  C C    . VAL B 2 12 ? -0.121  -2.610  -12.659 1.00 0.00 ? 12 VAL B C    9  
ATOM   6728  O O    . VAL B 2 12 ? 0.236   -3.644  -12.132 1.00 0.00 ? 12 VAL B O    9  
ATOM   6729  C CB   . VAL B 2 12 ? -2.423  -1.695  -13.097 1.00 0.00 ? 12 VAL B CB   9  
ATOM   6730  C CG1  . VAL B 2 12 ? -2.607  -3.039  -13.809 1.00 0.00 ? 12 VAL B CG1  9  
ATOM   6731  C CG2  . VAL B 2 12 ? -3.716  -1.334  -12.362 1.00 0.00 ? 12 VAL B CG2  9  
ATOM   6732  H H    . VAL B 2 12 ? -0.950  0.312   -12.420 1.00 0.00 ? 12 VAL B H    9  
ATOM   6733  H HA   . VAL B 2 12 ? -1.627  -2.247  -11.174 1.00 0.00 ? 12 VAL B HA   9  
ATOM   6734  H HB   . VAL B 2 12 ? -2.197  -0.928  -13.823 1.00 0.00 ? 12 VAL B HB   9  
ATOM   6735  H HG11 . VAL B 2 12 ? -2.311  -3.840  -13.147 1.00 0.00 ? 12 VAL B HG11 9  
ATOM   6736  H HG12 . VAL B 2 12 ? -1.995  -3.063  -14.698 1.00 0.00 ? 12 VAL B HG12 9  
ATOM   6737  H HG13 . VAL B 2 12 ? -3.645  -3.164  -14.083 1.00 0.00 ? 12 VAL B HG13 9  
ATOM   6738  H HG21 . VAL B 2 12 ? -3.697  -1.758  -11.370 1.00 0.00 ? 12 VAL B HG21 9  
ATOM   6739  H HG22 . VAL B 2 12 ? -4.562  -1.729  -12.906 1.00 0.00 ? 12 VAL B HG22 9  
ATOM   6740  H HG23 . VAL B 2 12 ? -3.803  -0.259  -12.292 1.00 0.00 ? 12 VAL B HG23 9  
ATOM   6741  N N    . GLU B 2 13 ? 0.480   -2.149  -13.722 1.00 0.00 ? 13 GLU B N    9  
ATOM   6742  C CA   . GLU B 2 13 ? 1.623   -2.900  -14.303 1.00 0.00 ? 13 GLU B CA   9  
ATOM   6743  C C    . GLU B 2 13 ? 2.618   -3.197  -13.184 1.00 0.00 ? 13 GLU B C    9  
ATOM   6744  O O    . GLU B 2 13 ? 3.349   -4.167  -13.225 1.00 0.00 ? 13 GLU B O    9  
ATOM   6745  C CB   . GLU B 2 13 ? 2.299   -2.053  -15.385 1.00 0.00 ? 13 GLU B CB   9  
ATOM   6746  C CG   . GLU B 2 13 ? 1.422   -2.033  -16.638 1.00 0.00 ? 13 GLU B CG   9  
ATOM   6747  C CD   . GLU B 2 13 ? 2.310   -2.076  -17.884 1.00 0.00 ? 13 GLU B CD   9  
ATOM   6748  O OE1  . GLU B 2 13 ? 3.397   -2.619  -17.793 1.00 0.00 ? 13 GLU B OE1  9  
ATOM   6749  O OE2  . GLU B 2 13 ? 1.885   -1.566  -18.909 1.00 0.00 ? 13 GLU B OE2  9  
ATOM   6750  H H    . GLU B 2 13 ? 0.188   -1.304  -14.126 1.00 0.00 ? 13 GLU B H    9  
ATOM   6751  H HA   . GLU B 2 13 ? 1.270   -3.827  -14.732 1.00 0.00 ? 13 GLU B HA   9  
ATOM   6752  H HB2  . GLU B 2 13 ? 2.434   -1.044  -15.021 1.00 0.00 ? 13 GLU B HB2  9  
ATOM   6753  H HB3  . GLU B 2 13 ? 3.261   -2.480  -15.628 1.00 0.00 ? 13 GLU B HB3  9  
ATOM   6754  H HG2  . GLU B 2 13 ? 0.766   -2.891  -16.633 1.00 0.00 ? 13 GLU B HG2  9  
ATOM   6755  H HG3  . GLU B 2 13 ? 0.832   -1.129  -16.651 1.00 0.00 ? 13 GLU B HG3  9  
ATOM   6756  N N    . ALA B 2 14 ? 2.638   -2.370  -12.173 1.00 0.00 ? 14 ALA B N    9  
ATOM   6757  C CA   . ALA B 2 14 ? 3.568   -2.601  -11.035 1.00 0.00 ? 14 ALA B CA   9  
ATOM   6758  C C    . ALA B 2 14 ? 3.122   -3.855  -10.281 1.00 0.00 ? 14 ALA B C    9  
ATOM   6759  O O    . ALA B 2 14 ? 3.819   -4.849  -10.247 1.00 0.00 ? 14 ALA B O    9  
ATOM   6760  C CB   . ALA B 2 14 ? 3.534   -1.394  -10.096 1.00 0.00 ? 14 ALA B CB   9  
ATOM   6761  H H    . ALA B 2 14 ? 2.031   -1.601  -12.159 1.00 0.00 ? 14 ALA B H    9  
ATOM   6762  H HA   . ALA B 2 14 ? 4.572   -2.741  -11.411 1.00 0.00 ? 14 ALA B HA   9  
ATOM   6763  H HB1  . ALA B 2 14 ? 2.560   -1.326  -9.634  1.00 0.00 ? 14 ALA B HB1  9  
ATOM   6764  H HB2  . ALA B 2 14 ? 3.728   -0.495  -10.661 1.00 0.00 ? 14 ALA B HB2  9  
ATOM   6765  H HB3  . ALA B 2 14 ? 4.289   -1.509  -9.334  1.00 0.00 ? 14 ALA B HB3  9  
ATOM   6766  N N    . LEU B 2 15 ? 1.959   -3.823  -9.684  1.00 0.00 ? 15 LEU B N    9  
ATOM   6767  C CA   . LEU B 2 15 ? 1.473   -5.023  -8.949  1.00 0.00 ? 15 LEU B CA   9  
ATOM   6768  C C    . LEU B 2 15 ? 1.713   -6.262  -9.813  1.00 0.00 ? 15 LEU B C    9  
ATOM   6769  O O    . LEU B 2 15 ? 2.186   -7.279  -9.347  1.00 0.00 ? 15 LEU B O    9  
ATOM   6770  C CB   . LEU B 2 15 ? -0.026  -4.879  -8.677  1.00 0.00 ? 15 LEU B CB   9  
ATOM   6771  C CG   . LEU B 2 15 ? -0.252  -3.836  -7.582  1.00 0.00 ? 15 LEU B CG   9  
ATOM   6772  C CD1  . LEU B 2 15 ? -1.657  -3.248  -7.722  1.00 0.00 ? 15 LEU B CD1  9  
ATOM   6773  C CD2  . LEU B 2 15 ? -0.113  -4.496  -6.209  1.00 0.00 ? 15 LEU B CD2  9  
ATOM   6774  H H    . LEU B 2 15 ? 1.403   -3.015  -9.726  1.00 0.00 ? 15 LEU B H    9  
ATOM   6775  H HA   . LEU B 2 15 ? 2.005   -5.119  -8.015  1.00 0.00 ? 15 LEU B HA   9  
ATOM   6776  H HB2  . LEU B 2 15 ? -0.526  -4.566  -9.581  1.00 0.00 ? 15 LEU B HB2  9  
ATOM   6777  H HB3  . LEU B 2 15 ? -0.426  -5.829  -8.356  1.00 0.00 ? 15 LEU B HB3  9  
ATOM   6778  H HG   . LEU B 2 15 ? 0.480   -3.047  -7.680  1.00 0.00 ? 15 LEU B HG   9  
ATOM   6779  H HD11 . LEU B 2 15 ? -2.260  -3.900  -8.335  1.00 0.00 ? 15 LEU B HD11 9  
ATOM   6780  H HD12 . LEU B 2 15 ? -1.595  -2.274  -8.184  1.00 0.00 ? 15 LEU B HD12 9  
ATOM   6781  H HD13 . LEU B 2 15 ? -2.107  -3.155  -6.745  1.00 0.00 ? 15 LEU B HD13 9  
ATOM   6782  H HD21 . LEU B 2 15 ? 0.775   -5.110  -6.191  1.00 0.00 ? 15 LEU B HD21 9  
ATOM   6783  H HD22 . LEU B 2 15 ? -0.980  -5.110  -6.015  1.00 0.00 ? 15 LEU B HD22 9  
ATOM   6784  H HD23 . LEU B 2 15 ? -0.037  -3.732  -5.449  1.00 0.00 ? 15 LEU B HD23 9  
ATOM   6785  N N    . TYR B 2 16 ? 1.392   -6.176  -11.074 1.00 0.00 ? 16 TYR B N    9  
ATOM   6786  C CA   . TYR B 2 16 ? 1.598   -7.335  -11.987 1.00 0.00 ? 16 TYR B CA   9  
ATOM   6787  C C    . TYR B 2 16 ? 3.061   -7.781  -11.929 1.00 0.00 ? 16 TYR B C    9  
ATOM   6788  O O    . TYR B 2 16 ? 3.371   -8.947  -12.080 1.00 0.00 ? 16 TYR B O    9  
ATOM   6789  C CB   . TYR B 2 16 ? 1.255   -6.917  -13.418 1.00 0.00 ? 16 TYR B CB   9  
ATOM   6790  C CG   . TYR B 2 16 ? 0.015   -7.651  -13.882 1.00 0.00 ? 16 TYR B CG   9  
ATOM   6791  C CD1  . TYR B 2 16 ? 0.097   -8.998  -14.266 1.00 0.00 ? 16 TYR B CD1  9  
ATOM   6792  C CD2  . TYR B 2 16 ? -1.220  -6.985  -13.931 1.00 0.00 ? 16 TYR B CD2  9  
ATOM   6793  C CE1  . TYR B 2 16 ? -1.051  -9.675  -14.698 1.00 0.00 ? 16 TYR B CE1  9  
ATOM   6794  C CE2  . TYR B 2 16 ? -2.366  -7.664  -14.365 1.00 0.00 ? 16 TYR B CE2  9  
ATOM   6795  C CZ   . TYR B 2 16 ? -2.281  -9.009  -14.747 1.00 0.00 ? 16 TYR B CZ   9  
ATOM   6796  O OH   . TYR B 2 16 ? -3.412  -9.676  -15.174 1.00 0.00 ? 16 TYR B OH   9  
ATOM   6797  H H    . TYR B 2 16 ? 1.015   -5.342  -11.424 1.00 0.00 ? 16 TYR B H    9  
ATOM   6798  H HA   . TYR B 2 16 ? 0.958   -8.152  -11.687 1.00 0.00 ? 16 TYR B HA   9  
ATOM   6799  H HB2  . TYR B 2 16 ? 1.077   -5.850  -13.446 1.00 0.00 ? 16 TYR B HB2  9  
ATOM   6800  H HB3  . TYR B 2 16 ? 2.082   -7.159  -14.071 1.00 0.00 ? 16 TYR B HB3  9  
ATOM   6801  H HD1  . TYR B 2 16 ? 1.043   -9.514  -14.228 1.00 0.00 ? 16 TYR B HD1  9  
ATOM   6802  H HD2  . TYR B 2 16 ? -1.288  -5.949  -13.637 1.00 0.00 ? 16 TYR B HD2  9  
ATOM   6803  H HE1  . TYR B 2 16 ? -0.987  -10.712 -14.992 1.00 0.00 ? 16 TYR B HE1  9  
ATOM   6804  H HE2  . TYR B 2 16 ? -3.316  -7.150  -14.402 1.00 0.00 ? 16 TYR B HE2  9  
ATOM   6805  H HH   . TYR B 2 16 ? -3.221  -10.617 -15.166 1.00 0.00 ? 16 TYR B HH   9  
ATOM   6806  N N    . LEU B 2 17 ? 3.964   -6.863  -11.720 1.00 0.00 ? 17 LEU B N    9  
ATOM   6807  C CA   . LEU B 2 17 ? 5.406   -7.236  -11.661 1.00 0.00 ? 17 LEU B CA   9  
ATOM   6808  C C    . LEU B 2 17 ? 5.842   -7.382  -10.204 1.00 0.00 ? 17 LEU B C    9  
ATOM   6809  O O    . LEU B 2 17 ? 6.827   -8.027  -9.902  1.00 0.00 ? 17 LEU B O    9  
ATOM   6810  C CB   . LEU B 2 17 ? 6.240   -6.148  -12.338 1.00 0.00 ? 17 LEU B CB   9  
ATOM   6811  C CG   . LEU B 2 17 ? 6.969   -6.739  -13.545 1.00 0.00 ? 17 LEU B CG   9  
ATOM   6812  C CD1  . LEU B 2 17 ? 7.863   -7.892  -13.086 1.00 0.00 ? 17 LEU B CD1  9  
ATOM   6813  C CD2  . LEU B 2 17 ? 5.943   -7.262  -14.553 1.00 0.00 ? 17 LEU B CD2  9  
ATOM   6814  H H    . LEU B 2 17 ? 3.695   -5.928  -11.606 1.00 0.00 ? 17 LEU B H    9  
ATOM   6815  H HA   . LEU B 2 17 ? 5.554   -8.174  -12.174 1.00 0.00 ? 17 LEU B HA   9  
ATOM   6816  H HB2  . LEU B 2 17 ? 5.591   -5.348  -12.665 1.00 0.00 ? 17 LEU B HB2  9  
ATOM   6817  H HB3  . LEU B 2 17 ? 6.964   -5.760  -11.636 1.00 0.00 ? 17 LEU B HB3  9  
ATOM   6818  H HG   . LEU B 2 17 ? 7.576   -5.976  -14.008 1.00 0.00 ? 17 LEU B HG   9  
ATOM   6819  H HD11 . LEU B 2 17 ? 7.577   -8.798  -13.600 1.00 0.00 ? 17 LEU B HD11 9  
ATOM   6820  H HD12 . LEU B 2 17 ? 7.753   -8.032  -12.021 1.00 0.00 ? 17 LEU B HD12 9  
ATOM   6821  H HD13 . LEU B 2 17 ? 8.894   -7.661  -13.313 1.00 0.00 ? 17 LEU B HD13 9  
ATOM   6822  H HD21 . LEU B 2 17 ? 5.848   -8.333  -14.447 1.00 0.00 ? 17 LEU B HD21 9  
ATOM   6823  H HD22 . LEU B 2 17 ? 6.271   -7.026  -15.554 1.00 0.00 ? 17 LEU B HD22 9  
ATOM   6824  H HD23 . LEU B 2 17 ? 4.987   -6.795  -14.368 1.00 0.00 ? 17 LEU B HD23 9  
ATOM   6825  N N    . VAL B 2 18 ? 5.118   -6.789  -9.299  1.00 0.00 ? 18 VAL B N    9  
ATOM   6826  C CA   . VAL B 2 18 ? 5.491   -6.895  -7.861  1.00 0.00 ? 18 VAL B CA   9  
ATOM   6827  C C    . VAL B 2 18 ? 5.248   -8.325  -7.380  1.00 0.00 ? 18 VAL B C    9  
ATOM   6828  O O    . VAL B 2 18 ? 6.158   -9.015  -6.965  1.00 0.00 ? 18 VAL B O    9  
ATOM   6829  C CB   . VAL B 2 18 ? 4.635   -5.930  -7.040  1.00 0.00 ? 18 VAL B CB   9  
ATOM   6830  C CG1  . VAL B 2 18 ? 4.882   -6.171  -5.550  1.00 0.00 ? 18 VAL B CG1  9  
ATOM   6831  C CG2  . VAL B 2 18 ? 5.014   -4.491  -7.391  1.00 0.00 ? 18 VAL B CG2  9  
ATOM   6832  H H    . VAL B 2 18 ? 4.328   -6.277  -9.565  1.00 0.00 ? 18 VAL B H    9  
ATOM   6833  H HA   . VAL B 2 18 ? 6.535   -6.645  -7.740  1.00 0.00 ? 18 VAL B HA   9  
ATOM   6834  H HB   . VAL B 2 18 ? 3.591   -6.095  -7.263  1.00 0.00 ? 18 VAL B HB   9  
ATOM   6835  H HG11 . VAL B 2 18 ? 4.390   -5.401  -4.974  1.00 0.00 ? 18 VAL B HG11 9  
ATOM   6836  H HG12 . VAL B 2 18 ? 5.944   -6.145  -5.353  1.00 0.00 ? 18 VAL B HG12 9  
ATOM   6837  H HG13 . VAL B 2 18 ? 4.487   -7.135  -5.271  1.00 0.00 ? 18 VAL B HG13 9  
ATOM   6838  H HG21 . VAL B 2 18 ? 4.292   -4.089  -8.086  1.00 0.00 ? 18 VAL B HG21 9  
ATOM   6839  H HG22 . VAL B 2 18 ? 5.994   -4.479  -7.841  1.00 0.00 ? 18 VAL B HG22 9  
ATOM   6840  H HG23 . VAL B 2 18 ? 5.021   -3.892  -6.492  1.00 0.00 ? 18 VAL B HG23 9  
ATOM   6841  N N    . CYS B 2 19 ? 4.027   -8.774  -7.434  1.00 0.00 ? 19 CYS B N    9  
ATOM   6842  C CA   . CYS B 2 19 ? 3.718   -10.161 -6.981  1.00 0.00 ? 19 CYS B CA   9  
ATOM   6843  C C    . CYS B 2 19 ? 4.194   -11.157 -8.040  1.00 0.00 ? 19 CYS B C    9  
ATOM   6844  O O    . CYS B 2 19 ? 5.102   -11.932 -7.817  1.00 0.00 ? 19 CYS B O    9  
ATOM   6845  C CB   . CYS B 2 19 ? 2.209   -10.316 -6.779  1.00 0.00 ? 19 CYS B CB   9  
ATOM   6846  S SG   . CYS B 2 19 ? 1.521   -8.779  -6.117  1.00 0.00 ? 19 CYS B SG   9  
ATOM   6847  H H    . CYS B 2 19 ? 3.309   -8.197  -7.773  1.00 0.00 ? 19 CYS B H    9  
ATOM   6848  H HA   . CYS B 2 19 ? 4.229   -10.357 -6.049  1.00 0.00 ? 19 CYS B HA   9  
ATOM   6849  H HB2  . CYS B 2 19 ? 1.742   -10.540 -7.726  1.00 0.00 ? 19 CYS B HB2  9  
ATOM   6850  H HB3  . CYS B 2 19 ? 2.020   -11.122 -6.086  1.00 0.00 ? 19 CYS B HB3  9  
ATOM   6851  N N    . GLY B 2 20 ? 3.587   -11.140 -9.197  1.00 0.00 ? 20 GLY B N    9  
ATOM   6852  C CA   . GLY B 2 20 ? 4.005   -12.083 -10.272 1.00 0.00 ? 20 GLY B CA   9  
ATOM   6853  C C    . GLY B 2 20 ? 3.480   -13.487 -9.967  1.00 0.00 ? 20 GLY B C    9  
ATOM   6854  O O    . GLY B 2 20 ? 2.784   -14.086 -10.763 1.00 0.00 ? 20 GLY B O    9  
ATOM   6855  H H    . GLY B 2 20 ? 2.859   -10.504 -9.359  1.00 0.00 ? 20 GLY B H    9  
ATOM   6856  H HA2  . GLY B 2 20 ? 3.606   -11.746 -11.218 1.00 0.00 ? 20 GLY B HA2  9  
ATOM   6857  H HA3  . GLY B 2 20 ? 5.083   -12.110 -10.326 1.00 0.00 ? 20 GLY B HA3  9  
ATOM   6858  N N    . GLU B 2 21 ? 3.814   -14.023 -8.825  1.00 0.00 ? 21 GLU B N    9  
ATOM   6859  C CA   . GLU B 2 21 ? 3.340   -15.393 -8.479  1.00 0.00 ? 21 GLU B CA   9  
ATOM   6860  C C    . GLU B 2 21 ? 2.042   -15.310 -7.675  1.00 0.00 ? 21 GLU B C    9  
ATOM   6861  O O    . GLU B 2 21 ? 1.077   -15.989 -7.964  1.00 0.00 ? 21 GLU B O    9  
ATOM   6862  C CB   . GLU B 2 21 ? 4.405   -16.097 -7.640  1.00 0.00 ? 21 GLU B CB   9  
ATOM   6863  C CG   . GLU B 2 21 ? 5.647   -16.337 -8.497  1.00 0.00 ? 21 GLU B CG   9  
ATOM   6864  C CD   . GLU B 2 21 ? 6.542   -17.379 -7.823  1.00 0.00 ? 21 GLU B CD   9  
ATOM   6865  O OE1  . GLU B 2 21 ? 6.187   -18.546 -7.856  1.00 0.00 ? 21 GLU B OE1  9  
ATOM   6866  O OE2  . GLU B 2 21 ? 7.567   -16.992 -7.286  1.00 0.00 ? 21 GLU B OE2  9  
ATOM   6867  H H    . GLU B 2 21 ? 4.381   -13.527 -8.198  1.00 0.00 ? 21 GLU B H    9  
ATOM   6868  H HA   . GLU B 2 21 ? 3.167   -15.954 -9.385  1.00 0.00 ? 21 GLU B HA   9  
ATOM   6869  H HB2  . GLU B 2 21 ? 4.664   -15.477 -6.794  1.00 0.00 ? 21 GLU B HB2  9  
ATOM   6870  H HB3  . GLU B 2 21 ? 4.022   -17.043 -7.290  1.00 0.00 ? 21 GLU B HB3  9  
ATOM   6871  H HG2  . GLU B 2 21 ? 5.346   -16.695 -9.470  1.00 0.00 ? 21 GLU B HG2  9  
ATOM   6872  H HG3  . GLU B 2 21 ? 6.193   -15.413 -8.605  1.00 0.00 ? 21 GLU B HG3  9  
ATOM   6873  N N    . ARG B 2 22 ? 2.016   -14.494 -6.661  1.00 0.00 ? 22 ARG B N    9  
ATOM   6874  C CA   . ARG B 2 22 ? 0.784   -14.377 -5.827  1.00 0.00 ? 22 ARG B CA   9  
ATOM   6875  C C    . ARG B 2 22 ? -0.219  -13.424 -6.485  1.00 0.00 ? 22 ARG B C    9  
ATOM   6876  O O    . ARG B 2 22 ? -0.829  -12.605 -5.825  1.00 0.00 ? 22 ARG B O    9  
ATOM   6877  C CB   . ARG B 2 22 ? 1.160   -13.846 -4.446  1.00 0.00 ? 22 ARG B CB   9  
ATOM   6878  C CG   . ARG B 2 22 ? 1.601   -15.013 -3.562  1.00 0.00 ? 22 ARG B CG   9  
ATOM   6879  C CD   . ARG B 2 22 ? 2.513   -14.492 -2.452  1.00 0.00 ? 22 ARG B CD   9  
ATOM   6880  N NE   . ARG B 2 22 ? 2.521   -15.456 -1.318  1.00 0.00 ? 22 ARG B NE   9  
ATOM   6881  C CZ   . ARG B 2 22 ? 3.353   -15.287 -0.326  1.00 0.00 ? 22 ARG B CZ   9  
ATOM   6882  N NH1  . ARG B 2 22 ? 4.622   -15.544 -0.489  1.00 0.00 ? 22 ARG B NH1  9  
ATOM   6883  N NH2  . ARG B 2 22 ? 2.915   -14.859 0.826   1.00 0.00 ? 22 ARG B NH2  9  
ATOM   6884  H H    . ARG B 2 22 ? 2.812   -13.964 -6.442  1.00 0.00 ? 22 ARG B H    9  
ATOM   6885  H HA   . ARG B 2 22 ? 0.333   -15.352 -5.720  1.00 0.00 ? 22 ARG B HA   9  
ATOM   6886  H HB2  . ARG B 2 22 ? 1.969   -13.137 -4.539  1.00 0.00 ? 22 ARG B HB2  9  
ATOM   6887  H HB3  . ARG B 2 22 ? 0.304   -13.362 -3.999  1.00 0.00 ? 22 ARG B HB3  9  
ATOM   6888  H HG2  . ARG B 2 22 ? 0.731   -15.482 -3.128  1.00 0.00 ? 22 ARG B HG2  9  
ATOM   6889  H HG3  . ARG B 2 22 ? 2.140   -15.734 -4.159  1.00 0.00 ? 22 ARG B HG3  9  
ATOM   6890  H HD2  . ARG B 2 22 ? 3.517   -14.379 -2.835  1.00 0.00 ? 22 ARG B HD2  9  
ATOM   6891  H HD3  . ARG B 2 22 ? 2.148   -13.535 -2.110  1.00 0.00 ? 22 ARG B HD3  9  
ATOM   6892  H HE   . ARG B 2 22 ? 1.905   -16.219 -1.316  1.00 0.00 ? 22 ARG B HE   9  
ATOM   6893  H HH11 . ARG B 2 22 ? 4.957   -15.870 -1.372  1.00 0.00 ? 22 ARG B HH11 9  
ATOM   6894  H HH12 . ARG B 2 22 ? 5.260   -15.411 0.271   1.00 0.00 ? 22 ARG B HH12 9  
ATOM   6895  H HH21 . ARG B 2 22 ? 1.943   -14.662 0.949   1.00 0.00 ? 22 ARG B HH21 9  
ATOM   6896  H HH22 . ARG B 2 22 ? 3.552   -14.728 1.585   1.00 0.00 ? 22 ARG B HH22 9  
ATOM   6897  N N    . GLY B 2 23 ? -0.401  -13.540 -7.774  1.00 0.00 ? 23 GLY B N    9  
ATOM   6898  C CA   . GLY B 2 23 ? -1.371  -12.659 -8.492  1.00 0.00 ? 23 GLY B CA   9  
ATOM   6899  C C    . GLY B 2 23 ? -1.359  -11.250 -7.897  1.00 0.00 ? 23 GLY B C    9  
ATOM   6900  O O    . GLY B 2 23 ? -0.327  -10.733 -7.517  1.00 0.00 ? 23 GLY B O    9  
ATOM   6901  H H    . GLY B 2 23 ? 0.094   -14.216 -8.272  1.00 0.00 ? 23 GLY B H    9  
ATOM   6902  H HA2  . GLY B 2 23 ? -1.097  -12.608 -9.536  1.00 0.00 ? 23 GLY B HA2  9  
ATOM   6903  H HA3  . GLY B 2 23 ? -2.364  -13.073 -8.403  1.00 0.00 ? 23 GLY B HA3  9  
ATOM   6904  N N    . PHE B 2 24 ? -2.505  -10.636 -7.806  1.00 0.00 ? 24 PHE B N    9  
ATOM   6905  C CA   . PHE B 2 24 ? -2.585  -9.258  -7.232  1.00 0.00 ? 24 PHE B CA   9  
ATOM   6906  C C    . PHE B 2 24 ? -4.030  -8.754  -7.342  1.00 0.00 ? 24 PHE B C    9  
ATOM   6907  O O    . PHE B 2 24 ? -4.847  -9.338  -8.026  1.00 0.00 ? 24 PHE B O    9  
ATOM   6908  C CB   . PHE B 2 24 ? -1.615  -8.316  -7.981  1.00 0.00 ? 24 PHE B CB   9  
ATOM   6909  C CG   . PHE B 2 24 ? -2.320  -7.583  -9.120  1.00 0.00 ? 24 PHE B CG   9  
ATOM   6910  C CD1  . PHE B 2 24 ? -2.576  -8.240  -10.333 1.00 0.00 ? 24 PHE B CD1  9  
ATOM   6911  C CD2  . PHE B 2 24 ? -2.716  -6.241  -8.960  1.00 0.00 ? 24 PHE B CD2  9  
ATOM   6912  C CE1  . PHE B 2 24 ? -3.221  -7.565  -11.377 1.00 0.00 ? 24 PHE B CE1  9  
ATOM   6913  C CE2  . PHE B 2 24 ? -3.360  -5.570  -10.008 1.00 0.00 ? 24 PHE B CE2  9  
ATOM   6914  C CZ   . PHE B 2 24 ? -3.612  -6.231  -11.214 1.00 0.00 ? 24 PHE B CZ   9  
ATOM   6915  H H    . PHE B 2 24 ? -3.321  -11.089 -8.112  1.00 0.00 ? 24 PHE B H    9  
ATOM   6916  H HA   . PHE B 2 24 ? -2.306  -9.297  -6.188  1.00 0.00 ? 24 PHE B HA   9  
ATOM   6917  H HB2  . PHE B 2 24 ? -1.223  -7.589  -7.285  1.00 0.00 ? 24 PHE B HB2  9  
ATOM   6918  H HB3  . PHE B 2 24 ? -0.791  -8.901  -8.381  1.00 0.00 ? 24 PHE B HB3  9  
ATOM   6919  H HD1  . PHE B 2 24 ? -2.278  -9.263  -10.465 1.00 0.00 ? 24 PHE B HD1  9  
ATOM   6920  H HD2  . PHE B 2 24 ? -2.524  -5.722  -8.033  1.00 0.00 ? 24 PHE B HD2  9  
ATOM   6921  H HE1  . PHE B 2 24 ? -3.417  -8.074  -12.309 1.00 0.00 ? 24 PHE B HE1  9  
ATOM   6922  H HE2  . PHE B 2 24 ? -3.662  -4.540  -9.883  1.00 0.00 ? 24 PHE B HE2  9  
ATOM   6923  H HZ   . PHE B 2 24 ? -4.110  -5.712  -12.021 1.00 0.00 ? 24 PHE B HZ   9  
ATOM   6924  N N    . PHE B 2 25 ? -4.356  -7.682  -6.674  1.00 0.00 ? 25 PHE B N    9  
ATOM   6925  C CA   . PHE B 2 25 ? -5.747  -7.161  -6.750  1.00 0.00 ? 25 PHE B CA   9  
ATOM   6926  C C    . PHE B 2 25 ? -5.741  -5.644  -6.553  1.00 0.00 ? 25 PHE B C    9  
ATOM   6927  O O    . PHE B 2 25 ? -4.936  -5.104  -5.821  1.00 0.00 ? 25 PHE B O    9  
ATOM   6928  C CB   . PHE B 2 25 ? -6.605  -7.831  -5.668  1.00 0.00 ? 25 PHE B CB   9  
ATOM   6929  C CG   . PHE B 2 25 ? -6.348  -7.186  -4.325  1.00 0.00 ? 25 PHE B CG   9  
ATOM   6930  C CD1  . PHE B 2 25 ? -5.317  -7.662  -3.504  1.00 0.00 ? 25 PHE B CD1  9  
ATOM   6931  C CD2  . PHE B 2 25 ? -7.144  -6.114  -3.898  1.00 0.00 ? 25 PHE B CD2  9  
ATOM   6932  C CE1  . PHE B 2 25 ? -5.081  -7.066  -2.258  1.00 0.00 ? 25 PHE B CE1  9  
ATOM   6933  C CE2  . PHE B 2 25 ? -6.908  -5.519  -2.652  1.00 0.00 ? 25 PHE B CE2  9  
ATOM   6934  C CZ   . PHE B 2 25 ? -5.877  -5.995  -1.831  1.00 0.00 ? 25 PHE B CZ   9  
ATOM   6935  H H    . PHE B 2 25 ? -3.689  -7.220  -6.126  1.00 0.00 ? 25 PHE B H    9  
ATOM   6936  H HA   . PHE B 2 25 ? -6.159  -7.390  -7.722  1.00 0.00 ? 25 PHE B HA   9  
ATOM   6937  H HB2  . PHE B 2 25 ? -7.650  -7.725  -5.921  1.00 0.00 ? 25 PHE B HB2  9  
ATOM   6938  H HB3  . PHE B 2 25 ? -6.356  -8.880  -5.614  1.00 0.00 ? 25 PHE B HB3  9  
ATOM   6939  H HD1  . PHE B 2 25 ? -4.702  -8.488  -3.832  1.00 0.00 ? 25 PHE B HD1  9  
ATOM   6940  H HD2  . PHE B 2 25 ? -7.939  -5.746  -4.531  1.00 0.00 ? 25 PHE B HD2  9  
ATOM   6941  H HE1  . PHE B 2 25 ? -4.286  -7.433  -1.625  1.00 0.00 ? 25 PHE B HE1  9  
ATOM   6942  H HE2  . PHE B 2 25 ? -7.522  -4.692  -2.323  1.00 0.00 ? 25 PHE B HE2  9  
ATOM   6943  H HZ   . PHE B 2 25 ? -5.697  -5.536  -0.870  1.00 0.00 ? 25 PHE B HZ   9  
ATOM   6944  N N    . TYR B 2 26 ? -6.635  -4.955  -7.204  1.00 0.00 ? 26 TYR B N    9  
ATOM   6945  C CA   . TYR B 2 26 ? -6.688  -3.474  -7.061  1.00 0.00 ? 26 TYR B CA   9  
ATOM   6946  C C    . TYR B 2 26 ? -7.663  -3.104  -5.940  1.00 0.00 ? 26 TYR B C    9  
ATOM   6947  O O    . TYR B 2 26 ? -8.629  -3.798  -5.692  1.00 0.00 ? 26 TYR B O    9  
ATOM   6948  C CB   . TYR B 2 26 ? -7.162  -2.851  -8.374  1.00 0.00 ? 26 TYR B CB   9  
ATOM   6949  C CG   . TYR B 2 26 ? -6.283  -1.674  -8.719  1.00 0.00 ? 26 TYR B CG   9  
ATOM   6950  C CD1  . TYR B 2 26 ? -4.891  -1.826  -8.764  1.00 0.00 ? 26 TYR B CD1  9  
ATOM   6951  C CD2  . TYR B 2 26 ? -6.861  -0.427  -8.995  1.00 0.00 ? 26 TYR B CD2  9  
ATOM   6952  C CE1  . TYR B 2 26 ? -4.077  -0.732  -9.083  1.00 0.00 ? 26 TYR B CE1  9  
ATOM   6953  C CE2  . TYR B 2 26 ? -6.047  0.667   -9.316  1.00 0.00 ? 26 TYR B CE2  9  
ATOM   6954  C CZ   . TYR B 2 26 ? -4.654  0.515   -9.359  1.00 0.00 ? 26 TYR B CZ   9  
ATOM   6955  O OH   . TYR B 2 26 ? -3.853  1.593   -9.675  1.00 0.00 ? 26 TYR B OH   9  
ATOM   6956  H H    . TYR B 2 26 ? -7.272  -5.413  -7.789  1.00 0.00 ? 26 TYR B H    9  
ATOM   6957  H HA   . TYR B 2 26 ? -5.703  -3.101  -6.819  1.00 0.00 ? 26 TYR B HA   9  
ATOM   6958  H HB2  . TYR B 2 26 ? -7.105  -3.587  -9.164  1.00 0.00 ? 26 TYR B HB2  9  
ATOM   6959  H HB3  . TYR B 2 26 ? -8.182  -2.517  -8.267  1.00 0.00 ? 26 TYR B HB3  9  
ATOM   6960  H HD1  . TYR B 2 26 ? -4.447  -2.786  -8.551  1.00 0.00 ? 26 TYR B HD1  9  
ATOM   6961  H HD2  . TYR B 2 26 ? -7.934  -0.311  -8.962  1.00 0.00 ? 26 TYR B HD2  9  
ATOM   6962  H HE1  . TYR B 2 26 ? -3.003  -0.849  -9.118  1.00 0.00 ? 26 TYR B HE1  9  
ATOM   6963  H HE2  . TYR B 2 26 ? -6.492  1.628   -9.528  1.00 0.00 ? 26 TYR B HE2  9  
ATOM   6964  H HH   . TYR B 2 26 ? -3.716  2.106   -8.874  1.00 0.00 ? 26 TYR B HH   9  
ATOM   6965  N N    . THR B 2 27 ? -7.419  -2.015  -5.264  1.00 0.00 ? 27 THR B N    9  
ATOM   6966  C CA   . THR B 2 27 ? -8.333  -1.603  -4.163  1.00 0.00 ? 27 THR B CA   9  
ATOM   6967  C C    . THR B 2 27 ? -9.451  -0.727  -4.732  1.00 0.00 ? 27 THR B C    9  
ATOM   6968  O O    . THR B 2 27 ? -10.479 -1.212  -5.161  1.00 0.00 ? 27 THR B O    9  
ATOM   6969  C CB   . THR B 2 27 ? -7.546  -0.809  -3.116  1.00 0.00 ? 27 THR B CB   9  
ATOM   6970  O OG1  . THR B 2 27 ? -6.544  -0.039  -3.763  1.00 0.00 ? 27 THR B OG1  9  
ATOM   6971  C CG2  . THR B 2 27 ? -6.890  -1.774  -2.125  1.00 0.00 ? 27 THR B CG2  9  
ATOM   6972  H H    . THR B 2 27 ? -6.635  -1.470  -5.482  1.00 0.00 ? 27 THR B H    9  
ATOM   6973  H HA   . THR B 2 27 ? -8.763  -2.475  -3.704  1.00 0.00 ? 27 THR B HA   9  
ATOM   6974  H HB   . THR B 2 27 ? -8.216  -0.154  -2.583  1.00 0.00 ? 27 THR B HB   9  
ATOM   6975  H HG1  . THR B 2 27 ? -6.690  0.884   -3.542  1.00 0.00 ? 27 THR B HG1  9  
ATOM   6976  H HG21 . THR B 2 27 ? -6.403  -2.571  -2.668  1.00 0.00 ? 27 THR B HG21 9  
ATOM   6977  H HG22 . THR B 2 27 ? -7.645  -2.191  -1.474  1.00 0.00 ? 27 THR B HG22 9  
ATOM   6978  H HG23 . THR B 2 27 ? -6.160  -1.242  -1.534  1.00 0.00 ? 27 THR B HG23 9  
ATOM   6979  N N    . LYS B 2 28 ? -9.254  0.560   -4.740  1.00 0.00 ? 28 LYS B N    9  
ATOM   6980  C CA   . LYS B 2 28 ? -10.296 1.476   -5.279  1.00 0.00 ? 28 LYS B CA   9  
ATOM   6981  C C    . LYS B 2 28 ? -10.109 1.623   -6.796  1.00 0.00 ? 28 LYS B C    9  
ATOM   6982  O O    . LYS B 2 28 ? -9.116  2.167   -7.238  1.00 0.00 ? 28 LYS B O    9  
ATOM   6983  C CB   . LYS B 2 28 ? -10.150 2.849   -4.614  1.00 0.00 ? 28 LYS B CB   9  
ATOM   6984  C CG   . LYS B 2 28 ? -11.356 3.108   -3.710  1.00 0.00 ? 28 LYS B CG   9  
ATOM   6985  C CD   . LYS B 2 28 ? -11.157 2.384   -2.378  1.00 0.00 ? 28 LYS B CD   9  
ATOM   6986  C CE   . LYS B 2 28 ? -11.807 3.192   -1.254  1.00 0.00 ? 28 LYS B CE   9  
ATOM   6987  N NZ   . LYS B 2 28 ? -12.424 2.261   -0.268  1.00 0.00 ? 28 LYS B NZ   9  
ATOM   6988  H H    . LYS B 2 28 ? -8.417  0.924   -4.389  1.00 0.00 ? 28 LYS B H    9  
ATOM   6989  H HA   . LYS B 2 28 ? -11.275 1.076   -5.064  1.00 0.00 ? 28 LYS B HA   9  
ATOM   6990  H HB2  . LYS B 2 28 ? -9.246  2.866   -4.020  1.00 0.00 ? 28 LYS B HB2  9  
ATOM   6991  H HB3  . LYS B 2 28 ? -10.098 3.616   -5.371  1.00 0.00 ? 28 LYS B HB3  9  
ATOM   6992  H HG2  . LYS B 2 28 ? -11.453 4.169   -3.535  1.00 0.00 ? 28 LYS B HG2  9  
ATOM   6993  H HG3  . LYS B 2 28 ? -12.250 2.737   -4.188  1.00 0.00 ? 28 LYS B HG3  9  
ATOM   6994  H HD2  . LYS B 2 28 ? -11.612 1.405   -2.429  1.00 0.00 ? 28 LYS B HD2  9  
ATOM   6995  H HD3  . LYS B 2 28 ? -10.101 2.280   -2.179  1.00 0.00 ? 28 LYS B HD3  9  
ATOM   6996  H HE2  . LYS B 2 28 ? -11.055 3.792   -0.760  1.00 0.00 ? 28 LYS B HE2  9  
ATOM   6997  H HE3  . LYS B 2 28 ? -12.567 3.836   -1.667  1.00 0.00 ? 28 LYS B HE3  9  
ATOM   6998  H HZ1  . LYS B 2 28 ? -12.583 2.759   0.629   1.00 0.00 ? 28 LYS B HZ1  9  
ATOM   6999  H HZ2  . LYS B 2 28 ? -11.787 1.453   -0.109  1.00 0.00 ? 28 LYS B HZ2  9  
ATOM   7000  H HZ3  . LYS B 2 28 ? -13.332 1.917   -0.638  1.00 0.00 ? 28 LYS B HZ3  9  
ATOM   7001  N N    . PRO B 2 29 ? -11.063 1.133   -7.553  1.00 0.00 ? 29 PRO B N    9  
ATOM   7002  C CA   . PRO B 2 29 ? -11.011 1.204   -9.026  1.00 0.00 ? 29 PRO B CA   9  
ATOM   7003  C C    . PRO B 2 29 ? -11.322 2.623   -9.508  1.00 0.00 ? 29 PRO B C    9  
ATOM   7004  O O    . PRO B 2 29 ? -12.303 3.223   -9.117  1.00 0.00 ? 29 PRO B O    9  
ATOM   7005  C CB   . PRO B 2 29 ? -12.092 0.218   -9.475  1.00 0.00 ? 29 PRO B CB   9  
ATOM   7006  C CG   . PRO B 2 29 ? -13.064 0.065   -8.282  1.00 0.00 ? 29 PRO B CG   9  
ATOM   7007  C CD   . PRO B 2 29 ? -12.276 0.474   -7.024  1.00 0.00 ? 29 PRO B CD   9  
ATOM   7008  H HA   . PRO B 2 29 ? -10.048 0.883   -9.387  1.00 0.00 ? 29 PRO B HA   9  
ATOM   7009  H HB2  . PRO B 2 29 ? -12.615 0.610   -10.337 1.00 0.00 ? 29 PRO B HB2  9  
ATOM   7010  H HB3  . PRO B 2 29 ? -11.651 -0.738  -9.710  1.00 0.00 ? 29 PRO B HB3  9  
ATOM   7011  H HG2  . PRO B 2 29 ? -13.918 0.714   -8.416  1.00 0.00 ? 29 PRO B HG2  9  
ATOM   7012  H HG3  . PRO B 2 29 ? -13.386 -0.961  -8.193  1.00 0.00 ? 29 PRO B HG3  9  
ATOM   7013  H HD2  . PRO B 2 29 ? -12.856 1.161   -6.424  1.00 0.00 ? 29 PRO B HD2  9  
ATOM   7014  H HD3  . PRO B 2 29 ? -12.006 -0.399  -6.449  1.00 0.00 ? 29 PRO B HD3  9  
ATOM   7015  N N    . THR B 2 30 ? -10.488 3.162   -10.354 1.00 0.00 ? 30 THR B N    9  
ATOM   7016  C CA   . THR B 2 30 ? -10.723 4.540   -10.866 1.00 0.00 ? 30 THR B CA   9  
ATOM   7017  C C    . THR B 2 30 ? -11.786 4.504   -11.966 1.00 0.00 ? 30 THR B C    9  
ATOM   7018  O O    . THR B 2 30 ? -11.649 5.253   -12.920 1.00 0.00 ? 30 THR B O    9  
ATOM   7019  C CB   . THR B 2 30 ? -9.417  5.096   -11.438 1.00 0.00 ? 30 THR B CB   9  
ATOM   7020  O OG1  . THR B 2 30 ? -9.656  6.378   -12.001 1.00 0.00 ? 30 THR B OG1  9  
ATOM   7021  C CG2  . THR B 2 30 ? -8.888  4.151   -12.517 1.00 0.00 ? 30 THR B CG2  9  
ATOM   7022  O OXT  . THR B 2 30 ? -12.719 3.728   -11.837 1.00 0.00 ? 30 THR B OXT  9  
ATOM   7023  H H    . THR B 2 30 ? -9.702  2.658   -10.654 1.00 0.00 ? 30 THR B H    9  
ATOM   7024  H HA   . THR B 2 30 ? -11.060 5.172   -10.059 1.00 0.00 ? 30 THR B HA   9  
ATOM   7025  H HB   . THR B 2 30 ? -8.685  5.178   -10.649 1.00 0.00 ? 30 THR B HB   9  
ATOM   7026  H HG1  . THR B 2 30 ? -10.110 6.911   -11.343 1.00 0.00 ? 30 THR B HG1  9  
ATOM   7027  H HG21 . THR B 2 30 ? -9.041  4.593   -13.490 1.00 0.00 ? 30 THR B HG21 9  
ATOM   7028  H HG22 . THR B 2 30 ? -9.417  3.210   -12.462 1.00 0.00 ? 30 THR B HG22 9  
ATOM   7029  H HG23 . THR B 2 30 ? -7.834  3.980   -12.362 1.00 0.00 ? 30 THR B HG23 9  
ATOM   7030  N N    . GLY A 1 1  ? -7.404  2.510   -1.669  1.00 0.00 ? 1  GLY A N    10 
ATOM   7031  C CA   . GLY A 1 1  ? -6.267  3.326   -1.056  1.00 0.00 ? 1  GLY A CA   10 
ATOM   7032  C C    . GLY A 1 1  ? -4.921  3.301   -1.695  1.00 0.00 ? 1  GLY A C    10 
ATOM   7033  O O    . GLY A 1 1  ? -4.166  4.250   -1.611  1.00 0.00 ? 1  GLY A O    10 
ATOM   7034  H H1   . GLY A 1 1  ? -7.458  1.583   -1.199  1.00 0.00 ? 1  GLY A H1   10 
ATOM   7035  H H2   . GLY A 1 1  ? -7.225  2.374   -2.684  1.00 0.00 ? 1  GLY A H2   10 
ATOM   7036  H H3   . GLY A 1 1  ? -8.303  3.016   -1.541  1.00 0.00 ? 1  GLY A H3   10 
ATOM   7037  H HA2  . GLY A 1 1  ? -6.284  4.248   -1.372  1.00 0.00 ? 1  GLY A HA2  10 
ATOM   7038  H HA3  . GLY A 1 1  ? -6.373  3.241   0.104   1.00 0.00 ? 1  GLY A HA3  10 
HETATM 7039  N N    . IIL A 1 2  ? -4.582  2.224   -2.348  1.00 0.00 ? 2  IIL A N    10 
HETATM 7040  C CA   . IIL A 1 2  ? -3.249  2.142   -3.007  1.00 0.00 ? 2  IIL A CA   10 
HETATM 7041  C C    . IIL A 1 2  ? -3.255  2.996   -4.277  1.00 0.00 ? 2  IIL A C    10 
HETATM 7042  O O    . IIL A 1 2  ? -2.274  3.628   -4.617  1.00 0.00 ? 2  IIL A O    10 
HETATM 7043  C CB   . IIL A 1 2  ? -2.949  0.688   -3.376  1.00 0.00 ? 2  IIL A CB   10 
HETATM 7044  C CG2  . IIL A 1 2  ? -1.584  0.609   -4.060  1.00 0.00 ? 2  IIL A CG2  10 
HETATM 7045  C CG1  . IIL A 1 2  ? -4.028  0.169   -4.329  1.00 0.00 ? 2  IIL A CG1  10 
HETATM 7046  C CD1  . IIL A 1 2  ? -3.964  -1.357  -4.390  1.00 0.00 ? 2  IIL A CD1  10 
HETATM 7047  H H    . IIL A 1 2  ? -5.205  1.469   -2.404  1.00 0.00 ? 2  IIL A H    10 
HETATM 7048  H HA   . IIL A 1 2  ? -2.489  2.506   -2.331  1.00 0.00 ? 2  IIL A HA   10 
HETATM 7049  H HB   . IIL A 1 2  ? -2.940  0.082   -2.483  1.00 0.00 ? 2  IIL A HB   10 
HETATM 7050  H HG21 . IIL A 1 2  ? -0.888  0.091   -3.416  1.00 0.00 ? 2  IIL A HG21 10 
HETATM 7051  H HG22 . IIL A 1 2  ? -1.221  1.608   -4.253  1.00 0.00 ? 2  IIL A HG22 10 
HETATM 7052  H HG23 . IIL A 1 2  ? -1.678  0.074   -4.992  1.00 0.00 ? 2  IIL A HG23 10 
HETATM 7053  H HG12 . IIL A 1 2  ? -3.863  0.575   -5.315  1.00 0.00 ? 2  IIL A HG12 10 
HETATM 7054  H HG13 . IIL A 1 2  ? -5.001  0.476   -3.972  1.00 0.00 ? 2  IIL A HG13 10 
HETATM 7055  H HD11 . IIL A 1 2  ? -4.757  -1.725  -5.025  1.00 0.00 ? 2  IIL A HD11 10 
HETATM 7056  H HD12 . IIL A 1 2  ? -4.082  -1.763  -3.396  1.00 0.00 ? 2  IIL A HD12 10 
HETATM 7057  H HD13 . IIL A 1 2  ? -3.009  -1.662  -4.792  1.00 0.00 ? 2  IIL A HD13 10 
ATOM   7058  N N    . VAL A 1 3  ? -4.352  3.019   -4.980  1.00 0.00 ? 3  VAL A N    10 
ATOM   7059  C CA   . VAL A 1 3  ? -4.421  3.829   -6.228  1.00 0.00 ? 3  VAL A CA   10 
ATOM   7060  C C    . VAL A 1 3  ? -4.428  5.319   -5.876  1.00 0.00 ? 3  VAL A C    10 
ATOM   7061  O O    . VAL A 1 3  ? -3.719  6.108   -6.467  1.00 0.00 ? 3  VAL A O    10 
ATOM   7062  C CB   . VAL A 1 3  ? -5.700  3.477   -6.990  1.00 0.00 ? 3  VAL A CB   10 
ATOM   7063  C CG1  . VAL A 1 3  ? -5.656  4.103   -8.382  1.00 0.00 ? 3  VAL A CG1  10 
ATOM   7064  C CG2  . VAL A 1 3  ? -5.811  1.955   -7.120  1.00 0.00 ? 3  VAL A CG2  10 
ATOM   7065  H H    . VAL A 1 3  ? -5.132  2.501   -4.690  1.00 0.00 ? 3  VAL A H    10 
ATOM   7066  H HA   . VAL A 1 3  ? -3.564  3.609   -6.846  1.00 0.00 ? 3  VAL A HA   10 
ATOM   7067  H HB   . VAL A 1 3  ? -6.556  3.857   -6.452  1.00 0.00 ? 3  VAL A HB   10 
ATOM   7068  H HG11 . VAL A 1 3  ? -6.462  3.706   -8.981  1.00 0.00 ? 3  VAL A HG11 10 
ATOM   7069  H HG12 . VAL A 1 3  ? -4.711  3.870   -8.852  1.00 0.00 ? 3  VAL A HG12 10 
ATOM   7070  H HG13 . VAL A 1 3  ? -5.762  5.174   -8.298  1.00 0.00 ? 3  VAL A HG13 10 
ATOM   7071  H HG21 . VAL A 1 3  ? -6.349  1.710   -8.025  1.00 0.00 ? 3  VAL A HG21 10 
ATOM   7072  H HG22 . VAL A 1 3  ? -6.341  1.558   -6.267  1.00 0.00 ? 3  VAL A HG22 10 
ATOM   7073  H HG23 . VAL A 1 3  ? -4.822  1.525   -7.162  1.00 0.00 ? 3  VAL A HG23 10 
ATOM   7074  N N    . GLU A 1 4  ? -5.226  5.712   -4.920  1.00 0.00 ? 4  GLU A N    10 
ATOM   7075  C CA   . GLU A 1 4  ? -5.275  7.153   -4.538  1.00 0.00 ? 4  GLU A CA   10 
ATOM   7076  C C    . GLU A 1 4  ? -3.994  7.533   -3.792  1.00 0.00 ? 4  GLU A C    10 
ATOM   7077  O O    . GLU A 1 4  ? -3.789  8.676   -3.434  1.00 0.00 ? 4  GLU A O    10 
ATOM   7078  C CB   . GLU A 1 4  ? -6.482  7.399   -3.630  1.00 0.00 ? 4  GLU A CB   10 
ATOM   7079  C CG   . GLU A 1 4  ? -7.745  7.523   -4.483  1.00 0.00 ? 4  GLU A CG   10 
ATOM   7080  C CD   . GLU A 1 4  ? -8.610  8.666   -3.948  1.00 0.00 ? 4  GLU A CD   10 
ATOM   7081  O OE1  . GLU A 1 4  ? -8.412  9.049   -2.807  1.00 0.00 ? 4  GLU A OE1  10 
ATOM   7082  O OE2  . GLU A 1 4  ? -9.454  9.140   -4.690  1.00 0.00 ? 4  GLU A OE2  10 
ATOM   7083  H H    . GLU A 1 4  ? -5.792  5.062   -4.455  1.00 0.00 ? 4  GLU A H    10 
ATOM   7084  H HA   . GLU A 1 4  ? -5.364  7.759   -5.427  1.00 0.00 ? 4  GLU A HA   10 
ATOM   7085  H HB2  . GLU A 1 4  ? -6.589  6.572   -2.943  1.00 0.00 ? 4  GLU A HB2  10 
ATOM   7086  H HB3  . GLU A 1 4  ? -6.335  8.313   -3.074  1.00 0.00 ? 4  GLU A HB3  10 
ATOM   7087  H HG2  . GLU A 1 4  ? -7.470  7.726   -5.507  1.00 0.00 ? 4  GLU A HG2  10 
ATOM   7088  H HG3  . GLU A 1 4  ? -8.303  6.599   -4.436  1.00 0.00 ? 4  GLU A HG3  10 
ATOM   7089  N N    . GLN A 1 5  ? -3.133  6.584   -3.549  1.00 0.00 ? 5  GLN A N    10 
ATOM   7090  C CA   . GLN A 1 5  ? -1.872  6.893   -2.820  1.00 0.00 ? 5  GLN A CA   10 
ATOM   7091  C C    . GLN A 1 5  ? -0.699  6.918   -3.804  1.00 0.00 ? 5  GLN A C    10 
ATOM   7092  O O    . GLN A 1 5  ? 0.042   7.879   -3.878  1.00 0.00 ? 5  GLN A O    10 
ATOM   7093  C CB   . GLN A 1 5  ? -1.631  5.821   -1.755  1.00 0.00 ? 5  GLN A CB   10 
ATOM   7094  C CG   . GLN A 1 5  ? -0.249  6.017   -1.132  1.00 0.00 ? 5  GLN A CG   10 
ATOM   7095  C CD   . GLN A 1 5  ? -0.268  7.246   -0.221  1.00 0.00 ? 5  GLN A CD   10 
ATOM   7096  O OE1  . GLN A 1 5  ? -1.247  7.504   0.451   1.00 0.00 ? 5  GLN A OE1  10 
ATOM   7097  N NE2  . GLN A 1 5  ? 0.780   8.021   -0.171  1.00 0.00 ? 5  GLN A NE2  10 
ATOM   7098  H H    . GLN A 1 5  ? -3.317  5.668   -3.840  1.00 0.00 ? 5  GLN A H    10 
ATOM   7099  H HA   . GLN A 1 5  ? -1.962  7.860   -2.343  1.00 0.00 ? 5  GLN A HA   10 
ATOM   7100  H HB2  . GLN A 1 5  ? -2.388  5.901   -0.989  1.00 0.00 ? 5  GLN A HB2  10 
ATOM   7101  H HB3  . GLN A 1 5  ? -1.682  4.843   -2.212  1.00 0.00 ? 5  GLN A HB3  10 
ATOM   7102  H HG2  . GLN A 1 5  ? 0.010   5.143   -0.553  1.00 0.00 ? 5  GLN A HG2  10 
ATOM   7103  H HG3  . GLN A 1 5  ? 0.482   6.162   -1.914  1.00 0.00 ? 5  GLN A HG3  10 
ATOM   7104  H HE21 . GLN A 1 5  ? 1.569   7.814   -0.713  1.00 0.00 ? 5  GLN A HE21 10 
ATOM   7105  H HE22 . GLN A 1 5  ? 0.778   8.810   0.411   1.00 0.00 ? 5  GLN A HE22 10 
ATOM   7106  N N    . CYS A 1 6  ? -0.520  5.873   -4.563  1.00 0.00 ? 6  CYS A N    10 
ATOM   7107  C CA   . CYS A 1 6  ? 0.606   5.852   -5.537  1.00 0.00 ? 6  CYS A CA   10 
ATOM   7108  C C    . CYS A 1 6  ? 0.243   6.709   -6.750  1.00 0.00 ? 6  CYS A C    10 
ATOM   7109  O O    . CYS A 1 6  ? 1.073   6.993   -7.590  1.00 0.00 ? 6  CYS A O    10 
ATOM   7110  C CB   . CYS A 1 6  ? 0.881   4.416   -5.984  1.00 0.00 ? 6  CYS A CB   10 
ATOM   7111  S SG   . CYS A 1 6  ? 1.093   3.362   -4.529  1.00 0.00 ? 6  CYS A SG   10 
ATOM   7112  H H    . CYS A 1 6  ? -1.126  5.104   -4.494  1.00 0.00 ? 6  CYS A H    10 
ATOM   7113  H HA   . CYS A 1 6  ? 1.491   6.257   -5.067  1.00 0.00 ? 6  CYS A HA   10 
ATOM   7114  H HB2  . CYS A 1 6  ? 0.053   4.061   -6.572  1.00 0.00 ? 6  CYS A HB2  10 
ATOM   7115  H HB3  . CYS A 1 6  ? 1.780   4.390   -6.581  1.00 0.00 ? 6  CYS A HB3  10 
ATOM   7116  N N    . CYS A 1 7  ? -0.991  7.129   -6.845  1.00 0.00 ? 7  CYS A N    10 
ATOM   7117  C CA   . CYS A 1 7  ? -1.400  7.978   -8.000  1.00 0.00 ? 7  CYS A CA   10 
ATOM   7118  C C    . CYS A 1 7  ? -1.568  9.423   -7.525  1.00 0.00 ? 7  CYS A C    10 
ATOM   7119  O O    . CYS A 1 7  ? -1.756  10.328  -8.314  1.00 0.00 ? 7  CYS A O    10 
ATOM   7120  C CB   . CYS A 1 7  ? -2.715  7.458   -8.590  1.00 0.00 ? 7  CYS A CB   10 
ATOM   7121  S SG   . CYS A 1 7  ? -3.069  8.318   -10.142 1.00 0.00 ? 7  CYS A SG   10 
ATOM   7122  H H    . CYS A 1 7  ? -1.645  6.893   -6.154  1.00 0.00 ? 7  CYS A H    10 
ATOM   7123  H HA   . CYS A 1 7  ? -0.631  7.946   -8.752  1.00 0.00 ? 7  CYS A HA   10 
ATOM   7124  H HB2  . CYS A 1 7  ? -2.630  6.398   -8.778  1.00 0.00 ? 7  CYS A HB2  10 
ATOM   7125  H HB3  . CYS A 1 7  ? -3.516  7.634   -7.895  1.00 0.00 ? 7  CYS A HB3  10 
ATOM   7126  N N    . THR A 1 8  ? -1.476  9.649   -6.243  1.00 0.00 ? 8  THR A N    10 
ATOM   7127  C CA   . THR A 1 8  ? -1.601  11.037  -5.719  1.00 0.00 ? 8  THR A CA   10 
ATOM   7128  C C    . THR A 1 8  ? -0.193  11.614  -5.564  1.00 0.00 ? 8  THR A C    10 
ATOM   7129  O O    . THR A 1 8  ? 0.016   12.810  -5.607  1.00 0.00 ? 8  THR A O    10 
ATOM   7130  C CB   . THR A 1 8  ? -2.306  11.015  -4.359  1.00 0.00 ? 8  THR A CB   10 
ATOM   7131  O OG1  . THR A 1 8  ? -2.375  12.335  -3.839  1.00 0.00 ? 8  THR A OG1  10 
ATOM   7132  C CG2  . THR A 1 8  ? -1.528  10.124  -3.393  1.00 0.00 ? 8  THR A CG2  10 
ATOM   7133  H H    . THR A 1 8  ? -1.306  8.909   -5.625  1.00 0.00 ? 8  THR A H    10 
ATOM   7134  H HA   . THR A 1 8  ? -2.166  11.640  -6.416  1.00 0.00 ? 8  THR A HA   10 
ATOM   7135  H HB   . THR A 1 8  ? -3.303  10.620  -4.477  1.00 0.00 ? 8  THR A HB   10 
ATOM   7136  H HG1  . THR A 1 8  ? -3.297  12.601  -3.827  1.00 0.00 ? 8  THR A HG1  10 
ATOM   7137  H HG21 . THR A 1 8  ? -0.483  10.398  -3.409  1.00 0.00 ? 8  THR A HG21 10 
ATOM   7138  H HG22 . THR A 1 8  ? -1.635  9.093   -3.693  1.00 0.00 ? 8  THR A HG22 10 
ATOM   7139  H HG23 . THR A 1 8  ? -1.919  10.249  -2.393  1.00 0.00 ? 8  THR A HG23 10 
ATOM   7140  N N    . SER A 1 9  ? 0.776   10.756  -5.395  1.00 0.00 ? 9  SER A N    10 
ATOM   7141  C CA   . SER A 1 9  ? 2.183   11.217  -5.248  1.00 0.00 ? 9  SER A CA   10 
ATOM   7142  C C    . SER A 1 9  ? 3.111   10.102  -5.731  1.00 0.00 ? 9  SER A C    10 
ATOM   7143  O O    . SER A 1 9  ? 2.679   9.161   -6.365  1.00 0.00 ? 9  SER A O    10 
ATOM   7144  C CB   . SER A 1 9  ? 2.466   11.529  -3.777  1.00 0.00 ? 9  SER A CB   10 
ATOM   7145  O OG   . SER A 1 9  ? 1.325   12.154  -3.204  1.00 0.00 ? 9  SER A OG   10 
ATOM   7146  H H    . SER A 1 9  ? 0.576   9.797   -5.373  1.00 0.00 ? 9  SER A H    10 
ATOM   7147  H HA   . SER A 1 9  ? 2.338   12.104  -5.845  1.00 0.00 ? 9  SER A HA   10 
ATOM   7148  H HB2  . SER A 1 9  ? 2.676   10.615  -3.247  1.00 0.00 ? 9  SER A HB2  10 
ATOM   7149  H HB3  . SER A 1 9  ? 3.323   12.188  -3.709  1.00 0.00 ? 9  SER A HB3  10 
ATOM   7150  H HG   . SER A 1 9  ? 1.300   11.927  -2.271  1.00 0.00 ? 9  SER A HG   10 
ATOM   7151  N N    . ILE A 1 10 ? 4.380   10.184  -5.441  1.00 0.00 ? 10 ILE A N    10 
ATOM   7152  C CA   . ILE A 1 10 ? 5.302   9.106   -5.897  1.00 0.00 ? 10 ILE A CA   10 
ATOM   7153  C C    . ILE A 1 10 ? 5.160   7.904   -4.963  1.00 0.00 ? 10 ILE A C    10 
ATOM   7154  O O    . ILE A 1 10 ? 5.100   8.046   -3.758  1.00 0.00 ? 10 ILE A O    10 
ATOM   7155  C CB   . ILE A 1 10 ? 6.745   9.612   -5.876  1.00 0.00 ? 10 ILE A CB   10 
ATOM   7156  C CG1  . ILE A 1 10 ? 6.935   10.661  -6.978  1.00 0.00 ? 10 ILE A CG1  10 
ATOM   7157  C CG2  . ILE A 1 10 ? 7.701   8.439   -6.114  1.00 0.00 ? 10 ILE A CG2  10 
ATOM   7158  C CD1  . ILE A 1 10 ? 6.996   9.973   -8.343  1.00 0.00 ? 10 ILE A CD1  10 
ATOM   7159  H H    . ILE A 1 10 ? 4.721   10.944  -4.924  1.00 0.00 ? 10 ILE A H    10 
ATOM   7160  H HA   . ILE A 1 10 ? 5.036   8.811   -6.903  1.00 0.00 ? 10 ILE A HA   10 
ATOM   7161  H HB   . ILE A 1 10 ? 6.956   10.056  -4.917  1.00 0.00 ? 10 ILE A HB   10 
ATOM   7162  H HG12 . ILE A 1 10 ? 6.105   11.352  -6.961  1.00 0.00 ? 10 ILE A HG12 10 
ATOM   7163  H HG13 . ILE A 1 10 ? 7.855   11.199  -6.807  1.00 0.00 ? 10 ILE A HG13 10 
ATOM   7164  H HG21 . ILE A 1 10 ? 7.285   7.785   -6.866  1.00 0.00 ? 10 ILE A HG21 10 
ATOM   7165  H HG22 . ILE A 1 10 ? 7.834   7.891   -5.194  1.00 0.00 ? 10 ILE A HG22 10 
ATOM   7166  H HG23 . ILE A 1 10 ? 8.655   8.815   -6.452  1.00 0.00 ? 10 ILE A HG23 10 
ATOM   7167  H HD11 . ILE A 1 10 ? 7.729   9.181   -8.315  1.00 0.00 ? 10 ILE A HD11 10 
ATOM   7168  H HD12 . ILE A 1 10 ? 7.276   10.694  -9.095  1.00 0.00 ? 10 ILE A HD12 10 
ATOM   7169  H HD13 . ILE A 1 10 ? 6.028   9.559   -8.581  1.00 0.00 ? 10 ILE A HD13 10 
ATOM   7170  N N    . CYS A 1 11 ? 5.081   6.724   -5.511  1.00 0.00 ? 11 CYS A N    10 
ATOM   7171  C CA   . CYS A 1 11 ? 4.917   5.516   -4.655  1.00 0.00 ? 11 CYS A CA   10 
ATOM   7172  C C    . CYS A 1 11 ? 6.165   4.639   -4.734  1.00 0.00 ? 11 CYS A C    10 
ATOM   7173  O O    . CYS A 1 11 ? 7.168   5.011   -5.310  1.00 0.00 ? 11 CYS A O    10 
ATOM   7174  C CB   . CYS A 1 11 ? 3.711   4.721   -5.153  1.00 0.00 ? 11 CYS A CB   10 
ATOM   7175  S SG   . CYS A 1 11 ? 2.863   3.950   -3.754  1.00 0.00 ? 11 CYS A SG   10 
ATOM   7176  H H    . CYS A 1 11 ? 5.115   6.633   -6.486  1.00 0.00 ? 11 CYS A H    10 
ATOM   7177  H HA   . CYS A 1 11 ? 4.750   5.819   -3.632  1.00 0.00 ? 11 CYS A HA   10 
ATOM   7178  H HB2  . CYS A 1 11 ? 3.032   5.387   -5.663  1.00 0.00 ? 11 CYS A HB2  10 
ATOM   7179  H HB3  . CYS A 1 11 ? 4.044   3.956   -5.838  1.00 0.00 ? 11 CYS A HB3  10 
ATOM   7180  N N    . SER A 1 12 ? 6.105   3.470   -4.155  1.00 0.00 ? 12 SER A N    10 
ATOM   7181  C CA   . SER A 1 12 ? 7.277   2.555   -4.188  1.00 0.00 ? 12 SER A CA   10 
ATOM   7182  C C    . SER A 1 12 ? 6.783   1.107   -4.253  1.00 0.00 ? 12 SER A C    10 
ATOM   7183  O O    . SER A 1 12 ? 5.723   0.779   -3.756  1.00 0.00 ? 12 SER A O    10 
ATOM   7184  C CB   . SER A 1 12 ? 8.115   2.753   -2.924  1.00 0.00 ? 12 SER A CB   10 
ATOM   7185  O OG   . SER A 1 12 ? 7.315   3.370   -1.924  1.00 0.00 ? 12 SER A OG   10 
ATOM   7186  H H    . SER A 1 12 ? 5.283   3.194   -3.700  1.00 0.00 ? 12 SER A H    10 
ATOM   7187  H HA   . SER A 1 12 ? 7.880   2.769   -5.058  1.00 0.00 ? 12 SER A HA   10 
ATOM   7188  H HB2  . SER A 1 12 ? 8.459   1.798   -2.564  1.00 0.00 ? 12 SER A HB2  10 
ATOM   7189  H HB3  . SER A 1 12 ? 8.968   3.378   -3.155  1.00 0.00 ? 12 SER A HB3  10 
ATOM   7190  H HG   . SER A 1 12 ? 7.793   4.133   -1.591  1.00 0.00 ? 12 SER A HG   10 
ATOM   7191  N N    . LEU A 1 13 ? 7.542   0.239   -4.861  1.00 0.00 ? 13 LEU A N    10 
ATOM   7192  C CA   . LEU A 1 13 ? 7.112   -1.183  -4.956  1.00 0.00 ? 13 LEU A CA   10 
ATOM   7193  C C    . LEU A 1 13 ? 7.066   -1.791  -3.552  1.00 0.00 ? 13 LEU A C    10 
ATOM   7194  O O    . LEU A 1 13 ? 6.529   -2.862  -3.345  1.00 0.00 ? 13 LEU A O    10 
ATOM   7195  C CB   . LEU A 1 13 ? 8.117   -1.956  -5.812  1.00 0.00 ? 13 LEU A CB   10 
ATOM   7196  C CG   . LEU A 1 13 ? 9.480   -1.957  -5.119  1.00 0.00 ? 13 LEU A CG   10 
ATOM   7197  C CD1  . LEU A 1 13 ? 9.946   -3.398  -4.910  1.00 0.00 ? 13 LEU A CD1  10 
ATOM   7198  C CD2  . LEU A 1 13 ? 10.496  -1.214  -5.991  1.00 0.00 ? 13 LEU A CD2  10 
ATOM   7199  H H    . LEU A 1 13 ? 8.393   0.520   -5.254  1.00 0.00 ? 13 LEU A H    10 
ATOM   7200  H HA   . LEU A 1 13 ? 6.130   -1.237  -5.409  1.00 0.00 ? 13 LEU A HA   10 
ATOM   7201  H HB2  . LEU A 1 13 ? 7.776   -2.973  -5.939  1.00 0.00 ? 13 LEU A HB2  10 
ATOM   7202  H HB3  . LEU A 1 13 ? 8.207   -1.483  -6.779  1.00 0.00 ? 13 LEU A HB3  10 
ATOM   7203  H HG   . LEU A 1 13 ? 9.396   -1.463  -4.162  1.00 0.00 ? 13 LEU A HG   10 
ATOM   7204  H HD11 . LEU A 1 13 ? 9.887   -3.647  -3.862  1.00 0.00 ? 13 LEU A HD11 10 
ATOM   7205  H HD12 . LEU A 1 13 ? 10.968  -3.499  -5.246  1.00 0.00 ? 13 LEU A HD12 10 
ATOM   7206  H HD13 . LEU A 1 13 ? 9.314   -4.066  -5.475  1.00 0.00 ? 13 LEU A HD13 10 
ATOM   7207  H HD21 . LEU A 1 13 ? 10.039  -0.952  -6.934  1.00 0.00 ? 13 LEU A HD21 10 
ATOM   7208  H HD22 . LEU A 1 13 ? 11.351  -1.849  -6.168  1.00 0.00 ? 13 LEU A HD22 10 
ATOM   7209  H HD23 . LEU A 1 13 ? 10.814  -0.315  -5.484  1.00 0.00 ? 13 LEU A HD23 10 
ATOM   7210  N N    . TYR A 1 14 ? 7.619   -1.112  -2.581  1.00 0.00 ? 14 TYR A N    10 
ATOM   7211  C CA   . TYR A 1 14 ? 7.596   -1.650  -1.195  1.00 0.00 ? 14 TYR A CA   10 
ATOM   7212  C C    . TYR A 1 14 ? 6.156   -1.660  -0.704  1.00 0.00 ? 14 TYR A C    10 
ATOM   7213  O O    . TYR A 1 14 ? 5.688   -2.614  -0.114  1.00 0.00 ? 14 TYR A O    10 
ATOM   7214  C CB   . TYR A 1 14 ? 8.447   -0.764  -0.284  1.00 0.00 ? 14 TYR A CB   10 
ATOM   7215  C CG   . TYR A 1 14 ? 9.787   -1.428  -0.042  1.00 0.00 ? 14 TYR A CG   10 
ATOM   7216  C CD1  . TYR A 1 14 ? 10.536  -1.913  -1.125  1.00 0.00 ? 14 TYR A CD1  10 
ATOM   7217  C CD2  . TYR A 1 14 ? 10.283  -1.561  1.264   1.00 0.00 ? 14 TYR A CD2  10 
ATOM   7218  C CE1  . TYR A 1 14 ? 11.776  -2.527  -0.902  1.00 0.00 ? 14 TYR A CE1  10 
ATOM   7219  C CE2  . TYR A 1 14 ? 11.522  -2.175  1.484   1.00 0.00 ? 14 TYR A CE2  10 
ATOM   7220  C CZ   . TYR A 1 14 ? 12.268  -2.657  0.402   1.00 0.00 ? 14 TYR A CZ   10 
ATOM   7221  O OH   . TYR A 1 14 ? 13.489  -3.263  0.621   1.00 0.00 ? 14 TYR A OH   10 
ATOM   7222  H H    . TYR A 1 14 ? 8.039   -0.248  -2.764  1.00 0.00 ? 14 TYR A H    10 
ATOM   7223  H HA   . TYR A 1 14 ? 7.983   -2.653  -1.192  1.00 0.00 ? 14 TYR A HA   10 
ATOM   7224  H HB2  . TYR A 1 14 ? 8.599   0.196   -0.758  1.00 0.00 ? 14 TYR A HB2  10 
ATOM   7225  H HB3  . TYR A 1 14 ? 7.939   -0.622  0.659   1.00 0.00 ? 14 TYR A HB3  10 
ATOM   7226  H HD1  . TYR A 1 14 ? 10.160  -1.814  -2.132  1.00 0.00 ? 14 TYR A HD1  10 
ATOM   7227  H HD2  . TYR A 1 14 ? 9.710   -1.190  2.100   1.00 0.00 ? 14 TYR A HD2  10 
ATOM   7228  H HE1  . TYR A 1 14 ? 12.352  -2.900  -1.737  1.00 0.00 ? 14 TYR A HE1  10 
ATOM   7229  H HE2  . TYR A 1 14 ? 11.903  -2.276  2.490   1.00 0.00 ? 14 TYR A HE2  10 
ATOM   7230  H HH   . TYR A 1 14 ? 13.647  -3.280  1.568   1.00 0.00 ? 14 TYR A HH   10 
ATOM   7231  N N    . GLN A 1 15 ? 5.446   -0.604  -0.967  1.00 0.00 ? 15 GLN A N    10 
ATOM   7232  C CA   . GLN A 1 15 ? 4.024   -0.538  -0.544  1.00 0.00 ? 15 GLN A CA   10 
ATOM   7233  C C    . GLN A 1 15 ? 3.196   -1.385  -1.508  1.00 0.00 ? 15 GLN A C    10 
ATOM   7234  O O    . GLN A 1 15 ? 2.088   -1.787  -1.213  1.00 0.00 ? 15 GLN A O    10 
ATOM   7235  C CB   . GLN A 1 15 ? 3.541   0.913   -0.589  1.00 0.00 ? 15 GLN A CB   10 
ATOM   7236  C CG   . GLN A 1 15 ? 4.158   1.695   0.571   1.00 0.00 ? 15 GLN A CG   10 
ATOM   7237  C CD   . GLN A 1 15 ? 3.235   2.853   0.953   1.00 0.00 ? 15 GLN A CD   10 
ATOM   7238  O OE1  . GLN A 1 15 ? 2.406   2.721   1.831   1.00 0.00 ? 15 GLN A OE1  10 
ATOM   7239  N NE2  . GLN A 1 15 ? 3.344   3.992   0.324   1.00 0.00 ? 15 GLN A NE2  10 
ATOM   7240  H H    . GLN A 1 15 ? 5.850   0.139   -1.457  1.00 0.00 ? 15 GLN A H    10 
ATOM   7241  H HA   . GLN A 1 15 ? 3.928   -0.925  0.457   1.00 0.00 ? 15 GLN A HA   10 
ATOM   7242  H HB2  . GLN A 1 15 ? 3.839   1.362   -1.526  1.00 0.00 ? 15 GLN A HB2  10 
ATOM   7243  H HB3  . GLN A 1 15 ? 2.465   0.937   -0.504  1.00 0.00 ? 15 GLN A HB3  10 
ATOM   7244  H HG2  . GLN A 1 15 ? 4.286   1.039   1.420   1.00 0.00 ? 15 GLN A HG2  10 
ATOM   7245  H HG3  . GLN A 1 15 ? 5.119   2.086   0.271   1.00 0.00 ? 15 GLN A HG3  10 
ATOM   7246  H HE21 . GLN A 1 15 ? 4.011   4.099   -0.385  1.00 0.00 ? 15 GLN A HE21 10 
ATOM   7247  H HE22 . GLN A 1 15 ? 2.756   4.739   0.560   1.00 0.00 ? 15 GLN A HE22 10 
ATOM   7248  N N    . LEU A 1 16 ? 3.737   -1.659  -2.664  1.00 0.00 ? 16 LEU A N    10 
ATOM   7249  C CA   . LEU A 1 16 ? 3.011   -2.479  -3.665  1.00 0.00 ? 16 LEU A CA   10 
ATOM   7250  C C    . LEU A 1 16 ? 2.993   -3.936  -3.205  1.00 0.00 ? 16 LEU A C    10 
ATOM   7251  O O    . LEU A 1 16 ? 2.191   -4.733  -3.652  1.00 0.00 ? 16 LEU A O    10 
ATOM   7252  C CB   . LEU A 1 16 ? 3.746   -2.369  -5.001  1.00 0.00 ? 16 LEU A CB   10 
ATOM   7253  C CG   . LEU A 1 16 ? 3.289   -1.110  -5.741  1.00 0.00 ? 16 LEU A CG   10 
ATOM   7254  C CD1  . LEU A 1 16 ? 3.912   -1.083  -7.138  1.00 0.00 ? 16 LEU A CD1  10 
ATOM   7255  C CD2  . LEU A 1 16 ? 1.767   -1.115  -5.867  1.00 0.00 ? 16 LEU A CD2  10 
ATOM   7256  H H    . LEU A 1 16 ? 4.632   -1.325  -2.876  1.00 0.00 ? 16 LEU A H    10 
ATOM   7257  H HA   . LEU A 1 16 ? 2.002   -2.117  -3.771  1.00 0.00 ? 16 LEU A HA   10 
ATOM   7258  H HB2  . LEU A 1 16 ? 4.806   -2.313  -4.816  1.00 0.00 ? 16 LEU A HB2  10 
ATOM   7259  H HB3  . LEU A 1 16 ? 3.536   -3.233  -5.599  1.00 0.00 ? 16 LEU A HB3  10 
ATOM   7260  H HG   . LEU A 1 16 ? 3.603   -0.234  -5.192  1.00 0.00 ? 16 LEU A HG   10 
ATOM   7261  H HD11 . LEU A 1 16 ? 3.511   -0.249  -7.694  1.00 0.00 ? 16 LEU A HD11 10 
ATOM   7262  H HD12 . LEU A 1 16 ? 3.681   -2.003  -7.654  1.00 0.00 ? 16 LEU A HD12 10 
ATOM   7263  H HD13 . LEU A 1 16 ? 4.983   -0.977  -7.053  1.00 0.00 ? 16 LEU A HD13 10 
ATOM   7264  H HD21 . LEU A 1 16 ? 1.340   -0.531  -5.067  1.00 0.00 ? 16 LEU A HD21 10 
ATOM   7265  H HD22 . LEU A 1 16 ? 1.406   -2.130  -5.806  1.00 0.00 ? 16 LEU A HD22 10 
ATOM   7266  H HD23 . LEU A 1 16 ? 1.483   -0.687  -6.817  1.00 0.00 ? 16 LEU A HD23 10 
ATOM   7267  N N    . GLU A 1 17 ? 3.873   -4.289  -2.310  1.00 0.00 ? 17 GLU A N    10 
ATOM   7268  C CA   . GLU A 1 17 ? 3.914   -5.694  -1.813  1.00 0.00 ? 17 GLU A CA   10 
ATOM   7269  C C    . GLU A 1 17 ? 2.766   -5.918  -0.830  1.00 0.00 ? 17 GLU A C    10 
ATOM   7270  O O    . GLU A 1 17 ? 2.249   -7.009  -0.695  1.00 0.00 ? 17 GLU A O    10 
ATOM   7271  C CB   . GLU A 1 17 ? 5.249   -5.947  -1.109  1.00 0.00 ? 17 GLU A CB   10 
ATOM   7272  C CG   . GLU A 1 17 ? 6.052   -6.988  -1.892  1.00 0.00 ? 17 GLU A CG   10 
ATOM   7273  C CD   . GLU A 1 17 ? 5.542   -8.388  -1.549  1.00 0.00 ? 17 GLU A CD   10 
ATOM   7274  O OE1  . GLU A 1 17 ? 4.594   -8.481  -0.787  1.00 0.00 ? 17 GLU A OE1  10 
ATOM   7275  O OE2  . GLU A 1 17 ? 6.108   -9.344  -2.052  1.00 0.00 ? 17 GLU A OE2  10 
ATOM   7276  H H    . GLU A 1 17 ? 4.508   -3.629  -1.964  1.00 0.00 ? 17 GLU A H    10 
ATOM   7277  H HA   . GLU A 1 17 ? 3.810   -6.371  -2.644  1.00 0.00 ? 17 GLU A HA   10 
ATOM   7278  H HB2  . GLU A 1 17 ? 5.810   -5.025  -1.057  1.00 0.00 ? 17 GLU A HB2  10 
ATOM   7279  H HB3  . GLU A 1 17 ? 5.065   -6.315  -0.110  1.00 0.00 ? 17 GLU A HB3  10 
ATOM   7280  H HG2  . GLU A 1 17 ? 5.935   -6.811  -2.951  1.00 0.00 ? 17 GLU A HG2  10 
ATOM   7281  H HG3  . GLU A 1 17 ? 7.096   -6.912  -1.628  1.00 0.00 ? 17 GLU A HG3  10 
ATOM   7282  N N    . ASN A 1 18 ? 2.362   -4.887  -0.147  1.00 0.00 ? 18 ASN A N    10 
ATOM   7283  C CA   . ASN A 1 18 ? 1.247   -5.023  0.828   1.00 0.00 ? 18 ASN A CA   10 
ATOM   7284  C C    . ASN A 1 18 ? -0.080  -5.151  0.076   1.00 0.00 ? 18 ASN A C    10 
ATOM   7285  O O    . ASN A 1 18 ? -1.130  -5.287  0.672   1.00 0.00 ? 18 ASN A O    10 
ATOM   7286  C CB   . ASN A 1 18 ? 1.210   -3.786  1.727   1.00 0.00 ? 18 ASN A CB   10 
ATOM   7287  C CG   . ASN A 1 18 ? 1.878   -4.107  3.065   1.00 0.00 ? 18 ASN A CG   10 
ATOM   7288  O OD1  . ASN A 1 18 ? 1.325   -3.840  4.114   1.00 0.00 ? 18 ASN A OD1  10 
ATOM   7289  N ND2  . ASN A 1 18 ? 3.053   -4.674  3.075   1.00 0.00 ? 18 ASN A ND2  10 
ATOM   7290  H H    . ASN A 1 18 ? 2.793   -4.019  -0.280  1.00 0.00 ? 18 ASN A H    10 
ATOM   7291  H HA   . ASN A 1 18 ? 1.404   -5.903  1.434   1.00 0.00 ? 18 ASN A HA   10 
ATOM   7292  H HB2  . ASN A 1 18 ? 1.738   -2.977  1.244   1.00 0.00 ? 18 ASN A HB2  10 
ATOM   7293  H HB3  . ASN A 1 18 ? 0.186   -3.496  1.897   1.00 0.00 ? 18 ASN A HB3  10 
ATOM   7294  H HD21 . ASN A 1 18 ? 3.500   -4.891  2.228   1.00 0.00 ? 18 ASN A HD21 10 
ATOM   7295  H HD22 . ASN A 1 18 ? 3.490   -4.883  3.926   1.00 0.00 ? 18 ASN A HD22 10 
ATOM   7296  N N    . TYR A 1 19 ? -0.043  -5.109  -1.229  1.00 0.00 ? 19 TYR A N    10 
ATOM   7297  C CA   . TYR A 1 19 ? -1.300  -5.229  -2.014  1.00 0.00 ? 19 TYR A CA   10 
ATOM   7298  C C    . TYR A 1 19 ? -1.228  -6.478  -2.891  1.00 0.00 ? 19 TYR A C    10 
ATOM   7299  O O    . TYR A 1 19 ? -1.778  -6.524  -3.973  1.00 0.00 ? 19 TYR A O    10 
ATOM   7300  C CB   . TYR A 1 19 ? -1.463  -3.990  -2.893  1.00 0.00 ? 19 TYR A CB   10 
ATOM   7301  C CG   . TYR A 1 19 ? -1.630  -2.774  -2.014  1.00 0.00 ? 19 TYR A CG   10 
ATOM   7302  C CD1  . TYR A 1 19 ? -2.803  -2.606  -1.264  1.00 0.00 ? 19 TYR A CD1  10 
ATOM   7303  C CD2  . TYR A 1 19 ? -0.611  -1.815  -1.945  1.00 0.00 ? 19 TYR A CD2  10 
ATOM   7304  C CE1  . TYR A 1 19 ? -2.955  -1.479  -0.446  1.00 0.00 ? 19 TYR A CE1  10 
ATOM   7305  C CE2  . TYR A 1 19 ? -0.764  -0.687  -1.126  1.00 0.00 ? 19 TYR A CE2  10 
ATOM   7306  C CZ   . TYR A 1 19 ? -1.936  -0.520  -0.376  1.00 0.00 ? 19 TYR A CZ   10 
ATOM   7307  O OH   . TYR A 1 19 ? -2.086  0.590   0.429   1.00 0.00 ? 19 TYR A OH   10 
ATOM   7308  H H    . TYR A 1 19 ? 0.811   -5.000  -1.693  1.00 0.00 ? 19 TYR A H    10 
ATOM   7309  H HA   . TYR A 1 19 ? -2.140  -5.308  -1.342  1.00 0.00 ? 19 TYR A HA   10 
ATOM   7310  H HB2  . TYR A 1 19 ? -0.586  -3.870  -3.513  1.00 0.00 ? 19 TYR A HB2  10 
ATOM   7311  H HB3  . TYR A 1 19 ? -2.333  -4.104  -3.519  1.00 0.00 ? 19 TYR A HB3  10 
ATOM   7312  H HD1  . TYR A 1 19 ? -3.588  -3.345  -1.318  1.00 0.00 ? 19 TYR A HD1  10 
ATOM   7313  H HD2  . TYR A 1 19 ? 0.291   -1.944  -2.523  1.00 0.00 ? 19 TYR A HD2  10 
ATOM   7314  H HE1  . TYR A 1 19 ? -3.858  -1.350  0.134   1.00 0.00 ? 19 TYR A HE1  10 
ATOM   7315  H HE2  . TYR A 1 19 ? 0.022   0.051   -1.072  1.00 0.00 ? 19 TYR A HE2  10 
ATOM   7316  H HH   . TYR A 1 19 ? -1.253  1.066   0.436   1.00 0.00 ? 19 TYR A HH   10 
ATOM   7317  N N    . CYS A 1 20 ? -0.547  -7.493  -2.432  1.00 0.00 ? 20 CYS A N    10 
ATOM   7318  C CA   . CYS A 1 20 ? -0.432  -8.739  -3.236  1.00 0.00 ? 20 CYS A CA   10 
ATOM   7319  C C    . CYS A 1 20 ? -1.527  -9.726  -2.822  1.00 0.00 ? 20 CYS A C    10 
ATOM   7320  O O    . CYS A 1 20 ? -2.639  -9.671  -3.306  1.00 0.00 ? 20 CYS A O    10 
ATOM   7321  C CB   . CYS A 1 20 ? 0.945   -9.365  -3.006  1.00 0.00 ? 20 CYS A CB   10 
ATOM   7322  S SG   . CYS A 1 20 ? 2.220   -8.273  -3.679  1.00 0.00 ? 20 CYS A SG   10 
ATOM   7323  H H    . CYS A 1 20 ? -0.109  -7.432  -1.557  1.00 0.00 ? 20 CYS A H    10 
ATOM   7324  H HA   . CYS A 1 20 ? -0.545  -8.503  -4.281  1.00 0.00 ? 20 CYS A HA   10 
ATOM   7325  H HB2  . CYS A 1 20 ? 1.108   -9.500  -1.948  1.00 0.00 ? 20 CYS A HB2  10 
ATOM   7326  H HB3  . CYS A 1 20 ? 0.992   -10.323 -3.502  1.00 0.00 ? 20 CYS A HB3  10 
ATOM   7327  N N    . ASN A 1 21 ? -1.220  -10.628 -1.934  1.00 0.00 ? 21 ASN A N    10 
ATOM   7328  C CA   . ASN A 1 21 ? -2.241  -11.619 -1.493  1.00 0.00 ? 21 ASN A CA   10 
ATOM   7329  C C    . ASN A 1 21 ? -1.987  -11.999 -0.032  1.00 0.00 ? 21 ASN A C    10 
ATOM   7330  O O    . ASN A 1 21 ? -0.840  -12.238 0.306   1.00 0.00 ? 21 ASN A O    10 
ATOM   7331  C CB   . ASN A 1 21 ? -2.144  -12.870 -2.371  1.00 0.00 ? 21 ASN A CB   10 
ATOM   7332  C CG   . ASN A 1 21 ? -2.955  -12.658 -3.651  1.00 0.00 ? 21 ASN A CG   10 
