data_1KN0
# 
_entry.id   1KN0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KN0         
RCSB  RCSB015127   
WWPDB D_1000015127 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          trt001000214.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KN0 
_pdbx_database_status.recvd_initial_deposition_date   2001-12-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kagawa, W.'                                             1 
'Kurumizaka, H.'                                         2 
'Ishitani, R.'                                           3 
'Fukai, S.'                                              4 
'Nureki, O.'                                             5 
'Shibata, T.'                                            6 
'Yokoyama, S.'                                           7 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of the homologous-pairing domain from the human Rad52 recombinase in the undecameric form.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            10 
_citation.page_first                359 
_citation.page_last                 371 
_citation.year                      2002 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12191481 
_citation.pdbx_database_id_DOI      '10.1016/S1097-2765(02)00587-7' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kagawa, W.'     1 
primary 'Kurumizaka, H.' 2 
primary 'Ishitani, R.'   3 
primary 'Fukai, S.'      4 
primary 'Nureki, O.'     5 
primary 'Shibata, T.'    6 
primary 'Yokoyama, S.'   7 
# 
_cell.entry_id           1KN0 
_cell.length_a           145.61 
_cell.length_b           145.61 
_cell.length_c           247.53 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              88 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KN0 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Rad52 23431.510 11 ? ? 'N-terminal domain' ? 
2 water   nat water 18.015    82 ? ? ?                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DNA repair protein RAD52 homolog' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFG
YNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGN
ALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFG
YNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGN
ALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNM
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K 
_entity_poly.pdbx_target_identifier         trt001000214.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLY n 
1 4   THR n 
1 5   GLU n 
1 6   GLU n 
1 7   ALA n 
1 8   ILE n 
1 9   LEU n 
1 10  GLY n 
1 11  GLY n 
1 12  ARG n 
1 13  ASP n 
1 14  SER n 
1 15  HIS n 
1 16  PRO n 
1 17  ALA n 
1 18  ALA n 
1 19  GLY n 
1 20  GLY n 
1 21  GLY n 
1 22  SER n 
1 23  VAL n 
1 24  LEU n 
1 25  CYS n 
1 26  PHE n 
1 27  GLY n 
1 28  GLN n 
1 29  CYS n 
1 30  GLN n 
1 31  TYR n 
1 32  THR n 
1 33  ALA n 
1 34  GLU n 
1 35  GLU n 
1 36  TYR n 
1 37  GLN n 
1 38  ALA n 
1 39  ILE n 
1 40  GLN n 
1 41  LYS n 
1 42  ALA n 
1 43  LEU n 
1 44  ARG n 
1 45  GLN n 
1 46  ARG n 
1 47  LEU n 
1 48  GLY n 
1 49  PRO n 
1 50  GLU n 
1 51  TYR n 
1 52  ILE n 
1 53  SER n 
1 54  SER n 
1 55  ARG n 
1 56  MET n 
1 57  ALA n 
1 58  GLY n 
1 59  GLY n 
1 60  GLY n 
1 61  GLN n 
1 62  LYS n 
1 63  VAL n 
1 64  CYS n 
1 65  TYR n 
1 66  ILE n 
1 67  GLU n 
1 68  GLY n 
1 69  HIS n 
1 70  ARG n 
1 71  VAL n 
1 72  ILE n 
1 73  ASN n 
1 74  LEU n 
1 75  ALA n 
1 76  ASN n 
1 77  GLU n 
1 78  MET n 
1 79  PHE n 
1 80  GLY n 
1 81  TYR n 
1 82  ASN n 
1 83  GLY n 
1 84  TRP n 
1 85  ALA n 
1 86  HIS n 
1 87  SER n 
1 88  ILE n 
1 89  THR n 
1 90  GLN n 
1 91  GLN n 
1 92  ASN n 
1 93  VAL n 
1 94  ASP n 
1 95  PHE n 
1 96  VAL n 
1 97  ASP n 
1 98  LEU n 
1 99  ASN n 
1 100 ASN n 
1 101 GLY n 
1 102 LYS n 
1 103 PHE n 
1 104 TYR n 
1 105 VAL n 
1 106 GLY n 
1 107 VAL n 
1 108 CYS n 
1 109 ALA n 
1 110 PHE n 
1 111 VAL n 
1 112 ARG n 
1 113 VAL n 
1 114 GLN n 
1 115 LEU n 
1 116 LYS n 
1 117 ASP n 
1 118 GLY n 
1 119 SER n 
1 120 TYR n 
1 121 HIS n 
1 122 GLU n 
1 123 ASP n 
1 124 VAL n 
1 125 GLY n 
1 126 TYR n 
1 127 GLY n 
1 128 VAL n 
1 129 SER n 
1 130 GLU n 
1 131 GLY n 
1 132 LEU n 
1 133 LYS n 
1 134 SER n 
1 135 LYS n 
1 136 ALA n 
1 137 LEU n 
1 138 SER n 
1 139 LEU n 
1 140 GLU n 
1 141 LYS n 
1 142 ALA n 
1 143 ARG n 
1 144 LYS n 
1 145 GLU n 
1 146 ALA n 
1 147 VAL n 
1 148 THR n 
1 149 ASP n 
1 150 GLY n 
1 151 LEU n 
1 152 LYS n 
1 153 ARG n 
1 154 ALA n 
1 155 LEU n 
1 156 ARG n 
1 157 SER n 
1 158 PHE n 
1 159 GLY n 
1 160 ASN n 
1 161 ALA n 
1 162 LEU n 
1 163 GLY n 
1 164 ASN n 
1 165 CYS n 
1 166 ILE n 
1 167 LEU n 
1 168 ASP n 
1 169 LYS n 
1 170 ASP n 
1 171 TYR n 
1 172 LEU n 
1 173 ARG n 
1 174 SER n 
1 175 LEU n 
1 176 ASN n 
1 177 LYS n 
1 178 LEU n 
1 179 PRO n 
1 180 ARG n 
1 181 GLN n 
1 182 LEU n 
1 183 PRO n 
1 184 LEU n 
1 185 GLU n 
1 186 VAL n 
1 187 ASP n 
1 188 LEU n 
1 189 THR n 
1 190 LYS n 
1 191 ALA n 
1 192 LYS n 
1 193 ARG n 
1 194 GLN n 
1 195 ASP n 
1 196 LEU n 
1 197 GLU n 
1 198 PRO n 
1 199 SER n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 ALA n 
1 204 ARG n 
1 205 TYR n 
1 206 ASN n 
1 207 SER n 
1 208 CYS n 
1 209 ARG n 
1 210 PRO n 
1 211 ASN n 
1 212 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 Rad52 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'JM109(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RAD52_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFG
YNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGN
ALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNM
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P43351 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1KN0 A 1 ? 212 ? P43351 1 ? 212 ? 1 212 
2  1 1KN0 B 1 ? 212 ? P43351 1 ? 212 ? 1 212 
3  1 1KN0 C 1 ? 212 ? P43351 1 ? 212 ? 1 212 
4  1 1KN0 D 1 ? 212 ? P43351 1 ? 212 ? 1 212 
5  1 1KN0 E 1 ? 212 ? P43351 1 ? 212 ? 1 212 
6  1 1KN0 F 1 ? 212 ? P43351 1 ? 212 ? 1 212 
7  1 1KN0 G 1 ? 212 ? P43351 1 ? 212 ? 1 212 
8  1 1KN0 H 1 ? 212 ? P43351 1 ? 212 ? 1 212 
9  1 1KN0 I 1 ? 212 ? P43351 1 ? 212 ? 1 212 
10 1 1KN0 J 1 ? 212 ? P43351 1 ? 212 ? 1 212 
11 1 1KN0 K 1 ? 212 ? P43351 1 ? 212 ? 1 212 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1KN0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   3 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   51.66 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.2 
_exptl_crystal_grow.pdbx_details    
'PEG 5000MME, ammonium sulfate, sodium cacodylate, pH 6.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS' 
_diffrn_detector.pdbx_collection_date   2001-04-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    DIAMOND 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.979  1.0 
2 0.9795 1.0 
3 1.02   1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL45PX' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL45PX 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.979, 0.9795, 1.02' 
# 
_reflns.entry_id                     1KN0 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.85 
_reflns.number_obs                   62872 
_reflns.number_all                   63100 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.85 
_reflns_shell.d_res_low              2.90 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1KN0 
_refine.ls_number_reflns_obs                     62321 
_refine.ls_number_reflns_all                     62776 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            2.85 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2361000 
_refine.ls_R_factor_all                          0.2862000 
_refine.ls_R_factor_R_work                       0.2310000 
_refine.ls_R_factor_R_free                       0.2970000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.11 
_refine.ls_number_reflns_R_free                  6303 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1KN0 
_refine_analyze.Luzzati_coordinate_error_obs    0.40 
_refine_analyze.Luzzati_sigma_a_obs             0.46 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.51 
_refine_analyze.Luzzati_sigma_a_free            0.59 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        15961 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             82 
_refine_hist.number_atoms_total               16043 
_refine_hist.d_res_high                       2.85 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_d          1.25246  ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d           0.007728 ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.79784 ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.78758  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
. 2.85 2.95  . 0.3375000 . 0.4121000 . . 593 5486 . . 'X-RAY DIFFRACTION' . 
. 2.95 3.07  . 0.3051000 . 0.3713000 . . 645 5487 . . 'X-RAY DIFFRACTION' . 
. 3.07 3.21  . 0.2924000 . 0.3660000 . . 632 5492 . . 'X-RAY DIFFRACTION' . 
. 3.21 3.38  . 0.2736000 . 0.3419000 . . 604 5580 . . 'X-RAY DIFFRACTION' . 
. 3.38 3.59  . 0.2636000 . 0.3269000 . . 645 5516 . . 'X-RAY DIFFRACTION' . 
. 3.59 3.87  . 0.2546000 . 0.3140000 . . 683 5517 . . 'X-RAY DIFFRACTION' . 
. 3.87 4.26  . 0.2268000 . 0.2916000 . . 622 5611 . . 'X-RAY DIFFRACTION' . 
. 4.26 4.87  . 0.1808000 . 0.2493000 . . 636 5648 . . 'X-RAY DIFFRACTION' . 
. 4.87 6.14  . 0.2130000 . 0.2839000 . . 616 5731 . . 'X-RAY DIFFRACTION' . 
. 6.14 50.00 . 0.1993000 . 0.2568000 . . 627 5950 . . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  1KN0 
_struct.title                     'Crystal Structure of the human Rad52 protein' 
_struct.pdbx_descriptor           Rad52 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KN0 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            
;beta-beta-beta-alpha fold, DNA-binding protein, ring protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, DNA BINDING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 1 ? 
J N N 1 ? 
K N N 1 ? 
L N N 2 ? 
M N N 2 ? 
N N N 2 ? 
O N N 2 ? 
P N N 2 ? 
Q N N 2 ? 
R N N 2 ? 
S N N 2 ? 
T N N 2 ? 
U N N 2 ? 
V N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 32  ? LEU A 43  ? THR A 32  LEU A 43  1 ? 12 
HELX_P HELX_P2  2  GLU A 67  ? GLY A 80  ? GLU A 67  GLY A 80  1 ? 14 
HELX_P HELX_P3  3  SER A 134 ? SER A 157 ? SER A 134 SER A 157 1 ? 24 
HELX_P HELX_P4  4  PHE A 158 ? GLY A 163 ? PHE A 158 GLY A 163 5 ? 6  
HELX_P HELX_P5  5  ASP A 168 ? LYS A 177 ? ASP A 168 LYS A 177 1 ? 10 
HELX_P HELX_P6  6  ASP A 187 ? ALA A 191 ? ASP A 187 ALA A 191 5 ? 5  
HELX_P HELX_P7  7  GLU A 197 ? ASN A 206 ? GLU A 197 ASN A 206 1 ? 10 
HELX_P HELX_P8  8  THR B 32  ? GLN B 45  ? THR B 32  GLN B 45  1 ? 14 
HELX_P HELX_P9  9  GLU B 67  ? GLY B 80  ? GLU B 67  GLY B 80  1 ? 14 
HELX_P HELX_P10 10 SER B 134 ? SER B 157 ? SER B 134 SER B 157 1 ? 24 
HELX_P HELX_P11 11 PHE B 158 ? GLY B 163 ? PHE B 158 GLY B 163 5 ? 6  
HELX_P HELX_P12 12 ASP B 168 ? LYS B 177 ? ASP B 168 LYS B 177 1 ? 10 
HELX_P HELX_P13 13 GLU B 197 ? ASN B 206 ? GLU B 197 ASN B 206 1 ? 10 
HELX_P HELX_P14 14 THR C 32  ? GLN C 45  ? THR C 32  GLN C 45  1 ? 14 
HELX_P HELX_P15 15 GLU C 67  ? GLY C 80  ? GLU C 67  GLY C 80  1 ? 14 
HELX_P HELX_P16 16 SER C 134 ? SER C 157 ? SER C 134 SER C 157 1 ? 24 
HELX_P HELX_P17 17 PHE C 158 ? GLY C 163 ? PHE C 158 GLY C 163 5 ? 6  
HELX_P HELX_P18 18 ASP C 168 ? LYS C 177 ? ASP C 168 LYS C 177 1 ? 10 
HELX_P HELX_P19 19 GLU C 197 ? ASN C 206 ? GLU C 197 ASN C 206 1 ? 10 
HELX_P HELX_P20 20 THR D 32  ? LEU D 43  ? THR D 32  LEU D 43  1 ? 12 
HELX_P HELX_P21 21 GLU D 67  ? GLY D 80  ? GLU D 67  GLY D 80  1 ? 14 
HELX_P HELX_P22 22 SER D 134 ? SER D 157 ? SER D 134 SER D 157 1 ? 24 
HELX_P HELX_P23 23 PHE D 158 ? LEU D 167 ? PHE D 158 LEU D 167 5 ? 10 
HELX_P HELX_P24 24 ASP D 168 ? LYS D 177 ? ASP D 168 LYS D 177 1 ? 10 
HELX_P HELX_P25 25 GLU D 197 ? ASN D 206 ? GLU D 197 ASN D 206 1 ? 10 
HELX_P HELX_P26 26 THR E 32  ? LEU E 43  ? THR E 32  LEU E 43  1 ? 12 
HELX_P HELX_P27 27 GLU E 67  ? GLY E 80  ? GLU E 67  GLY E 80  1 ? 14 
HELX_P HELX_P28 28 SER E 134 ? ARG E 156 ? SER E 134 ARG E 156 1 ? 23 
HELX_P HELX_P29 29 SER E 157 ? GLY E 163 ? SER E 157 GLY E 163 5 ? 7  
HELX_P HELX_P30 30 ASN E 164 ? LEU E 167 ? ASN E 164 LEU E 167 5 ? 4  
HELX_P HELX_P31 31 ASP E 168 ? LYS E 177 ? ASP E 168 LYS E 177 1 ? 10 
HELX_P HELX_P32 32 GLU E 197 ? ASN E 206 ? GLU E 197 ASN E 206 1 ? 10 
HELX_P HELX_P33 33 THR F 32  ? LEU F 43  ? THR F 32  LEU F 43  1 ? 12 
HELX_P HELX_P34 34 GLU F 67  ? PHE F 79  ? GLU F 67  PHE F 79  1 ? 13 
HELX_P HELX_P35 35 SER F 134 ? ARG F 156 ? SER F 134 ARG F 156 1 ? 23 
HELX_P HELX_P36 36 SER F 157 ? GLY F 163 ? SER F 157 GLY F 163 5 ? 7  
HELX_P HELX_P37 37 ASN F 164 ? LEU F 167 ? ASN F 164 LEU F 167 5 ? 4  
HELX_P HELX_P38 38 ASP F 168 ? LYS F 177 ? ASP F 168 LYS F 177 1 ? 10 
HELX_P HELX_P39 39 GLU F 197 ? ASN F 206 ? GLU F 197 ASN F 206 1 ? 10 
HELX_P HELX_P40 40 THR G 32  ? LEU G 43  ? THR G 32  LEU G 43  1 ? 12 
HELX_P HELX_P41 41 GLU G 67  ? GLY G 80  ? GLU G 67  GLY G 80  1 ? 14 
HELX_P HELX_P42 42 SER G 134 ? ARG G 156 ? SER G 134 ARG G 156 1 ? 23 
HELX_P HELX_P43 43 SER G 157 ? LEU G 167 ? SER G 157 LEU G 167 5 ? 11 
HELX_P HELX_P44 44 ASP G 168 ? LYS G 177 ? ASP G 168 LYS G 177 1 ? 10 
HELX_P HELX_P45 45 GLU G 197 ? ASN G 206 ? GLU G 197 ASN G 206 1 ? 10 
HELX_P HELX_P46 46 THR H 32  ? LEU H 43  ? THR H 32  LEU H 43  1 ? 12 
HELX_P HELX_P47 47 GLU H 67  ? PHE H 79  ? GLU H 67  PHE H 79  1 ? 13 
HELX_P HELX_P48 48 SER H 134 ? ARG H 156 ? SER H 134 ARG H 156 1 ? 23 
HELX_P HELX_P49 49 SER H 157 ? GLY H 163 ? SER H 157 GLY H 163 5 ? 7  
HELX_P HELX_P50 50 ASN H 164 ? LEU H 167 ? ASN H 164 LEU H 167 5 ? 4  
HELX_P HELX_P51 51 ASP H 168 ? LYS H 177 ? ASP H 168 LYS H 177 1 ? 10 
HELX_P HELX_P52 52 GLU H 197 ? ASN H 206 ? GLU H 197 ASN H 206 1 ? 10 
HELX_P HELX_P53 53 THR I 32  ? LEU I 43  ? THR I 32  LEU I 43  1 ? 12 
HELX_P HELX_P54 54 GLU I 67  ? GLY I 80  ? GLU I 67  GLY I 80  1 ? 14 
HELX_P HELX_P55 55 SER I 134 ? ARG I 156 ? SER I 134 ARG I 156 1 ? 23 
HELX_P HELX_P56 56 SER I 157 ? GLY I 163 ? SER I 157 GLY I 163 5 ? 7  
HELX_P HELX_P57 57 ASP I 168 ? LYS I 177 ? ASP I 168 LYS I 177 1 ? 10 
HELX_P HELX_P58 58 GLU I 197 ? ASN I 206 ? GLU I 197 ASN I 206 1 ? 10 
HELX_P HELX_P59 59 THR J 32  ? LEU J 43  ? THR J 32  LEU J 43  1 ? 12 
HELX_P HELX_P60 60 GLU J 67  ? GLY J 80  ? GLU J 67  GLY J 80  1 ? 14 
HELX_P HELX_P61 61 SER J 134 ? SER J 157 ? SER J 134 SER J 157 1 ? 24 
HELX_P HELX_P62 62 PHE J 158 ? LEU J 167 ? PHE J 158 LEU J 167 5 ? 10 
HELX_P HELX_P63 63 ASP J 168 ? LYS J 177 ? ASP J 168 LYS J 177 1 ? 10 
HELX_P HELX_P64 64 GLU J 197 ? ASN J 206 ? GLU J 197 ASN J 206 1 ? 10 
HELX_P HELX_P65 65 THR K 32  ? LEU K 43  ? THR K 32  LEU K 43  1 ? 12 
HELX_P HELX_P66 66 GLU K 67  ? GLY K 80  ? GLU K 67  GLY K 80  1 ? 14 
HELX_P HELX_P67 67 SER K 134 ? ARG K 156 ? SER K 134 ARG K 156 1 ? 23 
HELX_P HELX_P68 68 SER K 157 ? LEU K 167 ? SER K 157 LEU K 167 5 ? 11 
HELX_P HELX_P69 69 ASP K 168 ? LYS K 177 ? ASP K 168 LYS K 177 1 ? 10 
HELX_P HELX_P70 70 GLU K 197 ? ASN K 206 ? GLU K 197 ASN K 206 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 2 ? 
F ? 3 ? 
G ? 2 ? 
H ? 3 ? 
I ? 2 ? 
J ? 3 ? 
K ? 2 ? 
L ? 3 ? 
M ? 2 ? 
N ? 3 ? 
O ? 2 ? 
P ? 3 ? 
Q ? 2 ? 
R ? 3 ? 
S ? 2 ? 
T ? 3 ? 
U ? 2 ? 
V ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
O 1 2 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
Q 1 2 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
S 1 2 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
U 1 2 ? anti-parallel 
V 1 2 ? anti-parallel 
V 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 52  ? MET A 56  ? ILE A 52  MET A 56  
A 2 LYS A 62  ? ILE A 66  ? LYS A 62  ILE A 66  
B 1 TRP A 84  ? ASN A 99  ? TRP A 84  ASN A 99  
B 2 LYS A 102 ? LEU A 115 ? LYS A 102 LEU A 115 
B 3 TYR A 120 ? SER A 129 ? TYR A 120 SER A 129 
C 1 ILE B 52  ? MET B 56  ? ILE B 52  MET B 56  
C 2 LYS B 62  ? ILE B 66  ? LYS B 62  ILE B 66  
D 1 TRP B 84  ? ASN B 99  ? TRP B 84  ASN B 99  
D 2 LYS B 102 ? LEU B 115 ? LYS B 102 LEU B 115 
D 3 TYR B 120 ? SER B 129 ? TYR B 120 SER B 129 
E 1 ILE C 52  ? MET C 56  ? ILE C 52  MET C 56  
E 2 LYS C 62  ? ILE C 66  ? LYS C 62  ILE C 66  
F 1 TRP C 84  ? ASN C 99  ? TRP C 84  ASN C 99  
F 2 LYS C 102 ? LEU C 115 ? LYS C 102 LEU C 115 
F 3 TYR C 120 ? SER C 129 ? TYR C 120 SER C 129 
G 1 ILE D 52  ? MET D 56  ? ILE D 52  MET D 56  
G 2 LYS D 62  ? ILE D 66  ? LYS D 62  ILE D 66  
H 1 TRP D 84  ? ASN D 99  ? TRP D 84  ASN D 99  
H 2 LYS D 102 ? LEU D 115 ? LYS D 102 LEU D 115 
H 3 TYR D 120 ? SER D 129 ? TYR D 120 SER D 129 
I 1 ILE E 52  ? MET E 56  ? ILE E 52  MET E 56  
I 2 LYS E 62  ? ILE E 66  ? LYS E 62  ILE E 66  
J 1 TRP E 84  ? ASN E 99  ? TRP E 84  ASN E 99  
J 2 LYS E 102 ? LEU E 115 ? LYS E 102 LEU E 115 
J 3 TYR E 120 ? SER E 129 ? TYR E 120 SER E 129 
K 1 ILE F 52  ? MET F 56  ? ILE F 52  MET F 56  
K 2 LYS F 62  ? ILE F 66  ? LYS F 62  ILE F 66  
L 1 TRP F 84  ? ASN F 99  ? TRP F 84  ASN F 99  
L 2 LYS F 102 ? LEU F 115 ? LYS F 102 LEU F 115 
L 3 TYR F 120 ? SER F 129 ? TYR F 120 SER F 129 
M 1 ILE G 52  ? MET G 56  ? ILE G 52  MET G 56  
M 2 LYS G 62  ? ILE G 66  ? LYS G 62  ILE G 66  
N 1 TRP G 84  ? ASN G 99  ? TRP G 84  ASN G 99  
N 2 LYS G 102 ? LEU G 115 ? LYS G 102 LEU G 115 
N 3 TYR G 120 ? SER G 129 ? TYR G 120 SER G 129 
O 1 ILE H 52  ? MET H 56  ? ILE H 52  MET H 56  
O 2 LYS H 62  ? ILE H 66  ? LYS H 62  ILE H 66  
P 1 TRP H 84  ? ASN H 99  ? TRP H 84  ASN H 99  
P 2 LYS H 102 ? LEU H 115 ? LYS H 102 LEU H 115 
P 3 TYR H 120 ? SER H 129 ? TYR H 120 SER H 129 
Q 1 ILE I 52  ? MET I 56  ? ILE I 52  MET I 56  
Q 2 LYS I 62  ? ILE I 66  ? LYS I 62  ILE I 66  
R 1 TRP I 84  ? ASN I 99  ? TRP I 84  ASN I 99  
R 2 LYS I 102 ? LEU I 115 ? LYS I 102 LEU I 115 
R 3 TYR I 120 ? SER I 129 ? TYR I 120 SER I 129 
S 1 ILE J 52  ? MET J 56  ? ILE J 52  MET J 56  
S 2 LYS J 62  ? ILE J 66  ? LYS J 62  ILE J 66  
T 1 TRP J 84  ? ASN J 99  ? TRP J 84  ASN J 99  
T 2 LYS J 102 ? LEU J 115 ? LYS J 102 LEU J 115 
T 3 TYR J 120 ? SER J 129 ? TYR J 120 SER J 129 
U 1 ILE K 52  ? MET K 56  ? ILE K 52  MET K 56  
U 2 LYS K 62  ? ILE K 66  ? LYS K 62  ILE K 66  
V 1 TRP K 84  ? ASN K 99  ? TRP K 84  ASN K 99  
V 2 LYS K 102 ? LEU K 115 ? LYS K 102 LEU K 115 
V 3 TYR K 120 ? SER K 129 ? TYR K 120 SER K 129 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 55  ? N ARG A 55  O VAL A 63  ? O VAL A 63  
B 1 2 N ALA A 85  ? N ALA A 85  O GLN A 114 ? O GLN A 114 
B 2 3 N VAL A 107 ? N VAL A 107 O GLY A 127 ? O GLY A 127 
C 1 2 N ARG B 55  ? N ARG B 55  O VAL B 63  ? O VAL B 63  
D 1 2 N ALA B 85  ? N ALA B 85  O GLN B 114 ? O GLN B 114 
D 2 3 N VAL B 107 ? N VAL B 107 O GLY B 127 ? O GLY B 127 
E 1 2 N ARG C 55  ? N ARG C 55  O VAL C 63  ? O VAL C 63  
F 1 2 N ASP C 97  ? N ASP C 97  O TYR C 104 ? O TYR C 104 
F 2 3 N ALA C 109 ? N ALA C 109 O GLY C 125 ? O GLY C 125 
G 1 2 N ARG D 55  ? N ARG D 55  O VAL D 63  ? O VAL D 63  
H 1 2 N GLN D 90  ? N GLN D 90  O PHE D 110 ? O PHE D 110 
H 2 3 N VAL D 113 ? N VAL D 113 O HIS D 121 ? O HIS D 121 
I 1 2 N ARG E 55  ? N ARG E 55  O VAL E 63  ? O VAL E 63  
J 1 2 N GLN E 90  ? N GLN E 90  O PHE E 110 ? O PHE E 110 
J 2 3 N VAL E 107 ? N VAL E 107 O GLY E 127 ? O GLY E 127 
K 1 2 N ARG F 55  ? N ARG F 55  O VAL F 63  ? O VAL F 63  
L 1 2 N ALA F 85  ? N ALA F 85  O GLN F 114 ? O GLN F 114 
L 2 3 N VAL F 113 ? N VAL F 113 O HIS F 121 ? O HIS F 121 
M 1 2 N ARG G 55  ? N ARG G 55  O VAL G 63  ? O VAL G 63  
N 1 2 N GLN G 90  ? N GLN G 90  O PHE G 110 ? O PHE G 110 
N 2 3 N VAL G 107 ? N VAL G 107 O GLY G 127 ? O GLY G 127 
O 1 2 N ARG H 55  ? N ARG H 55  O VAL H 63  ? O VAL H 63  
P 1 2 N ALA H 85  ? N ALA H 85  O GLN H 114 ? O GLN H 114 
P 2 3 N VAL H 113 ? N VAL H 113 O HIS H 121 ? O HIS H 121 
Q 1 2 N ARG I 55  ? N ARG I 55  O VAL I 63  ? O VAL I 63  
R 1 2 N ALA I 85  ? N ALA I 85  O GLN I 114 ? O GLN I 114 
R 2 3 N VAL I 113 ? N VAL I 113 O HIS I 121 ? O HIS I 121 
S 1 2 N ARG J 55  ? N ARG J 55  O VAL J 63  ? O VAL J 63  
T 1 2 N ALA J 85  ? N ALA J 85  O GLN J 114 ? O GLN J 114 
T 2 3 N VAL J 107 ? N VAL J 107 O GLY J 127 ? O GLY J 127 
U 1 2 N ARG K 55  ? N ARG K 55  O VAL K 63  ? O VAL K 63  
V 1 2 N ALA K 85  ? N ALA K 85  O GLN K 114 ? O GLN K 114 
V 2 3 N VAL K 105 ? N VAL K 105 O SER K 129 ? O SER K 129 
# 
_database_PDB_matrix.entry_id          1KN0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KN0 
_atom_sites.fract_transf_matrix[1][1]   0.006868 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006868 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004040 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . CYS A 1 25  ? 104.015 26.341 111.897 1.00 86.67  ? 25  CYS A N   1 
ATOM   2     C CA  . CYS A 1 25  ? 102.520 26.400 111.863 1.00 86.67  ? 25  CYS A CA  1 
ATOM   3     C C   . CYS A 1 25  ? 101.975 27.464 110.886 1.00 86.67  ? 25  CYS A C   1 
ATOM   4     O O   . CYS A 1 25  ? 102.624 27.810 109.900 1.00 86.67  ? 25  CYS A O   1 
ATOM   5     C CB  . CYS A 1 25  ? 101.973 26.645 113.286 1.00 48.04  ? 25  CYS A CB  1 
ATOM   6     S SG  . CYS A 1 25  ? 102.362 28.272 114.069 1.00 48.04  ? 25  CYS A SG  1 
ATOM   7     N N   . PHE A 1 26  ? 100.781 27.978 111.164 1.00 44.04  ? 26  PHE A N   1 
ATOM   8     C CA  . PHE A 1 26  ? 100.149 28.978 110.309 1.00 44.04  ? 26  PHE A CA  1 
ATOM   9     C C   . PHE A 1 26  ? 100.717 30.362 110.560 1.00 44.04  ? 26  PHE A C   1 
ATOM   10    O O   . PHE A 1 26  ? 100.736 30.838 111.683 1.00 44.04  ? 26  PHE A O   1 
ATOM   11    C CB  . PHE A 1 26  ? 98.642  29.025 110.571 1.00 35.12  ? 26  PHE A CB  1 
ATOM   12    C CG  . PHE A 1 26  ? 97.864  29.682 109.476 1.00 35.12  ? 26  PHE A CG  1 
ATOM   13    C CD1 . PHE A 1 26  ? 97.483  28.959 108.353 1.00 35.12  ? 26  PHE A CD1 1 
ATOM   14    C CD2 . PHE A 1 26  ? 97.525  31.031 109.551 1.00 35.12  ? 26  PHE A CD2 1 
ATOM   15    C CE1 . PHE A 1 26  ? 96.764  29.565 107.303 1.00 35.12  ? 26  PHE A CE1 1 
ATOM   16    C CE2 . PHE A 1 26  ? 96.806  31.659 108.500 1.00 35.12  ? 26  PHE A CE2 1 
ATOM   17    C CZ  . PHE A 1 26  ? 96.424  30.922 107.374 1.00 35.12  ? 26  PHE A CZ  1 
ATOM   18    N N   . GLY A 1 27  ? 101.137 31.036 109.508 1.00 52.25  ? 27  GLY A N   1 
ATOM   19    C CA  . GLY A 1 27  ? 101.702 32.356 109.688 1.00 52.25  ? 27  GLY A CA  1 
ATOM   20    C C   . GLY A 1 27  ? 103.198 32.164 109.737 1.00 52.25  ? 27  GLY A C   1 
ATOM   21    O O   . GLY A 1 27  ? 103.962 33.086 109.469 1.00 52.25  ? 27  GLY A O   1 
ATOM   22    N N   . GLN A 1 28  ? 103.603 30.940 110.077 1.00 67.65  ? 28  GLN A N   1 
ATOM   23    C CA  . GLN A 1 28  ? 105.005 30.560 110.163 1.00 67.65  ? 28  GLN A CA  1 
ATOM   24    C C   . GLN A 1 28  ? 105.460 29.917 108.848 1.00 67.65  ? 28  GLN A C   1 
ATOM   25    O O   . GLN A 1 28  ? 106.340 30.435 108.173 1.00 67.65  ? 28  GLN A O   1 
ATOM   26    C CB  . GLN A 1 28  ? 105.217 29.571 111.309 1.00 152.81 ? 28  GLN A CB  1 
ATOM   27    C CG  . GLN A 1 28  ? 104.766 30.059 112.681 1.00 152.81 ? 28  GLN A CG  1 
ATOM   28    C CD  . GLN A 1 28  ? 105.608 31.199 113.234 1.00 152.81 ? 28  GLN A CD  1 
ATOM   29    O OE1 . GLN A 1 28  ? 105.491 31.549 114.409 1.00 152.81 ? 28  GLN A OE1 1 
ATOM   30    N NE2 . GLN A 1 28  ? 106.452 31.786 112.391 1.00 152.81 ? 28  GLN A NE2 1 
ATOM   31    N N   . CYS A 1 29  ? 104.848 28.797 108.482 1.00 78.91  ? 29  CYS A N   1 
ATOM   32    C CA  . CYS A 1 29  ? 105.195 28.078 107.254 1.00 78.91  ? 29  CYS A CA  1 
ATOM   33    C C   . CYS A 1 29  ? 105.558 28.947 106.046 1.00 78.91  ? 29  CYS A C   1 
ATOM   34    O O   . CYS A 1 29  ? 104.932 29.973 105.793 1.00 78.91  ? 29  CYS A O   1 
ATOM   35    C CB  . CYS A 1 29  ? 104.046 27.152 106.861 1.00 93.62  ? 29  CYS A CB  1 
ATOM   36    S SG  . CYS A 1 29  ? 103.653 25.903 108.093 1.00 93.62  ? 29  CYS A SG  1 
ATOM   37    N N   . GLN A 1 30  ? 106.576 28.519 105.304 1.00 71.87  ? 30  GLN A N   1 
ATOM   38    C CA  . GLN A 1 30  ? 107.027 29.218 104.109 1.00 71.87  ? 30  GLN A CA  1 
ATOM   39    C C   . GLN A 1 30  ? 106.780 28.310 102.908 1.00 71.87  ? 30  GLN A C   1 
ATOM   40    O O   . GLN A 1 30  ? 107.072 27.124 102.957 1.00 71.87  ? 30  GLN A O   1 
ATOM   41    C CB  . GLN A 1 30  ? 108.518 29.549 104.220 1.00 107.67 ? 30  GLN A CB  1 
ATOM   42    C CG  . GLN A 1 30  ? 108.827 30.600 105.273 1.00 107.67 ? 30  GLN A CG  1 
ATOM   43    C CD  . GLN A 1 30  ? 110.296 30.984 105.327 1.00 107.67 ? 30  GLN A CD  1 
ATOM   44    O OE1 . GLN A 1 30  ? 110.912 31.253 104.298 1.00 107.67 ? 30  GLN A OE1 1 
ATOM   45    N NE2 . GLN A 1 30  ? 110.860 31.028 106.536 1.00 107.67 ? 30  GLN A NE2 1 
ATOM   46    N N   . TYR A 1 31  ? 106.232 28.846 101.828 1.00 78.38  ? 31  TYR A N   1 
ATOM   47    C CA  . TYR A 1 31  ? 105.976 28.015 100.662 1.00 78.38  ? 31  TYR A CA  1 
ATOM   48    C C   . TYR A 1 31  ? 107.249 27.402 100.081 1.00 78.38  ? 31  TYR A C   1 
ATOM   49    O O   . TYR A 1 31  ? 108.304 28.036 100.058 1.00 78.38  ? 31  TYR A O   1 
ATOM   50    C CB  . TYR A 1 31  ? 105.271 28.824 99.572  1.00 56.18  ? 31  TYR A CB  1 
ATOM   51    C CG  . TYR A 1 31  ? 103.810 29.016 99.816  1.00 56.18  ? 31  TYR A CG  1 
ATOM   52    C CD1 . TYR A 1 31  ? 103.330 30.193 100.371 1.00 56.18  ? 31  TYR A CD1 1 
ATOM   53    C CD2 . TYR A 1 31  ? 102.900 28.006 99.519  1.00 56.18  ? 31  TYR A CD2 1 
ATOM   54    C CE1 . TYR A 1 31  ? 101.970 30.363 100.628 1.00 56.18  ? 31  TYR A CE1 1 
ATOM   55    C CE2 . TYR A 1 31  ? 101.545 28.159 99.770  1.00 56.18  ? 31  TYR A CE2 1 
ATOM   56    C CZ  . TYR A 1 31  ? 101.083 29.341 100.326 1.00 56.18  ? 31  TYR A CZ  1 
ATOM   57    O OH  . TYR A 1 31  ? 99.737  29.506 100.580 1.00 56.18  ? 31  TYR A OH  1 
ATOM   58    N N   . THR A 1 32  ? 107.150 26.162 99.614  1.00 86.53  ? 32  THR A N   1 
ATOM   59    C CA  . THR A 1 32  ? 108.298 25.500 99.001  1.00 86.53  ? 32  THR A CA  1 
ATOM   60    C C   . THR A 1 32  ? 108.286 25.891 97.538  1.00 86.53  ? 32  THR A C   1 
ATOM   61    O O   . THR A 1 32  ? 107.232 26.194 96.988  1.00 86.53  ? 32  THR A O   1 
ATOM   62    C CB  . THR A 1 32  ? 108.194 23.973 99.062  1.00 76.49  ? 32  THR A CB  1 
ATOM   63    O OG1 . THR A 1 32  ? 107.055 23.548 98.304  1.00 76.49  ? 32  THR A OG1 1 
ATOM   64    C CG2 . THR A 1 32  ? 108.067 23.500 100.498 1.00 76.49  ? 32  THR A CG2 1 
ATOM   65    N N   . ALA A 1 33  ? 109.450 25.870 96.903  1.00 48.52  ? 33  ALA A N   1 
ATOM   66    C CA  . ALA A 1 33  ? 109.538 26.243 95.500  1.00 48.52  ? 33  ALA A CA  1 
ATOM   67    C C   . ALA A 1 33  ? 108.475 25.550 94.647  1.00 48.52  ? 33  ALA A C   1 
ATOM   68    O O   . ALA A 1 33  ? 107.827 26.178 93.810  1.00 48.52  ? 33  ALA A O   1 
ATOM   69    C CB  . ALA A 1 33  ? 110.924 25.921 94.970  1.00 39.53  ? 33  ALA A CB  1 
ATOM   70    N N   . GLU A 1 34  ? 108.294 24.253 94.863  1.00 66.24  ? 34  GLU A N   1 
ATOM   71    C CA  . GLU A 1 34  ? 107.323 23.495 94.086  1.00 66.24  ? 34  GLU A CA  1 
ATOM   72    C C   . GLU A 1 34  ? 105.910 24.066 94.217  1.00 66.24  ? 34  GLU A C   1 
ATOM   73    O O   . GLU A 1 34  ? 105.249 24.352 93.211  1.00 66.24  ? 34  GLU A O   1 
ATOM   74    C CB  . GLU A 1 34  ? 107.314 22.020 94.522  1.00 125.36 ? 34  GLU A CB  1 
ATOM   75    C CG  . GLU A 1 34  ? 108.678 21.337 94.537  1.00 125.36 ? 34  GLU A CG  1 
ATOM   76    C CD  . GLU A 1 34  ? 109.348 21.363 95.908  1.00 125.36 ? 34  GLU A CD  1 
ATOM   77    O OE1 . GLU A 1 34  ? 108.799 20.757 96.858  1.00 125.36 ? 34  GLU A OE1 1 
ATOM   78    O OE2 . GLU A 1 34  ? 110.425 21.984 96.037  1.00 125.36 ? 34  GLU A OE2 1 
ATOM   79    N N   . GLU A 1 35  ? 105.456 24.234 95.462  1.00 57.01  ? 35  GLU A N   1 
ATOM   80    C CA  . GLU A 1 35  ? 104.110 24.734 95.717  1.00 57.01  ? 35  GLU A CA  1 
ATOM   81    C C   . GLU A 1 35  ? 103.960 26.166 95.225  1.00 57.01  ? 35  GLU A C   1 
ATOM   82    O O   . GLU A 1 35  ? 102.968 26.518 94.569  1.00 57.01  ? 35  GLU A O   1 
ATOM   83    C CB  . GLU A 1 35  ? 103.781 24.641 97.207  1.00 64.79  ? 35  GLU A CB  1 
ATOM   84    C CG  . GLU A 1 35  ? 102.311 24.868 97.483  1.00 64.79  ? 35  GLU A CG  1 
ATOM   85    C CD  . GLU A 1 35  ? 101.930 24.600 98.916  1.00 64.79  ? 35  GLU A CD  1 
ATOM   86    O OE1 . GLU A 1 35  ? 100.712 24.684 99.220  1.00 64.79  ? 35  GLU A OE1 1 
ATOM   87    O OE2 . GLU A 1 35  ? 102.845 24.311 99.727  1.00 64.79  ? 35  GLU A OE2 1 
ATOM   88    N N   . TYR A 1 36  ? 104.952 26.990 95.540  1.00 48.24  ? 36  TYR A N   1 
ATOM   89    C CA  . TYR A 1 36  ? 104.909 28.366 95.100  1.00 48.24  ? 36  TYR A CA  1 
ATOM   90    C C   . TYR A 1 36  ? 104.679 28.411 93.597  1.00 48.24  ? 36  TYR A C   1 
ATOM   91    O O   . TYR A 1 36  ? 103.742 29.040 93.103  1.00 48.24  ? 36  TYR A O   1 
ATOM   92    C CB  . TYR A 1 36  ? 106.215 29.102 95.393  1.00 83.07  ? 36  TYR A CB  1 
ATOM   93    C CG  . TYR A 1 36  ? 106.329 30.336 94.530  1.00 83.07  ? 36  TYR A CG  1 
ATOM   94    C CD1 . TYR A 1 36  ? 105.463 31.415 94.714  1.00 83.07  ? 36  TYR A CD1 1 
ATOM   95    C CD2 . TYR A 1 36  ? 107.207 30.375 93.450  1.00 83.07  ? 36  TYR A CD2 1 
ATOM   96    C CE1 . TYR A 1 36  ? 105.456 32.496 93.837  1.00 83.07  ? 36  TYR A CE1 1 
ATOM   97    C CE2 . TYR A 1 36  ? 107.211 31.453 92.565  1.00 83.07  ? 36  TYR A CE2 1 
ATOM   98    C CZ  . TYR A 1 36  ? 106.329 32.508 92.760  1.00 83.07  ? 36  TYR A CZ  1 
ATOM   99    O OH  . TYR A 1 36  ? 106.294 33.551 91.858  1.00 83.07  ? 36  TYR A OH  1 
ATOM   100   N N   . GLN A 1 37  ? 105.548 27.738 92.865  1.00 67.62  ? 37  GLN A N   1 
ATOM   101   C CA  . GLN A 1 37  ? 105.447 27.745 91.425  1.00 67.62  ? 37  GLN A CA  1 
ATOM   102   C C   . GLN A 1 37  ? 104.102 27.263 90.909  1.00 67.62  ? 37  GLN A C   1 
ATOM   103   O O   . GLN A 1 37  ? 103.514 27.890 90.026  1.00 67.62  ? 37  GLN A O   1 
ATOM   104   C CB  . GLN A 1 37  ? 106.558 26.900 90.828  1.00 91.96  ? 37  GLN A CB  1 
ATOM   105   C CG  . GLN A 1 37  ? 106.857 27.267 89.405  1.00 91.96  ? 37  GLN A CG  1 
ATOM   106   C CD  . GLN A 1 37  ? 107.902 26.380 88.790  1.00 91.96  ? 37  GLN A CD  1 
ATOM   107   O OE1 . GLN A 1 37  ? 108.489 26.727 87.773  1.00 91.96  ? 37  GLN A OE1 1 
ATOM   108   N NE2 . GLN A 1 37  ? 108.134 25.222 89.394  1.00 91.96  ? 37  GLN A NE2 1 
ATOM   109   N N   . ALA A 1 38  ? 103.614 26.153 91.453  1.00 62.46  ? 38  ALA A N   1 
ATOM   110   C CA  . ALA A 1 38  ? 102.340 25.608 91.006  1.00 62.46  ? 38  ALA A CA  1 
ATOM   111   C C   . ALA A 1 38  ? 101.203 26.598 91.236  1.00 62.46  ? 38  ALA A C   1 
ATOM   112   O O   . ALA A 1 38  ? 100.411 26.881 90.322  1.00 62.46  ? 38  ALA A O   1 
ATOM   113   C CB  . ALA A 1 38  ? 102.044 24.291 91.724  1.00 32.63  ? 38  ALA A CB  1 
ATOM   114   N N   . ILE A 1 39  ? 101.134 27.137 92.454  1.00 64.70  ? 39  ILE A N   1 
ATOM   115   C CA  . ILE A 1 39  ? 100.071 28.069 92.798  1.00 64.70  ? 39  ILE A CA  1 
ATOM   116   C C   . ILE A 1 39  ? 100.180 29.346 91.989  1.00 64.70  ? 39  ILE A C   1 
ATOM   117   O O   . ILE A 1 39  ? 99.181  29.870 91.501  1.00 64.70  ? 39  ILE A O   1 
ATOM   118   C CB  . ILE A 1 39  ? 100.075 28.361 94.323  1.00 49.61  ? 39  ILE A CB  1 
ATOM   119   C CG1 . ILE A 1 39  ? 99.582  27.115 95.076  1.00 49.61  ? 39  ILE A CG1 1 
ATOM   120   C CG2 . ILE A 1 39  ? 99.197  29.566 94.648  1.00 49.61  ? 39  ILE A CG2 1 
ATOM   121   C CD1 . ILE A 1 39  ? 99.661  27.214 96.571  1.00 49.61  ? 39  ILE A CD1 1 
ATOM   122   N N   . GLN A 1 40  ? 101.400 29.833 91.818  1.00 50.84  ? 40  GLN A N   1 
ATOM   123   C CA  . GLN A 1 40  ? 101.602 31.069 91.065  1.00 50.84  ? 40  GLN A CA  1 
ATOM   124   C C   . GLN A 1 40  ? 101.048 30.925 89.651  1.00 50.84  ? 40  GLN A C   1 
ATOM   125   O O   . GLN A 1 40  ? 100.449 31.850 89.107  1.00 50.84  ? 40  GLN A O   1 
ATOM   126   C CB  . GLN A 1 40  ? 103.094 31.435 91.016  1.00 52.00  ? 40  GLN A CB  1 
ATOM   127   C CG  . GLN A 1 40  ? 103.411 32.611 90.110  1.00 52.00  ? 40  GLN A CG  1 
ATOM   128   C CD  . GLN A 1 40  ? 102.869 33.919 90.638  1.00 52.00  ? 40  GLN A CD  1 
ATOM   129   O OE1 . GLN A 1 40  ? 101.921 33.937 91.415  1.00 52.00  ? 40  GLN A OE1 1 
ATOM   130   N NE2 . GLN A 1 40  ? 103.462 35.028 90.208  1.00 52.00  ? 40  GLN A NE2 1 
ATOM   131   N N   . LYS A 1 41  ? 101.240 29.757 89.056  1.00 56.87  ? 41  LYS A N   1 
ATOM   132   C CA  . LYS A 1 41  ? 100.738 29.535 87.714  1.00 56.87  ? 41  LYS A CA  1 
ATOM   133   C C   . LYS A 1 41  ? 99.225  29.407 87.753  1.00 56.87  ? 41  LYS A C   1 
ATOM   134   O O   . LYS A 1 41  ? 98.517  30.138 87.072  1.00 56.87  ? 41  LYS A O   1 
ATOM   135   C CB  . LYS A 1 41  ? 101.351 28.271 87.111  1.00 110.34 ? 41  LYS A CB  1 
ATOM   136   C CG  . LYS A 1 41  ? 102.857 28.341 86.927  1.00 110.34 ? 41  LYS A CG  1 
ATOM   137   C CD  . LYS A 1 41  ? 103.377 27.132 86.151  1.00 110.34 ? 41  LYS A CD  1 
ATOM   138   C CE  . LYS A 1 41  ? 104.893 27.182 85.992  1.00 110.34 ? 41  LYS A CE  1 
ATOM   139   N NZ  . LYS A 1 41  ? 105.350 28.462 85.377  1.00 110.34 ? 41  LYS A NZ  1 
ATOM   140   N N   . ALA A 1 42  ? 98.739  28.480 88.571  1.00 68.56  ? 42  ALA A N   1 
ATOM   141   C CA  . ALA A 1 42  ? 97.307  28.231 88.702  1.00 68.56  ? 42  ALA A CA  1 
ATOM   142   C C   . ALA A 1 42  ? 96.449  29.484 88.898  1.00 68.56  ? 42  ALA A C   1 
ATOM   143   O O   . ALA A 1 42  ? 95.407  29.638 88.261  1.00 68.56  ? 42  ALA A O   1 
ATOM   144   C CB  . ALA A 1 42  ? 97.060  27.253 89.850  1.00 36.76  ? 42  ALA A CB  1 
ATOM   145   N N   . LEU A 1 43  ? 96.881  30.380 89.780  1.00 52.94  ? 43  LEU A N   1 
ATOM   146   C CA  . LEU A 1 43  ? 96.123  31.594 90.062  1.00 52.94  ? 43  LEU A CA  1 
ATOM   147   C C   . LEU A 1 43  ? 95.879  32.456 88.830  1.00 52.94  ? 43  LEU A C   1 
ATOM   148   O O   . LEU A 1 43  ? 94.924  33.243 88.798  1.00 52.94  ? 43  LEU A O   1 
ATOM   149   C CB  . LEU A 1 43  ? 96.823  32.401 91.162  1.00 44.55  ? 43  LEU A CB  1 
ATOM   150   C CG  . LEU A 1 43  ? 96.656  31.832 92.576  1.00 44.55  ? 43  LEU A CG  1 
ATOM   151   C CD1 . LEU A 1 43  ? 97.607  32.524 93.522  1.00 44.55  ? 43  LEU A CD1 1 
ATOM   152   C CD2 . LEU A 1 43  ? 95.230  32.013 93.037  1.00 44.55  ? 43  LEU A CD2 1 
ATOM   153   N N   . ARG A 1 44  ? 96.737  32.316 87.818  1.00 51.66  ? 44  ARG A N   1 
ATOM   154   C CA  . ARG A 1 44  ? 96.576  33.075 86.577  1.00 51.66  ? 44  ARG A CA  1 
ATOM   155   C C   . ARG A 1 44  ? 95.323  32.646 85.790  1.00 51.66  ? 44  ARG A C   1 
ATOM   156   O O   . ARG A 1 44  ? 94.651  33.488 85.182  1.00 51.66  ? 44  ARG A O   1 
ATOM   157   C CB  . ARG A 1 44  ? 97.821  32.947 85.696  1.00 57.20  ? 44  ARG A CB  1 
ATOM   158   C CG  . ARG A 1 44  ? 98.956  33.850 86.136  1.00 57.20  ? 44  ARG A CG  1 
ATOM   159   C CD  . ARG A 1 44  ? 100.100 33.874 85.128  1.00 57.20  ? 44  ARG A CD  1 
ATOM   160   N NE  . ARG A 1 44  ? 101.103 32.835 85.351  1.00 57.20  ? 44  ARG A NE  1 
ATOM   161   C CZ  . ARG A 1 44  ? 102.306 33.059 85.882  1.00 57.20  ? 44  ARG A CZ  1 
ATOM   162   N NH1 . ARG A 1 44  ? 102.660 34.288 86.252  1.00 57.20  ? 44  ARG A NH1 1 
ATOM   163   N NH2 . ARG A 1 44  ? 103.172 32.055 86.025  1.00 57.20  ? 44  ARG A NH2 1 
ATOM   164   N N   . GLN A 1 45  ? 94.997  31.354 85.817  1.00 45.05  ? 45  GLN A N   1 
ATOM   165   C CA  . GLN A 1 45  ? 93.820  30.862 85.109  1.00 45.05  ? 45  GLN A CA  1 
ATOM   166   C C   . GLN A 1 45  ? 92.617  31.790 85.237  1.00 45.05  ? 45  GLN A C   1 
ATOM   167   O O   . GLN A 1 45  ? 92.496  32.533 86.200  1.00 45.05  ? 45  GLN A O   1 
ATOM   168   C CB  . GLN A 1 45  ? 93.401  29.500 85.635  1.00 59.65  ? 45  GLN A CB  1 
ATOM   169   C CG  . GLN A 1 45  ? 94.370  28.392 85.372  1.00 59.65  ? 45  GLN A CG  1 
ATOM   170   C CD  . GLN A 1 45  ? 93.962  27.144 86.100  1.00 59.65  ? 45  GLN A CD  1 
ATOM   171   O OE1 . GLN A 1 45  ? 94.118  27.043 87.313  1.00 59.65  ? 45  GLN A OE1 1 
ATOM   172   N NE2 . GLN A 1 45  ? 93.411  26.188 85.369  1.00 59.65  ? 45  GLN A NE2 1 
ATOM   173   N N   . ARG A 1 46  ? 91.722  31.743 84.260  1.00 49.16  ? 46  ARG A N   1 
ATOM   174   C CA  . ARG A 1 46  ? 90.514  32.550 84.297  1.00 49.16  ? 46  ARG A CA  1 
ATOM   175   C C   . ARG A 1 46  ? 89.382  31.565 84.558  1.00 49.16  ? 46  ARG A C   1 
ATOM   176   O O   . ARG A 1 46  ? 89.459  30.411 84.140  1.00 49.16  ? 46  ARG A O   1 
ATOM   177   C CB  . ARG A 1 46  ? 90.299  33.250 82.964  1.00 95.10  ? 46  ARG A CB  1 
ATOM   178   C CG  . ARG A 1 46  ? 91.219  34.415 82.722  1.00 95.10  ? 46  ARG A CG  1 
ATOM   179   C CD  . ARG A 1 46  ? 90.422  35.535 82.089  1.00 95.10  ? 46  ARG A CD  1 
ATOM   180   N NE  . ARG A 1 46  ? 91.165  36.781 81.970  1.00 95.10  ? 46  ARG A NE  1 
ATOM   181   C CZ  . ARG A 1 46  ? 92.226  36.945 81.189  1.00 95.10  ? 46  ARG A CZ  1 
ATOM   182   N NH1 . ARG A 1 46  ? 92.678  35.936 80.450  1.00 95.10  ? 46  ARG A NH1 1 
ATOM   183   N NH2 . ARG A 1 46  ? 92.828  38.126 81.142  1.00 95.10  ? 46  ARG A NH2 1 
ATOM   184   N N   . LEU A 1 47  ? 88.330  31.999 85.242  1.00 65.15  ? 47  LEU A N   1 
ATOM   185   C CA  . LEU A 1 47  ? 87.244  31.078 85.545  1.00 65.15  ? 47  LEU A CA  1 
ATOM   186   C C   . LEU A 1 47  ? 86.328  30.759 84.373  1.00 65.15  ? 47  LEU A C   1 
ATOM   187   O O   . LEU A 1 47  ? 85.991  31.624 83.563  1.00 65.15  ? 47  LEU A O   1 
ATOM   188   C CB  . LEU A 1 47  ? 86.399  31.584 86.727  1.00 63.45  ? 47  LEU A CB  1 
ATOM   189   C CG  . LEU A 1 47  ? 86.984  31.548 88.145  1.00 63.45  ? 47  LEU A CG  1 
ATOM   190   C CD1 . LEU A 1 47  ? 87.587  30.183 88.420  1.00 63.45  ? 47  LEU A CD1 1 
ATOM   191   C CD2 . LEU A 1 47  ? 88.048  32.608 88.287  1.00 63.45  ? 47  LEU A CD2 1 
ATOM   192   N N   . GLY A 1 48  ? 85.938  29.492 84.290  1.00 64.99  ? 48  GLY A N   1 
ATOM   193   C CA  . GLY A 1 48  ? 85.040  29.067 83.242  1.00 64.99  ? 48  GLY A CA  1 
ATOM   194   C C   . GLY A 1 48  ? 83.645  29.579 83.555  1.00 64.99  ? 48  GLY A C   1 
ATOM   195   O O   . GLY A 1 48  ? 83.414  30.156 84.620  1.00 64.99  ? 48  GLY A O   1 
ATOM   196   N N   . PRO A 1 49  ? 82.689  29.401 82.635  1.00 71.06  ? 49  PRO A N   1 
ATOM   197   C CA  . PRO A 1 49  ? 81.320  29.866 82.863  1.00 71.06  ? 49  PRO A CA  1 
ATOM   198   C C   . PRO A 1 49  ? 80.622  29.055 83.947  1.00 71.06  ? 49  PRO A C   1 
ATOM   199   O O   . PRO A 1 49  ? 79.510  29.372 84.357  1.00 71.06  ? 49  PRO A O   1 
ATOM   200   C CB  . PRO A 1 49  ? 80.665  29.681 81.497  1.00 67.17  ? 49  PRO A CB  1 
ATOM   201   C CG  . PRO A 1 49  ? 81.813  29.834 80.554  1.00 67.17  ? 49  PRO A CG  1 
ATOM   202   C CD  . PRO A 1 49  ? 82.877  29.025 81.223  1.00 67.17  ? 49  PRO A CD  1 
ATOM   203   N N   . GLU A 1 50  ? 81.275  27.999 84.404  1.00 62.03  ? 50  GLU A N   1 
ATOM   204   C CA  . GLU A 1 50  ? 80.695  27.163 85.436  1.00 62.03  ? 50  GLU A CA  1 
ATOM   205   C C   . GLU A 1 50  ? 80.760  27.863 86.779  1.00 62.03  ? 50  GLU A C   1 
ATOM   206   O O   . GLU A 1 50  ? 80.116  27.429 87.732  1.00 62.03  ? 50  GLU A O   1 
ATOM   207   C CB  . GLU A 1 50  ? 81.439  25.829 85.540  1.00 68.32  ? 50  GLU A CB  1 
ATOM   208   C CG  . GLU A 1 50  ? 81.570  25.083 84.239  1.00 68.32  ? 50  GLU A CG  1 
ATOM   209   C CD  . GLU A 1 50  ? 82.760  25.530 83.420  1.00 68.32  ? 50  GLU A CD  1 
ATOM   210   O OE1 . GLU A 1 50  ? 83.008  26.753 83.301  1.00 68.32  ? 50  GLU A OE1 1 
ATOM   211   O OE2 . GLU A 1 50  ? 83.446  24.637 82.884  1.00 68.32  ? 50  GLU A OE2 1 
ATOM   212   N N   . TYR A 1 51  ? 81.542  28.939 86.850  1.00 80.33  ? 51  TYR A N   1 
ATOM   213   C CA  . TYR A 1 51  ? 81.707  29.696 88.087  1.00 80.33  ? 51  TYR A CA  1 
ATOM   214   C C   . TYR A 1 51  ? 80.881  30.975 88.172  1.00 80.33  ? 51  TYR A C   1 
ATOM   215   O O   . TYR A 1 51  ? 80.469  31.392 89.259  1.00 80.33  ? 51  TYR A O   1 
ATOM   216   C CB  . TYR A 1 51  ? 83.182  30.044 88.291  1.00 66.28  ? 51  TYR A CB  1 
ATOM   217   C CG  . TYR A 1 51  ? 84.048  28.862 88.664  1.00 66.28  ? 51  TYR A CG  1 
ATOM   218   C CD1 . TYR A 1 51  ? 84.935  28.301 87.747  1.00 66.28  ? 51  TYR A CD1 1 
ATOM   219   C CD2 . TYR A 1 51  ? 83.964  28.288 89.934  1.00 66.28  ? 51  TYR A CD2 1 
ATOM   220   C CE1 . TYR A 1 51  ? 85.719  27.193 88.087  1.00 66.28  ? 51  TYR A CE1 1 
ATOM   221   C CE2 . TYR A 1 51  ? 84.737  27.183 90.286  1.00 66.28  ? 51  TYR A CE2 1 
ATOM   222   C CZ  . TYR A 1 51  ? 85.611  26.641 89.361  1.00 66.28  ? 51  TYR A CZ  1 
ATOM   223   O OH  . TYR A 1 51  ? 86.371  25.550 89.707  1.00 66.28  ? 51  TYR A OH  1 
ATOM   224   N N   . ILE A 1 52  ? 80.632  31.596 87.027  1.00 63.06  ? 52  ILE A N   1 
ATOM   225   C CA  . ILE A 1 52  ? 79.872  32.840 86.987  1.00 63.06  ? 52  ILE A CA  1 
ATOM   226   C C   . ILE A 1 52  ? 78.351  32.686 87.171  1.00 63.06  ? 52  ILE A C   1 
ATOM   227   O O   . ILE A 1 52  ? 77.767  31.627 86.916  1.00 63.06  ? 52  ILE A O   1 
ATOM   228   C CB  . ILE A 1 52  ? 80.145  33.582 85.669  1.00 47.91  ? 52  ILE A CB  1 
ATOM   229   C CG1 . ILE A 1 52  ? 81.636  33.474 85.312  1.00 47.91  ? 52  ILE A CG1 1 
ATOM   230   C CG2 . ILE A 1 52  ? 79.703  35.030 85.784  1.00 47.91  ? 52  ILE A CG2 1 
ATOM   231   C CD1 . ILE A 1 52  ? 82.589  33.938 86.388  1.00 47.91  ? 52  ILE A CD1 1 
ATOM   232   N N   . SER A 1 53  ? 77.723  33.759 87.638  1.00 63.40  ? 53  SER A N   1 
ATOM   233   C CA  . SER A 1 53  ? 76.280  33.808 87.868  1.00 63.40  ? 53  SER A CA  1 
ATOM   234   C C   . SER A 1 53  ? 75.874  35.235 87.517  1.00 63.40  ? 53  SER A C   1 
ATOM   235   O O   . SER A 1 53  ? 76.729  36.052 87.126  1.00 63.40  ? 53  SER A O   1 
ATOM   236   C CB  . SER A 1 53  ? 75.944  33.543 89.344  1.00 61.49  ? 53  SER A CB  1 
ATOM   237   O OG  . SER A 1 53  ? 76.345  32.248 89.763  1.00 61.49  ? 53  SER A OG  1 
ATOM   238   N N   . SER A 1 54  ? 74.584  35.545 87.652  1.00 82.66  ? 54  SER A N   1 
ATOM   239   C CA  . SER A 1 54  ? 74.113  36.898 87.351  1.00 82.66  ? 54  SER A CA  1 
ATOM   240   C C   . SER A 1 54  ? 72.845  37.298 88.081  1.00 82.66  ? 54  SER A C   1 
ATOM   241   O O   . SER A 1 54  ? 72.034  36.453 88.469  1.00 82.66  ? 54  SER A O   1 
ATOM   242   C CB  . SER A 1 54  ? 73.900  37.080 85.847  1.00 81.99  ? 54  SER A CB  1 
ATOM   243   O OG  . SER A 1 54  ? 72.880  36.228 85.373  1.00 81.99  ? 54  SER A OG  1 
ATOM   244   N N   . ARG A 1 55  ? 72.713  38.608 88.271  1.00 114.64 ? 55  ARG A N   1 
ATOM   245   C CA  . ARG A 1 55  ? 71.571  39.228 88.930  1.00 114.64 ? 55  ARG A CA  1 
ATOM   246   C C   . ARG A 1 55  ? 71.178  40.393 88.044  1.00 114.64 ? 55  ARG A C   1 
ATOM   247   O O   . ARG A 1 55  ? 71.968  40.834 87.204  1.00 114.64 ? 55  ARG A O   1 
ATOM   248   C CB  . ARG A 1 55  ? 71.962  39.774 90.299  1.00 135.14 ? 55  ARG A CB  1 
ATOM   249   C CG  . ARG A 1 55  ? 72.164  38.736 91.378  1.00 135.14 ? 55  ARG A CG  1 
ATOM   250   C CD  . ARG A 1 55  ? 73.278  39.182 92.312  1.00 135.14 ? 55  ARG A CD  1 
ATOM   251   N NE  . ARG A 1 55  ? 73.297  40.632 92.493  1.00 135.14 ? 55  ARG A NE  1 
ATOM   252   C CZ  . ARG A 1 55  ? 74.320  41.308 93.010  1.00 135.14 ? 55  ARG A CZ  1 
ATOM   253   N NH1 . ARG A 1 55  ? 75.417  40.667 93.404  1.00 135.14 ? 55  ARG A NH1 1 
ATOM   254   N NH2 . ARG A 1 55  ? 74.250  42.628 93.126  1.00 135.14 ? 55  ARG A NH2 1 
ATOM   255   N N   . MET A 1 56  ? 69.966  40.899 88.234  1.00 116.37 ? 56  MET A N   1 
ATOM   256   C CA  . MET A 1 56  ? 69.504  42.019 87.431  1.00 116.37 ? 56  MET A CA  1 
ATOM   257   C C   . MET A 1 56  ? 69.660  43.305 88.222  1.00 116.37 ? 56  MET A C   1 
ATOM   258   O O   . MET A 1 56  ? 68.882  43.585 89.129  1.00 116.37 ? 56  MET A O   1 
ATOM   259   C CB  . MET A 1 56  ? 68.043  41.817 87.021  1.00 136.21 ? 56  MET A CB  1 
ATOM   260   C CG  . MET A 1 56  ? 67.690  42.496 85.717  1.00 136.21 ? 56  MET A CG  1 
ATOM   261   S SD  . MET A 1 56  ? 68.953  42.135 84.488  1.00 136.21 ? 56  MET A SD  1 
ATOM   262   C CE  . MET A 1 56  ? 68.696  40.362 84.223  1.00 136.21 ? 56  MET A CE  1 
ATOM   263   N N   . ALA A 1 57  ? 70.687  44.076 87.883  1.00 162.77 ? 57  ALA A N   1 
ATOM   264   C CA  . ALA A 1 57  ? 70.951  45.334 88.563  1.00 162.77 ? 57  ALA A CA  1 
ATOM   265   C C   . ALA A 1 57  ? 69.695  46.191 88.554  1.00 162.77 ? 57  ALA A C   1 
ATOM   266   O O   . ALA A 1 57  ? 69.043  46.332 87.519  1.00 162.77 ? 57  ALA A O   1 
ATOM   267   C CB  . ALA A 1 57  ? 72.090  46.065 87.875  1.00 73.41  ? 57  ALA A CB  1 
ATOM   268   N N   . GLY A 1 58  ? 69.353  46.749 89.712  1.00 197.62 ? 58  GLY A N   1 
ATOM   269   C CA  . GLY A 1 58  ? 68.175  47.591 89.807  1.00 197.62 ? 58  GLY A CA  1 
ATOM   270   C C   . GLY A 1 58  ? 68.243  48.698 88.777  1.00 197.62 ? 58  GLY A C   1 
ATOM   271   O O   . GLY A 1 58  ? 68.892  49.722 88.998  1.00 197.62 ? 58  GLY A O   1 
ATOM   272   N N   . GLY A 1 59  ? 67.574  48.491 87.646  1.00 136.06 ? 59  GLY A N   1 
ATOM   273   C CA  . GLY A 1 59  ? 67.591  49.483 86.587  1.00 136.06 ? 59  GLY A CA  1 
ATOM   274   C C   . GLY A 1 59  ? 68.770  49.245 85.666  1.00 136.06 ? 59  GLY A C   1 
ATOM   275   O O   . GLY A 1 59  ? 68.683  49.470 84.461  1.00 136.06 ? 59  GLY A O   1 
ATOM   276   N N   . GLY A 1 60  ? 69.876  48.783 86.244  1.00 139.54 ? 60  GLY A N   1 
ATOM   277   C CA  . GLY A 1 60  ? 71.067  48.506 85.464  1.00 139.54 ? 60  GLY A CA  1 
ATOM   278   C C   . GLY A 1 60  ? 70.939  47.239 84.636  1.00 139.54 ? 60  GLY A C   1 
ATOM   279   O O   . GLY A 1 60  ? 69.859  46.655 84.532  1.00 139.54 ? 60  GLY A O   1 
ATOM   280   N N   . GLN A 1 61  ? 72.048  46.808 84.045  1.00 155.75 ? 61  GLN A N   1 
ATOM   281   C CA  . GLN A 1 61  ? 72.044  45.612 83.217  1.00 155.75 ? 61  GLN A CA  1 
ATOM   282   C C   . GLN A 1 61  ? 72.237  44.358 84.053  1.00 155.75 ? 61  GLN A C   1 
ATOM   283   O O   . GLN A 1 61  ? 71.903  44.317 85.237  1.00 155.75 ? 61  GLN A O   1 
ATOM   284   C CB  . GLN A 1 61  ? 73.155  45.679 82.162  1.00 134.05 ? 61  GLN A CB  1 
ATOM   285   C CG  . GLN A 1 61  ? 73.123  46.902 81.259  1.00 134.05 ? 61  GLN A CG  1 
ATOM   286   C CD  . GLN A 1 61  ? 73.875  48.085 81.841  1.00 134.05 ? 61  GLN A CD  1 
ATOM   287   O OE1 . GLN A 1 61  ? 73.546  48.581 82.917  1.00 134.05 ? 61  GLN A OE1 1 
ATOM   288   N NE2 . GLN A 1 61  ? 74.897  48.542 81.128  1.00 134.05 ? 61  GLN A NE2 1 
ATOM   289   N N   . LYS A 1 62  ? 72.784  43.337 83.406  1.00 114.97 ? 62  LYS A N   1 
ATOM   290   C CA  . LYS A 1 62  ? 73.060  42.055 84.028  1.00 114.97 ? 62  LYS A CA  1 
ATOM   291   C C   . LYS A 1 62  ? 74.409  42.127 84.730  1.00 114.97 ? 62  LYS A C   1 
ATOM   292   O O   . LYS A 1 62  ? 75.424  42.435 84.103  1.00 114.97 ? 62  LYS A O   1 
ATOM   293   C CB  . LYS A 1 62  ? 73.086  40.973 82.948  1.00 93.95  ? 62  LYS A CB  1 
ATOM   294   C CG  . LYS A 1 62  ? 73.647  39.642 83.383  1.00 93.95  ? 62  LYS A CG  1 
ATOM   295   C CD  . LYS A 1 62  ? 73.801  38.728 82.188  1.00 93.95  ? 62  LYS A CD  1 
ATOM   296   C CE  . LYS A 1 62  ? 74.439  37.415 82.584  1.00 93.95  ? 62  LYS A CE  1 
ATOM   297   N NZ  . LYS A 1 62  ? 74.593  36.501 81.420  1.00 93.95  ? 62  LYS A NZ  1 
ATOM   298   N N   . VAL A 1 63  ? 74.418  41.856 86.031  1.00 87.89  ? 63  VAL A N   1 
ATOM   299   C CA  . VAL A 1 63  ? 75.661  41.885 86.788  1.00 87.89  ? 63  VAL A CA  1 
ATOM   300   C C   . VAL A 1 63  ? 76.155  40.480 87.110  1.00 87.89  ? 63  VAL A C   1 
ATOM   301   O O   . VAL A 1 63  ? 75.445  39.686 87.733  1.00 87.89  ? 63  VAL A O   1 
ATOM   302   C CB  . VAL A 1 63  ? 75.501  42.662 88.090  1.00 76.76  ? 63  VAL A CB  1 
ATOM   303   C CG1 . VAL A 1 63  ? 76.815  42.674 88.844  1.00 76.76  ? 63  VAL A CG1 1 
ATOM   304   C CG2 . VAL A 1 63  ? 75.079  44.081 87.782  1.00 76.76  ? 63  VAL A CG2 1 
ATOM   305   N N   . CYS A 1 64  ? 77.379  40.191 86.673  1.00 81.29  ? 64  CYS A N   1 
ATOM   306   C CA  . CYS A 1 64  ? 78.003  38.893 86.888  1.00 81.29  ? 64  CYS A CA  1 
ATOM   307   C C   . CYS A 1 64  ? 78.765  38.843 88.212  1.00 81.29  ? 64  CYS A C   1 
ATOM   308   O O   . CYS A 1 64  ? 79.380  39.827 88.632  1.00 81.29  ? 64  CYS A O   1 
ATOM   309   C CB  . CYS A 1 64  ? 78.954  38.579 85.729  1.00 114.43 ? 64  CYS A CB  1 
ATOM   310   S SG  . CYS A 1 64  ? 78.152  38.548 84.109  1.00 114.43 ? 64  CYS A SG  1 
ATOM   311   N N   . TYR A 1 65  ? 78.721  37.685 88.863  1.00 62.81  ? 65  TYR A N   1 
ATOM   312   C CA  . TYR A 1 65  ? 79.393  37.501 90.140  1.00 62.81  ? 65  TYR A CA  1 
ATOM   313   C C   . TYR A 1 65  ? 79.611  36.022 90.414  1.00 62.81  ? 65  TYR A C   1 
ATOM   314   O O   . TYR A 1 65  ? 79.020  35.159 89.764  1.00 62.81  ? 65  TYR A O   1 
ATOM   315   C CB  . TYR A 1 65  ? 78.542  38.097 91.256  1.00 70.71  ? 65  TYR A CB  1 
ATOM   316   C CG  . TYR A 1 65  ? 77.305  37.288 91.560  1.00 70.71  ? 65  TYR A CG  1 
ATOM   317   C CD1 . TYR A 1 65  ? 77.342  36.235 92.473  1.00 70.71  ? 65  TYR A CD1 1 
ATOM   318   C CD2 . TYR A 1 65  ? 76.106  37.549 90.909  1.00 70.71  ? 65  TYR A CD2 1 
ATOM   319   C CE1 . TYR A 1 65  ? 76.211  35.460 92.730  1.00 70.71  ? 65  TYR A CE1 1 
ATOM   320   C CE2 . TYR A 1 65  ? 74.972  36.779 91.157  1.00 70.71  ? 65  TYR A CE2 1 
ATOM   321   C CZ  . TYR A 1 65  ? 75.032  35.740 92.066  1.00 70.71  ? 65  TYR A CZ  1 
ATOM   322   O OH  . TYR A 1 65  ? 73.917  34.980 92.302  1.00 70.71  ? 65  TYR A OH  1 
ATOM   323   N N   . ILE A 1 66  ? 80.463  35.735 91.390  1.00 55.72  ? 66  ILE A N   1 
ATOM   324   C CA  . ILE A 1 66  ? 80.727  34.358 91.756  1.00 55.72  ? 66  ILE A CA  1 
ATOM   325   C C   . ILE A 1 66  ? 80.093  34.112 93.117  1.00 55.72  ? 66  ILE A C   1 
ATOM   326   O O   . ILE A 1 66  ? 80.269  34.899 94.055  1.00 55.72  ? 66  ILE A O   1 
ATOM   327   C CB  . ILE A 1 66  ? 82.221  34.090 91.830  1.00 50.88  ? 66  ILE A CB  1 
ATOM   328   C CG1 . ILE A 1 66  ? 82.903  34.642 90.575  1.00 50.88  ? 66  ILE A CG1 1 
ATOM   329   C CG2 . ILE A 1 66  ? 82.451  32.604 91.987  1.00 50.88  ? 66  ILE A CG2 1 
ATOM   330   C CD1 . ILE A 1 66  ? 84.410  34.445 90.534  1.00 50.88  ? 66  ILE A CD1 1 
ATOM   331   N N   . GLU A 1 67  ? 79.327  33.032 93.209  1.00 72.28  ? 67  GLU A N   1 
ATOM   332   C CA  . GLU A 1 67  ? 78.656  32.688 94.451  1.00 72.28  ? 67  GLU A CA  1 
ATOM   333   C C   . GLU A 1 67  ? 79.701  32.373 95.499  1.00 72.28  ? 67  GLU A C   1 
ATOM   334   O O   . GLU A 1 67  ? 80.801  31.918 95.185  1.00 72.28  ? 67  GLU A O   1 
ATOM   335   C CB  . GLU A 1 67  ? 77.728  31.493 94.246  1.00 112.15 ? 67  GLU A CB  1 
ATOM   336   C CG  . GLU A 1 67  ? 76.588  31.778 93.290  1.00 112.15 ? 67  GLU A CG  1 
ATOM   337   C CD  . GLU A 1 67  ? 75.638  30.610 93.151  1.00 112.15 ? 67  GLU A CD  1 
ATOM   338   O OE1 . GLU A 1 67  ? 74.984  30.248 94.155  1.00 112.15 ? 67  GLU A OE1 1 
ATOM   339   O OE2 . GLU A 1 67  ? 75.546  30.054 92.035  1.00 112.15 ? 67  GLU A OE2 1 
ATOM   340   N N   . GLY A 1 68  ? 79.339  32.623 96.749  1.00 49.27  ? 68  GLY A N   1 
ATOM   341   C CA  . GLY A 1 68  ? 80.246  32.399 97.856  1.00 49.27  ? 68  GLY A CA  1 
ATOM   342   C C   . GLY A 1 68  ? 80.843  31.018 97.967  1.00 49.27  ? 68  GLY A C   1 
ATOM   343   O O   . GLY A 1 68  ? 82.069  30.864 97.934  1.00 49.27  ? 68  GLY A O   1 
ATOM   344   N N   . HIS A 1 69  ? 79.997  30.003 98.087  1.00 32.75  ? 69  HIS A N   1 
ATOM   345   C CA  . HIS A 1 69  ? 80.534  28.661 98.233  1.00 32.75  ? 69  HIS A CA  1 
ATOM   346   C C   . HIS A 1 69  ? 81.549  28.323 97.148  1.00 32.75  ? 69  HIS A C   1 
ATOM   347   O O   . HIS A 1 69  ? 82.409  27.465 97.336  1.00 32.75  ? 69  HIS A O   1 
ATOM   348   C CB  . HIS A 1 69  ? 79.419  27.615 98.272  1.00 77.59  ? 69  HIS A CB  1 
ATOM   349   C CG  . HIS A 1 69  ? 78.668  27.480 96.990  1.00 77.59  ? 69  HIS A CG  1 
ATOM   350   N ND1 . HIS A 1 69  ? 77.773  28.431 96.548  1.00 77.59  ? 69  HIS A ND1 1 
ATOM   351   C CD2 . HIS A 1 69  ? 78.694  26.515 96.042  1.00 77.59  ? 69  HIS A CD2 1 
ATOM   352   C CE1 . HIS A 1 69  ? 77.282  28.057 95.380  1.00 77.59  ? 69  HIS A CE1 1 
ATOM   353   N NE2 . HIS A 1 69  ? 77.825  26.899 95.050  1.00 77.59  ? 69  HIS A NE2 1 
ATOM   354   N N   . ARG A 1 70  ? 81.484  29.003 96.018  1.00 42.10  ? 70  ARG A N   1 
ATOM   355   C CA  . ARG A 1 70  ? 82.423  28.712 94.931  1.00 42.10  ? 70  ARG A CA  1 
ATOM   356   C C   . ARG A 1 70  ? 83.815  29.223 95.298  1.00 42.10  ? 70  ARG A C   1 
ATOM   357   O O   . ARG A 1 70  ? 84.810  28.493 95.241  1.00 42.10  ? 70  ARG A O   1 
ATOM   358   C CB  . ARG A 1 70  ? 81.959  29.392 93.636  1.00 88.55  ? 70  ARG A CB  1 
ATOM   359   C CG  . ARG A 1 70  ? 80.636  28.893 93.086  1.00 88.55  ? 70  ARG A CG  1 
ATOM   360   C CD  . ARG A 1 70  ? 80.822  27.674 92.201  1.00 88.55  ? 70  ARG A CD  1 
ATOM   361   N NE  . ARG A 1 70  ? 79.545  27.038 91.877  1.00 88.55  ? 70  ARG A NE  1 
ATOM   362   C CZ  . ARG A 1 70  ? 78.514  27.661 91.314  1.00 88.55  ? 70  ARG A CZ  1 
ATOM   363   N NH1 . ARG A 1 70  ? 78.600  28.951 91.000  1.00 88.55  ? 70  ARG A NH1 1 
ATOM   364   N NH2 . ARG A 1 70  ? 77.387  26.996 91.088  1.00 88.55  ? 70  ARG A NH2 1 
ATOM   365   N N   . VAL A 1 71  ? 83.876  30.496 95.664  1.00 41.36  ? 71  VAL A N   1 
ATOM   366   C CA  . VAL A 1 71  ? 85.125  31.118 96.035  1.00 41.36  ? 71  VAL A CA  1 
ATOM   367   C C   . VAL A 1 71  ? 85.765  30.331 97.175  1.00 41.36  ? 71  VAL A C   1 
ATOM   368   O O   . VAL A 1 71  ? 86.971  30.112 97.190  1.00 41.36  ? 71  VAL A O   1 
ATOM   369   C CB  . VAL A 1 71  ? 84.894  32.575 96.471  1.00 31.12  ? 71  VAL A CB  1 
ATOM   370   C CG1 . VAL A 1 71  ? 86.215  33.224 96.838  1.00 31.12  ? 71  VAL A CG1 1 
ATOM   371   C CG2 . VAL A 1 71  ? 84.237  33.348 95.356  1.00 31.12  ? 71  VAL A CG2 1 
ATOM   372   N N   . ILE A 1 72  ? 84.958  29.906 98.136  1.00 41.26  ? 72  ILE A N   1 
ATOM   373   C CA  . ILE A 1 72  ? 85.483  29.127 99.249  1.00 41.26  ? 72  ILE A CA  1 
ATOM   374   C C   . ILE A 1 72  ? 86.149  27.866 98.734  1.00 41.26  ? 72  ILE A C   1 
ATOM   375   O O   . ILE A 1 72  ? 87.335  27.658 98.984  1.00 41.26  ? 72  ILE A O   1 
ATOM   376   C CB  . ILE A 1 72  ? 84.369  28.775 100.264 1.00 49.41  ? 72  ILE A CB  1 
ATOM   377   C CG1 . ILE A 1 72  ? 84.140  29.977 101.180 1.00 49.41  ? 72  ILE A CG1 1 
ATOM   378   C CG2 . ILE A 1 72  ? 84.746  27.572 101.087 1.00 49.41  ? 72  ILE A CG2 1 
ATOM   379   C CD1 . ILE A 1 72  ? 82.981  29.805 102.115 1.00 49.41  ? 72  ILE A CD1 1 
ATOM   380   N N   . ASN A 1 73  ? 85.410  27.030 98.001  1.00 50.07  ? 73  ASN A N   1 
ATOM   381   C CA  . ASN A 1 73  ? 85.987  25.790 97.456  1.00 50.07  ? 73  ASN A CA  1 
ATOM   382   C C   . ASN A 1 73  ? 87.177  26.078 96.567  1.00 50.07  ? 73  ASN A C   1 
ATOM   383   O O   . ASN A 1 73  ? 88.129  25.316 96.550  1.00 50.07  ? 73  ASN A O   1 
ATOM   384   C CB  . ASN A 1 73  ? 84.955  24.986 96.668  1.00 66.88  ? 73  ASN A CB  1 
ATOM   385   C CG  . ASN A 1 73  ? 83.970  24.262 97.567  1.00 66.88  ? 73  ASN A CG  1 
ATOM   386   O OD1 . ASN A 1 73  ? 84.354  23.645 98.566  1.00 66.88  ? 73  ASN A OD1 1 
ATOM   387   N ND2 . ASN A 1 73  ? 82.694  24.320 97.208  1.00 66.88  ? 73  ASN A ND2 1 
ATOM   388   N N   . LEU A 1 74  ? 87.129  27.175 95.825  1.00 44.63  ? 74  LEU A N   1 
ATOM   389   C CA  . LEU A 1 74  ? 88.255  27.511 94.982  1.00 44.63  ? 74  LEU A CA  1 
ATOM   390   C C   . LEU A 1 74  ? 89.509  27.661 95.842  1.00 44.63  ? 74  LEU A C   1 
ATOM   391   O O   . LEU A 1 74  ? 90.567  27.105 95.517  1.00 44.63  ? 74  LEU A O   1 
ATOM   392   C CB  . LEU A 1 74  ? 87.988  28.808 94.219  1.00 63.06  ? 74  LEU A CB  1 
ATOM   393   C CG  . LEU A 1 74  ? 87.321  28.656 92.845  1.00 63.06  ? 74  LEU A CG  1 
ATOM   394   C CD1 . LEU A 1 74  ? 87.106  30.022 92.206  1.00 63.06  ? 74  LEU A CD1 1 
ATOM   395   C CD2 . LEU A 1 74  ? 88.205  27.780 91.946  1.00 63.06  ? 74  LEU A CD2 1 
ATOM   396   N N   . ALA A 1 75  ? 89.370  28.396 96.948  1.00 50.87  ? 75  ALA A N   1 
ATOM   397   C CA  . ALA A 1 75  ? 90.468  28.659 97.881  1.00 50.87  ? 75  ALA A CA  1 
ATOM   398   C C   . ALA A 1 75  ? 90.949  27.413 98.601  1.00 50.87  ? 75  ALA A C   1 
ATOM   399   O O   . ALA A 1 75  ? 92.159  27.203 98.754  1.00 50.87  ? 75  ALA A O   1 
ATOM   400   C CB  . ALA A 1 75  ? 90.046  29.705 98.892  1.00 46.01  ? 75  ALA A CB  1 
ATOM   401   N N   . ASN A 1 76  ? 90.013  26.590 99.061  1.00 41.01  ? 76  ASN A N   1 
ATOM   402   C CA  . ASN A 1 76  ? 90.401  25.355 99.743  1.00 41.01  ? 76  ASN A CA  1 
ATOM   403   C C   . ASN A 1 76  ? 91.239  24.460 98.823  1.00 41.01  ? 76  ASN A C   1 
ATOM   404   O O   . ASN A 1 76  ? 92.067  23.674 99.295  1.00 41.01  ? 76  ASN A O   1 
ATOM   405   C CB  . ASN A 1 76  ? 89.168  24.583 100.229 1.00 59.54  ? 76  ASN A CB  1 
ATOM   406   C CG  . ASN A 1 76  ? 88.487  25.263 101.386 1.00 59.54  ? 76  ASN A CG  1 
ATOM   407   O OD1 . ASN A 1 76  ? 89.145  25.698 102.330 1.00 59.54  ? 76  ASN A OD1 1 
ATOM   408   N ND2 . ASN A 1 76  ? 87.164  25.357 101.328 1.00 59.54  ? 76  ASN A ND2 1 
ATOM   409   N N   . GLU A 1 77  ? 91.018  24.584 97.512  1.00 48.78  ? 77  GLU A N   1 
ATOM   410   C CA  . GLU A 1 77  ? 91.764  23.799 96.543  1.00 48.78  ? 77  GLU A CA  1 
ATOM   411   C C   . GLU A 1 77  ? 93.109  24.426 96.245  1.00 48.78  ? 77  GLU A C   1 
ATOM   412   O O   . GLU A 1 77  ? 94.127  23.745 96.308  1.00 48.78  ? 77  GLU A O   1 
ATOM   413   C CB  . GLU A 1 77  ? 90.963  23.617 95.259  1.00 61.28  ? 77  GLU A CB  1 
ATOM   414   C CG  . GLU A 1 77  ? 89.883  22.542 95.376  1.00 61.28  ? 77  GLU A CG  1 
ATOM   415   C CD  . GLU A 1 77  ? 90.399  21.277 96.067  1.00 61.28  ? 77  GLU A CD  1 
ATOM   416   O OE1 . GLU A 1 77  ? 91.560  20.887 95.782  1.00 61.28  ? 77  GLU A OE1 1 
ATOM   417   O OE2 . GLU A 1 77  ? 89.653  20.676 96.884  1.00 61.28  ? 77  GLU A OE2 1 
ATOM   418   N N   . MET A 1 78  ? 93.118  25.721 95.941  1.00 46.86  ? 78  MET A N   1 
ATOM   419   C CA  . MET A 1 78  ? 94.361  26.429 95.652  1.00 46.86  ? 78  MET A CA  1 
ATOM   420   C C   . MET A 1 78  ? 95.342  26.367 96.807  1.00 46.86  ? 78  MET A C   1 
ATOM   421   O O   . MET A 1 78  ? 96.548  26.217 96.597  1.00 46.86  ? 78  MET A O   1 
ATOM   422   C CB  . MET A 1 78  ? 94.091  27.905 95.360  1.00 59.40  ? 78  MET A CB  1 
ATOM   423   C CG  . MET A 1 78  ? 93.731  28.227 93.922  1.00 59.40  ? 78  MET A CG  1 
ATOM   424   S SD  . MET A 1 78  ? 95.094  28.057 92.737  1.00 59.40  ? 78  MET A SD  1 
ATOM   425   C CE  . MET A 1 78  ? 96.447  28.615 93.708  1.00 59.40  ? 78  MET A CE  1 
ATOM   426   N N   . PHE A 1 79  ? 94.829  26.468 98.028  1.00 42.45  ? 79  PHE A N   1 
ATOM   427   C CA  . PHE A 1 79  ? 95.706  26.509 99.175  1.00 42.45  ? 79  PHE A CA  1 
ATOM   428   C C   . PHE A 1 79  ? 95.650  25.373 100.183 1.00 42.45  ? 79  PHE A C   1 
ATOM   429   O O   . PHE A 1 79  ? 96.594  25.191 100.951 1.00 42.45  ? 79  PHE A O   1 
ATOM   430   C CB  . PHE A 1 79  ? 95.454  27.799 99.912  1.00 25.62  ? 79  PHE A CB  1 
ATOM   431   C CG  . PHE A 1 79  ? 95.420  29.000 99.042  1.00 25.62  ? 79  PHE A CG  1 
ATOM   432   C CD1 . PHE A 1 79  ? 94.278  29.773 98.979  1.00 25.62  ? 79  PHE A CD1 1 
ATOM   433   C CD2 . PHE A 1 79  ? 96.568  29.423 98.362  1.00 25.62  ? 79  PHE A CD2 1 
ATOM   434   C CE1 . PHE A 1 79  ? 94.266  30.973 98.264  1.00 25.62  ? 79  PHE A CE1 1 
ATOM   435   C CE2 . PHE A 1 79  ? 96.576  30.628 97.635  1.00 25.62  ? 79  PHE A CE2 1 
ATOM   436   C CZ  . PHE A 1 79  ? 95.425  31.407 97.589  1.00 25.62  ? 79  PHE A CZ  1 
ATOM   437   N N   . GLY A 1 80  ? 94.562  24.615 100.207 1.00 31.29  ? 80  GLY A N   1 
ATOM   438   C CA  . GLY A 1 80  ? 94.483  23.545 101.177 1.00 31.29  ? 80  GLY A CA  1 
ATOM   439   C C   . GLY A 1 80  ? 93.576  24.060 102.265 1.00 31.29  ? 80  GLY A C   1 
ATOM   440   O O   . GLY A 1 80  ? 93.586  25.250 102.555 1.00 31.29  ? 80  GLY A O   1 
ATOM   441   N N   . TYR A 1 81  ? 92.786  23.188 102.873 1.00 39.74  ? 81  TYR A N   1 
ATOM   442   C CA  . TYR A 1 81  ? 91.868  23.642 103.894 1.00 39.74  ? 81  TYR A CA  1 
ATOM   443   C C   . TYR A 1 81  ? 92.574  24.430 104.997 1.00 39.74  ? 81  TYR A C   1 
ATOM   444   O O   . TYR A 1 81  ? 91.967  25.263 105.665 1.00 39.74  ? 81  TYR A O   1 
ATOM   445   C CB  . TYR A 1 81  ? 91.127  22.446 104.494 1.00 45.24  ? 81  TYR A CB  1 
ATOM   446   C CG  . TYR A 1 81  ? 91.992  21.555 105.351 1.00 45.24  ? 81  TYR A CG  1 
ATOM   447   C CD1 . TYR A 1 81  ? 92.109  21.763 106.723 1.00 45.24  ? 81  TYR A CD1 1 
ATOM   448   C CD2 . TYR A 1 81  ? 92.726  20.521 104.780 1.00 45.24  ? 81  TYR A CD2 1 
ATOM   449   C CE1 . TYR A 1 81  ? 92.941  20.960 107.496 1.00 45.24  ? 81  TYR A CE1 1 
ATOM   450   C CE2 . TYR A 1 81  ? 93.560  19.714 105.547 1.00 45.24  ? 81  TYR A CE2 1 
ATOM   451   C CZ  . TYR A 1 81  ? 93.663  19.936 106.895 1.00 45.24  ? 81  TYR A CZ  1 
ATOM   452   O OH  . TYR A 1 81  ? 94.488  19.127 107.629 1.00 45.24  ? 81  TYR A OH  1 
ATOM   453   N N   . ASN A 1 82  ? 93.861  24.184 105.179 1.00 34.92  ? 82  ASN A N   1 
ATOM   454   C CA  . ASN A 1 82  ? 94.583  24.862 106.239 1.00 34.92  ? 82  ASN A CA  1 
ATOM   455   C C   . ASN A 1 82  ? 95.655  25.810 105.700 1.00 34.92  ? 82  ASN A C   1 
ATOM   456   O O   . ASN A 1 82  ? 96.580  26.198 106.415 1.00 34.92  ? 82  ASN A O   1 
ATOM   457   C CB  . ASN A 1 82  ? 95.216  23.810 107.158 1.00 36.08  ? 82  ASN A CB  1 
ATOM   458   C CG  . ASN A 1 82  ? 96.434  23.137 106.526 1.00 36.08  ? 82  ASN A CG  1 
ATOM   459   O OD1 . ASN A 1 82  ? 96.528  23.003 105.285 1.00 36.08  ? 82  ASN A OD1 1 
ATOM   460   N ND2 . ASN A 1 82  ? 97.380  22.710 107.373 1.00 36.08  ? 82  ASN A ND2 1 
ATOM   461   N N   . GLY A 1 83  ? 95.535  26.191 104.437 1.00 38.03  ? 83  GLY A N   1 
ATOM   462   C CA  . GLY A 1 83  ? 96.534  27.069 103.853 1.00 38.03  ? 83  GLY A CA  1 
ATOM   463   C C   . GLY A 1 83  ? 96.103  28.508 103.719 1.00 38.03  ? 83  GLY A C   1 
ATOM   464   O O   . GLY A 1 83  ? 96.887  29.352 103.334 1.00 38.03  ? 83  GLY A O   1 
ATOM   465   N N   . TRP A 1 84  ? 94.849  28.792 104.023 1.00 32.67  ? 84  TRP A N   1 
ATOM   466   C CA  . TRP A 1 84  ? 94.362  30.153 103.944 1.00 32.67  ? 84  TRP A CA  1 
ATOM   467   C C   . TRP A 1 84  ? 93.392  30.349 105.091 1.00 32.67  ? 84  TRP A C   1 
ATOM   468   O O   . TRP A 1 84  ? 92.789  29.385 105.576 1.00 32.67  ? 84  TRP A O   1 
ATOM   469   C CB  . TRP A 1 84  ? 93.663  30.399 102.606 1.00 31.71  ? 84  TRP A CB  1 