ATOM   7333  O OD1  . ASN A 1 21 ? -2.542  -11.927 -4.529  1.00 0.00 ? 21 ASN A OD1  10 
ATOM   7334  N ND2  . ASN A 1 21 ? -4.098  -13.269 -3.794  1.00 0.00 ? 21 ASN A ND2  10 
ATOM   7335  O OXT  . ASN A 1 21 ? -2.945  -12.045 0.722   1.00 0.00 ? 21 ASN A OXT  10 
ATOM   7336  H H    . ASN A 1 21 ? -0.318  -10.656 -1.560  1.00 0.00 ? 21 ASN A H    10 
ATOM   7337  H HA   . ASN A 1 21 ? -3.227  -11.189 -1.587  1.00 0.00 ? 21 ASN A HA   10 
ATOM   7338  H HB2  . ASN A 1 21 ? -1.109  -13.050 -2.626  1.00 0.00 ? 21 ASN A HB2  10 
ATOM   7339  H HB3  . ASN A 1 21 ? -2.537  -13.721 -1.834  1.00 0.00 ? 21 ASN A HB3  10 
ATOM   7340  H HD21 . ASN A 1 21 ? -4.431  -13.859 -3.086  1.00 0.00 ? 21 ASN A HD21 10 
ATOM   7341  H HD22 . ASN A 1 21 ? -4.624  -13.138 -4.611  1.00 0.00 ? 21 ASN A HD22 10 
ATOM   7342  N N    . PHE B 2 1  ? 13.398  3.794   -2.969  1.00 0.00 ? 1  PHE B N    10 
ATOM   7343  C CA   . PHE B 2 1  ? 13.641  2.603   -3.832  1.00 0.00 ? 1  PHE B CA   10 
ATOM   7344  C C    . PHE B 2 1  ? 13.218  2.923   -5.268  1.00 0.00 ? 1  PHE B C    10 
ATOM   7345  O O    . PHE B 2 1  ? 13.924  2.632   -6.212  1.00 0.00 ? 1  PHE B O    10 
ATOM   7346  C CB   . PHE B 2 1  ? 12.824  1.418   -3.310  1.00 0.00 ? 1  PHE B CB   10 
ATOM   7347  C CG   . PHE B 2 1  ? 13.377  0.133   -3.889  1.00 0.00 ? 1  PHE B CG   10 
ATOM   7348  C CD1  . PHE B 2 1  ? 13.332  -0.090  -5.273  1.00 0.00 ? 1  PHE B CD1  10 
ATOM   7349  C CD2  . PHE B 2 1  ? 13.935  -0.838  -3.043  1.00 0.00 ? 1  PHE B CD2  10 
ATOM   7350  C CE1  . PHE B 2 1  ? 13.843  -1.278  -5.809  1.00 0.00 ? 1  PHE B CE1  10 
ATOM   7351  C CE2  . PHE B 2 1  ? 14.445  -2.027  -3.582  1.00 0.00 ? 1  PHE B CE2  10 
ATOM   7352  C CZ   . PHE B 2 1  ? 14.400  -2.247  -4.964  1.00 0.00 ? 1  PHE B CZ   10 
ATOM   7353  H H1   . PHE B 2 1  ? 12.391  3.841   -2.718  1.00 0.00 ? 1  PHE B H1   10 
ATOM   7354  H H2   . PHE B 2 1  ? 13.670  4.656   -3.483  1.00 0.00 ? 1  PHE B H2   10 
ATOM   7355  H H3   . PHE B 2 1  ? 13.965  3.715   -2.101  1.00 0.00 ? 1  PHE B H3   10 
ATOM   7356  H HA   . PHE B 2 1  ? 14.691  2.353   -3.814  1.00 0.00 ? 1  PHE B HA   10 
ATOM   7357  H HB2  . PHE B 2 1  ? 12.886  1.389   -2.231  1.00 0.00 ? 1  PHE B HB2  10 
ATOM   7358  H HB3  . PHE B 2 1  ? 11.791  1.535   -3.607  1.00 0.00 ? 1  PHE B HB3  10 
ATOM   7359  H HD1  . PHE B 2 1  ? 12.904  0.655   -5.927  1.00 0.00 ? 1  PHE B HD1  10 
ATOM   7360  H HD2  . PHE B 2 1  ? 13.972  -0.671  -1.978  1.00 0.00 ? 1  PHE B HD2  10 
ATOM   7361  H HE1  . PHE B 2 1  ? 13.808  -1.448  -6.875  1.00 0.00 ? 1  PHE B HE1  10 
ATOM   7362  H HE2  . PHE B 2 1  ? 14.874  -2.773  -2.931  1.00 0.00 ? 1  PHE B HE2  10 
ATOM   7363  H HZ   . PHE B 2 1  ? 14.794  -3.162  -5.378  1.00 0.00 ? 1  PHE B HZ   10 
ATOM   7364  N N    . VAL B 2 2  ? 12.071  3.522   -5.440  1.00 0.00 ? 2  VAL B N    10 
ATOM   7365  C CA   . VAL B 2 2  ? 11.607  3.862   -6.814  1.00 0.00 ? 2  VAL B CA   10 
ATOM   7366  C C    . VAL B 2 2  ? 11.817  5.363   -7.063  1.00 0.00 ? 2  VAL B C    10 
ATOM   7367  O O    . VAL B 2 2  ? 12.857  5.902   -6.746  1.00 0.00 ? 2  VAL B O    10 
ATOM   7368  C CB   . VAL B 2 2  ? 10.127  3.500   -6.954  1.00 0.00 ? 2  VAL B CB   10 
ATOM   7369  C CG1  . VAL B 2 2  ? 9.774   3.343   -8.434  1.00 0.00 ? 2  VAL B CG1  10 
ATOM   7370  C CG2  . VAL B 2 2  ? 9.855   2.180   -6.230  1.00 0.00 ? 2  VAL B CG2  10 
ATOM   7371  H H    . VAL B 2 2  ? 11.516  3.750   -4.666  1.00 0.00 ? 2  VAL B H    10 
ATOM   7372  H HA   . VAL B 2 2  ? 12.183  3.297   -7.535  1.00 0.00 ? 2  VAL B HA   10 
ATOM   7373  H HB   . VAL B 2 2  ? 9.521   4.283   -6.520  1.00 0.00 ? 2  VAL B HB   10 
ATOM   7374  H HG11 . VAL B 2 2  ? 9.965   2.326   -8.743  1.00 0.00 ? 2  VAL B HG11 10 
ATOM   7375  H HG12 . VAL B 2 2  ? 10.380  4.017   -9.022  1.00 0.00 ? 2  VAL B HG12 10 
ATOM   7376  H HG13 . VAL B 2 2  ? 8.730   3.575   -8.584  1.00 0.00 ? 2  VAL B HG13 10 
ATOM   7377  H HG21 . VAL B 2 2  ? 8.873   1.821   -6.496  1.00 0.00 ? 2  VAL B HG21 10 
ATOM   7378  H HG22 . VAL B 2 2  ? 9.907   2.337   -5.163  1.00 0.00 ? 2  VAL B HG22 10 
ATOM   7379  H HG23 . VAL B 2 2  ? 10.596  1.451   -6.523  1.00 0.00 ? 2  VAL B HG23 10 
ATOM   7380  N N    . ASN B 2 3  ? 10.842  6.040   -7.623  1.00 0.00 ? 3  ASN B N    10 
ATOM   7381  C CA   . ASN B 2 3  ? 10.988  7.503   -7.890  1.00 0.00 ? 3  ASN B CA   10 
ATOM   7382  C C    . ASN B 2 3  ? 9.990   7.923   -8.969  1.00 0.00 ? 3  ASN B C    10 
ATOM   7383  O O    . ASN B 2 3  ? 9.664   9.086   -9.106  1.00 0.00 ? 3  ASN B O    10 
ATOM   7384  C CB   . ASN B 2 3  ? 12.408  7.814   -8.370  1.00 0.00 ? 3  ASN B CB   10 
ATOM   7385  C CG   . ASN B 2 3  ? 13.227  8.386   -7.209  1.00 0.00 ? 3  ASN B CG   10 
ATOM   7386  O OD1  . ASN B 2 3  ? 14.309  7.915   -6.925  1.00 0.00 ? 3  ASN B OD1  10 
ATOM   7387  N ND2  . ASN B 2 3  ? 12.748  9.387   -6.521  1.00 0.00 ? 3  ASN B ND2  10 
ATOM   7388  H H    . ASN B 2 3  ? 10.011  5.589   -7.868  1.00 0.00 ? 3  ASN B H    10 
ATOM   7389  H HA   . ASN B 2 3  ? 10.787  8.054   -6.983  1.00 0.00 ? 3  ASN B HA   10 
ATOM   7390  H HB2  . ASN B 2 3  ? 12.874  6.908   -8.729  1.00 0.00 ? 3  ASN B HB2  10 
ATOM   7391  H HB3  . ASN B 2 3  ? 12.367  8.540   -9.169  1.00 0.00 ? 3  ASN B HB3  10 
ATOM   7392  H HD21 . ASN B 2 3  ? 11.874  9.766   -6.749  1.00 0.00 ? 3  ASN B HD21 10 
ATOM   7393  H HD22 . ASN B 2 3  ? 13.265  9.759   -5.775  1.00 0.00 ? 3  ASN B HD22 10 
ATOM   7394  N N    . GLN B 2 4  ? 9.502   6.989   -9.740  1.00 0.00 ? 4  GLN B N    10 
ATOM   7395  C CA   . GLN B 2 4  ? 8.528   7.337   -10.807 1.00 0.00 ? 4  GLN B CA   10 
ATOM   7396  C C    . GLN B 2 4  ? 7.114   7.357   -10.222 1.00 0.00 ? 4  GLN B C    10 
ATOM   7397  O O    . GLN B 2 4  ? 6.794   6.615   -9.315  1.00 0.00 ? 4  GLN B O    10 
ATOM   7398  C CB   . GLN B 2 4  ? 8.605   6.292   -11.918 1.00 0.00 ? 4  GLN B CB   10 
ATOM   7399  C CG   . GLN B 2 4  ? 9.485   6.816   -13.054 1.00 0.00 ? 4  GLN B CG   10 
ATOM   7400  C CD   . GLN B 2 4  ? 9.458   5.827   -14.220 1.00 0.00 ? 4  GLN B CD   10 
ATOM   7401  O OE1  . GLN B 2 4  ? 8.440   5.223   -14.497 1.00 0.00 ? 4  GLN B OE1  10 
ATOM   7402  N NE2  . GLN B 2 4  ? 10.542  5.635   -14.919 1.00 0.00 ? 4  GLN B NE2  10 
ATOM   7403  H H    . GLN B 2 4  ? 9.779   6.058   -9.619  1.00 0.00 ? 4  GLN B H    10 
ATOM   7404  H HA   . GLN B 2 4  ? 8.766   8.310   -11.209 1.00 0.00 ? 4  GLN B HA   10 
ATOM   7405  H HB2  . GLN B 2 4  ? 9.030   5.379   -11.524 1.00 0.00 ? 4  GLN B HB2  10 
ATOM   7406  H HB3  . GLN B 2 4  ? 7.616   6.094   -12.294 1.00 0.00 ? 4  GLN B HB3  10 
ATOM   7407  H HG2  . GLN B 2 4  ? 9.114   7.775   -13.383 1.00 0.00 ? 4  GLN B HG2  10 
ATOM   7408  H HG3  . GLN B 2 4  ? 10.501  6.924   -12.701 1.00 0.00 ? 4  GLN B HG3  10 
ATOM   7409  H HE21 . GLN B 2 4  ? 11.362  6.121   -14.694 1.00 0.00 ? 4  GLN B HE21 10 
ATOM   7410  H HE22 . GLN B 2 4  ? 10.537  5.003   -15.668 1.00 0.00 ? 4  GLN B HE22 10 
ATOM   7411  N N    . HIS B 2 5  ? 6.266   8.203   -10.738 1.00 0.00 ? 5  HIS B N    10 
ATOM   7412  C CA   . HIS B 2 5  ? 4.872   8.279   -10.218 1.00 0.00 ? 5  HIS B CA   10 
ATOM   7413  C C    . HIS B 2 5  ? 4.037   7.145   -10.822 1.00 0.00 ? 5  HIS B C    10 
ATOM   7414  O O    . HIS B 2 5  ? 4.131   6.851   -11.997 1.00 0.00 ? 5  HIS B O    10 
ATOM   7415  C CB   . HIS B 2 5  ? 4.272   9.632   -10.611 1.00 0.00 ? 5  HIS B CB   10 
ATOM   7416  C CG   . HIS B 2 5  ? 2.941   9.824   -9.936  1.00 0.00 ? 5  HIS B CG   10 
ATOM   7417  N ND1  . HIS B 2 5  ? 2.539   9.026   -8.886  1.00 0.00 ? 5  HIS B ND1  10 
ATOM   7418  C CD2  . HIS B 2 5  ? 1.942   10.729  -10.168 1.00 0.00 ? 5  HIS B CD2  10 
ATOM   7419  C CE1  . HIS B 2 5  ? 1.326   9.464   -8.516  1.00 0.00 ? 5  HIS B CE1  10 
ATOM   7420  N NE2  . HIS B 2 5  ? 0.921   10.503  -9.272  1.00 0.00 ? 5  HIS B NE2  10 
ATOM   7421  H H    . HIS B 2 5  ? 6.548   8.792   -11.469 1.00 0.00 ? 5  HIS B H    10 
ATOM   7422  H HA   . HIS B 2 5  ? 4.881   8.188   -9.142  1.00 0.00 ? 5  HIS B HA   10 
ATOM   7423  H HB2  . HIS B 2 5  ? 4.943   10.423  -10.310 1.00 0.00 ? 5  HIS B HB2  10 
ATOM   7424  H HB3  . HIS B 2 5  ? 4.139   9.665   -11.680 1.00 0.00 ? 5  HIS B HB3  10 
ATOM   7425  H HD2  . HIS B 2 5  ? 1.953   11.496  -10.928 1.00 0.00 ? 5  HIS B HD2  10 
ATOM   7426  H HE1  . HIS B 2 5  ? 0.749   9.043   -7.706  1.00 0.00 ? 5  HIS B HE1  10 
ATOM   7427  H HE2  . HIS B 2 5  ? 0.077   10.995  -9.199  1.00 0.00 ? 5  HIS B HE2  10 
ATOM   7428  N N    . LEU B 2 6  ? 3.221   6.503   -10.026 1.00 0.00 ? 6  LEU B N    10 
ATOM   7429  C CA   . LEU B 2 6  ? 2.383   5.387   -10.555 1.00 0.00 ? 6  LEU B CA   10 
ATOM   7430  C C    . LEU B 2 6  ? 0.921   5.819   -10.592 1.00 0.00 ? 6  LEU B C    10 
ATOM   7431  O O    . LEU B 2 6  ? 0.512   6.697   -9.868  1.00 0.00 ? 6  LEU B O    10 
ATOM   7432  C CB   . LEU B 2 6  ? 2.516   4.166   -9.639  1.00 0.00 ? 6  LEU B CB   10 
ATOM   7433  C CG   . LEU B 2 6  ? 3.819   3.428   -9.947  1.00 0.00 ? 6  LEU B CG   10 
ATOM   7434  C CD1  . LEU B 2 6  ? 4.949   4.443   -10.096 1.00 0.00 ? 6  LEU B CD1  10 
ATOM   7435  C CD2  . LEU B 2 6  ? 4.146   2.467   -8.802  1.00 0.00 ? 6  LEU B CD2  10 
ATOM   7436  H H    . LEU B 2 6  ? 3.160   6.756   -9.082  1.00 0.00 ? 6  LEU B H    10 
ATOM   7437  H HA   . LEU B 2 6  ? 2.710   5.129   -11.551 1.00 0.00 ? 6  LEU B HA   10 
ATOM   7438  H HB2  . LEU B 2 6  ? 2.522   4.490   -8.608  1.00 0.00 ? 6  LEU B HB2  10 
ATOM   7439  H HB3  . LEU B 2 6  ? 1.682   3.501   -9.804  1.00 0.00 ? 6  LEU B HB3  10 
ATOM   7440  H HG   . LEU B 2 6  ? 3.711   2.873   -10.867 1.00 0.00 ? 6  LEU B HG   10 
ATOM   7441  H HD11 . LEU B 2 6  ? 4.859   5.192   -9.322  1.00 0.00 ? 6  LEU B HD11 10 
ATOM   7442  H HD12 . LEU B 2 6  ? 4.880   4.916   -11.065 1.00 0.00 ? 6  LEU B HD12 10 
ATOM   7443  H HD13 . LEU B 2 6  ? 5.898   3.940   -10.004 1.00 0.00 ? 6  LEU B HD13 10 
ATOM   7444  H HD21 . LEU B 2 6  ? 3.628   2.784   -7.908  1.00 0.00 ? 6  LEU B HD21 10 
ATOM   7445  H HD22 . LEU B 2 6  ? 5.211   2.472   -8.621  1.00 0.00 ? 6  LEU B HD22 10 
ATOM   7446  H HD23 . LEU B 2 6  ? 3.830   1.470   -9.068  1.00 0.00 ? 6  LEU B HD23 10 
ATOM   7447  N N    . CYS B 2 7  ? 0.128   5.198   -11.419 1.00 0.00 ? 7  CYS B N    10 
ATOM   7448  C CA   . CYS B 2 7  ? -1.312  5.565   -11.492 1.00 0.00 ? 7  CYS B CA   10 
ATOM   7449  C C    . CYS B 2 7  ? -2.082  4.421   -12.176 1.00 0.00 ? 7  CYS B C    10 
ATOM   7450  O O    . CYS B 2 7  ? -2.241  3.359   -11.609 1.00 0.00 ? 7  CYS B O    10 
ATOM   7451  C CB   . CYS B 2 7  ? -1.471  6.876   -12.271 1.00 0.00 ? 7  CYS B CB   10 
ATOM   7452  S SG   . CYS B 2 7  ? -1.314  8.280   -11.140 1.00 0.00 ? 7  CYS B SG   10 
ATOM   7453  H H    . CYS B 2 7  ? 0.480   4.482   -11.988 1.00 0.00 ? 7  CYS B H    10 
ATOM   7454  H HA   . CYS B 2 7  ? -1.693  5.696   -10.489 1.00 0.00 ? 7  CYS B HA   10 
ATOM   7455  H HB2  . CYS B 2 7  ? -0.701  6.944   -13.022 1.00 0.00 ? 7  CYS B HB2  10 
ATOM   7456  H HB3  . CYS B 2 7  ? -2.442  6.904   -12.742 1.00 0.00 ? 7  CYS B HB3  10 
ATOM   7457  N N    . GLY B 2 8  ? -2.557  4.613   -13.382 1.00 0.00 ? 8  GLY B N    10 
ATOM   7458  C CA   . GLY B 2 8  ? -3.306  3.520   -14.065 1.00 0.00 ? 8  GLY B CA   10 
ATOM   7459  C C    . GLY B 2 8  ? -2.384  2.320   -14.297 1.00 0.00 ? 8  GLY B C    10 
ATOM   7460  O O    . GLY B 2 8  ? -2.052  1.593   -13.382 1.00 0.00 ? 8  GLY B O    10 
ATOM   7461  H H    . GLY B 2 8  ? -2.425  5.465   -13.839 1.00 0.00 ? 8  GLY B H    10 
ATOM   7462  H HA2  . GLY B 2 8  ? -4.141  3.217   -13.447 1.00 0.00 ? 8  GLY B HA2  10 
ATOM   7463  H HA3  . GLY B 2 8  ? -3.672  3.875   -15.015 1.00 0.00 ? 8  GLY B HA3  10 
ATOM   7464  N N    . SER B 2 9  ? -1.980  2.105   -15.518 1.00 0.00 ? 9  SER B N    10 
ATOM   7465  C CA   . SER B 2 9  ? -1.092  0.946   -15.821 1.00 0.00 ? 9  SER B CA   10 
ATOM   7466  C C    . SER B 2 9  ? 0.179   1.018   -14.969 1.00 0.00 ? 9  SER B C    10 
ATOM   7467  O O    . SER B 2 9  ? 0.603   0.036   -14.395 1.00 0.00 ? 9  SER B O    10 
ATOM   7468  C CB   . SER B 2 9  ? -0.712  0.971   -17.303 1.00 0.00 ? 9  SER B CB   10 
ATOM   7469  O OG   . SER B 2 9  ? 0.113   2.099   -17.559 1.00 0.00 ? 9  SER B OG   10 
ATOM   7470  H H    . SER B 2 9  ? -2.269  2.700   -16.241 1.00 0.00 ? 9  SER B H    10 
ATOM   7471  H HA   . SER B 2 9  ? -1.616  0.028   -15.604 1.00 0.00 ? 9  SER B HA   10 
ATOM   7472  H HB2  . SER B 2 9  ? -0.171  0.073   -17.552 1.00 0.00 ? 9  SER B HB2  10 
ATOM   7473  H HB3  . SER B 2 9  ? -1.611  1.025   -17.903 1.00 0.00 ? 9  SER B HB3  10 
ATOM   7474  H HG   . SER B 2 9  ? -0.365  2.689   -18.146 1.00 0.00 ? 9  SER B HG   10 
ATOM   7475  N N    . ASP B 2 10 ? 0.798   2.163   -14.885 1.00 0.00 ? 10 ASP B N    10 
ATOM   7476  C CA   . ASP B 2 10 ? 2.046   2.268   -14.073 1.00 0.00 ? 10 ASP B CA   10 
ATOM   7477  C C    . ASP B 2 10 ? 1.833   1.607   -12.709 1.00 0.00 ? 10 ASP B C    10 
ATOM   7478  O O    . ASP B 2 10 ? 2.663   0.851   -12.244 1.00 0.00 ? 10 ASP B O    10 
ATOM   7479  C CB   . ASP B 2 10 ? 2.426   3.740   -13.874 1.00 0.00 ? 10 ASP B CB   10 
ATOM   7480  C CG   . ASP B 2 10 ? 2.147   4.526   -15.157 1.00 0.00 ? 10 ASP B CG   10 
ATOM   7481  O OD1  . ASP B 2 10 ? 0.985   4.681   -15.494 1.00 0.00 ? 10 ASP B OD1  10 
ATOM   7482  O OD2  . ASP B 2 10 ? 3.101   4.960   -15.781 1.00 0.00 ? 10 ASP B OD2  10 
ATOM   7483  H H    . ASP B 2 10 ? 0.449   2.946   -15.359 1.00 0.00 ? 10 ASP B H    10 
ATOM   7484  H HA   . ASP B 2 10 ? 2.848   1.762   -14.590 1.00 0.00 ? 10 ASP B HA   10 
ATOM   7485  H HB2  . ASP B 2 10 ? 1.853   4.156   -13.062 1.00 0.00 ? 10 ASP B HB2  10 
ATOM   7486  H HB3  . ASP B 2 10 ? 3.473   3.809   -13.636 1.00 0.00 ? 10 ASP B HB3  10 
ATOM   7487  N N    . LEU B 2 11 ? 0.735   1.885   -12.057 1.00 0.00 ? 11 LEU B N    10 
ATOM   7488  C CA   . LEU B 2 11 ? 0.501   1.267   -10.721 1.00 0.00 ? 11 LEU B CA   10 
ATOM   7489  C C    . LEU B 2 11 ? 0.003   -0.168  -10.895 1.00 0.00 ? 11 LEU B C    10 
ATOM   7490  O O    . LEU B 2 11 ? 0.254   -1.025  -10.071 1.00 0.00 ? 11 LEU B O    10 
ATOM   7491  C CB   . LEU B 2 11 ? -0.546  2.089   -9.949  1.00 0.00 ? 11 LEU B CB   10 
ATOM   7492  C CG   . LEU B 2 11 ? -0.301  2.079   -8.419  1.00 0.00 ? 11 LEU B CG   10 
ATOM   7493  C CD1  . LEU B 2 11 ? -1.487  1.414   -7.723  1.00 0.00 ? 11 LEU B CD1  10 
ATOM   7494  C CD2  . LEU B 2 11 ? 0.975   1.317   -8.036  1.00 0.00 ? 11 LEU B CD2  10 
ATOM   7495  H H    . LEU B 2 11 ? 0.075   2.501   -12.439 1.00 0.00 ? 11 LEU B H    10 
ATOM   7496  H HA   . LEU B 2 11 ? 1.432   1.259   -10.181 1.00 0.00 ? 11 LEU B HA   10 
ATOM   7497  H HB2  . LEU B 2 11 ? -0.516  3.108   -10.300 1.00 0.00 ? 11 LEU B HB2  10 
ATOM   7498  H HB3  . LEU B 2 11 ? -1.527  1.683   -10.145 1.00 0.00 ? 11 LEU B HB3  10 
ATOM   7499  H HG   . LEU B 2 11 ? -0.222  3.099   -8.076  1.00 0.00 ? 11 LEU B HG   10 
ATOM   7500  H HD11 . LEU B 2 11 ? -2.405  1.864   -8.065  1.00 0.00 ? 11 LEU B HD11 10 
ATOM   7501  H HD12 . LEU B 2 11 ? -1.395  1.545   -6.655  1.00 0.00 ? 11 LEU B HD12 10 
ATOM   7502  H HD13 . LEU B 2 11 ? -1.493  0.358   -7.956  1.00 0.00 ? 11 LEU B HD13 10 
ATOM   7503  H HD21 . LEU B 2 11 ? 1.840   1.895   -8.324  1.00 0.00 ? 11 LEU B HD21 10 
ATOM   7504  H HD22 . LEU B 2 11 ? 0.991   0.365   -8.547  1.00 0.00 ? 11 LEU B HD22 10 
ATOM   7505  H HD23 . LEU B 2 11 ? 0.990   1.153   -6.969  1.00 0.00 ? 11 LEU B HD23 10 
ATOM   7506  N N    . VAL B 2 12 ? -0.697  -0.445  -11.960 1.00 0.00 ? 12 VAL B N    10 
ATOM   7507  C CA   . VAL B 2 12 ? -1.199  -1.829  -12.174 1.00 0.00 ? 12 VAL B CA   10 
ATOM   7508  C C    . VAL B 2 12 ? -0.038  -2.698  -12.661 1.00 0.00 ? 12 VAL B C    10 
ATOM   7509  O O    . VAL B 2 12 ? 0.256   -3.732  -12.094 1.00 0.00 ? 12 VAL B O    10 
ATOM   7510  C CB   . VAL B 2 12 ? -2.330  -1.800  -13.209 1.00 0.00 ? 12 VAL B CB   10 
ATOM   7511  C CG1  . VAL B 2 12 ? -2.462  -3.166  -13.892 1.00 0.00 ? 12 VAL B CG1  10 
ATOM   7512  C CG2  . VAL B 2 12 ? -3.646  -1.461  -12.504 1.00 0.00 ? 12 VAL B CG2  10 
ATOM   7513  H H    . VAL B 2 12 ? -0.887  0.253   -12.623 1.00 0.00 ? 12 VAL B H    10 
ATOM   7514  H HA   . VAL B 2 12 ? -1.572  -2.222  -11.239 1.00 0.00 ? 12 VAL B HA   10 
ATOM   7515  H HB   . VAL B 2 12 ? -2.115  -1.043  -13.950 1.00 0.00 ? 12 VAL B HB   10 
ATOM   7516  H HG11 . VAL B 2 12 ? -3.407  -3.218  -14.413 1.00 0.00 ? 12 VAL B HG11 10 
ATOM   7517  H HG12 . VAL B 2 12 ? -2.420  -3.946  -13.146 1.00 0.00 ? 12 VAL B HG12 10 
ATOM   7518  H HG13 . VAL B 2 12 ? -1.655  -3.297  -14.596 1.00 0.00 ? 12 VAL B HG13 10 
ATOM   7519  H HG21 . VAL B 2 12 ? -4.418  -1.299  -13.242 1.00 0.00 ? 12 VAL B HG21 10 
ATOM   7520  H HG22 . VAL B 2 12 ? -3.518  -0.567  -11.914 1.00 0.00 ? 12 VAL B HG22 10 
ATOM   7521  H HG23 . VAL B 2 12 ? -3.931  -2.280  -11.861 1.00 0.00 ? 12 VAL B HG23 10 
ATOM   7522  N N    . GLU B 2 13 ? 0.636   -2.279  -13.695 1.00 0.00 ? 13 GLU B N    10 
ATOM   7523  C CA   . GLU B 2 13 ? 1.786   -3.074  -14.198 1.00 0.00 ? 13 GLU B CA   10 
ATOM   7524  C C    . GLU B 2 13 ? 2.724   -3.365  -13.026 1.00 0.00 ? 13 GLU B C    10 
ATOM   7525  O O    . GLU B 2 13 ? 3.361   -4.397  -12.965 1.00 0.00 ? 13 GLU B O    10 
ATOM   7526  C CB   . GLU B 2 13 ? 2.532   -2.276  -15.269 1.00 0.00 ? 13 GLU B CB   10 
ATOM   7527  C CG   . GLU B 2 13 ? 1.732   -2.297  -16.573 1.00 0.00 ? 13 GLU B CG   10 
ATOM   7528  C CD   . GLU B 2 13 ? 2.661   -1.985  -17.747 1.00 0.00 ? 13 GLU B CD   10 
ATOM   7529  O OE1  . GLU B 2 13 ? 3.716   -2.594  -17.822 1.00 0.00 ? 13 GLU B OE1  10 
ATOM   7530  O OE2  . GLU B 2 13 ? 2.302   -1.140  -18.552 1.00 0.00 ? 13 GLU B OE2  10 
ATOM   7531  H H    . GLU B 2 13 ? 0.393   -1.435  -14.132 1.00 0.00 ? 13 GLU B H    10 
ATOM   7532  H HA   . GLU B 2 13 ? 1.430   -4.004  -14.616 1.00 0.00 ? 13 GLU B HA   10 
ATOM   7533  H HB2  . GLU B 2 13 ? 2.651   -1.255  -14.937 1.00 0.00 ? 13 GLU B HB2  10 
ATOM   7534  H HB3  . GLU B 2 13 ? 3.504   -2.716  -15.438 1.00 0.00 ? 13 GLU B HB3  10 
ATOM   7535  H HG2  . GLU B 2 13 ? 1.294   -3.275  -16.710 1.00 0.00 ? 13 GLU B HG2  10 
ATOM   7536  H HG3  . GLU B 2 13 ? 0.949   -1.556  -16.528 1.00 0.00 ? 13 GLU B HG3  10 
ATOM   7537  N N    . ALA B 2 14 ? 2.803   -2.460  -12.085 1.00 0.00 ? 14 ALA B N    10 
ATOM   7538  C CA   . ALA B 2 14 ? 3.688   -2.686  -10.909 1.00 0.00 ? 14 ALA B CA   10 
ATOM   7539  C C    . ALA B 2 14 ? 3.173   -3.893  -10.124 1.00 0.00 ? 14 ALA B C    10 
ATOM   7540  O O    . ALA B 2 14 ? 3.860   -4.883  -9.970  1.00 0.00 ? 14 ALA B O    10 
ATOM   7541  C CB   . ALA B 2 14 ? 3.674   -1.448  -10.010 1.00 0.00 ? 14 ALA B CB   10 
ATOM   7542  H H    . ALA B 2 14 ? 2.274   -1.638  -12.149 1.00 0.00 ? 14 ALA B H    10 
ATOM   7543  H HA   . ALA B 2 14 ? 4.696   -2.877  -11.246 1.00 0.00 ? 14 ALA B HA   10 
ATOM   7544  H HB1  . ALA B 2 14 ? 4.576   -1.424  -9.417  1.00 0.00 ? 14 ALA B HB1  10 
ATOM   7545  H HB2  . ALA B 2 14 ? 2.814   -1.487  -9.358  1.00 0.00 ? 14 ALA B HB2  10 
ATOM   7546  H HB3  . ALA B 2 14 ? 3.621   -0.560  -10.622 1.00 0.00 ? 14 ALA B HB3  10 
ATOM   7547  N N    . LEU B 2 15 ? 1.965   -3.826  -9.633  1.00 0.00 ? 15 LEU B N    10 
ATOM   7548  C CA   . LEU B 2 15 ? 1.410   -4.976  -8.869  1.00 0.00 ? 15 LEU B CA   10 
ATOM   7549  C C    . LEU B 2 15 ? 1.634   -6.261  -9.666  1.00 0.00 ? 15 LEU B C    10 
ATOM   7550  O O    . LEU B 2 15 ? 2.019   -7.281  -9.130  1.00 0.00 ? 15 LEU B O    10 
ATOM   7551  C CB   . LEU B 2 15 ? -0.090  -4.768  -8.660  1.00 0.00 ? 15 LEU B CB   10 
ATOM   7552  C CG   . LEU B 2 15 ? -0.316  -3.700  -7.588  1.00 0.00 ? 15 LEU B CG   10 
ATOM   7553  C CD1  . LEU B 2 15 ? -1.724  -3.121  -7.735  1.00 0.00 ? 15 LEU B CD1  10 
ATOM   7554  C CD2  . LEU B 2 15 ? -0.169  -4.330  -6.202  1.00 0.00 ? 15 LEU B CD2  10 
ATOM   7555  H H    . LEU B 2 15 ? 1.420   -3.022  -9.771  1.00 0.00 ? 15 LEU B H    10 
ATOM   7556  H HA   . LEU B 2 15 ? 1.904   -5.050  -7.911  1.00 0.00 ? 15 LEU B HA   10 
ATOM   7557  H HB2  . LEU B 2 15 ? -0.540  -4.447  -9.588  1.00 0.00 ? 15 LEU B HB2  10 
ATOM   7558  H HB3  . LEU B 2 15 ? -0.540  -5.695  -8.343  1.00 0.00 ? 15 LEU B HB3  10 
ATOM   7559  H HG   . LEU B 2 15 ? 0.412   -2.910  -7.707  1.00 0.00 ? 15 LEU B HG   10 
ATOM   7560  H HD11 . LEU B 2 15 ? -1.682  -2.044  -7.651  1.00 0.00 ? 15 LEU B HD11 10 
ATOM   7561  H HD12 . LEU B 2 15 ? -2.360  -3.517  -6.957  1.00 0.00 ? 15 LEU B HD12 10 
ATOM   7562  H HD13 . LEU B 2 15 ? -2.126  -3.390  -8.701  1.00 0.00 ? 15 LEU B HD13 10 
ATOM   7563  H HD21 . LEU B 2 15 ? -0.824  -3.828  -5.507  1.00 0.00 ? 15 LEU B HD21 10 
ATOM   7564  H HD22 . LEU B 2 15 ? 0.854   -4.231  -5.870  1.00 0.00 ? 15 LEU B HD22 10 
ATOM   7565  H HD23 . LEU B 2 15 ? -0.431  -5.377  -6.254  1.00 0.00 ? 15 LEU B HD23 10 
ATOM   7566  N N    . TYR B 2 16 ? 1.390   -6.216  -10.946 1.00 0.00 ? 16 TYR B N    10 
ATOM   7567  C CA   . TYR B 2 16 ? 1.581   -7.429  -11.790 1.00 0.00 ? 16 TYR B CA   10 
ATOM   7568  C C    . TYR B 2 16 ? 3.032   -7.908  -11.689 1.00 0.00 ? 16 TYR B C    10 
ATOM   7569  O O    . TYR B 2 16 ? 3.295   -9.083  -11.526 1.00 0.00 ? 16 TYR B O    10 
ATOM   7570  C CB   . TYR B 2 16 ? 1.260   -7.090  -13.248 1.00 0.00 ? 16 TYR B CB   10 
ATOM   7571  C CG   . TYR B 2 16 ? 0.063   -7.899  -13.702 1.00 0.00 ? 16 TYR B CG   10 
ATOM   7572  C CD1  . TYR B 2 16 ? 0.097   -9.301  -13.638 1.00 0.00 ? 16 TYR B CD1  10 
ATOM   7573  C CD2  . TYR B 2 16 ? -1.081  -7.251  -14.190 1.00 0.00 ? 16 TYR B CD2  10 
ATOM   7574  C CE1  . TYR B 2 16 ? -1.009  -10.051 -14.060 1.00 0.00 ? 16 TYR B CE1  10 
ATOM   7575  C CE2  . TYR B 2 16 ? -2.186  -8.003  -14.613 1.00 0.00 ? 16 TYR B CE2  10 
ATOM   7576  C CZ   . TYR B 2 16 ? -2.150  -9.400  -14.548 1.00 0.00 ? 16 TYR B CZ   10 
ATOM   7577  O OH   . TYR B 2 16 ? -3.239  -10.139 -14.964 1.00 0.00 ? 16 TYR B OH   10 
ATOM   7578  H H    . TYR B 2 16 ? 1.076   -5.382  -11.353 1.00 0.00 ? 16 TYR B H    10 
ATOM   7579  H HA   . TYR B 2 16 ? 0.919   -8.212  -11.450 1.00 0.00 ? 16 TYR B HA   10 
ATOM   7580  H HB2  . TYR B 2 16 ? 1.037   -6.035  -13.329 1.00 0.00 ? 16 TYR B HB2  10 
ATOM   7581  H HB3  . TYR B 2 16 ? 2.112   -7.324  -13.868 1.00 0.00 ? 16 TYR B HB3  10 
ATOM   7582  H HD1  . TYR B 2 16 ? 0.974   -9.804  -13.262 1.00 0.00 ? 16 TYR B HD1  10 
ATOM   7583  H HD2  . TYR B 2 16 ? -1.113  -6.174  -14.241 1.00 0.00 ? 16 TYR B HD2  10 
ATOM   7584  H HE1  . TYR B 2 16 ? -0.981  -11.129 -14.010 1.00 0.00 ? 16 TYR B HE1  10 
ATOM   7585  H HE2  . TYR B 2 16 ? -3.067  -7.503  -14.988 1.00 0.00 ? 16 TYR B HE2  10 
ATOM   7586  H HH   . TYR B 2 16 ? -2.979  -11.063 -14.988 1.00 0.00 ? 16 TYR B HH   10 
ATOM   7587  N N    . LEU B 2 17 ? 3.976   -7.012  -11.789 1.00 0.00 ? 17 LEU B N    10 
ATOM   7588  C CA   . LEU B 2 17 ? 5.405   -7.426  -11.703 1.00 0.00 ? 17 LEU B CA   10 
ATOM   7589  C C    . LEU B 2 17 ? 5.826   -7.522  -10.237 1.00 0.00 ? 17 LEU B C    10 
ATOM   7590  O O    . LEU B 2 17 ? 6.785   -8.187  -9.897  1.00 0.00 ? 17 LEU B O    10 
ATOM   7591  C CB   . LEU B 2 17 ? 6.279   -6.394  -12.417 1.00 0.00 ? 17 LEU B CB   10 
ATOM   7592  C CG   . LEU B 2 17 ? 7.242   -7.111  -13.364 1.00 0.00 ? 17 LEU B CG   10 
ATOM   7593  C CD1  . LEU B 2 17 ? 6.769   -6.926  -14.808 1.00 0.00 ? 17 LEU B CD1  10 
ATOM   7594  C CD2  . LEU B 2 17 ? 8.645   -6.519  -13.209 1.00 0.00 ? 17 LEU B CD2  10 
ATOM   7595  H H    . LEU B 2 17 ? 3.744   -6.070  -11.923 1.00 0.00 ? 17 LEU B H    10 
ATOM   7596  H HA   . LEU B 2 17 ? 5.528   -8.387  -12.173 1.00 0.00 ? 17 LEU B HA   10 
ATOM   7597  H HB2  . LEU B 2 17 ? 5.651   -5.720  -12.982 1.00 0.00 ? 17 LEU B HB2  10 
ATOM   7598  H HB3  . LEU B 2 17 ? 6.845   -5.833  -11.688 1.00 0.00 ? 17 LEU B HB3  10 
ATOM   7599  H HG   . LEU B 2 17 ? 7.265   -8.164  -13.124 1.00 0.00 ? 17 LEU B HG   10 
ATOM   7600  H HD11 . LEU B 2 17 ? 7.367   -7.542  -15.464 1.00 0.00 ? 17 LEU B HD11 10 
ATOM   7601  H HD12 . LEU B 2 17 ? 6.873   -5.890  -15.091 1.00 0.00 ? 17 LEU B HD12 10 
ATOM   7602  H HD13 . LEU B 2 17 ? 5.732   -7.218  -14.886 1.00 0.00 ? 17 LEU B HD13 10 
ATOM   7603  H HD21 . LEU B 2 17 ? 9.181   -7.059  -12.442 1.00 0.00 ? 17 LEU B HD21 10 
ATOM   7604  H HD22 . LEU B 2 17 ? 8.568   -5.479  -12.928 1.00 0.00 ? 17 LEU B HD22 10 
ATOM   7605  H HD23 . LEU B 2 17 ? 9.178   -6.600  -14.144 1.00 0.00 ? 17 LEU B HD23 10 
ATOM   7606  N N    . VAL B 2 18 ? 5.115   -6.866  -9.367  1.00 0.00 ? 18 VAL B N    10 
ATOM   7607  C CA   . VAL B 2 18 ? 5.470   -6.920  -7.923  1.00 0.00 ? 18 VAL B CA   10 
ATOM   7608  C C    . VAL B 2 18 ? 4.944   -8.222  -7.323  1.00 0.00 ? 18 VAL B C    10 
ATOM   7609  O O    . VAL B 2 18 ? 5.687   -9.014  -6.780  1.00 0.00 ? 18 VAL B O    10 
ATOM   7610  C CB   . VAL B 2 18 ? 4.831   -5.737  -7.198  1.00 0.00 ? 18 VAL B CB   10 
ATOM   7611  C CG1  . VAL B 2 18 ? 5.085   -5.864  -5.696  1.00 0.00 ? 18 VAL B CG1  10 
ATOM   7612  C CG2  . VAL B 2 18 ? 5.444   -4.434  -7.712  1.00 0.00 ? 18 VAL B CG2  10 
ATOM   7613  H H    . VAL B 2 18 ? 4.346   -6.338  -9.664  1.00 0.00 ? 18 VAL B H    10 
ATOM   7614  H HA   . VAL B 2 18 ? 6.543   -6.877  -7.812  1.00 0.00 ? 18 VAL B HA   10 
ATOM   7615  H HB   . VAL B 2 18 ? 3.766   -5.734  -7.383  1.00 0.00 ? 18 VAL B HB   10 
ATOM   7616  H HG11 . VAL B 2 18 ? 6.071   -6.274  -5.531  1.00 0.00 ? 18 VAL B HG11 10 
ATOM   7617  H HG12 . VAL B 2 18 ? 4.345   -6.521  -5.260  1.00 0.00 ? 18 VAL B HG12 10 
ATOM   7618  H HG13 . VAL B 2 18 ? 5.017   -4.890  -5.235  1.00 0.00 ? 18 VAL B HG13 10 
ATOM   7619  H HG21 . VAL B 2 18 ? 6.336   -4.208  -7.147  1.00 0.00 ? 18 VAL B HG21 10 
ATOM   7620  H HG22 . VAL B 2 18 ? 4.731   -3.631  -7.597  1.00 0.00 ? 18 VAL B HG22 10 
ATOM   7621  H HG23 . VAL B 2 18 ? 5.697   -4.543  -8.757  1.00 0.00 ? 18 VAL B HG23 10 
ATOM   7622  N N    . CYS B 2 19 ? 3.663   -8.443  -7.412  1.00 0.00 ? 19 CYS B N    10 
ATOM   7623  C CA   . CYS B 2 19 ? 3.078   -9.689  -6.845  1.00 0.00 ? 19 CYS B CA   10 
ATOM   7624  C C    . CYS B 2 19 ? 3.095   -10.795 -7.903  1.00 0.00 ? 19 CYS B C    10 
ATOM   7625  O O    . CYS B 2 19 ? 2.102   -11.450 -8.144  1.00 0.00 ? 19 CYS B O    10 
ATOM   7626  C CB   . CYS B 2 19 ? 1.636   -9.418  -6.414  1.00 0.00 ? 19 CYS B CB   10 
ATOM   7627  S SG   . CYS B 2 19 ? 1.560   -7.836  -5.537  1.00 0.00 ? 19 CYS B SG   10 
ATOM   7628  H H    . CYS B 2 19 ? 3.084   -7.785  -7.852  1.00 0.00 ? 19 CYS B H    10 
ATOM   7629  H HA   . CYS B 2 19 ? 3.656   -9.999  -5.988  1.00 0.00 ? 19 CYS B HA   10 
ATOM   7630  H HB2  . CYS B 2 19 ? 1.000   -9.378  -7.287  1.00 0.00 ? 19 CYS B HB2  10 
ATOM   7631  H HB3  . CYS B 2 19 ? 1.300   -10.209 -5.760  1.00 0.00 ? 19 CYS B HB3  10 
ATOM   7632  N N    . GLY B 2 20 ? 4.216   -11.008 -8.535  1.00 0.00 ? 20 GLY B N    10 
ATOM   7633  C CA   . GLY B 2 20 ? 4.294   -12.073 -9.575  1.00 0.00 ? 20 GLY B CA   10 
ATOM   7634  C C    . GLY B 2 20 ? 4.258   -13.448 -8.905  1.00 0.00 ? 20 GLY B C    10 
ATOM   7635  O O    . GLY B 2 20 ? 5.232   -14.174 -8.904  1.00 0.00 ? 20 GLY B O    10 
ATOM   7636  H H    . GLY B 2 20 ? 5.008   -10.469 -8.325  1.00 0.00 ? 20 GLY B H    10 
ATOM   7637  H HA2  . GLY B 2 20 ? 3.455   -11.978 -10.251 1.00 0.00 ? 20 GLY B HA2  10 
ATOM   7638  H HA3  . GLY B 2 20 ? 5.216   -11.970 -10.127 1.00 0.00 ? 20 GLY B HA3  10 
ATOM   7639  N N    . GLU B 2 21 ? 3.143   -13.811 -8.334  1.00 0.00 ? 21 GLU B N    10 
ATOM   7640  C CA   . GLU B 2 21 ? 3.049   -15.140 -7.664  1.00 0.00 ? 21 GLU B CA   10 
ATOM   7641  C C    . GLU B 2 21 ? 1.612   -15.366 -7.177  1.00 0.00 ? 21 GLU B C    10 
ATOM   7642  O O    . GLU B 2 21 ? 0.740   -15.724 -7.946  1.00 0.00 ? 21 GLU B O    10 
ATOM   7643  C CB   . GLU B 2 21 ? 4.014   -15.179 -6.478  1.00 0.00 ? 21 GLU B CB   10 
ATOM   7644  C CG   . GLU B 2 21 ? 4.070   -13.798 -5.825  1.00 0.00 ? 21 GLU B CG   10 
ATOM   7645  C CD   . GLU B 2 21 ? 5.433   -13.158 -6.097  1.00 0.00 ? 21 GLU B CD   10 
ATOM   7646  O OE1  . GLU B 2 21 ? 6.414   -13.883 -6.117  1.00 0.00 ? 21 GLU B OE1  10 
ATOM   7647  O OE2  . GLU B 2 21 ? 5.472   -11.952 -6.282  1.00 0.00 ? 21 GLU B OE2  10 
ATOM   7648  H H    . GLU B 2 21 ? 2.368   -13.212 -8.345  1.00 0.00 ? 21 GLU B H    10 
ATOM   7649  H HA   . GLU B 2 21 ? 3.314   -15.914 -8.366  1.00 0.00 ? 21 GLU B HA   10 
ATOM   7650  H HB2  . GLU B 2 21 ? 3.669   -15.906 -5.757  1.00 0.00 ? 21 GLU B HB2  10 
ATOM   7651  H HB3  . GLU B 2 21 ? 4.999   -15.452 -6.824  1.00 0.00 ? 21 GLU B HB3  10 
ATOM   7652  H HG2  . GLU B 2 21 ? 3.290   -13.174 -6.236  1.00 0.00 ? 21 GLU B HG2  10 
ATOM   7653  H HG3  . GLU B 2 21 ? 3.928   -13.898 -4.760  1.00 0.00 ? 21 GLU B HG3  10 
ATOM   7654  N N    . ARG B 2 22 ? 1.350   -15.157 -5.913  1.00 0.00 ? 22 ARG B N    10 
ATOM   7655  C CA   . ARG B 2 22 ? -0.033  -15.359 -5.401  1.00 0.00 ? 22 ARG B CA   10 
ATOM   7656  C C    . ARG B 2 22 ? -1.016  -14.602 -6.294  1.00 0.00 ? 22 ARG B C    10 
ATOM   7657  O O    . ARG B 2 22 ? -2.112  -15.057 -6.556  1.00 0.00 ? 22 ARG B O    10 
ATOM   7658  C CB   . ARG B 2 22 ? -0.128  -14.824 -3.970  1.00 0.00 ? 22 ARG B CB   10 
ATOM   7659  C CG   . ARG B 2 22 ? 0.983   -15.442 -3.119  1.00 0.00 ? 22 ARG B CG   10 
ATOM   7660  C CD   . ARG B 2 22 ? 2.039   -14.381 -2.809  1.00 0.00 ? 22 ARG B CD   10 
ATOM   7661  N NE   . ARG B 2 22 ? 1.790   -13.814 -1.454  1.00 0.00 ? 22 ARG B NE   10 
ATOM   7662  C CZ   . ARG B 2 22 ? 2.643   -14.030 -0.491  1.00 0.00 ? 22 ARG B CZ   10 
ATOM   7663  N NH1  . ARG B 2 22 ? 2.879   -15.248 -0.089  1.00 0.00 ? 22 ARG B NH1  10 
ATOM   7664  N NH2  . ARG B 2 22 ? 3.262   -13.025 0.069   1.00 0.00 ? 22 ARG B NH2  10 
ATOM   7665  H H    . ARG B 2 22 ? 2.059   -14.865 -5.304  1.00 0.00 ? 22 ARG B H    10 
ATOM   7666  H HA   . ARG B 2 22 ? -0.272  -16.412 -5.410  1.00 0.00 ? 22 ARG B HA   10 
ATOM   7667  H HB2  . ARG B 2 22 ? -0.019  -13.749 -3.981  1.00 0.00 ? 22 ARG B HB2  10 
ATOM   7668  H HB3  . ARG B 2 22 ? -1.088  -15.085 -3.551  1.00 0.00 ? 22 ARG B HB3  10 
ATOM   7669  H HG2  . ARG B 2 22 ? 0.562   -15.813 -2.194  1.00 0.00 ? 22 ARG B HG2  10 
ATOM   7670  H HG3  . ARG B 2 22 ? 1.441   -16.256 -3.658  1.00 0.00 ? 22 ARG B HG3  10 
ATOM   7671  H HD2  . ARG B 2 22 ? 3.020   -14.831 -2.837  1.00 0.00 ? 22 ARG B HD2  10 
ATOM   7672  H HD3  . ARG B 2 22 ? 1.984   -13.592 -3.545  1.00 0.00 ? 22 ARG B HD3  10 
ATOM   7673  H HE   . ARG B 2 22 ? 0.985   -13.282 -1.285  1.00 0.00 ? 22 ARG B HE   10 
ATOM   7674  H HH11 . ARG B 2 22 ? 2.405   -16.017 -0.518  1.00 0.00 ? 22 ARG B HH11 10 
ATOM   7675  H HH12 . ARG B 2 22 ? 3.535   -15.413 0.649   1.00 0.00 ? 22 ARG B HH12 10 
ATOM   7676  H HH21 . ARG B 2 22 ? 3.081   -12.092 -0.242  1.00 0.00 ? 22 ARG B HH21 10 
ATOM   7677  H HH22 . ARG B 2 22 ? 3.916   -13.190 0.807   1.00 0.00 ? 22 ARG B HH22 10 
ATOM   7678  N N    . GLY B 2 23 ? -0.630  -13.448 -6.764  1.00 0.00 ? 23 GLY B N    10 
ATOM   7679  C CA   . GLY B 2 23 ? -1.538  -12.658 -7.641  1.00 0.00 ? 23 GLY B CA   10 
ATOM   7680  C C    . GLY B 2 23 ? -1.734  -11.263 -7.047  1.00 0.00 ? 23 GLY B C    10 
ATOM   7681  O O    . GLY B 2 23 ? -0.833  -10.696 -6.462  1.00 0.00 ? 23 GLY B O    10 
ATOM   7682  H H    . GLY B 2 23 ? 0.259   -13.100 -6.540  1.00 0.00 ? 23 GLY B H    10 
ATOM   7683  H HA2  . GLY B 2 23 ? -1.103  -12.574 -8.628  1.00 0.00 ? 23 GLY B HA2  10 
ATOM   7684  H HA3  . GLY B 2 23 ? -2.494  -13.153 -7.710  1.00 0.00 ? 23 GLY B HA3  10 
ATOM   7685  N N    . PHE B 2 24 ? -2.908  -10.712 -7.186  1.00 0.00 ? 24 PHE B N    10 
ATOM   7686  C CA   . PHE B 2 24 ? -3.171  -9.354  -6.624  1.00 0.00 ? 24 PHE B CA   10 
ATOM   7687  C C    . PHE B 2 24 ? -4.586  -8.912  -7.015  1.00 0.00 ? 24 PHE B C    10 
ATOM   7688  O O    . PHE B 2 24 ? -5.064  -9.214  -8.090  1.00 0.00 ? 24 PHE B O    10 
ATOM   7689  C CB   . PHE B 2 24 ? -2.116  -8.352  -7.152  1.00 0.00 ? 24 PHE B CB   10 
ATOM   7690  C CG   . PHE B 2 24 ? -2.628  -7.597  -8.376  1.00 0.00 ? 24 PHE B CG   10 
ATOM   7691  C CD1  . PHE B 2 24 ? -2.734  -8.247  -9.615  1.00 0.00 ? 24 PHE B CD1  10 
ATOM   7692  C CD2  . PHE B 2 24 ? -2.991  -6.241  -8.269  1.00 0.00 ? 24 PHE B CD2  10 
ATOM   7693  C CE1  . PHE B 2 24 ? -3.202  -7.550  -10.737 1.00 0.00 ? 24 PHE B CE1  10 
ATOM   7694  C CE2  . PHE B 2 24 ? -3.458  -5.549  -9.394  1.00 0.00 ? 24 PHE B CE2  10 
ATOM   7695  C CZ   . PHE B 2 24 ? -3.561  -6.203  -10.628 1.00 0.00 ? 24 PHE B CZ   10 
ATOM   7696  H H    . PHE B 2 24 ? -3.623  -11.197 -7.653  1.00 0.00 ? 24 PHE B H    10 
ATOM   7697  H HA   . PHE B 2 24 ? -3.104  -9.402  -5.546  1.00 0.00 ? 24 PHE B HA   10 
ATOM   7698  H HB2  . PHE B 2 24 ? -1.889  -7.641  -6.371  1.00 0.00 ? 24 PHE B HB2  10 
ATOM   7699  H HB3  . PHE B 2 24 ? -1.211  -8.893  -7.410  1.00 0.00 ? 24 PHE B HB3  10 
ATOM   7700  H HD1  . PHE B 2 24 ? -2.459  -9.282  -9.707  1.00 0.00 ? 24 PHE B HD1  10 
ATOM   7701  H HD2  . PHE B 2 24 ? -2.915  -5.728  -7.322  1.00 0.00 ? 24 PHE B HD2  10 
ATOM   7702  H HE1  . PHE B 2 24 ? -3.282  -8.054  -11.689 1.00 0.00 ? 24 PHE B HE1  10 
ATOM   7703  H HE2  . PHE B 2 24 ? -3.736  -4.508  -9.311  1.00 0.00 ? 24 PHE B HE2  10 
ATOM   7704  H HZ   . PHE B 2 24 ? -3.921  -5.666  -11.495 1.00 0.00 ? 24 PHE B HZ   10 
ATOM   7705  N N    . PHE B 2 25 ? -5.259  -8.201  -6.152  1.00 0.00 ? 25 PHE B N    10 
ATOM   7706  C CA   . PHE B 2 25 ? -6.638  -7.746  -6.482  1.00 0.00 ? 25 PHE B CA   10 
ATOM   7707  C C    . PHE B 2 25 ? -6.697  -6.219  -6.433  1.00 0.00 ? 25 PHE B C    10 
ATOM   7708  O O    . PHE B 2 25 ? -6.759  -5.624  -5.375  1.00 0.00 ? 25 PHE B O    10 
ATOM   7709  C CB   . PHE B 2 25 ? -7.629  -8.333  -5.472  1.00 0.00 ? 25 PHE B CB   10 
ATOM   7710  C CG   . PHE B 2 25 ? -7.301  -7.830  -4.087  1.00 0.00 ? 25 PHE B CG   10 
ATOM   7711  C CD1  . PHE B 2 25 ? -6.185  -8.332  -3.404  1.00 0.00 ? 25 PHE B CD1  10 
ATOM   7712  C CD2  . PHE B 2 25 ? -8.116  -6.863  -3.482  1.00 0.00 ? 25 PHE B CD2  10 
ATOM   7713  C CE1  . PHE B 2 25 ? -5.883  -7.867  -2.117  1.00 0.00 ? 25 PHE B CE1  10 
ATOM   7714  C CE2  . PHE B 2 25 ? -7.814  -6.399  -2.195  1.00 0.00 ? 25 PHE B CE2  10 
ATOM   7715  C CZ   . PHE B 2 25 ? -6.699  -6.900  -1.512  1.00 0.00 ? 25 PHE B CZ   10 
ATOM   7716  H H    . PHE B 2 25 ? -4.856  -7.967  -5.290  1.00 0.00 ? 25 PHE B H    10 
ATOM   7717  H HA   . PHE B 2 25 ? -6.898  -8.083  -7.476  1.00 0.00 ? 25 PHE B HA   10 
ATOM   7718  H HB2  . PHE B 2 25 ? -8.631  -8.031  -5.737  1.00 0.00 ? 25 PHE B HB2  10 
ATOM   7719  H HB3  . PHE B 2 25 ? -7.562  -9.410  -5.489  1.00 0.00 ? 25 PHE B HB3  10 
ATOM   7720  H HD1  . PHE B 2 25 ? -5.556  -9.078  -3.870  1.00 0.00 ? 25 PHE B HD1  10 
ATOM   7721  H HD2  . PHE B 2 25 ? -8.975  -6.477  -4.008  1.00 0.00 ? 25 PHE B HD2  10 
ATOM   7722  H HE1  . PHE B 2 25 ? -5.023  -8.254  -1.590  1.00 0.00 ? 25 PHE B HE1  10 
ATOM   7723  H HE2  . PHE B 2 25 ? -8.443  -5.654  -1.729  1.00 0.00 ? 25 PHE B HE2  10 
ATOM   7724  H HZ   . PHE B 2 25 ? -6.467  -6.542  -0.520  1.00 0.00 ? 25 PHE B HZ   10 
ATOM   7725  N N    . TYR B 2 26 ? -6.678  -5.581  -7.571  1.00 0.00 ? 26 TYR B N    10 
ATOM   7726  C CA   . TYR B 2 26 ? -6.733  -4.093  -7.591  1.00 0.00 ? 26 TYR B CA   10 
ATOM   7727  C C    . TYR B 2 26 ? -7.846  -3.616  -6.657  1.00 0.00 ? 26 TYR B C    10 
ATOM   7728  O O    . TYR B 2 26 ? -8.812  -4.315  -6.419  1.00 0.00 ? 26 TYR B O    10 
ATOM   7729  C CB   . TYR B 2 26 ? -7.017  -3.610  -9.015  1.00 0.00 ? 26 TYR B CB   10 
ATOM   7730  C CG   . TYR B 2 26 ? -6.411  -2.241  -9.215  1.00 0.00 ? 26 TYR B CG   10 
ATOM   7731  C CD1  . TYR B 2 26 ? -5.090  -1.995  -8.820  1.00 0.00 ? 26 TYR B CD1  10 
ATOM   7732  C CD2  . TYR B 2 26 ? -7.171  -1.218  -9.798  1.00 0.00 ? 26 TYR B CD2  10 
ATOM   7733  C CE1  . TYR B 2 26 ? -4.528  -0.726  -9.004  1.00 0.00 ? 26 TYR B CE1  10 
ATOM   7734  C CE2  . TYR B 2 26 ? -6.608  0.053   -9.984  1.00 0.00 ? 26 TYR B CE2  10 
ATOM   7735  C CZ   . TYR B 2 26 ? -5.287  0.299   -9.588  1.00 0.00 ? 26 TYR B CZ   10 
ATOM   7736  O OH   . TYR B 2 26 ? -4.733  1.549   -9.771  1.00 0.00 ? 26 TYR B OH   10 
ATOM   7737  H H    . TYR B 2 26 ? -6.628  -6.081  -8.413  1.00 0.00 ? 26 TYR B H    10 
ATOM   7738  H HA   . TYR B 2 26 ? -5.787  -3.693  -7.256  1.00 0.00 ? 26 TYR B HA   10 
ATOM   7739  H HB2  . TYR B 2 26 ? -6.584  -4.303  -9.722  1.00 0.00 ? 26 TYR B HB2  10 
ATOM   7740  H HB3  . TYR B 2 26 ? -8.084  -3.557  -9.173  1.00 0.00 ? 26 TYR B HB3  10 
ATOM   7741  H HD1  . TYR B 2 26 ? -4.506  -2.784  -8.370  1.00 0.00 ? 26 TYR B HD1  10 
ATOM   7742  H HD2  . TYR B 2 26 ? -8.189  -1.407  -10.104 1.00 0.00 ? 26 TYR B HD2  10 
ATOM   7743  H HE1  . TYR B 2 26 ? -3.510  -0.535  -8.699  1.00 0.00 ? 26 TYR B HE1  10 
ATOM   7744  H HE2  . TYR B 2 26 ? -7.193  0.842   -10.434 1.00 0.00 ? 26 TYR B HE2  10 
ATOM   7745  H HH   . TYR B 2 26 ? -3.783  1.474   -9.652  1.00 0.00 ? 26 TYR B HH   10 
ATOM   7746  N N    . THR B 2 27 ? -7.720  -2.433  -6.124  1.00 0.00 ? 27 THR B N    10 
ATOM   7747  C CA   . THR B 2 27 ? -8.772  -1.916  -5.205  1.00 0.00 ? 27 THR B CA   10 
ATOM   7748  C C    . THR B 2 27 ? -9.894  -1.276  -6.026  1.00 0.00 ? 27 THR B C    10 
ATOM   7749  O O    . THR B 2 27 ? -9.940  -1.402  -7.234  1.00 0.00 ? 27 THR B O    10 
ATOM   7750  C CB   . THR B 2 27 ? -8.164  -0.873  -4.265  1.00 0.00 ? 27 THR B CB   10 
ATOM   7751  O OG1  . THR B 2 27 ? -7.140  -0.162  -4.948  1.00 0.00 ? 27 THR B OG1  10 
ATOM   7752  C CG2  . THR B 2 27 ? -7.572  -1.570  -3.040  1.00 0.00 ? 27 THR B CG2  10 
ATOM   7753  H H    . THR B 2 27 ? -6.934  -1.884  -6.327  1.00 0.00 ? 27 THR B H    10 
ATOM   7754  H HA   . THR B 2 27 ? -9.173  -2.733  -4.623  1.00 0.00 ? 27 THR B HA   10 
ATOM   7755  H HB   . THR B 2 27 ? -8.930  -0.183  -3.947  1.00 0.00 ? 27 THR B HB   10 
ATOM   7756  H HG1  . THR B 2 27 ? -7.398  -0.083  -5.869  1.00 0.00 ? 27 THR B HG1  10 
ATOM   7757  H HG21 . THR B 2 27 ? -7.920  -1.079  -2.143  1.00 0.00 ? 27 THR B HG21 10 
ATOM   7758  H HG22 . THR B 2 27 ? -6.494  -1.521  -3.082  1.00 0.00 ? 27 THR B HG22 10 
ATOM   7759  H HG23 . THR B 2 27 ? -7.885  -2.604  -3.028  1.00 0.00 ? 27 THR B HG23 10 
ATOM   7760  N N    . LYS B 2 28 ? -10.797 -0.590  -5.383  1.00 0.00 ? 28 LYS B N    10 
ATOM   7761  C CA   . LYS B 2 28 ? -11.913 0.055   -6.131  1.00 0.00 ? 28 LYS B CA   10 
ATOM   7762  C C    . LYS B 2 28 ? -11.962 1.546   -5.791  1.00 0.00 ? 28 LYS B C    10 
ATOM   7763  O O    . LYS B 2 28 ? -12.765 1.970   -4.984  1.00 0.00 ? 28 LYS B O    10 
ATOM   7764  C CB   . LYS B 2 28 ? -13.238 -0.604  -5.741  1.00 0.00 ? 28 LYS B CB   10 
ATOM   7765  C CG   . LYS B 2 28 ? -14.274 -0.349  -6.837  1.00 0.00 ? 28 LYS B CG   10 
ATOM   7766  C CD   . LYS B 2 28 ? -14.929 -1.672  -7.239  1.00 0.00 ? 28 LYS B CD   10 
ATOM   7767  C CE   . LYS B 2 28 ? -15.981 -1.413  -8.319  1.00 0.00 ? 28 LYS B CE   10 
ATOM   7768  N NZ   . LYS B 2 28 ? -15.602 -2.136  -9.567  1.00 0.00 ? 28 LYS B NZ   10 
ATOM   7769  H H    . LYS B 2 28 ? -10.744 -0.500  -4.408  1.00 0.00 ? 28 LYS B H    10 
ATOM   7770  H HA   . LYS B 2 28 ? -11.749 -0.067  -7.192  1.00 0.00 ? 28 LYS B HA   10 
ATOM   7771  H HB2  . LYS B 2 28 ? -13.090 -1.668  -5.623  1.00 0.00 ? 28 LYS B HB2  10 
ATOM   7772  H HB3  . LYS B 2 28 ? -13.588 -0.182  -4.810  1.00 0.00 ? 28 LYS B HB3  10 
ATOM   7773  H HG2  . LYS B 2 28 ? -15.029 0.330   -6.467  1.00 0.00 ? 28 LYS B HG2  10 
ATOM   7774  H HG3  . LYS B 2 28 ? -13.789 0.087   -7.696  1.00 0.00 ? 28 LYS B HG3  10 
ATOM   7775  H HD2  . LYS B 2 28 ? -14.175 -2.344  -7.624  1.00 0.00 ? 28 LYS B HD2  10 
ATOM   7776  H HD3  . LYS B 2 28 ? -15.403 -2.117  -6.378  1.00 0.00 ? 28 LYS B HD3  10 
ATOM   7777  H HE2  . LYS B 2 28 ? -16.942 -1.765  -7.977  1.00 0.00 ? 28 LYS B HE2  10 
ATOM   7778  H HE3  . LYS B 2 28 ? -16.036 -0.353  -8.521  1.00 0.00 ? 28 LYS B HE3  10 
ATOM   7779  H HZ1  . LYS B 2 28 ? -15.009 -1.520  -10.158 1.00 0.00 ? 28 LYS B HZ1  10 
ATOM   7780  H HZ2  . LYS B 2 28 ? -16.463 -2.396  -10.090 1.00 0.00 ? 28 LYS B HZ2  10 
ATOM   7781  H HZ3  . LYS B 2 28 ? -15.071 -2.994  -9.324  1.00 0.00 ? 28 LYS B HZ3  10 
ATOM   7782  N N    . PRO B 2 29 ? -11.096 2.298   -6.421  1.00 0.00 ? 29 PRO B N    10 
ATOM   7783  C CA   . PRO B 2 29 ? -11.007 3.754   -6.215  1.00 0.00 ? 29 PRO B CA   10 
ATOM   7784  C C    . PRO B 2 29 ? -12.128 4.470   -6.976  1.00 0.00 ? 29 PRO B C    10 
ATOM   7785  O O    . PRO B 2 29 ? -12.459 4.117   -8.090  1.00 0.00 ? 29 PRO B O    10 
ATOM   7786  C CB   . PRO B 2 29 ? -9.635  4.115   -6.791  1.00 0.00 ? 29 PRO B CB   10 
ATOM   7787  C CG   . PRO B 2 29 ? -9.269  2.987   -7.785  1.00 0.00 ? 29 PRO B CG   10 
ATOM   7788  C CD   . PRO B 2 29 ? -10.124 1.765   -7.398  1.00 0.00 ? 29 PRO B CD   10 
ATOM   7789  H HA   . PRO B 2 29 ? -11.042 3.994   -5.165  1.00 0.00 ? 29 PRO B HA   10 
ATOM   7790  H HB2  . PRO B 2 29 ? -9.689  5.065   -7.305  1.00 0.00 ? 29 PRO B HB2  10 
ATOM   7791  H HB3  . PRO B 2 29 ? -8.901  4.158   -6.003  1.00 0.00 ? 29 PRO B HB3  10 
ATOM   7792  H HG2  . PRO B 2 29 ? -9.496  3.297   -8.796  1.00 0.00 ? 29 PRO B HG2  10 
ATOM   7793  H HG3  . PRO B 2 29 ? -8.222  2.740   -7.697  1.00 0.00 ? 29 PRO B HG3  10 
ATOM   7794  H HD2  . PRO B 2 29 ? -10.634 1.373   -8.267  1.00 0.00 ? 29 PRO B HD2  10 
ATOM   7795  H HD3  . PRO B 2 29 ? -9.513  1.005   -6.940  1.00 0.00 ? 29 PRO B HD3  10 
ATOM   7796  N N    . THR B 2 30 ? -12.714 5.473   -6.381  1.00 0.00 ? 30 THR B N    10 
ATOM   7797  C CA   . THR B 2 30 ? -13.812 6.210   -7.070  1.00 0.00 ? 30 THR B CA   10 
ATOM   7798  C C    . THR B 2 30 ? -13.257 6.904   -8.316  1.00 0.00 ? 30 THR B C    10 
ATOM   7799  O O    . THR B 2 30 ? -13.995 7.662   -8.925  1.00 0.00 ? 30 THR B O    10 
ATOM   7800  C CB   . THR B 2 30 ? -14.396 7.259   -6.120  1.00 0.00 ? 30 THR B CB   10 
ATOM   7801  O OG1  . THR B 2 30 ? -15.342 8.054   -6.820  1.00 0.00 ? 30 THR B OG1  10 
ATOM   7802  C CG2  . THR B 2 30 ? -13.272 8.149   -5.589  1.00 0.00 ? 30 THR B CG2  10 
ATOM   7803  O OXT  . THR B 2 30 ? -12.106 6.665   -8.640  1.00 0.00 ? 30 THR B OXT  10 
ATOM   7804  H H    . THR B 2 30 ? -12.432 5.743   -5.482  1.00 0.00 ? 30 THR B H    10 
ATOM   7805  H HA   . THR B 2 30 ? -14.586 5.515   -7.359  1.00 0.00 ? 30 THR B HA   10 
ATOM   7806  H HB   . THR B 2 30 ? -14.881 6.765   -5.292  1.00 0.00 ? 30 THR B HB   10 
ATOM   7807  H HG1  . THR B 2 30 ? -15.951 7.464   -7.271  1.00 0.00 ? 30 THR B HG1  10 
ATOM   7808  H HG21 . THR B 2 30 ? -13.478 9.178   -5.843  1.00 0.00 ? 30 THR B HG21 10 
ATOM   7809  H HG22 . THR B 2 30 ? -12.335 7.848   -6.034  1.00 0.00 ? 30 THR B HG22 10 
ATOM   7810  H HG23 . THR B 2 30 ? -13.210 8.049   -4.515  1.00 0.00 ? 30 THR B HG23 10 
ATOM   7811  N N    . GLY A 1 1  ? -6.970  4.819   -1.125  1.00 0.00 ? 1  GLY A N    11 
ATOM   7812  C CA   . GLY A 1 1  ? -6.317  3.485   -1.485  1.00 0.00 ? 1  GLY A CA   11 
ATOM   7813  C C    . GLY A 1 1  ? -4.975  3.480   -2.132  1.00 0.00 ? 1  GLY A C    11 
ATOM   7814  O O    . GLY A 1 1  ? -4.458  4.508   -2.520  1.00 0.00 ? 1  GLY A O    11 
ATOM   7815  H H1   . GLY A 1 1  ? -7.415  4.745   -0.188  1.00 0.00 ? 1  GLY A H1   11 
ATOM   7816  H H2   . GLY A 1 1  ? -7.693  5.054   -1.835  1.00 0.00 ? 1  GLY A H2   11 
ATOM   7817  H H3   . GLY A 1 1  ? -6.246  5.566   -1.105  1.00 0.00 ? 1  GLY A H3   11 
ATOM   7818  H HA2  . GLY A 1 1  ? -5.835  3.110   -0.725  1.00 0.00 ? 1  GLY A HA2  11 
ATOM   7819  H HA3  . GLY A 1 1  ? -7.166  2.786   -1.877  1.00 0.00 ? 1  GLY A HA3  11 
HETATM 7820  N N    . IIL A 1 2  ? -4.377  2.329   -2.266  1.00 0.00 ? 2  IIL A N    11 
HETATM 7821  C CA   . IIL A 1 2  ? -3.033  2.258   -2.906  1.00 0.00 ? 2  IIL A CA   11 
HETATM 7822  C C    . IIL A 1 2  ? -3.050  3.054   -4.213  1.00 0.00 ? 2  IIL A C    11 
HETATM 7823  O O    . IIL A 1 2  ? -2.126  3.778   -4.521  1.00 0.00 ? 2  IIL A O    11 
HETATM 7824  C CB   . IIL A 1 2  ? -2.685  0.795   -3.197  1.00 0.00 ? 2  IIL A CB   11 
HETATM 7825  C CG2  . IIL A 1 2  ? -1.201  0.686   -3.551  1.00 0.00 ? 2  IIL A CG2  11 
HETATM 7826  C CG1  . IIL A 1 2  ? -3.530  0.293   -4.370  1.00 0.00 ? 2  IIL A CG1  11 
HETATM 7827  C CD1  . IIL A 1 2  ? -3.383  -1.225  -4.489  1.00 0.00 ? 2  IIL A CD1  11 
HETATM 7828  H H    . IIL A 1 2  ? -4.810  1.511   -1.947  1.00 0.00 ? 2  IIL A H    11 
HETATM 7829  H HA   . IIL A 1 2  ? -2.294  2.677   -2.240  1.00 0.00 ? 2  IIL A HA   11 
HETATM 7830  H HB   . IIL A 1 2  ? -2.891  0.195   -2.324  1.00 0.00 ? 2  IIL A HB   11 
HETATM 7831  H HG21 . IIL A 1 2  ? -1.001  1.264   -4.442  1.00 0.00 ? 2  IIL A HG21 11 
HETATM 7832  H HG22 . IIL A 1 2  ? -0.949  -0.348  -3.728  1.00 0.00 ? 2  IIL A HG22 11 
HETATM 7833  H HG23 . IIL A 1 2  ? -0.608  1.068   -2.734  1.00 0.00 ? 2  IIL A HG23 11 
HETATM 7834  H HG12 . IIL A 1 2  ? -3.192  0.757   -5.283  1.00 0.00 ? 2  IIL A HG12 11 
HETATM 7835  H HG13 . IIL A 1 2  ? -4.567  0.543   -4.199  1.00 0.00 ? 2  IIL A HG13 11 
HETATM 7836  H HD11 . IIL A 1 2  ? -2.438  -1.531  -4.064  1.00 0.00 ? 2  IIL A HD11 11 
HETATM 7837  H HD12 . IIL A 1 2  ? -3.419  -1.510  -5.530  1.00 0.00 ? 2  IIL A HD12 11 
HETATM 7838  H HD13 . IIL A 1 2  ? -4.190  -1.708  -3.956  1.00 0.00 ? 2  IIL A HD13 11 
ATOM   7839  N N    . VAL A 1 3  ? -4.097  2.927   -4.981  1.00 0.00 ? 3  VAL A N    11 
ATOM   7840  C CA   . VAL A 1 3  ? -4.174  3.677   -6.266  1.00 0.00 ? 3  VAL A CA   11 
ATOM   7841  C C    . VAL A 1 3  ? -4.294  5.175   -5.974  1.00 0.00 ? 3  VAL A C    11 
ATOM   7842  O O    . VAL A 1 3  ? -3.738  5.999   -6.672  1.00 0.00 ? 3  VAL A O    11 
ATOM   7843  C CB   . VAL A 1 3  ? -5.399  3.210   -7.052  1.00 0.00 ? 3  VAL A CB   11 
ATOM   7844  C CG1  . VAL A 1 3  ? -5.580  4.094   -8.287  1.00 0.00 ? 3  VAL A CG1  11 
ATOM   7845  C CG2  . VAL A 1 3  ? -5.199  1.758   -7.490  1.00 0.00 ? 3  VAL A CG2  11 
ATOM   7846  H H    . VAL A 1 3  ? -4.833  2.338   -4.713  1.00 0.00 ? 3  VAL A H    11 
ATOM   7847  H HA   . VAL A 1 3  ? -3.282  3.492   -6.845  1.00 0.00 ? 3  VAL A HA   11 
ATOM   7848  H HB   . VAL A 1 3  ? -6.277  3.282   -6.427  1.00 0.00 ? 3  VAL A HB   11 
ATOM   7849  H HG11 . VAL A 1 3  ? -4.829  3.843   -9.021  1.00 0.00 ? 3  VAL A HG11 11 
ATOM   7850  H HG12 . VAL A 1 3  ? -5.477  5.132   -8.006  1.00 0.00 ? 3  VAL A HG12 11 
ATOM   7851  H HG13 . VAL A 1 3  ? -6.562  3.929   -8.706  1.00 0.00 ? 3  VAL A HG13 11 
ATOM   7852  H HG21 . VAL A 1 3  ? -4.707  1.209   -6.701  1.00 0.00 ? 3  VAL A HG21 11 
ATOM   7853  H HG22 . VAL A 1 3  ? -4.589  1.731   -8.382  1.00 0.00 ? 3  VAL A HG22 11 
ATOM   7854  H HG23 . VAL A 1 3  ? -6.159  1.309   -7.697  1.00 0.00 ? 3  VAL A HG23 11 
ATOM   7855  N N    . GLU A 1 4  ? -5.016  5.533   -4.947  1.00 0.00 ? 4  GLU A N    11 
ATOM   7856  C CA   . GLU A 1 4  ? -5.171  6.977   -4.612  1.00 0.00 ? 4  GLU A CA   11 
ATOM   7857  C C    . GLU A 1 4  ? -3.913  7.475   -3.899  1.00 0.00 ? 4  GLU A C    11 
ATOM   7858  O O    . GLU A 1 4  ? -3.746  8.655   -3.665  1.00 0.00 ? 4  GLU A O    11 
ATOM   7859  C CB   . GLU A 1 4  ? -6.378  7.159   -3.689  1.00 0.00 ? 4  GLU A CB   11 
ATOM   7860  C CG   . GLU A 1 4  ? -7.637  6.635   -4.382  1.00 0.00 ? 4  GLU A CG   11 
ATOM   7861  C CD   . GLU A 1 4  ? -8.861  7.375   -3.840  1.00 0.00 ? 4  GLU A CD   11 
ATOM   7862  O OE1  . GLU A 1 4  ? -9.254  7.092   -2.721  1.00 0.00 ? 4  GLU A OE1  11 
ATOM   7863  O OE2  . GLU A 1 4  ? -9.384  8.216   -4.554  1.00 0.00 ? 4  GLU A OE2  11 
ATOM   7864  H H    . GLU A 1 4  ? -5.456  4.853   -4.398  1.00 0.00 ? 4  GLU A H    11 
ATOM   7865  H HA   . GLU A 1 4  ? -5.321  7.544   -5.519  1.00 0.00 ? 4  GLU A HA   11 
ATOM   7866  H HB2  . GLU A 1 4  ? -6.215  6.612   -2.772  1.00 0.00 ? 4  GLU A HB2  11 
ATOM   7867  H HB3  . GLU A 1 4  ? -6.504  8.209   -3.466  1.00 0.00 ? 4  GLU A HB3  11 
ATOM   7868  H HG2  . GLU A 1 4  ? -7.557  6.797   -5.447  1.00 0.00 ? 4  GLU A HG2  11 
ATOM   7869  H HG3  . GLU A 1 4  ? -7.742  5.579   -4.185  1.00 0.00 ? 4  GLU A HG3  11 
ATOM   7870  N N    . GLN A 1 5  ? -3.025  6.585   -3.547  1.00 0.00 ? 5  GLN A N    11 
ATOM   7871  C CA   . GLN A 1 5  ? -1.783  7.012   -2.845  1.00 0.00 ? 5  GLN A CA   11 
ATOM   7872  C C    . GLN A 1 5  ? -0.610  7.024   -3.831  1.00 0.00 ? 5  GLN A C    11 
ATOM   7873  O O    . GLN A 1 5  ? 0.184   7.943   -3.850  1.00 0.00 ? 5  GLN A O    11 
ATOM   7874  C CB   . GLN A 1 5  ? -1.489  6.042   -1.697  1.00 0.00 ? 5  GLN A CB   11 
ATOM   7875  C CG   . GLN A 1 5  ? -2.559  6.201   -0.613  1.00 0.00 ? 5  GLN A CG   11 
ATOM   7876  C CD   . GLN A 1 5  ? -2.243  5.272   0.560   1.00 0.00 ? 5  GLN A CD   11 
ATOM   7877  O OE1  . GLN A 1 5  ? -1.718  4.192   0.372   1.00 0.00 ? 5  GLN A OE1  11 
ATOM   7878  N NE2  . GLN A 1 5  ? -2.545  5.647   1.775   1.00 0.00 ? 5  GLN A NE2  11 
ATOM   7879  H H    . GLN A 1 5  ? -3.177  5.636   -3.741  1.00 0.00 ? 5  GLN A H    11 
ATOM   7880  H HA   . GLN A 1 5  ? -1.923  8.007   -2.445  1.00 0.00 ? 5  GLN A HA   11 
ATOM   7881  H HB2  . GLN A 1 5  ? -1.500  5.028   -2.070  1.00 0.00 ? 5  GLN A HB2  11 
ATOM   7882  H HB3  . GLN A 1 5  ? -0.519  6.262   -1.276  1.00 0.00 ? 5  GLN A HB3  11 
ATOM   7883  H HG2  . GLN A 1 5  ? -2.573  7.226   -0.270  1.00 0.00 ? 5  GLN A HG2  11 
ATOM   7884  H HG3  . GLN A 1 5  ? -3.526  5.946   -1.022  1.00 0.00 ? 5  GLN A HG3  11 
ATOM   7885  H HE21 . GLN A 1 5  ? -2.969  6.517   1.929   1.00 0.00 ? 5  GLN A HE21 11 
ATOM   7886  H HE22 . GLN A 1 5  ? -2.346  5.057   2.533   1.00 0.00 ? 5  GLN A HE22 11 
ATOM   7887  N N    . CYS A 1 6  ? -0.496  6.016   -4.655  1.00 0.00 ? 6  CYS A N    11 
ATOM   7888  C CA   . CYS A 1 6  ? 0.627   5.983   -5.634  1.00 0.00 ? 6  CYS A CA   11 
ATOM   7889  C C    . CYS A 1 6  ? 0.275   6.851   -6.844  1.00 0.00 ? 6  CYS A C    11 
ATOM   7890  O O    . CYS A 1 6  ? 1.123   7.177   -7.654  1.00 0.00 ? 6  CYS A O    11 
ATOM   7891  C CB   . CYS A 1 6  ? 0.876   4.544   -6.090  1.00 0.00 ? 6  CYS A CB   11 
ATOM   7892  S SG   . CYS A 1 6  ? 1.461   3.561   -4.688  1.00 0.00 ? 6  CYS A SG   11 
ATOM   7893  H H    . CYS A 1 6  ? -1.147  5.283   -4.629  1.00 0.00 ? 6  CYS A H    11 
ATOM   7894  H HA   . CYS A 1 6  ? 1.520   6.369   -5.166  1.00 0.00 ? 6  CYS A HA   11 
ATOM   7895  H HB2  . CYS A 1 6  ? -0.038  4.121   -6.472  1.00 0.00 ? 6  CYS A HB2  11 
ATOM   7896  H HB3  . CYS A 1 6  ? 1.623   4.539   -6.867  1.00 0.00 ? 6  CYS A HB3  11 
ATOM   7897  N N    . CYS A 1 7  ? -0.967  7.239   -6.969  1.00 0.00 ? 7  CYS A N    11 
ATOM   7898  C CA   . CYS A 1 7  ? -1.363  8.097   -8.119  1.00 0.00 ? 7  CYS A CA   11 
ATOM   7899  C C    . CYS A 1 7  ? -1.497  9.540   -7.635  1.00 0.00 ? 7  CYS A C    11 
ATOM   7900  O O    . CYS A 1 7  ? -1.353  10.476  -8.395  1.00 0.00 ? 7  CYS A O    11 
ATOM   7901  C CB   . CYS A 1 7  ? -2.689  7.602   -8.708  1.00 0.00 ? 7  CYS A CB   11 
ATOM   7902  S SG   . CYS A 1 7  ? -2.979  8.377   -10.319 1.00 0.00 ? 7  CYS A SG   11 
ATOM   7903  H H    . CYS A 1 7  ? -1.634  6.972   -6.302  1.00 0.00 ? 7  CYS A H    11 
ATOM   7904  H HA   . CYS A 1 7  ? -0.596  8.053   -8.870  1.00 0.00 ? 7  CYS A HA   11 
ATOM   7905  H HB2  . CYS A 1 7  ? -2.648  6.529   -8.830  1.00 0.00 ? 7  CYS A HB2  11 
ATOM   7906  H HB3  . CYS A 1 7  ? -3.493  7.854   -8.041  1.00 0.00 ? 7  CYS A HB3  11 
ATOM   7907  N N    . THR A 1 8  ? -1.738  9.728   -6.366  1.00 0.00 ? 8  THR A N    11 
ATOM   7908  C CA   . THR A 1 8  ? -1.841  11.112  -5.828  1.00 0.00 ? 8  THR A CA   11 
ATOM   7909  C C    . THR A 1 8  ? -0.421  11.647  -5.634  1.00 0.00 ? 8  THR A C    11 
ATOM   7910  O O    . THR A 1 8  ? -0.192  12.837  -5.553  1.00 0.00 ? 8  THR A O    11 
ATOM   7911  C CB   . THR A 1 8  ? -2.573  11.091  -4.482  1.00 0.00 ? 8  THR A CB   11 
ATOM   7912  O OG1  . THR A 1 8  ? -2.815  12.424  -4.058  1.00 0.00 ? 8  THR A OG1  11 
ATOM   7913  C CG2  . THR A 1 8  ? -1.713  10.370  -3.443  1.00 0.00 ? 8  THR A CG2  11 
ATOM   7914  H H    . THR A 1 8  ? -1.826  8.959   -5.764  1.00 0.00 ? 8  THR A H    11 
ATOM   7915  H HA   . THR A 1 8  ? -2.375  11.738  -6.527  1.00 0.00 ? 8  THR A HA   11 
ATOM   7916  H HB   . THR A 1 8  ? -3.511  10.570  -4.590  1.00 0.00 ? 8  THR A HB   11 
ATOM   7917  H HG1  . THR A 1 8  ? -2.151  12.989  -4.461  1.00 0.00 ? 8  THR A HG1  11 
ATOM   7918  H HG21 . THR A 1 8  ? -0.801  10.926  -3.281  1.00 0.00 ? 8  THR A HG21 11 
ATOM   7919  H HG22 . THR A 1 8  ? -1.473  9.379   -3.799  1.00 0.00 ? 8  THR A HG22 11 
ATOM   7920  H HG23 . THR A 1 8  ? -2.259  10.295  -2.514  1.00 0.00 ? 8  THR A HG23 11 
ATOM   7921  N N    . SER A 1 9  ? 0.534   10.757  -5.568  1.00 0.00 ? 9  SER A N    11 
ATOM   7922  C CA   . SER A 1 9  ? 1.952   11.169  -5.390  1.00 0.00 ? 9  SER A CA   11 
ATOM   7923  C C    . SER A 1 9  ? 2.844   9.975   -5.734  1.00 0.00 ? 9  SER A C    11 
ATOM   7924  O O    . SER A 1 9  ? 2.410   9.033   -6.368  1.00 0.00 ? 9  SER A O    11 
ATOM   7925  C CB   . SER A 1 9  ? 2.186   11.584  -3.938  1.00 0.00 ? 9  SER A CB   11 
ATOM   7926  O OG   . SER A 1 9  ? 1.316   12.661  -3.612  1.00 0.00 ? 9  SER A OG   11 
ATOM   7927  H H    . SER A 1 9  ? 0.315   9.807   -5.642  1.00 0.00 ? 9  SER A H    11 
ATOM   7928  H HA   . SER A 1 9  ? 2.177   11.995  -6.048  1.00 0.00 ? 9  SER A HA   11 
ATOM   7929  H HB2  . SER A 1 9  ? 1.981   10.753  -3.285  1.00 0.00 ? 9  SER A HB2  11 
ATOM   7930  H HB3  . SER A 1 9  ? 3.216   11.890  -3.814  1.00 0.00 ? 9  SER A HB3  11 
ATOM   7931  H HG   . SER A 1 9  ? 1.088   12.585  -2.682  1.00 0.00 ? 9  SER A HG   11 
ATOM   7932  N N    . ILE A 1 10 ? 4.080   9.990   -5.321  1.00 0.00 ? 10 ILE A N    11 
ATOM   7933  C CA   . ILE A 1 10 ? 4.971   8.837   -5.631  1.00 0.00 ? 10 ILE A CA   11 
ATOM   7934  C C    . ILE A 1 10 ? 5.106   7.955   -4.387  1.00 0.00 ? 10 ILE A C    11 
ATOM   7935  O O    . ILE A 1 10 ? 5.443   8.422   -3.317  1.00 0.00 ? 10 ILE A O    11 
ATOM   7936  C CB   . ILE A 1 10 ? 6.354   9.344   -6.056  1.00 0.00 ? 10 ILE A CB   11 
ATOM   7937  C CG1  . ILE A 1 10 ? 6.286   9.869   -7.495  1.00 0.00 ? 10 ILE A CG1  11 
ATOM   7938  C CG2  . ILE A 1 10 ? 7.365   8.194   -5.980  1.00 0.00 ? 10 ILE A CG2  11 
ATOM   7939  C CD1  . ILE A 1 10 ? 7.704   10.017  -8.055  1.00 0.00 ? 10 ILE A CD1  11 
ATOM   7940  H H    . ILE A 1 10 ? 4.419   10.751  -4.805  1.00 0.00 ? 10 ILE A H    11 
ATOM   7941  H HA   . ILE A 1 10 ? 4.539   8.257   -6.434  1.00 0.00 ? 10 ILE A HA   11 
ATOM   7942  H HB   . ILE A 1 10 ? 6.663   10.139  -5.394  1.00 0.00 ? 10 ILE A HB   11 
ATOM   7943  H HG12 . ILE A 1 10 ? 5.729   9.172   -8.106  1.00 0.00 ? 10 ILE A HG12 11 
ATOM   7944  H HG13 . ILE A 1 10 ? 5.795   10.830  -7.506  1.00 0.00 ? 10 ILE A HG13 11 
ATOM   7945  H HG21 . ILE A 1 10 ? 7.010   7.363   -6.571  1.00 0.00 ? 10 ILE A HG21 11 
ATOM   7946  H HG22 . ILE A 1 10 ? 7.478   7.881   -4.953  1.00 0.00 ? 10 ILE A HG22 11 
ATOM   7947  H HG23 . ILE A 1 10 ? 8.319   8.526   -6.362  1.00 0.00 ? 10 ILE A HG23 11 
ATOM   7948  H HD11 . ILE A 1 10 ? 8.341   10.470  -7.309  1.00 0.00 ? 10 ILE A HD11 11 
ATOM   7949  H HD12 . ILE A 1 10 ? 7.683   10.639  -8.936  1.00 0.00 ? 10 ILE A HD12 11 
ATOM   7950  H HD13 . ILE A 1 10 ? 8.092   9.042   -8.312  1.00 0.00 ? 10 ILE A HD13 11 
ATOM   7951  N N    . CYS A 1 11 ? 4.855   6.682   -4.521  1.00 0.00 ? 11 CYS A N    11 
ATOM   7952  C CA   . CYS A 1 11 ? 4.977   5.770   -3.350  1.00 0.00 ? 11 CYS A CA   11 
ATOM   7953  C C    . CYS A 1 11 ? 6.159   4.824   -3.572  1.00 0.00 ? 11 CYS A C    11 
ATOM   7954  O O    . CYS A 1 11 ? 7.075   5.127   -4.311  1.00 0.00 ? 11 CYS A O    11 
ATOM   7955  C CB   . CYS A 1 11 ? 3.687   4.961   -3.192  1.00 0.00 ? 11 CYS A CB   11 
ATOM   7956  S SG   . CYS A 1 11 ? 3.452   3.905   -4.643  1.00 0.00 ? 11 CYS A SG   11 
ATOM   7957  H H    . CYS A 1 11 ? 4.590   6.324   -5.394  1.00 0.00 ? 11 CYS A H    11 
ATOM   7958  H HA   . CYS A 1 11 ? 5.149   6.354   -2.457  1.00 0.00 ? 11 CYS A HA   11 
ATOM   7959  H HB2  . CYS A 1 11 ? 3.753   4.346   -2.306  1.00 0.00 ? 11 CYS A HB2  11 
ATOM   7960  H HB3  . CYS A 1 11 ? 2.849   5.636   -3.100  1.00 0.00 ? 11 CYS A HB3  11 
ATOM   7961  N N    . SER A 1 12 ? 6.153   3.681   -2.942  1.00 0.00 ? 12 SER A N    11 
ATOM   7962  C CA   . SER A 1 12 ? 7.286   2.730   -3.126  1.00 0.00 ? 12 SER A CA   11 
ATOM   7963  C C    . SER A 1 12 ? 6.746   1.334   -3.446  1.00 0.00 ? 12 SER A C    11 
ATOM   7964  O O    . SER A 1 12 ? 5.758   0.896   -2.891  1.00 0.00 ? 12 SER A O    11 
ATOM   7965  C CB   . SER A 1 12 ? 8.114   2.671   -1.843  1.00 0.00 ? 12 SER A CB   11 
ATOM   7966  O OG   . SER A 1 12 ? 7.323   3.118   -0.751  1.00 0.00 ? 12 SER A OG   11 
ATOM   7967  H H    . SER A 1 12 ? 5.408   3.451   -2.348  1.00 0.00 ? 12 SER A H    11 
ATOM   7968  H HA   . SER A 1 12 ? 7.910   3.068   -3.939  1.00 0.00 ? 12 SER A HA   11 
ATOM   7969  H HB2  . SER A 1 12 ? 8.428   1.656   -1.661  1.00 0.00 ? 12 SER A HB2  11 
ATOM   7970  H HB3  . SER A 1 12 ? 8.987   3.301   -1.951  1.00 0.00 ? 12 SER A HB3  11 
ATOM   7971  H HG   . SER A 1 12 ? 7.892   3.608   -0.153  1.00 0.00 ? 12 SER A HG   11 
ATOM   7972  N N    . LEU A 1 13 ? 7.397   0.630   -4.331  1.00 0.00 ? 13 LEU A N    11 
ATOM   7973  C CA   . LEU A 1 13 ? 6.934   -0.740  -4.684  1.00 0.00 ? 13 LEU A CA   11 
ATOM   7974  C C    . LEU A 1 13 ? 6.980   -1.620  -3.433  1.00 0.00 ? 13 LEU A C    11 
ATOM   7975  O O    . LEU A 1 13 ? 6.375   -2.674  -3.380  1.00 0.00 ? 13 LEU A O    11 
ATOM   7976  C CB   . LEU A 1 13 ? 7.851   -1.321  -5.760  1.00 0.00 ? 13 LEU A CB   11 
ATOM   7977  C CG   . LEU A 1 13 ? 9.254   -1.512  -5.191  1.00 0.00 ? 13 LEU A CG   11 
ATOM   7978  C CD1  . LEU A 1 13 ? 9.848   -2.802  -5.751  1.00 0.00 ? 13 LEU A CD1  11 
ATOM   7979  C CD2  . LEU A 1 13 ? 10.135  -0.328  -5.592  1.00 0.00 ? 13 LEU A CD2  11 
ATOM   7980  H H    . LEU A 1 13 ? 8.196   1.000   -4.759  1.00 0.00 ? 13 LEU A H    11 
ATOM   7981  H HA   . LEU A 1 13 ? 5.921   -0.700  -5.059  1.00 0.00 ? 13 LEU A HA   11 
ATOM   7982  H HB2  . LEU A 1 13 ? 7.460   -2.274  -6.087  1.00 0.00 ? 13 LEU A HB2  11 
ATOM   7983  H HB3  . LEU A 1 13 ? 7.894   -0.643  -6.599  1.00 0.00 ? 13 LEU A HB3  11 
ATOM   7984  H HG   . LEU A 1 13 ? 9.203   -1.578  -4.114  1.00 0.00 ? 13 LEU A HG   11 
ATOM   7985  H HD11 . LEU A 1 13 ? 9.753   -3.588  -5.017  1.00 0.00 ? 13 LEU A HD11 11 
ATOM   7986  H HD12 . LEU A 1 13 ? 10.891  -2.646  -5.982  1.00 0.00 ? 13 LEU A HD12 11 
ATOM   7987  H HD13 . LEU A 1 13 ? 9.317   -3.081  -6.648  1.00 0.00 ? 13 LEU A HD13 11 
ATOM   7988  H HD21 . LEU A 1 13 ? 11.124  -0.682  -5.842  1.00 0.00 ? 13 LEU A HD21 11 
ATOM   7989  H HD22 . LEU A 1 13 ? 10.199  0.367   -4.767  1.00 0.00 ? 13 LEU A HD22 11 
ATOM   7990  H HD23 . LEU A 1 13 ? 9.703   0.168   -6.448  1.00 0.00 ? 13 LEU A HD23 11 
ATOM   7991  N N    . TYR A 1 14 ? 7.683   -1.191  -2.418  1.00 0.00 ? 14 TYR A N    11 
ATOM   7992  C CA   . TYR A 1 14 ? 7.748   -2.001  -1.174  1.00 0.00 ? 14 TYR A CA   11 
ATOM   7993  C C    . TYR A 1 14 ? 6.354   -2.045  -0.568  1.00 0.00 ? 14 TYR A C    11 
ATOM   7994  O O    . TYR A 1 14 ? 5.903   -3.061  -0.076  1.00 0.00 ? 14 TYR A O    11 
ATOM   7995  C CB   . TYR A 1 14 ? 8.730   -1.366  -0.188  1.00 0.00 ? 14 TYR A CB   11 
ATOM   7996  C CG   . TYR A 1 14 ? 10.003  -2.186  -0.157  1.00 0.00 ? 14 TYR A CG   11 
ATOM   7997  C CD1  . TYR A 1 14 ? 9.951   -3.549  0.172   1.00 0.00 ? 14 TYR A CD1  11 
ATOM   7998  C CD2  . TYR A 1 14 ? 11.234  -1.588  -0.462  1.00 0.00 ? 14 TYR A CD2  11 
ATOM   7999  C CE1  . TYR A 1 14 ? 11.126  -4.310  0.197   1.00 0.00 ? 14 TYR A CE1  11 
ATOM   8000  C CE2  . TYR A 1 14 ? 12.409  -2.351  -0.436  1.00 0.00 ? 14 TYR A CE2  11 
ATOM   8001  C CZ   . TYR A 1 14 ? 12.355  -3.711  -0.106  1.00 0.00 ? 14 TYR A CZ   11 
ATOM   8002  O OH   . TYR A 1 14 ? 13.513  -4.461  -0.082  1.00 0.00 ? 14 TYR A OH   11 
ATOM   8003  H H    . TYR A 1 14 ? 8.154   -0.335  -2.473  1.00 0.00 ? 14 TYR A H    11 
ATOM   8004  H HA   . TYR A 1 14 ? 8.066   -3.000  -1.413  1.00 0.00 ? 14 TYR A HA   11 
ATOM   8005  H HB2  . TYR A 1 14 ? 8.953   -0.356  -0.501  1.00 0.00 ? 14 TYR A HB2  11 
ATOM   8006  H HB3  . TYR A 1 14 ? 8.289   -1.347  0.799   1.00 0.00 ? 14 TYR A HB3  11 
ATOM   8007  H HD1  . TYR A 1 14 ? 9.005   -4.013  0.406   1.00 0.00 ? 14 TYR A HD1  11 
ATOM   8008  H HD2  . TYR A 1 14 ? 11.279  -0.541  -0.717  1.00 0.00 ? 14 TYR A HD2  11 
ATOM   8009  H HE1  . TYR A 1 14 ? 11.084  -5.359  0.450   1.00 0.00 ? 14 TYR A HE1  11 
ATOM   8010  H HE2  . TYR A 1 14 ? 13.357  -1.890  -0.671  1.00 0.00 ? 14 TYR A HE2  11 
ATOM   8011  H HH   . TYR A 1 14 ? 13.992  -4.239  0.720   1.00 0.00 ? 14 TYR A HH   11 
ATOM   8012  N N    . GLN A 1 15 ? 5.658   -0.951  -0.635  1.00 0.00 ? 15 GLN A N    11 
ATOM   8013  C CA   . GLN A 1 15 ? 4.273   -0.916  -0.103  1.00 0.00 ? 15 GLN A CA   11 
ATOM   8014  C C    . GLN A 1 15 ? 3.370   -1.619  -1.112  1.00 0.00 ? 15 GLN A C    11 
ATOM   8015  O O    . GLN A 1 15 ? 2.297   -2.090  -0.790  1.00 0.00 ? 15 GLN A O    11 
ATOM   8016  C CB   . GLN A 1 15 ? 3.821   0.536   0.070   1.00 0.00 ? 15 GLN A CB   11 
ATOM   8017  C CG   . GLN A 1 15 ? 4.626   1.193   1.191   1.00 0.00 ? 15 GLN A CG   11 
ATOM   8018  C CD   . GLN A 1 15 ? 3.904   2.457   1.660   1.00 0.00 ? 15 GLN A CD   11 
ATOM   8019  O OE1  . GLN A 1 15 ? 3.958   3.480   1.007   1.00 0.00 ? 15 GLN A OE1  11 
ATOM   8020  N NE2  . GLN A 1 15 ? 3.222   2.429   2.773   1.00 0.00 ? 15 GLN A NE2  11 
ATOM   8021  H H    . GLN A 1 15 ? 6.042   -0.158  -1.061  1.00 0.00 ? 15 GLN A H    11 
ATOM   8022  H HA   . GLN A 1 15 ? 4.236   -1.428  0.846   1.00 0.00 ? 15 GLN A HA   11 
ATOM   8023  H HB2  . GLN A 1 15 ? 3.983   1.076   -0.853  1.00 0.00 ? 15 GLN A HB2  11 
ATOM   8024  H HB3  . GLN A 1 15 ? 2.772   0.560   0.321   1.00 0.00 ? 15 GLN A HB3  11 
ATOM   8025  H HG2  . GLN A 1 15 ? 4.721   0.503   2.016   1.00 0.00 ? 15 GLN A HG2  11 
ATOM   8026  H HG3  . GLN A 1 15 ? 5.607   1.456   0.825   1.00 0.00 ? 15 GLN A HG3  11 
ATOM   8027  H HE21 . GLN A 1 15 ? 3.177   1.604   3.300   1.00 0.00 ? 15 GLN A HE21 11 
ATOM   8028  H HE22 . GLN A 1 15 ? 2.755   3.234   3.081   1.00 0.00 ? 15 GLN A HE22 11 
ATOM   8029  N N    . LEU A 1 16 ? 3.817   -1.698  -2.336  1.00 0.00 ? 16 LEU A N    11 
ATOM   8030  C CA   . LEU A 1 16 ? 3.022   -2.373  -3.391  1.00 0.00 ? 16 LEU A CA   11 
ATOM   8031  C C    . LEU A 1 16 ? 2.939   -3.864  -3.069  1.00 0.00 ? 16 LEU A C    11 
ATOM   8032  O O    . LEU A 1 16 ? 2.075   -4.571  -3.549  1.00 0.00 ? 16 LEU A O    11 
ATOM   8033  C CB   . LEU A 1 16 ? 3.726   -2.172  -4.734  1.00 0.00 ? 16 LEU A CB   11 
ATOM   8034  C CG   . LEU A 1 16 ? 3.133   -0.959  -5.451  1.00 0.00 ? 16 LEU A CG   11 
ATOM   8035  C CD1  . LEU A 1 16 ? 3.850   -0.755  -6.786  1.00 0.00 ? 16 LEU A CD1  11 
ATOM   8036  C CD2  . LEU A 1 16 ? 1.643   -1.198  -5.707  1.00 0.00 ? 16 LEU A CD2  11 
ATOM   8037  H H    . LEU A 1 16 ? 4.690   -1.315  -2.562  1.00 0.00 ? 16 LEU A H    11 
ATOM   8038  H HA   . LEU A 1 16 ? 2.032   -1.952  -3.430  1.00 0.00 ? 16 LEU A HA   11 
ATOM   8039  H HB2  . LEU A 1 16 ? 4.777   -2.007  -4.561  1.00 0.00 ? 16 LEU A HB2  11 
ATOM   8040  H HB3  . LEU A 1 16 ? 3.602   -3.045  -5.344  1.00 0.00 ? 16 LEU A HB3  11 
ATOM   8041  H HG   . LEU A 1 16 ? 3.260   -0.079  -4.837  1.00 0.00 ? 16 LEU A HG   11 
ATOM   8042  H HD11 . LEU A 1 16 ? 4.113   -1.714  -7.205  1.00 0.00 ? 16 LEU A HD11 11 
ATOM   8043  H HD12 . LEU A 1 16 ? 4.746   -0.173  -6.628  1.00 0.00 ? 16 LEU A HD12 11 
ATOM   8044  H HD13 . LEU A 1 16 ? 3.197   -0.232  -7.470  1.00 0.00 ? 16 LEU A HD13 11 
ATOM   8045  H HD21 . LEU A 1 16 ? 1.472   -1.293  -6.769  1.00 0.00 ? 16 LEU A HD21 11 
ATOM   8046  H HD22 . LEU A 1 16 ? 1.073   -0.366  -5.322  1.00 0.00 ? 16 LEU A HD22 11 
ATOM   8047  H HD23 . LEU A 1 16 ? 1.335   -2.106  -5.211  1.00 0.00 ? 16 LEU A HD23 11 
ATOM   8048  N N    . GLU A 1 17 ? 3.835   -4.345  -2.252  1.00 0.00 ? 17 GLU A N    11 
ATOM   8049  C CA   . GLU A 1 17 ? 3.819   -5.788  -1.883  1.00 0.00 ? 17 GLU A CA   11 
ATOM   8050  C C    . GLU A 1 17 ? 2.690   -6.038  -0.883  1.00 0.00 ? 17 GLU A C    11 
ATOM   8051  O O    . GLU A 1 17 ? 2.169   -7.130  -0.775  1.00 0.00 ? 17 GLU A O    11 
ATOM   8052  C CB   . GLU A 1 17 ? 5.157   -6.169  -1.245  1.00 0.00 ? 17 GLU A CB   11 
ATOM   8053  C CG   . GLU A 1 17 ? 6.186   -6.452  -2.341  1.00 0.00 ? 17 GLU A CG   11 
ATOM   8054  C CD   . GLU A 1 17 ? 7.301   -7.335  -1.779  1.00 0.00 ? 17 GLU A CD   11 
ATOM   8055  O OE1  . GLU A 1 17 ? 6.986   -8.251  -1.037  1.00 0.00 ? 17 GLU A OE1  11 
ATOM   8056  O OE2  . GLU A 1 17 ? 8.450   -7.081  -2.099  1.00 0.00 ? 17 GLU A OE2  11 
ATOM   8057  H H    . GLU A 1 17 ? 4.519   -3.751  -1.877  1.00 0.00 ? 17 GLU A H    11 
ATOM   8058  H HA   . GLU A 1 17 ? 3.654   -6.384  -2.765  1.00 0.00 ? 17 GLU A HA   11 
ATOM   8059  H HB2  . GLU A 1 17 ? 5.504   -5.355  -0.626  1.00 0.00 ? 17 GLU A HB2  11 
ATOM   8060  H HB3  . GLU A 1 17 ? 5.029   -7.053  -0.639  1.00 0.00 ? 17 GLU A HB3  11 
ATOM   8061  H HG2  . GLU A 1 17 ? 5.705   -6.958  -3.166  1.00 0.00 ? 17 GLU A HG2  11 
ATOM   8062  H HG3  . GLU A 1 17 ? 6.608   -5.520  -2.688  1.00 0.00 ? 17 GLU A HG3  11 
ATOM   8063  N N    . ASN A 1 18 ? 2.308   -5.027  -0.160  1.00 0.00 ? 18 ASN A N    11 
ATOM   8064  C CA   . ASN A 1 18 ? 1.210   -5.188  0.830   1.00 0.00 ? 18 ASN A CA   11 
ATOM   8065  C C    . ASN A 1 18 ? -0.132  -5.241  0.095   1.00 0.00 ? 18 ASN A C    11 
ATOM   8066  O O    . ASN A 1 18 ? -1.177  -5.373  0.700   1.00 0.00 ? 18 ASN A O    11 
ATOM   8067  C CB   . ASN A 1 18 ? 1.223   -4.000  1.791   1.00 0.00 ? 18 ASN A CB   11 
ATOM   8068  C CG   . ASN A 1 18 ? 1.940   -4.397  3.083   1.00 0.00 ? 18 ASN A CG   11 
ATOM   8069  O OD1  . ASN A 1 18 ? 1.313   -4.810  4.037   1.00 0.00 ? 18 ASN A OD1  11 
ATOM   8070  N ND2  . ASN A 1 18 ? 3.240   -4.289  3.153   1.00 0.00 ? 18 ASN A ND2  11 
ATOM   8071  H H    . ASN A 1 18 ? 2.739   -4.156  -0.272  1.00 0.00 ? 18 ASN A H    11 
ATOM   8072  H HA   . ASN A 1 18 ? 1.356   -6.104  1.385   1.00 0.00 ? 18 ASN A HA   11 
ATOM   8073  H HB2  . ASN A 1 18 ? 1.740   -3.171  1.330   1.00 0.00 ? 18 ASN A HB2  11 
ATOM   8074  H HB3  . ASN A 1 18 ? 0.210   -3.711  2.018   1.00 0.00 ? 18 ASN A HB3  11 
ATOM   8075  H HD21 . ASN A 1 18 ? 3.746   -3.957  2.383   1.00 0.00 ? 18 ASN A HD21 11 
ATOM   8076  H HD22 . ASN A 1 18 ? 3.708   -4.540  3.976   1.00 0.00 ? 18 ASN A HD22 11 
ATOM   8077  N N    . TYR A 1 19 ? -0.109  -5.141  -1.208  1.00 0.00 ? 19 TYR A N    11 
ATOM   8078  C CA   . TYR A 1 19 ? -1.372  -5.188  -1.987  1.00 0.00 ? 19 TYR A CA   11 
ATOM   8079  C C    . TYR A 1 19 ? -1.341  -6.414  -2.897  1.00 0.00 ? 19 TYR A C    11 
ATOM   8080  O O    . TYR A 1 19 ? -1.905  -6.421  -3.973  1.00 0.00 ? 19 TYR A O    11 
ATOM   8081  C CB   . TYR A 1 19 ? -1.489  -3.919  -2.831  1.00 0.00 ? 19 TYR A CB   11 
ATOM   8082  C CG   . TYR A 1 19 ? -1.452  -2.711  -1.926  1.00 0.00 ? 19 TYR A CG   11 
ATOM   8083  C CD1  . TYR A 1 19 ? -2.621  -2.279  -1.285  1.00 0.00 ? 19 TYR A CD1  11 
ATOM   8084  C CD2  . TYR A 1 19 ? -0.248  -2.022  -1.725  1.00 0.00 ? 19 TYR A CD2  11 
ATOM   8085  C CE1  . TYR A 1 19 ? -2.585  -1.159  -0.443  1.00 0.00 ? 19 TYR A CE1  11 
ATOM   8086  C CE2  . TYR A 1 19 ? -0.212  -0.902  -0.883  1.00 0.00 ? 19 TYR A CE2  11 
ATOM   8087  C CZ   . TYR A 1 19 ? -1.381  -0.471  -0.242  1.00 0.00 ? 19 TYR A CZ   11 
ATOM   8088  O OH   . TYR A 1 19 ? -1.346  0.631   0.588   1.00 0.00 ? 19 TYR A OH   11 
ATOM   8089  H H    . TYR A 1 19 ? 0.742   -5.037  -1.677  1.00 0.00 ? 19 TYR A H    11 
ATOM   8090  H HA   . TYR A 1 19 ? -2.213  -5.255  -1.315  1.00 0.00 ? 19 TYR A HA   11 
ATOM   8091  H HB2  . TYR A 1 19 ? -0.666  -3.872  -3.529  1.00 0.00 ? 19 TYR A HB2  11 
ATOM   8092  H HB3  . TYR A 1 19 ? -2.420  -3.932  -3.374  1.00 0.00 ? 19 TYR A HB3  11 
ATOM   8093  H HD1  . TYR A 1 19 ? -3.549  -2.808  -1.440  1.00 0.00 ? 19 TYR A HD1  11 
ATOM   8094  H HD2  . TYR A 1 19 ? 0.652   -2.355  -2.219  1.00 0.00 ? 19 TYR A HD2  11 
ATOM   8095  H HE1  . TYR A 1 19 ? -3.486  -0.826  0.052   1.00 0.00 ? 19 TYR A HE1  11 
ATOM   8096  H HE2  . TYR A 1 19 ? 0.717   -0.373  -0.728  1.00 0.00 ? 19 TYR A HE2  11 
ATOM   8097  H HH   . TYR A 1 19 ? -2.054  0.542   1.229   1.00 0.00 ? 19 TYR A HH   11 
ATOM   8098  N N    . CYS A 1 20 ? -0.676  -7.451  -2.466  1.00 0.00 ? 20 CYS A N    11 
ATOM   8099  C CA   . CYS A 1 20 ? -0.591  -8.683  -3.295  1.00 0.00 ? 20 CYS A CA   11 
ATOM   8100  C C    . CYS A 1 20 ? -1.832  -9.550  -3.054  1.00 0.00 ? 20 CYS A C    11 
ATOM   8101  O O    . CYS A 1 20 ? -2.885  -9.305  -3.607  1.00 0.00 ? 20 CYS A O    11 
ATOM   8102  C CB   . CYS A 1 20 ? 0.673   -9.456  -2.913  1.00 0.00 ? 20 CYS A CB   11 
ATOM   8103  S SG   . CYS A 1 20 ? 2.129   -8.592  -3.552  1.00 0.00 ? 20 CYS A SG   11 
ATOM   8104  H H    . CYS A 1 20 ? -0.227  -7.416  -1.596  1.00 0.00 ? 20 CYS A H    11 
ATOM   8105  H HA   . CYS A 1 20 ? -0.544  -8.412  -4.337  1.00 0.00 ? 20 CYS A HA   11 
ATOM   8106  H HB2  . CYS A 1 20 ? 0.741   -9.528  -1.838  1.00 0.00 ? 20 CYS A HB2  11 
ATOM   8107  H HB3  . CYS A 1 20 ? 0.629   -10.446 -3.335  1.00 0.00 ? 20 CYS A HB3  11 
ATOM   8108  N N    . ASN A 1 21 ? -1.719  -10.558 -2.234  1.00 0.00 ? 21 ASN A N    11 
ATOM   8109  C CA   . ASN A 1 21 ? -2.894  -11.434 -1.964  1.00 0.00 ? 21 ASN A CA   11 
ATOM   8110  C C    . ASN A 1 21 ? -2.635  -12.257 -0.699  1.00 0.00 ? 21 ASN A C    11 
ATOM   8111  O O    . ASN A 1 21 ? -1.767  -11.871 0.066   1.00 0.00 ? 21 ASN A O    11 
ATOM   8112  C CB   . ASN A 1 21 ? -3.113  -12.376 -3.149  1.00 0.00 ? 21 ASN A CB   11 
ATOM   8113  C CG   . ASN A 1 21 ? -4.235  -11.831 -4.034  1.00 0.00 ? 21 ASN A CG   11 
ATOM   8114  O OD1  . ASN A 1 21 ? -5.188  -11.258 -3.542  1.00 0.00 ? 21 ASN A OD1  11 
ATOM   8115  N ND2  . ASN A 1 21 ? -4.163  -11.985 -5.327  1.00 0.00 ? 21 ASN A ND2  11 
ATOM   8116  O OXT  . ASN A 1 21 ? -3.308  -13.259 -0.520  1.00 0.00 ? 21 ASN A OXT  11 
ATOM   8117  H H    . ASN A 1 21 ? -0.863  -10.742 -1.796  1.00 0.00 ? 21 ASN A H    11 
ATOM   8118  H HA   . ASN A 1 21 ? -3.773  -10.823 -1.821  1.00 0.00 ? 21 ASN A HA   11 
ATOM   8119  H HB2  . ASN A 1 21 ? -2.202  -12.448 -3.725  1.00 0.00 ? 21 ASN A HB2  11 
ATOM   8120  H HB3  . ASN A 1 21 ? -3.387  -13.355 -2.785  1.00 0.00 ? 21 ASN A HB3  11 
ATOM   8121  H HD21 . ASN A 1 21 ? -3.395  -12.447 -5.724  1.00 0.00 ? 21 ASN A HD21 11 
ATOM   8122  H HD22 . ASN A 1 21 ? -4.878  -11.638 -5.903  1.00 0.00 ? 21 ASN A HD22 11 
ATOM   8123  N N    . PHE B 2 1  ? 10.535  3.048   -8.110  1.00 0.00 ? 1  PHE B N    11 
ATOM   8124  C CA   . PHE B 2 1  ? 11.634  2.482   -7.279  1.00 0.00 ? 1  PHE B CA   11 
ATOM   8125  C C    . PHE B 2 1  ? 12.084  3.524   -6.252  1.00 0.00 ? 1  PHE B C    11 
ATOM   8126  O O    . PHE B 2 1  ? 12.036  3.294   -5.059  1.00 0.00 ? 1  PHE B O    11 
ATOM   8127  C CB   . PHE B 2 1  ? 12.815  2.109   -8.177  1.00 0.00 ? 1  PHE B CB   11 
ATOM   8128  C CG   . PHE B 2 1  ? 13.220  0.673   -7.914  1.00 0.00 ? 1  PHE B CG   11 
ATOM   8129  C CD1  . PHE B 2 1  ? 13.335  0.203   -6.596  1.00 0.00 ? 1  PHE B CD1  11 
ATOM   8130  C CD2  . PHE B 2 1  ? 13.481  -0.193  -8.987  1.00 0.00 ? 1  PHE B CD2  11 
ATOM   8131  C CE1  . PHE B 2 1  ? 13.710  -1.126  -6.354  1.00 0.00 ? 1  PHE B CE1  11 
ATOM   8132  C CE2  . PHE B 2 1  ? 13.855  -1.521  -8.743  1.00 0.00 ? 1  PHE B CE2  11 
ATOM   8133  C CZ   . PHE B 2 1  ? 13.970  -1.987  -7.428  1.00 0.00 ? 1  PHE B CZ   11 
ATOM   8134  H H1   . PHE B 2 1  ? 10.629  2.709   -9.088  1.00 0.00 ? 1  PHE B H1   11 
ATOM   8135  H H2   . PHE B 2 1  ? 10.590  4.087   -8.097  1.00 0.00 ? 1  PHE B H2   11 
ATOM   8136  H H3   . PHE B 2 1  ? 9.617   2.744   -7.727  1.00 0.00 ? 1  PHE B H3   11 
ATOM   8137  H HA   . PHE B 2 1  ? 11.280  1.600   -6.765  1.00 0.00 ? 1  PHE B HA   11 
ATOM   8138  H HB2  . PHE B 2 1  ? 12.527  2.220   -9.213  1.00 0.00 ? 1  PHE B HB2  11 
ATOM   8139  H HB3  . PHE B 2 1  ? 13.648  2.763   -7.965  1.00 0.00 ? 1  PHE B HB3  11 
ATOM   8140  H HD1  . PHE B 2 1  ? 13.136  0.863   -5.766  1.00 0.00 ? 1  PHE B HD1  11 
ATOM   8141  H HD2  . PHE B 2 1  ? 13.393  0.163   -10.002 1.00 0.00 ? 1  PHE B HD2  11 
ATOM   8142  H HE1  . PHE B 2 1  ? 13.799  -1.486  -5.340  1.00 0.00 ? 1  PHE B HE1  11 
ATOM   8143  H HE2  . PHE B 2 1  ? 14.056  -2.186  -9.571  1.00 0.00 ? 1  PHE B HE2  11 
ATOM   8144  H HZ   . PHE B 2 1  ? 14.259  -3.011  -7.240  1.00 0.00 ? 1  PHE B HZ   11 
ATOM   8145  N N    . VAL B 2 2  ? 12.524  4.666   -6.703  1.00 0.00 ? 2  VAL B N    11 
ATOM   8146  C CA   . VAL B 2 2  ? 12.980  5.717   -5.747  1.00 0.00 ? 2  VAL B CA   11 
ATOM   8147  C C    . VAL B 2 2  ? 12.191  7.010   -5.970  1.00 0.00 ? 2  VAL B C    11 
ATOM   8148  O O    . VAL B 2 2  ? 11.876  7.723   -5.038  1.00 0.00 ? 2  VAL B O    11 
ATOM   8149  C CB   . VAL B 2 2  ? 14.473  5.984   -5.955  1.00 0.00 ? 2  VAL B CB   11 
ATOM   8150  C CG1  . VAL B 2 2  ? 14.942  7.052   -4.966  1.00 0.00 ? 2  VAL B CG1  11 
ATOM   8151  C CG2  . VAL B 2 2  ? 15.257  4.691   -5.715  1.00 0.00 ? 2  VAL B CG2  11 
ATOM   8152  H H    . VAL B 2 2  ? 12.559  4.832   -7.668  1.00 0.00 ? 2  VAL B H    11 
ATOM   8153  H HA   . VAL B 2 2  ? 12.815  5.374   -4.742  1.00 0.00 ? 2  VAL B HA   11 
ATOM   8154  H HB   . VAL B 2 2  ? 14.641  6.328   -6.964  1.00 0.00 ? 2  VAL B HB   11 
ATOM   8155  H HG11 . VAL B 2 2  ? 15.253  6.580   -4.046  1.00 0.00 ? 2  VAL B HG11 11 
ATOM   8156  H HG12 . VAL B 2 2  ? 14.131  7.737   -4.764  1.00 0.00 ? 2  VAL B HG12 11 
ATOM   8157  H HG13 . VAL B 2 2  ? 15.773  7.595   -5.391  1.00 0.00 ? 2  VAL B HG13 11 
ATOM   8158  H HG21 . VAL B 2 2  ? 15.318  4.498   -4.653  1.00 0.00 ? 2  VAL B HG21 11 
ATOM   8159  H HG22 . VAL B 2 2  ? 16.254  4.796   -6.118  1.00 0.00 ? 2  VAL B HG22 11 
ATOM   8160  H HG23 . VAL B 2 2  ? 14.757  3.869   -6.203  1.00 0.00 ? 2  VAL B HG23 11 
ATOM   8161  N N    . ASN B 2 3  ? 11.870  7.316   -7.193  1.00 0.00 ? 3  ASN B N    11 
ATOM   8162  C CA   . ASN B 2 3  ? 11.103  8.560   -7.478  1.00 0.00 ? 3  ASN B CA   11 
ATOM   8163  C C    . ASN B 2 3  ? 10.275  8.365   -8.748  1.00 0.00 ? 3  ASN B C    11 
ATOM   8164  O O    . ASN B 2 3  ? 10.199  9.238   -9.591  1.00 0.00 ? 3  ASN B O    11 
ATOM   8165  C CB   . ASN B 2 3  ? 12.072  9.728   -7.674  1.00 0.00 ? 3  ASN B CB   11 
ATOM   8166  C CG   . ASN B 2 3  ? 12.136  10.560  -6.391  1.00 0.00 ? 3  ASN B CG   11 
ATOM   8167  O OD1  . ASN B 2 3  ? 12.106  10.023  -5.302  1.00 0.00 ? 3  ASN B OD1  11 
ATOM   8168  N ND2  . ASN B 2 3  ? 12.225  11.859  -6.475  1.00 0.00 ? 3  ASN B ND2  11 
ATOM   8169  H H    . ASN B 2 3  ? 12.131  6.727   -7.924  1.00 0.00 ? 3  ASN B H    11 
ATOM   8170  H HA   . ASN B 2 3  ? 10.445  8.774   -6.649  1.00 0.00 ? 3  ASN B HA   11 
ATOM   8171  H HB2  . ASN B 2 3  ? 13.056  9.344   -7.904  1.00 0.00 ? 3  ASN B HB2  11 
ATOM   8172  H HB3  . ASN B 2 3  ? 11.728  10.349  -8.486  1.00 0.00 ? 3  ASN B HB3  11 
ATOM   8173  H HD21 . ASN B 2 3  ? 12.249  12.293  -7.353  1.00 0.00 ? 3  ASN B HD21 11 
ATOM   8174  H HD22 . ASN B 2 3  ? 12.265  12.401  -5.659  1.00 0.00 ? 3  ASN B HD22 11 
ATOM   8175  N N    . GLN B 2 4  ? 9.649   7.229   -8.892  1.00 0.00 ? 4  GLN B N    11 
ATOM   8176  C CA   . GLN B 2 4  ? 8.822   6.981   -10.103 1.00 0.00 ? 4  GLN B CA   11 
ATOM   8177  C C    . GLN B 2 4  ? 7.361   7.320   -9.801  1.00 0.00 ? 4  GLN B C    11 
ATOM   8178  O O    . GLN B 2 4  ? 6.938   7.330   -8.664  1.00 0.00 ? 4  GLN B O    11 
ATOM   8179  C CB   . GLN B 2 4  ? 8.930   5.509   -10.503 1.00 0.00 ? 4  GLN B CB   11 
ATOM   8180  C CG   . GLN B 2 4  ? 9.899   5.368   -11.677 1.00 0.00 ? 4  GLN B CG   11 
ATOM   8181  C CD   . GLN B 2 4  ? 9.277   4.458   -12.737 1.00 0.00 ? 4  GLN B CD   11 
ATOM   8182  O OE1  . GLN B 2 4  ? 8.810   3.379   -12.429 1.00 0.00 ? 4  GLN B OE1  11 
ATOM   8183  N NE2  . GLN B 2 4  ? 9.249   4.849   -13.982 1.00 0.00 ? 4  GLN B NE2  11 
ATOM   8184  H H    . GLN B 2 4  ? 9.720   6.540   -8.199  1.00 0.00 ? 4  GLN B H    11 
ATOM   8185  H HA   . GLN B 2 4  ? 9.175   7.601   -10.913 1.00 0.00 ? 4  GLN B HA   11 
ATOM   8186  H HB2  . GLN B 2 4  ? 9.294   4.936   -9.663  1.00 0.00 ? 4  GLN B HB2  11 
ATOM   8187  H HB3  . GLN B 2 4  ? 7.958   5.145   -10.794 1.00 0.00 ? 4  GLN B HB3  11 
ATOM   8188  H HG2  . GLN B 2 4  ? 10.092  6.343   -12.103 1.00 0.00 ? 4  GLN B HG2  11 
ATOM   8189  H HG3  . GLN B 2 4  ? 10.825  4.935   -11.331 1.00 0.00 ? 4  GLN B HG3  11 
ATOM   8190  H HE21 . GLN B 2 4  ? 9.623   5.719   -14.231 1.00 0.00 ? 4  GLN B HE21 11 
ATOM   8191  H HE22 . GLN B 2 4  ? 8.851   4.273   -14.668 1.00 0.00 ? 4  GLN B HE22 11 
ATOM   8192  N N    . HIS B 2 5  ? 6.587   7.597   -10.812 1.00 0.00 ? 5  HIS B N    11 
ATOM   8193  C CA   . HIS B 2 5  ? 5.157   7.935   -10.581 1.00 0.00 ? 5  HIS B CA   11 
ATOM   8194  C C    . HIS B 2 5  ? 4.285   6.719   -10.898 1.00 0.00 ? 5  HIS B C    11 
ATOM   8195  O O    . HIS B 2 5  ? 4.506   6.019   -11.865 1.00 0.00 ? 5  HIS B O    11 
ATOM   8196  C CB   . HIS B 2 5  ? 4.758   9.100   -11.486 1.00 0.00 ? 5  HIS B CB   11 
ATOM   8197  C CG   . HIS B 2 5  ? 3.776   9.982   -10.767 1.00 0.00 ? 5  HIS B CG   11 
ATOM   8198  N ND1  . HIS B 2 5  ? 2.838   9.459   -9.904  1.00 0.00 ? 5  HIS B ND1  11 
ATOM   8199  C CD2  . HIS B 2 5  ? 3.595   11.338  -10.795 1.00 0.00 ? 5  HIS B CD2  11 
ATOM   8200  C CE1  . HIS B 2 5  ? 2.124   10.494  -9.438  1.00 0.00 ? 5  HIS B CE1  11 
ATOM   8201  N NE2  . HIS B 2 5  ? 2.551   11.664  -9.955  1.00 0.00 ? 5  HIS B NE2  11 
ATOM   8202  H H    . HIS B 2 5  ? 6.947   7.583   -11.724 1.00 0.00 ? 5  HIS B H    11 
ATOM   8203  H HA   . HIS B 2 5  ? 5.017   8.218   -9.548  1.00 0.00 ? 5  HIS B HA   11 
ATOM   8204  H HB2  . HIS B 2 5  ? 5.636   9.674   -11.743 1.00 0.00 ? 5  HIS B HB2  11 
ATOM   8205  H HB3  . HIS B 2 5  ? 4.305   8.716   -12.384 1.00 0.00 ? 5  HIS B HB3  11 
ATOM   8206  H HD2  . HIS B 2 5  ? 4.175   12.038  -11.377 1.00 0.00 ? 5  HIS B HD2  11 
ATOM   8207  H HE1  . HIS B 2 5  ? 1.309   10.402  -8.735  1.00 0.00 ? 5  HIS B HE1  11 
ATOM   8208  H HE2  . HIS B 2 5  ? 2.195   12.559  -9.772  1.00 0.00 ? 5  HIS B HE2  11 
ATOM   8209  N N    . LEU B 2 6  ? 3.295   6.463   -10.087 1.00 0.00 ? 6  LEU B N    11 
ATOM   8210  C CA   . LEU B 2 6  ? 2.407   5.293   -10.337 1.00 0.00 ? 6  LEU B CA   11 
ATOM   8211  C C    . LEU B 2 6  ? 0.969   5.783   -10.495 1.00 0.00 ? 6  LEU B C    11 
ATOM   8212  O O    . LEU B 2 6  ? 0.574   6.744   -9.877  1.00 0.00 ? 6  LEU B O    11 
ATOM   8213  C CB   . LEU B 2 6  ? 2.486   4.340   -9.143  1.00 0.00 ? 6  LEU B CB   11 
ATOM   8214  C CG   . LEU B 2 6  ? 3.557   3.276   -9.389  1.00 0.00 ? 6  LEU B CG   11 
ATOM   8215  C CD1  . LEU B 2 6  ? 3.298   2.585   -10.727 1.00 0.00 ? 6  LEU B CD1  11 
ATOM   8216  C CD2  . LEU B 2 6  ? 4.932   3.943   -9.414  1.00 0.00 ? 6  LEU B CD2  11 
ATOM   8217  H H    . LEU B 2 6  ? 3.134   7.041   -9.312  1.00 0.00 ? 6  LEU B H    11 
ATOM   8218  H HA   . LEU B 2 6  ? 2.720   4.784   -11.236 1.00 0.00 ? 6  LEU B HA   11 
ATOM   8219  H HB2  . LEU B 2 6  ? 2.741   4.903   -8.259  1.00 0.00 ? 6  LEU B HB2  11 
ATOM   8220  H HB3  . LEU B 2 6  ? 1.529   3.860   -9.001  1.00 0.00 ? 6  LEU B HB3  11 
ATOM   8221  H HG   . LEU B 2 6  ? 3.524   2.544   -8.595  1.00 0.00 ? 6  LEU B HG   11 
ATOM   8222  H HD11 . LEU B 2 6  ? 2.387   2.971   -11.157 1.00 0.00 ? 6  LEU B HD11 11 
ATOM   8223  H HD12 . LEU B 2 6  ? 3.199   1.521   -10.570 1.00 0.00 ? 6  LEU B HD12 11 
ATOM   8224  H HD13 . LEU B 2 6  ? 4.123   2.776   -11.397 1.00 0.00 ? 6  LEU B HD13 11 
ATOM   8225  H HD21 . LEU B 2 6  ? 5.699   3.185   -9.371  1.00 0.00 ? 6  LEU B HD21 11 
ATOM   8226  H HD22 . LEU B 2 6  ? 5.027   4.600   -8.563  1.00 0.00 ? 6  LEU B HD22 11 
ATOM   8227  H HD23 . LEU B 2 6  ? 5.037   4.514   -10.325 1.00 0.00 ? 6  LEU B HD23 11 
ATOM   8228  N N    . CYS B 2 7  ? 0.181   5.130   -11.305 1.00 0.00 ? 7  CYS B N    11 
ATOM   8229  C CA   . CYS B 2 7  ? -1.235  5.573   -11.477 1.00 0.00 ? 7  CYS B CA   11 
ATOM   8230  C C    . CYS B 2 7  ? -2.040  4.454   -12.163 1.00 0.00 ? 7  CYS B C    11 
ATOM   8231  O O    . CYS B 2 7  ? -2.361  3.455   -11.552 1.00 0.00 ? 7  CYS B O    11 
ATOM   8232  C CB   . CYS B 2 7  ? -1.273  6.858   -12.319 1.00 0.00 ? 7  CYS B CB   11 
ATOM   8233  S SG   . CYS B 2 7  ? -1.185  8.313   -11.245 1.00 0.00 ? 7  CYS B SG   11 
ATOM   8234  H H    . CYS B 2 7  ? 0.514   4.348   -11.793 1.00 0.00 ? 7  CYS B H    11 
ATOM   8235  H HA   . CYS B 2 7  ? -1.662  5.768   -10.503 1.00 0.00 ? 7  CYS B HA   11 
ATOM   8236  H HB2  . CYS B 2 7  ? -0.431  6.872   -12.989 1.00 0.00 ? 7  CYS B HB2  11 
ATOM   8237  H HB3  . CYS B 2 7  ? -2.189  6.892   -12.888 1.00 0.00 ? 7  CYS B HB3  11 
ATOM   8238  N N    . GLY B 2 8  ? -2.374  4.600   -13.422 1.00 0.00 ? 8  GLY B N    11 
ATOM   8239  C CA   . GLY B 2 8  ? -3.156  3.533   -14.107 1.00 0.00 ? 8  GLY B CA   11 
ATOM   8240  C C    . GLY B 2 8  ? -2.239  2.357   -14.441 1.00 0.00 ? 8  GLY B C    11 
ATOM   8241  O O    . GLY B 2 8  ? -1.641  1.759   -13.571 1.00 0.00 ? 8  GLY B O    11 
ATOM   8242  H H    . GLY B 2 8  ? -2.114  5.402   -13.915 1.00 0.00 ? 8  GLY B H    11 
ATOM   8243  H HA2  . GLY B 2 8  ? -3.951  3.198   -13.457 1.00 0.00 ? 8  GLY B HA2  11 
ATOM   8244  H HA3  . GLY B 2 8  ? -3.579  3.927   -15.018 1.00 0.00 ? 8  GLY B HA3  11 
ATOM   8245  N N    . SER B 2 9  ? -2.129  2.019   -15.697 1.00 0.00 ? 9  SER B N    11 
ATOM   8246  C CA   . SER B 2 9  ? -1.254  0.879   -16.089 1.00 0.00 ? 9  SER B CA   11 
ATOM   8247  C C    . SER B 2 9  ? 0.062   0.959   -15.316 1.00 0.00 ? 9  SER B C    11 
ATOM   8248  O O    . SER B 2 9  ? 0.691   -0.041  -15.040 1.00 0.00 ? 9  SER B O    11 
ATOM   8249  C CB   . SER B 2 9  ? -0.969  0.942   -17.590 1.00 0.00 ? 9  SER B CB   11 
ATOM   8250  O OG   . SER B 2 9  ? -1.900  0.119   -18.279 1.00 0.00 ? 9  SER B OG   11 
ATOM   8251  H H    . SER B 2 9  ? -2.623  2.515   -16.383 1.00 0.00 ? 9  SER B H    11 
ATOM   8252  H HA   . SER B 2 9  ? -1.750  -0.052  -15.855 1.00 0.00 ? 9  SER B HA   11 
ATOM   8253  H HB2  . SER B 2 9  ? -1.070  1.957   -17.935 1.00 0.00 ? 9  SER B HB2  11 
ATOM   8254  H HB3  . SER B 2 9  ? 0.040   0.599   -17.779 1.00 0.00 ? 9  SER B HB3  11 
ATOM   8255  H HG   . SER B 2 9  ? -2.068  -0.656  -17.739 1.00 0.00 ? 9  SER B HG   11 
ATOM   8256  N N    . ASP B 2 10 ? 0.482   2.141   -14.958 1.00 0.00 ? 10 ASP B N    11 
ATOM   8257  C CA   . ASP B 2 10 ? 1.755   2.274   -14.198 1.00 0.00 ? 10 ASP B CA   11 
ATOM   8258  C C    . ASP B 2 10 ? 1.605   1.596   -12.836 1.00 0.00 ? 10 ASP B C    11 
ATOM   8259  O O    . ASP B 2 10 ? 2.409   0.771   -12.454 1.00 0.00 ? 10 ASP B O    11 
ATOM   8260  C CB   . ASP B 2 10 ? 2.085   3.754   -13.995 1.00 0.00 ? 10 ASP B CB   11 
ATOM   8261  C CG   . ASP B 2 10 ? 2.781   4.298   -15.244 1.00 0.00 ? 10 ASP B CG   11 
ATOM   8262  O OD1  . ASP B 2 10 ? 3.590   3.580   -15.809 1.00 0.00 ? 10 ASP B OD1  11 
ATOM   8263  O OD2  . ASP B 2 10 ? 2.493   5.423   -15.615 1.00 0.00 ? 10 ASP B OD2  11 
ATOM   8264  H H    . ASP B 2 10 ? -0.040  2.939   -15.185 1.00 0.00 ? 10 ASP B H    11 
ATOM   8265  H HA   . ASP B 2 10 ? 2.554   1.800   -14.750 1.00 0.00 ? 10 ASP B HA   11 
ATOM   8266  H HB2  . ASP B 2 10 ? 1.174   4.306   -13.820 1.00 0.00 ? 10 ASP B HB2  11 
ATOM   8267  H HB3  . ASP B 2 10 ? 2.742   3.862   -13.145 1.00 0.00 ? 10 ASP B HB3  11 
ATOM   8268  N N    . LEU B 2 11 ? 0.586   1.941   -12.092 1.00 0.00 ? 11 LEU B N    11 
ATOM   8269  C CA   . LEU B 2 11 ? 0.407   1.312   -10.753 1.00 0.00 ? 11 LEU B CA   11 
ATOM   8270  C C    . LEU B 2 11 ? -0.037  -0.143  -10.935 1.00 0.00 ? 11 LEU B C    11 
ATOM   8271  O O    . LEU B 2 11 ? 0.255   -0.997  -10.122 1.00 0.00 ? 11 LEU B O    11 
ATOM   8272  C CB   . LEU B 2 11 ? -0.662  2.084   -9.957  1.00 0.00 ? 11 LEU B CB   11 
ATOM   8273  C CG   . LEU B 2 11 ? -0.333  2.165   -8.447  1.00 0.00 ? 11 LEU B CG   11 
ATOM   8274  C CD1  . LEU B 2 11 ? -1.572  1.777   -7.641  1.00 0.00 ? 11 LEU B CD1  11 
ATOM   8275  C CD2  . LEU B 2 11 ? 0.811   1.221   -8.057  1.00 0.00 ? 11 LEU B CD2  11 
ATOM   8276  H H    . LEU B 2 11 ? -0.052  2.613   -12.411 1.00 0.00 ? 11 LEU B H    11 
ATOM   8277  H HA   . LEU B 2 11 ? 1.346   1.338   -10.228 1.00 0.00 ? 11 LEU B HA   11 
ATOM   8278  H HB2  . LEU B 2 11 ? -0.728  3.085   -10.349 1.00 0.00 ? 11 LEU B HB2  11 
ATOM   8279  H HB3  . LEU B 2 11 ? -1.617  1.595   -10.082 1.00 0.00 ? 11 LEU B HB3  11 
ATOM   8280  H HG   . LEU B 2 11 ? -0.058  3.182   -8.200  1.00 0.00 ? 11 LEU B HG   11 
ATOM   8281  H HD11 . LEU B 2 11 ? -2.459  2.092   -8.170  1.00 0.00 ? 11 LEU B HD11 11 
ATOM   8282  H HD12 . LEU B 2 11 ? -1.538  2.257   -6.675  1.00 0.00 ? 11 LEU B HD12 11 
ATOM   8283  H HD13 . LEU B 2 11 ? -1.594  0.705   -7.510  1.00 0.00 ? 11 LEU B HD13 11 
ATOM   8284  H HD21 . LEU B 2 11 ? 0.862   1.143   -6.982  1.00 0.00 ? 11 LEU B HD21 11 
ATOM   8285  H HD22 . LEU B 2 11 ? 1.744   1.614   -8.435  1.00 0.00 ? 11 LEU B HD22 11 
ATOM   8286  H HD23 . LEU B 2 11 ? 0.632   0.245   -8.483  1.00 0.00 ? 11 LEU B HD23 11 
ATOM   8287  N N    . VAL B 2 12 ? -0.735  -0.434  -11.999 1.00 0.00 ? 12 VAL B N    11 
ATOM   8288  C CA   . VAL B 2 12 ? -1.186  -1.835  -12.229 1.00 0.00 ? 12 VAL B CA   11 
ATOM   8289  C C    . VAL B 2 12 ? -0.006  -2.657  -12.750 1.00 0.00 ? 12 VAL B C    11 
ATOM   8290  O O    . VAL B 2 12 ? 0.347   -3.675  -12.189 1.00 0.00 ? 12 VAL B O    11 
ATOM   8291  C CB   . VAL B 2 12 ? -2.331  -1.840  -13.250 1.00 0.00 ? 12 VAL B CB   11 
ATOM   8292  C CG1  . VAL B 2 12 ? -2.460  -3.224  -13.898 1.00 0.00 ? 12 VAL B CG1  11 
ATOM   8293  C CG2  . VAL B 2 12 ? -3.643  -1.497  -12.537 1.00 0.00 ? 12 VAL B CG2  11 
ATOM   8294  H H    . VAL B 2 12 ? -0.957  0.265   -12.650 1.00 0.00 ? 12 VAL B H    11 
ATOM   8295  H HA   . VAL B 2 12 ? -1.532  -2.257  -11.296 1.00 0.00 ? 12 VAL B HA   11 
ATOM   8296  H HB   . VAL B 2 12 ? -2.133  -1.101  -14.013 1.00 0.00 ? 12 VAL B HB   11 
ATOM   8297  H HG11 . VAL B 2 12 ? -3.439  -3.326  -14.340 1.00 0.00 ? 12 VAL B HG11 11 
ATOM   8298  H HG12 . VAL B 2 12 ? -2.323  -3.987  -13.147 1.00 0.00 ? 12 VAL B HG12 11 
ATOM   8299  H HG13 . VAL B 2 12 ? -1.705  -3.334  -14.665 1.00 0.00 ? 12 VAL B HG13 11 
ATOM   8300  H HG21 . VAL B 2 12 ? -3.912  -2.306  -11.874 1.00 0.00 ? 12 VAL B HG21 11 
ATOM   8301  H HG22 . VAL B 2 12 ? -4.425  -1.356  -13.269 1.00 0.00 ? 12 VAL B HG22 11 
ATOM   8302  H HG23 . VAL B 2 12 ? -3.515  -0.590  -11.966 1.00 0.00 ? 12 VAL B HG23 11 
ATOM   8303  N N    . GLU B 2 13 ? 0.613   -2.221  -13.813 1.00 0.00 ? 13 GLU B N    11 
ATOM   8304  C CA   . GLU B 2 13 ? 1.773   -2.982  -14.350 1.00 0.00 ? 13 GLU B CA   11 
ATOM   8305  C C    . GLU B 2 13 ? 2.759   -3.235  -13.211 1.00 0.00 ? 13 GLU B C    11 
ATOM   8306  O O    . GLU B 2 13 ? 3.539   -4.166  -13.242 1.00 0.00 ? 13 GLU B O    11 
ATOM   8307  C CB   . GLU B 2 13 ? 2.456   -2.176  -15.456 1.00 0.00 ? 13 GLU B CB   11 
ATOM   8308  C CG   . GLU B 2 13 ? 1.681   -2.356  -16.762 1.00 0.00 ? 13 GLU B CG   11 
ATOM   8309  C CD   . GLU B 2 13 ? 2.621   -2.893  -17.843 1.00 0.00 ? 13 GLU B CD   11 
ATOM   8310  O OE1  . GLU B 2 13 ? 2.768   -4.102  -17.924 1.00 0.00 ? 13 GLU B OE1  11 
ATOM   8311  O OE2  . GLU B 2 13 ? 3.177   -2.088  -18.570 1.00 0.00 ? 13 GLU B OE2  11 
ATOM   8312  H H    . GLU B 2 13 ? 0.320   -1.394  -14.250 1.00 0.00 ? 13 GLU B H    11 
ATOM   8313  H HA   . GLU B 2 13 ? 1.431   -3.926  -14.749 1.00 0.00 ? 13 GLU B HA   11 
ATOM   8314  H HB2  . GLU B 2 13 ? 2.471   -1.131  -15.184 1.00 0.00 ? 13 GLU B HB2  11 
ATOM   8315  H HB3  . GLU B 2 13 ? 3.468   -2.529  -15.587 1.00 0.00 ? 13 GLU B HB3  11 
ATOM   8316  H HG2  . GLU B 2 13 ? 0.872   -3.056  -16.607 1.00 0.00 ? 13 GLU B HG2  11 
ATOM   8317  H HG3  . GLU B 2 13 ? 1.279   -1.406  -17.076 1.00 0.00 ? 13 GLU B HG3  11 
ATOM   8318  N N    . ALA B 2 14 ? 2.716   -2.414  -12.197 1.00 0.00 ? 14 ALA B N    11 
ATOM   8319  C CA   . ALA B 2 14 ? 3.634   -2.604  -11.041 1.00 0.00 ? 14 ALA B CA   11 
ATOM   8320  C C    . ALA B 2 14 ? 3.162   -3.809  -10.228 1.00 0.00 ? 14 ALA B C    11 
ATOM   8321  O O    . ALA B 2 14 ? 3.841   -4.813  -10.139 1.00 0.00 ? 14 ALA B O    11 
ATOM   8322  C CB   . ALA B 2 14 ? 3.613   -1.352  -10.162 1.00 0.00 ? 14 ALA B CB   11 
ATOM   8323  H H    . ALA B 2 14 ? 2.071   -1.678  -12.192 1.00 0.00 ? 14 ALA B H    11 
ATOM   8324  H HA   . ALA B 2 14 ? 4.639   -2.779  -11.400 1.00 0.00 ? 14 ALA B HA   11 
ATOM   8325  H HB1  . ALA B 2 14 ? 3.935   -1.608  -9.163  1.00 0.00 ? 14 ALA B HB1  11 
ATOM   8326  H HB2  . ALA B 2 14 ? 2.609   -0.955  -10.126 1.00 0.00 ? 14 ALA B HB2  11 
ATOM   8327  H HB3  . ALA B 2 14 ? 4.279   -0.609  -10.576 1.00 0.00 ? 14 ALA B HB3  11 
ATOM   8328  N N    . LEU B 2 15 ? 1.996   -3.726  -9.644  1.00 0.00 ? 15 LEU B N    11 
ATOM   8329  C CA   . LEU B 2 15 ? 1.482   -4.876  -8.852  1.00 0.00 ? 15 LEU B CA   11 
ATOM   8330  C C    . LEU B 2 15 ? 1.676   -6.159  -9.663  1.00 0.00 ? 15 LEU B C    11 
ATOM   8331  O O    . LEU B 2 15 ? 2.151   -7.160  -9.164  1.00 0.00 ? 15 LEU B O    11 
ATOM   8332  C CB   . LEU B 2 15 ? -0.006  -4.672  -8.569  1.00 0.00 ? 15 LEU B CB   11 
ATOM   8333  C CG   . LEU B 2 15 ? -0.186  -3.526  -7.572  1.00 0.00 ? 15 LEU B CG   11 
ATOM   8334  C CD1  . LEU B 2 15 ? -1.516  -2.819  -7.840  1.00 0.00 ? 15 LEU B CD1  11 
ATOM   8335  C CD2  . LEU B 2 15 ? -0.185  -4.086  -6.148  1.00 0.00 ? 15 LEU B CD2  11 
ATOM   8336  H H    . LEU B 2 15 ? 1.456   -2.913  -9.734  1.00 0.00 ? 15 LEU B H    11 
ATOM   8337  H HA   . LEU B 2 15 ? 2.024   -4.948  -7.922  1.00 0.00 ? 15 LEU B HA   11 
ATOM   8338  H HB2  . LEU B 2 15 ? -0.517  -4.432  -9.489  1.00 0.00 ? 15 LEU B HB2  11 
ATOM   8339  H HB3  . LEU B 2 15 ? -0.421  -5.577  -8.152  1.00 0.00 ? 15 LEU B HB3  11 
ATOM   8340  H HG   . LEU B 2 15 ? 0.625   -2.820  -7.684  1.00 0.00 ? 15 LEU B HG   11 
ATOM   8341  H HD11 . LEU B 2 15 ? -1.433  -1.778  -7.564  1.00 0.00 ? 15 LEU B HD11 11 
ATOM   8342  H HD12 . LEU B 2 15 ? -2.296  -3.285  -7.255  1.00 0.00 ? 15 LEU B HD12 11 
ATOM   8343  H HD13 . LEU B 2 15 ? -1.759  -2.896  -8.889  1.00 0.00 ? 15 LEU B HD13 11 
ATOM   8344  H HD21 . LEU B 2 15 ? -0.981  -3.626  -5.580  1.00 0.00 ? 15 LEU B HD21 11 
ATOM   8345  H HD22 . LEU B 2 15 ? 0.763   -3.873  -5.678  1.00 0.00 ? 15 LEU B HD22 11 
ATOM   8346  H HD23 . LEU B 2 15 ? -0.339  -5.154  -6.182  1.00 0.00 ? 15 LEU B HD23 11 
ATOM   8347  N N    . TYR B 2 16 ? 1.312   -6.127  -10.915 1.00 0.00 ? 16 TYR B N    11 
ATOM   8348  C CA   . TYR B 2 16 ? 1.471   -7.332  -11.777 1.00 0.00 ? 16 TYR B CA   11 
ATOM   8349  C C    . TYR B 2 16 ? 2.897   -7.875  -11.642 1.00 0.00 ? 16 TYR B C    11 
ATOM   8350  O O    . TYR B 2 16 ? 3.105   -9.057  -11.451 1.00 0.00 ? 16 TYR B O    11 
ATOM   8351  C CB   . TYR B 2 16 ? 1.216   -6.945  -13.235 1.00 0.00 ? 16 TYR B CB   11 
ATOM   8352  C CG   . TYR B 2 16 ? 0.179   -7.871  -13.835 1.00 0.00 ? 16 TYR B CG   11 
ATOM   8353  C CD1  . TYR B 2 16 ? 0.211   -9.243  -13.546 1.00 0.00 ? 16 TYR B CD1  11 
ATOM   8354  C CD2  . TYR B 2 16 ? -0.814  -7.361  -14.685 1.00 0.00 ? 16 TYR B CD2  11 
ATOM   8355  C CE1  . TYR B 2 16 ? -0.746  -10.101 -14.103 1.00 0.00 ? 16 TYR B CE1  11 
ATOM   8356  C CE2  . TYR B 2 16 ? -1.770  -8.220  -15.244 1.00 0.00 ? 16 TYR B CE2  11 
ATOM   8357  C CZ   . TYR B 2 16 ? -1.735  -9.589  -14.953 1.00 0.00 ? 16 TYR B CZ   11 
ATOM   8358  O OH   . TYR B 2 16 ? -2.676  -10.435 -15.504 1.00 0.00 ? 16 TYR B OH   11 
ATOM   8359  H H    . TYR B 2 16 ? 0.934   -5.305  -11.291 1.00 0.00 ? 16 TYR B H    11 
ATOM   8360  H HA   . TYR B 2 16 ? 0.764   -8.090  -11.476 1.00 0.00 ? 16 TYR B HA   11 
ATOM   8361  H HB2  . TYR B 2 16 ? 0.861   -5.924  -13.279 1.00 0.00 ? 16 TYR B HB2  11 
ATOM   8362  H HB3  . TYR B 2 16 ? 2.138   -7.026  -13.794 1.00 0.00 ? 16 TYR B HB3  11 
ATOM   8363  H HD1  . TYR B 2 16 ? 0.971   -9.639  -12.891 1.00 0.00 ? 16 TYR B HD1  11 
ATOM   8364  H HD2  . TYR B 2 16 ? -0.845  -6.306  -14.910 1.00 0.00 ? 16 TYR B HD2  11 
ATOM   8365  H HE1  . TYR B 2 16 ? -0.720  -11.157 -13.880 1.00 0.00 ? 16 TYR B HE1  11 
ATOM   8366  H HE2  . TYR B 2 16 ? -2.534  -7.827  -15.899 1.00 0.00 ? 16 TYR B HE2  11 
ATOM   8367  H HH   . TYR B 2 16 ? -3.500  -10.312 -15.028 1.00 0.00 ? 16 TYR B HH   11 
ATOM   8368  N N    . LEU B 2 17 ? 3.880   -7.023  -11.748 1.00 0.00 ? 17 LEU B N    11 
ATOM   8369  C CA   . LEU B 2 17 ? 5.292   -7.490  -11.635 1.00 0.00 ? 17 LEU B CA   11 
ATOM   8370  C C    . LEU B 2 17 ? 5.705   -7.533  -10.164 1.00 0.00 ? 17 LEU B C    11 
ATOM   8371  O O    . LEU B 2 17 ? 6.638   -8.216  -9.790  1.00 0.00 ? 17 LEU B O    11 
ATOM   8372  C CB   . LEU B 2 17 ? 6.209   -6.528  -12.393 1.00 0.00 ? 17 LEU B CB   11 
ATOM   8373  C CG   . LEU B 2 17 ? 6.666   -7.178  -13.699 1.00 0.00 ? 17 LEU B CG   11 
ATOM   8374  C CD1  . LEU B 2 17 ? 6.245   -6.302  -14.880 1.00 0.00 ? 17 LEU B CD1  11 
ATOM   8375  C CD2  . LEU B 2 17 ? 8.189   -7.322  -13.689 1.00 0.00 ? 17 LEU B CD2  11 
ATOM   8376  H H    . LEU B 2 17 ? 3.690   -6.074  -11.907 1.00 0.00 ? 17 LEU B H    11 
ATOM   8377  H HA   . LEU B 2 17 ? 5.377   -8.477  -12.058 1.00 0.00 ? 17 LEU B HA   11 
ATOM   8378  H HB2  . LEU B 2 17 ? 5.671   -5.617  -12.612 1.00 0.00 ? 17 LEU B HB2  11 
ATOM   8379  H HB3  . LEU B 2 17 ? 7.072   -6.301  -11.785 1.00 0.00 ? 17 LEU B HB3  11 
ATOM   8380  H HG   . LEU B 2 17 ? 6.211   -8.154  -13.794 1.00 0.00 ? 17 LEU B HG   11 
ATOM   8381  H HD11 . LEU B 2 17 ? 6.172   -5.274  -14.557 1.00 0.00 ? 17 LEU B HD11 11 
ATOM   8382  H HD12 . LEU B 2 17 ? 5.285   -6.631  -15.249 1.00 0.00 ? 17 LEU B HD12 11 
ATOM   8383  H HD13 . LEU B 2 17 ? 6.980   -6.381  -15.667 1.00 0.00 ? 17 LEU B HD13 11 
ATOM   8384  H HD21 . LEU B 2 17 ? 8.531   -7.608  -14.672 1.00 0.00 ? 17 LEU B HD21 11 
ATOM   8385  H HD22 . LEU B 2 17 ? 8.476   -8.078  -12.973 1.00 0.00 ? 17 LEU B HD22 11 
ATOM   8386  H HD23 . LEU B 2 17 ? 8.639   -6.378  -13.414 1.00 0.00 ? 17 LEU B HD23 11 
ATOM   8387  N N    . VAL B 2 18 ? 5.019   -6.810  -9.326  1.00 0.00 ? 18 VAL B N    11 
ATOM   8388  C CA   . VAL B 2 18 ? 5.374   -6.810  -7.880  1.00 0.00 ? 18 VAL B CA   11 
ATOM   8389  C C    . VAL B 2 18 ? 5.118   -8.201  -7.300  1.00 0.00 ? 18 VAL B C    11 
ATOM   8390  O O    . VAL B 2 18 ? 6.019   -8.863  -6.825  1.00 0.00 ? 18 VAL B O    11 
ATOM   8391  C CB   . VAL B 2 18 ? 4.511   -5.786  -7.146  1.00 0.00 ? 18 VAL B CB   11 
ATOM   8392  C CG1  . VAL B 2 18 ? 4.742   -5.907  -5.639  1.00 0.00 ? 18 VAL B CG1  11 
ATOM   8393  C CG2  . VAL B 2 18 ? 4.891   -4.379  -7.610  1.00 0.00 ? 18 VAL B CG2  11 
ATOM   8394  H H    . VAL B 2 18 ? 4.271   -6.267  -9.648  1.00 0.00 ? 18 VAL B H    11 
ATOM   8395  H HA   . VAL B 2 18 ? 6.416   -6.556  -7.763  1.00 0.00 ? 18 VAL B HA   11 
ATOM   8396  H HB   . VAL B 2 18 ? 3.470   -5.971  -7.366  1.00 0.00 ? 18 VAL B HB   11 
ATOM   8397  H HG11 . VAL B 2 18 ? 4.231   -6.782  -5.265  1.00 0.00 ? 18 VAL B HG11 11 
ATOM   8398  H HG12 . VAL B 2 18 ? 4.357   -5.027  -5.144  1.00 0.00 ? 18 VAL B HG12 11 
ATOM   8399  H HG13 . VAL B 2 18 ? 5.800   -5.997  -5.444  1.00 0.00 ? 18 VAL B HG13 11 
ATOM   8400  H HG21 . VAL B 2 18 ? 5.670   -4.445  -8.357  1.00 0.00 ? 18 VAL B HG21 11 
ATOM   8401  H HG22 . VAL B 2 18 ? 5.248   -3.806  -6.767  1.00 0.00 ? 18 VAL B HG22 11 
ATOM   8402  H HG23 . VAL B 2 18 ? 4.025   -3.895  -8.036  1.00 0.00 ? 18 VAL B HG23 11 
ATOM   8403  N N    . CYS B 2 19 ? 3.893   -8.649  -7.340  1.00 0.00 ? 19 CYS B N    11 
ATOM   8404  C CA   . CYS B 2 19 ? 3.575   -9.999  -6.798  1.00 0.00 ? 19 CYS B CA   11 
ATOM   8405  C C    . CYS B 2 19 ? 3.676   -11.027 -7.926  1.00 0.00 ? 19 CYS B C    11 
ATOM   8406  O O    . CYS B 2 19 ? 4.520   -11.901 -7.911  1.00 0.00 ? 19 CYS B O    11 
ATOM   8407  C CB   . CYS B 2 19 ? 2.151   -10.009 -6.229  1.00 0.00 ? 19 CYS B CB   11 
ATOM   8408  S SG   . CYS B 2 19 ? 1.755   -8.386  -5.526  1.00 0.00 ? 19 CYS B SG   11 
ATOM   8409  H H    . CYS B 2 19 ? 3.184   -8.096  -7.731  1.00 0.00 ? 19 CYS B H    11 
ATOM   8410  H HA   . CYS B 2 19 ? 4.278   -10.250 -6.017  1.00 0.00 ? 19 CYS B HA   11 
ATOM   8411  H HB2  . CYS B 2 19 ? 1.451   -10.237 -7.018  1.00 0.00 ? 19 CYS B HB2  11 
ATOM   8412  H HB3  . CYS B 2 19 ? 2.078   -10.762 -5.457  1.00 0.00 ? 19 CYS B HB3  11 
ATOM   8413  N N    . GLY B 2 20 ? 2.825   -10.924 -8.911  1.00 0.00 ? 20 GLY B N    11 
ATOM   8414  C CA   . GLY B 2 20 ? 2.873   -11.889 -10.046 1.00 0.00 ? 20 GLY B CA   11 
ATOM   8415  C C    . GLY B 2 20 ? 2.466   -13.282 -9.561  1.00 0.00 ? 20 GLY B C    11 
ATOM   8416  O O    . GLY B 2 20 ? 1.490   -13.846 -10.015 1.00 0.00 ? 20 GLY B O    11 
ATOM   8417  H H    . GLY B 2 20 ? 2.156   -10.209 -8.905  1.00 0.00 ? 20 GLY B H    11 
ATOM   8418  H HA2  . GLY B 2 20 ? 2.193   -11.564 -10.820 1.00 0.00 ? 20 GLY B HA2  11 
ATOM   8419  H HA3  . GLY B 2 20 ? 3.877   -11.929 -10.441 1.00 0.00 ? 20 GLY B HA3  11 
ATOM   8420  N N    . GLU B 2 21 ? 3.208   -13.844 -8.646  1.00 0.00 ? 21 GLU B N    11 
ATOM   8421  C CA   . GLU B 2 21 ? 2.864   -15.204 -8.141  1.00 0.00 ? 21 GLU B CA   11 
ATOM   8422  C C    . GLU B 2 21 ? 1.537   -15.151 -7.378  1.00 0.00 ? 21 GLU B C    11 
ATOM   8423  O O    . GLU B 2 21 ? 0.526   -15.638 -7.842  1.00 0.00 ? 21 GLU B O    11 
ATOM   8424  C CB   . GLU B 2 21 ? 3.971   -15.698 -7.207  1.00 0.00 ? 21 GLU B CB   11 
ATOM   8425  C CG   . GLU B 2 21 ? 3.819   -17.205 -6.983  1.00 0.00 ? 21 GLU B CG   11 
ATOM   8426  C CD   . GLU B 2 21 ? 5.134   -17.781 -6.455  1.00 0.00 ? 21 GLU B CD   11 
ATOM   8427  O OE1  . GLU B 2 21 ? 6.163   -17.497 -7.047  1.00 0.00 ? 21 GLU B OE1  11 
ATOM   8428  O OE2  . GLU B 2 21 ? 5.090   -18.495 -5.468  1.00 0.00 ? 21 GLU B OE2  11 
ATOM   8429  H H    . GLU B 2 21 ? 3.994   -13.375 -8.295  1.00 0.00 ? 21 GLU B H    11 
ATOM   8430  H HA   . GLU B 2 21 ? 2.769   -15.883 -8.975  1.00 0.00 ? 21 GLU B HA   11 
ATOM   8431  H HB2  . GLU B 2 21 ? 4.935   -15.495 -7.651  1.00 0.00 ? 21 GLU B HB2  11 
ATOM   8432  H HB3  . GLU B 2 21 ? 3.898   -15.186 -6.258  1.00 0.00 ? 21 GLU B HB3  11 
ATOM   8433  H HG2  . GLU B 2 21 ? 3.032   -17.385 -6.266  1.00 0.00 ? 21 GLU B HG2  11 
ATOM   8434  H HG3  . GLU B 2 21 ? 3.570   -17.684 -7.919  1.00 0.00 ? 21 GLU B HG3  11 
ATOM   8435  N N    . ARG B 2 22 ? 1.533   -14.567 -6.211  1.00 0.00 ? 22 ARG B N    11 
ATOM   8436  C CA   . ARG B 2 22 ? 0.272   -14.487 -5.420  1.00 0.00 ? 22 ARG B CA   11 
ATOM   8437  C C    . ARG B 2 22 ? -0.803  -13.770 -6.237  1.00 0.00 ? 22 ARG B C    11 
ATOM   8438  O O    . ARG B 2 22 ? -1.964  -14.128 -6.204  1.00 0.00 ? 22 ARG B O    11 
ATOM   8439  C CB   . ARG B 2 22 ? 0.530   -13.712 -4.128  1.00 0.00 ? 22 ARG B CB   11 
ATOM   8440  C CG   . ARG B 2 22 ? 1.641   -14.399 -3.335  1.00 0.00 ? 22 ARG B CG   11 
ATOM   8441  C CD   . ARG B 2 22 ? 2.001   -13.546 -2.118  1.00 0.00 ? 22 ARG B CD   11 
ATOM   8442  N NE   . ARG B 2 22 ? 2.368   -14.434 -0.982  1.00 0.00 ? 22 ARG B NE   11 
ATOM   8443  C CZ   . ARG B 2 22 ? 2.419   -13.956 0.230   1.00 0.00 ? 22 ARG B CZ   11 
ATOM   8444  N NH1  . ARG B 2 22 ? 2.746   -12.707 0.426   1.00 0.00 ? 22 ARG B NH1  11 
ATOM   8445  N NH2  . ARG B 2 22 ? 2.142   -14.724 1.248   1.00 0.00 ? 22 ARG B NH2  11 
ATOM   8446  H H    . ARG B 2 22 ? 2.361   -14.182 -5.853  1.00 0.00 ? 22 ARG B H    11 
ATOM   8447  H HA   . ARG B 2 22 ? -0.065  -15.485 -5.179  1.00 0.00 ? 22 ARG B HA   11 
ATOM   8448  H HB2  . ARG B 2 22 ? 0.829   -12.702 -4.368  1.00 0.00 ? 22 ARG B HB2  11 
ATOM   8449  H HB3  . ARG B 2 22 ? -0.372  -13.689 -3.536  1.00 0.00 ? 22 ARG B HB3  11 
ATOM   8450  H HG2  . ARG B 2 22 ? 1.301   -15.370 -3.006  1.00 0.00 ? 22 ARG B HG2  11 
ATOM   8451  H HG3  . ARG B 2 22 ? 2.512   -14.515 -3.961  1.00 0.00 ? 22 ARG B HG3  11 
ATOM   8452  H HD2  . ARG B 2 22 ? 2.837   -12.907 -2.360  1.00 0.00 ? 22 ARG B HD2  11 
ATOM   8453  H HD3  . ARG B 2 22 ? 1.153   -12.938 -1.841  1.00 0.00 ? 22 ARG B HD3  11 
ATOM   8454  H HE   . ARG B 2 22 ? 2.571   -15.380 -1.145  1.00 0.00 ? 22 ARG B HE   11 
ATOM   8455  H HH11 . ARG B 2 22 ? 2.956   -12.118 -0.354  1.00 0.00 ? 22 ARG B HH11 11 
ATOM   8456  H HH12 . ARG B 2 22 ? 2.786   -12.340 1.355   1.00 0.00 ? 22 ARG B HH12 11 
ATOM   8457  H HH21 . ARG B 2 22 ? 1.890   -15.680 1.097   1.00 0.00 ? 22 ARG B HH21 11 
ATOM   8458  H HH22 . ARG B 2 22 ? 2.182   -14.358 2.177   1.00 0.00 ? 22 ARG B HH22 11 
ATOM   8459  N N    . GLY B 2 23 ? -0.428  -12.756 -6.968  1.00 0.00 ? 23 GLY B N    11 
ATOM   8460  C CA   . GLY B 2 23 ? -1.430  -12.013 -7.783  1.00 0.00 ? 23 GLY B CA   11 
ATOM   8461  C C    . GLY B 2 23 ? -1.591  -10.599 -7.224  1.00 0.00 ? 23 GLY B C    11 
ATOM   8462  O O    . GLY B 2 23 ? -0.650  -10.008 -6.733  1.00 0.00 ? 23 GLY B O    11 
ATOM   8463  H H    . GLY B 2 23 ? 0.512   -12.483 -6.978  1.00 0.00 ? 23 GLY B H    11 
ATOM   8464  H HA2  . GLY B 2 23 ? -1.091  -11.961 -8.809  1.00 0.00 ? 23 GLY B HA2  11 
ATOM   8465  H HA3  . GLY B 2 23 ? -2.380  -12.524 -7.743  1.00 0.00 ? 23 GLY B HA3  11 
ATOM   8466  N N    . PHE B 2 24 ? -2.780  -10.059 -7.283  1.00 0.00 ? 24 PHE B N    11 
ATOM   8467  C CA   . PHE B 2 24 ? -3.005  -8.683  -6.744  1.00 0.00 ? 24 PHE B CA   11 
ATOM   8468  C C    . PHE B 2 24 ? -4.448  -8.247  -7.027  1.00 0.00 ? 24 PHE B C    11 
ATOM   8469  O O    . PHE B 2 24 ? -5.130  -8.818  -7.855  1.00 0.00 ? 24 PHE B O    11 
ATOM   8470  C CB   . PHE B 2 24 ? -2.006  -7.692  -7.385  1.00 0.00 ? 24 PHE B CB   11 
ATOM   8471  C CG   . PHE B 2 24 ? -2.600  -7.031  -8.625  1.00 0.00 ? 24 PHE B CG   11 
ATOM   8472  C CD1  . PHE B 2 24 ? -2.635  -7.719  -9.847  1.00 0.00 ? 24 PHE B CD1  11 
ATOM   8473  C CD2  . PHE B 2 24 ? -3.117  -5.723  -8.550  1.00 0.00 ? 24 PHE B CD2  11 
ATOM   8474  C CE1  . PHE B 2 24 ? -3.180  -7.108  -10.984 1.00 0.00 ? 24 PHE B CE1  11 
ATOM   8475  C CE2  . PHE B 2 24 ? -3.661  -5.118  -9.690  1.00 0.00 ? 24 PHE B CE2  11 
ATOM   8476  C CZ   . PHE B 2 24 ? -3.693  -5.810  -10.905 1.00 0.00 ? 24 PHE B CZ   11 
ATOM   8477  H H    . PHE B 2 24 ? -3.527  -10.566 -7.672  1.00 0.00 ? 24 PHE B H    11 
ATOM   8478  H HA   . PHE B 2 24 ? -2.849  -8.697  -5.676  1.00 0.00 ? 24 PHE B HA   11 
ATOM   8479  H HB2  . PHE B 2 24 ? -1.761  -6.927  -6.663  1.00 0.00 ? 24 PHE B HB2  11 
ATOM   8480  H HB3  . PHE B 2 24 ? -1.100  -8.224  -7.656  1.00 0.00 ? 24 PHE B HB3  11 
ATOM   8481  H HD1  . PHE B 2 24 ? -2.243  -8.717  -9.915  1.00 0.00 ? 24 PHE B HD1  11 
ATOM   8482  H HD2  . PHE B 2 24 ? -3.097  -5.180  -7.616  1.00 0.00 ? 24 PHE B HD2  11 
ATOM   8483  H HE1  . PHE B 2 24 ? -3.205  -7.642  -11.923 1.00 0.00 ? 24 PHE B HE1  11 
ATOM   8484  H HE2  . PHE B 2 24 ? -4.057  -4.115  -9.630  1.00 0.00 ? 24 PHE B HE2  11 
ATOM   8485  H HZ   . PHE B 2 24 ? -4.113  -5.341  -11.782 1.00 0.00 ? 24 PHE B HZ   11 
ATOM   8486  N N    . PHE B 2 25 ? -4.911  -7.235  -6.346  1.00 0.00 ? 25 PHE B N    11 
ATOM   8487  C CA   . PHE B 2 25 ? -6.304  -6.754  -6.574  1.00 0.00 ? 25 PHE B CA   11 
ATOM   8488  C C    . PHE B 2 25 ? -6.392  -5.274  -6.199  1.00 0.00 ? 25 PHE B C    11 
ATOM   8489  O O    . PHE B 2 25 ? -6.121  -4.890  -5.078  1.00 0.00 ? 25 PHE B O    11 
ATOM   8490  C CB   . PHE B 2 25 ? -7.277  -7.559  -5.711  1.00 0.00 ? 25 PHE B CB   11 
ATOM   8491  C CG   . PHE B 2 25 ? -6.850  -7.487  -4.264  1.00 0.00 ? 25 PHE B CG   11 
ATOM   8492  C CD1  . PHE B 2 25 ? -5.774  -8.263  -3.811  1.00 0.00 ? 25 PHE B CD1  11 
ATOM   8493  C CD2  . PHE B 2 25 ? -7.531  -6.646  -3.373  1.00 0.00 ? 25 PHE B CD2  11 
ATOM   8494  C CE1  . PHE B 2 25 ? -5.379  -8.197  -2.468  1.00 0.00 ? 25 PHE B CE1  11 
ATOM   8495  C CE2  . PHE B 2 25 ? -7.135  -6.580  -2.031  1.00 0.00 ? 25 PHE B CE2  11 
ATOM   8496  C CZ   . PHE B 2 25 ? -6.059  -7.355  -1.578  1.00 0.00 ? 25 PHE B CZ   11 
ATOM   8497  H H    . PHE B 2 25 ? -4.341  -6.788  -5.686  1.00 0.00 ? 25 PHE B H    11 
ATOM   8498  H HA   . PHE B 2 25 ? -6.560  -6.876  -7.616  1.00 0.00 ? 25 PHE B HA   11 
ATOM   8499  H HB2  . PHE B 2 25 ? -8.271  -7.149  -5.813  1.00 0.00 ? 25 PHE B HB2  11 
ATOM   8500  H HB3  . PHE B 2 25 ? -7.278  -8.590  -6.033  1.00 0.00 ? 25 PHE B HB3  11 
ATOM   8501  H HD1  . PHE B 2 25 ? -5.249  -8.911  -4.498  1.00 0.00 ? 25 PHE B HD1  11 
ATOM   8502  H HD2  . PHE B 2 25 ? -8.360  -6.049  -3.722  1.00 0.00 ? 25 PHE B HD2  11 
ATOM   8503  H HE1  . PHE B 2 25 ? -4.550  -8.793  -2.120  1.00 0.00 ? 25 PHE B HE1  11 
ATOM   8504  H HE2  . PHE B 2 25 ? -7.661  -5.931  -1.345  1.00 0.00 ? 25 PHE B HE2  11 
ATOM   8505  H HZ   . PHE B 2 25 ? -5.754  -7.303  -0.544  1.00 0.00 ? 25 PHE B HZ   11 
ATOM   8506  N N    . TYR B 2 26 ? -6.765  -4.438  -7.129  1.00 0.00 ? 26 TYR B N    11 
ATOM   8507  C CA   . TYR B 2 26 ? -6.868  -2.983  -6.828  1.00 0.00 ? 26 TYR B CA   11 
ATOM   8508  C C    . TYR B 2 26 ? -7.590  -2.785  -5.494  1.00 0.00 ? 26 TYR B C    11 
ATOM   8509  O O    . TYR B 2 26 ? -8.129  -3.715  -4.925  1.00 0.00 ? 26 TYR B O    11 
ATOM   8510  C CB   . TYR B 2 26 ? -7.653  -2.285  -7.940  1.00 0.00 ? 26 TYR B CB   11 
ATOM   8511  C CG   . TYR B 2 26 ? -6.727  -1.384  -8.721  1.00 0.00 ? 26 TYR B CG   11 
ATOM   8512  C CD1  . TYR B 2 26 ? -5.393  -1.760  -8.927  1.00 0.00 ? 26 TYR B CD1  11 
ATOM   8513  C CD2  . TYR B 2 26 ? -7.203  -0.174  -9.244  1.00 0.00 ? 26 TYR B CD2  11 
ATOM   8514  C CE1  . TYR B 2 26 ? -4.534  -0.925  -9.654  1.00 0.00 ? 26 TYR B CE1  11 
ATOM   8515  C CE2  . TYR B 2 26 ? -6.344  0.661   -9.971  1.00 0.00 ? 26 TYR B CE2  11 
ATOM   8516  C CZ   . TYR B 2 26 ? -5.010  0.285   -10.177 1.00 0.00 ? 26 TYR B CZ   11 
ATOM   8517  O OH   . TYR B 2 26 ? -4.164  1.108   -10.893 1.00 0.00 ? 26 TYR B OH   11 
ATOM   8518  H H    . TYR B 2 26 ? -6.977  -4.769  -8.027  1.00 0.00 ? 26 TYR B H    11 
ATOM   8519  H HA   . TYR B 2 26 ? -5.877  -2.558  -6.766  1.00 0.00 ? 26 TYR B HA   11 
ATOM   8520  H HB2  . TYR B 2 26 ? -8.077  -3.027  -8.601  1.00 0.00 ? 26 TYR B HB2  11 
ATOM   8521  H HB3  . TYR B 2 26 ? -8.446  -1.695  -7.505  1.00 0.00 ? 26 TYR B HB3  11 
ATOM   8522  H HD1  . TYR B 2 26 ? -5.026  -2.692  -8.523  1.00 0.00 ? 26 TYR B HD1  11 
ATOM   8523  H HD2  . TYR B 2 26 ? -8.231  0.116   -9.086  1.00 0.00 ? 26 TYR B HD2  11 
ATOM   8524  H HE1  . TYR B 2 26 ? -3.505  -1.214  -9.812  1.00 0.00 ? 26 TYR B HE1  11 
ATOM   8525  H HE2  . TYR B 2 26 ? -6.710  1.593   -10.374 1.00 0.00 ? 26 TYR B HE2  11 
ATOM   8526  H HH   . TYR B 2 26 ? -4.466  2.012   -10.782 1.00 0.00 ? 26 TYR B HH   11 
ATOM   8527  N N    . THR B 2 27 ? -7.609  -1.581  -4.991  1.00 0.00 ? 27 THR B N    11 
ATOM   8528  C CA   . THR B 2 27 ? -8.299  -1.324  -3.695  1.00 0.00 ? 27 THR B CA   11 
ATOM   8529  C C    . THR B 2 27 ? -9.717  -0.818  -3.968  1.00 0.00 ? 27 THR B C    11 
ATOM   8530  O O    . THR B 2 27 ? -9.923  0.090   -4.748  1.00 0.00 ? 27 THR B O    11 
ATOM   8531  C CB   . THR B 2 27 ? -7.522  -0.269  -2.906  1.00 0.00 ? 27 THR B CB   11 
ATOM   8532  O OG1  . THR B 2 27 ? -7.019  0.714   -3.799  1.00 0.00 ? 27 THR B OG1  11 
ATOM   8533  C CG2  . THR B 2 27 ? -6.358  -0.933  -2.168  1.00 0.00 ? 27 THR B CG2  11 
ATOM   8534  H H    . THR B 2 27 ? -7.171  -0.846  -5.466  1.00 0.00 ? 27 THR B H    11 
ATOM   8535  H HA   . THR B 2 27 ? -8.346  -2.240  -3.124  1.00 0.00 ? 27 THR B HA   11 
ATOM   8536  H HB   . THR B 2 27 ? -8.178  0.199   -2.187  1.00 0.00 ? 27 THR B HB   11 
ATOM   8537  H HG1  . THR B 2 27 ? -7.691  1.391   -3.904  1.00 0.00 ? 27 THR B HG1  11 
ATOM   8538  H HG21 . THR B 2 27 ? -6.287  -1.969  -2.465  1.00 0.00 ? 27 THR B HG21 11 
ATOM   8539  H HG22 . THR B 2 27 ? -6.527  -0.875  -1.102  1.00 0.00 ? 27 THR B HG22 11 
ATOM   8540  H HG23 . THR B 2 27 ? -5.438  -0.424  -2.414  1.00 0.00 ? 27 THR B HG23 11 
ATOM   8541  N N    . LYS B 2 28 ? -10.698 -1.399  -3.331  1.00 0.00 ? 28 LYS B N    11 
ATOM   8542  C CA   . LYS B 2 28 ? -12.101 -0.950  -3.556  1.00 0.00 ? 28 LYS B CA   11 
ATOM   8543  C C    . LYS B 2 28 ? -13.064 -1.953  -2.915  1.00 0.00 ? 28 LYS B C    11 