ATOM   470   C CG  . TRP A 1 84  ? 92.350  29.710 102.477 1.00 31.71  ? 84  TRP A CG  1 
ATOM   471   C CD1 . TRP A 1 84  ? 92.131  28.388 102.253 1.00 31.71  ? 84  TRP A CD1 1 
ATOM   472   C CD2 . TRP A 1 84  ? 91.064  30.308 102.633 1.00 31.71  ? 84  TRP A CD2 1 
ATOM   473   N NE1 . TRP A 1 84  ? 90.774  28.116 102.264 1.00 31.71  ? 84  TRP A NE1 1 
ATOM   474   C CE2 . TRP A 1 84  ? 90.103  29.282 102.496 1.00 31.71  ? 84  TRP A CE2 1 
ATOM   475   C CE3 . TRP A 1 84  ? 90.633  31.615 102.876 1.00 31.71  ? 84  TRP A CE3 1 
ATOM   476   C CZ2 . TRP A 1 84  ? 88.754  29.518 102.595 1.00 31.71  ? 84  TRP A CZ2 1 
ATOM   477   C CZ3 . TRP A 1 84  ? 89.290  31.850 102.974 1.00 31.71  ? 84  TRP A CZ3 1 
ATOM   478   C CH2 . TRP A 1 84  ? 88.361  30.806 102.834 1.00 31.71  ? 84  TRP A CH2 1 
ATOM   479   N N   . ALA A 1 85  ? 93.230  31.594 105.518 1.00 32.57  ? 85  ALA A N   1 
ATOM   480   C CA  . ALA A 1 85  ? 92.332  31.888 106.627 1.00 32.57  ? 85  ALA A CA  1 
ATOM   481   C C   . ALA A 1 85  ? 91.815  33.289 106.486 1.00 32.57  ? 85  ALA A C   1 
ATOM   482   O O   . ALA A 1 85  ? 92.413  34.113 105.785 1.00 32.57  ? 85  ALA A O   1 
ATOM   483   C CB  . ALA A 1 85  ? 93.070  31.747 107.959 1.00 26.00  ? 85  ALA A CB  1 
ATOM   484   N N   . HIS A 1 86  ? 90.697  33.567 107.148 1.00 31.65  ? 86  HIS A N   1 
ATOM   485   C CA  . HIS A 1 86  ? 90.135  34.904 107.086 1.00 31.65  ? 86  HIS A CA  1 
ATOM   486   C C   . HIS A 1 86  ? 89.486  35.306 108.399 1.00 31.65  ? 86  HIS A C   1 
ATOM   487   O O   . HIS A 1 86  ? 89.018  34.471 109.158 1.00 31.65  ? 86  HIS A O   1 
ATOM   488   C CB  . HIS A 1 86  ? 89.118  35.014 105.950 1.00 44.75  ? 86  HIS A CB  1 
ATOM   489   C CG  . HIS A 1 86  ? 87.815  34.341 106.235 1.00 44.75  ? 86  HIS A CG  1 
ATOM   490   N ND1 . HIS A 1 86  ? 86.605  35.000 106.185 1.00 44.75  ? 86  HIS A ND1 1 
ATOM   491   C CD2 . HIS A 1 86  ? 87.528  33.058 106.541 1.00 44.75  ? 86  HIS A CD2 1 
ATOM   492   C CE1 . HIS A 1 86  ? 85.629  34.150 106.445 1.00 44.75  ? 86  HIS A CE1 1 
ATOM   493   N NE2 . HIS A 1 86  ? 86.163  32.965 106.664 1.00 44.75  ? 86  HIS A NE2 1 
ATOM   494   N N   . SER A 1 87  ? 89.481  36.603 108.660 1.00 33.92  ? 87  SER A N   1 
ATOM   495   C CA  . SER A 1 87  ? 88.883  37.131 109.869 1.00 33.92  ? 87  SER A CA  1 
ATOM   496   C C   . SER A 1 87  ? 88.136  38.402 109.517 1.00 33.92  ? 87  SER A C   1 
ATOM   497   O O   . SER A 1 87  ? 88.384  39.005 108.472 1.00 33.92  ? 87  SER A O   1 
ATOM   498   C CB  . SER A 1 87  ? 89.955  37.450 110.891 1.00 30.61  ? 87  SER A CB  1 
ATOM   499   O OG  . SER A 1 87  ? 90.904  38.321 110.319 1.00 30.61  ? 87  SER A OG  1 
ATOM   500   N N   . ILE A 1 88  ? 87.212  38.787 110.393 1.00 30.80  ? 88  ILE A N   1 
ATOM   501   C CA  . ILE A 1 88  ? 86.423  39.980 110.200 1.00 30.80  ? 88  ILE A CA  1 
ATOM   502   C C   . ILE A 1 88  ? 87.041  41.042 111.077 1.00 30.80  ? 88  ILE A C   1 
ATOM   503   O O   . ILE A 1 88  ? 86.902  41.004 112.285 1.00 30.80  ? 88  ILE A O   1 
ATOM   504   C CB  . ILE A 1 88  ? 84.957  39.735 110.611 1.00 20.08  ? 88  ILE A CB  1 
ATOM   505   C CG1 . ILE A 1 88  ? 84.382  38.615 109.737 1.00 20.08  ? 88  ILE A CG1 1 
ATOM   506   C CG2 . ILE A 1 88  ? 84.148  41.021 110.486 1.00 20.08  ? 88  ILE A CG2 1 
ATOM   507   C CD1 . ILE A 1 88  ? 82.990  38.185 110.137 1.00 20.08  ? 88  ILE A CD1 1 
ATOM   508   N N   . THR A 1 89  ? 87.744  41.975 110.459 1.00 34.13  ? 89  THR A N   1 
ATOM   509   C CA  . THR A 1 89  ? 88.394  43.037 111.184 1.00 34.13  ? 89  THR A CA  1 
ATOM   510   C C   . THR A 1 89  ? 87.328  43.894 111.810 1.00 34.13  ? 89  THR A C   1 
ATOM   511   O O   . THR A 1 89  ? 87.399  44.275 112.981 1.00 34.13  ? 89  THR A O   1 
ATOM   512   C CB  . THR A 1 89  ? 89.218  43.896 110.249 1.00 34.90  ? 89  THR A CB  1 
ATOM   513   O OG1 . THR A 1 89  ? 90.262  43.102 109.678 1.00 34.90  ? 89  THR A OG1 1 
ATOM   514   C CG2 . THR A 1 89  ? 89.835  45.029 110.994 1.00 34.90  ? 89  THR A CG2 1 
ATOM   515   N N   . GLN A 1 90  ? 86.311  44.199 111.033 1.00 44.45  ? 90  GLN A N   1 
ATOM   516   C CA  . GLN A 1 90  ? 85.266  45.035 111.561 1.00 44.45  ? 90  GLN A CA  1 
ATOM   517   C C   . GLN A 1 90  ? 84.027  45.037 110.689 1.00 44.45  ? 90  GLN A C   1 
ATOM   518   O O   . GLN A 1 90  ? 84.109  44.920 109.477 1.00 44.45  ? 90  GLN A O   1 
ATOM   519   C CB  . GLN A 1 90  ? 85.794  46.456 111.725 1.00 48.86  ? 90  GLN A CB  1 
ATOM   520   C CG  . GLN A 1 90  ? 84.755  47.402 112.239 1.00 48.86  ? 90  GLN A CG  1 
ATOM   521   C CD  . GLN A 1 90  ? 85.310  48.775 112.576 1.00 48.86  ? 90  GLN A CD  1 
ATOM   522   O OE1 . GLN A 1 90  ? 85.768  49.525 111.702 1.00 48.86  ? 90  GLN A OE1 1 
ATOM   523   N NE2 . GLN A 1 90  ? 85.265  49.116 113.860 1.00 48.86  ? 90  GLN A NE2 1 
ATOM   524   N N   . GLN A 1 91  ? 82.870  45.127 111.322 1.00 45.77  ? 91  GLN A N   1 
ATOM   525   C CA  . GLN A 1 91  ? 81.628  45.181 110.591 1.00 45.77  ? 91  GLN A CA  1 
ATOM   526   C C   . GLN A 1 91  ? 80.824  46.301 111.203 1.00 45.77  ? 91  GLN A C   1 
ATOM   527   O O   . GLN A 1 91  ? 80.512  46.283 112.391 1.00 45.77  ? 91  GLN A O   1 
ATOM   528   C CB  . GLN A 1 91  ? 80.835  43.877 110.680 1.00 37.93  ? 91  GLN A CB  1 
ATOM   529   C CG  . GLN A 1 91  ? 79.434  44.038 110.062 1.00 37.93  ? 91  GLN A CG  1 
ATOM   530   C CD  . GLN A 1 91  ? 78.696  42.726 109.841 1.00 37.93  ? 91  GLN A CD  1 
ATOM   531   O OE1 . GLN A 1 91  ? 78.878  42.063 108.818 1.00 37.93  ? 91  GLN A OE1 1 
ATOM   532   N NE2 . GLN A 1 91  ? 77.856  42.343 110.804 1.00 37.93  ? 91  GLN A NE2 1 
ATOM   533   N N   . ASN A 1 92  ? 80.490  47.284 110.387 1.00 43.89  ? 92  ASN A N   1 
ATOM   534   C CA  . ASN A 1 92  ? 79.727  48.398 110.876 1.00 43.89  ? 92  ASN A CA  1 
ATOM   535   C C   . ASN A 1 92  ? 78.397  48.510 110.138 1.00 43.89  ? 92  ASN A C   1 
ATOM   536   O O   . ASN A 1 92  ? 78.362  48.461 108.907 1.00 43.89  ? 92  ASN A O   1 
ATOM   537   C CB  . ASN A 1 92  ? 80.527  49.682 110.705 1.00 64.96  ? 92  ASN A CB  1 
ATOM   538   C CG  . ASN A 1 92  ? 79.792  50.875 111.239 1.00 64.96  ? 92  ASN A CG  1 
ATOM   539   O OD1 . ASN A 1 92  ? 79.639  51.019 112.452 1.00 64.96  ? 92  ASN A OD1 1 
ATOM   540   N ND2 . ASN A 1 92  ? 79.303  51.730 110.346 1.00 64.96  ? 92  ASN A ND2 1 
ATOM   541   N N   . VAL A 1 93  ? 77.304  48.641 110.888 1.00 47.07  ? 93  VAL A N   1 
ATOM   542   C CA  . VAL A 1 93  ? 75.977  48.797 110.293 1.00 47.07  ? 93  VAL A CA  1 
ATOM   543   C C   . VAL A 1 93  ? 75.853  50.272 109.909 1.00 47.07  ? 93  VAL A C   1 
ATOM   544   O O   . VAL A 1 93  ? 75.734  51.119 110.790 1.00 47.07  ? 93  VAL A O   1 
ATOM   545   C CB  . VAL A 1 93  ? 74.858  48.457 111.319 1.00 46.76  ? 93  VAL A CB  1 
ATOM   546   C CG1 . VAL A 1 93  ? 73.496  48.780 110.737 1.00 46.76  ? 93  VAL A CG1 1 
ATOM   547   C CG2 . VAL A 1 93  ? 74.921  46.984 111.711 1.00 46.76  ? 93  VAL A CG2 1 
ATOM   548   N N   . ASP A 1 94  ? 75.881  50.591 108.614 1.00 50.88  ? 94  ASP A N   1 
ATOM   549   C CA  . ASP A 1 94  ? 75.789  51.996 108.196 1.00 50.88  ? 94  ASP A CA  1 
ATOM   550   C C   . ASP A 1 94  ? 74.470  52.666 108.536 1.00 50.88  ? 94  ASP A C   1 
ATOM   551   O O   . ASP A 1 94  ? 74.456  53.791 109.014 1.00 50.88  ? 94  ASP A O   1 
ATOM   552   C CB  . ASP A 1 94  ? 76.050  52.166 106.697 1.00 47.70  ? 94  ASP A CB  1 
ATOM   553   C CG  . ASP A 1 94  ? 77.517  52.049 106.340 1.00 47.70  ? 94  ASP A CG  1 
ATOM   554   O OD1 . ASP A 1 94  ? 78.364  52.364 107.203 1.00 47.70  ? 94  ASP A OD1 1 
ATOM   555   O OD2 . ASP A 1 94  ? 77.830  51.657 105.192 1.00 47.70  ? 94  ASP A OD2 1 
ATOM   556   N N   . PHE A 1 95  ? 73.358  51.989 108.294 1.00 44.52  ? 95  PHE A N   1 
ATOM   557   C CA  . PHE A 1 95  ? 72.078  52.591 108.602 1.00 44.52  ? 95  PHE A CA  1 
ATOM   558   C C   . PHE A 1 95  ? 70.979  51.557 108.583 1.00 44.52  ? 95  PHE A C   1 
ATOM   559   O O   . PHE A 1 95  ? 71.147  50.476 108.022 1.00 44.52  ? 95  PHE A O   1 
ATOM   560   C CB  . PHE A 1 95  ? 71.767  53.705 107.590 1.00 42.11  ? 95  PHE A CB  1 
ATOM   561   C CG  . PHE A 1 95  ? 71.657  53.228 106.168 1.00 42.11  ? 95  PHE A CG  1 
ATOM   562   C CD1 . PHE A 1 95  ? 70.475  52.670 105.695 1.00 42.11  ? 95  PHE A CD1 1 
ATOM   563   C CD2 . PHE A 1 95  ? 72.746  53.290 105.317 1.00 42.11  ? 95  PHE A CD2 1 
ATOM   564   C CE1 . PHE A 1 95  ? 70.372  52.169 104.390 1.00 42.11  ? 95  PHE A CE1 1 
ATOM   565   C CE2 . PHE A 1 95  ? 72.662  52.793 104.008 1.00 42.11  ? 95  PHE A CE2 1 
ATOM   566   C CZ  . PHE A 1 95  ? 71.464  52.229 103.547 1.00 42.11  ? 95  PHE A CZ  1 
ATOM   567   N N   . VAL A 1 96  ? 69.863  51.897 109.221 1.00 62.41  ? 96  VAL A N   1 
ATOM   568   C CA  . VAL A 1 96  ? 68.681  51.048 109.251 1.00 62.41  ? 96  VAL A CA  1 
ATOM   569   C C   . VAL A 1 96  ? 67.512  52.013 109.190 1.00 62.41  ? 96  VAL A C   1 
ATOM   570   O O   . VAL A 1 96  ? 67.040  52.495 110.216 1.00 62.41  ? 96  VAL A O   1 
ATOM   571   C CB  . VAL A 1 96  ? 68.567  50.222 110.540 1.00 55.50  ? 96  VAL A CB  1 
ATOM   572   C CG1 . VAL A 1 96  ? 67.314  49.350 110.481 1.00 55.50  ? 96  VAL A CG1 1 
ATOM   573   C CG2 . VAL A 1 96  ? 69.789  49.336 110.700 1.00 55.50  ? 96  VAL A CG2 1 
ATOM   574   N N   . ASP A 1 97  ? 67.063  52.303 107.973 1.00 67.97  ? 97  ASP A N   1 
ATOM   575   C CA  . ASP A 1 97  ? 65.963  53.226 107.760 1.00 67.97  ? 97  ASP A CA  1 
ATOM   576   C C   . ASP A 1 97  ? 64.615  52.558 107.530 1.00 67.97  ? 97  ASP A C   1 
ATOM   577   O O   . ASP A 1 97  ? 64.523  51.494 106.899 1.00 67.97  ? 97  ASP A O   1 
ATOM   578   C CB  . ASP A 1 97  ? 66.283  54.119 106.573 1.00 65.38  ? 97  ASP A CB  1 
ATOM   579   C CG  . ASP A 1 97  ? 67.481  54.994 106.821 1.00 65.38  ? 97  ASP A CG  1 
ATOM   580   O OD1 . ASP A 1 97  ? 67.685  55.375 107.988 1.00 65.38  ? 97  ASP A OD1 1 
ATOM   581   O OD2 . ASP A 1 97  ? 68.200  55.316 105.856 1.00 65.38  ? 97  ASP A OD2 1 
ATOM   582   N N   . LEU A 1 98  ? 63.567  53.207 108.033 1.00 75.71  ? 98  LEU A N   1 
ATOM   583   C CA  . LEU A 1 98  ? 62.212  52.701 107.884 1.00 75.71  ? 98  LEU A CA  1 
ATOM   584   C C   . LEU A 1 98  ? 61.310  53.618 107.059 1.00 75.71  ? 98  LEU A C   1 
ATOM   585   O O   . LEU A 1 98  ? 60.957  54.705 107.498 1.00 75.71  ? 98  LEU A O   1 
ATOM   586   C CB  . LEU A 1 98  ? 61.589  52.478 109.254 1.00 67.93  ? 98  LEU A CB  1 
ATOM   587   C CG  . LEU A 1 98  ? 60.157  51.941 109.218 1.00 67.93  ? 98  LEU A CG  1 
ATOM   588   C CD1 . LEU A 1 98  ? 60.053  50.733 108.296 1.00 67.93  ? 98  LEU A CD1 1 
ATOM   589   C CD2 . LEU A 1 98  ? 59.732  51.581 110.646 1.00 67.93  ? 98  LEU A CD2 1 
ATOM   590   N N   . ASN A 1 99  ? 60.961  53.164 105.857 1.00 95.71  ? 99  ASN A N   1 
ATOM   591   C CA  . ASN A 1 99  ? 60.087  53.899 104.944 1.00 95.71  ? 99  ASN A CA  1 
ATOM   592   C C   . ASN A 1 99  ? 58.809  53.094 104.757 1.00 95.71  ? 99  ASN A C   1 
ATOM   593   O O   . ASN A 1 99  ? 58.791  52.091 104.040 1.00 95.71  ? 99  ASN A O   1 
ATOM   594   C CB  . ASN A 1 99  ? 60.756  54.101 103.580 1.00 144.57 ? 99  ASN A CB  1 
ATOM   595   C CG  . ASN A 1 99  ? 61.884  55.107 103.627 1.00 144.57 ? 99  ASN A CG  1 
ATOM   596   O OD1 . ASN A 1 99  ? 61.700  56.239 104.075 1.00 144.57 ? 99  ASN A OD1 1 
ATOM   597   N ND2 . ASN A 1 99  ? 63.061  54.704 103.154 1.00 144.57 ? 99  ASN A ND2 1 
ATOM   598   N N   . ASN A 1 100 ? 57.746  53.548 105.412 1.00 95.18  ? 100 ASN A N   1 
ATOM   599   C CA  . ASN A 1 100 ? 56.442  52.900 105.360 1.00 95.18  ? 100 ASN A CA  1 
ATOM   600   C C   . ASN A 1 100 ? 56.497  51.379 105.467 1.00 95.18  ? 100 ASN A C   1 
ATOM   601   O O   . ASN A 1 100 ? 56.347  50.665 104.471 1.00 95.18  ? 100 ASN A O   1 
ATOM   602   C CB  . ASN A 1 100 ? 55.677  53.311 104.090 1.00 165.29 ? 100 ASN A CB  1 
ATOM   603   C CG  . ASN A 1 100 ? 56.409  52.949 102.814 1.00 165.29 ? 100 ASN A CG  1 
ATOM   604   O OD1 . ASN A 1 100 ? 57.456  53.516 102.498 1.00 165.29 ? 100 ASN A OD1 1 
ATOM   605   N ND2 . ASN A 1 100 ? 55.858  51.998 102.068 1.00 165.29 ? 100 ASN A ND2 1 
ATOM   606   N N   . GLY A 1 101 ? 56.716  50.901 106.690 1.00 121.79 ? 101 GLY A N   1 
ATOM   607   C CA  . GLY A 1 101 ? 56.761  49.474 106.957 1.00 121.79 ? 101 GLY A CA  1 
ATOM   608   C C   . GLY A 1 101 ? 57.866  48.660 106.310 1.00 121.79 ? 101 GLY A C   1 
ATOM   609   O O   . GLY A 1 101 ? 57.994  47.464 106.584 1.00 121.79 ? 101 GLY A O   1 
ATOM   610   N N   . LYS A 1 102 ? 58.661  49.289 105.451 1.00 96.44  ? 102 LYS A N   1 
ATOM   611   C CA  . LYS A 1 102 ? 59.750  48.589 104.783 1.00 96.44  ? 102 LYS A CA  1 
ATOM   612   C C   . LYS A 1 102 ? 61.100  49.059 105.323 1.00 96.44  ? 102 LYS A C   1 
ATOM   613   O O   . LYS A 1 102 ? 61.289  50.244 105.603 1.00 96.44  ? 102 LYS A O   1 
ATOM   614   C CB  . LYS A 1 102 ? 59.678  48.834 103.276 1.00 124.74 ? 102 LYS A CB  1 
ATOM   615   C CG  . LYS A 1 102 ? 58.388  48.362 102.636 1.00 124.74 ? 102 LYS A CG  1 
ATOM   616   C CD  . LYS A 1 102 ? 58.307  48.837 101.196 1.00 124.74 ? 102 LYS A CD  1 
ATOM   617   C CE  . LYS A 1 102 ? 56.964  48.499 100.568 1.00 124.74 ? 102 LYS A CE  1 
ATOM   618   N NZ  . LYS A 1 102 ? 56.829  49.117 99.218  1.00 124.74 ? 102 LYS A NZ  1 
ATOM   619   N N   . PHE A 1 103 ? 62.038  48.128 105.469 1.00 71.26  ? 103 PHE A N   1 
ATOM   620   C CA  . PHE A 1 103 ? 63.359  48.469 105.970 1.00 71.26  ? 103 PHE A CA  1 
ATOM   621   C C   . PHE A 1 103 ? 64.418  48.512 104.893 1.00 71.26  ? 103 PHE A C   1 
ATOM   622   O O   . PHE A 1 103 ? 64.464  47.655 104.006 1.00 71.26  ? 103 PHE A O   1 
ATOM   623   C CB  . PHE A 1 103 ? 63.786  47.488 107.040 1.00 55.96  ? 103 PHE A CB  1 
ATOM   624   C CG  . PHE A 1 103 ? 63.072  47.673 108.335 1.00 55.96  ? 103 PHE A CG  1 
ATOM   625   C CD1 . PHE A 1 103 ? 62.215  46.696 108.821 1.00 55.96  ? 103 PHE A CD1 1 
ATOM   626   C CD2 . PHE A 1 103 ? 63.274  48.820 109.088 1.00 55.96  ? 103 PHE A CD2 1 
ATOM   627   C CE1 . PHE A 1 103 ? 61.572  46.867 110.045 1.00 55.96  ? 103 PHE A CE1 1 
ATOM   628   C CE2 . PHE A 1 103 ? 62.635  48.997 110.312 1.00 55.96  ? 103 PHE A CE2 1 
ATOM   629   C CZ  . PHE A 1 103 ? 61.786  48.023 110.792 1.00 55.96  ? 103 PHE A CZ  1 
ATOM   630   N N   . TYR A 1 104 ? 65.263  49.535 104.990 1.00 66.90  ? 104 TYR A N   1 
ATOM   631   C CA  . TYR A 1 104 ? 66.369  49.771 104.067 1.00 66.90  ? 104 TYR A CA  1 
ATOM   632   C C   . TYR A 1 104 ? 67.643  49.744 104.915 1.00 66.90  ? 104 TYR A C   1 
ATOM   633   O O   . TYR A 1 104 ? 67.924  50.679 105.670 1.00 66.90  ? 104 TYR A O   1 
ATOM   634   C CB  . TYR A 1 104 ? 66.193  51.136 103.399 1.00 116.87 ? 104 TYR A CB  1 
ATOM   635   C CG  . TYR A 1 104 ? 64.923  51.234 102.585 1.00 116.87 ? 104 TYR A CG  1 
ATOM   636   C CD1 . TYR A 1 104 ? 63.674  51.053 103.179 1.00 116.87 ? 104 TYR A CD1 1 
ATOM   637   C CD2 . TYR A 1 104 ? 64.970  51.448 101.209 1.00 116.87 ? 104 TYR A CD2 1 
ATOM   638   C CE1 . TYR A 1 104 ? 62.506  51.074 102.423 1.00 116.87 ? 104 TYR A CE1 1 
ATOM   639   C CE2 . TYR A 1 104 ? 63.807  51.472 100.442 1.00 116.87 ? 104 TYR A CE2 1 
ATOM   640   C CZ  . TYR A 1 104 ? 62.580  51.281 101.055 1.00 116.87 ? 104 TYR A CZ  1 
ATOM   641   O OH  . TYR A 1 104 ? 61.433  51.276 100.296 1.00 116.87 ? 104 TYR A OH  1 
ATOM   642   N N   . VAL A 1 105 ? 68.407  48.667 104.802 1.00 47.69  ? 105 VAL A N   1 
ATOM   643   C CA  . VAL A 1 105 ? 69.612  48.535 105.602 1.00 47.69  ? 105 VAL A CA  1 
ATOM   644   C C   . VAL A 1 105 ? 70.898  48.442 104.804 1.00 47.69  ? 105 VAL A C   1 
ATOM   645   O O   . VAL A 1 105 ? 70.962  47.752 103.789 1.00 47.69  ? 105 VAL A O   1 
ATOM   646   C CB  . VAL A 1 105 ? 69.519  47.294 106.500 1.00 35.84  ? 105 VAL A CB  1 
ATOM   647   C CG1 . VAL A 1 105 ? 70.815  47.111 107.280 1.00 35.84  ? 105 VAL A CG1 1 
ATOM   648   C CG2 . VAL A 1 105 ? 68.323  47.421 107.419 1.00 35.84  ? 105 VAL A CG2 1 
ATOM   649   N N   . GLY A 1 106 ? 71.927  49.132 105.286 1.00 56.05  ? 106 GLY A N   1 
ATOM   650   C CA  . GLY A 1 106 ? 73.219  49.108 104.624 1.00 56.05  ? 106 GLY A CA  1 
ATOM   651   C C   . GLY A 1 106 ? 74.315  48.746 105.609 1.00 56.05  ? 106 GLY A C   1 
ATOM   652   O O   . GLY A 1 106 ? 74.493  49.430 106.619 1.00 56.05  ? 106 GLY A O   1 
ATOM   653   N N   . VAL A 1 107 ? 75.047  47.668 105.325 1.00 53.23  ? 107 VAL A N   1 
ATOM   654   C CA  . VAL A 1 107 ? 76.125  47.231 106.212 1.00 53.23  ? 107 VAL A CA  1 
ATOM   655   C C   . VAL A 1 107 ? 77.427  46.954 105.487 1.00 53.23  ? 107 VAL A C   1 
ATOM   656   O O   . VAL A 1 107 ? 77.423  46.440 104.379 1.00 53.23  ? 107 VAL A O   1 
ATOM   657   C CB  . VAL A 1 107 ? 75.727  45.964 106.990 1.00 50.95  ? 107 VAL A CB  1 
ATOM   658   C CG1 . VAL A 1 107 ? 76.930  45.392 107.716 1.00 50.95  ? 107 VAL A CG1 1 
ATOM   659   C CG2 . VAL A 1 107 ? 74.643  46.303 107.987 1.00 50.95  ? 107 VAL A CG2 1 
ATOM   660   N N   . CYS A 1 108 ? 78.543  47.308 106.118 1.00 36.38  ? 108 CYS A N   1 
ATOM   661   C CA  . CYS A 1 108 ? 79.850  47.067 105.518 1.00 36.38  ? 108 CYS A CA  1 
ATOM   662   C C   . CYS A 1 108 ? 80.675  46.177 106.438 1.00 36.38  ? 108 CYS A C   1 
ATOM   663   O O   . CYS A 1 108 ? 80.475  46.146 107.662 1.00 36.38  ? 108 CYS A O   1 
ATOM   664   C CB  . CYS A 1 108 ? 80.596  48.381 105.263 1.00 49.51  ? 108 CYS A CB  1 
ATOM   665   S SG  . CYS A 1 108 ? 81.211  49.206 106.753 1.00 49.51  ? 108 CYS A SG  1 
ATOM   666   N N   . ALA A 1 109 ? 81.590  45.435 105.836 1.00 46.80  ? 109 ALA A N   1 
ATOM   667   C CA  . ALA A 1 109 ? 82.444  44.556 106.602 1.00 46.80  ? 109 ALA A CA  1 
ATOM   668   C C   . ALA A 1 109 ? 83.855  44.598 106.062 1.00 46.80  ? 109 ALA A C   1 
ATOM   669   O O   . ALA A 1 109 ? 84.064  44.711 104.858 1.00 46.80  ? 109 ALA A O   1 
ATOM   670   C CB  . ALA A 1 109 ? 81.912  43.144 106.544 1.00 53.27  ? 109 ALA A CB  1 
ATOM   671   N N   . PHE A 1 110 ? 84.827  44.537 106.956 1.00 28.23  ? 110 PHE A N   1 
ATOM   672   C CA  . PHE A 1 110 ? 86.204  44.514 106.528 1.00 28.23  ? 110 PHE A CA  1 
ATOM   673   C C   . PHE A 1 110 ? 86.731  43.112 106.800 1.00 28.23  ? 110 PHE A C   1 
ATOM   674   O O   . PHE A 1 110 ? 86.749  42.647 107.950 1.00 28.23  ? 110 PHE A O   1 
ATOM   675   C CB  . PHE A 1 110 ? 87.010  45.564 107.269 1.00 37.17  ? 110 PHE A CB  1 
ATOM   676   C CG  . PHE A 1 110 ? 86.556  46.959 106.983 1.00 37.17  ? 110 PHE A CG  1 
ATOM   677   C CD1 . PHE A 1 110 ? 85.465  47.503 107.656 1.00 37.17  ? 110 PHE A CD1 1 
ATOM   678   C CD2 . PHE A 1 110 ? 87.176  47.716 105.990 1.00 37.17  ? 110 PHE A CD2 1 
ATOM   679   C CE1 . PHE A 1 110 ? 84.990  48.784 107.343 1.00 37.17  ? 110 PHE A CE1 1 
ATOM   680   C CE2 . PHE A 1 110 ? 86.712  48.993 105.670 1.00 37.17  ? 110 PHE A CE2 1 
ATOM   681   C CZ  . PHE A 1 110 ? 85.612  49.525 106.352 1.00 37.17  ? 110 PHE A CZ  1 
ATOM   682   N N   . VAL A 1 111 ? 87.126  42.426 105.725 1.00 29.06  ? 111 VAL A N   1 
ATOM   683   C CA  . VAL A 1 111 ? 87.637  41.065 105.837 1.00 29.06  ? 111 VAL A CA  1 
ATOM   684   C C   . VAL A 1 111 ? 89.090  40.967 105.453 1.00 29.06  ? 111 VAL A C   1 
ATOM   685   O O   . VAL A 1 111 ? 89.525  41.565 104.483 1.00 29.06  ? 111 VAL A O   1 
ATOM   686   C CB  . VAL A 1 111 ? 86.845  40.107 104.969 1.00 20.35  ? 111 VAL A CB  1 
ATOM   687   C CG1 . VAL A 1 111 ? 87.227  38.714 105.295 1.00 20.35  ? 111 VAL A CG1 1 
ATOM   688   C CG2 . VAL A 1 111 ? 85.392  40.282 105.215 1.00 20.35  ? 111 VAL A CG2 1 
ATOM   689   N N   . ARG A 1 112 ? 89.841  40.206 106.232 1.00 52.89  ? 112 ARG A N   1 
ATOM   690   C CA  . ARG A 1 112 ? 91.258  40.039 105.988 1.00 52.89  ? 112 ARG A CA  1 
ATOM   691   C C   . ARG A 1 112 ? 91.556  38.576 105.781 1.00 52.89  ? 112 ARG A C   1 
ATOM   692   O O   . ARG A 1 112 ? 91.235  37.733 106.619 1.00 52.89  ? 112 ARG A O   1 
ATOM   693   C CB  . ARG A 1 112 ? 92.070  40.547 107.174 1.00 39.63  ? 112 ARG A CB  1 
ATOM   694   C CG  . ARG A 1 112 ? 93.496  40.776 106.818 1.00 39.63  ? 112 ARG A CG  1 
ATOM   695   C CD  . ARG A 1 112 ? 94.324  41.202 107.986 1.00 39.63  ? 112 ARG A CD  1 
ATOM   696   N NE  . ARG A 1 112 ? 95.293  40.167 108.282 1.00 39.63  ? 112 ARG A NE  1 
ATOM   697   C CZ  . ARG A 1 112 ? 96.584  40.398 108.459 1.00 39.63  ? 112 ARG A CZ  1 
ATOM   698   N NH1 . ARG A 1 112 ? 97.044  41.656 108.365 1.00 39.63  ? 112 ARG A NH1 1 
ATOM   699   N NH2 . ARG A 1 112 ? 97.406  39.375 108.725 1.00 39.63  ? 112 ARG A NH2 1 
ATOM   700   N N   . VAL A 1 113 ? 92.178  38.271 104.655 1.00 33.03  ? 113 VAL A N   1 
ATOM   701   C CA  . VAL A 1 113 ? 92.528  36.894 104.336 1.00 33.03  ? 113 VAL A CA  1 
ATOM   702   C C   . VAL A 1 113 ? 94.024  36.722 104.446 1.00 33.03  ? 113 VAL A C   1 
ATOM   703   O O   . VAL A 1 113 ? 94.797  37.588 104.062 1.00 33.03  ? 113 VAL A O   1 
ATOM   704   C CB  . VAL A 1 113 ? 92.096  36.543 102.927 1.00 27.65  ? 113 VAL A CB  1 
ATOM   705   C CG1 . VAL A 1 113 ? 92.465  35.120 102.635 1.00 27.65  ? 113 VAL A CG1 1 
ATOM   706   C CG2 . VAL A 1 113 ? 90.601  36.788 102.766 1.00 27.65  ? 113 VAL A CG2 1 
ATOM   707   N N   . GLN A 1 114 ? 94.432  35.585 104.966 1.00 27.77  ? 114 GLN A N   1 
ATOM   708   C CA  . GLN A 1 114 ? 95.844  35.340 105.153 1.00 27.77  ? 114 GLN A CA  1 
ATOM   709   C C   . GLN A 1 114 ? 96.205  33.945 104.707 1.00 27.77  ? 114 GLN A C   1 
ATOM   710   O O   . GLN A 1 114 ? 95.420  33.022 104.865 1.00 27.77  ? 114 GLN A O   1 
ATOM   711   C CB  . GLN A 1 114 ? 96.195  35.506 106.621 1.00 56.23  ? 114 GLN A CB  1 
ATOM   712   C CG  . GLN A 1 114 ? 97.656  35.593 106.875 1.00 56.23  ? 114 GLN A CG  1 
ATOM   713   C CD  . GLN A 1 114 ? 97.975  35.616 108.341 1.00 56.23  ? 114 GLN A CD  1 
ATOM   714   O OE1 . GLN A 1 114 ? 97.806  34.626 109.028 1.00 56.23  ? 114 GLN A OE1 1 
ATOM   715   N NE2 . GLN A 1 114 ? 98.434  36.754 108.833 1.00 56.23  ? 114 GLN A NE2 1 
ATOM   716   N N   . LEU A 1 115 ? 97.392  33.800 104.135 1.00 33.87  ? 115 LEU A N   1 
ATOM   717   C CA  . LEU A 1 115 ? 97.852  32.495 103.707 1.00 33.87  ? 115 LEU A CA  1 
ATOM   718   C C   . LEU A 1 115 ? 98.774  31.965 104.800 1.00 33.87  ? 115 LEU A C   1 
ATOM   719   O O   . LEU A 1 115 ? 99.246  32.719 105.639 1.00 33.87  ? 115 LEU A O   1 
ATOM   720   C CB  . LEU A 1 115 ? 98.604  32.606 102.379 1.00 40.37  ? 115 LEU A CB  1 
ATOM   721   C CG  . LEU A 1 115 ? 97.825  33.152 101.170 1.00 40.37  ? 115 LEU A CG  1 
ATOM   722   C CD1 . LEU A 1 115 ? 98.727  33.200 99.961  1.00 40.37  ? 115 LEU A CD1 1 
ATOM   723   C CD2 . LEU A 1 115 ? 96.611  32.285 100.893 1.00 40.37  ? 115 LEU A CD2 1 
ATOM   724   N N   . LYS A 1 116 ? 99.043  30.672 104.805 1.00 36.11  ? 116 LYS A N   1 
ATOM   725   C CA  . LYS A 1 116 ? 99.909  30.103 105.823 1.00 36.11  ? 116 LYS A CA  1 
ATOM   726   C C   . LYS A 1 116 ? 101.307 30.729 105.923 1.00 36.11  ? 116 LYS A C   1 
ATOM   727   O O   . LYS A 1 116 ? 102.002 30.538 106.916 1.00 36.11  ? 116 LYS A O   1 
ATOM   728   C CB  . LYS A 1 116 ? 100.062 28.610 105.585 1.00 47.63  ? 116 LYS A CB  1 
ATOM   729   C CG  . LYS A 1 116 ? 100.712 28.284 104.263 1.00 47.63  ? 116 LYS A CG  1 
ATOM   730   C CD  . LYS A 1 116 ? 100.892 26.790 104.082 1.00 47.63  ? 116 LYS A CD  1 
ATOM   731   C CE  . LYS A 1 116 ? 101.409 26.444 102.678 1.00 47.63  ? 116 LYS A CE  1 
ATOM   732   N NZ  . LYS A 1 116 ? 101.573 24.967 102.462 1.00 47.63  ? 116 LYS A NZ  1 
ATOM   733   N N   . ASP A 1 117 ? 101.745 31.474 104.922 1.00 44.00  ? 117 ASP A N   1 
ATOM   734   C CA  . ASP A 1 117 ? 103.082 32.022 105.019 1.00 44.00  ? 117 ASP A CA  1 
ATOM   735   C C   . ASP A 1 117 ? 103.151 33.423 105.597 1.00 44.00  ? 117 ASP A C   1 
ATOM   736   O O   . ASP A 1 117 ? 104.246 33.964 105.761 1.00 44.00  ? 117 ASP A O   1 
ATOM   737   C CB  . ASP A 1 117 ? 103.758 31.995 103.657 1.00 64.29  ? 117 ASP A CB  1 
ATOM   738   C CG  . ASP A 1 117 ? 103.262 33.081 102.744 1.00 64.29  ? 117 ASP A CG  1 
ATOM   739   O OD1 . ASP A 1 117 ? 102.073 33.440 102.817 1.00 64.29  ? 117 ASP A OD1 1 
ATOM   740   O OD2 . ASP A 1 117 ? 104.063 33.579 101.932 1.00 64.29  ? 117 ASP A OD2 1 
ATOM   741   N N   . GLY A 1 118 ? 101.999 34.011 105.927 1.00 34.62  ? 118 GLY A N   1 
ATOM   742   C CA  . GLY A 1 118 ? 101.982 35.369 106.468 1.00 34.62  ? 118 GLY A CA  1 
ATOM   743   C C   . GLY A 1 118 ? 101.400 36.386 105.490 1.00 34.62  ? 118 GLY A C   1 
ATOM   744   O O   . GLY A 1 118 ? 100.954 37.484 105.871 1.00 34.62  ? 118 GLY A O   1 
ATOM   745   N N   . SER A 1 119 ? 101.414 35.995 104.222 1.00 50.21  ? 119 SER A N   1 
ATOM   746   C CA  . SER A 1 119 ? 100.874 36.774 103.123 1.00 50.21  ? 119 SER A CA  1 
ATOM   747   C C   . SER A 1 119 ? 99.390  37.137 103.404 1.00 50.21  ? 119 SER A C   1 
ATOM   748   O O   . SER A 1 119 ? 98.608  36.287 103.877 1.00 50.21  ? 119 SER A O   1 
ATOM   749   C CB  . SER A 1 119 ? 100.995 35.928 101.858 1.00 53.84  ? 119 SER A CB  1 
ATOM   750   O OG  . SER A 1 119 ? 100.726 36.698 100.718 1.00 53.84  ? 119 SER A OG  1 
ATOM   751   N N   . TYR A 1 120 ? 98.990  38.377 103.100 1.00 27.66  ? 120 TYR A N   1 
ATOM   752   C CA  . TYR A 1 120 ? 97.610  38.791 103.366 1.00 27.66  ? 120 TYR A CA  1 
ATOM   753   C C   . TYR A 1 120 ? 97.034  39.903 102.484 1.00 27.66  ? 120 TYR A C   1 
ATOM   754   O O   . TYR A 1 120 ? 97.758  40.722 101.929 1.00 27.66  ? 120 TYR A O   1 
ATOM   755   C CB  . TYR A 1 120 ? 97.516  39.250 104.823 1.00 26.85  ? 120 TYR A CB  1 
ATOM   756   C CG  . TYR A 1 120 ? 98.357  40.487 105.126 1.00 26.85  ? 120 TYR A CG  1 
ATOM   757   C CD1 . TYR A 1 120 ? 97.880  41.771 104.859 1.00 26.85  ? 120 TYR A CD1 1 
ATOM   758   C CD2 . TYR A 1 120 ? 99.648  40.374 105.632 1.00 26.85  ? 120 TYR A CD2 1 
ATOM   759   C CE1 . TYR A 1 120 ? 98.665  42.901 105.086 1.00 26.85  ? 120 TYR A CE1 1 
ATOM   760   C CE2 . TYR A 1 120 ? 100.441 41.506 105.854 1.00 26.85  ? 120 TYR A CE2 1 
ATOM   761   C CZ  . TYR A 1 120 ? 99.942  42.755 105.578 1.00 26.85  ? 120 TYR A CZ  1 
ATOM   762   O OH  . TYR A 1 120 ? 100.739 43.860 105.777 1.00 26.85  ? 120 TYR A OH  1 
ATOM   763   N N   . HIS A 1 121 ? 95.712  39.932 102.384 1.00 42.11  ? 121 HIS A N   1 
ATOM   764   C CA  . HIS A 1 121 ? 94.997  40.965 101.643 1.00 42.11  ? 121 HIS A CA  1 
ATOM   765   C C   . HIS A 1 121 ? 93.706  41.206 102.412 1.00 42.11  ? 121 HIS A C   1 
ATOM   766   O O   . HIS A 1 121 ? 93.086  40.259 102.926 1.00 42.11  ? 121 HIS A O   1 
ATOM   767   C CB  . HIS A 1 121 ? 94.663  40.523 100.220 1.00 53.76  ? 121 HIS A CB  1 
ATOM   768   C CG  . HIS A 1 121 ? 95.855  40.396 99.327  1.00 53.76  ? 121 HIS A CG  1 
ATOM   769   N ND1 . HIS A 1 121 ? 96.215  39.207 98.727  1.00 53.76  ? 121 HIS A ND1 1 
ATOM   770   C CD2 . HIS A 1 121 ? 96.765  41.310 98.922  1.00 53.76  ? 121 HIS A CD2 1 
ATOM   771   C CE1 . HIS A 1 121 ? 97.293  39.395 97.988  1.00 53.76  ? 121 HIS A CE1 1 
ATOM   772   N NE2 . HIS A 1 121 ? 97.647  40.664 98.090  1.00 53.76  ? 121 HIS A NE2 1 
ATOM   773   N N   . GLU A 1 122 ? 93.299  42.468 102.498 1.00 36.61  ? 122 GLU A N   1 
ATOM   774   C CA  . GLU A 1 122 ? 92.082  42.841 103.218 1.00 36.61  ? 122 GLU A CA  1 
ATOM   775   C C   . GLU A 1 122 ? 91.218  43.759 102.348 1.00 36.61  ? 122 GLU A C   1 
ATOM   776   O O   . GLU A 1 122 ? 91.734  44.603 101.625 1.00 36.61  ? 122 GLU A O   1 
ATOM   777   C CB  . GLU A 1 122 ? 92.479  43.548 104.525 1.00 52.17  ? 122 GLU A CB  1 
ATOM   778   C CG  . GLU A 1 122 ? 91.343  44.217 105.286 1.00 52.17  ? 122 GLU A CG  1 
ATOM   779   C CD  . GLU A 1 122 ? 91.791  44.918 106.574 1.00 52.17  ? 122 GLU A CD  1 
ATOM   780   O OE1 . GLU A 1 122 ? 92.895  45.516 106.600 1.00 52.17  ? 122 GLU A OE1 1 
ATOM   781   O OE2 . GLU A 1 122 ? 91.024  44.895 107.557 1.00 52.17  ? 122 GLU A OE2 1 
ATOM   782   N N   . ASP A 1 123 ? 89.900  43.593 102.395 1.00 40.55  ? 123 ASP A N   1 
ATOM   783   C CA  . ASP A 1 123 ? 89.020  44.460 101.605 1.00 40.55  ? 123 ASP A CA  1 
ATOM   784   C C   . ASP A 1 123 ? 87.692  44.776 102.320 1.00 40.55  ? 123 ASP A C   1 
ATOM   785   O O   . ASP A 1 123 ? 87.450  44.323 103.448 1.00 40.55  ? 123 ASP A O   1 
ATOM   786   C CB  . ASP A 1 123 ? 88.750  43.822 100.243 1.00 71.96  ? 123 ASP A CB  1 
ATOM   787   C CG  . ASP A 1 123 ? 88.711  44.842 99.123  1.00 71.96  ? 123 ASP A CG  1 
ATOM   788   O OD1 . ASP A 1 123 ? 87.864  45.753 99.181  1.00 71.96  ? 123 ASP A OD1 1 
ATOM   789   O OD2 . ASP A 1 123 ? 89.531  44.737 98.186  1.00 71.96  ? 123 ASP A OD2 1 
ATOM   790   N N   . VAL A 1 124 ? 86.846  45.574 101.677 1.00 40.45  ? 124 VAL A N   1 
ATOM   791   C CA  . VAL A 1 124 ? 85.544  45.919 102.249 1.00 40.45  ? 124 VAL A CA  1 
ATOM   792   C C   . VAL A 1 124 ? 84.484  45.156 101.515 1.00 40.45  ? 124 VAL A C   1 
ATOM   793   O O   . VAL A 1 124 ? 84.561  45.004 100.306 1.00 40.45  ? 124 VAL A O   1 
ATOM   794   C CB  . VAL A 1 124 ? 85.139  47.365 102.029 1.00 39.03  ? 124 VAL A CB  1 
ATOM   795   C CG1 . VAL A 1 124 ? 84.562  47.919 103.304 1.00 39.03  ? 124 VAL A CG1 1 
ATOM   796   C CG2 . VAL A 1 124 ? 86.286  48.167 101.517 1.00 39.03  ? 124 VAL A CG2 1 
ATOM   797   N N   . GLY A 1 125 ? 83.478  44.705 102.239 1.00 44.28  ? 125 GLY A N   1 
ATOM   798   C CA  . GLY A 1 125 ? 82.387  43.992 101.613 1.00 44.28  ? 125 GLY A CA  1 
ATOM   799   C C   . GLY A 1 125 ? 81.183  44.830 101.959 1.00 44.28  ? 125 GLY A C   1 
ATOM   800   O O   . GLY A 1 125 ? 81.261  45.651 102.876 1.00 44.28  ? 125 GLY A O   1 
ATOM   801   N N   . TYR A 1 126 ? 80.081  44.674 101.240 1.00 52.48  ? 126 TYR A N   1 
ATOM   802   C CA  . TYR A 1 126 ? 78.899  45.450 101.570 1.00 52.48  ? 126 TYR A CA  1 
ATOM   803   C C   . TYR A 1 126 ? 77.648  44.580 101.482 1.00 52.48  ? 126 TYR A C   1 
ATOM   804   O O   . TYR A 1 126 ? 77.510  43.774 100.568 1.00 52.48  ? 126 TYR A O   1 
ATOM   805   C CB  . TYR A 1 126 ? 78.773  46.655 100.649 1.00 41.97  ? 126 TYR A CB  1 
ATOM   806   C CG  . TYR A 1 126 ? 78.077  47.816 101.324 1.00 41.97  ? 126 TYR A CG  1 
ATOM   807   C CD1 . TYR A 1 126 ? 78.776  48.650 102.192 1.00 41.97  ? 126 TYR A CD1 1 
ATOM   808   C CD2 . TYR A 1 126 ? 76.696  48.033 101.162 1.00 41.97  ? 126 TYR A CD2 1 
ATOM   809   C CE1 . TYR A 1 126 ? 78.132  49.662 102.888 1.00 41.97  ? 126 TYR A CE1 1 
ATOM   810   C CE2 . TYR A 1 126 ? 76.037  49.053 101.857 1.00 41.97  ? 126 TYR A CE2 1 
ATOM   811   C CZ  . TYR A 1 126 ? 76.765  49.861 102.717 1.00 41.97  ? 126 TYR A CZ  1 
ATOM   812   O OH  . TYR A 1 126 ? 76.151  50.886 103.406 1.00 41.97  ? 126 TYR A OH  1 
ATOM   813   N N   . GLY A 1 127 ? 76.756  44.730 102.456 1.00 57.89  ? 127 GLY A N   1 
ATOM   814   C CA  . GLY A 1 127 ? 75.536  43.947 102.488 1.00 57.89  ? 127 GLY A CA  1 
ATOM   815   C C   . GLY A 1 127 ? 74.371  44.900 102.421 1.00 57.89  ? 127 GLY A C   1 
ATOM   816   O O   . GLY A 1 127 ? 74.416  45.985 103.020 1.00 57.89  ? 127 GLY A O   1 
ATOM   817   N N   . VAL A 1 128 ? 73.326  44.501 101.701 1.00 63.75  ? 128 VAL A N   1 
ATOM   818   C CA  . VAL A 1 128 ? 72.166  45.354 101.522 1.00 63.75  ? 128 VAL A CA  1 
ATOM   819   C C   . VAL A 1 128 ? 70.843  44.628 101.607 1.00 63.75  ? 128 VAL A C   1 
ATOM   820   O O   . VAL A 1 128 ? 70.741  43.479 101.200 1.00 63.75  ? 128 VAL A O   1 
ATOM   821   C CB  . VAL A 1 128 ? 72.202  46.006 100.162 1.00 37.71  ? 128 VAL A CB  1 
ATOM   822   C CG1 . VAL A 1 128 ? 71.148  47.040 100.089 1.00 37.71  ? 128 VAL A CG1 1 
ATOM   823   C CG2 . VAL A 1 128 ? 73.555  46.624 99.899  1.00 37.71  ? 128 VAL A CG2 1 
ATOM   824   N N   . SER A 1 129 ? 69.830  45.307 102.131 1.00 63.19  ? 129 SER A N   1 
ATOM   825   C CA  . SER A 1 129 ? 68.479  44.757 102.236 1.00 63.19  ? 129 SER A CA  1 
ATOM   826   C C   . SER A 1 129 ? 67.576  45.969 102.109 1.00 63.19  ? 129 SER A C   1 
ATOM   827   O O   . SER A 1 129 ? 67.627  46.874 102.949 1.00 63.19  ? 129 SER A O   1 
ATOM   828   C CB  . SER A 1 129 ? 68.251  44.080 103.586 1.00 60.86  ? 129 SER A CB  1 
ATOM   829   O OG  . SER A 1 129 ? 66.910  43.634 103.712 1.00 60.86  ? 129 SER A OG  1 
ATOM   830   N N   . GLU A 1 130 ? 66.748  46.003 101.070 1.00 79.09  ? 130 GLU A N   1 
ATOM   831   C CA  . GLU A 1 130 ? 65.900  47.166 100.880 1.00 79.09  ? 130 GLU A CA  1 
ATOM   832   C C   . GLU A 1 130 ? 64.398  46.932 100.841 1.00 79.09  ? 130 GLU A C   1 
ATOM   833   O O   . GLU A 1 130 ? 63.627  47.886 100.837 1.00 79.09  ? 130 GLU A O   1 
ATOM   834   C CB  . GLU A 1 130 ? 66.348  47.916 99.620  1.00 86.06  ? 130 GLU A CB  1 
ATOM   835   C CG  . GLU A 1 130 ? 67.857  48.158 99.579  1.00 86.06  ? 130 GLU A CG  1 
ATOM   836   C CD  . GLU A 1 130 ? 68.275  49.393 98.774  1.00 86.06  ? 130 GLU A CD  1 
ATOM   837   O OE1 . GLU A 1 130 ? 68.031  50.529 99.248  1.00 86.06  ? 130 GLU A OE1 1 
ATOM   838   O OE2 . GLU A 1 130 ? 68.857  49.225 97.673  1.00 86.06  ? 130 GLU A OE2 1 
ATOM   839   N N   . GLY A 1 131 ? 63.967  45.679 100.838 1.00 79.16  ? 131 GLY A N   1 
ATOM   840   C CA  . GLY A 1 131 ? 62.535  45.433 100.783 1.00 79.16  ? 131 GLY A CA  1 
ATOM   841   C C   . GLY A 1 131 ? 61.862  45.086 102.094 1.00 79.16  ? 131 GLY A C   1 
ATOM   842   O O   . GLY A 1 131 ? 61.073  45.867 102.618 1.00 79.16  ? 131 GLY A O   1 
ATOM   843   N N   . LEU A 1 132 ? 62.192  43.903 102.606 1.00 63.99  ? 132 LEU A N   1 
ATOM   844   C CA  . LEU A 1 132 ? 61.659  43.341 103.848 1.00 63.99  ? 132 LEU A CA  1 
ATOM   845   C C   . LEU A 1 132 ? 60.915  44.221 104.862 1.00 63.99  ? 132 LEU A C   1 
ATOM   846   O O   . LEU A 1 132 ? 61.238  45.390 105.083 1.00 63.99  ? 132 LEU A O   1 
ATOM   847   C CB  . LEU A 1 132 ? 62.779  42.590 104.564 1.00 107.02 ? 132 LEU A CB  1 
ATOM   848   C CG  . LEU A 1 132 ? 63.332  41.419 103.753 1.00 107.02 ? 132 LEU A CG  1 
ATOM   849   C CD1 . LEU A 1 132 ? 64.581  40.893 104.423 1.00 107.02 ? 132 LEU A CD1 1 
ATOM   850   C CD2 . LEU A 1 132 ? 62.274  40.326 103.629 1.00 107.02 ? 132 LEU A CD2 1 
ATOM   851   N N   . LYS A 1 133 ? 59.903  43.623 105.479 1.00 80.04  ? 133 LYS A N   1 
ATOM   852   C CA  . LYS A 1 133 ? 59.115  44.304 106.489 1.00 80.04  ? 133 LYS A CA  1 
ATOM   853   C C   . LYS A 1 133 ? 59.713  43.938 107.838 1.00 80.04  ? 133 LYS A C   1 
ATOM   854   O O   . LYS A 1 133 ? 59.497  44.633 108.833 1.00 80.04  ? 133 LYS A O   1 
ATOM   855   C CB  . LYS A 1 133 ? 57.654  43.851 106.428 1.00 141.21 ? 133 LYS A CB  1 
ATOM   856   C CG  . LYS A 1 133 ? 56.917  44.255 105.155 1.00 141.21 ? 133 LYS A CG  1 
ATOM   857   C CD  . LYS A 1 133 ? 55.507  43.674 105.114 1.00 141.21 ? 133 LYS A CD  1 
ATOM   858   C CE  . LYS A 1 133 ? 54.658  44.175 106.271 1.00 141.21 ? 133 LYS A CE  1 
ATOM   859   N NZ  . LYS A 1 133 ? 54.522  45.656 106.252 1.00 141.21 ? 133 LYS A NZ  1 
ATOM   860   N N   . SER A 1 134 ? 60.465  42.837 107.864 1.00 78.46  ? 134 SER A N   1 
ATOM   861   C CA  . SER A 1 134 ? 61.106  42.389 109.092 1.00 78.46  ? 134 SER A CA  1 
ATOM   862   C C   . SER A 1 134 ? 62.459  43.047 109.268 1.00 78.46  ? 134 SER A C   1 
ATOM   863   O O   . SER A 1 134 ? 63.326  42.971 108.392 1.00 78.46  ? 134 SER A O   1 
ATOM   864   C CB  . SER A 1 134 ? 61.299  40.878 109.098 1.00 86.80  ? 134 SER A CB  1 
ATOM   865   O OG  . SER A 1 134 ? 61.980  40.485 110.277 1.00 86.80  ? 134 SER A OG  1 
ATOM   866   N N   . LYS A 1 135 ? 62.641  43.693 110.412 1.00 89.91  ? 135 LYS A N   1 
ATOM   867   C CA  . LYS A 1 135 ? 63.901  44.347 110.696 1.00 89.91  ? 135 LYS A CA  1 
ATOM   868   C C   . LYS A 1 135 ? 64.974  43.270 110.864 1.00 89.91  ? 135 LYS A C   1 
ATOM   869   O O   . LYS A 1 135 ? 66.033  43.332 110.239 1.00 89.91  ? 135 LYS A O   1 
ATOM   870   C CB  . LYS A 1 135 ? 63.774  45.197 111.961 1.00 60.85  ? 135 LYS A CB  1 
ATOM   871   C CG  . LYS A 1 135 ? 65.025  45.978 112.273 1.00 60.85  ? 135 LYS A CG  1 
ATOM   872   C CD  . LYS A 1 135 ? 64.732  47.286 112.972 1.00 60.85  ? 135 LYS A CD  1 
ATOM   873   C CE  . LYS A 1 135 ? 64.290  47.064 114.381 1.00 60.85  ? 135 LYS A CE  1 
ATOM   874   N NZ  . LYS A 1 135 ? 64.129  48.371 115.036 1.00 60.85  ? 135 LYS A NZ  1 
ATOM   875   N N   . ALA A 1 136 ? 64.678  42.271 111.691 1.00 60.88  ? 136 ALA A N   1 
ATOM   876   C CA  . ALA A 1 136 ? 65.604  41.181 111.935 1.00 60.88  ? 136 ALA A CA  1 
ATOM   877   C C   . ALA A 1 136 ? 66.090  40.595 110.619 1.00 60.88  ? 136 ALA A C   1 
ATOM   878   O O   . ALA A 1 136 ? 67.293  40.531 110.368 1.00 60.88  ? 136 ALA A O   1 
ATOM   879   C CB  . ALA A 1 136 ? 64.934  40.097 112.764 1.00 63.43  ? 136 ALA A CB  1 
ATOM   880   N N   . LEU A 1 137 ? 65.165  40.165 109.774 1.00 64.05  ? 137 LEU A N   1 
ATOM   881   C CA  . LEU A 1 137 ? 65.576  39.580 108.511 1.00 64.05  ? 137 LEU A CA  1 
ATOM   882   C C   . LEU A 1 137 ? 66.378  40.532 107.644 1.00 64.05  ? 137 LEU A C   1 
ATOM   883   O O   . LEU A 1 137 ? 67.261  40.092 106.906 1.00 64.05  ? 137 LEU A O   1 
ATOM   884   C CB  . LEU A 1 137 ? 64.369  39.056 107.743 1.00 76.03  ? 137 LEU A CB  1 
ATOM   885   C CG  . LEU A 1 137 ? 64.016  37.608 108.084 1.00 76.03  ? 137 LEU A CG  1 
ATOM   886   C CD1 . LEU A 1 137 ? 63.859  37.437 109.592 1.00 76.03  ? 137 LEU A CD1 1 
ATOM   887   C CD2 . LEU A 1 137 ? 62.743  37.229 107.356 1.00 76.03  ? 137 LEU A CD2 1 
ATOM   888   N N   . SER A 1 138 ? 66.092  41.828 107.724 1.00 54.95  ? 138 SER A N   1 
ATOM   889   C CA  . SER A 1 138 ? 66.850  42.782 106.917 1.00 54.95  ? 138 SER A CA  1 
ATOM   890   C C   . SER A 1 138 ? 68.323  42.859 107.367 1.00 54.95  ? 138 SER A C   1 
ATOM   891   O O   . SER A 1 138 ? 69.239  42.874 106.537 1.00 54.95  ? 138 SER A O   1 
ATOM   892   C CB  . SER A 1 138 ? 66.194  44.155 106.969 1.00 69.58  ? 138 SER A CB  1 
ATOM   893   O OG  . SER A 1 138 ? 65.020  44.161 106.180 1.00 69.58  ? 138 SER A OG  1 
ATOM   894   N N   . LEU A 1 139 ? 68.548  42.903 108.678 1.00 43.54  ? 139 LEU A N   1 
ATOM   895   C CA  . LEU A 1 139 ? 69.898  42.938 109.226 1.00 43.54  ? 139 LEU A CA  1 
ATOM   896   C C   . LEU A 1 139 ? 70.637  41.629 108.924 1.00 43.54  ? 139 LEU A C   1 
ATOM   897   O O   . LEU A 1 139 ? 71.762  41.627 108.420 1.00 43.54  ? 139 LEU A O   1 
ATOM   898   C CB  . LEU A 1 139 ? 69.840  43.143 110.726 1.00 39.39  ? 139 LEU A CB  1 
ATOM   899   C CG  . LEU A 1 139 ? 69.494  44.560 111.139 1.00 39.39  ? 139 LEU A CG  1 
ATOM   900   C CD1 . LEU A 1 139 ? 69.395  44.605 112.648 1.00 39.39  ? 139 LEU A CD1 1 
ATOM   901   C CD2 . LEU A 1 139 ? 70.561  45.537 110.640 1.00 39.39  ? 139 LEU A CD2 1 
ATOM   902   N N   . GLU A 1 140 ? 70.004  40.508 109.240 1.00 50.27  ? 140 GLU A N   1 
ATOM   903   C CA  . GLU A 1 140 ? 70.621  39.219 108.981 1.00 50.27  ? 140 GLU A CA  1 
ATOM   904   C C   . GLU A 1 140 ? 71.154  39.189 107.561 1.00 50.27  ? 140 GLU A C   1 
ATOM   905   O O   . GLU A 1 140 ? 72.291  38.818 107.308 1.00 50.27  ? 140 GLU A O   1 
ATOM   906   C CB  . GLU A 1 140 ? 69.610  38.088 109.172 1.00 73.41  ? 140 GLU A CB  1 
ATOM   907   C CG  . GLU A 1 140 ? 70.132  36.724 108.705 1.00 73.41  ? 140 GLU A CG  1 
ATOM   908   C CD  . GLU A 1 140 ? 69.201  35.566 109.053 1.00 73.41  ? 140 GLU A CD  1 
ATOM   909   O OE1 . GLU A 1 140 ? 67.990  35.665 108.767 1.00 73.41  ? 140 GLU A OE1 1 
ATOM   910   O OE2 . GLU A 1 140 ? 69.682  34.552 109.602 1.00 73.41  ? 140 GLU A OE2 1 
ATOM   911   N N   . LYS A 1 141 ? 70.328  39.618 106.633 1.00 42.61  ? 141 LYS A N   1 
ATOM   912   C CA  . LYS A 1 141 ? 70.713  39.612 105.238 1.00 42.61  ? 141 LYS A CA  1 
ATOM   913   C C   . LYS A 1 141 ? 71.925  40.484 104.959 1.00 42.61  ? 141 LYS A C   1 
ATOM   914   O O   . LYS A 1 141 ? 72.916  40.025 104.396 1.00 42.61  ? 141 LYS A O   1 
ATOM   915   C CB  . LYS A 1 141 ? 69.538  40.075 104.385 1.00 50.78  ? 141 LYS A CB  1 
ATOM   916   C CG  . LYS A 1 141 ? 69.610  39.612 102.957 1.00 50.78  ? 141 LYS A CG  1 
ATOM   917   C CD  . LYS A 1 141 ? 69.637  40.771 101.996 1.00 50.78  ? 141 LYS A CD  1 
ATOM   918   C CE  . LYS A 1 141 ? 69.398  40.278 100.591 1.00 50.78  ? 141 LYS A CE  1 
ATOM   919   N NZ  . LYS A 1 141 ? 69.773  41.289 99.554  1.00 50.78  ? 141 LYS A NZ  1 
ATOM   920   N N   . ALA A 1 142 ? 71.850  41.746 105.360 1.00 47.56  ? 142 ALA A N   1 
ATOM   921   C CA  . ALA A 1 142 ? 72.944  42.669 105.117 1.00 47.56  ? 142 ALA A CA  1 
ATOM   922   C C   . ALA A 1 142 ? 74.246  42.342 105.860 1.00 47.56  ? 142 ALA A C   1 
ATOM   923   O O   . ALA A 1 142 ? 75.325  42.472 105.274 1.00 47.56  ? 142 ALA A O   1 
ATOM   924   C CB  . ALA A 1 142 ? 72.498  44.086 105.435 1.00 34.72  ? 142 ALA A CB  1 
ATOM   925   N N   . ARG A 1 143 ? 74.172  41.935 107.134 1.00 35.94  ? 143 ARG A N   1 
ATOM   926   C CA  . ARG A 1 143 ? 75.394  41.601 107.879 1.00 35.94  ? 143 ARG A CA  1 
ATOM   927   C C   . ARG A 1 143 ? 76.044  40.379 107.241 1.00 35.94  ? 143 ARG A C   1 
ATOM   928   O O   . ARG A 1 143 ? 77.254  40.359 107.017 1.00 35.94  ? 143 ARG A O   1 
ATOM   929   C CB  . ARG A 1 143 ? 75.113  41.297 109.360 1.00 38.97  ? 143 ARG A CB  1 
ATOM   930   C CG  . ARG A 1 143 ? 74.216  42.301 110.072 1.00 38.97  ? 143 ARG A CG  1 
ATOM   931   C CD  . ARG A 1 143 ? 74.281  42.205 111.612 1.00 38.97  ? 143 ARG A CD  1 
ATOM   932   N NE  . ARG A 1 143 ? 75.444  42.950 112.073 1.00 38.97  ? 143 ARG A NE  1 
ATOM   933   C CZ  . ARG A 1 143 ? 75.457  43.826 113.069 1.00 38.97  ? 143 ARG A CZ  1 
ATOM   934   N NH1 . ARG A 1 143 ? 74.364  44.090 113.754 1.00 38.97  ? 143 ARG A NH1 1 
ATOM   935   N NH2 . ARG A 1 143 ? 76.578  44.473 113.346 1.00 38.97  ? 143 ARG A NH2 1 
ATOM   936   N N   . LYS A 1 144 ? 75.247  39.367 106.924 1.00 33.07  ? 144 LYS A N   1 
ATOM   937   C CA  . LYS A 1 144 ? 75.816  38.176 106.309 1.00 33.07  ? 144 LYS A CA  1 
ATOM   938   C C   . LYS A 1 144 ? 76.429  38.439 104.937 1.00 33.07  ? 144 LYS A C   1 
ATOM   939   O O   . LYS A 1 144 ? 77.535  37.977 104.630 1.00 33.07  ? 144 LYS A O   1 
ATOM   940   C CB  . LYS A 1 144 ? 74.768  37.063 106.207 1.00 41.34  ? 144 LYS A CB  1 
ATOM   941   C CG  . LYS A 1 144 ? 74.353  36.515 107.565 1.00 41.34  ? 144 LYS A CG  1 
ATOM   942   C CD  . LYS A 1 144 ? 73.595  35.217 107.460 1.00 41.34  ? 144 LYS A CD  1 
ATOM   943   C CE  . LYS A 1 144 ? 73.215  34.735 108.839 1.00 41.34  ? 144 LYS A CE  1 
ATOM   944   N NZ  . LYS A 1 144 ? 72.650  33.353 108.815 1.00 41.34  ? 144 LYS A NZ  1 
ATOM   945   N N   . GLU A 1 145 ? 75.717  39.187 104.107 1.00 39.81  ? 145 GLU A N   1 
ATOM   946   C CA  . GLU A 1 145 ? 76.215  39.455 102.785 1.00 39.81  ? 145 GLU A CA  1 
ATOM   947   C C   . GLU A 1 145 ? 77.450  40.312 102.834 1.00 39.81  ? 145 GLU A C   1 
ATOM   948   O O   . GLU A 1 145 ? 78.400  40.074 102.086 1.00 39.81  ? 145 GLU A O   1 
ATOM   949   C CB  . GLU A 1 145 ? 75.135  40.112 101.947 1.00 66.29  ? 145 GLU A CB  1 
ATOM   950   C CG  . GLU A 1 145 ? 74.341  39.114 101.118 1.00 66.29  ? 145 GLU A CG  1 
ATOM   951   C CD  . GLU A 1 145 ? 73.045  39.694 100.573 1.00 66.29  ? 145 GLU A CD  1 
ATOM   952   O OE1 . GLU A 1 145 ? 73.070  40.823 100.005 1.00 66.29  ? 145 GLU A OE1 1 
ATOM   953   O OE2 . GLU A 1 145 ? 72.010  39.004 100.720 1.00 66.29  ? 145 GLU A OE2 1 
ATOM   954   N N   . ALA A 1 146 ? 77.466  41.303 103.718 1.00 41.06  ? 146 ALA A N   1 
ATOM   955   C CA  . ALA A 1 146 ? 78.641  42.165 103.806 1.00 41.06  ? 146 ALA A CA  1 
ATOM   956   C C   . ALA A 1 146 ? 79.911  41.341 104.025 1.00 41.06  ? 146 ALA A C   1 
ATOM   957   O O   . ALA A 1 146 ? 80.940  41.593 103.387 1.00 41.06  ? 146 ALA A O   1 
ATOM   958   C CB  . ALA A 1 146 ? 78.475  43.170 104.921 1.00 45.20  ? 146 ALA A CB  1 
ATOM   959   N N   . VAL A 1 147 ? 79.835  40.345 104.906 1.00 37.74  ? 147 VAL A N   1 
ATOM   960   C CA  . VAL A 1 147 ? 80.999  39.525 105.187 1.00 37.74  ? 147 VAL A CA  1 
ATOM   961   C C   . VAL A 1 147 ? 81.425  38.720 103.960 1.00 37.74  ? 147 VAL A C   1 
ATOM   962   O O   . VAL A 1 147 ? 82.591  38.790 103.525 1.00 37.74  ? 147 VAL A O   1 
ATOM   963   C CB  . VAL A 1 147 ? 80.741  38.586 106.402 1.00 27.51  ? 147 VAL A CB  1 
ATOM   964   C CG1 . VAL A 1 147 ? 81.800  37.511 106.492 1.00 27.51  ? 147 VAL A CG1 1 
ATOM   965   C CG2 . VAL A 1 147 ? 80.777  39.383 107.675 1.00 27.51  ? 147 VAL A CG2 1 
ATOM   966   N N   . THR A 1 148 ? 80.495  37.965 103.384 1.00 45.75  ? 148 THR A N   1 
ATOM   967   C CA  . THR A 1 148 ? 80.848  37.164 102.226 1.00 45.75  ? 148 THR A CA  1 
ATOM   968   C C   . THR A 1 148 ? 81.421  38.036 101.115 1.00 45.75  ? 148 THR A C   1 
ATOM   969   O O   . THR A 1 148 ? 82.479  37.724 100.552 1.00 45.75  ? 148 THR A O   1 
ATOM   970   C CB  . THR A 1 148 ? 79.657  36.404 101.710 1.00 37.55  ? 148 THR A CB  1 
ATOM   971   O OG1 . THR A 1 148 ? 79.183  35.539 102.743 1.00 37.55  ? 148 THR A OG1 1 
ATOM   972   C CG2 . THR A 1 148 ? 80.059  35.554 100.512 1.00 37.55  ? 148 THR A CG2 1 
ATOM   973   N N   . ASP A 1 149 ? 80.729  39.134 100.812 1.00 37.87  ? 149 ASP A N   1 
ATOM   974   C CA  . ASP A 1 149 ? 81.190  40.058 99.785  1.00 37.87  ? 149 ASP A CA  1 
ATOM   975   C C   . ASP A 1 149 ? 82.630  40.544 100.125 1.00 37.87  ? 149 ASP A C   1 
ATOM   976   O O   . ASP A 1 149 ? 83.472  40.738 99.225  1.00 37.87  ? 149 ASP A O   1 
ATOM   977   C CB  . ASP A 1 149 ? 80.219  41.246 99.690  1.00 52.16  ? 149 ASP A CB  1 
ATOM   978   C CG  . ASP A 1 149 ? 80.540  42.180 98.529  1.00 52.16  ? 149 ASP A CG  1 
ATOM   979   O OD1 . ASP A 1 149 ? 80.661  41.688 97.389  1.00 52.16  ? 149 ASP A OD1 1 
ATOM   980   O OD2 . ASP A 1 149 ? 80.664  43.404 98.748  1.00 52.16  ? 149 ASP A OD2 1 
ATOM   981   N N   . GLY A 1 150 ? 82.900  40.732 101.422 1.00 41.27  ? 150 GLY A N   1 
ATOM   982   C CA  . GLY A 1 150 ? 84.212  41.160 101.855 1.00 41.27  ? 150 GLY A CA  1 
ATOM   983   C C   . GLY A 1 150 ? 85.218  40.060 101.621 1.00 41.27  ? 150 GLY A C   1 
ATOM   984   O O   . GLY A 1 150 ? 86.290  40.301 101.081 1.00 41.27  ? 150 GLY A O   1 
ATOM   985   N N   . LEU A 1 151 ? 84.879  38.843 102.016 1.00 42.20  ? 151 LEU A N   1 
ATOM   986   C CA  . LEU A 1 151 ? 85.790  37.727 101.809 1.00 42.20  ? 151 LEU A CA  1 
ATOM   987   C C   . LEU A 1 151 ? 86.090  37.541 100.333 1.00 42.20  ? 151 LEU A C   1 
ATOM   988   O O   . LEU A 1 151 ? 87.242  37.306 99.962  1.00 42.20  ? 151 LEU A O   1 
ATOM   989   C CB  . LEU A 1 151 ? 85.196  36.435 102.348 1.00 26.10  ? 151 LEU A CB  1 
ATOM   990   C CG  . LEU A 1 151 ? 85.977  35.146 102.096 1.00 26.10  ? 151 LEU A CG  1 
ATOM   991   C CD1 . LEU A 1 151 ? 87.379  35.251 102.632 1.00 26.10  ? 151 LEU A CD1 1 
ATOM   992   C CD2 . LEU A 1 151 ? 85.251  34.021 102.767 1.00 26.10  ? 151 LEU A CD2 1 
ATOM   993   N N   . LYS A 1 152 ? 85.063  37.626 99.488  1.00 37.10  ? 152 LYS A N   1 
ATOM   994   C CA  . LYS A 1 152 ? 85.285  37.472 98.047  1.00 37.10  ? 152 LYS A CA  1 
ATOM   995   C C   . LYS A 1 152 ? 86.219  38.557 97.516  1.00 37.10  ? 152 LYS A C   1 
ATOM   996   O O   . LYS A 1 152 ? 87.212  38.266 96.857  1.00 37.10  ? 152 LYS A O   1 
ATOM   997   C CB  . LYS A 1 152 ? 83.970  37.509 97.267  1.00 49.57  ? 152 LYS A CB  1 
ATOM   998   C CG  . LYS A 1 152 ? 83.118  36.289 97.465  1.00 49.57  ? 152 LYS A CG  1 
ATOM   999   C CD  . LYS A 1 152 ? 81.976  36.246 96.463  1.00 49.57  ? 152 LYS A CD  1 
ATOM   1000  C CE  . LYS A 1 152 ? 81.029  37.421 96.603  1.00 49.57  ? 152 LYS A CE  1 
ATOM   1001  N NZ  . LYS A 1 152 ? 79.795  37.176 95.807  1.00 49.57  ? 152 LYS A NZ  1 
ATOM   1002  N N   . ARG A 1 153 ? 85.914  39.809 97.817  1.00 38.11  ? 153 ARG A N   1 
ATOM   1003  C CA  . ARG A 1 153 ? 86.760  40.884 97.341  1.00 38.11  ? 153 ARG A CA  1 
ATOM   1004  C C   . ARG A 1 153 ? 88.201  40.749 97.810  1.00 38.11  ? 153 ARG A C   1 
ATOM   1005  O O   . ARG A 1 153 ? 89.138  41.113 97.094  1.00 38.11  ? 153 ARG A O   1 
ATOM   1006  C CB  . ARG A 1 153 ? 86.193  42.237 97.763  1.00 46.25  ? 153 ARG A CB  1 
ATOM   1007  C CG  . ARG A 1 153 ? 85.060  42.706 96.877  1.00 46.25  ? 153 ARG A CG  1 
ATOM   1008  C CD  . ARG A 1 153 ? 84.404  43.935 97.432  1.00 46.25  ? 153 ARG A CD  1 
ATOM   1009  N NE  . ARG A 1 153 ? 85.329  45.053 97.519  1.00 46.25  ? 153 ARG A NE  1 
ATOM   1010  C CZ  . ARG A 1 153 ? 85.615  45.859 96.507  1.00 46.25  ? 153 ARG A CZ  1 
ATOM   1011  N NH1 . ARG A 1 153 ? 85.043  45.663 95.329  1.00 46.25  ? 153 ARG A NH1 1 
ATOM   1012  N NH2 . ARG A 1 153 ? 86.456  46.874 96.680  1.00 46.25  ? 153 ARG A NH2 1 
ATOM   1013  N N   . ALA A 1 154 ? 88.401  40.220 99.005  1.00 37.63  ? 154 ALA A N   1 
ATOM   1014  C CA  . ALA A 1 154 ? 89.757  40.075 99.478  1.00 37.63  ? 154 ALA A CA  1 
ATOM   1015  C C   . ALA A 1 154 ? 90.495  38.967 98.730  1.00 37.63  ? 154 ALA A C   1 
ATOM   1016  O O   . ALA A 1 154 ? 91.658  39.144 98.369  1.00 37.63  ? 154 ALA A O   1 
ATOM   1017  C CB  . ALA A 1 154 ? 89.747  39.808 100.920 1.00 26.16  ? 154 ALA A CB  1 
ATOM   1018  N N   . LEU A 1 155 ? 89.835  37.834 98.481  1.00 39.31  ? 155 LEU A N   1 
ATOM   1019  C CA  . LEU A 1 155 ? 90.488  36.732 97.772  1.00 39.31  ? 155 LEU A CA  1 
ATOM   1020  C C   . LEU A 1 155 ? 90.824  37.083 96.323  1.00 39.31  ? 155 LEU A C   1 
ATOM   1021  O O   . LEU A 1 155 ? 91.765  36.526 95.739  1.00 39.31  ? 155 LEU A O   1 
ATOM   1022  C CB  . LEU A 1 155 ? 89.625  35.463 97.813  1.00 23.31  ? 155 LEU A CB  1 
ATOM   1023  C CG  . LEU A 1 155 ? 89.570  34.720 99.166  1.00 23.31  ? 155 LEU A CG  1 
ATOM   1024  C CD1 . LEU A 1 155 ? 88.274  33.882 99.290  1.00 23.31  ? 155 LEU A CD1 1 
ATOM   1025  C CD2 . LEU A 1 155 ? 90.810  33.862 99.322  1.00 23.31  ? 155 LEU A CD2 1 
ATOM   1026  N N   . ARG A 1 156 ? 90.063  37.998 95.731  1.00 48.58  ? 156 ARG A N   1 
ATOM   1027  C CA  . ARG A 1 156 ? 90.340  38.403 94.360  1.00 48.58  ? 156 ARG A CA  1 
ATOM   1028  C C   . ARG A 1 156 ? 91.782  38.880 94.256  1.00 48.58  ? 156 ARG A C   1 
ATOM   1029  O O   . ARG A 1 156 ? 92.453  38.653 93.264  1.00 48.58  ? 156 ARG A O   1 
ATOM   1030  C CB  . ARG A 1 156 ? 89.429  39.549 93.921  1.00 72.72  ? 156 ARG A CB  1 
ATOM   1031  C CG  . ARG A 1 156 ? 87.987  39.178 93.649  1.00 72.72  ? 156 ARG A CG  1 
ATOM   1032  C CD  . ARG A 1 156 ? 87.234  40.406 93.162  1.00 72.72  ? 156 ARG A CD  1 
ATOM   1033  N NE  . ARG A 1 156 ? 85.795  40.285 93.379  1.00 72.72  ? 156 ARG A NE  1 
ATOM   1034  C CZ  . ARG A 1 156 ? 84.947  41.302 93.283  1.00 72.72  ? 156 ARG A CZ  1 
ATOM   1035  N NH1 . ARG A 1 156 ? 85.399  42.513 92.972  1.00 72.72  ? 156 ARG A NH1 1 
ATOM   1036  N NH2 . ARG A 1 156 ? 83.650  41.110 93.503  1.00 72.72  ? 156 ARG A NH2 1 
ATOM   1037  N N   . SER A 1 157 ? 92.270  39.536 95.290  1.00 55.25  ? 157 SER A N   1 
ATOM   1038  C CA  . SER A 1 157 ? 93.618  40.056 95.253  1.00 55.25  ? 157 SER A CA  1 
ATOM   1039  C C   . SER A 1 157 ? 94.696  39.013 94.981  1.00 55.25  ? 157 SER A C   1 
ATOM   1040  O O   . SER A 1 157 ? 95.824  39.358 94.616  1.00 55.25  ? 157 SER A O   1 
ATOM   1041  C CB  . SER A 1 157 ? 93.915  40.795 96.556  1.00 53.39  ? 157 SER A CB  1 
ATOM   1042  O OG  . SER A 1 157 ? 93.010  41.868 96.740  1.00 53.39  ? 157 SER A OG  1 
ATOM   1043  N N   . PHE A 1 158 ? 94.379  37.738 95.141  1.00 56.78  ? 158 PHE A N   1 
ATOM   1044  C CA  . PHE A 1 158 ? 95.411  36.744 94.901  1.00 56.78  ? 158 PHE A CA  1 
ATOM   1045  C C   . PHE A 1 158 ? 95.551  36.373 93.440  1.00 56.78  ? 158 PHE A C   1 
ATOM   1046  O O   . PHE A 1 158 ? 96.576  35.830 93.040  1.00 56.78  ? 158 PHE A O   1 
ATOM   1047  C CB  . PHE A 1 158 ? 95.174  35.482 95.737  1.00 38.10  ? 158 PHE A CB  1 
ATOM   1048  C CG  . PHE A 1 158 ? 95.523  35.641 97.197  1.00 38.10  ? 158 PHE A CG  1 
ATOM   1049  C CD1 . PHE A 1 158 ? 94.540  35.547 98.182  1.00 38.10  ? 158 PHE A CD1 1 
ATOM   1050  C CD2 . PHE A 1 158 ? 96.833  35.917 97.585  1.00 38.10  ? 158 PHE A CD2 1 
ATOM   1051  C CE1 . PHE A 1 158 ? 94.852  35.726 99.515  1.00 38.10  ? 158 PHE A CE1 1 
ATOM   1052  C CE2 . PHE A 1 158 ? 97.158  36.097 98.923  1.00 38.10  ? 158 PHE A CE2 1 
ATOM   1053  C CZ  . PHE A 1 158 ? 96.169  36.002 99.883  1.00 38.10  ? 158 PHE A CZ  1 
ATOM   1054  N N   . GLY A 1 159 ? 94.536  36.659 92.632  1.00 52.20  ? 159 GLY A N   1 
ATOM   1055  C CA  . GLY A 1 159 ? 94.642  36.319 91.220  1.00 52.20  ? 159 GLY A CA  1 
ATOM   1056  C C   . GLY A 1 159 ? 93.333  36.113 90.495  1.00 52.20  ? 159 GLY A C   1 
ATOM   1057  O O   . GLY A 1 159 ? 92.264  36.244 91.085  1.00 52.20  ? 159 GLY A O   1 
ATOM   1058  N N   . ASN A 1 160 ? 93.416  35.788 89.207  1.00 45.60  ? 160 ASN A N   1 
ATOM   1059  C CA  . ASN A 1 160 ? 92.208  35.578 88.399  1.00 45.60  ? 160 ASN A CA  1 
ATOM   1060  C C   . ASN A 1 160 ? 91.433  34.357 88.861  1.00 45.60  ? 160 ASN A C   1 
ATOM   1061  O O   . ASN A 1 160 ? 90.211  34.385 88.942  1.00 45.60  ? 160 ASN A O   1 
ATOM   1062  C CB  . ASN A 1 160 ? 92.567  35.418 86.924  1.00 76.97  ? 160 ASN A CB  1 
ATOM   1063  C CG  . ASN A 1 160 ? 93.283  36.619 86.374  1.00 76.97  ? 160 ASN A CG  1 
ATOM   1064  O OD1 . ASN A 1 160 ? 92.806  37.744 86.496  1.00 76.97  ? 160 ASN A OD1 1 
ATOM   1065  N ND2 . ASN A 1 160 ? 94.436  36.391 85.764  1.00 76.97  ? 160 ASN A ND2 1 
ATOM   1066  N N   . ALA A 1 161 ? 92.165  33.292 89.170  1.00 59.57  ? 161 ALA A N   1 
ATOM   1067  C CA  . ALA A 1 161 ? 91.583  32.033 89.620  1.00 59.57  ? 161 ALA A CA  1 
ATOM   1068  C C   . ALA A 1 161 ? 90.643  32.169 90.826  1.00 59.57  ? 161 ALA A C   1 
ATOM   1069  O O   . ALA A 1 161 ? 89.780  31.318 91.043  1.00 59.57  ? 161 ALA A O   1 
ATOM   1070  C CB  . ALA A 1 161 ? 92.696  31.040 89.928  1.00 79.48  ? 161 ALA A CB  1 
ATOM   1071  N N   . LEU A 1 162 ? 90.810  33.228 91.611  1.00 52.65  ? 162 LEU A N   1 
ATOM   1072  C CA  . LEU A 1 162 ? 89.946  33.463 92.769  1.00 52.65  ? 162 LEU A CA  1 
ATOM   1073  C C   . LEU A 1 162 ? 89.006  34.641 92.526  1.00 52.65  ? 162 LEU A C   1 
ATOM   1074  O O   . LEU A 1 162 ? 88.493  35.235 93.471  1.00 52.65  ? 162 LEU A O   1 
ATOM   1075  C CB  . LEU A 1 162 ? 90.779  33.715 94.026  1.00 42.85  ? 162 LEU A CB  1 
ATOM   1076  C CG  . LEU A 1 162 ? 91.522  32.488 94.563  1.00 42.85  ? 162 LEU A CG  1 
ATOM   1077  C CD1 . LEU A 1 162 ? 92.487  32.896 95.635  1.00 42.85  ? 162 LEU A CD1 1 
ATOM   1078  C CD2 . LEU A 1 162 ? 90.525  31.486 95.116  1.00 42.85  ? 162 LEU A CD2 1 
ATOM   1079  N N   . GLY A 1 163 ? 88.802  34.991 91.256  1.00 59.60  ? 163 GLY A N   1 
ATOM   1080  C CA  . GLY A 1 163 ? 87.886  36.067 90.921  1.00 59.60  ? 163 GLY A CA  1 
ATOM   1081  C C   . GLY A 1 163 ? 88.374  37.419 90.409  1.00 59.60  ? 163 GLY A C   1 
ATOM   1082  O O   . GLY A 1 163 ? 87.534  38.288 90.137  1.00 59.60  ? 163 GLY A O   1 
ATOM   1083  N N   . ASN A 1 164 ? 89.684  37.634 90.271  1.00 56.76  ? 164 ASN A N   1 
ATOM   1084  C CA  . ASN A 1 164 ? 90.145  38.932 89.788  1.00 56.76  ? 164 ASN A CA  1 
ATOM   1085  C C   . ASN A 1 164 ? 89.740  39.191 88.328  1.00 56.76  ? 164 ASN A C   1 
ATOM   1086  O O   . ASN A 1 164 ? 89.821  40.320 87.835  1.00 56.76  ? 164 ASN A O   1 
ATOM   1087  C CB  . ASN A 1 164 ? 91.655  39.060 89.943  1.00 47.43  ? 164 ASN A CB  1 
ATOM   1088  C CG  . ASN A 1 164 ? 92.139  40.495 89.744  1.00 47.43  ? 164 ASN A CG  1 
ATOM   1089  O OD1 . ASN A 1 164 ? 91.509  41.450 90.224  1.00 47.43  ? 164 ASN A OD1 1 
ATOM   1090  N ND2 . ASN A 1 164 ? 93.261  40.655 89.053  1.00 47.43  ? 164 ASN A ND2 1 
ATOM   1091  N N   . CYS A 1 165 ? 89.296  38.148 87.638  1.00 85.87  ? 165 CYS A N   1 
ATOM   1092  C CA  . CYS A 1 165 ? 88.868  38.298 86.254  1.00 85.87  ? 165 CYS A CA  1 
ATOM   1093  C C   . CYS A 1 165 ? 87.435  38.863 86.168  1.00 85.87  ? 165 CYS A C   1 
ATOM   1094  O O   . CYS A 1 165 ? 87.139  39.691 85.310  1.00 85.87  ? 165 CYS A O   1 
ATOM   1095  C CB  . CYS A 1 165 ? 88.966  36.945 85.517  1.00 65.32  ? 165 CYS A CB  1 
ATOM   1096  S SG  . CYS A 1 165 ? 88.016  35.521 86.232  1.00 65.32  ? 165 CYS A SG  1 
ATOM   1097  N N   . ILE A 1 166 ? 86.562  38.426 87.072  1.00 84.59  ? 166 ILE A N   1 
ATOM   1098  C CA  . ILE A 1 166 ? 85.161  38.860 87.103  1.00 84.59  ? 166 ILE A CA  1 
ATOM   1099  C C   . ILE A 1 166 ? 84.979  40.357 86.829  1.00 84.59  ? 166 ILE A C   1 
ATOM   1100  O O   . ILE A 1 166 ? 83.893  40.804 86.453  1.00 84.59  ? 166 ILE A O   1 
ATOM   1101  C CB  . ILE A 1 166 ? 84.506  38.535 88.486  1.00 57.81  ? 166 ILE A CB  1 
ATOM   1102  C CG1 . ILE A 1 166 ? 82.981  38.544 88.367  1.00 57.81  ? 166 ILE A CG1 1 
ATOM   1103  C CG2 . ILE A 1 166 ? 84.936  39.569 89.542  1.00 57.81  ? 166 ILE A CG2 1 
ATOM   1104  C CD1 . ILE A 1 166 ? 82.431  37.406 87.548  1.00 57.81  ? 166 ILE A CD1 1 
ATOM   1105  N N   . LEU A 1 167 ? 86.043  41.125 87.029  1.00 105.86 ? 167 LEU A N   1 
ATOM   1106  C CA  . LEU A 1 167 ? 86.006  42.566 86.824  1.00 105.86 ? 167 LEU A CA  1 
ATOM   1107  C C   . LEU A 1 167 ? 86.318  42.939 85.378  1.00 105.86 ? 167 LEU A C   1 
ATOM   1108  O O   . LEU A 1 167 ? 85.719  43.861 84.827  1.00 105.86 ? 167 LEU A O   1 
ATOM   1109  C CB  . LEU A 1 167 ? 87.014  43.245 87.758  1.00 105.56 ? 167 LEU A CB  1 
ATOM   1110  C CG  . LEU A 1 167 ? 86.805  43.026 89.260  1.00 105.56 ? 167 LEU A CG  1 
ATOM   1111  C CD1 . LEU A 1 167 ? 88.056  43.439 90.042  1.00 105.56 ? 167 LEU A CD1 1 
ATOM   1112  C CD2 . LEU A 1 167 ? 85.570  43.805 89.714  1.00 105.56 ? 167 LEU A CD2 1 
ATOM   1113  N N   . ASP A 1 168 ? 87.260  42.215 84.777  1.00 98.39  ? 168 ASP A N   1 
ATOM   1114  C CA  . ASP A 1 168 ? 87.689  42.449 83.399  1.00 98.39  ? 168 ASP A CA  1 
ATOM   1115  C C   . ASP A 1 168 ? 86.522  42.452 82.411  1.00 98.39  ? 168 ASP A C   1 
ATOM   1116  O O   . ASP A 1 168 ? 85.815  41.454 82.252  1.00 98.39  ? 168 ASP A O   1 
ATOM   1117  C CB  . ASP A 1 168 ? 88.704  41.379 82.976  1.00 96.48  ? 168 ASP A CB  1 
ATOM   1118  C CG  . ASP A 1 168 ? 89.526  41.795 81.766  1.00 96.48  ? 168 ASP A CG  1 
ATOM   1119  O OD1 . ASP A 1 168 ? 89.022  42.601 80.960  1.00 96.48  ? 168 ASP A OD1 1 
ATOM   1120  O OD2 . ASP A 1 168 ? 90.671  41.312 81.613  1.00 96.48  ? 168 ASP A OD2 1 
ATOM   1121  N N   . LYS A 1 169 ? 86.330  43.580 81.741  1.00 95.83  ? 169 LYS A N   1 
ATOM   1122  C CA  . LYS A 1 169 ? 85.256  43.704 80.769  1.00 95.83  ? 169 LYS A CA  1 
ATOM   1123  C C   . LYS A 1 169 ? 85.526  42.775 79.593  1.00 95.83  ? 169 LYS A C   1 
ATOM   1124  O O   . LYS A 1 169 ? 84.633  42.064 79.136  1.00 95.83  ? 169 LYS A O   1 
ATOM   1125  C CB  . LYS A 1 169 ? 85.152  45.152 80.309  1.00 95.18  ? 169 LYS A CB  1 
ATOM   1126  C CG  . LYS A 1 169 ? 84.857  46.090 81.457  1.00 95.18  ? 169 LYS A CG  1 
ATOM   1127  C CD  . LYS A 1 169 ? 85.010  47.537 81.063  1.00 95.18  ? 169 LYS A CD  1 
ATOM   1128  C CE  . LYS A 1 169 ? 84.777  48.458 82.260  1.00 95.18  ? 169 LYS A CE  1 
ATOM   1129  N NZ  . LYS A 1 169 ? 84.936  49.909 81.921  1.00 95.18  ? 169 LYS A NZ  1 
ATOM   1130  N N   . ASP A 1 170 ? 86.767  42.772 79.116  1.00 99.23  ? 170 ASP A N   1 
ATOM   1131  C CA  . ASP A 1 170 ? 87.157  41.907 78.007  1.00 99.23  ? 170 ASP A CA  1 
ATOM   1132  C C   . ASP A 1 170 ? 86.826  40.455 78.344  1.00 99.23  ? 170 ASP A C   1 
ATOM   1133  O O   . ASP A 1 170 ? 86.339  39.699 77.500  1.00 99.23  ? 170 ASP A O   1 
ATOM   1134  C CB  . ASP A 1 170 ? 88.660  42.038 77.730  1.00 108.09 ? 170 ASP A CB  1 
ATOM   1135  C CG  . ASP A 1 170 ? 89.056  43.440 77.308  1.00 108.09 ? 170 ASP A CG  1 
ATOM   1136  O OD1 . ASP A 1 170 ? 88.421  43.980 76.376  1.00 108.09 ? 170 ASP A OD1 1 
ATOM   1137  O OD2 . ASP A 1 170 ? 90.005  43.996 77.901  1.00 108.09 ? 170 ASP A OD2 1 
ATOM   1138  N N   . TYR A 1 171 ? 87.098  40.074 79.587  1.00 86.26  ? 171 TYR A N   1 
ATOM   1139  C CA  . TYR A 1 171 ? 86.830  38.720 80.050  1.00 86.26  ? 171 TYR A CA  1 
ATOM   1140  C C   . TYR A 1 171 ? 85.349  38.422 79.916  1.00 86.26  ? 171 TYR A C   1 
ATOM   1141  O O   . TYR A 1 171 ? 84.954  37.374 79.394  1.00 86.26  ? 171 TYR A O   1 
ATOM   1142  C CB  . TYR A 1 171 ? 87.244  38.569 81.519  1.00 76.09  ? 171 TYR A CB  1 
ATOM   1143  C CG  . TYR A 1 171 ? 86.726  37.303 82.189  1.00 76.09  ? 171 TYR A CG  1 
ATOM   1144  C CD1 . TYR A 1 171 ? 87.207  36.042 81.825  1.00 76.09  ? 171 TYR A CD1 1 
ATOM   1145  C CD2 . TYR A 1 171 ? 85.745  37.370 83.181  1.00 76.09  ? 171 TYR A CD2 1 
ATOM   1146  C CE1 . TYR A 1 171 ? 86.728  34.881 82.433  1.00 76.09  ? 171 TYR A CE1 1 
ATOM   1147  C CE2 . TYR A 1 171 ? 85.256  36.214 83.797  1.00 76.09  ? 171 TYR A CE2 1 
ATOM   1148  C CZ  . TYR A 1 171 ? 85.754  34.973 83.418  1.00 76.09  ? 171 TYR A CZ  1 
ATOM   1149  O OH  . TYR A 1 171 ? 85.285  33.835 84.031  1.00 76.09  ? 171 TYR A OH  1 
ATOM   1150  N N   . LEU A 1 172 ? 84.537  39.356 80.398  1.00 83.20  ? 172 LEU A N   1 
ATOM   1151  C CA  . LEU A 1 172 ? 83.096  39.206 80.359  1.00 83.20  ? 172 LEU A CA  1 
ATOM   1152  C C   . LEU A 1 172 ? 82.533  38.947 78.961  1.00 83.20  ? 172 LEU A C   1 
ATOM   1153  O O   . LEU A 1 172 ? 81.776  37.984 78.764  1.00 83.20  ? 172 LEU A O   1 
ATOM   1154  C CB  . LEU A 1 172 ? 82.433  40.435 80.981  1.00 74.86  ? 172 LEU A CB  1 
ATOM   1155  C CG  . LEU A 1 172 ? 82.585  40.539 82.501  1.00 74.86  ? 172 LEU A CG  1 
ATOM   1156  C CD1 . LEU A 1 172 ? 81.867  41.793 83.001  1.00 74.86  ? 172 LEU A CD1 1 
ATOM   1157  C CD2 . LEU A 1 172 ? 82.004  39.288 83.169  1.00 74.86  ? 172 LEU A CD2 1 
ATOM   1158  N N   . ARG A 1 173 ? 82.893  39.796 77.996  1.00 83.84  ? 173 ARG A N   1 
ATOM   1159  C CA  . ARG A 1 173 ? 82.407  39.627 76.628  1.00 83.84  ? 173 ARG A CA  1 
ATOM   1160  C C   . ARG A 1 173 ? 82.711  38.225 76.119  1.00 83.84  ? 173 ARG A C   1 
ATOM   1161  O O   . ARG A 1 173 ? 81.857  37.586 75.513  1.00 83.84  ? 173 ARG A O   1 
ATOM   1162  C CB  . ARG A 1 173 ? 83.029  40.666 75.693  1.00 100.84 ? 173 ARG A CB  1 
ATOM   1163  C CG  . ARG A 1 173 ? 82.576  42.101 75.964  1.00 100.84 ? 173 ARG A CG  1 
ATOM   1164  C CD  . ARG A 1 173 ? 83.124  43.107 74.941  1.00 100.84 ? 173 ARG A CD  1 
ATOM   1165  N NE  . ARG A 1 173 ? 84.589  43.195 74.916  1.00 100.84 ? 173 ARG A NE  1 
ATOM   1166  C CZ  . ARG A 1 173 ? 85.395  42.345 74.277  1.00 100.84 ? 173 ARG A CZ  1 
ATOM   1167  N NH1 . ARG A 1 173 ? 84.895  41.320 73.591  1.00 100.84 ? 173 ARG A NH1 1 
ATOM   1168  N NH2 . ARG A 1 173 ? 86.713  42.523 74.322  1.00 100.84 ? 173 ARG A NH2 1 
ATOM   1169  N N   . SER A 1 174 ? 83.923  37.744 76.377  1.00 95.06  ? 174 SER A N   1 
ATOM   1170  C CA  . SER A 1 174 ? 84.314  36.404 75.952  1.00 95.06  ? 174 SER A CA  1 
ATOM   1171  C C   . SER A 1 174 ? 83.427  35.347 76.600  1.00 95.06  ? 174 SER A C   1 
ATOM   1172  O O   . SER A 1 174 ? 83.322  34.228 76.103  1.00 95.06  ? 174 SER A O   1 
ATOM   1173  C CB  . SER A 1 174 ? 85.773  36.128 76.316  1.00 73.13  ? 174 SER A CB  1 
ATOM   1174  O OG  . SER A 1 174 ? 86.648  36.982 75.603  1.00 73.13  ? 174 SER A OG  1 
ATOM   1175  N N   . LEU A 1 175 ? 82.795  35.701 77.714  1.00 100.20 ? 175 LEU A N   1 
ATOM   1176  C CA  . LEU A 1 175 ? 81.924  34.768 78.414  1.00 100.20 ? 175 LEU A CA  1 
ATOM   1177  C C   . LEU A 1 175 ? 80.599  34.596 77.706  1.00 100.20 ? 175 LEU A C   1 
ATOM   1178  O O   . LEU A 1 175 ? 80.092  33.481 77.606  1.00 100.20 ? 175 LEU A O   1 
ATOM   1179  C CB  . LEU A 1 175 ? 81.676  35.228 79.848  1.00 107.93 ? 175 LEU A CB  1 
ATOM   1180  C CG  . LEU A 1 175 ? 82.726  34.808 80.876  1.00 107.93 ? 175 LEU A CG  1 
ATOM   1181  C CD1 . LEU A 1 175 ? 82.354  35.376 82.232  1.00 107.93 ? 175 LEU A CD1 1 
ATOM   1182  C CD2 . LEU A 1 175 ? 82.805  33.289 80.944  1.00 107.93 ? 175 LEU A CD2 1 
ATOM   1183  N N   . ASN A 1 176 ? 80.032  35.698 77.224  1.00 109.64 ? 176 ASN A N   1 
ATOM   1184  C CA  . ASN A 1 176 ? 78.762  35.643 76.508  1.00 109.64 ? 176 ASN A CA  1 
ATOM   1185  C C   . ASN A 1 176 ? 78.951  34.849 75.222  1.00 109.64 ? 176 ASN A C   1 
ATOM   1186  O O   . ASN A 1 176 ? 78.100  34.038 74.845  1.00 109.64 ? 176 ASN A O   1 
ATOM   1187  C CB  . ASN A 1 176 ? 78.282  37.052 76.174  1.00 106.60 ? 176 ASN A CB  1 
ATOM   1188  C CG  . ASN A 1 176 ? 78.190  37.928 77.395  1.00 106.60 ? 176 ASN A CG  1 
ATOM   1189  O OD1 . ASN A 1 176 ? 77.508  37.589 78.358  1.00 106.60 ? 176 ASN A OD1 1 
ATOM   1190  N ND2 . ASN A 1 176 ? 78.878  39.062 77.367  1.00 106.60 ? 176 ASN A ND2 1 
ATOM   1191  N N   . LYS A 1 177 ? 80.084  35.085 74.563  1.00 108.61 ? 177 LYS A N   1 
ATOM   1192  C CA  . LYS A 1 177 ? 80.416  34.409 73.319  1.00 108.61 ? 177 LYS A CA  1 
ATOM   1193  C C   . LYS A 1 177 ? 80.673  32.924 73.542  1.00 108.61 ? 177 LYS A C   1 
ATOM   1194  O O   . LYS A 1 177 ? 81.365  32.283 72.751  1.00 108.61 ? 177 LYS A O   1 
ATOM   1195  C CB  . LYS A 1 177 ? 81.654  35.049 72.679  1.00 132.27 ? 177 LYS A CB  1 
ATOM   1196  C CG  . LYS A 1 177 ? 81.477  36.509 72.292  1.00 132.27 ? 177 LYS A CG  1 
ATOM   1197  C CD  . LYS A 1 177 ? 82.748  37.081 71.681  1.00 132.27 ? 177 LYS A CD  1 
ATOM   1198  C CE  . LYS A 1 177 ? 82.587  38.564 71.370  1.00 132.27 ? 177 LYS A CE  1 
ATOM   1199  N NZ  . LYS A 1 177 ? 83.842  39.174 70.848  1.00 132.27 ? 177 LYS A NZ  1 
ATOM   1200  N N   . LEU A 1 178 ? 80.123  32.375 74.619  1.00 91.76  ? 178 LEU A N   1 
ATOM   1201  C CA  . LEU A 1 178 ? 80.311  30.960 74.905  1.00 91.76  ? 178 LEU A CA  1 
ATOM   1202  C C   . LEU A 1 178 ? 78.982  30.242 75.072  1.00 91.76  ? 178 LEU A C   1 
ATOM   1203  O O   . LEU A 1 178 ? 77.948  30.864 75.325  1.00 91.76  ? 178 LEU A O   1 
ATOM   1204  C CB  . LEU A 1 178 ? 81.179  30.772 76.160  1.00 95.40  ? 178 LEU A CB  1 
ATOM   1205  C CG  . LEU A 1 178 ? 82.695  30.870 75.949  1.00 95.40  ? 178 LEU A CG  1 
ATOM   1206  C CD1 . LEU A 1 178 ? 83.428  30.723 77.273  1.00 95.40  ? 178 LEU A CD1 1 
ATOM   1207  C CD2 . LEU A 1 178 ? 83.139  29.781 74.985  1.00 95.40  ? 178 LEU A CD2 1 
ATOM   1208  N N   . PRO A 1 179 ? 78.993  28.916 74.901  1.00 107.87 ? 179 PRO A N   1 
ATOM   1209  C CA  . PRO A 1 179 ? 77.801  28.077 75.031  1.00 107.87 ? 179 PRO A CA  1 
ATOM   1210  C C   . PRO A 1 179 ? 77.264  28.146 76.456  1.00 107.87 ? 179 PRO A C   1 
ATOM   1211  O O   . PRO A 1 179 ? 77.845  27.554 77.372  1.00 107.87 ? 179 PRO A O   1 
ATOM   1212  C CB  . PRO A 1 179 ? 78.322  26.684 74.689  1.00 82.08  ? 179 PRO A CB  1 
ATOM   1213  C CG  . PRO A 1 179 ? 79.442  26.963 73.747  1.00 82.08  ? 179 PRO A CG  1 
ATOM   1214  C CD  . PRO A 1 179 ? 80.132  28.130 74.398  1.00 82.08  ? 179 PRO A CD  1 
ATOM   1215  N N   . ARG A 1 180 ? 76.168  28.877 76.641  1.00 197.52 ? 180 ARG A N   1 
ATOM   1216  C CA  . ARG A 1 180 ? 75.557  29.020 77.959  1.00 197.52 ? 180 ARG A CA  1 
ATOM   1217  C C   . ARG A 1 180 ? 75.124  27.635 78.448  1.00 197.52 ? 180 ARG A C   1 
ATOM   1218  O O   . ARG A 1 180 ? 73.958  27.261 78.321  1.00 197.52 ? 180 ARG A O   1 
ATOM   1219  C CB  . ARG A 1 180 ? 74.345  29.957 77.873  1.00 179.67 ? 180 ARG A CB  1 
ATOM   1220  C CG  . ARG A 1 180 ? 74.261  30.995 78.987  1.00 179.67 ? 180 ARG A CG  1 
ATOM   1221  C CD  . ARG A 1 180 ? 74.199  30.343 80.355  1.00 179.67 ? 180 ARG A CD  1 
ATOM   1222  N NE  . ARG A 1 180 ? 73.066  29.432 80.473  1.00 179.67 ? 180 ARG A NE  1 
ATOM   1223  C CZ  . ARG A 1 180 ? 72.799  28.709 81.556  1.00 179.67 ? 180 ARG A CZ  1 
ATOM   1224  N NH1 . ARG A 1 180 ? 73.586  28.790 82.623  1.00 179.67 ? 180 ARG A NH1 1 
ATOM   1225  N NH2 . ARG A 1 180 ? 71.747  27.900 81.572  1.00 179.67 ? 180 ARG A NH2 1 
ATOM   1226  N N   . GLN A 1 181 ? 76.076  26.882 78.999  1.00 137.18 ? 181 GLN A N   1 
ATOM   1227  C CA  . GLN A 1 181 ? 75.827  25.532 79.502  1.00 137.18 ? 181 GLN A CA  1 
ATOM   1228  C C   . GLN A 1 181 ? 74.748  25.505 80.576  1.00 137.18 ? 181 GLN A C   1 
ATOM   1229  O O   . GLN A 1 181 ? 74.462  26.519 81.211  1.00 137.18 ? 181 GLN A O   1 
ATOM   1230  C CB  . GLN A 1 181 ? 77.113  24.933 80.071  1.00 143.23 ? 181 GLN A CB  1 
ATOM   1231  C CG  . GLN A 1 181 ? 77.679  25.719 81.240  1.00 143.23 ? 181 GLN A CG  1 
ATOM   1232  C CD  . GLN A 1 181 ? 78.842  25.020 81.906  1.00 143.23 ? 181 GLN A CD  1 
ATOM   1233  O OE1 . GLN A 1 181 ? 78.682  23.962 82.517  1.00 143.23 ? 181 GLN A OE1 1 
ATOM   1234  N NE2 . GLN A 1 181 ? 80.026  25.605 81.787  1.00 143.23 ? 181 GLN A NE2 1 
ATOM   1235  N N   . LEU A 1 182 ? 74.167  24.329 80.786  1.00 158.90 ? 182 LEU A N   1 
ATOM   1236  C CA  . LEU A 1 182 ? 73.104  24.159 81.770  1.00 158.90 ? 182 LEU A CA  1 
ATOM   1237  C C   . LEU A 1 182 ? 73.654  23.620 83.094  1.00 158.90 ? 182 LEU A C   1 
ATOM   1238  O O   . LEU A 1 182 ? 74.640  22.879 83.108  1.00 158.90 ? 182 LEU A O   1 
ATOM   1239  C CB  . LEU A 1 182 ? 72.042  23.205 81.212  1.00 185.21 ? 182 LEU A CB  1 
ATOM   1240  C CG  . LEU A 1 182 ? 70.631  23.263 81.803  1.00 185.21 ? 182 LEU A CG  1 
ATOM   1241  C CD1 . LEU A 1 182 ? 70.058  24.663 81.625  1.00 185.21 ? 182 LEU A CD1 1 
ATOM   1242  C CD2 . LEU A 1 182 ? 69.743  22.238 81.117  1.00 185.21 ? 182 LEU A CD2 1 
ATOM   1243  N N   . PRO A 1 183 ? 73.019  23.991 84.225  1.00 117.85 ? 183 PRO A N   1 
ATOM   1244  C CA  . PRO A 1 183 ? 73.438  23.551 85.557  1.00 117.85 ? 183 PRO A CA  1 
ATOM   1245  C C   . PRO A 1 183 ? 73.976  22.124 85.611  1.00 117.85 ? 183 PRO A C   1 
ATOM   1246  O O   . PRO A 1 183 ? 73.450  21.217 84.962  1.00 117.85 ? 183 PRO A O   1 
ATOM   1247  C CB  . PRO A 1 183 ? 72.171  23.741 86.381  1.00 146.59 ? 183 PRO A CB  1 
ATOM   1248  C CG  . PRO A 1 183 ? 71.649  25.023 85.829  1.00 146.59 ? 183 PRO A CG  1 
ATOM   1249  C CD  . PRO A 1 183 ? 71.814  24.838 84.323  1.00 146.59 ? 183 PRO A CD  1 
ATOM   1250  N N   . LEU A 1 184 ? 75.033  21.942 86.396  1.00 146.63 ? 184 LEU A N   1 
ATOM   1251  C CA  . LEU A 1 184 ? 75.672  20.645 86.550  1.00 146.63 ? 184 LEU A CA  1 
ATOM   1252  C C   . LEU A 1 184 ? 74.880  19.754 87.498  1.00 146.63 ? 184 LEU A C   1 
ATOM   1253  O O   . LEU A 1 184 ? 74.406  20.203 88.545  1.00 146.63 ? 184 LEU A O   1 
ATOM   1254  C CB  . LEU A 1 184 ? 77.097  20.820 87.087  1.00 142.59 ? 184 LEU A CB  1 
ATOM   1255  C CG  . LEU A 1 184 ? 78.033  21.839 86.420  1.00 142.59 ? 184 LEU A CG  1 
ATOM   1256  C CD1 . LEU A 1 184 ? 78.030  21.627 84.911  1.00 142.59 ? 184 LEU A CD1 1 
ATOM   1257  C CD2 . LEU A 1 184 ? 77.598  23.260 86.766  1.00 142.59 ? 184 LEU A CD2 1 
ATOM   1258  N N   . GLU A 1 185 ? 74.730  18.490 87.122  1.00 108.14 ? 185 GLU A N   1 
ATOM   1259  C CA  . GLU A 1 185 ? 74.011  17.545 87.956  1.00 108.14 ? 185 GLU A CA  1 
ATOM   1260  C C   . GLU A 1 185 ? 74.980  17.105 89.041  1.00 108.14 ? 185 GLU A C   1 
ATOM   1261  O O   . GLU A 1 185 ? 76.129  16.772 88.755  1.00 108.14 ? 185 GLU A O   1 
ATOM   1262  C CB  . GLU A 1 185 ? 73.566  16.338 87.134  1.00 200.00 ? 185 GLU A CB  1 
ATOM   1263  C CG  . GLU A 1 185 ? 72.809  15.294 87.937  1.00 200.00 ? 185 GLU A CG  1 
ATOM   1264  C CD  . GLU A 1 185 ? 72.502  14.048 87.128  1.00 200.00 ? 185 GLU A CD  1 
ATOM   1265  O OE1 . GLU A 1 185 ? 73.457  13.406 86.639  1.00 200.00 ? 185 GLU A OE1 1 
ATOM   1266  O OE2 . GLU A 1 185 ? 71.308  13.710 86.982  1.00 200.00 ? 185 GLU A OE2 1 
ATOM   1267  N N   . VAL A 1 186 ? 74.518  17.113 90.284  1.00 110.79 ? 186 VAL A N   1 
ATOM   1268  C CA  . VAL A 1 186 ? 75.362  16.726 91.405  1.00 110.79 ? 186 VAL A CA  1 
ATOM   1269  C C   . VAL A 1 186 ? 75.164  15.257 91.774  1.00 110.79 ? 186 VAL A C   1 
ATOM   1270  O O   . VAL A 1 186 ? 74.074  14.857 92.192  1.00 110.79 ? 186 VAL A O   1 
ATOM   1271  C CB  . VAL A 1 186 ? 75.063  17.609 92.639  1.00 120.02 ? 186 VAL A CB  1 
ATOM   1272  C CG1 . VAL A 1 186 ? 76.006  17.254 93.771  1.00 120.02 ? 186 VAL A CG1 1 
ATOM   1273  C CG2 . VAL A 1 186 ? 75.197  19.081 92.273  1.00 120.02 ? 186 VAL A CG2 1 
ATOM   1274  N N   . ASP A 1 187 ? 76.224  14.463 91.618  1.00 78.29  ? 187 ASP A N   1 
ATOM   1275  C CA  . ASP A 1 187 ? 76.184  13.033 91.932  1.00 78.29  ? 187 ASP A CA  1 
ATOM   1276  C C   . ASP A 1 187 ? 76.409  12.731 93.424  1.00 78.29  ? 187 ASP A C   1 
ATOM   1277  O O   . ASP A 1 187 ? 77.542  12.613 93.871  1.00 78.29  ? 187 ASP A O   1 
ATOM   1278  C CB  . ASP A 1 187 ? 77.232  12.297 91.101  1.00 96.51  ? 187 ASP A CB  1 
ATOM   1279  C CG  . ASP A 1 187 ? 77.292  10.818 91.418  1.00 96.51  ? 187 ASP A CG  1 
ATOM   1280  O OD1 . ASP A 1 187 ? 76.222  10.171 91.468  1.00 96.51  ? 187 ASP A OD1 1 
ATOM   1281  O OD2 . ASP A 1 187 ? 78.412  10.299 91.606  1.00 96.51  ? 187 ASP A OD2 1 
ATOM   1282  N N   . LEU A 1 188 ? 75.325  12.585 94.183  1.00 78.01  ? 188 LEU A N   1 
ATOM   1283  C CA  . LEU A 1 188 ? 75.408  12.316 95.621  1.00 78.01  ? 188 LEU A CA  1 
ATOM   1284  C C   . LEU A 1 188 ? 75.544  10.831 95.981  1.00 78.01  ? 188 LEU A C   1 
ATOM   1285  O O   . LEU A 1 188 ? 75.079  10.407 97.043  1.00 78.01  ? 188 LEU A O   1 
ATOM   1286  C CB  . LEU A 1 188 ? 74.166  12.877 96.331  1.00 78.52  ? 188 LEU A CB  1 
ATOM   1287  C CG  . LEU A 1 188 ? 73.794  14.325 96.016  1.00 78.52  ? 188 LEU A CG  1 
ATOM   1288  C CD1 . LEU A 1 188 ? 72.539  14.731 96.795  1.00 78.52  ? 188 LEU A CD1 1 
ATOM   1289  C CD2 . LEU A 1 188 ? 74.975  15.220 96.355  1.00 78.52  ? 188 LEU A CD2 1 
ATOM   1290  N N   . THR A 1 189 ? 76.181  10.041 95.120  1.00 81.63  ? 189 THR A N   1 
ATOM   1291  C CA  . THR A 1 189 ? 76.319  8.610  95.401  1.00 81.63  ? 189 THR A CA  1 
ATOM   1292  C C   . THR A 1 189 ? 77.403  8.335  96.432  1.00 81.63  ? 189 THR A C   1 
ATOM   1293  O O   . THR A 1 189 ? 77.201  7.558  97.373  1.00 81.63  ? 189 THR A O   1 
ATOM   1294  C CB  . THR A 1 189 ? 76.622  7.790  94.116  1.00 97.15  ? 189 THR A CB  1 
ATOM   1295  O OG1 . THR A 1 189 ? 77.788  8.312  93.469  1.00 97.15  ? 189 THR A OG1 1 
ATOM   1296  C CG2 . THR A 1 189 ? 75.434  7.836  93.161  1.00 97.15  ? 189 THR A CG2 1 
ATOM   1297  N N   . LYS A 1 190 ? 78.550  8.984  96.249  1.00 82.06  ? 190 LYS A N   1 
ATOM   1298  C CA  . LYS A 1 190 ? 79.677  8.833  97.164  1.00 82.06  ? 190 LYS A CA  1 
ATOM   1299  C C   . LYS A 1 190 ? 79.667  9.933  98.216  1.00 82.06  ? 190 LYS A C   1 
ATOM   1300  O O   . LYS A 1 190 ? 80.704  10.296 98.764  1.00 82.06  ? 190 LYS A O   1 
ATOM   1301  C CB  . LYS A 1 190 ? 80.986  8.870  96.387  1.00 106.83 ? 190 LYS A CB  1 
ATOM   1302  C CG  . LYS A 1 190 ? 81.115  7.736  95.398  1.00 106.83 ? 190 LYS A CG  1 
ATOM   1303  C CD  . LYS A 1 190 ? 82.442  7.783  94.686  1.00 106.83 ? 190 LYS A CD  1 
ATOM   1304  C CE  . LYS A 1 190 ? 82.561  6.634  93.708  1.00 106.83 ? 190 LYS A CE  1 
ATOM   1305  N NZ  . LYS A 1 190 ? 83.863  6.661  92.994  1.00 106.83 ? 190 LYS A NZ  1 
ATOM   1306  N N   . ALA A 1 191 ? 78.475  10.452 98.488  1.00 74.54  ? 191 ALA A N   1 
ATOM   1307  C CA  . ALA A 1 191 ? 78.278  11.501 99.472  1.00 74.54  ? 191 ALA A CA  1 
ATOM   1308  C C   . ALA A 1 191 ? 78.526  10.955 100.874 1.00 74.54  ? 191 ALA A C   1 
ATOM   1309  O O   . ALA A 1 191 ? 78.275  9.784  101.150 1.00 74.54  ? 191 ALA A O   1 
ATOM   1310  C CB  . ALA A 1 191 ? 76.863  12.032 99.361  1.00 49.76  ? 191 ALA A CB  1 
ATOM   1311  N N   . LYS A 1 192 ? 79.025  11.808 101.758 1.00 59.45  ? 192 LYS A N   1 
ATOM   1312  C CA  . LYS A 1 192 ? 79.300  11.396 103.129 1.00 59.45  ? 192 LYS A CA  1 
ATOM   1313  C C   . LYS A 1 192 ? 77.977  11.095 103.818 1.00 59.45  ? 192 LYS A C   1 
ATOM   1314  O O   . LYS A 1 192 ? 77.081  11.939 103.829 1.00 59.45  ? 192 LYS A O   1 
ATOM   1315  C CB  . LYS A 1 192 ? 80.040  12.515 103.858 1.00 65.31  ? 192 LYS A CB  1 
ATOM   1316  C CG  . LYS A 1 192 ? 80.299  12.238 105.315 1.00 65.31  ? 192 LYS A CG  1 
ATOM   1317  C CD  . LYS A 1 192 ? 81.053  13.373 105.942 1.00 65.31  ? 192 LYS A CD  1 
ATOM   1318  C CE  . LYS A 1 192 ? 81.350  13.070 107.382 1.00 65.31  ? 192 LYS A CE  1 
ATOM   1319  N NZ  . LYS A 1 192 ? 82.219  11.877 107.486 1.00 65.31  ? 192 LYS A NZ  1 
ATOM   1320  N N   . ARG A 1 193 ? 77.857  9.902  104.398 1.00 66.12  ? 193 ARG A N   1 
ATOM   1321  C CA  . ARG A 1 193 ? 76.609  9.512  105.048 1.00 66.12  ? 193 ARG A CA  1 
ATOM   1322  C C   . ARG A 1 193 ? 76.633  9.341  106.557 1.00 66.12  ? 193 ARG A C   1 
ATOM   1323  O O   . ARG A 1 193 ? 75.581  9.214  107.191 1.00 66.12  ? 193 ARG A O   1 
ATOM   1324  C CB  . ARG A 1 193 ? 76.051  8.253  104.387 1.00 84.09  ? 193 ARG A CB  1 
ATOM   1325  C CG  . ARG A 1 193 ? 75.495  8.526  103.000 1.00 84.09  ? 193 ARG A CG  1 
ATOM   1326  C CD  . ARG A 1 193 ? 74.470  7.489  102.601 1.00 84.09  ? 193 ARG A CD  1 
ATOM   1327  N NE  . ARG A 1 193 ? 73.597  7.977  101.542 1.00 84.09  ? 193 ARG A NE  1 
ATOM   1328  C CZ  . ARG A 1 193 ? 74.025  8.318  100.335 1.00 84.09  ? 193 ARG A CZ  1 
ATOM   1329  N NH1 . ARG A 1 193 ? 75.318  8.225  100.032 1.00 84.09  ? 193 ARG A NH1 1 
ATOM   1330  N NH2 . ARG A 1 193 ? 73.156  8.744  99.430  1.00 84.09  ? 193 ARG A NH2 1 
ATOM   1331  N N   . GLN A 1 194 ? 77.828  9.331  107.134 1.00 66.96  ? 194 GLN A N   1 
ATOM   1332  C CA  . GLN A 1 194 ? 77.969  9.230  108.581 1.00 66.96  ? 194 GLN A CA  1 
ATOM   1333  C C   . GLN A 1 194 ? 79.181  10.059 109.047 1.00 66.96  ? 194 GLN A C   1 
ATOM   1334  O O   . GLN A 1 194 ? 80.040  10.421 108.238 1.00 66.96  ? 194 GLN A O   1 
ATOM   1335  C CB  . GLN A 1 194 ? 78.062  7.760  109.004 1.00 87.71  ? 194 GLN A CB  1 
ATOM   1336  C CG  . GLN A 1 194 ? 78.870  6.898  108.076 1.00 87.71  ? 194 GLN A CG  1 
ATOM   1337  C CD  . GLN A 1 194 ? 80.342  7.120  108.250 1.00 87.71  ? 194 GLN A CD  1 
ATOM   1338  O OE1 . GLN A 1 194 ? 80.911  6.751  109.277 1.00 87.71  ? 194 GLN A OE1 1 
ATOM   1339  N NE2 . GLN A 1 194 ? 80.977  7.741  107.252 1.00 87.71  ? 194 GLN A NE2 1 
ATOM   1340  N N   . ASP A 1 195 ? 79.225  10.385 110.340 1.00 51.55  ? 195 ASP A N   1 
ATOM   1341  C CA  . ASP A 1 195 ? 80.302  11.202 110.902 1.00 51.55  ? 195 ASP A CA  1 
ATOM   1342  C C   . ASP A 1 195 ? 81.729  10.662 110.765 1.00 51.55  ? 195 ASP A C   1 
ATOM   1343  O O   . ASP A 1 195 ? 82.584  11.325 110.200 1.00 51.55  ? 195 ASP A O   1 
ATOM   1344  C CB  . ASP A 1 195 ? 80.047  11.516 112.396 1.00 62.69  ? 195 ASP A CB  1 
ATOM   1345  C CG  . ASP A 1 195 ? 78.784  12.350 112.630 1.00 62.69  ? 195 ASP A CG  1 
ATOM   1346  O OD1 . ASP A 1 195 ? 78.448  13.209 111.783 1.00 62.69  ? 195 ASP A OD1 1 
ATOM   1347  O OD2 . ASP A 1 195 ? 78.136  12.155 113.687 1.00 62.69  ? 195 ASP A OD2 1 
ATOM   1348  N N   . LEU A 1 196 ? 81.995  9.469  111.281 1.00 63.08  ? 196 LEU A N   1 
ATOM   1349  C CA  . LEU A 1 196 ? 83.350  8.920  111.240 1.00 63.08  ? 196 LEU A CA  1 
ATOM   1350  C C   . LEU A 1 196 ? 84.131  9.035  109.921 1.00 63.08  ? 196 LEU A C   1 
ATOM   1351  O O   . LEU A 1 196 ? 83.562  9.034  108.837 1.00 63.08  ? 196 LEU A O   1 
ATOM   1352  C CB  . LEU A 1 196 ? 83.328  7.463  111.716 1.00 86.02  ? 196 LEU A CB  1 
ATOM   1353  C CG  . LEU A 1 196 ? 84.678  6.790  111.988 1.00 86.02  ? 196 LEU A CG  1 
ATOM   1354  C CD1 . LEU A 1 196 ? 85.590  7.695  112.807 1.00 86.02  ? 196 LEU A CD1 1 
ATOM   1355  C CD2 . LEU A 1 196 ? 84.430  5.493  112.722 1.00 86.02  ? 196 LEU A CD2 1 
ATOM   1356  N N   . GLU A 1 197 ? 85.449  9.159  110.043 1.00 51.95  ? 197 GLU A N   1 
ATOM   1357  C CA  . GLU A 1 197 ? 86.357  9.274  108.905 1.00 51.95  ? 197 GLU A CA  1 
ATOM   1358  C C   . GLU A 1 197 ? 87.604  8.438  109.209 1.00 51.95  ? 197 GLU A C   1 
ATOM   1359  O O   . GLU A 1 197 ? 88.640  8.978  109.591 1.00 51.95  ? 197 GLU A O   1 
ATOM   1360  C CB  . GLU A 1 197 ? 86.797  10.724 108.705 1.00 57.55  ? 197 GLU A CB  1 
ATOM   1361  C CG  . GLU A 1 197 ? 85.742  11.670 108.195 1.00 57.55  ? 197 GLU A CG  1 
ATOM   1362  C CD  . GLU A 1 197 ? 85.413  11.457 106.740 1.00 57.55  ? 197 GLU A CD  1 
ATOM   1363  O OE1 . GLU A 1 197 ? 86.352  11.178 105.955 1.00 57.55  ? 197 GLU A OE1 1 
ATOM   1364  O OE2 . GLU A 1 197 ? 84.218  11.589 106.386 1.00 57.55  ? 197 GLU A OE2 1 
ATOM   1365  N N   . PRO A 1 198 ? 87.522  7.109  109.018 1.00 60.30  ? 198 PRO A N   1 
ATOM   1366  C CA  . PRO A 1 198 ? 88.609  6.148  109.261 1.00 60.30  ? 198 PRO A CA  1 
ATOM   1367  C C   . PRO A 1 198 ? 89.977  6.552  108.707 1.00 60.30  ? 198 PRO A C   1 
ATOM   1368  O O   . PRO A 1 198 ? 90.986  6.446  109.398 1.00 60.30  ? 198 PRO A O   1 
ATOM   1369  C CB  . PRO A 1 198 ? 88.083  4.880  108.610 1.00 59.90  ? 198 PRO A CB  1 
ATOM   1370  C CG  . PRO A 1 198 ? 86.593  5.024  108.782 1.00 59.90  ? 198 PRO A CG  1 
ATOM   1371  C CD  . PRO A 1 198 ? 86.375  6.441  108.377 1.00 59.90  ? 198 PRO A CD  1 
ATOM   1372  N N   . SER A 1 199 ? 90.005  6.993  107.452 1.00 59.20  ? 199 SER A N   1 
ATOM   1373  C CA  . SER A 1 199 ? 91.242  7.419  106.792 1.00 59.20  ? 199 SER A CA  1 
ATOM   1374  C C   . SER A 1 199 ? 91.903  8.528  107.614 1.00 59.20  ? 199 SER A C   1 
ATOM   1375  O O   . SER A 1 199 ? 93.113  8.499  107.875 1.00 59.20  ? 199 SER A O   1 
ATOM   1376  C CB  . SER A 1 199 ? 90.918  7.941  105.387 1.00 120.52 ? 199 SER A CB  1 
ATOM   1377  O OG  . SER A 1 199 ? 92.078  8.408  104.723 1.00 120.52 ? 199 SER A OG  1 
ATOM   1378  N N   . VAL A 1 200 ? 91.087  9.503  108.018 1.00 61.01  ? 200 VAL A N   1 
ATOM   1379  C CA  . VAL A 1 200 ? 91.543  10.631 108.812 1.00 61.01  ? 200 VAL A CA  1 
ATOM   1380  C C   . VAL A 1 200 ? 91.896  10.202 110.233 1.00 61.01  ? 200 VAL A C   1 
ATOM   1381  O O   . VAL A 1 200 ? 93.015  10.408 110.694 1.00 61.01  ? 200 VAL A O   1 
ATOM   1382  C CB  . VAL A 1 200 ? 90.471  11.722 108.853 1.00 44.80  ? 200 VAL A CB  1 
ATOM   1383  C CG1 . VAL A 1 200 ? 90.904  12.846 109.764 1.00 44.80  ? 200 VAL A CG1 1 
ATOM   1384  C CG2 . VAL A 1 200 ? 90.249  12.263 107.444 1.00 44.80  ? 200 VAL A CG2 1 
ATOM   1385  N N   . GLU A 1 201 ? 90.939  9.607  110.927 1.00 52.97  ? 201 GLU A N   1 
ATOM   1386  C CA  . GLU A 1 201 ? 91.160  9.126  112.290 1.00 52.97  ? 201 GLU A CA  1 
ATOM   1387  C C   . GLU A 1 201 ? 92.483  8.372  112.415 1.00 52.97  ? 201 GLU A C   1 
ATOM   1388  O O   . GLU A 1 201 ? 93.181  8.483  113.429 1.00 52.97  ? 201 GLU A O   1 
ATOM   1389  C CB  . GLU A 1 201 ? 90.015  8.199  112.713 1.00 70.65  ? 201 GLU A CB  1 
ATOM   1390  C CG  . GLU A 1 201 ? 90.168  7.575  114.089 1.00 70.65  ? 201 GLU A CG  1 
ATOM   1391  C CD  . GLU A 1 201 ? 90.203  8.608  115.210 1.00 70.65  ? 201 GLU A CD  1 
ATOM   1392  O OE1 . GLU A 1 201 ? 89.303  9.484  115.271 1.00 70.65  ? 201 GLU A OE1 1 
ATOM   1393  O OE2 . GLU A 1 201 ? 91.134  8.537  116.038 1.00 70.65  ? 201 GLU A OE2 1 
ATOM   1394  N N   . GLU A 1 202 ? 92.822  7.609  111.377 1.00 46.16  ? 202 GLU A N   1 
ATOM   1395  C CA  . GLU A 1 202 ? 94.048  6.825  111.367 1.00 46.16  ? 202 GLU A CA  1 
ATOM   1396  C C   . GLU A 1 202 ? 95.296  7.703  111.284 1.00 46.16  ? 202 GLU A C   1 
ATOM   1397  O O   . GLU A 1 202 ? 96.162  7.630  112.146 1.00 46.16  ? 202 GLU A O   1 
ATOM   1398  C CB  . GLU A 1 202 ? 94.026  5.829  110.204 1.00 99.84  ? 202 GLU A CB  1 
ATOM   1399  C CG  . GLU A 1 202 ? 95.216  4.891  110.179 1.00 99.84  ? 202 GLU A CG  1 
ATOM   1400  C CD  . GLU A 1 202 ? 95.111  3.843  109.094 1.00 99.84  ? 202 GLU A CD  1 
ATOM   1401  O OE1 . GLU A 1 202 ? 95.049  4.213  107.901 1.00 99.84  ? 202 GLU A OE1 1 
ATOM   1402  O OE2 . GLU A 1 202 ? 95.089  2.644  109.434 1.00 99.84  ? 202 GLU A OE2 1 
ATOM   1403  N N   . ALA A 1 203 ? 95.378  8.532  110.248 1.00 56.67  ? 203 ALA A N   1 
ATOM   1404  C CA  . ALA A 1 203 ? 96.526  9.404  110.058 1.00 56.67  ? 203 ALA A CA  1 
ATOM   1405  C C   . ALA A 1 203 ? 96.778  10.229 111.298 1.00 56.67  ? 203 ALA A C   1 
ATOM   1406  O O   . ALA A 1 203 ? 97.931  10.483 111.661 1.00 56.67  ? 203 ALA A O   1 
ATOM   1407  C CB  . ALA A 1 203 ? 96.291  10.325 108.872 1.00 59.31  ? 203 ALA A CB  1 
ATOM   1408  N N   . ARG A 1 204 ? 95.688  10.647 111.938 1.00 63.31  ? 204 ARG A N   1 
ATOM   1409  C CA  . ARG A 1 204 ? 95.742  11.467 113.143 1.00 63.31  ? 204 ARG A CA  1 
ATOM   1410  C C   . ARG A 1 204 ? 96.384  10.737 114.299 1.00 63.31  ? 204 ARG A C   1 
ATOM   1411  O O   . ARG A 1 204 ? 97.325  11.228 114.917 1.00 63.31  ? 204 ARG A O   1 
ATOM   1412  C CB  . ARG A 1 204 ? 94.337  11.893 113.549 1.00 46.99  ? 204 ARG A CB  1 
ATOM   1413  C CG  . ARG A 1 204 ? 94.281  12.724 114.808 1.00 46.99  ? 204 ARG A CG  1 
ATOM   1414  C CD  . ARG A 1 204 ? 92.854  13.112 115.042 1.00 46.99  ? 204 ARG A CD  1 
ATOM   1415  N NE  . ARG A 1 204 ? 92.331  13.845 113.891 1.00 46.99  ? 204 ARG A NE  1 
ATOM   1416  C CZ  . ARG A 1 204 ? 91.122  13.666 113.364 1.00 46.99  ? 204 ARG A CZ  1 
ATOM   1417  N NH1 . ARG A 1 204 ? 90.284  12.768 113.868 1.00 46.99  ? 204 ARG A NH1 1 
ATOM   1418  N NH2 . ARG A 1 204 ? 90.745  14.403 112.333 1.00 46.99  ? 204 ARG A NH2 1 
ATOM   1419  N N   . TYR A 1 205 ? 95.849  9.566  114.606 1.00 64.45  ? 205 TYR A N   1 
ATOM   1420  C CA  . TYR A 1 205 ? 96.379  8.760  115.685 1.00 64.45  ? 205 TYR A CA  1 
ATOM   1421  C C   . TYR A 1 205 ? 97.891  8.567  115.521 1.00 64.45  ? 205 TYR A C   1 
ATOM   1422  O O   . TYR A 1 205 ? 98.642  8.641  116.490 1.00 64.45  ? 205 TYR A O   1 
ATOM   1423  C CB  . TYR A 1 205 ? 95.689  7.405  115.696 1.00 65.81  ? 205 TYR A CB  1 
ATOM   1424  C CG  . TYR A 1 205 ? 96.200  6.513  116.789 1.00 65.81  ? 205 TYR A CG  1 
ATOM   1425  C CD1 . TYR A 1 205 ? 96.025  6.859  118.124 1.00 65.81  ? 205 TYR A CD1 1 
ATOM   1426  C CD2 . TYR A 1 205 ? 96.887  5.335  116.496 1.00 65.81  ? 205 TYR A CD2 1 
ATOM   1427  C CE1 . TYR A 1 205 ? 96.522  6.059  119.144 1.00 65.81  ? 205 TYR A CE1 1 
ATOM   1428  C CE2 . TYR A 1 205 ? 97.388  4.523  117.508 1.00 65.81  ? 205 TYR A CE2 1 
ATOM   1429  C CZ  . TYR A 1 205 ? 97.204  4.891  118.829 1.00 65.81  ? 205 TYR A CZ  1 
ATOM   1430  O OH  . TYR A 1 205 ? 97.707  4.096  119.836 1.00 65.81  ? 205 TYR A OH  1 
ATOM   1431  N N   . ASN A 1 206 ? 98.330  8.320  114.291 1.00 60.67  ? 206 ASN A N   1 
ATOM   1432  C CA  . ASN A 1 206 ? 99.749  8.117  114.008 1.00 60.67  ? 206 ASN A CA  1 
ATOM   1433  C C   . ASN A 1 206 ? 100.505 9.436  114.119 1.00 60.67  ? 206 ASN A C   1 
ATOM   1434  O O   . ASN A 1 206 ? 101.734 9.464  114.087 1.00 60.67  ? 206 ASN A O   1 
ATOM   1435  C CB  . ASN A 1 206 ? 99.944  7.544  112.595 1.00 95.06  ? 206 ASN A CB  1 
ATOM   1436  C CG  . ASN A 1 206 ? 99.158  6.272  112.365 1.00 95.06  ? 206 ASN A CG  1 
ATOM   1437  O OD1 . ASN A 1 206 ? 99.226  5.339  113.163 1.00 95.06  ? 206 ASN A OD1 1 
ATOM   1438  N ND2 . ASN A 1 206 ? 98.412  6.224  111.264 1.00 95.06  ? 206 ASN A ND2 1 
ATOM   1439  N N   . SER A 1 207 ? 99.756  10.526 114.242 1.00 115.20 ? 207 SER A N   1 
ATOM   1440  C CA  . SER A 1 207 ? 100.345 11.852 114.342 1.00 115.20 ? 207 SER A CA  1 
ATOM   1441  C C   . SER A 1 207 ? 100.696 12.187 115.783 1.00 115.20 ? 207 SER A C   1 
ATOM   1442  O O   . SER A 1 207 ? 101.198 13.272 116.068 1.00 115.20 ? 207 SER A O   1 
ATOM   1443  C CB  . SER A 1 207 ? 99.378  12.898 113.775 1.00 191.59 ? 207 SER A CB  1 
ATOM   1444  O OG  . SER A 1 207 ? 99.934  14.201 113.811 1.00 191.59 ? 207 SER A OG  1 
ATOM   1445  N N   . CYS A 1 208 ? 100.438 11.251 116.692 1.00 85.14  ? 208 CYS A N   1 
ATOM   1446  C CA  . CYS A 1 208 ? 100.738 11.461 118.107 1.00 85.14  ? 208 CYS A CA  1 
ATOM   1447  C C   . CYS A 1 208 ? 101.986 10.691 118.556 1.00 85.14  ? 208 CYS A C   1 
ATOM   1448  O O   . CYS A 1 208 ? 102.514 9.894  117.754 1.00 85.14  ? 208 CYS A O   1 
ATOM   1449  C CB  . CYS A 1 208 ? 99.545  11.040 118.966 1.00 66.98  ? 208 CYS A CB  1 
ATOM   1450  S SG  . CYS A 1 208 ? 98.021  11.943 118.663 1.00 66.98  ? 208 CYS A SG  1 
ATOM   1451  N N   . CYS B 1 25  ? 101.494 22.099 121.136 1.00 100.34 ? 25  CYS B N   1 
ATOM   1452  C CA  . CYS B 1 25  ? 100.093 22.088 121.647 1.00 100.34 ? 25  CYS B CA  1 
ATOM   1453  C C   . CYS B 1 25  ? 99.107  22.658 120.616 1.00 100.34 ? 25  CYS B C   1 
ATOM   1454  O O   . CYS B 1 25  ? 99.289  22.480 119.417 1.00 100.34 ? 25  CYS B O   1 
ATOM   1455  C CB  . CYS B 1 25  ? 100.020 22.883 122.960 1.00 75.65  ? 25  CYS B CB  1 
ATOM   1456  S SG  . CYS B 1 25  ? 100.461 24.635 122.834 1.00 75.65  ? 25  CYS B SG  1 
ATOM   1457  N N   . PHE B 1 26  ? 98.063  23.334 121.087 1.00 51.25  ? 26  PHE B N   1 
ATOM   1458  C CA  . PHE B 1 26  ? 97.063  23.925 120.208 1.00 51.25  ? 26  PHE B CA  1 
ATOM   1459  C C   . PHE B 1 26  ? 97.540  25.254 119.643 1.00 51.25  ? 26  PHE B C   1 
ATOM   1460  O O   . PHE B 1 26  ? 98.035  26.100 120.385 1.00 51.25  ? 26  PHE B O   1 
ATOM   1461  C CB  . PHE B 1 26  ? 95.753  24.155 120.956 1.00 32.43  ? 26  PHE B CB  1 
ATOM   1462  C CG  . PHE B 1 26  ? 94.576  24.258 120.044 1.00 32.43  ? 26  PHE B CG  1 
ATOM   1463  C CD1 . PHE B 1 26  ? 93.896  23.101 119.622 1.00 32.43  ? 26  PHE B CD1 1 
ATOM   1464  C CD2 . PHE B 1 26  ? 94.182  25.496 119.547 1.00 32.43  ? 26  PHE B CD2 1 
ATOM   1465  C CE1 . PHE B 1 26  ? 92.833  23.181 118.713 1.00 32.43  ? 26  PHE B CE1 1 
ATOM   1466  C CE2 . PHE B 1 26  ? 93.125  25.595 118.636 1.00 32.43  ? 26  PHE B CE2 1 
ATOM   1467  C CZ  . PHE B 1 26  ? 92.441  24.430 118.213 1.00 32.43  ? 26  PHE B CZ  1 
ATOM   1468  N N   . GLY B 1 27  ? 97.351  25.463 118.341 1.00 46.13  ? 27  GLY B N   1 
ATOM   1469  C CA  . GLY B 1 27  ? 97.831  26.693 117.729 1.00 46.13  ? 27  GLY B CA  1 
ATOM   1470  C C   . GLY B 1 27  ? 99.289  26.491 117.329 1.00 46.13  ? 27  GLY B C   1 
ATOM   1471  O O   . GLY B 1 27  ? 99.820  27.194 116.487 1.00 46.13  ? 27  GLY B O   1 
ATOM   1472  N N   . GLN B 1 28  ? 99.935  25.510 117.951 1.00 68.40  ? 28  GLN B N   1 
ATOM   1473  C CA  . GLN B 1 28  ? 101.321 25.179 117.665 1.00 68.40  ? 28  GLN B CA  1 
ATOM   1474  C C   . GLN B 1 28  ? 101.395 24.046 116.633 1.00 68.40  ? 28  GLN B C   1 
ATOM   1475  O O   . GLN B 1 28  ? 101.918 24.236 115.538 1.00 68.40  ? 28  GLN B O   1 
ATOM   1476  C CB  . GLN B 1 28  ? 102.031 24.735 118.944 1.00 136.55 ? 28  GLN B CB  1 
ATOM   1477  C CG  . GLN B 1 28  ? 102.011 25.745 120.082 1.00 136.55 ? 28  GLN B CG  1 
ATOM   1478  C CD  . GLN B 1 28  ? 102.841 26.987 119.803 1.00 136.55 ? 28  GLN B CD  1 
ATOM   1479  O OE1 . GLN B 1 28  ? 103.081 27.797 120.701 1.00 136.55 ? 28  GLN B OE1 1 
ATOM   1480  N NE2 . GLN B 1 28  ? 103.280 27.147 118.558 1.00 136.55 ? 28  GLN B NE2 1 
ATOM   1481  N N   . CYS B 1 29  ? 100.862 22.877 116.993 1.00 52.33  ? 29  CYS B N   1 
ATOM   1482  C CA  . CYS B 1 29  ? 100.877 21.692 116.139 1.00 52.33  ? 29  CYS B CA  1 
ATOM   1483  C C   . CYS B 1 29  ? 100.723 21.964 114.651 1.00 52.33  ? 29  CYS B C   1 
ATOM   1484  O O   . CYS B 1 29  ? 99.999  22.855 114.244 1.00 52.33  ? 29  CYS B O   1 
ATOM   1485  C CB  . CYS B 1 29  ? 99.805  20.716 116.594 1.00 82.62  ? 29  CYS B CB  1 
ATOM   1486  S SG  . CYS B 1 29  ? 100.153 20.053 118.217 1.00 82.62  ? 29  CYS B SG  1 
ATOM   1487  N N   . GLN B 1 30  ? 101.441 21.202 113.842 1.00 67.59  ? 30  GLN B N   1 
ATOM   1488  C CA  . GLN B 1 30  ? 101.380 21.342 112.401 1.00 67.59  ? 30  GLN B CA  1 
ATOM   1489  C C   . GLN B 1 30  ? 100.864 20.003 111.906 1.00 67.59  ? 30  GLN B C   1 
ATOM   1490  O O   . GLN B 1 30  ? 101.231 18.969 112.457 1.00 67.59  ? 30  GLN B O   1 
ATOM   1491  C CB  . GLN B 1 30  ? 102.778 21.632 111.832 1.00 139.29 ? 30  GLN B CB  1 
ATOM   1492  C CG  . GLN B 1 30  ? 103.314 23.024 112.190 1.00 139.29 ? 30  GLN B CG  1 
ATOM   1493  C CD  . GLN B 1 30  ? 104.681 23.329 111.588 1.00 139.29 ? 30  GLN B CD  1 
ATOM   1494  O OE1 . GLN B 1 30  ? 104.905 23.121 110.395 1.00 139.29 ? 30  GLN B OE1 1 
ATOM   1495  N NE2 . GLN B 1 30  ? 105.597 23.841 112.413 1.00 139.29 ? 30  GLN B NE2 1 
ATOM   1496  N N   . TYR B 1 31  ? 99.992  20.003 110.901 1.00 46.31  ? 31  TYR B N   1 
ATOM   1497  C CA  . TYR B 1 31  ? 99.471  18.739 110.389 1.00 46.31  ? 31  TYR B CA  1 
ATOM   1498  C C   . TYR B 1 31  ? 100.549 17.918 109.679 1.00 46.31  ? 31  TYR B C   1 
ATOM   1499  O O   . TYR B 1 31  ? 101.390 18.450 108.956 1.00 46.31  ? 31  TYR B O   1 
ATOM   1500  C CB  . TYR B 1 31  ? 98.314  18.976 109.422 1.00 38.85  ? 31  TYR B CB  1 
ATOM   1501  C CG  . TYR B 1 31  ? 97.006  19.349 110.082 1.00 38.85  ? 31  TYR B CG  1 
ATOM   1502  C CD1 . TYR B 1 31  ? 96.577  20.674 110.143 1.00 38.85  ? 31  TYR B CD1 1 
ATOM   1503  C CD2 . TYR B 1 31  ? 96.186  18.370 110.626 1.00 38.85  ? 31  TYR B CD2 1 
ATOM   1504  C CE1 . TYR B 1 31  ? 95.372  21.003 110.720 1.00 38.85  ? 31  TYR B CE1 1 
ATOM   1505  C CE2 . TYR B 1 31  ? 94.985  18.687 111.208 1.00 38.85  ? 31  TYR B CE2 1 
ATOM   1506  C CZ  . TYR B 1 31  ? 94.577  20.006 111.256 1.00 38.85  ? 31  TYR B CZ  1 
ATOM   1507  O OH  . TYR B 1 31  ? 93.372  20.320 111.863 1.00 38.85  ? 31  TYR B OH  1 
ATOM   1508  N N   . THR B 1 32  ? 100.525 16.615 109.905 1.00 49.82  ? 32  THR B N   1 
ATOM   1509  C CA  . THR B 1 32  ? 101.473 15.724 109.260 1.00 49.82  ? 32  THR B CA  1 
ATOM   1510  C C   . THR B 1 32  ? 100.946 15.504 107.851 1.00 49.82  ? 32  THR B C   1 
ATOM   1511  O O   . THR B 1 32  ? 99.763  15.711 107.597 1.00 49.82  ? 32  THR B O   1 
ATOM   1512  C CB  . THR B 1 32  ? 101.538 14.375 110.001 1.00 45.74  ? 32  THR B CB  1 
ATOM   1513  O OG1 . THR B 1 32  ? 100.224 13.801 110.089 1.00 45.74  ? 32  THR B OG1 1 
ATOM   1514  C CG2 . THR B 1 32  ? 102.076 14.576 111.397 1.00 45.74  ? 32  THR B CG2 1 
ATOM   1515  N N   . ALA B 1 33  ? 101.803 15.100 106.925 1.00 53.41  ? 33  ALA B N   1 
ATOM   1516  C CA  . ALA B 1 33  ? 101.326 14.873 105.561 1.00 53.41  ? 33  ALA B CA  1 
ATOM   1517  C C   . ALA B 1 33  ? 100.151 13.882 105.534 1.00 53.41  ? 33  ALA B C   1 
ATOM   1518  O O   . ALA B 1 33  ? 99.176  14.093 104.809 1.00 53.41  ? 33  ALA B O   1 
ATOM   1519  C CB  . ALA B 1 33  ? 102.465 14.370 104.675 1.00 52.02  ? 33  ALA B CB  1 
ATOM   1520  N N   . GLU B 1 34  ? 100.227 12.819 106.330 1.00 55.08  ? 34  GLU B N   1 
ATOM   1521  C CA  . GLU B 1 34  ? 99.146  11.844 106.334 1.00 55.08  ? 34  GLU B CA  1 
ATOM   1522  C C   . GLU B 1 34  ? 97.807  12.467 106.723 1.00 55.08  ? 34  GLU B C   1 
ATOM   1523  O O   . GLU B 1 34  ? 96.801  12.325 106.012 1.00 55.08  ? 34  GLU B O   1 
ATOM   1524  C CB  . GLU B 1 34  ? 99.446  10.681 107.279 1.00 141.37 ? 34  GLU B CB  1 
ATOM   1525  C CG  . GLU B 1 34  ? 100.773 10.009 107.041 1.00 141.37 ? 34  GLU B CG  1 
ATOM   1526  C CD  . GLU B 1 34  ? 101.856 10.590 107.911 1.00 141.37 ? 34  GLU B CD  1 
ATOM   1527  O OE1 . GLU B 1 34  ? 101.736 10.476 109.153 1.00 141.37 ? 34  GLU B OE1 1 
ATOM   1528  O OE2 . GLU B 1 34  ? 102.820 11.161 107.361 1.00 141.37 ? 34  GLU B OE2 1 
ATOM   1529  N N   . GLU B 1 35  ? 97.786  13.163 107.852 1.00 43.99  ? 35  GLU B N   1 
ATOM   1530  C CA  . GLU B 1 35  ? 96.553  13.768 108.300 1.00 43.99  ? 35  GLU B CA  1 
ATOM   1531  C C   . GLU B 1 35  ? 96.086  14.870 107.371 1.00 43.99  ? 35  GLU B C   1 
ATOM   1532  O O   . GLU B 1 35  ? 94.884  14.994 107.101 1.00 43.99  ? 35  GLU B O   1 
ATOM   1533  C CB  . GLU B 1 35  ? 96.692  14.304 109.714 1.00 54.70  ? 35  GLU B CB  1 
ATOM   1534  C CG  . GLU B 1 35  ? 95.340  14.682 110.291 1.00 54.70  ? 35  GLU B CG  1 
ATOM   1535  C CD  . GLU B 1 35  ? 95.395  15.094 111.750 1.00 54.70  ? 35  GLU B CD  1 
ATOM   1536  O OE1 . GLU B 1 35  ? 94.306  15.307 112.341 1.00 54.70  ? 35  GLU B OE1 1 
ATOM   1537  O OE2 . GLU B 1 35  ? 96.515  15.204 112.305 1.00 54.70  ? 35  GLU B OE2 1 
ATOM   1538  N N   . TYR B 1 36  ? 97.025  15.676 106.879 1.00 41.38  ? 36  TYR B N   1 
ATOM   1539  C CA  . TYR B 1 36  ? 96.658  16.746 105.958 1.00 41.38  ? 36  TYR B CA  1 
ATOM   1540  C C   . TYR B 1 36  ? 95.918  16.186 104.752 1.00 41.38  ? 36  TYR B C   1 
ATOM   1541  O O   . TYR B 1 36  ? 94.790  16.578 104.471 1.00 41.38  ? 36  TYR B O   1 
ATOM   1542  C CB  . TYR B 1 36  ? 97.879  17.494 105.446 1.00 58.85  ? 36  TYR B CB  1 
ATOM   1543  C CG  . TYR B 1 36  ? 97.545  18.247 104.183 1.00 58.85  ? 36  TYR B CG  1 
ATOM   1544  C CD1 . TYR B 1 36  ? 96.704  19.358 104.216 1.00 58.85  ? 36  TYR B CD1 1 
ATOM   1545  C CD2 . TYR B 1 36  ? 97.967  17.776 102.942 1.00 58.85  ? 36  TYR B CD2 1 
ATOM   1546  C CE1 . TYR B 1 36  ? 96.280  19.978 103.039 1.00 58.85  ? 36  TYR B CE1 1 
ATOM   1547  C CE2 . TYR B 1 36  ? 97.553  18.383 101.766 1.00 58.85  ? 36  TYR B CE2 1 
ATOM   1548  C CZ  . TYR B 1 36  ? 96.702  19.483 101.811 1.00 58.85  ? 36  TYR B CZ  1 
ATOM   1549  O OH  . TYR B 1 36  ? 96.228  20.042 100.634 1.00 58.85  ? 36  TYR B OH  1 
ATOM   1550  N N   . GLN B 1 37  ? 96.569  15.269 104.040 1.00 49.93  ? 37  GLN B N   1 
ATOM   1551  C CA  . GLN B 1 37  ? 95.992  14.654 102.856 1.00 49.93  ? 37  GLN B CA  1 
ATOM   1552  C C   . GLN B 1 37  ? 94.620  14.016 103.093 1.00 49.93  ? 37  GLN B C   1 
ATOM   1553  O O   . GLN B 1 37  ? 93.694  14.193 102.295 1.00 49.93  ? 37  GLN B O   1 
ATOM   1554  C CB  . GLN B 1 37  ? 96.941  13.607 102.317 1.00 169.77 ? 37  GLN B CB  1 
ATOM   1555  C CG  . GLN B 1 37  ? 96.720  13.329 100.872 1.00 169.77 ? 37  GLN B CG  1 
ATOM   1556  C CD  . GLN B 1 37  ? 97.733  12.369 100.350 1.00 169.77 ? 37  GLN B CD  1 
ATOM   1557  O OE1 . GLN B 1 37  ? 98.079  12.400 99.174  1.00 169.77 ? 37  GLN B OE1 1 
ATOM   1558  N NE2 . GLN B 1 37  ? 98.223  11.495 101.222 1.00 169.77 ? 37  GLN B NE2 1 
ATOM   1559  N N   . ALA B 1 38  ? 94.496  13.278 104.190 1.00 42.05  ? 38  ALA B N   1 
ATOM   1560  C CA  . ALA B 1 38  ? 93.255  12.608 104.529 1.00 42.05  ? 38  ALA B CA  1 
ATOM   1561  C C   . ALA B 1 38  ? 92.110  13.592 104.698 1.00 42.05  ? 38  ALA B C   1 
ATOM   1562  O O   . ALA B 1 38  ? 91.030  13.406 104.123 1.00 42.05  ? 38  ALA B O   1 
ATOM   1563  C CB  . ALA B 1 38  ? 93.442  11.793 105.818 1.00 30.50  ? 38  ALA B CB  1 
ATOM   1564  N N   . ILE B 1 39  ? 92.353  14.627 105.505 1.00 52.10  ? 39  ILE B N   1 
ATOM   1565  C CA  . ILE B 1 39  ? 91.370  15.659 105.795 1.00 52.10  ? 39  ILE B CA  1 
ATOM   1566  C C   . ILE B 1 39  ? 91.075  16.458 104.543 1.00 52.10  ? 39  ILE B C   1 
ATOM   1567  O O   . ILE B 1 39  ? 89.905  16.752 104.230 1.00 52.10  ? 39  ILE B O   1 
ATOM   1568  C CB  . ILE B 1 39  ? 91.896  16.597 106.885 1.00 37.04  ? 39  ILE B CB  1 
ATOM   1569  C CG1 . ILE B 1 39  ? 91.924  15.849 108.221 1.00 37.04  ? 39  ILE B CG1 1 
ATOM   1570  C CG2 . ILE B 1 39  ? 91.070  17.868 106.949 1.00 37.04  ? 39  ILE B CG2 1 
ATOM   1571  C CD1 . ILE B 1 39  ? 92.445  16.694 109.366 1.00 37.04  ? 39  ILE B CD1 1 
ATOM   1572  N N   . GLN B 1 40  ? 92.128  16.803 103.811 1.00 38.56  ? 40  GLN B N   1 
ATOM   1573  C CA  . GLN B 1 40  ? 91.924  17.573 102.603 1.00 38.56  ? 40  GLN B CA  1 
ATOM   1574  C C   . GLN B 1 40  ? 90.975  16.844 101.667 1.00 38.56  ? 40  GLN B C   1 
ATOM   1575  O O   . GLN B 1 40  ? 90.129  17.479 101.021 1.00 38.56  ? 40  GLN B O   1 
ATOM   1576  C CB  . GLN B 1 40  ? 93.240  17.860 101.887 1.00 51.16  ? 40  GLN B CB  1 
ATOM   1577  C CG  . GLN B 1 40  ? 93.055  18.512 100.500 1.00 51.16  ? 40  GLN B CG  1 
ATOM   1578  C CD  . GLN B 1 40  ? 92.562  19.968 100.524 1.00 51.16  ? 40  GLN B CD  1 
ATOM   1579  O OE1 . GLN B 1 40  ? 91.766  20.346 101.363 1.00 51.16  ? 40  GLN B OE1 1 
ATOM   1580  N NE2 . GLN B 1 40  ? 93.020  20.770 99.572  1.00 51.16  ? 40  GLN B NE2 1 
ATOM   1581  N N   . LYS B 1 41  ? 91.100  15.517 101.595 1.00 49.32  ? 41  LYS B N   1 
ATOM   1582  C CA  . LYS B 1 41  ? 90.237  14.747 100.719 1.00 49.32  ? 41  LYS B CA  1 
ATOM   1583  C C   . LYS B 1 41  ? 88.850  14.659 101.278 1.00 49.32  ? 41  LYS B C   1 
ATOM   1584  O O   . LYS B 1 41  ? 87.877  14.994 100.593 1.00 49.32  ? 41  LYS B O   1 
ATOM   1585  C CB  . LYS B 1 41  ? 90.767  13.340 100.512 1.00 130.22 ? 41  LYS B CB  1 
ATOM   1586  C CG  . LYS B 1 41  ? 92.019  13.293 99.700  1.00 130.22 ? 41  LYS B CG  1 
ATOM   1587  C CD  . LYS B 1 41  ? 92.346  11.872 99.333  1.00 130.22 ? 41  LYS B CD  1 
ATOM   1588  C CE  . LYS B 1 41  ? 93.628  11.850 98.571  1.00 130.22 ? 41  LYS B CE  1 
ATOM   1589  N NZ  . LYS B 1 41  ? 93.585  12.835 97.457  1.00 130.22 ? 41  LYS B NZ  1 
ATOM   1590  N N   . ALA B 1 42  ? 88.752  14.227 102.530 1.00 43.08  ? 42  ALA B N   1 
ATOM   1591  C CA  . ALA B 1 42  ? 87.445  14.080 103.158 1.00 43.08  ? 42  ALA B CA  1 
ATOM   1592  C C   . ALA B 1 42  ? 86.605  15.363 103.192 1.00 43.08  ? 42  ALA B C   1 
ATOM   1593  O O   . ALA B 1 42  ? 85.388  15.306 103.054 1.00 43.08  ? 42  ALA B O   1 
ATOM   1594  C CB  . ALA B 1 42  ? 87.607  13.509 104.543 1.00 16.46  ? 42  ALA B CB  1 
ATOM   1595  N N   . LEU B 1 43  ? 87.239  16.522 103.344 1.00 48.81  ? 43  LEU B N   1 
ATOM   1596  C CA  . LEU B 1 43  ? 86.467  17.755 103.372 1.00 48.81  ? 43  LEU B CA  1 
ATOM   1597  C C   . LEU B 1 43  ? 85.697  18.033 102.070 1.00 48.81  ? 43  LEU B C   1 
ATOM   1598  O O   . LEU B 1 43  ? 84.675  18.730 102.071 1.00 48.81  ? 43  LEU B O   1 
ATOM   1599  C CB  . LEU B 1 43  ? 87.386  18.925 103.733 1.00 34.22  ? 43  LEU B CB  1 
ATOM   1600  C CG  . LEU B 1 43  ? 87.684  19.072 105.241 1.00 34.22  ? 43  LEU B CG  1 
ATOM   1601  C CD1 . LEU B 1 43  ? 88.719  20.151 105.453 1.00 34.22  ? 43  LEU B CD1 1 
ATOM   1602  C CD2 . LEU B 1 43  ? 86.422  19.394 106.009 1.00 34.22  ? 43  LEU B CD2 1 
ATOM   1603  N N   . ARG B 1 44  ? 86.176  17.465 100.967 1.00 54.65  ? 44  ARG B N   1 
ATOM   1604  C CA  . ARG B 1 44  ? 85.537  17.640 99.666  1.00 54.65  ? 44  ARG B CA  1 
ATOM   1605  C C   . ARG B 1 44  ? 84.175  16.985 99.577  1.00 54.65  ? 44  ARG B C   1 
ATOM   1606  O O   . ARG B 1 44  ? 83.300  17.482 98.876  1.00 54.65  ? 44  ARG B O   1 
ATOM   1607  C CB  . ARG B 1 44  ? 86.429  17.098 98.558  1.00 52.71  ? 44  ARG B CB  1 
ATOM   1608  C CG  . ARG B 1 44  ? 87.519  18.059 98.153  1.00 52.71  ? 44  ARG B CG  1 
ATOM   1609  C CD  . ARG B 1 44  ? 88.242  17.586 96.913  1.00 52.71  ? 44  ARG B CD  1 
ATOM   1610  N NE  . ARG B 1 44  ? 89.354  16.698 97.225  1.00 52.71  ? 44  ARG B NE  1 
ATOM   1611  C CZ  . ARG B 1 44  ? 90.623  17.071 97.146  1.00 52.71  ? 44  ARG B CZ  1 
ATOM   1612  N NH1 . ARG B 1 44  ? 90.918  18.312 96.763  1.00 52.71  ? 44  ARG B NH1 1 
ATOM   1613  N NH2 . ARG B 1 44  ? 91.592  16.215 97.452  1.00 52.71  ? 44  ARG B NH2 1 
ATOM   1614  N N   . GLN B 1 45  ? 83.991  15.876 100.283 1.00 36.31  ? 45  GLN B N   1 
ATOM   1615  C CA  . GLN B 1 45  ? 82.703  15.165 100.281 1.00 36.31  ? 45  GLN B CA  1 
ATOM   1616  C C   . GLN B 1 45  ? 81.482  16.066 100.470 1.00 36.31  ? 45  GLN B C   1 
ATOM   1617  O O   . GLN B 1 45  ? 81.556  17.087 101.144 1.00 36.31  ? 45  GLN B O   1 
ATOM   1618  C CB  . GLN B 1 45  ? 82.666  14.114 101.394 1.00 63.46  ? 45  GLN B CB  1 
ATOM   1619  C CG  . GLN B 1 45  ? 83.609  12.944 101.220 1.00 63.46  ? 45  GLN B CG  1 
ATOM   1620  C CD  . GLN B 1 45  ? 83.694  12.135 102.474 1.00 63.46  ? 45  GLN B CD  1 
ATOM   1621  O OE1 . GLN B 1 45  ? 84.299  12.561 103.450 1.00 63.46  ? 45  GLN B OE1 1 
ATOM   1622  N NE2 . GLN B 1 45  ? 83.067  10.970 102.472 1.00 63.46  ? 45  GLN B NE2 1 
ATOM   1623  N N   . ARG B 1 46  ? 80.358  15.688 99.872  1.00 42.49  ? 46  ARG B N   1 
ATOM   1624  C CA  . ARG B 1 46  ? 79.130  16.453 100.034 1.00 42.49  ? 46  ARG B CA  1 
ATOM   1625  C C   . ARG B 1 46  ? 78.323  15.689 101.049 1.00 42.49  ? 46  ARG B C   1 
ATOM   1626  O O   . ARG B 1 46  ? 78.464  14.469 101.146 1.00 42.49  ? 46  ARG B O   1 
ATOM   1627  C CB  . ARG B 1 46  ? 78.372  16.531 98.724  1.00 75.96  ? 46  ARG B CB  1 
ATOM   1628  C CG  . ARG B 1 46  ? 79.036  17.407 97.700  1.00 75.96  ? 46  ARG B CG  1 
ATOM   1629  C CD  . ARG B 1 46  ? 77.975  18.179 96.963  1.00 75.96  ? 46  ARG B CD  1 
ATOM   1630  N NE  . ARG B 1 46  ? 78.532  19.244 96.146  1.00 75.96  ? 46  ARG B NE  1 
ATOM   1631  C CZ  . ARG B 1 46  ? 79.320  19.045 95.097  1.00 75.96  ? 46  ARG B CZ  1 
ATOM   1632  N NH1 . ARG B 1 46  ? 79.650  17.809 94.727  1.00 75.96  ? 46  ARG B NH1 1 
ATOM   1633  N NH2 . ARG B 1 46  ? 79.776  20.088 94.421  1.00 75.96  ? 46  ARG B NH2 1 
ATOM   1634  N N   . LEU B 1 47  ? 77.485  16.369 101.820 1.00 74.70  ? 47  LEU B N   1 
ATOM   1635  C CA  . LEU B 1 47  ? 76.705  15.650 102.822 1.00 74.70  ? 47  LEU B CA  1 
ATOM   1636  C C   . LEU B 1 47  ? 75.524  14.883 102.230 1.00 74.70  ? 47  LEU B C   1 
ATOM   1637  O O   . LEU B 1 47  ? 74.933  15.298 101.233 1.00 74.70  ? 47  LEU B O   1 
ATOM   1638  C CB  . LEU B 1 47  ? 76.198  16.600 103.917 1.00 52.58  ? 47  LEU B CB  1 
ATOM   1639  C CG  . LEU B 1 47  ? 77.211  17.170 104.912 1.00 52.58  ? 47  LEU B CG  1 
ATOM   1640  C CD1 . LEU B 1 47  ? 78.081  16.052 105.482 1.00 52.58  ? 47  LEU B CD1 1 
ATOM   1641  C CD2 . LEU B 1 47  ? 78.072  18.194 104.196 1.00 52.58  ? 47  LEU B CD2 1 
ATOM   1642  N N   . GLY B 1 48  ? 75.197  13.751 102.846 1.00 75.52  ? 48  GLY B N   1 
ATOM   1643  C CA  . GLY B 1 48  ? 74.072  12.958 102.395 1.00 75.52  ? 48  GLY B CA  1 
ATOM   1644  C C   . GLY B 1 48  ? 72.795  13.570 102.948 1.00 75.52  ? 48  GLY B C   1 
ATOM   1645  O O   . GLY B 1 48  ? 72.849  14.523 103.727 1.00 75.52  ? 48  GLY B O   1 
ATOM   1646  N N   . PRO B 1 49  ? 71.622  13.049 102.569 1.00 89.73  ? 49  PRO B N   1 
ATOM   1647  C CA  . PRO B 1 49  ? 70.360  13.604 103.068 1.00 89.73  ? 49  PRO B CA  1 
ATOM   1648  C C   . PRO B 1 49  ? 70.167  13.421 104.569 1.00 89.73  ? 49  PRO B C   1 
ATOM   1649  O O   . PRO B 1 49  ? 69.276  14.032 105.167 1.00 89.73  ? 49  PRO B O   1 
ATOM   1650  C CB  . PRO B 1 49  ? 69.313  12.851 102.257 1.00 122.63 ? 49  PRO B CB  1 
ATOM   1651  C CG  . PRO B 1 49  ? 70.045  12.518 100.979 1.00 122.63 ? 49  PRO B CG  1 
ATOM   1652  C CD  . PRO B 1 49  ? 71.378  12.071 101.497 1.00 122.63 ? 49  PRO B CD  1 
ATOM   1653  N N   . GLU B 1 50  ? 71.009  12.582 105.166 1.00 61.64  ? 50  GLU B N   1 
ATOM   1654  C CA  . GLU B 1 50  ? 70.939  12.302 106.589 1.00 61.64  ? 50  GLU B CA  1 
ATOM   1655  C C   . GLU B 1 50  ? 71.359  13.507 107.388 1.00 61.64  ? 50  GLU B C   1 
ATOM   1656  O O   . GLU B 1 50  ? 71.134  13.551 108.594 1.00 61.64  ? 50  GLU B O   1 
ATOM   1657  C CB  . GLU B 1 50  ? 71.853  11.144 106.966 1.00 80.82  ? 50  GLU B CB  1 
ATOM   1658  C CG  . GLU B 1 50  ? 71.663  9.901  106.136 1.00 80.82  ? 50  GLU B CG  1 
ATOM   1659  C CD  . GLU B 1 50  ? 72.462  9.929  104.851 1.00 80.82  ? 50  GLU B CD  1 
ATOM   1660  O OE1 . GLU B 1 50  ? 72.479  10.970 104.160 1.00 80.82  ? 50  GLU B OE1 1 
ATOM   1661  O OE2 . GLU B 1 50  ? 73.067  8.894  104.526 1.00 80.82  ? 50  GLU B OE2 1 
ATOM   1662  N N   . TYR B 1 51  ? 71.969  14.488 106.725 1.00 68.84  ? 51  TYR B N   1 
ATOM   1663  C CA  . TYR B 1 51  ? 72.428  15.693 107.409 1.00 68.84  ? 51  TYR B CA  1 
ATOM   1664  C C   . TYR B 1 51  ? 71.543  16.915 107.206 1.00 68.84  ? 51  TYR B C   1 
ATOM   1665  O O   . TYR B 1 51  ? 71.503  17.814 108.048 1.00 68.84  ? 51  TYR B O   1 
ATOM   1666  C CB  . TYR B 1 51  ? 73.853  16.036 106.965 1.00 65.84  ? 51  TYR B CB  1 
ATOM   1667  C CG  . TYR B 1 51  ? 74.917  15.074 107.464 1.00 65.84  ? 51  TYR B CG  1 
ATOM   1668  C CD1 . TYR B 1 51  ? 75.459  14.099 106.633 1.00 65.84  ? 51  TYR B CD1 1 
ATOM   1669  C CD2 . TYR B 1 51  ? 75.362  15.131 108.787 1.00 65.84  ? 51  TYR B CD2 1 
ATOM   1670  C CE1 . TYR B 1 51  ? 76.415  13.200 107.109 1.00 65.84  ? 51  TYR B CE1 1 
ATOM   1671  C CE2 . TYR B 1 51  ? 76.311  14.242 109.269 1.00 65.84  ? 51  TYR B CE2 1 
ATOM   1672  C CZ  . TYR B 1 51  ? 76.833  13.277 108.429 1.00 65.84  ? 51  TYR B CZ  1 
ATOM   1673  O OH  . TYR B 1 51  ? 77.757  12.389 108.931 1.00 65.84  ? 51  TYR B OH  1 
ATOM   1674  N N   . ILE B 1 52  ? 70.819  16.941 106.099 1.00 54.81  ? 52  ILE B N   1 
ATOM   1675  C CA  . ILE B 1 52  ? 69.971  18.083 105.787 1.00 54.81  ? 52  ILE B CA  1 
ATOM   1676  C C   . ILE B 1 52  ? 68.622  18.144 106.515 1.00 54.81  ? 52  ILE B C   1 
ATOM   1677  O O   . ILE B 1 52  ? 68.055  17.119 106.870 1.00 54.81  ? 52  ILE B O   1 
ATOM   1678  C CB  . ILE B 1 52  ? 69.738  18.131 104.276 1.00 41.64  ? 52  ILE B CB  1 
ATOM   1679  C CG1 . ILE B 1 52  ? 71.046  17.783 103.565 1.00 41.64  ? 52  ILE B CG1 1 
ATOM   1680  C CG2 . ILE B 1 52  ? 69.253  19.500 103.857 1.00 41.64  ? 52  ILE B CG2 1 
ATOM   1681  C CD1 . ILE B 1 52  ? 72.262  18.619 104.027 1.00 41.64  ? 52  ILE B CD1 1 
ATOM   1682  N N   . SER B 1 53  ? 68.124  19.352 106.744 1.00 100.76 ? 53  SER B N   1 
ATOM   1683  C CA  . SER B 1 53  ? 66.837  19.543 107.403 1.00 100.76 ? 53  SER B CA  1 
ATOM   1684  C C   . SER B 1 53  ? 66.154  20.698 106.684 1.00 100.76 ? 53  SER B C   1 
ATOM   1685  O O   . SER B 1 53  ? 66.681  21.199 105.691 1.00 100.76 ? 53  SER B O   1 
ATOM   1686  C CB  . SER B 1 53  ? 67.029  19.885 108.881 1.00 58.11  ? 53  SER B CB  1 
ATOM   1687  O OG  . SER B 1 53  ? 67.727  18.848 109.548 1.00 58.11  ? 53  SER B OG  1 
ATOM   1688  N N   . SER B 1 54  ? 64.988  21.126 107.163 1.00 87.89  ? 54  SER B N   1 
ATOM   1689  C CA  . SER B 1 54  ? 64.301  22.231 106.512 1.00 87.89  ? 54  SER B CA  1 
ATOM   1690  C C   . SER B 1 54  ? 63.286  22.930 107.394 1.00 87.89  ? 54  SER B C   1 
ATOM   1691  O O   . SER B 1 54  ? 62.785  22.370 108.373 1.00 87.89  ? 54  SER B O   1 
ATOM   1692  C CB  . SER B 1 54  ? 63.627  21.754 105.222 1.00 80.35  ? 54  SER B CB  1 
ATOM   1693  O OG  . SER B 1 54  ? 62.712  20.707 105.481 1.00 80.35  ? 54  SER B OG  1 
ATOM   1694  N N   . ARG B 1 55  ? 63.016  24.176 107.031 1.00 113.24 ? 55  ARG B N   1 
ATOM   1695  C CA  . ARG B 1 55  ? 62.064  25.025 107.725 1.00 113.24 ? 55  ARG B CA  1 
ATOM   1696  C C   . ARG B 1 55  ? 61.253  25.694 106.626 1.00 113.24 ? 55  ARG B C   1 
ATOM   1697  O O   . ARG B 1 55  ? 61.633  25.637 105.454 1.00 113.24 ? 55  ARG B O   1 
ATOM   1698  C CB  . ARG B 1 55  ? 62.796  26.097 108.529 1.00 147.98 ? 55  ARG B CB  1 
ATOM   1699  C CG  . ARG B 1 55  ? 63.505  25.604 109.770 1.00 147.98 ? 55  ARG B CG  1 
ATOM   1700  C CD  . ARG B 1 55  ? 64.807  26.365 109.956 1.00 147.98 ? 55  ARG B CD  1 
ATOM   1701  N NE  . ARG B 1 55  ? 64.696  27.760 109.538 1.00 147.98 ? 55  ARG B NE  1 
ATOM   1702  C CZ  . ARG B 1 55  ? 65.733  28.577 109.378 1.00 147.98 ? 55  ARG B CZ  1 
ATOM   1703  N NH1 . ARG B 1 55  ? 66.969  28.144 109.599 1.00 147.98 ? 55  ARG B NH1 1 
ATOM   1704  N NH2 . ARG B 1 55  ? 65.536  29.828 108.991 1.00 147.98 ? 55  ARG B NH2 1 
ATOM   1705  N N   . MET B 1 56  ? 60.145  26.329 106.992 1.00 156.33 ? 56  MET B N   1 
ATOM   1706  C CA  . MET B 1 56  ? 59.328  27.006 105.997 1.00 156.33 ? 56  MET B CA  1 
ATOM   1707  C C   . MET B 1 56  ? 59.554  28.507 106.098 1.00 156.33 ? 56  MET B C   1 
ATOM   1708  O O   . MET B 1 56  ? 59.057  29.161 107.016 1.00 156.33 ? 56  MET B O   1 
ATOM   1709  C CB  . MET B 1 56  ? 57.848  26.680 106.201 1.00 159.18 ? 56  MET B CB  1 
ATOM   1710  C CG  . MET B 1 56  ? 57.043  26.699 104.916 1.00 159.18 ? 56  MET B CG  1 
ATOM   1711  S SD  . MET B 1 56  ? 57.861  25.739 103.612 1.00 159.18 ? 56  MET B SD  1 
ATOM   1712  C CE  . MET B 1 56  ? 57.673  24.078 104.227 1.00 159.18 ? 56  MET B CE  1 
ATOM   1713  N N   . ALA B 1 57  ? 60.323  29.041 105.154 1.00 177.59 ? 57  ALA B N   1 
ATOM   1714  C CA  . ALA B 1 57  ? 60.631  30.464 105.121 1.00 177.59 ? 57  ALA B CA  1 
ATOM   1715  C C   . ALA B 1 57  ? 59.345  31.270 105.206 1.00 177.59 ? 57  ALA B C   1 
ATOM   1716  O O   . ALA B 1 57  ? 58.383  30.987 104.494 1.00 177.59 ? 57  ALA B O   1 
ATOM   1717  C CB  . ALA B 1 57  ? 61.376  30.808 103.837 1.00 129.69 ? 57  ALA B CB  1 
ATOM   1718  N N   . GLY B 1 58  ? 59.330  32.266 106.087 1.00 200.00 ? 58  GLY B N   1 
ATOM   1719  C CA  . GLY B 1 58  ? 58.149  33.097 106.233 1.00 200.00 ? 58  GLY B CA  1 
ATOM   1720  C C   . GLY B 1 58  ? 57.739  33.645 104.881 1.00 200.00 ? 58  GLY B C   1 
ATOM   1721  O O   . GLY B 1 58  ? 58.302  34.633 104.408 1.00 200.00 ? 58  GLY B O   1 
ATOM   1722  N N   . GLY B 1 59  ? 56.758  33.003 104.257 1.00 147.41 ? 59  GLY B N   1 
ATOM   1723  C CA  . GLY B 1 59  ? 56.309  33.439 102.949 1.00 147.41 ? 59  GLY B CA  1 
ATOM   1724  C C   . GLY B 1 59  ? 57.154  32.791 101.869 1.00 147.41 ? 59  GLY B C   1 
ATOM   1725  O O   . GLY B 1 59  ? 56.650  32.445 100.797 1.00 147.41 ? 59  GLY B O   1 
ATOM   1726  N N   . GLY B 1 60  ? 58.442  32.620 102.159 1.00 178.79 ? 60  GLY B N   1 
ATOM   1727  C CA  . GLY B 1 60  ? 59.352  32.009 101.206 1.00 178.79 ? 60  GLY B CA  1 
ATOM   1728  C C   . GLY B 1 60  ? 59.121  30.518 101.057 1.00 178.79 ? 60  GLY B C   1 
ATOM   1729  O O   . GLY B 1 60  ? 58.129  29.980 101.555 1.00 178.79 ? 60  GLY B O   1 
ATOM   1730  N N   . GLN B 1 61  ? 60.039  29.846 100.369 1.00 197.79 ? 61  GLN B N   1 
ATOM   1731  C CA  . GLN B 1 61  ? 59.923  28.410 100.154 1.00 197.79 ? 61  GLN B CA  1 
ATOM   1732  C C   . GLN B 1 61  ? 60.533  27.620 101.304 1.00 197.79 ? 61  GLN B C   1 
ATOM   1733  O O   . GLN B 1 61  ? 60.634  28.102 102.433 1.00 197.79 ? 61  GLN B O   1 
ATOM   1734  C CB  . GLN B 1 61  ? 60.617  27.991 98.850  1.00 195.68 ? 61  GLN B CB  1 
ATOM   1735  C CG  . GLN B 1 61  ? 60.123  28.685 97.590  1.00 195.68 ? 61  GLN B CG  1 
ATOM   1736  C CD  . GLN B 1 61  ? 60.823  30.003 97.329  1.00 195.68 ? 61  GLN B CD  1 
ATOM   1737  O OE1 . GLN B 1 61  ? 60.756  30.929 98.136  1.00 195.68 ? 61  GLN B OE1 1 
ATOM   1738  N NE2 . GLN B 1 61  ? 61.504  30.092 96.193  1.00 195.68 ? 61  GLN B NE2 1 
ATOM   1739  N N   . LYS B 1 62  ? 60.936  26.395 100.988 1.00 117.78 ? 62  LYS B N   1 
ATOM   1740  C CA  . LYS B 1 62  ? 61.546  25.486 101.942 1.00 117.78 ? 62  LYS B CA  1 
ATOM   1741  C C   . LYS B 1 62  ? 63.033  25.782 102.023 1.00 117.78 ? 62  LYS B C   1 
ATOM   1742  O O   . LYS B 1 62  ? 63.737  25.759 101.010 1.00 117.78 ? 62  LYS B O   1 
ATOM   1743  C CB  . LYS B 1 62  ? 61.328  24.046 101.480 1.00 86.67  ? 62  LYS B CB  1 
ATOM   1744  C CG  . LYS B 1 62  ? 62.146  23.003 102.195 1.00 86.67  ? 62  LYS B CG  1 
ATOM   1745  C CD  . LYS B 1 62  ? 61.979  21.659 101.508 1.00 86.67  ? 62  LYS B CD  1 
ATOM   1746  C CE  . LYS B 1 62  ? 62.788  20.573 102.189 1.00 86.67  ? 62  LYS B CE  1 
ATOM   1747  N NZ  . LYS B 1 62  ? 62.583  19.232 101.559 1.00 86.67  ? 62  LYS B NZ  1 
ATOM   1748  N N   . VAL B 1 63  ? 63.505  26.066 103.233 1.00 84.60  ? 63  VAL B N   1 
ATOM   1749  C CA  . VAL B 1 63  ? 64.916  26.355 103.444 1.00 84.60  ? 63  VAL B CA  1 
ATOM   1750  C C   . VAL B 1 63  ? 65.654  25.205 104.127 1.00 84.60  ? 63  VAL B C   1 
ATOM   1751  O O   . VAL B 1 63  ? 65.296  24.781 105.226 1.00 84.60  ? 63  VAL B O   1 
ATOM   1752  C CB  . VAL B 1 63  ? 65.099  27.615 104.279 1.00 59.16  ? 63  VAL B CB  1 
ATOM   1753  C CG1 . VAL B 1 63  ? 66.572  27.903 104.441 1.00 59.16  ? 63  VAL B CG1 1 
ATOM   1754  C CG2 . VAL B 1 63  ? 64.399  28.775 103.610 1.00 59.16  ? 63  VAL B CG2 1 
ATOM   1755  N N   . CYS B 1 64  ? 66.689  24.714 103.452 1.00 81.28  ? 64  CYS B N   1 
ATOM   1756  C CA  . CYS B 1 64  ? 67.506  23.622 103.950 1.00 81.28  ? 64  CYS B CA  1 
ATOM   1757  C C   . CYS B 1 64  ? 68.641  24.118 104.824 1.00 81.28  ? 64  CYS B C   1 
ATOM   1758  O O   . CYS B 1 64  ? 69.202  25.184 104.591 1.00 81.28  ? 64  CYS B O   1 
ATOM   1759  C CB  . CYS B 1 64  ? 68.081  22.841 102.784 1.00 83.04  ? 64  CYS B CB  1 
ATOM   1760  S SG  . CYS B 1 64  ? 66.813  22.156 101.754 1.00 83.04  ? 64  CYS B SG  1 
ATOM   1761  N N   . TYR B 1 65  ? 68.992  23.326 105.825 1.00 83.27  ? 65  TYR B N   1 
ATOM   1762  C CA  . TYR B 1 65  ? 70.052  23.698 106.748 1.00 83.27  ? 65  TYR B CA  1 
ATOM   1763  C C   . TYR B 1 65  ? 70.543  22.466 107.498 1.00 83.27  ? 65  TYR B C   1 
ATOM   1764  O O   . TYR B 1 65  ? 69.922  21.403 107.445 1.00 83.27  ? 65  TYR B O   1 
ATOM   1765  C CB  . TYR B 1 65  ? 69.512  24.713 107.750 1.00 85.39  ? 65  TYR B CB  1 
ATOM   1766  C CG  . TYR B 1 65  ? 68.533  24.116 108.742 1.00 85.39  ? 65  TYR B CG  1 
ATOM   1767  C CD1 . TYR B 1 65  ? 68.978  23.576 109.945 1.00 85.39  ? 65  TYR B CD1 1 
ATOM   1768  C CD2 . TYR B 1 65  ? 67.166  24.085 108.477 1.00 85.39  ? 65  TYR B CD2 1 
ATOM   1769  C CE1 . TYR B 1 65  ? 68.089  23.028 110.862 1.00 85.39  ? 65  TYR B CE1 1 
ATOM   1770  C CE2 . TYR B 1 65  ? 66.274  23.535 109.386 1.00 85.39  ? 65  TYR B CE2 1 
ATOM   1771  C CZ  . TYR B 1 65  ? 66.741  23.013 110.579 1.00 85.39  ? 65  TYR B CZ  1 
ATOM   1772  O OH  . TYR B 1 65  ? 65.863  22.510 111.512 1.00 85.39  ? 65  TYR B OH  1 
ATOM   1773  N N   . ILE B 1 66  ? 71.662  22.605 108.198 1.00 48.59  ? 66  ILE B N   1 
ATOM   1774  C CA  . ILE B 1 66  ? 72.183  21.489 108.972 1.00 48.59  ? 66  ILE B CA  1 
ATOM   1775  C C   . ILE B 1 66  ? 72.059  21.826 110.454 1.00 48.59  ? 66  ILE B C   1 
ATOM   1776  O O   . ILE B 1 66  ? 72.412  22.924 110.877 1.00 48.59  ? 66  ILE B O   1 
ATOM   1777  C CB  . ILE B 1 66  ? 73.631  21.196 108.618 1.00 36.34  ? 66  ILE B CB  1 
ATOM   1778  C CG1 . ILE B 1 66  ? 73.776  21.123 107.106 1.00 36.34  ? 66  ILE B CG1 1 
ATOM   1779  C CG2 . ILE B 1 66  ? 74.017  19.858 109.167 1.00 36.34  ? 66  ILE B CG2 1 
ATOM   1780  C CD1 . ILE B 1 66  ? 75.200  20.850 106.612 1.00 36.34  ? 66  ILE B CD1 1 
ATOM   1781  N N   . GLU B 1 67  ? 71.525  20.888 111.235 1.00 50.57  ? 67  GLU B N   1 
ATOM   1782  C CA  . GLU B 1 67  ? 71.335  21.125 112.665 1.00 50.57  ? 67  GLU B CA  1 
ATOM   1783  C C   . GLU B 1 67  ? 72.657  21.261 113.406 1.00 50.57  ? 67  GLU B C   1 
ATOM   1784  O O   . GLU B 1 67  ? 73.639  20.610 113.070 1.00 50.57  ? 67  GLU B O   1 
ATOM   1785  C CB  . GLU B 1 67  ? 70.486  20.015 113.274 1.00 99.12  ? 67  GLU B CB  1 
ATOM   1786  C CG  . GLU B 1 67  ? 69.081  19.958 112.710 1.00 99.12  ? 67  GLU B CG  1 
ATOM   1787  C CD  . GLU B 1 67  ? 68.208  18.928 113.405 1.00 99.12  ? 67  GLU B CD  1 
ATOM   1788  O OE1 . GLU B 1 67  ? 67.923  19.105 114.611 1.00 99.12  ? 67  GLU B OE1 1 
ATOM   1789  O OE2 . GLU B 1 67  ? 67.810  17.941 112.744 1.00 99.12  ? 67  GLU B OE2 1 
ATOM   1790  N N   . GLY B 1 68  ? 72.670  22.132 114.407 1.00 45.62  ? 68  GLY B N   1 
ATOM   1791  C CA  . GLY B 1 68  ? 73.870  22.378 115.183 1.00 45.62  ? 68  GLY B CA  1 
ATOM   1792  C C   . GLY B 1 68  ? 74.682  21.167 115.605 1.00 45.62  ? 68  GLY B C   1 
ATOM   1793  O O   . GLY B 1 68  ? 75.858  21.036 115.255 1.00 45.62  ? 68  GLY B O   1 
ATOM   1794  N N   . HIS B 1 69  ? 74.062  20.268 116.354 1.00 41.89  ? 69  HIS B N   1 
ATOM   1795  C CA  . HIS B 1 69  ? 74.768  19.093 116.828 1.00 41.89  ? 69  HIS B CA  1 
ATOM   1796  C C   . HIS B 1 69  ? 75.345  18.274 115.702 1.00 41.89  ? 69  HIS B C   1 
ATOM   1797  O O   . HIS B 1 69  ? 76.271  17.503 115.911 1.00 41.89  ? 69  HIS B O   1 
ATOM   1798  C CB  . HIS B 1 69  ? 73.856  18.228 117.684 1.00 63.06  ? 69  HIS B CB  1 
ATOM   1799  C CG  . HIS B 1 69  ? 72.744  17.598 116.921 1.00 63.06  ? 69  HIS B CG  1 
ATOM   1800  N ND1 . HIS B 1 69  ? 71.702  18.325 116.395 1.00 63.06  ? 69  HIS B ND1 1 
ATOM   1801  C CD2 . HIS B 1 69  ? 72.517  16.308 116.580 1.00 63.06  ? 69  HIS B CD2 1 
ATOM   1802  C CE1 . HIS B 1 69  ? 70.877  17.509 115.762 1.00 63.06  ? 69  HIS B CE1 1 
ATOM   1803  N NE2 . HIS B 1 69  ? 71.350  16.280 115.859 1.00 63.06  ? 69  HIS B NE2 1 
ATOM   1804  N N   . ARG B 1 70  ? 74.816  18.422 114.498 1.00 60.16  ? 70  ARG B N   1 
ATOM   1805  C CA  . ARG B 1 70  ? 75.364  17.660 113.378 1.00 60.16  ? 70  ARG B CA  1 
ATOM   1806  C C   . ARG B 1 70  ? 76.733  18.229 113.059 1.00 60.16  ? 70  ARG B C   1 
ATOM   1807  O O   . ARG B 1 70  ? 77.739  17.514 113.093 1.00 60.16  ? 70  ARG B O   1 
ATOM   1808  C CB  . ARG B 1 70  ? 74.470  17.777 112.140 1.00 70.57  ? 70  ARG B CB  1 
ATOM   1809  C CG  . ARG B 1 70  ? 73.127  17.117 112.293 1.00 70.57  ? 70  ARG B CG  1 
ATOM   1810  C CD  . ARG B 1 70  ? 73.179  15.632 111.974 1.00 70.57  ? 70  ARG B CD  1 
ATOM   1811  N NE  . ARG B 1 70  ? 71.974  14.947 112.443 1.00 70.57  ? 70  ARG B NE  1 
ATOM   1812  C CZ  . ARG B 1 70  ? 70.728  15.326 112.163 1.00 70.57  ? 70  ARG B CZ  1 
ATOM   1813  N NH1 . ARG B 1 70  ? 70.499  16.391 111.400 1.00 70.57  ? 70  ARG B NH1 1 
ATOM   1814  N NH2 . ARG B 1 70  ? 69.704  14.660 112.681 1.00 70.57  ? 70  ARG B NH2 1 
ATOM   1815  N N   . VAL B 1 71  ? 76.759  19.529 112.759 1.00 59.30  ? 71  VAL B N   1 
ATOM   1816  C CA  . VAL B 1 71  ? 77.995  20.221 112.419 1.00 59.30  ? 71  VAL B CA  1 
ATOM   1817  C C   . VAL B 1 71  ? 79.060  19.982 113.477 1.00 59.30  ? 71  VAL B C   1 
ATOM   1818  O O   . VAL B 1 71  ? 80.223  19.783 113.154 1.00 59.30  ? 71  VAL B O   1 
ATOM   1819  C CB  . VAL B 1 71  ? 77.755  21.734 112.265 1.00 50.88  ? 71  VAL B CB  1 
ATOM   1820  C CG1 . VAL B 1 71  ? 79.060  22.445 111.971 1.00 50.88  ? 71  VAL B CG1 1 
ATOM   1821  C CG2 . VAL B 1 71  ? 76.759  21.978 111.135 1.00 50.88  ? 71  VAL B CG2 1 
ATOM   1822  N N   . ILE B 1 72  ? 78.659  19.996 114.741 1.00 39.50  ? 72  ILE B N   1 
ATOM   1823  C CA  . ILE B 1 72  ? 79.592  19.765 115.828 1.00 39.50  ? 72  ILE B CA  1 
ATOM   1824  C C   . ILE B 1 72  ? 80.210  18.395 115.679 1.00 39.50  ? 72  ILE B C   1 
ATOM   1825  O O   . ILE B 1 72  ? 81.443  18.275 115.614 1.00 39.50  ? 72  ILE B O   1 
ATOM   1826  C CB  . ILE B 1 72  ? 78.910  19.908 117.218 1.00 39.33  ? 72  ILE B CB  1 
ATOM   1827  C CG1 . ILE B 1 72  ? 78.692  21.389 117.522 1.00 39.33  ? 72  ILE B CG1 1 
ATOM   1828  C CG2 . ILE B 1 72  ? 79.766  19.315 118.311 1.00 39.33  ? 72  ILE B CG2 1 
ATOM   1829  C CD1 . ILE B 1 72  ? 78.088  21.631 118.888 1.00 39.33  ? 72  ILE B CD1 1 
ATOM   1830  N N   . ASN B 1 73  ? 79.385  17.357 115.588 1.00 34.36  ? 73  ASN B N   1 
ATOM   1831  C CA  . ASN B 1 73  ? 79.943  16.012 115.435 1.00 34.36  ? 73  ASN B CA  1 
ATOM   1832  C C   . ASN B 1 73  ? 80.757  15.863 114.169 1.00 34.36  ? 73  ASN B C   1 
ATOM   1833  O O   . ASN B 1 73  ? 81.788  15.196 114.171 1.00 34.36  ? 73  ASN B O   1 
ATOM   1834  C CB  . ASN B 1 73  ? 78.852  14.961 115.488 1.00 44.61  ? 73  ASN B CB  1 
ATOM   1835  C CG  . ASN B 1 73  ? 78.369  14.719 116.897 1.00 44.61  ? 73  ASN B CG  1 
ATOM   1836  O OD1 . ASN B 1 73  ? 79.172  14.616 117.829 1.00 44.61  ? 73  ASN B OD1 1 
ATOM   1837  N ND2 . ASN B 1 73  ? 77.056  14.622 117.068 1.00 44.61  ? 73  ASN B ND2 1 
ATOM   1838  N N   . LEU B 1 74  ? 80.311  16.492 113.086 1.00 43.12  ? 74  LEU B N   1 
ATOM   1839  C CA  . LEU B 1 74  ? 81.050  16.428 111.833 1.00 43.12  ? 74  LEU B CA  1 
ATOM   1840  C C   . LEU B 1 74  ? 82.475  16.914 112.050 1.00 43.12  ? 74  LEU B C   1 
ATOM   1841  O O   . LEU B 1 74  ? 83.428  16.292 111.589 1.00 43.12  ? 74  LEU B O   1 
ATOM   1842  C CB  . LEU B 1 74  ? 80.372  17.297 110.782 1.00 45.28  ? 74  LEU B CB  1 
ATOM   1843  C CG  . LEU B 1 74  ? 79.349  16.601 109.876 1.00 45.28  ? 74  LEU B CG  1 
ATOM   1844  C CD1 . LEU B 1 74  ? 78.736  17.607 108.929 1.00 45.28  ? 74  LEU B CD1 1 
ATOM   1845  C CD2 . LEU B 1 74  ? 80.036  15.494 109.089 1.00 45.28  ? 74  LEU B CD2 1 
ATOM   1846  N N   . ALA B 1 75  ? 82.603  18.024 112.775 1.00 41.25  ? 75  ALA B N   1 
ATOM   1847  C CA  . ALA B 1 75  ? 83.888  18.632 113.079 1.00 41.25  ? 75  ALA B CA  1 
ATOM   1848  C C   . ALA B 1 75  ? 84.715  17.779 114.021 1.00 41.25  ? 75  ALA B C   1 
ATOM   1849  O O   . ALA B 1 75  ? 85.919  17.604 113.807 1.00 41.25  ? 75  ALA B O   1 
ATOM   1850  C CB  . ALA B 1 75  ? 83.678  20.011 113.682 1.00 39.07  ? 75  ALA B CB  1 
ATOM   1851  N N   . ASN B 1 76  ? 84.089  17.250 115.067 1.00 36.73  ? 76  ASN B N   1 
ATOM   1852  C CA  . ASN B 1 76  ? 84.852  16.428 116.001 1.00 36.73  ? 76  ASN B CA  1 
ATOM   1853  C C   . ASN B 1 76  ? 85.424  15.237 115.264 1.00 36.73  ? 76  ASN B C   1 
ATOM   1854  O O   . ASN B 1 76  ? 86.485  14.745 115.620 1.00 36.73  ? 76  ASN B O   1 
ATOM   1855  C CB  . ASN B 1 76  ? 84.003  15.951 117.184 1.00 52.75  ? 76  ASN B CB  1 
ATOM   1856  C CG  . ASN B 1 76  ? 83.656  17.072 118.151 1.00 52.75  ? 76  ASN B CG  1 
ATOM   1857  O OD1 . ASN B 1 76  ? 84.527  17.804 118.635 1.00 52.75  ? 76  ASN B OD1 1 
ATOM   1858  N ND2 . ASN B 1 76  ? 82.374  17.203 118.444 1.00 52.75  ? 76  ASN B ND2 1 
ATOM   1859  N N   . GLU B 1 77  ? 84.744  14.770 114.223 1.00 34.57  ? 77  GLU B N   1 
ATOM   1860  C CA  . GLU B 1 77  ? 85.280  13.645 113.469 1.00 34.57  ? 77  GLU B CA  1 
ATOM   1861  C C   . GLU B 1 77  ? 86.348  14.074 112.469 1.00 34.57  ? 77  GLU B C   1 
ATOM   1862  O O   . GLU B 1 77  ? 87.361  13.409 112.334 1.00 34.57  ? 77  GLU B O   1 
ATOM   1863  C CB  . GLU B 1 77  ? 84.169  12.906 112.743 1.00 64.23  ? 77  GLU B CB  1 
ATOM   1864  C CG  . GLU B 1 77  ? 83.302  12.064 113.658 1.00 64.23  ? 77  GLU B CG  1 
ATOM   1865  C CD  . GLU B 1 77  ? 84.128  11.214 114.601 1.00 64.23  ? 77  GLU B CD  1 
ATOM   1866  O OE1 . GLU B 1 77  ? 85.181  10.704 114.165 1.00 64.23  ? 77  GLU B OE1 1 
ATOM   1867  O OE2 . GLU B 1 77  ? 83.721  11.055 115.771 1.00 64.23  ? 77  GLU B OE2 1 