ATOM   8544  O O    . LYS B 2 28 ? -13.760 -2.670  -3.606  1.00 0.00 ? 28 LYS B O    11 
ATOM   8545  C CB   . LYS B 2 28 ? -12.375 -0.869  -5.059  1.00 0.00 ? 28 LYS B CB   11 
ATOM   8546  C CG   . LYS B 2 28 ? -12.528 0.596   -5.473  1.00 0.00 ? 28 LYS B CG   11 
ATOM   8547  C CD   . LYS B 2 28 ? -13.908 1.102   -5.051  1.00 0.00 ? 28 LYS B CD   11 
ATOM   8548  C CE   . LYS B 2 28 ? -13.988 2.614   -5.276  1.00 0.00 ? 28 LYS B CE   11 
ATOM   8549  N NZ   . LYS B 2 28 ? -15.084 2.914   -6.241  1.00 0.00 ? 28 LYS B NZ   11 
ATOM   8550  H H    . LYS B 2 28 ? -10.510 -2.130  -2.706  1.00 0.00 ? 28 LYS B H    11 
ATOM   8551  H HA   . LYS B 2 28 ? -12.245 0.024   -3.110  1.00 0.00 ? 28 LYS B HA   11 
ATOM   8552  H HB2  . LYS B 2 28 ? -11.552 -1.314  -5.599  1.00 0.00 ? 28 LYS B HB2  11 
ATOM   8553  H HB3  . LYS B 2 28 ? -13.285 -1.403  -5.287  1.00 0.00 ? 28 LYS B HB3  11 
ATOM   8554  H HG2  . LYS B 2 28 ? -11.762 1.187   -4.993  1.00 0.00 ? 28 LYS B HG2  11 
ATOM   8555  H HG3  . LYS B 2 28 ? -12.428 0.679   -6.545  1.00 0.00 ? 28 LYS B HG3  11 
ATOM   8556  H HD2  . LYS B 2 28 ? -14.667 0.609   -5.640  1.00 0.00 ? 28 LYS B HD2  11 
ATOM   8557  H HD3  . LYS B 2 28 ? -14.065 0.887   -4.005  1.00 0.00 ? 28 LYS B HD3  11 
ATOM   8558  H HE2  . LYS B 2 28 ? -14.191 3.108   -4.337  1.00 0.00 ? 28 LYS B HE2  11 
ATOM   8559  H HE3  . LYS B 2 28 ? -13.050 2.969   -5.675  1.00 0.00 ? 28 LYS B HE3  11 
ATOM   8560  H HZ1  . LYS B 2 28 ? -15.834 3.449   -5.759  1.00 0.00 ? 28 LYS B HZ1  11 
ATOM   8561  H HZ2  . LYS B 2 28 ? -15.475 2.022   -6.609  1.00 0.00 ? 28 LYS B HZ2  11 
ATOM   8562  H HZ3  . LYS B 2 28 ? -14.708 3.479   -7.027  1.00 0.00 ? 28 LYS B HZ3  11 
ATOM   8563  N N    . PRO B 2 29 ? -13.071 -1.973  -1.607  1.00 0.00 ? 29 PRO B N    11 
ATOM   8564  C CA   . PRO B 2 29 ? -13.934 -2.881  -0.833  1.00 0.00 ? 29 PRO B CA   11 
ATOM   8565  C C    . PRO B 2 29 ? -15.368 -2.348  -0.784  1.00 0.00 ? 29 PRO B C    11 
ATOM   8566  O O    . PRO B 2 29 ? -15.599 -1.182  -0.528  1.00 0.00 ? 29 PRO B O    11 
ATOM   8567  C CB   . PRO B 2 29 ? -13.303 -2.874  0.561   1.00 0.00 ? 29 PRO B CB   11 
ATOM   8568  C CG   . PRO B 2 29 ? -12.484 -1.564  0.664   1.00 0.00 ? 29 PRO B CG   11 
ATOM   8569  C CD   . PRO B 2 29 ? -12.219 -1.095  -0.779  1.00 0.00 ? 29 PRO B CD   11 
ATOM   8570  H HA   . PRO B 2 29 ? -13.910 -3.876  -1.244  1.00 0.00 ? 29 PRO B HA   11 
ATOM   8571  H HB2  . PRO B 2 29 ? -14.077 -2.893  1.318   1.00 0.00 ? 29 PRO B HB2  11 
ATOM   8572  H HB3  . PRO B 2 29 ? -12.647 -3.724  0.676   1.00 0.00 ? 29 PRO B HB3  11 
ATOM   8573  H HG2  . PRO B 2 29 ? -13.050 -0.816  1.203   1.00 0.00 ? 29 PRO B HG2  11 
ATOM   8574  H HG3  . PRO B 2 29 ? -11.547 -1.751  1.164   1.00 0.00 ? 29 PRO B HG3  11 
ATOM   8575  H HD2  . PRO B 2 29 ? -12.509 -0.060  -0.898  1.00 0.00 ? 29 PRO B HD2  11 
ATOM   8576  H HD3  . PRO B 2 29 ? -11.180 -1.231  -1.037  1.00 0.00 ? 29 PRO B HD3  11 
ATOM   8577  N N    . THR B 2 30 ? -16.333 -3.192  -1.030  1.00 0.00 ? 30 THR B N    11 
ATOM   8578  C CA   . THR B 2 30 ? -17.749 -2.733  -0.997  1.00 0.00 ? 30 THR B CA   11 
ATOM   8579  C C    . THR B 2 30 ? -18.143 -2.398  0.443   1.00 0.00 ? 30 THR B C    11 
ATOM   8580  O O    . THR B 2 30 ? -18.090 -3.290  1.273   1.00 0.00 ? 30 THR B O    11 
ATOM   8581  C CB   . THR B 2 30 ? -18.661 -3.840  -1.531  1.00 0.00 ? 30 THR B CB   11 
ATOM   8582  O OG1  . THR B 2 30 ? -20.018 -3.449  -1.373  1.00 0.00 ? 30 THR B OG1  11 
ATOM   8583  C CG2  . THR B 2 30 ? -18.407 -5.133  -0.754  1.00 0.00 ? 30 THR B CG2  11 
ATOM   8584  O OXT  . THR B 2 30 ? -18.490 -1.254  0.690   1.00 0.00 ? 30 THR B OXT  11 
ATOM   8585  H H    . THR B 2 30 ? -16.125 -4.127  -1.234  1.00 0.00 ? 30 THR B H    11 
ATOM   8586  H HA   . THR B 2 30 ? -17.856 -1.851  -1.613  1.00 0.00 ? 30 THR B HA   11 
ATOM   8587  H HB   . THR B 2 30 ? -18.453 -4.007  -2.576  1.00 0.00 ? 30 THR B HB   11 
ATOM   8588  H HG1  . THR B 2 30 ? -20.216 -2.789  -2.043  1.00 0.00 ? 30 THR B HG1  11 
ATOM   8589  H HG21 . THR B 2 30 ? -19.303 -5.414  -0.221  1.00 0.00 ? 30 THR B HG21 11 
ATOM   8590  H HG22 . THR B 2 30 ? -17.603 -4.979  -0.051  1.00 0.00 ? 30 THR B HG22 11 
ATOM   8591  H HG23 . THR B 2 30 ? -18.137 -5.920  -1.443  1.00 0.00 ? 30 THR B HG23 11 
ATOM   8592  N N    . GLY A 1 1  ? -6.156  4.881   -0.792  1.00 0.00 ? 1  GLY A N    12 
ATOM   8593  C CA   . GLY A 1 1  ? -5.052  3.868   -0.494  1.00 0.00 ? 1  GLY A CA   12 
ATOM   8594  C C    . GLY A 1 1  ? -4.015  3.587   -1.529  1.00 0.00 ? 1  GLY A C    12 
ATOM   8595  O O    . GLY A 1 1  ? -3.429  4.488   -2.095  1.00 0.00 ? 1  GLY A O    12 
ATOM   8596  H H1   . GLY A 1 1  ? -6.318  4.926   -1.818  1.00 0.00 ? 1  GLY A H1   12 
ATOM   8597  H H2   . GLY A 1 1  ? -5.869  5.818   -0.445  1.00 0.00 ? 1  GLY A H2   12 
ATOM   8598  H H3   . GLY A 1 1  ? -7.033  4.588   -0.317  1.00 0.00 ? 1  GLY A H3   12 
ATOM   8599  H HA2  . GLY A 1 1  ? -4.311  4.283   -0.016  1.00 0.00 ? 1  GLY A HA2  12 
ATOM   8600  H HA3  . GLY A 1 1  ? -5.545  2.993   0.100   1.00 0.00 ? 1  GLY A HA3  12 
HETATM 8601  N N    . IIL A 1 2  ? -3.757  2.337   -1.800  1.00 0.00 ? 2  IIL A N    12 
HETATM 8602  C CA   . IIL A 1 2  ? -2.729  1.992   -2.822  1.00 0.00 ? 2  IIL A CA   12 
HETATM 8603  C C    . IIL A 1 2  ? -3.009  2.757   -4.115  1.00 0.00 ? 2  IIL A C    12 
HETATM 8604  O O    . IIL A 1 2  ? -2.132  3.372   -4.687  1.00 0.00 ? 2  IIL A O    12 
HETATM 8605  C CB   . IIL A 1 2  ? -2.767  0.487   -3.105  1.00 0.00 ? 2  IIL A CB   12 
HETATM 8606  C CG2  . IIL A 1 2  ? -1.867  0.173   -4.302  1.00 0.00 ? 2  IIL A CG2  12 
HETATM 8607  C CG1  . IIL A 1 2  ? -4.200  0.056   -3.422  1.00 0.00 ? 2  IIL A CG1  12 
HETATM 8608  C CD1  . IIL A 1 2  ? -4.276  -1.469  -3.442  1.00 0.00 ? 2  IIL A CD1  12 
HETATM 8609  H H    . IIL A 1 2  ? -4.239  1.624   -1.330  1.00 0.00 ? 2  IIL A H    12 
HETATM 8610  H HA   . IIL A 1 2  ? -1.751  2.261   -2.452  1.00 0.00 ? 2  IIL A HA   12 
HETATM 8611  H HB   . IIL A 1 2  ? -2.414  -0.051  -2.239  1.00 0.00 ? 2  IIL A HB   12 
HETATM 8612  H HG21 . IIL A 1 2  ? -1.361  1.072   -4.618  1.00 0.00 ? 2  IIL A HG21 12 
HETATM 8613  H HG22 . IIL A 1 2  ? -2.470  -0.206  -5.114  1.00 0.00 ? 2  IIL A HG22 12 
HETATM 8614  H HG23 . IIL A 1 2  ? -1.137  -0.570  -4.018  1.00 0.00 ? 2  IIL A HG23 12 
HETATM 8615  H HG12 . IIL A 1 2  ? -4.486  0.440   -4.390  1.00 0.00 ? 2  IIL A HG12 12 
HETATM 8616  H HG13 . IIL A 1 2  ? -4.871  0.441   -2.667  1.00 0.00 ? 2  IIL A HG13 12 
HETATM 8617  H HD11 . IIL A 1 2  ? -5.298  -1.775  -3.599  1.00 0.00 ? 2  IIL A HD11 12 
HETATM 8618  H HD12 . IIL A 1 2  ? -3.924  -1.859  -2.498  1.00 0.00 ? 2  IIL A HD12 12 
HETATM 8619  H HD13 . IIL A 1 2  ? -3.658  -1.851  -4.241  1.00 0.00 ? 2  IIL A HD13 12 
ATOM   8620  N N    . VAL A 1 3  ? -4.225  2.723   -4.583  1.00 0.00 ? 3  VAL A N    12 
ATOM   8621  C CA   . VAL A 1 3  ? -4.556  3.447   -5.838  1.00 0.00 ? 3  VAL A CA   12 
ATOM   8622  C C    . VAL A 1 3  ? -4.400  4.950   -5.613  1.00 0.00 ? 3  VAL A C    12 
ATOM   8623  O O    . VAL A 1 3  ? -4.012  5.679   -6.497  1.00 0.00 ? 3  VAL A O    12 
ATOM   8624  C CB   . VAL A 1 3  ? -6.000  3.141   -6.234  1.00 0.00 ? 3  VAL A CB   12 
ATOM   8625  C CG1  . VAL A 1 3  ? -6.355  3.908   -7.509  1.00 0.00 ? 3  VAL A CG1  12 
ATOM   8626  C CG2  . VAL A 1 3  ? -6.151  1.641   -6.486  1.00 0.00 ? 3  VAL A CG2  12 
ATOM   8627  H H    . VAL A 1 3  ? -4.920  2.221   -4.108  1.00 0.00 ? 3  VAL A H    12 
ATOM   8628  H HA   . VAL A 1 3  ? -3.890  3.129   -6.627  1.00 0.00 ? 3  VAL A HA   12 
ATOM   8629  H HB   . VAL A 1 3  ? -6.662  3.445   -5.437  1.00 0.00 ? 3  VAL A HB   12 
ATOM   8630  H HG11 . VAL A 1 3  ? -5.557  3.800   -8.229  1.00 0.00 ? 3  VAL A HG11 12 
ATOM   8631  H HG12 . VAL A 1 3  ? -6.491  4.954   -7.275  1.00 0.00 ? 3  VAL A HG12 12 
ATOM   8632  H HG13 . VAL A 1 3  ? -7.270  3.511   -7.926  1.00 0.00 ? 3  VAL A HG13 12 
ATOM   8633  H HG21 . VAL A 1 3  ? -5.204  1.150   -6.314  1.00 0.00 ? 3  VAL A HG21 12 
ATOM   8634  H HG22 . VAL A 1 3  ? -6.462  1.476   -7.506  1.00 0.00 ? 3  VAL A HG22 12 
ATOM   8635  H HG23 . VAL A 1 3  ? -6.893  1.236   -5.813  1.00 0.00 ? 3  VAL A HG23 12 
ATOM   8636  N N    . GLU A 1 4  ? -4.707  5.415   -4.435  1.00 0.00 ? 4  GLU A N    12 
ATOM   8637  C CA   . GLU A 1 4  ? -4.583  6.873   -4.156  1.00 0.00 ? 4  GLU A CA   12 
ATOM   8638  C C    . GLU A 1 4  ? -3.196  7.183   -3.586  1.00 0.00 ? 4  GLU A C    12 
ATOM   8639  O O    . GLU A 1 4  ? -2.934  8.279   -3.132  1.00 0.00 ? 4  GLU A O    12 
ATOM   8640  C CB   . GLU A 1 4  ? -5.652  7.285   -3.139  1.00 0.00 ? 4  GLU A CB   12 
ATOM   8641  C CG   . GLU A 1 4  ? -7.040  6.985   -3.707  1.00 0.00 ? 4  GLU A CG   12 
ATOM   8642  C CD   . GLU A 1 4  ? -7.601  8.242   -4.372  1.00 0.00 ? 4  GLU A CD   12 
ATOM   8643  O OE1  . GLU A 1 4  ? -7.053  9.306   -4.140  1.00 0.00 ? 4  GLU A OE1  12 
ATOM   8644  O OE2  . GLU A 1 4  ? -8.570  8.119   -5.104  1.00 0.00 ? 4  GLU A OE2  12 
ATOM   8645  H H    . GLU A 1 4  ? -5.025  4.808   -3.736  1.00 0.00 ? 4  GLU A H    12 
ATOM   8646  H HA   . GLU A 1 4  ? -4.727  7.428   -5.071  1.00 0.00 ? 4  GLU A HA   12 
ATOM   8647  H HB2  . GLU A 1 4  ? -5.508  6.730   -2.224  1.00 0.00 ? 4  GLU A HB2  12 
ATOM   8648  H HB3  . GLU A 1 4  ? -5.567  8.342   -2.938  1.00 0.00 ? 4  GLU A HB3  12 
ATOM   8649  H HG2  . GLU A 1 4  ? -6.968  6.191   -4.436  1.00 0.00 ? 4  GLU A HG2  12 
ATOM   8650  H HG3  . GLU A 1 4  ? -7.698  6.681   -2.906  1.00 0.00 ? 4  GLU A HG3  12 
ATOM   8651  N N    . GLN A 1 5  ? -2.300  6.231   -3.600  1.00 0.00 ? 5  GLN A N    12 
ATOM   8652  C CA   . GLN A 1 5  ? -0.940  6.493   -3.049  1.00 0.00 ? 5  GLN A CA   12 
ATOM   8653  C C    . GLN A 1 5  ? 0.067   6.647   -4.197  1.00 0.00 ? 5  GLN A C    12 
ATOM   8654  O O    . GLN A 1 5  ? 0.666   7.691   -4.365  1.00 0.00 ? 5  GLN A O    12 
ATOM   8655  C CB   . GLN A 1 5  ? -0.527  5.338   -2.132  1.00 0.00 ? 5  GLN A CB   12 
ATOM   8656  C CG   . GLN A 1 5  ? 0.875   5.599   -1.585  1.00 0.00 ? 5  GLN A CG   12 
ATOM   8657  C CD   . GLN A 1 5  ? 0.791   5.894   -0.086  1.00 0.00 ? 5  GLN A CD   12 
ATOM   8658  O OE1  . GLN A 1 5  ? 0.855   7.037   0.324   1.00 0.00 ? 5  GLN A OE1  12 
ATOM   8659  N NE2  . GLN A 1 5  ? 0.649   4.907   0.756   1.00 0.00 ? 5  GLN A NE2  12 
ATOM   8660  H H    . GLN A 1 5  ? -2.521  5.350   -3.965  1.00 0.00 ? 5  GLN A H    12 
ATOM   8661  H HA   . GLN A 1 5  ? -0.966  7.411   -2.480  1.00 0.00 ? 5  GLN A HA   12 
ATOM   8662  H HB2  . GLN A 1 5  ? -1.226  5.266   -1.309  1.00 0.00 ? 5  GLN A HB2  12 
ATOM   8663  H HB3  . GLN A 1 5  ? -0.531  4.413   -2.688  1.00 0.00 ? 5  GLN A HB3  12 
ATOM   8664  H HG2  . GLN A 1 5  ? 1.492   4.727   -1.748  1.00 0.00 ? 5  GLN A HG2  12 
ATOM   8665  H HG3  . GLN A 1 5  ? 1.306   6.447   -2.094  1.00 0.00 ? 5  GLN A HG3  12 
ATOM   8666  H HE21 . GLN A 1 5  ? 0.597   3.986   0.426   1.00 0.00 ? 5  GLN A HE21 12 
ATOM   8667  H HE22 . GLN A 1 5  ? 0.594   5.087   1.718   1.00 0.00 ? 5  GLN A HE22 12 
ATOM   8668  N N    . CYS A 1 6  ? 0.257   5.632   -5.001  1.00 0.00 ? 6  CYS A N    12 
ATOM   8669  C CA   . CYS A 1 6  ? 1.215   5.765   -6.137  1.00 0.00 ? 6  CYS A CA   12 
ATOM   8670  C C    . CYS A 1 6  ? 0.557   6.562   -7.261  1.00 0.00 ? 6  CYS A C    12 
ATOM   8671  O O    . CYS A 1 6  ? 1.220   7.059   -8.150  1.00 0.00 ? 6  CYS A O    12 
ATOM   8672  C CB   . CYS A 1 6  ? 1.622   4.385   -6.663  1.00 0.00 ? 6  CYS A CB   12 
ATOM   8673  S SG   . CYS A 1 6  ? 3.295   3.981   -6.095  1.00 0.00 ? 6  CYS A SG   12 
ATOM   8674  H H    . CYS A 1 6  ? -0.238  4.798   -4.869  1.00 0.00 ? 6  CYS A H    12 
ATOM   8675  H HA   . CYS A 1 6  ? 2.096   6.291   -5.799  1.00 0.00 ? 6  CYS A HA   12 
ATOM   8676  H HB2  . CYS A 1 6  ? 0.929   3.645   -6.299  1.00 0.00 ? 6  CYS A HB2  12 
ATOM   8677  H HB3  . CYS A 1 6  ? 1.599   4.390   -7.739  1.00 0.00 ? 6  CYS A HB3  12 
ATOM   8678  N N    . CYS A 1 7  ? -0.739  6.700   -7.226  1.00 0.00 ? 7  CYS A N    12 
ATOM   8679  C CA   . CYS A 1 7  ? -1.422  7.480   -8.291  1.00 0.00 ? 7  CYS A CA   12 
ATOM   8680  C C    . CYS A 1 7  ? -1.429  8.952   -7.882  1.00 0.00 ? 7  CYS A C    12 
ATOM   8681  O O    . CYS A 1 7  ? -1.146  9.831   -8.671  1.00 0.00 ? 7  CYS A O    12 
ATOM   8682  C CB   . CYS A 1 7  ? -2.861  6.984   -8.457  1.00 0.00 ? 7  CYS A CB   12 
ATOM   8683  S SG   . CYS A 1 7  ? -3.616  7.669   -9.961  1.00 0.00 ? 7  CYS A SG   12 
ATOM   8684  H H    . CYS A 1 7  ? -1.258  6.298   -6.498  1.00 0.00 ? 7  CYS A H    12 
ATOM   8685  H HA   . CYS A 1 7  ? -0.880  7.359   -9.211  1.00 0.00 ? 7  CYS A HA   12 
ATOM   8686  H HB2  . CYS A 1 7  ? -2.868  5.906   -8.516  1.00 0.00 ? 7  CYS A HB2  12 
ATOM   8687  H HB3  . CYS A 1 7  ? -3.436  7.298   -7.603  1.00 0.00 ? 7  CYS A HB3  12 
ATOM   8688  N N    . THR A 1 8  ? -1.742  9.221   -6.643  1.00 0.00 ? 8  THR A N    12 
ATOM   8689  C CA   . THR A 1 8  ? -1.757  10.629  -6.165  1.00 0.00 ? 8  THR A CA   12 
ATOM   8690  C C    . THR A 1 8  ? -0.357  11.223  -6.344  1.00 0.00 ? 8  THR A C    12 
ATOM   8691  O O    . THR A 1 8  ? -0.193  12.393  -6.632  1.00 0.00 ? 8  THR A O    12 
ATOM   8692  C CB   . THR A 1 8  ? -2.155  10.655  -4.681  1.00 0.00 ? 8  THR A CB   12 
ATOM   8693  O OG1  . THR A 1 8  ? -2.637  11.947  -4.344  1.00 0.00 ? 8  THR A OG1  12 
ATOM   8694  C CG2  . THR A 1 8  ? -0.947  10.314  -3.805  1.00 0.00 ? 8  THR A CG2  12 
ATOM   8695  H H    . THR A 1 8  ? -1.957  8.492   -6.025  1.00 0.00 ? 8  THR A H    12 
ATOM   8696  H HA   . THR A 1 8  ? -2.469  11.199  -6.743  1.00 0.00 ? 8  THR A HA   12 
ATOM   8697  H HB   . THR A 1 8  ? -2.931  9.924   -4.506  1.00 0.00 ? 8  THR A HB   12 
ATOM   8698  H HG1  . THR A 1 8  ? -3.279  12.207  -5.008  1.00 0.00 ? 8  THR A HG1  12 
ATOM   8699  H HG21 . THR A 1 8  ? -0.173  11.052  -3.954  1.00 0.00 ? 8  THR A HG21 12 
ATOM   8700  H HG22 . THR A 1 8  ? -0.572  9.339   -4.076  1.00 0.00 ? 8  THR A HG22 12 
ATOM   8701  H HG23 . THR A 1 8  ? -1.246  10.309  -2.768  1.00 0.00 ? 8  THR A HG23 12 
ATOM   8702  N N    . SER A 1 9  ? 0.650   10.413  -6.174  1.00 0.00 ? 9  SER A N    12 
ATOM   8703  C CA   . SER A 1 9  ? 2.048   10.895  -6.328  1.00 0.00 ? 9  SER A CA   12 
ATOM   8704  C C    . SER A 1 9  ? 2.949   9.687   -6.583  1.00 0.00 ? 9  SER A C    12 
ATOM   8705  O O    . SER A 1 9  ? 2.537   8.715   -7.182  1.00 0.00 ? 9  SER A O    12 
ATOM   8706  C CB   . SER A 1 9  ? 2.490   11.603  -5.047  1.00 0.00 ? 9  SER A CB   12 
ATOM   8707  O OG   . SER A 1 9  ? 1.456   12.475  -4.609  1.00 0.00 ? 9  SER A OG   12 
ATOM   8708  H H    . SER A 1 9  ? 0.486   9.475   -5.945  1.00 0.00 ? 9  SER A H    12 
ATOM   8709  H HA   . SER A 1 9  ? 2.109   11.577  -7.162  1.00 0.00 ? 9  SER A HA   12 
ATOM   8710  H HB2  . SER A 1 9  ? 2.687   10.874  -4.279  1.00 0.00 ? 9  SER A HB2  12 
ATOM   8711  H HB3  . SER A 1 9  ? 3.391   12.168  -5.243  1.00 0.00 ? 9  SER A HB3  12 
ATOM   8712  H HG   . SER A 1 9  ? 1.791   12.981  -3.864  1.00 0.00 ? 9  SER A HG   12 
ATOM   8713  N N    . ILE A 1 10 ? 4.167   9.730   -6.128  1.00 0.00 ? 10 ILE A N    12 
ATOM   8714  C CA   . ILE A 1 10 ? 5.073   8.569   -6.347  1.00 0.00 ? 10 ILE A CA   12 
ATOM   8715  C C    . ILE A 1 10 ? 5.220   7.789   -5.042  1.00 0.00 ? 10 ILE A C    12 
ATOM   8716  O O    . ILE A 1 10 ? 5.918   8.202   -4.137  1.00 0.00 ? 10 ILE A O    12 
ATOM   8717  C CB   . ILE A 1 10 ? 6.441   9.070   -6.803  1.00 0.00 ? 10 ILE A CB   12 
ATOM   8718  C CG1  . ILE A 1 10 ? 6.236   10.187  -7.851  1.00 0.00 ? 10 ILE A CG1  12 
ATOM   8719  C CG2  . ILE A 1 10 ? 7.237   7.893   -7.384  1.00 0.00 ? 10 ILE A CG2  12 
ATOM   8720  C CD1  . ILE A 1 10 ? 7.050   9.920   -9.124  1.00 0.00 ? 10 ILE A CD1  12 
ATOM   8721  H H    . ILE A 1 10 ? 4.484   10.518  -5.640  1.00 0.00 ? 10 ILE A H    12 
ATOM   8722  H HA   . ILE A 1 10 ? 4.654   7.924   -7.105  1.00 0.00 ? 10 ILE A HA   12 
ATOM   8723  H HB   . ILE A 1 10 ? 6.971   9.470   -5.951  1.00 0.00 ? 10 ILE A HB   12 
ATOM   8724  H HG12 . ILE A 1 10 ? 5.189   10.244  -8.108  1.00 0.00 ? 10 ILE A HG12 12 
ATOM   8725  H HG13 . ILE A 1 10 ? 6.546   11.131  -7.427  1.00 0.00 ? 10 ILE A HG13 12 
ATOM   8726  H HG21 . ILE A 1 10 ? 6.796   7.588   -8.321  1.00 0.00 ? 10 ILE A HG21 12 
ATOM   8727  H HG22 . ILE A 1 10 ? 7.215   7.066   -6.691  1.00 0.00 ? 10 ILE A HG22 12 
ATOM   8728  H HG23 . ILE A 1 10 ? 8.260   8.197   -7.549  1.00 0.00 ? 10 ILE A HG23 12 
ATOM   8729  H HD11 . ILE A 1 10 ? 8.019   9.527   -8.856  1.00 0.00 ? 10 ILE A HD11 12 
ATOM   8730  H HD12 . ILE A 1 10 ? 7.173   10.841  -9.672  1.00 0.00 ? 10 ILE A HD12 12 
ATOM   8731  H HD13 . ILE A 1 10 ? 6.526   9.202   -9.738  1.00 0.00 ? 10 ILE A HD13 12 
ATOM   8732  N N    . CYS A 1 11 ? 4.572   6.662   -4.935  1.00 0.00 ? 11 CYS A N    12 
ATOM   8733  C CA   . CYS A 1 11 ? 4.685   5.863   -3.681  1.00 0.00 ? 11 CYS A CA   12 
ATOM   8734  C C    . CYS A 1 11 ? 5.773   4.797   -3.861  1.00 0.00 ? 11 CYS A C    12 
ATOM   8735  O O    . CYS A 1 11 ? 6.491   4.795   -4.842  1.00 0.00 ? 11 CYS A O    12 
ATOM   8736  C CB   . CYS A 1 11 ? 3.322   5.232   -3.329  1.00 0.00 ? 11 CYS A CB   12 
ATOM   8737  S SG   . CYS A 1 11 ? 3.108   3.612   -4.121  1.00 0.00 ? 11 CYS A SG   12 
ATOM   8738  H H    . CYS A 1 11 ? 4.017   6.344   -5.677  1.00 0.00 ? 11 CYS A H    12 
ATOM   8739  H HA   . CYS A 1 11 ? 4.982   6.525   -2.880  1.00 0.00 ? 11 CYS A HA   12 
ATOM   8740  H HB2  . CYS A 1 11 ? 3.258   5.109   -2.259  1.00 0.00 ? 11 CYS A HB2  12 
ATOM   8741  H HB3  . CYS A 1 11 ? 2.532   5.894   -3.654  1.00 0.00 ? 11 CYS A HB3  12 
ATOM   8742  N N    . SER A 1 12 ? 5.924   3.910   -2.917  1.00 0.00 ? 12 SER A N    12 
ATOM   8743  C CA   . SER A 1 12 ? 6.993   2.877   -3.043  1.00 0.00 ? 12 SER A CA   12 
ATOM   8744  C C    . SER A 1 12 ? 6.394   1.509   -3.382  1.00 0.00 ? 12 SER A C    12 
ATOM   8745  O O    . SER A 1 12 ? 5.337   1.136   -2.906  1.00 0.00 ? 12 SER A O    12 
ATOM   8746  C CB   . SER A 1 12 ? 7.757   2.781   -1.723  1.00 0.00 ? 12 SER A CB   12 
ATOM   8747  O OG   . SER A 1 12 ? 6.918   3.221   -0.664  1.00 0.00 ? 12 SER A OG   12 
ATOM   8748  H H    . SER A 1 12 ? 5.353   3.933   -2.121  1.00 0.00 ? 12 SER A H    12 
ATOM   8749  H HA   . SER A 1 12 ? 7.678   3.167   -3.826  1.00 0.00 ? 12 SER A HA   12 
ATOM   8750  H HB2  . SER A 1 12 ? 8.046   1.759   -1.546  1.00 0.00 ? 12 SER A HB2  12 
ATOM   8751  H HB3  . SER A 1 12 ? 8.643   3.400   -1.775  1.00 0.00 ? 12 SER A HB3  12 
ATOM   8752  H HG   . SER A 1 12 ? 7.149   4.131   -0.461  1.00 0.00 ? 12 SER A HG   12 
ATOM   8753  N N    . LEU A 1 13 ? 7.081   0.750   -4.194  1.00 0.00 ? 13 LEU A N    12 
ATOM   8754  C CA   . LEU A 1 13 ? 6.578   -0.600  -4.561  1.00 0.00 ? 13 LEU A CA   12 
ATOM   8755  C C    . LEU A 1 13 ? 6.626   -1.494  -3.321  1.00 0.00 ? 13 LEU A C    12 
ATOM   8756  O O    . LEU A 1 13 ? 5.992   -2.529  -3.263  1.00 0.00 ? 13 LEU A O    12 
ATOM   8757  C CB   . LEU A 1 13 ? 7.468   -1.198  -5.651  1.00 0.00 ? 13 LEU A CB   12 
ATOM   8758  C CG   . LEU A 1 13 ? 8.881   -1.396  -5.101  1.00 0.00 ? 13 LEU A CG   12 
ATOM   8759  C CD1  . LEU A 1 13 ? 9.242   -2.882  -5.141  1.00 0.00 ? 13 LEU A CD1  12 
ATOM   8760  C CD2  . LEU A 1 13 ? 9.874   -0.608  -5.956  1.00 0.00 ? 13 LEU A CD2  12 
ATOM   8761  H H    . LEU A 1 13 ? 7.936   1.066   -4.554  1.00 0.00 ? 13 LEU A H    12 
ATOM   8762  H HA   . LEU A 1 13 ? 5.561   -0.525  -4.921  1.00 0.00 ? 13 LEU A HA   12 
ATOM   8763  H HB2  . LEU A 1 13 ? 7.064   -2.150  -5.961  1.00 0.00 ? 13 LEU A HB2  12 
ATOM   8764  H HB3  . LEU A 1 13 ? 7.503   -0.527  -6.496  1.00 0.00 ? 13 LEU A HB3  12 
ATOM   8765  H HG   . LEU A 1 13 ? 8.923   -1.043  -4.080  1.00 0.00 ? 13 LEU A HG   12 
ATOM   8766  H HD11 . LEU A 1 13 ? 8.544   -3.439  -4.533  1.00 0.00 ? 13 LEU A HD11 12 
ATOM   8767  H HD12 . LEU A 1 13 ? 10.242  -3.019  -4.756  1.00 0.00 ? 13 LEU A HD12 12 
ATOM   8768  H HD13 . LEU A 1 13 ? 9.197   -3.237  -6.159  1.00 0.00 ? 13 LEU A HD13 12 
ATOM   8769  H HD21 . LEU A 1 13 ? 9.984   -1.091  -6.916  1.00 0.00 ? 13 LEU A HD21 12 
ATOM   8770  H HD22 . LEU A 1 13 ? 10.831  -0.574  -5.459  1.00 0.00 ? 13 LEU A HD22 12 
ATOM   8771  H HD23 . LEU A 1 13 ? 9.506   0.398   -6.099  1.00 0.00 ? 13 LEU A HD23 12 
ATOM   8772  N N    . TYR A 1 14 ? 7.365   -1.093  -2.318  1.00 0.00 ? 14 TYR A N    12 
ATOM   8773  C CA   . TYR A 1 14 ? 7.440   -1.909  -1.079  1.00 0.00 ? 14 TYR A CA   12 
ATOM   8774  C C    . TYR A 1 14 ? 6.037   -2.007  -0.505  1.00 0.00 ? 14 TYR A C    12 
ATOM   8775  O O    . TYR A 1 14 ? 5.600   -3.046  -0.051  1.00 0.00 ? 14 TYR A O    12 
ATOM   8776  C CB   . TYR A 1 14 ? 8.367   -1.234  -0.067  1.00 0.00 ? 14 TYR A CB   12 
ATOM   8777  C CG   . TYR A 1 14 ? 9.601   -2.087  0.143   1.00 0.00 ? 14 TYR A CG   12 
ATOM   8778  C CD1  . TYR A 1 14 ? 10.332  -2.553  -0.962  1.00 0.00 ? 14 TYR A CD1  12 
ATOM   8779  C CD2  . TYR A 1 14 ? 10.017  -2.415  1.442   1.00 0.00 ? 14 TYR A CD2  12 
ATOM   8780  C CE1  . TYR A 1 14 ? 11.473  -3.341  -0.766  1.00 0.00 ? 14 TYR A CE1  12 
ATOM   8781  C CE2  . TYR A 1 14 ? 11.158  -3.203  1.635   1.00 0.00 ? 14 TYR A CE2  12 
ATOM   8782  C CZ   . TYR A 1 14 ? 11.887  -3.666  0.532   1.00 0.00 ? 14 TYR A CZ   12 
ATOM   8783  O OH   . TYR A 1 14 ? 13.011  -4.442  0.723   1.00 0.00 ? 14 TYR A OH   12 
ATOM   8784  H H    . TYR A 1 14 ? 7.856   -0.249  -2.378  1.00 0.00 ? 14 TYR A H    12 
ATOM   8785  H HA   . TYR A 1 14 ? 7.804   -2.894  -1.314  1.00 0.00 ? 14 TYR A HA   12 
ATOM   8786  H HB2  . TYR A 1 14 ? 8.658   -0.261  -0.440  1.00 0.00 ? 14 TYR A HB2  12 
ATOM   8787  H HB3  . TYR A 1 14 ? 7.846   -1.115  0.873   1.00 0.00 ? 14 TYR A HB3  12 
ATOM   8788  H HD1  . TYR A 1 14 ? 10.016  -2.305  -1.964  1.00 0.00 ? 14 TYR A HD1  12 
ATOM   8789  H HD2  . TYR A 1 14 ? 9.457   -2.061  2.294   1.00 0.00 ? 14 TYR A HD2  12 
ATOM   8790  H HE1  . TYR A 1 14 ? 12.035  -3.698  -1.616  1.00 0.00 ? 14 TYR A HE1  12 
ATOM   8791  H HE2  . TYR A 1 14 ? 11.477  -3.455  2.636   1.00 0.00 ? 14 TYR A HE2  12 
ATOM   8792  H HH   . TYR A 1 14 ? 13.308  -4.750  -0.136  1.00 0.00 ? 14 TYR A HH   12 
ATOM   8793  N N    . GLN A 1 15 ? 5.321   -0.925  -0.554  1.00 0.00 ? 15 GLN A N    12 
ATOM   8794  C CA   . GLN A 1 15 ? 3.929   -0.934  -0.046  1.00 0.00 ? 15 GLN A CA   12 
ATOM   8795  C C    . GLN A 1 15 ? 3.053   -1.621  -1.091  1.00 0.00 ? 15 GLN A C    12 
ATOM   8796  O O    . GLN A 1 15 ? 1.984   -2.118  -0.799  1.00 0.00 ? 15 GLN A O    12 
ATOM   8797  C CB   . GLN A 1 15 ? 3.448   0.503   0.170   1.00 0.00 ? 15 GLN A CB   12 
ATOM   8798  C CG   . GLN A 1 15 ? 4.453   1.252   1.048   1.00 0.00 ? 15 GLN A CG   12 
ATOM   8799  C CD   . GLN A 1 15 ? 3.941   2.669   1.313   1.00 0.00 ? 15 GLN A CD   12 
ATOM   8800  O OE1  . GLN A 1 15 ? 3.323   2.924   2.327   1.00 0.00 ? 15 GLN A OE1  12 
ATOM   8801  N NE2  . GLN A 1 15 ? 4.172   3.608   0.437   1.00 0.00 ? 15 GLN A NE2  12 
ATOM   8802  H H    . GLN A 1 15 ? 5.697   -0.112  -0.946  1.00 0.00 ? 15 GLN A H    12 
ATOM   8803  H HA   . GLN A 1 15 ? 3.888   -1.480  0.882   1.00 0.00 ? 15 GLN A HA   12 
ATOM   8804  H HB2  . GLN A 1 15 ? 3.363   1.002   -0.784  1.00 0.00 ? 15 GLN A HB2  12 
ATOM   8805  H HB3  . GLN A 1 15 ? 2.487   0.491   0.659   1.00 0.00 ? 15 GLN A HB3  12 
ATOM   8806  H HG2  . GLN A 1 15 ? 4.572   0.729   1.986   1.00 0.00 ? 15 GLN A HG2  12 
ATOM   8807  H HG3  . GLN A 1 15 ? 5.406   1.306   0.541   1.00 0.00 ? 15 GLN A HG3  12 
ATOM   8808  H HE21 . GLN A 1 15 ? 4.671   3.402   -0.381  1.00 0.00 ? 15 GLN A HE21 12 
ATOM   8809  H HE22 . GLN A 1 15 ? 3.848   4.519   0.598   1.00 0.00 ? 15 GLN A HE22 12 
ATOM   8810  N N    . LEU A 1 16 ? 3.516   -1.657  -2.313  1.00 0.00 ? 16 LEU A N    12 
ATOM   8811  C CA   . LEU A 1 16 ? 2.736   -2.318  -3.392  1.00 0.00 ? 16 LEU A CA   12 
ATOM   8812  C C    . LEU A 1 16 ? 2.684   -3.823  -3.126  1.00 0.00 ? 16 LEU A C    12 
ATOM   8813  O O    . LEU A 1 16 ? 1.807   -4.518  -3.596  1.00 0.00 ? 16 LEU A O    12 
ATOM   8814  C CB   . LEU A 1 16 ? 3.430   -2.059  -4.729  1.00 0.00 ? 16 LEU A CB   12 
ATOM   8815  C CG   . LEU A 1 16 ? 2.787   -0.858  -5.424  1.00 0.00 ? 16 LEU A CG   12 
ATOM   8816  C CD1  . LEU A 1 16 ? 3.456   -0.632  -6.781  1.00 0.00 ? 16 LEU A CD1  12 
ATOM   8817  C CD2  . LEU A 1 16 ? 1.296   -1.131  -5.633  1.00 0.00 ? 16 LEU A CD2  12 
ATOM   8818  H H    . LEU A 1 16 ? 4.385   -1.255  -2.520  1.00 0.00 ? 16 LEU A H    12 
ATOM   8819  H HA   . LEU A 1 16 ? 1.737   -1.919  -3.416  1.00 0.00 ? 16 LEU A HA   12 
ATOM   8820  H HB2  . LEU A 1 16 ? 4.472   -1.859  -4.552  1.00 0.00 ? 16 LEU A HB2  12 
ATOM   8821  H HB3  . LEU A 1 16 ? 3.340   -2.926  -5.357  1.00 0.00 ? 16 LEU A HB3  12 
ATOM   8822  H HG   . LEU A 1 16 ? 2.910   0.024   -4.811  1.00 0.00 ? 16 LEU A HG   12 
ATOM   8823  H HD11 . LEU A 1 16 ? 3.498   -1.567  -7.322  1.00 0.00 ? 16 LEU A HD11 12 
ATOM   8824  H HD12 . LEU A 1 16 ? 4.459   -0.260  -6.630  1.00 0.00 ? 16 LEU A HD12 12 
ATOM   8825  H HD13 . LEU A 1 16 ? 2.886   0.087   -7.349  1.00 0.00 ? 16 LEU A HD13 12 
ATOM   8826  H HD21 . LEU A 1 16 ? 1.015   -0.841  -6.633  1.00 0.00 ? 16 LEU A HD21 12 
ATOM   8827  H HD22 . LEU A 1 16 ? 0.723   -0.561  -4.917  1.00 0.00 ? 16 LEU A HD22 12 
ATOM   8828  H HD23 . LEU A 1 16 ? 1.102   -2.184  -5.494  1.00 0.00 ? 16 LEU A HD23 12 
ATOM   8829  N N    . GLU A 1 17 ? 3.621   -4.327  -2.372  1.00 0.00 ? 17 GLU A N    12 
ATOM   8830  C CA   . GLU A 1 17 ? 3.633   -5.787  -2.069  1.00 0.00 ? 17 GLU A CA   12 
ATOM   8831  C C    . GLU A 1 17 ? 2.512   -6.106  -1.082  1.00 0.00 ? 17 GLU A C    12 
ATOM   8832  O O    . GLU A 1 17 ? 1.938   -7.178  -1.095  1.00 0.00 ? 17 GLU A O    12 
ATOM   8833  C CB   . GLU A 1 17 ? 4.981   -6.170  -1.453  1.00 0.00 ? 17 GLU A CB   12 
ATOM   8834  C CG   . GLU A 1 17 ? 6.069   -6.122  -2.526  1.00 0.00 ? 17 GLU A CG   12 
ATOM   8835  C CD   . GLU A 1 17 ? 7.442   -6.273  -1.866  1.00 0.00 ? 17 GLU A CD   12 
ATOM   8836  O OE1  . GLU A 1 17 ? 7.675   -7.305  -1.259  1.00 0.00 ? 17 GLU A OE1  12 
ATOM   8837  O OE2  . GLU A 1 17 ? 8.236   -5.354  -1.978  1.00 0.00 ? 17 GLU A OE2  12 
ATOM   8838  H H    . GLU A 1 17 ? 4.316   -3.744  -2.005  1.00 0.00 ? 17 GLU A H    12 
ATOM   8839  H HA   . GLU A 1 17 ? 3.479   -6.344  -2.977  1.00 0.00 ? 17 GLU A HA   12 
ATOM   8840  H HB2  . GLU A 1 17 ? 5.224   -5.475  -0.662  1.00 0.00 ? 17 GLU A HB2  12 
ATOM   8841  H HB3  . GLU A 1 17 ? 4.921   -7.170  -1.048  1.00 0.00 ? 17 GLU A HB3  12 
ATOM   8842  H HG2  . GLU A 1 17 ? 5.917   -6.927  -3.231  1.00 0.00 ? 17 GLU A HG2  12 
ATOM   8843  H HG3  . GLU A 1 17 ? 6.024   -5.176  -3.043  1.00 0.00 ? 17 GLU A HG3  12 
ATOM   8844  N N    . ASN A 1 18 ? 2.195   -5.175  -0.231  1.00 0.00 ? 18 ASN A N    12 
ATOM   8845  C CA   . ASN A 1 18 ? 1.112   -5.403  0.761   1.00 0.00 ? 18 ASN A CA   12 
ATOM   8846  C C    . ASN A 1 18 ? -0.245  -5.350  0.055   1.00 0.00 ? 18 ASN A C    12 
ATOM   8847  O O    . ASN A 1 18 ? -1.280  -5.540  0.663   1.00 0.00 ? 18 ASN A O    12 
ATOM   8848  C CB   . ASN A 1 18 ? 1.179   -4.312  1.831   1.00 0.00 ? 18 ASN A CB   12 
ATOM   8849  C CG   . ASN A 1 18 ? 1.942   -4.834  3.049   1.00 0.00 ? 18 ASN A CG   12 
ATOM   8850  O OD1  . ASN A 1 18 ? 1.357   -5.403  3.950   1.00 0.00 ? 18 ASN A OD1  12 
ATOM   8851  N ND2  . ASN A 1 18 ? 3.234   -4.664  3.115   1.00 0.00 ? 18 ASN A ND2  12 
ATOM   8852  H H    . ASN A 1 18 ? 2.669   -4.320  -0.249  1.00 0.00 ? 18 ASN A H    12 
ATOM   8853  H HA   . ASN A 1 18 ? 1.242   -6.370  1.223   1.00 0.00 ? 18 ASN A HA   12 
ATOM   8854  H HB2  . ASN A 1 18 ? 1.688   -3.447  1.430   1.00 0.00 ? 18 ASN A HB2  12 
ATOM   8855  H HB3  . ASN A 1 18 ? 0.180   -4.036  2.124   1.00 0.00 ? 18 ASN A HB3  12 
ATOM   8856  H HD21 . ASN A 1 18 ? 3.706   -4.205  2.388   1.00 0.00 ? 18 ASN A HD21 12 
ATOM   8857  H HD22 . ASN A 1 18 ? 3.733   -4.994  3.892   1.00 0.00 ? 18 ASN A HD22 12 
ATOM   8858  N N    . TYR A 1 19 ? -0.249  -5.096  -1.226  1.00 0.00 ? 19 TYR A N    12 
ATOM   8859  C CA   . TYR A 1 19 ? -1.532  -5.035  -1.972  1.00 0.00 ? 19 TYR A CA   12 
ATOM   8860  C C    . TYR A 1 19 ? -1.559  -6.155  -3.008  1.00 0.00 ? 19 TYR A C    12 
ATOM   8861  O O    . TYR A 1 19 ? -2.090  -6.006  -4.090  1.00 0.00 ? 19 TYR A O    12 
ATOM   8862  C CB   . TYR A 1 19 ? -1.644  -3.680  -2.667  1.00 0.00 ? 19 TYR A CB   12 
ATOM   8863  C CG   . TYR A 1 19 ? -1.663  -2.591  -1.623  1.00 0.00 ? 19 TYR A CG   12 
ATOM   8864  C CD1  . TYR A 1 19 ? -2.645  -2.597  -0.624  1.00 0.00 ? 19 TYR A CD1  12 
ATOM   8865  C CD2  . TYR A 1 19 ? -0.697  -1.577  -1.650  1.00 0.00 ? 19 TYR A CD2  12 
ATOM   8866  C CE1  . TYR A 1 19 ? -2.662  -1.588  0.348   1.00 0.00 ? 19 TYR A CE1  12 
ATOM   8867  C CE2  . TYR A 1 19 ? -0.713  -0.568  -0.678  1.00 0.00 ? 19 TYR A CE2  12 
ATOM   8868  C CZ   . TYR A 1 19 ? -1.696  -0.573  0.321   1.00 0.00 ? 19 TYR A CZ   12 
ATOM   8869  O OH   . TYR A 1 19 ? -1.711  0.421   1.279   1.00 0.00 ? 19 TYR A OH   12 
ATOM   8870  H H    . TYR A 1 19 ? 0.594   -4.948  -1.700  1.00 0.00 ? 19 TYR A H    12 
ATOM   8871  H HA   . TYR A 1 19 ? -2.354  -5.158  -1.288  1.00 0.00 ? 19 TYR A HA   12 
ATOM   8872  H HB2  . TYR A 1 19 ? -0.796  -3.539  -3.322  1.00 0.00 ? 19 TYR A HB2  12 
ATOM   8873  H HB3  . TYR A 1 19 ? -2.555  -3.644  -3.242  1.00 0.00 ? 19 TYR A HB3  12 
ATOM   8874  H HD1  . TYR A 1 19 ? -3.390  -3.380  -0.603  1.00 0.00 ? 19 TYR A HD1  12 
ATOM   8875  H HD2  . TYR A 1 19 ? 0.061   -1.575  -2.419  1.00 0.00 ? 19 TYR A HD2  12 
ATOM   8876  H HE1  . TYR A 1 19 ? -3.419  -1.592  1.118   1.00 0.00 ? 19 TYR A HE1  12 
ATOM   8877  H HE2  . TYR A 1 19 ? 0.032   0.214   -0.698  1.00 0.00 ? 19 TYR A HE2  12 
ATOM   8878  H HH   . TYR A 1 19 ? -0.816  0.757   1.372   1.00 0.00 ? 19 TYR A HH   12 
ATOM   8879  N N    . CYS A 1 20 ? -0.983  -7.278  -2.681  1.00 0.00 ? 20 CYS A N    12 
ATOM   8880  C CA   . CYS A 1 20 ? -0.966  -8.417  -3.638  1.00 0.00 ? 20 CYS A CA   12 
ATOM   8881  C C    . CYS A 1 20 ? -2.066  -9.410  -3.264  1.00 0.00 ? 20 CYS A C    12 
ATOM   8882  O O    . CYS A 1 20 ? -3.198  -9.287  -3.686  1.00 0.00 ? 20 CYS A O    12 
ATOM   8883  C CB   . CYS A 1 20 ? 0.398   -9.106  -3.573  1.00 0.00 ? 20 CYS A CB   12 
ATOM   8884  S SG   . CYS A 1 20 ? 1.637   -8.065  -4.383  1.00 0.00 ? 20 CYS A SG   12 
ATOM   8885  H H    . CYS A 1 20 ? -0.560  -7.373  -1.802  1.00 0.00 ? 20 CYS A H    12 
ATOM   8886  H HA   . CYS A 1 20 ? -1.138  -8.052  -4.636  1.00 0.00 ? 20 CYS A HA   12 
ATOM   8887  H HB2  . CYS A 1 20 ? 0.675   -9.259  -2.541  1.00 0.00 ? 20 CYS A HB2  12 
ATOM   8888  H HB3  . CYS A 1 20 ? 0.344   -10.058 -4.076  1.00 0.00 ? 20 CYS A HB3  12 
ATOM   8889  N N    . ASN A 1 21 ? -1.743  -10.392 -2.473  1.00 0.00 ? 21 ASN A N    12 
ATOM   8890  C CA   . ASN A 1 21 ? -2.768  -11.394 -2.068  1.00 0.00 ? 21 ASN A CA   12 
ATOM   8891  C C    . ASN A 1 21 ? -2.442  -11.925 -0.670  1.00 0.00 ? 21 ASN A C    12 
ATOM   8892  O O    . ASN A 1 21 ? -3.306  -12.549 -0.078  1.00 0.00 ? 21 ASN A O    12 
ATOM   8893  C CB   . ASN A 1 21 ? -2.773  -12.554 -3.066  1.00 0.00 ? 21 ASN A CB   12 
ATOM   8894  C CG   . ASN A 1 21 ? -3.837  -12.300 -4.134  1.00 0.00 ? 21 ASN A CG   12 
ATOM   8895  O OD1  . ASN A 1 21 ? -4.871  -12.937 -4.143  1.00 0.00 ? 21 ASN A OD1  12 
ATOM   8896  N ND2  . ASN A 1 21 ? -3.626  -11.386 -5.041  1.00 0.00 ? 21 ASN A ND2  12 
ATOM   8897  O OXT  . ASN A 1 21 ? -1.333  -11.696 -0.215  1.00 0.00 ? 21 ASN A OXT  12 
ATOM   8898  H H    . ASN A 1 21 ? -0.824  -10.470 -2.145  1.00 0.00 ? 21 ASN A H    12 
ATOM   8899  H HA   . ASN A 1 21 ? -3.742  -10.926 -2.056  1.00 0.00 ? 21 ASN A HA   12 
ATOM   8900  H HB2  . ASN A 1 21 ? -1.802  -12.631 -3.535  1.00 0.00 ? 21 ASN A HB2  12 
ATOM   8901  H HB3  . ASN A 1 21 ? -2.997  -13.474 -2.550  1.00 0.00 ? 21 ASN A HB3  12 
ATOM   8902  H HD21 . ASN A 1 21 ? -2.792  -10.872 -5.034  1.00 0.00 ? 21 ASN A HD21 12 
ATOM   8903  H HD22 . ASN A 1 21 ? -4.302  -11.213 -5.729  1.00 0.00 ? 21 ASN A HD22 12 
ATOM   8904  N N    . PHE B 2 1  ? 9.241   2.014   -10.054 1.00 0.00 ? 1  PHE B N    12 
ATOM   8905  C CA   . PHE B 2 1  ? 9.852   1.501   -8.795  1.00 0.00 ? 1  PHE B CA   12 
ATOM   8906  C C    . PHE B 2 1  ? 9.744   2.568   -7.703  1.00 0.00 ? 1  PHE B C    12 
ATOM   8907  O O    . PHE B 2 1  ? 8.833   2.557   -6.899  1.00 0.00 ? 1  PHE B O    12 
ATOM   8908  C CB   . PHE B 2 1  ? 11.327  1.173   -9.043  1.00 0.00 ? 1  PHE B CB   12 
ATOM   8909  C CG   . PHE B 2 1  ? 11.539  -0.320  -8.911  1.00 0.00 ? 1  PHE B CG   12 
ATOM   8910  C CD1  . PHE B 2 1  ? 10.706  -1.213  -9.602  1.00 0.00 ? 1  PHE B CD1  12 
ATOM   8911  C CD2  . PHE B 2 1  ? 12.569  -0.815  -8.095  1.00 0.00 ? 1  PHE B CD2  12 
ATOM   8912  C CE1  . PHE B 2 1  ? 10.903  -2.595  -9.478  1.00 0.00 ? 1  PHE B CE1  12 
ATOM   8913  C CE2  . PHE B 2 1  ? 12.763  -2.197  -7.974  1.00 0.00 ? 1  PHE B CE2  12 
ATOM   8914  C CZ   . PHE B 2 1  ? 11.931  -3.087  -8.665  1.00 0.00 ? 1  PHE B CZ   12 
ATOM   8915  H H1   . PHE B 2 1  ? 9.653   2.939   -10.288 1.00 0.00 ? 1  PHE B H1   12 
ATOM   8916  H H2   . PHE B 2 1  ? 8.213   2.115   -9.923  1.00 0.00 ? 1  PHE B H2   12 
ATOM   8917  H H3   . PHE B 2 1  ? 9.429   1.347   -10.827 1.00 0.00 ? 1  PHE B H3   12 
ATOM   8918  H HA   . PHE B 2 1  ? 9.332   0.608   -8.479  1.00 0.00 ? 1  PHE B HA   12 
ATOM   8919  H HB2  . PHE B 2 1  ? 11.604  1.494   -10.038 1.00 0.00 ? 1  PHE B HB2  12 
ATOM   8920  H HB3  . PHE B 2 1  ? 11.937  1.691   -8.317  1.00 0.00 ? 1  PHE B HB3  12 
ATOM   8921  H HD1  . PHE B 2 1  ? 9.912   -0.837  -10.229 1.00 0.00 ? 1  PHE B HD1  12 
ATOM   8922  H HD2  . PHE B 2 1  ? 13.211  -0.133  -7.562  1.00 0.00 ? 1  PHE B HD2  12 
ATOM   8923  H HE1  . PHE B 2 1  ? 10.261  -3.281  -10.010 1.00 0.00 ? 1  PHE B HE1  12 
ATOM   8924  H HE2  . PHE B 2 1  ? 13.556  -2.577  -7.345  1.00 0.00 ? 1  PHE B HE2  12 
ATOM   8925  H HZ   . PHE B 2 1  ? 12.082  -4.152  -8.569  1.00 0.00 ? 1  PHE B HZ   12 
ATOM   8926  N N    . VAL B 2 2  ? 10.666  3.489   -7.670  1.00 0.00 ? 2  VAL B N    12 
ATOM   8927  C CA   . VAL B 2 2  ? 10.617  4.557   -6.634  1.00 0.00 ? 2  VAL B CA   12 
ATOM   8928  C C    . VAL B 2 2  ? 11.114  5.869   -7.238  1.00 0.00 ? 2  VAL B C    12 
ATOM   8929  O O    . VAL B 2 2  ? 12.085  6.446   -6.789  1.00 0.00 ? 2  VAL B O    12 
ATOM   8930  C CB   . VAL B 2 2  ? 11.507  4.170   -5.457  1.00 0.00 ? 2  VAL B CB   12 
ATOM   8931  C CG1  . VAL B 2 2  ? 11.494  5.294   -4.420  1.00 0.00 ? 2  VAL B CG1  12 
ATOM   8932  C CG2  . VAL B 2 2  ? 10.974  2.882   -4.827  1.00 0.00 ? 2  VAL B CG2  12 
ATOM   8933  H H    . VAL B 2 2  ? 11.391  3.480   -8.329  1.00 0.00 ? 2  VAL B H    12 
ATOM   8934  H HA   . VAL B 2 2  ? 9.600   4.682   -6.293  1.00 0.00 ? 2  VAL B HA   12 
ATOM   8935  H HB   . VAL B 2 2  ? 12.518  4.013   -5.805  1.00 0.00 ? 2  VAL B HB   12 
ATOM   8936  H HG11 . VAL B 2 2  ? 11.252  4.887   -3.450  1.00 0.00 ? 2  VAL B HG11 12 
ATOM   8937  H HG12 . VAL B 2 2  ? 10.751  6.029   -4.696  1.00 0.00 ? 2  VAL B HG12 12 
ATOM   8938  H HG13 . VAL B 2 2  ? 12.466  5.762   -4.383  1.00 0.00 ? 2  VAL B HG13 12 
ATOM   8939  H HG21 . VAL B 2 2  ? 9.934   3.012   -4.569  1.00 0.00 ? 2  VAL B HG21 12 
ATOM   8940  H HG22 . VAL B 2 2  ? 11.541  2.655   -3.938  1.00 0.00 ? 2  VAL B HG22 12 
ATOM   8941  H HG23 . VAL B 2 2  ? 11.071  2.071   -5.534  1.00 0.00 ? 2  VAL B HG23 12 
ATOM   8942  N N    . ASN B 2 3  ? 10.455  6.341   -8.257  1.00 0.00 ? 3  ASN B N    12 
ATOM   8943  C CA   . ASN B 2 3  ? 10.884  7.614   -8.899  1.00 0.00 ? 3  ASN B CA   12 
ATOM   8944  C C    . ASN B 2 3  ? 9.892   7.987   -10.004 1.00 0.00 ? 3  ASN B C    12 
ATOM   8945  O O    . ASN B 2 3  ? 9.618   9.148   -10.238 1.00 0.00 ? 3  ASN B O    12 
ATOM   8946  C CB   . ASN B 2 3  ? 12.277  7.431   -9.505  1.00 0.00 ? 3  ASN B CB   12 
ATOM   8947  C CG   . ASN B 2 3  ? 13.329  7.994   -8.548  1.00 0.00 ? 3  ASN B CG   12 
ATOM   8948  O OD1  . ASN B 2 3  ? 13.283  9.155   -8.191  1.00 0.00 ? 3  ASN B OD1  12 
ATOM   8949  N ND2  . ASN B 2 3  ? 14.282  7.215   -8.115  1.00 0.00 ? 3  ASN B ND2  12 
ATOM   8950  H H    . ASN B 2 3  ? 9.677   5.855   -8.598  1.00 0.00 ? 3  ASN B H    12 
ATOM   8951  H HA   . ASN B 2 3  ? 10.913  8.399   -8.159  1.00 0.00 ? 3  ASN B HA   12 
ATOM   8952  H HB2  . ASN B 2 3  ? 12.463  6.379   -9.667  1.00 0.00 ? 3  ASN B HB2  12 
ATOM   8953  H HB3  . ASN B 2 3  ? 12.332  7.957   -10.447 1.00 0.00 ? 3  ASN B HB3  12 
ATOM   8954  H HD21 . ASN B 2 3  ? 14.319  6.280   -8.404  1.00 0.00 ? 3  ASN B HD21 12 
ATOM   8955  H HD22 . ASN B 2 3  ? 14.961  7.566   -7.502  1.00 0.00 ? 3  ASN B HD22 12 
ATOM   8956  N N    . GLN B 2 4  ? 9.356   7.014   -10.687 1.00 0.00 ? 4  GLN B N    12 
ATOM   8957  C CA   . GLN B 2 4  ? 8.390   7.313   -11.780 1.00 0.00 ? 4  GLN B CA   12 
ATOM   8958  C C    . GLN B 2 4  ? 6.980   7.449   -11.206 1.00 0.00 ? 4  GLN B C    12 
ATOM   8959  O O    . GLN B 2 4  ? 6.619   6.789   -10.251 1.00 0.00 ? 4  GLN B O    12 
ATOM   8960  C CB   . GLN B 2 4  ? 8.412   6.170   -12.793 1.00 0.00 ? 4  GLN B CB   12 
ATOM   8961  C CG   . GLN B 2 4  ? 9.280   6.564   -13.988 1.00 0.00 ? 4  GLN B CG   12 
ATOM   8962  C CD   . GLN B 2 4  ? 10.727  6.139   -13.731 1.00 0.00 ? 4  GLN B CD   12 
ATOM   8963  O OE1  . GLN B 2 4  ? 11.075  4.988   -13.907 1.00 0.00 ? 4  GLN B OE1  12 
ATOM   8964  N NE2  . GLN B 2 4  ? 11.590  7.026   -13.321 1.00 0.00 ? 4  GLN B NE2  12 
ATOM   8965  H H    . GLN B 2 4  ? 9.592   6.085   -10.488 1.00 0.00 ? 4  GLN B H    12 
ATOM   8966  H HA   . GLN B 2 4  ? 8.670   8.233   -12.266 1.00 0.00 ? 4  GLN B HA   12 
ATOM   8967  H HB2  . GLN B 2 4  ? 8.819   5.284   -12.328 1.00 0.00 ? 4  GLN B HB2  12 
ATOM   8968  H HB3  . GLN B 2 4  ? 7.407   5.971   -13.130 1.00 0.00 ? 4  GLN B HB3  12 
ATOM   8969  H HG2  . GLN B 2 4  ? 8.912   6.072   -14.875 1.00 0.00 ? 4  GLN B HG2  12 
ATOM   8970  H HG3  . GLN B 2 4  ? 9.240   7.634   -14.125 1.00 0.00 ? 4  GLN B HG3  12 
ATOM   8971  H HE21 . GLN B 2 4  ? 11.310  7.955   -13.180 1.00 0.00 ? 4  GLN B HE21 12 
ATOM   8972  H HE22 . GLN B 2 4  ? 12.520  6.764   -13.154 1.00 0.00 ? 4  GLN B HE22 12 
ATOM   8973  N N    . HIS B 2 5  ? 6.178   8.300   -11.787 1.00 0.00 ? 5  HIS B N    12 
ATOM   8974  C CA   . HIS B 2 5  ? 4.791   8.480   -11.282 1.00 0.00 ? 5  HIS B CA   12 
ATOM   8975  C C    . HIS B 2 5  ? 3.938   7.279   -11.693 1.00 0.00 ? 5  HIS B C    12 
ATOM   8976  O O    . HIS B 2 5  ? 4.108   6.715   -12.755 1.00 0.00 ? 5  HIS B O    12 
ATOM   8977  C CB   . HIS B 2 5  ? 4.192   9.757   -11.877 1.00 0.00 ? 5  HIS B CB   12 
ATOM   8978  C CG   . HIS B 2 5  ? 2.814   9.976   -11.312 1.00 0.00 ? 5  HIS B CG   12 
ATOM   8979  N ND1  . HIS B 2 5  ? 1.711   10.089  -12.131 1.00 0.00 ? 5  HIS B ND1  12 
ATOM   8980  C CD2  . HIS B 2 5  ? 2.381   10.100  -10.020 1.00 0.00 ? 5  HIS B CD2  12 
ATOM   8981  C CE1  . HIS B 2 5  ? 0.654   10.276  -11.328 1.00 0.00 ? 5  HIS B CE1  12 
ATOM   8982  N NE2  . HIS B 2 5  ? 1.014   10.290  -10.028 1.00 0.00 ? 5  HIS B NE2  12 
ATOM   8983  H H    . HIS B 2 5  ? 6.490   8.818   -12.558 1.00 0.00 ? 5  HIS B H    12 
ATOM   8984  H HA   . HIS B 2 5  ? 4.806   8.558   -10.205 1.00 0.00 ? 5  HIS B HA   12 
ATOM   8985  H HB2  . HIS B 2 5  ? 4.821   10.599  -11.629 1.00 0.00 ? 5  HIS B HB2  12 
ATOM   8986  H HB3  . HIS B 2 5  ? 4.129   9.658   -12.950 1.00 0.00 ? 5  HIS B HB3  12 
ATOM   8987  H HD2  . HIS B 2 5  ? 3.004   10.057  -9.140  1.00 0.00 ? 5  HIS B HD2  12 
ATOM   8988  H HE1  . HIS B 2 5  ? -0.360  10.400  -11.679 1.00 0.00 ? 5  HIS B HE1  12 
ATOM   8989  H HE2  . HIS B 2 5  ? 0.428   10.410  -9.252  1.00 0.00 ? 5  HIS B HE2  12 
ATOM   8990  N N    . LEU B 2 6  ? 3.024   6.884   -10.853 1.00 0.00 ? 6  LEU B N    12 
ATOM   8991  C CA   . LEU B 2 6  ? 2.156   5.721   -11.180 1.00 0.00 ? 6  LEU B CA   12 
ATOM   8992  C C    . LEU B 2 6  ? 0.697   6.181   -11.215 1.00 0.00 ? 6  LEU B C    12 
ATOM   8993  O O    . LEU B 2 6  ? 0.392   7.304   -10.876 1.00 0.00 ? 6  LEU B O    12 
ATOM   8994  C CB   . LEU B 2 6  ? 2.320   4.659   -10.093 1.00 0.00 ? 6  LEU B CB   12 
ATOM   8995  C CG   . LEU B 2 6  ? 3.571   3.825   -10.360 1.00 0.00 ? 6  LEU B CG   12 
ATOM   8996  C CD1  . LEU B 2 6  ? 3.399   3.037   -11.659 1.00 0.00 ? 6  LEU B CD1  12 
ATOM   8997  C CD2  . LEU B 2 6  ? 4.781   4.751   -10.478 1.00 0.00 ? 6  LEU B CD2  12 
ATOM   8998  H H    . LEU B 2 6  ? 2.908   7.355   -10.001 1.00 0.00 ? 6  LEU B H    12 
ATOM   8999  H HA   . LEU B 2 6  ? 2.435   5.311   -12.139 1.00 0.00 ? 6  LEU B HA   12 
ATOM   9000  H HB2  . LEU B 2 6  ? 2.416   5.147   -9.137  1.00 0.00 ? 6  LEU B HB2  12 
ATOM   9001  H HB3  . LEU B 2 6  ? 1.454   4.014   -10.084 1.00 0.00 ? 6  LEU B HB3  12 
ATOM   9002  H HG   . LEU B 2 6  ? 3.724   3.135   -9.542  1.00 0.00 ? 6  LEU B HG   12 
ATOM   9003  H HD11 . LEU B 2 6  ? 4.303   3.109   -12.246 1.00 0.00 ? 6  LEU B HD11 12 
ATOM   9004  H HD12 . LEU B 2 6  ? 2.570   3.445   -12.219 1.00 0.00 ? 6  LEU B HD12 12 
ATOM   9005  H HD13 . LEU B 2 6  ? 3.202   2.001   -11.426 1.00 0.00 ? 6  LEU B HD13 12 
ATOM   9006  H HD21 . LEU B 2 6  ? 5.677   4.205   -10.223 1.00 0.00 ? 6  LEU B HD21 12 
ATOM   9007  H HD22 . LEU B 2 6  ? 4.662   5.585   -9.802  1.00 0.00 ? 6  LEU B HD22 12 
ATOM   9008  H HD23 . LEU B 2 6  ? 4.857   5.114   -11.491 1.00 0.00 ? 6  LEU B HD23 12 
ATOM   9009  N N    . CYS B 2 7  ? -0.204  5.317   -11.608 1.00 0.00 ? 7  CYS B N    12 
ATOM   9010  C CA   . CYS B 2 7  ? -1.652  5.689   -11.650 1.00 0.00 ? 7  CYS B CA   12 
ATOM   9011  C C    . CYS B 2 7  ? -2.440  4.611   -12.413 1.00 0.00 ? 7  CYS B C    12 
ATOM   9012  O O    . CYS B 2 7  ? -2.741  3.564   -11.876 1.00 0.00 ? 7  CYS B O    12 
ATOM   9013  C CB   . CYS B 2 7  ? -1.837  7.056   -12.330 1.00 0.00 ? 7  CYS B CB   12 
ATOM   9014  S SG   . CYS B 2 7  ? -2.080  8.346   -11.082 1.00 0.00 ? 7  CYS B SG   12 
ATOM   9015  H H    . CYS B 2 7  ? 0.072   4.413   -11.865 1.00 0.00 ? 7  CYS B H    12 
ATOM   9016  H HA   . CYS B 2 7  ? -2.028  5.743   -10.638 1.00 0.00 ? 7  CYS B HA   12 
ATOM   9017  H HB2  . CYS B 2 7  ? -0.961  7.287   -12.914 1.00 0.00 ? 7  CYS B HB2  12 
ATOM   9018  H HB3  . CYS B 2 7  ? -2.701  7.025   -12.975 1.00 0.00 ? 7  CYS B HB3  12 
ATOM   9019  N N    . GLY B 2 8  ? -2.779  4.849   -13.658 1.00 0.00 ? 8  GLY B N    12 
ATOM   9020  C CA   . GLY B 2 8  ? -3.552  3.832   -14.429 1.00 0.00 ? 8  GLY B CA   12 
ATOM   9021  C C    . GLY B 2 8  ? -2.718  2.564   -14.596 1.00 0.00 ? 8  GLY B C    12 
ATOM   9022  O O    . GLY B 2 8  ? -2.092  2.095   -13.667 1.00 0.00 ? 8  GLY B O    12 
ATOM   9023  H H    . GLY B 2 8  ? -2.528  5.691   -14.085 1.00 0.00 ? 8  GLY B H    12 
ATOM   9024  H HA2  . GLY B 2 8  ? -4.464  3.595   -13.898 1.00 0.00 ? 8  GLY B HA2  12 
ATOM   9025  H HA3  . GLY B 2 8  ? -3.796  4.227   -15.403 1.00 0.00 ? 8  GLY B HA3  12 
ATOM   9026  N N    . SER B 2 9  ? -2.702  2.006   -15.779 1.00 0.00 ? 9  SER B N    12 
ATOM   9027  C CA   . SER B 2 9  ? -1.902  0.771   -16.008 1.00 0.00 ? 9  SER B CA   12 
ATOM   9028  C C    . SER B 2 9  ? -0.542  0.930   -15.332 1.00 0.00 ? 9  SER B C    12 
ATOM   9029  O O    . SER B 2 9  ? 0.089   -0.034  -14.944 1.00 0.00 ? 9  SER B O    12 
ATOM   9030  C CB   . SER B 2 9  ? -1.707  0.560   -17.510 1.00 0.00 ? 9  SER B CB   12 
ATOM   9031  O OG   . SER B 2 9  ? -2.594  -0.454  -17.962 1.00 0.00 ? 9  SER B OG   12 
ATOM   9032  H H    . SER B 2 9  ? -3.212  2.403   -16.515 1.00 0.00 ? 9  SER B H    12 
ATOM   9033  H HA   . SER B 2 9  ? -2.419  -0.078  -15.587 1.00 0.00 ? 9  SER B HA   12 
ATOM   9034  H HB2  . SER B 2 9  ? -1.919  1.476   -18.035 1.00 0.00 ? 9  SER B HB2  12 
ATOM   9035  H HB3  . SER B 2 9  ? -0.683  0.268   -17.700 1.00 0.00 ? 9  SER B HB3  12 
ATOM   9036  H HG   . SER B 2 9  ? -2.241  -0.813  -18.780 1.00 0.00 ? 9  SER B HG   12 
ATOM   9037  N N    . ASP B 2 10 ? -0.086  2.144   -15.187 1.00 0.00 ? 10 ASP B N    12 
ATOM   9038  C CA   . ASP B 2 10 ? 1.228   2.374   -14.533 1.00 0.00 ? 10 ASP B CA   12 
ATOM   9039  C C    . ASP B 2 10 ? 1.218   1.746   -13.139 1.00 0.00 ? 10 ASP B C    12 
ATOM   9040  O O    . ASP B 2 10 ? 2.057   0.929   -12.814 1.00 0.00 ? 10 ASP B O    12 
ATOM   9041  C CB   . ASP B 2 10 ? 1.482   3.877   -14.415 1.00 0.00 ? 10 ASP B CB   12 
ATOM   9042  C CG   . ASP B 2 10 ? 1.385   4.518   -15.802 1.00 0.00 ? 10 ASP B CG   12 
ATOM   9043  O OD1  . ASP B 2 10 ? 0.422   4.239   -16.496 1.00 0.00 ? 10 ASP B OD1  12 
ATOM   9044  O OD2  . ASP B 2 10 ? 2.277   5.276   -16.145 1.00 0.00 ? 10 ASP B OD2  12 
ATOM   9045  H H    . ASP B 2 10 ? -0.613  2.906   -15.507 1.00 0.00 ? 10 ASP B H    12 
ATOM   9046  H HA   . ASP B 2 10 ? 2.009   1.922   -15.126 1.00 0.00 ? 10 ASP B HA   12 
ATOM   9047  H HB2  . ASP B 2 10 ? 0.743   4.317   -13.761 1.00 0.00 ? 10 ASP B HB2  12 
ATOM   9048  H HB3  . ASP B 2 10 ? 2.468   4.045   -14.012 1.00 0.00 ? 10 ASP B HB3  12 
ATOM   9049  N N    . LEU B 2 11 ? 0.276   2.114   -12.309 1.00 0.00 ? 11 LEU B N    12 
ATOM   9050  C CA   . LEU B 2 11 ? 0.233   1.522   -10.942 1.00 0.00 ? 11 LEU B CA   12 
ATOM   9051  C C    . LEU B 2 11 ? -0.049  0.022   -11.051 1.00 0.00 ? 11 LEU B C    12 
ATOM   9052  O O    . LEU B 2 11 ? 0.421   -0.769  -10.255 1.00 0.00 ? 11 LEU B O    12 
ATOM   9053  C CB   . LEU B 2 11 ? -0.872  2.196   -10.114 1.00 0.00 ? 11 LEU B CB   12 
ATOM   9054  C CG   . LEU B 2 11 ? -0.395  2.435   -8.673  1.00 0.00 ? 11 LEU B CG   12 
ATOM   9055  C CD1  . LEU B 2 11 ? -1.607  2.496   -7.745  1.00 0.00 ? 11 LEU B CD1  12 
ATOM   9056  C CD2  . LEU B 2 11 ? 0.518   1.293   -8.213  1.00 0.00 ? 11 LEU B CD2  12 
ATOM   9057  H H    . LEU B 2 11 ? -0.396  2.771   -12.585 1.00 0.00 ? 11 LEU B H    12 
ATOM   9058  H HA   . LEU B 2 11 ? 1.186   1.673   -10.459 1.00 0.00 ? 11 LEU B HA   12 
ATOM   9059  H HB2  . LEU B 2 11 ? -1.128  3.142   -10.567 1.00 0.00 ? 11 LEU B HB2  12 
ATOM   9060  H HB3  . LEU B 2 11 ? -1.746  1.563   -10.096 1.00 0.00 ? 11 LEU B HB3  12 
ATOM   9061  H HG   . LEU B 2 11 ? 0.143   3.372   -8.623  1.00 0.00 ? 11 LEU B HG   12 
ATOM   9062  H HD11 . LEU B 2 11 ? -1.301  2.862   -6.777  1.00 0.00 ? 11 LEU B HD11 12 
ATOM   9063  H HD12 . LEU B 2 11 ? -2.028  1.507   -7.639  1.00 0.00 ? 11 LEU B HD12 12 
ATOM   9064  H HD13 . LEU B 2 11 ? -2.348  3.160   -8.164  1.00 0.00 ? 11 LEU B HD13 12 
ATOM   9065  H HD21 . LEU B 2 11 ? 1.496   1.411   -8.656  1.00 0.00 ? 11 LEU B HD21 12 
ATOM   9066  H HD22 . LEU B 2 11 ? 0.095   0.349   -8.518  1.00 0.00 ? 11 LEU B HD22 12 
ATOM   9067  H HD23 . LEU B 2 11 ? 0.607   1.315   -7.136  1.00 0.00 ? 11 LEU B HD23 12 
ATOM   9068  N N    . VAL B 2 12 ? -0.805  -0.381  -12.036 1.00 0.00 ? 12 VAL B N    12 
ATOM   9069  C CA   . VAL B 2 12 ? -1.108  -1.830  -12.194 1.00 0.00 ? 12 VAL B CA   12 
ATOM   9070  C C    . VAL B 2 12 ? 0.166   -2.561  -12.625 1.00 0.00 ? 12 VAL B C    12 
ATOM   9071  O O    . VAL B 2 12 ? 0.606   -3.492  -11.980 1.00 0.00 ? 12 VAL B O    12 
ATOM   9072  C CB   . VAL B 2 12 ? -2.204  -2.005  -13.254 1.00 0.00 ? 12 VAL B CB   12 
ATOM   9073  C CG1  . VAL B 2 12 ? -2.173  -3.428  -13.822 1.00 0.00 ? 12 VAL B CG1  12 
ATOM   9074  C CG2  . VAL B 2 12 ? -3.570  -1.749  -12.613 1.00 0.00 ? 12 VAL B CG2  12 
ATOM   9075  H H    . VAL B 2 12 ? -1.171  0.267   -12.675 1.00 0.00 ? 12 VAL B H    12 
ATOM   9076  H HA   . VAL B 2 12 ? -1.450  -2.228  -11.249 1.00 0.00 ? 12 VAL B HA   12 
ATOM   9077  H HB   . VAL B 2 12 ? -2.044  -1.296  -14.053 1.00 0.00 ? 12 VAL B HB   12 
ATOM   9078  H HG11 . VAL B 2 12 ? -1.949  -4.127  -13.031 1.00 0.00 ? 12 VAL B HG11 12 
ATOM   9079  H HG12 . VAL B 2 12 ? -1.412  -3.494  -14.586 1.00 0.00 ? 12 VAL B HG12 12 
ATOM   9080  H HG13 . VAL B 2 12 ? -3.136  -3.665  -14.251 1.00 0.00 ? 12 VAL B HG13 12 
ATOM   9081  H HG21 . VAL B 2 12 ? -3.632  -2.281  -11.676 1.00 0.00 ? 12 VAL B HG21 12 
ATOM   9082  H HG22 . VAL B 2 12 ? -4.349  -2.095  -13.276 1.00 0.00 ? 12 VAL B HG22 12 
ATOM   9083  H HG23 . VAL B 2 12 ? -3.692  -0.691  -12.436 1.00 0.00 ? 12 VAL B HG23 12 
ATOM   9084  N N    . GLU B 2 13 ? 0.764   -2.142  -13.707 1.00 0.00 ? 13 GLU B N    12 
ATOM   9085  C CA   . GLU B 2 13 ? 2.011   -2.811  -14.169 1.00 0.00 ? 13 GLU B CA   12 
ATOM   9086  C C    . GLU B 2 13 ? 2.932   -3.032  -12.970 1.00 0.00 ? 13 GLU B C    12 
ATOM   9087  O O    . GLU B 2 13 ? 3.699   -3.974  -12.926 1.00 0.00 ? 13 GLU B O    12 
ATOM   9088  C CB   . GLU B 2 13 ? 2.718   -1.927  -15.199 1.00 0.00 ? 13 GLU B CB   12 
ATOM   9089  C CG   . GLU B 2 13 ? 1.909   -1.904  -16.497 1.00 0.00 ? 13 GLU B CG   12 
ATOM   9090  C CD   . GLU B 2 13 ? 2.770   -1.327  -17.623 1.00 0.00 ? 13 GLU B CD   12 
ATOM   9091  O OE1  . GLU B 2 13 ? 3.800   -1.911  -17.914 1.00 0.00 ? 13 GLU B OE1  12 
ATOM   9092  O OE2  . GLU B 2 13 ? 2.382   -0.311  -18.176 1.00 0.00 ? 13 GLU B OE2  12 
ATOM   9093  H H    . GLU B 2 13 ? 0.396   -1.388  -14.211 1.00 0.00 ? 13 GLU B H    12 
ATOM   9094  H HA   . GLU B 2 13 ? 1.766   -3.764  -14.616 1.00 0.00 ? 13 GLU B HA   12 
ATOM   9095  H HB2  . GLU B 2 13 ? 2.807   -0.922  -14.810 1.00 0.00 ? 13 GLU B HB2  12 
ATOM   9096  H HB3  . GLU B 2 13 ? 3.703   -2.324  -15.399 1.00 0.00 ? 13 GLU B HB3  12 
ATOM   9097  H HG2  . GLU B 2 13 ? 1.609   -2.910  -16.751 1.00 0.00 ? 13 GLU B HG2  12 
ATOM   9098  H HG3  . GLU B 2 13 ? 1.033   -1.288  -16.364 1.00 0.00 ? 13 GLU B HG3  12 
ATOM   9099  N N    . ALA B 2 14 ? 2.859   -2.170  -11.992 1.00 0.00 ? 14 ALA B N    12 
ATOM   9100  C CA   . ALA B 2 14 ? 3.724   -2.327  -10.791 1.00 0.00 ? 14 ALA B CA   12 
ATOM   9101  C C    . ALA B 2 14 ? 3.278   -3.563  -10.009 1.00 0.00 ? 14 ALA B C    12 
ATOM   9102  O O    . ALA B 2 14 ? 4.010   -4.524  -9.879  1.00 0.00 ? 14 ALA B O    12 
ATOM   9103  C CB   . ALA B 2 14 ? 3.601   -1.087  -9.904  1.00 0.00 ? 14 ALA B CB   12 
ATOM   9104  H H    . ALA B 2 14 ? 2.230   -1.419  -12.047 1.00 0.00 ? 14 ALA B H    12 
ATOM   9105  H HA   . ALA B 2 14 ? 4.751   -2.450  -11.101 1.00 0.00 ? 14 ALA B HA   12 
ATOM   9106  H HB1  . ALA B 2 14 ? 3.607   -0.202  -10.520 1.00 0.00 ? 14 ALA B HB1  12 
ATOM   9107  H HB2  . ALA B 2 14 ? 4.434   -1.053  -9.216  1.00 0.00 ? 14 ALA B HB2  12 
ATOM   9108  H HB3  . ALA B 2 14 ? 2.677   -1.134  -9.348  1.00 0.00 ? 14 ALA B HB3  12 
ATOM   9109  N N    . LEU B 2 15 ? 2.080   -3.551  -9.491  1.00 0.00 ? 15 LEU B N    12 
ATOM   9110  C CA   . LEU B 2 15 ? 1.598   -4.733  -8.727  1.00 0.00 ? 15 LEU B CA   12 
ATOM   9111  C C    . LEU B 2 15 ? 1.911   -6.001  -9.522  1.00 0.00 ? 15 LEU B C    12 
ATOM   9112  O O    . LEU B 2 15 ? 2.432   -6.963  -8.996  1.00 0.00 ? 15 LEU B O    12 
ATOM   9113  C CB   . LEU B 2 15 ? 0.088   -4.620  -8.513  1.00 0.00 ? 15 LEU B CB   12 
ATOM   9114  C CG   . LEU B 2 15 ? -0.200  -3.497  -7.517  1.00 0.00 ? 15 LEU B CG   12 
ATOM   9115  C CD1  . LEU B 2 15 ? -1.573  -2.892  -7.813  1.00 0.00 ? 15 LEU B CD1  12 
ATOM   9116  C CD2  . LEU B 2 15 ? -0.188  -4.063  -6.093  1.00 0.00 ? 15 LEU B CD2  12 
ATOM   9117  H H    . LEU B 2 15 ? 1.498   -2.771  -9.607  1.00 0.00 ? 15 LEU B H    12 
ATOM   9118  H HA   . LEU B 2 15 ? 2.098   -4.773  -7.770  1.00 0.00 ? 15 LEU B HA   12 
ATOM   9119  H HB2  . LEU B 2 15 ? -0.393  -4.400  -9.454  1.00 0.00 ? 15 LEU B HB2  12 
ATOM   9120  H HB3  . LEU B 2 15 ? -0.290  -5.552  -8.123  1.00 0.00 ? 15 LEU B HB3  12 
ATOM   9121  H HG   . LEU B 2 15 ? 0.558   -2.732  -7.609  1.00 0.00 ? 15 LEU B HG   12 
ATOM   9122  H HD11 . LEU B 2 15 ? -1.599  -1.871  -7.459  1.00 0.00 ? 15 LEU B HD11 12 
ATOM   9123  H HD12 . LEU B 2 15 ? -2.336  -3.468  -7.311  1.00 0.00 ? 15 LEU B HD12 12 
ATOM   9124  H HD13 . LEU B 2 15 ? -1.751  -2.907  -8.878  1.00 0.00 ? 15 LEU B HD13 12 
ATOM   9125  H HD21 . LEU B 2 15 ? 0.820   -4.040  -5.706  1.00 0.00 ? 15 LEU B HD21 12 
ATOM   9126  H HD22 . LEU B 2 15 ? -0.544  -5.083  -6.109  1.00 0.00 ? 15 LEU B HD22 12 
ATOM   9127  H HD23 . LEU B 2 15 ? -0.830  -3.467  -5.463  1.00 0.00 ? 15 LEU B HD23 12 
ATOM   9128  N N    . TYR B 2 16 ? 1.599   -6.004  -10.788 1.00 0.00 ? 16 TYR B N    12 
ATOM   9129  C CA   . TYR B 2 16 ? 1.880   -7.206  -11.623 1.00 0.00 ? 16 TYR B CA   12 
ATOM   9130  C C    . TYR B 2 16 ? 3.345   -7.615  -11.451 1.00 0.00 ? 16 TYR B C    12 
ATOM   9131  O O    . TYR B 2 16 ? 3.648   -8.741  -11.108 1.00 0.00 ? 16 TYR B O    12 
ATOM   9132  C CB   . TYR B 2 16 ? 1.608   -6.880  -13.094 1.00 0.00 ? 16 TYR B CB   12 
ATOM   9133  C CG   . TYR B 2 16 ? 0.349   -7.590  -13.546 1.00 0.00 ? 16 TYR B CG   12 
ATOM   9134  C CD1  . TYR B 2 16 ? 0.187   -8.962  -13.301 1.00 0.00 ? 16 TYR B CD1  12 
ATOM   9135  C CD2  . TYR B 2 16 ? -0.659  -6.877  -14.212 1.00 0.00 ? 16 TYR B CD2  12 
ATOM   9136  C CE1  . TYR B 2 16 ? -0.979  -9.617  -13.721 1.00 0.00 ? 16 TYR B CE1  12 
ATOM   9137  C CE2  . TYR B 2 16 ? -1.824  -7.534  -14.631 1.00 0.00 ? 16 TYR B CE2  12 
ATOM   9138  C CZ   . TYR B 2 16 ? -1.983  -8.903  -14.385 1.00 0.00 ? 16 TYR B CZ   12 
ATOM   9139  O OH   . TYR B 2 16 ? -3.132  -9.547  -14.797 1.00 0.00 ? 16 TYR B OH   12 
ATOM   9140  H H    . TYR B 2 16 ? 1.181   -5.215  -11.191 1.00 0.00 ? 16 TYR B H    12 
ATOM   9141  H HA   . TYR B 2 16 ? 1.240   -8.018  -11.310 1.00 0.00 ? 16 TYR B HA   12 
ATOM   9142  H HB2  . TYR B 2 16 ? 1.483   -5.811  -13.206 1.00 0.00 ? 16 TYR B HB2  12 
ATOM   9143  H HB3  . TYR B 2 16 ? 2.444   -7.208  -13.695 1.00 0.00 ? 16 TYR B HB3  12 
ATOM   9144  H HD1  . TYR B 2 16 ? 0.960   -9.516  -12.789 1.00 0.00 ? 16 TYR B HD1  12 
ATOM   9145  H HD2  . TYR B 2 16 ? -0.540  -5.822  -14.401 1.00 0.00 ? 16 TYR B HD2  12 
ATOM   9146  H HE1  . TYR B 2 16 ? -1.102  -10.673 -13.532 1.00 0.00 ? 16 TYR B HE1  12 
ATOM   9147  H HE2  . TYR B 2 16 ? -2.599  -6.983  -15.143 1.00 0.00 ? 16 TYR B HE2  12 
ATOM   9148  H HH   . TYR B 2 16 ? -2.982  -10.494 -14.734 1.00 0.00 ? 16 TYR B HH   12 