ATOM   1868  N N   . MET B 1 78  ? 86.141  15.187 111.768 1.00 32.52  ? 78  MET B N   1 
ATOM   1869  C CA  . MET B 1 78  ? 87.131  15.638 110.804 1.00 32.52  ? 78  MET B CA  1 
ATOM   1870  C C   . MET B 1 78  ? 88.450  16.038 111.463 1.00 32.52  ? 78  MET B C   1 
ATOM   1871  O O   . MET B 1 78  ? 89.536  15.749 110.929 1.00 32.52  ? 78  MET B O   1 
ATOM   1872  C CB  . MET B 1 78  ? 86.605  16.831 110.022 1.00 58.14  ? 78  MET B CB  1 
ATOM   1873  C CG  . MET B 1 78  ? 85.831  16.475 108.772 1.00 58.14  ? 78  MET B CG  1 
ATOM   1874  S SD  . MET B 1 78  ? 86.806  15.629 107.489 1.00 58.14  ? 78  MET B SD  1 
ATOM   1875  C CE  . MET B 1 78  ? 88.201  16.621 107.454 1.00 58.14  ? 78  MET B CE  1 
ATOM   1876  N N   . PHE B 1 79  ? 88.347  16.690 112.628 1.00 31.80  ? 79  PHE B N   1 
ATOM   1877  C CA  . PHE B 1 79  ? 89.524  17.201 113.319 1.00 31.80  ? 79  PHE B CA  1 
ATOM   1878  C C   . PHE B 1 79  ? 89.914  16.628 114.674 1.00 31.80  ? 79  PHE B C   1 
ATOM   1879  O O   . PHE B 1 79  ? 90.997  16.920 115.155 1.00 31.80  ? 79  PHE B O   1 
ATOM   1880  C CB  . PHE B 1 79  ? 89.390  18.712 113.490 1.00 29.41  ? 79  PHE B CB  1 
ATOM   1881  C CG  . PHE B 1 79  ? 88.944  19.433 112.246 1.00 29.41  ? 79  PHE B CG  1 
ATOM   1882  C CD1 . PHE B 1 79  ? 87.696  20.054 112.207 1.00 29.41  ? 79  PHE B CD1 1 
ATOM   1883  C CD2 . PHE B 1 79  ? 89.783  19.533 111.125 1.00 29.41  ? 79  PHE B CD2 1 
ATOM   1884  C CE1 . PHE B 1 79  ? 87.291  20.772 111.074 1.00 29.41  ? 79  PHE B CE1 1 
ATOM   1885  C CE2 . PHE B 1 79  ? 89.387  20.251 109.981 1.00 29.41  ? 79  PHE B CE2 1 
ATOM   1886  C CZ  . PHE B 1 79  ? 88.150  20.869 109.957 1.00 29.41  ? 79  PHE B CZ  1 
ATOM   1887  N N   . GLY B 1 80  ? 89.049  15.830 115.288 1.00 39.55  ? 80  GLY B N   1 
ATOM   1888  C CA  . GLY B 1 80  ? 89.368  15.295 116.596 1.00 39.55  ? 80  GLY B CA  1 
ATOM   1889  C C   . GLY B 1 80  ? 88.781  16.262 117.601 1.00 39.55  ? 80  GLY B C   1 
ATOM   1890  O O   . GLY B 1 80  ? 88.720  17.461 117.341 1.00 39.55  ? 80  GLY B O   1 
ATOM   1891  N N   . TYR B 1 81  ? 88.337  15.768 118.744 1.00 49.52  ? 81  TYR B N   1 
ATOM   1892  C CA  . TYR B 1 81  ? 87.750  16.649 119.748 1.00 49.52  ? 81  TYR B CA  1 
ATOM   1893  C C   . TYR B 1 81  ? 88.667  17.836 120.107 1.00 49.52  ? 81  TYR B C   1 
ATOM   1894  O O   . TYR B 1 81  ? 88.198  18.897 120.526 1.00 49.52  ? 81  TYR B O   1 
ATOM   1895  C CB  . TYR B 1 81  ? 87.425  15.839 121.002 1.00 45.84  ? 81  TYR B CB  1 
ATOM   1896  C CG  . TYR B 1 81  ? 88.653  15.348 121.744 1.00 45.84  ? 81  TYR B CG  1 
ATOM   1897  C CD1 . TYR B 1 81  ? 89.272  16.148 122.700 1.00 45.84  ? 81  TYR B CD1 1 
ATOM   1898  C CD2 . TYR B 1 81  ? 89.196  14.087 121.485 1.00 45.84  ? 81  TYR B CD2 1 
ATOM   1899  C CE1 . TYR B 1 81  ? 90.396  15.718 123.392 1.00 45.84  ? 81  TYR B CE1 1 
ATOM   1900  C CE2 . TYR B 1 81  ? 90.327  13.645 122.168 1.00 45.84  ? 81  TYR B CE2 1 
ATOM   1901  C CZ  . TYR B 1 81  ? 90.920  14.471 123.128 1.00 45.84  ? 81  TYR B CZ  1 
ATOM   1902  O OH  . TYR B 1 81  ? 92.019  14.038 123.839 1.00 45.84  ? 81  TYR B OH  1 
ATOM   1903  N N   . ASN B 1 82  ? 89.967  17.652 119.918 1.00 33.64  ? 82  ASN B N   1 
ATOM   1904  C CA  . ASN B 1 82  ? 90.950  18.676 120.243 1.00 33.64  ? 82  ASN B CA  1 
ATOM   1905  C C   . ASN B 1 82  ? 91.682  19.204 119.013 1.00 33.64  ? 82  ASN B C   1 
ATOM   1906  O O   . ASN B 1 82  ? 92.794  19.721 119.131 1.00 33.64  ? 82  ASN B O   1 
ATOM   1907  C CB  . ASN B 1 82  ? 91.987  18.101 121.212 1.00 37.49  ? 82  ASN B CB  1 
ATOM   1908  C CG  . ASN B 1 82  ? 92.930  17.106 120.531 1.00 37.49  ? 82  ASN B CG  1 
ATOM   1909  O OD1 . ASN B 1 82  ? 92.526  16.385 119.611 1.00 37.49  ? 82  ASN B OD1 1 
ATOM   1910  N ND2 . ASN B 1 82  ? 94.188  17.064 120.978 1.00 37.49  ? 82  ASN B ND2 1 
ATOM   1911  N N   . GLY B 1 83  ? 91.079  19.074 117.836 1.00 36.09  ? 83  GLY B N   1 
ATOM   1912  C CA  . GLY B 1 83  ? 91.736  19.547 116.625 1.00 36.09  ? 83  GLY B CA  1 
ATOM   1913  C C   . GLY B 1 83  ? 91.165  20.856 116.131 1.00 36.09  ? 83  GLY B C   1 
ATOM   1914  O O   . GLY B 1 83  ? 91.716  21.523 115.271 1.00 36.09  ? 83  GLY B O   1 
ATOM   1915  N N   . TRP B 1 84  ? 90.037  21.240 116.694 1.00 33.76  ? 84  TRP B N   1 
ATOM   1916  C CA  . TRP B 1 84  ? 89.413  22.475 116.287 1.00 33.76  ? 84  TRP B CA  1 
ATOM   1917  C C   . TRP B 1 84  ? 88.886  23.186 117.512 1.00 33.76  ? 84  TRP B C   1 
ATOM   1918  O O   . TRP B 1 84  ? 88.640  22.564 118.544 1.00 33.76  ? 84  TRP B O   1 
ATOM   1919  C CB  . TRP B 1 84  ? 88.263  22.197 115.326 1.00 34.58  ? 84  TRP B CB  1 
ATOM   1920  C CG  . TRP B 1 84  ? 87.075  21.587 115.992 1.00 34.58  ? 84  TRP B CG  1 
ATOM   1921  C CD1 . TRP B 1 84  ? 86.949  20.302 116.442 1.00 34.58  ? 84  TRP B CD1 1 
ATOM   1922  C CD2 . TRP B 1 84  ? 85.852  22.242 116.299 1.00 34.58  ? 84  TRP B CD2 1 
ATOM   1923  N NE1 . TRP B 1 84  ? 85.716  20.120 117.011 1.00 34.58  ? 84  TRP B NE1 1 
ATOM   1924  C CE2 . TRP B 1 84  ? 85.022  21.298 116.936 1.00 34.58  ? 84  TRP B CE2 1 
ATOM   1925  C CE3 . TRP B 1 84  ? 85.373  23.539 116.098 1.00 34.58  ? 84  TRP B CE3 1 
ATOM   1926  C CZ2 . TRP B 1 84  ? 83.735  21.611 117.376 1.00 34.58  ? 84  TRP B CZ2 1 
ATOM   1927  C CZ3 . TRP B 1 84  ? 84.091  23.854 116.534 1.00 34.58  ? 84  TRP B CZ3 1 
ATOM   1928  C CH2 . TRP B 1 84  ? 83.287  22.890 117.167 1.00 34.58  ? 84  TRP B CH2 1 
ATOM   1929  N N   . ALA B 1 85  ? 88.696  24.494 117.387 1.00 44.75  ? 85  ALA B N   1 
ATOM   1930  C CA  . ALA B 1 85  ? 88.219  25.290 118.503 1.00 44.75  ? 85  ALA B CA  1 
ATOM   1931  C C   . ALA B 1 85  ? 87.475  26.480 117.973 1.00 44.75  ? 85  ALA B C   1 
ATOM   1932  O O   . ALA B 1 85  ? 87.625  26.846 116.805 1.00 44.75  ? 85  ALA B O   1 
ATOM   1933  C CB  . ALA B 1 85  ? 89.403  25.758 119.351 1.00 30.40  ? 85  ALA B CB  1 
ATOM   1934  N N   . HIS B 1 86  ? 86.662  27.086 118.823 1.00 31.71  ? 86  HIS B N   1 
ATOM   1935  C CA  . HIS B 1 86  ? 85.937  28.265 118.394 1.00 31.71  ? 86  HIS B CA  1 
ATOM   1936  C C   . HIS B 1 86  ? 85.724  29.193 119.562 1.00 31.71  ? 86  HIS B C   1 
ATOM   1937  O O   . HIS B 1 86  ? 85.708  28.767 120.709 1.00 31.71  ? 86  HIS B O   1 
ATOM   1938  C CB  . HIS B 1 86  ? 84.585  27.905 117.752 1.00 37.00  ? 86  HIS B CB  1 
ATOM   1939  C CG  . HIS B 1 86  ? 83.551  27.414 118.718 1.00 37.00  ? 86  HIS B CG  1 
ATOM   1940  N ND1 . HIS B 1 86  ? 82.336  28.036 118.886 1.00 37.00  ? 86  HIS B ND1 1 
ATOM   1941  C CD2 . HIS B 1 86  ? 83.538  26.343 119.544 1.00 37.00  ? 86  HIS B CD2 1 
ATOM   1942  C CE1 . HIS B 1 86  ? 81.617  27.370 119.773 1.00 37.00  ? 86  HIS B CE1 1 
ATOM   1943  N NE2 . HIS B 1 86  ? 82.326  26.336 120.188 1.00 37.00  ? 86  HIS B NE2 1 
ATOM   1944  N N   . SER B 1 87  ? 85.584  30.475 119.265 1.00 23.93  ? 87  SER B N   1 
ATOM   1945  C CA  . SER B 1 87  ? 85.340  31.453 120.303 1.00 23.93  ? 87  SER B CA  1 
ATOM   1946  C C   . SER B 1 87  ? 84.390  32.496 119.754 1.00 23.93  ? 87  SER B C   1 
ATOM   1947  O O   . SER B 1 87  ? 84.225  32.633 118.548 1.00 23.93  ? 87  SER B O   1 
ATOM   1948  C CB  . SER B 1 87  ? 86.646  32.111 120.726 1.00 27.48  ? 87  SER B CB  1 
ATOM   1949  O OG  . SER B 1 87  ? 87.249  32.756 119.626 1.00 27.48  ? 87  SER B OG  1 
ATOM   1950  N N   . ILE B 1 88  ? 83.754  33.229 120.649 1.00 47.20  ? 88  ILE B N   1 
ATOM   1951  C CA  . ILE B 1 88  ? 82.844  34.259 120.220 1.00 47.20  ? 88  ILE B CA  1 
ATOM   1952  C C   . ILE B 1 88  ? 83.622  35.552 120.268 1.00 47.20  ? 88  ILE B C   1 
ATOM   1953  O O   . ILE B 1 88  ? 83.966  36.033 121.340 1.00 47.20  ? 88  ILE B O   1 
ATOM   1954  C CB  . ILE B 1 88  ? 81.626  34.331 121.146 1.00 33.87  ? 88  ILE B CB  1 
ATOM   1955  C CG1 . ILE B 1 88  ? 80.882  32.984 121.114 1.00 33.87  ? 88  ILE B CG1 1 
ATOM   1956  C CG2 . ILE B 1 88  ? 80.719  35.450 120.715 1.00 33.87  ? 88  ILE B CG2 1 
ATOM   1957  C CD1 . ILE B 1 88  ? 79.844  32.791 122.207 1.00 33.87  ? 88  ILE B CD1 1 
ATOM   1958  N N   . THR B 1 89  ? 83.930  36.097 119.099 1.00 35.70  ? 89  THR B N   1 
ATOM   1959  C CA  . THR B 1 89  ? 84.658  37.348 119.024 1.00 35.70  ? 89  THR B CA  1 
ATOM   1960  C C   . THR B 1 89  ? 83.818  38.487 119.578 1.00 35.70  ? 89  THR B C   1 
ATOM   1961  O O   . THR B 1 89  ? 84.326  39.364 120.279 1.00 35.70  ? 89  THR B O   1 
ATOM   1962  C CB  . THR B 1 89  ? 85.046  37.702 117.590 1.00 34.50  ? 89  THR B CB  1 
ATOM   1963  O OG1 . THR B 1 89  ? 85.920  36.696 117.075 1.00 34.50  ? 89  THR B OG1 1 
ATOM   1964  C CG2 . THR B 1 89  ? 85.796  39.018 117.574 1.00 34.50  ? 89  THR B CG2 1 
ATOM   1965  N N   . GLN B 1 90  ? 82.536  38.481 119.244 1.00 36.56  ? 90  GLN B N   1 
ATOM   1966  C CA  . GLN B 1 90  ? 81.641  39.498 119.747 1.00 36.56  ? 90  GLN B CA  1 
ATOM   1967  C C   . GLN B 1 90  ? 80.186  39.179 119.497 1.00 36.56  ? 90  GLN B C   1 
ATOM   1968  O O   . GLN B 1 90  ? 79.846  38.539 118.487 1.00 36.56  ? 90  GLN B O   1 
ATOM   1969  C CB  . GLN B 1 90  ? 81.940  40.835 119.110 1.00 69.39  ? 90  GLN B CB  1 
ATOM   1970  C CG  . GLN B 1 90  ? 80.966  41.856 119.572 1.00 69.39  ? 90  GLN B CG  1 
ATOM   1971  C CD  . GLN B 1 90  ? 81.308  43.222 119.105 1.00 69.39  ? 90  GLN B CD  1 
ATOM   1972  O OE1 . GLN B 1 90  ? 81.198  43.529 117.924 1.00 69.39  ? 90  GLN B OE1 1 
ATOM   1973  N NE2 . GLN B 1 90  ? 81.736  44.068 120.032 1.00 69.39  ? 90  GLN B NE2 1 
ATOM   1974  N N   . GLN B 1 91  ? 79.322  39.591 120.423 1.00 35.26  ? 91  GLN B N   1 
ATOM   1975  C CA  . GLN B 1 91  ? 77.899  39.374 120.206 1.00 35.26  ? 91  GLN B CA  1 
ATOM   1976  C C   . GLN B 1 91  ? 77.218  40.685 120.472 1.00 35.26  ? 91  GLN B C   1 
ATOM   1977  O O   . GLN B 1 91  ? 77.398  41.290 121.529 1.00 35.26  ? 91  GLN B O   1 
ATOM   1978  C CB  . GLN B 1 91  ? 77.306  38.282 121.111 1.00 43.55  ? 91  GLN B CB  1 
ATOM   1979  C CG  . GLN B 1 91  ? 75.768  38.194 121.008 1.00 43.55  ? 91  GLN B CG  1 
ATOM   1980  C CD  . GLN B 1 91  ? 75.167  36.942 121.655 1.00 43.55  ? 91  GLN B CD  1 
ATOM   1981  O OE1 . GLN B 1 91  ? 74.889  35.946 120.990 1.00 43.55  ? 91  GLN B OE1 1 
ATOM   1982  N NE2 . GLN B 1 91  ? 74.967  36.998 122.951 1.00 43.55  ? 91  GLN B NE2 1 
ATOM   1983  N N   . ASN B 1 92  ? 76.451  41.147 119.493 1.00 43.14  ? 92  ASN B N   1 
ATOM   1984  C CA  . ASN B 1 92  ? 75.738  42.399 119.646 1.00 43.14  ? 92  ASN B CA  1 
ATOM   1985  C C   . ASN B 1 92  ? 74.229  42.243 119.421 1.00 43.14  ? 92  ASN B C   1 
ATOM   1986  O O   . ASN B 1 92  ? 73.788  41.712 118.396 1.00 43.14  ? 92  ASN B O   1 
ATOM   1987  C CB  . ASN B 1 92  ? 76.298  43.443 118.688 1.00 91.11  ? 92  ASN B CB  1 
ATOM   1988  C CG  . ASN B 1 92  ? 75.667  44.794 118.896 1.00 91.11  ? 92  ASN B CG  1 
ATOM   1989  O OD1 . ASN B 1 92  ? 75.858  45.429 119.936 1.00 91.11  ? 92  ASN B OD1 1 
ATOM   1990  N ND2 . ASN B 1 92  ? 74.887  45.240 117.918 1.00 91.11  ? 92  ASN B ND2 1 
ATOM   1991  N N   . VAL B 1 93  ? 73.448  42.689 120.406 1.00 39.04  ? 93  VAL B N   1 
ATOM   1992  C CA  . VAL B 1 93  ? 71.994  42.641 120.320 1.00 39.04  ? 93  VAL B CA  1 
ATOM   1993  C C   . VAL B 1 93  ? 71.589  43.847 119.466 1.00 39.04  ? 93  VAL B C   1 
ATOM   1994  O O   . VAL B 1 93  ? 71.709  44.986 119.896 1.00 39.04  ? 93  VAL B O   1 
ATOM   1995  C CB  . VAL B 1 93  ? 71.343  42.766 121.712 1.00 37.71  ? 93  VAL B CB  1 
ATOM   1996  C CG1 . VAL B 1 93  ? 69.818  42.819 121.561 1.00 37.71  ? 93  VAL B CG1 1 
ATOM   1997  C CG2 . VAL B 1 93  ? 71.753  41.586 122.592 1.00 37.71  ? 93  VAL B CG2 1 
ATOM   1998  N N   . ASP B 1 94  ? 71.125  43.590 118.252 1.00 39.56  ? 94  ASP B N   1 
ATOM   1999  C CA  . ASP B 1 94  ? 70.756  44.671 117.347 1.00 39.56  ? 94  ASP B CA  1 
ATOM   2000  C C   . ASP B 1 94  ? 69.553  45.472 117.788 1.00 39.56  ? 94  ASP B C   1 
ATOM   2001  O O   . ASP B 1 94  ? 69.521  46.677 117.630 1.00 39.56  ? 94  ASP B O   1 
ATOM   2002  C CB  . ASP B 1 94  ? 70.495  44.136 115.928 1.00 53.69  ? 94  ASP B CB  1 
ATOM   2003  C CG  . ASP B 1 94  ? 71.774  43.941 115.129 1.00 53.69  ? 94  ASP B CG  1 
ATOM   2004  O OD1 . ASP B 1 94  ? 72.788  44.586 115.491 1.00 53.69  ? 94  ASP B OD1 1 
ATOM   2005  O OD2 . ASP B 1 94  ? 71.759  43.165 114.135 1.00 53.69  ? 94  ASP B OD2 1 
ATOM   2006  N N   . PHE B 1 95  ? 68.548  44.807 118.325 1.00 64.76  ? 95  PHE B N   1 
ATOM   2007  C CA  . PHE B 1 95  ? 67.366  45.529 118.734 1.00 64.76  ? 95  PHE B CA  1 
ATOM   2008  C C   . PHE B 1 95  ? 66.443  44.642 119.525 1.00 64.76  ? 95  PHE B C   1 
ATOM   2009  O O   . PHE B 1 95  ? 66.510  43.418 119.428 1.00 64.76  ? 95  PHE B O   1 
ATOM   2010  C CB  . PHE B 1 95  ? 66.641  46.063 117.494 1.00 48.18  ? 95  PHE B CB  1 
ATOM   2011  C CG  . PHE B 1 95  ? 66.138  44.987 116.561 1.00 48.18  ? 95  PHE B CG  1 
ATOM   2012  C CD1 . PHE B 1 95  ? 64.947  44.308 116.824 1.00 48.18  ? 95  PHE B CD1 1 
ATOM   2013  C CD2 . PHE B 1 95  ? 66.849  44.649 115.423 1.00 48.18  ? 95  PHE B CD2 1 
ATOM   2014  C CE1 . PHE B 1 95  ? 64.476  43.303 115.955 1.00 48.18  ? 95  PHE B CE1 1 
ATOM   2015  C CE2 . PHE B 1 95  ? 66.388  43.649 114.550 1.00 48.18  ? 95  PHE B CE2 1 
ATOM   2016  C CZ  . PHE B 1 95  ? 65.204  42.978 114.818 1.00 48.18  ? 95  PHE B CZ  1 
ATOM   2017  N N   . VAL B 1 96  ? 65.590  45.273 120.320 1.00 71.71  ? 96  VAL B N   1 
ATOM   2018  C CA  . VAL B 1 96  ? 64.602  44.567 121.118 1.00 71.71  ? 96  VAL B CA  1 
ATOM   2019  C C   . VAL B 1 96  ? 63.360  45.428 121.061 1.00 71.71  ? 96  VAL B C   1 
ATOM   2020  O O   . VAL B 1 96  ? 63.194  46.347 121.865 1.00 71.71  ? 96  VAL B O   1 
ATOM   2021  C CB  . VAL B 1 96  ? 65.041  44.410 122.581 1.00 45.20  ? 96  VAL B CB  1 
ATOM   2022  C CG1 . VAL B 1 96  ? 63.949  43.712 123.352 1.00 45.20  ? 96  VAL B CG1 1 
ATOM   2023  C CG2 . VAL B 1 96  ? 66.300  43.584 122.662 1.00 45.20  ? 96  VAL B CG2 1 
ATOM   2024  N N   . ASP B 1 97  ? 62.501  45.143 120.091 1.00 79.48  ? 97  ASP B N   1 
ATOM   2025  C CA  . ASP B 1 97  ? 61.287  45.920 119.923 1.00 79.48  ? 97  ASP B CA  1 
ATOM   2026  C C   . ASP B 1 97  ? 60.053  45.247 120.477 1.00 79.48  ? 97  ASP B C   1 
ATOM   2027  O O   . ASP B 1 97  ? 59.961  44.019 120.513 1.00 79.48  ? 97  ASP B O   1 
ATOM   2028  C CB  . ASP B 1 97  ? 61.059  46.248 118.449 1.00 71.98  ? 97  ASP B CB  1 
ATOM   2029  C CG  . ASP B 1 97  ? 62.180  47.077 117.859 1.00 71.98  ? 97  ASP B CG  1 
ATOM   2030  O OD1 . ASP B 1 97  ? 62.747  47.944 118.571 1.00 71.98  ? 97  ASP B OD1 1 
ATOM   2031  O OD2 . ASP B 1 97  ? 62.481  46.862 116.669 1.00 71.98  ? 97  ASP B OD2 1 
ATOM   2032  N N   . LEU B 1 98  ? 59.103  46.077 120.901 1.00 85.80  ? 98  LEU B N   1 
ATOM   2033  C CA  . LEU B 1 98  ? 57.851  45.608 121.470 1.00 85.80  ? 98  LEU B CA  1 
ATOM   2034  C C   . LEU B 1 98  ? 56.641  46.118 120.695 1.00 85.80  ? 98  LEU B C   1 
ATOM   2035  O O   . LEU B 1 98  ? 56.343  47.304 120.726 1.00 85.80  ? 98  LEU B O   1 
ATOM   2036  C CB  . LEU B 1 98  ? 57.749  46.056 122.925 1.00 80.20  ? 98  LEU B CB  1 
ATOM   2037  C CG  . LEU B 1 98  ? 56.484  45.631 123.668 1.00 80.20  ? 98  LEU B CG  1 
ATOM   2038  C CD1 . LEU B 1 98  ? 56.254  44.133 123.490 1.00 80.20  ? 98  LEU B CD1 1 
ATOM   2039  C CD2 . LEU B 1 98  ? 56.617  45.984 125.138 1.00 80.20  ? 98  LEU B CD2 1 
ATOM   2040  N N   . ASN B 1 99  ? 55.957  45.215 119.997 1.00 87.43  ? 99  ASN B N   1 
ATOM   2041  C CA  . ASN B 1 99  ? 54.762  45.541 119.220 1.00 87.43  ? 99  ASN B CA  1 
ATOM   2042  C C   . ASN B 1 99  ? 53.591  44.780 119.824 1.00 87.43  ? 99  ASN B C   1 
ATOM   2043  O O   . ASN B 1 99  ? 53.441  43.572 119.615 1.00 87.43  ? 99  ASN B O   1 
ATOM   2044  C CB  . ASN B 1 99  ? 54.937  45.133 117.757 1.00 143.03 ? 99  ASN B CB  1 
ATOM   2045  C CG  . ASN B 1 99  ? 55.948  45.994 117.032 1.00 143.03 ? 99  ASN B CG  1 
ATOM   2046  O OD1 . ASN B 1 99  ? 55.829  47.217 117.018 1.00 143.03 ? 99  ASN B OD1 1 
ATOM   2047  N ND2 . ASN B 1 99  ? 56.948  45.362 116.423 1.00 143.03 ? 99  ASN B ND2 1 
ATOM   2048  N N   . ASN B 1 100 ? 52.766  45.501 120.575 1.00 102.95 ? 100 ASN B N   1 
ATOM   2049  C CA  . ASN B 1 100 ? 51.604  44.935 121.250 1.00 102.95 ? 100 ASN B CA  1 
ATOM   2050  C C   . ASN B 1 100 ? 51.873  43.613 121.971 1.00 102.95 ? 100 ASN B C   1 
ATOM   2051  O O   . ASN B 1 100 ? 51.482  42.544 121.506 1.00 102.95 ? 100 ASN B O   1 
ATOM   2052  C CB  . ASN B 1 100 ? 50.428  44.772 120.270 1.00 173.14 ? 100 ASN B CB  1 
ATOM   2053  C CG  . ASN B 1 100 ? 50.760  43.885 119.085 1.00 173.14 ? 100 ASN B CG  1 
ATOM   2054  O OD1 . ASN B 1 100 ? 51.561  44.248 118.224 1.00 173.14 ? 100 ASN B OD1 1 
ATOM   2055  N ND2 . ASN B 1 100 ? 50.138  42.714 119.034 1.00 173.14 ? 100 ASN B ND2 1 
ATOM   2056  N N   . GLY B 1 101 ? 52.548  43.702 123.112 1.00 79.96  ? 101 GLY B N   1 
ATOM   2057  C CA  . GLY B 1 101 ? 52.835  42.520 123.907 1.00 79.96  ? 101 GLY B CA  1 
ATOM   2058  C C   . GLY B 1 101 ? 53.736  41.445 123.321 1.00 79.96  ? 101 GLY B C   1 
ATOM   2059  O O   . GLY B 1 101 ? 54.022  40.453 123.994 1.00 79.96  ? 101 GLY B O   1 
ATOM   2060  N N   . LYS B 1 102 ? 54.177  41.625 122.081 1.00 101.16 ? 102 LYS B N   1 
ATOM   2061  C CA  . LYS B 1 102 ? 55.053  40.651 121.440 1.00 101.16 ? 102 LYS B CA  1 
ATOM   2062  C C   . LYS B 1 102 ? 56.439  41.266 121.244 1.00 101.16 ? 102 LYS B C   1 
ATOM   2063  O O   . LYS B 1 102 ? 56.558  42.449 120.941 1.00 101.16 ? 102 LYS B O   1 
ATOM   2064  C CB  . LYS B 1 102 ? 54.478  40.231 120.083 1.00 125.67 ? 102 LYS B CB  1 
ATOM   2065  C CG  . LYS B 1 102 ? 53.109  39.572 120.154 1.00 125.67 ? 102 LYS B CG  1 
ATOM   2066  C CD  . LYS B 1 102 ? 52.503  39.413 118.768 1.00 125.67 ? 102 LYS B CD  1 
ATOM   2067  C CE  . LYS B 1 102 ? 51.079  38.893 118.842 1.00 125.67 ? 102 LYS B CE  1 
ATOM   2068  N NZ  . LYS B 1 102 ? 50.431  38.886 117.503 1.00 125.67 ? 102 LYS B NZ  1 
ATOM   2069  N N   . PHE B 1 103 ? 57.484  40.462 121.423 1.00 69.21  ? 103 PHE B N   1 
ATOM   2070  C CA  . PHE B 1 103 ? 58.853  40.934 121.253 1.00 69.21  ? 103 PHE B CA  1 
ATOM   2071  C C   . PHE B 1 103 ? 59.500  40.477 119.964 1.00 69.21  ? 103 PHE B C   1 
ATOM   2072  O O   . PHE B 1 103 ? 59.383  39.315 119.569 1.00 69.21  ? 103 PHE B O   1 
ATOM   2073  C CB  . PHE B 1 103 ? 59.715  40.468 122.404 1.00 62.46  ? 103 PHE B CB  1 
ATOM   2074  C CG  . PHE B 1 103 ? 59.457  41.194 123.666 1.00 62.46  ? 103 PHE B CG  1 
ATOM   2075  C CD1 . PHE B 1 103 ? 58.946  40.533 124.777 1.00 62.46  ? 103 PHE B CD1 1 
ATOM   2076  C CD2 . PHE B 1 103 ? 59.753  42.545 123.765 1.00 62.46  ? 103 PHE B CD2 1 
ATOM   2077  C CE1 . PHE B 1 103 ? 58.739  41.225 125.986 1.00 62.46  ? 103 PHE B CE1 1 
ATOM   2078  C CE2 . PHE B 1 103 ? 59.550  43.242 124.967 1.00 62.46  ? 103 PHE B CE2 1 
ATOM   2079  C CZ  . PHE B 1 103 ? 59.046  42.582 126.075 1.00 62.46  ? 103 PHE B CZ  1 
ATOM   2080  N N   . TYR B 1 104 ? 60.190  41.416 119.326 1.00 61.75  ? 104 TYR B N   1 
ATOM   2081  C CA  . TYR B 1 104 ? 60.907  41.186 118.079 1.00 61.75  ? 104 TYR B CA  1 
ATOM   2082  C C   . TYR B 1 104 ? 62.372  41.511 118.378 1.00 61.75  ? 104 TYR B C   1 
ATOM   2083  O O   . TYR B 1 104 ? 62.757  42.677 118.499 1.00 61.75  ? 104 TYR B O   1 
ATOM   2084  C CB  . TYR B 1 104 ? 60.363  42.101 116.979 1.00 130.74 ? 104 TYR B CB  1 
ATOM   2085  C CG  . TYR B 1 104 ? 58.898  41.873 116.681 1.00 130.74 ? 104 TYR B CG  1 
ATOM   2086  C CD1 . TYR B 1 104 ? 57.935  42.008 117.681 1.00 130.74 ? 104 TYR B CD1 1 
ATOM   2087  C CD2 . TYR B 1 104 ? 58.475  41.497 115.408 1.00 130.74 ? 104 TYR B CD2 1 
ATOM   2088  C CE1 . TYR B 1 104 ? 56.589  41.770 117.427 1.00 130.74 ? 104 TYR B CE1 1 
ATOM   2089  C CE2 . TYR B 1 104 ? 57.126  41.258 115.140 1.00 130.74 ? 104 TYR B CE2 1 
ATOM   2090  C CZ  . TYR B 1 104 ? 56.190  41.394 116.157 1.00 130.74 ? 104 TYR B CZ  1 
ATOM   2091  O OH  . TYR B 1 104 ? 54.860  41.142 115.909 1.00 130.74 ? 104 TYR B OH  1 
ATOM   2092  N N   . VAL B 1 105 ? 63.181  40.469 118.522 1.00 49.58  ? 105 VAL B N   1 
ATOM   2093  C CA  . VAL B 1 105 ? 64.589  40.649 118.823 1.00 49.58  ? 105 VAL B CA  1 
ATOM   2094  C C   . VAL B 1 105 ? 65.514  40.158 117.739 1.00 49.58  ? 105 VAL B C   1 
ATOM   2095  O O   . VAL B 1 105 ? 65.315  39.073 117.186 1.00 49.58  ? 105 VAL B O   1 
ATOM   2096  C CB  . VAL B 1 105 ? 64.962  39.929 120.104 1.00 53.97  ? 105 VAL B CB  1 
ATOM   2097  C CG1 . VAL B 1 105 ? 66.445  40.025 120.333 1.00 53.97  ? 105 VAL B CG1 1 
ATOM   2098  C CG2 . VAL B 1 105 ? 64.205  40.538 121.262 1.00 53.97  ? 105 VAL B CG2 1 
ATOM   2099  N N   . GLY B 1 106 ? 66.532  40.970 117.462 1.00 58.19  ? 106 GLY B N   1 
ATOM   2100  C CA  . GLY B 1 106 ? 67.538  40.645 116.460 1.00 58.19  ? 106 GLY B CA  1 
ATOM   2101  C C   . GLY B 1 106 ? 68.927  40.671 117.077 1.00 58.19  ? 106 GLY B C   1 
ATOM   2102  O O   . GLY B 1 106 ? 69.318  41.662 117.694 1.00 58.19  ? 106 GLY B O   1 
ATOM   2103  N N   . VAL B 1 107 ? 69.672  39.582 116.923 1.00 46.82  ? 107 VAL B N   1 
ATOM   2104  C CA  . VAL B 1 107 ? 71.017  39.503 117.478 1.00 46.82  ? 107 VAL B CA  1 
ATOM   2105  C C   . VAL B 1 107 ? 72.041  38.906 116.536 1.00 46.82  ? 107 VAL B C   1 
ATOM   2106  O O   . VAL B 1 107 ? 71.746  37.983 115.785 1.00 46.82  ? 107 VAL B O   1 
ATOM   2107  C CB  . VAL B 1 107 ? 71.032  38.668 118.752 1.00 53.02  ? 107 VAL B CB  1 
ATOM   2108  C CG1 . VAL B 1 107 ? 72.462  38.482 119.224 1.00 53.02  ? 107 VAL B CG1 1 
ATOM   2109  C CG2 . VAL B 1 107 ? 70.214  39.354 119.815 1.00 53.02  ? 107 VAL B CG2 1 
ATOM   2110  N N   . CYS B 1 108 ? 73.258  39.425 116.591 1.00 34.24  ? 108 CYS B N   1 
ATOM   2111  C CA  . CYS B 1 108 ? 74.314  38.903 115.738 1.00 34.24  ? 108 CYS B CA  1 
ATOM   2112  C C   . CYS B 1 108 ? 75.507  38.450 116.560 1.00 34.24  ? 108 CYS B C   1 
ATOM   2113  O O   . CYS B 1 108 ? 75.763  38.948 117.655 1.00 34.24  ? 108 CYS B O   1 
ATOM   2114  C CB  . CYS B 1 108 ? 74.774  39.952 114.737 1.00 42.36  ? 108 CYS B CB  1 
ATOM   2115  S SG  . CYS B 1 108 ? 75.649  41.286 115.500 1.00 42.36  ? 108 CYS B SG  1 
ATOM   2116  N N   . ALA B 1 109 ? 76.250  37.498 116.030 1.00 50.31  ? 109 ALA B N   1 
ATOM   2117  C CA  . ALA B 1 109 ? 77.399  37.004 116.749 1.00 50.31  ? 109 ALA B CA  1 
ATOM   2118  C C   . ALA B 1 109 ? 78.517  36.753 115.761 1.00 50.31  ? 109 ALA B C   1 
ATOM   2119  O O   . ALA B 1 109 ? 78.270  36.337 114.636 1.00 50.31  ? 109 ALA B O   1 
ATOM   2120  C CB  . ALA B 1 109 ? 77.027  35.707 117.483 1.00 29.87  ? 109 ALA B CB  1 
ATOM   2121  N N   . PHE B 1 110 ? 79.741  37.039 116.172 1.00 41.07  ? 110 PHE B N   1 
ATOM   2122  C CA  . PHE B 1 110 ? 80.887  36.793 115.325 1.00 41.07  ? 110 PHE B CA  1 
ATOM   2123  C C   . PHE B 1 110 ? 81.664  35.660 115.984 1.00 41.07  ? 110 PHE B C   1 
ATOM   2124  O O   . PHE B 1 110 ? 82.118  35.777 117.120 1.00 41.07  ? 110 PHE B O   1 
ATOM   2125  C CB  . PHE B 1 110 ? 81.743  38.038 115.217 1.00 38.93  ? 110 PHE B CB  1 
ATOM   2126  C CG  . PHE B 1 110 ? 81.039  39.186 114.580 1.00 38.93  ? 110 PHE B CG  1 
ATOM   2127  C CD1 . PHE B 1 110 ? 80.168  39.975 115.308 1.00 38.93  ? 110 PHE B CD1 1 
ATOM   2128  C CD2 . PHE B 1 110 ? 81.209  39.456 113.227 1.00 38.93  ? 110 PHE B CD2 1 
ATOM   2129  C CE1 . PHE B 1 110 ? 79.468  41.025 114.686 1.00 38.93  ? 110 PHE B CE1 1 
ATOM   2130  C CE2 . PHE B 1 110 ? 80.522  40.488 112.615 1.00 38.93  ? 110 PHE B CE2 1 
ATOM   2131  C CZ  . PHE B 1 110 ? 79.651  41.271 113.344 1.00 38.93  ? 110 PHE B CZ  1 
ATOM   2132  N N   . VAL B 1 111 ? 81.806  34.562 115.256 1.00 26.10  ? 111 VAL B N   1 
ATOM   2133  C CA  . VAL B 1 111 ? 82.475  33.387 115.754 1.00 26.10  ? 111 VAL B CA  1 
ATOM   2134  C C   . VAL B 1 111 ? 83.717  33.092 114.932 1.00 26.10  ? 111 VAL B C   1 
ATOM   2135  O O   . VAL B 1 111 ? 83.690  33.145 113.715 1.00 26.10  ? 111 VAL B O   1 
ATOM   2136  C CB  . VAL B 1 111 ? 81.535  32.191 115.672 1.00 24.99  ? 111 VAL B CB  1 
ATOM   2137  C CG1 . VAL B 1 111 ? 82.201  30.947 116.237 1.00 24.99  ? 111 VAL B CG1 1 
ATOM   2138  C CG2 . VAL B 1 111 ? 80.227  32.518 116.396 1.00 24.99  ? 111 VAL B CG2 1 
ATOM   2139  N N   . ARG B 1 112 ? 84.809  32.773 115.614 1.00 39.94  ? 112 ARG B N   1 
ATOM   2140  C CA  . ARG B 1 112 ? 86.054  32.455 114.961 1.00 39.94  ? 112 ARG B CA  1 
ATOM   2141  C C   . ARG B 1 112 ? 86.341  31.004 115.274 1.00 39.94  ? 112 ARG B C   1 
ATOM   2142  O O   . ARG B 1 112 ? 86.230  30.595 116.434 1.00 39.94  ? 112 ARG B O   1 
ATOM   2143  C CB  . ARG B 1 112 ? 87.153  33.315 115.536 1.00 48.15  ? 112 ARG B CB  1 
ATOM   2144  C CG  . ARG B 1 112 ? 88.355  33.378 114.675 1.00 48.15  ? 112 ARG B CG  1 
ATOM   2145  C CD  . ARG B 1 112 ? 89.414  34.258 115.277 1.00 48.15  ? 112 ARG B CD  1 
ATOM   2146  N NE  . ARG B 1 112 ? 90.560  33.442 115.646 1.00 48.15  ? 112 ARG B NE  1 
ATOM   2147  C CZ  . ARG B 1 112 ? 91.797  33.635 115.193 1.00 48.15  ? 112 ARG B CZ  1 
ATOM   2148  N NH1 . ARG B 1 112 ? 92.042  34.648 114.355 1.00 48.15  ? 112 ARG B NH1 1 
ATOM   2149  N NH2 . ARG B 1 112 ? 92.773  32.795 115.541 1.00 48.15  ? 112 ARG B NH2 1 
ATOM   2150  N N   . VAL B 1 113 ? 86.674  30.214 114.252 1.00 36.07  ? 113 VAL B N   1 
ATOM   2151  C CA  . VAL B 1 113 ? 86.997  28.796 114.443 1.00 36.07  ? 113 VAL B CA  1 
ATOM   2152  C C   . VAL B 1 113 ? 88.458  28.624 114.108 1.00 36.07  ? 113 VAL B C   1 
ATOM   2153  O O   . VAL B 1 113 ? 88.939  29.182 113.125 1.00 36.07  ? 113 VAL B O   1 
ATOM   2154  C CB  . VAL B 1 113 ? 86.210  27.909 113.510 1.00 26.96  ? 113 VAL B CB  1 
ATOM   2155  C CG1 . VAL B 1 113 ? 86.592  26.454 113.733 1.00 26.96  ? 113 VAL B CG1 1 
ATOM   2156  C CG2 . VAL B 1 113 ? 84.747  28.091 113.763 1.00 26.96  ? 113 VAL B CG2 1 
ATOM   2157  N N   . GLN B 1 114 ? 89.178  27.847 114.897 1.00 32.37  ? 114 GLN B N   1 
ATOM   2158  C CA  . GLN B 1 114 ? 90.599  27.684 114.629 1.00 32.37  ? 114 GLN B CA  1 
ATOM   2159  C C   . GLN B 1 114 ? 91.038  26.231 114.717 1.00 32.37  ? 114 GLN B C   1 
ATOM   2160  O O   . GLN B 1 114 ? 90.571  25.492 115.564 1.00 32.37  ? 114 GLN B O   1 
ATOM   2161  C CB  . GLN B 1 114 ? 91.389  28.516 115.623 1.00 44.65  ? 114 GLN B CB  1 
ATOM   2162  C CG  . GLN B 1 114 ? 92.849  28.545 115.341 1.00 44.65  ? 114 GLN B CG  1 
ATOM   2163  C CD  . GLN B 1 114 ? 93.651  29.113 116.491 1.00 44.65  ? 114 GLN B CD  1 
ATOM   2164  O OE1 . GLN B 1 114 ? 93.830  28.461 117.505 1.00 44.65  ? 114 GLN B OE1 1 
ATOM   2165  N NE2 . GLN B 1 114 ? 94.132  30.343 116.335 1.00 44.65  ? 114 GLN B NE2 1 
ATOM   2166  N N   . LEU B 1 115 ? 91.928  25.812 113.832 1.00 38.47  ? 115 LEU B N   1 
ATOM   2167  C CA  . LEU B 1 115 ? 92.398  24.443 113.860 1.00 38.47  ? 115 LEU B CA  1 
ATOM   2168  C C   . LEU B 1 115 ? 93.689  24.422 114.654 1.00 38.47  ? 115 LEU B C   1 
ATOM   2169  O O   . LEU B 1 115 ? 94.336  25.456 114.844 1.00 38.47  ? 115 LEU B O   1 
ATOM   2170  C CB  . LEU B 1 115 ? 92.641  23.923 112.447 1.00 35.02  ? 115 LEU B CB  1 
ATOM   2171  C CG  . LEU B 1 115 ? 91.429  23.912 111.508 1.00 35.02  ? 115 LEU B CG  1 
ATOM   2172  C CD1 . LEU B 1 115 ? 91.851  23.367 110.166 1.00 35.02  ? 115 LEU B CD1 1 
ATOM   2173  C CD2 . LEU B 1 115 ? 90.328  23.069 112.081 1.00 35.02  ? 115 LEU B CD2 1 
ATOM   2174  N N   . LYS B 1 116 ? 94.070  23.237 115.107 1.00 31.27  ? 116 LYS B N   1 
ATOM   2175  C CA  . LYS B 1 116 ? 95.245  23.107 115.909 1.00 31.27  ? 116 LYS B CA  1 
ATOM   2176  C C   . LYS B 1 116 ? 96.482  23.686 115.263 1.00 31.27  ? 116 LYS B C   1 
ATOM   2177  O O   . LYS B 1 116 ? 97.429  24.055 115.952 1.00 31.27  ? 116 LYS B O   1 
ATOM   2178  C CB  . LYS B 1 116 ? 95.472  21.641 116.259 1.00 37.53  ? 116 LYS B CB  1 
ATOM   2179  C CG  . LYS B 1 116 ? 95.732  20.726 115.073 1.00 37.53  ? 116 LYS B CG  1 
ATOM   2180  C CD  . LYS B 1 116 ? 95.994  19.310 115.546 1.00 37.53  ? 116 LYS B CD  1 
ATOM   2181  C CE  . LYS B 1 116 ? 96.186  18.350 114.410 1.00 37.53  ? 116 LYS B CE  1 
ATOM   2182  N NZ  . LYS B 1 116 ? 96.632  17.019 114.911 1.00 37.53  ? 116 LYS B NZ  1 
ATOM   2183  N N   . ASP B 1 117 ? 96.499  23.808 113.951 1.00 34.52  ? 117 ASP B N   1 
ATOM   2184  C CA  . ASP B 1 117 ? 97.703  24.315 113.320 1.00 34.52  ? 117 ASP B CA  1 
ATOM   2185  C C   . ASP B 1 117 ? 97.763  25.816 113.200 1.00 34.52  ? 117 ASP B C   1 
ATOM   2186  O O   . ASP B 1 117 ? 98.776  26.353 112.748 1.00 34.52  ? 117 ASP B O   1 
ATOM   2187  C CB  . ASP B 1 117 ? 97.902  23.685 111.954 1.00 53.33  ? 117 ASP B CB  1 
ATOM   2188  C CG  . ASP B 1 117 ? 97.043  24.312 110.910 1.00 53.33  ? 117 ASP B CG  1 
ATOM   2189  O OD1 . ASP B 1 117 ? 95.884  24.648 111.223 1.00 53.33  ? 117 ASP B OD1 1 
ATOM   2190  O OD2 . ASP B 1 117 ? 97.523  24.467 109.766 1.00 53.33  ? 117 ASP B OD2 1 
ATOM   2191  N N   . GLY B 1 118 ? 96.700  26.503 113.611 1.00 27.45  ? 118 GLY B N   1 
ATOM   2192  C CA  . GLY B 1 118 ? 96.717  27.950 113.535 1.00 27.45  ? 118 GLY B CA  1 
ATOM   2193  C C   . GLY B 1 118 ? 95.722  28.461 112.530 1.00 27.45  ? 118 GLY B C   1 
ATOM   2194  O O   . GLY B 1 118 ? 95.209  29.564 112.633 1.00 27.45  ? 118 GLY B O   1 
ATOM   2195  N N   . SER B 1 119 ? 95.454  27.647 111.532 1.00 37.80  ? 119 SER B N   1 
ATOM   2196  C CA  . SER B 1 119 ? 94.484  27.980 110.515 1.00 37.80  ? 119 SER B CA  1 
ATOM   2197  C C   . SER B 1 119 ? 93.188  28.494 111.182 1.00 37.80  ? 119 SER B C   1 
ATOM   2198  O O   . SER B 1 119 ? 92.801  28.022 112.251 1.00 37.80  ? 119 SER B O   1 
ATOM   2199  C CB  . SER B 1 119 ? 94.199  26.717 109.707 1.00 67.99  ? 119 SER B CB  1 
ATOM   2200  O OG  . SER B 1 119 ? 93.265  26.972 108.684 1.00 67.99  ? 119 SER B OG  1 
ATOM   2201  N N   . TYR B 1 120 ? 92.517  29.461 110.560 1.00 30.61  ? 120 TYR B N   1 
ATOM   2202  C CA  . TYR B 1 120 ? 91.265  29.960 111.131 1.00 30.61  ? 120 TYR B CA  1 
ATOM   2203  C C   . TYR B 1 120 ? 90.287  30.577 110.118 1.00 30.61  ? 120 TYR B C   1 
ATOM   2204  O O   . TYR B 1 120 ? 90.670  31.009 109.039 1.00 30.61  ? 120 TYR B O   1 
ATOM   2205  C CB  . TYR B 1 120 ? 91.580  30.993 112.224 1.00 30.65  ? 120 TYR B CB  1 
ATOM   2206  C CG  . TYR B 1 120 ? 92.285  32.220 111.700 1.00 30.65  ? 120 TYR B CG  1 
ATOM   2207  C CD1 . TYR B 1 120 ? 91.572  33.274 111.123 1.00 30.65  ? 120 TYR B CD1 1 
ATOM   2208  C CD2 . TYR B 1 120 ? 93.674  32.288 111.691 1.00 30.65  ? 120 TYR B CD2 1 
ATOM   2209  C CE1 . TYR B 1 120 ? 92.227  34.351 110.551 1.00 30.65  ? 120 TYR B CE1 1 
ATOM   2210  C CE2 . TYR B 1 120 ? 94.346  33.365 111.115 1.00 30.65  ? 120 TYR B CE2 1 
ATOM   2211  C CZ  . TYR B 1 120 ? 93.624  34.392 110.546 1.00 30.65  ? 120 TYR B CZ  1 
ATOM   2212  O OH  . TYR B 1 120 ? 94.304  35.448 109.977 1.00 30.65  ? 120 TYR B OH  1 
ATOM   2213  N N   . HIS B 1 121 ? 89.017  30.627 110.491 1.00 38.21  ? 121 HIS B N   1 
ATOM   2214  C CA  . HIS B 1 121 ? 87.977  31.238 109.672 1.00 38.21  ? 121 HIS B CA  1 
ATOM   2215  C C   . HIS B 1 121 ? 86.966  31.853 110.622 1.00 38.21  ? 121 HIS B C   1 
ATOM   2216  O O   . HIS B 1 121 ? 86.551  31.209 111.584 1.00 38.21  ? 121 HIS B O   1 
ATOM   2217  C CB  . HIS B 1 121 ? 87.259  30.206 108.802 1.00 36.84  ? 121 HIS B CB  1 
ATOM   2218  C CG  . HIS B 1 121 ? 88.047  29.756 107.619 1.00 36.84  ? 121 HIS B CG  1 
ATOM   2219  N ND1 . HIS B 1 121 ? 88.415  28.441 107.434 1.00 36.84  ? 121 HIS B ND1 1 
ATOM   2220  C CD2 . HIS B 1 121 ? 88.565  30.442 106.575 1.00 36.84  ? 121 HIS B CD2 1 
ATOM   2221  C CE1 . HIS B 1 121 ? 89.131  28.338 106.330 1.00 36.84  ? 121 HIS B CE1 1 
ATOM   2222  N NE2 . HIS B 1 121 ? 89.238  29.540 105.790 1.00 36.84  ? 121 HIS B NE2 1 
ATOM   2223  N N   . GLU B 1 122 ? 86.560  33.086 110.358 1.00 34.47  ? 122 GLU B N   1 
ATOM   2224  C CA  . GLU B 1 122 ? 85.581  33.755 111.210 1.00 34.47  ? 122 GLU B CA  1 
ATOM   2225  C C   . GLU B 1 122 ? 84.348  34.209 110.395 1.00 34.47  ? 122 GLU B C   1 
ATOM   2226  O O   . GLU B 1 122 ? 84.468  34.567 109.223 1.00 34.47  ? 122 GLU B O   1 
ATOM   2227  C CB  . GLU B 1 122 ? 86.258  34.938 111.897 1.00 48.30  ? 122 GLU B CB  1 
ATOM   2228  C CG  . GLU B 1 122 ? 85.324  35.925 112.547 1.00 48.30  ? 122 GLU B CG  1 
ATOM   2229  C CD  . GLU B 1 122 ? 86.064  37.030 113.295 1.00 48.30  ? 122 GLU B CD  1 
ATOM   2230  O OE1 . GLU B 1 122 ? 87.159  37.437 112.841 1.00 48.30  ? 122 GLU B OE1 1 
ATOM   2231  O OE2 . GLU B 1 122 ? 85.541  37.503 114.332 1.00 48.30  ? 122 GLU B OE2 1 
ATOM   2232  N N   . ASP B 1 123 ? 83.160  34.168 110.992 1.00 34.92  ? 123 ASP B N   1 
ATOM   2233  C CA  . ASP B 1 123 ? 81.951  34.596 110.282 1.00 34.92  ? 123 ASP B CA  1 
ATOM   2234  C C   . ASP B 1 123 ? 80.907  35.191 111.243 1.00 34.92  ? 123 ASP B C   1 
ATOM   2235  O O   . ASP B 1 123 ? 81.090  35.143 112.461 1.00 34.92  ? 123 ASP B O   1 
ATOM   2236  C CB  . ASP B 1 123 ? 81.342  33.411 109.510 1.00 58.06  ? 123 ASP B CB  1 
ATOM   2237  C CG  . ASP B 1 123 ? 80.713  33.829 108.183 1.00 58.06  ? 123 ASP B CG  1 
ATOM   2238  O OD1 . ASP B 1 123 ? 79.883  34.750 108.188 1.00 58.06  ? 123 ASP B OD1 1 
ATOM   2239  O OD2 . ASP B 1 123 ? 81.046  33.233 107.133 1.00 58.06  ? 123 ASP B OD2 1 
ATOM   2240  N N   . VAL B 1 124 ? 79.832  35.755 110.683 1.00 42.77  ? 124 VAL B N   1 
ATOM   2241  C CA  . VAL B 1 124 ? 78.746  36.359 111.458 1.00 42.77  ? 124 VAL B CA  1 
ATOM   2242  C C   . VAL B 1 124 ? 77.619  35.386 111.526 1.00 42.77  ? 124 VAL B C   1 
ATOM   2243  O O   . VAL B 1 124 ? 77.334  34.708 110.538 1.00 42.77  ? 124 VAL B O   1 
ATOM   2244  C CB  . VAL B 1 124 ? 78.069  37.542 110.780 1.00 53.67  ? 124 VAL B CB  1 
ATOM   2245  C CG1 . VAL B 1 124 ? 77.718  38.566 111.806 1.00 53.67  ? 124 VAL B CG1 1 
ATOM   2246  C CG2 . VAL B 1 124 ? 78.912  38.087 109.676 1.00 53.67  ? 124 VAL B CG2 1 
ATOM   2247  N N   . GLY B 1 125 ? 76.942  35.355 112.665 1.00 33.78  ? 125 GLY B N   1 
ATOM   2248  C CA  . GLY B 1 125 ? 75.805  34.474 112.814 1.00 33.78  ? 125 GLY B CA  1 
ATOM   2249  C C   . GLY B 1 125 ? 74.675  35.389 113.182 1.00 33.78  ? 125 GLY B C   1 
ATOM   2250  O O   . GLY B 1 125 ? 74.941  36.513 113.636 1.00 33.78  ? 125 GLY B O   1 
ATOM   2251  N N   . TYR B 1 126 ? 73.431  34.965 112.972 1.00 31.69  ? 126 TYR B N   1 
ATOM   2252  C CA  . TYR B 1 126 ? 72.325  35.824 113.354 1.00 31.69  ? 126 TYR B CA  1 
ATOM   2253  C C   . TYR B 1 126 ? 71.236  35.064 114.082 1.00 31.69  ? 126 TYR B C   1 
ATOM   2254  O O   . TYR B 1 126 ? 70.928  33.927 113.746 1.00 31.69  ? 126 TYR B O   1 
ATOM   2255  C CB  . TYR B 1 126 ? 71.741  36.537 112.150 1.00 38.93  ? 126 TYR B CB  1 
ATOM   2256  C CG  . TYR B 1 126 ? 71.203  37.901 112.517 1.00 38.93  ? 126 TYR B CG  1 
ATOM   2257  C CD1 . TYR B 1 126 ? 72.065  38.979 112.734 1.00 38.93  ? 126 TYR B CD1 1 
ATOM   2258  C CD2 . TYR B 1 126 ? 69.836  38.107 112.709 1.00 38.93  ? 126 TYR B CD2 1 
ATOM   2259  C CE1 . TYR B 1 126 ? 71.581  40.229 113.135 1.00 38.93  ? 126 TYR B CE1 1 
ATOM   2260  C CE2 . TYR B 1 126 ? 69.342  39.352 113.117 1.00 38.93  ? 126 TYR B CE2 1 
ATOM   2261  C CZ  . TYR B 1 126 ? 70.223  40.402 113.323 1.00 38.93  ? 126 TYR B CZ  1 
ATOM   2262  O OH  . TYR B 1 126 ? 69.730  41.631 113.694 1.00 38.93  ? 126 TYR B OH  1 
ATOM   2263  N N   . GLY B 1 127 ? 70.673  35.691 115.108 1.00 63.40  ? 127 GLY B N   1 
ATOM   2264  C CA  . GLY B 1 127 ? 69.631  35.045 115.882 1.00 63.40  ? 127 GLY B CA  1 
ATOM   2265  C C   . GLY B 1 127 ? 68.383  35.888 115.857 1.00 63.40  ? 127 GLY B C   1 
ATOM   2266  O O   . GLY B 1 127 ? 68.466  37.107 115.958 1.00 63.40  ? 127 GLY B O   1 
ATOM   2267  N N   . VAL B 1 128 ? 67.223  35.253 115.726 1.00 77.01  ? 128 VAL B N   1 
ATOM   2268  C CA  . VAL B 1 128 ? 65.978  36.000 115.675 1.00 77.01  ? 128 VAL B CA  1 
ATOM   2269  C C   . VAL B 1 128 ? 64.871  35.382 116.507 1.00 77.01  ? 128 VAL B C   1 
ATOM   2270  O O   . VAL B 1 128 ? 64.820  34.172 116.698 1.00 77.01  ? 128 VAL B O   1 
ATOM   2271  C CB  . VAL B 1 128 ? 65.483  36.112 114.236 1.00 51.11  ? 128 VAL B CB  1 
ATOM   2272  C CG1 . VAL B 1 128 ? 64.338  37.098 114.152 1.00 51.11  ? 128 VAL B CG1 1 
ATOM   2273  C CG2 . VAL B 1 128 ? 66.625  36.549 113.330 1.00 51.11  ? 128 VAL B CG2 1 
ATOM   2274  N N   . SER B 1 129 ? 63.993  36.234 117.016 1.00 57.49  ? 129 SER B N   1 
ATOM   2275  C CA  . SER B 1 129 ? 62.838  35.806 117.807 1.00 57.49  ? 129 SER B CA  1 
ATOM   2276  C C   . SER B 1 129 ? 61.794  36.858 117.502 1.00 57.49  ? 129 SER B C   1 
ATOM   2277  O O   . SER B 1 129 ? 62.013  38.025 117.798 1.00 57.49  ? 129 SER B O   1 
ATOM   2278  C CB  . SER B 1 129 ? 63.159  35.810 119.305 1.00 76.85  ? 129 SER B CB  1 
ATOM   2279  O OG  . SER B 1 129 ? 62.000  35.521 120.071 1.00 76.85  ? 129 SER B OG  1 
ATOM   2280  N N   . GLU B 1 130 ? 60.672  36.472 116.908 1.00 128.16 ? 130 GLU B N   1 
ATOM   2281  C CA  . GLU B 1 130 ? 59.683  37.478 116.562 1.00 128.16 ? 130 GLU B CA  1 
ATOM   2282  C C   . GLU B 1 130 ? 58.288  37.323 117.142 1.00 128.16 ? 130 GLU B C   1 
ATOM   2283  O O   . GLU B 1 130 ? 57.451  38.202 116.963 1.00 128.16 ? 130 GLU B O   1 
ATOM   2284  C CB  . GLU B 1 130 ? 59.586  37.602 115.040 1.00 84.65  ? 130 GLU B CB  1 
ATOM   2285  C CG  . GLU B 1 130 ? 60.946  37.693 114.355 1.00 84.65  ? 130 GLU B CG  1 
ATOM   2286  C CD  . GLU B 1 130 ? 60.920  38.477 113.050 1.00 84.65  ? 130 GLU B CD  1 
ATOM   2287  O OE1 . GLU B 1 130 ? 60.813  39.725 113.102 1.00 84.65  ? 130 GLU B OE1 1 
ATOM   2288  O OE2 . GLU B 1 130 ? 61.010  37.843 111.973 1.00 84.65  ? 130 GLU B OE2 1 
ATOM   2289  N N   . GLY B 1 131 ? 58.021  36.231 117.845 1.00 81.11  ? 131 GLY B N   1 
ATOM   2290  C CA  . GLY B 1 131 ? 56.687  36.067 118.395 1.00 81.11  ? 131 GLY B CA  1 
ATOM   2291  C C   . GLY B 1 131 ? 56.550  36.305 119.889 1.00 81.11  ? 131 GLY B C   1 
ATOM   2292  O O   . GLY B 1 131 ? 55.944  37.282 120.323 1.00 81.11  ? 131 GLY B O   1 
ATOM   2293  N N   . LEU B 1 132 ? 57.119  35.388 120.666 1.00 91.58  ? 132 LEU B N   1 
ATOM   2294  C CA  . LEU B 1 132 ? 57.089  35.399 122.128 1.00 91.58  ? 132 LEU B CA  1 
ATOM   2295  C C   . LEU B 1 132 ? 56.650  36.661 122.860 1.00 91.58  ? 132 LEU B C   1 
ATOM   2296  O O   . LEU B 1 132 ? 56.889  37.784 122.422 1.00 91.58  ? 132 LEU B O   1 
ATOM   2297  C CB  . LEU B 1 132 ? 58.453  34.968 122.660 1.00 95.11  ? 132 LEU B CB  1 
ATOM   2298  C CG  . LEU B 1 132 ? 58.871  33.554 122.245 1.00 95.11  ? 132 LEU B CG  1 
ATOM   2299  C CD1 . LEU B 1 132 ? 60.322  33.317 122.634 1.00 95.11  ? 132 LEU B CD1 1 
ATOM   2300  C CD2 . LEU B 1 132 ? 57.947  32.525 122.901 1.00 95.11  ? 132 LEU B CD2 1 
ATOM   2301  N N   . LYS B 1 133 ? 56.004  36.446 124.001 1.00 84.82  ? 133 LYS B N   1 
ATOM   2302  C CA  . LYS B 1 133 ? 55.520  37.527 124.853 1.00 84.82  ? 133 LYS B CA  1 
ATOM   2303  C C   . LYS B 1 133 ? 56.546  37.770 125.953 1.00 84.82  ? 133 LYS B C   1 
ATOM   2304  O O   . LYS B 1 133 ? 56.549  38.819 126.590 1.00 84.82  ? 133 LYS B O   1 
ATOM   2305  C CB  . LYS B 1 133 ? 54.174  37.150 125.485 1.00 172.78 ? 133 LYS B CB  1 
ATOM   2306  C CG  . LYS B 1 133 ? 53.026  36.975 124.498 1.00 172.78 ? 133 LYS B CG  1 
ATOM   2307  C CD  . LYS B 1 133 ? 51.754  36.479 125.189 1.00 172.78 ? 133 LYS B CD  1 
ATOM   2308  C CE  . LYS B 1 133 ? 51.262  37.453 126.251 1.00 172.78 ? 133 LYS B CE  1 
ATOM   2309  N NZ  . LYS B 1 133 ? 50.923  38.786 125.680 1.00 172.78 ? 133 LYS B NZ  1 
ATOM   2310  N N   . SER B 1 134 ? 57.408  36.783 126.179 1.00 74.21  ? 134 SER B N   1 
ATOM   2311  C CA  . SER B 1 134 ? 58.454  36.889 127.190 1.00 74.21  ? 134 SER B CA  1 
ATOM   2312  C C   . SER B 1 134 ? 59.708  37.526 126.598 1.00 74.21  ? 134 SER B C   1 
ATOM   2313  O O   . SER B 1 134 ? 60.238  37.072 125.581 1.00 74.21  ? 134 SER B O   1 
ATOM   2314  C CB  . SER B 1 134 ? 58.817  35.511 127.738 1.00 79.08  ? 134 SER B CB  1 
ATOM   2315  O OG  . SER B 1 134 ? 59.909  35.600 128.643 1.00 79.08  ? 134 SER B OG  1 
ATOM   2316  N N   . LYS B 1 135 ? 60.184  38.585 127.237 1.00 75.81  ? 135 LYS B N   1 
ATOM   2317  C CA  . LYS B 1 135 ? 61.380  39.247 126.758 1.00 75.81  ? 135 LYS B CA  1 
ATOM   2318  C C   . LYS B 1 135 ? 62.562  38.307 126.948 1.00 75.81  ? 135 LYS B C   1 
ATOM   2319  O O   . LYS B 1 135 ? 63.336  38.067 126.019 1.00 75.81  ? 135 LYS B O   1 
ATOM   2320  C CB  . LYS B 1 135 ? 61.607  40.547 127.522 1.00 51.60  ? 135 LYS B CB  1 
ATOM   2321  C CG  . LYS B 1 135 ? 62.834  41.283 127.046 1.00 51.60  ? 135 LYS B CG  1 
ATOM   2322  C CD  . LYS B 1 135 ? 62.678  42.779 127.138 1.00 51.60  ? 135 LYS B CD  1 
ATOM   2323  C CE  . LYS B 1 135 ? 62.695  43.275 128.562 1.00 51.60  ? 135 LYS B CE  1 
ATOM   2324  N NZ  . LYS B 1 135 ? 62.593  44.757 128.537 1.00 51.60  ? 135 LYS B NZ  1 
ATOM   2325  N N   . ALA B 1 136 ? 62.689  37.771 128.156 1.00 79.25  ? 136 ALA B N   1 
ATOM   2326  C CA  . ALA B 1 136 ? 63.762  36.841 128.454 1.00 79.25  ? 136 ALA B CA  1 
ATOM   2327  C C   . ALA B 1 136 ? 63.861  35.750 127.384 1.00 79.25  ? 136 ALA B C   1 
ATOM   2328  O O   . ALA B 1 136 ? 64.886  35.615 126.715 1.00 79.25  ? 136 ALA B O   1 
ATOM   2329  C CB  . ALA B 1 136 ? 63.537  36.206 129.811 1.00 49.19  ? 136 ALA B CB  1 
ATOM   2330  N N   . LEU B 1 137 ? 62.799  34.974 127.212 1.00 64.26  ? 137 LEU B N   1 
ATOM   2331  C CA  . LEU B 1 137 ? 62.837  33.898 126.232 1.00 64.26  ? 137 LEU B CA  1 
ATOM   2332  C C   . LEU B 1 137 ? 63.191  34.360 124.826 1.00 64.26  ? 137 LEU B C   1 
ATOM   2333  O O   . LEU B 1 137 ? 63.830  33.627 124.078 1.00 64.26  ? 137 LEU B O   1 
ATOM   2334  C CB  . LEU B 1 137 ? 61.506  33.141 126.225 1.00 52.73  ? 137 LEU B CB  1 
ATOM   2335  C CG  . LEU B 1 137 ? 61.429  32.030 127.281 1.00 52.73  ? 137 LEU B CG  1 
ATOM   2336  C CD1 . LEU B 1 137 ? 61.775  32.549 128.673 1.00 52.73  ? 137 LEU B CD1 1 
ATOM   2337  C CD2 . LEU B 1 137 ? 60.048  31.456 127.270 1.00 52.73  ? 137 LEU B CD2 1 
ATOM   2338  N N   . SER B 1 138 ? 62.791  35.573 124.466 1.00 63.58  ? 138 SER B N   1 
ATOM   2339  C CA  . SER B 1 138 ? 63.081  36.095 123.132 1.00 63.58  ? 138 SER B CA  1 
ATOM   2340  C C   . SER B 1 138 ? 64.576  36.303 122.940 1.00 63.58  ? 138 SER B C   1 
ATOM   2341  O O   . SER B 1 138 ? 65.129  35.974 121.887 1.00 63.58  ? 138 SER B O   1 
ATOM   2342  C CB  . SER B 1 138 ? 62.343  37.417 122.901 1.00 68.91  ? 138 SER B CB  1 
ATOM   2343  O OG  . SER B 1 138 ? 60.980  37.205 122.560 1.00 68.91  ? 138 SER B OG  1 
ATOM   2344  N N   . LEU B 1 139 ? 65.224  36.861 123.961 1.00 63.07  ? 139 LEU B N   1 
ATOM   2345  C CA  . LEU B 1 139 ? 66.656  37.108 123.919 1.00 63.07  ? 139 LEU B CA  1 
ATOM   2346  C C   . LEU B 1 139 ? 67.422  35.786 123.958 1.00 63.07  ? 139 LEU B C   1 
ATOM   2347  O O   . LEU B 1 139 ? 68.282  35.539 123.121 1.00 63.07  ? 139 LEU B O   1 
ATOM   2348  C CB  . LEU B 1 139 ? 67.058  37.989 125.095 1.00 46.09  ? 139 LEU B CB  1 
ATOM   2349  C CG  . LEU B 1 139 ? 66.658  39.462 124.990 1.00 46.09  ? 139 LEU B CG  1 
ATOM   2350  C CD1 . LEU B 1 139 ? 67.010  40.187 126.263 1.00 46.09  ? 139 LEU B CD1 1 
ATOM   2351  C CD2 . LEU B 1 139 ? 67.392  40.098 123.831 1.00 46.09  ? 139 LEU B CD2 1 
ATOM   2352  N N   . GLU B 1 140 ? 67.107  34.936 124.928 1.00 46.65  ? 140 GLU B N   1 
ATOM   2353  C CA  . GLU B 1 140 ? 67.772  33.648 125.028 1.00 46.65  ? 140 GLU B CA  1 
ATOM   2354  C C   . GLU B 1 140 ? 67.790  32.947 123.677 1.00 46.65  ? 140 GLU B C   1 
ATOM   2355  O O   . GLU B 1 140 ? 68.808  32.387 123.263 1.00 46.65  ? 140 GLU B O   1 
ATOM   2356  C CB  . GLU B 1 140 ? 67.071  32.753 126.047 1.00 63.25  ? 140 GLU B CB  1 
ATOM   2357  C CG  . GLU B 1 140 ? 67.586  31.330 126.055 1.00 63.25  ? 140 GLU B CG  1 
ATOM   2358  C CD  . GLU B 1 140 ? 66.860  30.442 127.048 1.00 63.25  ? 140 GLU B CD  1 
ATOM   2359  O OE1 . GLU B 1 140 ? 65.608  30.481 127.074 1.00 63.25  ? 140 GLU B OE1 1 
ATOM   2360  O OE2 . GLU B 1 140 ? 67.536  29.695 127.794 1.00 63.25  ? 140 GLU B OE2 1 
ATOM   2361  N N   . LYS B 1 141 ? 66.669  32.988 122.977 1.00 50.13  ? 141 LYS B N   1 
ATOM   2362  C CA  . LYS B 1 141 ? 66.575  32.323 121.681 1.00 50.13  ? 141 LYS B CA  1 
ATOM   2363  C C   . LYS B 1 141 ? 67.509  32.963 120.668 1.00 50.13  ? 141 LYS B C   1 
ATOM   2364  O O   . LYS B 1 141 ? 68.309  32.286 120.021 1.00 50.13  ? 141 LYS B O   1 
ATOM   2365  C CB  . LYS B 1 141 ? 65.135  32.394 121.157 1.00 55.57  ? 141 LYS B CB  1 
ATOM   2366  C CG  . LYS B 1 141 ? 64.782  31.364 120.102 1.00 55.57  ? 141 LYS B CG  1 
ATOM   2367  C CD  . LYS B 1 141 ? 64.253  32.024 118.855 1.00 55.57  ? 141 LYS B CD  1 
ATOM   2368  C CE  . LYS B 1 141 ? 63.783  30.978 117.852 1.00 55.57  ? 141 LYS B CE  1 
ATOM   2369  N NZ  . LYS B 1 141 ? 63.692  31.499 116.446 1.00 55.57  ? 141 LYS B NZ  1 
ATOM   2370  N N   . ALA B 1 142 ? 67.410  34.280 120.540 1.00 45.97  ? 142 ALA B N   1 
ATOM   2371  C CA  . ALA B 1 142 ? 68.223  35.002 119.586 1.00 45.97  ? 142 ALA B CA  1 
ATOM   2372  C C   . ALA B 1 142 ? 69.715  34.908 119.872 1.00 45.97  ? 142 ALA B C   1 
ATOM   2373  O O   . ALA B 1 142 ? 70.495  34.625 118.971 1.00 45.97  ? 142 ALA B O   1 
ATOM   2374  C CB  . ALA B 1 142 ? 67.784  36.445 119.547 1.00 26.05  ? 142 ALA B CB  1 
ATOM   2375  N N   . ARG B 1 143 ? 70.120  35.142 121.115 1.00 46.67  ? 143 ARG B N   1 
ATOM   2376  C CA  . ARG B 1 143 ? 71.534  35.087 121.449 1.00 46.67  ? 143 ARG B CA  1 
ATOM   2377  C C   . ARG B 1 143 ? 72.117  33.719 121.167 1.00 46.67  ? 143 ARG B C   1 
ATOM   2378  O O   . ARG B 1 143 ? 73.203  33.614 120.580 1.00 46.67  ? 143 ARG B O   1 
ATOM   2379  C CB  . ARG B 1 143 ? 71.768  35.445 122.915 1.00 42.05  ? 143 ARG B CB  1 
ATOM   2380  C CG  . ARG B 1 143 ? 71.183  36.773 123.300 1.00 42.05  ? 143 ARG B CG  1 
ATOM   2381  C CD  . ARG B 1 143 ? 71.715  37.332 124.627 1.00 42.05  ? 143 ARG B CD  1 
ATOM   2382  N NE  . ARG B 1 143 ? 72.891  38.161 124.421 1.00 42.05  ? 143 ARG B NE  1 
ATOM   2383  C CZ  . ARG B 1 143 ? 73.057  39.380 124.929 1.00 42.05  ? 143 ARG B CZ  1 
ATOM   2384  N NH1 . ARG B 1 143 ? 72.126  39.927 125.678 1.00 42.05  ? 143 ARG B NH1 1 
ATOM   2385  N NH2 . ARG B 1 143 ? 74.162  40.063 124.691 1.00 42.05  ? 143 ARG B NH2 1 
ATOM   2386  N N   . LYS B 1 144 ? 71.401  32.668 121.572 1.00 41.21  ? 144 LYS B N   1 
ATOM   2387  C CA  . LYS B 1 144 ? 71.895  31.310 121.365 1.00 41.21  ? 144 LYS B CA  1 
ATOM   2388  C C   . LYS B 1 144 ? 71.989  30.978 119.900 1.00 41.21  ? 144 LYS B C   1 
ATOM   2389  O O   . LYS B 1 144 ? 73.007  30.474 119.436 1.00 41.21  ? 144 LYS B O   1 
ATOM   2390  C CB  . LYS B 1 144 ? 71.014  30.291 122.078 1.00 39.18  ? 144 LYS B CB  1 
ATOM   2391  C CG  . LYS B 1 144 ? 71.036  30.453 123.575 1.00 39.18  ? 144 LYS B CG  1 
ATOM   2392  C CD  . LYS B 1 144 ? 70.532  29.223 124.318 1.00 39.18  ? 144 LYS B CD  1 
ATOM   2393  C CE  . LYS B 1 144 ? 70.739  29.404 125.811 1.00 39.18  ? 144 LYS B CE  1 
ATOM   2394  N NZ  . LYS B 1 144 ? 70.302  28.203 126.537 1.00 39.18  ? 144 LYS B NZ  1 
ATOM   2395  N N   . GLU B 1 145 ? 70.929  31.281 119.166 1.00 46.51  ? 145 GLU B N   1 
ATOM   2396  C CA  . GLU B 1 145 ? 70.910  30.998 117.746 1.00 46.51  ? 145 GLU B CA  1 
ATOM   2397  C C   . GLU B 1 145 ? 72.015  31.718 116.965 1.00 46.51  ? 145 GLU B C   1 
ATOM   2398  O O   . GLU B 1 145 ? 72.686  31.119 116.106 1.00 46.51  ? 145 GLU B O   1 
ATOM   2399  C CB  . GLU B 1 145 ? 69.534  31.329 117.183 1.00 85.96  ? 145 GLU B CB  1 
ATOM   2400  C CG  . GLU B 1 145 ? 68.639  30.113 117.157 1.00 85.96  ? 145 GLU B CG  1 
ATOM   2401  C CD  . GLU B 1 145 ? 67.192  30.436 116.864 1.00 85.96  ? 145 GLU B CD  1 
ATOM   2402  O OE1 . GLU B 1 145 ? 66.921  31.220 115.921 1.00 85.96  ? 145 GLU B OE1 1 
ATOM   2403  O OE2 . GLU B 1 145 ? 66.330  29.883 117.581 1.00 85.96  ? 145 GLU B OE2 1 
ATOM   2404  N N   . ALA B 1 146 ? 72.213  32.994 117.268 1.00 42.73  ? 146 ALA B N   1 
ATOM   2405  C CA  . ALA B 1 146 ? 73.244  33.785 116.597 1.00 42.73  ? 146 ALA B CA  1 
ATOM   2406  C C   . ALA B 1 146 ? 74.624  33.098 116.670 1.00 42.73  ? 146 ALA B C   1 
ATOM   2407  O O   . ALA B 1 146 ? 75.351  33.035 115.680 1.00 42.73  ? 146 ALA B O   1 
ATOM   2408  C CB  . ALA B 1 146 ? 73.311  35.196 117.230 1.00 43.01  ? 146 ALA B CB  1 
ATOM   2409  N N   . VAL B 1 147 ? 74.963  32.577 117.847 1.00 44.10  ? 147 VAL B N   1 
ATOM   2410  C CA  . VAL B 1 147 ? 76.235  31.914 118.067 1.00 44.10  ? 147 VAL B CA  1 
ATOM   2411  C C   . VAL B 1 147 ? 76.321  30.629 117.279 1.00 44.10  ? 147 VAL B C   1 
ATOM   2412  O O   . VAL B 1 147 ? 77.295  30.389 116.570 1.00 44.10  ? 147 VAL B O   1 
ATOM   2413  C CB  . VAL B 1 147 ? 76.435  31.607 119.555 1.00 30.48  ? 147 VAL B CB  1 
ATOM   2414  C CG1 . VAL B 1 147 ? 77.655  30.776 119.756 1.00 30.48  ? 147 VAL B CG1 1 
ATOM   2415  C CG2 . VAL B 1 147 ? 76.591  32.885 120.316 1.00 30.48  ? 147 VAL B CG2 1 
ATOM   2416  N N   . THR B 1 148 ? 75.303  29.792 117.394 1.00 46.27  ? 148 THR B N   1 
ATOM   2417  C CA  . THR B 1 148 ? 75.325  28.541 116.661 1.00 46.27  ? 148 THR B CA  1 
ATOM   2418  C C   . THR B 1 148 ? 75.352  28.846 115.173 1.00 46.27  ? 148 THR B C   1 
ATOM   2419  O O   . THR B 1 148 ? 76.106  28.231 114.410 1.00 46.27  ? 148 THR B O   1 
ATOM   2420  C CB  . THR B 1 148 ? 74.102  27.679 116.992 1.00 49.16  ? 148 THR B CB  1 
ATOM   2421  O OG1 . THR B 1 148 ? 74.075  27.414 118.401 1.00 49.16  ? 148 THR B OG1 1 
ATOM   2422  C CG2 . THR B 1 148 ? 74.168  26.367 116.237 1.00 49.16  ? 148 THR B CG2 1 
ATOM   2423  N N   . ASP B 1 149 ? 74.536  29.810 114.758 1.00 40.07  ? 149 ASP B N   1 
ATOM   2424  C CA  . ASP B 1 149 ? 74.519  30.179 113.357 1.00 40.07  ? 149 ASP B CA  1 
ATOM   2425  C C   . ASP B 1 149 ? 75.931  30.627 112.923 1.00 40.07  ? 149 ASP B C   1 
ATOM   2426  O O   . ASP B 1 149 ? 76.435  30.244 111.849 1.00 40.07  ? 149 ASP B O   1 
ATOM   2427  C CB  . ASP B 1 149 ? 73.488  31.282 113.112 1.00 44.30  ? 149 ASP B CB  1 
ATOM   2428  C CG  . ASP B 1 149 ? 73.252  31.534 111.626 1.00 44.30  ? 149 ASP B CG  1 
ATOM   2429  O OD1 . ASP B 1 149 ? 73.018  30.551 110.881 1.00 44.30  ? 149 ASP B OD1 1 
ATOM   2430  O OD2 . ASP B 1 149 ? 73.301  32.714 111.205 1.00 44.30  ? 149 ASP B OD2 1 
ATOM   2431  N N   . GLY B 1 150 ? 76.577  31.433 113.760 1.00 34.75  ? 150 GLY B N   1 
ATOM   2432  C CA  . GLY B 1 150 ? 77.925  31.876 113.435 1.00 34.75  ? 150 GLY B CA  1 
ATOM   2433  C C   . GLY B 1 150 ? 78.867  30.689 113.291 1.00 34.75  ? 150 GLY B C   1 
ATOM   2434  O O   . GLY B 1 150 ? 79.579  30.562 112.295 1.00 34.75  ? 150 GLY B O   1 
ATOM   2435  N N   . LEU B 1 151 ? 78.849  29.805 114.281 1.00 28.27  ? 151 LEU B N   1 
ATOM   2436  C CA  . LEU B 1 151 ? 79.701  28.638 114.265 1.00 28.27  ? 151 LEU B CA  1 
ATOM   2437  C C   . LEU B 1 151 ? 79.552  27.809 112.992 1.00 28.27  ? 151 LEU B C   1 
ATOM   2438  O O   . LEU B 1 151 ? 80.552  27.376 112.401 1.00 28.27  ? 151 LEU B O   1 
ATOM   2439  C CB  . LEU B 1 151 ? 79.403  27.768 115.472 1.00 24.81  ? 151 LEU B CB  1 
ATOM   2440  C CG  . LEU B 1 151 ? 80.227  26.490 115.532 1.00 24.81  ? 151 LEU B CG  1 
ATOM   2441  C CD1 . LEU B 1 151 ? 81.729  26.781 115.280 1.00 24.81  ? 151 LEU B CD1 1 
ATOM   2442  C CD2 . LEU B 1 151 ? 79.979  25.856 116.895 1.00 24.81  ? 151 LEU B CD2 1 
ATOM   2443  N N   . LYS B 1 152 ? 78.312  27.574 112.565 1.00 35.29  ? 152 LYS B N   1 
ATOM   2444  C CA  . LYS B 1 152 ? 78.097  26.798 111.349 1.00 35.29  ? 152 LYS B CA  1 
ATOM   2445  C C   . LYS B 1 152 ? 78.648  27.554 110.140 1.00 35.29  ? 152 LYS B C   1 
ATOM   2446  O O   . LYS B 1 152 ? 79.339  26.995 109.291 1.00 35.29  ? 152 LYS B O   1 
ATOM   2447  C CB  . LYS B 1 152 ? 76.611  26.511 111.139 1.00 44.62  ? 152 LYS B CB  1 
ATOM   2448  C CG  . LYS B 1 152 ? 76.008  25.660 112.224 1.00 44.62  ? 152 LYS B CG  1 
ATOM   2449  C CD  . LYS B 1 152 ? 74.628  25.112 111.866 1.00 44.62  ? 152 LYS B CD  1 
ATOM   2450  C CE  . LYS B 1 152 ? 73.579  26.197 111.660 1.00 44.62  ? 152 LYS B CE  1 
ATOM   2451  N NZ  . LYS B 1 152 ? 72.207  25.597 111.591 1.00 44.62  ? 152 LYS B NZ  1 
ATOM   2452  N N   . ARG B 1 153 ? 78.351  28.836 110.061 1.00 39.78  ? 153 ARG B N   1 
ATOM   2453  C CA  . ARG B 1 153 ? 78.833  29.589 108.936 1.00 39.78  ? 153 ARG B CA  1 
ATOM   2454  C C   . ARG B 1 153 ? 80.355  29.604 108.886 1.00 39.78  ? 153 ARG B C   1 
ATOM   2455  O O   . ARG B 1 153 ? 80.938  29.619 107.810 1.00 39.78  ? 153 ARG B O   1 
ATOM   2456  C CB  . ARG B 1 153 ? 78.290  31.008 108.997 1.00 40.26  ? 153 ARG B CB  1 
ATOM   2457  C CG  . ARG B 1 153 ? 76.878  31.141 108.465 1.00 40.26  ? 153 ARG B CG  1 
ATOM   2458  C CD  . ARG B 1 153 ? 76.317  32.539 108.736 1.00 40.26  ? 153 ARG B CD  1 
ATOM   2459  N NE  . ARG B 1 153 ? 77.025  33.581 108.000 1.00 40.26  ? 153 ARG B NE  1 
ATOM   2460  C CZ  . ARG B 1 153 ? 76.974  33.705 106.684 1.00 40.26  ? 153 ARG B CZ  1 
ATOM   2461  N NH1 . ARG B 1 153 ? 76.245  32.856 105.979 1.00 40.26  ? 153 ARG B NH1 1 
ATOM   2462  N NH2 . ARG B 1 153 ? 77.658  34.663 106.076 1.00 40.26  ? 153 ARG B NH2 1 
ATOM   2463  N N   . ALA B 1 154 ? 81.005  29.589 110.045 1.00 29.73  ? 154 ALA B N   1 
ATOM   2464  C CA  . ALA B 1 154 ? 82.463  29.624 110.069 1.00 29.73  ? 154 ALA B CA  1 
ATOM   2465  C C   . ALA B 1 154 ? 83.081  28.303 109.626 1.00 29.73  ? 154 ALA B C   1 
ATOM   2466  O O   . ALA B 1 154 ? 84.049  28.280 108.858 1.00 29.73  ? 154 ALA B O   1 
ATOM   2467  C CB  . ALA B 1 154 ? 82.942  29.992 111.446 1.00 20.18  ? 154 ALA B CB  1 
ATOM   2468  N N   . LEU B 1 155 ? 82.520  27.206 110.119 1.00 42.04  ? 155 LEU B N   1 
ATOM   2469  C CA  . LEU B 1 155 ? 83.004  25.894 109.753 1.00 42.04  ? 155 LEU B CA  1 
ATOM   2470  C C   . LEU B 1 155 ? 82.812  25.625 108.256 1.00 42.04  ? 155 LEU B C   1 
ATOM   2471  O O   . LEU B 1 155 ? 83.632  24.949 107.635 1.00 42.04  ? 155 LEU B O   1 
ATOM   2472  C CB  . LEU B 1 155 ? 82.293  24.849 110.599 1.00 38.68  ? 155 LEU B CB  1 
ATOM   2473  C CG  . LEU B 1 155 ? 82.801  24.828 112.052 1.00 38.68  ? 155 LEU B CG  1 
ATOM   2474  C CD1 . LEU B 1 155 ? 81.923  23.966 112.936 1.00 38.68  ? 155 LEU B CD1 1 
ATOM   2475  C CD2 . LEU B 1 155 ? 84.211  24.288 112.071 1.00 38.68  ? 155 LEU B CD2 1 
ATOM   2476  N N   . ARG B 1 156 ? 81.749  26.169 107.668 1.00 34.07  ? 156 ARG B N   1 
ATOM   2477  C CA  . ARG B 1 156 ? 81.510  25.972 106.245 1.00 34.07  ? 156 ARG B CA  1 
ATOM   2478  C C   . ARG B 1 156 ? 82.748  26.314 105.446 1.00 34.07  ? 156 ARG B C   1 
ATOM   2479  O O   . ARG B 1 156 ? 83.026  25.699 104.428 1.00 34.07  ? 156 ARG B O   1 
ATOM   2480  C CB  . ARG B 1 156 ? 80.388  26.864 105.728 1.00 65.48  ? 156 ARG B CB  1 
ATOM   2481  C CG  . ARG B 1 156 ? 79.007  26.483 106.139 1.00 65.48  ? 156 ARG B CG  1 
ATOM   2482  C CD  . ARG B 1 156 ? 78.023  27.379 105.401 1.00 65.48  ? 156 ARG B CD  1 
ATOM   2483  N NE  . ARG B 1 156 ? 76.714  27.414 106.040 1.00 65.48  ? 156 ARG B NE  1 
ATOM   2484  C CZ  . ARG B 1 156 ? 75.803  28.340 105.777 1.00 65.48  ? 156 ARG B CZ  1 
ATOM   2485  N NH1 . ARG B 1 156 ? 76.070  29.290 104.884 1.00 65.48  ? 156 ARG B NH1 1 
ATOM   2486  N NH2 . ARG B 1 156 ? 74.645  28.339 106.426 1.00 65.48  ? 156 ARG B NH2 1 
ATOM   2487  N N   . SER B 1 157 ? 83.490  27.309 105.897 1.00 45.25  ? 157 SER B N   1 
ATOM   2488  C CA  . SER B 1 157 ? 84.672  27.736 105.175 1.00 45.25  ? 157 SER B CA  1 
ATOM   2489  C C   . SER B 1 157 ? 85.713  26.653 104.971 1.00 45.25  ? 157 SER B C   1 
ATOM   2490  O O   . SER B 1 157 ? 86.546  26.771 104.080 1.00 45.25  ? 157 SER B O   1 
ATOM   2491  C CB  . SER B 1 157 ? 85.295  28.942 105.868 1.00 61.50  ? 157 SER B CB  1 
ATOM   2492  O OG  . SER B 1 157 ? 84.383  30.026 105.869 1.00 61.50  ? 157 SER B OG  1 
ATOM   2493  N N   . PHE B 1 158 ? 85.672  25.593 105.768 1.00 44.84  ? 158 PHE B N   1 
ATOM   2494  C CA  . PHE B 1 158 ? 86.651  24.525 105.604 1.00 44.84  ? 158 PHE B CA  1 
ATOM   2495  C C   . PHE B 1 158 ? 86.318  23.573 104.448 1.00 44.84  ? 158 PHE B C   1 
ATOM   2496  O O   . PHE B 1 158 ? 87.171  22.806 103.999 1.00 44.84  ? 158 PHE B O   1 
ATOM   2497  C CB  . PHE B 1 158 ? 86.817  23.735 106.916 1.00 39.84  ? 158 PHE B CB  1 
ATOM   2498  C CG  . PHE B 1 158 ? 87.568  24.492 107.981 1.00 39.84  ? 158 PHE B CG  1 
ATOM   2499  C CD1 . PHE B 1 158 ? 86.919  24.998 109.099 1.00 39.84  ? 158 PHE B CD1 1 
ATOM   2500  C CD2 . PHE B 1 158 ? 88.916  24.781 107.821 1.00 39.84  ? 158 PHE B CD2 1 
ATOM   2501  C CE1 . PHE B 1 158 ? 87.614  25.787 110.029 1.00 39.84  ? 158 PHE B CE1 1 
ATOM   2502  C CE2 . PHE B 1 158 ? 89.603  25.564 108.746 1.00 39.84  ? 158 PHE B CE2 1 
ATOM   2503  C CZ  . PHE B 1 158 ? 88.947  26.063 109.843 1.00 39.84  ? 158 PHE B CZ  1 
ATOM   2504  N N   . GLY B 1 159 ? 85.086  23.616 103.956 1.00 51.28  ? 159 GLY B N   1 
ATOM   2505  C CA  . GLY B 1 159 ? 84.735  22.724 102.864 1.00 51.28  ? 159 GLY B CA  1 
ATOM   2506  C C   . GLY B 1 159 ? 83.319  22.172 102.832 1.00 51.28  ? 159 GLY B C   1 
ATOM   2507  O O   . GLY B 1 159 ? 82.501  22.431 103.713 1.00 51.28  ? 159 GLY B O   1 
ATOM   2508  N N   . ASN B 1 160 ? 83.034  21.382 101.807 1.00 47.12  ? 160 ASN B N   1 
ATOM   2509  C CA  . ASN B 1 160 ? 81.700  20.826 101.662 1.00 47.12  ? 160 ASN B CA  1 
ATOM   2510  C C   . ASN B 1 160 ? 81.311  19.931 102.813 1.00 47.12  ? 160 ASN B C   1 
ATOM   2511  O O   . ASN B 1 160 ? 80.202  20.011 103.318 1.00 47.12  ? 160 ASN B O   1 
ATOM   2512  C CB  . ASN B 1 160 ? 81.572  20.037 100.347 1.00 61.11  ? 160 ASN B CB  1 
ATOM   2513  C CG  . ASN B 1 160 ? 81.818  20.897 99.127  1.00 61.11  ? 160 ASN B CG  1 
ATOM   2514  O OD1 . ASN B 1 160 ? 81.247  21.975 98.994  1.00 61.11  ? 160 ASN B OD1 1 
ATOM   2515  N ND2 . ASN B 1 160 ? 82.671  20.423 98.228  1.00 61.11  ? 160 ASN B ND2 1 
ATOM   2516  N N   . ALA B 1 161 ? 82.225  19.078 103.240 1.00 47.35  ? 161 ALA B N   1 
ATOM   2517  C CA  . ALA B 1 161 ? 81.894  18.163 104.316 1.00 47.35  ? 161 ALA B CA  1 
ATOM   2518  C C   . ALA B 1 161 ? 81.469  18.839 105.605 1.00 47.35  ? 161 ALA B C   1 
ATOM   2519  O O   . ALA B 1 161 ? 80.953  18.176 106.484 1.00 47.35  ? 161 ALA B O   1 
ATOM   2520  C CB  . ALA B 1 161 ? 83.052  17.221 104.571 1.00 41.61  ? 161 ALA B CB  1 
ATOM   2521  N N   . LEU B 1 162 ? 81.687  20.145 105.743 1.00 57.36  ? 162 LEU B N   1 
ATOM   2522  C CA  . LEU B 1 162 ? 81.268  20.851 106.966 1.00 57.36  ? 162 LEU B CA  1 
ATOM   2523  C C   . LEU B 1 162 ? 80.146  21.838 106.662 1.00 57.36  ? 162 LEU B C   1 
ATOM   2524  O O   . LEU B 1 162 ? 79.853  22.751 107.446 1.00 57.36  ? 162 LEU B O   1 
ATOM   2525  C CB  . LEU B 1 162 ? 82.457  21.557 107.644 1.00 43.26  ? 162 LEU B CB  1 
ATOM   2526  C CG  . LEU B 1 162 ? 83.458  20.601 108.336 1.00 43.26  ? 162 LEU B CG  1 
ATOM   2527  C CD1 . LEU B 1 162 ? 84.714  21.306 108.741 1.00 43.26  ? 162 LEU B CD1 1 
ATOM   2528  C CD2 . LEU B 1 162 ? 82.817  20.014 109.540 1.00 43.26  ? 162 LEU B CD2 1 
ATOM   2529  N N   . GLY B 1 163 ? 79.537  21.641 105.492 1.00 44.60  ? 163 GLY B N   1 
ATOM   2530  C CA  . GLY B 1 163 ? 78.405  22.441 105.088 1.00 44.60  ? 163 GLY B CA  1 
ATOM   2531  C C   . GLY B 1 163 ? 78.535  23.415 103.953 1.00 44.60  ? 163 GLY B C   1 
ATOM   2532  O O   . GLY B 1 163 ? 77.574  24.125 103.692 1.00 44.60  ? 163 GLY B O   1 
ATOM   2533  N N   . ASN B 1 164 ? 79.667  23.482 103.264 1.00 62.81  ? 164 ASN B N   1 
ATOM   2534  C CA  . ASN B 1 164 ? 79.757  24.467 102.196 1.00 62.81  ? 164 ASN B CA  1 
ATOM   2535  C C   . ASN B 1 164 ? 78.884  24.129 101.010 1.00 62.81  ? 164 ASN B C   1 
ATOM   2536  O O   . ASN B 1 164 ? 78.671  24.966 100.141 1.00 62.81  ? 164 ASN B O   1 
ATOM   2537  C CB  . ASN B 1 164 ? 81.189  24.650 101.731 1.00 43.46  ? 164 ASN B CB  1 
ATOM   2538  C CG  . ASN B 1 164 ? 81.357  25.872 100.869 1.00 43.46  ? 164 ASN B CG  1 
ATOM   2539  O OD1 . ASN B 1 164 ? 80.789  26.932 101.152 1.00 43.46  ? 164 ASN B OD1 1 
ATOM   2540  N ND2 . ASN B 1 164 ? 82.154  25.745 99.822  1.00 43.46  ? 164 ASN B ND2 1 
ATOM   2541  N N   . CYS B 1 165 ? 78.367  22.908 100.972 1.00 83.33  ? 165 CYS B N   1 
ATOM   2542  C CA  . CYS B 1 165 ? 77.504  22.502 99.871  1.00 83.33  ? 165 CYS B CA  1 
ATOM   2543  C C   . CYS B 1 165 ? 76.062  22.994 100.079 1.00 83.33  ? 165 CYS B C   1 
ATOM   2544  O O   . CYS B 1 165 ? 75.373  23.347 99.122  1.00 83.33  ? 165 CYS B O   1 
ATOM   2545  C CB  . CYS B 1 165 ? 77.543  20.969 99.699  1.00 71.11  ? 165 CYS B CB  1 
ATOM   2546  S SG  . CYS B 1 165 ? 77.114  19.958 101.171 1.00 71.11  ? 165 CYS B SG  1 
ATOM   2547  N N   . ILE B 1 166 ? 75.627  23.039 101.335 1.00 60.21  ? 166 ILE B N   1 
ATOM   2548  C CA  . ILE B 1 166 ? 74.269  23.468 101.702 1.00 60.21  ? 166 ILE B CA  1 
ATOM   2549  C C   . ILE B 1 166 ? 73.785  24.717 100.964 1.00 60.21  ? 166 ILE B C   1 
ATOM   2550  O O   . ILE B 1 166 ? 72.589  25.017 100.957 1.00 60.21  ? 166 ILE B O   1 
ATOM   2551  C CB  . ILE B 1 166 ? 74.176  23.751 103.225 1.00 64.27  ? 166 ILE B CB  1 
ATOM   2552  C CG1 . ILE B 1 166 ? 72.724  23.772 103.673 1.00 64.27  ? 166 ILE B CG1 1 
ATOM   2553  C CG2 . ILE B 1 166 ? 74.773  25.105 103.546 1.00 64.27  ? 166 ILE B CG2 1 
ATOM   2554  C CD1 . ILE B 1 166 ? 72.079  22.425 103.644 1.00 64.27  ? 166 ILE B CD1 1 
ATOM   2555  N N   . LEU B 1 167 ? 74.723  25.446 100.362 1.00 88.98  ? 167 LEU B N   1 
ATOM   2556  C CA  . LEU B 1 167 ? 74.422  26.678 99.631  1.00 88.98  ? 167 LEU B CA  1 
ATOM   2557  C C   . LEU B 1 167 ? 74.250  26.407 98.137  1.00 88.98  ? 167 LEU B C   1 
ATOM   2558  O O   . LEU B 1 167 ? 73.451  27.058 97.468  1.00 88.98  ? 167 LEU B O   1 
ATOM   2559  C CB  . LEU B 1 167 ? 75.561  27.690 99.828  1.00 96.84  ? 167 LEU B CB  1 
ATOM   2560  C CG  . LEU B 1 167 ? 75.890  28.101 101.265 1.00 96.84  ? 167 LEU B CG  1 
ATOM   2561  C CD1 . LEU B 1 167 ? 77.304  28.695 101.361 1.00 96.84  ? 167 LEU B CD1 1 
ATOM   2562  C CD2 . LEU B 1 167 ? 74.822  29.077 101.738 1.00 96.84  ? 167 LEU B CD2 1 
ATOM   2563  N N   . ASP B 1 168 ? 75.020  25.449 97.628  1.00 88.09  ? 168 ASP B N   1 
ATOM   2564  C CA  . ASP B 1 168 ? 74.992  25.076 96.220  1.00 88.09  ? 168 ASP B CA  1 
ATOM   2565  C C   . ASP B 1 168 ? 73.577  24.704 95.780  1.00 88.09  ? 168 ASP B C   1 
ATOM   2566  O O   . ASP B 1 168 ? 72.969  23.788 96.330  1.00 88.09  ? 168 ASP B O   1 
ATOM   2567  C CB  . ASP B 1 168 ? 75.930  23.890 95.984  1.00 96.28  ? 168 ASP B CB  1 
ATOM   2568  C CG  . ASP B 1 168 ? 76.280  23.705 94.525  1.00 96.28  ? 168 ASP B CG  1 
ATOM   2569  O OD1 . ASP B 1 168 ? 75.471  24.125 93.670  1.00 96.28  ? 168 ASP B OD1 1 
ATOM   2570  O OD2 . ASP B 1 168 ? 77.357  23.132 94.234  1.00 96.28  ? 168 ASP B OD2 1 
ATOM   2571  N N   . LYS B 1 169 ? 73.055  25.411 94.784  1.00 70.35  ? 169 LYS B N   1 
ATOM   2572  C CA  . LYS B 1 169 ? 71.709  25.141 94.285  1.00 70.35  ? 169 LYS B CA  1 
ATOM   2573  C C   . LYS B 1 169 ? 71.669  23.796 93.552  1.00 70.35  ? 169 LYS B C   1 
ATOM   2574  O O   . LYS B 1 169 ? 70.720  23.025 93.708  1.00 70.35  ? 169 LYS B O   1 
ATOM   2575  C CB  . LYS B 1 169 ? 71.264  26.278 93.363  1.00 128.44 ? 169 LYS B CB  1 
ATOM   2576  C CG  . LYS B 1 169 ? 71.278  27.640 94.044  1.00 128.44 ? 169 LYS B CG  1 
ATOM   2577  C CD  . LYS B 1 169 ? 71.061  28.769 93.051  1.00 128.44 ? 169 LYS B CD  1 
ATOM   2578  C CE  . LYS B 1 169 ? 71.159  30.125 93.734  1.00 128.44 ? 169 LYS B CE  1 
ATOM   2579  N NZ  . LYS B 1 169 ? 70.968  31.251 92.774  1.00 128.44 ? 169 LYS B NZ  1 
ATOM   2580  N N   . ASP B 1 170 ? 72.707  23.515 92.763  1.00 72.67  ? 170 ASP B N   1 
ATOM   2581  C CA  . ASP B 1 170 ? 72.794  22.252 92.025  1.00 72.67  ? 170 ASP B CA  1 
ATOM   2582  C C   . ASP B 1 170 ? 72.806  21.096 93.007  1.00 72.67  ? 170 ASP B C   1 
ATOM   2583  O O   . ASP B 1 170 ? 72.211  20.050 92.756  1.00 72.67  ? 170 ASP B O   1 
ATOM   2584  C CB  . ASP B 1 170 ? 74.072  22.185 91.184  1.00 97.07  ? 170 ASP B CB  1 
ATOM   2585  C CG  . ASP B 1 170 ? 74.139  23.268 90.135  1.00 97.07  ? 170 ASP B CG  1 
ATOM   2586  O OD1 . ASP B 1 170 ? 73.157  23.421 89.378  1.00 97.07  ? 170 ASP B OD1 1 
ATOM   2587  O OD2 . ASP B 1 170 ? 75.179  23.959 90.065  1.00 97.07  ? 170 ASP B OD2 1 
ATOM   2588  N N   . TYR B 1 171 ? 73.503  21.291 94.121  1.00 70.31  ? 171 TYR B N   1 
ATOM   2589  C CA  . TYR B 1 171 ? 73.593  20.279 95.165  1.00 70.31  ? 171 TYR B CA  1 
ATOM   2590  C C   . TYR B 1 171 ? 72.208  19.991 95.710  1.00 70.31  ? 171 TYR B C   1 
ATOM   2591  O O   . TYR B 1 171 ? 71.796  18.828 95.799  1.00 70.31  ? 171 TYR B O   1 
ATOM   2592  C CB  . TYR B 1 171 ? 74.497  20.765 96.308  1.00 58.12  ? 171 TYR B CB  1 
ATOM   2593  C CG  . TYR B 1 171 ? 74.378  19.962 97.596  1.00 58.12  ? 171 TYR B CG  1 
ATOM   2594  C CD1 . TYR B 1 171 ? 74.872  18.660 97.679  1.00 58.12  ? 171 TYR B CD1 1 
ATOM   2595  C CD2 . TYR B 1 171 ? 73.732  20.496 98.718  1.00 58.12  ? 171 TYR B CD2 1 
ATOM   2596  C CE1 . TYR B 1 171 ? 74.727  17.906 98.844  1.00 58.12  ? 171 TYR B CE1 1 
ATOM   2597  C CE2 . TYR B 1 171 ? 73.577  19.751 99.885  1.00 58.12  ? 171 TYR B CE2 1 
ATOM   2598  C CZ  . TYR B 1 171 ? 74.078  18.458 99.940  1.00 58.12  ? 171 TYR B CZ  1 
ATOM   2599  O OH  . TYR B 1 171 ? 73.930  17.723 101.097 1.00 58.12  ? 171 TYR B OH  1 
ATOM   2600  N N   . LEU B 1 172 ? 71.496  21.054 96.080  1.00 69.27  ? 172 LEU B N   1 
ATOM   2601  C CA  . LEU B 1 172 ? 70.155  20.916 96.630  1.00 69.27  ? 172 LEU B CA  1 
ATOM   2602  C C   . LEU B 1 172 ? 69.207  20.138 95.713  1.00 69.27  ? 172 LEU B C   1 
ATOM   2603  O O   . LEU B 1 172 ? 68.550  19.200 96.165  1.00 69.27  ? 172 LEU B O   1 
ATOM   2604  C CB  . LEU B 1 172 ? 69.563  22.291 96.926  1.00 65.25  ? 172 LEU B CB  1 
ATOM   2605  C CG  . LEU B 1 172 ? 70.174  23.064 98.086  1.00 65.25  ? 172 LEU B CG  1 
ATOM   2606  C CD1 . LEU B 1 172 ? 69.563  24.440 98.149  1.00 65.25  ? 172 LEU B CD1 1 
ATOM   2607  C CD2 . LEU B 1 172 ? 69.912  22.316 99.369  1.00 65.25  ? 172 LEU B CD2 1 
ATOM   2608  N N   . ARG B 1 173 ? 69.130  20.522 94.436  1.00 107.21 ? 173 ARG B N   1 
ATOM   2609  C CA  . ARG B 1 173 ? 68.237  19.835 93.510  1.00 107.21 ? 173 ARG B CA  1 
ATOM   2610  C C   . ARG B 1 173 ? 68.503  18.341 93.558  1.00 107.21 ? 173 ARG B C   1 
ATOM   2611  O O   . ARG B 1 173 ? 67.562  17.549 93.629  1.00 107.21 ? 173 ARG B O   1 
ATOM   2612  C CB  . ARG B 1 173 ? 68.406  20.366 92.082  1.00 119.66 ? 173 ARG B CB  1 
ATOM   2613  C CG  . ARG B 1 173 ? 67.856  21.781 91.874  1.00 119.66 ? 173 ARG B CG  1 
ATOM   2614  C CD  . ARG B 1 173 ? 67.858  22.217 90.399  1.00 119.66 ? 173 ARG B CD  1 
ATOM   2615  N NE  . ARG B 1 173 ? 69.195  22.236 89.804  1.00 119.66 ? 173 ARG B NE  1 
ATOM   2616  C CZ  . ARG B 1 173 ? 69.835  21.164 89.342  1.00 119.66 ? 173 ARG B CZ  1 
ATOM   2617  N NH1 . ARG B 1 173 ? 69.266  19.967 89.392  1.00 119.66 ? 173 ARG B NH1 1 
ATOM   2618  N NH2 . ARG B 1 173 ? 71.055  21.289 88.835  1.00 119.66 ? 173 ARG B NH2 1 
ATOM   2619  N N   . SER B 1 174 ? 69.781  17.962 93.544  1.00 50.89  ? 174 SER B N   1 
ATOM   2620  C CA  . SER B 1 174 ? 70.174  16.540 93.604  1.00 50.89  ? 174 SER B CA  1 
ATOM   2621  C C   . SER B 1 174 ? 69.677  15.841 94.875  1.00 50.89  ? 174 SER B C   1 
ATOM   2622  O O   . SER B 1 174 ? 69.545  14.620 94.927  1.00 50.89  ? 174 SER B O   1 
ATOM   2623  C CB  . SER B 1 174 ? 71.688  16.405 93.527  1.00 65.33  ? 174 SER B CB  1 
ATOM   2624  O OG  . SER B 1 174 ? 72.143  16.973 92.319  1.00 65.33  ? 174 SER B OG  1 
ATOM   2625  N N   . LEU B 1 175 ? 69.399  16.633 95.897  1.00 84.61  ? 175 LEU B N   1 
ATOM   2626  C CA  . LEU B 1 175 ? 68.902  16.097 97.144  1.00 84.61  ? 175 LEU B CA  1 
ATOM   2627  C C   . LEU B 1 175 ? 67.434  15.714 97.034  1.00 84.61  ? 175 LEU B C   1 
ATOM   2628  O O   . LEU B 1 175 ? 67.029  14.673 97.544  1.00 84.61  ? 175 LEU B O   1 
ATOM   2629  C CB  . LEU B 1 175 ? 69.086  17.117 98.263  1.00 94.68  ? 175 LEU B CB  1 
ATOM   2630  C CG  . LEU B 1 175 ? 70.491  17.193 98.851  1.00 94.68  ? 175 LEU B CG  1 
ATOM   2631  C CD1 . LEU B 1 175 ? 70.554  18.315 99.877  1.00 94.68  ? 175 LEU B CD1 1 
ATOM   2632  C CD2 . LEU B 1 175 ? 70.839  15.857 99.486  1.00 94.68  ? 175 LEU B CD2 1 
ATOM   2633  N N   . ASN B 1 176 ? 66.633  16.554 96.384  1.00 157.77 ? 176 ASN B N   1 
ATOM   2634  C CA  . ASN B 1 176 ? 65.214  16.261 96.227  1.00 157.77 ? 176 ASN B CA  1 
ATOM   2635  C C   . ASN B 1 176 ? 65.073  15.007 95.390  1.00 157.77 ? 176 ASN B C   1 
ATOM   2636  O O   . ASN B 1 176 ? 64.183  14.190 95.624  1.00 157.77 ? 176 ASN B O   1 
ATOM   2637  C CB  . ASN B 1 176 ? 64.493  17.412 95.531  1.00 152.43 ? 176 ASN B CB  1 
ATOM   2638  C CG  . ASN B 1 176 ? 64.642  18.716 96.270  1.00 152.43 ? 176 ASN B CG  1 
ATOM   2639  O OD1 . ASN B 1 176 ? 64.340  18.809 97.460  1.00 152.43 ? 176 ASN B OD1 1 
ATOM   2640  N ND2 . ASN B 1 176 ? 65.111  19.739 95.568  1.00 152.43 ? 176 ASN B ND2 1 
ATOM   2641  N N   . LYS B 1 177 ? 65.968  14.858 94.418  1.00 75.79  ? 177 LYS B N   1 
ATOM   2642  C CA  . LYS B 1 177 ? 65.962  13.702 93.523  1.00 75.79  ? 177 LYS B CA  1 
ATOM   2643  C C   . LYS B 1 177 ? 66.443  12.435 94.232  1.00 75.79  ? 177 LYS B C   1 
ATOM   2644  O O   . LYS B 1 177 ? 66.843  11.457 93.591  1.00 75.79  ? 177 LYS B O   1 
ATOM   2645  C CB  . LYS B 1 177 ? 66.837  13.970 92.288  1.00 113.20 ? 177 LYS B CB  1 
ATOM   2646  C CG  . LYS B 1 177 ? 66.355  15.120 91.406  1.00 113.20 ? 177 LYS B CG  1 
ATOM   2647  C CD  . LYS B 1 177 ? 67.287  15.356 90.220  1.00 113.20 ? 177 LYS B CD  1 
ATOM   2648  C CE  . LYS B 1 177 ? 66.857  16.573 89.401  1.00 113.20 ? 177 LYS B CE  1 
ATOM   2649  N NZ  . LYS B 1 177 ? 67.782  16.860 88.263  1.00 113.20 ? 177 LYS B NZ  1 
ATOM   2650  N N   . LEU B 1 178 ? 66.395  12.457 95.559  1.00 74.95  ? 178 LEU B N   1 
ATOM   2651  C CA  . LEU B 1 178 ? 66.820  11.310 96.348  1.00 74.95  ? 178 LEU B CA  1 
ATOM   2652  C C   . LEU B 1 178 ? 65.748  10.829 97.287  1.00 74.95  ? 178 LEU B C   1 
ATOM   2653  O O   . LEU B 1 178 ? 64.882  11.594 97.703  1.00 74.95  ? 178 LEU B O   1 
ATOM   2654  C CB  . LEU B 1 178 ? 68.065  11.629 97.153  1.00 72.55  ? 178 LEU B CB  1 
ATOM   2655  C CG  . LEU B 1 178 ? 69.367  11.527 96.369  1.00 72.55  ? 178 LEU B CG  1 
ATOM   2656  C CD1 . LEU B 1 178 ? 70.510  11.871 97.295  1.00 72.55  ? 178 LEU B CD1 1 
ATOM   2657  C CD2 . LEU B 1 178 ? 69.546  10.124 95.805  1.00 72.55  ? 178 LEU B CD2 1 
ATOM   2658  N N   . PRO B 1 179 ? 65.806  9.544  97.652  1.00 87.24  ? 179 PRO B N   1 
ATOM   2659  C CA  . PRO B 1 179 ? 64.821  8.944  98.554  1.00 87.24  ? 179 PRO B CA  1 
ATOM   2660  C C   . PRO B 1 179 ? 64.759  9.664  99.884  1.00 87.24  ? 179 PRO B C   1 
ATOM   2661  O O   . PRO B 1 179 ? 65.681  9.579  100.692 1.00 87.24  ? 179 PRO B O   1 
ATOM   2662  C CB  . PRO B 1 179 ? 65.294  7.499  98.681  1.00 63.91  ? 179 PRO B CB  1 
ATOM   2663  C CG  . PRO B 1 179 ? 66.077  7.270  97.406  1.00 63.91  ? 179 PRO B CG  1 
ATOM   2664  C CD  . PRO B 1 179 ? 66.825  8.562  97.248  1.00 63.91  ? 179 PRO B CD  1 
ATOM   2665  N N   . ARG B 1 180 ? 63.672  10.393 100.097 1.00 171.92 ? 180 ARG B N   1 
ATOM   2666  C CA  . ARG B 1 180 ? 63.497  11.119 101.339 1.00 171.92 ? 180 ARG B CA  1 
ATOM   2667  C C   . ARG B 1 180 ? 63.403  10.074 102.448 1.00 171.92 ? 180 ARG B C   1 
ATOM   2668  O O   . ARG B 1 180 ? 62.307  9.689  102.857 1.00 171.92 ? 180 ARG B O   1 
ATOM   2669  C CB  . ARG B 1 180 ? 62.216  11.951 101.275 1.00 197.69 ? 180 ARG B CB  1 
ATOM   2670  C CG  . ARG B 1 180 ? 62.358  13.350 101.846 1.00 197.69 ? 180 ARG B CG  1 
ATOM   2671  C CD  . ARG B 1 180 ? 62.821  13.310 103.292 1.00 197.69 ? 180 ARG B CD  1 
ATOM   2672  N NE  . ARG B 1 180 ? 61.890  12.574 104.142 1.00 197.69 ? 180 ARG B NE  1 
ATOM   2673  C CZ  . ARG B 1 180 ? 62.074  12.359 105.441 1.00 197.69 ? 180 ARG B CZ  1 
ATOM   2674  N NH1 . ARG B 1 180 ? 63.160  12.824 106.043 1.00 197.69 ? 180 ARG B NH1 1 
ATOM   2675  N NH2 . ARG B 1 180 ? 61.174  11.676 106.137 1.00 197.69 ? 180 ARG B NH2 1 
ATOM   2676  N N   . GLN B 1 181 ? 64.560  9.609  102.917 1.00 174.18 ? 181 GLN B N   1 
ATOM   2677  C CA  . GLN B 1 181 ? 64.630  8.593  103.967 1.00 174.18 ? 181 GLN B CA  1 
ATOM   2678  C C   . GLN B 1 181 ? 63.969  9.044  105.260 1.00 174.18 ? 181 GLN B C   1 
ATOM   2679  O O   . GLN B 1 181 ? 63.811  10.240 105.509 1.00 174.18 ? 181 GLN B O   1 
ATOM   2680  C CB  . GLN B 1 181 ? 66.082  8.229  104.259 1.00 131.14 ? 181 GLN B CB  1 
ATOM   2681  C CG  . GLN B 1 181 ? 66.897  9.400  104.769 1.00 131.14 ? 181 GLN B CG  1 
ATOM   2682  C CD  . GLN B 1 181 ? 68.276  8.984  105.204 1.00 131.14 ? 181 GLN B CD  1 
ATOM   2683  O OE1 . GLN B 1 181 ? 68.439  8.276  106.198 1.00 131.14 ? 181 GLN B OE1 1 
ATOM   2684  N NE2 . GLN B 1 181 ? 69.281  9.409  104.456 1.00 131.14 ? 181 GLN B NE2 1 
ATOM   2685  N N   . LEU B 1 182 ? 63.608  8.074  106.091 1.00 180.29 ? 182 LEU B N   1 
ATOM   2686  C CA  . LEU B 1 182 ? 62.945  8.354  107.356 1.00 180.29 ? 182 LEU B CA  1 
ATOM   2687  C C   . LEU B 1 182 ? 63.954  8.406  108.504 1.00 180.29 ? 182 LEU B C   1 
ATOM   2688  O O   . LEU B 1 182 ? 64.998  7.754  108.449 1.00 180.29 ? 182 LEU B O   1 
ATOM   2689  C CB  . LEU B 1 182 ? 61.891  7.274  107.624 1.00 152.83 ? 182 LEU B CB  1 
ATOM   2690  C CG  . LEU B 1 182 ? 60.744  7.616  108.580 1.00 152.83 ? 182 LEU B CG  1 
ATOM   2691  C CD1 . LEU B 1 182 ? 59.974  8.819  108.043 1.00 152.83 ? 182 LEU B CD1 1 
ATOM   2692  C CD2 . LEU B 1 182 ? 59.821  6.420  108.729 1.00 152.83 ? 182 LEU B CD2 1 
ATOM   2693  N N   . PRO B 1 183 ? 63.652  9.191  109.559 1.00 126.90 ? 183 PRO B N   1 
ATOM   2694  C CA  . PRO B 1 183 ? 64.516  9.345  110.732 1.00 126.90 ? 183 PRO B CA  1 
ATOM   2695  C C   . PRO B 1 183 ? 65.229  8.068  111.150 1.00 126.90 ? 183 PRO B C   1 
ATOM   2696  O O   . PRO B 1 183 ? 64.642  6.988  111.150 1.00 126.90 ? 183 PRO B O   1 
ATOM   2697  C CB  . PRO B 1 183 ? 63.546  9.847  111.792 1.00 112.53 ? 183 PRO B CB  1 
ATOM   2698  C CG  . PRO B 1 183 ? 62.706  10.779 111.004 1.00 112.53 ? 183 PRO B CG  1 
ATOM   2699  C CD  . PRO B 1 183 ? 62.424  9.992  109.729 1.00 112.53 ? 183 PRO B CD  1 
ATOM   2700  N N   . LEU B 1 184 ? 66.502  8.208  111.505 1.00 117.18 ? 184 LEU B N   1 
ATOM   2701  C CA  . LEU B 1 184 ? 67.321  7.077  111.921 1.00 117.18 ? 184 LEU B CA  1 
ATOM   2702  C C   . LEU B 1 184 ? 66.994  6.707  113.360 1.00 117.18 ? 184 LEU B C   1 
ATOM   2703  O O   . LEU B 1 184 ? 66.805  7.582  114.207 1.00 117.18 ? 184 LEU B O   1 
ATOM   2704  C CB  . LEU B 1 184 ? 68.811  7.426  111.799 1.00 199.94 ? 184 LEU B CB  1 
ATOM   2705  C CG  . LEU B 1 184 ? 69.350  8.029  110.491 1.00 199.94 ? 184 LEU B CG  1 
ATOM   2706  C CD1 . LEU B 1 184 ? 68.896  7.186  109.306 1.00 199.94 ? 184 LEU B CD1 1 
ATOM   2707  C CD2 . LEU B 1 184 ? 68.869  9.468  110.336 1.00 199.94 ? 184 LEU B CD2 1 
ATOM   2708  N N   . GLU B 1 185 ? 66.915  5.407  113.626 1.00 93.82  ? 185 GLU B N   1 
ATOM   2709  C CA  . GLU B 1 185 ? 66.619  4.916  114.966 1.00 93.82  ? 185 GLU B CA  1 
ATOM   2710  C C   . GLU B 1 185 ? 67.916  4.921  115.768 1.00 93.82  ? 185 GLU B C   1 
ATOM   2711  O O   . GLU B 1 185 ? 68.919  4.361  115.330 1.00 93.82  ? 185 GLU B O   1 
ATOM   2712  C CB  . GLU B 1 185 ? 66.059  3.496  114.899 1.00 196.78 ? 185 GLU B CB  1 
ATOM   2713  C CG  . GLU B 1 185 ? 65.738  2.900  116.255 1.00 196.78 ? 185 GLU B CG  1 
ATOM   2714  C CD  . GLU B 1 185 ? 65.328  1.446  116.167 1.00 196.78 ? 185 GLU B CD  1 
ATOM   2715  O OE1 . GLU B 1 185 ? 66.134  0.630  115.672 1.00 196.78 ? 185 GLU B OE1 1 
ATOM   2716  O OE2 . GLU B 1 185 ? 64.200  1.119  116.592 1.00 196.78 ? 185 GLU B OE2 1 
ATOM   2717  N N   . VAL B 1 186 ? 67.895  5.547  116.940 1.00 88.93  ? 186 VAL B N   1 
ATOM   2718  C CA  . VAL B 1 186 ? 69.089  5.632  117.775 1.00 88.93  ? 186 VAL B CA  1 
ATOM   2719  C C   . VAL B 1 186 ? 69.200  4.484  118.785 1.00 88.93  ? 186 VAL B C   1 
ATOM   2720  O O   . VAL B 1 186 ? 68.426  4.398  119.745 1.00 88.93  ? 186 VAL B O   1 
ATOM   2721  C CB  . VAL B 1 186 ? 69.122  6.973  118.530 1.00 82.87  ? 186 VAL B CB  1 
ATOM   2722  C CG1 . VAL B 1 186 ? 70.418  7.101  119.299 1.00 82.87  ? 186 VAL B CG1 1 
ATOM   2723  C CG2 . VAL B 1 186 ? 68.960  8.125  117.553 1.00 82.87  ? 186 VAL B CG2 1 
ATOM   2724  N N   . ASP B 1 187 ? 70.179  3.611  118.567 1.00 96.29  ? 187 ASP B N   1 
ATOM   2725  C CA  . ASP B 1 187 ? 70.401  2.459  119.441 1.00 96.29  ? 187 ASP B CA  1 
ATOM   2726  C C   . ASP B 1 187 ? 71.132  2.846  120.715 1.00 96.29  ? 187 ASP B C   1 
ATOM   2727  O O   . ASP B 1 187 ? 72.348  3.017  120.717 1.00 96.29  ? 187 ASP B O   1 
ATOM   2728  C CB  . ASP B 1 187 ? 71.199  1.384  118.700 1.00 90.95  ? 187 ASP B CB  1 
ATOM   2729  C CG  . ASP B 1 187 ? 71.584  0.229  119.593 1.00 90.95  ? 187 ASP B CG  1 
ATOM   2730  O OD1 . ASP B 1 187 ? 70.698  -0.285 120.308 1.00 90.95  ? 187 ASP B OD1 1 
ATOM   2731  O OD2 . ASP B 1 187 ? 72.770  -0.164 119.574 1.00 90.95  ? 187 ASP B OD2 1 
ATOM   2732  N N   . LEU B 1 188 ? 70.383  2.956  121.805 1.00 68.21  ? 188 LEU B N   1 
ATOM   2733  C CA  . LEU B 1 188 ? 70.951  3.346  123.087 1.00 68.21  ? 188 LEU B CA  1 
ATOM   2734  C C   . LEU B 1 188 ? 71.379  2.158  123.956 1.00 68.21  ? 188 LEU B C   1 
ATOM   2735  O O   . LEU B 1 188 ? 71.331  2.240  125.184 1.00 68.21  ? 188 LEU B O   1 
ATOM   2736  C CB  . LEU B 1 188 ? 69.933  4.208  123.852 1.00 73.33  ? 188 LEU B CB  1 
ATOM   2737  C CG  . LEU B 1 188 ? 69.296  5.381  123.094 1.00 73.33  ? 188 LEU B CG  1 
ATOM   2738  C CD1 . LEU B 1 188 ? 68.292  6.086  123.981 1.00 73.33  ? 188 LEU B CD1 1 
ATOM   2739  C CD2 . LEU B 1 188 ? 70.372  6.353  122.650 1.00 73.33  ? 188 LEU B CD2 1 
ATOM   2740  N N   . THR B 1 189 ? 71.804  1.058  123.343 1.00 82.44  ? 189 THR B N   1 
ATOM   2741  C CA  . THR B 1 189 ? 72.203  -0.103 124.138 1.00 82.44  ? 189 THR B CA  1 
ATOM   2742  C C   . THR B 1 189 ? 73.592  0.058  124.716 1.00 82.44  ? 189 THR B C   1 
ATOM   2743  O O   . THR B 1 189 ? 73.840  -0.311 125.864 1.00 82.44  ? 189 THR B O   1 
ATOM   2744  C CB  . THR B 1 189 ? 72.172  -1.405 123.321 1.00 77.34  ? 189 THR B CB  1 
ATOM   2745  O OG1 . THR B 1 189 ? 73.060  -1.299 122.202 1.00 77.34  ? 189 THR B OG1 1 
ATOM   2746  C CG2 . THR B 1 189 ? 70.761  -1.685 122.839 1.00 77.34  ? 189 THR B CG2 1 
ATOM   2747  N N   . LYS B 1 190 ? 74.500  0.608  123.919 1.00 108.15 ? 190 LYS B N   1 
ATOM   2748  C CA  . LYS B 1 190 ? 75.867  0.815  124.370 1.00 108.15 ? 190 LYS B CA  1 
ATOM   2749  C C   . LYS B 1 190 ? 76.047  2.257  124.832 1.00 108.15 ? 190 LYS B C   1 
ATOM   2750  O O   . LYS B 1 190 ? 77.152  2.800  124.804 1.00 108.15 ? 190 LYS B O   1 
ATOM   2751  C CB  . LYS B 1 190 ? 76.846  0.488  123.241 1.00 136.08 ? 190 LYS B CB  1 
ATOM   2752  C CG  . LYS B 1 190 ? 76.784  -0.965 122.789 1.00 136.08 ? 190 LYS B CG  1 
ATOM   2753  C CD  . LYS B 1 190 ? 77.815  -1.273 121.714 1.00 136.08 ? 190 LYS B CD  1 
ATOM   2754  C CE  . LYS B 1 190 ? 77.742  -2.732 121.280 1.00 136.08 ? 190 LYS B CE  1 
ATOM   2755  N NZ  . LYS B 1 190 ? 78.727  -3.052 120.208 1.00 136.08 ? 190 LYS B NZ  1 
ATOM   2756  N N   . ALA B 1 191 ? 74.949  2.866  125.268 1.00 60.55  ? 191 ALA B N   1 
ATOM   2757  C CA  . ALA B 1 191 ? 74.966  4.246  125.733 1.00 60.55  ? 191 ALA B CA  1 
ATOM   2758  C C   . ALA B 1 191 ? 75.718  4.345  127.035 1.00 60.55  ? 191 ALA B C   1 
ATOM   2759  O O   . ALA B 1 191 ? 75.701  3.405  127.830 1.00 60.55  ? 191 ALA B O   1 
ATOM   2760  C CB  . ALA B 1 191 ? 73.553  4.758  125.929 1.00 47.54  ? 191 ALA B CB  1 
ATOM   2761  N N   . LYS B 1 192 ? 76.366  5.487  127.253 1.00 63.19  ? 192 LYS B N   1 
ATOM   2762  C CA  . LYS B 1 192 ? 77.132  5.707  128.473 1.00 63.19  ? 192 LYS B CA  1 
ATOM   2763  C C   . LYS B 1 192 ? 76.143  5.765  129.608 1.00 63.19  ? 192 LYS B C   1 
ATOM   2764  O O   . LYS B 1 192 ? 75.163  6.512  129.531 1.00 63.19  ? 192 LYS B O   1 
ATOM   2765  C CB  . LYS B 1 192 ? 77.917  7.016  128.388 1.00 67.80  ? 192 LYS B CB  1 
ATOM   2766  C CG  . LYS B 1 192 ? 78.773  7.328  129.604 1.00 67.80  ? 192 LYS B CG  1 
ATOM   2767  C CD  . LYS B 1 192 ? 79.568  8.606  129.389 1.00 67.80  ? 192 LYS B CD  1 
ATOM   2768  C CE  . LYS B 1 192 ? 80.316  8.996  130.637 1.00 67.80  ? 192 LYS B CE  1 
ATOM   2769  N NZ  . LYS B 1 192 ? 81.272  7.939  131.036 1.00 67.80  ? 192 LYS B NZ  1 
ATOM   2770  N N   . ARG B 1 193 ? 76.396  4.976  130.653 1.00 64.40  ? 193 ARG B N   1 
ATOM   2771  C CA  . ARG B 1 193 ? 75.494  4.917  131.794 1.00 64.40  ? 193 ARG B CA  1 
ATOM   2772  C C   . ARG B 1 193 ? 76.044  5.374  133.137 1.00 64.40  ? 193 ARG B C   1 
ATOM   2773  O O   . ARG B 1 193 ? 75.289  5.493  134.108 1.00 64.40  ? 193 ARG B O   1 
ATOM   2774  C CB  . ARG B 1 193 ? 74.927  3.511  131.926 1.00 103.55 ? 193 ARG B CB  1 
ATOM   2775  C CG  . ARG B 1 193 ? 73.956  3.179  130.827 1.00 103.55 ? 193 ARG B CG  1 
ATOM   2776  C CD  . ARG B 1 193 ? 73.001  2.102  131.264 1.00 103.55 ? 193 ARG B CD  1 
ATOM   2777  N NE  . ARG B 1 193 ? 71.793  2.114  130.451 1.00 103.55 ? 193 ARG B NE  1 
ATOM   2778  C CZ  . ARG B 1 193 ? 71.780  1.912  129.140 1.00 103.55 ? 193 ARG B CZ  1 
ATOM   2779  N NH1 . ARG B 1 193 ? 72.915  1.680  128.485 1.00 103.55 ? 193 ARG B NH1 1 
ATOM   2780  N NH2 . ARG B 1 193 ? 70.628  1.942  128.484 1.00 103.55 ? 193 ARG B NH2 1 
ATOM   2781  N N   . GLN B 1 194 ? 77.350  5.615  133.202 1.00 77.24  ? 194 GLN B N   1 
ATOM   2782  C CA  . GLN B 1 194 ? 77.981  6.100  134.425 1.00 77.24  ? 194 GLN B CA  1 
ATOM   2783  C C   . GLN B 1 194 ? 79.162  6.996  134.048 1.00 77.24  ? 194 GLN B C   1 
ATOM   2784  O O   . GLN B 1 194 ? 79.629  6.957  132.909 1.00 77.24  ? 194 GLN B O   1 
ATOM   2785  C CB  . GLN B 1 194 ? 78.401  4.926  135.314 1.00 87.33  ? 194 GLN B CB  1 
ATOM   2786  C CG  . GLN B 1 194 ? 78.934  3.733  134.572 1.00 87.33  ? 194 GLN B CG  1 
ATOM   2787  C CD  . GLN B 1 194 ? 80.338  3.947  134.103 1.00 87.33  ? 194 GLN B CD  1 
ATOM   2788  O OE1 . GLN B 1 194 ? 81.254  4.101  134.911 1.00 87.33  ? 194 GLN B OE1 1 
ATOM   2789  N NE2 . GLN B 1 194 ? 80.527  3.967  132.786 1.00 87.33  ? 194 GLN B NE2 1 
ATOM   2790  N N   . ASP B 1 195 ? 79.630  7.814  134.990 1.00 67.63  ? 195 ASP B N   1 
ATOM   2791  C CA  . ASP B 1 195 ? 80.727  8.751  134.729 1.00 67.63  ? 195 ASP B CA  1 
ATOM   2792  C C   . ASP B 1 195 ? 82.085  8.152  134.335 1.00 67.63  ? 195 ASP B C   1 
ATOM   2793  O O   . ASP B 1 195 ? 82.597  8.433  133.261 1.00 67.63  ? 195 ASP B O   1 
ATOM   2794  C CB  . ASP B 1 195 ? 80.927  9.692  135.930 1.00 59.20  ? 195 ASP B CB  1 
ATOM   2795  C CG  . ASP B 1 195 ? 79.677  10.518 136.254 1.00 59.20  ? 195 ASP B CG  1 
ATOM   2796  O OD1 . ASP B 1 195 ? 78.934  10.878 135.320 1.00 59.20  ? 195 ASP B OD1 1 
ATOM   2797  O OD2 . ASP B 1 195 ? 79.438  10.823 137.446 1.00 59.20  ? 195 ASP B OD2 1 
ATOM   2798  N N   . LEU B 1 196 ? 82.661  7.326  135.199 1.00 69.97  ? 196 LEU B N   1 
ATOM   2799  C CA  . LEU B 1 196 ? 83.972  6.738  134.947 1.00 69.97  ? 196 LEU B CA  1 
ATOM   2800  C C   . LEU B 1 196 ? 84.202  6.244  133.525 1.00 69.97  ? 196 LEU B C   1 
ATOM   2801  O O   . LEU B 1 196 ? 83.265  5.837  132.846 1.00 69.97  ? 196 LEU B O   1 
ATOM   2802  C CB  . LEU B 1 196 ? 84.227  5.608  135.938 1.00 70.47  ? 196 LEU B CB  1 
ATOM   2803  C CG  . LEU B 1 196 ? 85.651  5.070  135.939 1.00 70.47  ? 196 LEU B CG  1 
ATOM   2804  C CD1 . LEU B 1 196 ? 86.654  6.221  135.986 1.00 70.47  ? 196 LEU B CD1 1 
ATOM   2805  C CD2 . LEU B 1 196 ? 85.820  4.164  137.130 1.00 70.47  ? 196 LEU B CD2 1 
ATOM   2806  N N   . GLU B 1 197 ? 85.465  6.292  133.093 1.00 45.05  ? 197 GLU B N   1 
ATOM   2807  C CA  . GLU B 1 197 ? 85.900  5.879  131.759 1.00 45.05  ? 197 GLU B CA  1 
ATOM   2808  C C   . GLU B 1 197 ? 87.253  5.216  131.943 1.00 45.05  ? 197 GLU B C   1 
ATOM   2809  O O   . GLU B 1 197 ? 88.288  5.833  131.720 1.00 45.05  ? 197 GLU B O   1 
ATOM   2810  C CB  . GLU B 1 197 ? 86.091  7.099  130.860 1.00 48.08  ? 197 GLU B CB  1 
ATOM   2811  C CG  . GLU B 1 197 ? 84.838  7.797  130.398 1.00 48.08  ? 197 GLU B CG  1 
ATOM   2812  C CD  . GLU B 1 197 ? 84.120  7.024  129.311 1.00 48.08  ? 197 GLU B CD  1 
ATOM   2813  O OE1 . GLU B 1 197 ? 84.800  6.360  128.485 1.00 48.08  ? 197 GLU B OE1 1 
ATOM   2814  O OE2 . GLU B 1 197 ? 82.876  7.097  129.271 1.00 48.08  ? 197 GLU B OE2 1 
ATOM   2815  N N   . PRO B 1 198 ? 87.267  3.940  132.328 1.00 61.78  ? 198 PRO B N   1 
ATOM   2816  C CA  . PRO B 1 198 ? 88.495  3.168  132.556 1.00 61.78  ? 198 PRO B CA  1 
ATOM   2817  C C   . PRO B 1 198 ? 89.551  3.289  131.471 1.00 61.78  ? 198 PRO B C   1 
ATOM   2818  O O   . PRO B 1 198 ? 90.733  3.512  131.741 1.00 61.78  ? 198 PRO B O   1 
ATOM   2819  C CB  . PRO B 1 198 ? 87.981  1.741  132.674 1.00 59.20  ? 198 PRO B CB  1 
ATOM   2820  C CG  . PRO B 1 198 ? 86.594  1.934  133.220 1.00 59.20  ? 198 PRO B CG  1 
ATOM   2821  C CD  . PRO B 1 198 ? 86.087  3.064  132.383 1.00 59.20  ? 198 PRO B CD  1 
ATOM   2822  N N   . SER B 1 199 ? 89.116  3.123  130.237 1.00 50.64  ? 199 SER B N   1 
ATOM   2823  C CA  . SER B 1 199 ? 90.025  3.182  129.114 1.00 50.64  ? 199 SER B CA  1 
ATOM   2824  C C   . SER B 1 199 ? 90.807  4.499  129.121 1.00 50.64  ? 199 SER B C   1 
ATOM   2825  O O   . SER B 1 199 ? 92.038  4.519  128.963 1.00 50.64  ? 199 SER B O   1 
ATOM   2826  C CB  . SER B 1 199 ? 89.227  3.026  127.825 1.00 53.98  ? 199 SER B CB  1 
ATOM   2827  O OG  . SER B 1 199 ? 90.089  3.034  126.711 1.00 53.98  ? 199 SER B OG  1 
ATOM   2828  N N   . VAL B 1 200 ? 90.081  5.595  129.315 1.00 58.50  ? 200 VAL B N   1 
ATOM   2829  C CA  . VAL B 1 200 ? 90.686  6.915  129.337 1.00 58.50  ? 200 VAL B CA  1 
ATOM   2830  C C   . VAL B 1 200 ? 91.542  7.096  130.583 1.00 58.50  ? 200 VAL B C   1 
ATOM   2831  O O   . VAL B 1 200 ? 92.721  7.463  130.491 1.00 58.50  ? 200 VAL B O   1 
ATOM   2832  C CB  . VAL B 1 200 ? 89.610  8.006  129.301 1.00 42.51  ? 200 VAL B CB  1 
ATOM   2833  C CG1 . VAL B 1 200 ? 90.253  9.366  129.360 1.00 42.51  ? 200 VAL B CG1 1 
ATOM   2834  C CG2 . VAL B 1 200 ? 88.781  7.858  128.033 1.00 42.51  ? 200 VAL B CG2 1 
ATOM   2835  N N   . GLU B 1 201 ? 90.945  6.827  131.742 1.00 45.92  ? 201 GLU B N   1 
ATOM   2836  C CA  . GLU B 1 201 ? 91.649  6.964  133.011 1.00 45.92  ? 201 GLU B CA  1 
ATOM   2837  C C   . GLU B 1 201 ? 93.009  6.283  132.920 1.00 45.92  ? 201 GLU B C   1 
ATOM   2838  O O   . GLU B 1 201 ? 94.027  6.788  133.416 1.00 45.92  ? 201 GLU B O   1 
ATOM   2839  C CB  . GLU B 1 201 ? 90.815  6.361  134.147 1.00 74.34  ? 201 GLU B CB  1 
ATOM   2840  C CG  . GLU B 1 201 ? 91.431  6.478  135.544 1.00 74.34  ? 201 GLU B CG  1 
ATOM   2841  C CD  . GLU B 1 201 ? 91.824  7.909  135.939 1.00 74.34  ? 201 GLU B CD  1 
ATOM   2842  O OE1 . GLU B 1 201 ? 91.010  8.851  135.768 1.00 74.34  ? 201 GLU B OE1 1 
ATOM   2843  O OE2 . GLU B 1 201 ? 92.954  8.083  136.441 1.00 74.34  ? 201 GLU B OE2 1 
ATOM   2844  N N   . GLU B 1 202 ? 93.035  5.143  132.252 1.00 51.67  ? 202 GLU B N   1 
ATOM   2845  C CA  . GLU B 1 202 ? 94.282  4.429  132.113 1.00 51.67  ? 202 GLU B CA  1 
ATOM   2846  C C   . GLU B 1 202 ? 95.294  5.206  131.283 1.00 51.67  ? 202 GLU B C   1 
ATOM   2847  O O   . GLU B 1 202 ? 96.369  5.552  131.773 1.00 51.67  ? 202 GLU B O   1 
ATOM   2848  C CB  . GLU B 1 202 ? 94.035  3.072  131.482 1.00 110.04 ? 202 GLU B CB  1 
ATOM   2849  C CG  . GLU B 1 202 ? 95.269  2.215  131.442 1.00 110.04 ? 202 GLU B CG  1 
ATOM   2850  C CD  . GLU B 1 202 ? 94.958  0.806  131.020 1.00 110.04 ? 202 GLU B CD  1 
ATOM   2851  O OE1 . GLU B 1 202 ? 94.544  0.609  129.859 1.00 110.04 ? 202 GLU B OE1 1 
ATOM   2852  O OE2 . GLU B 1 202 ? 95.118  -0.107 131.854 1.00 110.04 ? 202 GLU B OE2 1 
ATOM   2853  N N   . ALA B 1 203 ? 94.942  5.490  130.034 1.00 56.45  ? 203 ALA B N   1 
ATOM   2854  C CA  . ALA B 1 203 ? 95.836  6.209  129.135 1.00 56.45  ? 203 ALA B CA  1 
ATOM   2855  C C   . ALA B 1 203 ? 96.336  7.509  129.729 1.00 56.45  ? 203 ALA B C   1 
ATOM   2856  O O   . ALA B 1 203 ? 97.467  7.922  129.476 1.00 56.45  ? 203 ALA B O   1 
ATOM   2857  C CB  . ALA B 1 203 ? 95.147  6.486  127.814 1.00 40.04  ? 203 ALA B CB  1 
ATOM   2858  N N   . ARG B 1 204 ? 95.484  8.163  130.504 1.00 57.10  ? 204 ARG B N   1 
ATOM   2859  C CA  . ARG B 1 204 ? 95.857  9.415  131.141 1.00 57.10  ? 204 ARG B CA  1 
ATOM   2860  C C   . ARG B 1 204 ? 96.927  9.203  132.212 1.00 57.10  ? 204 ARG B C   1 
ATOM   2861  O O   . ARG B 1 204 ? 97.947  9.901  132.235 1.00 57.10  ? 204 ARG B O   1 
ATOM   2862  C CB  . ARG B 1 204 ? 94.635  10.043 131.780 1.00 40.01  ? 204 ARG B CB  1 
ATOM   2863  C CG  . ARG B 1 204 ? 94.926  11.289 132.591 1.00 40.01  ? 204 ARG B CG  1 
ATOM   2864  C CD  . ARG B 1 204 ? 93.627  11.832 133.127 1.00 40.01  ? 204 ARG B CD  1 
ATOM   2865  N NE  . ARG B 1 204 ? 92.659  11.980 132.048 1.00 40.01  ? 204 ARG B NE  1 
ATOM   2866  C CZ  . ARG B 1 204 ? 91.407  11.571 132.116 1.00 40.01  ? 204 ARG B CZ  1 
ATOM   2867  N NH1 . ARG B 1 204 ? 90.951  10.982 133.208 1.00 40.01  ? 204 ARG B NH1 1 
ATOM   2868  N NH2 . ARG B 1 204 ? 90.611  11.752 131.087 1.00 40.01  ? 204 ARG B NH2 1 
ATOM   2869  N N   . TYR B 1 205 ? 96.682  8.246  133.104 1.00 62.00  ? 205 TYR B N   1 
ATOM   2870  C CA  . TYR B 1 205 ? 97.631  7.955  134.162 1.00 62.00  ? 205 TYR B CA  1 
ATOM   2871  C C   . TYR B 1 205 ? 99.022  7.653  133.577 1.00 62.00  ? 205 TYR B C   1 
ATOM   2872  O O   . TYR B 1 205 ? 100.040 8.116  134.095 1.00 62.00  ? 205 TYR B O   1 
ATOM   2873  C CB  . TYR B 1 205 ? 97.136  6.778  135.014 1.00 77.90  ? 205 TYR B CB  1 
ATOM   2874  C CG  . TYR B 1 205 ? 98.090  6.418  136.130 1.00 77.90  ? 205 TYR B CG  1 
ATOM   2875  C CD1 . TYR B 1 205 ? 98.332  7.302  137.174 1.00 77.90  ? 205 TYR B CD1 1 
ATOM   2876  C CD2 . TYR B 1 205 ? 98.822  5.227  136.092 1.00 77.90  ? 205 TYR B CD2 1 
ATOM   2877  C CE1 . TYR B 1 205 ? 99.286  7.016  138.149 1.00 77.90  ? 205 TYR B CE1 1 
ATOM   2878  C CE2 . TYR B 1 205 ? 99.777  4.932  137.061 1.00 77.90  ? 205 TYR B CE2 1 
ATOM   2879  C CZ  . TYR B 1 205 ? 100.007 5.829  138.083 1.00 77.90  ? 205 TYR B CZ  1 
ATOM   2880  O OH  . TYR B 1 205 ? 100.966 5.539  139.027 1.00 77.90  ? 205 TYR B OH  1 
ATOM   2881  N N   . ASN B 1 206 ? 99.064  6.890  132.489 1.00 56.80  ? 206 ASN B N   1 
ATOM   2882  C CA  . ASN B 1 206 ? 100.339 6.550  131.860 1.00 56.80  ? 206 ASN B CA  1 
ATOM   2883  C C   . ASN B 1 206 ? 100.919 7.750  131.117 1.00 56.80  ? 206 ASN B C   1 
ATOM   2884  O O   . ASN B 1 206 ? 102.017 7.671  130.550 1.00 56.80  ? 206 ASN B O   1 
ATOM   2885  C CB  . ASN B 1 206 ? 100.163 5.395  130.862 1.00 84.68  ? 206 ASN B CB  1 
ATOM   2886  C CG  . ASN B 1 206 ? 99.491  4.176  131.475 1.00 84.68  ? 206 ASN B CG  1 
ATOM   2887  O OD1 . ASN B 1 206 ? 99.954  3.638  132.473 1.00 84.68  ? 206 ASN B OD1 1 
ATOM   2888  N ND2 . ASN B 1 206 ? 98.399  3.731  130.867 1.00 84.68  ? 206 ASN B ND2 1 
ATOM   2889  N N   . SER B 1 207 ? 100.178 8.854  131.109 1.00 102.27 ? 207 SER B N   1 
ATOM   2890  C CA  . SER B 1 207 ? 100.608 10.065 130.427 1.00 102.27 ? 207 SER B CA  1 
ATOM   2891  C C   . SER B 1 207 ? 101.369 10.984 131.365 1.00 102.27 ? 207 SER B C   1 
ATOM   2892  O O   . SER B 1 207 ? 101.867 12.025 130.948 1.00 102.27 ? 207 SER B O   1 
ATOM   2893  C CB  . SER B 1 207 ? 99.393  10.798 129.862 1.00 108.94 ? 207 SER B CB  1 
ATOM   2894  O OG  . SER B 1 207 ? 99.780  11.987 129.205 1.00 108.94 ? 207 SER B OG  1 
ATOM   2895  N N   . CYS B 1 208 ? 101.456 10.594 132.632 1.00 96.33  ? 208 CYS B N   1 
ATOM   2896  C CA  . CYS B 1 208 ? 102.149 11.385 133.645 1.00 96.33  ? 208 CYS B CA  1 
ATOM   2897  C C   . CYS B 1 208 ? 103.536 10.795 133.964 1.00 96.33  ? 208 CYS B C   1 
ATOM   2898  O O   . CYS B 1 208 ? 103.910 9.795  133.310 1.00 96.33  ? 208 CYS B O   1 
ATOM   2899  C CB  . CYS B 1 208 ? 101.306 11.447 134.929 1.00 76.26  ? 208 CYS B CB  1 
ATOM   2900  S SG  . CYS B 1 208 ? 99.612  12.108 134.785 1.00 76.26  ? 208 CYS B SG  1 
ATOM   2901  N N   . CYS C 1 25  ? 102.647 22.089 131.470 1.00 102.20 ? 25  CYS C N   1 
ATOM   2902  C CA  . CYS C 1 25  ? 101.503 22.391 132.382 1.00 102.20 ? 25  CYS C CA  1 
ATOM   2903  C C   . CYS C 1 25  ? 100.176 22.457 131.622 1.00 102.20 ? 25  CYS C C   1 
ATOM   2904  O O   . CYS C 1 25  ? 99.965  21.725 130.663 1.00 102.20 ? 25  CYS C O   1 
ATOM   2905  C CB  . CYS C 1 25  ? 101.746 23.724 133.105 1.00 74.92  ? 25  CYS C CB  1 
ATOM   2906  S SG  . CYS C 1 25  ? 101.769 25.203 132.019 1.00 74.92  ? 25  CYS C SG  1 
ATOM   2907  N N   . PHE C 1 26  ? 99.288  23.346 132.057 1.00 54.14  ? 26  PHE C N   1 
ATOM   2908  C CA  . PHE C 1 26  ? 97.984  23.520 131.430 1.00 54.14  ? 26  PHE C CA  1 
ATOM   2909  C C   . PHE C 1 26  ? 98.048  24.476 130.245 1.00 54.14  ? 26  PHE C C   1 
ATOM   2910  O O   . PHE C 1 26  ? 98.533  25.590 130.369 1.00 54.14  ? 26  PHE C O   1 
ATOM   2911  C CB  . PHE C 1 26  ? 96.986  24.075 132.433 1.00 38.62  ? 26  PHE C CB  1 
ATOM   2912  C CG  . PHE C 1 26  ? 95.573  23.843 132.032 1.00 38.62  ? 26  PHE C CG  1 
ATOM   2913  C CD1 . PHE C 1 26  ? 94.943  22.631 132.331 1.00 38.62  ? 26  PHE C CD1 1 
ATOM   2914  C CD2 . PHE C 1 26  ? 94.889  24.797 131.299 1.00 38.62  ? 26  PHE C CD2 1 
ATOM   2915  C CE1 . PHE C 1 26  ? 93.652  22.386 131.901 1.00 38.62  ? 26  PHE C CE1 1 
ATOM   2916  C CE2 . PHE C 1 26  ? 93.601  24.567 130.860 1.00 38.62  ? 26  PHE C CE2 1 
ATOM   2917  C CZ  . PHE C 1 26  ? 92.970  23.358 131.158 1.00 38.62  ? 26  PHE C CZ  1 
ATOM   2918  N N   . GLY C 1 27  ? 97.522  24.065 129.102 1.00 62.52  ? 27  GLY C N   1 
ATOM   2919  C CA  . GLY C 1 27  ? 97.590  24.921 127.937 1.00 62.52  ? 27  GLY C CA  1 
ATOM   2920  C C   . GLY C 1 27  ? 98.830  24.522 127.162 1.00 62.52  ? 27  GLY C C   1 
ATOM   2921  O O   . GLY C 1 27  ? 98.946  24.805 125.974 1.00 62.52  ? 27  GLY C O   1 
ATOM   2922  N N   . GLN C 1 28  ? 99.757  23.851 127.849 1.00 69.96  ? 28  GLN C N   1 
ATOM   2923  C CA  . GLN C 1 28  ? 101.005 23.370 127.263 1.00 69.96  ? 28  GLN C CA  1 
ATOM   2924  C C   . GLN C 1 28  ? 100.875 21.883 126.885 1.00 69.96  ? 28  GLN C C   1 
ATOM   2925  O O   . GLN C 1 28  ? 101.082 21.499 125.733 1.00 69.96  ? 28  GLN C O   1 
ATOM   2926  C CB  . GLN C 1 28  ? 102.154 23.515 128.267 1.00 124.43 ? 28  GLN C CB  1 
ATOM   2927  C CG  . GLN C 1 28  ? 102.394 24.919 128.812 1.00 124.43 ? 28  GLN C CG  1 
ATOM   2928  C CD  . GLN C 1 28  ? 103.005 25.864 127.794 1.00 124.43 ? 28  GLN C CD  1 
ATOM   2929  O OE1 . GLN C 1 28  ? 103.457 26.954 128.144 1.00 124.43 ? 28  GLN C OE1 1 
ATOM   2930  N NE2 . GLN C 1 28  ? 103.018 25.455 126.530 1.00 124.43 ? 28  GLN C NE2 1 
ATOM   2931  N N   . CYS C 1 29  ? 100.525 21.053 127.863 1.00 66.24  ? 29  CYS C N   1 
ATOM   2932  C CA  . CYS C 1 29  ? 100.397 19.617 127.657 1.00 66.24  ? 29  CYS C CA  1 
ATOM   2933  C C   . CYS C 1 29  ? 99.739  19.237 126.342 1.00 66.24  ? 29  CYS C C   1 
ATOM   2934  O O   . CYS C 1 29  ? 98.789  19.869 125.908 1.00 66.24  ? 29  CYS C O   1 
ATOM   2935  C CB  . CYS C 1 29  ? 99.617  18.985 128.810 1.00 117.88 ? 29  CYS C CB  1 
ATOM   2936  S SG  . CYS C 1 29  ? 100.416 19.100 130.422 1.00 117.88 ? 29  CYS C SG  1 
ATOM   2937  N N   . GLN C 1 30  ? 100.266 18.201 125.706 1.00 65.65  ? 30  GLN C N   1 
ATOM   2938  C CA  . GLN C 1 30  ? 99.729  17.707 124.454 1.00 65.65  ? 30  GLN C CA  1 
ATOM   2939  C C   . GLN C 1 30  ? 99.256  16.296 124.761 1.00 65.65  ? 30  GLN C C   1 
ATOM   2940  O O   . GLN C 1 30  ? 99.940  15.571 125.477 1.00 65.65  ? 30  GLN C O   1 
ATOM   2941  C CB  . GLN C 1 30  ? 100.817 17.659 123.381 1.00 94.22  ? 30  GLN C CB  1 
ATOM   2942  C CG  . GLN C 1 30  ? 101.319 19.015 122.953 1.00 94.22  ? 30  GLN C CG  1 
ATOM   2943  C CD  . GLN C 1 30  ? 102.385 18.918 121.885 1.00 94.22  ? 30  GLN C CD  1 
ATOM   2944  O OE1 . GLN C 1 30  ? 102.208 18.215 120.895 1.00 94.22  ? 30  GLN C OE1 1 
ATOM   2945  N NE2 . GLN C 1 30  ? 103.496 19.631 122.075 1.00 94.22  ? 30  GLN C NE2 1 
ATOM   2946  N N   . TYR C 1 31  ? 98.096  15.901 124.240 1.00 38.41  ? 31  TYR C N   1 
ATOM   2947  C CA  . TYR C 1 31  ? 97.593  14.566 124.506 1.00 38.41  ? 31  TYR C CA  1 
ATOM   2948  C C   . TYR C 1 31  ? 98.539  13.524 123.908 1.00 38.41  ? 31  TYR C C   1 
ATOM   2949  O O   . TYR C 1 31  ? 99.230  13.790 122.927 1.00 38.41  ? 31  TYR C O   1 
ATOM   2950  C CB  . TYR C 1 31  ? 96.183  14.400 123.922 1.00 40.82  ? 31  TYR C CB  1 
ATOM   2951  C CG  . TYR C 1 31  ? 95.100  15.041 124.748 1.00 40.82  ? 31  TYR C CG  1 
ATOM   2952  C CD1 . TYR C 1 31  ? 94.585  16.292 124.421 1.00 40.82  ? 31  TYR C CD1 1 
ATOM   2953  C CD2 . TYR C 1 31  ? 94.601  14.401 125.880 1.00 40.82  ? 31  TYR C CD2 1 
ATOM   2954  C CE1 . TYR C 1 31  ? 93.602  16.888 125.202 1.00 40.82  ? 31  TYR C CE1 1 
ATOM   2955  C CE2 . TYR C 1 31  ? 93.620  14.989 126.662 1.00 40.82  ? 31  TYR C CE2 1 
ATOM   2956  C CZ  . TYR C 1 31  ? 93.125  16.233 126.321 1.00 40.82  ? 31  TYR C CZ  1 
ATOM   2957  O OH  . TYR C 1 31  ? 92.152  16.824 127.115 1.00 40.82  ? 31  TYR C OH  1 
ATOM   2958  N N   . THR C 1 32  ? 98.600  12.351 124.526 1.00 37.84  ? 32  THR C N   1 
ATOM   2959  C CA  . THR C 1 32  ? 99.423  11.270 124.012 1.00 37.84  ? 32  THR C CA  1 
ATOM   2960  C C   . THR C 1 32  ? 98.483  10.473 123.112 1.00 37.84  ? 32  THR C C   1 
ATOM   2961  O O   . THR C 1 32  ? 97.269  10.555 123.257 1.00 37.84  ? 32  THR C O   1 
ATOM   2962  C CB  . THR C 1 32  ? 99.896  10.347 125.128 1.00 45.70  ? 32  THR C CB  1 
ATOM   2963  O OG1 . THR C 1 32  ? 98.754  9.835  125.832 1.00 45.70  ? 32  THR C OG1 1 
ATOM   2964  C CG2 . THR C 1 32  ? 100.800 11.084 126.079 1.00 45.70  ? 32  THR C CG2 1 
ATOM   2965  N N   . ALA C 1 33  ? 99.030  9.693  122.190 1.00 63.19  ? 33  ALA C N   1 
ATOM   2966  C CA  . ALA C 1 33  ? 98.189  8.901  121.302 1.00 63.19  ? 33  ALA C CA  1 
ATOM   2967  C C   . ALA C 1 33  ? 97.170  8.054  122.063 1.00 63.19  ? 33  ALA C C   1 
ATOM   2968  O O   . ALA C 1 33  ? 96.011  7.950  121.653 1.00 63.19  ? 33  ALA C O   1 
ATOM   2969  C CB  . ALA C 1 33  ? 99.053  8.010  120.452 1.00 44.67  ? 33  ALA C CB  1 
ATOM   2970  N N   . GLU C 1 34  ? 97.603  7.456  123.172 1.00 40.26  ? 34  GLU C N   1 
ATOM   2971  C CA  . GLU C 1 34  ? 96.719  6.607  123.961 1.00 40.26  ? 34  GLU C CA  1 
ATOM   2972  C C   . GLU C 1 34  ? 95.542  7.369  124.501 1.00 40.26  ? 34  GLU C C   1 
ATOM   2973  O O   . GLU C 1 34  ? 94.406  6.951  124.310 1.00 40.26  ? 34  GLU C O   1 
ATOM   2974  C CB  . GLU C 1 34  ? 97.456  5.960  125.138 1.00 110.38 ? 34  GLU C CB  1 
ATOM   2975  C CG  . GLU C 1 34  ? 98.724  5.215  124.767 1.00 110.38 ? 34  GLU C CG  1 
ATOM   2976  C CD  . GLU C 1 34  ? 99.960  6.082  124.902 1.00 110.38 ? 34  GLU C CD  1 
ATOM   2977  O OE1 . GLU C 1 34  ? 100.251 6.520  126.037 1.00 110.38 ? 34  GLU C OE1 1 
ATOM   2978  O OE2 . GLU C 1 34  ? 100.637 6.329  123.881 1.00 110.38 ? 34  GLU C OE2 1 
ATOM   2979  N N   . GLU C 1 35  ? 95.805  8.495  125.163 1.00 50.77  ? 35  GLU C N   1 
ATOM   2980  C CA  . GLU C 1 35  ? 94.724  9.275  125.753 1.00 50.77  ? 35  GLU C CA  1 
ATOM   2981  C C   . GLU C 1 35  ? 93.820  9.891  124.714 1.00 50.77  ? 35  GLU C C   1 
ATOM   2982  O O   . GLU C 1 35  ? 92.596  9.914  124.883 1.00 50.77  ? 35  GLU C O   1 
ATOM   2983  C CB  . GLU C 1 35  ? 95.266  10.367 126.674 1.00 54.94  ? 35  GLU C CB  1 
ATOM   2984  C CG  . GLU C 1 35  ? 94.156  11.047 127.468 1.00 54.94  ? 35  GLU C CG  1 
ATOM   2985  C CD  . GLU C 1 35  ? 94.652  12.072 128.478 1.00 54.94  ? 35  GLU C CD  1 
ATOM   2986  O OE1 . GLU C 1 35  ? 93.798  12.634 129.202 1.00 54.94  ? 35  GLU C OE1 1 
ATOM   2987  O OE2 . GLU C 1 35  ? 95.881  12.315 128.547 1.00 54.94  ? 35  GLU C OE2 1 
ATOM   2988  N N   . TYR C 1 36  ? 94.418  10.379 123.630 1.00 35.82  ? 36  TYR C N   1 
ATOM   2989  C CA  . TYR C 1 36  ? 93.644  11.000 122.566 1.00 35.82  ? 36  TYR C CA  1 
ATOM   2990  C C   . TYR C 1 36  ? 92.618  10.014 122.063 1.00 35.82  ? 36  TYR C C   1 
ATOM   2991  O O   . TYR C 1 36  ? 91.412  10.298 122.037 1.00 35.82  ? 36  TYR C O   1 
ATOM   2992  C CB  . TYR C 1 36  ? 94.527  11.404 121.391 1.00 45.98  ? 36  TYR C CB  1 
ATOM   2993  C CG  . TYR C 1 36  ? 93.708  11.566 120.127 1.00 45.98  ? 36  TYR C CG  1 
ATOM   2994  C CD1 . TYR C 1 36  ? 92.853  12.651 119.963 1.00 45.98  ? 36  TYR C CD1 1 
ATOM   2995  C CD2 . TYR C 1 36  ? 93.677  10.555 119.169 1.00 45.98  ? 36  TYR C CD2 1 
ATOM   2996  C CE1 . TYR C 1 36  ? 91.988  12.721 118.902 1.00 45.98  ? 36  TYR C CE1 1 
ATOM   2997  C CE2 . TYR C 1 36  ? 92.813  10.615 118.107 1.00 45.98  ? 36  TYR C CE2 1 
ATOM   2998  C CZ  . TYR C 1 36  ? 91.961  11.700 117.974 1.00 45.98  ? 36  TYR C CZ  1 
ATOM   2999  O OH  . TYR C 1 36  ? 91.062  11.738 116.924 1.00 45.98  ? 36  TYR C OH  1 
ATOM   3000  N N   . GLN C 1 37  ? 93.116  8.845  121.667 1.00 37.80  ? 37  GLN C N   1 
ATOM   3001  C CA  . GLN C 1 37  ? 92.270  7.808  121.124 1.00 37.80  ? 37  GLN C CA  1 
ATOM   3002  C C   . GLN C 1 37  ? 91.141  7.396  122.059 1.00 37.80  ? 37  GLN C C   1 
ATOM   3003  O O   . GLN C 1 37  ? 90.003  7.208  121.632 1.00 37.80  ? 37  GLN C O   1 
ATOM   3004  C CB  . GLN C 1 37  ? 93.112  6.600  120.764 1.00 61.49  ? 37  GLN C CB  1 
ATOM   3005  C CG  . GLN C 1 37  ? 92.386  5.657  119.856 1.00 61.49  ? 37  GLN C CG  1 
ATOM   3006  C CD  . GLN C 1 37  ? 93.219  4.453  119.484 1.00 61.49  ? 37  GLN C CD  1 
ATOM   3007  O OE1 . GLN C 1 37  ? 92.989  3.822  118.452 1.00 61.49  ? 37  GLN C OE1 1 
ATOM   3008  N NE2 . GLN C 1 37  ? 94.185  4.121  120.321 1.00 61.49  ? 37  GLN C NE2 1 
ATOM   3009  N N   . ALA C 1 38  ? 91.449  7.274  123.335 1.00 38.83  ? 38  ALA C N   1 
ATOM   3010  C CA  . ALA C 1 38  ? 90.452  6.844  124.294 1.00 38.83  ? 38  ALA C CA  1 
ATOM   3011  C C   . ALA C 1 38  ? 89.317  7.844  124.425 1.00 38.83  ? 38  ALA C C   1 
ATOM   3012  O O   . ALA C 1 38  ? 88.124  7.478  124.375 1.00 38.83  ? 38  ALA C O   1 
ATOM   3013  C CB  . ALA C 1 38  ? 91.110  6.606  125.667 1.00 48.72  ? 38  ALA C CB  1 
ATOM   3014  N N   . ILE C 1 39  ? 89.701  9.107  124.609 1.00 51.18  ? 39  ILE C N   1 
ATOM   3015  C CA  . ILE C 1 39  ? 88.748  10.198 124.770 1.00 51.18  ? 39  ILE C CA  1 
ATOM   3016  C C   . ILE C 1 39  ? 87.959  10.416 123.485 1.00 51.18  ? 39  ILE C C   1 
ATOM   3017  O O   . ILE C 1 39  ? 86.750  10.656 123.531 1.00 51.18  ? 39  ILE C O   1 
ATOM   3018  C CB  . ILE C 1 39  ? 89.487  11.510 125.193 1.00 41.13  ? 39  ILE C CB  1 
ATOM   3019  C CG1 . ILE C 1 39  ? 89.966  11.376 126.638 1.00 41.13  ? 39  ILE C CG1 1 
ATOM   3020  C CG2 . ILE C 1 39  ? 88.584  12.718 125.048 1.00 41.13  ? 39  ILE C CG2 1 
ATOM   3021  C CD1 . ILE C 1 39  ? 90.832  12.507 127.114 1.00 41.13  ? 39  ILE C CD1 1 
ATOM   3022  N N   . GLN C 1 40  ? 88.638  10.318 122.342 1.00 38.20  ? 40  GLN C N   1 
ATOM   3023  C CA  . GLN C 1 40  ? 87.969  10.514 121.061 1.00 38.20  ? 40  GLN C CA  1 
ATOM   3024  C C   . GLN C 1 40  ? 86.814  9.539  120.903 1.00 38.20  ? 40  GLN C C   1 
ATOM   3025  O O   . GLN C 1 40  ? 85.722  9.914  120.456 1.00 38.20  ? 40  GLN C O   1 
ATOM   3026  C CB  . GLN C 1 40  ? 88.933  10.331 119.892 1.00 48.22  ? 40  GLN C CB  1 
ATOM   3027  C CG  . GLN C 1 40  ? 88.228  10.365 118.530 1.00 48.22  ? 40  GLN C CG  1 
ATOM   3028  C CD  . GLN C 1 40  ? 87.745  11.761 118.112 1.00 48.22  ? 40  GLN C CD  1 
ATOM   3029  O OE1 . GLN C 1 40  ? 87.525  12.645 118.943 1.00 48.22  ? 40  GLN C OE1 1 
ATOM   3030  N NE2 . GLN C 1 40  ? 87.565  11.949 116.811 1.00 48.22  ? 40  GLN C NE2 1 
ATOM   3031  N N   . LYS C 1 41  ? 87.054  8.287  121.280 1.00 52.80  ? 41  LYS C N   1 
ATOM   3032  C CA  . LYS C 1 41  ? 86.031  7.261  121.177 1.00 52.80  ? 41  LYS C CA  1 
ATOM   3033  C C   . LYS C 1 41  ? 84.960  7.501  122.204 1.00 52.80  ? 41  LYS C C   1 
ATOM   3034  O O   . LYS C 1 41  ? 83.778  7.591  121.874 1.00 52.80  ? 41  LYS C O   1 
ATOM   3035  C CB  . LYS C 1 41  ? 86.625  5.873  121.387 1.00 88.70  ? 41  LYS C CB  1 
ATOM   3036  C CG  . LYS C 1 41  ? 87.553  5.432  120.280 1.00 88.70  ? 41  LYS C CG  1 
ATOM   3037  C CD  . LYS C 1 41  ? 87.976  3.985  120.472 1.00 88.70  ? 41  LYS C CD  1 
ATOM   3038  C CE  . LYS C 1 41  ? 88.989  3.567  119.416 1.00 88.70  ? 41  LYS C CE  1 
ATOM   3039  N NZ  . LYS C 1 41  ? 88.491  3.839  118.028 1.00 88.70  ? 41  LYS C NZ  1 
ATOM   3040  N N   . ALA C 1 42  ? 85.370  7.624  123.455 1.00 46.24  ? 42  ALA C N   1 
ATOM   3041  C CA  . ALA C 1 42  ? 84.412  7.837  124.522 1.00 46.24  ? 42  ALA C CA  1 
ATOM   3042  C C   . ALA C 1 42  ? 83.465  9.025  124.288 1.00 46.24  ? 42  ALA C C   1 
ATOM   3043  O O   . ALA C 1 42  ? 82.272  8.926  124.577 1.00 46.24  ? 42  ALA C O   1 
ATOM   3044  C CB  . ALA C 1 42  ? 85.144  7.984  125.820 1.00 8.27   ? 42  ALA C CB  1 
ATOM   3045  N N   . LEU C 1 43  ? 83.969  10.135 123.757 1.00 47.94  ? 43  LEU C N   1 
ATOM   3046  C CA  . LEU C 1 43  ? 83.110  11.293 123.520 1.00 47.94  ? 43  LEU C CA  1 
ATOM   3047  C C   . LEU C 1 43  ? 81.927  11.014 122.574 1.00 47.94  ? 43  LEU C C   1 
ATOM   3048  O O   . LEU C 1 43  ? 80.892  11.704 122.620 1.00 47.94  ? 43  LEU C O   1 
ATOM   3049  C CB  . LEU C 1 43  ? 83.941  12.470 123.000 1.00 38.20  ? 43  LEU C CB  1 
ATOM   3050  C CG  . LEU C 1 43  ? 84.731  13.185 124.100 1.00 38.20  ? 43  LEU C CG  1 
ATOM   3051  C CD1 . LEU C 1 43  ? 85.684  14.180 123.487 1.00 38.20  ? 43  LEU C CD1 1 
ATOM   3052  C CD2 . LEU C 1 43  ? 83.772  13.881 125.062 1.00 38.20  ? 43  LEU C CD2 1 
ATOM   3053  N N   . ARG C 1 44  ? 82.072  10.000 121.726 1.00 46.06  ? 44  ARG C N   1 
ATOM   3054  C CA  . ARG C 1 44  ? 81.010  9.646  120.795 1.00 46.06  ? 44  ARG C CA  1 
ATOM   3055  C C   . ARG C 1 44  ? 79.791  9.048  121.493 1.00 46.06  ? 44  ARG C C   1 
ATOM   3056  O O   . ARG C 1 44  ? 78.666  9.202  121.025 1.00 46.06  ? 44  ARG C O   1 
ATOM   3057  C CB  . ARG C 1 44  ? 81.518  8.651  119.747 1.00 47.87  ? 44  ARG C CB  1 
ATOM   3058  C CG  . ARG C 1 44  ? 82.432  9.258  118.695 1.00 47.87  ? 44  ARG C CG  1 
ATOM   3059  C CD  . ARG C 1 44  ? 82.694  8.288  117.551 1.00 47.87  ? 44  ARG C CD  1 
ATOM   3060  N NE  . ARG C 1 44  ? 83.953  7.563  117.691 1.00 47.87  ? 44  ARG C NE  1 
ATOM   3061  C CZ  . ARG C 1 44  ? 85.084  7.917  117.084 1.00 47.87  ? 44  ARG C CZ  1 
ATOM   3062  N NH1 . ARG C 1 44  ? 85.099  8.987  116.301 1.00 47.87  ? 44  ARG C NH1 1 
ATOM   3063  N NH2 . ARG C 1 44  ? 86.199  7.205  117.244 1.00 47.87  ? 44  ARG C NH2 1 
ATOM   3064  N N   . GLN C 1 45  ? 80.009  8.358  122.607 1.00 55.24  ? 45  GLN C N   1 
ATOM   3065  C CA  . GLN C 1 45  ? 78.914  7.735  123.341 1.00 55.24  ? 45  GLN C CA  1 
ATOM   3066  C C   . GLN C 1 45  ? 77.740  8.671  123.558 1.00 55.24  ? 45  GLN C C   1 
ATOM   3067  O O   . GLN C 1 45  ? 77.924  9.878  123.686 1.00 55.24  ? 45  GLN C O   1 
ATOM   3068  C CB  . GLN C 1 45  ? 79.388  7.291  124.714 1.00 63.27  ? 45  GLN C CB  1 
ATOM   3069  C CG  . GLN C 1 45  ? 80.379  6.169  124.741 1.00 63.27  ? 45  GLN C CG  1 
ATOM   3070  C CD  . GLN C 1 45  ? 80.926  5.996  126.131 1.00 63.27  ? 45  GLN C CD  1 
ATOM   3071  O OE1 . GLN C 1 45  ? 81.620  6.871  126.644 1.00 63.27  ? 45  GLN C OE1 1 
ATOM   3072  N NE2 . GLN C 1 45  ? 80.599  4.881  126.765 1.00 63.27  ? 45  GLN C NE2 1 
ATOM   3073  N N   . ARG C 1 46  ? 76.536  8.112  123.609 1.00 62.92  ? 46  ARG C N   1 
ATOM   3074  C CA  . ARG C 1 46  ? 75.352  8.911  123.872 1.00 62.92  ? 46  ARG C CA  1 
ATOM   3075  C C   . ARG C 1 46  ? 75.026  8.702  125.349 1.00 62.92  ? 46  ARG C C   1 
ATOM   3076  O O   . ARG C 1 46  ? 75.325  7.639  125.902 1.00 62.92  ? 46  ARG C O   1 
ATOM   3077  C CB  . ARG C 1 46  ? 74.190  8.453  123.003 1.00 75.73  ? 46  ARG C CB  1 
ATOM   3078  C CG  . ARG C 1 46  ? 74.331  8.837  121.557 1.00 75.73  ? 46  ARG C CG  1 
ATOM   3079  C CD  . ARG C 1 46  ? 72.980  9.230  121.021 1.00 75.73  ? 46  ARG C CD  1 
ATOM   3080  N NE  . ARG C 1 46  ? 73.027  9.789  119.676 1.00 75.73  ? 46  ARG C NE  1 
ATOM   3081  C CZ  . ARG C 1 46  ? 73.354  9.096  118.591 1.00 75.73  ? 46  ARG C CZ  1 
ATOM   3082  N NH1 . ARG C 1 46  ? 73.672  7.812  118.689 1.00 75.73  ? 46  ARG C NH1 1 
ATOM   3083  N NH2 . ARG C 1 46  ? 73.346  9.687  117.403 1.00 75.73  ? 46  ARG C NH2 1 
ATOM   3084  N N   . LEU C 1 47  ? 74.441  9.705  126.000 1.00 69.52  ? 47  LEU C N   1 
ATOM   3085  C CA  . LEU C 1 47  ? 74.118  9.568  127.414 1.00 69.52  ? 47  LEU C CA  1 
ATOM   3086  C C   . LEU C 1 47  ? 72.925  8.662  127.630 1.00 69.52  ? 47  LEU C C   1 
ATOM   3087  O O   . LEU C 1 47  ? 72.032  8.603  126.790 1.00 69.52  ? 47  LEU C O   1 
ATOM   3088  C CB  . LEU C 1 47  ? 73.821  10.927 128.050 1.00 60.59  ? 47  LEU C CB  1 
ATOM   3089  C CG  . LEU C 1 47  ? 75.007  11.833 128.346 1.00 60.59  ? 47  LEU C CG  1 
ATOM   3090  C CD1 . LEU C 1 47  ? 76.112  11.009 128.962 1.00 60.59  ? 47  LEU C CD1 1 
ATOM   3091  C CD2 . LEU C 1 47  ? 75.482  12.473 127.070 1.00 60.59  ? 47  LEU C CD2 1 
ATOM   3092  N N   . GLY C 1 48  ? 72.926  7.951  128.755 1.00 60.92  ? 48  GLY C N   1 
ATOM   3093  C CA  . GLY C 1 48  ? 71.816  7.080  129.081 1.00 60.92  ? 48  GLY C CA  1 
ATOM   3094  C C   . GLY C 1 48  ? 70.721  7.914  129.714 1.00 60.92  ? 48  GLY C C   1 
ATOM   3095  O O   . GLY C 1 48  ? 70.905  9.108  129.907 1.00 60.92  ? 48  GLY C O   1 
ATOM   3096  N N   . PRO C 1 49  ? 69.567  7.326  130.042 1.00 82.17  ? 49  PRO C N   1 
ATOM   3097  C CA  . PRO C 1 49  ? 68.479  8.097  130.658 1.00 82.17  ? 49  PRO C CA  1 
ATOM   3098  C C   . PRO C 1 49  ? 68.823  8.601  132.060 1.00 82.17  ? 49  PRO C C   1 
ATOM   3099  O O   . PRO C 1 49  ? 68.150  9.480  132.599 1.00 82.17  ? 49  PRO C O   1 
ATOM   3100  C CB  . PRO C 1 49  ? 67.319  7.102  130.678 1.00 63.29  ? 49  PRO C CB  1 
ATOM   3101  C CG  . PRO C 1 49  ? 67.615  6.206  129.503 1.00 63.29  ? 49  PRO C CG  1 
ATOM   3102  C CD  . PRO C 1 49  ? 69.105  5.987  129.639 1.00 63.29  ? 49  PRO C CD  1 
ATOM   3103  N N   . GLU C 1 50  ? 69.875  8.035  132.642 1.00 63.36  ? 50  GLU C N   1 
ATOM   3104  C CA  . GLU C 1 50  ? 70.317  8.399  133.984 1.00 63.36  ? 50  GLU C CA  1 
ATOM   3105  C C   . GLU C 1 50  ? 70.847  9.818  134.027 1.00 63.36  ? 50  GLU C C   1 
ATOM   3106  O O   . GLU C 1 50  ? 71.096  10.370 135.107 1.00 63.36  ? 50  GLU C O   1 
ATOM   3107  C CB  . GLU C 1 50  ? 71.425  7.459  134.454 1.00 78.75  ? 50  GLU C CB  1 
ATOM   3108  C CG  . GLU C 1 50  ? 71.096  5.990  134.321 1.00 78.75  ? 50  GLU C CG  1 
ATOM   3109  C CD  . GLU C 1 50  ? 71.392  5.415  132.939 1.00 78.75  ? 50  GLU C CD  1 
ATOM   3110  O OE1 . GLU C 1 50  ? 70.962  5.991  131.910 1.00 78.75  ? 50  GLU C OE1 1 
ATOM   3111  O OE2 . GLU C 1 50  ? 72.054  4.358  132.888 1.00 78.75  ? 50  GLU C OE2 1 
ATOM   3112  N N   . TYR C 1 51  ? 71.023  10.407 132.848 1.00 66.66  ? 51  TYR C N   1 
ATOM   3113  C CA  . TYR C 1 51  ? 71.553  11.752 132.755 1.00 66.66  ? 51  TYR C CA  1 
ATOM   3114  C C   . TYR C 1 51  ? 70.516  12.806 132.409 1.00 66.66  ? 51  TYR C C   1 
ATOM   3115  O O   . TYR C 1 51  ? 70.624  13.960 132.834 1.00 66.66  ? 51  TYR C O   1 
ATOM   3116  C CB  . TYR C 1 51  ? 72.676  11.784 131.728 1.00 40.81  ? 51  TYR C CB  1 
ATOM   3117  C CG  . TYR C 1 51  ? 73.961  11.106 132.164 1.00 40.81  ? 51  TYR C CG  1 
ATOM   3118  C CD1 . TYR C 1 51  ? 74.294  9.816  131.722 1.00 40.81  ? 51  TYR C CD1 1 
ATOM   3119  C CD2 . TYR C 1 51  ? 74.860  11.763 133.002 1.00 40.81  ? 51  TYR C CD2 1 
ATOM   3120  C CE1 . TYR C 1 51  ? 75.494  9.200  132.100 1.00 40.81  ? 51  TYR C CE1 1 
ATOM   3121  C CE2 . TYR C 1 51  ? 76.064  11.158 133.386 1.00 40.81  ? 51  TYR C CE2 1 
ATOM   3122  C CZ  . TYR C 1 51  ? 76.376  9.880  132.934 1.00 40.81  ? 51  TYR C CZ  1 
ATOM   3123  O OH  . TYR C 1 51  ? 77.569  9.307  133.343 1.00 40.81  ? 51  TYR C OH  1 
ATOM   3124  N N   . ILE C 1 52  ? 69.494  12.406 131.667 1.00 56.65  ? 52  ILE C N   1 
ATOM   3125  C CA  . ILE C 1 52  ? 68.462  13.342 131.242 1.00 56.65  ? 52  ILE C CA  1 
ATOM   3126  C C   . ILE C 1 52  ? 67.460  13.744 132.314 1.00 56.65  ? 52  ILE C C   1 
ATOM   3127  O O   . ILE C 1 52  ? 67.224  13.009 133.263 1.00 56.65  ? 52  ILE C O   1 
ATOM   3128  C CB  . ILE C 1 52  ? 67.696  12.770 130.057 1.00 51.69  ? 52  ILE C CB  1 
ATOM   3129  C CG1 . ILE C 1 52  ? 68.686  12.119 129.085 1.00 51.69  ? 52  ILE C CG1 1 
ATOM   3130  C CG2 . ILE C 1 52  ? 66.904  13.864 129.373 1.00 51.69  ? 52  ILE C CG2 1 
ATOM   3131  C CD1 . ILE C 1 52  ? 69.924  12.971 128.750 1.00 51.69  ? 52  ILE C CD1 1 
ATOM   3132  N N   . SER C 1 53  ? 66.879  14.925 132.162 1.00 56.86  ? 53  SER C N   1 
ATOM   3133  C CA  . SER C 1 53  ? 65.878  15.426 133.103 1.00 56.86  ? 53  SER C CA  1 
ATOM   3134  C C   . SER C 1 53  ? 64.848  16.180 132.265 1.00 56.86  ? 53  SER C C   1 
ATOM   3135  O O   . SER C 1 53  ? 64.957  16.217 131.036 1.00 56.86  ? 53  SER C O   1 
ATOM   3136  C CB  . SER C 1 53  ? 66.515  16.381 134.126 1.00 48.11  ? 53  SER C CB  1 
ATOM   3137  O OG  . SER C 1 53  ? 67.563  15.755 134.845 1.00 48.11  ? 53  SER C OG  1 
ATOM   3138  N N   . SER C 1 54  ? 63.848  16.777 132.908 1.00 72.72  ? 54  SER C N   1 
ATOM   3139  C CA  . SER C 1 54  ? 62.853  17.535 132.154 1.00 72.72  ? 54  SER C CA  1 
ATOM   3140  C C   . SER C 1 54  ? 62.127  18.620 132.948 1.00 72.72  ? 54  SER C C   1 
ATOM   3141  O O   . SER C 1 54  ? 62.015  18.555 134.166 1.00 72.72  ? 54  SER C O   1 
ATOM   3142  C CB  . SER C 1 54  ? 61.839  16.588 131.520 1.00 105.79 ? 54  SER C CB  1 
ATOM   3143  O OG  . SER C 1 54  ? 61.210  15.798 132.504 1.00 105.79 ? 54  SER C OG  1 
ATOM   3144  N N   . ARG C 1 55  ? 61.664  19.634 132.229 1.00 92.06  ? 55  ARG C N   1 
ATOM   3145  C CA  . ARG C 1 55  ? 60.945  20.754 132.812 1.00 92.06  ? 55  ARG C CA  1 
ATOM   3146  C C   . ARG C 1 55  ? 59.753  20.958 131.908 1.00 92.06  ? 55  ARG C C   1 
ATOM   3147  O O   . ARG C 1 55  ? 59.735  20.445 130.790 1.00 92.06  ? 55  ARG C O   1 
ATOM   3148  C CB  . ARG C 1 55  ? 61.803  22.015 132.783 1.00 123.20 ? 55  ARG C CB  1 
ATOM   3149  C CG  . ARG C 1 55  ? 62.950  22.048 133.769 1.00 123.20 ? 55  ARG C CG  1 
ATOM   3150  C CD  . ARG C 1 55  ? 64.131  22.760 133.138 1.00 123.20 ? 55  ARG C CD  1 
ATOM   3151  N NE  . ARG C 1 55  ? 63.695  23.779 132.189 1.00 123.20 ? 55  ARG C NE  1 
ATOM   3152  C CZ  . ARG C 1 55  ? 64.503  24.402 131.340 1.00 123.20 ? 55  ARG C CZ  1 
ATOM   3153  N NH1 . ARG C 1 55  ? 65.798  24.107 131.320 1.00 123.20 ? 55  ARG C NH1 1 
ATOM   3154  N NH2 . ARG C 1 55  ? 64.016  25.319 130.512 1.00 123.20 ? 55  ARG C NH2 1 
ATOM   3155  N N   . MET C 1 56  ? 58.759  21.704 132.371 1.00 139.95 ? 56  MET C N   1 
ATOM   3156  C CA  . MET C 1 56  ? 57.596  21.939 131.537 1.00 139.95 ? 56  MET C CA  1 
ATOM   3157  C C   . MET C 1 56  ? 57.681  23.326 130.922 1.00 139.95 ? 56  MET C C   1 
ATOM   3158  O O   . MET C 1 56  ? 57.488  24.332 131.603 1.00 139.95 ? 56  MET C O   1 
ATOM   3159  C CB  . MET C 1 56  ? 56.310  21.793 132.351 1.00 146.24 ? 56  MET C CB  1 
ATOM   3160  C CG  . MET C 1 56  ? 55.101  21.407 131.506 1.00 146.24 ? 56  MET C CG  1 
ATOM   3161  S SD  . MET C 1 56  ? 55.456  19.987 130.436 1.00 146.24 ? 56  MET C SD  1 
ATOM   3162  C CE  . MET C 1 56  ? 55.799  18.695 131.677 1.00 146.24 ? 56  MET C CE  1 
ATOM   3163  N N   . ALA C 1 57  ? 57.988  23.368 129.629 1.00 200.00 ? 57  ALA C N   1 
ATOM   3164  C CA  . ALA C 1 57  ? 58.108  24.627 128.906 1.00 200.00 ? 57  ALA C CA  1 
ATOM   3165  C C   . ALA C 1 57  ? 56.846  25.454 129.090 1.00 200.00 ? 57  ALA C C   1 
ATOM   3166  O O   . ALA C 1 57  ? 55.736  24.937 128.964 1.00 200.00 ? 57  ALA C O   1 
ATOM   3167  C CB  . ALA C 1 57  ? 58.344  24.360 127.423 1.00 172.28 ? 57  ALA C CB  1 
ATOM   3168  N N   . GLY C 1 58  ? 57.023  26.736 129.397 1.00 200.00 ? 58  GLY C N   1 
ATOM   3169  C CA  . GLY C 1 58  ? 55.881  27.611 129.581 1.00 200.00 ? 58  GLY C CA  1 
ATOM   3170  C C   . GLY C 1 58  ? 54.986  27.560 128.357 1.00 200.00 ? 58  GLY C C   1 
ATOM   3171  O O   . GLY C 1 58  ? 55.226  28.259 127.371 1.00 200.00 ? 58  GLY C O   1 
ATOM   3172  N N   . GLY C 1 59  ? 53.953  26.725 128.418 1.00 199.82 ? 59  GLY C N   1 
ATOM   3173  C CA  . GLY C 1 59  ? 53.046  26.589 127.295 1.00 199.82 ? 59  GLY C CA  1 
ATOM   3174  C C   . GLY C 1 59  ? 53.526  25.495 126.361 1.00 199.82 ? 59  GLY C C   1 
ATOM   3175  O O   . GLY C 1 59  ? 52.726  24.751 125.794 1.00 199.82 ? 59  GLY C O   1 
ATOM   3176  N N   . GLY C 1 60  ? 54.842  25.397 126.207 1.00 182.91 ? 60  GLY C N   1 
ATOM   3177  C CA  . GLY C 1 60  ? 55.416  24.384 125.343 1.00 182.91 ? 60  GLY C CA  1 
ATOM   3178  C C   . GLY C 1 60  ? 55.304  22.992 125.937 1.00 182.91 ? 60  GLY C C   1 
ATOM   3179  O O   . GLY C 1 60  ? 54.593  22.779 126.922 1.00 182.91 ? 60  GLY C O   1 
ATOM   3180  N N   . GLN C 1 61  ? 56.013  22.041 125.337 1.00 149.54 ? 61  GLN C N   1 
ATOM   3181  C CA  . GLN C 1 61  ? 55.989  20.661 125.805 1.00 149.54 ? 61  GLN C CA  1 
ATOM   3182  C C   . GLN C 1 61  ? 57.036  20.408 126.882 1.00 149.54 ? 61  GLN C C   1 
ATOM   3183  O O   . GLN C 1 61  ? 57.418  21.307 127.634 1.00 149.54 ? 61  GLN C O   1 
ATOM   3184  C CB  . GLN C 1 61  ? 56.239  19.689 124.645 1.00 167.82 ? 61  GLN C CB  1 
ATOM   3185  C CG  . GLN C 1 61  ? 55.299  19.830 123.464 1.00 167.82 ? 61  GLN C CG  1 
ATOM   3186  C CD  . GLN C 1 61  ? 55.761  20.871 122.464 1.00 167.82 ? 61  GLN C CD  1 
ATOM   3187  O OE1 . GLN C 1 61  ? 55.874  22.056 122.781 1.00 167.82 ? 61  GLN C OE1 1 
ATOM   3188  N NE2 . GLN C 1 61  ? 56.032  20.428 121.241 1.00 167.82 ? 61  GLN C NE2 1 
ATOM   3189  N N   . LYS C 1 62  ? 57.492  19.161 126.935 1.00 141.92 ? 62  LYS C N   1 
ATOM   3190  C CA  . LYS C 1 62  ? 58.501  18.718 127.887 1.00 141.92 ? 62  LYS C CA  1 
ATOM   3191  C C   . LYS C 1 62  ? 59.892  18.974 127.314 1.00 141.92 ? 62  LYS C C   1 
ATOM   3192  O O   . LYS C 1 62  ? 60.221  18.501 126.226 1.00 141.92 ? 62  LYS C O   1 
ATOM   3193  C CB  . LYS C 1 62  ? 58.316  17.223 128.160 1.00 140.30 ? 62  LYS C CB  1 
ATOM   3194  C CG  . LYS C 1 62  ? 59.419  16.569 128.970 1.00 140.30 ? 62  LYS C CG  1 
ATOM   3195  C CD  . LYS C 1 62  ? 59.219  15.061 129.010 1.00 140.30 ? 62  LYS C CD  1 
ATOM   3196  C CE  . LYS C 1 62  ? 60.370  14.358 129.710 1.00 140.30 ? 62  LYS C CE  1 
ATOM   3197  N NZ  . LYS C 1 62  ? 60.178  12.881 129.757 1.00 140.30 ? 62  LYS C NZ  1 
ATOM   3198  N N   . VAL C 1 63  ? 60.704  19.726 128.049 1.00 101.21 ? 63  VAL C N   1 
ATOM   3199  C CA  . VAL C 1 63  ? 62.060  20.042 127.614 1.00 101.21 ? 63  VAL C CA  1 
ATOM   3200  C C   . VAL C 1 63  ? 63.102  19.245 128.384 1.00 101.21 ? 63  VAL C C   1 
ATOM   3201  O O   . VAL C 1 63  ? 63.178  19.310 129.611 1.00 101.21 ? 63  VAL C O   1 
ATOM   3202  C CB  . VAL C 1 63  ? 62.364  21.544 127.781 1.00 66.83  ? 63  VAL C CB  1 
ATOM   3203  C CG1 . VAL C 1 63  ? 63.807  21.831 127.409 1.00 66.83  ? 63  VAL C CG1 1 
ATOM   3204  C CG2 . VAL C 1 63  ? 61.429  22.352 126.897 1.00 66.83  ? 63  VAL C CG2 1 
ATOM   3205  N N   . CYS C 1 64  ? 63.910  18.493 127.650 1.00 99.17  ? 64  CYS C N   1 
ATOM   3206  C CA  . CYS C 1 64  ? 64.947  17.683 128.263 1.00 99.17  ? 64  CYS C CA  1 
ATOM   3207  C C   . CYS C 1 64  ? 66.248  18.455 128.377 1.00 99.17  ? 64  CYS C C   1 
ATOM   3208  O O   . CYS C 1 64  ? 66.577  19.273 127.520 1.00 99.17  ? 64  CYS C O   1 
ATOM   3209  C CB  . CYS C 1 64  ? 65.169  16.410 127.449 1.00 80.44  ? 64  CYS C CB  1 
ATOM   3210  S SG  . CYS C 1 64  ? 63.732  15.332 127.427 1.00 80.44  ? 64  CYS C SG  1 
ATOM   3211  N N   . TYR C 1 65  ? 66.990  18.180 129.441 1.00 71.17  ? 65  TYR C N   1 
ATOM   3212  C CA  . TYR C 1 65  ? 68.251  18.853 129.683 1.00 71.17  ? 65  TYR C CA  1 
ATOM   3213  C C   . TYR C 1 65  ? 69.091  17.996 130.610 1.00 71.17  ? 65  TYR C C   1 
ATOM   3214  O O   . TYR C 1 65  ? 68.628  16.974 131.111 1.00 71.17  ? 65  TYR C O   1 
ATOM   3215  C CB  . TYR C 1 65  ? 67.988  20.209 130.327 1.00 62.48  ? 65  TYR C CB  1 
ATOM   3216  C CG  . TYR C 1 65  ? 67.474  20.113 131.743 1.00 62.48  ? 65  TYR C CG  1 
ATOM   3217  C CD1 . TYR C 1 65  ? 68.353  20.122 132.824 1.00 62.48  ? 65  TYR C CD1 1 
ATOM   3218  C CD2 . TYR C 1 65  ? 66.108  20.013 132.008 1.00 62.48  ? 65  TYR C CD2 1 
ATOM   3219  C CE1 . TYR C 1 65  ? 67.887  20.039 134.142 1.00 62.48  ? 65  TYR C CE1 1 
ATOM   3220  C CE2 . TYR C 1 65  ? 65.633  19.927 133.324 1.00 62.48  ? 65  TYR C CE2 1 
ATOM   3221  C CZ  . TYR C 1 65  ? 66.530  19.944 134.386 1.00 62.48  ? 65  TYR C CZ  1 
ATOM   3222  O OH  . TYR C 1 65  ? 66.071  19.897 135.686 1.00 62.48  ? 65  TYR C OH  1 
ATOM   3223  N N   . ILE C 1 66  ? 70.327  18.419 130.834 1.00 51.57  ? 66  ILE C N   1 
ATOM   3224  C CA  . ILE C 1 66  ? 71.228  17.695 131.707 1.00 51.57  ? 66  ILE C CA  1 
ATOM   3225  C C   . ILE C 1 66  ? 71.554  18.623 132.855 1.00 51.57  ? 66  ILE C C   1 
ATOM   3226  O O   . ILE C 1 66  ? 71.925  19.785 132.640 1.00 51.57  ? 66  ILE C O   1 
ATOM   3227  C CB  . ILE C 1 66  ? 72.522  17.323 130.967 1.00 36.45  ? 66  ILE C CB  1 
ATOM   3228  C CG1 . ILE C 1 66  ? 72.171  16.555 129.696 1.00 36.45  ? 66  ILE C CG1 1 
ATOM   3229  C CG2 . ILE C 1 66  ? 73.418  16.487 131.852 1.00 36.45  ? 66  ILE C CG2 1 
ATOM   3230  C CD1 . ILE C 1 66  ? 73.350  16.156 128.866 1.00 36.45  ? 66  ILE C CD1 1 
ATOM   3231  N N   . GLU C 1 67  ? 71.403  18.127 134.078 1.00 61.98  ? 67  GLU C N   1 
ATOM   3232  C CA  . GLU C 1 67  ? 71.687  18.958 135.239 1.00 61.98  ? 67  GLU C CA  1 
ATOM   3233  C C   . GLU C 1 67  ? 73.168  19.334 135.315 1.00 61.98  ? 67  GLU C C   1 
ATOM   3234  O O   . GLU C 1 67  ? 74.048  18.577 134.893 1.00 61.98  ? 67  GLU C O   1 
ATOM   3235  C CB  . GLU C 1 67  ? 71.235  18.248 136.515 1.00 100.04 ? 67  GLU C CB  1 
ATOM   3236  C CG  . GLU C 1 67  ? 69.737  18.032 136.555 1.00 100.04 ? 67  GLU C CG  1 
ATOM   3237  C CD  . GLU C 1 67  ? 69.275  17.398 137.837 1.00 100.04 ? 67  GLU C CD  1 
ATOM   3238  O OE1 . GLU C 1 67  ? 69.487  18.002 138.911 1.00 100.04 ? 67  GLU C OE1 1 
ATOM   3239  O OE2 . GLU C 1 67  ? 68.699  16.295 137.771 1.00 100.04 ? 67  GLU C OE2 1 
ATOM   3240  N N   . GLY C 1 68  ? 73.425  20.520 135.853 1.00 62.95  ? 68  GLY C N   1 
ATOM   3241  C CA  . GLY C 1 68  ? 74.782  21.006 135.966 1.00 62.95  ? 68  GLY C CA  1 
ATOM   3242  C C   . GLY C 1 68  ? 75.792  20.043 136.547 1.00 62.95  ? 68  GLY C C   1 
ATOM   3243  O O   . GLY C 1 68  ? 76.739  19.660 135.866 1.00 62.95  ? 68  GLY C O   1 
ATOM   3244  N N   . HIS C 1 69  ? 75.604  19.645 137.803 1.00 47.04  ? 69  HIS C N   1 
ATOM   3245  C CA  . HIS C 1 69  ? 76.549  18.747 138.458 1.00 47.04  ? 69  HIS C CA  1 
ATOM   3246  C C   . HIS C 1 69  ? 76.887  17.509 137.625 1.00 47.04  ? 69  HIS C C   1 
ATOM   3247  O O   . HIS C 1 69  ? 77.972  16.953 137.766 1.00 47.04  ? 69  HIS C O   1 
ATOM   3248  C CB  . HIS C 1 69  ? 76.018  18.326 139.827 1.00 64.47  ? 69  HIS C CB  1 
ATOM   3249  C CG  . HIS C 1 69  ? 74.815  17.439 139.760 1.00 64.47  ? 69  HIS C CG  1 
ATOM   3250  N ND1 . HIS C 1 69  ? 73.584  17.886 139.332 1.00 64.47  ? 69  HIS C ND1 1 
ATOM   3251  C CD2 . HIS C 1 69  ? 74.659  16.124 140.050 1.00 64.47  ? 69  HIS C CD2 1 
ATOM   3252  C CE1 . HIS C 1 69  ? 72.720  16.886 139.363 1.00 64.47  ? 69  HIS C CE1 1 
ATOM   3253  N NE2 . HIS C 1 69  ? 73.347  15.805 139.795 1.00 64.47  ? 69  HIS C NE2 1 
ATOM   3254  N N   . ARG C 1 70  ? 75.967  17.082 136.758 1.00 50.81  ? 70  ARG C N   1 
ATOM   3255  C CA  . ARG C 1 70  ? 76.188  15.910 135.890 1.00 50.81  ? 70  ARG C CA  1 
ATOM   3256  C C   . ARG C 1 70  ? 77.292  16.228 134.879 1.00 50.81  ? 70  ARG C C   1 
ATOM   3257  O O   . ARG C 1 70  ? 78.346  15.581 134.831 1.00 50.81  ? 70  ARG C O   1 
ATOM   3258  C CB  . ARG C 1 70  ? 74.902  15.554 135.128 1.00 84.50  ? 70  ARG C CB  1 
ATOM   3259  C CG  . ARG C 1 70  ? 73.745  15.073 135.991 1.00 84.50  ? 70  ARG C CG  1 
ATOM   3260  C CD  . ARG C 1 70  ? 73.833  13.578 136.296 1.00 84.50  ? 70  ARG C CD  1 
ATOM   3261  N NE  . ARG C 1 70  ? 72.952  13.193 137.399 1.00 84.50  ? 70  ARG C NE  1 
ATOM   3262  C CZ  . ARG C 1 70  ? 71.641  13.419 137.439 1.00 84.50  ? 70  ARG C CZ  1 
ATOM   3263  N NH1 . ARG C 1 70  ? 71.027  14.027 136.428 1.00 84.50  ? 70  ARG C NH1 1 
ATOM   3264  N NH2 . ARG C 1 70  ? 70.949  13.068 138.512 1.00 84.50  ? 70  ARG C NH2 1 
ATOM   3265  N N   . VAL C 1 71  ? 77.038  17.235 134.059 1.00 53.23  ? 71  VAL C N   1 