ATOM   9149  N N    . LEU B 2 17 ? 4.261   -6.712  -11.686 1.00 0.00 ? 17 LEU B N    12 
ATOM   9150  C CA   . LEU B 2 17 ? 5.702   -7.057  -11.535 1.00 0.00 ? 17 LEU B CA   12 
ATOM   9151  C C    . LEU B 2 17 ? 6.049   -7.166  -10.050 1.00 0.00 ? 17 LEU B C    12 
ATOM   9152  O O    . LEU B 2 17 ? 7.034   -7.770  -9.674  1.00 0.00 ? 17 LEU B O    12 
ATOM   9153  C CB   . LEU B 2 17 ? 6.561   -5.968  -12.181 1.00 0.00 ? 17 LEU B CB   12 
ATOM   9154  C CG   . LEU B 2 17 ? 7.862   -6.583  -12.695 1.00 0.00 ? 17 LEU B CG   12 
ATOM   9155  C CD1  . LEU B 2 17 ? 7.935   -6.434  -14.215 1.00 0.00 ? 17 LEU B CD1  12 
ATOM   9156  C CD2  . LEU B 2 17 ? 9.053   -5.865  -12.054 1.00 0.00 ? 17 LEU B CD2  12 
ATOM   9157  H H    . LEU B 2 17 ? 4.000   -5.809  -11.963 1.00 0.00 ? 17 LEU B H    12 
ATOM   9158  H HA   . LEU B 2 17 ? 5.897   -8.002  -12.017 1.00 0.00 ? 17 LEU B HA   12 
ATOM   9159  H HB2  . LEU B 2 17 ? 6.020   -5.525  -13.007 1.00 0.00 ? 17 LEU B HB2  12 
ATOM   9160  H HB3  . LEU B 2 17 ? 6.788   -5.206  -11.451 1.00 0.00 ? 17 LEU B HB3  12 
ATOM   9161  H HG   . LEU B 2 17 ? 7.891   -7.631  -12.435 1.00 0.00 ? 17 LEU B HG   12 
ATOM   9162  H HD11 . LEU B 2 17 ? 7.178   -5.736  -14.545 1.00 0.00 ? 17 LEU B HD11 12 
ATOM   9163  H HD12 . LEU B 2 17 ? 7.765   -7.394  -14.679 1.00 0.00 ? 17 LEU B HD12 12 
ATOM   9164  H HD13 . LEU B 2 17 ? 8.910   -6.067  -14.496 1.00 0.00 ? 17 LEU B HD13 12 
ATOM   9165  H HD21 . LEU B 2 17 ? 9.965   -6.169  -12.546 1.00 0.00 ? 17 LEU B HD21 12 
ATOM   9166  H HD22 . LEU B 2 17 ? 9.107   -6.122  -11.007 1.00 0.00 ? 17 LEU B HD22 12 
ATOM   9167  H HD23 . LEU B 2 17 ? 8.927   -4.797  -12.157 1.00 0.00 ? 17 LEU B HD23 12 
ATOM   9168  N N    . VAL B 2 18 ? 5.245   -6.590  -9.202  1.00 0.00 ? 18 VAL B N    12 
ATOM   9169  C CA   . VAL B 2 18 ? 5.527   -6.664  -7.742  1.00 0.00 ? 18 VAL B CA   12 
ATOM   9170  C C    . VAL B 2 18 ? 5.031   -8.006  -7.202  1.00 0.00 ? 18 VAL B C    12 
ATOM   9171  O O    . VAL B 2 18 ? 5.783   -8.775  -6.634  1.00 0.00 ? 18 VAL B O    12 
ATOM   9172  C CB   . VAL B 2 18 ? 4.793   -5.530  -7.024  1.00 0.00 ? 18 VAL B CB   12 
ATOM   9173  C CG1  . VAL B 2 18 ? 5.001   -5.666  -5.517  1.00 0.00 ? 18 VAL B CG1  12 
ATOM   9174  C CG2  . VAL B 2 18 ? 5.347   -4.185  -7.493  1.00 0.00 ? 18 VAL B CG2  12 
ATOM   9175  H H    . VAL B 2 18 ? 4.455   -6.111  -9.525  1.00 0.00 ? 18 VAL B H    12 
ATOM   9176  H HA   . VAL B 2 18 ? 6.589   -6.574  -7.572  1.00 0.00 ? 18 VAL B HA   12 
ATOM   9177  H HB   . VAL B 2 18 ? 3.737   -5.586  -7.247  1.00 0.00 ? 18 VAL B HB   12 
ATOM   9178  H HG11 . VAL B 2 18 ? 5.363   -4.731  -5.118  1.00 0.00 ? 18 VAL B HG11 12 
ATOM   9179  H HG12 . VAL B 2 18 ? 5.723   -6.446  -5.322  1.00 0.00 ? 18 VAL B HG12 12 
ATOM   9180  H HG13 . VAL B 2 18 ? 4.062   -5.920  -5.046  1.00 0.00 ? 18 VAL B HG13 12 
ATOM   9181  H HG21 . VAL B 2 18 ? 4.565   -3.441  -7.452  1.00 0.00 ? 18 VAL B HG21 12 
ATOM   9182  H HG22 . VAL B 2 18 ? 5.705   -4.276  -8.508  1.00 0.00 ? 18 VAL B HG22 12 
ATOM   9183  H HG23 . VAL B 2 18 ? 6.161   -3.887  -6.848  1.00 0.00 ? 18 VAL B HG23 12 
ATOM   9184  N N    . CYS B 2 19 ? 3.771   -8.289  -7.372  1.00 0.00 ? 19 CYS B N    12 
ATOM   9185  C CA   . CYS B 2 19 ? 3.216   -9.577  -6.868  1.00 0.00 ? 19 CYS B CA   12 
ATOM   9186  C C    . CYS B 2 19 ? 3.794   -10.740 -7.677  1.00 0.00 ? 19 CYS B C    12 
ATOM   9187  O O    . CYS B 2 19 ? 4.557   -11.540 -7.172  1.00 0.00 ? 19 CYS B O    12 
ATOM   9188  C CB   . CYS B 2 19 ? 1.694   -9.558  -7.008  1.00 0.00 ? 19 CYS B CB   12 
ATOM   9189  S SG   . CYS B 2 19 ? 1.048   -8.017  -6.314  1.00 0.00 ? 19 CYS B SG   12 
ATOM   9190  H H    . CYS B 2 19 ? 3.186   -7.650  -7.832  1.00 0.00 ? 19 CYS B H    12 
ATOM   9191  H HA   . CYS B 2 19 ? 3.479   -9.698  -5.828  1.00 0.00 ? 19 CYS B HA   12 
ATOM   9192  H HB2  . CYS B 2 19 ? 1.426   -9.621  -8.052  1.00 0.00 ? 19 CYS B HB2  12 
ATOM   9193  H HB3  . CYS B 2 19 ? 1.272   -10.398 -6.475  1.00 0.00 ? 19 CYS B HB3  12 
ATOM   9194  N N    . GLY B 2 20 ? 3.436   -10.845 -8.928  1.00 0.00 ? 20 GLY B N    12 
ATOM   9195  C CA   . GLY B 2 20 ? 3.967   -11.961 -9.761  1.00 0.00 ? 20 GLY B CA   12 
ATOM   9196  C C    . GLY B 2 20 ? 3.277   -13.266 -9.360  1.00 0.00 ? 20 GLY B C    12 
ATOM   9197  O O    . GLY B 2 20 ? 2.341   -13.708 -10.000 1.00 0.00 ? 20 GLY B O    12 
ATOM   9198  H H    . GLY B 2 20 ? 2.821   -10.192 -9.319  1.00 0.00 ? 20 GLY B H    12 
ATOM   9199  H HA2  . GLY B 2 20 ? 3.773   -11.754 -10.804 1.00 0.00 ? 20 GLY B HA2  12 
ATOM   9200  H HA3  . GLY B 2 20 ? 5.030   -12.056 -9.602  1.00 0.00 ? 20 GLY B HA3  12 
ATOM   9201  N N    . GLU B 2 21 ? 3.730   -13.889 -8.306  1.00 0.00 ? 21 GLU B N    12 
ATOM   9202  C CA   . GLU B 2 21 ? 3.102   -15.165 -7.864  1.00 0.00 ? 21 GLU B CA   12 
ATOM   9203  C C    . GLU B 2 21 ? 1.874   -14.860 -7.004  1.00 0.00 ? 21 GLU B C    12 
ATOM   9204  O O    . GLU B 2 21 ? 0.764   -15.232 -7.334  1.00 0.00 ? 21 GLU B O    12 
ATOM   9205  C CB   . GLU B 2 21 ? 4.113   -15.969 -7.043  1.00 0.00 ? 21 GLU B CB   12 
ATOM   9206  C CG   . GLU B 2 21 ? 3.777   -17.457 -7.138  1.00 0.00 ? 21 GLU B CG   12 
ATOM   9207  C CD   . GLU B 2 21 ? 5.067   -18.264 -7.300  1.00 0.00 ? 21 GLU B CD   12 
ATOM   9208  O OE1  . GLU B 2 21 ? 5.988   -18.031 -6.536  1.00 0.00 ? 21 GLU B OE1  12 
ATOM   9209  O OE2  . GLU B 2 21 ? 5.111   -19.102 -8.186  1.00 0.00 ? 21 GLU B OE2  12 
ATOM   9210  H H    . GLU B 2 21 ? 4.485   -13.518 -7.805  1.00 0.00 ? 21 GLU B H    12 
ATOM   9211  H HA   . GLU B 2 21 ? 2.802   -15.739 -8.729  1.00 0.00 ? 21 GLU B HA   12 
ATOM   9212  H HB2  . GLU B 2 21 ? 5.107   -15.798 -7.430  1.00 0.00 ? 21 GLU B HB2  12 
ATOM   9213  H HB3  . GLU B 2 21 ? 4.069   -15.657 -6.011  1.00 0.00 ? 21 GLU B HB3  12 
ATOM   9214  H HG2  . GLU B 2 21 ? 3.268   -17.768 -6.237  1.00 0.00 ? 21 GLU B HG2  12 
ATOM   9215  H HG3  . GLU B 2 21 ? 3.138   -17.628 -7.991  1.00 0.00 ? 21 GLU B HG3  12 
ATOM   9216  N N    . ARG B 2 22 ? 2.060   -14.187 -5.901  1.00 0.00 ? 22 ARG B N    12 
ATOM   9217  C CA   . ARG B 2 22 ? 0.905   -13.859 -5.020  1.00 0.00 ? 22 ARG B CA   12 
ATOM   9218  C C    . ARG B 2 22 ? -0.267  -13.359 -5.869  1.00 0.00 ? 22 ARG B C    12 
ATOM   9219  O O    . ARG B 2 22 ? -1.407  -13.710 -5.640  1.00 0.00 ? 22 ARG B O    12 
ATOM   9220  C CB   . ARG B 2 22 ? 1.314   -12.770 -4.026  1.00 0.00 ? 22 ARG B CB   12 
ATOM   9221  C CG   . ARG B 2 22 ? 2.259   -13.363 -2.979  1.00 0.00 ? 22 ARG B CG   12 
ATOM   9222  C CD   . ARG B 2 22 ? 3.109   -12.245 -2.377  1.00 0.00 ? 22 ARG B CD   12 
ATOM   9223  N NE   . ARG B 2 22 ? 2.638   -11.948 -0.996  1.00 0.00 ? 22 ARG B NE   12 
ATOM   9224  C CZ   . ARG B 2 22 ? 3.266   -11.067 -0.267  1.00 0.00 ? 22 ARG B CZ   12 
ATOM   9225  N NH1  . ARG B 2 22 ? 4.538   -11.217 -0.018  1.00 0.00 ? 22 ARG B NH1  12 
ATOM   9226  N NH2  . ARG B 2 22 ? 2.626   -10.035 0.210   1.00 0.00 ? 22 ARG B NH2  12 
ATOM   9227  H H    . ARG B 2 22 ? 2.964   -13.897 -5.653  1.00 0.00 ? 22 ARG B H    12 
ATOM   9228  H HA   . ARG B 2 22 ? 0.603   -14.743 -4.478  1.00 0.00 ? 22 ARG B HA   12 
ATOM   9229  H HB2  . ARG B 2 22 ? 1.816   -11.973 -4.554  1.00 0.00 ? 22 ARG B HB2  12 
ATOM   9230  H HB3  . ARG B 2 22 ? 0.435   -12.382 -3.535  1.00 0.00 ? 22 ARG B HB3  12 
ATOM   9231  H HG2  . ARG B 2 22 ? 1.682   -13.839 -2.200  1.00 0.00 ? 22 ARG B HG2  12 
ATOM   9232  H HG3  . ARG B 2 22 ? 2.904   -14.091 -3.447  1.00 0.00 ? 22 ARG B HG3  12 
ATOM   9233  H HD2  . ARG B 2 22 ? 4.144   -12.554 -2.347  1.00 0.00 ? 22 ARG B HD2  12 
ATOM   9234  H HD3  . ARG B 2 22 ? 3.016   -11.358 -2.987  1.00 0.00 ? 22 ARG B HD3  12 
ATOM   9235  H HE   . ARG B 2 22 ? 1.854   -12.415 -0.634  1.00 0.00 ? 22 ARG B HE   12 
ATOM   9236  H HH11 . ARG B 2 22 ? 5.031   -12.007 -0.384  1.00 0.00 ? 22 ARG B HH11 12 
ATOM   9237  H HH12 . ARG B 2 22 ? 5.022   -10.540 0.538   1.00 0.00 ? 22 ARG B HH12 12 
ATOM   9238  H HH21 . ARG B 2 22 ? 1.651   -9.919  0.019   1.00 0.00 ? 22 ARG B HH21 12 
ATOM   9239  H HH22 . ARG B 2 22 ? 3.110   -9.360  0.767   1.00 0.00 ? 22 ARG B HH22 12 
ATOM   9240  N N    . GLY B 2 23 ? 0.004   -12.539 -6.849  1.00 0.00 ? 23 GLY B N    12 
ATOM   9241  C CA   . GLY B 2 23 ? -1.096  -12.018 -7.708  1.00 0.00 ? 23 GLY B CA   12 
ATOM   9242  C C    . GLY B 2 23 ? -1.623  -10.706 -7.126  1.00 0.00 ? 23 GLY B C    12 
ATOM   9243  O O    . GLY B 2 23 ? -1.001  -10.100 -6.277  1.00 0.00 ? 23 GLY B O    12 
ATOM   9244  H H    . GLY B 2 23 ? 0.929   -12.266 -7.019  1.00 0.00 ? 23 GLY B H    12 
ATOM   9245  H HA2  . GLY B 2 23 ? -0.720  -11.846 -8.707  1.00 0.00 ? 23 GLY B HA2  12 
ATOM   9246  H HA3  . GLY B 2 23 ? -1.898  -12.740 -7.744  1.00 0.00 ? 23 GLY B HA3  12 
ATOM   9247  N N    . PHE B 2 24 ? -2.770  -10.269 -7.569  1.00 0.00 ? 24 PHE B N    12 
ATOM   9248  C CA   . PHE B 2 24 ? -3.343  -8.996  -7.035  1.00 0.00 ? 24 PHE B CA   12 
ATOM   9249  C C    . PHE B 2 24 ? -4.648  -8.673  -7.772  1.00 0.00 ? 24 PHE B C    12 
ATOM   9250  O O    . PHE B 2 24 ? -4.957  -9.256  -8.793  1.00 0.00 ? 24 PHE B O    12 
ATOM   9251  C CB   . PHE B 2 24 ? -2.323  -7.846  -7.201  1.00 0.00 ? 24 PHE B CB   12 
ATOM   9252  C CG   . PHE B 2 24 ? -2.549  -7.090  -8.507  1.00 0.00 ? 24 PHE B CG   12 
ATOM   9253  C CD1  . PHE B 2 24 ? -2.299  -7.713  -9.737  1.00 0.00 ? 24 PHE B CD1  12 
ATOM   9254  C CD2  . PHE B 2 24 ? -3.014  -5.761  -8.483  1.00 0.00 ? 24 PHE B CD2  12 
ATOM   9255  C CE1  . PHE B 2 24 ? -2.509  -7.019  -10.935 1.00 0.00 ? 24 PHE B CE1  12 
ATOM   9256  C CE2  . PHE B 2 24 ? -3.223  -5.070  -9.684  1.00 0.00 ? 24 PHE B CE2  12 
ATOM   9257  C CZ   . PHE B 2 24 ? -2.970  -5.699  -10.908 1.00 0.00 ? 24 PHE B CZ   12 
ATOM   9258  H H    . PHE B 2 24 ? -3.261  -10.787 -8.246  1.00 0.00 ? 24 PHE B H    12 
ATOM   9259  H HA   . PHE B 2 24 ? -3.560  -9.126  -5.984  1.00 0.00 ? 24 PHE B HA   12 
ATOM   9260  H HB2  . PHE B 2 24 ? -2.432  -7.159  -6.375  1.00 0.00 ? 24 PHE B HB2  12 
ATOM   9261  H HB3  . PHE B 2 24 ? -1.319  -8.258  -7.189  1.00 0.00 ? 24 PHE B HB3  12 
ATOM   9262  H HD1  . PHE B 2 24 ? -1.945  -8.727  -9.766  1.00 0.00 ? 24 PHE B HD1  12 
ATOM   9263  H HD2  . PHE B 2 24 ? -3.212  -5.267  -7.543  1.00 0.00 ? 24 PHE B HD2  12 
ATOM   9264  H HE1  . PHE B 2 24 ? -2.314  -7.503  -11.881 1.00 0.00 ? 24 PHE B HE1  12 
ATOM   9265  H HE2  . PHE B 2 24 ? -3.579  -4.050  -9.665  1.00 0.00 ? 24 PHE B HE2  12 
ATOM   9266  H HZ   . PHE B 2 24 ? -3.132  -5.164  -11.833 1.00 0.00 ? 24 PHE B HZ   12 
ATOM   9267  N N    . PHE B 2 25 ? -5.412  -7.743  -7.266  1.00 0.00 ? 25 PHE B N    12 
ATOM   9268  C CA   . PHE B 2 25 ? -6.691  -7.385  -7.948  1.00 0.00 ? 25 PHE B CA   12 
ATOM   9269  C C    . PHE B 2 25 ? -7.169  -6.006  -7.489  1.00 0.00 ? 25 PHE B C    12 
ATOM   9270  O O    . PHE B 2 25 ? -8.336  -5.791  -7.237  1.00 0.00 ? 25 PHE B O    12 
ATOM   9271  C CB   . PHE B 2 25 ? -7.759  -8.451  -7.659  1.00 0.00 ? 25 PHE B CB   12 
ATOM   9272  C CG   . PHE B 2 25 ? -8.227  -8.394  -6.217  1.00 0.00 ? 25 PHE B CG   12 
ATOM   9273  C CD1  . PHE B 2 25 ? -7.522  -7.654  -5.255  1.00 0.00 ? 25 PHE B CD1  12 
ATOM   9274  C CD2  . PHE B 2 25 ? -9.380  -9.101  -5.841  1.00 0.00 ? 25 PHE B CD2  12 
ATOM   9275  C CE1  . PHE B 2 25 ? -7.971  -7.621  -3.927  1.00 0.00 ? 25 PHE B CE1  12 
ATOM   9276  C CE2  . PHE B 2 25 ? -9.825  -9.067  -4.515  1.00 0.00 ? 25 PHE B CE2  12 
ATOM   9277  C CZ   . PHE B 2 25 ? -9.122  -8.327  -3.557  1.00 0.00 ? 25 PHE B CZ   12 
ATOM   9278  H H    . PHE B 2 25 ? -5.141  -7.280  -6.449  1.00 0.00 ? 25 PHE B H    12 
ATOM   9279  H HA   . PHE B 2 25 ? -6.513  -7.347  -9.011  1.00 0.00 ? 25 PHE B HA   12 
ATOM   9280  H HB2  . PHE B 2 25 ? -8.605  -8.289  -8.309  1.00 0.00 ? 25 PHE B HB2  12 
ATOM   9281  H HB3  . PHE B 2 25 ? -7.343  -9.428  -7.859  1.00 0.00 ? 25 PHE B HB3  12 
ATOM   9282  H HD1  . PHE B 2 25 ? -6.639  -7.109  -5.531  1.00 0.00 ? 25 PHE B HD1  12 
ATOM   9283  H HD2  . PHE B 2 25 ? -9.924  -9.672  -6.579  1.00 0.00 ? 25 PHE B HD2  12 
ATOM   9284  H HE1  . PHE B 2 25 ? -7.427  -7.051  -3.188  1.00 0.00 ? 25 PHE B HE1  12 
ATOM   9285  H HE2  . PHE B 2 25 ? -10.713 -9.613  -4.229  1.00 0.00 ? 25 PHE B HE2  12 
ATOM   9286  H HZ   . PHE B 2 25 ? -9.466  -8.302  -2.534  1.00 0.00 ? 25 PHE B HZ   12 
ATOM   9287  N N    . TYR B 2 26 ? -6.266  -5.069  -7.400  1.00 0.00 ? 26 TYR B N    12 
ATOM   9288  C CA   . TYR B 2 26 ? -6.638  -3.685  -6.979  1.00 0.00 ? 26 TYR B CA   12 
ATOM   9289  C C    . TYR B 2 26 ? -7.535  -3.721  -5.738  1.00 0.00 ? 26 TYR B C    12 
ATOM   9290  O O    . TYR B 2 26 ? -8.712  -4.009  -5.815  1.00 0.00 ? 26 TYR B O    12 
ATOM   9291  C CB   . TYR B 2 26 ? -7.383  -2.994  -8.122  1.00 0.00 ? 26 TYR B CB   12 
ATOM   9292  C CG   . TYR B 2 26 ? -6.471  -1.989  -8.784  1.00 0.00 ? 26 TYR B CG   12 
ATOM   9293  C CD1  . TYR B 2 26 ? -5.645  -1.170  -8.003  1.00 0.00 ? 26 TYR B CD1  12 
ATOM   9294  C CD2  . TYR B 2 26 ? -6.452  -1.875  -10.180 1.00 0.00 ? 26 TYR B CD2  12 
ATOM   9295  C CE1  . TYR B 2 26 ? -4.800  -0.238  -8.617  1.00 0.00 ? 26 TYR B CE1  12 
ATOM   9296  C CE2  . TYR B 2 26 ? -5.606  -0.943  -10.794 1.00 0.00 ? 26 TYR B CE2  12 
ATOM   9297  C CZ   . TYR B 2 26 ? -4.779  -0.125  -10.013 1.00 0.00 ? 26 TYR B CZ   12 
ATOM   9298  O OH   . TYR B 2 26 ? -3.945  0.794   -10.620 1.00 0.00 ? 26 TYR B OH   12 
ATOM   9299  H H    . TYR B 2 26 ? -5.335  -5.275  -7.626  1.00 0.00 ? 26 TYR B H    12 
ATOM   9300  H HA   . TYR B 2 26 ? -5.741  -3.131  -6.753  1.00 0.00 ? 26 TYR B HA   12 
ATOM   9301  H HB2  . TYR B 2 26 ? -7.694  -3.732  -8.848  1.00 0.00 ? 26 TYR B HB2  12 
ATOM   9302  H HB3  . TYR B 2 26 ? -8.253  -2.486  -7.730  1.00 0.00 ? 26 TYR B HB3  12 
ATOM   9303  H HD1  . TYR B 2 26 ? -5.661  -1.259  -6.926  1.00 0.00 ? 26 TYR B HD1  12 
ATOM   9304  H HD2  . TYR B 2 26 ? -7.088  -2.506  -10.783 1.00 0.00 ? 26 TYR B HD2  12 
ATOM   9305  H HE1  . TYR B 2 26 ? -4.163  0.391   -8.014  1.00 0.00 ? 26 TYR B HE1  12 
ATOM   9306  H HE2  . TYR B 2 26 ? -5.593  -0.854  -11.871 1.00 0.00 ? 26 TYR B HE2  12 
ATOM   9307  H HH   . TYR B 2 26 ? -3.156  0.331   -10.909 1.00 0.00 ? 26 TYR B HH   12 
ATOM   9308  N N    . THR B 2 27 ? -6.988  -3.411  -4.594  1.00 0.00 ? 27 THR B N    12 
ATOM   9309  C CA   . THR B 2 27 ? -7.810  -3.412  -3.351  1.00 0.00 ? 27 THR B CA   12 
ATOM   9310  C C    . THR B 2 27 ? -8.595  -2.099  -3.265  1.00 0.00 ? 27 THR B C    12 
ATOM   9311  O O    . THR B 2 27 ? -8.313  -1.153  -3.972  1.00 0.00 ? 27 THR B O    12 
ATOM   9312  C CB   . THR B 2 27 ? -6.896  -3.544  -2.131  1.00 0.00 ? 27 THR B CB   12 
ATOM   9313  O OG1  . THR B 2 27 ? -6.319  -2.282  -1.832  1.00 0.00 ? 27 THR B OG1  12 
ATOM   9314  C CG2  . THR B 2 27 ? -5.789  -4.556  -2.430  1.00 0.00 ? 27 THR B CG2  12 
ATOM   9315  H H    . THR B 2 27 ? -6.040  -3.169  -4.555  1.00 0.00 ? 27 THR B H    12 
ATOM   9316  H HA   . THR B 2 27 ? -8.499  -4.240  -3.377  1.00 0.00 ? 27 THR B HA   12 
ATOM   9317  H HB   . THR B 2 27 ? -7.472  -3.887  -1.285  1.00 0.00 ? 27 THR B HB   12 
ATOM   9318  H HG1  . THR B 2 27 ? -5.657  -2.412  -1.150  1.00 0.00 ? 27 THR B HG1  12 
ATOM   9319  H HG21 . THR B 2 27 ? -5.159  -4.175  -3.221  1.00 0.00 ? 27 THR B HG21 12 
ATOM   9320  H HG22 . THR B 2 27 ? -6.231  -5.491  -2.740  1.00 0.00 ? 27 THR B HG22 12 
ATOM   9321  H HG23 . THR B 2 27 ? -5.195  -4.714  -1.541  1.00 0.00 ? 27 THR B HG23 12 
ATOM   9322  N N    . LYS B 2 28 ? -9.582  -2.034  -2.411  1.00 0.00 ? 28 LYS B N    12 
ATOM   9323  C CA   . LYS B 2 28 ? -10.380 -0.780  -2.296  1.00 0.00 ? 28 LYS B CA   12 
ATOM   9324  C C    . LYS B 2 28 ? -10.500 -0.370  -0.823  1.00 0.00 ? 28 LYS B C    12 
ATOM   9325  O O    . LYS B 2 28 ? -11.575 -0.403  -0.259  1.00 0.00 ? 28 LYS B O    12 
ATOM   9326  C CB   . LYS B 2 28 ? -11.778 -1.009  -2.878  1.00 0.00 ? 28 LYS B CB   12 
ATOM   9327  C CG   . LYS B 2 28 ? -12.036 0.001   -3.998  1.00 0.00 ? 28 LYS B CG   12 
ATOM   9328  C CD   . LYS B 2 28 ? -13.354 -0.334  -4.699  1.00 0.00 ? 28 LYS B CD   12 
ATOM   9329  C CE   . LYS B 2 28 ? -13.137 -0.347  -6.214  1.00 0.00 ? 28 LYS B CE   12 
ATOM   9330  N NZ   . LYS B 2 28 ? -14.264 -1.064  -6.872  1.00 0.00 ? 28 LYS B NZ   12 
ATOM   9331  H H    . LYS B 2 28 ? -9.800  -2.809  -1.851  1.00 0.00 ? 28 LYS B H    12 
ATOM   9332  H HA   . LYS B 2 28 ? -9.889  0.009   -2.846  1.00 0.00 ? 28 LYS B HA   12 
ATOM   9333  H HB2  . LYS B 2 28 ? -11.842 -2.012  -3.275  1.00 0.00 ? 28 LYS B HB2  12 
ATOM   9334  H HB3  . LYS B 2 28 ? -12.518 -0.881  -2.102  1.00 0.00 ? 28 LYS B HB3  12 
ATOM   9335  H HG2  . LYS B 2 28 ? -12.092 0.995   -3.579  1.00 0.00 ? 28 LYS B HG2  12 
ATOM   9336  H HG3  . LYS B 2 28 ? -11.229 -0.042  -4.714  1.00 0.00 ? 28 LYS B HG3  12 
ATOM   9337  H HD2  . LYS B 2 28 ? -13.698 -1.307  -4.374  1.00 0.00 ? 28 LYS B HD2  12 
ATOM   9338  H HD3  . LYS B 2 28 ? -14.093 0.411   -4.450  1.00 0.00 ? 28 LYS B HD3  12 
ATOM   9339  H HE2  . LYS B 2 28 ? -13.093 0.668   -6.580  1.00 0.00 ? 28 LYS B HE2  12 
ATOM   9340  H HE3  . LYS B 2 28 ? -12.208 -0.851  -6.439  1.00 0.00 ? 28 LYS B HE3  12 
ATOM   9341  H HZ1  . LYS B 2 28 ? -13.887 -1.773  -7.531  1.00 0.00 ? 28 LYS B HZ1  12 
ATOM   9342  H HZ2  . LYS B 2 28 ? -14.851 -0.381  -7.396  1.00 0.00 ? 28 LYS B HZ2  12 
ATOM   9343  H HZ3  . LYS B 2 28 ? -14.843 -1.539  -6.151  1.00 0.00 ? 28 LYS B HZ3  12 
ATOM   9344  N N    . PRO B 2 29 ? -9.388  0.014   -0.251  1.00 0.00 ? 29 PRO B N    12 
ATOM   9345  C CA   . PRO B 2 29 ? -9.327  0.450   1.154   1.00 0.00 ? 29 PRO B CA   12 
ATOM   9346  C C    . PRO B 2 29 ? -9.830  1.892   1.278   1.00 0.00 ? 29 PRO B C    12 
ATOM   9347  O O    . PRO B 2 29 ? -9.590  2.717   0.419   1.00 0.00 ? 29 PRO B O    12 
ATOM   9348  C CB   . PRO B 2 29 ? -7.837  0.361   1.493   1.00 0.00 ? 29 PRO B CB   12 
ATOM   9349  C CG   . PRO B 2 29 ? -7.078  0.434   0.145   1.00 0.00 ? 29 PRO B CG   12 
ATOM   9350  C CD   . PRO B 2 29 ? -8.088  0.044   -0.950  1.00 0.00 ? 29 PRO B CD   12 
ATOM   9351  H HA   . PRO B 2 29 ? -9.893  -0.212  1.789   1.00 0.00 ? 29 PRO B HA   12 
ATOM   9352  H HB2  . PRO B 2 29 ? -7.552  1.188   2.129   1.00 0.00 ? 29 PRO B HB2  12 
ATOM   9353  H HB3  . PRO B 2 29 ? -7.622  -0.576  1.981   1.00 0.00 ? 29 PRO B HB3  12 
ATOM   9354  H HG2  . PRO B 2 29 ? -6.717  1.440   -0.020  1.00 0.00 ? 29 PRO B HG2  12 
ATOM   9355  H HG3  . PRO B 2 29 ? -6.254  -0.262  0.146   1.00 0.00 ? 29 PRO B HG3  12 
ATOM   9356  H HD2  . PRO B 2 29 ? -8.097  0.787   -1.736  1.00 0.00 ? 29 PRO B HD2  12 
ATOM   9357  H HD3  . PRO B 2 29 ? -7.858  -0.930  -1.349  1.00 0.00 ? 29 PRO B HD3  12 
ATOM   9358  N N    . THR B 2 30 ? -10.526 2.202   2.336   1.00 0.00 ? 30 THR B N    12 
ATOM   9359  C CA   . THR B 2 30 ? -11.043 3.591   2.502   1.00 0.00 ? 30 THR B CA   12 
ATOM   9360  C C    . THR B 2 30 ? -9.879  4.581   2.438   1.00 0.00 ? 30 THR B C    12 
ATOM   9361  O O    . THR B 2 30 ? -10.113 5.716   2.057   1.00 0.00 ? 30 THR B O    12 
ATOM   9362  C CB   . THR B 2 30 ? -11.748 3.719   3.856   1.00 0.00 ? 30 THR B CB   12 
ATOM   9363  O OG1  . THR B 2 30 ? -12.018 5.090   4.126   1.00 0.00 ? 30 THR B OG1  12 
ATOM   9364  C CG2  . THR B 2 30 ? -10.854 3.151   4.959   1.00 0.00 ? 30 THR B CG2  12 
ATOM   9365  O OXT  . THR B 2 30 ? -8.772  4.188   2.770   1.00 0.00 ? 30 THR B OXT  12 
ATOM   9366  H H    . THR B 2 30 ? -10.713 1.525   3.018   1.00 0.00 ? 30 THR B H    12 
ATOM   9367  H HA   . THR B 2 30 ? -11.743 3.810   1.710   1.00 0.00 ? 30 THR B HA   12 
ATOM   9368  H HB   . THR B 2 30 ? -12.675 3.168   3.832   1.00 0.00 ? 30 THR B HB   12 
ATOM   9369  H HG1  . THR B 2 30 ? -11.901 5.585   3.312   1.00 0.00 ? 30 THR B HG1  12 
ATOM   9370  H HG21 . THR B 2 30 ? -9.897  3.651   4.940   1.00 0.00 ? 30 THR B HG21 12 
ATOM   9371  H HG22 . THR B 2 30 ? -10.711 2.093   4.797   1.00 0.00 ? 30 THR B HG22 12 
ATOM   9372  H HG23 . THR B 2 30 ? -11.323 3.308   5.918   1.00 0.00 ? 30 THR B HG23 12 
ATOM   9373  N N    . GLY A 1 1  ? -6.988  4.230   -1.009  1.00 0.00 ? 1  GLY A N    13 
ATOM   9374  C CA   . GLY A 1 1  ? -6.273  2.922   -1.345  1.00 0.00 ? 1  GLY A CA   13 
ATOM   9375  C C    . GLY A 1 1  ? -4.896  2.966   -1.917  1.00 0.00 ? 1  GLY A C    13 
ATOM   9376  O O    . GLY A 1 1  ? -4.127  3.865   -1.640  1.00 0.00 ? 1  GLY A O    13 
ATOM   9377  H H1   . GLY A 1 1  ? -7.139  4.289   0.018   1.00 0.00 ? 1  GLY A H1   13 
ATOM   9378  H H2   . GLY A 1 1  ? -7.907  4.259   -1.497  1.00 0.00 ? 1  GLY A H2   13 
ATOM   9379  H H3   . GLY A 1 1  ? -6.406  5.034   -1.318  1.00 0.00 ? 1  GLY A H3   13 
ATOM   9380  H HA2  . GLY A 1 1  ? -5.822  2.554   -0.564  1.00 0.00 ? 1  GLY A HA2  13 
ATOM   9381  H HA3  . GLY A 1 1  ? -7.075  2.199   -1.789  1.00 0.00 ? 1  GLY A HA3  13 
HETATM 9382  N N    . IIL A 1 2  ? -4.549  2.001   -2.724  1.00 0.00 ? 2  IIL A N    13 
HETATM 9383  C CA   . IIL A 1 2  ? -3.187  1.985   -3.327  1.00 0.00 ? 2  IIL A CA   13 
HETATM 9384  C C    . IIL A 1 2  ? -3.167  2.877   -4.569  1.00 0.00 ? 2  IIL A C    13 
HETATM 9385  O O    . IIL A 1 2  ? -2.134  3.367   -4.977  1.00 0.00 ? 2  IIL A O    13 
HETATM 9386  C CB   . IIL A 1 2  ? -2.830  0.552   -3.729  1.00 0.00 ? 2  IIL A CB   13 
HETATM 9387  C CG2  . IIL A 1 2  ? -1.360  0.492   -4.147  1.00 0.00 ? 2  IIL A CG2  13 
HETATM 9388  C CG1  . IIL A 1 2  ? -3.712  0.117   -4.901  1.00 0.00 ? 2  IIL A CG1  13 
HETATM 9389  C CD1  . IIL A 1 2  ? -4.196  -1.316  -4.673  1.00 0.00 ? 2  IIL A CD1  13 
HETATM 9390  H H    . IIL A 1 2  ? -5.185  1.285   -2.932  1.00 0.00 ? 2  IIL A H    13 
HETATM 9391  H HA   . IIL A 1 2  ? -2.467  2.349   -2.609  1.00 0.00 ? 2  IIL A HA   13 
HETATM 9392  H HB   . IIL A 1 2  ? -2.993  -0.110  -2.890  1.00 0.00 ? 2  IIL A HB   13 
HETATM 9393  H HG21 . IIL A 1 2  ? -1.238  -0.243  -4.928  1.00 0.00 ? 2  IIL A HG21 13 
HETATM 9394  H HG22 . IIL A 1 2  ? -0.754  0.216   -3.296  1.00 0.00 ? 2  IIL A HG22 13 
HETATM 9395  H HG23 . IIL A 1 2  ? -1.048  1.460   -4.511  1.00 0.00 ? 2  IIL A HG23 13 
HETATM 9396  H HG12 . IIL A 1 2  ? -3.143  0.162   -5.817  1.00 0.00 ? 2  IIL A HG12 13 
HETATM 9397  H HG13 . IIL A 1 2  ? -4.564  0.779   -4.974  1.00 0.00 ? 2  IIL A HG13 13 
HETATM 9398  H HD11 . IIL A 1 2  ? -3.566  -1.999  -5.223  1.00 0.00 ? 2  IIL A HD11 13 
HETATM 9399  H HD12 . IIL A 1 2  ? -5.216  -1.409  -5.016  1.00 0.00 ? 2  IIL A HD12 13 
HETATM 9400  H HD13 . IIL A 1 2  ? -4.147  -1.548  -3.619  1.00 0.00 ? 2  IIL A HD13 13 
ATOM   9401  N N    . VAL A 1 3  ? -4.301  3.083   -5.178  1.00 0.00 ? 3  VAL A N    13 
ATOM   9402  C CA   . VAL A 1 3  ? -4.350  3.934   -6.399  1.00 0.00 ? 3  VAL A CA   13 
ATOM   9403  C C    . VAL A 1 3  ? -4.369  5.414   -6.007  1.00 0.00 ? 3  VAL A C    13 
ATOM   9404  O O    . VAL A 1 3  ? -3.797  6.249   -6.678  1.00 0.00 ? 3  VAL A O    13 
ATOM   9405  C CB   . VAL A 1 3  ? -5.617  3.605   -7.191  1.00 0.00 ? 3  VAL A CB   13 
ATOM   9406  C CG1  . VAL A 1 3  ? -5.677  4.483   -8.440  1.00 0.00 ? 3  VAL A CG1  13 
ATOM   9407  C CG2  . VAL A 1 3  ? -5.593  2.131   -7.605  1.00 0.00 ? 3  VAL A CG2  13 
ATOM   9408  H H    . VAL A 1 3  ? -5.123  2.673   -4.836  1.00 0.00 ? 3  VAL A H    13 
ATOM   9409  H HA   . VAL A 1 3  ? -3.483  3.735   -7.011  1.00 0.00 ? 3  VAL A HA   13 
ATOM   9410  H HB   . VAL A 1 3  ? -6.484  3.794   -6.575  1.00 0.00 ? 3  VAL A HB   13 
ATOM   9411  H HG11 . VAL A 1 3  ? -6.000  3.889   -9.283  1.00 0.00 ? 3  VAL A HG11 13 
ATOM   9412  H HG12 . VAL A 1 3  ? -4.698  4.891   -8.641  1.00 0.00 ? 3  VAL A HG12 13 
ATOM   9413  H HG13 . VAL A 1 3  ? -6.378  5.289   -8.280  1.00 0.00 ? 3  VAL A HG13 13 
ATOM   9414  H HG21 . VAL A 1 3  ? -6.191  1.998   -8.494  1.00 0.00 ? 3  VAL A HG21 13 
ATOM   9415  H HG22 . VAL A 1 3  ? -5.997  1.526   -6.806  1.00 0.00 ? 3  VAL A HG22 13 
ATOM   9416  H HG23 . VAL A 1 3  ? -4.576  1.829   -7.806  1.00 0.00 ? 3  VAL A HG23 13 
ATOM   9417  N N    . GLU A 1 4  ? -5.031  5.748   -4.933  1.00 0.00 ? 4  GLU A N    13 
ATOM   9418  C CA   . GLU A 1 4  ? -5.095  7.177   -4.513  1.00 0.00 ? 4  GLU A CA   13 
ATOM   9419  C C    . GLU A 1 4  ? -3.800  7.575   -3.799  1.00 0.00 ? 4  GLU A C    13 
ATOM   9420  O O    . GLU A 1 4  ? -3.630  8.710   -3.396  1.00 0.00 ? 4  GLU A O    13 
ATOM   9421  C CB   . GLU A 1 4  ? -6.276  7.377   -3.562  1.00 0.00 ? 4  GLU A CB   13 
ATOM   9422  C CG   . GLU A 1 4  ? -7.488  6.595   -4.074  1.00 0.00 ? 4  GLU A CG   13 
ATOM   9423  C CD   . GLU A 1 4  ? -7.859  7.091   -5.473  1.00 0.00 ? 4  GLU A CD   13 
ATOM   9424  O OE1  . GLU A 1 4  ? -8.296  8.224   -5.583  1.00 0.00 ? 4  GLU A OE1  13 
ATOM   9425  O OE2  . GLU A 1 4  ? -7.699  6.328   -6.412  1.00 0.00 ? 4  GLU A OE2  13 
ATOM   9426  H H    . GLU A 1 4  ? -5.494  5.062   -4.408  1.00 0.00 ? 4  GLU A H    13 
ATOM   9427  H HA   . GLU A 1 4  ? -5.228  7.801   -5.384  1.00 0.00 ? 4  GLU A HA   13 
ATOM   9428  H HB2  . GLU A 1 4  ? -6.008  7.021   -2.577  1.00 0.00 ? 4  GLU A HB2  13 
ATOM   9429  H HB3  . GLU A 1 4  ? -6.522  8.426   -3.510  1.00 0.00 ? 4  GLU A HB3  13 
ATOM   9430  H HG2  . GLU A 1 4  ? -7.250  5.543   -4.114  1.00 0.00 ? 4  GLU A HG2  13 
ATOM   9431  H HG3  . GLU A 1 4  ? -8.321  6.750   -3.408  1.00 0.00 ? 4  GLU A HG3  13 
ATOM   9432  N N    . GLN A 1 5  ? -2.888  6.659   -3.628  1.00 0.00 ? 5  GLN A N    13 
ATOM   9433  C CA   . GLN A 1 5  ? -1.620  7.002   -2.929  1.00 0.00 ? 5  GLN A CA   13 
ATOM   9434  C C    . GLN A 1 5  ? -0.472  7.109   -3.938  1.00 0.00 ? 5  GLN A C    13 
ATOM   9435  O O    . GLN A 1 5  ? 0.211   8.113   -4.007  1.00 0.00 ? 5  GLN A O    13 
ATOM   9436  C CB   . GLN A 1 5  ? -1.298  5.916   -1.903  1.00 0.00 ? 5  GLN A CB   13 
ATOM   9437  C CG   . GLN A 1 5  ? 0.020   6.255   -1.208  1.00 0.00 ? 5  GLN A CG   13 
ATOM   9438  C CD   . GLN A 1 5  ? -0.258  7.147   0.002   1.00 0.00 ? 5  GLN A CD   13 
ATOM   9439  O OE1  . GLN A 1 5  ? -1.056  6.807   0.852   1.00 0.00 ? 5  GLN A OE1  13 
ATOM   9440  N NE2  . GLN A 1 5  ? 0.371   8.285   0.116   1.00 0.00 ? 5  GLN A NE2  13 
ATOM   9441  H H    . GLN A 1 5  ? -3.039  5.746   -3.951  1.00 0.00 ? 5  GLN A H    13 
ATOM   9442  H HA   . GLN A 1 5  ? -1.739  7.949   -2.422  1.00 0.00 ? 5  GLN A HA   13 
ATOM   9443  H HB2  . GLN A 1 5  ? -2.091  5.866   -1.170  1.00 0.00 ? 5  GLN A HB2  13 
ATOM   9444  H HB3  . GLN A 1 5  ? -1.206  4.964   -2.401  1.00 0.00 ? 5  GLN A HB3  13 
ATOM   9445  H HG2  . GLN A 1 5  ? 0.501   5.344   -0.885  1.00 0.00 ? 5  GLN A HG2  13 
ATOM   9446  H HG3  . GLN A 1 5  ? 0.664   6.779   -1.899  1.00 0.00 ? 5  GLN A HG3  13 
ATOM   9447  H HE21 . GLN A 1 5  ? 1.013   8.560   -0.571  1.00 0.00 ? 5  GLN A HE21 13 
ATOM   9448  H HE22 . GLN A 1 5  ? 0.199   8.865   0.886   1.00 0.00 ? 5  GLN A HE22 13 
ATOM   9449  N N    . CYS A 1 6  ? -0.242  6.085   -4.714  1.00 0.00 ? 6  CYS A N    13 
ATOM   9450  C CA   . CYS A 1 6  ? 0.873   6.137   -5.704  1.00 0.00 ? 6  CYS A CA   13 
ATOM   9451  C C    . CYS A 1 6  ? 0.479   7.026   -6.884  1.00 0.00 ? 6  CYS A C    13 
ATOM   9452  O O    . CYS A 1 6  ? 1.306   7.411   -7.686  1.00 0.00 ? 6  CYS A O    13 
ATOM   9453  C CB   . CYS A 1 6  ? 1.176   4.725   -6.209  1.00 0.00 ? 6  CYS A CB   13 
ATOM   9454  S SG   . CYS A 1 6  ? 1.207   3.582   -4.807  1.00 0.00 ? 6  CYS A SG   13 
ATOM   9455  H H    . CYS A 1 6  ? -0.797  5.279   -4.642  1.00 0.00 ? 6  CYS A H    13 
ATOM   9456  H HA   . CYS A 1 6  ? 1.754   6.544   -5.229  1.00 0.00 ? 6  CYS A HA   13 
ATOM   9457  H HB2  . CYS A 1 6  ? 0.412   4.421   -6.909  1.00 0.00 ? 6  CYS A HB2  13 
ATOM   9458  H HB3  . CYS A 1 6  ? 2.137   4.717   -6.700  1.00 0.00 ? 6  CYS A HB3  13 
ATOM   9459  N N    . CYS A 1 7  ? -0.776  7.358   -6.999  1.00 0.00 ? 7  CYS A N    13 
ATOM   9460  C CA   . CYS A 1 7  ? -1.211  8.224   -8.128  1.00 0.00 ? 7  CYS A CA   13 
ATOM   9461  C C    . CYS A 1 7  ? -1.346  9.664   -7.637  1.00 0.00 ? 7  CYS A C    13 
ATOM   9462  O O    . CYS A 1 7  ? -1.171  10.604  -8.387  1.00 0.00 ? 7  CYS A O    13 
ATOM   9463  C CB   . CYS A 1 7  ? -2.550  7.727   -8.674  1.00 0.00 ? 7  CYS A CB   13 
ATOM   9464  S SG   . CYS A 1 7  ? -2.900  8.560   -10.239 1.00 0.00 ? 7  CYS A SG   13 
ATOM   9465  H H    . CYS A 1 7  ? -1.432  7.040   -6.343  1.00 0.00 ? 7  CYS A H    13 
ATOM   9466  H HA   . CYS A 1 7  ? -0.469  8.187   -8.911  1.00 0.00 ? 7  CYS A HA   13 
ATOM   9467  H HB2  . CYS A 1 7  ? -2.498  6.662   -8.837  1.00 0.00 ? 7  CYS A HB2  13 
ATOM   9468  H HB3  . CYS A 1 7  ? -3.333  7.943   -7.967  1.00 0.00 ? 7  CYS A HB3  13 
ATOM   9469  N N    . THR A 1 8  ? -1.638  9.847   -6.379  1.00 0.00 ? 8  THR A N    13 
ATOM   9470  C CA   . THR A 1 8  ? -1.761  11.229  -5.841  1.00 0.00 ? 8  THR A CA   13 
ATOM   9471  C C    . THR A 1 8  ? -0.355  11.814  -5.688  1.00 0.00 ? 8  THR A C    13 
ATOM   9472  O O    . THR A 1 8  ? -0.159  13.012  -5.690  1.00 0.00 ? 8  THR A O    13 
ATOM   9473  C CB   . THR A 1 8  ? -2.456  11.187  -4.476  1.00 0.00 ? 8  THR A CB   13 
ATOM   9474  O OG1  . THR A 1 8  ? -2.844  12.502  -4.102  1.00 0.00 ? 8  THR A OG1  13 
ATOM   9475  C CG2  . THR A 1 8  ? -1.499  10.617  -3.428  1.00 0.00 ? 8  THR A CG2  13 
ATOM   9476  H H    . THR A 1 8  ? -1.761  9.076   -5.787  1.00 0.00 ? 8  THR A H    13 
ATOM   9477  H HA   . THR A 1 8  ? -2.335  11.837  -6.524  1.00 0.00 ? 8  THR A HA   13 
ATOM   9478  H HB   . THR A 1 8  ? -3.330  10.557  -4.538  1.00 0.00 ? 8  THR A HB   13 
ATOM   9479  H HG1  . THR A 1 8  ? -3.402  12.856  -4.798  1.00 0.00 ? 8  THR A HG1  13 
ATOM   9480  H HG21 . THR A 1 8  ? -0.974  11.427  -2.944  1.00 0.00 ? 8  THR A HG21 13 
ATOM   9481  H HG22 . THR A 1 8  ? -0.788  9.962   -3.909  1.00 0.00 ? 8  THR A HG22 13 
ATOM   9482  H HG23 . THR A 1 8  ? -2.061  10.061  -2.692  1.00 0.00 ? 8  THR A HG23 13 
ATOM   9483  N N    . SER A 1 9  ? 0.623   10.959  -5.564  1.00 0.00 ? 9  SER A N    13 
ATOM   9484  C CA   . SER A 1 9  ? 2.031   11.422  -5.419  1.00 0.00 ? 9  SER A CA   13 
ATOM   9485  C C    . SER A 1 9  ? 2.959   10.273  -5.815  1.00 0.00 ? 9  SER A C    13 
ATOM   9486  O O    . SER A 1 9  ? 2.584   9.399   -6.570  1.00 0.00 ? 9  SER A O    13 
ATOM   9487  C CB   . SER A 1 9  ? 2.296   11.815  -3.965  1.00 0.00 ? 9  SER A CB   13 
ATOM   9488  O OG   . SER A 1 9  ? 1.304   12.740  -3.538  1.00 0.00 ? 9  SER A OG   13 
ATOM   9489  H H    . SER A 1 9  ? 0.429   9.998   -5.571  1.00 0.00 ? 9  SER A H    13 
ATOM   9490  H HA   . SER A 1 9  ? 2.204   12.270  -6.064  1.00 0.00 ? 9  SER A HA   13 
ATOM   9491  H HB2  . SER A 1 9  ? 2.257   10.940  -3.338  1.00 0.00 ? 9  SER A HB2  13 
ATOM   9492  H HB3  . SER A 1 9  ? 3.278   12.264  -3.889  1.00 0.00 ? 9  SER A HB3  13 
ATOM   9493  H HG   . SER A 1 9  ? 1.343   12.796  -2.581  1.00 0.00 ? 9  SER A HG   13 
ATOM   9494  N N    . ILE A 1 10 ? 4.161   10.250  -5.312  1.00 0.00 ? 10 ILE A N    13 
ATOM   9495  C CA   . ILE A 1 10 ? 5.081   9.139   -5.674  1.00 0.00 ? 10 ILE A CA   13 
ATOM   9496  C C    . ILE A 1 10 ? 4.715   7.903   -4.838  1.00 0.00 ? 10 ILE A C    13 
ATOM   9497  O O    . ILE A 1 10 ? 3.795   7.937   -4.045  1.00 0.00 ? 10 ILE A O    13 
ATOM   9498  C CB   . ILE A 1 10 ? 6.534   9.580   -5.418  1.00 0.00 ? 10 ILE A CB   13 
ATOM   9499  C CG1  . ILE A 1 10 ? 7.429   9.047   -6.538  1.00 0.00 ? 10 ILE A CG1  13 
ATOM   9500  C CG2  . ILE A 1 10 ? 7.042   9.055   -4.070  1.00 0.00 ? 10 ILE A CG2  13 
ATOM   9501  C CD1  . ILE A 1 10 ? 8.741   9.831   -6.550  1.00 0.00 ? 10 ILE A CD1  13 
ATOM   9502  H H    . ILE A 1 10 ? 4.455   10.954  -4.698  1.00 0.00 ? 10 ILE A H    13 
ATOM   9503  H HA   . ILE A 1 10 ? 4.958   8.905   -6.722  1.00 0.00 ? 10 ILE A HA   13 
ATOM   9504  H HB   . ILE A 1 10 ? 6.578   10.660  -5.414  1.00 0.00 ? 10 ILE A HB   13 
ATOM   9505  H HG12 . ILE A 1 10 ? 7.632   8.000   -6.371  1.00 0.00 ? 10 ILE A HG12 13 
ATOM   9506  H HG13 . ILE A 1 10 ? 6.931   9.171   -7.488  1.00 0.00 ? 10 ILE A HG13 13 
ATOM   9507  H HG21 . ILE A 1 10 ? 8.012   9.484   -3.859  1.00 0.00 ? 10 ILE A HG21 13 
ATOM   9508  H HG22 . ILE A 1 10 ? 7.126   7.979   -4.112  1.00 0.00 ? 10 ILE A HG22 13 
ATOM   9509  H HG23 . ILE A 1 10 ? 6.348   9.333   -3.290  1.00 0.00 ? 10 ILE A HG23 13 
ATOM   9510  H HD11 . ILE A 1 10 ? 8.932   10.226  -5.563  1.00 0.00 ? 10 ILE A HD11 13 
ATOM   9511  H HD12 . ILE A 1 10 ? 8.668   10.644  -7.256  1.00 0.00 ? 10 ILE A HD12 13 
ATOM   9512  H HD13 . ILE A 1 10 ? 9.548   9.176   -6.838  1.00 0.00 ? 10 ILE A HD13 13 
ATOM   9513  N N    . CYS A 1 11 ? 5.412   6.815   -5.010  1.00 0.00 ? 11 CYS A N    13 
ATOM   9514  C CA   . CYS A 1 11 ? 5.075   5.596   -4.220  1.00 0.00 ? 11 CYS A CA   13 
ATOM   9515  C C    . CYS A 1 11 ? 6.304   4.694   -4.092  1.00 0.00 ? 11 CYS A C    13 
ATOM   9516  O O    . CYS A 1 11 ? 7.342   4.952   -4.669  1.00 0.00 ? 11 CYS A O    13 
ATOM   9517  C CB   . CYS A 1 11 ? 3.957   4.829   -4.928  1.00 0.00 ? 11 CYS A CB   13 
ATOM   9518  S SG   . CYS A 1 11 ? 2.782   4.200   -3.703  1.00 0.00 ? 11 CYS A SG   13 
ATOM   9519  H H    . CYS A 1 11 ? 6.148   6.796   -5.657  1.00 0.00 ? 11 CYS A H    13 
ATOM   9520  H HA   . CYS A 1 11 ? 4.740   5.887   -3.236  1.00 0.00 ? 11 CYS A HA   13 
ATOM   9521  H HB2  . CYS A 1 11 ? 3.445   5.490   -5.611  1.00 0.00 ? 11 CYS A HB2  13 
ATOM   9522  H HB3  . CYS A 1 11 ? 4.380   4.002   -5.478  1.00 0.00 ? 11 CYS A HB3  13 
ATOM   9523  N N    . SER A 1 12 ? 6.186   3.636   -3.340  1.00 0.00 ? 12 SER A N    13 
ATOM   9524  C CA   . SER A 1 12 ? 7.335   2.705   -3.170  1.00 0.00 ? 12 SER A CA   13 
ATOM   9525  C C    . SER A 1 12 ? 6.872   1.282   -3.482  1.00 0.00 ? 12 SER A C    13 
ATOM   9526  O O    . SER A 1 12 ? 5.775   0.884   -3.140  1.00 0.00 ? 12 SER A O    13 
ATOM   9527  C CB   . SER A 1 12 ? 7.839   2.774   -1.728  1.00 0.00 ? 12 SER A CB   13 
ATOM   9528  O OG   . SER A 1 12 ? 6.817   3.310   -0.897  1.00 0.00 ? 12 SER A OG   13 
ATOM   9529  H H    . SER A 1 12 ? 5.336   3.450   -2.890  1.00 0.00 ? 12 SER A H    13 
ATOM   9530  H HA   . SER A 1 12 ? 8.129   2.984   -3.845  1.00 0.00 ? 12 SER A HA   13 
ATOM   9531  H HB2  . SER A 1 12 ? 8.093   1.784   -1.386  1.00 0.00 ? 12 SER A HB2  13 
ATOM   9532  H HB3  . SER A 1 12 ? 8.717   3.403   -1.687  1.00 0.00 ? 12 SER A HB3  13 
ATOM   9533  H HG   . SER A 1 12 ? 7.231   3.876   -0.244  1.00 0.00 ? 12 SER A HG   13 
ATOM   9534  N N    . LEU A 1 13 ? 7.697   0.511   -4.133  1.00 0.00 ? 13 LEU A N    13 
ATOM   9535  C CA   . LEU A 1 13 ? 7.301   -0.883  -4.473  1.00 0.00 ? 13 LEU A CA   13 
ATOM   9536  C C    . LEU A 1 13 ? 7.178   -1.711  -3.191  1.00 0.00 ? 13 LEU A C    13 
ATOM   9537  O O    . LEU A 1 13 ? 6.628   -2.796  -3.191  1.00 0.00 ? 13 LEU A O    13 
ATOM   9538  C CB   . LEU A 1 13 ? 8.354   -1.501  -5.398  1.00 0.00 ? 13 LEU A CB   13 
ATOM   9539  C CG   . LEU A 1 13 ? 9.629   -1.832  -4.616  1.00 0.00 ? 13 LEU A CG   13 
ATOM   9540  C CD1  . LEU A 1 13 ? 10.180  -3.169  -5.108  1.00 0.00 ? 13 LEU A CD1  13 
ATOM   9541  C CD2  . LEU A 1 13 ? 10.672  -0.738  -4.849  1.00 0.00 ? 13 LEU A CD2  13 
ATOM   9542  H H    . LEU A 1 13 ? 8.575   0.851   -4.403  1.00 0.00 ? 13 LEU A H    13 
ATOM   9543  H HA   . LEU A 1 13 ? 6.344   -0.871  -4.980  1.00 0.00 ? 13 LEU A HA   13 
ATOM   9544  H HB2  . LEU A 1 13 ? 7.958   -2.406  -5.835  1.00 0.00 ? 13 LEU A HB2  13 
ATOM   9545  H HB3  . LEU A 1 13 ? 8.591   -0.800  -6.184  1.00 0.00 ? 13 LEU A HB3  13 
ATOM   9546  H HG   . LEU A 1 13 ? 9.408   -1.903  -3.563  1.00 0.00 ? 13 LEU A HG   13 
ATOM   9547  H HD11 . LEU A 1 13 ? 11.257  -3.156  -5.054  1.00 0.00 ? 13 LEU A HD11 13 
ATOM   9548  H HD12 . LEU A 1 13 ? 9.871   -3.330  -6.131  1.00 0.00 ? 13 LEU A HD12 13 
ATOM   9549  H HD13 . LEU A 1 13 ? 9.797   -3.965  -4.487  1.00 0.00 ? 13 LEU A HD13 13 
ATOM   9550  H HD21 . LEU A 1 13 ? 10.241  0.051   -5.446  1.00 0.00 ? 13 LEU A HD21 13 
ATOM   9551  H HD22 . LEU A 1 13 ? 11.524  -1.157  -5.365  1.00 0.00 ? 13 LEU A HD22 13 
ATOM   9552  H HD23 . LEU A 1 13 ? 10.991  -0.336  -3.897  1.00 0.00 ? 13 LEU A HD23 13 
ATOM   9553  N N    . TYR A 1 14 ? 7.679   -1.210  -2.093  1.00 0.00 ? 14 TYR A N    13 
ATOM   9554  C CA   . TYR A 1 14 ? 7.578   -1.972  -0.822  1.00 0.00 ? 14 TYR A CA   13 
ATOM   9555  C C    . TYR A 1 14 ? 6.117   -2.020  -0.406  1.00 0.00 ? 14 TYR A C    13 
ATOM   9556  O O    . TYR A 1 14 ? 5.582   -3.059  -0.076  1.00 0.00 ? 14 TYR A O    13 
ATOM   9557  C CB   . TYR A 1 14 ? 8.404   -1.283  0.265   1.00 0.00 ? 14 TYR A CB   13 
ATOM   9558  C CG   . TYR A 1 14 ? 9.236   -2.319  0.990   1.00 0.00 ? 14 TYR A CG   13 
ATOM   9559  C CD1  . TYR A 1 14 ? 10.259  -2.999  0.311   1.00 0.00 ? 14 TYR A CD1  13 
ATOM   9560  C CD2  . TYR A 1 14 ? 8.985   -2.604  2.340   1.00 0.00 ? 14 TYR A CD2  13 
ATOM   9561  C CE1  . TYR A 1 14 ? 11.028  -3.959  0.981   1.00 0.00 ? 14 TYR A CE1  13 
ATOM   9562  C CE2  . TYR A 1 14 ? 9.756   -3.565  3.009   1.00 0.00 ? 14 TYR A CE2  13 
ATOM   9563  C CZ   . TYR A 1 14 ? 10.777  -4.241  2.329   1.00 0.00 ? 14 TYR A CZ   13 
ATOM   9564  O OH   . TYR A 1 14 ? 11.534  -5.187  2.990   1.00 0.00 ? 14 TYR A OH   13 
ATOM   9565  H H    . TYR A 1 14 ? 8.111   -0.331  -2.106  1.00 0.00 ? 14 TYR A H    13 
ATOM   9566  H HA   . TYR A 1 14 ? 7.939   -2.973  -0.973  1.00 0.00 ? 14 TYR A HA   13 
ATOM   9567  H HB2  . TYR A 1 14 ? 9.052   -0.546  -0.189  1.00 0.00 ? 14 TYR A HB2  13 
ATOM   9568  H HB3  . TYR A 1 14 ? 7.741   -0.795  0.967   1.00 0.00 ? 14 TYR A HB3  13 
ATOM   9569  H HD1  . TYR A 1 14 ? 10.453  -2.785  -0.729  1.00 0.00 ? 14 TYR A HD1  13 
ATOM   9570  H HD2  . TYR A 1 14 ? 8.200   -2.084  2.866   1.00 0.00 ? 14 TYR A HD2  13 
ATOM   9571  H HE1  . TYR A 1 14 ? 11.814  -4.481  0.457   1.00 0.00 ? 14 TYR A HE1  13 
ATOM   9572  H HE2  . TYR A 1 14 ? 9.562   -3.782  4.047   1.00 0.00 ? 14 TYR A HE2  13 
ATOM   9573  H HH   . TYR A 1 14 ? 11.213  -5.247  3.892   1.00 0.00 ? 14 TYR A HH   13 
ATOM   9574  N N    . GLN A 1 15 ? 5.466   -0.901  -0.447  1.00 0.00 ? 15 GLN A N    13 
ATOM   9575  C CA   . GLN A 1 15 ? 4.028   -0.868  -0.086  1.00 0.00 ? 15 GLN A CA   13 
ATOM   9576  C C    . GLN A 1 15 ? 3.238   -1.548  -1.204  1.00 0.00 ? 15 GLN A C    13 
ATOM   9577  O O    . GLN A 1 15 ? 2.094   -1.918  -1.039  1.00 0.00 ? 15 GLN A O    13 
ATOM   9578  C CB   . GLN A 1 15 ? 3.569   0.583   0.064   1.00 0.00 ? 15 GLN A CB   13 
ATOM   9579  C CG   . GLN A 1 15 ? 4.216   1.196   1.307   1.00 0.00 ? 15 GLN A CG   13 
ATOM   9580  C CD   . GLN A 1 15 ? 3.326   2.315   1.847   1.00 0.00 ? 15 GLN A CD   13 
ATOM   9581  O OE1  . GLN A 1 15 ? 3.226   2.505   3.043   1.00 0.00 ? 15 GLN A OE1  13 
ATOM   9582  N NE2  . GLN A 1 15 ? 2.668   3.070   1.010   1.00 0.00 ? 15 GLN A NE2  13 
ATOM   9583  H H    . GLN A 1 15 ? 5.921   -0.086  -0.737  1.00 0.00 ? 15 GLN A H    13 
ATOM   9584  H HA   . GLN A 1 15 ? 3.879   -1.397  0.841   1.00 0.00 ? 15 GLN A HA   13 
ATOM   9585  H HB2  . GLN A 1 15 ? 3.861   1.146   -0.811  1.00 0.00 ? 15 GLN A HB2  13 
ATOM   9586  H HB3  . GLN A 1 15 ? 2.494   0.613   0.168   1.00 0.00 ? 15 GLN A HB3  13 
ATOM   9587  H HG2  . GLN A 1 15 ? 4.336   0.434   2.063   1.00 0.00 ? 15 GLN A HG2  13 
ATOM   9588  H HG3  . GLN A 1 15 ? 5.183   1.601   1.047   1.00 0.00 ? 15 GLN A HG3  13 
ATOM   9589  H HE21 . GLN A 1 15 ? 2.748   2.916   0.045   1.00 0.00 ? 15 GLN A HE21 13 
ATOM   9590  H HE22 . GLN A 1 15 ? 2.095   3.790   1.345   1.00 0.00 ? 15 GLN A HE22 13 
ATOM   9591  N N    . LEU A 1 16 ? 3.857   -1.720  -2.343  1.00 0.00 ? 16 LEU A N    13 
ATOM   9592  C CA   . LEU A 1 16 ? 3.173   -2.378  -3.485  1.00 0.00 ? 16 LEU A CA   13 
ATOM   9593  C C    . LEU A 1 16 ? 3.041   -3.875  -3.198  1.00 0.00 ? 16 LEU A C    13 
ATOM   9594  O O    . LEU A 1 16 ? 2.178   -4.549  -3.726  1.00 0.00 ? 16 LEU A O    13 
ATOM   9595  C CB   . LEU A 1 16 ? 4.019   -2.173  -4.744  1.00 0.00 ? 16 LEU A CB   13 
ATOM   9596  C CG   . LEU A 1 16 ? 3.551   -0.920  -5.485  1.00 0.00 ? 16 LEU A CG   13 
ATOM   9597  C CD1  . LEU A 1 16 ? 4.317   -0.795  -6.803  1.00 0.00 ? 16 LEU A CD1  13 
ATOM   9598  C CD2  . LEU A 1 16 ? 2.054   -1.029  -5.777  1.00 0.00 ? 16 LEU A CD2  13 
ATOM   9599  H H    . LEU A 1 16 ? 4.781   -1.416  -2.447  1.00 0.00 ? 16 LEU A H    13 
ATOM   9600  H HA   . LEU A 1 16 ? 2.198   -1.945  -3.626  1.00 0.00 ? 16 LEU A HA   13 
ATOM   9601  H HB2  . LEU A 1 16 ? 5.053   -2.058  -4.459  1.00 0.00 ? 16 LEU A HB2  13 
ATOM   9602  H HB3  . LEU A 1 16 ? 3.921   -3.028  -5.387  1.00 0.00 ? 16 LEU A HB3  13 
ATOM   9603  H HG   . LEU A 1 16 ? 3.740   -0.048  -4.875  1.00 0.00 ? 16 LEU A HG   13 
ATOM   9604  H HD11 . LEU A 1 16 ? 4.767   -1.745  -7.049  1.00 0.00 ? 16 LEU A HD11 13 
ATOM   9605  H HD12 . LEU A 1 16 ? 5.089   -0.045  -6.702  1.00 0.00 ? 16 LEU A HD12 13 
ATOM   9606  H HD13 . LEU A 1 16 ? 3.635   -0.506  -7.588  1.00 0.00 ? 16 LEU A HD13 13 
ATOM   9607  H HD21 . LEU A 1 16 ? 1.874   -0.796  -6.816  1.00 0.00 ? 16 LEU A HD21 13 
ATOM   9608  H HD22 . LEU A 1 16 ? 1.514   -0.333  -5.153  1.00 0.00 ? 16 LEU A HD22 13 
ATOM   9609  H HD23 . LEU A 1 16 ? 1.718   -2.034  -5.570  1.00 0.00 ? 16 LEU A HD23 13 
ATOM   9610  N N    . GLU A 1 17 ? 3.897   -4.395  -2.366  1.00 0.00 ? 17 GLU A N    13 
ATOM   9611  C CA   . GLU A 1 17 ? 3.836   -5.848  -2.036  1.00 0.00 ? 17 GLU A CA   13 
ATOM   9612  C C    . GLU A 1 17 ? 2.672   -6.110  -1.082  1.00 0.00 ? 17 GLU A C    13 
ATOM   9613  O O    . GLU A 1 17 ? 2.122   -7.193  -1.036  1.00 0.00 ? 17 GLU A O    13 
ATOM   9614  C CB   . GLU A 1 17 ? 5.145   -6.275  -1.367  1.00 0.00 ? 17 GLU A CB   13 
ATOM   9615  C CG   . GLU A 1 17 ? 6.227   -6.472  -2.430  1.00 0.00 ? 17 GLU A CG   13 
ATOM   9616  C CD   . GLU A 1 17 ? 6.007   -7.810  -3.143  1.00 0.00 ? 17 GLU A CD   13 
ATOM   9617  O OE1  . GLU A 1 17 ? 4.873   -8.256  -3.184  1.00 0.00 ? 17 GLU A OE1  13 
ATOM   9618  O OE2  . GLU A 1 17 ? 6.977   -8.363  -3.635  1.00 0.00 ? 17 GLU A OE2  13 
ATOM   9619  H H    . GLU A 1 17 ? 4.583   -3.828  -1.957  1.00 0.00 ? 17 GLU A H    13 
ATOM   9620  H HA   . GLU A 1 17 ? 3.693   -6.414  -2.940  1.00 0.00 ? 17 GLU A HA   13 
ATOM   9621  H HB2  . GLU A 1 17 ? 5.459   -5.508  -0.673  1.00 0.00 ? 17 GLU A HB2  13 
ATOM   9622  H HB3  . GLU A 1 17 ? 4.992   -7.201  -0.835  1.00 0.00 ? 17 GLU A HB3  13 
ATOM   9623  H HG2  . GLU A 1 17 ? 6.176   -5.668  -3.149  1.00 0.00 ? 17 GLU A HG2  13 
ATOM   9624  H HG3  . GLU A 1 17 ? 7.199   -6.474  -1.960  1.00 0.00 ? 17 GLU A HG3  13 
ATOM   9625  N N    . ASN A 1 18 ? 2.295   -5.126  -0.318  1.00 0.00 ? 18 ASN A N    13 
ATOM   9626  C CA   . ASN A 1 18 ? 1.171   -5.312  0.639   1.00 0.00 ? 18 ASN A CA   13 
ATOM   9627  C C    . ASN A 1 18 ? -0.157  -5.312  -0.120  1.00 0.00 ? 18 ASN A C    13 
ATOM   9628  O O    . ASN A 1 18 ? -1.214  -5.457  0.462   1.00 0.00 ? 18 ASN A O    13 
ATOM   9629  C CB   . ASN A 1 18 ? 1.180   -4.169  1.654   1.00 0.00 ? 18 ASN A CB   13 
ATOM   9630  C CG   . ASN A 1 18 ? 1.862   -4.637  2.942   1.00 0.00 ? 18 ASN A CG   13 
ATOM   9631  O OD1  . ASN A 1 18 ? 1.204   -4.943  3.916   1.00 0.00 ? 18 ASN A OD1  13 
ATOM   9632  N ND2  . ASN A 1 18 ? 3.165   -4.706  2.986   1.00 0.00 ? 18 ASN A ND2  13 
ATOM   9633  H H    . ASN A 1 18 ? 2.753   -4.265  -0.373  1.00 0.00 ? 18 ASN A H    13 
ATOM   9634  H HA   . ASN A 1 18 ? 1.288   -6.252  1.156   1.00 0.00 ? 18 ASN A HA   13 
ATOM   9635  H HB2  . ASN A 1 18 ? 1.721   -3.328  1.244   1.00 0.00 ? 18 ASN A HB2  13 
ATOM   9636  H HB3  . ASN A 1 18 ? 0.167   -3.875  1.871   1.00 0.00 ? 18 ASN A HB3  13 
ATOM   9637  H HD21 . ASN A 1 18 ? 3.696   -4.461  2.200   1.00 0.00 ? 18 ASN A HD21 13 
ATOM   9638  H HD22 . ASN A 1 18 ? 3.611   -5.003  3.807   1.00 0.00 ? 18 ASN A HD22 13 
ATOM   9639  N N    . TYR A 1 19 ? -0.115  -5.156  -1.414  1.00 0.00 ? 19 TYR A N    13 
ATOM   9640  C CA   . TYR A 1 19 ? -1.378  -5.153  -2.202  1.00 0.00 ? 19 TYR A CA   13 
ATOM   9641  C C    . TYR A 1 19 ? -1.421  -6.400  -3.083  1.00 0.00 ? 19 TYR A C    13 
ATOM   9642  O O    . TYR A 1 19 ? -2.053  -6.423  -4.119  1.00 0.00 ? 19 TYR A O    13 
ATOM   9643  C CB   . TYR A 1 19 ? -1.431  -3.900  -3.077  1.00 0.00 ? 19 TYR A CB   13 
ATOM   9644  C CG   . TYR A 1 19 ? -1.683  -2.697  -2.202  1.00 0.00 ? 19 TYR A CG   13 
ATOM   9645  C CD1  . TYR A 1 19 ? -2.973  -2.441  -1.717  1.00 0.00 ? 19 TYR A CD1  13 
ATOM   9646  C CD2  . TYR A 1 19 ? -0.626  -1.840  -1.868  1.00 0.00 ? 19 TYR A CD2  13 
ATOM   9647  C CE1  . TYR A 1 19 ? -3.206  -1.329  -0.899  1.00 0.00 ? 19 TYR A CE1  13 
ATOM   9648  C CE2  . TYR A 1 19 ? -0.859  -0.727  -1.050  1.00 0.00 ? 19 TYR A CE2  13 
ATOM   9649  C CZ   . TYR A 1 19 ? -2.148  -0.470  -0.566  1.00 0.00 ? 19 TYR A CZ   13 
ATOM   9650  O OH   . TYR A 1 19 ? -2.378  0.626   0.241   1.00 0.00 ? 19 TYR A OH   13 
ATOM   9651  H H    . TYR A 1 19 ? 0.745   -5.044  -1.868  1.00 0.00 ? 19 TYR A H    13 
ATOM   9652  H HA   . TYR A 1 19 ? -2.222  -5.159  -1.529  1.00 0.00 ? 19 TYR A HA   13 
ATOM   9653  H HB2  . TYR A 1 19 ? -0.489  -3.780  -3.594  1.00 0.00 ? 19 TYR A HB2  13 
ATOM   9654  H HB3  . TYR A 1 19 ? -2.228  -3.996  -3.797  1.00 0.00 ? 19 TYR A HB3  13 
ATOM   9655  H HD1  . TYR A 1 19 ? -3.787  -3.103  -1.976  1.00 0.00 ? 19 TYR A HD1  13 
ATOM   9656  H HD2  . TYR A 1 19 ? 0.367   -2.037  -2.242  1.00 0.00 ? 19 TYR A HD2  13 
ATOM   9657  H HE1  . TYR A 1 19 ? -4.199  -1.132  -0.525  1.00 0.00 ? 19 TYR A HE1  13 
ATOM   9658  H HE2  . TYR A 1 19 ? -0.044  -0.067  -0.794  1.00 0.00 ? 19 TYR A HE2  13 
ATOM   9659  H HH   . TYR A 1 19 ? -1.681  0.658   0.903   1.00 0.00 ? 19 TYR A HH   13 
ATOM   9660  N N    . CYS A 1 20 ? -0.749  -7.441  -2.673  1.00 0.00 ? 20 CYS A N    13 
ATOM   9661  C CA   . CYS A 1 20 ? -0.745  -8.692  -3.479  1.00 0.00 ? 20 CYS A CA   13 
ATOM   9662  C C    . CYS A 1 20 ? -1.797  -9.657  -2.932  1.00 0.00 ? 20 CYS A C    13 
ATOM   9663  O O    . CYS A 1 20 ? -2.953  -9.605  -3.302  1.00 0.00 ? 20 CYS A O    13 
ATOM   9664  C CB   . CYS A 1 20 ? 0.641   -9.336  -3.400  1.00 0.00 ? 20 CYS A CB   13 
ATOM   9665  S SG   . CYS A 1 20 ? 1.822   -8.336  -4.339  1.00 0.00 ? 20 CYS A SG   13 
ATOM   9666  H H    . CYS A 1 20 ? -0.247  -7.399  -1.833  1.00 0.00 ? 20 CYS A H    13 
ATOM   9667  H HA   . CYS A 1 20 ? -0.972  -8.462  -4.505  1.00 0.00 ? 20 CYS A HA   13 
ATOM   9668  H HB2  . CYS A 1 20 ? 0.955   -9.391  -2.368  1.00 0.00 ? 20 CYS A HB2  13 
ATOM   9669  H HB3  . CYS A 1 20 ? 0.600   -10.330 -3.817  1.00 0.00 ? 20 CYS A HB3  13 
ATOM   9670  N N    . ASN A 1 21 ? -1.408  -10.536 -2.054  1.00 0.00 ? 21 ASN A N    13 
ATOM   9671  C CA   . ASN A 1 21 ? -2.387  -11.503 -1.483  1.00 0.00 ? 21 ASN A CA   13 
ATOM   9672  C C    . ASN A 1 21 ? -1.751  -12.236 -0.300  1.00 0.00 ? 21 ASN A C    13 
ATOM   9673  O O    . ASN A 1 21 ? -2.212  -12.037 0.812   1.00 0.00 ? 21 ASN A O    13 
ATOM   9674  C CB   . ASN A 1 21 ? -2.784  -12.518 -2.557  1.00 0.00 ? 21 ASN A CB   13 
ATOM   9675  C CG   . ASN A 1 21 ? -4.131  -12.124 -3.165  1.00 0.00 ? 21 ASN A CG   13 
ATOM   9676  O OD1  . ASN A 1 21 ? -5.007  -11.648 -2.471  1.00 0.00 ? 21 ASN A OD1  13 
ATOM   9677  N ND2  . ASN A 1 21 ? -4.334  -12.303 -4.440  1.00 0.00 ? 21 ASN A ND2  13 
ATOM   9678  O OXT  . ASN A 1 21 ? -0.814  -12.984 -0.526  1.00 0.00 ? 21 ASN A OXT  13 
ATOM   9679  H H    . ASN A 1 21 ? -0.473  -10.560 -1.770  1.00 0.00 ? 21 ASN A H    13 
ATOM   9680  H HA   . ASN A 1 21 ? -3.265  -10.972 -1.149  1.00 0.00 ? 21 ASN A HA   13 
ATOM   9681  H HB2  . ASN A 1 21 ? -2.031  -12.535 -3.331  1.00 0.00 ? 21 ASN A HB2  13 
ATOM   9682  H HB3  . ASN A 1 21 ? -2.864  -13.499 -2.113  1.00 0.00 ? 21 ASN A HB3  13 
ATOM   9683  H HD21 . ASN A 1 21 ? -3.626  -12.687 -5.000  1.00 0.00 ? 21 ASN A HD21 13 
ATOM   9684  H HD22 . ASN A 1 21 ? -5.193  -12.053 -4.840  1.00 0.00 ? 21 ASN A HD22 13 
ATOM   9685  N N    . PHE B 2 1  ? 11.784  0.276   -9.770  1.00 0.00 ? 1  PHE B N    13 
ATOM   9686  C CA   . PHE B 2 1  ? 12.506  -0.082  -8.517  1.00 0.00 ? 1  PHE B CA   13 
ATOM   9687  C C    . PHE B 2 1  ? 12.949  1.196   -7.804  1.00 0.00 ? 1  PHE B C    13 
ATOM   9688  O O    . PHE B 2 1  ? 13.987  1.242   -7.176  1.00 0.00 ? 1  PHE B O    13 
ATOM   9689  C CB   . PHE B 2 1  ? 13.732  -0.929  -8.863  1.00 0.00 ? 1  PHE B CB   13 
ATOM   9690  C CG   . PHE B 2 1  ? 14.340  -1.482  -7.592  1.00 0.00 ? 1  PHE B CG   13 
ATOM   9691  C CD1  . PHE B 2 1  ? 13.571  -2.276  -6.729  1.00 0.00 ? 1  PHE B CD1  13 
ATOM   9692  C CD2  . PHE B 2 1  ? 15.679  -1.203  -7.275  1.00 0.00 ? 1  PHE B CD2  13 
ATOM   9693  C CE1  . PHE B 2 1  ? 14.137  -2.788  -5.554  1.00 0.00 ? 1  PHE B CE1  13 
ATOM   9694  C CE2  . PHE B 2 1  ? 16.244  -1.718  -6.100  1.00 0.00 ? 1  PHE B CE2  13 
ATOM   9695  C CZ   . PHE B 2 1  ? 15.473  -2.510  -5.240  1.00 0.00 ? 1  PHE B CZ   13 
ATOM   9696  H H1   . PHE B 2 1  ? 11.591  -0.585  -10.318 1.00 0.00 ? 1  PHE B H1   13 
ATOM   9697  H H2   . PHE B 2 1  ? 12.373  0.923   -10.336 1.00 0.00 ? 1  PHE B H2   13 
ATOM   9698  H H3   . PHE B 2 1  ? 10.887  0.742   -9.534  1.00 0.00 ? 1  PHE B H3   13 
ATOM   9699  H HA   . PHE B 2 1  ? 11.849  -0.646  -7.872  1.00 0.00 ? 1  PHE B HA   13 
ATOM   9700  H HB2  . PHE B 2 1  ? 13.434  -1.745  -9.508  1.00 0.00 ? 1  PHE B HB2  13 
ATOM   9701  H HB3  . PHE B 2 1  ? 14.460  -0.316  -9.376  1.00 0.00 ? 1  PHE B HB3  13 
ATOM   9702  H HD1  . PHE B 2 1  ? 12.540  -2.492  -6.967  1.00 0.00 ? 1  PHE B HD1  13 
ATOM   9703  H HD2  . PHE B 2 1  ? 16.275  -0.592  -7.935  1.00 0.00 ? 1  PHE B HD2  13 
ATOM   9704  H HE1  . PHE B 2 1  ? 13.543  -3.399  -4.891  1.00 0.00 ? 1  PHE B HE1  13 
ATOM   9705  H HE2  . PHE B 2 1  ? 17.274  -1.502  -5.858  1.00 0.00 ? 1  PHE B HE2  13 
ATOM   9706  H HZ   . PHE B 2 1  ? 15.909  -2.906  -4.336  1.00 0.00 ? 1  PHE B HZ   13 
ATOM   9707  N N    . VAL B 2 2  ? 12.167  2.236   -7.897  1.00 0.00 ? 2  VAL B N    13 
ATOM   9708  C CA   . VAL B 2 2  ? 12.537  3.514   -7.227  1.00 0.00 ? 2  VAL B CA   13 
ATOM   9709  C C    . VAL B 2 2  ? 11.264  4.313   -6.944  1.00 0.00 ? 2  VAL B C    13 
ATOM   9710  O O    . VAL B 2 2  ? 10.166  3.810   -7.072  1.00 0.00 ? 2  VAL B O    13 
ATOM   9711  C CB   . VAL B 2 2  ? 13.463  4.329   -8.138  1.00 0.00 ? 2  VAL B CB   13 
ATOM   9712  C CG1  . VAL B 2 2  ? 14.448  5.129   -7.283  1.00 0.00 ? 2  VAL B CG1  13 
ATOM   9713  C CG2  . VAL B 2 2  ? 14.244  3.386   -9.059  1.00 0.00 ? 2  VAL B CG2  13 
ATOM   9714  H H    . VAL B 2 2  ? 11.333  2.176   -8.409  1.00 0.00 ? 2  VAL B H    13 
ATOM   9715  H HA   . VAL B 2 2  ? 13.043  3.300   -6.297  1.00 0.00 ? 2  VAL B HA   13 
ATOM   9716  H HB   . VAL B 2 2  ? 12.871  5.009   -8.734  1.00 0.00 ? 2  VAL B HB   13 
ATOM   9717  H HG11 . VAL B 2 2  ? 15.456  4.940   -7.622  1.00 0.00 ? 2  VAL B HG11 13 
ATOM   9718  H HG12 . VAL B 2 2  ? 14.354  4.829   -6.250  1.00 0.00 ? 2  VAL B HG12 13 
ATOM   9719  H HG13 . VAL B 2 2  ? 14.230  6.183   -7.374  1.00 0.00 ? 2  VAL B HG13 13 
ATOM   9720  H HG21 . VAL B 2 2  ? 14.901  3.964   -9.693  1.00 0.00 ? 2  VAL B HG21 13 
ATOM   9721  H HG22 . VAL B 2 2  ? 13.553  2.828   -9.673  1.00 0.00 ? 2  VAL B HG22 13 
ATOM   9722  H HG23 . VAL B 2 2  ? 14.830  2.702   -8.463  1.00 0.00 ? 2  VAL B HG23 13 
ATOM   9723  N N    . ASN B 2 3  ? 11.397  5.552   -6.560  1.00 0.00 ? 3  ASN B N    13 
ATOM   9724  C CA   . ASN B 2 3  ? 10.186  6.372   -6.274  1.00 0.00 ? 3  ASN B CA   13 
ATOM   9725  C C    . ASN B 2 3  ? 9.552   6.816   -7.594  1.00 0.00 ? 3  ASN B C    13 
ATOM   9726  O O    . ASN B 2 3  ? 10.041  7.707   -8.258  1.00 0.00 ? 3  ASN B O    13 
ATOM   9727  C CB   . ASN B 2 3  ? 10.584  7.605   -5.463  1.00 0.00 ? 3  ASN B CB   13 
ATOM   9728  C CG   . ASN B 2 3  ? 11.411  7.176   -4.250  1.00 0.00 ? 3  ASN B CG   13 
ATOM   9729  O OD1  . ASN B 2 3  ? 10.972  6.369   -3.456  1.00 0.00 ? 3  ASN B OD1  13 
ATOM   9730  N ND2  . ASN B 2 3  ? 12.599  7.686   -4.073  1.00 0.00 ? 3  ASN B ND2  13 
ATOM   9731  H H    . ASN B 2 3  ? 12.291  5.944   -6.463  1.00 0.00 ? 3  ASN B H    13 
ATOM   9732  H HA   . ASN B 2 3  ? 9.476   5.784   -5.712  1.00 0.00 ? 3  ASN B HA   13 
ATOM   9733  H HB2  . ASN B 2 3  ? 11.171  8.268   -6.083  1.00 0.00 ? 3  ASN B HB2  13 
ATOM   9734  H HB3  . ASN B 2 3  ? 9.696   8.117   -5.127  1.00 0.00 ? 3  ASN B HB3  13 
ATOM   9735  H HD21 . ASN B 2 3  ? 12.953  8.336   -4.714  1.00 0.00 ? 3  ASN B HD21 13 
ATOM   9736  H HD22 . ASN B 2 3  ? 13.137  7.418   -3.299  1.00 0.00 ? 3  ASN B HD22 13 
ATOM   9737  N N    . GLN B 2 4  ? 8.471   6.196   -7.986  1.00 0.00 ? 4  GLN B N    13 
ATOM   9738  C CA   . GLN B 2 4  ? 7.820   6.579   -9.264  1.00 0.00 ? 4  GLN B CA   13 
ATOM   9739  C C    . GLN B 2 4  ? 6.316   6.756   -9.069  1.00 0.00 ? 4  GLN B C    13 
ATOM   9740  O O    . GLN B 2 4  ? 5.635   5.890   -8.558  1.00 0.00 ? 4  GLN B O    13 
ATOM   9741  C CB   . GLN B 2 4  ? 8.062   5.483   -10.292 1.00 0.00 ? 4  GLN B CB   13 
ATOM   9742  C CG   . GLN B 2 4  ? 9.174   5.915   -11.245 1.00 0.00 ? 4  GLN B CG   13 
ATOM   9743  C CD   . GLN B 2 4  ? 9.124   5.056   -12.509 1.00 0.00 ? 4  GLN B CD   13 
ATOM   9744  O OE1  . GLN B 2 4  ? 8.738   5.525   -13.560 1.00 0.00 ? 4  GLN B OE1  13 
ATOM   9745  N NE2  . GLN B 2 4  ? 9.496   3.806   -12.449 1.00 0.00 ? 4  GLN B NE2  13 
ATOM   9746  H H    . GLN B 2 4  ? 8.094   5.474   -7.449  1.00 0.00 ? 4  GLN B H    13 
ATOM   9747  H HA   . GLN B 2 4  ? 8.248   7.504   -9.622  1.00 0.00 ? 4  GLN B HA   13 
ATOM   9748  H HB2  . GLN B 2 4  ? 8.353   4.576   -9.784  1.00 0.00 ? 4  GLN B HB2  13 
ATOM   9749  H HB3  . GLN B 2 4  ? 7.158   5.310   -10.846 1.00 0.00 ? 4  GLN B HB3  13 
ATOM   9750  H HG2  . GLN B 2 4  ? 9.037   6.954   -11.507 1.00 0.00 ? 4  GLN B HG2  13 
ATOM   9751  H HG3  . GLN B 2 4  ? 10.130  5.790   -10.762 1.00 0.00 ? 4  GLN B HG3  13 
ATOM   9752  H HE21 . GLN B 2 4  ? 9.804   3.427   -11.599 1.00 0.00 ? 4  GLN B HE21 13 
ATOM   9753  H HE22 . GLN B 2 4  ? 9.467   3.248   -13.254 1.00 0.00 ? 4  GLN B HE22 13 
ATOM   9754  N N    . HIS B 2 5  ? 5.795   7.871   -9.495  1.00 0.00 ? 5  HIS B N    13 