ATOM   3266  C CA  . VAL C 1 71  ? 78.008  17.647 133.067 1.00 53.23  ? 71  VAL C CA  1 
ATOM   3267  C C   . VAL C 1 71  ? 79.379  17.820 133.736 1.00 53.23  ? 71  VAL C C   1 
ATOM   3268  O O   . VAL C 1 71  ? 80.380  17.278 133.258 1.00 53.23  ? 71  VAL C O   1 
ATOM   3269  C CB  . VAL C 1 71  ? 77.563  18.951 132.403 1.00 50.23  ? 71  VAL C CB  1 
ATOM   3270  C CG1 . VAL C 1 71  ? 78.582  19.389 131.376 1.00 50.23  ? 71  VAL C CG1 1 
ATOM   3271  C CG2 . VAL C 1 71  ? 76.215  18.745 131.742 1.00 50.23  ? 71  VAL C CG2 1 
ATOM   3272  N N   . ILE C 1 72  ? 79.428  18.550 134.850 1.00 45.39  ? 72  ILE C N   1 
ATOM   3273  C CA  . ILE C 1 72  ? 80.694  18.751 135.555 1.00 45.39  ? 72  ILE C CA  1 
ATOM   3274  C C   . ILE C 1 72  ? 81.409  17.430 135.820 1.00 45.39  ? 72  ILE C C   1 
ATOM   3275  O O   . ILE C 1 72  ? 82.578  17.289 135.476 1.00 45.39  ? 72  ILE C O   1 
ATOM   3276  C CB  . ILE C 1 72  ? 80.505  19.498 136.905 1.00 54.46  ? 72  ILE C CB  1 
ATOM   3277  C CG1 . ILE C 1 72  ? 80.156  20.960 136.627 1.00 54.46  ? 72  ILE C CG1 1 
ATOM   3278  C CG2 . ILE C 1 72  ? 81.772  19.399 137.745 1.00 54.46  ? 72  ILE C CG2 1 
ATOM   3279  C CD1 . ILE C 1 72  ? 80.180  21.852 137.839 1.00 54.46  ? 72  ILE C CD1 1 
ATOM   3280  N N   . ASN C 1 73  ? 80.717  16.464 136.426 1.00 54.15  ? 73  ASN C N   1 
ATOM   3281  C CA  . ASN C 1 73  ? 81.338  15.172 136.696 1.00 54.15  ? 73  ASN C CA  1 
ATOM   3282  C C   . ASN C 1 73  ? 81.710  14.467 135.403 1.00 54.15  ? 73  ASN C C   1 
ATOM   3283  O O   . ASN C 1 73  ? 82.774  13.849 135.322 1.00 54.15  ? 73  ASN C O   1 
ATOM   3284  C CB  . ASN C 1 73  ? 80.430  14.288 137.541 1.00 61.83  ? 73  ASN C CB  1 
ATOM   3285  C CG  . ASN C 1 73  ? 80.508  14.633 139.007 1.00 61.83  ? 73  ASN C CG  1 
ATOM   3286  O OD1 . ASN C 1 73  ? 81.597  14.870 139.538 1.00 61.83  ? 73  ASN C OD1 1 
ATOM   3287  N ND2 . ASN C 1 73  ? 79.360  14.656 139.676 1.00 61.83  ? 73  ASN C ND2 1 
ATOM   3288  N N   . LEU C 1 74  ? 80.852  14.570 134.390 1.00 57.21  ? 74  LEU C N   1 
ATOM   3289  C CA  . LEU C 1 74  ? 81.160  13.955 133.104 1.00 57.21  ? 74  LEU C CA  1 
ATOM   3290  C C   . LEU C 1 74  ? 82.499  14.479 132.572 1.00 57.21  ? 74  LEU C C   1 
ATOM   3291  O O   . LEU C 1 74  ? 83.323  13.721 132.050 1.00 57.21  ? 74  LEU C O   1 
ATOM   3292  C CB  . LEU C 1 74  ? 80.070  14.262 132.097 1.00 45.00  ? 74  LEU C CB  1 
ATOM   3293  C CG  . LEU C 1 74  ? 78.931  13.265 132.006 1.00 45.00  ? 74  LEU C CG  1 
ATOM   3294  C CD1 . LEU C 1 74  ? 77.877  13.777 131.029 1.00 45.00  ? 74  LEU C CD1 1 
ATOM   3295  C CD2 . LEU C 1 74  ? 79.494  11.942 131.541 1.00 45.00  ? 74  LEU C CD2 1 
ATOM   3296  N N   . ALA C 1 75  ? 82.716  15.781 132.704 1.00 31.21  ? 75  ALA C N   1 
ATOM   3297  C CA  . ALA C 1 75  ? 83.968  16.365 132.238 1.00 31.21  ? 75  ALA C CA  1 
ATOM   3298  C C   . ALA C 1 75  ? 85.181  15.952 133.105 1.00 31.21  ? 75  ALA C C   1 
ATOM   3299  O O   . ALA C 1 75  ? 86.272  15.673 132.583 1.00 31.21  ? 75  ALA C O   1 
ATOM   3300  C CB  . ALA C 1 75  ? 83.845  17.875 132.195 1.00 55.11  ? 75  ALA C CB  1 
ATOM   3301  N N   . ASN C 1 76  ? 84.996  15.916 134.422 1.00 47.02  ? 76  ASN C N   1 
ATOM   3302  C CA  . ASN C 1 76  ? 86.086  15.518 135.302 1.00 47.02  ? 76  ASN C CA  1 
ATOM   3303  C C   . ASN C 1 76  ? 86.522  14.086 135.018 1.00 47.02  ? 76  ASN C C   1 
ATOM   3304  O O   . ASN C 1 76  ? 87.679  13.737 135.231 1.00 47.02  ? 76  ASN C O   1 
ATOM   3305  C CB  . ASN C 1 76  ? 85.679  15.673 136.756 1.00 57.50  ? 76  ASN C CB  1 
ATOM   3306  C CG  . ASN C 1 76  ? 85.596  17.113 137.163 1.00 57.50  ? 76  ASN C CG  1 
ATOM   3307  O OD1 . ASN C 1 76  ? 86.538  17.864 136.958 1.00 57.50  ? 76  ASN C OD1 1 
ATOM   3308  N ND2 . ASN C 1 76  ? 84.470  17.515 137.733 1.00 57.50  ? 76  ASN C ND2 1 
ATOM   3309  N N   . GLU C 1 77  ? 85.592  13.263 134.532 1.00 47.95  ? 77  GLU C N   1 
ATOM   3310  C CA  . GLU C 1 77  ? 85.895  11.876 134.181 1.00 47.95  ? 77  GLU C CA  1 
ATOM   3311  C C   . GLU C 1 77  ? 86.514  11.778 132.796 1.00 47.95  ? 77  GLU C C   1 
ATOM   3312  O O   . GLU C 1 77  ? 87.503  11.077 132.612 1.00 47.95  ? 77  GLU C O   1 
ATOM   3313  C CB  . GLU C 1 77  ? 84.642  11.012 134.236 1.00 63.19  ? 77  GLU C CB  1 
ATOM   3314  C CG  . GLU C 1 77  ? 84.220  10.674 135.641 1.00 63.19  ? 77  GLU C CG  1 
ATOM   3315  C CD  . GLU C 1 77  ? 85.398  10.276 136.509 1.00 63.19  ? 77  GLU C CD  1 
ATOM   3316  O OE1 . GLU C 1 77  ? 86.312  9.599  135.976 1.00 63.19  ? 77  GLU C OE1 1 
ATOM   3317  O OE2 . GLU C 1 77  ? 85.409  10.633 137.713 1.00 63.19  ? 77  GLU C OE2 1 
ATOM   3318  N N   . MET C 1 78  ? 85.930  12.478 131.824 1.00 41.61  ? 78  MET C N   1 
ATOM   3319  C CA  . MET C 1 78  ? 86.465  12.480 130.471 1.00 41.61  ? 78  MET C CA  1 
ATOM   3320  C C   . MET C 1 78  ? 87.873  13.062 130.384 1.00 41.61  ? 78  MET C C   1 
ATOM   3321  O O   . MET C 1 78  ? 88.720  12.513 129.695 1.00 41.61  ? 78  MET C O   1 
ATOM   3322  C CB  . MET C 1 78  ? 85.558  13.276 129.543 1.00 60.79  ? 78  MET C CB  1 
ATOM   3323  C CG  . MET C 1 78  ? 84.463  12.456 128.891 1.00 60.79  ? 78  MET C CG  1 
ATOM   3324  S SD  . MET C 1 78  ? 85.130  11.109 127.895 1.00 60.79  ? 78  MET C SD  1 
ATOM   3325  C CE  . MET C 1 78  ? 86.235  11.965 126.907 1.00 60.79  ? 78  MET C CE  1 
ATOM   3326  N N   . PHE C 1 79  ? 88.140  14.154 131.097 1.00 43.00  ? 79  PHE C N   1 
ATOM   3327  C CA  . PHE C 1 79  ? 89.458  14.794 131.013 1.00 43.00  ? 79  PHE C CA  1 
ATOM   3328  C C   . PHE C 1 79  ? 90.332  14.789 132.258 1.00 43.00  ? 79  PHE C C   1 
ATOM   3329  O O   . PHE C 1 79  ? 91.531  15.052 132.170 1.00 43.00  ? 79  PHE C O   1 
ATOM   3330  C CB  . PHE C 1 79  ? 89.291  16.257 130.562 1.00 29.33  ? 79  PHE C CB  1 
ATOM   3331  C CG  . PHE C 1 79  ? 88.367  16.432 129.387 1.00 29.33  ? 79  PHE C CG  1 
ATOM   3332  C CD1 . PHE C 1 79  ? 87.143  17.062 129.549 1.00 29.33  ? 79  PHE C CD1 1 
ATOM   3333  C CD2 . PHE C 1 79  ? 88.730  15.972 128.117 1.00 29.33  ? 79  PHE C CD2 1 
ATOM   3334  C CE1 . PHE C 1 79  ? 86.283  17.239 128.466 1.00 29.33  ? 79  PHE C CE1 1 
ATOM   3335  C CE2 . PHE C 1 79  ? 87.892  16.136 127.032 1.00 29.33  ? 79  PHE C CE2 1 
ATOM   3336  C CZ  . PHE C 1 79  ? 86.661  16.773 127.199 1.00 29.33  ? 79  PHE C CZ  1 
ATOM   3337  N N   . GLY C 1 80  ? 89.746  14.495 133.408 1.00 45.21  ? 80  GLY C N   1 
ATOM   3338  C CA  . GLY C 1 80  ? 90.516  14.541 134.634 1.00 45.21  ? 80  GLY C CA  1 
ATOM   3339  C C   . GLY C 1 80  ? 90.272  15.905 135.282 1.00 45.21  ? 80  GLY C C   1 
ATOM   3340  O O   . GLY C 1 80  ? 90.152  16.905 134.582 1.00 45.21  ? 80  GLY C O   1 
ATOM   3341  N N   . TYR C 1 81  ? 90.195  15.948 136.608 1.00 50.18  ? 81  TYR C N   1 
ATOM   3342  C CA  . TYR C 1 81  ? 89.950  17.178 137.343 1.00 50.18  ? 81  TYR C CA  1 
ATOM   3343  C C   . TYR C 1 81  ? 90.814  18.330 136.869 1.00 50.18  ? 81  TYR C C   1 
ATOM   3344  O O   . TYR C 1 81  ? 90.404  19.495 136.954 1.00 50.18  ? 81  TYR C O   1 
ATOM   3345  C CB  . TYR C 1 81  ? 90.209  16.951 138.821 1.00 41.72  ? 81  TYR C CB  1 
ATOM   3346  C CG  . TYR C 1 81  ? 91.674  16.817 139.181 1.00 41.72  ? 81  TYR C CG  1 
ATOM   3347  C CD1 . TYR C 1 81  ? 92.415  17.917 139.592 1.00 41.72  ? 81  TYR C CD1 1 
ATOM   3348  C CD2 . TYR C 1 81  ? 92.308  15.575 139.165 1.00 41.72  ? 81  TYR C CD2 1 
ATOM   3349  C CE1 . TYR C 1 81  ? 93.743  17.778 139.987 1.00 41.72  ? 81  TYR C CE1 1 
ATOM   3350  C CE2 . TYR C 1 81  ? 93.639  15.434 139.559 1.00 41.72  ? 81  TYR C CE2 1 
ATOM   3351  C CZ  . TYR C 1 81  ? 94.346  16.535 139.969 1.00 41.72  ? 81  TYR C CZ  1 
ATOM   3352  O OH  . TYR C 1 81  ? 95.661  16.401 140.369 1.00 41.72  ? 81  TYR C OH  1 
ATOM   3353  N N   . ASN C 1 82  ? 92.007  18.003 136.377 1.00 35.67  ? 82  ASN C N   1 
ATOM   3354  C CA  . ASN C 1 82  ? 92.934  19.022 135.895 1.00 35.67  ? 82  ASN C CA  1 
ATOM   3355  C C   . ASN C 1 82  ? 93.149  19.009 134.381 1.00 35.67  ? 82  ASN C C   1 
ATOM   3356  O O   . ASN C 1 82  ? 94.148  19.551 133.906 1.00 35.67  ? 82  ASN C O   1 
ATOM   3357  C CB  . ASN C 1 82  ? 94.284  18.830 136.571 1.00 48.51  ? 82  ASN C CB  1 
ATOM   3358  C CG  . ASN C 1 82  ? 95.083  17.701 135.945 1.00 48.51  ? 82  ASN C CG  1 
ATOM   3359  O OD1 . ASN C 1 82  ? 94.520  16.697 135.511 1.00 48.51  ? 82  ASN C OD1 1 
ATOM   3360  N ND2 . ASN C 1 82  ? 96.401  17.858 135.901 1.00 48.51  ? 82  ASN C ND2 1 
ATOM   3361  N N   . GLY C 1 83  ? 92.240  18.385 133.636 1.00 37.92  ? 83  GLY C N   1 
ATOM   3362  C CA  . GLY C 1 83  ? 92.382  18.316 132.190 1.00 37.92  ? 83  GLY C CA  1 
ATOM   3363  C C   . GLY C 1 83  ? 91.531  19.308 131.407 1.00 37.92  ? 83  GLY C C   1 
ATOM   3364  O O   . GLY C 1 83  ? 91.710  19.478 130.210 1.00 37.92  ? 83  GLY C O   1 
ATOM   3365  N N   . TRP C 1 84  ? 90.588  19.956 132.072 1.00 35.78  ? 84  TRP C N   1 
ATOM   3366  C CA  . TRP C 1 84  ? 89.748  20.932 131.420 1.00 35.78  ? 84  TRP C CA  1 
ATOM   3367  C C   . TRP C 1 84  ? 89.598  22.120 132.370 1.00 35.78  ? 84  TRP C C   1 
ATOM   3368  O O   . TRP C 1 84  ? 89.847  22.014 133.573 1.00 35.78  ? 84  TRP C O   1 
ATOM   3369  C CB  . TRP C 1 84  ? 88.382  20.342 131.112 1.00 40.76  ? 84  TRP C CB  1 
ATOM   3370  C CG  . TRP C 1 84  ? 87.566  20.087 132.324 1.00 40.76  ? 84  TRP C CG  1 
ATOM   3371  C CD1 . TRP C 1 84  ? 87.745  19.096 133.246 1.00 40.76  ? 84  TRP C CD1 1 
ATOM   3372  C CD2 . TRP C 1 84  ? 86.451  20.853 132.774 1.00 40.76  ? 84  TRP C CD2 1 
ATOM   3373  N NE1 . TRP C 1 84  ? 86.801  19.201 134.250 1.00 40.76  ? 84  TRP C NE1 1 
ATOM   3374  C CE2 . TRP C 1 84  ? 85.997  20.274 133.979 1.00 40.76  ? 84  TRP C CE2 1 
ATOM   3375  C CE3 . TRP C 1 84  ? 85.790  21.978 132.279 1.00 40.76  ? 84  TRP C CE3 1 
ATOM   3376  C CZ2 . TRP C 1 84  ? 84.915  20.784 134.687 1.00 40.76  ? 84  TRP C CZ2 1 
ATOM   3377  C CZ3 . TRP C 1 84  ? 84.715  22.483 132.987 1.00 40.76  ? 84  TRP C CZ3 1 
ATOM   3378  C CH2 . TRP C 1 84  ? 84.289  21.887 134.176 1.00 40.76  ? 84  TRP C CH2 1 
ATOM   3379  N N   . ALA C 1 85  ? 89.192  23.256 131.823 1.00 43.06  ? 85  ALA C N   1 
ATOM   3380  C CA  . ALA C 1 85  ? 89.018  24.450 132.625 1.00 43.06  ? 85  ALA C CA  1 
ATOM   3381  C C   . ALA C 1 85  ? 88.017  25.331 131.951 1.00 43.06  ? 85  ALA C C   1 
ATOM   3382  O O   . ALA C 1 85  ? 87.701  25.138 130.781 1.00 43.06  ? 85  ALA C O   1 
ATOM   3383  C CB  . ALA C 1 85  ? 90.327  25.197 132.764 1.00 33.28  ? 85  ALA C CB  1 
ATOM   3384  N N   . HIS C 1 86  ? 87.495  26.289 132.699 1.00 35.15  ? 86  HIS C N   1 
ATOM   3385  C CA  . HIS C 1 86  ? 86.547  27.219 132.129 1.00 35.15  ? 86  HIS C CA  1 
ATOM   3386  C C   . HIS C 1 86  ? 86.666  28.595 132.782 1.00 35.15  ? 86  HIS C C   1 
ATOM   3387  O O   . HIS C 1 86  ? 87.209  28.757 133.883 1.00 35.15  ? 86  HIS C O   1 
ATOM   3388  C CB  . HIS C 1 86  ? 85.119  26.687 132.217 1.00 50.18  ? 86  HIS C CB  1 
ATOM   3389  C CG  . HIS C 1 86  ? 84.525  26.776 133.576 1.00 50.18  ? 86  HIS C CG  1 
ATOM   3390  N ND1 . HIS C 1 86  ? 83.288  27.330 133.813 1.00 50.18  ? 86  HIS C ND1 1 
ATOM   3391  C CD2 . HIS C 1 86  ? 84.983  26.353 134.773 1.00 50.18  ? 86  HIS C CD2 1 
ATOM   3392  C CE1 . HIS C 1 86  ? 83.007  27.242 135.100 1.00 50.18  ? 86  HIS C CE1 1 
ATOM   3393  N NE2 . HIS C 1 86  ? 84.021  26.652 135.704 1.00 50.18  ? 86  HIS C NE2 1 
ATOM   3394  N N   . SER C 1 87  ? 86.193  29.597 132.060 1.00 37.76  ? 87  SER C N   1 
ATOM   3395  C CA  . SER C 1 87  ? 86.260  30.946 132.550 1.00 37.76  ? 87  SER C CA  1 
ATOM   3396  C C   . SER C 1 87  ? 85.090  31.708 131.998 1.00 37.76  ? 87  SER C C   1 
ATOM   3397  O O   . SER C 1 87  ? 84.511  31.341 130.985 1.00 37.76  ? 87  SER C O   1 
ATOM   3398  C CB  . SER C 1 87  ? 87.559  31.605 132.110 1.00 43.52  ? 87  SER C CB  1 
ATOM   3399  O OG  . SER C 1 87  ? 87.560  31.818 130.715 1.00 43.52  ? 87  SER C OG  1 
ATOM   3400  N N   . ILE C 1 88  ? 84.720  32.766 132.686 1.00 38.66  ? 88  ILE C N   1 
ATOM   3401  C CA  . ILE C 1 88  ? 83.612  33.560 132.226 1.00 38.66  ? 88  ILE C CA  1 
ATOM   3402  C C   . ILE C 1 88  ? 84.232  34.722 131.476 1.00 38.66  ? 88  ILE C C   1 
ATOM   3403  O O   . ILE C 1 88  ? 84.888  35.580 132.074 1.00 38.66  ? 88  ILE C O   1 
ATOM   3404  C CB  . ILE C 1 88  ? 82.799  34.077 133.413 1.00 44.25  ? 88  ILE C CB  1 
ATOM   3405  C CG1 . ILE C 1 88  ? 82.301  32.892 134.238 1.00 44.25  ? 88  ILE C CG1 1 
ATOM   3406  C CG2 . ILE C 1 88  ? 81.660  34.936 132.920 1.00 44.25  ? 88  ILE C CG2 1 
ATOM   3407  C CD1 . ILE C 1 88  ? 81.641  33.291 135.523 1.00 44.25  ? 88  ILE C CD1 1 
ATOM   3408  N N   . THR C 1 89  ? 84.050  34.738 130.160 1.00 30.20  ? 89  THR C N   1 
ATOM   3409  C CA  . THR C 1 89  ? 84.597  35.815 129.319 1.00 30.20  ? 89  THR C CA  1 
ATOM   3410  C C   . THR C 1 89  ? 83.896  37.124 129.685 1.00 30.20  ? 89  THR C C   1 
ATOM   3411  O O   . THR C 1 89  ? 84.527  38.170 129.842 1.00 30.20  ? 89  THR C O   1 
ATOM   3412  C CB  . THR C 1 89  ? 84.336  35.542 127.823 1.00 38.57  ? 89  THR C CB  1 
ATOM   3413  O OG1 . THR C 1 89  ? 84.979  34.331 127.437 1.00 38.57  ? 89  THR C OG1 1 
ATOM   3414  C CG2 . THR C 1 89  ? 84.871  36.670 126.978 1.00 38.57  ? 89  THR C CG2 1 
ATOM   3415  N N   . GLN C 1 90  ? 82.577  37.033 129.827 1.00 46.74  ? 90  GLN C N   1 
ATOM   3416  C CA  . GLN C 1 90  ? 81.777  38.173 130.163 1.00 46.74  ? 90  GLN C CA  1 
ATOM   3417  C C   . GLN C 1 90  ? 80.377  37.754 130.571 1.00 46.74  ? 90  GLN C C   1 
ATOM   3418  O O   . GLN C 1 90  ? 79.885  36.716 130.140 1.00 46.74  ? 90  GLN C O   1 
ATOM   3419  C CB  . GLN C 1 90  ? 81.699  39.084 128.962 1.00 77.00  ? 90  GLN C CB  1 
ATOM   3420  C CG  . GLN C 1 90  ? 80.776  40.240 129.176 1.00 77.00  ? 90  GLN C CG  1 
ATOM   3421  C CD  . GLN C 1 90  ? 80.849  41.248 128.057 1.00 77.00  ? 90  GLN C CD  1 
ATOM   3422  O OE1 . GLN C 1 90  ? 80.392  40.996 126.937 1.00 77.00  ? 90  GLN C OE1 1 
ATOM   3423  N NE2 . GLN C 1 90  ? 81.440  42.402 128.349 1.00 77.00  ? 90  GLN C NE2 1 
ATOM   3424  N N   . GLN C 1 91  ? 79.751  38.549 131.437 1.00 64.93  ? 91  GLN C N   1 
ATOM   3425  C CA  . GLN C 1 91  ? 78.370  38.316 131.860 1.00 64.93  ? 91  GLN C CA  1 
ATOM   3426  C C   . GLN C 1 91  ? 77.672  39.661 131.820 1.00 64.93  ? 91  GLN C C   1 
ATOM   3427  O O   . GLN C 1 91  ? 78.112  40.623 132.446 1.00 64.93  ? 91  GLN C O   1 
ATOM   3428  C CB  . GLN C 1 91  ? 78.253  37.749 133.272 1.00 42.41  ? 91  GLN C CB  1 
ATOM   3429  C CG  . GLN C 1 91  ? 76.793  37.713 133.720 1.00 42.41  ? 91  GLN C CG  1 
ATOM   3430  C CD  . GLN C 1 91  ? 76.544  36.897 134.980 1.00 42.41  ? 91  GLN C CD  1 
ATOM   3431  O OE1 . GLN C 1 91  ? 76.115  35.737 134.919 1.00 42.41  ? 91  GLN C OE1 1 
ATOM   3432  N NE2 . GLN C 1 91  ? 76.812  37.498 136.132 1.00 42.41  ? 91  GLN C NE2 1 
ATOM   3433  N N   . ASN C 1 92  ? 76.580  39.727 131.079 1.00 59.83  ? 92  ASN C N   1 
ATOM   3434  C CA  . ASN C 1 92  ? 75.855  40.966 130.953 1.00 59.83  ? 92  ASN C CA  1 
ATOM   3435  C C   . ASN C 1 92  ? 74.406  40.821 131.383 1.00 59.83  ? 92  ASN C C   1 
ATOM   3436  O O   . ASN C 1 92  ? 73.721  39.888 130.967 1.00 59.83  ? 92  ASN C O   1 
ATOM   3437  C CB  . ASN C 1 92  ? 75.924  41.443 129.501 1.00 93.25  ? 92  ASN C CB  1 
ATOM   3438  C CG  . ASN C 1 92  ? 75.224  42.760 129.295 1.00 93.25  ? 92  ASN C CG  1 
ATOM   3439  O OD1 . ASN C 1 92  ? 75.614  43.776 129.873 1.00 93.25  ? 92  ASN C OD1 1 
ATOM   3440  N ND2 . ASN C 1 92  ? 74.175  42.755 128.477 1.00 93.25  ? 92  ASN C ND2 1 
ATOM   3441  N N   . VAL C 1 93  ? 73.942  41.741 132.221 1.00 39.44  ? 93  VAL C N   1 
ATOM   3442  C CA  . VAL C 1 93  ? 72.546  41.720 132.663 1.00 39.44  ? 93  VAL C CA  1 
ATOM   3443  C C   . VAL C 1 93  ? 71.733  42.413 131.578 1.00 39.44  ? 93  VAL C C   1 
ATOM   3444  O O   . VAL C 1 93  ? 71.845  43.614 131.421 1.00 39.44  ? 93  VAL C O   1 
ATOM   3445  C CB  . VAL C 1 93  ? 72.325  42.505 134.006 1.00 36.94  ? 93  VAL C CB  1 
ATOM   3446  C CG1 . VAL C 1 93  ? 70.827  42.540 134.334 1.00 36.94  ? 93  VAL C CG1 1 
ATOM   3447  C CG2 . VAL C 1 93  ? 73.084  41.836 135.168 1.00 36.94  ? 93  VAL C CG2 1 
ATOM   3448  N N   . ASP C 1 94  ? 70.922  41.673 130.832 1.00 43.53  ? 94  ASP C N   1 
ATOM   3449  C CA  . ASP C 1 94  ? 70.126  42.265 129.753 1.00 43.53  ? 94  ASP C CA  1 
ATOM   3450  C C   . ASP C 1 94  ? 69.055  43.243 130.204 1.00 43.53  ? 94  ASP C C   1 
ATOM   3451  O O   . ASP C 1 94  ? 68.883  44.304 129.604 1.00 43.53  ? 94  ASP C O   1 
ATOM   3452  C CB  . ASP C 1 94  ? 69.446  41.183 128.911 1.00 58.20  ? 94  ASP C CB  1 
ATOM   3453  C CG  . ASP C 1 94  ? 70.383  40.546 127.934 1.00 58.20  ? 94  ASP C CG  1 
ATOM   3454  O OD1 . ASP C 1 94  ? 71.434  41.164 127.657 1.00 58.20  ? 94  ASP C OD1 1 
ATOM   3455  O OD2 . ASP C 1 94  ? 70.065  39.441 127.440 1.00 58.20  ? 94  ASP C OD2 1 
ATOM   3456  N N   . PHE C 1 95  ? 68.310  42.874 131.241 1.00 69.58  ? 95  PHE C N   1 
ATOM   3457  C CA  . PHE C 1 95  ? 67.250  43.737 131.745 1.00 69.58  ? 95  PHE C CA  1 
ATOM   3458  C C   . PHE C 1 95  ? 66.746  43.283 133.089 1.00 69.58  ? 95  PHE C C   1 
ATOM   3459  O O   . PHE C 1 95  ? 66.862  42.112 133.464 1.00 69.58  ? 95  PHE C O   1 
ATOM   3460  C CB  . PHE C 1 95  ? 66.076  43.773 130.768 1.00 62.44  ? 95  PHE C CB  1 
ATOM   3461  C CG  . PHE C 1 95  ? 65.402  42.443 130.580 1.00 62.44  ? 95  PHE C CG  1 
ATOM   3462  C CD1 . PHE C 1 95  ? 64.507  41.960 131.517 1.00 62.44  ? 95  PHE C CD1 1 
ATOM   3463  C CD2 . PHE C 1 95  ? 65.681  41.658 129.470 1.00 62.44  ? 95  PHE C CD2 1 
ATOM   3464  C CE1 . PHE C 1 95  ? 63.896  40.709 131.355 1.00 62.44  ? 95  PHE C CE1 1 
ATOM   3465  C CE2 . PHE C 1 95  ? 65.075  40.402 129.299 1.00 62.44  ? 95  PHE C CE2 1 
ATOM   3466  C CZ  . PHE C 1 95  ? 64.181  39.929 130.245 1.00 62.44  ? 95  PHE C CZ  1 
ATOM   3467  N N   . VAL C 1 96  ? 66.185  44.232 133.816 1.00 72.89  ? 96  VAL C N   1 
ATOM   3468  C CA  . VAL C 1 96  ? 65.616  43.959 135.120 1.00 72.89  ? 96  VAL C CA  1 
ATOM   3469  C C   . VAL C 1 96  ? 64.321  44.753 135.168 1.00 72.89  ? 96  VAL C C   1 
ATOM   3470  O O   . VAL C 1 96  ? 64.308  45.908 135.584 1.00 72.89  ? 96  VAL C O   1 
ATOM   3471  C CB  . VAL C 1 96  ? 66.540  44.419 136.269 1.00 42.78  ? 96  VAL C CB  1 
ATOM   3472  C CG1 . VAL C 1 96  ? 65.848  44.168 137.600 1.00 42.78  ? 96  VAL C CG1 1 
ATOM   3473  C CG2 . VAL C 1 96  ? 67.851  43.666 136.224 1.00 42.78  ? 96  VAL C CG2 1 
ATOM   3474  N N   . ASP C 1 97  ? 63.236  44.134 134.717 1.00 86.67  ? 97  ASP C N   1 
ATOM   3475  C CA  . ASP C 1 97  ? 61.946  44.797 134.703 1.00 86.67  ? 97  ASP C CA  1 
ATOM   3476  C C   . ASP C 1 97  ? 61.052  44.489 135.896 1.00 86.67  ? 97  ASP C C   1 
ATOM   3477  O O   . ASP C 1 97  ? 61.066  43.380 136.445 1.00 86.67  ? 97  ASP C O   1 
ATOM   3478  C CB  . ASP C 1 97  ? 61.200  44.459 133.423 1.00 59.56  ? 97  ASP C CB  1 
ATOM   3479  C CG  . ASP C 1 97  ? 61.936  44.919 132.195 1.00 59.56  ? 97  ASP C CG  1 
ATOM   3480  O OD1 . ASP C 1 97  ? 62.677  45.925 132.293 1.00 59.56  ? 97  ASP C OD1 1 
ATOM   3481  O OD2 . ASP C 1 97  ? 61.758  44.279 131.132 1.00 59.56  ? 97  ASP C OD2 1 
ATOM   3482  N N   . LEU C 1 98  ? 60.272  45.500 136.280 1.00 72.74  ? 98  LEU C N   1 
ATOM   3483  C CA  . LEU C 1 98  ? 59.342  45.408 137.394 1.00 72.74  ? 98  LEU C CA  1 
ATOM   3484  C C   . LEU C 1 98  ? 57.891  45.580 136.937 1.00 72.74  ? 98  LEU C C   1 
ATOM   3485  O O   . LEU C 1 98  ? 57.482  46.665 136.533 1.00 72.74  ? 98  LEU C O   1 
ATOM   3486  C CB  . LEU C 1 98  ? 59.688  46.467 138.436 1.00 69.31  ? 98  LEU C CB  1 
ATOM   3487  C CG  . LEU C 1 98  ? 58.787  46.437 139.666 1.00 69.31  ? 98  LEU C CG  1 
ATOM   3488  C CD1 . LEU C 1 98  ? 58.661  45.003 140.179 1.00 69.31  ? 98  LEU C CD1 1 
ATOM   3489  C CD2 . LEU C 1 98  ? 59.357  47.362 140.730 1.00 69.31  ? 98  LEU C CD2 1 
ATOM   3490  N N   . ASN C 1 99  ? 57.130  44.491 136.984 1.00 96.31  ? 99  ASN C N   1 
ATOM   3491  C CA  . ASN C 1 99  ? 55.723  44.514 136.606 1.00 96.31  ? 99  ASN C CA  1 
ATOM   3492  C C   . ASN C 1 99  ? 54.941  44.174 137.854 1.00 96.31  ? 99  ASN C C   1 
ATOM   3493  O O   . ASN C 1 99  ? 54.936  43.028 138.300 1.00 96.31  ? 99  ASN C O   1 
ATOM   3494  C CB  . ASN C 1 99  ? 55.410  43.479 135.518 1.00 152.64 ? 99  ASN C CB  1 
ATOM   3495  C CG  . ASN C 1 99  ? 55.895  43.903 134.149 1.00 152.64 ? 99  ASN C CG  1 
ATOM   3496  O OD1 . ASN C 1 99  ? 55.569  44.991 133.672 1.00 152.64 ? 99  ASN C OD1 1 
ATOM   3497  N ND2 . ASN C 1 99  ? 56.671  43.039 133.501 1.00 152.64 ? 99  ASN C ND2 1 
ATOM   3498  N N   . ASN C 1 100 ? 54.284  45.178 138.416 1.00 99.51  ? 100 ASN C N   1 
ATOM   3499  C CA  . ASN C 1 100 ? 53.497  44.999 139.626 1.00 99.51  ? 100 ASN C CA  1 
ATOM   3500  C C   . ASN C 1 100 ? 54.147  44.083 140.663 1.00 99.51  ? 100 ASN C C   1 
ATOM   3501  O O   . ASN C 1 100 ? 53.791  42.910 140.775 1.00 99.51  ? 100 ASN C O   1 
ATOM   3502  C CB  . ASN C 1 100 ? 52.091  44.481 139.281 1.00 200.00 ? 100 ASN C CB  1 
ATOM   3503  C CG  . ASN C 1 100 ? 52.113  43.156 138.538 1.00 200.00 ? 100 ASN C CG  1 
ATOM   3504  O OD1 . ASN C 1 100 ? 52.547  43.080 137.387 1.00 200.00 ? 100 ASN C OD1 1 
ATOM   3505  N ND2 . ASN C 1 100 ? 51.641  42.102 139.197 1.00 200.00 ? 100 ASN C ND2 1 
ATOM   3506  N N   . GLY C 1 101 ? 55.103  44.629 141.412 1.00 84.48  ? 101 GLY C N   1 
ATOM   3507  C CA  . GLY C 1 101 ? 55.776  43.869 142.452 1.00 84.48  ? 101 GLY C CA  1 
ATOM   3508  C C   . GLY C 1 101 ? 56.545  42.617 142.053 1.00 84.48  ? 101 GLY C C   1 
ATOM   3509  O O   . GLY C 1 101 ? 57.188  41.998 142.908 1.00 84.48  ? 101 GLY C O   1 
ATOM   3510  N N   . LYS C 1 102 ? 56.489  42.233 140.779 1.00 101.80 ? 102 LYS C N   1 
ATOM   3511  C CA  . LYS C 1 102 ? 57.209  41.049 140.310 1.00 101.80 ? 102 LYS C CA  1 
ATOM   3512  C C   . LYS C 1 102 ? 58.376  41.459 139.419 1.00 101.80 ? 102 LYS C C   1 
ATOM   3513  O O   . LYS C 1 102 ? 58.271  42.408 138.640 1.00 101.80 ? 102 LYS C O   1 
ATOM   3514  C CB  . LYS C 1 102 ? 56.268  40.123 139.537 1.00 128.28 ? 102 LYS C CB  1 
ATOM   3515  C CG  . LYS C 1 102 ? 55.104  39.603 140.358 1.00 128.28 ? 102 LYS C CG  1 
ATOM   3516  C CD  . LYS C 1 102 ? 54.100  38.881 139.479 1.00 128.28 ? 102 LYS C CD  1 
ATOM   3517  C CE  . LYS C 1 102 ? 52.865  38.476 140.265 1.00 128.28 ? 102 LYS C CE  1 
ATOM   3518  N NZ  . LYS C 1 102 ? 51.829  37.887 139.373 1.00 128.28 ? 102 LYS C NZ  1 
ATOM   3519  N N   . PHE C 1 103 ? 59.489  40.742 139.546 1.00 81.79  ? 103 PHE C N   1 
ATOM   3520  C CA  . PHE C 1 103 ? 60.679  41.023 138.756 1.00 81.79  ? 103 PHE C CA  1 
ATOM   3521  C C   . PHE C 1 103 ? 60.935  40.046 137.620 1.00 81.79  ? 103 PHE C C   1 
ATOM   3522  O O   . PHE C 1 103 ? 60.887  38.825 137.793 1.00 81.79  ? 103 PHE C O   1 
ATOM   3523  C CB  . PHE C 1 103 ? 61.904  41.053 139.651 1.00 65.53  ? 103 PHE C CB  1 
ATOM   3524  C CG  . PHE C 1 103 ? 62.015  42.293 140.468 1.00 65.53  ? 103 PHE C CG  1 
ATOM   3525  C CD1 . PHE C 1 103 ? 62.016  42.229 141.852 1.00 65.53  ? 103 PHE C CD1 1 
ATOM   3526  C CD2 . PHE C 1 103 ? 62.139  43.532 139.858 1.00 65.53  ? 103 PHE C CD2 1 
ATOM   3527  C CE1 . PHE C 1 103 ? 62.142  43.386 142.618 1.00 65.53  ? 103 PHE C CE1 1 
ATOM   3528  C CE2 . PHE C 1 103 ? 62.265  44.693 140.618 1.00 65.53  ? 103 PHE C CE2 1 
ATOM   3529  C CZ  . PHE C 1 103 ? 62.268  44.620 141.996 1.00 65.53  ? 103 PHE C CZ  1 
ATOM   3530  N N   . TYR C 1 104 ? 61.221  40.610 136.455 1.00 87.27  ? 104 TYR C N   1 
ATOM   3531  C CA  . TYR C 1 104 ? 61.514  39.831 135.270 1.00 87.27  ? 104 TYR C CA  1 
ATOM   3532  C C   . TYR C 1 104 ? 62.948  40.171 134.878 1.00 87.27  ? 104 TYR C C   1 
ATOM   3533  O O   . TYR C 1 104 ? 63.213  41.255 134.362 1.00 87.27  ? 104 TYR C O   1 
ATOM   3534  C CB  . TYR C 1 104 ? 60.538  40.204 134.156 1.00 125.64 ? 104 TYR C CB  1 
ATOM   3535  C CG  . TYR C 1 104 ? 59.093  39.945 134.526 1.00 125.64 ? 104 TYR C CG  1 
ATOM   3536  C CD1 . TYR C 1 104 ? 58.523  40.541 135.652 1.00 125.64 ? 104 TYR C CD1 1 
ATOM   3537  C CD2 . TYR C 1 104 ? 58.296  39.093 133.760 1.00 125.64 ? 104 TYR C CD2 1 
ATOM   3538  C CE1 . TYR C 1 104 ? 57.201  40.298 136.009 1.00 125.64 ? 104 TYR C CE1 1 
ATOM   3539  C CE2 . TYR C 1 104 ? 56.965  38.842 134.108 1.00 125.64 ? 104 TYR C CE2 1 
ATOM   3540  C CZ  . TYR C 1 104 ? 56.426  39.450 135.236 1.00 125.64 ? 104 TYR C CZ  1 
ATOM   3541  O OH  . TYR C 1 104 ? 55.115  39.218 135.593 1.00 125.64 ? 104 TYR C OH  1 
ATOM   3542  N N   . VAL C 1 105 ? 63.871  39.248 135.139 1.00 66.00  ? 105 VAL C N   1 
ATOM   3543  C CA  . VAL C 1 105 ? 65.279  39.465 134.834 1.00 66.00  ? 105 VAL C CA  1 
ATOM   3544  C C   . VAL C 1 105 ? 65.856  38.528 133.775 1.00 66.00  ? 105 VAL C C   1 
ATOM   3545  O O   . VAL C 1 105 ? 65.654  37.315 133.832 1.00 66.00  ? 105 VAL C O   1 
ATOM   3546  C CB  . VAL C 1 105 ? 66.134  39.330 136.120 1.00 53.26  ? 105 VAL C CB  1 
ATOM   3547  C CG1 . VAL C 1 105 ? 67.613  39.473 135.783 1.00 53.26  ? 105 VAL C CG1 1 
ATOM   3548  C CG2 . VAL C 1 105 ? 65.703  40.373 137.149 1.00 53.26  ? 105 VAL C CG2 1 
ATOM   3549  N N   . GLY C 1 106 ? 66.583  39.106 132.818 1.00 48.30  ? 106 GLY C N   1 
ATOM   3550  C CA  . GLY C 1 106 ? 67.220  38.321 131.765 1.00 48.30  ? 106 GLY C CA  1 
ATOM   3551  C C   . GLY C 1 106 ? 68.719  38.537 131.789 1.00 48.30  ? 106 GLY C C   1 
ATOM   3552  O O   . GLY C 1 106 ? 69.174  39.668 131.809 1.00 48.30  ? 106 GLY C O   1 
ATOM   3553  N N   . VAL C 1 107 ? 69.500  37.471 131.799 1.00 55.97  ? 107 VAL C N   1 
ATOM   3554  C CA  . VAL C 1 107 ? 70.951  37.624 131.840 1.00 55.97  ? 107 VAL C CA  1 
ATOM   3555  C C   . VAL C 1 107 ? 71.658  36.635 130.935 1.00 55.97  ? 107 VAL C C   1 
ATOM   3556  O O   . VAL C 1 107 ? 71.178  35.525 130.711 1.00 55.97  ? 107 VAL C O   1 
ATOM   3557  C CB  . VAL C 1 107 ? 71.475  37.456 133.279 1.00 40.55  ? 107 VAL C CB  1 
ATOM   3558  C CG1 . VAL C 1 107 ? 72.993  37.363 133.304 1.00 40.55  ? 107 VAL C CG1 1 
ATOM   3559  C CG2 . VAL C 1 107 ? 71.009  38.622 134.105 1.00 40.55  ? 107 VAL C CG2 1 
ATOM   3560  N N   . CYS C 1 108 ? 72.802  37.043 130.404 1.00 41.75  ? 108 CYS C N   1 
ATOM   3561  C CA  . CYS C 1 108 ? 73.558  36.163 129.532 1.00 41.75  ? 108 CYS C CA  1 
ATOM   3562  C C   . CYS C 1 108 ? 74.995  36.073 129.988 1.00 41.75  ? 108 CYS C C   1 
ATOM   3563  O O   . CYS C 1 108 ? 75.521  37.000 130.585 1.00 41.75  ? 108 CYS C O   1 
ATOM   3564  C CB  . CYS C 1 108 ? 73.517  36.680 128.092 1.00 46.50  ? 108 CYS C CB  1 
ATOM   3565  S SG  . CYS C 1 108 ? 74.495  38.150 127.828 1.00 46.50  ? 108 CYS C SG  1 
ATOM   3566  N N   . ALA C 1 109 ? 75.625  34.943 129.715 1.00 59.04  ? 109 ALA C N   1 
ATOM   3567  C CA  . ALA C 1 109 ? 77.015  34.784 130.069 1.00 59.04  ? 109 ALA C CA  1 
ATOM   3568  C C   . ALA C 1 109 ? 77.740  34.106 128.924 1.00 59.04  ? 109 ALA C C   1 
ATOM   3569  O O   . ALA C 1 109 ? 77.157  33.302 128.193 1.00 59.04  ? 109 ALA C O   1 
ATOM   3570  C CB  . ALA C 1 109 ? 77.148  33.963 131.315 1.00 27.58  ? 109 ALA C CB  1 
ATOM   3571  N N   . PHE C 1 110 ? 79.014  34.448 128.764 1.00 26.42  ? 110 PHE C N   1 
ATOM   3572  C CA  . PHE C 1 110 ? 79.839  33.861 127.738 1.00 26.42  ? 110 PHE C CA  1 
ATOM   3573  C C   . PHE C 1 110 ? 80.898  33.090 128.458 1.00 26.42  ? 110 PHE C C   1 
ATOM   3574  O O   . PHE C 1 110 ? 81.744  33.676 129.117 1.00 26.42  ? 110 PHE C O   1 
ATOM   3575  C CB  . PHE C 1 110 ? 80.471  34.947 126.881 1.00 41.29  ? 110 PHE C CB  1 
ATOM   3576  C CG  . PHE C 1 110 ? 79.476  35.723 126.094 1.00 41.29  ? 110 PHE C CG  1 
ATOM   3577  C CD1 . PHE C 1 110 ? 78.781  36.776 126.675 1.00 41.29  ? 110 PHE C CD1 1 
ATOM   3578  C CD2 . PHE C 1 110 ? 79.155  35.343 124.802 1.00 41.29  ? 110 PHE C CD2 1 
ATOM   3579  C CE1 . PHE C 1 110 ? 77.780  37.434 125.985 1.00 41.29  ? 110 PHE C CE1 1 
ATOM   3580  C CE2 . PHE C 1 110 ? 78.149  35.998 124.107 1.00 41.29  ? 110 PHE C CE2 1 
ATOM   3581  C CZ  . PHE C 1 110 ? 77.462  37.046 124.704 1.00 41.29  ? 110 PHE C CZ  1 
ATOM   3582  N N   . VAL C 1 111 ? 80.851  31.775 128.321 1.00 32.63  ? 111 VAL C N   1 
ATOM   3583  C CA  . VAL C 1 111 ? 81.803  30.906 128.973 1.00 32.63  ? 111 VAL C CA  1 
ATOM   3584  C C   . VAL C 1 111 ? 82.739  30.262 127.954 1.00 32.63  ? 111 VAL C C   1 
ATOM   3585  O O   . VAL C 1 111 ? 82.329  29.900 126.859 1.00 32.63  ? 111 VAL C O   1 
ATOM   3586  C CB  . VAL C 1 111 ? 81.059  29.814 129.763 1.00 31.17  ? 111 VAL C CB  1 
ATOM   3587  C CG1 . VAL C 1 111 ? 82.052  28.968 130.554 1.00 31.17  ? 111 VAL C CG1 1 
ATOM   3588  C CG2 . VAL C 1 111 ? 80.030  30.456 130.669 1.00 31.17  ? 111 VAL C CG2 1 
ATOM   3589  N N   . ARG C 1 112 ? 83.999  30.110 128.336 1.00 39.41  ? 112 ARG C N   1 
ATOM   3590  C CA  . ARG C 1 112 ? 85.006  29.532 127.465 1.00 39.41  ? 112 ARG C CA  1 
ATOM   3591  C C   . ARG C 1 112 ? 85.653  28.362 128.166 1.00 39.41  ? 112 ARG C C   1 
ATOM   3592  O O   . ARG C 1 112 ? 86.248  28.534 129.225 1.00 39.41  ? 112 ARG C O   1 
ATOM   3593  C CB  . ARG C 1 112 ? 86.081  30.561 127.144 1.00 44.31  ? 112 ARG C CB  1 
ATOM   3594  C CG  . ARG C 1 112 ? 86.875  30.172 125.949 1.00 44.31  ? 112 ARG C CG  1 
ATOM   3595  C CD  . ARG C 1 112 ? 88.015  31.101 125.662 1.00 44.31  ? 112 ARG C CD  1 
ATOM   3596  N NE  . ARG C 1 112 ? 89.282  30.423 125.915 1.00 44.31  ? 112 ARG C NE  1 
ATOM   3597  C CZ  . ARG C 1 112 ? 90.308  30.405 125.068 1.00 44.31  ? 112 ARG C CZ  1 
ATOM   3598  N NH1 . ARG C 1 112 ? 90.213  31.044 123.896 1.00 44.31  ? 112 ARG C NH1 1 
ATOM   3599  N NH2 . ARG C 1 112 ? 91.423  29.740 125.389 1.00 44.31  ? 112 ARG C NH2 1 
ATOM   3600  N N   . VAL C 1 113 ? 85.538  27.174 127.575 1.00 34.82  ? 113 VAL C N   1 
ATOM   3601  C CA  . VAL C 1 113 ? 86.125  25.978 128.154 1.00 34.82  ? 113 VAL C CA  1 
ATOM   3602  C C   . VAL C 1 113 ? 87.431  25.673 127.422 1.00 34.82  ? 113 VAL C C   1 
ATOM   3603  O O   . VAL C 1 113 ? 87.521  25.855 126.205 1.00 34.82  ? 113 VAL C O   1 
ATOM   3604  C CB  . VAL C 1 113 ? 85.185  24.783 128.010 1.00 33.66  ? 113 VAL C CB  1 
ATOM   3605  C CG1 . VAL C 1 113 ? 85.820  23.564 128.631 1.00 33.66  ? 113 VAL C CG1 1 
ATOM   3606  C CG2 . VAL C 1 113 ? 83.852  25.061 128.689 1.00 33.66  ? 113 VAL C CG2 1 
ATOM   3607  N N   . GLN C 1 114 ? 88.445  25.210 128.145 1.00 42.15  ? 114 GLN C N   1 
ATOM   3608  C CA  . GLN C 1 114 ? 89.716  24.911 127.517 1.00 42.15  ? 114 GLN C CA  1 
ATOM   3609  C C   . GLN C 1 114 ? 90.276  23.606 128.015 1.00 42.15  ? 114 GLN C C   1 
ATOM   3610  O O   . GLN C 1 114 ? 90.204  23.337 129.195 1.00 42.15  ? 114 GLN C O   1 
ATOM   3611  C CB  . GLN C 1 114 ? 90.717  26.006 127.813 1.00 51.04  ? 114 GLN C CB  1 
ATOM   3612  C CG  . GLN C 1 114 ? 91.982  25.819 127.031 1.00 51.04  ? 114 GLN C CG  1 
ATOM   3613  C CD  . GLN C 1 114 ? 93.040  26.827 127.389 1.00 51.04  ? 114 GLN C CD  1 
ATOM   3614  O OE1 . GLN C 1 114 ? 93.624  26.773 128.464 1.00 51.04  ? 114 GLN C OE1 1 
ATOM   3615  N NE2 . GLN C 1 114 ? 93.289  27.766 126.487 1.00 51.04  ? 114 GLN C NE2 1 
ATOM   3616  N N   . LEU C 1 115 ? 90.835  22.792 127.130 1.00 31.43  ? 115 LEU C N   1 
ATOM   3617  C CA  . LEU C 1 115 ? 91.402  21.538 127.570 1.00 31.43  ? 115 LEU C CA  1 
ATOM   3618  C C   . LEU C 1 115 ? 92.856  21.784 127.855 1.00 31.43  ? 115 LEU C C   1 
ATOM   3619  O O   . LEU C 1 115 ? 93.407  22.802 127.434 1.00 31.43  ? 115 LEU C O   1 
ATOM   3620  C CB  . LEU C 1 115 ? 91.267  20.469 126.501 1.00 26.98  ? 115 LEU C CB  1 
ATOM   3621  C CG  . LEU C 1 115 ? 89.847  20.113 126.078 1.00 26.98  ? 115 LEU C CG  1 
ATOM   3622  C CD1 . LEU C 1 115 ? 89.901  18.974 125.062 1.00 26.98  ? 115 LEU C CD1 1 
ATOM   3623  C CD2 . LEU C 1 115 ? 89.040  19.698 127.281 1.00 26.98  ? 115 LEU C CD2 1 
ATOM   3624  N N   . LYS C 1 116 ? 93.496  20.854 128.542 1.00 30.74  ? 116 LYS C N   1 
ATOM   3625  C CA  . LYS C 1 116 ? 94.890  21.033 128.883 1.00 30.74  ? 116 LYS C CA  1 
ATOM   3626  C C   . LYS C 1 116 ? 95.810  21.225 127.690 1.00 30.74  ? 116 LYS C C   1 
ATOM   3627  O O   . LYS C 1 116 ? 96.932  21.704 127.853 1.00 30.74  ? 116 LYS C O   1 
ATOM   3628  C CB  . LYS C 1 116 ? 95.391  19.853 129.725 1.00 44.00  ? 116 LYS C CB  1 
ATOM   3629  C CG  . LYS C 1 116 ? 95.346  18.507 129.026 1.00 44.00  ? 116 LYS C CG  1 
ATOM   3630  C CD  . LYS C 1 116 ? 95.947  17.408 129.866 1.00 44.00  ? 116 LYS C CD  1 
ATOM   3631  C CE  . LYS C 1 116 ? 95.777  16.046 129.209 1.00 44.00  ? 116 LYS C CE  1 
ATOM   3632  N NZ  . LYS C 1 116 ? 96.483  14.967 129.966 1.00 44.00  ? 116 LYS C NZ  1 
ATOM   3633  N N   . ASP C 1 117 ? 95.370  20.874 126.490 1.00 39.17  ? 117 ASP C N   1 
ATOM   3634  C CA  . ASP C 1 117 ? 96.265  21.019 125.340 1.00 39.17  ? 117 ASP C CA  1 
ATOM   3635  C C   . ASP C 1 117 ? 96.124  22.333 124.589 1.00 39.17  ? 117 ASP C C   1 
ATOM   3636  O O   . ASP C 1 117 ? 96.864  22.587 123.642 1.00 39.17  ? 117 ASP C O   1 
ATOM   3637  C CB  . ASP C 1 117 ? 96.065  19.869 124.368 1.00 47.15  ? 117 ASP C CB  1 
ATOM   3638  C CG  . ASP C 1 117 ? 94.808  20.022 123.546 1.00 47.15  ? 117 ASP C CG  1 
ATOM   3639  O OD1 . ASP C 1 117 ? 93.776  20.497 124.090 1.00 47.15  ? 117 ASP C OD1 1 
ATOM   3640  O OD2 . ASP C 1 117 ? 94.865  19.653 122.352 1.00 47.15  ? 117 ASP C OD2 1 
ATOM   3641  N N   . GLY C 1 118 ? 95.182  23.166 125.011 1.00 25.35  ? 118 GLY C N   1 
ATOM   3642  C CA  . GLY C 1 118 ? 94.987  24.434 124.339 1.00 25.35  ? 118 GLY C CA  1 
ATOM   3643  C C   . GLY C 1 118 ? 93.645  24.467 123.638 1.00 25.35  ? 118 GLY C C   1 
ATOM   3644  O O   . GLY C 1 118 ? 93.039  25.508 123.450 1.00 25.35  ? 118 GLY C O   1 
ATOM   3645  N N   . SER C 1 119 ? 93.173  23.300 123.246 1.00 36.54  ? 119 SER C N   1 
ATOM   3646  C CA  . SER C 1 119 ? 91.890  23.160 122.583 1.00 36.54  ? 119 SER C CA  1 
ATOM   3647  C C   . SER C 1 119 ? 90.851  23.985 123.354 1.00 36.54  ? 119 SER C C   1 
ATOM   3648  O O   . SER C 1 119 ? 90.902  24.040 124.574 1.00 36.54  ? 119 SER C O   1 
ATOM   3649  C CB  . SER C 1 119 ? 91.534  21.671 122.585 1.00 51.95  ? 119 SER C CB  1 
ATOM   3650  O OG  . SER C 1 119 ? 90.301  21.433 121.954 1.00 51.95  ? 119 SER C OG  1 
ATOM   3651  N N   . TYR C 1 120 ? 89.918  24.636 122.667 1.00 30.80  ? 120 TYR C N   1 
ATOM   3652  C CA  . TYR C 1 120 ? 88.900  25.420 123.383 1.00 30.80  ? 120 TYR C CA  1 
ATOM   3653  C C   . TYR C 1 120 ? 87.590  25.647 122.631 1.00 30.80  ? 120 TYR C C   1 
ATOM   3654  O O   . TYR C 1 120 ? 87.562  25.674 121.417 1.00 30.80  ? 120 TYR C O   1 
ATOM   3655  C CB  . TYR C 1 120 ? 89.471  26.781 123.763 1.00 31.89  ? 120 TYR C CB  1 
ATOM   3656  C CG  . TYR C 1 120 ? 89.813  27.616 122.558 1.00 31.89  ? 120 TYR C CG  1 
ATOM   3657  C CD1 . TYR C 1 120 ? 88.853  28.388 121.925 1.00 31.89  ? 120 TYR C CD1 1 
ATOM   3658  C CD2 . TYR C 1 120 ? 91.091  27.598 122.025 1.00 31.89  ? 120 TYR C CD2 1 
ATOM   3659  C CE1 . TYR C 1 120 ? 89.160  29.128 120.779 1.00 31.89  ? 120 TYR C CE1 1 
ATOM   3660  C CE2 . TYR C 1 120 ? 91.417  28.335 120.880 1.00 31.89  ? 120 TYR C CE2 1 
ATOM   3661  C CZ  . TYR C 1 120 ? 90.448  29.098 120.260 1.00 31.89  ? 120 TYR C CZ  1 
ATOM   3662  O OH  . TYR C 1 120 ? 90.767  29.816 119.129 1.00 31.89  ? 120 TYR C OH  1 
ATOM   3663  N N   . HIS C 1 121 ? 86.503  25.813 123.366 1.00 33.48  ? 121 HIS C N   1 
ATOM   3664  C CA  . HIS C 1 121 ? 85.209  26.089 122.763 1.00 33.48  ? 121 HIS C CA  1 
ATOM   3665  C C   . HIS C 1 121 ? 84.515  27.119 123.639 1.00 33.48  ? 121 HIS C C   1 
ATOM   3666  O O   . HIS C 1 121 ? 84.618  27.068 124.869 1.00 33.48  ? 121 HIS C O   1 
ATOM   3667  C CB  . HIS C 1 121 ? 84.357  24.831 122.670 1.00 45.06  ? 121 HIS C CB  1 
ATOM   3668  C CG  . HIS C 1 121 ? 84.819  23.858 121.633 1.00 45.06  ? 121 HIS C CG  1 
ATOM   3669  N ND1 . HIS C 1 121 ? 85.187  22.566 121.940 1.00 45.06  ? 121 HIS C ND1 1 
ATOM   3670  C CD2 . HIS C 1 121 ? 84.950  23.978 120.295 1.00 45.06  ? 121 HIS C CD2 1 
ATOM   3671  C CE1 . HIS C 1 121 ? 85.524  21.930 120.831 1.00 45.06  ? 121 HIS C CE1 1 
ATOM   3672  N NE2 . HIS C 1 121 ? 85.388  22.768 119.818 1.00 45.06  ? 121 HIS C NE2 1 
ATOM   3673  N N   . GLU C 1 122 ? 83.825  28.067 123.027 1.00 41.17  ? 122 GLU C N   1 
ATOM   3674  C CA  . GLU C 1 122 ? 83.153  29.085 123.811 1.00 41.17  ? 122 GLU C CA  1 
ATOM   3675  C C   . GLU C 1 122 ? 81.669  29.195 123.420 1.00 41.17  ? 122 GLU C C   1 
ATOM   3676  O O   . GLU C 1 122 ? 81.326  28.991 122.256 1.00 41.17  ? 122 GLU C O   1 
ATOM   3677  C CB  . GLU C 1 122 ? 83.899  30.413 123.622 1.00 48.40  ? 122 GLU C CB  1 
ATOM   3678  C CG  . GLU C 1 122 ? 83.185  31.629 124.145 1.00 48.40  ? 122 GLU C CG  1 
ATOM   3679  C CD  . GLU C 1 122 ? 84.039  32.870 124.080 1.00 48.40  ? 122 GLU C CD  1 
ATOM   3680  O OE1 . GLU C 1 122 ? 84.715  33.076 123.049 1.00 48.40  ? 122 GLU C OE1 1 
ATOM   3681  O OE2 . GLU C 1 122 ? 84.024  33.649 125.059 1.00 48.40  ? 122 GLU C OE2 1 
ATOM   3682  N N   . ASP C 1 123 ? 80.785  29.475 124.381 1.00 36.21  ? 123 ASP C N   1 
ATOM   3683  C CA  . ASP C 1 123 ? 79.369  29.608 124.056 1.00 36.21  ? 123 ASP C CA  1 
ATOM   3684  C C   . ASP C 1 123 ? 78.624  30.581 124.973 1.00 36.21  ? 123 ASP C C   1 
ATOM   3685  O O   . ASP C 1 123 ? 79.189  31.073 125.954 1.00 36.21  ? 123 ASP C O   1 
ATOM   3686  C CB  . ASP C 1 123 ? 78.680  28.248 124.107 1.00 55.54  ? 123 ASP C CB  1 
ATOM   3687  C CG  . ASP C 1 123 ? 77.640  28.090 123.022 1.00 55.54  ? 123 ASP C CG  1 
ATOM   3688  O OD1 . ASP C 1 123 ? 76.745  28.955 122.926 1.00 55.54  ? 123 ASP C OD1 1 
ATOM   3689  O OD2 . ASP C 1 123 ? 77.724  27.097 122.259 1.00 55.54  ? 123 ASP C OD2 1 
ATOM   3690  N N   . VAL C 1 124 ? 77.361  30.860 124.641 1.00 56.86  ? 124 VAL C N   1 
ATOM   3691  C CA  . VAL C 1 124 ? 76.526  31.760 125.438 1.00 56.86  ? 124 VAL C CA  1 
ATOM   3692  C C   . VAL C 1 124 ? 75.575  30.967 126.325 1.00 56.86  ? 124 VAL C C   1 
ATOM   3693  O O   . VAL C 1 124 ? 75.037  29.937 125.926 1.00 56.86  ? 124 VAL C O   1 
ATOM   3694  C CB  . VAL C 1 124 ? 75.596  32.630 124.588 1.00 58.59  ? 124 VAL C CB  1 
ATOM   3695  C CG1 . VAL C 1 124 ? 75.538  34.038 125.153 1.00 58.59  ? 124 VAL C CG1 1 
ATOM   3696  C CG2 . VAL C 1 124 ? 76.012  32.595 123.166 1.00 58.59  ? 124 VAL C CG2 1 
ATOM   3697  N N   . GLY C 1 125 ? 75.350  31.466 127.529 1.00 39.46  ? 125 GLY C N   1 
ATOM   3698  C CA  . GLY C 1 125 ? 74.425  30.813 128.419 1.00 39.46  ? 125 GLY C CA  1 
ATOM   3699  C C   . GLY C 1 125 ? 73.410  31.885 128.698 1.00 39.46  ? 125 GLY C C   1 
ATOM   3700  O O   . GLY C 1 125 ? 73.682  33.054 128.438 1.00 39.46  ? 125 GLY C O   1 
ATOM   3701  N N   . TYR C 1 126 ? 72.244  31.516 129.205 1.00 54.53  ? 126 TYR C N   1 
ATOM   3702  C CA  . TYR C 1 126 ? 71.237  32.516 129.524 1.00 54.53  ? 126 TYR C CA  1 
ATOM   3703  C C   . TYR C 1 126 ? 70.511  32.145 130.809 1.00 54.53  ? 126 TYR C C   1 
ATOM   3704  O O   . TYR C 1 126 ? 70.110  31.004 130.997 1.00 54.53  ? 126 TYR C O   1 
ATOM   3705  C CB  . TYR C 1 126 ? 70.235  32.663 128.378 1.00 63.11  ? 126 TYR C CB  1 
ATOM   3706  C CG  . TYR C 1 126 ? 69.673  34.057 128.267 1.00 63.11  ? 126 TYR C CG  1 
ATOM   3707  C CD1 . TYR C 1 126 ? 70.406  35.081 127.684 1.00 63.11  ? 126 TYR C CD1 1 
ATOM   3708  C CD2 . TYR C 1 126 ? 68.435  34.370 128.800 1.00 63.11  ? 126 TYR C CD2 1 
ATOM   3709  C CE1 . TYR C 1 126 ? 69.917  36.399 127.641 1.00 63.11  ? 126 TYR C CE1 1 
ATOM   3710  C CE2 . TYR C 1 126 ? 67.935  35.680 128.764 1.00 63.11  ? 126 TYR C CE2 1 
ATOM   3711  C CZ  . TYR C 1 126 ? 68.681  36.689 128.186 1.00 63.11  ? 126 TYR C CZ  1 
ATOM   3712  O OH  . TYR C 1 126 ? 68.188  37.978 128.181 1.00 63.11  ? 126 TYR C OH  1 
ATOM   3713  N N   . GLY C 1 127 ? 70.369  33.113 131.703 1.00 69.33  ? 127 GLY C N   1 
ATOM   3714  C CA  . GLY C 1 127 ? 69.689  32.872 132.960 1.00 69.33  ? 127 GLY C CA  1 
ATOM   3715  C C   . GLY C 1 127 ? 68.399  33.660 132.966 1.00 69.33  ? 127 GLY C C   1 
ATOM   3716  O O   . GLY C 1 127 ? 68.342  34.763 132.426 1.00 69.33  ? 127 GLY C O   1 
ATOM   3717  N N   . VAL C 1 128 ? 67.355  33.111 133.569 1.00 62.87  ? 128 VAL C N   1 
ATOM   3718  C CA  . VAL C 1 128 ? 66.085  33.809 133.586 1.00 62.87  ? 128 VAL C CA  1 
ATOM   3719  C C   . VAL C 1 128 ? 65.406  33.666 134.919 1.00 62.87  ? 128 VAL C C   1 
ATOM   3720  O O   . VAL C 1 128 ? 65.550  32.642 135.572 1.00 62.87  ? 128 VAL C O   1 
ATOM   3721  C CB  . VAL C 1 128 ? 65.136  33.238 132.541 1.00 42.07  ? 128 VAL C CB  1 
ATOM   3722  C CG1 . VAL C 1 128 ? 63.904  34.107 132.439 1.00 42.07  ? 128 VAL C CG1 1 
ATOM   3723  C CG2 . VAL C 1 128 ? 65.831  33.132 131.203 1.00 42.07  ? 128 VAL C CG2 1 
ATOM   3724  N N   . SER C 1 129 ? 64.666  34.699 135.308 1.00 62.40  ? 129 SER C N   1 
ATOM   3725  C CA  . SER C 1 129 ? 63.899  34.728 136.551 1.00 62.40  ? 129 SER C CA  1 
ATOM   3726  C C   . SER C 1 129 ? 62.712  35.612 136.225 1.00 62.40  ? 129 SER C C   1 
ATOM   3727  O O   . SER C 1 129 ? 62.896  36.790 135.929 1.00 62.40  ? 129 SER C O   1 
ATOM   3728  C CB  . SER C 1 129 ? 64.706  35.351 137.683 1.00 59.61  ? 129 SER C CB  1 
ATOM   3729  O OG  . SER C 1 129 ? 63.898  35.491 138.836 1.00 59.61  ? 129 SER C OG  1 
ATOM   3730  N N   . GLU C 1 130 ? 61.499  35.068 136.279 1.00 122.18 ? 130 GLU C N   1 
ATOM   3731  C CA  . GLU C 1 130 ? 60.335  35.870 135.923 1.00 122.18 ? 130 GLU C CA  1 
ATOM   3732  C C   . GLU C 1 130 ? 59.223  36.028 136.952 1.00 122.18 ? 130 GLU C C   1 
ATOM   3733  O O   . GLU C 1 130 ? 58.238  36.721 136.698 1.00 122.18 ? 130 GLU C O   1 
ATOM   3734  C CB  . GLU C 1 130 ? 59.736  35.344 134.620 1.00 85.26  ? 130 GLU C CB  1 
ATOM   3735  C CG  . GLU C 1 130 ? 60.759  35.176 133.516 1.00 85.26  ? 130 GLU C CG  1 
ATOM   3736  C CD  . GLU C 1 130 ? 60.153  35.248 132.125 1.00 85.26  ? 130 GLU C CD  1 
ATOM   3737  O OE1 . GLU C 1 130 ? 59.819  36.364 131.674 1.00 85.26  ? 130 GLU C OE1 1 
ATOM   3738  O OE2 . GLU C 1 130 ? 60.008  34.187 131.484 1.00 85.26  ? 130 GLU C OE2 1 
ATOM   3739  N N   . GLY C 1 131 ? 59.362  35.411 138.116 1.00 73.83  ? 131 GLY C N   1 
ATOM   3740  C CA  . GLY C 1 131 ? 58.300  35.552 139.096 1.00 73.83  ? 131 GLY C CA  1 
ATOM   3741  C C   . GLY C 1 131 ? 58.632  36.388 140.319 1.00 73.83  ? 131 GLY C C   1 
ATOM   3742  O O   . GLY C 1 131 ? 58.070  37.460 140.519 1.00 73.83  ? 131 GLY C O   1 
ATOM   3743  N N   . LEU C 1 132 ? 59.549  35.868 141.128 1.00 72.67  ? 132 LEU C N   1 
ATOM   3744  C CA  . LEU C 1 132 ? 59.998  36.471 142.371 1.00 72.67  ? 132 LEU C CA  1 
ATOM   3745  C C   . LEU C 1 132 ? 59.674  37.937 142.623 1.00 72.67  ? 132 LEU C C   1 
ATOM   3746  O O   . LEU C 1 132 ? 59.574  38.749 141.707 1.00 72.67  ? 132 LEU C O   1 
ATOM   3747  C CB  . LEU C 1 132 ? 61.499  36.239 142.524 1.00 76.90  ? 132 LEU C CB  1 
ATOM   3748  C CG  . LEU C 1 132 ? 61.891  34.758 142.606 1.00 76.90  ? 132 LEU C CG  1 
ATOM   3749  C CD1 . LEU C 1 132 ? 63.396  34.634 142.564 1.00 76.90  ? 132 LEU C CD1 1 
ATOM   3750  C CD2 . LEU C 1 132 ? 61.355  34.131 143.885 1.00 76.90  ? 132 LEU C CD2 1 
ATOM   3751  N N   . LYS C 1 133 ? 59.501  38.262 143.897 1.00 76.84  ? 133 LYS C N   1 
ATOM   3752  C CA  . LYS C 1 133 ? 59.192  39.620 144.305 1.00 76.84  ? 133 LYS C CA  1 
ATOM   3753  C C   . LYS C 1 133 ? 60.495  40.250 144.736 1.00 76.84  ? 133 LYS C C   1 
ATOM   3754  O O   . LYS C 1 133 ? 60.607  41.466 144.774 1.00 76.84  ? 133 LYS C O   1 
ATOM   3755  C CB  . LYS C 1 133 ? 58.198  39.619 145.479 1.00 99.07  ? 133 LYS C CB  1 
ATOM   3756  C CG  . LYS C 1 133 ? 56.800  39.087 145.141 1.00 99.07  ? 133 LYS C CG  1 
ATOM   3757  C CD  . LYS C 1 133 ? 55.921  38.949 146.381 1.00 99.07  ? 133 LYS C CD  1 
ATOM   3758  C CE  . LYS C 1 133 ? 55.745  40.278 147.096 1.00 99.07  ? 133 LYS C CE  1 
ATOM   3759  N NZ  . LYS C 1 133 ? 55.122  41.288 146.210 1.00 99.07  ? 133 LYS C NZ  1 
ATOM   3760  N N   . SER C 1 134 ? 61.479  39.409 145.061 1.00 91.59  ? 134 SER C N   1 
ATOM   3761  C CA  . SER C 1 134 ? 62.793  39.889 145.495 1.00 91.59  ? 134 SER C CA  1 
ATOM   3762  C C   . SER C 1 134 ? 63.692  40.143 144.309 1.00 91.59  ? 134 SER C C   1 
ATOM   3763  O O   . SER C 1 134 ? 63.875  39.280 143.452 1.00 91.59  ? 134 SER C O   1 
ATOM   3764  C CB  . SER C 1 134 ? 63.492  38.881 146.412 1.00 78.70  ? 134 SER C CB  1 
ATOM   3765  O OG  . SER C 1 134 ? 64.785  39.346 146.779 1.00 78.70  ? 134 SER C OG  1 
ATOM   3766  N N   . LYS C 1 135 ? 64.261  41.337 144.269 1.00 105.55 ? 135 LYS C N   1 
ATOM   3767  C CA  . LYS C 1 135 ? 65.145  41.698 143.186 1.00 105.55 ? 135 LYS C CA  1 
ATOM   3768  C C   . LYS C 1 135 ? 66.427  40.896 143.327 1.00 105.55 ? 135 LYS C C   1 
ATOM   3769  O O   . LYS C 1 135 ? 66.880  40.265 142.375 1.00 105.55 ? 135 LYS C O   1 
ATOM   3770  C CB  . LYS C 1 135 ? 65.438  43.198 143.223 1.00 69.42  ? 135 LYS C CB  1 
ATOM   3771  C CG  . LYS C 1 135 ? 66.221  43.684 142.024 1.00 69.42  ? 135 LYS C CG  1 
ATOM   3772  C CD  . LYS C 1 135 ? 65.859  45.103 141.611 1.00 69.42  ? 135 LYS C CD  1 
ATOM   3773  C CE  . LYS C 1 135 ? 66.461  46.142 142.544 1.00 69.42  ? 135 LYS C CE  1 
ATOM   3774  N NZ  . LYS C 1 135 ? 66.266  47.546 142.044 1.00 69.42  ? 135 LYS C NZ  1 
ATOM   3775  N N   . ALA C 1 136 ? 67.002  40.909 144.523 1.00 67.42  ? 136 ALA C N   1 
ATOM   3776  C CA  . ALA C 1 136 ? 68.226  40.169 144.771 1.00 67.42  ? 136 ALA C CA  1 
ATOM   3777  C C   . ALA C 1 136 ? 68.084  38.723 144.311 1.00 67.42  ? 136 ALA C C   1 
ATOM   3778  O O   . ALA C 1 136 ? 68.856  38.256 143.473 1.00 67.42  ? 136 ALA C O   1 
ATOM   3779  C CB  . ALA C 1 136 ? 68.565  40.203 146.235 1.00 55.21  ? 136 ALA C CB  1 
ATOM   3780  N N   . LEU C 1 137 ? 67.096  38.013 144.843 1.00 74.70  ? 137 LEU C N   1 
ATOM   3781  C CA  . LEU C 1 137 ? 66.910  36.617 144.464 1.00 74.70  ? 137 LEU C CA  1 
ATOM   3782  C C   . LEU C 1 137 ? 66.732  36.398 142.967 1.00 74.70  ? 137 LEU C C   1 
ATOM   3783  O O   . LEU C 1 137 ? 67.193  35.386 142.427 1.00 74.70  ? 137 LEU C O   1 
ATOM   3784  C CB  . LEU C 1 137 ? 65.726  36.012 145.220 1.00 103.98 ? 137 LEU C CB  1 
ATOM   3785  C CG  . LEU C 1 137 ? 66.080  35.407 146.579 1.00 103.98 ? 137 LEU C CG  1 
ATOM   3786  C CD1 . LEU C 1 137 ? 66.803  36.431 147.437 1.00 103.98 ? 137 LEU C CD1 1 
ATOM   3787  C CD2 . LEU C 1 137 ? 64.813  34.923 147.252 1.00 103.98 ? 137 LEU C CD2 1 
ATOM   3788  N N   . SER C 1 138 ? 66.063  37.336 142.301 1.00 85.24  ? 138 SER C N   1 
ATOM   3789  C CA  . SER C 1 138 ? 65.841  37.228 140.864 1.00 85.24  ? 138 SER C CA  1 
ATOM   3790  C C   . SER C 1 138 ? 67.170  37.301 140.106 1.00 85.24  ? 138 SER C C   1 
ATOM   3791  O O   . SER C 1 138 ? 67.398  36.532 139.167 1.00 85.24  ? 138 SER C O   1 
ATOM   3792  C CB  . SER C 1 138 ? 64.888  38.336 140.376 1.00 80.75  ? 138 SER C CB  1 
ATOM   3793  O OG  . SER C 1 138 ? 63.523  38.009 140.606 1.00 80.75  ? 138 SER C OG  1 
ATOM   3794  N N   . LEU C 1 139 ? 68.048  38.215 140.520 1.00 62.91  ? 139 LEU C N   1 
ATOM   3795  C CA  . LEU C 1 139 ? 69.335  38.356 139.861 1.00 62.91  ? 139 LEU C CA  1 
ATOM   3796  C C   . LEU C 1 139 ? 70.201  37.153 140.161 1.00 62.91  ? 139 LEU C C   1 
ATOM   3797  O O   . LEU C 1 139 ? 70.706  36.506 139.247 1.00 62.91  ? 139 LEU C O   1 
ATOM   3798  C CB  . LEU C 1 139 ? 70.039  39.639 140.302 1.00 62.82  ? 139 LEU C CB  1 
ATOM   3799  C CG  . LEU C 1 139 ? 69.454  40.948 139.750 1.00 62.82  ? 139 LEU C CG  1 
ATOM   3800  C CD1 . LEU C 1 139 ? 70.168  42.100 140.393 1.00 62.82  ? 139 LEU C CD1 1 
ATOM   3801  C CD2 . LEU C 1 139 ? 69.603  41.035 138.245 1.00 62.82  ? 139 LEU C CD2 1 
ATOM   3802  N N   . GLU C 1 140 ? 70.364  36.837 141.436 1.00 51.82  ? 140 GLU C N   1 
ATOM   3803  C CA  . GLU C 1 140 ? 71.173  35.686 141.798 1.00 51.82  ? 140 GLU C CA  1 
ATOM   3804  C C   . GLU C 1 140 ? 70.791  34.488 140.932 1.00 51.82  ? 140 GLU C C   1 
ATOM   3805  O O   . GLU C 1 140 ? 71.650  33.765 140.434 1.00 51.82  ? 140 GLU C O   1 
ATOM   3806  C CB  . GLU C 1 140 ? 70.976  35.325 143.271 1.00 82.14  ? 140 GLU C CB  1 
ATOM   3807  C CG  . GLU C 1 140 ? 71.618  34.008 143.662 1.00 82.14  ? 140 GLU C CG  1 
ATOM   3808  C CD  . GLU C 1 140 ? 71.391  33.644 145.114 1.00 82.14  ? 140 GLU C CD  1 
ATOM   3809  O OE1 . GLU C 1 140 ? 70.221  33.615 145.552 1.00 82.14  ? 140 GLU C OE1 1 
ATOM   3810  O OE2 . GLU C 1 140 ? 72.386  33.375 145.817 1.00 82.14  ? 140 GLU C OE2 1 
ATOM   3811  N N   . LYS C 1 141 ? 69.499  34.285 140.734 1.00 47.73  ? 141 LYS C N   1 
ATOM   3812  C CA  . LYS C 1 141 ? 69.043  33.147 139.944 1.00 47.73  ? 141 LYS C CA  1 
ATOM   3813  C C   . LYS C 1 141 ? 69.512  33.241 138.497 1.00 47.73  ? 141 LYS C C   1 
ATOM   3814  O O   . LYS C 1 141 ? 70.088  32.293 137.949 1.00 47.73  ? 141 LYS C O   1 
ATOM   3815  C CB  . LYS C 1 141 ? 67.515  33.053 139.984 1.00 53.34  ? 141 LYS C CB  1 
ATOM   3816  C CG  . LYS C 1 141 ? 66.975  31.690 139.611 1.00 53.34  ? 141 LYS C CG  1 
ATOM   3817  C CD  . LYS C 1 141 ? 65.918  31.780 138.516 1.00 53.34  ? 141 LYS C CD  1 
ATOM   3818  C CE  . LYS C 1 141 ? 65.254  30.428 138.257 1.00 53.34  ? 141 LYS C CE  1 
ATOM   3819  N NZ  . LYS C 1 141 ? 64.686  30.316 136.876 1.00 53.34  ? 141 LYS C NZ  1 
ATOM   3820  N N   . ALA C 1 142 ? 69.270  34.397 137.885 1.00 70.60  ? 142 ALA C N   1 
ATOM   3821  C CA  . ALA C 1 142 ? 69.634  34.614 136.493 1.00 70.60  ? 142 ALA C CA  1 
ATOM   3822  C C   . ALA C 1 142 ? 71.133  34.620 136.224 1.00 70.60  ? 142 ALA C C   1 
ATOM   3823  O O   . ALA C 1 142 ? 71.576  34.064 135.223 1.00 70.60  ? 142 ALA C O   1 
ATOM   3824  C CB  . ALA C 1 142 ? 69.008  35.907 135.987 1.00 37.56  ? 142 ALA C CB  1 
ATOM   3825  N N   . ARG C 1 143 ? 71.917  35.237 137.105 1.00 65.76  ? 143 ARG C N   1 
ATOM   3826  C CA  . ARG C 1 143 ? 73.360  35.282 136.893 1.00 65.76  ? 143 ARG C CA  1 
ATOM   3827  C C   . ARG C 1 143 ? 73.977  33.906 137.023 1.00 65.76  ? 143 ARG C C   1 
ATOM   3828  O O   . ARG C 1 143 ? 74.846  33.537 136.238 1.00 65.76  ? 143 ARG C O   1 
ATOM   3829  C CB  . ARG C 1 143 ? 74.052  36.225 137.879 1.00 57.21  ? 143 ARG C CB  1 
ATOM   3830  C CG  . ARG C 1 143 ? 73.459  37.605 137.905 1.00 57.21  ? 143 ARG C CG  1 
ATOM   3831  C CD  . ARG C 1 143 ? 74.363  38.638 138.573 1.00 57.21  ? 143 ARG C CD  1 
ATOM   3832  N NE  . ARG C 1 143 ? 75.298  39.214 137.617 1.00 57.21  ? 143 ARG C NE  1 
ATOM   3833  C CZ  . ARG C 1 143 ? 75.483  40.520 137.417 1.00 57.21  ? 143 ARG C CZ  1 
ATOM   3834  N NH1 . ARG C 1 143 ? 74.797  41.415 138.111 1.00 57.21  ? 143 ARG C NH1 1 
ATOM   3835  N NH2 . ARG C 1 143 ? 76.360  40.938 136.509 1.00 57.21  ? 143 ARG C NH2 1 
ATOM   3836  N N   . LYS C 1 144 ? 73.524  33.139 138.006 1.00 51.77  ? 144 LYS C N   1 
ATOM   3837  C CA  . LYS C 1 144 ? 74.078  31.807 138.220 1.00 51.77  ? 144 LYS C CA  1 
ATOM   3838  C C   . LYS C 1 144 ? 73.694  30.879 137.079 1.00 51.77  ? 144 LYS C C   1 
ATOM   3839  O O   . LYS C 1 144 ? 74.540  30.188 136.508 1.00 51.77  ? 144 LYS C O   1 
ATOM   3840  C CB  . LYS C 1 144 ? 73.604  31.234 139.567 1.00 50.75  ? 144 LYS C CB  1 
ATOM   3841  C CG  . LYS C 1 144 ? 74.113  32.001 140.763 1.00 50.75  ? 144 LYS C CG  1 
ATOM   3842  C CD  . LYS C 1 144 ? 74.013  31.210 142.055 1.00 50.75  ? 144 LYS C CD  1 
ATOM   3843  C CE  . LYS C 1 144 ? 74.698  31.956 143.214 1.00 50.75  ? 144 LYS C CE  1 
ATOM   3844  N NZ  . LYS C 1 144 ? 74.698  31.185 144.488 1.00 50.75  ? 144 LYS C NZ  1 
ATOM   3845  N N   . GLU C 1 145 ? 72.414  30.870 136.748 1.00 51.84  ? 145 GLU C N   1 
ATOM   3846  C CA  . GLU C 1 145 ? 71.947  30.027 135.670 1.00 51.84  ? 145 GLU C CA  1 
ATOM   3847  C C   . GLU C 1 145 ? 72.614  30.328 134.328 1.00 51.84  ? 145 GLU C C   1 
ATOM   3848  O O   . GLU C 1 145 ? 72.930  29.405 133.582 1.00 51.84  ? 145 GLU C O   1 
ATOM   3849  C CB  . GLU C 1 145 ? 70.430  30.128 135.554 1.00 79.67  ? 145 GLU C CB  1 
ATOM   3850  C CG  . GLU C 1 145 ? 69.734  29.052 136.350 1.00 79.67  ? 145 GLU C CG  1 
ATOM   3851  C CD  . GLU C 1 145 ? 68.250  29.280 136.501 1.00 79.67  ? 145 GLU C CD  1 
ATOM   3852  O OE1 . GLU C 1 145 ? 67.579  29.641 135.499 1.00 79.67  ? 145 GLU C OE1 1 
ATOM   3853  O OE2 . GLU C 1 145 ? 67.760  29.079 137.635 1.00 79.67  ? 145 GLU C OE2 1 
ATOM   3854  N N   . ALA C 1 146 ? 72.839  31.602 134.018 1.00 48.84  ? 146 ALA C N   1 
ATOM   3855  C CA  . ALA C 1 146 ? 73.476  31.956 132.752 1.00 48.84  ? 146 ALA C CA  1 
ATOM   3856  C C   . ALA C 1 146 ? 74.851  31.303 132.629 1.00 48.84  ? 146 ALA C C   1 
ATOM   3857  O O   . ALA C 1 146 ? 75.200  30.760 131.579 1.00 48.84  ? 146 ALA C O   1 
ATOM   3858  C CB  . ALA C 1 146 ? 73.615  33.443 132.632 1.00 36.84  ? 146 ALA C CB  1 
ATOM   3859  N N   . VAL C 1 147 ? 75.633  31.356 133.702 1.00 41.92  ? 147 VAL C N   1 
ATOM   3860  C CA  . VAL C 1 147 ? 76.953  30.757 133.695 1.00 41.92  ? 147 VAL C CA  1 
ATOM   3861  C C   . VAL C 1 147 ? 76.879  29.247 133.538 1.00 41.92  ? 147 VAL C C   1 
ATOM   3862  O O   . VAL C 1 147 ? 77.567  28.676 132.692 1.00 41.92  ? 147 VAL C O   1 
ATOM   3863  C CB  . VAL C 1 147 ? 77.727  31.084 134.983 1.00 38.52  ? 147 VAL C CB  1 
ATOM   3864  C CG1 . VAL C 1 147 ? 79.004  30.269 135.058 1.00 38.52  ? 147 VAL C CG1 1 
ATOM   3865  C CG2 . VAL C 1 147 ? 78.073  32.545 135.009 1.00 38.52  ? 147 VAL C CG2 1 
ATOM   3866  N N   . THR C 1 148 ? 76.058  28.583 134.342 1.00 51.30  ? 148 THR C N   1 
ATOM   3867  C CA  . THR C 1 148 ? 75.961  27.131 134.232 1.00 51.30  ? 148 THR C CA  1 
ATOM   3868  C C   . THR C 1 148 ? 75.468  26.767 132.833 1.00 51.30  ? 148 THR C C   1 
ATOM   3869  O O   . THR C 1 148 ? 75.972  25.840 132.193 1.00 51.30  ? 148 THR C O   1 
ATOM   3870  C CB  . THR C 1 148 ? 75.007  26.530 135.316 1.00 40.12  ? 148 THR C CB  1 
ATOM   3871  O OG1 . THR C 1 148 ? 75.513  26.843 136.620 1.00 40.12  ? 148 THR C OG1 1 
ATOM   3872  C CG2 . THR C 1 148 ? 74.930  25.018 135.186 1.00 40.12  ? 148 THR C CG2 1 
ATOM   3873  N N   . ASP C 1 149 ? 74.482  27.510 132.352 1.00 37.80  ? 149 ASP C N   1 
ATOM   3874  C CA  . ASP C 1 149 ? 73.956  27.264 131.021 1.00 37.80  ? 149 ASP C CA  1 
ATOM   3875  C C   . ASP C 1 149 ? 75.085  27.457 129.991 1.00 37.80  ? 149 ASP C C   1 
ATOM   3876  O O   . ASP C 1 149 ? 75.214  26.698 129.025 1.00 37.80  ? 149 ASP C O   1 
ATOM   3877  C CB  . ASP C 1 149 ? 72.809  28.223 130.749 1.00 47.69  ? 149 ASP C CB  1 
ATOM   3878  C CG  . ASP C 1 149 ? 72.030  27.847 129.534 1.00 47.69  ? 149 ASP C CG  1 
ATOM   3879  O OD1 . ASP C 1 149 ? 71.692  26.651 129.392 1.00 47.69  ? 149 ASP C OD1 1 
ATOM   3880  O OD2 . ASP C 1 149 ? 71.738  28.750 128.721 1.00 47.69  ? 149 ASP C OD2 1 
ATOM   3881  N N   . GLY C 1 150 ? 75.913  28.472 130.217 1.00 37.60  ? 150 GLY C N   1 
ATOM   3882  C CA  . GLY C 1 150 ? 77.006  28.725 129.311 1.00 37.60  ? 150 GLY C CA  1 
ATOM   3883  C C   . GLY C 1 150 ? 77.974  27.557 129.262 1.00 37.60  ? 150 GLY C C   1 
ATOM   3884  O O   . GLY C 1 150 ? 78.307  27.031 128.180 1.00 37.60  ? 150 GLY C O   1 
ATOM   3885  N N   . LEU C 1 151 ? 78.436  27.163 130.448 1.00 41.09  ? 151 LEU C N   1 
ATOM   3886  C CA  . LEU C 1 151 ? 79.377  26.060 130.590 1.00 41.09  ? 151 LEU C CA  1 
ATOM   3887  C C   . LEU C 1 151 ? 78.857  24.786 129.927 1.00 41.09  ? 151 LEU C C   1 
ATOM   3888  O O   . LEU C 1 151 ? 79.594  24.108 129.209 1.00 41.09  ? 151 LEU C O   1 
ATOM   3889  C CB  . LEU C 1 151 ? 79.661  25.808 132.069 1.00 32.15  ? 151 LEU C CB  1 
ATOM   3890  C CG  . LEU C 1 151 ? 80.574  24.627 132.413 1.00 32.15  ? 151 LEU C CG  1 
ATOM   3891  C CD1 . LEU C 1 151 ? 81.846  24.657 131.560 1.00 32.15  ? 151 LEU C CD1 1 
ATOM   3892  C CD2 . LEU C 1 151 ? 80.951  24.693 133.883 1.00 32.15  ? 151 LEU C CD2 1 
ATOM   3893  N N   . LYS C 1 152 ? 77.584  24.473 130.143 1.00 48.88  ? 152 LYS C N   1 
ATOM   3894  C CA  . LYS C 1 152 ? 77.024  23.267 129.555 1.00 48.88  ? 152 LYS C CA  1 
ATOM   3895  C C   . LYS C 1 152 ? 77.039  23.343 128.045 1.00 48.88  ? 152 LYS C C   1 
ATOM   3896  O O   . LYS C 1 152 ? 77.438  22.389 127.372 1.00 48.88  ? 152 LYS C O   1 
ATOM   3897  C CB  . LYS C 1 152 ? 75.593  23.025 130.041 1.00 58.36  ? 152 LYS C CB  1 
ATOM   3898  C CG  . LYS C 1 152 ? 75.488  22.494 131.462 1.00 58.36  ? 152 LYS C CG  1 
ATOM   3899  C CD  . LYS C 1 152 ? 74.077  22.030 131.784 1.00 58.36  ? 152 LYS C CD  1 
ATOM   3900  C CE  . LYS C 1 152 ? 73.047  23.133 131.588 1.00 58.36  ? 152 LYS C CE  1 
ATOM   3901  N NZ  . LYS C 1 152 ? 71.666  22.712 131.989 1.00 58.36  ? 152 LYS C NZ  1 
ATOM   3902  N N   . ARG C 1 153 ? 76.602  24.477 127.511 1.00 40.24  ? 153 ARG C N   1 
ATOM   3903  C CA  . ARG C 1 153 ? 76.571  24.646 126.065 1.00 40.24  ? 153 ARG C CA  1 
ATOM   3904  C C   . ARG C 1 153 ? 77.991  24.622 125.458 1.00 40.24  ? 153 ARG C C   1 
ATOM   3905  O O   . ARG C 1 153 ? 78.188  24.177 124.325 1.00 40.24  ? 153 ARG C O   1 
ATOM   3906  C CB  . ARG C 1 153 ? 75.840  25.947 125.702 1.00 45.54  ? 153 ARG C CB  1 
ATOM   3907  C CG  . ARG C 1 153 ? 74.322  25.854 125.714 1.00 45.54  ? 153 ARG C CG  1 
ATOM   3908  C CD  . ARG C 1 153 ? 73.666  27.220 125.550 1.00 45.54  ? 153 ARG C CD  1 
ATOM   3909  N NE  . ARG C 1 153 ? 74.004  27.858 124.283 1.00 45.54  ? 153 ARG C NE  1 
ATOM   3910  C CZ  . ARG C 1 153 ? 73.444  27.561 123.118 1.00 45.54  ? 153 ARG C CZ  1 
ATOM   3911  N NH1 . ARG C 1 153 ? 72.509  26.625 123.072 1.00 45.54  ? 153 ARG C NH1 1 
ATOM   3912  N NH2 . ARG C 1 153 ? 73.815  28.195 122.005 1.00 45.54  ? 153 ARG C NH2 1 
ATOM   3913  N N   . ALA C 1 154 ? 78.980  25.088 126.211 1.00 34.79  ? 154 ALA C N   1 
ATOM   3914  C CA  . ALA C 1 154 ? 80.335  25.082 125.695 1.00 34.79  ? 154 ALA C CA  1 
ATOM   3915  C C   . ALA C 1 154 ? 80.888  23.672 125.674 1.00 34.79  ? 154 ALA C C   1 
ATOM   3916  O O   . ALA C 1 154 ? 81.526  23.277 124.709 1.00 34.79  ? 154 ALA C O   1 
ATOM   3917  C CB  . ALA C 1 154 ? 81.227  25.976 126.524 1.00 17.06  ? 154 ALA C CB  1 
ATOM   3918  N N   . LEU C 1 155 ? 80.650  22.913 126.736 1.00 43.61  ? 155 LEU C N   1 
ATOM   3919  C CA  . LEU C 1 155 ? 81.148  21.549 126.784 1.00 43.61  ? 155 LEU C CA  1 
ATOM   3920  C C   . LEU C 1 155 ? 80.472  20.655 125.741 1.00 43.61  ? 155 LEU C C   1 
ATOM   3921  O O   . LEU C 1 155 ? 81.068  19.675 125.280 1.00 43.61  ? 155 LEU C O   1 
ATOM   3922  C CB  . LEU C 1 155 ? 80.963  20.970 128.186 1.00 32.36  ? 155 LEU C CB  1 
ATOM   3923  C CG  . LEU C 1 155 ? 81.888  21.527 129.278 1.00 32.36  ? 155 LEU C CG  1 
ATOM   3924  C CD1 . LEU C 1 155 ? 81.320  21.220 130.656 1.00 32.36  ? 155 LEU C CD1 1 
ATOM   3925  C CD2 . LEU C 1 155 ? 83.287  20.948 129.123 1.00 32.36  ? 155 LEU C CD2 1 
ATOM   3926  N N   . ARG C 1 156 ? 79.243  20.981 125.356 1.00 38.10  ? 156 ARG C N   1 
ATOM   3927  C CA  . ARG C 1 156 ? 78.563  20.165 124.353 1.00 38.10  ? 156 ARG C CA  1 
ATOM   3928  C C   . ARG C 1 156 ? 79.415  20.045 123.093 1.00 38.10  ? 156 ARG C C   1 
ATOM   3929  O O   . ARG C 1 156 ? 79.402  19.014 122.406 1.00 38.10  ? 156 ARG C O   1 
ATOM   3930  C CB  . ARG C 1 156 ? 77.217  20.766 123.949 1.00 73.40  ? 156 ARG C CB  1 
ATOM   3931  C CG  . ARG C 1 156 ? 76.118  20.676 124.975 1.00 73.40  ? 156 ARG C CG  1 
ATOM   3932  C CD  . ARG C 1 156 ? 74.823  21.176 124.344 1.00 73.40  ? 156 ARG C CD  1 
ATOM   3933  N NE  . ARG C 1 156 ? 73.827  21.585 125.329 1.00 73.40  ? 156 ARG C NE  1 
ATOM   3934  C CZ  . ARG C 1 156 ? 72.771  22.334 125.028 1.00 73.40  ? 156 ARG C CZ  1 
ATOM   3935  N NH1 . ARG C 1 156 ? 72.591  22.733 123.774 1.00 73.40  ? 156 ARG C NH1 1 
ATOM   3936  N NH2 . ARG C 1 156 ? 71.913  22.715 125.972 1.00 73.40  ? 156 ARG C NH2 1 
ATOM   3937  N N   . SER C 1 157 ? 80.154  21.103 122.782 1.00 32.31  ? 157 SER C N   1 
ATOM   3938  C CA  . SER C 1 157 ? 80.977  21.117 121.585 1.00 32.31  ? 157 SER C CA  1 
ATOM   3939  C C   . SER C 1 157 ? 81.980  19.985 121.518 1.00 32.31  ? 157 SER C C   1 
ATOM   3940  O O   . SER C 1 157 ? 82.443  19.644 120.452 1.00 32.31  ? 157 SER C O   1 
ATOM   3941  C CB  . SER C 1 157 ? 81.701  22.456 121.457 1.00 35.74  ? 157 SER C CB  1 
ATOM   3942  O OG  . SER C 1 157 ? 80.778  23.525 121.331 1.00 35.74  ? 157 SER C OG  1 
ATOM   3943  N N   . PHE C 1 158 ? 82.321  19.387 122.643 1.00 45.54  ? 158 PHE C N   1 
ATOM   3944  C CA  . PHE C 1 158 ? 83.303  18.308 122.608 1.00 45.54  ? 158 PHE C CA  1 
ATOM   3945  C C   . PHE C 1 158 ? 82.738  16.947 122.194 1.00 45.54  ? 158 PHE C C   1 
ATOM   3946  O O   . PHE C 1 158 ? 83.490  15.995 121.979 1.00 45.54  ? 158 PHE C O   1 
ATOM   3947  C CB  . PHE C 1 158 ? 84.011  18.183 123.965 1.00 32.55  ? 158 PHE C CB  1 
ATOM   3948  C CG  . PHE C 1 158 ? 84.987  19.287 124.243 1.00 32.55  ? 158 PHE C CG  1 
ATOM   3949  C CD1 . PHE C 1 158 ? 84.681  20.298 125.142 1.00 32.55  ? 158 PHE C CD1 1 
ATOM   3950  C CD2 . PHE C 1 158 ? 86.211  19.315 123.607 1.00 32.55  ? 158 PHE C CD2 1 
ATOM   3951  C CE1 . PHE C 1 158 ? 85.594  21.328 125.402 1.00 32.55  ? 158 PHE C CE1 1 
ATOM   3952  C CE2 . PHE C 1 158 ? 87.119  20.330 123.860 1.00 32.55  ? 158 PHE C CE2 1 
ATOM   3953  C CZ  . PHE C 1 158 ? 86.807  21.341 124.764 1.00 32.55  ? 158 PHE C CZ  1 
ATOM   3954  N N   . GLY C 1 159 ? 81.422  16.842 122.084 1.00 49.03  ? 159 GLY C N   1 
ATOM   3955  C CA  . GLY C 1 159 ? 80.859  15.570 121.683 1.00 49.03  ? 159 GLY C CA  1 
ATOM   3956  C C   . GLY C 1 159 ? 79.604  15.157 122.416 1.00 49.03  ? 159 GLY C C   1 
ATOM   3957  O O   . GLY C 1 159 ? 79.208  15.787 123.409 1.00 49.03  ? 159 GLY C O   1 
ATOM   3958  N N   . ASN C 1 160 ? 78.987  14.080 121.930 1.00 54.00  ? 160 ASN C N   1 
ATOM   3959  C CA  . ASN C 1 160 ? 77.754  13.578 122.518 1.00 54.00  ? 160 ASN C CA  1 
ATOM   3960  C C   . ASN C 1 160 ? 77.867  13.267 124.007 1.00 54.00  ? 160 ASN C C   1 
ATOM   3961  O O   . ASN C 1 160 ? 76.977  13.599 124.771 1.00 54.00  ? 160 ASN C O   1 
ATOM   3962  C CB  . ASN C 1 160 ? 77.291  12.323 121.783 1.00 51.61  ? 160 ASN C CB  1 
ATOM   3963  C CG  . ASN C 1 160 ? 77.160  12.539 120.306 1.00 51.61  ? 160 ASN C CG  1 
ATOM   3964  O OD1 . ASN C 1 160 ? 76.575  13.525 119.850 1.00 51.61  ? 160 ASN C OD1 1 
ATOM   3965  N ND2 . ASN C 1 160 ? 77.694  11.613 119.538 1.00 51.61  ? 160 ASN C ND2 1 