ATOM   9755  C CA   . HIS B 2 5  ? 4.337   8.117   -9.368  1.00 0.00 ? 5  HIS B CA   13 
ATOM   9756  C C    . HIS B 2 5  ? 3.598   7.165   -10.303 1.00 0.00 ? 5  HIS B C    13 
ATOM   9757  O O    . HIS B 2 5  ? 3.823   7.154   -11.497 1.00 0.00 ? 5  HIS B O    13 
ATOM   9758  C CB   . HIS B 2 5  ? 4.053   9.569   -9.756  1.00 0.00 ? 5  HIS B CB   13 
ATOM   9759  C CG   . HIS B 2 5  ? 2.599   9.744   -10.116 1.00 0.00 ? 5  HIS B CG   13 
ATOM   9760  N ND1  . HIS B 2 5  ? 2.192   9.823   -11.433 1.00 0.00 ? 5  HIS B ND1  13 
ATOM   9761  C CD2  . HIS B 2 5  ? 1.481   9.855   -9.338  1.00 0.00 ? 5  HIS B CD2  13 
ATOM   9762  C CE1  . HIS B 2 5  ? 0.861   9.976   -11.416 1.00 0.00 ? 5  HIS B CE1  13 
ATOM   9763  N NE2  . HIS B 2 5  ? 0.382   10.002  -10.156 1.00 0.00 ? 5  HIS B NE2  13 
ATOM   9764  H H    . HIS B 2 5  ? 6.366   8.546   -9.914  1.00 0.00 ? 5  HIS B H    13 
ATOM   9765  H HA   . HIS B 2 5  ? 4.024   7.938   -8.350  1.00 0.00 ? 5  HIS B HA   13 
ATOM   9766  H HB2  . HIS B 2 5  ? 4.305   10.211  -8.929  1.00 0.00 ? 5  HIS B HB2  13 
ATOM   9767  H HB3  . HIS B 2 5  ? 4.665   9.831   -10.605 1.00 0.00 ? 5  HIS B HB3  13 
ATOM   9768  H HD2  . HIS B 2 5  ? 1.461   9.833   -8.259  1.00 0.00 ? 5  HIS B HD2  13 
ATOM   9769  H HE1  . HIS B 2 5  ? 0.249   10.066  -12.301 1.00 0.00 ? 5  HIS B HE1  13 
ATOM   9770  H HE2  . HIS B 2 5  ? -0.553  10.104  -9.880  1.00 0.00 ? 5  HIS B HE2  13 
ATOM   9771  N N    . LEU B 2 6  ? 2.732   6.355   -9.769  1.00 0.00 ? 6  LEU B N    13 
ATOM   9772  C CA   . LEU B 2 6  ? 1.997   5.389   -10.628 1.00 0.00 ? 6  LEU B CA   13 
ATOM   9773  C C    . LEU B 2 6  ? 0.490   5.619   -10.517 1.00 0.00 ? 6  LEU B C    13 
ATOM   9774  O O    . LEU B 2 6  ? 0.017   6.319   -9.647  1.00 0.00 ? 6  LEU B O    13 
ATOM   9775  C CB   . LEU B 2 6  ? 2.333   3.968   -10.168 1.00 0.00 ? 6  LEU B CB   13 
ATOM   9776  C CG   . LEU B 2 6  ? 3.520   3.417   -10.970 1.00 0.00 ? 6  LEU B CG   13 
ATOM   9777  C CD1  . LEU B 2 6  ? 4.527   4.529   -11.272 1.00 0.00 ? 6  LEU B CD1  13 
ATOM   9778  C CD2  . LEU B 2 6  ? 4.217   2.334   -10.150 1.00 0.00 ? 6  LEU B CD2  13 
ATOM   9779  H H    . LEU B 2 6  ? 2.576   6.372   -8.803  1.00 0.00 ? 6  LEU B H    13 
ATOM   9780  H HA   . LEU B 2 6  ? 2.305   5.513   -11.654 1.00 0.00 ? 6  LEU B HA   13 
ATOM   9781  H HB2  . LEU B 2 6  ? 2.586   3.984   -9.118  1.00 0.00 ? 6  LEU B HB2  13 
ATOM   9782  H HB3  . LEU B 2 6  ? 1.474   3.332   -10.319 1.00 0.00 ? 6  LEU B HB3  13 
ATOM   9783  H HG   . LEU B 2 6  ? 3.162   2.993   -11.898 1.00 0.00 ? 6  LEU B HG   13 
ATOM   9784  H HD11 . LEU B 2 6  ? 4.139   5.165   -12.053 1.00 0.00 ? 6  LEU B HD11 13 
ATOM   9785  H HD12 . LEU B 2 6  ? 5.461   4.091   -11.595 1.00 0.00 ? 6  LEU B HD12 13 
ATOM   9786  H HD13 . LEU B 2 6  ? 4.695   5.113   -10.380 1.00 0.00 ? 6  LEU B HD13 13 
ATOM   9787  H HD21 . LEU B 2 6  ? 3.776   2.289   -9.165  1.00 0.00 ? 6  LEU B HD21 13 
ATOM   9788  H HD22 . LEU B 2 6  ? 5.268   2.571   -10.064 1.00 0.00 ? 6  LEU B HD22 13 
ATOM   9789  H HD23 . LEU B 2 6  ? 4.101   1.380   -10.641 1.00 0.00 ? 6  LEU B HD23 13 
ATOM   9790  N N    . CYS B 2 7  ? -0.262  5.021   -11.397 1.00 0.00 ? 7  CYS B N    13 
ATOM   9791  C CA   . CYS B 2 7  ? -1.739  5.181   -11.369 1.00 0.00 ? 7  CYS B CA   13 
ATOM   9792  C C    . CYS B 2 7  ? -2.370  3.922   -11.970 1.00 0.00 ? 7  CYS B C    13 
ATOM   9793  O O    . CYS B 2 7  ? -1.730  2.905   -12.064 1.00 0.00 ? 7  CYS B O    13 
ATOM   9794  C CB   . CYS B 2 7  ? -2.142  6.399   -12.204 1.00 0.00 ? 7  CYS B CB   13 
ATOM   9795  S SG   . CYS B 2 7  ? -1.445  7.899   -11.472 1.00 0.00 ? 7  CYS B SG   13 
ATOM   9796  H H    . CYS B 2 7  ? 0.150   4.458   -12.081 1.00 0.00 ? 7  CYS B H    13 
ATOM   9797  H HA   . CYS B 2 7  ? -2.072  5.305   -10.346 1.00 0.00 ? 7  CYS B HA   13 
ATOM   9798  H HB2  . CYS B 2 7  ? -1.768  6.284   -13.210 1.00 0.00 ? 7  CYS B HB2  13 
ATOM   9799  H HB3  . CYS B 2 7  ? -3.218  6.479   -12.229 1.00 0.00 ? 7  CYS B HB3  13 
ATOM   9800  N N    . GLY B 2 8  ? -3.610  3.993   -12.378 1.00 0.00 ? 8  GLY B N    13 
ATOM   9801  C CA   . GLY B 2 8  ? -4.299  2.802   -12.978 1.00 0.00 ? 8  GLY B CA   13 
ATOM   9802  C C    . GLY B 2 8  ? -3.293  1.815   -13.590 1.00 0.00 ? 8  GLY B C    13 
ATOM   9803  O O    . GLY B 2 8  ? -2.687  1.016   -12.900 1.00 0.00 ? 8  GLY B O    13 
ATOM   9804  H H    . GLY B 2 8  ? -4.099  4.838   -12.288 1.00 0.00 ? 8  GLY B H    13 
ATOM   9805  H HA2  . GLY B 2 8  ? -4.865  2.298   -12.212 1.00 0.00 ? 8  GLY B HA2  13 
ATOM   9806  H HA3  . GLY B 2 8  ? -4.974  3.140   -13.751 1.00 0.00 ? 8  GLY B HA3  13 
ATOM   9807  N N    . SER B 2 9  ? -3.123  1.854   -14.879 1.00 0.00 ? 9  SER B N    13 
ATOM   9808  C CA   . SER B 2 9  ? -2.175  0.911   -15.544 1.00 0.00 ? 9  SER B CA   13 
ATOM   9809  C C    . SER B 2 9  ? -0.792  0.967   -14.881 1.00 0.00 ? 9  SER B C    13 
ATOM   9810  O O    . SER B 2 9  ? -0.354  0.021   -14.257 1.00 0.00 ? 9  SER B O    13 
ATOM   9811  C CB   . SER B 2 9  ? -2.038  1.292   -17.018 1.00 0.00 ? 9  SER B CB   13 
ATOM   9812  O OG   . SER B 2 9  ? -1.004  0.514   -17.610 1.00 0.00 ? 9  SER B OG   13 
ATOM   9813  H H    . SER B 2 9  ? -3.630  2.496   -15.417 1.00 0.00 ? 9  SER B H    13 
ATOM   9814  H HA   . SER B 2 9  ? -2.564  -0.094  -15.473 1.00 0.00 ? 9  SER B HA   13 
ATOM   9815  H HB2  . SER B 2 9  ? -2.965  1.100   -17.531 1.00 0.00 ? 9  SER B HB2  13 
ATOM   9816  H HB3  . SER B 2 9  ? -1.797  2.344   -17.094 1.00 0.00 ? 9  SER B HB3  13 
ATOM   9817  H HG   . SER B 2 9  ? -1.330  -0.383  -17.712 1.00 0.00 ? 9  SER B HG   13 
ATOM   9818  N N    . ASP B 2 10 ? -0.094  2.057   -15.039 1.00 0.00 ? 10 ASP B N    13 
ATOM   9819  C CA   . ASP B 2 10 ? 1.275   2.175   -14.452 1.00 0.00 ? 10 ASP B CA   13 
ATOM   9820  C C    . ASP B 2 10 ? 1.339   1.540   -13.054 1.00 0.00 ? 10 ASP B C    13 
ATOM   9821  O O    . ASP B 2 10 ? 2.267   0.818   -12.742 1.00 0.00 ? 10 ASP B O    13 
ATOM   9822  C CB   . ASP B 2 10 ? 1.665   3.653   -14.368 1.00 0.00 ? 10 ASP B CB   13 
ATOM   9823  C CG   . ASP B 2 10 ? 1.336   4.342   -15.694 1.00 0.00 ? 10 ASP B CG   13 
ATOM   9824  O OD1  . ASP B 2 10 ? 2.172   4.304   -16.583 1.00 0.00 ? 10 ASP B OD1  13 
ATOM   9825  O OD2  . ASP B 2 10 ? 0.254   4.894   -15.801 1.00 0.00 ? 10 ASP B OD2  13 
ATOM   9826  H H    . ASP B 2 10 ? -0.462  2.798   -15.565 1.00 0.00 ? 10 ASP B H    13 
ATOM   9827  H HA   . ASP B 2 10 ? 1.975   1.667   -15.098 1.00 0.00 ? 10 ASP B HA   13 
ATOM   9828  H HB2  . ASP B 2 10 ? 1.115   4.126   -13.572 1.00 0.00 ? 10 ASP B HB2  13 
ATOM   9829  H HB3  . ASP B 2 10 ? 2.725   3.736   -14.176 1.00 0.00 ? 10 ASP B HB3  13 
ATOM   9830  N N    . LEU B 2 11 ? 0.373   1.786   -12.207 1.00 0.00 ? 11 LEU B N    13 
ATOM   9831  C CA   . LEU B 2 11 ? 0.418   1.174   -10.846 1.00 0.00 ? 11 LEU B CA   13 
ATOM   9832  C C    . LEU B 2 11 ? 0.073   -0.309  -10.972 1.00 0.00 ? 11 LEU B C    13 
ATOM   9833  O O    . LEU B 2 11 ? 0.570   -1.140  -10.238 1.00 0.00 ? 11 LEU B O    13 
ATOM   9834  C CB   . LEU B 2 11 ? -0.589  1.868   -9.912  1.00 0.00 ? 11 LEU B CB   13 
ATOM   9835  C CG   . LEU B 2 11 ? 0.003   2.060   -8.506  1.00 0.00 ? 11 LEU B CG   13 
ATOM   9836  C CD1  . LEU B 2 11 ? -1.129  2.063   -7.479  1.00 0.00 ? 11 LEU B CD1  13 
ATOM   9837  C CD2  . LEU B 2 11 ? 0.970   0.927   -8.169  1.00 0.00 ? 11 LEU B CD2  13 
ATOM   9838  H H    . LEU B 2 11 ? -0.380  2.361   -12.466 1.00 0.00 ? 11 LEU B H    13 
ATOM   9839  H HA   . LEU B 2 11 ? 1.415   1.276   -10.443 1.00 0.00 ? 11 LEU B HA   13 
ATOM   9840  H HB2  . LEU B 2 11 ? -0.837  2.833   -10.314 1.00 0.00 ? 11 LEU B HB2  13 
ATOM   9841  H HB3  . LEU B 2 11 ? -1.485  1.269   -9.840  1.00 0.00 ? 11 LEU B HB3  13 
ATOM   9842  H HG   . LEU B 2 11 ? 0.525   3.005   -8.465  1.00 0.00 ? 11 LEU B HG   13 
ATOM   9843  H HD11 . LEU B 2 11 ? -2.067  2.252   -7.978  1.00 0.00 ? 11 LEU B HD11 13 
ATOM   9844  H HD12 . LEU B 2 11 ? -0.948  2.834   -6.745  1.00 0.00 ? 11 LEU B HD12 13 
ATOM   9845  H HD13 . LEU B 2 11 ? -1.171  1.100   -6.988  1.00 0.00 ? 11 LEU B HD13 13 
ATOM   9846  H HD21 . LEU B 2 11 ? 1.123   0.894   -7.102  1.00 0.00 ? 11 LEU B HD21 13 
ATOM   9847  H HD22 . LEU B 2 11 ? 1.914   1.100   -8.663  1.00 0.00 ? 11 LEU B HD22 13 
ATOM   9848  H HD23 . LEU B 2 11 ? 0.553   -0.010  -8.501  1.00 0.00 ? 11 LEU B HD23 13 
ATOM   9849  N N    . VAL B 2 12 ? -0.759  -0.650  -11.915 1.00 0.00 ? 12 VAL B N    13 
ATOM   9850  C CA   . VAL B 2 12 ? -1.116  -2.079  -12.102 1.00 0.00 ? 12 VAL B CA   13 
ATOM   9851  C C    . VAL B 2 12 ? 0.107   -2.805  -12.660 1.00 0.00 ? 12 VAL B C    13 
ATOM   9852  O O    . VAL B 2 12 ? 0.416   -3.915  -12.275 1.00 0.00 ? 12 VAL B O    13 
ATOM   9853  C CB   . VAL B 2 12 ? -2.286  -2.183  -13.085 1.00 0.00 ? 12 VAL B CB   13 
ATOM   9854  C CG1  . VAL B 2 12 ? -2.364  -3.602  -13.658 1.00 0.00 ? 12 VAL B CG1  13 
ATOM   9855  C CG2  . VAL B 2 12 ? -3.590  -1.861  -12.354 1.00 0.00 ? 12 VAL B CG2  13 
ATOM   9856  H H    . VAL B 2 12 ? -1.135  0.032   -12.511 1.00 0.00 ? 12 VAL B H    13 
ATOM   9857  H HA   . VAL B 2 12 ? -1.395  -2.511  -11.152 1.00 0.00 ? 12 VAL B HA   13 
ATOM   9858  H HB   . VAL B 2 12 ? -2.141  -1.475  -13.889 1.00 0.00 ? 12 VAL B HB   13 
ATOM   9859  H HG11 . VAL B 2 12 ? -1.706  -3.683  -14.510 1.00 0.00 ? 12 VAL B HG11 13 
ATOM   9860  H HG12 . VAL B 2 12 ? -3.379  -3.811  -13.965 1.00 0.00 ? 12 VAL B HG12 13 
ATOM   9861  H HG13 . VAL B 2 12 ? -2.064  -4.313  -12.902 1.00 0.00 ? 12 VAL B HG13 13 
ATOM   9862  H HG21 . VAL B 2 12 ? -4.386  -1.738  -13.074 1.00 0.00 ? 12 VAL B HG21 13 
ATOM   9863  H HG22 . VAL B 2 12 ? -3.471  -0.948  -11.790 1.00 0.00 ? 12 VAL B HG22 13 
ATOM   9864  H HG23 . VAL B 2 12 ? -3.836  -2.669  -11.681 1.00 0.00 ? 12 VAL B HG23 13 
ATOM   9865  N N    . GLU B 2 13 ? 0.815   -2.173  -13.555 1.00 0.00 ? 13 GLU B N    13 
ATOM   9866  C CA   . GLU B 2 13 ? 2.029   -2.808  -14.131 1.00 0.00 ? 13 GLU B CA   13 
ATOM   9867  C C    . GLU B 2 13 ? 2.966   -3.194  -12.988 1.00 0.00 ? 13 GLU B C    13 
ATOM   9868  O O    . GLU B 2 13 ? 3.539   -4.265  -12.974 1.00 0.00 ? 13 GLU B O    13 
ATOM   9869  C CB   . GLU B 2 13 ? 2.729   -1.815  -15.058 1.00 0.00 ? 13 GLU B CB   13 
ATOM   9870  C CG   . GLU B 2 13 ? 2.013   -1.789  -16.410 1.00 0.00 ? 13 GLU B CG   13 
ATOM   9871  C CD   . GLU B 2 13 ? 3.047   -1.762  -17.536 1.00 0.00 ? 13 GLU B CD   13 
ATOM   9872  O OE1  . GLU B 2 13 ? 4.228   -1.793  -17.229 1.00 0.00 ? 13 GLU B OE1  13 
ATOM   9873  O OE2  . GLU B 2 13 ? 2.642   -1.711  -18.685 1.00 0.00 ? 13 GLU B OE2  13 
ATOM   9874  H H    . GLU B 2 13 ? 0.551   -1.273  -13.841 1.00 0.00 ? 13 GLU B H    13 
ATOM   9875  H HA   . GLU B 2 13 ? 1.750   -3.692  -14.685 1.00 0.00 ? 13 GLU B HA   13 
ATOM   9876  H HB2  . GLU B 2 13 ? 2.699   -0.829  -14.616 1.00 0.00 ? 13 GLU B HB2  13 
ATOM   9877  H HB3  . GLU B 2 13 ? 3.756   -2.116  -15.201 1.00 0.00 ? 13 GLU B HB3  13 
ATOM   9878  H HG2  . GLU B 2 13 ? 1.398   -2.672  -16.507 1.00 0.00 ? 13 GLU B HG2  13 
ATOM   9879  H HG3  . GLU B 2 13 ? 1.392   -0.908  -16.471 1.00 0.00 ? 13 GLU B HG3  13 
ATOM   9880  N N    . ALA B 2 14 ? 3.116   -2.329  -12.021 1.00 0.00 ? 14 ALA B N    13 
ATOM   9881  C CA   . ALA B 2 14 ? 4.004   -2.651  -10.871 1.00 0.00 ? 14 ALA B CA   13 
ATOM   9882  C C    . ALA B 2 14 ? 3.414   -3.837  -10.107 1.00 0.00 ? 14 ALA B C    13 
ATOM   9883  O O    . ALA B 2 14 ? 4.044   -4.865  -9.954  1.00 0.00 ? 14 ALA B O    13 
ATOM   9884  C CB   . ALA B 2 14 ? 4.099   -1.440  -9.942  1.00 0.00 ? 14 ALA B CB   13 
ATOM   9885  H H    . ALA B 2 14 ? 2.638   -1.474  -12.047 1.00 0.00 ? 14 ALA B H    13 
ATOM   9886  H HA   . ALA B 2 14 ? 4.989   -2.909  -11.235 1.00 0.00 ? 14 ALA B HA   13 
ATOM   9887  H HB1  . ALA B 2 14 ? 3.427   -1.575  -9.108  1.00 0.00 ? 14 ALA B HB1  13 
ATOM   9888  H HB2  . ALA B 2 14 ? 3.826   -0.549  -10.486 1.00 0.00 ? 14 ALA B HB2  13 
ATOM   9889  H HB3  . ALA B 2 14 ? 5.111   -1.343  -9.579  1.00 0.00 ? 14 ALA B HB3  13 
ATOM   9890  N N    . LEU B 2 15 ? 2.203   -3.707  -9.634  1.00 0.00 ? 15 LEU B N    13 
ATOM   9891  C CA   . LEU B 2 15 ? 1.570   -4.830  -8.893  1.00 0.00 ? 15 LEU B CA   13 
ATOM   9892  C C    . LEU B 2 15 ? 1.754   -6.119  -9.693  1.00 0.00 ? 15 LEU B C    13 
ATOM   9893  O O    . LEU B 2 15 ? 2.116   -7.150  -9.161  1.00 0.00 ? 15 LEU B O    13 
ATOM   9894  C CB   . LEU B 2 15 ? 0.078   -4.547  -8.721  1.00 0.00 ? 15 LEU B CB   13 
ATOM   9895  C CG   . LEU B 2 15 ? -0.117  -3.447  -7.677  1.00 0.00 ? 15 LEU B CG   13 
ATOM   9896  C CD1  . LEU B 2 15 ? -1.469  -2.766  -7.898  1.00 0.00 ? 15 LEU B CD1  13 
ATOM   9897  C CD2  . LEU B 2 15 ? -0.081  -4.065  -6.278  1.00 0.00 ? 15 LEU B CD2  13 
ATOM   9898  H H    . LEU B 2 15 ? 1.708   -2.872  -9.774  1.00 0.00 ? 15 LEU B H    13 
ATOM   9899  H HA   . LEU B 2 15 ? 2.035   -4.935  -7.923  1.00 0.00 ? 15 LEU B HA   13 
ATOM   9900  H HB2  . LEU B 2 15 ? -0.339  -4.225  -9.666  1.00 0.00 ? 15 LEU B HB2  13 
ATOM   9901  H HB3  . LEU B 2 15 ? -0.425  -5.445  -8.394  1.00 0.00 ? 15 LEU B HB3  13 
ATOM   9902  H HG   . LEU B 2 15 ? 0.674   -2.718  -7.772  1.00 0.00 ? 15 LEU B HG   13 
ATOM   9903  H HD11 . LEU B 2 15 ? -1.368  -1.704  -7.733  1.00 0.00 ? 15 LEU B HD11 13 
ATOM   9904  H HD12 . LEU B 2 15 ? -2.193  -3.172  -7.208  1.00 0.00 ? 15 LEU B HD12 13 
ATOM   9905  H HD13 . LEU B 2 15 ? -1.799  -2.944  -8.912  1.00 0.00 ? 15 LEU B HD13 13 
ATOM   9906  H HD21 . LEU B 2 15 ? -0.735  -4.923  -6.248  1.00 0.00 ? 15 LEU B HD21 13 
ATOM   9907  H HD22 . LEU B 2 15 ? -0.410  -3.334  -5.554  1.00 0.00 ? 15 LEU B HD22 13 
ATOM   9908  H HD23 . LEU B 2 15 ? 0.928   -4.373  -6.048  1.00 0.00 ? 15 LEU B HD23 13 
ATOM   9909  N N    . TYR B 2 16 ? 1.511   -6.064  -10.973 1.00 0.00 ? 16 TYR B N    13 
ATOM   9910  C CA   . TYR B 2 16 ? 1.673   -7.278  -11.821 1.00 0.00 ? 16 TYR B CA   13 
ATOM   9911  C C    . TYR B 2 16 ? 3.125   -7.755  -11.749 1.00 0.00 ? 16 TYR B C    13 
ATOM   9912  O O    . TYR B 2 16 ? 3.400   -8.938  -11.736 1.00 0.00 ? 16 TYR B O    13 
ATOM   9913  C CB   . TYR B 2 16 ? 1.322   -6.932  -13.269 1.00 0.00 ? 16 TYR B CB   13 
ATOM   9914  C CG   . TYR B 2 16 ? 0.229   -7.857  -13.758 1.00 0.00 ? 16 TYR B CG   13 
ATOM   9915  C CD1  . TYR B 2 16 ? 0.221   -9.205  -13.370 1.00 0.00 ? 16 TYR B CD1  13 
ATOM   9916  C CD2  . TYR B 2 16 ? -0.780  -7.368  -14.601 1.00 0.00 ? 16 TYR B CD2  13 
ATOM   9917  C CE1  . TYR B 2 16 ? -0.792  -10.060 -13.824 1.00 0.00 ? 16 TYR B CE1  13 
ATOM   9918  C CE2  . TYR B 2 16 ? -1.793  -8.224  -15.054 1.00 0.00 ? 16 TYR B CE2  13 
ATOM   9919  C CZ   . TYR B 2 16 ? -1.798  -9.569  -14.666 1.00 0.00 ? 16 TYR B CZ   13 
ATOM   9920  O OH   . TYR B 2 16 ? -2.795  -10.411 -15.113 1.00 0.00 ? 16 TYR B OH   13 
ATOM   9921  H H    . TYR B 2 16 ? 1.224   -5.220  -11.378 1.00 0.00 ? 16 TYR B H    13 
ATOM   9922  H HA   . TYR B 2 16 ? 1.016   -8.058  -11.465 1.00 0.00 ? 16 TYR B HA   13 
ATOM   9923  H HB2  . TYR B 2 16 ? 0.982   -5.907  -13.321 1.00 0.00 ? 16 TYR B HB2  13 
ATOM   9924  H HB3  . TYR B 2 16 ? 2.199   -7.051  -13.890 1.00 0.00 ? 16 TYR B HB3  13 
ATOM   9925  H HD1  . TYR B 2 16 ? 0.994   -9.586  -12.722 1.00 0.00 ? 16 TYR B HD1  13 
ATOM   9926  H HD2  . TYR B 2 16 ? -0.779  -6.331  -14.901 1.00 0.00 ? 16 TYR B HD2  13 
ATOM   9927  H HE1  . TYR B 2 16 ? -0.796  -11.098 -13.526 1.00 0.00 ? 16 TYR B HE1  13 
ATOM   9928  H HE2  . TYR B 2 16 ? -2.568  -7.845  -15.704 1.00 0.00 ? 16 TYR B HE2  13 
ATOM   9929  H HH   . TYR B 2 16 ? -2.693  -10.514 -16.062 1.00 0.00 ? 16 TYR B HH   13 
ATOM   9930  N N    . LEU B 2 17 ? 4.055   -6.841  -11.705 1.00 0.00 ? 17 LEU B N    13 
ATOM   9931  C CA   . LEU B 2 17 ? 5.488   -7.239  -11.635 1.00 0.00 ? 17 LEU B CA   13 
ATOM   9932  C C    . LEU B 2 17 ? 5.919   -7.342  -10.170 1.00 0.00 ? 17 LEU B C    13 
ATOM   9933  O O    . LEU B 2 17 ? 7.014   -7.771  -9.864  1.00 0.00 ? 17 LEU B O    13 
ATOM   9934  C CB   . LEU B 2 17 ? 6.342   -6.185  -12.345 1.00 0.00 ? 17 LEU B CB   13 
ATOM   9935  C CG   . LEU B 2 17 ? 6.263   -6.397  -13.857 1.00 0.00 ? 17 LEU B CG   13 
ATOM   9936  C CD1  . LEU B 2 17 ? 6.582   -5.084  -14.577 1.00 0.00 ? 17 LEU B CD1  13 
ATOM   9937  C CD2  . LEU B 2 17 ? 7.277   -7.464  -14.272 1.00 0.00 ? 17 LEU B CD2  13 
ATOM   9938  H H    . LEU B 2 17 ? 3.810   -5.892  -11.717 1.00 0.00 ? 17 LEU B H    13 
ATOM   9939  H HA   . LEU B 2 17 ? 5.622   -8.196  -12.119 1.00 0.00 ? 17 LEU B HA   13 
ATOM   9940  H HB2  . LEU B 2 17 ? 5.973   -5.199  -12.100 1.00 0.00 ? 17 LEU B HB2  13 
ATOM   9941  H HB3  . LEU B 2 17 ? 7.369   -6.276  -12.023 1.00 0.00 ? 17 LEU B HB3  13 
ATOM   9942  H HG   . LEU B 2 17 ? 5.267   -6.721  -14.123 1.00 0.00 ? 17 LEU B HG   13 
ATOM   9943  H HD11 . LEU B 2 17 ? 5.995   -4.287  -14.145 1.00 0.00 ? 17 LEU B HD11 13 
ATOM   9944  H HD12 . LEU B 2 17 ? 6.342   -5.181  -15.625 1.00 0.00 ? 17 LEU B HD12 13 
ATOM   9945  H HD13 . LEU B 2 17 ? 7.631   -4.859  -14.466 1.00 0.00 ? 17 LEU B HD13 13 
ATOM   9946  H HD21 . LEU B 2 17 ? 6.767   -8.264  -14.788 1.00 0.00 ? 17 LEU B HD21 13 
ATOM   9947  H HD22 . LEU B 2 17 ? 7.766   -7.856  -13.394 1.00 0.00 ? 17 LEU B HD22 13 
ATOM   9948  H HD23 . LEU B 2 17 ? 8.015   -7.025  -14.928 1.00 0.00 ? 17 LEU B HD23 13 
ATOM   9949  N N    . VAL B 2 18 ? 5.068   -6.950  -9.262  1.00 0.00 ? 18 VAL B N    13 
ATOM   9950  C CA   . VAL B 2 18 ? 5.429   -7.024  -7.819  1.00 0.00 ? 18 VAL B CA   13 
ATOM   9951  C C    . VAL B 2 18 ? 5.017   -8.387  -7.262  1.00 0.00 ? 18 VAL B C    13 
ATOM   9952  O O    . VAL B 2 18 ? 5.826   -9.124  -6.732  1.00 0.00 ? 18 VAL B O    13 
ATOM   9953  C CB   . VAL B 2 18 ? 4.689   -5.924  -7.056  1.00 0.00 ? 18 VAL B CB   13 
ATOM   9954  C CG1  . VAL B 2 18 ? 4.990   -6.051  -5.564  1.00 0.00 ? 18 VAL B CG1  13 
ATOM   9955  C CG2  . VAL B 2 18 ? 5.152   -4.555  -7.556  1.00 0.00 ? 18 VAL B CG2  13 
ATOM   9956  H H    . VAL B 2 18 ? 4.190   -6.606  -9.527  1.00 0.00 ? 18 VAL B H    13 
ATOM   9957  H HA   . VAL B 2 18 ? 6.494   -6.891  -7.704  1.00 0.00 ? 18 VAL B HA   13 
ATOM   9958  H HB   . VAL B 2 18 ? 3.626   -6.028  -7.218  1.00 0.00 ? 18 VAL B HB   13 
ATOM   9959  H HG11 . VAL B 2 18 ? 6.025   -6.323  -5.428  1.00 0.00 ? 18 VAL B HG11 13 
ATOM   9960  H HG12 . VAL B 2 18 ? 4.357   -6.814  -5.134  1.00 0.00 ? 18 VAL B HG12 13 
ATOM   9961  H HG13 . VAL B 2 18 ? 4.798   -5.106  -5.077  1.00 0.00 ? 18 VAL B HG13 13 
ATOM   9962  H HG21 . VAL B 2 18 ? 5.585   -4.658  -8.539  1.00 0.00 ? 18 VAL B HG21 13 
ATOM   9963  H HG22 . VAL B 2 18 ? 5.889   -4.154  -6.877  1.00 0.00 ? 18 VAL B HG22 13 
ATOM   9964  H HG23 . VAL B 2 18 ? 4.306   -3.885  -7.604  1.00 0.00 ? 18 VAL B HG23 13 
ATOM   9965  N N    . CYS B 2 19 ? 3.763   -8.724  -7.375  1.00 0.00 ? 19 CYS B N    13 
ATOM   9966  C CA   . CYS B 2 19 ? 3.291   -10.035 -6.851  1.00 0.00 ? 19 CYS B CA   13 
ATOM   9967  C C    . CYS B 2 19 ? 3.803   -11.160 -7.753  1.00 0.00 ? 19 CYS B C    13 
ATOM   9968  O O    . CYS B 2 19 ? 4.593   -11.987 -7.342  1.00 0.00 ? 19 CYS B O    13 
ATOM   9969  C CB   . CYS B 2 19 ? 1.763   -10.049 -6.833  1.00 0.00 ? 19 CYS B CB   13 
ATOM   9970  S SG   . CYS B 2 19 ? 1.158   -8.448  -6.243  1.00 0.00 ? 19 CYS B SG   13 
ATOM   9971  H H    . CYS B 2 19 ? 3.130   -8.110  -7.804  1.00 0.00 ? 19 CYS B H    13 
ATOM   9972  H HA   . CYS B 2 19 ? 3.666   -10.179 -5.848  1.00 0.00 ? 19 CYS B HA   13 
ATOM   9973  H HB2  . CYS B 2 19 ? 1.391   -10.230 -7.831  1.00 0.00 ? 19 CYS B HB2  13 
ATOM   9974  H HB3  . CYS B 2 19 ? 1.418   -10.830 -6.172  1.00 0.00 ? 19 CYS B HB3  13 
ATOM   9975  N N    . GLY B 2 20 ? 3.363   -11.195 -8.980  1.00 0.00 ? 20 GLY B N    13 
ATOM   9976  C CA   . GLY B 2 20 ? 3.827   -12.265 -9.909  1.00 0.00 ? 20 GLY B CA   13 
ATOM   9977  C C    . GLY B 2 20 ? 3.046   -13.554 -9.648  1.00 0.00 ? 20 GLY B C    13 
ATOM   9978  O O    . GLY B 2 20 ? 2.196   -13.944 -10.423 1.00 0.00 ? 20 GLY B O    13 
ATOM   9979  H H    . GLY B 2 20 ? 2.728   -10.517 -9.292  1.00 0.00 ? 20 GLY B H    13 
ATOM   9980  H HA2  . GLY B 2 20 ? 3.668   -11.947 -10.930 1.00 0.00 ? 20 GLY B HA2  13 
ATOM   9981  H HA3  . GLY B 2 20 ? 4.879   -12.447 -9.750  1.00 0.00 ? 20 GLY B HA3  13 
ATOM   9982  N N    . GLU B 2 21 ? 3.330   -14.221 -8.564  1.00 0.00 ? 21 GLU B N    13 
ATOM   9983  C CA   . GLU B 2 21 ? 2.606   -15.487 -8.257  1.00 0.00 ? 21 GLU B CA   13 
ATOM   9984  C C    . GLU B 2 21 ? 1.453   -15.199 -7.295  1.00 0.00 ? 21 GLU B C    13 
ATOM   9985  O O    . GLU B 2 21 ? 0.302   -15.455 -7.594  1.00 0.00 ? 21 GLU B O    13 
ATOM   9986  C CB   . GLU B 2 21 ? 3.576   -16.478 -7.607  1.00 0.00 ? 21 GLU B CB   13 
ATOM   9987  C CG   . GLU B 2 21 ? 4.853   -16.569 -8.444  1.00 0.00 ? 21 GLU B CG   13 
ATOM   9988  C CD   . GLU B 2 21 ? 4.844   -17.868 -9.251  1.00 0.00 ? 21 GLU B CD   13 
ATOM   9989  O OE1  . GLU B 2 21 ? 3.857   -18.117 -9.924  1.00 0.00 ? 21 GLU B OE1  13 
ATOM   9990  O OE2  . GLU B 2 21 ? 5.823   -18.592 -9.181  1.00 0.00 ? 21 GLU B OE2  13 
ATOM   9991  H H    . GLU B 2 21 ? 4.022   -13.892 -7.952  1.00 0.00 ? 21 GLU B H    13 
ATOM   9992  H HA   . GLU B 2 21 ? 2.218   -15.912 -9.170  1.00 0.00 ? 21 GLU B HA   13 
ATOM   9993  H HB2  . GLU B 2 21 ? 3.822   -16.139 -6.610  1.00 0.00 ? 21 GLU B HB2  13 
ATOM   9994  H HB3  . GLU B 2 21 ? 3.113   -17.452 -7.552  1.00 0.00 ? 21 GLU B HB3  13 
ATOM   9995  H HG2  . GLU B 2 21 ? 4.900   -15.725 -9.119  1.00 0.00 ? 21 GLU B HG2  13 
ATOM   9996  H HG3  . GLU B 2 21 ? 5.714   -16.557 -7.793  1.00 0.00 ? 21 GLU B HG3  13 
ATOM   9997  N N    . ARG B 2 22 ? 1.756   -14.674 -6.142  1.00 0.00 ? 22 ARG B N    13 
ATOM   9998  C CA   . ARG B 2 22 ? 0.687   -14.367 -5.148  1.00 0.00 ? 22 ARG B CA   13 
ATOM   9999  C C    . ARG B 2 22 ? -0.528  -13.765 -5.860  1.00 0.00 ? 22 ARG B C    13 
ATOM   10000 O O    . ARG B 2 22 ? -1.660  -14.059 -5.529  1.00 0.00 ? 22 ARG B O    13 
ATOM   10001 C CB   . ARG B 2 22 ? 1.222   -13.364 -4.123  1.00 0.00 ? 22 ARG B CB   13 
ATOM   10002 C CG   . ARG B 2 22 ? 2.638   -13.767 -3.707  1.00 0.00 ? 22 ARG B CG   13 
ATOM   10003 C CD   . ARG B 2 22 ? 2.757   -13.721 -2.184  1.00 0.00 ? 22 ARG B CD   13 
ATOM   10004 N NE   . ARG B 2 22 ? 2.985   -15.098 -1.662  1.00 0.00 ? 22 ARG B NE   13 
ATOM   10005 C CZ   . ARG B 2 22 ? 2.924   -15.329 -0.378  1.00 0.00 ? 22 ARG B CZ   13 
ATOM   10006 N NH1  . ARG B 2 22 ? 3.959   -15.090 0.378   1.00 0.00 ? 22 ARG B NH1  13 
ATOM   10007 N NH2  . ARG B 2 22 ? 1.827   -15.803 0.146   1.00 0.00 ? 22 ARG B NH2  13 
ATOM   10008 H H    . ARG B 2 22 ? 2.692   -14.483 -5.925  1.00 0.00 ? 22 ARG B H    13 
ATOM   10009 H HA   . ARG B 2 22 ? 0.395   -15.275 -4.642  1.00 0.00 ? 22 ARG B HA   13 
ATOM   10010 H HB2  . ARG B 2 22 ? 1.242   -12.378 -4.562  1.00 0.00 ? 22 ARG B HB2  13 
ATOM   10011 H HB3  . ARG B 2 22 ? 0.582   -13.360 -3.253  1.00 0.00 ? 22 ARG B HB3  13 
ATOM   10012 H HG2  . ARG B 2 22 ? 2.844   -14.769 -4.056  1.00 0.00 ? 22 ARG B HG2  13 
ATOM   10013 H HG3  . ARG B 2 22 ? 3.350   -13.082 -4.143  1.00 0.00 ? 22 ARG B HG3  13 
ATOM   10014 H HD2  . ARG B 2 22 ? 3.586   -13.088 -1.906  1.00 0.00 ? 22 ARG B HD2  13 
ATOM   10015 H HD3  . ARG B 2 22 ? 1.845   -13.324 -1.764  1.00 0.00 ? 22 ARG B HD3  13 
ATOM   10016 H HE   . ARG B 2 22 ? 3.181   -15.831 -2.284  1.00 0.00 ? 22 ARG B HE   13 
ATOM   10017 H HH11 . ARG B 2 22 ? 4.800   -14.729 -0.024  1.00 0.00 ? 22 ARG B HH11 13 
ATOM   10018 H HH12 . ARG B 2 22 ? 3.912   -15.268 1.361   1.00 0.00 ? 22 ARG B HH12 13 
ATOM   10019 H HH21 . ARG B 2 22 ? 1.034   -15.988 -0.433  1.00 0.00 ? 22 ARG B HH21 13 
ATOM   10020 H HH22 . ARG B 2 22 ? 1.779   -15.981 1.130   1.00 0.00 ? 22 ARG B HH22 13 
ATOM   10021 N N    . GLY B 2 23 ? -0.303  -12.922 -6.830  1.00 0.00 ? 23 GLY B N    13 
ATOM   10022 C CA   . GLY B 2 23 ? -1.446  -12.299 -7.555  1.00 0.00 ? 23 GLY B CA   13 
ATOM   10023 C C    . GLY B 2 23 ? -1.709  -10.905 -6.985  1.00 0.00 ? 23 GLY B C    13 
ATOM   10024 O O    . GLY B 2 23 ? -0.850  -10.309 -6.367  1.00 0.00 ? 23 GLY B O    13 
ATOM   10025 H H    . GLY B 2 23 ? 0.618   -12.696 -7.077  1.00 0.00 ? 23 GLY B H    13 
ATOM   10026 H HA2  . GLY B 2 23 ? -1.205  -12.221 -8.606  1.00 0.00 ? 23 GLY B HA2  13 
ATOM   10027 H HA3  . GLY B 2 23 ? -2.327  -12.909 -7.432  1.00 0.00 ? 23 GLY B HA3  13 
ATOM   10028 N N    . PHE B 2 24 ? -2.890  -10.384 -7.177  1.00 0.00 ? 24 PHE B N    13 
ATOM   10029 C CA   . PHE B 2 24 ? -3.200  -9.026  -6.634  1.00 0.00 ? 24 PHE B CA   13 
ATOM   10030 C C    . PHE B 2 24 ? -4.613  -8.605  -7.054  1.00 0.00 ? 24 PHE B C    13 
ATOM   10031 O O    . PHE B 2 24 ? -5.290  -9.300  -7.787  1.00 0.00 ? 24 PHE B O    13 
ATOM   10032 C CB   . PHE B 2 24 ? -2.153  -8.008  -7.146  1.00 0.00 ? 24 PHE B CB   13 
ATOM   10033 C CG   . PHE B 2 24 ? -2.655  -7.277  -8.388  1.00 0.00 ? 24 PHE B CG   13 
ATOM   10034 C CD1  . PHE B 2 24 ? -2.610  -7.902  -9.644  1.00 0.00 ? 24 PHE B CD1  13 
ATOM   10035 C CD2  . PHE B 2 24 ? -3.169  -5.970  -8.282  1.00 0.00 ? 24 PHE B CD2  13 
ATOM   10036 C CE1  . PHE B 2 24 ? -3.072  -7.230  -10.783 1.00 0.00 ? 24 PHE B CE1  13 
ATOM   10037 C CE2  . PHE B 2 24 ? -3.631  -5.303  -9.424  1.00 0.00 ? 24 PHE B CE2  13 
ATOM   10038 C CZ   . PHE B 2 24 ? -3.582  -5.932  -10.672 1.00 0.00 ? 24 PHE B CZ   13 
ATOM   10039 H H    . PHE B 2 24 ? -3.575  -10.889 -7.671  1.00 0.00 ? 24 PHE B H    13 
ATOM   10040 H HA   . PHE B 2 24 ? -3.154  -9.064  -5.556  1.00 0.00 ? 24 PHE B HA   13 
ATOM   10041 H HB2  . PHE B 2 24 ? -1.959  -7.285  -6.366  1.00 0.00 ? 24 PHE B HB2  13 
ATOM   10042 H HB3  . PHE B 2 24 ? -1.231  -8.532  -7.379  1.00 0.00 ? 24 PHE B HB3  13 
ATOM   10043 H HD1  . PHE B 2 24 ? -2.219  -8.899  -9.737  1.00 0.00 ? 24 PHE B HD1  13 
ATOM   10044 H HD2  . PHE B 2 24 ? -3.210  -5.476  -7.322  1.00 0.00 ? 24 PHE B HD2  13 
ATOM   10045 H HE1  . PHE B 2 24 ? -3.035  -7.714  -11.747 1.00 0.00 ? 24 PHE B HE1  13 
ATOM   10046 H HE2  . PHE B 2 24 ? -4.025  -4.300  -9.340  1.00 0.00 ? 24 PHE B HE2  13 
ATOM   10047 H HZ   . PHE B 2 24 ? -3.940  -5.416  -11.551 1.00 0.00 ? 24 PHE B HZ   13 
ATOM   10048 N N    . PHE B 2 25 ? -5.055  -7.468  -6.595  1.00 0.00 ? 25 PHE B N    13 
ATOM   10049 C CA   . PHE B 2 25 ? -6.417  -6.989  -6.962  1.00 0.00 ? 25 PHE B CA   13 
ATOM   10050 C C    . PHE B 2 25 ? -6.449  -5.462  -6.892  1.00 0.00 ? 25 PHE B C    13 
ATOM   10051 O O    . PHE B 2 25 ? -6.431  -4.878  -5.827  1.00 0.00 ? 25 PHE B O    13 
ATOM   10052 C CB   . PHE B 2 25 ? -7.439  -7.568  -5.984  1.00 0.00 ? 25 PHE B CB   13 
ATOM   10053 C CG   . PHE B 2 25 ? -7.062  -7.183  -4.573  1.00 0.00 ? 25 PHE B CG   13 
ATOM   10054 C CD1  . PHE B 2 25 ? -6.040  -7.873  -3.907  1.00 0.00 ? 25 PHE B CD1  13 
ATOM   10055 C CD2  . PHE B 2 25 ? -7.735  -6.135  -3.930  1.00 0.00 ? 25 PHE B CD2  13 
ATOM   10056 C CE1  . PHE B 2 25 ? -5.692  -7.515  -2.597  1.00 0.00 ? 25 PHE B CE1  13 
ATOM   10057 C CE2  . PHE B 2 25 ? -7.387  -5.779  -2.621  1.00 0.00 ? 25 PHE B CE2  13 
ATOM   10058 C CZ   . PHE B 2 25 ? -6.366  -6.469  -1.954  1.00 0.00 ? 25 PHE B CZ   13 
ATOM   10059 H H    . PHE B 2 25 ? -4.489  -6.925  -6.008  1.00 0.00 ? 25 PHE B H    13 
ATOM   10060 H HA   . PHE B 2 25 ? -6.655  -7.311  -7.966  1.00 0.00 ? 25 PHE B HA   13 
ATOM   10061 H HB2  . PHE B 2 25 ? -8.419  -7.177  -6.215  1.00 0.00 ? 25 PHE B HB2  13 
ATOM   10062 H HB3  . PHE B 2 25 ? -7.451  -8.645  -6.071  1.00 0.00 ? 25 PHE B HB3  13 
ATOM   10063 H HD1  . PHE B 2 25 ? -5.520  -8.680  -4.402  1.00 0.00 ? 25 PHE B HD1  13 
ATOM   10064 H HD2  . PHE B 2 25 ? -8.522  -5.604  -4.444  1.00 0.00 ? 25 PHE B HD2  13 
ATOM   10065 H HE1  . PHE B 2 25 ? -4.904  -8.047  -2.082  1.00 0.00 ? 25 PHE B HE1  13 
ATOM   10066 H HE2  . PHE B 2 25 ? -7.906  -4.972  -2.126  1.00 0.00 ? 25 PHE B HE2  13 
ATOM   10067 H HZ   . PHE B 2 25 ? -6.098  -6.194  -0.945  1.00 0.00 ? 25 PHE B HZ   13 
ATOM   10068 N N    . TYR B 2 26 ? -6.492  -4.807  -8.020  1.00 0.00 ? 26 TYR B N    13 
ATOM   10069 C CA   . TYR B 2 26 ? -6.519  -3.317  -8.019  1.00 0.00 ? 26 TYR B CA   13 
ATOM   10070 C C    . TYR B 2 26 ? -7.676  -2.825  -7.147  1.00 0.00 ? 26 TYR B C    13 
ATOM   10071 O O    . TYR B 2 26 ? -8.748  -3.397  -7.139  1.00 0.00 ? 26 TYR B O    13 
ATOM   10072 C CB   . TYR B 2 26 ? -6.709  -2.807  -9.448  1.00 0.00 ? 26 TYR B CB   13 
ATOM   10073 C CG   . TYR B 2 26 ? -5.860  -1.579  -9.662  1.00 0.00 ? 26 TYR B CG   13 
ATOM   10074 C CD1  . TYR B 2 26 ? -4.515  -1.581  -9.269  1.00 0.00 ? 26 TYR B CD1  13 
ATOM   10075 C CD2  . TYR B 2 26 ? -6.415  -0.436  -10.254 1.00 0.00 ? 26 TYR B CD2  13 
ATOM   10076 C CE1  . TYR B 2 26 ? -3.725  -0.443  -9.469  1.00 0.00 ? 26 TYR B CE1  13 
ATOM   10077 C CE2  . TYR B 2 26 ? -5.625  0.703   -10.455 1.00 0.00 ? 26 TYR B CE2  13 
ATOM   10078 C CZ   . TYR B 2 26 ? -4.280  0.700   -10.062 1.00 0.00 ? 26 TYR B CZ   13 
ATOM   10079 O OH   . TYR B 2 26 ? -3.500  1.823   -10.258 1.00 0.00 ? 26 TYR B OH   13 
ATOM   10080 H H    . TYR B 2 26 ? -6.503  -5.297  -8.870  1.00 0.00 ? 26 TYR B H    13 
ATOM   10081 H HA   . TYR B 2 26 ? -5.587  -2.942  -7.623  1.00 0.00 ? 26 TYR B HA   13 
ATOM   10082 H HB2  . TYR B 2 26 ? -6.412  -3.575  -10.147 1.00 0.00 ? 26 TYR B HB2  13 
ATOM   10083 H HB3  . TYR B 2 26 ? -7.748  -2.558  -9.606  1.00 0.00 ? 26 TYR B HB3  13 
ATOM   10084 H HD1  . TYR B 2 26 ? -4.089  -2.461  -8.812  1.00 0.00 ? 26 TYR B HD1  13 
ATOM   10085 H HD2  . TYR B 2 26 ? -7.453  -0.434  -10.555 1.00 0.00 ? 26 TYR B HD2  13 
ATOM   10086 H HE1  . TYR B 2 26 ? -2.688  -0.445  -9.167  1.00 0.00 ? 26 TYR B HE1  13 
ATOM   10087 H HE2  . TYR B 2 26 ? -6.052  1.583   -10.911 1.00 0.00 ? 26 TYR B HE2  13 
ATOM   10088 H HH   . TYR B 2 26 ? -3.145  1.785   -11.149 1.00 0.00 ? 26 TYR B HH   13 
ATOM   10089 N N    . THR B 2 27 ? -7.468  -1.763  -6.416  1.00 0.00 ? 27 THR B N    13 
ATOM   10090 C CA   . THR B 2 27 ? -8.557  -1.229  -5.550  1.00 0.00 ? 27 THR B CA   13 
ATOM   10091 C C    . THR B 2 27 ? -9.375  -0.204  -6.340  1.00 0.00 ? 27 THR B C    13 
ATOM   10092 O O    . THR B 2 27 ? -9.092  0.075   -7.489  1.00 0.00 ? 27 THR B O    13 
ATOM   10093 C CB   . THR B 2 27 ? -7.947  -0.556  -4.318  1.00 0.00 ? 27 THR B CB   13 
ATOM   10094 O OG1  . THR B 2 27 ? -6.948  0.366   -4.731  1.00 0.00 ? 27 THR B OG1  13 
ATOM   10095 C CG2  . THR B 2 27 ? -7.324  -1.617  -3.410  1.00 0.00 ? 27 THR B CG2  13 
ATOM   10096 H H    . THR B 2 27 ? -6.598  -1.315  -6.440  1.00 0.00 ? 27 THR B H    13 
ATOM   10097 H HA   . THR B 2 27 ? -9.199  -2.040  -5.238  1.00 0.00 ? 27 THR B HA   13 
ATOM   10098 H HB   . THR B 2 27 ? -8.718  -0.032  -3.775  1.00 0.00 ? 27 THR B HB   13 
ATOM   10099 H HG1  . THR B 2 27 ? -7.246  1.249   -4.501  1.00 0.00 ? 27 THR B HG1  13 
ATOM   10100 H HG21 . THR B 2 27 ? -7.771  -1.559  -2.429  1.00 0.00 ? 27 THR B HG21 13 
ATOM   10101 H HG22 . THR B 2 27 ? -6.261  -1.443  -3.332  1.00 0.00 ? 27 THR B HG22 13 
ATOM   10102 H HG23 . THR B 2 27 ? -7.499  -2.597  -3.828  1.00 0.00 ? 27 THR B HG23 13 
ATOM   10103 N N    . LYS B 2 28 ? -10.386 0.358   -5.736  1.00 0.00 ? 28 LYS B N    13 
ATOM   10104 C CA   . LYS B 2 28 ? -11.216 1.363   -6.459  1.00 0.00 ? 28 LYS B CA   13 
ATOM   10105 C C    . LYS B 2 28 ? -12.175 2.045   -5.476  1.00 0.00 ? 28 LYS B C    13 
ATOM   10106 O O    . LYS B 2 28 ? -13.360 1.776   -5.482  1.00 0.00 ? 28 LYS B O    13 
ATOM   10107 C CB   . LYS B 2 28 ? -12.024 0.664   -7.553  1.00 0.00 ? 28 LYS B CB   13 
ATOM   10108 C CG   . LYS B 2 28 ? -11.491 1.081   -8.924  1.00 0.00 ? 28 LYS B CG   13 
ATOM   10109 C CD   . LYS B 2 28 ? -11.981 2.491   -9.259  1.00 0.00 ? 28 LYS B CD   13 
ATOM   10110 C CE   . LYS B 2 28 ? -11.403 2.923   -10.607 1.00 0.00 ? 28 LYS B CE   13 
ATOM   10111 N NZ   . LYS B 2 28 ? -11.708 1.886   -11.632 1.00 0.00 ? 28 LYS B NZ   13 
ATOM   10112 H H    . LYS B 2 28 ? -10.599 0.119   -4.810  1.00 0.00 ? 28 LYS B H    13 
ATOM   10113 H HA   . LYS B 2 28 ? -10.572 2.105   -6.906  1.00 0.00 ? 28 LYS B HA   13 
ATOM   10114 H HB2  . LYS B 2 28 ? -11.933 -0.407  -7.440  1.00 0.00 ? 28 LYS B HB2  13 
ATOM   10115 H HB3  . LYS B 2 28 ? -13.062 0.948   -7.471  1.00 0.00 ? 28 LYS B HB3  13 
ATOM   10116 H HG2  . LYS B 2 28 ? -10.411 1.068   -8.909  1.00 0.00 ? 28 LYS B HG2  13 
ATOM   10117 H HG3  . LYS B 2 28 ? -11.848 0.391   -9.674  1.00 0.00 ? 28 LYS B HG3  13 
ATOM   10118 H HD2  . LYS B 2 28 ? -13.061 2.495   -9.309  1.00 0.00 ? 28 LYS B HD2  13 
ATOM   10119 H HD3  . LYS B 2 28 ? -11.654 3.177   -8.492  1.00 0.00 ? 28 LYS B HD3  13 
ATOM   10120 H HE2  . LYS B 2 28 ? -11.844 3.865   -10.903 1.00 0.00 ? 28 LYS B HE2  13 
ATOM   10121 H HE3  . LYS B 2 28 ? -10.332 3.038   -10.519 1.00 0.00 ? 28 LYS B HE3  13 
ATOM   10122 H HZ1  . LYS B 2 28 ? -11.056 1.085   -11.520 1.00 0.00 ? 28 LYS B HZ1  13 
ATOM   10123 H HZ2  . LYS B 2 28 ? -11.597 2.295   -12.583 1.00 0.00 ? 28 LYS B HZ2  13 
ATOM   10124 H HZ3  . LYS B 2 28 ? -12.685 1.555   -11.507 1.00 0.00 ? 28 LYS B HZ3  13 
ATOM   10125 N N    . PRO B 2 29 ? -11.630 2.912   -4.663  1.00 0.00 ? 29 PRO B N    13 
ATOM   10126 C CA   . PRO B 2 29 ? -12.408 3.661   -3.662  1.00 0.00 ? 29 PRO B CA   13 
ATOM   10127 C C    . PRO B 2 29 ? -13.141 4.831   -4.323  1.00 0.00 ? 29 PRO B C    13 
ATOM   10128 O O    . PRO B 2 29 ? -12.557 5.611   -5.050  1.00 0.00 ? 29 PRO B O    13 
ATOM   10129 C CB   . PRO B 2 29 ? -11.342 4.168   -2.687  1.00 0.00 ? 29 PRO B CB   13 
ATOM   10130 C CG   . PRO B 2 29 ? -10.005 4.177   -3.466  1.00 0.00 ? 29 PRO B CG   13 
ATOM   10131 C CD   . PRO B 2 29 ? -10.186 3.226   -4.665  1.00 0.00 ? 29 PRO B CD   13 
ATOM   10132 H HA   . PRO B 2 29 ? -13.100 3.013   -3.150  1.00 0.00 ? 29 PRO B HA   13 
ATOM   10133 H HB2  . PRO B 2 29 ? -11.590 5.168   -2.356  1.00 0.00 ? 29 PRO B HB2  13 
ATOM   10134 H HB3  . PRO B 2 29 ? -11.265 3.504   -1.841  1.00 0.00 ? 29 PRO B HB3  13 
ATOM   10135 H HG2  . PRO B 2 29 ? -9.787  5.177   -3.814  1.00 0.00 ? 29 PRO B HG2  13 
ATOM   10136 H HG3  . PRO B 2 29 ? -9.207  3.819   -2.836  1.00 0.00 ? 29 PRO B HG3  13 
ATOM   10137 H HD2  . PRO B 2 29 ? -9.904  3.719   -5.584  1.00 0.00 ? 29 PRO B HD2  13 
ATOM   10138 H HD3  . PRO B 2 29 ? -9.610  2.325   -4.524  1.00 0.00 ? 29 PRO B HD3  13 
ATOM   10139 N N    . THR B 2 30 ? -14.415 4.961   -4.077  1.00 0.00 ? 30 THR B N    13 
ATOM   10140 C CA   . THR B 2 30 ? -15.180 6.083   -4.692  1.00 0.00 ? 30 THR B CA   13 
ATOM   10141 C C    . THR B 2 30 ? -14.712 7.408   -4.088  1.00 0.00 ? 30 THR B C    13 
ATOM   10142 O O    . THR B 2 30 ? -13.521 7.667   -4.134  1.00 0.00 ? 30 THR B O    13 
ATOM   10143 C CB   . THR B 2 30 ? -16.676 5.894   -4.417  1.00 0.00 ? 30 THR B CB   13 
ATOM   10144 O OG1  . THR B 2 30 ? -17.406 6.991   -4.957  1.00 0.00 ? 30 THR B OG1  13 
ATOM   10145 C CG2  . THR B 2 30 ? -16.913 5.817   -2.909  1.00 0.00 ? 30 THR B CG2  13 
ATOM   10146 O OXT  . THR B 2 30 ? -15.550 8.139   -3.588  1.00 0.00 ? 30 THR B OXT  13 
ATOM   10147 H H    . THR B 2 30 ? -14.869 4.323   -3.488  1.00 0.00 ? 30 THR B H    13 
ATOM   10148 H HA   . THR B 2 30 ? -15.009 6.095   -5.758  1.00 0.00 ? 30 THR B HA   13 
ATOM   10149 H HB   . THR B 2 30 ? -17.013 4.977   -4.876  1.00 0.00 ? 30 THR B HB   13 
ATOM   10150 H HG1  . THR B 2 30 ? -16.792 7.558   -5.429  1.00 0.00 ? 30 THR B HG1  13 
ATOM   10151 H HG21 . THR B 2 30 ? -16.032 5.421   -2.425  1.00 0.00 ? 30 THR B HG21 13 
ATOM   10152 H HG22 . THR B 2 30 ? -17.754 5.170   -2.709  1.00 0.00 ? 30 THR B HG22 13 
ATOM   10153 H HG23 . THR B 2 30 ? -17.121 6.805   -2.526  1.00 0.00 ? 30 THR B HG23 13 
ATOM   10154 N N    . GLY A 1 1  ? -6.980  1.799   -0.477  1.00 0.00 ? 1  GLY A N    14 
ATOM   10155 C CA   . GLY A 1 1  ? -6.047  2.984   -0.232  1.00 0.00 ? 1  GLY A CA   14 
ATOM   10156 C C    . GLY A 1 1  ? -4.668  2.963   -0.800  1.00 0.00 ? 1  GLY A C    14 
ATOM   10157 O O    . GLY A 1 1  ? -3.708  3.300   -0.136  1.00 0.00 ? 1  GLY A O    14 
ATOM   10158 H H1   . GLY A 1 1  ? -6.421  0.970   -0.764  1.00 0.00 ? 1  GLY A H1   14 
ATOM   10159 H H2   . GLY A 1 1  ? -7.655  2.039   -1.231  1.00 0.00 ? 1  GLY A H2   14 
ATOM   10160 H H3   . GLY A 1 1  ? -7.500  1.579   0.396   1.00 0.00 ? 1  GLY A H3   14 
ATOM   10161 H HA2  . GLY A 1 1  ? -6.192  3.690   -0.888  1.00 0.00 ? 1  GLY A HA2  14 
ATOM   10162 H HA3  . GLY A 1 1  ? -6.228  3.337   0.866   1.00 0.00 ? 1  GLY A HA3  14 
HETATM 10163 N N    . IIL A 1 2  ? -4.533  2.570   -2.037  1.00 0.00 ? 2  IIL A N    14 
HETATM 10164 C CA   . IIL A 1 2  ? -3.180  2.527   -2.661  1.00 0.00 ? 2  IIL A CA   14 
HETATM 10165 C C    . IIL A 1 2  ? -3.191  3.335   -3.961  1.00 0.00 ? 2  IIL A C    14 
HETATM 10166 O O    . IIL A 1 2  ? -2.241  4.016   -4.289  1.00 0.00 ? 2  IIL A O    14 
HETATM 10167 C CB   . IIL A 1 2  ? -2.808  1.077   -2.971  1.00 0.00 ? 2  IIL A CB   14 
HETATM 10168 C CG2  . IIL A 1 2  ? -1.429  1.037   -3.632  1.00 0.00 ? 2  IIL A CG2  14 
HETATM 10169 C CG1  . IIL A 1 2  ? -3.849  0.479   -3.920  1.00 0.00 ? 2  IIL A CG1  14 
HETATM 10170 C CD1  . IIL A 1 2  ? -3.582  -1.016  -4.098  1.00 0.00 ? 2  IIL A CD1  14 
HETATM 10171 H H    . IIL A 1 2  ? -5.320  2.303   -2.555  1.00 0.00 ? 2  IIL A H    14 
HETATM 10172 H HA   . IIL A 1 2  ? -2.455  2.948   -1.981  1.00 0.00 ? 2  IIL A HA   14 
HETATM 10173 H HB   . IIL A 1 2  ? -2.786  0.505   -2.055  1.00 0.00 ? 2  IIL A HB   14 
HETATM 10174 H HG21 . IIL A 1 2  ? -0.695  1.455   -2.959  1.00 0.00 ? 2  IIL A HG21 14 
HETATM 10175 H HG22 . IIL A 1 2  ? -1.450  1.615   -4.544  1.00 0.00 ? 2  IIL A HG22 14 
HETATM 10176 H HG23 . IIL A 1 2  ? -1.168  0.014   -3.860  1.00 0.00 ? 2  IIL A HG23 14 
HETATM 10177 H HG12 . IIL A 1 2  ? -3.788  0.971   -4.879  1.00 0.00 ? 2  IIL A HG12 14 
HETATM 10178 H HG13 . IIL A 1 2  ? -4.837  0.621   -3.505  1.00 0.00 ? 2  IIL A HG13 14 
HETATM 10179 H HD11 . IIL A 1 2  ? -2.540  -1.169  -4.342  1.00 0.00 ? 2  IIL A HD11 14 
HETATM 10180 H HD12 . IIL A 1 2  ? -4.199  -1.399  -4.898  1.00 0.00 ? 2  IIL A HD12 14 
HETATM 10181 H HD13 . IIL A 1 2  ? -3.816  -1.536  -3.181  1.00 0.00 ? 2  IIL A HD13 14 
ATOM   10182 N N    . VAL A 1 3  ? -4.259  3.258   -4.707  1.00 0.00 ? 3  VAL A N    14 
ATOM   10183 C CA   . VAL A 1 3  ? -4.330  4.016   -5.987  1.00 0.00 ? 3  VAL A CA   14 
ATOM   10184 C C    . VAL A 1 3  ? -4.387  5.517   -5.694  1.00 0.00 ? 3  VAL A C    14 
ATOM   10185 O O    . VAL A 1 3  ? -3.660  6.300   -6.271  1.00 0.00 ? 3  VAL A O    14 
ATOM   10186 C CB   . VAL A 1 3  ? -5.587  3.602   -6.752  1.00 0.00 ? 3  VAL A CB   14 
ATOM   10187 C CG1  . VAL A 1 3  ? -5.492  4.099   -8.195  1.00 0.00 ? 3  VAL A CG1  14 
ATOM   10188 C CG2  . VAL A 1 3  ? -5.705  2.076   -6.748  1.00 0.00 ? 3  VAL A CG2  14 
ATOM   10189 H H    . VAL A 1 3  ? -5.013  2.699   -4.425  1.00 0.00 ? 3  VAL A H    14 
ATOM   10190 H HA   . VAL A 1 3  ? -3.457  3.798   -6.583  1.00 0.00 ? 3  VAL A HA   14 
ATOM   10191 H HB   . VAL A 1 3  ? -6.456  4.033   -6.278  1.00 0.00 ? 3  VAL A HB   14 
ATOM   10192 H HG11 . VAL A 1 3  ? -6.319  3.707   -8.767  1.00 0.00 ? 3  VAL A HG11 14 
ATOM   10193 H HG12 . VAL A 1 3  ? -4.561  3.765   -8.630  1.00 0.00 ? 3  VAL A HG12 14 
ATOM   10194 H HG13 . VAL A 1 3  ? -5.526  5.179   -8.205  1.00 0.00 ? 3  VAL A HG13 14 
ATOM   10195 H HG21 . VAL A 1 3  ? -6.048  1.738   -7.714  1.00 0.00 ? 3  VAL A HG21 14 
ATOM   10196 H HG22 . VAL A 1 3  ? -6.412  1.772   -5.989  1.00 0.00 ? 3  VAL A HG22 14 
ATOM   10197 H HG23 . VAL A 1 3  ? -4.740  1.639   -6.536  1.00 0.00 ? 3  VAL A HG23 14 
ATOM   10198 N N    . GLU A 1 4  ? -5.251  5.923   -4.804  1.00 0.00 ? 4  GLU A N    14 
ATOM   10199 C CA   . GLU A 1 4  ? -5.364  7.373   -4.476  1.00 0.00 ? 4  GLU A CA   14 
ATOM   10200 C C    . GLU A 1 4  ? -4.064  7.866   -3.836  1.00 0.00 ? 4  GLU A C    14 
ATOM   10201 O O    . GLU A 1 4  ? -3.864  9.051   -3.658  1.00 0.00 ? 4  GLU A O    14 
ATOM   10202 C CB   . GLU A 1 4  ? -6.524  7.582   -3.501  1.00 0.00 ? 4  GLU A CB   14 
ATOM   10203 C CG   . GLU A 1 4  ? -7.763  6.847   -4.014  1.00 0.00 ? 4  GLU A CG   14 
ATOM   10204 C CD   . GLU A 1 4  ? -8.819  7.866   -4.444  1.00 0.00 ? 4  GLU A CD   14 
ATOM   10205 O OE1  . GLU A 1 4  ? -8.507  8.695   -5.284  1.00 0.00 ? 4  GLU A OE1  14 
ATOM   10206 O OE2  . GLU A 1 4  ? -9.921  7.802   -3.926  1.00 0.00 ? 4  GLU A OE2  14 
ATOM   10207 H H    . GLU A 1 4  ? -5.830  5.273   -4.354  1.00 0.00 ? 4  GLU A H    14 
ATOM   10208 H HA   . GLU A 1 4  ? -5.553  7.931   -5.381  1.00 0.00 ? 4  GLU A HA   14 
ATOM   10209 H HB2  . GLU A 1 4  ? -6.251  7.194   -2.529  1.00 0.00 ? 4  GLU A HB2  14 
ATOM   10210 H HB3  . GLU A 1 4  ? -6.741  8.637   -3.420  1.00 0.00 ? 4  GLU A HB3  14 
ATOM   10211 H HG2  . GLU A 1 4  ? -7.490  6.231   -4.859  1.00 0.00 ? 4  GLU A HG2  14 
ATOM   10212 H HG3  . GLU A 1 4  ? -8.165  6.225   -3.229  1.00 0.00 ? 4  GLU A HG3  14 
ATOM   10213 N N    . GLN A 1 5  ? -3.178  6.973   -3.488  1.00 0.00 ? 5  GLN A N    14 
ATOM   10214 C CA   . GLN A 1 5  ? -1.898  7.409   -2.860  1.00 0.00 ? 5  GLN A CA   14 
ATOM   10215 C C    . GLN A 1 5  ? -0.759  7.291   -3.875  1.00 0.00 ? 5  GLN A C    14 
ATOM   10216 O O    . GLN A 1 5  ? 0.082   8.163   -3.979  1.00 0.00 ? 5  GLN A O    14 
ATOM   10217 C CB   . GLN A 1 5  ? -1.593  6.532   -1.641  1.00 0.00 ? 5  GLN A CB   14 
ATOM   10218 C CG   . GLN A 1 5  ? -2.388  7.040   -0.436  1.00 0.00 ? 5  GLN A CG   14 
ATOM   10219 C CD   . GLN A 1 5  ? -1.543  8.054   0.339   1.00 0.00 ? 5  GLN A CD   14 
ATOM   10220 O OE1  . GLN A 1 5  ? -0.352  8.159   0.127   1.00 0.00 ? 5  GLN A OE1  14 
ATOM   10221 N NE2  . GLN A 1 5  ? -2.114  8.809   1.237   1.00 0.00 ? 5  GLN A NE2  14 
ATOM   10222 H H    . GLN A 1 5  ? -3.353  6.020   -3.637  1.00 0.00 ? 5  GLN A H    14 
ATOM   10223 H HA   . GLN A 1 5  ? -1.990  8.438   -2.546  1.00 0.00 ? 5  GLN A HA   14 
ATOM   10224 H HB2  . GLN A 1 5  ? -1.873  5.511   -1.853  1.00 0.00 ? 5  GLN A HB2  14 
ATOM   10225 H HB3  . GLN A 1 5  ? -0.538  6.579   -1.418  1.00 0.00 ? 5  GLN A HB3  14 
ATOM   10226 H HG2  . GLN A 1 5  ? -3.297  7.513   -0.778  1.00 0.00 ? 5  GLN A HG2  14 
ATOM   10227 H HG3  . GLN A 1 5  ? -2.633  6.211   0.209   1.00 0.00 ? 5  GLN A HG3  14 
ATOM   10228 H HE21 . GLN A 1 5  ? -3.076  8.724   1.409   1.00 0.00 ? 5  GLN A HE21 14 
ATOM   10229 H HE22 . GLN A 1 5  ? -1.583  9.461   1.740   1.00 0.00 ? 5  GLN A HE22 14 
ATOM   10230 N N    . CYS A 1 6  ? -0.723  6.226   -4.630  1.00 0.00 ? 6  CYS A N    14 
ATOM   10231 C CA   . CYS A 1 6  ? 0.364   6.069   -5.637  1.00 0.00 ? 6  CYS A CA   14 
ATOM   10232 C C    . CYS A 1 6  ? -0.042  6.785   -6.924  1.00 0.00 ? 6  CYS A C    14 
ATOM   10233 O O    . CYS A 1 6  ? 0.784   7.105   -7.760  1.00 0.00 ? 6  CYS A O    14 
ATOM   10234 C CB   . CYS A 1 6  ? 0.587   4.583   -5.918  1.00 0.00 ? 6  CYS A CB   14 
ATOM   10235 S SG   . CYS A 1 6  ? 0.752   3.695   -4.349  1.00 0.00 ? 6  CYS A SG   14 
ATOM   10236 H H    . CYS A 1 6  ? -1.411  5.534   -4.540  1.00 0.00 ? 6  CYS A H    14 
ATOM   10237 H HA   . CYS A 1 6  ? 1.275   6.505   -5.255  1.00 0.00 ? 6  CYS A HA   14 
ATOM   10238 H HB2  . CYS A 1 6  ? -0.252  4.192   -6.469  1.00 0.00 ? 6  CYS A HB2  14 
ATOM   10239 H HB3  . CYS A 1 6  ? 1.487   4.457   -6.501  1.00 0.00 ? 6  CYS A HB3  14 
ATOM   10240 N N    . CYS A 1 7  ? -1.312  7.048   -7.085  1.00 0.00 ? 7  CYS A N    14 
ATOM   10241 C CA   . CYS A 1 7  ? -1.778  7.755   -8.308  1.00 0.00 ? 7  CYS A CA   14 
ATOM   10242 C C    . CYS A 1 7  ? -1.845  9.256   -8.011  1.00 0.00 ? 7  CYS A C    14 
ATOM   10243 O O    . CYS A 1 7  ? -1.888  10.078  -8.905  1.00 0.00 ? 7  CYS A O    14 
ATOM   10244 C CB   . CYS A 1 7  ? -3.163  7.231   -8.709  1.00 0.00 ? 7  CYS A CB   14 
ATOM   10245 S SG   . CYS A 1 7  ? -3.660  7.915   -10.313 1.00 0.00 ? 7  CYS A SG   14 
ATOM   10246 H H    . CYS A 1 7  ? -1.957  6.788   -6.395  1.00 0.00 ? 7  CYS A H    14 
ATOM   10247 H HA   . CYS A 1 7  ? -1.077  7.580   -9.103  1.00 0.00 ? 7  CYS A HA   14 
ATOM   10248 H HB2  . CYS A 1 7  ? -3.131  6.155   -8.775  1.00 0.00 ? 7  CYS A HB2  14 
ATOM   10249 H HB3  . CYS A 1 7  ? -3.882  7.522   -7.960  1.00 0.00 ? 7  CYS A HB3  14 
ATOM   10250 N N    . THR A 1 8  ? -1.832  9.614   -6.756  1.00 0.00 ? 8  THR A N    14 
ATOM   10251 C CA   . THR A 1 8  ? -1.870  11.055  -6.384  1.00 0.00 ? 8  THR A CA   14 
ATOM   10252 C C    . THR A 1 8  ? -0.430  11.555  -6.256  1.00 0.00 ? 8  THR A C    14 
ATOM   10253 O O    . THR A 1 8  ? -0.153  12.734  -6.353  1.00 0.00 ? 8  THR A O    14 
ATOM   10254 C CB   . THR A 1 8  ? -2.593  11.217  -5.044  1.00 0.00 ? 8  THR A CB   14 
ATOM   10255 O OG1  . THR A 1 8  ? -2.834  12.597  -4.805  1.00 0.00 ? 8  THR A OG1  14 
ATOM   10256 C CG2  . THR A 1 8  ? -1.726  10.646  -3.921  1.00 0.00 ? 8  THR A CG2  14 
ATOM   10257 H H    . THR A 1 8  ? -1.781  8.931   -6.054  1.00 0.00 ? 8  THR A H    14 
ATOM   10258 H HA   . THR A 1 8  ? -2.385  11.616  -7.149  1.00 0.00 ? 8  THR A HA   14 
ATOM   10259 H HB   . THR A 1 8  ? -3.532  10.686  -5.073  1.00 0.00 ? 8  THR A HB   14 
ATOM   10260 H HG1  . THR A 1 8  ? -2.129  13.099  -5.219  1.00 0.00 ? 8  THR A HG1  14 
ATOM   10261 H HG21 . THR A 1 8  ? -1.603  9.583   -4.068  1.00 0.00 ? 8  THR A HG21 14 
ATOM   10262 H HG22 . THR A 1 8  ? -2.205  10.824  -2.970  1.00 0.00 ? 8  THR A HG22 14 
ATOM   10263 H HG23 . THR A 1 8  ? -0.759  11.125  -3.933  1.00 0.00 ? 8  THR A HG23 14 
ATOM   10264 N N    . SER A 1 9  ? 0.488   10.650  -6.049  1.00 0.00 ? 9  SER A N    14 
ATOM   10265 C CA   . SER A 1 9  ? 1.920   11.032  -5.920  1.00 0.00 ? 9  SER A CA   14 
ATOM   10266 C C    . SER A 1 9  ? 2.779   9.812   -6.263  1.00 0.00 ? 9  SER A C    14 
ATOM   10267 O O    . SER A 1 9  ? 2.278   8.808   -6.728  1.00 0.00 ? 9  SER A O    14 
ATOM   10268 C CB   . SER A 1 9  ? 2.206   11.477  -4.486  1.00 0.00 ? 9  SER A CB   14 
ATOM   10269 O OG   . SER A 1 9  ? 1.238   12.439  -4.091  1.00 0.00 ? 9  SER A OG   14 
ATOM   10270 H H    . SER A 1 9  ? 0.230   9.707   -5.983  1.00 0.00 ? 9  SER A H    14 
ATOM   10271 H HA   . SER A 1 9  ? 2.145   11.838  -6.604  1.00 0.00 ? 9  SER A HA   14 
ATOM   10272 H HB2  . SER A 1 9  ? 2.153   10.628  -3.825  1.00 0.00 ? 9  SER A HB2  14 
ATOM   10273 H HB3  . SER A 1 9  ? 3.198   11.908  -4.435  1.00 0.00 ? 9  SER A HB3  14 
ATOM   10274 H HG   . SER A 1 9  ? 1.449   12.724  -3.199  1.00 0.00 ? 9  SER A HG   14 
ATOM   10275 N N    . ILE A 1 10 ? 4.063   9.878   -6.038  1.00 0.00 ? 10 ILE A N    14 
ATOM   10276 C CA   . ILE A 1 10 ? 4.923   8.704   -6.360  1.00 0.00 ? 10 ILE A CA   14 
ATOM   10277 C C    . ILE A 1 10 ? 4.803   7.668   -5.239  1.00 0.00 ? 10 ILE A C    14 
ATOM   10278 O O    . ILE A 1 10 ? 4.575   8.000   -4.093  1.00 0.00 ? 10 ILE A O    14 
ATOM   10279 C CB   . ILE A 1 10 ? 6.380   9.151   -6.512  1.00 0.00 ? 10 ILE A CB   14 
ATOM   10280 C CG1  . ILE A 1 10 ? 6.526   9.910   -7.842  1.00 0.00 ? 10 ILE A CG1  14 
ATOM   10281 C CG2  . ILE A 1 10 ? 7.292   7.918   -6.501  1.00 0.00 ? 10 ILE A CG2  14 
ATOM   10282 C CD1  . ILE A 1 10 ? 7.972   9.852   -8.342  1.00 0.00 ? 10 ILE A CD1  14 
ATOM   10283 H H    . ILE A 1 10 ? 4.458   10.692  -5.659  1.00 0.00 ? 10 ILE A H    14 
ATOM   10284 H HA   . ILE A 1 10 ? 4.587   8.262   -7.287  1.00 0.00 ? 10 ILE A HA   14 
ATOM   10285 H HB   . ILE A 1 10 ? 6.644   9.801   -5.691  1.00 0.00 ? 10 ILE A HB   14 
ATOM   10286 H HG12 . ILE A 1 10 ? 5.878   9.464   -8.580  1.00 0.00 ? 10 ILE A HG12 14 
ATOM   10287 H HG13 . ILE A 1 10 ? 6.241   10.942  -7.696  1.00 0.00 ? 10 ILE A HG13 14 
ATOM   10288 H HG21 . ILE A 1 10 ? 7.251   7.448   -5.529  1.00 0.00 ? 10 ILE A HG21 14 
ATOM   10289 H HG22 . ILE A 1 10 ? 8.308   8.218   -6.711  1.00 0.00 ? 10 ILE A HG22 14 
ATOM   10290 H HG23 . ILE A 1 10 ? 6.961   7.217   -7.254  1.00 0.00 ? 10 ILE A HG23 14 
ATOM   10291 H HD11 . ILE A 1 10 ? 8.255   8.821   -8.501  1.00 0.00 ? 10 ILE A HD11 14 
ATOM   10292 H HD12 . ILE A 1 10 ? 8.626   10.296  -7.605  1.00 0.00 ? 10 ILE A HD12 14 
ATOM   10293 H HD13 . ILE A 1 10 ? 8.054   10.395  -9.271  1.00 0.00 ? 10 ILE A HD13 14 
ATOM   10294 N N    . CYS A 1 11 ? 4.937   6.412   -5.567  1.00 0.00 ? 11 CYS A N    14 
ATOM   10295 C CA   . CYS A 1 11 ? 4.810   5.350   -4.529  1.00 0.00 ? 11 CYS A CA   14 
ATOM   10296 C C    . CYS A 1 11 ? 6.075   4.494   -4.495  1.00 0.00 ? 11 CYS A C    14 
ATOM   10297 O O    . CYS A 1 11 ? 7.067   4.797   -5.128  1.00 0.00 ? 11 CYS A O    14 
ATOM   10298 C CB   . CYS A 1 11 ? 3.619   4.458   -4.878  1.00 0.00 ? 11 CYS A CB   14 
ATOM   10299 S SG   . CYS A 1 11 ? 2.423   4.468   -3.520  1.00 0.00 ? 11 CYS A SG   14 
ATOM   10300 H H    . CYS A 1 11 ? 5.107   6.166   -6.500  1.00 0.00 ? 11 CYS A H    14 
ATOM   10301 H HA   . CYS A 1 11 ? 4.651   5.803   -3.562  1.00 0.00 ? 11 CYS A HA   14 
ATOM   10302 H HB2  . CYS A 1 11 ? 3.147   4.827   -5.774  1.00 0.00 ? 11 CYS A HB2  14 
ATOM   10303 H HB3  . CYS A 1 11 ? 3.964   3.448   -5.045  1.00 0.00 ? 11 CYS A HB3  14 
ATOM   10304 N N    . SER A 1 12 ? 6.035   3.413   -3.765  1.00 0.00 ? 12 SER A N    14 
ATOM   10305 C CA   . SER A 1 12 ? 7.216   2.512   -3.685  1.00 0.00 ? 12 SER A CA   14 
ATOM   10306 C C    . SER A 1 12 ? 6.752   1.072   -3.902  1.00 0.00 ? 12 SER A C    14 
ATOM   10307 O O    . SER A 1 12 ? 5.701   0.673   -3.439  1.00 0.00 ? 12 SER A O    14 
ATOM   10308 C CB   . SER A 1 12 ? 7.872   2.639   -2.310  1.00 0.00 ? 12 SER A CB   14 
ATOM   10309 O OG   . SER A 1 12 ? 6.937   3.197   -1.394  1.00 0.00 ? 12 SER A OG   14 
ATOM   10310 H H    . SER A 1 12 ? 5.217   3.189   -3.272  1.00 0.00 ? 12 SER A H    14 
ATOM   10311 H HA   . SER A 1 12 ? 7.928   2.781   -4.453  1.00 0.00 ? 12 SER A HA   14 
ATOM   10312 H HB2  . SER A 1 12 ? 8.173   1.667   -1.961  1.00 0.00 ? 12 SER A HB2  14 
ATOM   10313 H HB3  . SER A 1 12 ? 8.741   3.277   -2.387  1.00 0.00 ? 12 SER A HB3  14 
ATOM   10314 H HG   . SER A 1 12 ? 7.294   4.030   -1.079  1.00 0.00 ? 12 SER A HG   14 
ATOM   10315 N N    . LEU A 1 13 ? 7.515   0.292   -4.611  1.00 0.00 ? 13 LEU A N    14 
ATOM   10316 C CA   . LEU A 1 13 ? 7.105   -1.117  -4.866  1.00 0.00 ? 13 LEU A CA   14 
ATOM   10317 C C    . LEU A 1 13 ? 7.150   -1.918  -3.561  1.00 0.00 ? 13 LEU A C    14 
ATOM   10318 O O    . LEU A 1 13 ? 6.553   -2.972  -3.452  1.00 0.00 ? 13 LEU A O    14 
ATOM   10319 C CB   . LEU A 1 13 ? 8.057   -1.742  -5.887  1.00 0.00 ? 13 LEU A CB   14 
ATOM   10320 C CG   . LEU A 1 13 ? 9.479   -1.746  -5.325  1.00 0.00 ? 13 LEU A CG   14 
ATOM   10321 C CD1  . LEU A 1 13 ? 10.045  -3.165  -5.389  1.00 0.00 ? 13 LEU A CD1  14 
ATOM   10322 C CD2  . LEU A 1 13 ? 10.357  -0.809  -6.159  1.00 0.00 ? 13 LEU A CD2  14 
ATOM   10323 H H    . LEU A 1 13 ? 8.354   0.633   -4.983  1.00 0.00 ? 13 LEU A H    14 
ATOM   10324 H HA   . LEU A 1 13 ? 6.097   -1.131  -5.260  1.00 0.00 ? 13 LEU A HA   14 
ATOM   10325 H HB2  . LEU A 1 13 ? 7.747   -2.755  -6.091  1.00 0.00 ? 13 LEU A HB2  14 
ATOM   10326 H HB3  . LEU A 1 13 ? 8.034   -1.166  -6.799  1.00 0.00 ? 13 LEU A HB3  14 
ATOM   10327 H HG   . LEU A 1 13 ? 9.463   -1.410  -4.298  1.00 0.00 ? 13 LEU A HG   14 
ATOM   10328 H HD11 . LEU A 1 13 ? 10.778  -3.295  -4.608  1.00 0.00 ? 13 LEU A HD11 14 
ATOM   10329 H HD12 . LEU A 1 13 ? 10.509  -3.323  -6.351  1.00 0.00 ? 13 LEU A HD12 14 
ATOM   10330 H HD13 . LEU A 1 13 ? 9.244   -3.876  -5.254  1.00 0.00 ? 13 LEU A HD13 14 
ATOM   10331 H HD21 . LEU A 1 13 ? 10.007  -0.803  -7.181  1.00 0.00 ? 13 LEU A HD21 14 
ATOM   10332 H HD22 . LEU A 1 13 ? 11.380  -1.155  -6.131  1.00 0.00 ? 13 LEU A HD22 14 
ATOM   10333 H HD23 . LEU A 1 13 ? 10.303  0.191   -5.755  1.00 0.00 ? 13 LEU A HD23 14 
ATOM   10334 N N    . TYR A 1 14 ? 7.838   -1.428  -2.565  1.00 0.00 ? 14 TYR A N    14 
ATOM   10335 C CA   . TYR A 1 14 ? 7.899   -2.169  -1.276  1.00 0.00 ? 14 TYR A CA   14 
ATOM   10336 C C    . TYR A 1 14 ? 6.500   -2.212  -0.683  1.00 0.00 ? 14 TYR A C    14 
ATOM   10337 O O    . TYR A 1 14 ? 6.042   -3.228  -0.199  1.00 0.00 ? 14 TYR A O    14 
ATOM   10338 C CB   . TYR A 1 14 ? 8.851   -1.458  -0.310  1.00 0.00 ? 14 TYR A CB   14 
ATOM   10339 C CG   . TYR A 1 14 ? 10.227  -2.083  -0.410  1.00 0.00 ? 14 TYR A CG   14 
ATOM   10340 C CD1  . TYR A 1 14 ? 10.904  -2.101  -1.638  1.00 0.00 ? 14 TYR A CD1  14 
ATOM   10341 C CD2  . TYR A 1 14 ? 10.828  -2.646  0.726   1.00 0.00 ? 14 TYR A CD2  14 
ATOM   10342 C CE1  . TYR A 1 14 ? 12.176  -2.680  -1.730  1.00 0.00 ? 14 TYR A CE1  14 
ATOM   10343 C CE2  . TYR A 1 14 ? 12.101  -3.225  0.633   1.00 0.00 ? 14 TYR A CE2  14 
ATOM   10344 C CZ   . TYR A 1 14 ? 12.774  -3.242  -0.594  1.00 0.00 ? 14 TYR A CZ   14 
ATOM   10345 O OH   . TYR A 1 14 ? 14.028  -3.813  -0.686  1.00 0.00 ? 14 TYR A OH   14 
ATOM   10346 H H    . TYR A 1 14 ? 8.304   -0.574  -2.662  1.00 0.00 ? 14 TYR A H    14 
ATOM   10347 H HA   . TYR A 1 14 ? 8.243   -3.172  -1.453  1.00 0.00 ? 14 TYR A HA   14 
ATOM   10348 H HB2  . TYR A 1 14 ? 8.908   -0.409  -0.568  1.00 0.00 ? 14 TYR A HB2  14 
ATOM   10349 H HB3  . TYR A 1 14 ? 8.481   -1.560  0.699   1.00 0.00 ? 14 TYR A HB3  14 
ATOM   10350 H HD1  . TYR A 1 14 ? 10.446  -1.669  -2.515  1.00 0.00 ? 14 TYR A HD1  14 
ATOM   10351 H HD2  . TYR A 1 14 ? 10.311  -2.635  1.672   1.00 0.00 ? 14 TYR A HD2  14 
ATOM   10352 H HE1  . TYR A 1 14 ? 12.696  -2.693  -2.676  1.00 0.00 ? 14 TYR A HE1  14 
ATOM   10353 H HE2  . TYR A 1 14 ? 12.561  -3.658  1.509   1.00 0.00 ? 14 TYR A HE2  14 
ATOM   10354 H HH   . TYR A 1 14 ? 14.278  -4.122  0.186   1.00 0.00 ? 14 TYR A HH   14 
ATOM   10355 N N    . GLN A 1 15 ? 5.811   -1.113  -0.739  1.00 0.00 ? 15 GLN A N    14 
ATOM   10356 C CA   . GLN A 1 15 ? 4.429   -1.076  -0.202  1.00 0.00 ? 15 GLN A CA   14 
ATOM   10357 C C    . GLN A 1 15 ? 3.499   -1.750  -1.209  1.00 0.00 ? 15 GLN A C    14 
ATOM   10358 O O    . GLN A 1 15 ? 2.385   -2.120  -0.898  1.00 0.00 ? 15 GLN A O    14 
ATOM   10359 C CB   . GLN A 1 15 ? 3.994   0.376   0.008   1.00 0.00 ? 15 GLN A CB   14 
ATOM   10360 C CG   . GLN A 1 15 ? 5.056   1.110   0.828   1.00 0.00 ? 15 GLN A CG   14 
ATOM   10361 C CD   . GLN A 1 15 ? 4.547   2.508   1.187   1.00 0.00 ? 15 GLN A CD   14 
ATOM   10362 O OE1  . GLN A 1 15 ? 4.434   2.847   2.348   1.00 0.00 ? 15 GLN A OE1  14 
ATOM   10363 N NE2  . GLN A 1 15 ? 4.236   3.340   0.231   1.00 0.00 ? 15 GLN A NE2  14 
ATOM   10364 H H    . GLN A 1 15 ? 6.202   -0.318  -1.150  1.00 0.00 ? 15 GLN A H    14 
ATOM   10365 H HA   . GLN A 1 15 ? 4.394   -1.607  0.735   1.00 0.00 ? 15 GLN A HA   14 
ATOM   10366 H HB2  . GLN A 1 15 ? 3.879   0.859   -0.951  1.00 0.00 ? 15 GLN A HB2  14 
ATOM   10367 H HB3  . GLN A 1 15 ? 3.053   0.397   0.539   1.00 0.00 ? 15 GLN A HB3  14 
ATOM   10368 H HG2  . GLN A 1 15 ? 5.257   0.556   1.734   1.00 0.00 ? 15 GLN A HG2  14 
ATOM   10369 H HG3  . GLN A 1 15 ? 5.962   1.196   0.248   1.00 0.00 ? 15 GLN A HG3  14 
ATOM   10370 H HE21 . GLN A 1 15 ? 4.329   3.067   -0.706  1.00 0.00 ? 15 GLN A HE21 14 
ATOM   10371 H HE22 . GLN A 1 15 ? 3.910   4.237   0.450   1.00 0.00 ? 15 GLN A HE22 14 
ATOM   10372 N N    . LEU A 1 16 ? 3.960   -1.915  -2.420  1.00 0.00 ? 16 LEU A N    14 
ATOM   10373 C CA   . LEU A 1 16 ? 3.128   -2.566  -3.459  1.00 0.00 ? 16 LEU A CA   14 
ATOM   10374 C C    . LEU A 1 16 ? 3.011   -4.057  -3.144  1.00 0.00 ? 16 LEU A C    14 
ATOM   10375 O O    . LEU A 1 16 ? 2.115   -4.735  -3.606  1.00 0.00 ? 16 LEU A O    14 
ATOM   10376 C CB   . LEU A 1 16 ? 3.805   -2.377  -4.816  1.00 0.00 ? 16 LEU A CB   14 
ATOM   10377 C CG   . LEU A 1 16 ? 3.321   -1.073  -5.454  1.00 0.00 ? 16 LEU A CG   14 
ATOM   10378 C CD1  . LEU A 1 16 ? 4.040   -0.856  -6.786  1.00 0.00 ? 16 LEU A CD1  14 
ATOM   10379 C CD2  . LEU A 1 16 ? 1.814   -1.153  -5.702  1.00 0.00 ? 16 LEU A CD2  14 
ATOM   10380 H H    . LEU A 1 16 ? 4.863   -1.612  -2.645  1.00 0.00 ? 16 LEU A H    14 
ATOM   10381 H HA   . LEU A 1 16 ? 2.148   -2.119  -3.475  1.00 0.00 ? 16 LEU A HA   14 
ATOM   10382 H HB2  . LEU A 1 16 ? 4.874   -2.336  -4.676  1.00 0.00 ? 16 LEU A HB2  14 
ATOM   10383 H HB3  . LEU A 1 16 ? 3.563   -3.201  -5.459  1.00 0.00 ? 16 LEU A HB3  14 
ATOM   10384 H HG   . LEU A 1 16 ? 3.537   -0.247  -4.793  1.00 0.00 ? 16 LEU A HG   14 
ATOM   10385 H HD11 . LEU A 1 16 ? 4.862   -0.170  -6.644  1.00 0.00 ? 16 LEU A HD11 14 
ATOM   10386 H HD12 . LEU A 1 16 ? 3.347   -0.444  -7.504  1.00 0.00 ? 16 LEU A HD12 14 
ATOM   10387 H HD13 . LEU A 1 16 ? 4.418   -1.801  -7.148  1.00 0.00 ? 16 LEU A HD13 14 
ATOM   10388 H HD21 . LEU A 1 16 ? 1.303   -0.475  -5.034  1.00 0.00 ? 16 LEU A HD21 14 
ATOM   10389 H HD22 . LEU A 1 16 ? 1.473   -2.161  -5.521  1.00 0.00 ? 16 LEU A HD22 14 
ATOM   10390 H HD23 . LEU A 1 16 ? 1.602   -0.879  -6.724  1.00 0.00 ? 16 LEU A HD23 14 
ATOM   10391 N N    . GLU A 1 17 ? 3.915   -4.570  -2.356  1.00 0.00 ? 17 GLU A N    14 
ATOM   10392 C CA   . GLU A 1 17 ? 3.864   -6.016  -2.003  1.00 0.00 ? 17 GLU A CA   14 
ATOM   10393 C C    . GLU A 1 17 ? 2.698   -6.269  -1.050  1.00 0.00 ? 17 GLU A C    14 
ATOM   10394 O O    . GLU A 1 17 ? 2.089   -7.321  -1.057  1.00 0.00 ? 17 GLU A O    14 
ATOM   10395 C CB   . GLU A 1 17 ? 5.173   -6.424  -1.319  1.00 0.00 ? 17 GLU A CB   14 
ATOM   10396 C CG   . GLU A 1 17 ? 6.098   -7.092  -2.339  1.00 0.00 ? 17 GLU A CG   14 
ATOM   10397 C CD   . GLU A 1 17 ? 5.531   -8.462  -2.723  1.00 0.00 ? 17 GLU A CD   14 
ATOM   10398 O OE1  . GLU A 1 17 ? 4.868   -9.060  -1.892  1.00 0.00 ? 17 GLU A OE1  14 
ATOM   10399 O OE2  . GLU A 1 17 ? 5.771   -8.887  -3.841  1.00 0.00 ? 17 GLU A OE2  14 
ATOM   10400 H H    . GLU A 1 17 ? 4.627   -4.001  -1.995  1.00 0.00 ? 17 GLU A H    14 
ATOM   10401 H HA   . GLU A 1 17 ? 3.728   -6.598  -2.897  1.00 0.00 ? 17 GLU A HA   14 
ATOM   10402 H HB2  . GLU A 1 17 ? 5.656   -5.547  -0.915  1.00 0.00 ? 17 GLU A HB2  14 
ATOM   10403 H HB3  . GLU A 1 17 ? 4.960   -7.119  -0.521  1.00 0.00 ? 17 GLU A HB3  14 
ATOM   10404 H HG2  . GLU A 1 17 ? 6.172   -6.472  -3.219  1.00 0.00 ? 17 GLU A HG2  14 
ATOM   10405 H HG3  . GLU A 1 17 ? 7.078   -7.220  -1.905  1.00 0.00 ? 17 GLU A HG3  14 
ATOM   10406 N N    . ASN A 1 18 ? 2.384   -5.309  -0.230  1.00 0.00 ? 18 ASN A N    14 
ATOM   10407 C CA   . ASN A 1 18 ? 1.262   -5.478  0.732   1.00 0.00 ? 18 ASN A CA   14 
ATOM   10408 C C    . ASN A 1 18 ? -0.074  -5.356  -0.004  1.00 0.00 ? 18 ASN A C    14 
ATOM   10409 O O    . ASN A 1 18 ? -1.130  -5.446  0.590   1.00 0.00 ? 18 ASN A O    14 
ATOM   10410 C CB   . ASN A 1 18 ? 1.356   -4.393  1.804   1.00 0.00 ? 18 ASN A CB   14 
ATOM   10411 C CG   . ASN A 1 18 ? 2.103   -4.940  3.021   1.00 0.00 ? 18 ASN A CG   14 
ATOM   10412 O OD1  . ASN A 1 18 ? 2.956   -5.796  2.890   1.00 0.00 ? 18 ASN A OD1  14 
ATOM   10413 N ND2  . ASN A 1 18 ? 1.820   -4.480  4.208   1.00 0.00 ? 18 ASN A ND2  14 
ATOM   10414 H H    . ASN A 1 18 ? 2.889   -4.473  -0.246  1.00 0.00 ? 18 ASN A H    14 
ATOM   10415 H HA   . ASN A 1 18 ? 1.330   -6.449  1.197   1.00 0.00 ? 18 ASN A HA   14 
ATOM   10416 H HB2  . ASN A 1 18 ? 1.889   -3.540  1.407   1.00 0.00 ? 18 ASN A HB2  14 
ATOM   10417 H HB3  . ASN A 1 18 ? 0.366   -4.090  2.097   1.00 0.00 ? 18 ASN A HB3  14 
ATOM   10418 H HD21 . ASN A 1 18 ? 1.134   -3.789  4.315   1.00 0.00 ? 18 ASN A HD21 14 
ATOM   10419 H HD22 . ASN A 1 18 ? 2.295   -4.824  4.994   1.00 0.00 ? 18 ASN A HD22 14 
ATOM   10420 N N    . TYR A 1 19 ? -0.040  -5.156  -1.292  1.00 0.00 ? 19 TYR A N    14 
ATOM   10421 C CA   . TYR A 1 19 ? -1.309  -5.033  -2.060  1.00 0.00 ? 19 TYR A CA   14 
ATOM   10422 C C    . TYR A 1 19 ? -1.435  -6.224  -3.009  1.00 0.00 ? 19 TYR A C    14 
ATOM   10423 O O    . TYR A 1 19 ? -2.094  -6.152  -4.028  1.00 0.00 ? 19 TYR A O    14 
ATOM   10424 C CB   . TYR A 1 19 ? -1.293  -3.735  -2.867  1.00 0.00 ? 19 TYR A CB   14 
ATOM   10425 C CG   . TYR A 1 19 ? -1.375  -2.559  -1.925  1.00 0.00 ? 19 TYR A CG   14 
ATOM   10426 C CD1  . TYR A 1 19 ? -2.417  -2.480  -0.993  1.00 0.00 ? 19 TYR A CD1  14 
ATOM   10427 C CD2  . TYR A 1 19 ? -0.407  -1.546  -1.982  1.00 0.00 ? 19 TYR A CD2  14 
ATOM   10428 C CE1  . TYR A 1 19 ? -2.492  -1.388  -0.116  1.00 0.00 ? 19 TYR A CE1  14 
ATOM   10429 C CE2  . TYR A 1 19 ? -0.483  -0.455  -1.107  1.00 0.00 ? 19 TYR A CE2  14 
ATOM   10430 C CZ   . TYR A 1 19 ? -1.524  -0.376  -0.174  1.00 0.00 ? 19 TYR A CZ   14 
ATOM   10431 O OH   . TYR A 1 19 ? -1.598  0.699   0.688   1.00 0.00 ? 19 TYR A OH   14 
ATOM   10432 H H    . TYR A 1 19 ? 0.820   -5.088  -1.757  1.00 0.00 ? 19 TYR A H    14 
ATOM   10433 H HA   . TYR A 1 19 ? -2.144  -5.025  -1.377  1.00 0.00 ? 19 TYR A HA   14 
ATOM   10434 H HB2  . TYR A 1 19 ? -0.376  -3.677  -3.437  1.00 0.00 ? 19 TYR A HB2  14 
ATOM   10435 H HB3  . TYR A 1 19 ? -2.137  -3.717  -3.538  1.00 0.00 ? 19 TYR A HB3  14 
ATOM   10436 H HD1  . TYR A 1 19 ? -3.162  -3.259  -0.948  1.00 0.00 ? 19 TYR A HD1  14 
ATOM   10437 H HD2  . TYR A 1 19 ? 0.396   -1.607  -2.701  1.00 0.00 ? 19 TYR A HD2  14 
ATOM   10438 H HE1  . TYR A 1 19 ? -3.296  -1.327  0.603   1.00 0.00 ? 19 TYR A HE1  14 
ATOM   10439 H HE2  . TYR A 1 19 ? 0.263   0.325   -1.151  1.00 0.00 ? 19 TYR A HE2  14 
ATOM   10440 H HH   . TYR A 1 19 ? -1.571  0.361   1.586   1.00 0.00 ? 19 TYR A HH   14 
ATOM   10441 N N    . CYS A 1 20 ? -0.805  -7.318  -2.683  1.00 0.00 ? 20 CYS A N    14 
ATOM   10442 C CA   . CYS A 1 20 ? -0.884  -8.513  -3.567  1.00 0.00 ? 20 CYS A CA   14 
ATOM   10443 C C    . CYS A 1 20 ? -2.014  -9.428  -3.093  1.00 0.00 ? 20 CYS A C    14 
ATOM   10444 O O    . CYS A 1 20 ? -3.166  -9.229  -3.425  1.00 0.00 ? 20 CYS A O    14 
ATOM   10445 C CB   . CYS A 1 20 ? 0.450   -9.261  -3.522  1.00 0.00 ? 20 CYS A CB   14 
ATOM   10446 S SG   . CYS A 1 20 ? 1.694   -8.317  -4.434  1.00 0.00 ? 20 CYS A SG   14 
ATOM   10447 H H    . CYS A 1 20 ? -0.278  -7.353  -1.859  1.00 0.00 ? 20 CYS A H    14 
ATOM   10448 H HA   . CYS A 1 20 ? -1.082  -8.198  -4.578  1.00 0.00 ? 20 CYS A HA   14 
ATOM   10449 H HB2  . CYS A 1 20 ? 0.764   -9.378  -2.496  1.00 0.00 ? 20 CYS A HB2  14 
ATOM   10450 H HB3  . CYS A 1 20 ? 0.332   -10.233 -3.976  1.00 0.00 ? 20 CYS A HB3  14 
ATOM   10451 N N    . ASN A 1 21 ? -1.701  -10.429 -2.321  1.00 0.00 ? 21 ASN A N    14 
ATOM   10452 C CA   . ASN A 1 21 ? -2.763  -11.352 -1.831  1.00 0.00 ? 21 ASN A CA   14 
ATOM   10453 C C    . ASN A 1 21 ? -2.600  -11.567 -0.326  1.00 0.00 ? 21 ASN A C    14 
ATOM   10454 O O    . ASN A 1 21 ? -3.602  -11.797 0.331   1.00 0.00 ? 21 ASN A O    14 
ATOM   10455 C CB   . ASN A 1 21 ? -2.643  -12.695 -2.557  1.00 0.00 ? 21 ASN A CB   14 
ATOM   10456 C CG   . ASN A 1 21 ? -3.454  -12.646 -3.854  1.00 0.00 ? 21 ASN A CG   14 
ATOM   10457 O OD1  . ASN A 1 21 ? -4.442  -13.339 -3.991  1.00 0.00 ? 21 ASN A OD1  14 
ATOM   10458 N ND2  . ASN A 1 21 ? -3.074  -11.853 -4.818  1.00 0.00 ? 21 ASN A ND2  14 
ATOM   10459 O OXT  . ASN A 1 21 ? -1.477  -11.497 0.146   1.00 0.00 ? 21 ASN A OXT  14 
ATOM   10460 H H    . ASN A 1 21 ? -0.768  -10.575 -2.063  1.00 0.00 ? 21 ASN A H    14 
ATOM   10461 H HA   . ASN A 1 21 ? -3.732  -10.921 -2.031  1.00 0.00 ? 21 ASN A HA   14 
ATOM   10462 H HB2  . ASN A 1 21 ? -1.605  -12.888 -2.786  1.00 0.00 ? 21 ASN A HB2  14 
ATOM   10463 H HB3  . ASN A 1 21 ? -3.026  -13.481 -1.924  1.00 0.00 ? 21 ASN A HB3  14 
ATOM   10464 H HD21 . ASN A 1 21 ? -2.276  -11.294 -4.706  1.00 0.00 ? 21 ASN A HD21 14 
ATOM   10465 H HD22 . ASN A 1 21 ? -3.586  -11.815 -5.652  1.00 0.00 ? 21 ASN A HD22 14 
ATOM   10466 N N    . PHE B 2 1  ? 12.397  -0.658  -10.790 1.00 0.00 ? 1  PHE B N    14 
ATOM   10467 C CA   . PHE B 2 1  ? 12.033  -0.043  -9.483  1.00 0.00 ? 1  PHE B CA   14 
ATOM   10468 C C    . PHE B 2 1  ? 10.944  1.009   -9.701  1.00 0.00 ? 1  PHE B C    14 
ATOM   10469 O O    . PHE B 2 1  ? 10.216  0.968   -10.672 1.00 0.00 ? 1  PHE B O    14 
ATOM   10470 C CB   . PHE B 2 1  ? 13.268  0.618   -8.870  1.00 0.00 ? 1  PHE B CB   14 
ATOM   10471 C CG   . PHE B 2 1  ? 13.509  0.050   -7.487  1.00 0.00 ? 1  PHE B CG   14 
ATOM   10472 C CD1  . PHE B 2 1  ? 14.257  -1.128  -7.331  1.00 0.00 ? 1  PHE B CD1  14 
ATOM   10473 C CD2  . PHE B 2 1  ? 12.980  0.695   -6.360  1.00 0.00 ? 1  PHE B CD2  14 
ATOM   10474 C CE1  . PHE B 2 1  ? 14.476  -1.655  -6.052  1.00 0.00 ? 1  PHE B CE1  14 
ATOM   10475 C CE2  . PHE B 2 1  ? 13.200  0.165   -5.081  1.00 0.00 ? 1  PHE B CE2  14 
ATOM   10476 C CZ   . PHE B 2 1  ? 13.948  -1.008  -4.927  1.00 0.00 ? 1  PHE B CZ   14 
ATOM   10477 H H1   . PHE B 2 1  ? 11.532  -0.945  -11.292 1.00 0.00 ? 1  PHE B H1   14 
ATOM   10478 H H2   . PHE B 2 1  ? 12.997  -1.491  -10.626 1.00 0.00 ? 1  PHE B H2   14 
ATOM   10479 H H3   . PHE B 2 1  ? 12.915  0.035   -11.367 1.00 0.00 ? 1  PHE B H3   14 
ATOM   10480 H HA   . PHE B 2 1  ? 11.666  -0.808  -8.815  1.00 0.00 ? 1  PHE B HA   14 
ATOM   10481 H HB2  . PHE B 2 1  ? 14.127  0.426   -9.498  1.00 0.00 ? 1  PHE B HB2  14 
ATOM   10482 H HB3  . PHE B 2 1  ? 13.107  1.685   -8.799  1.00 0.00 ? 1  PHE B HB3  14 
ATOM   10483 H HD1  . PHE B 2 1  ? 14.665  -1.628  -8.195  1.00 0.00 ? 1  PHE B HD1  14 
ATOM   10484 H HD2  . PHE B 2 1  ? 12.403  1.599   -6.474  1.00 0.00 ? 1  PHE B HD2  14 
ATOM   10485 H HE1  . PHE B 2 1  ? 15.053  -2.560  -5.933  1.00 0.00 ? 1  PHE B HE1  14 
ATOM   10486 H HE2  . PHE B 2 1  ? 12.793  0.663   -4.213  1.00 0.00 ? 1  PHE B HE2  14 
ATOM   10487 H HZ   . PHE B 2 1  ? 14.117  -1.416  -3.941  1.00 0.00 ? 1  PHE B HZ   14 
ATOM   10488 N N    . VAL B 2 2  ? 10.826  1.952   -8.807  1.00 0.00 ? 2  VAL B N    14 
ATOM   10489 C CA   . VAL B 2 2  ? 9.782   3.000   -8.969  1.00 0.00 ? 2  VAL B CA   14 
ATOM   10490 C C    . VAL B 2 2  ? 10.449  4.356   -9.233  1.00 0.00 ? 2  VAL B C    14 
ATOM   10491 O O    . VAL B 2 2  ? 10.957  4.602   -10.308 1.00 0.00 ? 2  VAL B O    14 
ATOM   10492 C CB   . VAL B 2 2  ? 8.926   3.069   -7.702  1.00 0.00 ? 2  VAL B CB   14 
ATOM   10493 C CG1  . VAL B 2 2  ? 7.853   4.146   -7.869  1.00 0.00 ? 2  VAL B CG1  14 
ATOM   10494 C CG2  . VAL B 2 2  ? 8.255   1.713   -7.469  1.00 0.00 ? 2  VAL B CG2  14 
ATOM   10495 H H    . VAL B 2 2  ? 11.422  1.968   -8.029  1.00 0.00 ? 2  VAL B H    14 
ATOM   10496 H HA   . VAL B 2 2  ? 9.154   2.747   -9.810  1.00 0.00 ? 2  VAL B HA   14 
ATOM   10497 H HB   . VAL B 2 2  ? 9.553   3.312   -6.857  1.00 0.00 ? 2  VAL B HB   14 
ATOM   10498 H HG11 . VAL B 2 2  ? 8.044   4.954   -7.179  1.00 0.00 ? 2  VAL B HG11 14 
ATOM   10499 H HG12 . VAL B 2 2  ? 6.881   3.721   -7.665  1.00 0.00 ? 2  VAL B HG12 14 
ATOM   10500 H HG13 . VAL B 2 2  ? 7.875   4.523   -8.881  1.00 0.00 ? 2  VAL B HG13 14 
ATOM   10501 H HG21 . VAL B 2 2  ? 7.355   1.852   -6.887  1.00 0.00 ? 2  VAL B HG21 14 
ATOM   10502 H HG22 . VAL B 2 2  ? 8.933   1.064   -6.936  1.00 0.00 ? 2  VAL B HG22 14 
ATOM   10503 H HG23 . VAL B 2 2  ? 8.002   1.268   -8.421  1.00 0.00 ? 2  VAL B HG23 14 
ATOM   10504 N N    . ASN B 2 3  ? 10.451  5.242   -8.271  1.00 0.00 ? 3  ASN B N    14 
ATOM   10505 C CA   . ASN B 2 3  ? 11.080  6.573   -8.491  1.00 0.00 ? 3  ASN B CA   14 
ATOM   10506 C C    . ASN B 2 3  ? 10.292  7.336   -9.558  1.00 0.00 ? 3  ASN B C    14 
ATOM   10507 O O    . ASN B 2 3  ? 10.706  8.376   -10.028 1.00 0.00 ? 3  ASN B O    14 
ATOM   10508 C CB   . ASN B 2 3  ? 12.525  6.385   -8.955  1.00 0.00 ? 3  ASN B CB   14 
ATOM   10509 C CG   . ASN B 2 3  ? 13.474  6.597   -7.773  1.00 0.00 ? 3  ASN B CG   14 
ATOM   10510 O OD1  . ASN B 2 3  ? 13.680  5.704   -6.975  1.00 0.00 ? 3  ASN B OD1  14 
ATOM   10511 N ND2  . ASN B 2 3  ? 14.063  7.752   -7.626  1.00 0.00 ? 3  ASN B ND2  14 
ATOM   10512 H H    . ASN B 2 3  ? 10.035  5.037   -7.411  1.00 0.00 ? 3  ASN B H    14 
ATOM   10513 H HA   . ASN B 2 3  ? 11.066  7.134   -7.568  1.00 0.00 ? 3  ASN B HA   14 
ATOM   10514 H HB2  . ASN B 2 3  ? 12.650  5.383   -9.341  1.00 0.00 ? 3  ASN B HB2  14 
ATOM   10515 H HB3  . ASN B 2 3  ? 12.751  7.101   -9.728  1.00 0.00 ? 3  ASN B HB3  14 
ATOM   10516 H HD21 . ASN B 2 3  ? 13.897  8.472   -8.269  1.00 0.00 ? 3  ASN B HD21 14 
ATOM   10517 H HD22 . ASN B 2 3  ? 14.671  7.898   -6.871  1.00 0.00 ? 3  ASN B HD22 14 
ATOM   10518 N N    . GLN B 2 4  ? 9.153   6.824   -9.940  1.00 0.00 ? 4  GLN B N    14 
ATOM   10519 C CA   . GLN B 2 4  ? 8.329   7.506   -10.966 1.00 0.00 ? 4  GLN B CA   14 
ATOM   10520 C C    . GLN B 2 4  ? 6.909   7.680   -10.431 1.00 0.00 ? 4  GLN B C    14 
ATOM   10521 O O    . GLN B 2 4  ? 6.598   7.280   -9.326  1.00 0.00 ? 4  GLN B O    14 
ATOM   10522 C CB   . GLN B 2 4  ? 8.296   6.647   -12.228 1.00 0.00 ? 4  GLN B CB   14 
ATOM   10523 C CG   . GLN B 2 4  ? 9.267   7.216   -13.261 1.00 0.00 ? 4  GLN B CG   14 
ATOM   10524 C CD   . GLN B 2 4  ? 8.976   6.597   -14.630 1.00 0.00 ? 4  GLN B CD   14 
ATOM   10525 O OE1  . GLN B 2 4  ? 8.045   6.994   -15.304 1.00 0.00 ? 4  GLN B OE1  14 
ATOM   10526 N NE2  . GLN B 2 4  ? 9.737   5.635   -15.071 1.00 0.00 ? 4  GLN B NE2  14 
ATOM   10527 H H    . GLN B 2 4  ? 8.836   5.988   -9.550  1.00 0.00 ? 4  GLN B H    14 
ATOM   10528 H HA   . GLN B 2 4  ? 8.754   8.471   -11.194 1.00 0.00 ? 4  GLN B HA   14 
ATOM   10529 H HB2  . GLN B 2 4  ? 8.585   5.636   -11.981 1.00 0.00 ? 4  GLN B HB2  14 
ATOM   10530 H HB3  . GLN B 2 4  ? 7.298   6.646   -12.632 1.00 0.00 ? 4  GLN B HB3  14 
ATOM   10531 H HG2  . GLN B 2 4  ? 9.146   8.288   -13.315 1.00 0.00 ? 4  GLN B HG2  14 
ATOM   10532 H HG3  . GLN B 2 4  ? 10.281  6.982   -12.971 1.00 0.00 ? 4  GLN B HG3  14 
ATOM   10533 H HE21 . GLN B 2 4  ? 10.487  5.315   -14.528 1.00 0.00 ? 4  GLN B HE21 14 
ATOM   10534 H HE22 . GLN B 2 4  ? 9.558   5.229   -15.946 1.00 0.00 ? 4  GLN B HE22 14 
ATOM   10535 N N    . HIS B 2 5  ? 6.044   8.269   -11.204 1.00 0.00 ? 5  HIS B N    14 
ATOM   10536 C CA   . HIS B 2 5  ? 4.645   8.465   -10.737 1.00 0.00 ? 5  HIS B CA   14 
ATOM   10537 C C    . HIS B 2 5  ? 3.813   7.232   -11.101 1.00 0.00 ? 5  HIS B C    14 
ATOM   10538 O O    . HIS B 2 5  ? 3.915   6.705   -12.193 1.00 0.00 ? 5  HIS B O    14 
ATOM   10539 C CB   . HIS B 2 5  ? 4.063   9.705   -11.414 1.00 0.00 ? 5  HIS B CB   14 
ATOM   10540 C CG   . HIS B 2 5  ? 2.918   10.237  -10.598 1.00 0.00 ? 5  HIS B CG   14 
ATOM   10541 N ND1  . HIS B 2 5  ? 1.622   10.200  -11.067 1.00 0.00 ? 5  HIS B ND1  14 
ATOM   10542 C CD2  . HIS B 2 5  ? 2.889   10.810  -9.357  1.00 0.00 ? 5  HIS B CD2  14 
ATOM   10543 C CE1  . HIS B 2 5  ? 0.854   10.744  -10.112 1.00 0.00 ? 5  HIS B CE1  14 
ATOM   10544 N NE2  . HIS B 2 5  ? 1.584   11.132  -9.047  1.00 0.00 ? 5  HIS B NE2  14 
ATOM   10545 H H    . HIS B 2 5  ? 6.313   8.582   -12.092 1.00 0.00 ? 5  HIS B H    14 
ATOM   10546 H HA   . HIS B 2 5  ? 4.637   8.601   -9.666  1.00 0.00 ? 5  HIS B HA   14 
ATOM   10547 H HB2  . HIS B 2 5  ? 4.829   10.463  -11.495 1.00 0.00 ? 5  HIS B HB2  14 
ATOM   10548 H HB3  . HIS B 2 5  ? 3.712   9.444   -12.399 1.00 0.00 ? 5  HIS B HB3  14 
ATOM   10549 H HD2  . HIS B 2 5  ? 3.746   10.982  -8.723  1.00 0.00 ? 5  HIS B HD2  14 
ATOM   10550 H HE1  . HIS B 2 5  ? -0.217  10.857  -10.187 1.00 0.00 ? 5  HIS B HE1  14 
ATOM   10551 H HE2  . HIS B 2 5  ? 1.257   11.554  -8.225  1.00 0.00 ? 5  HIS B HE2  14 
ATOM   10552 N N    . LEU B 2 6  ? 2.991   6.764   -10.199 1.00 0.00 ? 6  LEU B N    14 
ATOM   10553 C CA   . LEU B 2 6  ? 2.158   5.564   -10.500 1.00 0.00 ? 6  LEU B CA   14 
ATOM   10554 C C    . LEU B 2 6  ? 0.713   6.004   -10.714 1.00 0.00 ? 6  LEU B C    14 
ATOM   10555 O O    . LEU B 2 6  ? 0.376   7.142   -10.486 1.00 0.00 ? 6  LEU B O    14 
ATOM   10556 C CB   . LEU B 2 6  ? 2.210   4.593   -9.316  1.00 0.00 ? 6  LEU B CB   14 
ATOM   10557 C CG   . LEU B 2 6  ? 3.443   3.696   -9.430  1.00 0.00 ? 6  LEU B CG   14 
ATOM   10558 C CD1  . LEU B 2 6  ? 3.367   2.883   -10.722 1.00 0.00 ? 6  LEU B CD1  14 
ATOM   10559 C CD2  . LEU B 2 6  ? 4.701   4.562   -9.445  1.00 0.00 ? 6  LEU B CD2  14 
ATOM   10560 H H    . LEU B 2 6  ? 2.919   7.201   -9.324  1.00 0.00 ? 6  LEU B H    14 
ATOM   10561 H HA   . LEU B 2 6  ? 2.527   5.078   -11.390 1.00 0.00 ? 6  LEU B HA   14 
ATOM   10562 H HB2  . LEU B 2 6  ? 2.259   5.156   -8.394  1.00 0.00 ? 6  LEU B HB2  14 
ATOM   10563 H HB3  . LEU B 2 6  ? 1.321   3.981   -9.315  1.00 0.00 ? 6  LEU B HB3  14 
ATOM   10564 H HG   . LEU B 2 6  ? 3.477   3.023   -8.584  1.00 0.00 ? 6  LEU B HG   14 
ATOM   10565 H HD11 . LEU B 2 6  ? 2.543   3.239   -11.319 1.00 0.00 ? 6  LEU B HD11 14 
ATOM   10566 H HD12 . LEU B 2 6  ? 3.216   1.841   -10.485 1.00 0.00 ? 6  LEU B HD12 14 
ATOM   10567 H HD13 . LEU B 2 6  ? 4.288   2.997   -11.274 1.00 0.00 ? 6  LEU B HD13 14 
ATOM   10568 H HD21 . LEU B 2 6  ? 4.738   5.123   -10.367 1.00 0.00 ? 6  LEU B HD21 14 
ATOM   10569 H HD22 . LEU B 2 6  ? 5.573   3.929   -9.372  1.00 0.00 ? 6  LEU B HD22 14 
ATOM   10570 H HD23 . LEU B 2 6  ? 4.677   5.244   -8.609  1.00 0.00 ? 6  LEU B HD23 14 
ATOM   10571 N N    . CYS B 2 7  ? -0.139  5.102   -11.131 1.00 0.00 ? 7  CYS B N    14 
ATOM   10572 C CA   . CYS B 2 7  ? -1.579  5.450   -11.341 1.00 0.00 ? 7  CYS B CA   14 
ATOM   10573 C C    . CYS B 2 7  ? -2.307  4.228   -11.932 1.00 0.00 ? 7  CYS B C    14 
ATOM   10574 O O    . CYS B 2 7  ? -2.546  3.256   -11.244 1.00 0.00 ? 7  CYS B O    14 
ATOM   10575 C CB   . CYS B 2 7  ? -1.714  6.661   -12.283 1.00 0.00 ? 7  CYS B CB   14 
ATOM   10576 S SG   . CYS B 2 7  ? -1.936  8.187   -11.327 1.00 0.00 ? 7  CYS B SG   14 
ATOM   10577 H H    . CYS B 2 7  ? 0.167   4.186   -11.291 1.00 0.00 ? 7  CYS B H    14 
ATOM   10578 H HA   . CYS B 2 7  ? -2.018  5.687   -10.382 1.00 0.00 ? 7  CYS B HA   14 
ATOM   10579 H HB2  . CYS B 2 7  ? -0.826  6.746   -12.886 1.00 0.00 ? 7  CYS B HB2  14 
ATOM   10580 H HB3  . CYS B 2 7  ? -2.571  6.525   -12.923 1.00 0.00 ? 7  CYS B HB3  14 
ATOM   10581 N N    . GLY B 2 8  ? -2.659  4.249   -13.194 1.00 0.00 ? 8  GLY B N    14 
ATOM   10582 C CA   . GLY B 2 8  ? -3.369  3.078   -13.784 1.00 0.00 ? 8  GLY B CA   14 
ATOM   10583 C C    . GLY B 2 8  ? -2.353  2.021   -14.209 1.00 0.00 ? 8  GLY B C    14 
ATOM   10584 O O    . GLY B 2 8  ? -1.655  1.454   -13.392 1.00 0.00 ? 8  GLY B O    14 
ATOM   10585 H H    . GLY B 2 8  ? -2.457  5.025   -13.752 1.00 0.00 ? 8  GLY B H    14 
ATOM   10586 H HA2  . GLY B 2 8  ? -4.040  2.658   -13.048 1.00 0.00 ? 8  GLY B HA2  14 
ATOM   10587 H HA3  . GLY B 2 8  ? -3.934  3.396   -14.646 1.00 0.00 ? 8  GLY B HA3  14 
ATOM   10588 N N    . SER B 2 9  ? -2.261  1.753   -15.485 1.00 0.00 ? 9  SER B N    14 
ATOM   10589 C CA   . SER B 2 9  ? -1.287  0.734   -15.964 1.00 0.00 ? 9  SER B CA   14 
ATOM   10590 C C    . SER B 2 9  ? 0.040   0.928   -15.231 1.00 0.00 ? 9  SER B C    14 
ATOM   10591 O O    . SER B 2 9  ? 0.803   0.000   -15.049 1.00 0.00 ? 9  SER B O    14 
ATOM   10592 C CB   . SER B 2 9  ? -1.070  0.901   -17.467 1.00 0.00 ? 9  SER B CB   14 
ATOM   10593 O OG   . SER B 2 9  ? -1.739  -0.145  -18.157 1.00 0.00 ? 9  SER B OG   14 
ATOM   10594 H H    . SER B 2 9  ? -2.834  2.223   -16.126 1.00 0.00 ? 9  SER B H    14 
ATOM   10595 H HA   . SER B 2 9  ? -1.669  -0.256  -15.761 1.00 0.00 ? 9  SER B HA   14 
ATOM   10596 H HB2  . SER B 2 9  ? -1.469  1.849   -17.787 1.00 0.00 ? 9  SER B HB2  14 
ATOM   10597 H HB3  . SER B 2 9  ? -0.011  0.869   -17.682 1.00 0.00 ? 9  SER B HB3  14 
ATOM   10598 H HG   . SER B 2 9  ? -1.467  -0.114  -19.077 1.00 0.00 ? 9  SER B HG   14 
ATOM   10599 N N    . ASP B 2 10 ? 0.317   2.128   -14.802 1.00 0.00 ? 10 ASP B N    14 
ATOM   10600 C CA   . ASP B 2 10 ? 1.587   2.380   -14.073 1.00 0.00 ? 10 ASP B CA   14 
ATOM   10601 C C    . ASP B 2 10 ? 1.524   1.701   -12.707 1.00 0.00 ? 10 ASP B C    14 
ATOM   10602 O O    . ASP B 2 10 ? 2.384   0.918   -12.351 1.00 0.00 ? 10 ASP B O    14 
ATOM   10603 C CB   . ASP B 2 10 ? 1.781   3.887   -13.887 1.00 0.00 ? 10 ASP B CB   14 
ATOM   10604 C CG   . ASP B 2 10 ? 2.285   4.501   -15.194 1.00 0.00 ? 10 ASP B CG   14 
ATOM   10605 O OD1  . ASP B 2 10 ? 3.454   4.326   -15.495 1.00 0.00 ? 10 ASP B OD1  14 
ATOM   10606 O OD2  . ASP B 2 10 ? 1.493   5.137   -15.871 1.00 0.00 ? 10 ASP B OD2  14 
ATOM   10607 H H    . ASP B 2 10 ? -0.314  2.862   -14.955 1.00 0.00 ? 10 ASP B H    14 
ATOM   10608 H HA   . ASP B 2 10 ? 2.417   1.978   -14.637 1.00 0.00 ? 10 ASP B HA   14 
ATOM   10609 H HB2  . ASP B 2 10 ? 0.839   4.340   -13.614 1.00 0.00 ? 10 ASP B HB2  14 
ATOM   10610 H HB3  . ASP B 2 10 ? 2.505   4.063   -13.105 1.00 0.00 ? 10 ASP B HB3  14 
ATOM   10611 N N    . LEU B 2 11 ? 0.512   1.991   -11.930 1.00 0.00 ? 11 LEU B N    14 
ATOM   10612 C CA   . LEU B 2 11 ? 0.412   1.355   -10.590 1.00 0.00 ? 11 LEU B CA   14 
ATOM   10613 C C    . LEU B 2 11 ? 0.051   -0.118  -10.771 1.00 0.00 ? 11 LEU B C    14 
ATOM   10614 O O    . LEU B 2 11 ? 0.373   -0.957  -9.952  1.00 0.00 ? 11 LEU B O    14 
ATOM   10615 C CB   . LEU B 2 11 ? -0.679  2.060   -9.770  1.00 0.00 ? 11 LEU B CB   14 
ATOM   10616 C CG   . LEU B 2 11 ? -0.333  2.143   -8.264  1.00 0.00 ? 11 LEU B CG   14 
ATOM   10617 C CD1  . LEU B 2 11 ? -1.469  1.525   -7.450  1.00 0.00 ? 11 LEU B CD1  14 
ATOM   10618 C CD2  . LEU B 2 11 ? 0.964   1.400   -7.928  1.00 0.00 ? 11 LEU B CD2  14 
ATOM   10619 H H    . LEU B 2 11 ? -0.177  2.623   -12.230 1.00 0.00 ? 11 LEU B H    14 
ATOM   10620 H HA   . LEU B 2 11 ? 1.363   1.436   -10.094 1.00 0.00 ? 11 LEU B HA   14 
ATOM   10621 H HB2  . LEU B 2 11 ? -0.804  3.059   -10.152 1.00 0.00 ? 11 LEU B HB2  14 
ATOM   10622 H HB3  . LEU B 2 11 ? -1.609  1.523   -9.888  1.00 0.00 ? 11 LEU B HB3  14 
ATOM   10623 H HG   . LEU B 2 11 ? -0.229  3.181   -7.989  1.00 0.00 ? 11 LEU B HG   14 
ATOM   10624 H HD11 . LEU B 2 11 ? -1.055  0.865   -6.701  1.00 0.00 ? 11 LEU B HD11 14 
ATOM   10625 H HD12 . LEU B 2 11 ? -2.116  0.962   -8.105  1.00 0.00 ? 11 LEU B HD12 14 
ATOM   10626 H HD13 . LEU B 2 11 ? -2.034  2.308   -6.967  1.00 0.00 ? 11 LEU B HD13 14 
ATOM   10627 H HD21 . LEU B 2 11 ? 1.010   1.221   -6.865  1.00 0.00 ? 11 LEU B HD21 14 
ATOM   10628 H HD22 . LEU B 2 11 ? 1.809   2.001   -8.229  1.00 0.00 ? 11 LEU B HD22 14 
ATOM   10629 H HD23 . LEU B 2 11 ? 0.984   0.458   -8.456  1.00 0.00 ? 11 LEU B HD23 14 
ATOM   10630 N N    . VAL B 2 12 ? -0.612  -0.436  -11.847 1.00 0.00 ? 12 VAL B N    14 
ATOM   10631 C CA   . VAL B 2 12 ? -0.994  -1.849  -12.099 1.00 0.00 ? 12 VAL B CA   14 
ATOM   10632 C C    . VAL B 2 12 ? 0.234   -2.613  -12.605 1.00 0.00 ? 12 VAL B C    14 
ATOM   10633 O O    . VAL B 2 12 ? 0.542   -3.690  -12.135 1.00 0.00 ? 12 VAL B O    14 
ATOM   10634 C CB   . VAL B 2 12 ? -2.110  -1.883  -13.149 1.00 0.00 ? 12 VAL B CB   14 
ATOM   10635 C CG1  . VAL B 2 12 ? -2.195  -3.277  -13.780 1.00 0.00 ? 12 VAL B CG1  14 
ATOM   10636 C CG2  . VAL B 2 12 ? -3.444  -1.548  -12.479 1.00 0.00 ? 12 VAL B CG2  14 
ATOM   10637 H H    . VAL B 2 12 ? -0.854  0.258   -12.495 1.00 0.00 ? 12 VAL B H    14 
ATOM   10638 H HA   . VAL B 2 12 ? -1.346  -2.299  -11.182 1.00 0.00 ? 12 VAL B HA   14 
ATOM   10639 H HB   . VAL B 2 12 ? -1.898  -1.152  -13.916 1.00 0.00 ? 12 VAL B HB   14 
ATOM   10640 H HG11 . VAL B 2 12 ? -2.267  -4.021  -13.000 1.00 0.00 ? 12 VAL B HG11 14 
ATOM   10641 H HG12 . VAL B 2 12 ? -1.309  -3.459  -14.371 1.00 0.00 ? 12 VAL B HG12 14 
ATOM   10642 H HG13 . VAL B 2 12 ? -3.068  -3.331  -14.412 1.00 0.00 ? 12 VAL B HG13 14 
ATOM   10643 H HG21 . VAL B 2 12 ? -3.913  -2.457  -12.135 1.00 0.00 ? 12 VAL B HG21 14 
ATOM   10644 H HG22 . VAL B 2 12 ? -4.092  -1.057  -13.191 1.00 0.00 ? 12 VAL B HG22 14 
ATOM   10645 H HG23 . VAL B 2 12 ? -3.270  -0.892  -11.639 1.00 0.00 ? 12 VAL B HG23 14 
ATOM   10646 N N    . GLU B 2 13 ? 0.944   -2.059  -13.552 1.00 0.00 ? 13 GLU B N    14 
ATOM   10647 C CA   . GLU B 2 13 ? 2.154   -2.755  -14.071 1.00 0.00 ? 13 GLU B CA   14 
ATOM   10648 C C    . GLU B 2 13 ? 3.053   -3.124  -12.892 1.00 0.00 ? 13 GLU B C    14 
ATOM   10649 O O    . GLU B 2 13 ? 3.719   -4.140  -12.896 1.00 0.00 ? 13 GLU B O    14 
ATOM   10650 C CB   . GLU B 2 13 ? 2.915   -1.829  -15.024 1.00 0.00 ? 13 GLU B CB   14 
ATOM   10651 C CG   . GLU B 2 13 ? 2.459   -2.090  -16.461 1.00 0.00 ? 13 GLU B CG   14 
ATOM   10652 C CD   . GLU B 2 13 ? 3.682   -2.230  -17.370 1.00 0.00 ? 13 GLU B CD   14 
ATOM   10653 O OE1  . GLU B 2 13 ? 4.351   -1.232  -17.588 1.00 0.00 ? 13 GLU B OE1  14 
ATOM   10654 O OE2  . GLU B 2 13 ? 3.929   -3.332  -17.832 1.00 0.00 ? 13 GLU B OE2  14 
ATOM   10655 H H    . GLU B 2 13 ? 0.685   -1.187  -13.914 1.00 0.00 ? 13 GLU B H    14 
ATOM   10656 H HA   . GLU B 2 13 ? 1.860   -3.652  -14.595 1.00 0.00 ? 13 GLU B HA   14 
ATOM   10657 H HB2  . GLU B 2 13 ? 2.717   -0.800  -14.762 1.00 0.00 ? 13 GLU B HB2  14 
ATOM   10658 H HB3  . GLU B 2 13 ? 3.974   -2.022  -14.945 1.00 0.00 ? 13 GLU B HB3  14 
ATOM   10659 H HG2  . GLU B 2 13 ? 1.879   -3.000  -16.495 1.00 0.00 ? 13 GLU B HG2  14 
ATOM   10660 H HG3  . GLU B 2 13 ? 1.853   -1.264  -16.802 1.00 0.00 ? 13 GLU B HG3  14 
ATOM   10661 N N    . ALA B 2 14 ? 3.069   -2.306  -11.874 1.00 0.00 ? 14 ALA B N    14 
ATOM   10662 C CA   . ALA B 2 14 ? 3.914   -2.610  -10.687 1.00 0.00 ? 14 ALA B CA   14 
ATOM   10663 C C    . ALA B 2 14 ? 3.337   -3.828  -9.963  1.00 0.00 ? 14 ALA B C    14 
ATOM   10664 O O    . ALA B 2 14 ? 3.981   -4.849  -9.835  1.00 0.00 ? 14 ALA B O    14 
ATOM   10665 C CB   . ALA B 2 14 ? 3.916   -1.406  -9.742  1.00 0.00 ? 14 ALA B CB   14 
ATOM   10666 H H    . ALA B 2 14 ? 2.518   -1.495  -11.889 1.00 0.00 ? 14 ALA B H    14 
ATOM   10667 H HA   . ALA B 2 14 ? 4.924   -2.824  -11.006 1.00 0.00 ? 14 ALA B HA   14 
ATOM   10668 H HB1  . ALA B 2 14 ? 3.729   -0.505  -10.307 1.00 0.00 ? 14 ALA B HB1  14 
ATOM   10669 H HB2  . ALA B 2 14 ? 4.877   -1.332  -9.254  1.00 0.00 ? 14 ALA B HB2  14 
ATOM   10670 H HB3  . ALA B 2 14 ? 3.143   -1.532  -8.999  1.00 0.00 ? 14 ALA B HB3  14 
ATOM   10671 N N    . LEU B 2 15 ? 2.122   -3.730  -9.494  1.00 0.00 ? 15 LEU B N    14 
ATOM   10672 C CA   . LEU B 2 15 ? 1.500   -4.885  -8.784  1.00 0.00 ? 15 LEU B CA   14 
ATOM   10673 C C    . LEU B 2 15 ? 1.705   -6.156  -9.612  1.00 0.00 ? 15 LEU B C    14 
ATOM   10674 O O    . LEU B 2 15 ? 2.017   -7.207  -9.088  1.00 0.00 ? 15 LEU B O    14 
ATOM   10675 C CB   . LEU B 2 15 ? 0.000   -4.632  -8.614  1.00 0.00 ? 15 LEU B CB   14 
ATOM   10676 C CG   . LEU B 2 15 ? -0.235  -3.666  -7.452  1.00 0.00 ? 15 LEU B CG   14 
ATOM   10677 C CD1  . LEU B 2 15 ? -1.689  -3.190  -7.475  1.00 0.00 ? 15 LEU B CD1  14 
ATOM   10678 C CD2  . LEU B 2 15 ? 0.044   -4.382  -6.128  1.00 0.00 ? 15 LEU B CD2  14 
ATOM   10679 H H    . LEU B 2 15 ? 1.616   -2.900  -9.612  1.00 0.00 ? 15 LEU B H    14 
ATOM   10680 H HA   . LEU B 2 15 ? 1.960   -5.005  -7.815  1.00 0.00 ? 15 LEU B HA   14 
ATOM   10681 H HB2  . LEU B 2 15 ? -0.396  -4.203  -9.524  1.00 0.00 ? 15 LEU B HB2  14 
ATOM   10682 H HB3  . LEU B 2 15 ? -0.500  -5.566  -8.410  1.00 0.00 ? 15 LEU B HB3  14 
ATOM   10683 H HG   . LEU B 2 15 ? 0.424   -2.815  -7.551  1.00 0.00 ? 15 LEU B HG   14 
ATOM   10684 H HD11 . LEU B 2 15 ? -1.748  -2.193  -7.063  1.00 0.00 ? 15 LEU B HD11 14 
ATOM   10685 H HD12 . LEU B 2 15 ? -2.296  -3.860  -6.884  1.00 0.00 ? 15 LEU B HD12 14 
ATOM   10686 H HD13 . LEU B 2 15 ? -2.049  -3.181  -8.493  1.00 0.00 ? 15 LEU B HD13 14 
ATOM   10687 H HD21 . LEU B 2 15 ? -0.578  -5.261  -6.056  1.00 0.00 ? 15 LEU B HD21 14 
ATOM   10688 H HD22 . LEU B 2 15 ? -0.174  -3.716  -5.307  1.00 0.00 ? 15 LEU B HD22 14 
ATOM   10689 H HD23 . LEU B 2 15 ? 1.084   -4.673  -6.089  1.00 0.00 ? 15 LEU B HD23 14 
ATOM   10690 N N    . TYR B 2 16 ? 1.522   -6.066  -10.900 1.00 0.00 ? 16 TYR B N    14 
ATOM   10691 C CA   . TYR B 2 16 ? 1.696   -7.265  -11.768 1.00 0.00 ? 16 TYR B CA   14 
ATOM   10692 C C    . TYR B 2 16 ? 3.117   -7.816  -11.622 1.00 0.00 ? 16 TYR B C    14 
ATOM   10693 O O    . TYR B 2 16 ? 3.314   -8.980  -11.333 1.00 0.00 ? 16 TYR B O    14 
ATOM   10694 C CB   . TYR B 2 16 ? 1.451   -6.872  -13.226 1.00 0.00 ? 16 TYR B CB   14 
ATOM   10695 C CG   . TYR B 2 16 ? 0.287   -7.667  -13.777 1.00 0.00 ? 16 TYR B CG   14 
ATOM   10696 C CD1  . TYR B 2 16 ? 0.257   -9.064  -13.631 1.00 0.00 ? 16 TYR B CD1  14 
ATOM   10697 C CD2  . TYR B 2 16 ? -0.765  -7.012  -14.432 1.00 0.00 ? 16 TYR B CD2  14 
ATOM   10698 C CE1  . TYR B 2 16 ? -0.822  -9.799  -14.141 1.00 0.00 ? 16 TYR B CE1  14 
ATOM   10699 C CE2  . TYR B 2 16 ? -1.843  -7.747  -14.941 1.00 0.00 ? 16 TYR B CE2  14 
ATOM   10700 C CZ   . TYR B 2 16 ? -1.872  -9.141  -14.795 1.00 0.00 ? 16 TYR B CZ   14 
ATOM   10701 O OH   . TYR B 2 16 ? -2.934  -9.865  -15.296 1.00 0.00 ? 16 TYR B OH   14 
ATOM   10702 H H    . TYR B 2 16 ? 1.267   -5.208  -11.297 1.00 0.00 ? 16 TYR B H    14 
ATOM   10703 H HA   . TYR B 2 16 ? 0.984   -8.024  -11.478 1.00 0.00 ? 16 TYR B HA   14 
ATOM   10704 H HB2  . TYR B 2 16 ? 1.225   -5.815  -13.279 1.00 0.00 ? 16 TYR B HB2  14 
ATOM   10705 H HB3  . TYR B 2 16 ? 2.338   -7.078  -13.808 1.00 0.00 ? 16 TYR B HB3  14 
ATOM   10706 H HD1  . TYR B 2 16 ? 1.064   -9.573  -13.128 1.00 0.00 ? 16 TYR B HD1  14 
ATOM   10707 H HD2  . TYR B 2 16 ? -0.746  -5.940  -14.545 1.00 0.00 ? 16 TYR B HD2  14 
ATOM   10708 H HE1  . TYR B 2 16 ? -0.844  -10.872 -14.029 1.00 0.00 ? 16 TYR B HE1  14 
ATOM   10709 H HE2  . TYR B 2 16 ? -2.652  -7.241  -15.445 1.00 0.00 ? 16 TYR B HE2  14 
ATOM   10710 H HH   . TYR B 2 16 ? -2.663  -10.784 -15.358 1.00 0.00 ? 16 TYR B HH   14 
ATOM   10711 N N    . LEU B 2 17 ? 4.109   -6.995  -11.827 1.00 0.00 ? 17 LEU B N    14 
ATOM   10712 C CA   . LEU B 2 17 ? 5.513   -7.480  -11.706 1.00 0.00 ? 17 LEU B CA   14 
ATOM   10713 C C    . LEU B 2 17 ? 5.888   -7.612  -10.230 1.00 0.00 ? 17 LEU B C    14 
ATOM   10714 O O    . LEU B 2 17 ? 6.837   -8.283  -9.878  1.00 0.00 ? 17 LEU B O    14 
ATOM   10715 C CB   . LEU B 2 17 ? 6.455   -6.488  -12.389 1.00 0.00 ? 17 LEU B CB   14 
ATOM   10716 C CG   . LEU B 2 17 ? 6.778   -6.982  -13.800 1.00 0.00 ? 17 LEU B CG   14 
ATOM   10717 C CD1  . LEU B 2 17 ? 7.382   -8.385  -13.726 1.00 0.00 ? 17 LEU B CD1  14 
ATOM   10718 C CD2  . LEU B 2 17 ? 5.492   -7.027  -14.629 1.00 0.00 ? 17 LEU B CD2  14 
ATOM   10719 H H    . LEU B 2 17 ? 3.931   -6.061  -12.065 1.00 0.00 ? 17 LEU B H    14 
ATOM   10720 H HA   . LEU B 2 17 ? 5.600   -8.443  -12.183 1.00 0.00 ? 17 LEU B HA   14 
ATOM   10721 H HB2  . LEU B 2 17 ? 5.977   -5.521  -12.447 1.00 0.00 ? 17 LEU B HB2  14 
ATOM   10722 H HB3  . LEU B 2 17 ? 7.368   -6.406  -11.820 1.00 0.00 ? 17 LEU B HB3  14 
ATOM   10723 H HG   . LEU B 2 17 ? 7.485   -6.309  -14.265 1.00 0.00 ? 17 LEU B HG   14 
ATOM   10724 H HD11 . LEU B 2 17 ? 6.632   -9.115  -13.991 1.00 0.00 ? 17 LEU B HD11 14 
ATOM   10725 H HD12 . LEU B 2 17 ? 7.730   -8.575  -12.722 1.00 0.00 ? 17 LEU B HD12 14 
ATOM   10726 H HD13 . LEU B 2 17 ? 8.212   -8.456  -14.414 1.00 0.00 ? 17 LEU B HD13 14 
ATOM   10727 H HD21 . LEU B 2 17 ? 4.772   -6.337  -14.213 1.00 0.00 ? 17 LEU B HD21 14 
ATOM   10728 H HD22 . LEU B 2 17 ? 5.086   -8.027  -14.609 1.00 0.00 ? 17 LEU B HD22 14 
ATOM   10729 H HD23 . LEU B 2 17 ? 5.711   -6.748  -15.649 1.00 0.00 ? 17 LEU B HD23 14 
ATOM   10730 N N    . VAL B 2 18 ? 5.150   -6.979  -9.364  1.00 0.00 ? 18 VAL B N    14 
ATOM   10731 C CA   . VAL B 2 18 ? 5.464   -7.070  -7.910  1.00 0.00 ? 18 VAL B CA   14 
ATOM   10732 C C    . VAL B 2 18 ? 4.939   -8.396  -7.359  1.00 0.00 ? 18 VAL B C    14 
ATOM   10733 O O    . VAL B 2 18 ? 5.682   -9.203  -6.839  1.00 0.00 ? 18 VAL B O    14 
ATOM   10734 C CB   . VAL B 2 18 ? 4.795   -5.910  -7.175  1.00 0.00 ? 18 VAL B CB   14 
ATOM   10735 C CG1  . VAL B 2 18 ? 5.065   -6.032  -5.676  1.00 0.00 ? 18 VAL B CG1  14 
ATOM   10736 C CG2  . VAL B 2 18 ? 5.365   -4.586  -7.687  1.00 0.00 ? 18 VAL B CG2  14 
ATOM   10737 H H    . VAL B 2 18 ? 4.388   -6.445  -9.667  1.00 0.00 ? 18 VAL B H    14 
ATOM   10738 H HA   . VAL B 2 18 ? 6.533   -7.018  -7.769  1.00 0.00 ? 18 VAL B HA   14 
ATOM   10739 H HB   . VAL B 2 18 ? 3.729   -5.937  -7.353  1.00 0.00 ? 18 VAL B HB   14 
ATOM   10740 H HG11 . VAL B 2 18 ? 5.989   -6.568  -5.520  1.00 0.00 ? 18 VAL B HG11 14 
ATOM   10741 H HG12 . VAL B 2 18 ? 4.253   -6.569  -5.207  1.00 0.00 ? 18 VAL B HG12 14 
ATOM   10742 H HG13 . VAL B 2 18 ? 5.142   -5.046  -5.242  1.00 0.00 ? 18 VAL B HG13 14 
ATOM   10743 H HG21 . VAL B 2 18 ? 5.946   -4.118  -6.907  1.00 0.00 ? 18 VAL B HG21 14 
ATOM   10744 H HG22 . VAL B 2 18 ? 4.555   -3.932  -7.974  1.00 0.00 ? 18 VAL B HG22 14 
ATOM   10745 H HG23 . VAL B 2 18 ? 5.997   -4.774  -8.544  1.00 0.00 ? 18 VAL B HG23 14 
ATOM   10746 N N    . CYS B 2 19 ? 3.660   -8.627  -7.472  1.00 0.00 ? 19 CYS B N    14 
ATOM   10747 C CA   . CYS B 2 19 ? 3.083   -9.901  -6.958  1.00 0.00 ? 19 CYS B CA   14 
ATOM   10748 C C    . CYS B 2 19 ? 3.590   -11.068 -7.807  1.00 0.00 ? 19 CYS B C    14 
ATOM   10749 O O    . CYS B 2 19 ? 4.267   -11.953 -7.323  1.00 0.00 ? 19 CYS B O    14 
ATOM   10750 C CB   . CYS B 2 19 ? 1.558   -9.835  -7.039  1.00 0.00 ? 19 CYS B CB   14 
ATOM   10751 S SG   . CYS B 2 19 ? 0.989   -8.273  -6.325  1.00 0.00 ? 19 CYS B SG   14 
ATOM   10752 H H    . CYS B 2 19 ? 3.078   -7.963  -7.897  1.00 0.00 ? 19 CYS B H    14 
ATOM   10753 H HA   . CYS B 2 19 ? 3.384   -10.045 -5.931  1.00 0.00 ? 19 CYS B HA   14 
ATOM   10754 H HB2  . CYS B 2 19 ? 1.250   -9.892  -8.073  1.00 0.00 ? 19 CYS B HB2  14 
ATOM   10755 H HB3  . CYS B 2 19 ? 1.131   -10.659 -6.488  1.00 0.00 ? 19 CYS B HB3  14 
ATOM   10756 N N    . GLY B 2 20 ? 3.271   -11.074 -9.073  1.00 0.00 ? 20 GLY B N    14 
ATOM   10757 C CA   . GLY B 2 20 ? 3.739   -12.183 -9.953  1.00 0.00 ? 20 GLY B CA   14 
ATOM   10758 C C    . GLY B 2 20 ? 2.897   -13.435 -9.697  1.00 0.00 ? 20 GLY B C    14 
ATOM   10759 O O    . GLY B 2 20 ? 1.841   -13.612 -10.269 1.00 0.00 ? 20 GLY B O    14 
ATOM   10760 H H    . GLY B 2 20 ? 2.727   -10.349 -9.446  1.00 0.00 ? 20 GLY B H    14 
ATOM   10761 H HA2  . GLY B 2 20 ? 3.640   -11.886 -10.988 1.00 0.00 ? 20 GLY B HA2  14 
ATOM   10762 H HA3  . GLY B 2 20 ? 4.774   -12.400 -9.738  1.00 0.00 ? 20 GLY B HA3  14 
ATOM   10763 N N    . GLU B 2 21 ? 3.360   -14.306 -8.843  1.00 0.00 ? 21 GLU B N    14 
ATOM   10764 C CA   . GLU B 2 21 ? 2.590   -15.549 -8.555  1.00 0.00 ? 21 GLU B CA   14 
ATOM   10765 C C    . GLU B 2 21 ? 1.487   -15.248 -7.539  1.00 0.00 ? 21 GLU B C    14 
ATOM   10766 O O    . GLU B 2 21 ? 0.333   -15.557 -7.754  1.00 0.00 ? 21 GLU B O    14 
ATOM   10767 C CB   . GLU B 2 21 ? 3.529   -16.611 -7.982  1.00 0.00 ? 21 GLU B CB   14 
ATOM   10768 C CG   . GLU B 2 21 ? 3.009   -18.000 -8.352  1.00 0.00 ? 21 GLU B CG   14 
ATOM   10769 C CD   . GLU B 2 21 ? 3.923   -19.068 -7.748  1.00 0.00 ? 21 GLU B CD   14 
ATOM   10770 O OE1  . GLU B 2 21 ? 4.940   -19.362 -8.355  1.00 0.00 ? 21 GLU B OE1  14 
ATOM   10771 O OE2  . GLU B 2 21 ? 3.590   -19.575 -6.690  1.00 0.00 ? 21 GLU B OE2  14 
ATOM   10772 H H    . GLU B 2 21 ? 4.217   -14.146 -8.395  1.00 0.00 ? 21 GLU B H    14 
ATOM   10773 H HA   . GLU B 2 21 ? 2.146   -15.918 -9.468  1.00 0.00 ? 21 GLU B HA   14 
ATOM   10774 H HB2  . GLU B 2 21 ? 4.520   -16.473 -8.390  1.00 0.00 ? 21 GLU B HB2  14 
ATOM   10775 H HB3  . GLU B 2 21 ? 3.566   -16.517 -6.907  1.00 0.00 ? 21 GLU B HB3  14 
ATOM   10776 H HG2  . GLU B 2 21 ? 2.008   -18.122 -7.966  1.00 0.00 ? 21 GLU B HG2  14 
ATOM   10777 H HG3  . GLU B 2 21 ? 2.997   -18.105 -9.426  1.00 0.00 ? 21 GLU B HG3  14 
ATOM   10778 N N    . ARG B 2 22 ? 1.840   -14.651 -6.432  1.00 0.00 ? 22 ARG B N    14 
ATOM   10779 C CA   . ARG B 2 22 ? 0.820   -14.329 -5.393  1.00 0.00 ? 22 ARG B CA   14 
ATOM   10780 C C    . ARG B 2 22 ? -0.461  -13.828 -6.064  1.00 0.00 ? 22 ARG B C    14 
ATOM   10781 O O    . ARG B 2 22 ? -1.549  -14.271 -5.752  1.00 0.00 ? 22 ARG B O    14 
ATOM   10782 C CB   . ARG B 2 22 ? 1.373   -13.246 -4.466  1.00 0.00 ? 22 ARG B CB   14 
ATOM   10783 C CG   . ARG B 2 22 ? 2.819   -13.588 -4.102  1.00 0.00 ? 22 ARG B CG   14 
ATOM   10784 C CD   . ARG B 2 22 ? 2.997   -13.514 -2.587  1.00 0.00 ? 22 ARG B CD   14 
ATOM   10785 N NE   . ARG B 2 22 ? 4.283   -14.163 -2.208  1.00 0.00 ? 22 ARG B NE   14 
ATOM   10786 C CZ   . ARG B 2 22 ? 4.285   -15.180 -1.390  1.00 0.00 ? 22 ARG B CZ   14 
ATOM   10787 N NH1  . ARG B 2 22 ? 3.506   -16.202 -1.619  1.00 0.00 ? 22 ARG B NH1  14 
ATOM   10788 N NH2  . ARG B 2 22 ? 5.065   -15.175 -0.344  1.00 0.00 ? 22 ARG B NH2  14 
ATOM   10789 H H    . ARG B 2 22 ? 2.780   -14.417 -6.283  1.00 0.00 ? 22 ARG B H    14 
ATOM   10790 H HA   . ARG B 2 22 ? 0.602   -15.216 -4.817  1.00 0.00 ? 22 ARG B HA   14 
ATOM   10791 H HB2  . ARG B 2 22 ? 1.342   -12.290 -4.969  1.00 0.00 ? 22 ARG B HB2  14 
ATOM   10792 H HB3  . ARG B 2 22 ? 0.777   -13.201 -3.566  1.00 0.00 ? 22 ARG B HB3  14 
ATOM   10793 H HG2  . ARG B 2 22 ? 3.048   -14.588 -4.443  1.00 0.00 ? 22 ARG B HG2  14 
ATOM   10794 H HG3  . ARG B 2 22 ? 3.484   -12.885 -4.577  1.00 0.00 ? 22 ARG B HG3  14 
ATOM   10795 H HD2  . ARG B 2 22 ? 3.010   -12.480 -2.282  1.00 0.00 ? 22 ARG B HD2  14 
ATOM   10796 H HD3  . ARG B 2 22 ? 2.179   -14.023 -2.102  1.00 0.00 ? 22 ARG B HD3  14 
ATOM   10797 H HE   . ARG B 2 22 ? 5.128   -13.827 -2.573  1.00 0.00 ? 22 ARG B HE   14 
ATOM   10798 H HH11 . ARG B 2 22 ? 2.908   -16.205 -2.420  1.00 0.00 ? 22 ARG B HH11 14 
ATOM   10799 H HH12 . ARG B 2 22 ? 3.506   -16.981 -0.992  1.00 0.00 ? 22 ARG B HH12 14 
ATOM   10800 H HH21 . ARG B 2 22 ? 5.663   -14.393 -0.169  1.00 0.00 ? 22 ARG B HH21 14 
ATOM   10801 H HH22 . ARG B 2 22 ? 5.065   -15.955 0.283   1.00 0.00 ? 22 ARG B HH22 14 
ATOM   10802 N N    . GLY B 2 23 ? -0.342  -12.915 -6.988  1.00 0.00 ? 23 GLY B N    14 
ATOM   10803 C CA   . GLY B 2 23 ? -1.555  -12.399 -7.684  1.00 0.00 ? 23 GLY B CA   14 
ATOM   10804 C C    . GLY B 2 23 ? -1.912  -11.009 -7.153  1.00 0.00 ? 23 GLY B C    14 
ATOM   10805 O O    . GLY B 2 23 ? -1.135  -10.374 -6.470  1.00 0.00 ? 23 GLY B O    14 
ATOM   10806 H H    . GLY B 2 23 ? 0.545   -12.576 -7.230  1.00 0.00 ? 23 GLY B H    14 
ATOM   10807 H HA2  . GLY B 2 23 ? -1.360  -12.340 -8.745  1.00 0.00 ? 23 GLY B HA2  14 
ATOM   10808 H HA3  . GLY B 2 23 ? -2.382  -13.070 -7.507  1.00 0.00 ? 23 GLY B HA3  14 
ATOM   10809 N N    . PHE B 2 24 ? -3.093  -10.541 -7.462  1.00 0.00 ? 24 PHE B N    14 
ATOM   10810 C CA   . PHE B 2 24 ? -3.525  -9.193  -6.981  1.00 0.00 ? 24 PHE B CA   14 
ATOM   10811 C C    . PHE B 2 24 ? -4.899  -8.862  -7.577  1.00 0.00 ? 24 PHE B C    14 
ATOM   10812 O O    . PHE B 2 24 ? -5.232  -9.291  -8.665  1.00 0.00 ? 24 PHE B O    14 
ATOM   10813 C CB   . PHE B 2 24 ? -2.482  -8.126  -7.389  1.00 0.00 ? 24 PHE B CB   14 
ATOM   10814 C CG   . PHE B 2 24 ? -2.849  -7.471  -8.718  1.00 0.00 ? 24 PHE B CG   14 
ATOM   10815 C CD1  . PHE B 2 24 ? -3.016  -8.255  -9.870  1.00 0.00 ? 24 PHE B CD1  14 
ATOM   10816 C CD2  . PHE B 2 24 ? -3.023  -6.076  -8.798  1.00 0.00 ? 24 PHE B CD2  14 
ATOM   10817 C CE1  . PHE B 2 24 ? -3.354  -7.653  -11.090 1.00 0.00 ? 24 PHE B CE1  14 
ATOM   10818 C CE2  . PHE B 2 24 ? -3.359  -5.479  -10.019 1.00 0.00 ? 24 PHE B CE2  14 
ATOM   10819 C CZ   . PHE B 2 24 ? -3.524  -6.267  -11.164 1.00 0.00 ? 24 PHE B CZ   14 
ATOM   10820 H H    . PHE B 2 24 ? -3.703  -11.086 -8.007  1.00 0.00 ? 24 PHE B H    14 
ATOM   10821 H HA   . PHE B 2 24 ? -3.606  -9.216  -5.903  1.00 0.00 ? 24 PHE B HA   14 
ATOM   10822 H HB2  . PHE B 2 24 ? -2.441  -7.365  -6.623  1.00 0.00 ? 24 PHE B HB2  14 
ATOM   10823 H HB3  . PHE B 2 24 ? -1.507  -8.596  -7.472  1.00 0.00 ? 24 PHE B HB3  14 
ATOM   10824 H HD1  . PHE B 2 24 ? -2.887  -9.321  -9.821  1.00 0.00 ? 24 PHE B HD1  14 
ATOM   10825 H HD2  . PHE B 2 24 ? -2.900  -5.459  -7.919  1.00 0.00 ? 24 PHE B HD2  14 
ATOM   10826 H HE1  . PHE B 2 24 ? -3.481  -8.260  -11.974 1.00 0.00 ? 24 PHE B HE1  14 
ATOM   10827 H HE2  . PHE B 2 24 ? -3.492  -4.409  -10.078 1.00 0.00 ? 24 PHE B HE2  14 
ATOM   10828 H HZ   . PHE B 2 24 ? -3.784  -5.803  -12.105 1.00 0.00 ? 24 PHE B HZ   14 
ATOM   10829 N N    . PHE B 2 25 ? -5.703  -8.108  -6.877  1.00 0.00 ? 25 PHE B N    14 
ATOM   10830 C CA   . PHE B 2 25 ? -7.049  -7.765  -7.419  1.00 0.00 ? 25 PHE B CA   14 
ATOM   10831 C C    . PHE B 2 25 ? -7.267  -6.254  -7.351  1.00 0.00 ? 25 PHE B C    14 
ATOM   10832 O O    . PHE B 2 25 ? -8.350  -5.790  -7.062  1.00 0.00 ? 25 PHE B O    14 
ATOM   10833 C CB   . PHE B 2 25 ? -8.128  -8.482  -6.604  1.00 0.00 ? 25 PHE B CB   14 
ATOM   10834 C CG   . PHE B 2 25 ? -8.142  -7.938  -5.195  1.00 0.00 ? 25 PHE B CG   14 
ATOM   10835 C CD1  . PHE B 2 25 ? -7.133  -8.301  -4.293  1.00 0.00 ? 25 PHE B CD1  14 
ATOM   10836 C CD2  . PHE B 2 25 ? -9.165  -7.070  -4.790  1.00 0.00 ? 25 PHE B CD2  14 
ATOM   10837 C CE1  . PHE B 2 25 ? -7.148  -7.795  -2.985  1.00 0.00 ? 25 PHE B CE1  14 
ATOM   10838 C CE2  . PHE B 2 25 ? -9.179  -6.565  -3.483  1.00 0.00 ? 25 PHE B CE2  14 
ATOM   10839 C CZ   . PHE B 2 25 ? -8.171  -6.928  -2.581  1.00 0.00 ? 25 PHE B CZ   14 
ATOM   10840 H H    . PHE B 2 25 ? -5.424  -7.771  -6.001  1.00 0.00 ? 25 PHE B H    14 
ATOM   10841 H HA   . PHE B 2 25 ? -7.104  -8.080  -8.447  1.00 0.00 ? 25 PHE B HA   14 
ATOM   10842 H HB2  . PHE B 2 25 ? -9.091  -8.319  -7.063  1.00 0.00 ? 25 PHE B HB2  14 
ATOM   10843 H HB3  . PHE B 2 25 ? -7.915  -9.540  -6.578  1.00 0.00 ? 25 PHE B HB3  14 
ATOM   10844 H HD1  . PHE B 2 25 ? -6.345  -8.969  -4.604  1.00 0.00 ? 25 PHE B HD1  14 
ATOM   10845 H HD2  . PHE B 2 25 ? -9.943  -6.791  -5.485  1.00 0.00 ? 25 PHE B HD2  14 
ATOM   10846 H HE1  . PHE B 2 25 ? -6.370  -8.075  -2.290  1.00 0.00 ? 25 PHE B HE1  14 
ATOM   10847 H HE2  . PHE B 2 25 ? -9.968  -5.896  -3.171  1.00 0.00 ? 25 PHE B HE2  14 
ATOM   10848 H HZ   . PHE B 2 25 ? -8.181  -6.538  -1.573  1.00 0.00 ? 25 PHE B HZ   14 
ATOM   10849 N N    . TYR B 2 26 ? -6.243  -5.497  -7.638  1.00 0.00 ? 26 TYR B N    14 
ATOM   10850 C CA   . TYR B 2 26 ? -6.347  -4.003  -7.620  1.00 0.00 ? 26 TYR B CA   14 
ATOM   10851 C C    . TYR B 2 26 ? -7.315  -3.530  -6.527  1.00 0.00 ? 26 TYR B C    14 
ATOM   10852 O O    . TYR B 2 26 ? -8.517  -3.543  -6.700  1.00 0.00 ? 26 TYR B O    14 
ATOM   10853 C CB   . TYR B 2 26 ? -6.848  -3.514  -8.981  1.00 0.00 ? 26 TYR B CB   14 
ATOM   10854 C CG   . TYR B 2 26 ? -6.345  -2.112  -9.228  1.00 0.00 ? 26 TYR B CG   14 
ATOM   10855 C CD1  . TYR B 2 26 ? -4.975  -1.835  -9.137  1.00 0.00 ? 26 TYR B CD1  14 
ATOM   10856 C CD2  . TYR B 2 26 ? -7.248  -1.088  -9.546  1.00 0.00 ? 26 TYR B CD2  14 
ATOM   10857 C CE1  . TYR B 2 26 ? -4.507  -0.533  -9.365  1.00 0.00 ? 26 TYR B CE1  14 
ATOM   10858 C CE2  . TYR B 2 26 ? -6.779  0.214   -9.773  1.00 0.00 ? 26 TYR B CE2  14 
ATOM   10859 C CZ   . TYR B 2 26 ? -5.409  0.490   -9.682  1.00 0.00 ? 26 TYR B CZ   14 
ATOM   10860 O OH   . TYR B 2 26 ? -4.947  1.771   -9.906  1.00 0.00 ? 26 TYR B OH   14 
ATOM   10861 H H    . TYR B 2 26 ? -5.394  -5.920  -7.882  1.00 0.00 ? 26 TYR B H    14 
ATOM   10862 H HA   . TYR B 2 26 ? -5.369  -3.582  -7.433  1.00 0.00 ? 26 TYR B HA   14 
ATOM   10863 H HB2  . TYR B 2 26 ? -6.482  -4.170  -9.757  1.00 0.00 ? 26 TYR B HB2  14 
ATOM   10864 H HB3  . TYR B 2 26 ? -7.928  -3.514  -8.988  1.00 0.00 ? 26 TYR B HB3  14 
ATOM   10865 H HD1  . TYR B 2 26 ? -4.279  -2.624  -8.893  1.00 0.00 ? 26 TYR B HD1  14 
ATOM   10866 H HD2  . TYR B 2 26 ? -8.304  -1.301  -9.616  1.00 0.00 ? 26 TYR B HD2  14 
ATOM   10867 H HE1  . TYR B 2 26 ? -3.451  -0.320  -9.295  1.00 0.00 ? 26 TYR B HE1  14 
ATOM   10868 H HE2  . TYR B 2 26 ? -7.474  1.003   -10.018 1.00 0.00 ? 26 TYR B HE2  14 
ATOM   10869 H HH   . TYR B 2 26 ? -4.222  1.720   -10.533 1.00 0.00 ? 26 TYR B HH   14 
ATOM   10870 N N    . THR B 2 27 ? -6.801  -3.096  -5.409  1.00 0.00 ? 27 THR B N    14 
ATOM   10871 C CA   . THR B 2 27 ? -7.698  -2.615  -4.318  1.00 0.00 ? 27 THR B CA   14 
ATOM   10872 C C    . THR B 2 27 ? -8.164  -1.191  -4.633  1.00 0.00 ? 27 THR B C    14 
ATOM   10873 O O    . THR B 2 27 ? -7.379  -0.331  -4.979  1.00 0.00 ? 27 THR B O    14 
ATOM   10874 C CB   . THR B 2 27 ? -6.937  -2.616  -2.989  1.00 0.00 ? 27 THR B CB   14 
ATOM   10875 O OG1  . THR B 2 27 ? -6.257  -1.377  -2.835  1.00 0.00 ? 27 THR B OG1  14 
ATOM   10876 C CG2  . THR B 2 27 ? -5.924  -3.760  -2.977  1.00 0.00 ? 27 THR B CG2  14 
ATOM   10877 H H    . THR B 2 27 ? -5.828  -3.079  -5.288  1.00 0.00 ? 27 THR B H    14 
ATOM   10878 H HA   . THR B 2 27 ? -8.554  -3.267  -4.242  1.00 0.00 ? 27 THR B HA   14 
ATOM   10879 H HB   . THR B 2 27 ? -7.632  -2.748  -2.176  1.00 0.00 ? 27 THR B HB   14 
ATOM   10880 H HG1  . THR B 2 27 ? -5.790  -1.398  -1.996  1.00 0.00 ? 27 THR B HG1  14 
ATOM   10881 H HG21 . THR B 2 27 ? -6.271  -4.554  -3.624  1.00 0.00 ? 27 THR B HG21 14 
ATOM   10882 H HG22 . THR B 2 27 ? -5.817  -4.137  -1.970  1.00 0.00 ? 27 THR B HG22 14 
ATOM   10883 H HG23 . THR B 2 27 ? -4.969  -3.400  -3.330  1.00 0.00 ? 27 THR B HG23 14 
ATOM   10884 N N    . LYS B 2 28 ? -9.439  -0.937  -4.515  1.00 0.00 ? 28 LYS B N    14 
ATOM   10885 C CA   . LYS B 2 28 ? -9.960  0.428   -4.808  1.00 0.00 ? 28 LYS B CA   14 
ATOM   10886 C C    . LYS B 2 28 ? -11.279 0.638   -4.057  1.00 0.00 ? 28 LYS B C    14 
ATOM   10887 O O    . LYS B 2 28 ? -12.339 0.611   -4.649  1.00 0.00 ? 28 LYS B O    14 
ATOM   10888 C CB   . LYS B 2 28 ? -10.201 0.571   -6.312  1.00 0.00 ? 28 LYS B CB   14 
ATOM   10889 C CG   . LYS B 2 28 ? -10.498 2.035   -6.649  1.00 0.00 ? 28 LYS B CG   14 
ATOM   10890 C CD   . LYS B 2 28 ? -9.222  2.715   -7.153  1.00 0.00 ? 28 LYS B CD   14 
ATOM   10891 C CE   . LYS B 2 28 ? -9.592  3.959   -7.964  1.00 0.00 ? 28 LYS B CE   14 
ATOM   10892 N NZ   . LYS B 2 28 ? -9.159  5.182   -7.229  1.00 0.00 ? 28 LYS B NZ   14 
ATOM   10893 H H    . LYS B 2 28 ? -10.056 -1.646  -4.235  1.00 0.00 ? 28 LYS B H    14 
ATOM   10894 H HA   . LYS B 2 28 ? -9.239  1.166   -4.486  1.00 0.00 ? 28 LYS B HA   14 
ATOM   10895 H HB2  . LYS B 2 28 ? -9.321  0.248   -6.850  1.00 0.00 ? 28 LYS B HB2  14 
ATOM   10896 H HB3  . LYS B 2 28 ? -11.044 -0.039  -6.601  1.00 0.00 ? 28 LYS B HB3  14 
ATOM   10897 H HG2  . LYS B 2 28 ? -11.257 2.081   -7.416  1.00 0.00 ? 28 LYS B HG2  14 
ATOM   10898 H HG3  . LYS B 2 28 ? -10.849 2.543   -5.763  1.00 0.00 ? 28 LYS B HG3  14 
ATOM   10899 H HD2  . LYS B 2 28 ? -8.611  3.002   -6.310  1.00 0.00 ? 28 LYS B HD2  14 
ATOM   10900 H HD3  . LYS B 2 28 ? -8.673  2.029   -7.780  1.00 0.00 ? 28 LYS B HD3  14 
ATOM   10901 H HE2  . LYS B 2 28 ? -9.099  3.923   -8.924  1.00 0.00 ? 28 LYS B HE2  14 
ATOM   10902 H HE3  . LYS B 2 28 ? -10.662 3.988   -8.110  1.00 0.00 ? 28 LYS B HE3  14 
ATOM   10903 H HZ1  . LYS B 2 28 ? -9.883  5.921   -7.328  1.00 0.00 ? 28 LYS B HZ1  14 
ATOM   10904 H HZ2  . LYS B 2 28 ? -8.259  5.523   -7.626  1.00 0.00 ? 28 LYS B HZ2  14 
ATOM   10905 H HZ3  . LYS B 2 28 ? -9.032  4.956   -6.222  1.00 0.00 ? 28 LYS B HZ3  14 
ATOM   10906 N N    . PRO B 2 29 ? -11.170 0.840   -2.768  1.00 0.00 ? 29 PRO B N    14 
ATOM   10907 C CA   . PRO B 2 29 ? -12.338 1.057   -1.897  1.00 0.00 ? 29 PRO B CA   14 
ATOM   10908 C C    . PRO B 2 29 ? -12.865 2.486   -2.055  1.00 0.00 ? 29 PRO B C    14 
ATOM   10909 O O    . PRO B 2 29 ? -12.110 3.435   -2.107  1.00 0.00 ? 29 PRO B O    14 
ATOM   10910 C CB   . PRO B 2 29 ? -11.782 0.828   -0.489  1.00 0.00 ? 29 PRO B CB   14 
ATOM   10911 C CG   . PRO B 2 29 ? -10.254 1.052   -0.581  1.00 0.00 ? 29 PRO B CG   14 
ATOM   10912 C CD   . PRO B 2 29 ? -9.873  0.872   -2.062  1.00 0.00 ? 29 PRO B CD   14 
ATOM   10913 H HA   . PRO B 2 29 ? -13.112 0.339   -2.109  1.00 0.00 ? 29 PRO B HA   14 
ATOM   10914 H HB2  . PRO B 2 29 ? -12.223 1.535   0.203   1.00 0.00 ? 29 PRO B HB2  14 
ATOM   10915 H HB3  . PRO B 2 29 ? -11.983 -0.182  -0.169  1.00 0.00 ? 29 PRO B HB3  14 
ATOM   10916 H HG2  . PRO B 2 29 ? -10.006 2.051   -0.250  1.00 0.00 ? 29 PRO B HG2  14 
ATOM   10917 H HG3  . PRO B 2 29 ? -9.735  0.321   0.020   1.00 0.00 ? 29 PRO B HG3  14 
ATOM   10918 H HD2  . PRO B 2 29 ? -9.273  1.705   -2.402  1.00 0.00 ? 29 PRO B HD2  14 
ATOM   10919 H HD3  . PRO B 2 29 ? -9.347  -0.059  -2.208  1.00 0.00 ? 29 PRO B HD3  14 
ATOM   10920 N N    . THR B 2 30 ? -14.159 2.644   -2.129  1.00 0.00 ? 30 THR B N    14 
ATOM   10921 C CA   . THR B 2 30 ? -14.738 4.008   -2.284  1.00 0.00 ? 30 THR B CA   14 
ATOM   10922 C C    . THR B 2 30 ? -14.223 4.911   -1.161  1.00 0.00 ? 30 THR B C    14 
ATOM   10923 O O    . THR B 2 30 ? -13.727 4.380   -0.180  1.00 0.00 ? 30 THR B O    14 
ATOM   10924 C CB   . THR B 2 30 ? -16.264 3.923   -2.210  1.00 0.00 ? 30 THR B CB   14 
ATOM   10925 O OG1  . THR B 2 30 ? -16.808 5.233   -2.170  1.00 0.00 ? 30 THR B OG1  14 
ATOM   10926 C CG2  . THR B 2 30 ? -16.671 3.158   -0.950  1.00 0.00 ? 30 THR B CG2  14 
ATOM   10927 O OXT  . THR B 2 30 ? -14.335 6.118   -1.299  1.00 0.00 ? 30 THR B OXT  14 
ATOM   10928 H H    . THR B 2 30 ? -14.750 1.864   -2.085  1.00 0.00 ? 30 THR B H    14 
ATOM   10929 H HA   . THR B 2 30 ? -14.445 4.419   -3.239  1.00 0.00 ? 30 THR B HA   14 
ATOM   10930 H HB   . THR B 2 30 ? -16.638 3.402   -3.078  1.00 0.00 ? 30 THR B HB   14 
ATOM   10931 H HG1  . THR B 2 30 ? -16.858 5.562   -3.070  1.00 0.00 ? 30 THR B HG1  14 
ATOM   10932 H HG21 . THR B 2 30 ? -16.248 3.643   -0.082  1.00 0.00 ? 30 THR B HG21 14 
ATOM   10933 H HG22 . THR B 2 30 ? -16.305 2.144   -1.010  1.00 0.00 ? 30 THR B HG22 14 
ATOM   10934 H HG23 . THR B 2 30 ? -17.747 3.148   -0.867  1.00 0.00 ? 30 THR B HG23 14 
ATOM   10935 N N    . GLY A 1 1  ? -7.928  2.718   -1.980  1.00 0.00 ? 1  GLY A N    15 
ATOM   10936 C CA   . GLY A 1 1  ? -6.866  2.846   -0.887  1.00 0.00 ? 1  GLY A CA   15 
ATOM   10937 C C    . GLY A 1 1  ? -5.424  2.843   -1.264  1.00 0.00 ? 1  GLY A C    15 
ATOM   10938 O O    . GLY A 1 1  ? -4.601  3.460   -0.617  1.00 0.00 ? 1  GLY A O    15 
ATOM   10939 H H1   . GLY A 1 1  ? -8.180  3.665   -2.331  1.00 0.00 ? 1  GLY A H1   15 
ATOM   10940 H H2   . GLY A 1 1  ? -8.774  2.257   -1.587  1.00 0.00 ? 1  GLY A H2   15 
ATOM   10941 H H3   . GLY A 1 1  ? -7.554  2.147   -2.763  1.00 0.00 ? 1  GLY A H3   15 
ATOM   10942 H HA2  . GLY A 1 1  ? -6.697  3.780   -0.665  1.00 0.00 ? 1  GLY A HA2  15 
ATOM   10943 H HA3  . GLY A 1 1  ? -7.240  2.219   0.025   1.00 0.00 ? 1  GLY A HA3  15 
HETATM 10944 N N    . IIL A 1 2  ? -5.078  2.153   -2.316  1.00 0.00 ? 2  IIL A N    15 
HETATM 10945 C CA   . IIL A 1 2  ? -3.652  2.109   -2.747  1.00 0.00 ? 2  IIL A CA   15 
HETATM 10946 C C    . IIL A 1 2  ? -3.487  2.918   -4.036  1.00 0.00 ? 2  IIL A C    15 
HETATM 10947 O O    . IIL A 1 2  ? -2.470  3.544   -4.262  1.00 0.00 ? 2  IIL A O    15 
HETATM 10948 C CB   . IIL A 1 2  ? -3.248  0.653   -2.995  1.00 0.00 ? 2  IIL A CB   15 
HETATM 10949 C CG2  . IIL A 1 2  ? -1.918  0.610   -3.749  1.00 0.00 ? 2  IIL A CG2  15 
HETATM 10950 C CG1  . IIL A 1 2  ? -4.332  -0.037  -3.826  1.00 0.00 ? 2  IIL A CG1  15 
HETATM 10951 C CD1  . IIL A 1 2  ? -3.813  -1.383  -4.331  1.00 0.00 ? 2  IIL A CD1  15 
HETATM 10952 H H    . IIL A 1 2  ? -5.756  1.662   -2.823  1.00 0.00 ? 2  IIL A H    15 
HETATM 10953 H HA   . IIL A 1 2  ? -3.027  2.530   -1.973  1.00 0.00 ? 2  IIL A HA   15 
HETATM 10954 H HB   . IIL A 1 2  ? -3.140  0.141   -2.049  1.00 0.00 ? 2  IIL A HB   15 
HETATM 10955 H HG21 . IIL A 1 2  ? -2.067  0.955   -4.763  1.00 0.00 ? 2  IIL A HG21 15 
HETATM 10956 H HG22 . IIL A 1 2  ? -1.545  -0.404  -3.765  1.00 0.00 ? 2  IIL A HG22 15 
HETATM 10957 H HG23 . IIL A 1 2  ? -1.202  1.249   -3.253  1.00 0.00 ? 2  IIL A HG23 15 
HETATM 10958 H HG12 . IIL A 1 2  ? -4.591  0.586   -4.669  1.00 0.00 ? 2  IIL A HG12 15 
HETATM 10959 H HG13 . IIL A 1 2  ? -5.208  -0.195  -3.213  1.00 0.00 ? 2  IIL A HG13 15 
HETATM 10960 H HD11 . IIL A 1 2  ? -4.587  -1.878  -4.899  1.00 0.00 ? 2  IIL A HD11 15 
HETATM 10961 H HD12 . IIL A 1 2  ? -3.534  -2.000  -3.489  1.00 0.00 ? 2  IIL A HD12 15 
HETATM 10962 H HD13 . IIL A 1 2  ? -2.950  -1.222  -4.960  1.00 0.00 ? 2  IIL A HD13 15 
ATOM   10963 N N    . VAL A 1 3  ? -4.479  2.911   -4.884  1.00 0.00 ? 3  VAL A N    15 
ATOM   10964 C CA   . VAL A 1 3  ? -4.379  3.680   -6.156  1.00 0.00 ? 3  VAL A CA   15 
ATOM   10965 C C    . VAL A 1 3  ? -4.318  5.176   -5.845  1.00 0.00 ? 3  VAL A C    15 