ATOM   3966  N N   . ALA C 1 161 ? 78.961  12.631 124.406 1.00 45.56  ? 161 ALA C N   1 
ATOM   3967  C CA  . ALA C 1 161 ? 79.157  12.261 125.794 1.00 45.56  ? 161 ALA C CA  1 
ATOM   3968  C C   . ALA C 1 161 ? 79.102  13.447 126.753 1.00 45.56  ? 161 ALA C C   1 
ATOM   3969  O O   . ALA C 1 161 ? 78.982  13.258 127.965 1.00 45.56  ? 161 ALA C O   1 
ATOM   3970  C CB  . ALA C 1 161 ? 80.471  11.521 125.950 1.00 23.37  ? 161 ALA C CB  1 
ATOM   3971  N N   . LEU C 1 162 ? 79.189  14.668 126.229 1.00 50.63  ? 162 LEU C N   1 
ATOM   3972  C CA  . LEU C 1 162 ? 79.128  15.849 127.093 1.00 50.63  ? 162 LEU C CA  1 
ATOM   3973  C C   . LEU C 1 162 ? 77.887  16.684 126.837 1.00 50.63  ? 162 LEU C C   1 
ATOM   3974  O O   . LEU C 1 162 ? 77.841  17.869 127.196 1.00 50.63  ? 162 LEU C O   1 
ATOM   3975  C CB  . LEU C 1 162 ? 80.375  16.716 126.937 1.00 46.53  ? 162 LEU C CB  1 
ATOM   3976  C CG  . LEU C 1 162 ? 81.627  16.133 127.603 1.00 46.53  ? 162 LEU C CG  1 
ATOM   3977  C CD1 . LEU C 1 162 ? 82.871  16.923 127.222 1.00 46.53  ? 162 LEU C CD1 1 
ATOM   3978  C CD2 . LEU C 1 162 ? 81.429  16.155 129.105 1.00 46.53  ? 162 LEU C CD2 1 
ATOM   3979  N N   . GLY C 1 163 ? 76.890  16.055 126.204 1.00 41.87  ? 163 GLY C N   1 
ATOM   3980  C CA  . GLY C 1 163 ? 75.630  16.719 125.935 1.00 41.87  ? 163 GLY C CA  1 
ATOM   3981  C C   . GLY C 1 163 ? 75.234  17.045 124.510 1.00 41.87  ? 163 GLY C C   1 
ATOM   3982  O O   . GLY C 1 163 ? 74.118  17.506 124.284 1.00 41.87  ? 163 GLY C O   1 
ATOM   3983  N N   . ASN C 1 164 ? 76.095  16.806 123.532 1.00 61.64  ? 164 ASN C N   1 
ATOM   3984  C CA  . ASN C 1 164 ? 75.716  17.164 122.172 1.00 61.64  ? 164 ASN C CA  1 
ATOM   3985  C C   . ASN C 1 164 ? 74.555  16.363 121.604 1.00 61.64  ? 164 ASN C C   1 
ATOM   3986  O O   . ASN C 1 164 ? 73.979  16.730 120.577 1.00 61.64  ? 164 ASN C O   1 
ATOM   3987  C CB  . ASN C 1 164 ? 76.900  17.052 121.231 1.00 31.13  ? 164 ASN C CB  1 
ATOM   3988  C CG  . ASN C 1 164 ? 76.623  17.704 119.918 1.00 31.13  ? 164 ASN C CG  1 
ATOM   3989  O OD1 . ASN C 1 164 ? 76.163  18.851 119.875 1.00 31.13  ? 164 ASN C OD1 1 
ATOM   3990  N ND2 . ASN C 1 164 ? 76.891  16.996 118.836 1.00 31.13  ? 164 ASN C ND2 1 
ATOM   3991  N N   . CYS C 1 165 ? 74.223  15.261 122.265 1.00 57.80  ? 165 CYS C N   1 
ATOM   3992  C CA  . CYS C 1 165 ? 73.120  14.426 121.827 1.00 57.80  ? 165 CYS C CA  1 
ATOM   3993  C C   . CYS C 1 165 ? 71.776  15.019 122.288 1.00 57.80  ? 165 CYS C C   1 
ATOM   3994  O O   . CYS C 1 165 ? 70.768  14.921 121.577 1.00 57.80  ? 165 CYS C O   1 
ATOM   3995  C CB  . CYS C 1 165 ? 73.308  12.997 122.364 1.00 63.78  ? 165 CYS C CB  1 
ATOM   3996  S SG  . CYS C 1 165 ? 73.595  12.833 124.176 1.00 63.78  ? 165 CYS C SG  1 
ATOM   3997  N N   . ILE C 1 166 ? 71.786  15.664 123.459 1.00 51.85  ? 166 ILE C N   1 
ATOM   3998  C CA  . ILE C 1 166 ? 70.587  16.266 124.056 1.00 51.85  ? 166 ILE C CA  1 
ATOM   3999  C C   . ILE C 1 166 ? 69.742  17.061 123.073 1.00 51.85  ? 166 ILE C C   1 
ATOM   4000  O O   . ILE C 1 166 ? 68.559  17.283 123.305 1.00 51.85  ? 166 ILE C O   1 
ATOM   4001  C CB  . ILE C 1 166 ? 70.953  17.209 125.240 1.00 54.21  ? 166 ILE C CB  1 
ATOM   4002  C CG1 . ILE C 1 166 ? 69.736  17.448 126.121 1.00 54.21  ? 166 ILE C CG1 1 
ATOM   4003  C CG2 . ILE C 1 166 ? 71.407  18.552 124.736 1.00 54.21  ? 166 ILE C CG2 1 
ATOM   4004  C CD1 . ILE C 1 166 ? 69.342  16.231 126.913 1.00 54.21  ? 166 ILE C CD1 1 
ATOM   4005  N N   . LEU C 1 167 ? 70.359  17.491 121.980 1.00 79.04  ? 167 LEU C N   1 
ATOM   4006  C CA  . LEU C 1 167 ? 69.679  18.285 120.963 1.00 79.04  ? 167 LEU C CA  1 
ATOM   4007  C C   . LEU C 1 167 ? 68.996  17.397 119.922 1.00 79.04  ? 167 LEU C C   1 
ATOM   4008  O O   . LEU C 1 167 ? 67.896  17.699 119.456 1.00 79.04  ? 167 LEU C O   1 
ATOM   4009  C CB  . LEU C 1 167 ? 70.697  19.200 120.264 1.00 81.12  ? 167 LEU C CB  1 
ATOM   4010  C CG  . LEU C 1 167 ? 71.471  20.177 121.149 1.00 81.12  ? 167 LEU C CG  1 
ATOM   4011  C CD1 . LEU C 1 167 ? 72.745  20.660 120.437 1.00 81.12  ? 167 LEU C CD1 1 
ATOM   4012  C CD2 . LEU C 1 167 ? 70.532  21.330 121.534 1.00 81.12  ? 167 LEU C CD2 1 
ATOM   4013  N N   . ASP C 1 168 ? 69.666  16.300 119.571 1.00 72.93  ? 168 ASP C N   1 
ATOM   4014  C CA  . ASP C 1 168 ? 69.178  15.363 118.565 1.00 72.93  ? 168 ASP C CA  1 
ATOM   4015  C C   . ASP C 1 168 ? 67.754  14.871 118.822 1.00 72.93  ? 168 ASP C C   1 
ATOM   4016  O O   . ASP C 1 168 ? 67.473  14.210 119.826 1.00 72.93  ? 168 ASP C O   1 
ATOM   4017  C CB  . ASP C 1 168 ? 70.123  14.169 118.478 1.00 81.09  ? 168 ASP C CB  1 
ATOM   4018  C CG  . ASP C 1 168 ? 69.928  13.373 117.212 1.00 81.09  ? 168 ASP C CG  1 
ATOM   4019  O OD1 . ASP C 1 168 ? 68.821  13.453 116.636 1.00 81.09  ? 168 ASP C OD1 1 
ATOM   4020  O OD2 . ASP C 1 168 ? 70.874  12.664 116.803 1.00 81.09  ? 168 ASP C OD2 1 
ATOM   4021  N N   . LYS C 1 169 ? 66.851  15.187 117.905 1.00 94.63  ? 169 LYS C N   1 
ATOM   4022  C CA  . LYS C 1 169 ? 65.469  14.772 118.061 1.00 94.63  ? 169 LYS C CA  1 
ATOM   4023  C C   . LYS C 1 169 ? 65.363  13.244 118.052 1.00 94.63  ? 169 LYS C C   1 
ATOM   4024  O O   . LYS C 1 169 ? 64.707  12.654 118.919 1.00 94.63  ? 169 LYS C O   1 
ATOM   4025  C CB  . LYS C 1 169 ? 64.630  15.399 116.951 1.00 121.76 ? 169 LYS C CB  1 
ATOM   4026  C CG  . LYS C 1 169 ? 64.712  16.917 116.959 1.00 121.76 ? 169 LYS C CG  1 
ATOM   4027  C CD  . LYS C 1 169 ? 64.008  17.544 115.767 1.00 121.76 ? 169 LYS C CD  1 
ATOM   4028  C CE  . LYS C 1 169 ? 64.119  19.066 115.796 1.00 121.76 ? 169 LYS C CE  1 
ATOM   4029  N NZ  . LYS C 1 169 ? 63.535  19.697 114.576 1.00 121.76 ? 169 LYS C NZ  1 
ATOM   4030  N N   . ASP C 1 170 ? 66.027  12.611 117.086 1.00 80.96  ? 170 ASP C N   1 
ATOM   4031  C CA  . ASP C 1 170 ? 66.018  11.151 116.961 1.00 80.96  ? 170 ASP C CA  1 
ATOM   4032  C C   . ASP C 1 170 ? 66.472  10.503 118.265 1.00 80.96  ? 170 ASP C C   1 
ATOM   4033  O O   . ASP C 1 170 ? 65.927  9.487  118.694 1.00 80.96  ? 170 ASP C O   1 
ATOM   4034  C CB  . ASP C 1 170 ? 66.944  10.695 115.823 1.00 123.52 ? 170 ASP C CB  1 
ATOM   4035  C CG  . ASP C 1 170 ? 66.500  11.201 114.461 1.00 123.52 ? 170 ASP C CG  1 
ATOM   4036  O OD1 . ASP C 1 170 ? 65.336  10.953 114.085 1.00 123.52 ? 170 ASP C OD1 1 
ATOM   4037  O OD2 . ASP C 1 170 ? 67.317  11.842 113.762 1.00 123.52 ? 170 ASP C OD2 1 
ATOM   4038  N N   . TYR C 1 171 ? 67.487  11.094 118.882 1.00 78.38  ? 171 TYR C N   1 
ATOM   4039  C CA  . TYR C 1 171 ? 68.023  10.602 120.144 1.00 78.38  ? 171 TYR C CA  1 
ATOM   4040  C C   . TYR C 1 171 ? 66.923  10.656 121.194 1.00 78.38  ? 171 TYR C C   1 
ATOM   4041  O O   . TYR C 1 171 ? 66.692  9.687  121.909 1.00 78.38  ? 171 TYR C O   1 
ATOM   4042  C CB  . TYR C 1 171 ? 69.209  11.477 120.588 1.00 55.40  ? 171 TYR C CB  1 
ATOM   4043  C CG  . TYR C 1 171 ? 69.615  11.302 122.037 1.00 55.40  ? 171 TYR C CG  1 
ATOM   4044  C CD1 . TYR C 1 171 ? 70.233  10.131 122.474 1.00 55.40  ? 171 TYR C CD1 1 
ATOM   4045  C CD2 . TYR C 1 171 ? 69.358  12.303 122.979 1.00 55.40  ? 171 TYR C CD2 1 
ATOM   4046  C CE1 . TYR C 1 171 ? 70.585  9.956  123.806 1.00 55.40  ? 171 TYR C CE1 1 
ATOM   4047  C CE2 . TYR C 1 171 ? 69.703  12.138 124.319 1.00 55.40  ? 171 TYR C CE2 1 
ATOM   4048  C CZ  . TYR C 1 171 ? 70.315  10.963 124.725 1.00 55.40  ? 171 TYR C CZ  1 
ATOM   4049  O OH  . TYR C 1 171 ? 70.646  10.797 126.054 1.00 55.40  ? 171 TYR C OH  1 
ATOM   4050  N N   . LEU C 1 172 ? 66.240  11.795 121.266 1.00 70.74  ? 172 LEU C N   1 
ATOM   4051  C CA  . LEU C 1 172 ? 65.186  11.980 122.246 1.00 70.74  ? 172 LEU C CA  1 
ATOM   4052  C C   . LEU C 1 172 ? 64.070  10.956 122.133 1.00 70.74  ? 172 LEU C C   1 
ATOM   4053  O O   . LEU C 1 172 ? 63.644  10.393 123.137 1.00 70.74  ? 172 LEU C O   1 
ATOM   4054  C CB  . LEU C 1 172 ? 64.609  13.397 122.157 1.00 66.23  ? 172 LEU C CB  1 
ATOM   4055  C CG  . LEU C 1 172 ? 65.497  14.535 122.677 1.00 66.23  ? 172 LEU C CG  1 
ATOM   4056  C CD1 . LEU C 1 172 ? 64.751  15.859 122.588 1.00 66.23  ? 172 LEU C CD1 1 
ATOM   4057  C CD2 . LEU C 1 172 ? 65.886  14.271 124.109 1.00 66.23  ? 172 LEU C CD2 1 
ATOM   4058  N N   . ARG C 1 173 ? 63.583  10.706 120.925 1.00 104.18 ? 173 ARG C N   1 
ATOM   4059  C CA  . ARG C 1 173 ? 62.516  9.728  120.778 1.00 104.18 ? 173 ARG C CA  1 
ATOM   4060  C C   . ARG C 1 173 ? 62.950  8.386  121.353 1.00 104.18 ? 173 ARG C C   1 
ATOM   4061  O O   . ARG C 1 173 ? 62.193  7.736  122.071 1.00 104.18 ? 173 ARG C O   1 
ATOM   4062  C CB  . ARG C 1 173 ? 62.128  9.569  119.310 1.00 91.80  ? 173 ARG C CB  1 
ATOM   4063  C CG  . ARG C 1 173 ? 61.444  10.797 118.731 1.00 91.80  ? 173 ARG C CG  1 
ATOM   4064  C CD  . ARG C 1 173 ? 60.913  10.553 117.318 1.00 91.80  ? 173 ARG C CD  1 
ATOM   4065  N NE  . ARG C 1 173 ? 61.972  10.256 116.357 1.00 91.80  ? 173 ARG C NE  1 
ATOM   4066  C CZ  . ARG C 1 173 ? 62.533  9.062  116.203 1.00 91.80  ? 173 ARG C CZ  1 
ATOM   4067  N NH1 . ARG C 1 173 ? 62.136  8.035  116.944 1.00 91.80  ? 173 ARG C NH1 1 
ATOM   4068  N NH2 . ARG C 1 173 ? 63.501  8.899  115.309 1.00 91.80  ? 173 ARG C NH2 1 
ATOM   4069  N N   . SER C 1 174 ? 64.178  7.981  121.052 1.00 71.26  ? 174 SER C N   1 
ATOM   4070  C CA  . SER C 1 174 ? 64.702  6.714  121.552 1.00 71.26  ? 174 SER C CA  1 
ATOM   4071  C C   . SER C 1 174 ? 64.753  6.684  123.073 1.00 71.26  ? 174 SER C C   1 
ATOM   4072  O O   . SER C 1 174 ? 64.841  5.620  123.677 1.00 71.26  ? 174 SER C O   1 
ATOM   4073  C CB  . SER C 1 174 ? 66.107  6.462  121.005 1.00 81.44  ? 174 SER C CB  1 
ATOM   4074  O OG  . SER C 1 174 ? 66.088  6.375  119.593 1.00 81.44  ? 174 SER C OG  1 
ATOM   4075  N N   . LEU C 1 175 ? 64.706  7.850  123.696 1.00 75.56  ? 175 LEU C N   1 
ATOM   4076  C CA  . LEU C 1 175 ? 64.758  7.910  125.145 1.00 75.56  ? 175 LEU C CA  1 
ATOM   4077  C C   . LEU C 1 175 ? 63.406  7.645  125.766 1.00 75.56  ? 175 LEU C C   1 
ATOM   4078  O O   . LEU C 1 175 ? 63.328  7.097  126.862 1.00 75.56  ? 175 LEU C O   1 
ATOM   4079  C CB  . LEU C 1 175 ? 65.260  9.270  125.617 1.00 86.07  ? 175 LEU C CB  1 
ATOM   4080  C CG  . LEU C 1 175 ? 66.769  9.477  125.703 1.00 86.07  ? 175 LEU C CG  1 
ATOM   4081  C CD1 . LEU C 1 175 ? 67.045  10.918 126.083 1.00 86.07  ? 175 LEU C CD1 1 
ATOM   4082  C CD2 . LEU C 1 175 ? 67.366  8.535  126.732 1.00 86.07  ? 175 LEU C CD2 1 
ATOM   4083  N N   . ASN C 1 176 ? 62.341  8.051  125.085 1.00 119.36 ? 176 ASN C N   1 
ATOM   4084  C CA  . ASN C 1 176 ? 61.001  7.820  125.609 1.00 119.36 ? 176 ASN C CA  1 
ATOM   4085  C C   . ASN C 1 176 ? 60.699  6.326  125.504 1.00 119.36 ? 176 ASN C C   1 
ATOM   4086  O O   . ASN C 1 176 ? 60.113  5.729  126.409 1.00 119.36 ? 176 ASN C O   1 
ATOM   4087  C CB  . ASN C 1 176 ? 59.972  8.621  124.813 1.00 145.90 ? 176 ASN C CB  1 
ATOM   4088  C CG  . ASN C 1 176 ? 60.249  10.109 124.838 1.00 145.90 ? 176 ASN C CG  1 
ATOM   4089  O OD1 . ASN C 1 176 ? 60.337  10.718 125.905 1.00 145.90 ? 176 ASN C OD1 1 
ATOM   4090  N ND2 . ASN C 1 176 ? 60.387  10.705 123.658 1.00 145.90 ? 176 ASN C ND2 1 
ATOM   4091  N N   . LYS C 1 177 ? 61.121  5.728  124.394 1.00 96.30  ? 177 LYS C N   1 
ATOM   4092  C CA  . LYS C 1 177 ? 60.914  4.306  124.158 1.00 96.30  ? 177 LYS C CA  1 
ATOM   4093  C C   . LYS C 1 177 ? 61.746  3.468  125.129 1.00 96.30  ? 177 LYS C C   1 
ATOM   4094  O O   . LYS C 1 177 ? 61.984  2.289  124.886 1.00 96.30  ? 177 LYS C O   1 
ATOM   4095  C CB  . LYS C 1 177 ? 61.295  3.944  122.713 1.00 114.99 ? 177 LYS C CB  1 
ATOM   4096  C CG  . LYS C 1 177 ? 60.493  4.675  121.643 1.00 114.99 ? 177 LYS C CG  1 
ATOM   4097  C CD  . LYS C 1 177 ? 60.970  4.338  120.230 1.00 114.99 ? 177 LYS C CD  1 
ATOM   4098  C CE  . LYS C 1 177 ? 60.205  5.158  119.188 1.00 114.99 ? 177 LYS C CE  1 
ATOM   4099  N NZ  . LYS C 1 177 ? 60.669  4.940  117.785 1.00 114.99 ? 177 LYS C NZ  1 
ATOM   4100  N N   . LEU C 1 178 ? 62.193  4.072  126.225 1.00 128.48 ? 178 LEU C N   1 
ATOM   4101  C CA  . LEU C 1 178 ? 62.996  3.349  127.208 1.00 128.48 ? 178 LEU C CA  1 
ATOM   4102  C C   . LEU C 1 178 ? 62.377  3.323  128.598 1.00 128.48 ? 178 LEU C C   1 
ATOM   4103  O O   . LEU C 1 178 ? 61.615  4.220  128.974 1.00 128.48 ? 178 LEU C O   1 
ATOM   4104  C CB  . LEU C 1 178 ? 64.407  3.942  127.306 1.00 88.79  ? 178 LEU C CB  1 
ATOM   4105  C CG  . LEU C 1 178 ? 65.430  3.505  126.262 1.00 88.79  ? 178 LEU C CG  1 
ATOM   4106  C CD1 . LEU C 1 178 ? 66.736  4.222  126.521 1.00 88.79  ? 178 LEU C CD1 1 
ATOM   4107  C CD2 . LEU C 1 178 ? 65.630  1.999  126.331 1.00 88.79  ? 178 LEU C CD2 1 
ATOM   4108  N N   . PRO C 1 179 ? 62.705  2.283  129.381 1.00 181.16 ? 179 PRO C N   1 
ATOM   4109  C CA  . PRO C 1 179 ? 62.197  2.111  130.743 1.00 181.16 ? 179 PRO C CA  1 
ATOM   4110  C C   . PRO C 1 179 ? 62.514  3.329  131.592 1.00 181.16 ? 179 PRO C C   1 
ATOM   4111  O O   . PRO C 1 179 ? 63.656  3.518  132.012 1.00 181.16 ? 179 PRO C O   1 
ATOM   4112  C CB  . PRO C 1 179 ? 62.933  0.867  131.231 1.00 170.91 ? 179 PRO C CB  1 
ATOM   4113  C CG  . PRO C 1 179 ? 63.127  0.081  129.974 1.00 170.91 ? 179 PRO C CG  1 
ATOM   4114  C CD  . PRO C 1 179 ? 63.566  1.147  129.003 1.00 170.91 ? 179 PRO C CD  1 
ATOM   4115  N N   . ARG C 1 180 ? 61.504  4.158  131.830 1.00 175.11 ? 180 ARG C N   1 
ATOM   4116  C CA  . ARG C 1 180 ? 61.683  5.354  132.637 1.00 175.11 ? 180 ARG C CA  1 
ATOM   4117  C C   . ARG C 1 180 ? 62.103  4.911  134.041 1.00 175.11 ? 180 ARG C C   1 
ATOM   4118  O O   . ARG C 1 180 ? 61.275  4.824  134.948 1.00 175.11 ? 180 ARG C O   1 
ATOM   4119  C CB  . ARG C 1 180 ? 60.371  6.143  132.694 1.00 164.64 ? 180 ARG C CB  1 
ATOM   4120  C CG  . ARG C 1 180 ? 60.537  7.649  132.558 1.00 164.64 ? 180 ARG C CG  1 
ATOM   4121  C CD  . ARG C 1 180 ? 61.471  8.209  133.621 1.00 164.64 ? 180 ARG C CD  1 
ATOM   4122  N NE  . ARG C 1 180 ? 60.996  7.929  134.975 1.00 164.64 ? 180 ARG C NE  1 
ATOM   4123  C CZ  . ARG C 1 180 ? 61.638  8.287  136.084 1.00 164.64 ? 180 ARG C CZ  1 
ATOM   4124  N NH1 . ARG C 1 180 ? 62.788  8.943  136.005 1.00 164.64 ? 180 ARG C NH1 1 
ATOM   4125  N NH2 . ARG C 1 180 ? 61.134  7.985  137.273 1.00 164.64 ? 180 ARG C NH2 1 
ATOM   4126  N N   . GLN C 1 181 ? 63.393  4.625  134.206 1.00 200.00 ? 181 GLN C N   1 
ATOM   4127  C CA  . GLN C 1 181 ? 63.940  4.169  135.483 1.00 200.00 ? 181 GLN C CA  1 
ATOM   4128  C C   . GLN C 1 181 ? 63.702  5.148  136.628 1.00 200.00 ? 181 GLN C C   1 
ATOM   4129  O O   . GLN C 1 181 ? 63.449  6.331  136.406 1.00 200.00 ? 181 GLN C O   1 
ATOM   4130  C CB  . GLN C 1 181 ? 65.439  3.911  135.350 1.00 174.64 ? 181 GLN C CB  1 
ATOM   4131  C CG  . GLN C 1 181 ? 66.240  5.142  134.981 1.00 174.64 ? 181 GLN C CG  1 
ATOM   4132  C CD  . GLN C 1 181 ? 67.726  4.891  135.036 1.00 174.64 ? 181 GLN C CD  1 
ATOM   4133  O OE1 . GLN C 1 181 ? 68.298  4.692  136.109 1.00 174.64 ? 181 GLN C OE1 1 
ATOM   4134  N NE2 . GLN C 1 181 ? 68.364  4.889  133.874 1.00 174.64 ? 181 GLN C NE2 1 
ATOM   4135  N N   . LEU C 1 182 ? 63.810  4.643  137.856 1.00 110.13 ? 182 LEU C N   1 
ATOM   4136  C CA  . LEU C 1 182 ? 63.588  5.454  139.050 1.00 110.13 ? 182 LEU C CA  1 
ATOM   4137  C C   . LEU C 1 182 ? 64.894  5.951  139.656 1.00 110.13 ? 182 LEU C C   1 
ATOM   4138  O O   . LEU C 1 182 ? 65.915  5.268  139.595 1.00 110.13 ? 182 LEU C O   1 
ATOM   4139  C CB  . LEU C 1 182 ? 62.816  4.642  140.094 1.00 162.35 ? 182 LEU C CB  1 
ATOM   4140  C CG  . LEU C 1 182 ? 62.068  5.433  141.169 1.00 162.35 ? 182 LEU C CG  1 
ATOM   4141  C CD1 . LEU C 1 182 ? 61.079  6.353  140.492 1.00 162.35 ? 182 LEU C CD1 1 
ATOM   4142  C CD2 . LEU C 1 182 ? 61.344  4.493  142.115 1.00 162.35 ? 182 LEU C CD2 1 
ATOM   4143  N N   . PRO C 1 183 ? 64.872  7.153  140.256 1.00 161.75 ? 183 PRO C N   1 
ATOM   4144  C CA  . PRO C 1 183 ? 66.054  7.748  140.877 1.00 161.75 ? 183 PRO C CA  1 
ATOM   4145  C C   . PRO C 1 183 ? 66.982  6.735  141.523 1.00 161.75 ? 183 PRO C C   1 
ATOM   4146  O O   . PRO C 1 183 ? 66.540  5.790  142.176 1.00 161.75 ? 183 PRO C O   1 
ATOM   4147  C CB  . PRO C 1 183 ? 65.447  8.716  141.878 1.00 185.85 ? 183 PRO C CB  1 
ATOM   4148  C CG  . PRO C 1 183 ? 64.303  9.266  141.098 1.00 185.85 ? 183 PRO C CG  1 
ATOM   4149  C CD  . PRO C 1 183 ? 63.700  8.027  140.451 1.00 185.85 ? 183 PRO C CD  1 
ATOM   4150  N N   . LEU C 1 184 ? 68.277  6.945  141.324 1.00 140.65 ? 184 LEU C N   1 
ATOM   4151  C CA  . LEU C 1 184 ? 69.293  6.064  141.869 1.00 140.65 ? 184 LEU C CA  1 
ATOM   4152  C C   . LEU C 1 184 ? 69.511  6.357  143.352 1.00 140.65 ? 184 LEU C C   1 
ATOM   4153  O O   . LEU C 1 184 ? 69.534  7.515  143.772 1.00 140.65 ? 184 LEU C O   1 
ATOM   4154  C CB  . LEU C 1 184 ? 70.613  6.248  141.108 1.00 195.06 ? 184 LEU C CB  1 
ATOM   4155  C CG  . LEU C 1 184 ? 70.612  6.219  139.572 1.00 195.06 ? 184 LEU C CG  1 
ATOM   4156  C CD1 . LEU C 1 184 ? 69.874  4.982  139.082 1.00 195.06 ? 184 LEU C CD1 1 
ATOM   4157  C CD2 . LEU C 1 184 ? 69.960  7.482  139.022 1.00 195.06 ? 184 LEU C CD2 1 
ATOM   4158  N N   . GLU C 1 185 ? 69.658  5.302  144.143 1.00 151.78 ? 185 GLU C N   1 
ATOM   4159  C CA  . GLU C 1 185 ? 69.894  5.458  145.570 1.00 151.78 ? 185 GLU C CA  1 
ATOM   4160  C C   . GLU C 1 185 ? 71.377  5.747  145.768 1.00 151.78 ? 185 GLU C C   1 
ATOM   4161  O O   . GLU C 1 185 ? 72.231  5.039  145.236 1.00 151.78 ? 185 GLU C O   1 
ATOM   4162  C CB  . GLU C 1 185 ? 69.516  4.179  146.313 1.00 199.20 ? 185 GLU C CB  1 
ATOM   4163  C CG  . GLU C 1 185 ? 69.755  4.246  147.810 1.00 199.20 ? 185 GLU C CG  1 
ATOM   4164  C CD  . GLU C 1 185 ? 69.517  2.916  148.497 1.00 199.20 ? 185 GLU C CD  1 
ATOM   4165  O OE1 . GLU C 1 185 ? 70.197  1.931  148.135 1.00 199.20 ? 185 GLU C OE1 1 
ATOM   4166  O OE2 . GLU C 1 185 ? 68.654  2.857  149.397 1.00 199.20 ? 185 GLU C OE2 1 
ATOM   4167  N N   . VAL C 1 186 ? 71.685  6.786  146.532 1.00 85.50  ? 186 VAL C N   1 
ATOM   4168  C CA  . VAL C 1 186 ? 73.072  7.149  146.773 1.00 85.50  ? 186 VAL C CA  1 
ATOM   4169  C C   . VAL C 1 186 ? 73.611  6.539  148.058 1.00 85.50  ? 186 VAL C C   1 
ATOM   4170  O O   . VAL C 1 186 ? 73.194  6.907  149.155 1.00 85.50  ? 186 VAL C O   1 
ATOM   4171  C CB  . VAL C 1 186 ? 73.230  8.670  146.853 1.00 78.68  ? 186 VAL C CB  1 
ATOM   4172  C CG1 . VAL C 1 186 ? 74.694  9.036  146.980 1.00 78.68  ? 186 VAL C CG1 1 
ATOM   4173  C CG2 . VAL C 1 186 ? 72.606  9.315  145.624 1.00 78.68  ? 186 VAL C CG2 1 
ATOM   4174  N N   . ASP C 1 187 ? 74.543  5.605  147.915 1.00 102.95 ? 187 ASP C N   1 
ATOM   4175  C CA  . ASP C 1 187 ? 75.150  4.946  149.064 1.00 102.95 ? 187 ASP C CA  1 
ATOM   4176  C C   . ASP C 1 187 ? 76.207  5.830  149.734 1.00 102.95 ? 187 ASP C C   1 
ATOM   4177  O O   . ASP C 1 187 ? 77.336  5.944  149.249 1.00 102.95 ? 187 ASP C O   1 
ATOM   4178  C CB  . ASP C 1 187 ? 75.785  3.626  148.625 1.00 142.70 ? 187 ASP C CB  1 
ATOM   4179  C CG  . ASP C 1 187 ? 76.580  2.969  149.734 1.00 142.70 ? 187 ASP C CG  1 
ATOM   4180  O OD1 . ASP C 1 187 ? 76.032  2.847  150.851 1.00 142.70 ? 187 ASP C OD1 1 
ATOM   4181  O OD2 . ASP C 1 187 ? 77.744  2.574  149.490 1.00 142.70 ? 187 ASP C OD2 1 
ATOM   4182  N N   . LEU C 1 188 ? 75.847  6.441  150.858 1.00 73.23  ? 188 LEU C N   1 
ATOM   4183  C CA  . LEU C 1 188 ? 76.772  7.317  151.560 1.00 73.23  ? 188 LEU C CA  1 
ATOM   4184  C C   . LEU C 1 188 ? 77.571  6.613  152.658 1.00 73.23  ? 188 LEU C C   1 
ATOM   4185  O O   . LEU C 1 188 ? 77.856  7.207  153.705 1.00 73.23  ? 188 LEU C O   1 
ATOM   4186  C CB  . LEU C 1 188 ? 76.008  8.491  152.161 1.00 91.63  ? 188 LEU C CB  1 
ATOM   4187  C CG  . LEU C 1 188 ? 75.115  9.282  151.199 1.00 91.63  ? 188 LEU C CG  1 
ATOM   4188  C CD1 . LEU C 1 188 ? 74.371  10.370 151.953 1.00 91.63  ? 188 LEU C CD1 1 
ATOM   4189  C CD2 . LEU C 1 188 ? 75.956  9.895  150.107 1.00 91.63  ? 188 LEU C CD2 1 
ATOM   4190  N N   . THR C 1 189 ? 77.940  5.355  152.425 1.00 94.75  ? 189 THR C N   1 
ATOM   4191  C CA  . THR C 1 189 ? 78.713  4.603  153.409 1.00 94.75  ? 189 THR C CA  1 
ATOM   4192  C C   . THR C 1 189 ? 80.195  4.940  153.330 1.00 94.75  ? 189 THR C C   1 
ATOM   4193  O O   . THR C 1 189 ? 80.846  5.137  154.353 1.00 94.75  ? 189 THR C O   1 
ATOM   4194  C CB  . THR C 1 189 ? 78.556  3.094  153.211 1.00 135.71 ? 189 THR C CB  1 
ATOM   4195  O OG1 . THR C 1 189 ? 78.934  2.745  151.873 1.00 135.71 ? 189 THR C OG1 1 
ATOM   4196  C CG2 . THR C 1 189 ? 77.121  2.675  153.470 1.00 135.71 ? 189 THR C CG2 1 
ATOM   4197  N N   . LYS C 1 190 ? 80.725  5.002  152.113 1.00 125.31 ? 190 LYS C N   1 
ATOM   4198  C CA  . LYS C 1 190 ? 82.134  5.318  151.913 1.00 125.31 ? 190 LYS C CA  1 
ATOM   4199  C C   . LYS C 1 190 ? 82.327  6.804  151.631 1.00 125.31 ? 190 LYS C C   1 
ATOM   4200  O O   . LYS C 1 190 ? 83.314  7.219  151.018 1.00 125.31 ? 190 LYS C O   1 
ATOM   4201  C CB  . LYS C 1 190 ? 82.705  4.484  150.762 1.00 198.15 ? 190 LYS C CB  1 
ATOM   4202  C CG  . LYS C 1 190 ? 82.705  2.985  151.032 1.00 198.15 ? 190 LYS C CG  1 
ATOM   4203  C CD  . LYS C 1 190 ? 83.302  2.208  149.873 1.00 198.15 ? 190 LYS C CD  1 
ATOM   4204  C CE  . LYS C 1 190 ? 83.288  0.719  150.156 1.00 198.15 ? 190 LYS C CE  1 
ATOM   4205  N NZ  . LYS C 1 190 ? 83.802  -0.059 149.000 1.00 198.15 ? 190 LYS C NZ  1 
ATOM   4206  N N   . ALA C 1 191 ? 81.373  7.603  152.088 1.00 93.53  ? 191 ALA C N   1 
ATOM   4207  C CA  . ALA C 1 191 ? 81.441  9.041  151.895 1.00 93.53  ? 191 ALA C CA  1 
ATOM   4208  C C   . ALA C 1 191 ? 82.568  9.650  152.724 1.00 93.53  ? 191 ALA C C   1 
ATOM   4209  O O   . ALA C 1 191 ? 82.899  9.170  153.811 1.00 93.53  ? 191 ALA C O   1 
ATOM   4210  C CB  . ALA C 1 191 ? 80.115  9.678  152.269 1.00 90.51  ? 191 ALA C CB  1 
ATOM   4211  N N   . LYS C 1 192 ? 83.159  10.711 152.191 1.00 75.87  ? 192 LYS C N   1 
ATOM   4212  C CA  . LYS C 1 192 ? 84.245  11.406 152.866 1.00 75.87  ? 192 LYS C CA  1 
ATOM   4213  C C   . LYS C 1 192 ? 83.697  11.950 154.173 1.00 75.87  ? 192 LYS C C   1 
ATOM   4214  O O   . LYS C 1 192 ? 82.643  12.593 154.196 1.00 75.87  ? 192 LYS C O   1 
ATOM   4215  C CB  . LYS C 1 192 ? 84.760  12.549 151.981 1.00 61.30  ? 192 LYS C CB  1 
ATOM   4216  C CG  . LYS C 1 192 ? 85.918  13.345 152.570 1.00 61.30  ? 192 LYS C CG  1 
ATOM   4217  C CD  . LYS C 1 192 ? 86.433  14.366 151.583 1.00 61.30  ? 192 LYS C CD  1 
ATOM   4218  C CE  . LYS C 1 192 ? 87.522  15.195 152.195 1.00 61.30  ? 192 LYS C CE  1 
ATOM   4219  N NZ  . LYS C 1 192 ? 88.672  14.355 152.567 1.00 61.30  ? 192 LYS C NZ  1 
ATOM   4220  N N   . ARG C 1 193 ? 84.408  11.694 155.264 1.00 90.49  ? 193 ARG C N   1 
ATOM   4221  C CA  . ARG C 1 193 ? 83.939  12.156 156.551 1.00 90.49  ? 193 ARG C CA  1 
ATOM   4222  C C   . ARG C 1 193 ? 84.837  13.120 157.297 1.00 90.49  ? 193 ARG C C   1 
ATOM   4223  O O   . ARG C 1 193 ? 84.422  13.701 158.299 1.00 90.49  ? 193 ARG C O   1 
ATOM   4224  C CB  . ARG C 1 193 ? 83.594  10.953 157.404 1.00 74.14  ? 193 ARG C CB  1 
ATOM   4225  C CG  . ARG C 1 193 ? 82.362  10.243 156.869 1.00 74.14  ? 193 ARG C CG  1 
ATOM   4226  C CD  . ARG C 1 193 ? 81.629  9.580  157.990 1.00 74.14  ? 193 ARG C CD  1 
ATOM   4227  N NE  . ARG C 1 193 ? 80.222  9.320  157.710 1.00 74.14  ? 193 ARG C NE  1 
ATOM   4228  C CZ  . ARG C 1 193 ? 79.789  8.512  156.751 1.00 74.14  ? 193 ARG C CZ  1 
ATOM   4229  N NH1 . ARG C 1 193 ? 80.670  7.892  155.969 1.00 74.14  ? 193 ARG C NH1 1 
ATOM   4230  N NH2 . ARG C 1 193 ? 78.479  8.304  156.601 1.00 74.14  ? 193 ARG C NH2 1 
ATOM   4231  N N   . GLN C 1 194 ? 86.062  13.293 156.817 1.00 76.36  ? 194 GLN C N   1 
ATOM   4232  C CA  . GLN C 1 194 ? 86.980  14.242 157.433 1.00 76.36  ? 194 GLN C CA  1 
ATOM   4233  C C   . GLN C 1 194 ? 87.867  14.869 156.355 1.00 76.36  ? 194 GLN C C   1 
ATOM   4234  O O   . GLN C 1 194 ? 87.964  14.340 155.250 1.00 76.36  ? 194 GLN C O   1 
ATOM   4235  C CB  . GLN C 1 194 ? 87.799  13.564 158.534 1.00 174.99 ? 194 GLN C CB  1 
ATOM   4236  C CG  . GLN C 1 194 ? 88.266  12.178 158.195 1.00 174.99 ? 194 GLN C CG  1 
ATOM   4237  C CD  . GLN C 1 194 ? 89.354  12.191 157.156 1.00 174.99 ? 194 GLN C CD  1 
ATOM   4238  O OE1 . GLN C 1 194 ? 90.437  12.729 157.387 1.00 174.99 ? 194 GLN C OE1 1 
ATOM   4239  N NE2 . GLN C 1 194 ? 89.075  11.603 155.999 1.00 174.99 ? 194 GLN C NE2 1 
ATOM   4240  N N   . ASP C 1 195 ? 88.493  16.003 156.665 1.00 75.42  ? 195 ASP C N   1 
ATOM   4241  C CA  . ASP C 1 195 ? 89.322  16.701 155.685 1.00 75.42  ? 195 ASP C CA  1 
ATOM   4242  C C   . ASP C 1 195 ? 90.505  15.929 155.107 1.00 75.42  ? 195 ASP C C   1 
ATOM   4243  O O   . ASP C 1 195 ? 90.576  15.724 153.903 1.00 75.42  ? 195 ASP C O   1 
ATOM   4244  C CB  . ASP C 1 195 ? 89.840  18.036 156.254 1.00 76.37  ? 195 ASP C CB  1 
ATOM   4245  C CG  . ASP C 1 195 ? 88.717  18.977 156.675 1.00 76.37  ? 195 ASP C CG  1 
ATOM   4246  O OD1 . ASP C 1 195 ? 87.637  18.952 156.039 1.00 76.37  ? 195 ASP C OD1 1 
ATOM   4247  O OD2 . ASP C 1 195 ? 88.922  19.753 157.637 1.00 76.37  ? 195 ASP C OD2 1 
ATOM   4248  N N   . LEU C 1 196 ? 91.428  15.503 155.960 1.00 94.96  ? 196 LEU C N   1 
ATOM   4249  C CA  . LEU C 1 196 ? 92.627  14.812 155.500 1.00 94.96  ? 196 LEU C CA  1 
ATOM   4250  C C   . LEU C 1 196 ? 92.430  13.734 154.435 1.00 94.96  ? 196 LEU C C   1 
ATOM   4251  O O   . LEU C 1 196 ? 91.392  13.073 154.379 1.00 94.96  ? 196 LEU C O   1 
ATOM   4252  C CB  . LEU C 1 196 ? 93.386  14.236 156.691 1.00 72.20  ? 196 LEU C CB  1 
ATOM   4253  C CG  . LEU C 1 196 ? 94.791  13.713 156.371 1.00 72.20  ? 196 LEU C CG  1 
ATOM   4254  C CD1 . LEU C 1 196 ? 95.606  14.769 155.652 1.00 72.20  ? 196 LEU C CD1 1 
ATOM   4255  C CD2 . LEU C 1 196 ? 95.489  13.326 157.654 1.00 72.20  ? 196 LEU C CD2 1 
ATOM   4256  N N   . GLU C 1 197 ? 93.454  13.580 153.593 1.00 64.57  ? 197 GLU C N   1 
ATOM   4257  C CA  . GLU C 1 197 ? 93.480  12.618 152.493 1.00 64.57  ? 197 GLU C CA  1 
ATOM   4258  C C   . GLU C 1 197 ? 94.891  12.040 152.442 1.00 64.57  ? 197 GLU C C   1 
ATOM   4259  O O   . GLU C 1 197 ? 95.731  12.500 151.672 1.00 64.57  ? 197 GLU C O   1 
ATOM   4260  C CB  . GLU C 1 197 ? 93.197  13.328 151.170 1.00 53.25  ? 197 GLU C CB  1 
ATOM   4261  C CG  . GLU C 1 197 ? 91.779  13.825 150.976 1.00 53.25  ? 197 GLU C CG  1 
ATOM   4262  C CD  . GLU C 1 197 ? 90.844  12.704 150.626 1.00 53.25  ? 197 GLU C CD  1 
ATOM   4263  O OE1 . GLU C 1 197 ? 91.331  11.690 150.073 1.00 53.25  ? 197 GLU C OE1 1 
ATOM   4264  O OE2 . GLU C 1 197 ? 89.627  12.828 150.885 1.00 53.25  ? 197 GLU C OE2 1 
ATOM   4265  N N   . PRO C 1 198 ? 95.167  11.012 153.259 1.00 70.75  ? 198 PRO C N   1 
ATOM   4266  C CA  . PRO C 1 198 ? 96.472  10.345 153.344 1.00 70.75  ? 198 PRO C CA  1 
ATOM   4267  C C   . PRO C 1 198 ? 97.054  9.937  152.008 1.00 70.75  ? 198 PRO C C   1 
ATOM   4268  O O   . PRO C 1 198 ? 98.221  10.179 151.735 1.00 70.75  ? 198 PRO C O   1 
ATOM   4269  C CB  . PRO C 1 198 ? 96.182  9.141  154.223 1.00 78.17  ? 198 PRO C CB  1 
ATOM   4270  C CG  . PRO C 1 198 ? 95.073  9.623  155.091 1.00 78.17  ? 198 PRO C CG  1 
ATOM   4271  C CD  . PRO C 1 198 ? 94.183  10.327 154.113 1.00 78.17  ? 198 PRO C CD  1 
ATOM   4272  N N   . SER C 1 199 ? 96.235  9.302  151.181 1.00 71.07  ? 199 SER C N   1 
ATOM   4273  C CA  . SER C 1 199 ? 96.673  8.854  149.860 1.00 71.07  ? 199 SER C CA  1 
ATOM   4274  C C   . SER C 1 199 ? 97.259  10.026 149.062 1.00 71.07  ? 199 SER C C   1 
ATOM   4275  O O   . SER C 1 199 ? 98.351  9.936  148.487 1.00 71.07  ? 199 SER C O   1 
ATOM   4276  C CB  . SER C 1 199 ? 95.487  8.256  149.116 1.00 119.88 ? 199 SER C CB  1 
ATOM   4277  O OG  . SER C 1 199 ? 95.898  7.704  147.885 1.00 119.88 ? 199 SER C OG  1 
ATOM   4278  N N   . VAL C 1 200 ? 96.512  11.126 149.047 1.00 57.38  ? 200 VAL C N   1 
ATOM   4279  C CA  . VAL C 1 200 ? 96.907  12.351 148.365 1.00 57.38  ? 200 VAL C CA  1 
ATOM   4280  C C   . VAL C 1 200 ? 98.135  12.989 149.004 1.00 57.38  ? 200 VAL C C   1 
ATOM   4281  O O   . VAL C 1 200 ? 99.142  13.205 148.341 1.00 57.38  ? 200 VAL C O   1 
ATOM   4282  C CB  . VAL C 1 200 ? 95.760  13.380 148.391 1.00 56.58  ? 200 VAL C CB  1 
ATOM   4283  C CG1 . VAL C 1 200 ? 96.207  14.662 147.745 1.00 56.58  ? 200 VAL C CG1 1 
ATOM   4284  C CG2 . VAL C 1 200 ? 94.539  12.819 147.670 1.00 56.58  ? 200 VAL C CG2 1 
ATOM   4285  N N   . GLU C 1 201 ? 98.037  13.290 150.293 1.00 63.93  ? 201 GLU C N   1 
ATOM   4286  C CA  . GLU C 1 201 ? 99.125  13.912 151.065 1.00 63.93  ? 201 GLU C CA  1 
ATOM   4287  C C   . GLU C 1 201 ? 100.468 13.205 150.862 1.00 63.93  ? 201 GLU C C   1 
ATOM   4288  O O   . GLU C 1 201 ? 101.532 13.828 150.827 1.00 63.93  ? 201 GLU C O   1 
ATOM   4289  C CB  . GLU C 1 201 ? 98.763  13.909 152.557 1.00 75.60  ? 201 GLU C CB  1 
ATOM   4290  C CG  . GLU C 1 201 ? 99.827  14.478 153.475 1.00 75.60  ? 201 GLU C CG  1 
ATOM   4291  C CD  . GLU C 1 201 ? 100.176 15.900 153.129 1.00 75.60  ? 201 GLU C CD  1 
ATOM   4292  O OE1 . GLU C 1 201 ? 99.238  16.706 152.936 1.00 75.60  ? 201 GLU C OE1 1 
ATOM   4293  O OE2 . GLU C 1 201 ? 101.387 16.203 153.051 1.00 75.60  ? 201 GLU C OE2 1 
ATOM   4294  N N   . GLU C 1 202 ? 100.413 11.894 150.720 1.00 67.99  ? 202 GLU C N   1 
ATOM   4295  C CA  . GLU C 1 202 ? 101.619 11.133 150.516 1.00 67.99  ? 202 GLU C CA  1 
ATOM   4296  C C   . GLU C 1 202 ? 102.206 11.427 149.144 1.00 67.99  ? 202 GLU C C   1 
ATOM   4297  O O   . GLU C 1 202 ? 103.312 11.954 149.030 1.00 67.99  ? 202 GLU C O   1 
ATOM   4298  C CB  . GLU C 1 202 ? 101.309 9.651  150.641 1.00 103.21 ? 202 GLU C CB  1 
ATOM   4299  C CG  . GLU C 1 202 ? 102.512 8.761  150.524 1.00 103.21 ? 202 GLU C CG  1 
ATOM   4300  C CD  . GLU C 1 202 ? 102.174 7.332  150.867 1.00 103.21 ? 202 GLU C CD  1 
ATOM   4301  O OE1 . GLU C 1 202 ? 101.339 6.722  150.165 1.00 103.21 ? 202 GLU C OE1 1 
ATOM   4302  O OE2 . GLU C 1 202 ? 102.738 6.823  151.853 1.00 103.21 ? 202 GLU C OE2 1 
ATOM   4303  N N   . ALA C 1 203 ? 101.454 11.084 148.105 1.00 72.18  ? 203 ALA C N   1 
ATOM   4304  C CA  . ALA C 1 203 ? 101.899 11.298 146.738 1.00 72.18  ? 203 ALA C CA  1 
ATOM   4305  C C   . ALA C 1 203 ? 102.467 12.707 146.534 1.00 72.18  ? 203 ALA C C   1 
ATOM   4306  O O   . ALA C 1 203 ? 103.486 12.892 145.863 1.00 72.18  ? 203 ALA C O   1 
ATOM   4307  C CB  . ALA C 1 203 ? 100.749 11.064 145.806 1.00 35.38  ? 203 ALA C CB  1 
ATOM   4308  N N   . ARG C 1 204 ? 101.797 13.693 147.123 1.00 64.57  ? 204 ARG C N   1 
ATOM   4309  C CA  . ARG C 1 204 ? 102.206 15.083 147.012 1.00 64.57  ? 204 ARG C CA  1 
ATOM   4310  C C   . ARG C 1 204 ? 103.576 15.303 147.615 1.00 64.57  ? 204 ARG C C   1 
ATOM   4311  O O   . ARG C 1 204 ? 104.457 15.868 146.975 1.00 64.57  ? 204 ARG C O   1 
ATOM   4312  C CB  . ARG C 1 204 ? 101.194 15.983 147.716 1.00 70.27  ? 204 ARG C CB  1 
ATOM   4313  C CG  . ARG C 1 204 ? 101.585 17.439 147.751 1.00 70.27  ? 204 ARG C CG  1 
ATOM   4314  C CD  . ARG C 1 204 ? 100.523 18.200 148.462 1.00 70.27  ? 204 ARG C CD  1 
ATOM   4315  N NE  . ARG C 1 204 ? 99.234  17.924 147.856 1.00 70.27  ? 204 ARG C NE  1 
ATOM   4316  C CZ  . ARG C 1 204 ? 98.114  17.732 148.538 1.00 70.27  ? 204 ARG C CZ  1 
ATOM   4317  N NH1 . ARG C 1 204 ? 98.115  17.782 149.865 1.00 70.27  ? 204 ARG C NH1 1 
ATOM   4318  N NH2 . ARG C 1 204 ? 96.986  17.490 147.892 1.00 70.27  ? 204 ARG C NH2 1 
ATOM   4319  N N   . TYR C 1 205 ? 103.751 14.860 148.855 1.00 78.02  ? 205 TYR C N   1 
ATOM   4320  C CA  . TYR C 1 205 ? 105.026 15.030 149.529 1.00 78.02  ? 205 TYR C CA  1 
ATOM   4321  C C   . TYR C 1 205 ? 106.168 14.466 148.685 1.00 78.02  ? 205 TYR C C   1 
ATOM   4322  O O   . TYR C 1 205 ? 107.244 15.063 148.596 1.00 78.02  ? 205 TYR C O   1 
ATOM   4323  C CB  . TYR C 1 205 ? 105.005 14.347 150.902 1.00 120.67 ? 205 TYR C CB  1 
ATOM   4324  C CG  . TYR C 1 205 ? 106.317 14.472 151.658 1.00 120.67 ? 205 TYR C CG  1 
ATOM   4325  C CD1 . TYR C 1 205 ? 106.780 15.715 152.089 1.00 120.67 ? 205 TYR C CD1 1 
ATOM   4326  C CD2 . TYR C 1 205 ? 107.114 13.349 151.905 1.00 120.67 ? 205 TYR C CD2 1 
ATOM   4327  C CE1 . TYR C 1 205 ? 108.002 15.836 152.741 1.00 120.67 ? 205 TYR C CE1 1 
ATOM   4328  C CE2 . TYR C 1 205 ? 108.337 13.462 152.556 1.00 120.67 ? 205 TYR C CE2 1 
ATOM   4329  C CZ  . TYR C 1 205 ? 108.774 14.705 152.970 1.00 120.67 ? 205 TYR C CZ  1 
ATOM   4330  O OH  . TYR C 1 205 ? 109.986 14.817 153.607 1.00 120.67 ? 205 TYR C OH  1 
ATOM   4331  N N   . ASN C 1 206 ? 105.930 13.318 148.060 1.00 72.25  ? 206 ASN C N   1 
ATOM   4332  C CA  . ASN C 1 206 ? 106.957 12.690 147.241 1.00 72.25  ? 206 ASN C CA  1 
ATOM   4333  C C   . ASN C 1 206 ? 107.126 13.438 145.931 1.00 72.25  ? 206 ASN C C   1 
ATOM   4334  O O   . ASN C 1 206 ? 108.011 13.115 145.137 1.00 72.25  ? 206 ASN C O   1 
ATOM   4335  C CB  . ASN C 1 206 ? 106.587 11.237 146.954 1.00 86.23  ? 206 ASN C CB  1 
ATOM   4336  C CG  . ASN C 1 206 ? 106.279 10.466 148.207 1.00 86.23  ? 206 ASN C CG  1 
ATOM   4337  O OD1 . ASN C 1 206 ? 107.111 10.374 149.102 1.00 86.23  ? 206 ASN C OD1 1 
ATOM   4338  N ND2 . ASN C 1 206 ? 105.073 9.905  148.283 1.00 86.23  ? 206 ASN C ND2 1 
ATOM   4339  N N   . SER C 1 207 ? 106.265 14.430 145.714 1.00 103.95 ? 207 SER C N   1 
ATOM   4340  C CA  . SER C 1 207 ? 106.290 15.240 144.503 1.00 103.95 ? 207 SER C CA  1 
ATOM   4341  C C   . SER C 1 207 ? 107.216 16.444 144.656 1.00 103.95 ? 207 SER C C   1 
ATOM   4342  O O   . SER C 1 207 ? 107.410 17.210 143.710 1.00 103.95 ? 207 SER C O   1 
ATOM   4343  C CB  . SER C 1 207 ? 104.871 15.714 144.167 1.00 144.55 ? 207 SER C CB  1 
ATOM   4344  O OG  . SER C 1 207 ? 104.847 16.500 142.988 1.00 144.55 ? 207 SER C OG  1 
ATOM   4345  N N   . CYS C 1 208 ? 107.793 16.599 145.845 1.00 89.12  ? 208 CYS C N   1 
ATOM   4346  C CA  . CYS C 1 208 ? 108.692 17.711 146.131 1.00 89.12  ? 208 CYS C CA  1 
ATOM   4347  C C   . CYS C 1 208 ? 110.147 17.254 146.178 1.00 89.12  ? 208 CYS C C   1 
ATOM   4348  O O   . CYS C 1 208 ? 110.369 16.031 146.023 1.00 89.12  ? 208 CYS C O   1 
ATOM   4349  C CB  . CYS C 1 208 ? 108.312 18.355 147.463 1.00 77.16  ? 208 CYS C CB  1 
ATOM   4350  S SG  . CYS C 1 208 ? 106.598 18.955 147.572 1.00 77.16  ? 208 CYS C SG  1 
ATOM   4351  N N   . CYS D 1 25  ? 107.285 26.547 139.722 1.00 98.03  ? 25  CYS D N   1 
ATOM   4352  C CA  . CYS D 1 25  ? 106.483 27.227 140.784 1.00 98.03  ? 25  CYS D CA  1 
ATOM   4353  C C   . CYS D 1 25  ? 104.982 27.055 140.565 1.00 98.03  ? 25  CYS D C   1 
ATOM   4354  O O   . CYS D 1 25  ? 104.554 26.068 139.981 1.00 98.03  ? 25  CYS D O   1 
ATOM   4355  C CB  . CYS D 1 25  ? 106.828 28.715 140.833 1.00 86.05  ? 25  CYS D CB  1 
ATOM   4356  S SG  . CYS D 1 25  ? 106.519 29.591 139.296 1.00 86.05  ? 25  CYS D SG  1 
ATOM   4357  N N   . PHE D 1 26  ? 104.186 28.014 141.032 1.00 73.54  ? 26  PHE D N   1 
ATOM   4358  C CA  . PHE D 1 26  ? 102.737 27.929 140.888 1.00 73.54  ? 26  PHE D CA  1 
ATOM   4359  C C   . PHE D 1 26  ? 102.312 28.296 139.478 1.00 73.54  ? 26  PHE D C   1 
ATOM   4360  O O   . PHE D 1 26  ? 102.738 29.320 138.956 1.00 73.54  ? 26  PHE D O   1 
ATOM   4361  C CB  . PHE D 1 26  ? 102.045 28.855 141.873 1.00 45.94  ? 26  PHE D CB  1 
ATOM   4362  C CG  . PHE D 1 26  ? 100.601 28.542 142.061 1.00 45.94  ? 26  PHE D CG  1 
ATOM   4363  C CD1 . PHE D 1 26  ? 100.209 27.571 142.971 1.00 45.94  ? 26  PHE D CD1 1 
ATOM   4364  C CD2 . PHE D 1 26  ? 99.627  29.192 141.309 1.00 45.94  ? 26  PHE D CD2 1 
ATOM   4365  C CE1 . PHE D 1 26  ? 98.850  27.243 143.137 1.00 45.94  ? 26  PHE D CE1 1 
ATOM   4366  C CE2 . PHE D 1 26  ? 98.269  28.878 141.459 1.00 45.94  ? 26  PHE D CE2 1 
ATOM   4367  C CZ  . PHE D 1 26  ? 97.872  27.900 142.377 1.00 45.94  ? 26  PHE D CZ  1 
ATOM   4368  N N   . GLY D 1 27  ? 101.453 27.472 138.880 1.00 61.42  ? 27  GLY D N   1 
ATOM   4369  C CA  . GLY D 1 27  ? 101.022 27.701 137.512 1.00 61.42  ? 27  GLY D CA  1 
ATOM   4370  C C   . GLY D 1 27  ? 101.987 27.001 136.559 1.00 61.42  ? 27  GLY D C   1 
ATOM   4371  O O   . GLY D 1 27  ? 101.685 26.800 135.381 1.00 61.42  ? 27  GLY D O   1 
ATOM   4372  N N   . GLN D 1 28  ? 103.157 26.640 137.089 1.00 56.39  ? 28  GLN D N   1 
ATOM   4373  C CA  . GLN D 1 28  ? 104.209 25.966 136.346 1.00 56.39  ? 28  GLN D CA  1 
ATOM   4374  C C   . GLN D 1 28  ? 104.176 24.473 136.657 1.00 56.39  ? 28  GLN D C   1 
ATOM   4375  O O   . GLN D 1 28  ? 104.054 23.649 135.764 1.00 56.39  ? 28  GLN D O   1 
ATOM   4376  C CB  . GLN D 1 28  ? 105.582 26.501 136.752 1.00 131.20 ? 28  GLN D CB  1 
ATOM   4377  C CG  . GLN D 1 28  ? 105.797 27.989 136.548 1.00 131.20 ? 28  GLN D CG  1 
ATOM   4378  C CD  . GLN D 1 28  ? 105.898 28.385 135.087 1.00 131.20 ? 28  GLN D CD  1 
ATOM   4379  O OE1 . GLN D 1 28  ? 106.292 29.508 134.767 1.00 131.20 ? 28  GLN D OE1 1 
ATOM   4380  N NE2 . GLN D 1 28  ? 105.540 27.468 134.193 1.00 131.20 ? 28  GLN D NE2 1 
ATOM   4381  N N   . CYS D 1 29  ? 104.294 24.129 137.933 1.00 84.09  ? 29  CYS D N   1 
ATOM   4382  C CA  . CYS D 1 29  ? 104.303 22.736 138.355 1.00 84.09  ? 29  CYS D CA  1 
ATOM   4383  C C   . CYS D 1 29  ? 103.270 21.879 137.655 1.00 84.09  ? 29  CYS D C   1 
ATOM   4384  O O   . CYS D 1 29  ? 102.164 22.334 137.396 1.00 84.09  ? 29  CYS D O   1 
ATOM   4385  C CB  . CYS D 1 29  ? 104.100 22.652 139.861 1.00 95.13  ? 29  CYS D CB  1 
ATOM   4386  S SG  . CYS D 1 29  ? 105.492 23.343 140.768 1.00 95.13  ? 29  CYS D SG  1 
ATOM   4387  N N   . GLN D 1 30  ? 103.653 20.643 137.334 1.00 83.10  ? 30  GLN D N   1 
ATOM   4388  C CA  . GLN D 1 30  ? 102.772 19.676 136.680 1.00 83.10  ? 30  GLN D CA  1 
ATOM   4389  C C   . GLN D 1 30  ? 102.549 18.531 137.665 1.00 83.10  ? 30  GLN D C   1 
ATOM   4390  O O   . GLN D 1 30  ? 103.490 18.105 138.337 1.00 83.10  ? 30  GLN D O   1 
ATOM   4391  C CB  . GLN D 1 30  ? 103.418 19.148 135.396 1.00 121.66 ? 30  GLN D CB  1 
ATOM   4392  C CG  . GLN D 1 30  ? 103.508 20.189 134.291 1.00 121.66 ? 30  GLN D CG  1 
ATOM   4393  C CD  . GLN D 1 30  ? 104.128 19.648 133.016 1.00 121.66 ? 30  GLN D CD  1 
ATOM   4394  O OE1 . GLN D 1 30  ? 103.731 18.593 132.525 1.00 121.66 ? 30  GLN D OE1 1 
ATOM   4395  N NE2 . GLN D 1 30  ? 105.101 20.375 132.467 1.00 121.66 ? 30  GLN D NE2 1 
ATOM   4396  N N   . TYR D 1 31  ? 101.314 18.043 137.774 1.00 60.19  ? 31  TYR D N   1 
ATOM   4397  C CA  . TYR D 1 31  ? 101.024 16.956 138.705 1.00 60.19  ? 31  TYR D CA  1 
ATOM   4398  C C   . TYR D 1 31  ? 101.760 15.697 138.298 1.00 60.19  ? 31  TYR D C   1 
ATOM   4399  O O   . TYR D 1 31  ? 101.907 15.423 137.108 1.00 60.19  ? 31  TYR D O   1 
ATOM   4400  C CB  . TYR D 1 31  ? 99.529  16.653 138.756 1.00 61.79  ? 31  TYR D CB  1 
ATOM   4401  C CG  . TYR D 1 31  ? 98.707  17.624 139.569 1.00 61.79  ? 31  TYR D CG  1 
ATOM   4402  C CD1 . TYR D 1 31  ? 97.984  18.649 138.957 1.00 61.79  ? 31  TYR D CD1 1 
ATOM   4403  C CD2 . TYR D 1 31  ? 98.645  17.516 140.957 1.00 61.79  ? 31  TYR D CD2 1 
ATOM   4404  C CE1 . TYR D 1 31  ? 97.217  19.542 139.712 1.00 61.79  ? 31  TYR D CE1 1 
ATOM   4405  C CE2 . TYR D 1 31  ? 97.885  18.405 141.720 1.00 61.79  ? 31  TYR D CE2 1 
ATOM   4406  C CZ  . TYR D 1 31  ? 97.178  19.416 141.088 1.00 61.79  ? 31  TYR D CZ  1 
ATOM   4407  O OH  . TYR D 1 31  ? 96.470  20.330 141.833 1.00 61.79  ? 31  TYR D OH  1 
ATOM   4408  N N   . THR D 1 32  ? 102.243 14.941 139.285 1.00 61.21  ? 32  THR D N   1 
ATOM   4409  C CA  . THR D 1 32  ? 102.937 13.682 139.019 1.00 61.21  ? 32  THR D CA  1 
ATOM   4410  C C   . THR D 1 32  ? 101.867 12.613 138.960 1.00 61.21  ? 32  THR D C   1 
ATOM   4411  O O   . THR D 1 32  ? 100.786 12.760 139.545 1.00 61.21  ? 32  THR D O   1 
ATOM   4412  C CB  . THR D 1 32  ? 103.866 13.272 140.154 1.00 56.51  ? 32  THR D CB  1 
ATOM   4413  O OG1 . THR D 1 32  ? 103.085 13.063 141.341 1.00 56.51  ? 32  THR D OG1 1 
ATOM   4414  C CG2 . THR D 1 32  ? 104.913 14.328 140.398 1.00 56.51  ? 32  THR D CG2 1 
ATOM   4415  N N   . ALA D 1 33  ? 102.177 11.526 138.268 1.00 50.93  ? 33  ALA D N   1 
ATOM   4416  C CA  . ALA D 1 33  ? 101.240 10.413 138.146 1.00 50.93  ? 33  ALA D CA  1 
ATOM   4417  C C   . ALA D 1 33  ? 100.583 10.032 139.485 1.00 50.93  ? 33  ALA D C   1 
ATOM   4418  O O   . ALA D 1 33  ? 99.357  9.922  139.584 1.00 50.93  ? 33  ALA D O   1 
ATOM   4419  C CB  . ALA D 1 33  ? 101.968 9.201  137.540 1.00 32.48  ? 33  ALA D CB  1 
ATOM   4420  N N   . GLU D 1 34  ? 101.405 9.850  140.510 1.00 55.72  ? 34  GLU D N   1 
ATOM   4421  C CA  . GLU D 1 34  ? 100.911 9.468  141.824 1.00 55.72  ? 34  GLU D CA  1 
ATOM   4422  C C   . GLU D 1 34  ? 99.917  10.467 142.403 1.00 55.72  ? 34  GLU D C   1 
ATOM   4423  O O   . GLU D 1 34  ? 98.849  10.066 142.909 1.00 55.72  ? 34  GLU D O   1 
ATOM   4424  C CB  . GLU D 1 34  ? 102.067 9.299  142.814 1.00 109.97 ? 34  GLU D CB  1 
ATOM   4425  C CG  . GLU D 1 34  ? 103.219 8.449  142.321 1.00 109.97 ? 34  GLU D CG  1 
ATOM   4426  C CD  . GLU D 1 34  ? 104.295 9.277  141.650 1.00 109.97 ? 34  GLU D CD  1 
ATOM   4427  O OE1 . GLU D 1 34  ? 104.899 10.142 142.337 1.00 109.97 ? 34  GLU D OE1 1 
ATOM   4428  O OE2 . GLU D 1 34  ? 104.532 9.065  140.440 1.00 109.97 ? 34  GLU D OE2 1 
ATOM   4429  N N   . GLU D 1 35  ? 100.254 11.756 142.348 1.00 69.99  ? 35  GLU D N   1 
ATOM   4430  C CA  . GLU D 1 35  ? 99.358  12.766 142.906 1.00 69.99  ? 35  GLU D CA  1 
ATOM   4431  C C   . GLU D 1 35  ? 98.103  12.947 142.049 1.00 69.99  ? 35  GLU D C   1 
ATOM   4432  O O   . GLU D 1 35  ? 96.985  13.105 142.575 1.00 69.99  ? 35  GLU D O   1 
ATOM   4433  C CB  . GLU D 1 35  ? 100.082 14.104 143.083 1.00 41.00  ? 35  GLU D CB  1 
ATOM   4434  C CG  . GLU D 1 35  ? 99.232  15.136 143.839 1.00 41.00  ? 35  GLU D CG  1 
ATOM   4435  C CD  . GLU D 1 35  ? 99.971  16.431 144.097 1.00 41.00  ? 35  GLU D CD  1 
ATOM   4436  O OE1 . GLU D 1 35  ? 99.367  17.309 144.762 1.00 41.00  ? 35  GLU D OE1 1 
ATOM   4437  O OE2 . GLU D 1 35  ? 101.141 16.554 143.630 1.00 41.00  ? 35  GLU D OE2 1 
ATOM   4438  N N   . TYR D 1 36  ? 98.277  12.924 140.731 1.00 58.40  ? 36  TYR D N   1 
ATOM   4439  C CA  . TYR D 1 36  ? 97.126  13.051 139.849 1.00 58.40  ? 36  TYR D CA  1 
ATOM   4440  C C   . TYR D 1 36  ? 96.106  11.938 140.171 1.00 58.40  ? 36  TYR D C   1 
ATOM   4441  O O   . TYR D 1 36  ? 94.914  12.197 140.407 1.00 58.40  ? 36  TYR D O   1 
ATOM   4442  C CB  . TYR D 1 36  ? 97.538  12.930 138.369 1.00 51.79  ? 36  TYR D CB  1 
ATOM   4443  C CG  . TYR D 1 36  ? 96.354  12.570 137.505 1.00 51.79  ? 36  TYR D CG  1 
ATOM   4444  C CD1 . TYR D 1 36  ? 95.313  13.468 137.326 1.00 51.79  ? 36  TYR D CD1 1 
ATOM   4445  C CD2 . TYR D 1 36  ? 96.187  11.272 137.037 1.00 51.79  ? 36  TYR D CD2 1 
ATOM   4446  C CE1 . TYR D 1 36  ? 94.126  13.080 136.723 1.00 51.79  ? 36  TYR D CE1 1 
ATOM   4447  C CE2 . TYR D 1 36  ? 95.011  10.868 136.430 1.00 51.79  ? 36  TYR D CE2 1 
ATOM   4448  C CZ  . TYR D 1 36  ? 93.974  11.770 136.277 1.00 51.79  ? 36  TYR D CZ  1 
ATOM   4449  O OH  . TYR D 1 36  ? 92.777  11.355 135.718 1.00 51.79  ? 36  TYR D OH  1 
ATOM   4450  N N   . GLN D 1 37  ? 96.584  10.694 140.173 1.00 45.80  ? 37  GLN D N   1 
ATOM   4451  C CA  . GLN D 1 37  ? 95.706  9.572  140.437 1.00 45.80  ? 37  GLN D CA  1 
ATOM   4452  C C   . GLN D 1 37  ? 94.948  9.693  141.758 1.00 45.80  ? 37  GLN D C   1 
ATOM   4453  O O   . GLN D 1 37  ? 93.720  9.540  141.796 1.00 45.80  ? 37  GLN D O   1 
ATOM   4454  C CB  . GLN D 1 37  ? 96.498  8.278  140.415 1.00 77.96  ? 37  GLN D CB  1 
ATOM   4455  C CG  . GLN D 1 37  ? 95.631  7.071  140.149 1.00 77.96  ? 37  GLN D CG  1 
ATOM   4456  C CD  . GLN D 1 37  ? 96.450  5.813  140.011 1.00 77.96  ? 37  GLN D CD  1 
ATOM   4457  O OE1 . GLN D 1 37  ? 96.061  4.871  139.319 1.00 77.96  ? 37  GLN D OE1 1 
ATOM   4458  N NE2 . GLN D 1 37  ? 97.593  5.786  140.672 1.00 77.96  ? 37  GLN D NE2 1 
ATOM   4459  N N   . ALA D 1 38  ? 95.691  9.974  142.831 1.00 47.20  ? 38  ALA D N   1 
ATOM   4460  C CA  . ALA D 1 38  ? 95.133  10.107 144.173 1.00 47.20  ? 38  ALA D CA  1 
ATOM   4461  C C   . ALA D 1 38  ? 94.034  11.148 144.229 1.00 47.20  ? 38  ALA D C   1 
ATOM   4462  O O   . ALA D 1 38  ? 92.913  10.865 144.653 1.00 47.20  ? 38  ALA D O   1 
ATOM   4463  C CB  . ALA D 1 38  ? 96.232  10.468 145.143 1.00 39.14  ? 38  ALA D CB  1 
ATOM   4464  N N   . ILE D 1 39  ? 94.366  12.360 143.802 1.00 46.90  ? 39  ILE D N   1 
ATOM   4465  C CA  . ILE D 1 39  ? 93.409  13.455 143.789 1.00 46.90  ? 39  ILE D CA  1 
ATOM   4466  C C   . ILE D 1 39  ? 92.217  13.160 142.871 1.00 46.90  ? 39  ILE D C   1 
ATOM   4467  O O   . ILE D 1 39  ? 91.072  13.490 143.206 1.00 46.90  ? 39  ILE D O   1 
ATOM   4468  C CB  . ILE D 1 39  ? 94.097  14.743 143.329 1.00 31.67  ? 39  ILE D CB  1 
ATOM   4469  C CG1 . ILE D 1 39  ? 95.105  15.168 144.387 1.00 31.67  ? 39  ILE D CG1 1 
ATOM   4470  C CG2 . ILE D 1 39  ? 93.067  15.822 143.023 1.00 31.67  ? 39  ILE D CG2 1 
ATOM   4471  C CD1 . ILE D 1 39  ? 95.851  16.443 144.060 1.00 31.67  ? 39  ILE D CD1 1 
ATOM   4472  N N   . GLN D 1 40  ? 92.494  12.540 141.718 1.00 42.31  ? 40  GLN D N   1 
ATOM   4473  C CA  . GLN D 1 40  ? 91.450  12.215 140.754 1.00 42.31  ? 40  GLN D CA  1 
ATOM   4474  C C   . GLN D 1 40  ? 90.409  11.322 141.410 1.00 42.31  ? 40  GLN D C   1 
ATOM   4475  O O   . GLN D 1 40  ? 89.196  11.549 141.242 1.00 42.31  ? 40  GLN D O   1 
ATOM   4476  C CB  . GLN D 1 40  ? 92.051  11.535 139.513 1.00 50.77  ? 40  GLN D CB  1 
ATOM   4477  C CG  . GLN D 1 40  ? 91.013  11.037 138.470 1.00 50.77  ? 40  GLN D CG  1 
ATOM   4478  C CD  . GLN D 1 40  ? 90.169  12.143 137.823 1.00 50.77  ? 40  GLN D CD  1 
ATOM   4479  O OE1 . GLN D 1 40  ? 90.169  13.282 138.272 1.00 50.77  ? 40  GLN D OE1 1 
ATOM   4480  N NE2 . GLN D 1 40  ? 89.428  11.789 136.776 1.00 50.77  ? 40  GLN D NE2 1 
ATOM   4481  N N   . LYS D 1 41  ? 90.883  10.331 142.178 1.00 57.02  ? 41  LYS D N   1 
ATOM   4482  C CA  . LYS D 1 41  ? 89.996  9.404  142.894 1.00 57.02  ? 41  LYS D CA  1 
ATOM   4483  C C   . LYS D 1 41  ? 89.306  10.092 144.071 1.00 57.02  ? 41  LYS D C   1 
ATOM   4484  O O   . LYS D 1 41  ? 88.084  9.995  144.240 1.00 57.02  ? 41  LYS D O   1 
ATOM   4485  C CB  . LYS D 1 41  ? 90.773  8.197  143.411 1.00 66.30  ? 41  LYS D CB  1 
ATOM   4486  C CG  . LYS D 1 41  ? 91.336  7.317  142.315 1.00 66.30  ? 41  LYS D CG  1 
ATOM   4487  C CD  . LYS D 1 41  ? 91.887  6.015  142.869 1.00 66.30  ? 41  LYS D CD  1 
ATOM   4488  C CE  . LYS D 1 41  ? 92.666  5.236  141.811 1.00 66.30  ? 41  LYS D CE  1 
ATOM   4489  N NZ  . LYS D 1 41  ? 91.868  4.981  140.579 1.00 66.30  ? 41  LYS D NZ  1 
ATOM   4490  N N   . ALA D 1 42  ? 90.093  10.802 144.869 1.00 53.43  ? 42  ALA D N   1 
ATOM   4491  C CA  . ALA D 1 42  ? 89.560  11.502 146.021 1.00 53.43  ? 42  ALA D CA  1 
ATOM   4492  C C   . ALA D 1 42  ? 88.387  12.416 145.681 1.00 53.43  ? 42  ALA D C   1 
ATOM   4493  O O   . ALA D 1 42  ? 87.332  12.345 146.318 1.00 53.43  ? 42  ALA D O   1 
ATOM   4494  C CB  . ALA D 1 42  ? 90.661  12.298 146.698 1.00 30.99  ? 42  ALA D CB  1 
ATOM   4495  N N   . LEU D 1 43  ? 88.555  13.268 144.673 1.00 43.91  ? 43  LEU D N   1 
ATOM   4496  C CA  . LEU D 1 43  ? 87.499  14.207 144.273 1.00 43.91  ? 43  LEU D CA  1 
ATOM   4497  C C   . LEU D 1 43  ? 86.140  13.574 143.966 1.00 43.91  ? 43  LEU D C   1 
ATOM   4498  O O   . LEU D 1 43  ? 85.101  14.248 144.016 1.00 43.91  ? 43  LEU D O   1 
ATOM   4499  C CB  . LEU D 1 43  ? 87.974  15.024 143.070 1.00 55.51  ? 43  LEU D CB  1 
ATOM   4500  C CG  . LEU D 1 43  ? 89.068  16.027 143.441 1.00 55.51  ? 43  LEU D CG  1 
ATOM   4501  C CD1 . LEU D 1 43  ? 89.708  16.592 142.200 1.00 55.51  ? 43  LEU D CD1 1 
ATOM   4502  C CD2 . LEU D 1 43  ? 88.465  17.120 144.303 1.00 55.51  ? 43  LEU D CD2 1 
ATOM   4503  N N   . ARG D 1 44  ? 86.153  12.284 143.642 1.00 54.06  ? 44  ARG D N   1 
ATOM   4504  C CA  . ARG D 1 44  ? 84.930  11.555 143.339 1.00 54.06  ? 44  ARG D CA  1 
ATOM   4505  C C   . ARG D 1 44  ? 84.039  11.369 144.566 1.00 54.06  ? 44  ARG D C   1 
ATOM   4506  O O   . ARG D 1 44  ? 82.809  11.360 144.452 1.00 54.06  ? 44  ARG D O   1 
ATOM   4507  C CB  . ARG D 1 44  ? 85.265  10.190 142.734 1.00 61.44  ? 44  ARG D CB  1 
ATOM   4508  C CG  . ARG D 1 44  ? 85.546  10.229 141.249 1.00 61.44  ? 44  ARG D CG  1 
ATOM   4509  C CD  . ARG D 1 44  ? 85.539  8.846  140.651 1.00 61.44  ? 44  ARG D CD  1 
ATOM   4510  N NE  . ARG D 1 44  ? 86.875  8.264  140.575 1.00 61.44  ? 44  ARG D NE  1 
ATOM   4511  C CZ  . ARG D 1 44  ? 87.650  8.316  139.492 1.00 61.44  ? 44  ARG D CZ  1 
ATOM   4512  N NH1 . ARG D 1 44  ? 87.209  8.931  138.404 1.00 61.44  ? 44  ARG D NH1 1 
ATOM   4513  N NH2 . ARG D 1 44  ? 88.855  7.737  139.477 1.00 61.44  ? 44  ARG D NH2 1 
ATOM   4514  N N   . GLN D 1 45  ? 84.669  11.218 145.731 1.00 74.22  ? 45  GLN D N   1 
ATOM   4515  C CA  . GLN D 1 45  ? 83.963  11.040 147.001 1.00 74.22  ? 45  GLN D CA  1 
ATOM   4516  C C   . GLN D 1 45  ? 82.823  12.024 147.213 1.00 74.22  ? 45  GLN D C   1 
ATOM   4517  O O   . GLN D 1 45  ? 82.913  13.176 146.815 1.00 74.22  ? 45  GLN D O   1 
ATOM   4518  C CB  . GLN D 1 45  ? 84.928  11.217 148.164 1.00 59.53  ? 45  GLN D CB  1 
ATOM   4519  C CG  . GLN D 1 45  ? 85.931  10.127 148.314 1.00 59.53  ? 45  GLN D CG  1 
ATOM   4520  C CD  . GLN D 1 45  ? 86.910  10.432 149.406 1.00 59.53  ? 45  GLN D CD  1 
ATOM   4521  O OE1 . GLN D 1 45  ? 87.729  11.355 149.289 1.00 59.53  ? 45  GLN D OE1 1 
ATOM   4522  N NE2 . GLN D 1 45  ? 86.834  9.669  150.489 1.00 59.53  ? 45  GLN D NE2 1 
ATOM   4523  N N   . ARG D 1 46  ? 81.752  11.576 147.849 1.00 65.71  ? 46  ARG D N   1 
ATOM   4524  C CA  . ARG D 1 46  ? 80.650  12.474 148.136 1.00 65.71  ? 46  ARG D CA  1 
ATOM   4525  C C   . ARG D 1 46  ? 80.886  12.884 149.575 1.00 65.71  ? 46  ARG D C   1 
ATOM   4526  O O   . ARG D 1 46  ? 81.524  12.146 150.326 1.00 65.71  ? 46  ARG D O   1 
ATOM   4527  C CB  . ARG D 1 46  ? 79.315  11.759 148.004 1.00 73.57  ? 46  ARG D CB  1 
ATOM   4528  C CG  . ARG D 1 46  ? 78.955  11.404 146.589 1.00 73.57  ? 46  ARG D CG  1 
ATOM   4529  C CD  . ARG D 1 46  ? 77.477  11.569 146.426 1.00 73.57  ? 46  ARG D CD  1 
ATOM   4530  N NE  . ARG D 1 46  ? 77.039  11.509 145.036 1.00 73.57  ? 46  ARG D NE  1 
ATOM   4531  C CZ  . ARG D 1 46  ? 77.073  10.411 144.292 1.00 73.57  ? 46  ARG D CZ  1 
ATOM   4532  N NH1 . ARG D 1 46  ? 77.533  9.276  144.804 1.00 73.57  ? 46  ARG D NH1 1 
ATOM   4533  N NH2 . ARG D 1 46  ? 76.628  10.444 143.044 1.00 73.57  ? 46  ARG D NH2 1 
ATOM   4534  N N   . LEU D 1 47  ? 80.396  14.053 149.972 1.00 81.35  ? 47  LEU D N   1 
ATOM   4535  C CA  . LEU D 1 47  ? 80.606  14.495 151.347 1.00 81.35  ? 47  LEU D CA  1 
ATOM   4536  C C   . LEU D 1 47  ? 79.640  13.850 152.327 1.00 81.35  ? 47  LEU D C   1 
ATOM   4537  O O   . LEU D 1 47  ? 78.500  13.542 151.985 1.00 81.35  ? 47  LEU D O   1 
ATOM   4538  C CB  . LEU D 1 47  ? 80.486  16.018 151.456 1.00 69.46  ? 47  LEU D CB  1 
ATOM   4539  C CG  . LEU D 1 47  ? 81.572  16.889 150.828 1.00 69.46  ? 47  LEU D CG  1 
ATOM   4540  C CD1 . LEU D 1 47  ? 82.945  16.420 151.279 1.00 69.46  ? 47  LEU D CD1 1 
ATOM   4541  C CD2 . LEU D 1 47  ? 81.443  16.818 149.334 1.00 69.46  ? 47  LEU D CD2 1 
ATOM   4542  N N   . GLY D 1 48  ? 80.116  13.642 153.549 1.00 97.72  ? 48  GLY D N   1 
ATOM   4543  C CA  . GLY D 1 48  ? 79.280  13.057 154.577 1.00 97.72  ? 48  GLY D CA  1 
ATOM   4544  C C   . GLY D 1 48  ? 78.387  14.133 155.167 1.00 97.72  ? 48  GLY D C   1 
ATOM   4545  O O   . GLY D 1 48  ? 78.547  15.309 154.846 1.00 97.72  ? 48  GLY D O   1 
ATOM   4546  N N   . PRO D 1 49  ? 77.433  13.768 156.031 1.00 82.93  ? 49  PRO D N   1 
ATOM   4547  C CA  . PRO D 1 49  ? 76.551  14.776 156.620 1.00 82.93  ? 49  PRO D CA  1 
ATOM   4548  C C   . PRO D 1 49  ? 77.286  15.744 157.543 1.00 82.93  ? 49  PRO D C   1 
ATOM   4549  O O   . PRO D 1 49  ? 76.715  16.734 157.988 1.00 82.93  ? 49  PRO D O   1 
ATOM   4550  C CB  . PRO D 1 49  ? 75.516  13.934 157.359 1.00 72.73  ? 49  PRO D CB  1 
ATOM   4551  C CG  . PRO D 1 49  ? 75.478  12.661 156.557 1.00 72.73  ? 49  PRO D CG  1 
ATOM   4552  C CD  . PRO D 1 49  ? 76.945  12.411 156.323 1.00 72.73  ? 49  PRO D CD  1 
ATOM   4553  N N   . GLU D 1 50  ? 78.551  15.460 157.826 1.00 78.27  ? 50  GLU D N   1 
ATOM   4554  C CA  . GLU D 1 50  ? 79.347  16.324 158.694 1.00 78.27  ? 50  GLU D CA  1 
ATOM   4555  C C   . GLU D 1 50  ? 79.690  17.628 158.000 1.00 78.27  ? 50  GLU D C   1 
ATOM   4556  O O   . GLU D 1 50  ? 80.169  18.568 158.630 1.00 78.27  ? 50  GLU D O   1 
ATOM   4557  C CB  . GLU D 1 50  ? 80.656  15.641 159.093 1.00 98.64  ? 50  GLU D CB  1 
ATOM   4558  C CG  . GLU D 1 50  ? 80.481  14.277 159.711 1.00 98.64  ? 50  GLU D CG  1 
ATOM   4559  C CD  . GLU D 1 50  ? 80.324  13.174 158.680 1.00 98.64  ? 50  GLU D CD  1 
ATOM   4560  O OE1 . GLU D 1 50  ? 79.493  13.301 157.753 1.00 98.64  ? 50  GLU D OE1 1 
ATOM   4561  O OE2 . GLU D 1 50  ? 81.038  12.165 158.809 1.00 98.64  ? 50  GLU D OE2 1 
ATOM   4562  N N   . TYR D 1 51  ? 79.442  17.682 156.698 1.00 100.64 ? 51  TYR D N   1 
ATOM   4563  C CA  . TYR D 1 51  ? 79.761  18.859 155.911 1.00 100.64 ? 51  TYR D CA  1 
ATOM   4564  C C   . TYR D 1 51  ? 78.561  19.724 155.552 1.00 100.64 ? 51  TYR D C   1 
ATOM   4565  O O   . TYR D 1 51  ? 78.673  20.947 155.449 1.00 100.64 ? 51  TYR D O   1 
ATOM   4566  C CB  . TYR D 1 51  ? 80.479  18.422 154.636 1.00 45.88  ? 51  TYR D CB  1 
ATOM   4567  C CG  . TYR D 1 51  ? 81.890  17.916 154.861 1.00 45.88  ? 51  TYR D CG  1 
ATOM   4568  C CD1 . TYR D 1 51  ? 82.169  16.546 154.943 1.00 45.88  ? 51  TYR D CD1 1 
ATOM   4569  C CD2 . TYR D 1 51  ? 82.952  18.821 155.002 1.00 45.88  ? 51  TYR D CD2 1 
ATOM   4570  C CE1 . TYR D 1 51  ? 83.475  16.094 155.159 1.00 45.88  ? 51  TYR D CE1 1 
ATOM   4571  C CE2 . TYR D 1 51  ? 84.250  18.392 155.219 1.00 45.88  ? 51  TYR D CE2 1 
ATOM   4572  C CZ  . TYR D 1 51  ? 84.514  17.027 155.299 1.00 45.88  ? 51  TYR D CZ  1 
ATOM   4573  O OH  . TYR D 1 51  ? 85.823  16.620 155.526 1.00 45.88  ? 51  TYR D OH  1 
ATOM   4574  N N   . ILE D 1 52  ? 77.414  19.087 155.375 1.00 74.73  ? 52  ILE D N   1 
ATOM   4575  C CA  . ILE D 1 52  ? 76.202  19.793 154.998 1.00 74.73  ? 52  ILE D CA  1 
ATOM   4576  C C   . ILE D 1 52  ? 75.579  20.635 156.109 1.00 74.73  ? 52  ILE D C   1 
ATOM   4577  O O   . ILE D 1 52  ? 75.762  20.360 157.297 1.00 74.73  ? 52  ILE D O   1 
ATOM   4578  C CB  . ILE D 1 52  ? 75.158  18.800 154.476 1.00 85.70  ? 52  ILE D CB  1 
ATOM   4579  C CG1 . ILE D 1 52  ? 75.837  17.808 153.538 1.00 85.70  ? 52  ILE D CG1 1 
ATOM   4580  C CG2 . ILE D 1 52  ? 74.051  19.533 153.738 1.00 85.70  ? 52  ILE D CG2 1 
ATOM   4581  C CD1 . ILE D 1 52  ? 76.713  18.458 152.476 1.00 85.70  ? 52  ILE D CD1 1 
ATOM   4582  N N   . SER D 1 53  ? 74.843  21.667 155.701 1.00 111.80 ? 53  SER D N   1 
ATOM   4583  C CA  . SER D 1 53  ? 74.163  22.577 156.617 1.00 111.80 ? 53  SER D CA  1 
ATOM   4584  C C   . SER D 1 53  ? 72.838  22.960 155.970 1.00 111.80 ? 53  SER D C   1 
ATOM   4585  O O   . SER D 1 53  ? 72.500  22.442 154.903 1.00 111.80 ? 53  SER D O   1 
ATOM   4586  C CB  . SER D 1 53  ? 75.007  23.828 156.837 1.00 46.28  ? 53  SER D CB  1 
ATOM   4587  O OG  . SER D 1 53  ? 76.311  23.491 157.292 1.00 46.28  ? 53  SER D OG  1 
ATOM   4588  N N   . SER D 1 54  ? 72.085  23.856 156.601 1.00 84.71  ? 54  SER D N   1 
ATOM   4589  C CA  . SER D 1 54  ? 70.815  24.263 156.018 1.00 84.71  ? 54  SER D CA  1 
ATOM   4590  C C   . SER D 1 54  ? 70.294  25.616 156.491 1.00 84.71  ? 54  SER D C   1 
ATOM   4591  O O   . SER D 1 54  ? 70.674  26.125 157.551 1.00 84.71  ? 54  SER D O   1 
ATOM   4592  C CB  . SER D 1 54  ? 69.746  23.183 156.249 1.00 122.92 ? 54  SER D CB  1 
ATOM   4593  O OG  . SER D 1 54  ? 69.502  22.968 157.628 1.00 122.92 ? 54  SER D OG  1 
ATOM   4594  N N   . ARG D 1 55  ? 69.433  26.192 155.660 1.00 88.86  ? 55  ARG D N   1 
ATOM   4595  C CA  . ARG D 1 55  ? 68.794  27.475 155.915 1.00 88.86  ? 55  ARG D CA  1 
ATOM   4596  C C   . ARG D 1 55  ? 67.354  27.344 155.448 1.00 88.86  ? 55  ARG D C   1 
ATOM   4597  O O   . ARG D 1 55  ? 67.032  26.491 154.620 1.00 88.86  ? 55  ARG D O   1 
ATOM   4598  C CB  . ARG D 1 55  ? 69.462  28.577 155.110 1.00 105.67 ? 55  ARG D CB  1 
ATOM   4599  C CG  . ARG D 1 55  ? 70.847  28.960 155.565 1.00 105.67 ? 55  ARG D CG  1 
ATOM   4600  C CD  . ARG D 1 55  ? 71.687  29.324 154.348 1.00 105.67 ? 55  ARG D CD  1 
ATOM   4601  N NE  . ARG D 1 55  ? 70.884  29.928 153.287 1.00 105.67 ? 55  ARG D NE  1 
ATOM   4602  C CZ  . ARG D 1 55  ? 71.304  30.102 152.038 1.00 105.67 ? 55  ARG D CZ  1 
ATOM   4603  N NH1 . ARG D 1 55  ? 72.526  29.718 151.687 1.00 105.67 ? 55  ARG D NH1 1 
ATOM   4604  N NH2 . ARG D 1 55  ? 70.501  30.654 151.138 1.00 105.67 ? 55  ARG D NH2 1 
ATOM   4605  N N   . MET D 1 56  ? 66.481  28.192 155.967 1.00 169.36 ? 56  MET D N   1 
ATOM   4606  C CA  . MET D 1 56  ? 65.091  28.114 155.570 1.00 169.36 ? 56  MET D CA  1 
ATOM   4607  C C   . MET D 1 56  ? 64.828  29.110 154.454 1.00 169.36 ? 56  MET D C   1 
ATOM   4608  O O   . MET D 1 56  ? 64.738  30.315 154.687 1.00 169.36 ? 56  MET D O   1 
ATOM   4609  C CB  . MET D 1 56  ? 64.187  28.383 156.774 1.00 199.83 ? 56  MET D CB  1 
ATOM   4610  C CG  . MET D 1 56  ? 62.872  27.627 156.723 1.00 199.83 ? 56  MET D CG  1 
ATOM   4611  S SD  . MET D 1 56  ? 63.088  25.883 156.307 1.00 199.83 ? 56  MET D SD  1 
ATOM   4612  C CE  . MET D 1 56  ? 63.812  25.255 157.805 1.00 199.83 ? 56  MET D CE  1 
ATOM   4613  N N   . ALA D 1 57  ? 64.732  28.594 153.234 1.00 162.77 ? 57  ALA D N   1 
ATOM   4614  C CA  . ALA D 1 57  ? 64.478  29.425 152.068 1.00 162.77 ? 57  ALA D CA  1 
ATOM   4615  C C   . ALA D 1 57  ? 63.254  30.293 152.320 1.00 162.77 ? 57  ALA D C   1 
ATOM   4616  O O   . ALA D 1 57  ? 62.227  29.800 152.787 1.00 162.77 ? 57  ALA D O   1 
ATOM   4617  C CB  . ALA D 1 57  ? 64.254  28.545 150.856 1.00 87.99  ? 57  ALA D CB  1 
ATOM   4618  N N   . GLY D 1 58  ? 63.367  31.584 152.022 1.00 174.81 ? 58  GLY D N   1 
ATOM   4619  C CA  . GLY D 1 58  ? 62.245  32.483 152.228 1.00 174.81 ? 58  GLY D CA  1 
ATOM   4620  C C   . GLY D 1 58  ? 61.014  31.988 151.494 1.00 174.81 ? 58  GLY D C   1 
ATOM   4621  O O   . GLY D 1 58  ? 60.870  32.213 150.295 1.00 174.81 ? 58  GLY D O   1 
ATOM   4622  N N   . GLY D 1 59  ? 60.124  31.309 152.209 1.00 182.66 ? 59  GLY D N   1 
ATOM   4623  C CA  . GLY D 1 59  ? 58.924  30.784 151.582 1.00 182.66 ? 59  GLY D CA  1 
ATOM   4624  C C   . GLY D 1 59  ? 59.165  29.371 151.097 1.00 182.66 ? 59  GLY D C   1 
ATOM   4625  O O   . GLY D 1 59  ? 58.286  28.512 151.175 1.00 182.66 ? 59  GLY D O   1 
ATOM   4626  N N   . GLY D 1 60  ? 60.377  29.140 150.599 1.00 200.00 ? 60  GLY D N   1 
ATOM   4627  C CA  . GLY D 1 60  ? 60.747  27.835 150.086 1.00 200.00 ? 60  GLY D CA  1 
ATOM   4628  C C   . GLY D 1 60  ? 61.097  26.835 151.167 1.00 200.00 ? 60  GLY D C   1 
ATOM   4629  O O   . GLY D 1 60  ? 60.944  27.108 152.354 1.00 200.00 ? 60  GLY D O   1 
ATOM   4630  N N   . GLN D 1 61  ? 61.591  25.674 150.750 1.00 164.93 ? 61  GLN D N   1 
ATOM   4631  C CA  . GLN D 1 61  ? 61.949  24.618 151.685 1.00 164.93 ? 61  GLN D CA  1 
ATOM   4632  C C   . GLN D 1 61  ? 63.297  24.826 152.355 1.00 164.93 ? 61  GLN D C   1 
ATOM   4633  O O   . GLN D 1 61  ? 63.821  25.938 152.442 1.00 164.93 ? 61  GLN D O   1 
ATOM   4634  C CB  . GLN D 1 61  ? 61.990  23.256 150.983 1.00 200.00 ? 61  GLN D CB  1 
ATOM   4635  C CG  . GLN D 1 61  ? 60.728  22.827 150.281 1.00 200.00 ? 61  GLN D CG  1 
ATOM   4636  C CD  . GLN D 1 61  ? 60.593  23.394 148.889 1.00 200.00 ? 61  GLN D CD  1 
ATOM   4637  O OE1 . GLN D 1 61  ? 60.616  24.608 148.689 1.00 200.00 ? 61  GLN D OE1 1 
ATOM   4638  N NE2 . GLN D 1 61  ? 60.448  22.509 147.910 1.00 200.00 ? 61  GLN D NE2 1 
ATOM   4639  N N   . LYS D 1 62  ? 63.839  23.708 152.822 1.00 148.29 ? 62  LYS D N   1 
ATOM   4640  C CA  . LYS D 1 62  ? 65.126  23.650 153.487 1.00 148.29 ? 62  LYS D CA  1 
ATOM   4641  C C   . LYS D 1 62  ? 66.194  23.574 152.411 1.00 148.29 ? 62  LYS D C   1 
ATOM   4642  O O   . LYS D 1 62  ? 66.187  22.665 151.583 1.00 148.29 ? 62  LYS D O   1 
ATOM   4643  C CB  . LYS D 1 62  ? 65.190  22.401 154.375 1.00 137.34 ? 62  LYS D CB  1 
ATOM   4644  C CG  . LYS D 1 62  ? 66.567  22.061 154.914 1.00 137.34 ? 62  LYS D CG  1 
ATOM   4645  C CD  . LYS D 1 62  ? 66.550  20.710 155.614 1.00 137.34 ? 62  LYS D CD  1 
ATOM   4646  C CE  . LYS D 1 62  ? 67.938  20.309 156.072 1.00 137.34 ? 62  LYS D CE  1 
ATOM   4647  N NZ  . LYS D 1 62  ? 67.924  18.980 156.726 1.00 137.34 ? 62  LYS D NZ  1 
ATOM   4648  N N   . VAL D 1 63  ? 67.102  24.539 152.417 1.00 82.59  ? 63  VAL D N   1 
ATOM   4649  C CA  . VAL D 1 63  ? 68.184  24.568 151.444 1.00 82.59  ? 63  VAL D CA  1 
ATOM   4650  C C   . VAL D 1 63  ? 69.506  24.149 152.086 1.00 82.59  ? 63  VAL D C   1 
ATOM   4651  O O   . VAL D 1 63  ? 69.954  24.738 153.075 1.00 82.59  ? 63  VAL D O   1 
ATOM   4652  C CB  . VAL D 1 63  ? 68.336  25.968 150.833 1.00 89.91  ? 63  VAL D CB  1 
ATOM   4653  C CG1 . VAL D 1 63  ? 69.514  25.999 149.890 1.00 89.91  ? 63  VAL D CG1 1 
ATOM   4654  C CG2 . VAL D 1 63  ? 67.064  26.343 150.094 1.00 89.91  ? 63  VAL D CG2 1 
ATOM   4655  N N   . CYS D 1 64  ? 70.120  23.119 151.516 1.00 115.04 ? 64  CYS D N   1 
ATOM   4656  C CA  . CYS D 1 64  ? 71.386  22.607 152.015 1.00 115.04 ? 64  CYS D CA  1 
ATOM   4657  C C   . CYS D 1 64  ? 72.544  23.315 151.326 1.00 115.04 ? 64  CYS D C   1 
ATOM   4658  O O   . CYS D 1 64  ? 72.444  23.697 150.162 1.00 115.04 ? 64  CYS D O   1 
ATOM   4659  C CB  . CYS D 1 64  ? 71.468  21.100 151.779 1.00 98.12  ? 64  CYS D CB  1 
ATOM   4660  S SG  . CYS D 1 64  ? 70.180  20.188 152.642 1.00 98.12  ? 64  CYS D SG  1 
ATOM   4661  N N   . TYR D 1 65  ? 73.641  23.487 152.053 1.00 67.32  ? 65  TYR D N   1 
ATOM   4662  C CA  . TYR D 1 65  ? 74.813  24.162 151.525 1.00 67.32  ? 65  TYR D CA  1 
ATOM   4663  C C   . TYR D 1 65  ? 76.006  23.751 152.372 1.00 67.32  ? 65  TYR D C   1 
ATOM   4664  O O   . TYR D 1 65  ? 75.846  23.062 153.369 1.00 67.32  ? 65  TYR D O   1 