ATOM   10966 O O    . VAL A 1 3  ? -3.553  5.911   -6.436  1.00 0.00 ? 3  VAL A O    15 
ATOM   10967 C CB   . VAL A 1 3  ? -5.607  3.396   -7.022  1.00 0.00 ? 3  VAL A CB   15 
ATOM   10968 C CG1  . VAL A 1 3  ? -5.429  4.059   -8.389  1.00 0.00 ? 3  VAL A CG1  15 
ATOM   10969 C CG2  . VAL A 1 3  ? -5.768  1.886   -7.206  1.00 0.00 ? 3  VAL A CG2  15 
ATOM   10970 H H    . VAL A 1 3  ? -5.291  2.399   -4.683  1.00 0.00 ? 3  VAL A H    15 
ATOM   10971 H HA   . VAL A 1 3  ? -3.487  3.384   -6.688  1.00 0.00 ? 3  VAL A HA   15 
ATOM   10972 H HB   . VAL A 1 3  ? -6.487  3.799   -6.541  1.00 0.00 ? 3  VAL A HB   15 
ATOM   10973 H HG11 . VAL A 1 3  ? -6.031  3.542   -9.121  1.00 0.00 ? 3  VAL A HG11 15 
ATOM   10974 H HG12 . VAL A 1 3  ? -4.389  4.011   -8.679  1.00 0.00 ? 3  VAL A HG12 15 
ATOM   10975 H HG13 . VAL A 1 3  ? -5.739  5.091   -8.331  1.00 0.00 ? 3  VAL A HG13 15 
ATOM   10976 H HG21 . VAL A 1 3  ? -6.664  1.686   -7.774  1.00 0.00 ? 3  VAL A HG21 15 
ATOM   10977 H HG22 . VAL A 1 3  ? -5.839  1.411   -6.238  1.00 0.00 ? 3  VAL A HG22 15 
ATOM   10978 H HG23 . VAL A 1 3  ? -4.911  1.496   -7.736  1.00 0.00 ? 3  VAL A HG23 15 
ATOM   10979 N N    . GLU A 1 4  ? -5.122  5.636   -4.925  1.00 0.00 ? 4  GLU A N    15 
ATOM   10980 C CA   . GLU A 1 4  ? -5.112  7.086   -4.584  1.00 0.00 ? 4  GLU A CA   15 
ATOM   10981 C C    . GLU A 1 4  ? -3.845  7.422   -3.793  1.00 0.00 ? 4  GLU A C    15 
ATOM   10982 O O    . GLU A 1 4  ? -3.606  8.562   -3.449  1.00 0.00 ? 4  GLU A O    15 
ATOM   10983 C CB   . GLU A 1 4  ? -6.345  7.422   -3.742  1.00 0.00 ? 4  GLU A CB   15 
ATOM   10984 C CG   . GLU A 1 4  ? -7.611  7.064   -4.523  1.00 0.00 ? 4  GLU A CG   15 
ATOM   10985 C CD   . GLU A 1 4  ? -8.679  8.132   -4.281  1.00 0.00 ? 4  GLU A CD   15 
ATOM   10986 O OE1  . GLU A 1 4  ? -8.309  9.258   -3.989  1.00 0.00 ? 4  GLU A OE1  15 
ATOM   10987 O OE2  . GLU A 1 4  ? -9.850  7.808   -4.392  1.00 0.00 ? 4  GLU A OE2  15 
ATOM   10988 H H    . GLU A 1 4  ? -5.735  5.027   -4.462  1.00 0.00 ? 4  GLU A H    15 
ATOM   10989 H HA   . GLU A 1 4  ? -5.132  7.667   -5.494  1.00 0.00 ? 4  GLU A HA   15 
ATOM   10990 H HB2  . GLU A 1 4  ? -6.317  6.858   -2.820  1.00 0.00 ? 4  GLU A HB2  15 
ATOM   10991 H HB3  . GLU A 1 4  ? -6.350  8.478   -3.516  1.00 0.00 ? 4  GLU A HB3  15 
ATOM   10992 H HG2  . GLU A 1 4  ? -7.382  7.014   -5.577  1.00 0.00 ? 4  GLU A HG2  15 
ATOM   10993 H HG3  . GLU A 1 4  ? -7.982  6.107   -4.189  1.00 0.00 ? 4  GLU A HG3  15 
ATOM   10994 N N    . GLN A 1 5  ? -3.031  6.443   -3.502  1.00 0.00 ? 5  GLN A N    15 
ATOM   10995 C CA   . GLN A 1 5  ? -1.784  6.725   -2.735  1.00 0.00 ? 5  GLN A CA   15 
ATOM   10996 C C    . GLN A 1 5  ? -0.580  6.728   -3.684  1.00 0.00 ? 5  GLN A C    15 
ATOM   10997 O O    . GLN A 1 5  ? 0.264   7.601   -3.616  1.00 0.00 ? 5  GLN A O    15 
ATOM   10998 C CB   . GLN A 1 5  ? -1.590  5.660   -1.650  1.00 0.00 ? 5  GLN A CB   15 
ATOM   10999 C CG   . GLN A 1 5  ? -2.300  6.101   -0.369  1.00 0.00 ? 5  GLN A CG   15 
ATOM   11000 C CD   . GLN A 1 5  ? -1.270  6.654   0.617   1.00 0.00 ? 5  GLN A CD   15 
ATOM   11001 O OE1  . GLN A 1 5  ? -0.358  5.957   1.014   1.00 0.00 ? 5  GLN A OE1  15 
ATOM   11002 N NE2  . GLN A 1 5  ? -1.377  7.887   1.032   1.00 0.00 ? 5  GLN A NE2  15 
ATOM   11003 H H    . GLN A 1 5  ? -3.237  5.529   -3.787  1.00 0.00 ? 5  GLN A H    15 
ATOM   11004 H HA   . GLN A 1 5  ? -1.869  7.696   -2.268  1.00 0.00 ? 5  GLN A HA   15 
ATOM   11005 H HB2  . GLN A 1 5  ? -2.002  4.720   -1.985  1.00 0.00 ? 5  GLN A HB2  15 
ATOM   11006 H HB3  . GLN A 1 5  ? -0.536  5.539   -1.448  1.00 0.00 ? 5  GLN A HB3  15 
ATOM   11007 H HG2  . GLN A 1 5  ? -3.025  6.867   -0.604  1.00 0.00 ? 5  GLN A HG2  15 
ATOM   11008 H HG3  . GLN A 1 5  ? -2.801  5.253   0.073   1.00 0.00 ? 5  GLN A HG3  15 
ATOM   11009 H HE21 . GLN A 1 5  ? -2.112  8.450   0.712   1.00 0.00 ? 5  GLN A HE21 15 
ATOM   11010 H HE22 . GLN A 1 5  ? -0.722  8.249   1.664   1.00 0.00 ? 5  GLN A HE22 15 
ATOM   11011 N N    . CYS A 1 6  ? -0.491  5.774   -4.578  1.00 0.00 ? 6  CYS A N    15 
ATOM   11012 C CA   . CYS A 1 6  ? 0.665   5.762   -5.518  1.00 0.00 ? 6  CYS A CA   15 
ATOM   11013 C C    . CYS A 1 6  ? 0.310   6.584   -6.755  1.00 0.00 ? 6  CYS A C    15 
ATOM   11014 O O    . CYS A 1 6  ? 1.164   6.931   -7.550  1.00 0.00 ? 6  CYS A O    15 
ATOM   11015 C CB   . CYS A 1 6  ? 1.007   4.325   -5.932  1.00 0.00 ? 6  CYS A CB   15 
ATOM   11016 S SG   . CYS A 1 6  ? 1.238   3.294   -4.458  1.00 0.00 ? 6  CYS A SG   15 
ATOM   11017 H H    . CYS A 1 6  ? -1.181  5.080   -4.635  1.00 0.00 ? 6  CYS A H    15 
ATOM   11018 H HA   . CYS A 1 6  ? 1.515   6.210   -5.034  1.00 0.00 ? 6  CYS A HA   15 
ATOM   11019 H HB2  . CYS A 1 6  ? 0.206   3.923   -6.531  1.00 0.00 ? 6  CYS A HB2  15 
ATOM   11020 H HB3  . CYS A 1 6  ? 1.918   4.329   -6.513  1.00 0.00 ? 6  CYS A HB3  15 
ATOM   11021 N N    . CYS A 1 7  ? -0.941  6.916   -6.913  1.00 0.00 ? 7  CYS A N    15 
ATOM   11022 C CA   . CYS A 1 7  ? -1.348  7.733   -8.085  1.00 0.00 ? 7  CYS A CA   15 
ATOM   11023 C C    . CYS A 1 7  ? -1.443  9.195   -7.644  1.00 0.00 ? 7  CYS A C    15 
ATOM   11024 O O    . CYS A 1 7  ? -1.524  10.098  -8.454  1.00 0.00 ? 7  CYS A O    15 
ATOM   11025 C CB   . CYS A 1 7  ? -2.704  7.244   -8.608  1.00 0.00 ? 7  CYS A CB   15 
ATOM   11026 S SG   . CYS A 1 7  ? -3.128  8.098   -10.150 1.00 0.00 ? 7  CYS A SG   15 
ATOM   11027 H H    . CYS A 1 7  ? -1.610  6.636   -6.255  1.00 0.00 ? 7  CYS A H    15 
ATOM   11028 H HA   . CYS A 1 7  ? -0.601  7.641   -8.855  1.00 0.00 ? 7  CYS A HA   15 
ATOM   11029 H HB2  . CYS A 1 7  ? -2.654  6.181   -8.792  1.00 0.00 ? 7  CYS A HB2  15 
ATOM   11030 H HB3  . CYS A 1 7  ? -3.463  7.443   -7.870  1.00 0.00 ? 7  CYS A HB3  15 
ATOM   11031 N N    . THR A 1 8  ? -1.409  9.434   -6.358  1.00 0.00 ? 8  THR A N    15 
ATOM   11032 C CA   . THR A 1 8  ? -1.469  10.831  -5.853  1.00 0.00 ? 8  THR A CA   15 
ATOM   11033 C C    . THR A 1 8  ? -0.036  11.324  -5.639  1.00 0.00 ? 8  THR A C    15 
ATOM   11034 O O    . THR A 1 8  ? 0.269   12.488  -5.809  1.00 0.00 ? 8  THR A O    15 
ATOM   11035 C CB   . THR A 1 8  ? -2.235  10.866  -4.526  1.00 0.00 ? 8  THR A CB   15 
ATOM   11036 O OG1  . THR A 1 8  ? -2.576  12.209  -4.214  1.00 0.00 ? 8  THR A OG1  15 
ATOM   11037 C CG2  . THR A 1 8  ? -1.360  10.285  -3.412  1.00 0.00 ? 8  THR A CG2  15 
ATOM   11038 H H    . THR A 1 8  ? -1.326  8.692   -5.726  1.00 0.00 ? 8  THR A H    15 
ATOM   11039 H HA   . THR A 1 8  ? -1.965  11.459  -6.578  1.00 0.00 ? 8  THR A HA   15 
ATOM   11040 H HB   . THR A 1 8  ? -3.134  10.276  -4.615  1.00 0.00 ? 8  THR A HB   15 
ATOM   11041 H HG1  . THR A 1 8  ? -3.218  12.510  -4.863  1.00 0.00 ? 8  THR A HG1  15 
ATOM   11042 H HG21 . THR A 1 8  ? -0.765  9.475   -3.808  1.00 0.00 ? 8  THR A HG21 15 
ATOM   11043 H HG22 . THR A 1 8  ? -1.989  9.915   -2.616  1.00 0.00 ? 8  THR A HG22 15 
ATOM   11044 H HG23 . THR A 1 8  ? -0.708  11.055  -3.028  1.00 0.00 ? 8  THR A HG23 15 
ATOM   11045 N N    . SER A 1 9  ? 0.848   10.431  -5.275  1.00 0.00 ? 9  SER A N    15 
ATOM   11046 C CA   . SER A 1 9  ? 2.270   10.820  -5.058  1.00 0.00 ? 9  SER A CA   15 
ATOM   11047 C C    . SER A 1 9  ? 3.169   9.853   -5.831  1.00 0.00 ? 9  SER A C    15 
ATOM   11048 O O    . SER A 1 9  ? 2.756   9.254   -6.804  1.00 0.00 ? 9  SER A O    15 
ATOM   11049 C CB   . SER A 1 9  ? 2.603   10.748  -3.567  1.00 0.00 ? 9  SER A CB   15 
ATOM   11050 O OG   . SER A 1 9  ? 1.582   11.399  -2.825  1.00 0.00 ? 9  SER A OG   15 
ATOM   11051 H H    . SER A 1 9  ? 0.575   9.498   -5.154  1.00 0.00 ? 9  SER A H    15 
ATOM   11052 H HA   . SER A 1 9  ? 2.429   11.827  -5.418  1.00 0.00 ? 9  SER A HA   15 
ATOM   11053 H HB2  . SER A 1 9  ? 2.664   9.718   -3.258  1.00 0.00 ? 9  SER A HB2  15 
ATOM   11054 H HB3  . SER A 1 9  ? 3.556   11.231  -3.388  1.00 0.00 ? 9  SER A HB3  15 
ATOM   11055 H HG   . SER A 1 9  ? 1.533   12.311  -3.123  1.00 0.00 ? 9  SER A HG   15 
ATOM   11056 N N    . ILE A 1 10 ? 4.393   9.690   -5.410  1.00 0.00 ? 10 ILE A N    15 
ATOM   11057 C CA   . ILE A 1 10 ? 5.304   8.756   -6.131  1.00 0.00 ? 10 ILE A CA   15 
ATOM   11058 C C    . ILE A 1 10 ? 5.035   7.328   -5.663  1.00 0.00 ? 10 ILE A C    15 
ATOM   11059 O O    . ILE A 1 10 ? 4.743   6.449   -6.451  1.00 0.00 ? 10 ILE A O    15 
ATOM   11060 C CB   . ILE A 1 10 ? 6.760   9.137   -5.843  1.00 0.00 ? 10 ILE A CB   15 
ATOM   11061 C CG1  . ILE A 1 10 ? 7.115   10.411  -6.634  1.00 0.00 ? 10 ILE A CG1  15 
ATOM   11062 C CG2  . ILE A 1 10 ? 7.688   7.979   -6.239  1.00 0.00 ? 10 ILE A CG2  15 
ATOM   11063 C CD1  . ILE A 1 10 ? 7.743   10.054  -7.985  1.00 0.00 ? 10 ILE A CD1  15 
ATOM   11064 H H    . ILE A 1 10 ? 4.712   10.179  -4.623  1.00 0.00 ? 10 ILE A H    15 
ATOM   11065 H HA   . ILE A 1 10 ? 5.115   8.821   -7.185  1.00 0.00 ? 10 ILE A HA   15 
ATOM   11066 H HB   . ILE A 1 10 ? 6.871   9.332   -4.786  1.00 0.00 ? 10 ILE A HB   15 
ATOM   11067 H HG12 . ILE A 1 10 ? 6.217   10.987  -6.802  1.00 0.00 ? 10 ILE A HG12 15 
ATOM   11068 H HG13 . ILE A 1 10 ? 7.815   11.001  -6.062  1.00 0.00 ? 10 ILE A HG13 15 
ATOM   11069 H HG21 . ILE A 1 10 ? 7.583   7.174   -5.527  1.00 0.00 ? 10 ILE A HG21 15 
ATOM   11070 H HG22 . ILE A 1 10 ? 8.711   8.324   -6.244  1.00 0.00 ? 10 ILE A HG22 15 
ATOM   11071 H HG23 . ILE A 1 10 ? 7.423   7.626   -7.224  1.00 0.00 ? 10 ILE A HG23 15 
ATOM   11072 H HD11 . ILE A 1 10 ? 8.808   9.928   -7.861  1.00 0.00 ? 10 ILE A HD11 15 
ATOM   11073 H HD12 . ILE A 1 10 ? 7.556   10.850  -8.691  1.00 0.00 ? 10 ILE A HD12 15 
ATOM   11074 H HD13 . ILE A 1 10 ? 7.311   9.135   -8.353  1.00 0.00 ? 10 ILE A HD13 15 
ATOM   11075 N N    . CYS A 1 11 ? 5.127   7.093   -4.389  1.00 0.00 ? 11 CYS A N    15 
ATOM   11076 C CA   . CYS A 1 11 ? 4.868   5.721   -3.863  1.00 0.00 ? 11 CYS A CA   15 
ATOM   11077 C C    . CYS A 1 11 ? 5.872   4.744   -4.477  1.00 0.00 ? 11 CYS A C    15 
ATOM   11078 O O    . CYS A 1 11 ? 6.350   4.940   -5.577  1.00 0.00 ? 11 CYS A O    15 
ATOM   11079 C CB   . CYS A 1 11 ? 3.443   5.322   -4.238  1.00 0.00 ? 11 CYS A CB   15 
ATOM   11080 S SG   . CYS A 1 11 ? 3.183   3.555   -3.969  1.00 0.00 ? 11 CYS A SG   15 
ATOM   11081 H H    . CYS A 1 11 ? 5.359   7.821   -3.780  1.00 0.00 ? 11 CYS A H    15 
ATOM   11082 H HA   . CYS A 1 11 ? 4.972   5.721   -2.789  1.00 0.00 ? 11 CYS A HA   15 
ATOM   11083 H HB2  . CYS A 1 11 ? 2.746   5.878   -3.629  1.00 0.00 ? 11 CYS A HB2  15 
ATOM   11084 H HB3  . CYS A 1 11 ? 3.269   5.554   -5.278  1.00 0.00 ? 11 CYS A HB3  15 
ATOM   11085 N N    . SER A 1 12 ? 6.208   3.697   -3.772  1.00 0.00 ? 12 SER A N    15 
ATOM   11086 C CA   . SER A 1 12 ? 7.194   2.723   -4.318  1.00 0.00 ? 12 SER A CA   15 
ATOM   11087 C C    . SER A 1 12 ? 6.606   1.309   -4.308  1.00 0.00 ? 12 SER A C    15 
ATOM   11088 O O    . SER A 1 12 ? 5.645   1.021   -3.617  1.00 0.00 ? 12 SER A O    15 
ATOM   11089 C CB   . SER A 1 12 ? 8.458   2.749   -3.459  1.00 0.00 ? 12 SER A CB   15 
ATOM   11090 O OG   . SER A 1 12 ? 8.109   3.086   -2.123  1.00 0.00 ? 12 SER A OG   15 
ATOM   11091 H H    . SER A 1 12 ? 5.821   3.558   -2.882  1.00 0.00 ? 12 SER A H    15 
ATOM   11092 H HA   . SER A 1 12 ? 7.447   2.997   -5.332  1.00 0.00 ? 12 SER A HA   15 
ATOM   11093 H HB2  . SER A 1 12 ? 8.924   1.778   -3.471  1.00 0.00 ? 12 SER A HB2  15 
ATOM   11094 H HB3  . SER A 1 12 ? 9.148   3.482   -3.857  1.00 0.00 ? 12 SER A HB3  15 
ATOM   11095 H HG   . SER A 1 12 ? 8.820   2.796   -1.548  1.00 0.00 ? 12 SER A HG   15 
ATOM   11096 N N    . LEU A 1 13 ? 7.184   0.422   -5.072  1.00 0.00 ? 13 LEU A N    15 
ATOM   11097 C CA   . LEU A 1 13 ? 6.673   -0.974  -5.113  1.00 0.00 ? 13 LEU A CA   15 
ATOM   11098 C C    . LEU A 1 13 ? 6.810   -1.607  -3.727  1.00 0.00 ? 13 LEU A C    15 
ATOM   11099 O O    . LEU A 1 13 ? 6.249   -2.649  -3.451  1.00 0.00 ? 13 LEU A O    15 
ATOM   11100 C CB   . LEU A 1 13 ? 7.469   -1.780  -6.141  1.00 0.00 ? 13 LEU A CB   15 
ATOM   11101 C CG   . LEU A 1 13 ? 8.894   -2.012  -5.640  1.00 0.00 ? 13 LEU A CG   15 
ATOM   11102 C CD1  . LEU A 1 13 ? 9.355   -3.398  -6.082  1.00 0.00 ? 13 LEU A CD1  15 
ATOM   11103 C CD2  . LEU A 1 13 ? 9.822   -0.953  -6.237  1.00 0.00 ? 13 LEU A CD2  15 
ATOM   11104 H H    . LEU A 1 13 ? 7.959   0.674   -5.616  1.00 0.00 ? 13 LEU A H    15 
ATOM   11105 H HA   . LEU A 1 13 ? 5.634   -0.964  -5.401  1.00 0.00 ? 13 LEU A HA   15 
ATOM   11106 H HB2  . LEU A 1 13 ? 6.986   -2.732  -6.300  1.00 0.00 ? 13 LEU A HB2  15 
ATOM   11107 H HB3  . LEU A 1 13 ? 7.503   -1.236  -7.073  1.00 0.00 ? 13 LEU A HB3  15 
ATOM   11108 H HG   . LEU A 1 13 ? 8.919   -1.951  -4.563  1.00 0.00 ? 13 LEU A HG   15 
ATOM   11109 H HD11 . LEU A 1 13 ? 10.423  -3.479  -5.954  1.00 0.00 ? 13 LEU A HD11 15 
ATOM   11110 H HD12 . LEU A 1 13 ? 9.102   -3.545  -7.121  1.00 0.00 ? 13 LEU A HD12 15 
ATOM   11111 H HD13 . LEU A 1 13 ? 8.861   -4.148  -5.482  1.00 0.00 ? 13 LEU A HD13 15 
ATOM   11112 H HD21 . LEU A 1 13 ? 9.712   -0.029  -5.688  1.00 0.00 ? 13 LEU A HD21 15 
ATOM   11113 H HD22 . LEU A 1 13 ? 9.564   -0.790  -7.272  1.00 0.00 ? 13 LEU A HD22 15 
ATOM   11114 H HD23 . LEU A 1 13 ? 10.845  -1.292  -6.169  1.00 0.00 ? 13 LEU A HD23 15 
ATOM   11115 N N    . TYR A 1 14 ? 7.544   -0.977  -2.845  1.00 0.00 ? 14 TYR A N    15 
ATOM   11116 C CA   . TYR A 1 14 ? 7.703   -1.537  -1.477  1.00 0.00 ? 14 TYR A CA   15 
ATOM   11117 C C    . TYR A 1 14 ? 6.335   -1.563  -0.816  1.00 0.00 ? 14 TYR A C    15 
ATOM   11118 O O    . TYR A 1 14 ? 5.940   -2.531  -0.197  1.00 0.00 ? 14 TYR A O    15 
ATOM   11119 C CB   . TYR A 1 14 ? 8.652   -0.652  -0.663  1.00 0.00 ? 14 TYR A CB   15 
ATOM   11120 C CG   . TYR A 1 14 ? 9.841   -1.470  -0.206  1.00 0.00 ? 14 TYR A CG   15 
ATOM   11121 C CD1  . TYR A 1 14 ? 10.967  -1.598  -1.033  1.00 0.00 ? 14 TYR A CD1  15 
ATOM   11122 C CD2  . TYR A 1 14 ? 9.819   -2.106  1.045   1.00 0.00 ? 14 TYR A CD2  15 
ATOM   11123 C CE1  . TYR A 1 14 ? 12.065  -2.357  -0.610  1.00 0.00 ? 14 TYR A CE1  15 
ATOM   11124 C CE2  . TYR A 1 14 ? 10.918  -2.865  1.466   1.00 0.00 ? 14 TYR A CE2  15 
ATOM   11125 C CZ   . TYR A 1 14 ? 12.041  -2.990  0.639   1.00 0.00 ? 14 TYR A CZ   15 
ATOM   11126 O OH   . TYR A 1 14 ? 13.124  -3.738  1.054   1.00 0.00 ? 14 TYR A OH   15 
ATOM   11127 H H    . TYR A 1 14 ? 7.977   -0.133  -3.080  1.00 0.00 ? 14 TYR A H    15 
ATOM   11128 H HA   . TYR A 1 14 ? 8.094   -2.536  -1.536  1.00 0.00 ? 14 TYR A HA   15 
ATOM   11129 H HB2  . TYR A 1 14 ? 8.992   0.171   -1.279  1.00 0.00 ? 14 TYR A HB2  15 
ATOM   11130 H HB3  . TYR A 1 14 ? 8.129   -0.260  0.198   1.00 0.00 ? 14 TYR A HB3  15 
ATOM   11131 H HD1  . TYR A 1 14 ? 10.988  -1.112  -1.995  1.00 0.00 ? 14 TYR A HD1  15 
ATOM   11132 H HD2  . TYR A 1 14 ? 8.954   -2.011  1.685   1.00 0.00 ? 14 TYR A HD2  15 
ATOM   11133 H HE1  . TYR A 1 14 ? 12.932  -2.454  -1.248  1.00 0.00 ? 14 TYR A HE1  15 
ATOM   11134 H HE2  . TYR A 1 14 ? 10.900  -3.353  2.429   1.00 0.00 ? 14 TYR A HE2  15 
ATOM   11135 H HH   . TYR A 1 14 ? 13.574  -4.067  0.273   1.00 0.00 ? 14 TYR A HH   15 
ATOM   11136 N N    . GLN A 1 15 ? 5.601   -0.502  -0.966  1.00 0.00 ? 15 GLN A N    15 
ATOM   11137 C CA   . GLN A 1 15 ? 4.242   -0.449  -0.375  1.00 0.00 ? 15 GLN A CA   15 
ATOM   11138 C C    . GLN A 1 15 ? 3.301   -1.262  -1.259  1.00 0.00 ? 15 GLN A C    15 
ATOM   11139 O O    . GLN A 1 15 ? 2.231   -1.666  -0.847  1.00 0.00 ? 15 GLN A O    15 
ATOM   11140 C CB   . GLN A 1 15 ? 3.761   1.003   -0.307  1.00 0.00 ? 15 GLN A CB   15 
ATOM   11141 C CG   . GLN A 1 15 ? 4.663   1.800   0.640   1.00 0.00 ? 15 GLN A CG   15 
ATOM   11142 C CD   . GLN A 1 15 ? 3.851   2.916   1.300   1.00 0.00 ? 15 GLN A CD   15 
ATOM   11143 O OE1  . GLN A 1 15 ? 2.698   3.119   0.975   1.00 0.00 ? 15 GLN A OE1  15 
ATOM   11144 N NE2  . GLN A 1 15 ? 4.408   3.654   2.221   1.00 0.00 ? 15 GLN A NE2  15 
ATOM   11145 H H    . GLN A 1 15 ? 5.943   0.252   -1.485  1.00 0.00 ? 15 GLN A H    15 
ATOM   11146 H HA   . GLN A 1 15 ? 4.267   -0.872  0.616   1.00 0.00 ? 15 GLN A HA   15 
ATOM   11147 H HB2  . GLN A 1 15 ? 3.799   1.441   -1.294  1.00 0.00 ? 15 GLN A HB2  15 
ATOM   11148 H HB3  . GLN A 1 15 ? 2.746   1.030   0.061   1.00 0.00 ? 15 GLN A HB3  15 
ATOM   11149 H HG2  . GLN A 1 15 ? 5.056   1.141   1.401   1.00 0.00 ? 15 GLN A HG2  15 
ATOM   11150 H HG3  . GLN A 1 15 ? 5.479   2.232   0.080   1.00 0.00 ? 15 GLN A HG3  15 
ATOM   11151 H HE21 . GLN A 1 15 ? 5.338   3.492   2.484   1.00 0.00 ? 15 GLN A HE21 15 
ATOM   11152 H HE22 . GLN A 1 15 ? 3.895   4.372   2.650   1.00 0.00 ? 15 GLN A HE22 15 
ATOM   11153 N N    . LEU A 1 16 ? 3.702   -1.514  -2.477  1.00 0.00 ? 16 LEU A N    15 
ATOM   11154 C CA   . LEU A 1 16 ? 2.852   -2.309  -3.397  1.00 0.00 ? 16 LEU A CA   15 
ATOM   11155 C C    . LEU A 1 16 ? 2.837   -3.767  -2.936  1.00 0.00 ? 16 LEU A C    15 
ATOM   11156 O O    . LEU A 1 16 ? 1.961   -4.532  -3.286  1.00 0.00 ? 16 LEU A O    15 
ATOM   11157 C CB   . LEU A 1 16 ? 3.443   -2.229  -4.802  1.00 0.00 ? 16 LEU A CB   15 
ATOM   11158 C CG   . LEU A 1 16 ? 2.929   -0.973  -5.508  1.00 0.00 ? 16 LEU A CG   15 
ATOM   11159 C CD1  . LEU A 1 16 ? 3.648   -0.814  -6.849  1.00 0.00 ? 16 LEU A CD1  15 
ATOM   11160 C CD2  . LEU A 1 16 ? 1.425   -1.105  -5.751  1.00 0.00 ? 16 LEU A CD2  15 
ATOM   11161 H H    . LEU A 1 16 ? 4.570   -1.187  -2.785  1.00 0.00 ? 16 LEU A H    15 
ATOM   11162 H HA   . LEU A 1 16 ? 1.849   -1.916  -3.400  1.00 0.00 ? 16 LEU A HA   15 
ATOM   11163 H HB2  . LEU A 1 16 ? 4.518   -2.192  -4.731  1.00 0.00 ? 16 LEU A HB2  15 
ATOM   11164 H HB3  . LEU A 1 16 ? 3.156   -3.097  -5.362  1.00 0.00 ? 16 LEU A HB3  15 
ATOM   11165 H HG   . LEU A 1 16 ? 3.124   -0.108  -4.891  1.00 0.00 ? 16 LEU A HG   15 
ATOM   11166 H HD11 . LEU A 1 16 ? 2.920   -0.639  -7.628  1.00 0.00 ? 16 LEU A HD11 15 
ATOM   11167 H HD12 . LEU A 1 16 ? 4.201   -1.715  -7.071  1.00 0.00 ? 16 LEU A HD12 15 
ATOM   11168 H HD13 . LEU A 1 16 ? 4.328   0.024   -6.797  1.00 0.00 ? 16 LEU A HD13 15 
ATOM   11169 H HD21 . LEU A 1 16 ? 0.903   -0.333  -5.204  1.00 0.00 ? 16 LEU A HD21 15 
ATOM   11170 H HD22 . LEU A 1 16 ? 1.089   -2.074  -5.414  1.00 0.00 ? 16 LEU A HD22 15 
ATOM   11171 H HD23 . LEU A 1 16 ? 1.220   -0.998  -6.806  1.00 0.00 ? 16 LEU A HD23 15 
ATOM   11172 N N    . GLU A 1 17 ? 3.809   -4.154  -2.158  1.00 0.00 ? 17 GLU A N    15 
ATOM   11173 C CA   . GLU A 1 17 ? 3.863   -5.562  -1.673  1.00 0.00 ? 17 GLU A CA   15 
ATOM   11174 C C    . GLU A 1 17 ? 2.683   -5.827  -0.741  1.00 0.00 ? 17 GLU A C    15 
ATOM   11175 O O    . GLU A 1 17 ? 2.139   -6.913  -0.700  1.00 0.00 ? 17 GLU A O    15 
ATOM   11176 C CB   . GLU A 1 17 ? 5.173   -5.793  -0.916  1.00 0.00 ? 17 GLU A CB   15 
ATOM   11177 C CG   . GLU A 1 17 ? 5.918   -6.979  -1.533  1.00 0.00 ? 17 GLU A CG   15 
ATOM   11178 C CD   . GLU A 1 17 ? 5.249   -8.285  -1.100  1.00 0.00 ? 17 GLU A CD   15 
ATOM   11179 O OE1  . GLU A 1 17 ? 5.512   -8.723  0.009   1.00 0.00 ? 17 GLU A OE1  15 
ATOM   11180 O OE2  . GLU A 1 17 ? 4.486   -8.825  -1.884  1.00 0.00 ? 17 GLU A OE2  15 
ATOM   11181 H H    . GLU A 1 17 ? 4.505   -3.517  -1.894  1.00 0.00 ? 17 GLU A H    15 
ATOM   11182 H HA   . GLU A 1 17 ? 3.810   -6.231  -2.514  1.00 0.00 ? 17 GLU A HA   15 
ATOM   11183 H HB2  . GLU A 1 17 ? 5.788   -4.907  -0.981  1.00 0.00 ? 17 GLU A HB2  15 
ATOM   11184 H HB3  . GLU A 1 17 ? 4.957   -6.006  0.120   1.00 0.00 ? 17 GLU A HB3  15 
ATOM   11185 H HG2  . GLU A 1 17 ? 5.891   -6.900  -2.610  1.00 0.00 ? 17 GLU A HG2  15 
ATOM   11186 H HG3  . GLU A 1 17 ? 6.944   -6.974  -1.197  1.00 0.00 ? 17 GLU A HG3  15 
ATOM   11187 N N    . ASN A 1 18 ? 2.283   -4.837  0.001   1.00 0.00 ? 18 ASN A N    15 
ATOM   11188 C CA   . ASN A 1 18 ? 1.138   -5.015  0.934   1.00 0.00 ? 18 ASN A CA   15 
ATOM   11189 C C    . ASN A 1 18 ? -0.168  -5.073  0.137   1.00 0.00 ? 18 ASN A C    15 
ATOM   11190 O O    . ASN A 1 18 ? -1.235  -5.246  0.691   1.00 0.00 ? 18 ASN A O    15 
ATOM   11191 C CB   . ASN A 1 18 ? 1.095   -3.834  1.904   1.00 0.00 ? 18 ASN A CB   15 
ATOM   11192 C CG   . ASN A 1 18 ? 1.741   -4.238  3.230   1.00 0.00 ? 18 ASN A CG   15 
ATOM   11193 O OD1  . ASN A 1 18 ? 1.079   -4.751  4.110   1.00 0.00 ? 18 ASN A OD1  15 
ATOM   11194 N ND2  . ASN A 1 18 ? 3.016   -4.029  3.409   1.00 0.00 ? 18 ASN A ND2  15 
ATOM   11195 H H    . ASN A 1 18 ? 2.738   -3.975  -0.057  1.00 0.00 ? 18 ASN A H    15 
ATOM   11196 H HA   . ASN A 1 18 ? 1.264   -5.932  1.490   1.00 0.00 ? 18 ASN A HA   15 
ATOM   11197 H HB2  . ASN A 1 18 ? 1.634   -3.000  1.478   1.00 0.00 ? 18 ASN A HB2  15 
ATOM   11198 H HB3  . ASN A 1 18 ? 0.070   -3.548  2.076   1.00 0.00 ? 18 ASN A HB3  15 
ATOM   11199 H HD21 . ASN A 1 18 ? 3.549   -3.616  2.698   1.00 0.00 ? 18 ASN A HD21 15 
ATOM   11200 H HD22 . ASN A 1 18 ? 3.440   -4.283  4.255   1.00 0.00 ? 18 ASN A HD22 15 
ATOM   11201 N N    . TYR A 1 19 ? -0.092  -4.932  -1.158  1.00 0.00 ? 19 TYR A N    15 
ATOM   11202 C CA   . TYR A 1 19 ? -1.325  -4.982  -1.987  1.00 0.00 ? 19 TYR A CA   15 
ATOM   11203 C C    . TYR A 1 19 ? -1.236  -6.166  -2.948  1.00 0.00 ? 19 TYR A C    15 
ATOM   11204 O O    . TYR A 1 19 ? -1.723  -6.117  -4.060  1.00 0.00 ? 19 TYR A O    15 
ATOM   11205 C CB   . TYR A 1 19 ? -1.452  -3.682  -2.781  1.00 0.00 ? 19 TYR A CB   15 
ATOM   11206 C CG   . TYR A 1 19 ? -1.592  -2.525  -1.823  1.00 0.00 ? 19 TYR A CG   15 
ATOM   11207 C CD1  . TYR A 1 19 ? -2.779  -2.356  -1.097  1.00 0.00 ? 19 TYR A CD1  15 
ATOM   11208 C CD2  . TYR A 1 19 ? -0.535  -1.622  -1.655  1.00 0.00 ? 19 TYR A CD2  15 
ATOM   11209 C CE1  . TYR A 1 19 ? -2.908  -1.284  -0.204  1.00 0.00 ? 19 TYR A CE1  15 
ATOM   11210 C CE2  . TYR A 1 19 ? -0.664  -0.549  -0.762  1.00 0.00 ? 19 TYR A CE2  15 
ATOM   11211 C CZ   . TYR A 1 19 ? -1.850  -0.381  -0.036  1.00 0.00 ? 19 TYR A CZ   15 
ATOM   11212 O OH   . TYR A 1 19 ? -1.976  0.674   0.844   1.00 0.00 ? 19 TYR A OH   15 
ATOM   11213 H H    . TYR A 1 19 ? 0.775   -4.795  -1.588  1.00 0.00 ? 19 TYR A H    15 
ATOM   11214 H HA   . TYR A 1 19 ? -2.188  -5.100  -1.347  1.00 0.00 ? 19 TYR A HA   15 
ATOM   11215 H HB2  . TYR A 1 19 ? -0.570  -3.543  -3.389  1.00 0.00 ? 19 TYR A HB2  15 
ATOM   11216 H HB3  . TYR A 1 19 ? -2.322  -3.731  -3.415  1.00 0.00 ? 19 TYR A HB3  15 
ATOM   11217 H HD1  . TYR A 1 19 ? -3.595  -3.052  -1.228  1.00 0.00 ? 19 TYR A HD1  15 
ATOM   11218 H HD2  . TYR A 1 19 ? 0.380   -1.751  -2.214  1.00 0.00 ? 19 TYR A HD2  15 
ATOM   11219 H HE1  . TYR A 1 19 ? -3.822  -1.154  0.356   1.00 0.00 ? 19 TYR A HE1  15 
ATOM   11220 H HE2  . TYR A 1 19 ? 0.153   0.146   -0.632  1.00 0.00 ? 19 TYR A HE2  15 
ATOM   11221 H HH   . TYR A 1 19 ? -2.442  1.383   0.394   1.00 0.00 ? 19 TYR A HH   15 
ATOM   11222 N N    . CYS A 1 20 ? -0.611  -7.230  -2.525  1.00 0.00 ? 20 CYS A N    15 
ATOM   11223 C CA   . CYS A 1 20 ? -0.482  -8.420  -3.409  1.00 0.00 ? 20 CYS A CA   15 
ATOM   11224 C C    . CYS A 1 20 ? -1.578  -9.433  -3.065  1.00 0.00 ? 20 CYS A C    15 
ATOM   11225 O O    . CYS A 1 20 ? -2.695  -9.332  -3.533  1.00 0.00 ? 20 CYS A O    15 
ATOM   11226 C CB   . CYS A 1 20 ? 0.896   -9.054  -3.207  1.00 0.00 ? 20 CYS A CB   15 
ATOM   11227 S SG   . CYS A 1 20 ? 2.107   -8.201  -4.248  1.00 0.00 ? 20 CYS A SG   15 
ATOM   11228 H H    . CYS A 1 20 ? -0.223  -7.246  -1.625  1.00 0.00 ? 20 CYS A H    15 
ATOM   11229 H HA   . CYS A 1 20 ? -0.589  -8.118  -4.437  1.00 0.00 ? 20 CYS A HA   15 
ATOM   11230 H HB2  . CYS A 1 20 ? 1.185   -8.963  -2.171  1.00 0.00 ? 20 CYS A HB2  15 
ATOM   11231 H HB3  . CYS A 1 20 ? 0.856   -10.096 -3.481  1.00 0.00 ? 20 CYS A HB3  15 
ATOM   11232 N N    . ASN A 1 21 ? -1.271  -10.407 -2.254  1.00 0.00 ? 21 ASN A N    15 
ATOM   11233 C CA   . ASN A 1 21 ? -2.300  -11.421 -1.884  1.00 0.00 ? 21 ASN A CA   15 
ATOM   11234 C C    . ASN A 1 21 ? -2.225  -11.700 -0.382  1.00 0.00 ? 21 ASN A C    15 
ATOM   11235 O O    . ASN A 1 21 ? -1.758  -10.834 0.339   1.00 0.00 ? 21 ASN A O    15 
ATOM   11236 C CB   . ASN A 1 21 ? -2.040  -12.718 -2.653  1.00 0.00 ? 21 ASN A CB   15 
ATOM   11237 C CG   . ASN A 1 21 ? -2.919  -12.759 -3.903  1.00 0.00 ? 21 ASN A CG   15 
ATOM   11238 O OD1  . ASN A 1 21 ? -2.812  -11.907 -4.764  1.00 0.00 ? 21 ASN A OD1  15 
ATOM   11239 N ND2  . ASN A 1 21 ? -3.792  -13.719 -4.041  1.00 0.00 ? 21 ASN A ND2  15 
ATOM   11240 O OXT  . ASN A 1 21 ? -2.636  -12.775 0.022   1.00 0.00 ? 21 ASN A OXT  15 
ATOM   11241 H H    . ASN A 1 21 ? -0.368  -10.470 -1.888  1.00 0.00 ? 21 ASN A H    15 
ATOM   11242 H HA   . ASN A 1 21 ? -3.281  -11.046 -2.132  1.00 0.00 ? 21 ASN A HA   15 
ATOM   11243 H HB2  . ASN A 1 21 ? -1.000  -12.762 -2.941  1.00 0.00 ? 21 ASN A HB2  15 
ATOM   11244 H HB3  . ASN A 1 21 ? -2.275  -13.563 -2.023  1.00 0.00 ? 21 ASN A HB3  15 
ATOM   11245 H HD21 . ASN A 1 21 ? -3.877  -14.406 -3.347  1.00 0.00 ? 21 ASN A HD21 15 
ATOM   11246 H HD22 . ASN A 1 21 ? -4.359  -13.755 -4.839  1.00 0.00 ? 21 ASN A HD22 15 
ATOM   11247 N N    . PHE B 2 1  ? 9.532   2.552   -8.429  1.00 0.00 ? 1  PHE B N    15 
ATOM   11248 C CA   . PHE B 2 1  ? 10.765  1.909   -7.890  1.00 0.00 ? 1  PHE B CA   15 
ATOM   11249 C C    . PHE B 2 1  ? 11.752  2.991   -7.445  1.00 0.00 ? 1  PHE B C    15 
ATOM   11250 O O    . PHE B 2 1  ? 12.327  2.919   -6.378  1.00 0.00 ? 1  PHE B O    15 
ATOM   11251 C CB   . PHE B 2 1  ? 11.410  1.041   -8.977  1.00 0.00 ? 1  PHE B CB   15 
ATOM   11252 C CG   . PHE B 2 1  ? 12.062  -0.172  -8.340  1.00 0.00 ? 1  PHE B CG   15 
ATOM   11253 C CD1  . PHE B 2 1  ? 12.769  -0.039  -7.135  1.00 0.00 ? 1  PHE B CD1  15 
ATOM   11254 C CD2  . PHE B 2 1  ? 11.963  -1.430  -8.955  1.00 0.00 ? 1  PHE B CD2  15 
ATOM   11255 C CE1  . PHE B 2 1  ? 13.373  -1.158  -6.547  1.00 0.00 ? 1  PHE B CE1  15 
ATOM   11256 C CE2  . PHE B 2 1  ? 12.569  -2.549  -8.365  1.00 0.00 ? 1  PHE B CE2  15 
ATOM   11257 C CZ   . PHE B 2 1  ? 13.274  -2.413  -7.161  1.00 0.00 ? 1  PHE B CZ   15 
ATOM   11258 H H1   . PHE B 2 1  ? 9.408   2.287   -9.426  1.00 0.00 ? 1  PHE B H1   15 
ATOM   11259 H H2   . PHE B 2 1  ? 9.619   3.587   -8.352  1.00 0.00 ? 1  PHE B H2   15 
ATOM   11260 H H3   . PHE B 2 1  ? 8.708   2.232   -7.883  1.00 0.00 ? 1  PHE B H3   15 
ATOM   11261 H HA   . PHE B 2 1  ? 10.506  1.290   -7.043  1.00 0.00 ? 1  PHE B HA   15 
ATOM   11262 H HB2  . PHE B 2 1  ? 10.651  0.721   -9.678  1.00 0.00 ? 1  PHE B HB2  15 
ATOM   11263 H HB3  . PHE B 2 1  ? 12.158  1.620   -9.502  1.00 0.00 ? 1  PHE B HB3  15 
ATOM   11264 H HD1  . PHE B 2 1  ? 12.848  0.924   -6.658  1.00 0.00 ? 1  PHE B HD1  15 
ATOM   11265 H HD2  . PHE B 2 1  ? 11.421  -1.539  -9.880  1.00 0.00 ? 1  PHE B HD2  15 
ATOM   11266 H HE1  . PHE B 2 1  ? 13.916  -1.053  -5.620  1.00 0.00 ? 1  PHE B HE1  15 
ATOM   11267 H HE2  . PHE B 2 1  ? 12.492  -3.517  -8.838  1.00 0.00 ? 1  PHE B HE2  15 
ATOM   11268 H HZ   . PHE B 2 1  ? 13.739  -3.274  -6.708  1.00 0.00 ? 1  PHE B HZ   15 
ATOM   11269 N N    . VAL B 2 2  ? 11.956  3.996   -8.254  1.00 0.00 ? 2  VAL B N    15 
ATOM   11270 C CA   . VAL B 2 2  ? 12.912  5.072   -7.867  1.00 0.00 ? 2  VAL B CA   15 
ATOM   11271 C C    . VAL B 2 2  ? 12.330  6.441   -8.233  1.00 0.00 ? 2  VAL B C    15 
ATOM   11272 O O    . VAL B 2 2  ? 12.495  6.920   -9.338  1.00 0.00 ? 2  VAL B O    15 
ATOM   11273 C CB   . VAL B 2 2  ? 14.235  4.862   -8.606  1.00 0.00 ? 2  VAL B CB   15 
ATOM   11274 C CG1  . VAL B 2 2  ? 13.959  4.618   -10.090 1.00 0.00 ? 2  VAL B CG1  15 
ATOM   11275 C CG2  . VAL B 2 2  ? 15.111  6.107   -8.454  1.00 0.00 ? 2  VAL B CG2  15 
ATOM   11276 H H    . VAL B 2 2  ? 11.486  4.040   -9.112  1.00 0.00 ? 2  VAL B H    15 
ATOM   11277 H HA   . VAL B 2 2  ? 13.086  5.031   -6.802  1.00 0.00 ? 2  VAL B HA   15 
ATOM   11278 H HB   . VAL B 2 2  ? 14.747  4.006   -8.190  1.00 0.00 ? 2  VAL B HB   15 
ATOM   11279 H HG11 . VAL B 2 2  ? 12.964  4.961   -10.333 1.00 0.00 ? 2  VAL B HG11 15 
ATOM   11280 H HG12 . VAL B 2 2  ? 14.036  3.562   -10.302 1.00 0.00 ? 2  VAL B HG12 15 
ATOM   11281 H HG13 . VAL B 2 2  ? 14.680  5.159   -10.685 1.00 0.00 ? 2  VAL B HG13 15 
ATOM   11282 H HG21 . VAL B 2 2  ? 14.993  6.740   -9.322  1.00 0.00 ? 2  VAL B HG21 15 
ATOM   11283 H HG22 . VAL B 2 2  ? 16.145  5.810   -8.365  1.00 0.00 ? 2  VAL B HG22 15 
ATOM   11284 H HG23 . VAL B 2 2  ? 14.815  6.651   -7.569  1.00 0.00 ? 2  VAL B HG23 15 
ATOM   11285 N N    . ASN B 2 3  ? 11.654  7.076   -7.314  1.00 0.00 ? 3  ASN B N    15 
ATOM   11286 C CA   . ASN B 2 3  ? 11.069  8.411   -7.607  1.00 0.00 ? 3  ASN B CA   15 
ATOM   11287 C C    . ASN B 2 3  ? 10.166  8.315   -8.834  1.00 0.00 ? 3  ASN B C    15 
ATOM   11288 O O    . ASN B 2 3  ? 9.928   9.290   -9.520  1.00 0.00 ? 3  ASN B O    15 
ATOM   11289 C CB   . ASN B 2 3  ? 12.192  9.415   -7.874  1.00 0.00 ? 3  ASN B CB   15 
ATOM   11290 C CG   . ASN B 2 3  ? 12.914  9.728   -6.563  1.00 0.00 ? 3  ASN B CG   15 
ATOM   11291 O OD1  . ASN B 2 3  ? 12.970  10.868  -6.144  1.00 0.00 ? 3  ASN B OD1  15 
ATOM   11292 N ND2  . ASN B 2 3  ? 13.471  8.758   -5.892  1.00 0.00 ? 3  ASN B ND2  15 
ATOM   11293 H H    . ASN B 2 3  ? 11.534  6.674   -6.430  1.00 0.00 ? 3  ASN B H    15 
ATOM   11294 H HA   . ASN B 2 3  ? 10.487  8.743   -6.759  1.00 0.00 ? 3  ASN B HA   15 
ATOM   11295 H HB2  . ASN B 2 3  ? 12.892  8.991   -8.579  1.00 0.00 ? 3  ASN B HB2  15 
ATOM   11296 H HB3  . ASN B 2 3  ? 11.776  10.323  -8.280  1.00 0.00 ? 3  ASN B HB3  15 
ATOM   11297 H HD21 . ASN B 2 3  ? 13.424  7.839   -6.229  1.00 0.00 ? 3  ASN B HD21 15 
ATOM   11298 H HD22 . ASN B 2 3  ? 13.936  8.948   -5.051  1.00 0.00 ? 3  ASN B HD22 15 
ATOM   11299 N N    . GLN B 2 4  ? 9.657   7.149   -9.116  1.00 0.00 ? 4  GLN B N    15 
ATOM   11300 C CA   . GLN B 2 4  ? 8.767   6.995   -10.294 1.00 0.00 ? 4  GLN B CA   15 
ATOM   11301 C C    . GLN B 2 4  ? 7.316   7.162   -9.852  1.00 0.00 ? 4  GLN B C    15 
ATOM   11302 O O    . GLN B 2 4  ? 6.863   6.531   -8.918  1.00 0.00 ? 4  GLN B O    15 
ATOM   11303 C CB   . GLN B 2 4  ? 8.960   5.606   -10.897 1.00 0.00 ? 4  GLN B CB   15 
ATOM   11304 C CG   . GLN B 2 4  ? 9.901   5.696   -12.098 1.00 0.00 ? 4  GLN B CG   15 
ATOM   11305 C CD   . GLN B 2 4  ? 10.396  4.296   -12.463 1.00 0.00 ? 4  GLN B CD   15 
ATOM   11306 O OE1  . GLN B 2 4  ? 11.287  3.769   -11.826 1.00 0.00 ? 4  GLN B OE1  15 
ATOM   11307 N NE2  . GLN B 2 4  ? 9.852   3.666   -13.468 1.00 0.00 ? 4  GLN B NE2  15 
ATOM   11308 H H    . GLN B 2 4  ? 9.858   6.375   -8.552  1.00 0.00 ? 4  GLN B H    15 
ATOM   11309 H HA   . GLN B 2 4  ? 9.009   7.747   -11.029 1.00 0.00 ? 4  GLN B HA   15 
ATOM   11310 H HB2  . GLN B 2 4  ? 9.386   4.950   -10.153 1.00 0.00 ? 4  GLN B HB2  15 
ATOM   11311 H HB3  . GLN B 2 4  ? 8.007   5.218   -11.216 1.00 0.00 ? 4  GLN B HB3  15 
ATOM   11312 H HG2  . GLN B 2 4  ? 9.370   6.122   -12.938 1.00 0.00 ? 4  GLN B HG2  15 
ATOM   11313 H HG3  . GLN B 2 4  ? 10.745  6.321   -11.850 1.00 0.00 ? 4  GLN B HG3  15 
ATOM   11314 H HE21 . GLN B 2 4  ? 9.133   4.090   -13.981 1.00 0.00 ? 4  GLN B HE21 15 
ATOM   11315 H HE22 . GLN B 2 4  ? 10.162  2.768   -13.709 1.00 0.00 ? 4  GLN B HE22 15 
ATOM   11316 N N    . HIS B 2 5  ? 6.583   8.009   -10.515 1.00 0.00 ? 5  HIS B N    15 
ATOM   11317 C CA   . HIS B 2 5  ? 5.160   8.220   -10.132 1.00 0.00 ? 5  HIS B CA   15 
ATOM   11318 C C    . HIS B 2 5  ? 4.301   7.106   -10.731 1.00 0.00 ? 5  HIS B C    15 
ATOM   11319 O O    . HIS B 2 5  ? 4.436   6.758   -11.888 1.00 0.00 ? 5  HIS B O    15 
ATOM   11320 C CB   . HIS B 2 5  ? 4.688   9.575   -10.661 1.00 0.00 ? 5  HIS B CB   15 
ATOM   11321 C CG   . HIS B 2 5  ? 3.708   10.183  -9.695  1.00 0.00 ? 5  HIS B CG   15 
ATOM   11322 N ND1  . HIS B 2 5  ? 2.362   9.891   -9.757  1.00 0.00 ? 5  HIS B ND1  15 
ATOM   11323 C CD2  . HIS B 2 5  ? 3.890   11.063  -8.663  1.00 0.00 ? 5  HIS B CD2  15 
ATOM   11324 C CE1  . HIS B 2 5  ? 1.772   10.590  -8.777  1.00 0.00 ? 5  HIS B CE1  15 
ATOM   11325 N NE2  . HIS B 2 5  ? 2.666   11.323  -8.082  1.00 0.00 ? 5  HIS B NE2  15 
ATOM   11326 H H    . HIS B 2 5  ? 6.969   8.506   -11.265 1.00 0.00 ? 5  HIS B H    15 
ATOM   11327 H HA   . HIS B 2 5  ? 5.071   8.203   -9.056  1.00 0.00 ? 5  HIS B HA   15 
ATOM   11328 H HB2  . HIS B 2 5  ? 5.537   10.232  -10.772 1.00 0.00 ? 5  HIS B HB2  15 
ATOM   11329 H HB3  . HIS B 2 5  ? 4.211   9.440   -11.618 1.00 0.00 ? 5  HIS B HB3  15 
ATOM   11330 H HD2  . HIS B 2 5  ? 4.835   11.484  -8.355  1.00 0.00 ? 5  HIS B HD2  15 
ATOM   11331 H HE1  . HIS B 2 5  ? 0.712   10.571  -8.570  1.00 0.00 ? 5  HIS B HE1  15 
ATOM   11332 H HE2  . HIS B 2 5  ? 2.485   11.916  -7.324  1.00 0.00 ? 5  HIS B HE2  15 
ATOM   11333 N N    . LEU B 2 6  ? 3.420   6.541   -9.954  1.00 0.00 ? 6  LEU B N    15 
ATOM   11334 C CA   . LEU B 2 6  ? 2.555   5.450   -10.482 1.00 0.00 ? 6  LEU B CA   15 
ATOM   11335 C C    . LEU B 2 6  ? 1.129   5.968   -10.625 1.00 0.00 ? 6  LEU B C    15 
ATOM   11336 O O    . LEU B 2 6  ? 0.825   7.066   -10.218 1.00 0.00 ? 6  LEU B O    15 
ATOM   11337 C CB   . LEU B 2 6  ? 2.577   4.268   -9.506  1.00 0.00 ? 6  LEU B CB   15 
ATOM   11338 C CG   . LEU B 2 6  ? 3.817   3.404   -9.759  1.00 0.00 ? 6  LEU B CG   15 
ATOM   11339 C CD1  . LEU B 2 6  ? 5.025   4.301   -10.036 1.00 0.00 ? 6  LEU B CD1  15 
ATOM   11340 C CD2  . LEU B 2 6  ? 4.099   2.547   -8.523  1.00 0.00 ? 6  LEU B CD2  15 
ATOM   11341 H H    . LEU B 2 6  ? 3.326   6.836   -9.024  1.00 0.00 ? 6  LEU B H    15 
ATOM   11342 H HA   . LEU B 2 6  ? 2.924   5.130   -11.446 1.00 0.00 ? 6  LEU B HA   15 
ATOM   11343 H HB2  . LEU B 2 6  ? 2.599   4.642   -8.493  1.00 0.00 ? 6  LEU B HB2  15 
ATOM   11344 H HB3  . LEU B 2 6  ? 1.690   3.670   -9.649  1.00 0.00 ? 6  LEU B HB3  15 
ATOM   11345 H HG   . LEU B 2 6  ? 3.642   2.764   -10.611 1.00 0.00 ? 6  LEU B HG   15 
ATOM   11346 H HD11 . LEU B 2 6  ? 4.946   4.710   -11.033 1.00 0.00 ? 6  LEU B HD11 15 
ATOM   11347 H HD12 . LEU B 2 6  ? 5.931   3.722   -9.954  1.00 0.00 ? 6  LEU B HD12 15 
ATOM   11348 H HD13 . LEU B 2 6  ? 5.044   5.107   -9.318  1.00 0.00 ? 6  LEU B HD13 15 
ATOM   11349 H HD21 . LEU B 2 6  ? 5.143   2.271   -8.507  1.00 0.00 ? 6  LEU B HD21 15 
ATOM   11350 H HD22 . LEU B 2 6  ? 3.491   1.656   -8.557  1.00 0.00 ? 6  LEU B HD22 15 
ATOM   11351 H HD23 . LEU B 2 6  ? 3.863   3.112   -7.632  1.00 0.00 ? 6  LEU B HD23 15 
ATOM   11352 N N    . CYS B 2 7  ? 0.258   5.183   -11.194 1.00 0.00 ? 7  CYS B N    15 
ATOM   11353 C CA   . CYS B 2 7  ? -1.160  5.614   -11.363 1.00 0.00 ? 7  CYS B CA   15 
ATOM   11354 C C    . CYS B 2 7  ? -1.936  4.487   -12.063 1.00 0.00 ? 7  CYS B C    15 
ATOM   11355 O O    . CYS B 2 7  ? -2.280  3.496   -11.450 1.00 0.00 ? 7  CYS B O    15 
ATOM   11356 C CB   . CYS B 2 7  ? -1.227  6.904   -12.197 1.00 0.00 ? 7  CYS B CB   15 
ATOM   11357 S SG   . CYS B 2 7  ? -1.368  8.346   -11.108 1.00 0.00 ? 7  CYS B SG   15 
ATOM   11358 H H    . CYS B 2 7  ? 0.535   4.296   -11.507 1.00 0.00 ? 7  CYS B H    15 
ATOM   11359 H HA   . CYS B 2 7  ? -1.595  5.792   -10.389 1.00 0.00 ? 7  CYS B HA   15 
ATOM   11360 H HB2  . CYS B 2 7  ? -0.331  6.994   -12.789 1.00 0.00 ? 7  CYS B HB2  15 
ATOM   11361 H HB3  . CYS B 2 7  ? -2.087  6.869   -12.848 1.00 0.00 ? 7  CYS B HB3  15 
ATOM   11362 N N    . GLY B 2 8  ? -2.203  4.609   -13.339 1.00 0.00 ? 8  GLY B N    15 
ATOM   11363 C CA   . GLY B 2 8  ? -2.947  3.529   -14.045 1.00 0.00 ? 8  GLY B CA   15 
ATOM   11364 C C    . GLY B 2 8  ? -2.012  2.351   -14.311 1.00 0.00 ? 8  GLY B C    15 
ATOM   11365 O O    . GLY B 2 8  ? -1.565  1.682   -13.401 1.00 0.00 ? 8  GLY B O    15 
ATOM   11366 H H    . GLY B 2 8  ? -1.910  5.401   -13.833 1.00 0.00 ? 8  GLY B H    15 
ATOM   11367 H HA2  . GLY B 2 8  ? -3.775  3.203   -13.431 1.00 0.00 ? 8  GLY B HA2  15 
ATOM   11368 H HA3  . GLY B 2 8  ? -3.324  3.906   -14.985 1.00 0.00 ? 8  GLY B HA3  15 
ATOM   11369 N N    . SER B 2 9  ? -1.713  2.090   -15.554 1.00 0.00 ? 9  SER B N    15 
ATOM   11370 C CA   . SER B 2 9  ? -0.807  0.953   -15.879 1.00 0.00 ? 9  SER B CA   15 
ATOM   11371 C C    . SER B 2 9  ? 0.431   1.016   -14.984 1.00 0.00 ? 9  SER B C    15 
ATOM   11372 O O    . SER B 2 9  ? 0.973   0.003   -14.590 1.00 0.00 ? 9  SER B O    15 
ATOM   11373 C CB   . SER B 2 9  ? -0.381  1.042   -17.344 1.00 0.00 ? 9  SER B CB   15 
ATOM   11374 O OG   . SER B 2 9  ? -1.108  0.085   -18.102 1.00 0.00 ? 9  SER B OG   15 
ATOM   11375 H H    . SER B 2 9  ? -2.086  2.641   -16.273 1.00 0.00 ? 9  SER B H    15 
ATOM   11376 H HA   . SER B 2 9  ? -1.325  0.021   -15.711 1.00 0.00 ? 9  SER B HA   15 
ATOM   11377 H HB2  . SER B 2 9  ? -0.590  2.029   -17.723 1.00 0.00 ? 9  SER B HB2  15 
ATOM   11378 H HB3  . SER B 2 9  ? 0.681   0.846   -17.420 1.00 0.00 ? 9  SER B HB3  15 
ATOM   11379 H HG   . SER B 2 9  ? -2.045  0.238   -17.954 1.00 0.00 ? 9  SER B HG   15 
ATOM   11380 N N    . ASP B 2 10 ? 0.885   2.196   -14.660 1.00 0.00 ? 10 ASP B N    15 
ATOM   11381 C CA   . ASP B 2 10 ? 2.090   2.312   -13.793 1.00 0.00 ? 10 ASP B CA   15 
ATOM   11382 C C    . ASP B 2 10 ? 1.810   1.649   -12.442 1.00 0.00 ? 10 ASP B C    15 
ATOM   11383 O O    . ASP B 2 10 ? 2.610   0.880   -11.945 1.00 0.00 ? 10 ASP B O    15 
ATOM   11384 C CB   . ASP B 2 10 ? 2.437   3.789   -13.578 1.00 0.00 ? 10 ASP B CB   15 
ATOM   11385 C CG   . ASP B 2 10 ? 2.244   4.556   -14.889 1.00 0.00 ? 10 ASP B CG   15 
ATOM   11386 O OD1  . ASP B 2 10 ? 2.359   3.941   -15.935 1.00 0.00 ? 10 ASP B OD1  15 
ATOM   11387 O OD2  . ASP B 2 10 ? 1.985   5.747   -14.822 1.00 0.00 ? 10 ASP B OD2  15 
ATOM   11388 H H    . ASP B 2 10 ? 0.436   3.003   -14.988 1.00 0.00 ? 10 ASP B H    15 
ATOM   11389 H HA   . ASP B 2 10 ? 2.921   1.815   -14.270 1.00 0.00 ? 10 ASP B HA   15 
ATOM   11390 H HB2  . ASP B 2 10 ? 1.796   4.204   -12.818 1.00 0.00 ? 10 ASP B HB2  15 
ATOM   11391 H HB3  . ASP B 2 10 ? 3.464   3.875   -13.263 1.00 0.00 ? 10 ASP B HB3  15 
ATOM   11392 N N    . LEU B 2 11 ? 0.684   1.934   -11.841 1.00 0.00 ? 11 LEU B N    15 
ATOM   11393 C CA   . LEU B 2 11 ? 0.376   1.306   -10.524 1.00 0.00 ? 11 LEU B CA   15 
ATOM   11394 C C    . LEU B 2 11 ? -0.082  -0.137  -10.753 1.00 0.00 ? 11 LEU B C    15 
ATOM   11395 O O    . LEU B 2 11 ? 0.105   -1.004  -9.918  1.00 0.00 ? 11 LEU B O    15 
ATOM   11396 C CB   . LEU B 2 11 ? -0.743  2.106   -9.829  1.00 0.00 ? 11 LEU B CB   15 
ATOM   11397 C CG   . LEU B 2 11 ? -0.644  2.059   -8.284  1.00 0.00 ? 11 LEU B CG   15 
ATOM   11398 C CD1  . LEU B 2 11 ? -1.814  1.249   -7.729  1.00 0.00 ? 11 LEU B CD1  15 
ATOM   11399 C CD2  . LEU B 2 11 ? 0.670   1.421   -7.808  1.00 0.00 ? 11 LEU B CD2  15 
ATOM   11400 H H    . LEU B 2 11 ? 0.047   2.555   -12.252 1.00 0.00 ? 11 LEU B H    15 
ATOM   11401 H HA   . LEU B 2 11 ? 1.266   1.310   -9.920  1.00 0.00 ? 11 LEU B HA   15 
ATOM   11402 H HB2  . LEU B 2 11 ? -0.685  3.133   -10.150 1.00 0.00 ? 11 LEU B HB2  15 
ATOM   11403 H HB3  . LEU B 2 11 ? -1.700  1.704   -10.127 1.00 0.00 ? 11 LEU B HB3  15 
ATOM   11404 H HG   . LEU B 2 11 ? -0.709  3.068   -7.902  1.00 0.00 ? 11 LEU B HG   15 
ATOM   11405 H HD11 . LEU B 2 11 ? -1.577  0.196   -7.774  1.00 0.00 ? 11 LEU B HD11 15 
ATOM   11406 H HD12 . LEU B 2 11 ? -2.698  1.444   -8.319  1.00 0.00 ? 11 LEU B HD12 15 
ATOM   11407 H HD13 . LEU B 2 11 ? -1.995  1.534   -6.704  1.00 0.00 ? 11 LEU B HD13 15 
ATOM   11408 H HD21 . LEU B 2 11 ? 1.501   2.041   -8.112  1.00 0.00 ? 11 LEU B HD21 15 
ATOM   11409 H HD22 . LEU B 2 11 ? 0.774   0.440   -8.246  1.00 0.00 ? 11 LEU B HD22 15 
ATOM   11410 H HD23 . LEU B 2 11 ? 0.660   1.336   -6.732  1.00 0.00 ? 11 LEU B HD23 15 
ATOM   11411 N N    . VAL B 2 12 ? -0.675  -0.403  -11.887 1.00 0.00 ? 12 VAL B N    15 
ATOM   11412 C CA   . VAL B 2 12 ? -1.142  -1.785  -12.181 1.00 0.00 ? 12 VAL B CA   15 
ATOM   11413 C C    . VAL B 2 12 ? 0.048   -2.620  -12.658 1.00 0.00 ? 12 VAL B C    15 
ATOM   11414 O O    . VAL B 2 12 ? 0.458   -3.559  -12.004 1.00 0.00 ? 12 VAL B O    15 
ATOM   11415 C CB   . VAL B 2 12 ? -2.219  -1.725  -13.271 1.00 0.00 ? 12 VAL B CB   15 
ATOM   11416 C CG1  . VAL B 2 12 ? -2.342  -3.084  -13.972 1.00 0.00 ? 12 VAL B CG1  15 
ATOM   11417 C CG2  . VAL B 2 12 ? -3.563  -1.366  -12.633 1.00 0.00 ? 12 VAL B CG2  15 
ATOM   11418 H H    . VAL B 2 12 ? -0.807  0.308   -12.550 1.00 0.00 ? 12 VAL B H    15 
ATOM   11419 H HA   . VAL B 2 12 ? -1.556  -2.225  -11.285 1.00 0.00 ? 12 VAL B HA   15 
ATOM   11420 H HB   . VAL B 2 12 ? -1.951  -0.968  -13.993 1.00 0.00 ? 12 VAL B HB   15 
ATOM   11421 H HG11 . VAL B 2 12 ? -1.486  -3.236  -14.614 1.00 0.00 ? 12 VAL B HG11 15 
ATOM   11422 H HG12 . VAL B 2 12 ? -3.244  -3.103  -14.565 1.00 0.00 ? 12 VAL B HG12 15 
ATOM   11423 H HG13 . VAL B 2 12 ? -2.380  -3.869  -13.231 1.00 0.00 ? 12 VAL B HG13 15 
ATOM   11424 H HG21 . VAL B 2 12 ? -3.719  -0.300  -12.701 1.00 0.00 ? 12 VAL B HG21 15 
ATOM   11425 H HG22 . VAL B 2 12 ? -3.562  -1.666  -11.595 1.00 0.00 ? 12 VAL B HG22 15 
ATOM   11426 H HG23 . VAL B 2 12 ? -4.358  -1.880  -13.155 1.00 0.00 ? 12 VAL B HG23 15 
ATOM   11427 N N    . GLU B 2 13 ? 0.614   -2.279  -13.785 1.00 0.00 ? 13 GLU B N    15 
ATOM   11428 C CA   . GLU B 2 13 ? 1.785   -3.048  -14.288 1.00 0.00 ? 13 GLU B CA   15 
ATOM   11429 C C    . GLU B 2 13 ? 2.742   -3.293  -13.121 1.00 0.00 ? 13 GLU B C    15 
ATOM   11430 O O    . GLU B 2 13 ? 3.474   -4.262  -13.095 1.00 0.00 ? 13 GLU B O    15 
ATOM   11431 C CB   . GLU B 2 13 ? 2.495   -2.249  -15.382 1.00 0.00 ? 13 GLU B CB   15 
ATOM   11432 C CG   . GLU B 2 13 ? 1.617   -2.208  -16.634 1.00 0.00 ? 13 GLU B CG   15 
ATOM   11433 C CD   . GLU B 2 13 ? 2.499   -2.056  -17.875 1.00 0.00 ? 13 GLU B CD   15 
ATOM   11434 O OE1  . GLU B 2 13 ? 3.565   -2.649  -17.897 1.00 0.00 ? 13 GLU B OE1  15 
ATOM   11435 O OE2  . GLU B 2 13 ? 2.092   -1.350  -18.783 1.00 0.00 ? 13 GLU B OE2  15 
ATOM   11436 H H    . GLU B 2 13 ? 0.274   -1.513  -14.294 1.00 0.00 ? 13 GLU B H    15 
ATOM   11437 H HA   . GLU B 2 13 ? 1.451   -3.995  -14.688 1.00 0.00 ? 13 GLU B HA   15 
ATOM   11438 H HB2  . GLU B 2 13 ? 2.674   -1.242  -15.033 1.00 0.00 ? 13 GLU B HB2  15 
ATOM   11439 H HB3  . GLU B 2 13 ? 3.437   -2.721  -15.620 1.00 0.00 ? 13 GLU B HB3  15 
ATOM   11440 H HG2  . GLU B 2 13 ? 1.050   -3.125  -16.705 1.00 0.00 ? 13 GLU B HG2  15 
ATOM   11441 H HG3  . GLU B 2 13 ? 0.940   -1.369  -16.571 1.00 0.00 ? 13 GLU B HG3  15 
ATOM   11442 N N    . ALA B 2 14 ? 2.727   -2.422  -12.149 1.00 0.00 ? 14 ALA B N    15 
ATOM   11443 C CA   . ALA B 2 14 ? 3.619   -2.602  -10.971 1.00 0.00 ? 14 ALA B CA   15 
ATOM   11444 C C    . ALA B 2 14 ? 3.159   -3.833  -10.188 1.00 0.00 ? 14 ALA B C    15 
ATOM   11445 O O    . ALA B 2 14 ? 3.878   -4.806  -10.066 1.00 0.00 ? 14 ALA B O    15 
ATOM   11446 C CB   . ALA B 2 14 ? 3.539   -1.365  -10.074 1.00 0.00 ? 14 ALA B CB   15 
ATOM   11447 H H    . ALA B 2 14 ? 2.120   -1.653  -12.188 1.00 0.00 ? 14 ALA B H    15 
ATOM   11448 H HA   . ALA B 2 14 ? 4.635   -2.744  -11.306 1.00 0.00 ? 14 ALA B HA   15 
ATOM   11449 H HB1  . ALA B 2 14 ? 3.705   -0.478  -10.668 1.00 0.00 ? 14 ALA B HB1  15 
ATOM   11450 H HB2  . ALA B 2 14 ? 4.294   -1.429  -9.305  1.00 0.00 ? 14 ALA B HB2  15 
ATOM   11451 H HB3  . ALA B 2 14 ? 2.563   -1.313  -9.617  1.00 0.00 ? 14 ALA B HB3  15 
ATOM   11452 N N    . LEU B 2 15 ? 1.964   -3.805  -9.661  1.00 0.00 ? 15 LEU B N    15 
ATOM   11453 C CA   . LEU B 2 15 ? 1.465   -4.983  -8.895  1.00 0.00 ? 15 LEU B CA   15 
ATOM   11454 C C    . LEU B 2 15 ? 1.681   -6.255  -9.717  1.00 0.00 ? 15 LEU B C    15 
ATOM   11455 O O    . LEU B 2 15 ? 2.174   -7.250  -9.225  1.00 0.00 ? 15 LEU B O    15 
ATOM   11456 C CB   . LEU B 2 15 ? -0.028  -4.817  -8.616  1.00 0.00 ? 15 LEU B CB   15 
ATOM   11457 C CG   . LEU B 2 15 ? -0.243  -3.674  -7.625  1.00 0.00 ? 15 LEU B CG   15 
ATOM   11458 C CD1  . LEU B 2 15 ? -1.623  -3.060  -7.853  1.00 0.00 ? 15 LEU B CD1  15 
ATOM   11459 C CD2  . LEU B 2 15 ? -0.157  -4.214  -6.196  1.00 0.00 ? 15 LEU B CD2  15 
ATOM   11460 H H    . LEU B 2 15 ? 1.394   -3.015  -9.774  1.00 0.00 ? 15 LEU B H    15 
ATOM   11461 H HA   . LEU B 2 15 ? 2.002   -5.060  -7.961  1.00 0.00 ? 15 LEU B HA   15 
ATOM   11462 H HB2  . LEU B 2 15 ? -0.543  -4.595  -9.539  1.00 0.00 ? 15 LEU B HB2  15 
ATOM   11463 H HB3  . LEU B 2 15 ? -0.418  -5.732  -8.198  1.00 0.00 ? 15 LEU B HB3  15 
ATOM   11464 H HG   . LEU B 2 15 ? 0.516   -2.920  -7.775  1.00 0.00 ? 15 LEU B HG   15 
ATOM   11465 H HD11 . LEU B 2 15 ? -1.630  -2.046  -7.486  1.00 0.00 ? 15 LEU B HD11 15 
ATOM   11466 H HD12 . LEU B 2 15 ? -2.366  -3.641  -7.324  1.00 0.00 ? 15 LEU B HD12 15 
ATOM   11467 H HD13 . LEU B 2 15 ? -1.849  -3.063  -8.909  1.00 0.00 ? 15 LEU B HD13 15 
ATOM   11468 H HD21 . LEU B 2 15 ? -0.368  -3.419  -5.497  1.00 0.00 ? 15 LEU B HD21 15 
ATOM   11469 H HD22 . LEU B 2 15 ? 0.836   -4.599  -6.016  1.00 0.00 ? 15 LEU B HD22 15 
ATOM   11470 H HD23 . LEU B 2 15 ? -0.878  -5.008  -6.068  1.00 0.00 ? 15 LEU B HD23 15 
ATOM   11471 N N    . TYR B 2 16 ? 1.307   -6.228  -10.966 1.00 0.00 ? 16 TYR B N    15 
ATOM   11472 C CA   . TYR B 2 16 ? 1.479   -7.431  -11.830 1.00 0.00 ? 16 TYR B CA   15 
ATOM   11473 C C    . TYR B 2 16 ? 2.919   -7.937  -11.735 1.00 0.00 ? 16 TYR B C    15 
ATOM   11474 O O    . TYR B 2 16 ? 3.163   -9.102  -11.487 1.00 0.00 ? 16 TYR B O    15 
ATOM   11475 C CB   . TYR B 2 16 ? 1.167   -7.061  -13.282 1.00 0.00 ? 16 TYR B CB   15 
ATOM   11476 C CG   . TYR B 2 16 ? 0.012   -7.900  -13.786 1.00 0.00 ? 16 TYR B CG   15 
ATOM   11477 C CD1  . TYR B 2 16 ? -0.111  -9.241  -13.390 1.00 0.00 ? 16 TYR B CD1  15 
ATOM   11478 C CD2  . TYR B 2 16 ? -0.936  -7.340  -14.654 1.00 0.00 ? 16 TYR B CD2  15 
ATOM   11479 C CE1  . TYR B 2 16 ? -1.178  -10.016 -13.861 1.00 0.00 ? 16 TYR B CE1  15 
ATOM   11480 C CE2  . TYR B 2 16 ? -2.003  -8.116  -15.124 1.00 0.00 ? 16 TYR B CE2  15 
ATOM   11481 C CZ   . TYR B 2 16 ? -2.125  -9.455  -14.728 1.00 0.00 ? 16 TYR B CZ   15 
ATOM   11482 O OH   . TYR B 2 16 ? -3.176  -10.219 -15.192 1.00 0.00 ? 16 TYR B OH   15 
ATOM   11483 H H    . TYR B 2 16 ? 0.907   -5.414  -11.337 1.00 0.00 ? 16 TYR B H    15 
ATOM   11484 H HA   . TYR B 2 16 ? 0.802   -8.207  -11.503 1.00 0.00 ? 16 TYR B HA   15 
ATOM   11485 H HB2  . TYR B 2 16 ? 0.904   -6.014  -13.336 1.00 0.00 ? 16 TYR B HB2  15 
ATOM   11486 H HB3  . TYR B 2 16 ? 2.040   -7.242  -13.893 1.00 0.00 ? 16 TYR B HB3  15 
ATOM   11487 H HD1  . TYR B 2 16 ? 0.615   -9.676  -12.721 1.00 0.00 ? 16 TYR B HD1  15 
ATOM   11488 H HD2  . TYR B 2 16 ? -0.846  -6.310  -14.961 1.00 0.00 ? 16 TYR B HD2  15 
ATOM   11489 H HE1  . TYR B 2 16 ? -1.273  -11.048 -13.555 1.00 0.00 ? 16 TYR B HE1  15 
ATOM   11490 H HE2  . TYR B 2 16 ? -2.733  -7.683  -15.793 1.00 0.00 ? 16 TYR B HE2  15 
ATOM   11491 H HH   . TYR B 2 16 ? -3.296  -10.957 -14.589 1.00 0.00 ? 16 TYR B HH   15 
ATOM   11492 N N    . LEU B 2 17 ? 3.878   -7.076  -11.943 1.00 0.00 ? 17 LEU B N    15 
ATOM   11493 C CA   . LEU B 2 17 ? 5.301   -7.514  -11.877 1.00 0.00 ? 17 LEU B CA   15 
ATOM   11494 C C    . LEU B 2 17 ? 5.760   -7.576  -10.418 1.00 0.00 ? 17 LEU B C    15 
ATOM   11495 O O    . LEU B 2 17 ? 6.779   -8.158  -10.105 1.00 0.00 ? 17 LEU B O    15 
ATOM   11496 C CB   . LEU B 2 17 ? 6.176   -6.522  -12.647 1.00 0.00 ? 17 LEU B CB   15 
ATOM   11497 C CG   . LEU B 2 17 ? 6.846   -7.237  -13.822 1.00 0.00 ? 17 LEU B CG   15 
ATOM   11498 C CD1  . LEU B 2 17 ? 6.261   -6.717  -15.138 1.00 0.00 ? 17 LEU B CD1  15 
ATOM   11499 C CD2  . LEU B 2 17 ? 8.352   -6.964  -13.791 1.00 0.00 ? 17 LEU B CD2  15 
ATOM   11500 H H    . LEU B 2 17 ? 3.661   -6.142  -12.150 1.00 0.00 ? 17 LEU B H    15 
ATOM   11501 H HA   . LEU B 2 17 ? 5.393   -8.493  -12.321 1.00 0.00 ? 17 LEU B HA   15 
ATOM   11502 H HB2  . LEU B 2 17 ? 5.563   -5.714  -13.019 1.00 0.00 ? 17 LEU B HB2  15 
ATOM   11503 H HB3  . LEU B 2 17 ? 6.936   -6.125  -11.990 1.00 0.00 ? 17 LEU B HB3  15 
ATOM   11504 H HG   . LEU B 2 17 ? 6.669   -8.300  -13.746 1.00 0.00 ? 17 LEU B HG   15 
ATOM   11505 H HD11 . LEU B 2 17 ? 6.885   -5.924  -15.522 1.00 0.00 ? 17 LEU B HD11 15 
ATOM   11506 H HD12 . LEU B 2 17 ? 5.265   -6.337  -14.963 1.00 0.00 ? 17 LEU B HD12 15 
ATOM   11507 H HD13 . LEU B 2 17 ? 6.219   -7.522  -15.856 1.00 0.00 ? 17 LEU B HD13 15 
ATOM   11508 H HD21 . LEU B 2 17 ? 8.796   -7.279  -14.724 1.00 0.00 ? 17 LEU B HD21 15 
ATOM   11509 H HD22 . LEU B 2 17 ? 8.800   -7.513  -12.976 1.00 0.00 ? 17 LEU B HD22 15 
ATOM   11510 H HD23 . LEU B 2 17 ? 8.524   -5.908  -13.649 1.00 0.00 ? 17 LEU B HD23 15 
ATOM   11511 N N    . VAL B 2 18 ? 5.019   -6.983  -9.523  1.00 0.00 ? 18 VAL B N    15 
ATOM   11512 C CA   . VAL B 2 18 ? 5.420   -7.014  -8.089  1.00 0.00 ? 18 VAL B CA   15 
ATOM   11513 C C    . VAL B 2 18 ? 5.035   -8.364  -7.483  1.00 0.00 ? 18 VAL B C    15 
ATOM   11514 O O    . VAL B 2 18 ? 5.873   -9.106  -7.009  1.00 0.00 ? 18 VAL B O    15 
ATOM   11515 C CB   . VAL B 2 18 ? 4.703   -5.894  -7.332  1.00 0.00 ? 18 VAL B CB   15 
ATOM   11516 C CG1  . VAL B 2 18 ? 5.033   -5.995  -5.844  1.00 0.00 ? 18 VAL B CG1  15 
ATOM   11517 C CG2  . VAL B 2 18 ? 5.173   -4.540  -7.863  1.00 0.00 ? 18 VAL B CG2  15 
ATOM   11518 H H    . VAL B 2 18 ? 4.200   -6.519  -9.795  1.00 0.00 ? 18 VAL B H    15 
ATOM   11519 H HA   . VAL B 2 18 ? 6.488   -6.875  -8.011  1.00 0.00 ? 18 VAL B HA   15 
ATOM   11520 H HB   . VAL B 2 18 ? 3.635   -5.988  -7.472  1.00 0.00 ? 18 VAL B HB   15 
ATOM   11521 H HG11 . VAL B 2 18 ? 6.080   -6.230  -5.722  1.00 0.00 ? 18 VAL B HG11 15 
ATOM   11522 H HG12 . VAL B 2 18 ? 4.435   -6.771  -5.394  1.00 0.00 ? 18 VAL B HG12 15 
ATOM   11523 H HG13 . VAL B 2 18 ? 4.820   -5.051  -5.365  1.00 0.00 ? 18 VAL B HG13 15 
ATOM   11524 H HG21 . VAL B 2 18 ? 5.590   -4.665  -8.850  1.00 0.00 ? 18 VAL B HG21 15 
ATOM   11525 H HG22 . VAL B 2 18 ? 5.926   -4.137  -7.201  1.00 0.00 ? 18 VAL B HG22 15 
ATOM   11526 H HG23 . VAL B 2 18 ? 4.334   -3.862  -7.909  1.00 0.00 ? 18 VAL B HG23 15 
ATOM   11527 N N    . CYS B 2 19 ? 3.772   -8.686  -7.493  1.00 0.00 ? 19 CYS B N    15 
ATOM   11528 C CA   . CYS B 2 19 ? 3.328   -9.986  -6.916  1.00 0.00 ? 19 CYS B CA   15 
ATOM   11529 C C    . CYS B 2 19 ? 3.678   -11.122 -7.879  1.00 0.00 ? 19 CYS B C    15 
ATOM   11530 O O    . CYS B 2 19 ? 4.500   -11.967 -7.583  1.00 0.00 ? 19 CYS B O    15 
ATOM   11531 C CB   . CYS B 2 19 ? 1.813   -9.953  -6.696  1.00 0.00 ? 19 CYS B CB   15 
ATOM   11532 S SG   . CYS B 2 19 ? 1.323   -8.314  -6.107  1.00 0.00 ? 19 CYS B SG   15 
ATOM   11533 H H    . CYS B 2 19 ? 3.115   -8.071  -7.880  1.00 0.00 ? 19 CYS B H    15 
ATOM   11534 H HA   . CYS B 2 19 ? 3.824   -10.149 -5.971  1.00 0.00 ? 19 CYS B HA   15 
ATOM   11535 H HB2  . CYS B 2 19 ? 1.309   -10.166 -7.626  1.00 0.00 ? 19 CYS B HB2  15 
ATOM   11536 H HB3  . CYS B 2 19 ? 1.540   -10.696 -5.961  1.00 0.00 ? 19 CYS B HB3  15 
ATOM   11537 N N    . GLY B 2 20 ? 3.064   -11.150 -9.031  1.00 0.00 ? 20 GLY B N    15 
ATOM   11538 C CA   . GLY B 2 20 ? 3.364   -12.233 -10.007 1.00 0.00 ? 20 GLY B CA   15 
ATOM   11539 C C    . GLY B 2 20 ? 2.695   -13.531 -9.554  1.00 0.00 ? 20 GLY B C    15 
ATOM   11540 O O    . GLY B 2 20 ? 1.496   -13.696 -9.672  1.00 0.00 ? 20 GLY B O    15 
ATOM   11541 H H    . GLY B 2 20 ? 2.405   -10.460 -9.252  1.00 0.00 ? 20 GLY B H    15 
ATOM   11542 H HA2  . GLY B 2 20 ? 2.990   -11.952 -10.982 1.00 0.00 ? 20 GLY B HA2  15 
ATOM   11543 H HA3  . GLY B 2 20 ? 4.432   -12.383 -10.062 1.00 0.00 ? 20 GLY B HA3  15 
ATOM   11544 N N    . GLU B 2 21 ? 3.458   -14.455 -9.036  1.00 0.00 ? 21 GLU B N    15 
ATOM   11545 C CA   . GLU B 2 21 ? 2.864   -15.741 -8.574  1.00 0.00 ? 21 GLU B CA   15 
ATOM   11546 C C    . GLU B 2 21 ? 1.758   -15.456 -7.556  1.00 0.00 ? 21 GLU B C    15 
ATOM   11547 O O    . GLU B 2 21 ? 0.607   -15.786 -7.762  1.00 0.00 ? 21 GLU B O    15 
ATOM   11548 C CB   . GLU B 2 21 ? 3.948   -16.597 -7.915  1.00 0.00 ? 21 GLU B CB   15 
ATOM   11549 C CG   . GLU B 2 21 ? 4.982   -17.013 -8.962  1.00 0.00 ? 21 GLU B CG   15 
ATOM   11550 C CD   . GLU B 2 21 ? 5.582   -18.367 -8.577  1.00 0.00 ? 21 GLU B CD   15 
ATOM   11551 O OE1  . GLU B 2 21 ? 6.553   -18.374 -7.841  1.00 0.00 ? 21 GLU B OE1  15 
ATOM   11552 O OE2  . GLU B 2 21 ? 5.057   -19.373 -9.027  1.00 0.00 ? 21 GLU B OE2  15 
ATOM   11553 H H    . GLU B 2 21 ? 4.422   -14.300 -8.948  1.00 0.00 ? 21 GLU B H    15 
ATOM   11554 H HA   . GLU B 2 21 ? 2.449   -16.272 -9.419  1.00 0.00 ? 21 GLU B HA   15 
ATOM   11555 H HB2  . GLU B 2 21 ? 4.433   -16.026 -7.135  1.00 0.00 ? 21 GLU B HB2  15 
ATOM   11556 H HB3  . GLU B 2 21 ? 3.499   -17.481 -7.486  1.00 0.00 ? 21 GLU B HB3  15 
ATOM   11557 H HG2  . GLU B 2 21 ? 4.505   -17.090 -9.928  1.00 0.00 ? 21 GLU B HG2  15 
ATOM   11558 H HG3  . GLU B 2 21 ? 5.767   -16.273 -9.006  1.00 0.00 ? 21 GLU B HG3  15 
ATOM   11559 N N    . ARG B 2 22 ? 2.102   -14.846 -6.455  1.00 0.00 ? 22 ARG B N    15 
ATOM   11560 C CA   . ARG B 2 22 ? 1.080   -14.538 -5.415  1.00 0.00 ? 22 ARG B CA   15 
ATOM   11561 C C    . ARG B 2 22 ? -0.168  -13.944 -6.073  1.00 0.00 ? 22 ARG B C    15 
ATOM   11562 O O    . ARG B 2 22 ? -1.279  -14.185 -5.645  1.00 0.00 ? 22 ARG B O    15 
ATOM   11563 C CB   . ARG B 2 22 ? 1.655   -13.527 -4.423  1.00 0.00 ? 22 ARG B CB   15 
ATOM   11564 C CG   . ARG B 2 22 ? 2.782   -14.178 -3.620  1.00 0.00 ? 22 ARG B CG   15 
ATOM   11565 C CD   . ARG B 2 22 ? 3.332   -13.173 -2.606  1.00 0.00 ? 22 ARG B CD   15 
ATOM   11566 N NE   . ARG B 2 22 ? 3.124   -13.695 -1.226  1.00 0.00 ? 22 ARG B NE   15 
ATOM   11567 C CZ   . ARG B 2 22 ? 3.017   -12.865 -0.225  1.00 0.00 ? 22 ARG B CZ   15 
ATOM   11568 N NH1  . ARG B 2 22 ? 1.954   -12.116 -0.109  1.00 0.00 ? 22 ARG B NH1  15 
ATOM   11569 N NH2  . ARG B 2 22 ? 3.973   -12.785 0.661   1.00 0.00 ? 22 ARG B NH2  15 
ATOM   11570 H H    . ARG B 2 22 ? 3.038   -14.591 -6.310  1.00 0.00 ? 22 ARG B H    15 
ATOM   11571 H HA   . ARG B 2 2