ATOM   4665  C CB  . TYR D 1 65  ? 74.606  25.675 151.604 1.00 82.67  ? 65  TYR D CB  1 
ATOM   4666  C CG  . TYR D 1 65  ? 74.611  26.222 153.021 1.00 82.67  ? 65  TYR D CG  1 
ATOM   4667  C CD1 . TYR D 1 65  ? 75.811  26.580 153.646 1.00 82.67  ? 65  TYR D CD1 1 
ATOM   4668  C CD2 . TYR D 1 65  ? 73.426  26.359 153.746 1.00 82.67  ? 65  TYR D CD2 1 
ATOM   4669  C CE1 . TYR D 1 65  ? 75.833  27.059 154.951 1.00 82.67  ? 65  TYR D CE1 1 
ATOM   4670  C CE2 . TYR D 1 65  ? 73.443  26.834 155.054 1.00 82.67  ? 65  TYR D CE2 1 
ATOM   4671  C CZ  . TYR D 1 65  ? 74.650  27.183 155.648 1.00 82.67  ? 65  TYR D CZ  1 
ATOM   4672  O OH  . TYR D 1 65  ? 74.687  27.657 156.942 1.00 82.67  ? 65  TYR D OH  1 
ATOM   4673  N N   . ILE D 1 66  ? 77.196  24.175 151.976 1.00 73.74  ? 66  ILE D N   1 
ATOM   4674  C CA  . ILE D 1 66  ? 78.393  23.844 152.722 1.00 73.74  ? 66  ILE D CA  1 
ATOM   4675  C C   . ILE D 1 66  ? 79.020  25.143 153.179 1.00 73.74  ? 66  ILE D C   1 
ATOM   4676  O O   . ILE D 1 66  ? 79.325  26.009 152.363 1.00 73.74  ? 66  ILE D O   1 
ATOM   4677  C CB  . ILE D 1 66  ? 79.396  23.106 151.844 1.00 41.11  ? 66  ILE D CB  1 
ATOM   4678  C CG1 . ILE D 1 66  ? 78.709  21.921 151.194 1.00 41.11  ? 66  ILE D CG1 1 
ATOM   4679  C CG2 . ILE D 1 66  ? 80.621  22.675 152.665 1.00 41.11  ? 66  ILE D CG2 1 
ATOM   4680  C CD1 . ILE D 1 66  ? 79.631  21.116 150.262 1.00 41.11  ? 66  ILE D CD1 1 
ATOM   4681  N N   . GLU D 1 67  ? 79.211  25.283 154.483 1.00 73.39  ? 67  GLU D N   1 
ATOM   4682  C CA  . GLU D 1 67  ? 79.800  26.495 155.026 1.00 73.39  ? 67  GLU D CA  1 
ATOM   4683  C C   . GLU D 1 67  ? 81.167  26.721 154.409 1.00 73.39  ? 67  GLU D C   1 
ATOM   4684  O O   . GLU D 1 67  ? 81.881  25.770 154.067 1.00 73.39  ? 67  GLU D O   1 
ATOM   4685  C CB  . GLU D 1 67  ? 79.899  26.401 156.551 1.00 130.63 ? 67  GLU D CB  1 
ATOM   4686  C CG  . GLU D 1 67  ? 78.539  26.292 157.234 1.00 130.63 ? 67  GLU D CG  1 
ATOM   4687  C CD  . GLU D 1 67  ? 78.638  26.214 158.744 1.00 130.63 ? 67  GLU D CD  1 
ATOM   4688  O OE1 . GLU D 1 67  ? 79.130  27.178 159.368 1.00 130.63 ? 67  GLU D OE1 1 
ATOM   4689  O OE2 . GLU D 1 67  ? 78.219  25.183 159.308 1.00 130.63 ? 67  GLU D OE2 1 
ATOM   4690  N N   . GLY D 1 68  ? 81.512  27.996 154.267 1.00 53.03  ? 68  GLY D N   1 
ATOM   4691  C CA  . GLY D 1 68  ? 82.772  28.384 153.666 1.00 53.03  ? 68  GLY D CA  1 
ATOM   4692  C C   . GLY D 1 68  ? 84.066  27.812 154.215 1.00 53.03  ? 68  GLY D C   1 
ATOM   4693  O O   . GLY D 1 68  ? 84.883  27.292 153.440 1.00 53.03  ? 68  GLY D O   1 
ATOM   4694  N N   . HIS D 1 69  ? 84.281  27.916 155.528 1.00 62.65  ? 69  HIS D N   1 
ATOM   4695  C CA  . HIS D 1 69  ? 85.526  27.417 156.119 1.00 62.65  ? 69  HIS D CA  1 
ATOM   4696  C C   . HIS D 1 69  ? 85.703  25.934 155.815 1.00 62.65  ? 69  HIS D C   1 
ATOM   4697  O O   . HIS D 1 69  ? 86.829  25.446 155.741 1.00 62.65  ? 69  HIS D O   1 
ATOM   4698  C CB  . HIS D 1 69  ? 85.556  27.663 157.634 1.00 83.09  ? 69  HIS D CB  1 
ATOM   4699  C CG  . HIS D 1 69  ? 84.495  26.927 158.391 1.00 83.09  ? 69  HIS D CG  1 
ATOM   4700  N ND1 . HIS D 1 69  ? 83.157  27.251 158.307 1.00 83.09  ? 69  HIS D ND1 1 
ATOM   4701  C CD2 . HIS D 1 69  ? 84.572  25.855 159.217 1.00 83.09  ? 69  HIS D CD2 1 
ATOM   4702  C CE1 . HIS D 1 69  ? 82.455  26.410 159.046 1.00 83.09  ? 69  HIS D CE1 1 
ATOM   4703  N NE2 . HIS D 1 69  ? 83.289  25.553 159.609 1.00 83.09  ? 69  HIS D NE2 1 
ATOM   4704  N N   . ARG D 1 70  ? 84.586  25.228 155.624 1.00 58.70  ? 70  ARG D N   1 
ATOM   4705  C CA  . ARG D 1 70  ? 84.616  23.799 155.303 1.00 58.70  ? 70  ARG D CA  1 
ATOM   4706  C C   . ARG D 1 70  ? 85.295  23.637 153.954 1.00 58.70  ? 70  ARG D C   1 
ATOM   4707  O O   . ARG D 1 70  ? 86.341  22.987 153.835 1.00 58.70  ? 70  ARG D O   1 
ATOM   4708  C CB  . ARG D 1 70  ? 83.194  23.237 155.207 1.00 115.89 ? 70  ARG D CB  1 
ATOM   4709  C CG  . ARG D 1 70  ? 82.451  23.173 156.522 1.00 115.89 ? 70  ARG D CG  1 
ATOM   4710  C CD  . ARG D 1 70  ? 82.863  21.966 157.346 1.00 115.89 ? 70  ARG D CD  1 
ATOM   4711  N NE  . ARG D 1 70  ? 82.405  22.084 158.726 1.00 115.89 ? 70  ARG D NE  1 
ATOM   4712  C CZ  . ARG D 1 70  ? 81.156  22.369 159.080 1.00 115.89 ? 70  ARG D CZ  1 
ATOM   4713  N NH1 . ARG D 1 70  ? 80.223  22.566 158.154 1.00 115.89 ? 70  ARG D NH1 1 
ATOM   4714  N NH2 . ARG D 1 70  ? 80.841  22.474 160.364 1.00 115.89 ? 70  ARG D NH2 1 
ATOM   4715  N N   . VAL D 1 71  ? 84.681  24.248 152.943 1.00 57.56  ? 71  VAL D N   1 
ATOM   4716  C CA  . VAL D 1 71  ? 85.190  24.202 151.580 1.00 57.56  ? 71  VAL D CA  1 
ATOM   4717  C C   . VAL D 1 71  ? 86.653  24.601 151.528 1.00 57.56  ? 71  VAL D C   1 
ATOM   4718  O O   . VAL D 1 71  ? 87.442  24.019 150.794 1.00 57.56  ? 71  VAL D O   1 
ATOM   4719  C CB  . VAL D 1 71  ? 84.381  25.125 150.662 1.00 56.98  ? 71  VAL D CB  1 
ATOM   4720  C CG1 . VAL D 1 71  ? 84.981  25.126 149.285 1.00 56.98  ? 71  VAL D CG1 1 
ATOM   4721  C CG2 . VAL D 1 71  ? 82.930  24.649 150.598 1.00 56.98  ? 71  VAL D CG2 1 
ATOM   4722  N N   . ILE D 1 72  ? 87.024  25.591 152.318 1.00 53.15  ? 72  ILE D N   1 
ATOM   4723  C CA  . ILE D 1 72  ? 88.406  26.011 152.325 1.00 53.15  ? 72  ILE D CA  1 
ATOM   4724  C C   . ILE D 1 72  ? 89.302  24.872 152.764 1.00 53.15  ? 72  ILE D C   1 
ATOM   4725  O O   . ILE D 1 72  ? 90.235  24.502 152.047 1.00 53.15  ? 72  ILE D O   1 
ATOM   4726  C CB  . ILE D 1 72  ? 88.627  27.207 153.256 1.00 54.85  ? 72  ILE D CB  1 
ATOM   4727  C CG1 . ILE D 1 72  ? 87.950  28.437 152.667 1.00 54.85  ? 72  ILE D CG1 1 
ATOM   4728  C CG2 . ILE D 1 72  ? 90.113  27.467 153.432 1.00 54.85  ? 72  ILE D CG2 1 
ATOM   4729  C CD1 . ILE D 1 72  ? 88.228  29.709 153.419 1.00 54.85  ? 72  ILE D CD1 1 
ATOM   4730  N N   . ASN D 1 73  ? 89.028  24.317 153.943 1.00 78.68  ? 73  ASN D N   1 
ATOM   4731  C CA  . ASN D 1 73  ? 89.848  23.221 154.461 1.00 78.68  ? 73  ASN D CA  1 
ATOM   4732  C C   . ASN D 1 73  ? 89.852  22.026 153.523 1.00 78.68  ? 73  ASN D C   1 
ATOM   4733  O O   . ASN D 1 73  ? 90.892  21.393 153.329 1.00 78.68  ? 73  ASN D O   1 
ATOM   4734  C CB  . ASN D 1 73  ? 89.381  22.800 155.855 1.00 82.24  ? 73  ASN D CB  1 
ATOM   4735  C CG  . ASN D 1 73  ? 89.876  23.739 156.940 1.00 82.24  ? 73  ASN D CG  1 
ATOM   4736  O OD1 . ASN D 1 73  ? 91.062  24.098 156.984 1.00 82.24  ? 73  ASN D OD1 1 
ATOM   4737  N ND2 . ASN D 1 73  ? 88.973  24.135 157.832 1.00 82.24  ? 73  ASN D ND2 1 
ATOM   4738  N N   . LEU D 1 74  ? 88.691  21.718 152.946 1.00 62.54  ? 74  LEU D N   1 
ATOM   4739  C CA  . LEU D 1 74  ? 88.591  20.615 151.998 1.00 62.54  ? 74  LEU D CA  1 
ATOM   4740  C C   . LEU D 1 74  ? 89.664  20.785 150.911 1.00 62.54  ? 74  LEU D C   1 
ATOM   4741  O O   . LEU D 1 74  ? 90.430  19.859 150.608 1.00 62.54  ? 74  LEU D O   1 
ATOM   4742  C CB  . LEU D 1 74  ? 87.216  20.614 151.345 1.00 45.90  ? 74  LEU D CB  1 
ATOM   4743  C CG  . LEU D 1 74  ? 86.145  19.781 152.020 1.00 45.90  ? 74  LEU D CG  1 
ATOM   4744  C CD1 . LEU D 1 74  ? 84.827  19.896 151.254 1.00 45.90  ? 74  LEU D CD1 1 
ATOM   4745  C CD2 . LEU D 1 74  ? 86.625  18.319 152.070 1.00 45.90  ? 74  LEU D CD2 1 
ATOM   4746  N N   . ALA D 1 75  ? 89.709  21.986 150.338 1.00 48.60  ? 75  ALA D N   1 
ATOM   4747  C CA  . ALA D 1 75  ? 90.656  22.313 149.291 1.00 48.60  ? 75  ALA D CA  1 
ATOM   4748  C C   . ALA D 1 75  ? 92.091  22.246 149.787 1.00 48.60  ? 75  ALA D C   1 
ATOM   4749  O O   . ALA D 1 75  ? 92.953  21.672 149.122 1.00 48.60  ? 75  ALA D O   1 
ATOM   4750  C CB  . ALA D 1 75  ? 90.351  23.697 148.730 1.00 58.24  ? 75  ALA D CB  1 
ATOM   4751  N N   . ASN D 1 76  ? 92.367  22.828 150.951 1.00 61.91  ? 76  ASN D N   1 
ATOM   4752  C CA  . ASN D 1 76  ? 93.729  22.790 151.477 1.00 61.91  ? 76  ASN D CA  1 
ATOM   4753  C C   . ASN D 1 76  ? 94.230  21.363 151.645 1.00 61.91  ? 76  ASN D C   1 
ATOM   4754  O O   . ASN D 1 76  ? 95.431  21.113 151.587 1.00 61.91  ? 76  ASN D O   1 
ATOM   4755  C CB  . ASN D 1 76  ? 93.798  23.515 152.802 1.00 67.79  ? 76  ASN D CB  1 
ATOM   4756  C CG  . ASN D 1 76  ? 93.711  24.992 152.637 1.00 67.79  ? 76  ASN D CG  1 
ATOM   4757  O OD1 . ASN D 1 76  ? 94.597  25.612 152.040 1.00 67.79  ? 76  ASN D OD1 1 
ATOM   4758  N ND2 . ASN D 1 76  ? 92.641  25.580 153.157 1.00 67.79  ? 76  ASN D ND2 1 
ATOM   4759  N N   . GLU D 1 77  ? 93.300  20.431 151.855 1.00 76.56  ? 77  GLU D N   1 
ATOM   4760  C CA  . GLU D 1 77  ? 93.656  19.025 152.006 1.00 76.56  ? 77  GLU D CA  1 
ATOM   4761  C C   . GLU D 1 77  ? 93.840  18.375 150.638 1.00 76.56  ? 77  GLU D C   1 
ATOM   4762  O O   . GLU D 1 77  ? 94.885  17.775 150.363 1.00 76.56  ? 77  GLU D O   1 
ATOM   4763  C CB  . GLU D 1 77  ? 92.584  18.273 152.809 1.00 86.35  ? 77  GLU D CB  1 
ATOM   4764  C CG  . GLU D 1 77  ? 92.688  18.480 154.313 1.00 86.35  ? 77  GLU D CG  1 
ATOM   4765  C CD  . GLU D 1 77  ? 94.134  18.494 154.787 1.00 86.35  ? 77  GLU D CD  1 
ATOM   4766  O OE1 . GLU D 1 77  ? 94.934  17.668 154.281 1.00 86.35  ? 77  GLU D OE1 1 
ATOM   4767  O OE2 . GLU D 1 77  ? 94.468  19.329 155.663 1.00 86.35  ? 77  GLU D OE2 1 
ATOM   4768  N N   . MET D 1 78  ? 92.822  18.502 149.790 1.00 50.67  ? 78  MET D N   1 
ATOM   4769  C CA  . MET D 1 78  ? 92.865  17.953 148.443 1.00 50.67  ? 78  MET D CA  1 
ATOM   4770  C C   . MET D 1 78  ? 94.090  18.401 147.654 1.00 50.67  ? 78  MET D C   1 
ATOM   4771  O O   . MET D 1 78  ? 94.670  17.584 146.942 1.00 50.67  ? 78  MET D O   1 
ATOM   4772  C CB  . MET D 1 78  ? 91.625  18.369 147.648 1.00 63.24  ? 78  MET D CB  1 
ATOM   4773  C CG  . MET D 1 78  ? 90.431  17.453 147.766 1.00 63.24  ? 78  MET D CG  1 
ATOM   4774  S SD  . MET D 1 78  ? 90.807  15.748 147.303 1.00 63.24  ? 78  MET D SD  1 
ATOM   4775  C CE  . MET D 1 78  ? 91.719  15.994 145.848 1.00 63.24  ? 78  MET D CE  1 
ATOM   4776  N N   . PHE D 1 79  ? 94.486  19.679 147.777 1.00 45.70  ? 79  PHE D N   1 
ATOM   4777  C CA  . PHE D 1 79  ? 95.617  20.219 146.997 1.00 45.70  ? 79  PHE D CA  1 
ATOM   4778  C C   . PHE D 1 79  ? 96.838  20.706 147.785 1.00 45.70  ? 79  PHE D C   1 
ATOM   4779  O O   . PHE D 1 79  ? 97.943  20.848 147.230 1.00 45.70  ? 79  PHE D O   1 
ATOM   4780  C CB  . PHE D 1 79  ? 95.157  21.395 146.100 1.00 31.41  ? 79  PHE D CB  1 
ATOM   4781  C CG  . PHE D 1 79  ? 93.870  21.147 145.354 1.00 31.41  ? 79  PHE D CG  1 
ATOM   4782  C CD1 . PHE D 1 79  ? 92.695  21.805 145.730 1.00 31.41  ? 79  PHE D CD1 1 
ATOM   4783  C CD2 . PHE D 1 79  ? 93.823  20.237 144.306 1.00 31.41  ? 79  PHE D CD2 1 
ATOM   4784  C CE1 . PHE D 1 79  ? 91.495  21.558 145.079 1.00 31.41  ? 79  PHE D CE1 1 
ATOM   4785  C CE2 . PHE D 1 79  ? 92.631  19.973 143.643 1.00 31.41  ? 79  PHE D CE2 1 
ATOM   4786  C CZ  . PHE D 1 79  ? 91.461  20.632 144.025 1.00 31.41  ? 79  PHE D CZ  1 
ATOM   4787  N N   . GLY D 1 80  ? 96.638  20.979 149.067 1.00 101.90 ? 80  GLY D N   1 
ATOM   4788  C CA  . GLY D 1 80  ? 97.728  21.485 149.874 1.00 101.90 ? 80  GLY D CA  1 
ATOM   4789  C C   . GLY D 1 80  ? 97.568  22.990 149.915 1.00 101.90 ? 80  GLY D C   1 
ATOM   4790  O O   . GLY D 1 80  ? 97.091  23.583 148.957 1.00 101.90 ? 80  GLY D O   1 
ATOM   4791  N N   . TYR D 1 81  ? 97.953  23.607 151.021 1.00 60.68  ? 81  TYR D N   1 
ATOM   4792  C CA  . TYR D 1 81  ? 97.838  25.045 151.171 1.00 60.68  ? 81  TYR D CA  1 
ATOM   4793  C C   . TYR D 1 81  ? 98.366  25.823 149.962 1.00 60.68  ? 81  TYR D C   1 
ATOM   4794  O O   . TYR D 1 81  ? 97.890  26.931 149.675 1.00 60.68  ? 81  TYR D O   1 
ATOM   4795  C CB  . TYR D 1 81  ? 98.589  25.510 152.431 1.00 44.40  ? 81  TYR D CB  1 
ATOM   4796  C CG  . TYR D 1 81  ? 100.109 25.464 152.323 1.00 44.40  ? 81  TYR D CG  1 
ATOM   4797  C CD1 . TYR D 1 81  ? 100.838 26.587 151.939 1.00 44.40  ? 81  TYR D CD1 1 
ATOM   4798  C CD2 . TYR D 1 81  ? 100.810 24.283 152.576 1.00 44.40  ? 81  TYR D CD2 1 
ATOM   4799  C CE1 . TYR D 1 81  ? 102.231 26.532 151.806 1.00 44.40  ? 81  TYR D CE1 1 
ATOM   4800  C CE2 . TYR D 1 81  ? 102.195 24.215 152.445 1.00 44.40  ? 81  TYR D CE2 1 
ATOM   4801  C CZ  . TYR D 1 81  ? 102.903 25.329 152.058 1.00 44.40  ? 81  TYR D CZ  1 
ATOM   4802  O OH  . TYR D 1 81  ? 104.273 25.220 151.883 1.00 44.40  ? 81  TYR D OH  1 
ATOM   4803  N N   . ASN D 1 82  ? 99.331  25.252 149.246 1.00 48.98  ? 82  ASN D N   1 
ATOM   4804  C CA  . ASN D 1 82  ? 99.920  25.951 148.111 1.00 48.98  ? 82  ASN D CA  1 
ATOM   4805  C C   . ASN D 1 82  ? 99.653  25.260 146.774 1.00 48.98  ? 82  ASN D C   1 
ATOM   4806  O O   . ASN D 1 82  ? 100.391 25.453 145.793 1.00 48.98  ? 82  ASN D O   1 
ATOM   4807  C CB  . ASN D 1 82  ? 101.420 26.031 148.311 1.00 50.95  ? 82  ASN D CB  1 
ATOM   4808  C CG  . ASN D 1 82  ? 102.078 24.714 148.053 1.00 50.95  ? 82  ASN D CG  1 
ATOM   4809  O OD1 . ASN D 1 82  ? 101.484 23.669 148.317 1.00 50.95  ? 82  ASN D OD1 1 
ATOM   4810  N ND2 . ASN D 1 82  ? 103.302 24.739 147.524 1.00 50.95  ? 82  ASN D ND2 1 
ATOM   4811  N N   . GLY D 1 83  ? 98.615  24.441 146.733 1.00 57.51  ? 83  GLY D N   1 
ATOM   4812  C CA  . GLY D 1 83  ? 98.321  23.745 145.508 1.00 57.51  ? 83  GLY D CA  1 
ATOM   4813  C C   . GLY D 1 83  ? 97.148  24.367 144.806 1.00 57.51  ? 83  GLY D C   1 
ATOM   4814  O O   . GLY D 1 83  ? 96.849  24.016 143.668 1.00 57.51  ? 83  GLY D O   1 
ATOM   4815  N N   . TRP D 1 84  ? 96.464  25.284 145.476 1.00 44.93  ? 84  TRP D N   1 
ATOM   4816  C CA  . TRP D 1 84  ? 95.324  25.919 144.848 1.00 44.93  ? 84  TRP D CA  1 
ATOM   4817  C C   . TRP D 1 84  ? 95.310  27.391 145.173 1.00 44.93  ? 84  TRP D C   1 
ATOM   4818  O O   . TRP D 1 84  ? 95.913  27.813 146.145 1.00 44.93  ? 84  TRP D O   1 
ATOM   4819  C CB  . TRP D 1 84  ? 94.030  25.275 145.308 1.00 61.45  ? 84  TRP D CB  1 
ATOM   4820  C CG  . TRP D 1 84  ? 93.685  25.619 146.689 1.00 61.45  ? 84  TRP D CG  1 
ATOM   4821  C CD1 . TRP D 1 84  ? 94.268  25.144 147.830 1.00 61.45  ? 84  TRP D CD1 1 
ATOM   4822  C CD2 . TRP D 1 84  ? 92.667  26.530 147.105 1.00 61.45  ? 84  TRP D CD2 1 
ATOM   4823  N NE1 . TRP D 1 84  ? 93.672  25.703 148.932 1.00 61.45  ? 84  TRP D NE1 1 
ATOM   4824  C CE2 . TRP D 1 84  ? 92.688  26.559 148.516 1.00 61.45  ? 84  TRP D CE2 1 
ATOM   4825  C CE3 . TRP D 1 84  ? 91.736  27.327 146.421 1.00 61.45  ? 84  TRP D CE3 1 
ATOM   4826  C CZ2 . TRP D 1 84  ? 91.819  27.351 149.254 1.00 61.45  ? 84  TRP D CZ2 1 
ATOM   4827  C CZ3 . TRP D 1 84  ? 90.870  28.114 147.158 1.00 61.45  ? 84  TRP D CZ3 1 
ATOM   4828  C CH2 . TRP D 1 84  ? 90.918  28.120 148.559 1.00 61.45  ? 84  TRP D CH2 1 
ATOM   4829  N N   . ALA D 1 85  ? 94.616  28.168 144.354 1.00 49.95  ? 85  ALA D N   1 
ATOM   4830  C CA  . ALA D 1 85  ? 94.556  29.607 144.544 1.00 49.95  ? 85  ALA D CA  1 
ATOM   4831  C C   . ALA D 1 85  ? 93.279  30.174 143.966 1.00 49.95  ? 85  ALA D C   1 
ATOM   4832  O O   . ALA D 1 85  ? 92.610  29.534 143.156 1.00 49.95  ? 85  ALA D O   1 
ATOM   4833  C CB  . ALA D 1 85  ? 95.762  30.275 143.874 1.00 36.15  ? 85  ALA D CB  1 
ATOM   4834  N N   . HIS D 1 86  ? 92.930  31.377 144.395 1.00 40.66  ? 86  HIS D N   1 
ATOM   4835  C CA  . HIS D 1 86  ? 91.739  32.013 143.864 1.00 40.66  ? 86  HIS D CA  1 
ATOM   4836  C C   . HIS D 1 86  ? 91.931  33.519 143.844 1.00 40.66  ? 86  HIS D C   1 
ATOM   4837  O O   . HIS D 1 86  ? 92.781  34.061 144.561 1.00 40.66  ? 86  HIS D O   1 
ATOM   4838  C CB  . HIS D 1 86  ? 90.493  31.629 144.664 1.00 56.04  ? 86  HIS D CB  1 
ATOM   4839  C CG  . HIS D 1 86  ? 90.444  32.225 146.033 1.00 56.04  ? 86  HIS D CG  1 
ATOM   4840  N ND1 . HIS D 1 86  ? 89.279  32.700 146.594 1.00 56.04  ? 86  HIS D ND1 1 
ATOM   4841  C CD2 . HIS D 1 86  ? 91.409  32.402 146.962 1.00 56.04  ? 86  HIS D CD2 1 
ATOM   4842  C CE1 . HIS D 1 86  ? 89.530  33.144 147.812 1.00 56.04  ? 86  HIS D CE1 1 
ATOM   4843  N NE2 . HIS D 1 86  ? 90.817  32.973 148.059 1.00 56.04  ? 86  HIS D NE2 1 
ATOM   4844  N N   . SER D 1 87  ? 91.176  34.182 142.976 1.00 48.16  ? 87  SER D N   1 
ATOM   4845  C CA  . SER D 1 87  ? 91.262  35.631 142.845 1.00 48.16  ? 87  SER D CA  1 
ATOM   4846  C C   . SER D 1 87  ? 89.902  36.157 142.449 1.00 48.16  ? 87  SER D C   1 
ATOM   4847  O O   . SER D 1 87  ? 89.107  35.443 141.843 1.00 48.16  ? 87  SER D O   1 
ATOM   4848  C CB  . SER D 1 87  ? 92.296  36.022 141.785 1.00 49.79  ? 87  SER D CB  1 
ATOM   4849  O OG  . SER D 1 87  ? 91.981  35.461 140.527 1.00 49.79  ? 87  SER D OG  1 
ATOM   4850  N N   . ILE D 1 88  ? 89.613  37.397 142.819 1.00 42.69  ? 88  ILE D N   1 
ATOM   4851  C CA  . ILE D 1 88  ? 88.327  37.979 142.468 1.00 42.69  ? 88  ILE D CA  1 
ATOM   4852  C C   . ILE D 1 88  ? 88.535  38.694 141.147 1.00 42.69  ? 88  ILE D C   1 
ATOM   4853  O O   . ILE D 1 88  ? 89.273  39.685 141.067 1.00 42.69  ? 88  ILE D O   1 
ATOM   4854  C CB  . ILE D 1 88  ? 87.856  38.982 143.533 1.00 41.02  ? 88  ILE D CB  1 
ATOM   4855  C CG1 . ILE D 1 88  ? 87.726  38.275 144.888 1.00 41.02  ? 88  ILE D CG1 1 
ATOM   4856  C CG2 . ILE D 1 88  ? 86.524  39.584 143.122 1.00 41.02  ? 88  ILE D CG2 1 
ATOM   4857  C CD1 . ILE D 1 88  ? 87.384  39.190 146.048 1.00 41.02  ? 88  ILE D CD1 1 
ATOM   4858  N N   . THR D 1 89  ? 87.919  38.166 140.098 1.00 42.79  ? 89  THR D N   1 
ATOM   4859  C CA  . THR D 1 89  ? 88.050  38.760 138.774 1.00 42.79  ? 89  THR D CA  1 
ATOM   4860  C C   . THR D 1 89  ? 87.360  40.099 138.808 1.00 42.79  ? 89  THR D C   1 
ATOM   4861  O O   . THR D 1 89  ? 87.853  41.083 138.272 1.00 42.79  ? 89  THR D O   1 
ATOM   4862  C CB  . THR D 1 89  ? 87.385  37.894 137.714 1.00 41.41  ? 89  THR D CB  1 
ATOM   4863  O OG1 . THR D 1 89  ? 88.108  36.669 137.594 1.00 41.41  ? 89  THR D OG1 1 
ATOM   4864  C CG2 . THR D 1 89  ? 87.384  38.587 136.383 1.00 41.41  ? 89  THR D CG2 1 
ATOM   4865  N N   . GLN D 1 90  ? 86.215  40.132 139.473 1.00 49.16  ? 90  GLN D N   1 
ATOM   4866  C CA  . GLN D 1 90  ? 85.445  41.347 139.584 1.00 49.16  ? 90  GLN D CA  1 
ATOM   4867  C C   . GLN D 1 90  ? 84.284  41.172 140.537 1.00 49.16  ? 90  GLN D C   1 
ATOM   4868  O O   . GLN D 1 90  ? 83.775  40.063 140.725 1.00 49.16  ? 90  GLN D O   1 
ATOM   4869  C CB  . GLN D 1 90  ? 84.907  41.736 138.216 1.00 82.63  ? 90  GLN D CB  1 
ATOM   4870  C CG  . GLN D 1 90  ? 83.965  42.892 138.273 1.00 82.63  ? 90  GLN D CG  1 
ATOM   4871  C CD  . GLN D 1 90  ? 83.555  43.361 136.912 1.00 82.63  ? 90  GLN D CD  1 
ATOM   4872  O OE1 . GLN D 1 90  ? 82.771  42.710 136.221 1.00 82.63  ? 90  GLN D OE1 1 
ATOM   4873  N NE2 . GLN D 1 90  ? 84.094  44.503 136.505 1.00 82.63  ? 90  GLN D NE2 1 
ATOM   4874  N N   . GLN D 1 91  ? 83.892  42.275 141.163 1.00 40.06  ? 91  GLN D N   1 
ATOM   4875  C CA  . GLN D 1 91  ? 82.739  42.287 142.053 1.00 40.06  ? 91  GLN D CA  1 
ATOM   4876  C C   . GLN D 1 91  ? 81.951  43.515 141.689 1.00 40.06  ? 91  GLN D C   1 
ATOM   4877  O O   . GLN D 1 91  ? 82.496  44.604 141.607 1.00 40.06  ? 91  GLN D O   1 
ATOM   4878  C CB  . GLN D 1 91  ? 83.130  42.374 143.514 1.00 55.61  ? 91  GLN D CB  1 
ATOM   4879  C CG  . GLN D 1 91  ? 81.913  42.641 144.392 1.00 55.61  ? 91  GLN D CG  1 
ATOM   4880  C CD  . GLN D 1 91  ? 82.199  42.461 145.855 1.00 55.61  ? 91  GLN D CD  1 
ATOM   4881  O OE1 . GLN D 1 91  ? 81.999  41.377 146.405 1.00 55.61  ? 91  GLN D OE1 1 
ATOM   4882  N NE2 . GLN D 1 91  ? 82.689  43.518 146.498 1.00 55.61  ? 91  GLN D NE2 1 
ATOM   4883  N N   . ASN D 1 92  ? 80.665  43.341 141.456 1.00 45.42  ? 92  ASN D N   1 
ATOM   4884  C CA  . ASN D 1 92  ? 79.823  44.457 141.086 1.00 45.42  ? 92  ASN D CA  1 
ATOM   4885  C C   . ASN D 1 92  ? 78.611  44.531 142.003 1.00 45.42  ? 92  ASN D C   1 
ATOM   4886  O O   . ASN D 1 92  ? 77.915  43.534 142.213 1.00 45.42  ? 92  ASN D O   1 
ATOM   4887  C CB  . ASN D 1 92  ? 79.364  44.299 139.640 1.00 121.88 ? 92  ASN D CB  1 
ATOM   4888  C CG  . ASN D 1 92  ? 78.514  45.454 139.178 1.00 121.88 ? 92  ASN D CG  1 
ATOM   4889  O OD1 . ASN D 1 92  ? 78.983  46.588 139.113 1.00 121.88 ? 92  ASN D OD1 1 
ATOM   4890  N ND2 . ASN D 1 92  ? 77.253  45.178 138.859 1.00 121.88 ? 92  ASN D ND2 1 
ATOM   4891  N N   . VAL D 1 93  ? 78.371  45.711 142.565 1.00 49.41  ? 93  VAL D N   1 
ATOM   4892  C CA  . VAL D 1 93  ? 77.214  45.904 143.428 1.00 49.41  ? 93  VAL D CA  1 
ATOM   4893  C C   . VAL D 1 93  ? 75.990  46.124 142.529 1.00 49.41  ? 93  VAL D C   1 
ATOM   4894  O O   . VAL D 1 93  ? 75.809  47.202 141.975 1.00 49.41  ? 93  VAL D O   1 
ATOM   4895  C CB  . VAL D 1 93  ? 77.387  47.132 144.328 1.00 53.11  ? 93  VAL D CB  1 
ATOM   4896  C CG1 . VAL D 1 93  ? 76.109  47.392 145.079 1.00 53.11  ? 93  VAL D CG1 1 
ATOM   4897  C CG2 . VAL D 1 93  ? 78.524  46.908 145.315 1.00 53.11  ? 93  VAL D CG2 1 
ATOM   4898  N N   . ASP D 1 94  ? 75.151  45.112 142.372 1.00 55.18  ? 94  ASP D N   1 
ATOM   4899  C CA  . ASP D 1 94  ? 73.989  45.275 141.520 1.00 55.18  ? 94  ASP D CA  1 
ATOM   4900  C C   . ASP D 1 94  ? 73.064  46.413 141.916 1.00 55.18  ? 94  ASP D C   1 
ATOM   4901  O O   . ASP D 1 94  ? 72.664  47.210 141.068 1.00 55.18  ? 94  ASP D O   1 
ATOM   4902  C CB  . ASP D 1 94  ? 73.178  43.986 141.455 1.00 92.87  ? 94  ASP D CB  1 
ATOM   4903  C CG  . ASP D 1 94  ? 73.796  42.966 140.543 1.00 92.87  ? 94  ASP D CG  1 
ATOM   4904  O OD1 . ASP D 1 94  ? 74.542  43.371 139.627 1.00 92.87  ? 94  ASP D OD1 1 
ATOM   4905  O OD2 . ASP D 1 94  ? 73.524  41.764 140.733 1.00 92.87  ? 94  ASP D OD2 1 
ATOM   4906  N N   . PHE D 1 95  ? 72.701  46.485 143.190 1.00 100.78 ? 95  PHE D N   1 
ATOM   4907  C CA  . PHE D 1 95  ? 71.804  47.541 143.635 1.00 100.78 ? 95  PHE D CA  1 
ATOM   4908  C C   . PHE D 1 95  ? 71.824  47.742 145.132 1.00 100.78 ? 95  PHE D C   1 
ATOM   4909  O O   . PHE D 1 95  ? 72.239  46.860 145.884 1.00 100.78 ? 95  PHE D O   1 
ATOM   4910  C CB  . PHE D 1 95  ? 70.370  47.234 143.193 1.00 85.28  ? 95  PHE D CB  1 
ATOM   4911  C CG  . PHE D 1 95  ? 69.795  45.994 143.811 1.00 85.28  ? 95  PHE D CG  1 
ATOM   4912  C CD1 . PHE D 1 95  ? 69.261  46.020 145.094 1.00 85.28  ? 95  PHE D CD1 1 
ATOM   4913  C CD2 . PHE D 1 95  ? 69.799  44.793 143.111 1.00 85.28  ? 95  PHE D CD2 1 
ATOM   4914  C CE1 . PHE D 1 95  ? 68.738  44.862 145.673 1.00 85.28  ? 95  PHE D CE1 1 
ATOM   4915  C CE2 . PHE D 1 95  ? 69.279  43.631 143.678 1.00 85.28  ? 95  PHE D CE2 1 
ATOM   4916  C CZ  . PHE D 1 95  ? 68.748  43.665 144.963 1.00 85.28  ? 95  PHE D CZ  1 
ATOM   4917  N N   . VAL D 1 96  ? 71.381  48.923 145.550 1.00 64.69  ? 96  VAL D N   1 
ATOM   4918  C CA  . VAL D 1 96  ? 71.292  49.273 146.962 1.00 64.69  ? 96  VAL D CA  1 
ATOM   4919  C C   . VAL D 1 96  ? 70.031  50.103 147.079 1.00 64.69  ? 96  VAL D C   1 
ATOM   4920  O O   . VAL D 1 96  ? 70.061  51.315 146.892 1.00 64.69  ? 96  VAL D O   1 
ATOM   4921  C CB  . VAL D 1 96  ? 72.511  50.107 147.453 1.00 44.29  ? 96  VAL D CB  1 
ATOM   4922  C CG1 . VAL D 1 96  ? 72.321  50.479 148.910 1.00 44.29  ? 96  VAL D CG1 1 
ATOM   4923  C CG2 . VAL D 1 96  ? 73.792  49.301 147.321 1.00 44.29  ? 96  VAL D CG2 1 
ATOM   4924  N N   . ASP D 1 97  ? 68.920  49.431 147.360 1.00 95.07  ? 97  ASP D N   1 
ATOM   4925  C CA  . ASP D 1 97  ? 67.639  50.104 147.495 1.00 95.07  ? 97  ASP D CA  1 
ATOM   4926  C C   . ASP D 1 97  ? 67.239  50.333 148.947 1.00 95.07  ? 97  ASP D C   1 
ATOM   4927  O O   . ASP D 1 97  ? 67.629  49.581 149.846 1.00 95.07  ? 97  ASP D O   1 
ATOM   4928  C CB  . ASP D 1 97  ? 66.552  49.307 146.784 1.00 72.99  ? 97  ASP D CB  1 
ATOM   4929  C CG  . ASP D 1 97  ? 66.824  49.147 145.312 1.00 72.99  ? 97  ASP D CG  1 
ATOM   4930  O OD1 . ASP D 1 97  ? 67.340  50.108 144.701 1.00 72.99  ? 97  ASP D OD1 1 
ATOM   4931  O OD2 . ASP D 1 97  ? 66.509  48.069 144.765 1.00 72.99  ? 97  ASP D OD2 1 
ATOM   4932  N N   . LEU D 1 98  ? 66.451  51.383 149.161 1.00 133.91 ? 98  LEU D N   1 
ATOM   4933  C CA  . LEU D 1 98  ? 65.985  51.749 150.491 1.00 133.91 ? 98  LEU D CA  1 
ATOM   4934  C C   . LEU D 1 98  ? 64.463  51.800 150.568 1.00 133.91 ? 98  LEU D C   1 
ATOM   4935  O O   . LEU D 1 98  ? 63.833  52.682 149.986 1.00 133.91 ? 98  LEU D O   1 
ATOM   4936  C CB  . LEU D 1 98  ? 66.567  53.108 150.886 1.00 91.74  ? 98  LEU D CB  1 
ATOM   4937  C CG  . LEU D 1 98  ? 66.145  53.666 152.241 1.00 91.74  ? 98  LEU D CG  1 
ATOM   4938  C CD1 . LEU D 1 98  ? 66.426  52.640 153.330 1.00 91.74  ? 98  LEU D CD1 1 
ATOM   4939  C CD2 . LEU D 1 98  ? 66.891  54.968 152.509 1.00 91.74  ? 98  LEU D CD2 1 
ATOM   4940  N N   . ASN D 1 99  ? 63.884  50.837 151.278 1.00 132.08 ? 99  ASN D N   1 
ATOM   4941  C CA  . ASN D 1 99  ? 62.440  50.767 151.462 1.00 132.08 ? 99  ASN D CA  1 
ATOM   4942  C C   . ASN D 1 99  ? 62.153  50.964 152.935 1.00 132.08 ? 99  ASN D C   1 
ATOM   4943  O O   . ASN D 1 99  ? 62.409  50.078 153.754 1.00 132.08 ? 99  ASN D O   1 
ATOM   4944  C CB  . ASN D 1 99  ? 61.891  49.415 151.012 1.00 173.26 ? 99  ASN D CB  1 
ATOM   4945  C CG  . ASN D 1 99  ? 61.907  49.256 149.511 1.00 173.26 ? 99  ASN D CG  1 
ATOM   4946  O OD1 . ASN D 1 99  ? 61.364  50.088 148.785 1.00 173.26 ? 99  ASN D OD1 1 
ATOM   4947  N ND2 . ASN D 1 99  ? 62.528  48.183 149.033 1.00 173.26 ? 99  ASN D ND2 1 
ATOM   4948  N N   . ASN D 1 100 ? 61.621  52.137 153.260 1.00 113.38 ? 100 ASN D N   1 
ATOM   4949  C CA  . ASN D 1 100 ? 61.298  52.507 154.631 1.00 113.38 ? 100 ASN D CA  1 
ATOM   4950  C C   . ASN D 1 100 ? 62.360  52.075 155.643 1.00 113.38 ? 100 ASN D C   1 
ATOM   4951  O O   . ASN D 1 100 ? 62.195  51.095 156.367 1.00 113.38 ? 100 ASN D O   1 
ATOM   4952  C CB  . ASN D 1 100 ? 59.918  51.961 155.034 1.00 148.70 ? 100 ASN D CB  1 
ATOM   4953  C CG  . ASN D 1 100 ? 59.820  50.453 154.920 1.00 148.70 ? 100 ASN D CG  1 
ATOM   4954  O OD1 . ASN D 1 100 ? 59.867  49.894 153.822 1.00 148.70 ? 100 ASN D OD1 1 
ATOM   4955  N ND2 . ASN D 1 100 ? 59.680  49.783 156.060 1.00 148.70 ? 100 ASN D ND2 1 
ATOM   4956  N N   . GLY D 1 101 ? 63.459  52.821 155.664 1.00 90.75  ? 101 GLY D N   1 
ATOM   4957  C CA  . GLY D 1 101 ? 64.545  52.569 156.594 1.00 90.75  ? 101 GLY D CA  1 
ATOM   4958  C C   . GLY D 1 101 ? 65.292  51.259 156.495 1.00 90.75  ? 101 GLY D C   1 
ATOM   4959  O O   . GLY D 1 101 ? 66.294  51.073 157.190 1.00 90.75  ? 101 GLY D O   1 
ATOM   4960  N N   . LYS D 1 102 ? 64.818  50.344 155.657 1.00 101.69 ? 102 LYS D N   1 
ATOM   4961  C CA  . LYS D 1 102 ? 65.488  49.055 155.506 1.00 101.69 ? 102 LYS D CA  1 
ATOM   4962  C C   . LYS D 1 102 ? 66.223  49.002 154.173 1.00 101.69 ? 102 LYS D C   1 
ATOM   4963  O O   . LYS D 1 102 ? 65.717  49.496 153.163 1.00 101.69 ? 102 LYS D O   1 
ATOM   4964  C CB  . LYS D 1 102 ? 64.472  47.916 155.579 1.00 108.97 ? 102 LYS D CB  1 
ATOM   4965  C CG  . LYS D 1 102 ? 63.715  47.847 156.887 1.00 108.97 ? 102 LYS D CG  1 
ATOM   4966  C CD  . LYS D 1 102 ? 62.556  46.876 156.776 1.00 108.97 ? 102 LYS D CD  1 
ATOM   4967  C CE  . LYS D 1 102 ? 61.674  46.923 158.007 1.00 108.97 ? 102 LYS D CE  1 
ATOM   4968  N NZ  . LYS D 1 102 ? 60.456  46.091 157.819 1.00 108.97 ? 102 LYS D NZ  1 
ATOM   4969  N N   . PHE D 1 103 ? 67.410  48.399 154.176 1.00 95.50  ? 103 PHE D N   1 
ATOM   4970  C CA  . PHE D 1 103 ? 68.221  48.283 152.966 1.00 95.50  ? 103 PHE D CA  1 
ATOM   4971  C C   . PHE D 1 103 ? 68.187  46.930 152.280 1.00 95.50  ? 103 PHE D C   1 
ATOM   4972  O O   . PHE D 1 103 ? 68.340  45.883 152.917 1.00 95.50  ? 103 PHE D O   1 
ATOM   4973  C CB  . PHE D 1 103 ? 69.670  48.629 153.267 1.00 96.43  ? 103 PHE D CB  1 
ATOM   4974  C CG  . PHE D 1 103 ? 69.912  50.084 153.423 1.00 96.43  ? 103 PHE D CG  1 
ATOM   4975  C CD1 . PHE D 1 103 ? 70.389  50.593 154.621 1.00 96.43  ? 103 PHE D CD1 1 
ATOM   4976  C CD2 . PHE D 1 103 ? 69.666  50.953 152.367 1.00 96.43  ? 103 PHE D CD2 1 
ATOM   4977  C CE1 . PHE D 1 103 ? 70.622  51.952 154.768 1.00 96.43  ? 103 PHE D CE1 1 
ATOM   4978  C CE2 . PHE D 1 103 ? 69.894  52.314 152.500 1.00 96.43  ? 103 PHE D CE2 1 
ATOM   4979  C CZ  . PHE D 1 103 ? 70.374  52.818 153.704 1.00 96.43  ? 103 PHE D CZ  1 
ATOM   4980  N N   . TYR D 1 104 ? 68.003  46.976 150.965 1.00 95.90  ? 104 TYR D N   1 
ATOM   4981  C CA  . TYR D 1 104 ? 67.954  45.785 150.138 1.00 95.90  ? 104 TYR D CA  1 
ATOM   4982  C C   . TYR D 1 104 ? 69.134  45.846 149.170 1.00 95.90  ? 104 TYR D C   1 
ATOM   4983  O O   . TYR D 1 104 ? 69.114  46.603 148.199 1.00 95.90  ? 104 TYR D O   1 
ATOM   4984  C CB  . TYR D 1 104 ? 66.623  45.737 149.379 1.00 109.90 ? 104 TYR D CB  1 
ATOM   4985  C CG  . TYR D 1 104 ? 65.421  45.661 150.298 1.00 109.90 ? 104 TYR D CG  1 
ATOM   4986  C CD1 . TYR D 1 104 ? 65.177  46.661 151.236 1.00 109.90 ? 104 TYR D CD1 1 
ATOM   4987  C CD2 . TYR D 1 104 ? 64.548  44.572 150.259 1.00 109.90 ? 104 TYR D CD2 1 
ATOM   4988  C CE1 . TYR D 1 104 ? 64.098  46.582 152.117 1.00 109.90 ? 104 TYR D CE1 1 
ATOM   4989  C CE2 . TYR D 1 104 ? 63.462  44.485 151.135 1.00 109.90 ? 104 TYR D CE2 1 
ATOM   4990  C CZ  . TYR D 1 104 ? 63.245  45.493 152.062 1.00 109.90 ? 104 TYR D CZ  1 
ATOM   4991  O OH  . TYR D 1 104 ? 62.179  45.419 152.932 1.00 109.90 ? 104 TYR D OH  1 
ATOM   4992  N N   . VAL D 1 105 ? 70.162  45.047 149.446 1.00 90.29  ? 105 VAL D N   1 
ATOM   4993  C CA  . VAL D 1 105 ? 71.364  45.026 148.624 1.00 90.29  ? 105 VAL D CA  1 
ATOM   4994  C C   . VAL D 1 105 ? 71.659  43.701 147.935 1.00 90.29  ? 105 VAL D C   1 
ATOM   4995  O O   . VAL D 1 105 ? 71.540  42.633 148.534 1.00 90.29  ? 105 VAL D O   1 
ATOM   4996  C CB  . VAL D 1 105 ? 72.584  45.407 149.466 1.00 73.28  ? 105 VAL D CB  1 
ATOM   4997  C CG1 . VAL D 1 105 ? 73.852  45.314 148.640 1.00 73.28  ? 105 VAL D CG1 1 
ATOM   4998  C CG2 . VAL D 1 105 ? 72.399  46.800 149.997 1.00 73.28  ? 105 VAL D CG2 1 
ATOM   4999  N N   . GLY D 1 106 ? 72.054  43.795 146.668 1.00 49.64  ? 106 GLY D N   1 
ATOM   5000  C CA  . GLY D 1 106 ? 72.408  42.619 145.883 1.00 49.64  ? 106 GLY D CA  1 
ATOM   5001  C C   . GLY D 1 106 ? 73.791  42.775 145.261 1.00 49.64  ? 106 GLY D C   1 
ATOM   5002  O O   . GLY D 1 106 ? 74.069  43.745 144.566 1.00 49.64  ? 106 GLY D O   1 
ATOM   5003  N N   . VAL D 1 107 ? 74.677  41.827 145.514 1.00 80.84  ? 107 VAL D N   1 
ATOM   5004  C CA  . VAL D 1 107 ? 76.014  41.917 144.950 1.00 80.84  ? 107 VAL D CA  1 
ATOM   5005  C C   . VAL D 1 107 ? 76.457  40.620 144.314 1.00 80.84  ? 107 VAL D C   1 
ATOM   5006  O O   . VAL D 1 107 ? 76.090  39.533 144.753 1.00 80.84  ? 107 VAL D O   1 
ATOM   5007  C CB  . VAL D 1 107 ? 77.046  42.315 146.011 1.00 41.14  ? 107 VAL D CB  1 
ATOM   5008  C CG1 . VAL D 1 107 ? 78.455  42.303 145.409 1.00 41.14  ? 107 VAL D CG1 1 
ATOM   5009  C CG2 . VAL D 1 107 ? 76.708  43.701 146.540 1.00 41.14  ? 107 VAL D CG2 1 
ATOM   5010  N N   . CYS D 1 108 ? 77.252  40.740 143.263 1.00 60.17  ? 108 CYS D N   1 
ATOM   5011  C CA  . CYS D 1 108 ? 77.746  39.564 142.576 1.00 60.17  ? 108 CYS D CA  1 
ATOM   5012  C C   . CYS D 1 108 ? 79.254  39.647 142.517 1.00 60.17  ? 108 CYS D C   1 
ATOM   5013  O O   . CYS D 1 108 ? 79.834  40.733 142.469 1.00 60.17  ? 108 CYS D O   1 
ATOM   5014  C CB  . CYS D 1 108 ? 77.162  39.470 141.153 1.00 57.56  ? 108 CYS D CB  1 
ATOM   5015  S SG  . CYS D 1 108 ? 77.828  40.651 139.952 1.00 57.56  ? 108 CYS D SG  1 
ATOM   5016  N N   . ALA D 1 109 ? 79.888  38.490 142.543 1.00 46.04  ? 109 ALA D N   1 
ATOM   5017  C CA  . ALA D 1 109 ? 81.323  38.455 142.473 1.00 46.04  ? 109 ALA D CA  1 
ATOM   5018  C C   . ALA D 1 109 ? 81.747  37.327 141.536 1.00 46.04  ? 109 ALA D C   1 
ATOM   5019  O O   . ALA D 1 109 ? 81.072  36.308 141.449 1.00 46.04  ? 109 ALA D O   1 
ATOM   5020  C CB  . ALA D 1 109 ? 81.890  38.263 143.860 1.00 34.53  ? 109 ALA D CB  1 
ATOM   5021  N N   . PHE D 1 110 ? 82.841  37.531 140.809 1.00 36.36  ? 110 PHE D N   1 
ATOM   5022  C CA  . PHE D 1 110 ? 83.334  36.512 139.905 1.00 36.36  ? 110 PHE D CA  1 
ATOM   5023  C C   . PHE D 1 110 ? 84.650  36.067 140.466 1.00 36.36  ? 110 PHE D C   1 
ATOM   5024  O O   . PHE D 1 110 ? 85.593  36.852 140.574 1.00 36.36  ? 110 PHE D O   1 
ATOM   5025  C CB  . PHE D 1 110 ? 83.501  37.064 138.492 1.00 28.95  ? 110 PHE D CB  1 
ATOM   5026  C CG  . PHE D 1 110 ? 82.207  37.481 137.868 1.00 28.95  ? 110 PHE D CG  1 
ATOM   5027  C CD1 . PHE D 1 110 ? 81.658  38.736 138.148 1.00 28.95  ? 110 PHE D CD1 1 
ATOM   5028  C CD2 . PHE D 1 110 ? 81.493  36.589 137.075 1.00 28.95  ? 110 PHE D CD2 1 
ATOM   5029  C CE1 . PHE D 1 110 ? 80.418  39.097 137.660 1.00 28.95  ? 110 PHE D CE1 1 
ATOM   5030  C CE2 . PHE D 1 110 ? 80.239  36.925 136.566 1.00 28.95  ? 110 PHE D CE2 1 
ATOM   5031  C CZ  . PHE D 1 110 ? 79.694  38.192 136.864 1.00 28.95  ? 110 PHE D CZ  1 
ATOM   5032  N N   . VAL D 1 111 ? 84.696  34.800 140.856 1.00 42.33  ? 111 VAL D N   1 
ATOM   5033  C CA  . VAL D 1 111 ? 85.897  34.247 141.440 1.00 42.33  ? 111 VAL D CA  1 
ATOM   5034  C C   . VAL D 1 111 ? 86.458  33.196 140.534 1.00 42.33  ? 111 VAL D C   1 
ATOM   5035  O O   . VAL D 1 111 ? 85.711  32.406 139.967 1.00 42.33  ? 111 VAL D O   1 
ATOM   5036  C CB  . VAL D 1 111 ? 85.607  33.620 142.795 1.00 41.92  ? 111 VAL D CB  1 
ATOM   5037  C CG1 . VAL D 1 111 ? 86.902  33.239 143.480 1.00 41.92  ? 111 VAL D CG1 1 
ATOM   5038  C CG2 . VAL D 1 111 ? 84.822  34.590 143.636 1.00 41.92  ? 111 VAL D CG2 1 
ATOM   5039  N N   . ARG D 1 112 ? 87.780  33.198 140.421 1.00 48.67  ? 112 ARG D N   1 
ATOM   5040  C CA  . ARG D 1 112 ? 88.511  32.274 139.581 1.00 48.67  ? 112 ARG D CA  1 
ATOM   5041  C C   . ARG D 1 112 ? 89.489  31.471 140.421 1.00 48.67  ? 112 ARG D C   1 
ATOM   5042  O O   . ARG D 1 112 ? 90.378  32.045 141.059 1.00 48.67  ? 112 ARG D O   1 
ATOM   5043  C CB  . ARG D 1 112 ? 89.299  33.045 138.522 1.00 61.61  ? 112 ARG D CB  1 
ATOM   5044  C CG  . ARG D 1 112 ? 89.809  32.163 137.418 1.00 61.61  ? 112 ARG D CG  1 
ATOM   5045  C CD  . ARG D 1 112 ? 90.675  32.896 136.438 1.00 61.61  ? 112 ARG D CD  1 
ATOM   5046  N NE  . ARG D 1 112 ? 92.017  32.340 136.468 1.00 61.61  ? 112 ARG D NE  1 
ATOM   5047  C CZ  . ARG D 1 112 ? 92.666  31.880 135.402 1.00 61.61  ? 112 ARG D CZ  1 
ATOM   5048  N NH1 . ARG D 1 112 ? 92.087  31.915 134.194 1.00 61.61  ? 112 ARG D NH1 1 
ATOM   5049  N NH2 . ARG D 1 112 ? 93.892  31.373 135.550 1.00 61.61  ? 112 ARG D NH2 1 
ATOM   5050  N N   . VAL D 1 113 ? 89.333  30.149 140.408 1.00 44.25  ? 113 VAL D N   1 
ATOM   5051  C CA  . VAL D 1 113 ? 90.223  29.275 141.159 1.00 44.25  ? 113 VAL D CA  1 
ATOM   5052  C C   . VAL D 1 113 ? 91.212  28.635 140.205 1.00 44.25  ? 113 VAL D C   1 
ATOM   5053  O O   . VAL D 1 113 ? 90.853  28.268 139.099 1.00 44.25  ? 113 VAL D O   1 
ATOM   5054  C CB  . VAL D 1 113 ? 89.439  28.158 141.887 1.00 35.94  ? 113 VAL D CB  1 
ATOM   5055  C CG1 . VAL D 1 113 ? 90.375  27.352 142.749 1.00 35.94  ? 113 VAL D CG1 1 
ATOM   5056  C CG2 . VAL D 1 113 ? 88.367  28.760 142.746 1.00 35.94  ? 113 VAL D CG2 1 
ATOM   5057  N N   . GLN D 1 114 ? 92.453  28.496 140.642 1.00 51.94  ? 114 GLN D N   1 
ATOM   5058  C CA  . GLN D 1 114 ? 93.469  27.891 139.808 1.00 51.94  ? 114 GLN D CA  1 
ATOM   5059  C C   . GLN D 1 114 ? 94.315  26.911 140.597 1.00 51.94  ? 114 GLN D C   1 
ATOM   5060  O O   . GLN D 1 114 ? 94.640  27.177 141.747 1.00 51.94  ? 114 GLN D O   1 
ATOM   5061  C CB  . GLN D 1 114 ? 94.375  28.960 139.249 1.00 49.20  ? 114 GLN D CB  1 
ATOM   5062  C CG  . GLN D 1 114 ? 95.339  28.424 138.261 1.00 49.20  ? 114 GLN D CG  1 
ATOM   5063  C CD  . GLN D 1 114 ? 96.283  29.474 137.761 1.00 49.20  ? 114 GLN D CD  1 
ATOM   5064  O OE1 . GLN D 1 114 ? 97.300  29.766 138.383 1.00 49.20  ? 114 GLN D OE1 1 
ATOM   5065  N NE2 . GLN D 1 114 ? 95.946  30.065 136.632 1.00 49.20  ? 114 GLN D NE2 1 
ATOM   5066  N N   . LEU D 1 115 ? 94.673  25.780 139.988 1.00 39.62  ? 115 LEU D N   1 
ATOM   5067  C CA  . LEU D 1 115 ? 95.503  24.788 140.658 1.00 39.62  ? 115 LEU D CA  1 
ATOM   5068  C C   . LEU D 1 115 ? 96.947  25.100 140.313 1.00 39.62  ? 115 LEU D C   1 
ATOM   5069  O O   . LEU D 1 115 ? 97.203  25.909 139.444 1.00 39.62  ? 115 LEU D O   1 
ATOM   5070  C CB  . LEU D 1 115 ? 95.141  23.386 140.198 1.00 50.50  ? 115 LEU D CB  1 
ATOM   5071  C CG  . LEU D 1 115 ? 93.715  22.950 140.519 1.00 50.50  ? 115 LEU D CG  1 
ATOM   5072  C CD1 . LEU D 1 115 ? 93.513  21.532 140.043 1.00 50.50  ? 115 LEU D CD1 1 
ATOM   5073  C CD2 . LEU D 1 115 ? 93.472  23.027 142.002 1.00 50.50  ? 115 LEU D CD2 1 
ATOM   5074  N N   . LYS D 1 116 ? 97.893  24.466 140.990 1.00 49.29  ? 116 LYS D N   1 
ATOM   5075  C CA  . LYS D 1 116 ? 99.298  24.731 140.738 1.00 49.29  ? 116 LYS D CA  1 
ATOM   5076  C C   . LYS D 1 116 ? 99.758  24.385 139.327 1.00 49.29  ? 116 LYS D C   1 
ATOM   5077  O O   . LYS D 1 116 ? 100.808 24.850 138.879 1.00 49.29  ? 116 LYS D O   1 
ATOM   5078  C CB  . LYS D 1 116 ? 100.161 23.986 141.753 1.00 61.30  ? 116 LYS D CB  1 
ATOM   5079  C CG  . LYS D 1 116 ? 99.931  22.497 141.806 1.00 61.30  ? 116 LYS D CG  1 
ATOM   5080  C CD  . LYS D 1 116 ? 100.966 21.838 142.701 1.00 61.30  ? 116 LYS D CD  1 
ATOM   5081  C CE  . LYS D 1 116 ? 100.763 20.329 142.812 1.00 61.30  ? 116 LYS D CE  1 
ATOM   5082  N NZ  . LYS D 1 116 ? 101.782 19.679 143.714 1.00 61.30  ? 116 LYS D NZ  1 
ATOM   5083  N N   . ASP D 1 117 ? 98.976  23.584 138.614 1.00 48.42  ? 117 ASP D N   1 
ATOM   5084  C CA  . ASP D 1 117 ? 99.369  23.195 137.268 1.00 48.42  ? 117 ASP D CA  1 
ATOM   5085  C C   . ASP D 1 117 ? 98.804  24.055 136.165 1.00 48.42  ? 117 ASP D C   1 
ATOM   5086  O O   . ASP D 1 117 ? 99.044  23.779 134.991 1.00 48.42  ? 117 ASP D O   1 
ATOM   5087  C CB  . ASP D 1 117 ? 99.011  21.736 137.010 1.00 53.17  ? 117 ASP D CB  1 
ATOM   5088  C CG  . ASP D 1 117 ? 97.571  21.539 136.660 1.00 53.17  ? 117 ASP D CG  1 
ATOM   5089  O OD1 . ASP D 1 117 ? 96.711  22.300 137.146 1.00 53.17  ? 117 ASP D OD1 1 
ATOM   5090  O OD2 . ASP D 1 117 ? 97.299  20.591 135.901 1.00 53.17  ? 117 ASP D OD2 1 
ATOM   5091  N N   . GLY D 1 118 ? 98.074  25.101 136.541 1.00 27.88  ? 118 GLY D N   1 
ATOM   5092  C CA  . GLY D 1 118 ? 97.493  25.990 135.557 1.00 27.88  ? 118 GLY D CA  1 
ATOM   5093  C C   . GLY D 1 118 ? 96.005  25.762 135.353 1.00 27.88  ? 118 GLY D C   1 
ATOM   5094  O O   . GLY D 1 118 ? 95.294  26.595 134.799 1.00 27.88  ? 118 GLY D O   1 
ATOM   5095  N N   . SER D 1 119 ? 95.538  24.603 135.791 1.00 43.95  ? 119 SER D N   1 
ATOM   5096  C CA  . SER D 1 119 ? 94.145  24.221 135.686 1.00 43.95  ? 119 SER D CA  1 
ATOM   5097  C C   . SER D 1 119 ? 93.300  25.333 136.334 1.00 43.95  ? 119 SER D C   1 
ATOM   5098  O O   . SER D 1 119 ? 93.744  25.951 137.288 1.00 43.95  ? 119 SER D O   1 
ATOM   5099  C CB  . SER D 1 119 ? 93.993  22.887 136.417 1.00 56.14  ? 119 SER D CB  1 
ATOM   5100  O OG  . SER D 1 119 ? 92.690  22.374 136.290 1.00 56.14  ? 119 SER D OG  1 
ATOM   5101  N N   . TYR D 1 120 ? 92.097  25.605 135.837 1.00 31.93  ? 120 TYR D N   1 
ATOM   5102  C CA  . TYR D 1 120 ? 91.286  26.666 136.442 1.00 31.93  ? 120 TYR D CA  1 
ATOM   5103  C C   . TYR D 1 120 ? 89.774  26.619 136.195 1.00 31.93  ? 120 TYR D C   1 
ATOM   5104  O O   . TYR D 1 120 ? 89.309  26.104 135.180 1.00 31.93  ? 120 TYR D O   1 
ATOM   5105  C CB  . TYR D 1 120 ? 91.796  28.026 135.970 1.00 28.87  ? 120 TYR D CB  1 
ATOM   5106  C CG  . TYR D 1 120 ? 91.623  28.249 134.479 1.00 28.87  ? 120 TYR D CG  1 
ATOM   5107  C CD1 . TYR D 1 120 ? 90.391  28.613 133.938 1.00 28.87  ? 120 TYR D CD1 1 
ATOM   5108  C CD2 . TYR D 1 120 ? 92.686  28.058 133.611 1.00 28.87  ? 120 TYR D CD2 1 
ATOM   5109  C CE1 . TYR D 1 120 ? 90.233  28.773 132.577 1.00 28.87  ? 120 TYR D CE1 1 
ATOM   5110  C CE2 . TYR D 1 120 ? 92.544  28.216 132.257 1.00 28.87  ? 120 TYR D CE2 1 
ATOM   5111  C CZ  . TYR D 1 120 ? 91.326  28.570 131.733 1.00 28.87  ? 120 TYR D CZ  1 
ATOM   5112  O OH  . TYR D 1 120 ? 91.227  28.699 130.356 1.00 28.87  ? 120 TYR D OH  1 
ATOM   5113  N N   . HIS D 1 121 ? 89.009  27.169 137.125 1.00 41.97  ? 121 HIS D N   1 
ATOM   5114  C CA  . HIS D 1 121 ? 87.563  27.225 136.982 1.00 41.97  ? 121 HIS D CA  1 
ATOM   5115  C C   . HIS D 1 121 ? 87.128  28.531 137.600 1.00 41.97  ? 121 HIS D C   1 
ATOM   5116  O O   . HIS D 1 121 ? 87.636  28.919 138.657 1.00 41.97  ? 121 HIS D O   1 
ATOM   5117  C CB  . HIS D 1 121 ? 86.859  26.081 137.698 1.00 53.07  ? 121 HIS D CB  1 
ATOM   5118  C CG  . HIS D 1 121 ? 87.065  24.750 137.059 1.00 53.07  ? 121 HIS D CG  1 
ATOM   5119  N ND1 . HIS D 1 121 ? 87.831  23.761 137.635 1.00 53.07  ? 121 HIS D ND1 1 
ATOM   5120  C CD2 . HIS D 1 121 ? 86.602  24.241 135.894 1.00 53.07  ? 121 HIS D CD2 1 
ATOM   5121  C CE1 . HIS D 1 121 ? 87.829  22.698 136.852 1.00 53.07  ? 121 HIS D CE1 1 
ATOM   5122  N NE2 . HIS D 1 121 ? 87.089  22.965 135.788 1.00 53.07  ? 121 HIS D NE2 1 
ATOM   5123  N N   . GLU D 1 122 ? 86.197  29.214 136.941 1.00 53.80  ? 122 GLU D N   1 
ATOM   5124  C CA  . GLU D 1 122 ? 85.711  30.501 137.409 1.00 53.80  ? 122 GLU D CA  1 
ATOM   5125  C C   . GLU D 1 122 ? 84.177  30.502 137.419 1.00 53.80  ? 122 GLU D C   1 
ATOM   5126  O O   . GLU D 1 122 ? 83.552  29.925 136.532 1.00 53.80  ? 122 GLU D O   1 
ATOM   5127  C CB  . GLU D 1 122 ? 86.267  31.587 136.493 1.00 68.90  ? 122 GLU D CB  1 
ATOM   5128  C CG  . GLU D 1 122 ? 85.553  32.904 136.564 1.00 68.90  ? 122 GLU D CG  1 
ATOM   5129  C CD  . GLU D 1 122 ? 86.184  33.957 135.677 1.00 68.90  ? 122 GLU D CD  1 
ATOM   5130  O OE1 . GLU D 1 122 ? 86.385  33.695 134.474 1.00 68.90  ? 122 GLU D OE1 1 
ATOM   5131  O OE2 . GLU D 1 122 ? 86.472  35.057 136.187 1.00 68.90  ? 122 GLU D OE2 1 
ATOM   5132  N N   . ASP D 1 123 ? 83.569  31.134 138.424 1.00 46.44  ? 123 ASP D N   1 
ATOM   5133  C CA  . ASP D 1 123 ? 82.116  31.155 138.527 1.00 46.44  ? 123 ASP D CA  1 
ATOM   5134  C C   . ASP D 1 123 ? 81.629  32.467 139.141 1.00 46.44  ? 123 ASP D C   1 
ATOM   5135  O O   . ASP D 1 123 ? 82.441  33.348 139.460 1.00 46.44  ? 123 ASP D O   1 
ATOM   5136  C CB  . ASP D 1 123 ? 81.654  29.986 139.398 1.00 54.27  ? 123 ASP D CB  1 
ATOM   5137  C CG  . ASP D 1 123 ? 80.357  29.381 138.921 1.00 54.27  ? 123 ASP D CG  1 
ATOM   5138  O OD1 . ASP D 1 123 ? 79.382  30.135 138.738 1.00 54.27  ? 123 ASP D OD1 1 
ATOM   5139  O OD2 . ASP D 1 123 ? 80.313  28.144 138.728 1.00 54.27  ? 123 ASP D OD2 1 
ATOM   5140  N N   . VAL D 1 124 ? 80.308  32.588 139.293 1.00 48.37  ? 124 VAL D N   1 
ATOM   5141  C CA  . VAL D 1 124 ? 79.685  33.760 139.901 1.00 48.37  ? 124 VAL D CA  1 
ATOM   5142  C C   . VAL D 1 124 ? 79.189  33.443 141.302 1.00 48.37  ? 124 VAL D C   1 
ATOM   5143  O O   . VAL D 1 124 ? 78.612  32.387 141.541 1.00 48.37  ? 124 VAL D O   1 
ATOM   5144  C CB  . VAL D 1 124 ? 78.417  34.189 139.214 1.00 51.02  ? 124 VAL D CB  1 
ATOM   5145  C CG1 . VAL D 1 124 ? 78.379  35.701 139.100 1.00 51.02  ? 124 VAL D CG1 1 
ATOM   5146  C CG2 . VAL D 1 124 ? 78.291  33.497 137.921 1.00 51.02  ? 124 VAL D CG2 1 
ATOM   5147  N N   . GLY D 1 125 ? 79.384  34.378 142.218 1.00 51.49  ? 125 GLY D N   1 
ATOM   5148  C CA  . GLY D 1 125 ? 78.884  34.214 143.566 1.00 51.49  ? 125 GLY D CA  1 
ATOM   5149  C C   . GLY D 1 125 ? 77.889  35.344 143.761 1.00 51.49  ? 125 GLY D C   1 
ATOM   5150  O O   . GLY D 1 125 ? 77.943  36.338 143.041 1.00 51.49  ? 125 GLY D O   1 
ATOM   5151  N N   . TYR D 1 126 ? 76.960  35.208 144.694 1.00 81.59  ? 126 TYR D N   1 
ATOM   5152  C CA  . TYR D 1 126 ? 76.018  36.294 144.919 1.00 81.59  ? 126 TYR D CA  1 
ATOM   5153  C C   . TYR D 1 126 ? 75.810  36.537 146.407 1.00 81.59  ? 126 TYR D C   1 
ATOM   5154  O O   . TYR D 1 126 ? 75.633  35.604 147.187 1.00 81.59  ? 126 TYR D O   1 
ATOM   5155  C CB  . TYR D 1 126 ? 74.669  36.014 144.251 1.00 81.28  ? 126 TYR D CB  1 
ATOM   5156  C CG  . TYR D 1 126 ? 73.963  37.279 143.803 1.00 81.28  ? 126 TYR D CG  1 
ATOM   5157  C CD1 . TYR D 1 126 ? 74.382  37.965 142.662 1.00 81.28  ? 126 TYR D CD1 1 
ATOM   5158  C CD2 . TYR D 1 126 ? 72.911  37.815 144.541 1.00 81.28  ? 126 TYR D CD2 1 
ATOM   5159  C CE1 . TYR D 1 126 ? 73.779  39.147 142.271 1.00 81.28  ? 126 TYR D CE1 1 
ATOM   5160  C CE2 . TYR D 1 126 ? 72.299  39.004 144.157 1.00 81.28  ? 126 TYR D CE2 1 
ATOM   5161  C CZ  . TYR D 1 126 ? 72.740  39.660 143.021 1.00 81.28  ? 126 TYR D CZ  1 
ATOM   5162  O OH  . TYR D 1 126 ? 72.143  40.830 142.633 1.00 81.28  ? 126 TYR D OH  1 
ATOM   5163  N N   . GLY D 1 127 ? 75.851  37.805 146.793 1.00 66.74  ? 127 GLY D N   1 
ATOM   5164  C CA  . GLY D 1 127 ? 75.656  38.171 148.180 1.00 66.74  ? 127 GLY D CA  1 
ATOM   5165  C C   . GLY D 1 127 ? 74.358  38.946 148.306 1.00 66.74  ? 127 GLY D C   1 
ATOM   5166  O O   . GLY D 1 127 ? 73.997  39.712 147.410 1.00 66.74  ? 127 GLY D O   1 
ATOM   5167  N N   . VAL D 1 128 ? 73.645  38.743 149.410 1.00 80.57  ? 128 VAL D N   1 
ATOM   5168  C CA  . VAL D 1 128 ? 72.387  39.442 149.623 1.00 80.57  ? 128 VAL D CA  1 
ATOM   5169  C C   . VAL D 1 128 ? 72.195  39.906 151.060 1.00 80.57  ? 128 VAL D C   1 
ATOM   5170  O O   . VAL D 1 128 ? 72.687  39.281 151.996 1.00 80.57  ? 128 VAL D O   1 
ATOM   5171  C CB  . VAL D 1 128 ? 71.203  38.555 149.267 1.00 43.69  ? 128 VAL D CB  1 
ATOM   5172  C CG1 . VAL D 1 128 ? 69.937  39.379 149.248 1.00 43.69  ? 128 VAL D CG1 1 
ATOM   5173  C CG2 . VAL D 1 128 ? 71.429  37.887 147.928 1.00 43.69  ? 128 VAL D CG2 1 
ATOM   5174  N N   . SER D 1 129 ? 71.484  41.016 151.214 1.00 85.92  ? 129 SER D N   1 
ATOM   5175  C CA  . SER D 1 129 ? 71.165  41.590 152.520 1.00 85.92  ? 129 SER D CA  1 
ATOM   5176  C C   . SER D 1 129 ? 69.835  42.287 152.311 1.00 85.92  ? 129 SER D C   1 
ATOM   5177  O O   . SER D 1 129 ? 69.758  43.227 151.525 1.00 85.92  ? 129 SER D O   1 
ATOM   5178  C CB  . SER D 1 129 ? 72.211  42.614 152.945 1.00 87.04  ? 129 SER D CB  1 
ATOM   5179  O OG  . SER D 1 129 ? 71.783  43.285 154.116 1.00 87.04  ? 129 SER D OG  1 
ATOM   5180  N N   . GLU D 1 130 ? 68.787  41.845 153.001 1.00 92.65  ? 130 GLU D N   1 
ATOM   5181  C CA  . GLU D 1 130 ? 67.484  42.461 152.779 1.00 92.65  ? 130 GLU D CA  1 
ATOM   5182  C C   . GLU D 1 130 ? 66.749  43.045 153.984 1.00 92.65  ? 130 GLU D C   1 
ATOM   5183  O O   . GLU D 1 130 ? 65.656  43.601 153.837 1.00 92.65  ? 130 GLU D O   1 
ATOM   5184  C CB  . GLU D 1 130 ? 66.563  41.466 152.063 1.00 96.22  ? 130 GLU D CB  1 
ATOM   5185  C CG  . GLU D 1 130 ? 67.182  40.805 150.836 1.00 96.22  ? 130 GLU D CG  1 
ATOM   5186  C CD  . GLU D 1 130 ? 66.141  40.297 149.859 1.00 96.22  ? 130 GLU D CD  1 
ATOM   5187  O OE1 . GLU D 1 130 ? 65.520  41.126 149.162 1.00 96.22  ? 130 GLU D OE1 1 
ATOM   5188  O OE2 . GLU D 1 130 ? 65.934  39.069 149.790 1.00 96.22  ? 130 GLU D OE2 1 
ATOM   5189  N N   . GLY D 1 131 ? 67.333  42.941 155.171 1.00 87.07  ? 131 GLY D N   1 
ATOM   5190  C CA  . GLY D 1 131 ? 66.661  43.490 156.335 1.00 87.07  ? 131 GLY D CA  1 
ATOM   5191  C C   . GLY D 1 131 ? 67.269  44.765 156.884 1.00 87.07  ? 131 GLY D C   1 
ATOM   5192  O O   . GLY D 1 131 ? 66.690  45.845 156.776 1.00 87.07  ? 131 GLY D O   1 
ATOM   5193  N N   . LEU D 1 132 ? 68.446  44.610 157.477 1.00 86.90  ? 132 LEU D N   1 
ATOM   5194  C CA  . LEU D 1 132 ? 69.212  45.680 158.099 1.00 86.90  ? 132 LEU D CA  1 
ATOM   5195  C C   . LEU D 1 132 ? 68.825  47.133 157.828 1.00 86.90  ? 132 LEU D C   1 
ATOM   5196  O O   . LEU D 1 132 ? 68.347  47.494 156.748 1.00 86.90  ? 132 LEU D O   1 
ATOM   5197  C CB  . LEU D 1 132 ? 70.692  45.488 157.768 1.00 139.59 ? 132 LEU D CB  1 
ATOM   5198  C CG  . LEU D 1 132 ? 71.299  44.189 158.296 1.00 139.59 ? 132 LEU D CG  1 
ATOM   5199  C CD1 . LEU D 1 132 ? 72.690  43.999 157.720 1.00 139.59 ? 132 LEU D CD1 1 
ATOM   5200  C CD2 . LEU D 1 132 ? 71.340  44.227 159.818 1.00 139.59 ? 132 LEU D CD2 1 
ATOM   5201  N N   . LYS D 1 133 ? 69.052  47.963 158.840 1.00 109.67 ? 133 LYS D N   1 
ATOM   5202  C CA  . LYS D 1 133 ? 68.780  49.389 158.756 1.00 109.67 ? 133 LYS D CA  1 
ATOM   5203  C C   . LYS D 1 133 ? 70.101  50.073 158.417 1.00 109.67 ? 133 LYS D C   1 
ATOM   5204  O O   . LYS D 1 133 ? 70.122  51.191 157.914 1.00 109.67 ? 133 LYS D O   1 
ATOM   5205  C CB  . LYS D 1 133 ? 68.254  49.911 160.098 1.00 192.35 ? 133 LYS D CB  1 
ATOM   5206  C CG  . LYS D 1 133 ? 66.906  49.339 160.515 1.00 192.35 ? 133 LYS D CG  1 
ATOM   5207  C CD  . LYS D 1 133 ? 66.503  49.808 161.911 1.00 192.35 ? 133 LYS D CD  1 
ATOM   5208  C CE  . LYS D 1 133 ? 66.377  51.326 161.993 1.00 192.35 ? 133 LYS D CE  1 
ATOM   5209  N NZ  . LYS D 1 133 ? 65.318  51.859 161.092 1.00 192.35 ? 133 LYS D NZ  1 
ATOM   5210  N N   . SER D 1 134 ? 71.204  49.388 158.697 1.00 97.41  ? 134 SER D N   1 
ATOM   5211  C CA  . SER D 1 134 ? 72.523  49.932 158.427 1.00 97.41  ? 134 SER D CA  1 
ATOM   5212  C C   . SER D 1 134 ? 72.931  49.670 156.994 1.00 97.41  ? 134 SER D C   1 
ATOM   5213  O O   . SER D 1 134 ? 72.931  48.526 156.542 1.00 97.41  ? 134 SER D O   1 
ATOM   5214  C CB  . SER D 1 134 ? 73.565  49.308 159.352 1.00 80.54  ? 134 SER D CB  1 
ATOM   5215  O OG  . SER D 1 134 ? 74.848  49.863 159.101 1.00 80.54  ? 134 SER D OG  1 
ATOM   5216  N N   . LYS D 1 135 ? 73.283  50.731 156.279 1.00 110.40 ? 135 LYS D N   1 
ATOM   5217  C CA  . LYS D 1 135 ? 73.710  50.576 154.904 1.00 110.40 ? 135 LYS D CA  1 
ATOM   5218  C C   . LYS D 1 135 ? 75.056  49.867 154.920 1.00 110.40 ? 135 LYS D C   1 
ATOM   5219  O O   . LYS D 1 135 ? 75.237  48.868 154.231 1.00 110.40 ? 135 LYS D O   1 
ATOM   5220  C CB  . LYS D 1 135 ? 73.823  51.940 154.218 1.00 93.08  ? 135 LYS D CB  1 
ATOM   5221  C CG  . LYS D 1 135 ? 74.185  51.845 152.749 1.00 93.08  ? 135 LYS D CG  1 
ATOM   5222  C CD  . LYS D 1 135 ? 73.612  52.987 151.914 1.00 93.08  ? 135 LYS D CD  1 
ATOM   5223  C CE  . LYS D 1 135 ? 74.260  54.321 152.208 1.00 93.08  ? 135 LYS D CE  1 
ATOM   5224  N NZ  . LYS D 1 135 ? 73.745  55.354 151.267 1.00 93.08  ? 135 LYS D NZ  1 
ATOM   5225  N N   . ALA D 1 136 ? 75.987  50.367 155.729 1.00 109.37 ? 136 ALA D N   1 
ATOM   5226  C CA  . ALA D 1 136 ? 77.316  49.768 155.831 1.00 109.37 ? 136 ALA D CA  1 
ATOM   5227  C C   . ALA D 1 136 ? 77.238  48.271 156.070 1.00 109.37 ? 136 ALA D C   1 
ATOM   5228  O O   . ALA D 1 136 ? 77.854  47.489 155.349 1.00 109.37 ? 136 ALA D O   1 
ATOM   5229  C CB  . ALA D 1 136 ? 78.106  50.416 156.953 1.00 60.72  ? 136 ALA D CB  1 
ATOM   5230  N N   . LEU D 1 137 ? 76.484  47.871 157.087 1.00 98.26  ? 137 LEU D N   1 
ATOM   5231  C CA  . LEU D 1 137 ? 76.351  46.456 157.404 1.00 98.26  ? 137 LEU D CA  1 
ATOM   5232  C C   . LEU D 1 137 ? 75.679  45.646 156.303 1.00 98.26  ? 137 LEU D C   1 
ATOM   5233  O O   . LEU D 1 137 ? 75.964  44.463 156.146 1.00 98.26  ? 137 LEU D O   1 
ATOM   5234  C CB  . LEU D 1 137 ? 75.599  46.276 158.721 1.00 110.60 ? 137 LEU D CB  1 
ATOM   5235  C CG  . LEU D 1 137 ? 76.484  46.262 159.971 1.00 110.60 ? 137 LEU D CG  1 
ATOM   5236  C CD1 . LEU D 1 137 ? 77.370  47.499 160.024 1.00 110.60 ? 137 LEU D CD1 1 
ATOM   5237  C CD2 . LEU D 1 137 ? 75.594  46.174 161.193 1.00 110.60 ? 137 LEU D CD2 1 
ATOM   5238  N N   . SER D 1 138 ? 74.786  46.273 155.545 1.00 80.29  ? 138 SER D N   1 
ATOM   5239  C CA  . SER D 1 138 ? 74.115  45.575 154.454 1.00 80.29  ? 138 SER D CA  1 
ATOM   5240  C C   . SER D 1 138 ? 75.084  45.255 153.301 1.00 80.29  ? 138 SER D C   1 
ATOM   5241  O O   . SER D 1 138 ? 75.022  44.173 152.704 1.00 80.29  ? 138 SER D O   1 
ATOM   5242  C CB  . SER D 1 138 ? 72.949  46.411 153.926 1.00 82.09  ? 138 SER D CB  1 
ATOM   5243  O OG  . SER D 1 138 ? 71.827  46.329 154.783 1.00 82.09  ? 138 SER D OG  1 
ATOM   5244  N N   . LEU D 1 139 ? 75.969  46.200 152.987 1.00 101.43 ? 139 LEU D N   1 
ATOM   5245  C CA  . LEU D 1 139 ? 76.947  46.001 151.926 1.00 101.43 ? 139 LEU D CA  1 
ATOM   5246  C C   . LEU D 1 139 ? 77.997  45.007 152.378 1.00 101.43 ? 139 LEU D C   1 
ATOM   5247  O O   . LEU D 1 139 ? 78.284  44.050 151.670 1.00 101.43 ? 139 LEU D O   1 
ATOM   5248  C CB  . LEU D 1 139 ? 77.631  47.316 151.552 1.00 68.60  ? 139 LEU D CB  1 
ATOM   5249  C CG  . LEU D 1 139 ? 76.805  48.334 150.769 1.00 68.60  ? 139 LEU D CG  1 
ATOM   5250  C CD1 . LEU D 1 139 ? 77.622  49.583 150.581 1.00 68.60  ? 139 LEU D CD1 1 
ATOM   5251  C CD2 . LEU D 1 139 ? 76.394  47.767 149.432 1.00 68.60  ? 139 LEU D CD2 1 
ATOM   5252  N N   . GLU D 1 140 ? 78.569  45.227 153.558 1.00 77.68  ? 140 GLU D N   1 
ATOM   5253  C CA  . GLU D 1 140 ? 79.594  44.324 154.070 1.00 77.68  ? 140 GLU D CA  1 
ATOM   5254  C C   . GLU D 1 140 ? 79.134  42.878 153.947 1.00 77.68  ? 140 GLU D C   1 
ATOM   5255  O O   . GLU D 1 140 ? 79.894  41.993 153.546 1.00 77.68  ? 140 GLU D O   1 
ATOM   5256  C CB  . GLU D 1 140 ? 79.914  44.625 155.539 1.00 95.06  ? 140 GLU D CB  1 
ATOM   5257  C CG  . GLU D 1 140 ? 80.814  43.573 156.194 1.00 95.06  ? 140 GLU D CG  1 
ATOM   5258  C CD  . GLU D 1 140 ? 81.140  43.890 157.638 1.00 95.06  ? 140 GLU D CD  1 
ATOM   5259  O OE1 . GLU D 1 140 ? 80.197  44.203 158.392 1.00 95.06  ? 140 GLU D OE1 1 
ATOM   5260  O OE2 . GLU D 1 140 ? 82.330  43.821 158.021 1.00 95.06  ? 140 GLU D OE2 1 
ATOM   5261  N N   . LYS D 1 141 ? 77.877  42.640 154.285 1.00 90.54  ? 141 LYS D N   1 
ATOM   5262  C CA  . LYS D 1 141 ? 77.338  41.296 154.220 1.00 90.54  ? 141 LYS D CA  1 
ATOM   5263  C C   . LYS D 1 141 ? 77.311  40.800 152.778 1.00 90.54  ? 141 LYS D C   1 
ATOM   5264  O O   . LYS D 1 141 ? 77.883  39.758 152.452 1.00 90.54  ? 141 LYS D O   1 
ATOM   5265  C CB  . LYS D 1 141 ? 75.924  41.271 154.815 1.00 86.87  ? 141 LYS D CB  1 
ATOM   5266  C CG  . LYS D 1 141 ? 75.448  39.889 155.258 1.00 86.87  ? 141 LYS D CG  1 
ATOM   5267  C CD  . LYS D 1 141 ? 74.104  39.549 154.641 1.00 86.87  ? 141 LYS D CD  1 
ATOM   5268  C CE  . LYS D 1 141 ? 73.557  38.247 155.194 1.00 86.87  ? 141 LYS D CE  1 
ATOM   5269  N NZ  . LYS D 1 141 ? 72.405  37.726 154.399 1.00 86.87  ? 141 LYS D NZ  1 
ATOM   5270  N N   . ALA D 1 142 ? 76.662  41.564 151.910 1.00 76.48  ? 142 ALA D N   1 
ATOM   5271  C CA  . ALA D 1 142 ? 76.536  41.175 150.519 1.00 76.48  ? 142 ALA D CA  1 
ATOM   5272  C C   . ALA D 1 142 ? 77.863  41.012 149.800 1.00 76.48  ? 142 ALA D C   1 
ATOM   5273  O O   . ALA D 1 142 ? 78.059  40.047 149.074 1.00 76.48  ? 142 ALA D O   1 
ATOM   5274  C CB  . ALA D 1 142 ? 75.671  42.166 149.791 1.00 47.31  ? 142 ALA D CB  1 
ATOM   5275  N N   . ARG D 1 143 ? 78.780  41.944 149.994 1.00 55.91  ? 143 ARG D N   1 
ATOM   5276  C CA  . ARG D 1 143 ? 80.059  41.849 149.317 1.00 55.91  ? 143 ARG D CA  1 
ATOM   5277  C C   . ARG D 1 143 ? 80.815  40.613 149.757 1.00 55.91  ? 143 ARG D C   1 
ATOM   5278  O O   . ARG D 1 143 ? 81.315  39.867 148.928 1.00 55.91  ? 143 ARG D O   1 
ATOM   5279  C CB  . ARG D 1 143 ? 80.918  43.099 149.569 1.00 71.44  ? 143 ARG D CB  1 
ATOM   5280  C CG  . ARG D 1 143 ? 80.208  44.410 149.251 1.00 71.44  ? 143 ARG D CG  1 
ATOM   5281  C CD  . ARG D 1 143 ? 81.159  45.600 149.081 1.00 71.44  ? 143 ARG D CD  1 
ATOM   5282  N NE  . ARG D 1 143 ? 81.717  45.664 147.729 1.00 71.44  ? 143 ARG D NE  1 
ATOM   5283  C CZ  . ARG D 1 143 ? 81.717  46.751 146.964 1.00 71.44  ? 143 ARG D CZ  1 
ATOM   5284  N NH1 . ARG D 1 143 ? 81.192  47.878 147.405 1.00 71.44  ? 143 ARG D NH1 1 
ATOM   5285  N NH2 . ARG D 1 143 ? 82.237  46.705 145.750 1.00 71.44  ? 143 ARG D NH2 1 
ATOM   5286  N N   . LYS D 1 144 ? 80.893  40.387 151.062 1.00 62.48  ? 144 LYS D N   1 
ATOM   5287  C CA  . LYS D 1 144 ? 81.624  39.241 151.576 1.00 62.48  ? 144 LYS D CA  1 
ATOM   5288  C C   . LYS D 1 144 ? 80.992  37.919 151.168 1.00 62.48  ? 144 LYS D C   1 
ATOM   5289  O O   . LYS D 1 144 ? 81.691  36.985 150.785 1.00 62.48  ? 144 LYS D O   1 
ATOM   5290  C CB  . LYS D 1 144 ? 81.735  39.324 153.095 1.00 65.68  ? 144 LYS D CB  1 
ATOM   5291  C CG  . LYS D 1 144 ? 82.507  40.528 153.579 1.00 65.68  ? 144 LYS D CG  1 
ATOM   5292  C CD  . LYS D 1 144 ? 82.810  40.426 155.057 1.00 65.68  ? 144 LYS D CD  1 
ATOM   5293  C CE  . LYS D 1 144 ? 83.699  41.568 155.496 1.00 65.68  ? 144 LYS D CE  1 
ATOM   5294  N NZ  . LYS D 1 144 ? 84.182  41.385 156.894 1.00 65.68  ? 144 LYS D NZ  1 
ATOM   5295  N N   . GLU D 1 145 ? 79.672  37.838 151.249 1.00 73.64  ? 145 GLU D N   1 
ATOM   5296  C CA  . GLU D 1 145 ? 78.994  36.617 150.858 1.00 73.64  ? 145 GLU D CA  1 
ATOM   5297  C C   . GLU D 1 145 ? 79.174  36.312 149.367 1.00 73.64  ? 145 GLU D C   1 
ATOM   5298  O O   . GLU D 1 145 ? 79.465  35.167 148.992 1.00 73.64  ? 145 GLU D O   1 
ATOM   5299  C CB  . GLU D 1 145 ? 77.518  36.704 151.218 1.00 77.92  ? 145 GLU D CB  1 
ATOM   5300  C CG  . GLU D 1 145 ? 77.224  36.049 152.547 1.00 77.92  ? 145 GLU D CG  1 
ATOM   5301  C CD  . GLU D 1 145 ? 75.876  36.434 153.105 1.00 77.92  ? 145 GLU D CD  1 
ATOM   5302  O OE1 . GLU D 1 145 ? 74.865  36.346 152.357 1.00 77.92  ? 145 GLU D OE1 1 
ATOM   5303  O OE2 . GLU D 1 145 ? 75.842  36.821 154.295 1.00 77.92  ? 145 GLU D OE2 1 
ATOM   5304  N N   . ALA D 1 146 ? 79.021  37.331 148.522 1.00 57.96  ? 146 ALA D N   1 
ATOM   5305  C CA  . ALA D 1 146 ? 79.180  37.156 147.082 1.00 57.96  ? 146 ALA D CA  1 
ATOM   5306  C C   . ALA D 1 146 ? 80.525  36.509 146.752 1.00 57.96  ? 146 ALA D C   1 
ATOM   5307  O O   . ALA D 1 146 ? 80.611  35.646 145.877 1.00 57.96  ? 146 ALA D O   1 
ATOM   5308  C CB  . ALA D 1 146 ? 79.055  38.491 146.374 1.00 48.52  ? 146 ALA D CB  1 
ATOM   5309  N N   . VAL D 1 147 ? 81.575  36.915 147.450 1.00 54.73  ? 147 VAL D N   1 
ATOM   5310  C CA  . VAL D 1 147 ? 82.873  36.327 147.193 1.00 54.73  ? 147 VAL D CA  1 
ATOM   5311  C C   . VAL D 1 147 ? 82.917  34.874 147.637 1.00 54.73  ? 147 VAL D C   1 
ATOM   5312  O O   . VAL D 1 147 ? 83.239  33.984 146.852 1.00 54.73  ? 147 VAL D O   1 
ATOM   5313  C CB  . VAL D 1 147 ? 83.990  37.092 147.903 1.00 46.85  ? 147 VAL D CB  1 
ATOM   5314  C CG1 . VAL D 1 147 ? 85.319  36.346 147.761 1.00 46.85  ? 147 VAL D CG1 1 
ATOM   5315  C CG2 . VAL D 1 147 ? 84.114  38.460 147.292 1.00 46.85  ? 147 VAL D CG2 1 
ATOM   5316  N N   . THR D 1 148 ? 82.593  34.618 148.894 1.00 66.11  ? 148 THR D N   1 
ATOM   5317  C CA  . THR D 1 148 ? 82.627  33.250 149.366 1.00 66.11  ? 148 THR D CA  1 
ATOM   5318  C C   . THR D 1 148 ? 81.746  32.382 148.476 1.00 66.11  ? 148 THR D C   1 
ATOM   5319  O O   . THR D 1 148 ? 82.181  31.338 148.007 1.00 66.11  ? 148 THR D O   1 
ATOM   5320  C CB  . THR D 1 148 ? 82.161  33.155 150.830 1.00 69.69  ? 148 THR D CB  1 
ATOM   5321  O OG1 . THR D 1 148 ? 83.043  33.931 151.650 1.00 69.69  ? 148 THR D OG1 1 
ATOM   5322  C CG2 . THR D 1 148 ? 82.179  31.707 151.309 1.00 69.69  ? 148 THR D CG2 1 
ATOM   5323  N N   . ASP D 1 149 ? 80.520  32.824 148.220 1.00 48.44  ? 149 ASP D N   1 
ATOM   5324  C CA  . ASP D 1 149 ? 79.610  32.049 147.378 1.00 48.44  ? 149 ASP D CA  1 
ATOM   5325  C C   . ASP D 1 149 ? 80.255  31.750 146.030 1.00 48.44  ? 149 ASP D C   1 
ATOM   5326  O O   . ASP D 1 149 ? 80.032  30.682 145.458 1.00 48.44  ? 149 ASP D O   1 
ATOM   5327  C CB  . ASP D 1 149 ? 78.307  32.816 147.163 1.00 84.98  ? 149 ASP D CB  1 
ATOM   5328  C CG  . ASP D 1 149 ? 77.281  32.019 146.392 1.00 84.98  ? 149 ASP D CG  1 
ATOM   5329  O OD1 . ASP D 1 149 ? 77.034  30.850 146.761 1.00 84.98  ? 149 ASP D OD1 1 
ATOM   5330  O OD2 . ASP D 1 149 ? 76.710  32.565 145.423 1.00 84.98  ? 149 ASP D OD2 1 
ATOM   5331  N N   . GLY D 1 150 ? 81.053  32.701 145.535 1.00 53.54  ? 150 GLY D N   1 
ATOM   5332  C CA  . GLY D 1 150 ? 81.733  32.536 144.261 1.00 53.54  ? 150 GLY D CA  1 
ATOM   5333  C C   . GLY D 1 150 ? 82.811  31.479 144.373 1.00 53.54  ? 150 GLY D C   1 
ATOM   5334  O O   . GLY D 1 150 ? 82.861  30.544 143.576 1.00 53.54  ? 150 GLY D O   1 
ATOM   5335  N N   . LEU D 1 151 ? 83.677  31.620 145.368 1.00 48.77  ? 151 LEU D N   1 
ATOM   5336  C CA  . LEU D 1 151 ? 84.746  30.654 145.585 1.00 48.77  ? 151 LEU D CA  1 
ATOM   5337  C C   . LEU D 1 151 ? 84.215  29.227 145.727 1.00 48.77  ? 151 LEU D C   1 
ATOM   5338  O O   . LEU D 1 151 ? 84.804  28.276 145.203 1.00 48.77  ? 151 LEU D O   1 
ATOM   5339  C CB  . LEU D 1 151 ? 85.529  31.024 146.830 1.00 36.10  ? 151 LEU D CB  1 
ATOM   5340  C CG  . LEU D 1 151 ? 86.526  29.978 147.342 1.00 36.10  ? 151 LEU D CG  1 
ATOM   5341  C CD1 . LEU D 1 151 ? 87.436  29.465 146.238 1.00 36.10  ? 151 LEU D CD1 1 
ATOM   5342  C CD2 . LEU D 1 151 ? 87.371  30.634 148.448 1.00 36.10  ? 151 LEU D CD2 1 
ATOM   5343  N N   . LYS D 1 152 ? 83.102  29.076 146.432 1.00 70.45  ? 152 LYS D N   1 
ATOM   5344  C CA  . LYS D 1 152 ? 82.528  27.755 146.612 1.00 70.45  ? 152 LYS D CA  1 
ATOM   5345  C C   . LYS D 1 152 ? 82.056  27.210 145.276 1.00 70.45  ? 152 LYS D C   1 
ATOM   5346  O O   . LYS D 1 152 ? 82.396  26.088 144.892 1.00 70.45  ? 152 LYS D O   1 
ATOM   5347  C CB  . LYS D 1 152 ? 81.350  27.783 147.599 1.00 66.70  ? 152 LYS D CB  1 
ATOM   5348  C CG  . LYS D 1 152 ? 81.751  27.891 149.077 1.00 66.70  ? 152 LYS D CG  1 
ATOM   5349  C CD  . LYS D 1 152 ? 80.564  27.633 150.018 1.00 66.70  ? 152 LYS D CD  1 
ATOM   5350  C CE  . LYS D 1 152 ? 79.413  28.594 149.756 1.00 66.70  ? 152 LYS D CE  1 
ATOM   5351  N NZ  . LYS D 1 152 ? 78.323  28.476 150.752 1.00 66.70  ? 152 LYS D NZ  1 
ATOM   5352  N N   . ARG D 1 153 ? 81.278  28.011 144.564 1.00 60.04  ? 153 ARG D N   1 
ATOM   5353  C CA  . ARG D 1 153 ? 80.761  27.577 143.285 1.00 60.04  ? 153 ARG D CA  1 
ATOM   5354  C C   . ARG D 1 153 ? 81.881  27.224 142.302 1.00 60.04  ? 153 ARG D C   1 
ATOM   5355  O O   . ARG D 1 153 ? 81.752  26.306 141.492 1.00 60.04  ? 153 ARG D O   1 
ATOM   5356  C CB  . ARG D 1 153 ? 79.840  28.657 142.703 1.00 44.19  ? 153 ARG D CB  1 
ATOM   5357  C CG  . ARG D 1 153 ? 78.412  28.630 143.228 1.00 44.19  ? 153 ARG D CG  1 
ATOM   5358  C CD  . ARG D 1 153 ? 77.605  29.827 142.733 1.00 44.19  ? 153 ARG D CD  1 
ATOM   5359  N NE  . ARG D 1 153 ? 77.441  29.822 141.284 1.00 44.19  ? 153 ARG D NE  1 
ATOM   5360  C CZ  . ARG D 1 153 ? 76.536  29.092 140.640 1.00 44.19  ? 153 ARG D CZ  1 
ATOM   5361  N NH1 . ARG D 1 153 ? 75.714  28.314 141.331 1.00 44.19  ? 153 ARG D NH1 1 
ATOM   5362  N NH2 . ARG D 1 153 ? 76.446  29.135 139.311 1.00 44.19  ? 153 ARG D NH2 1 
ATOM   5363  N N   . ALA D 1 154 ? 82.992  27.932 142.373 1.00 37.38  ? 154 ALA D N   1 
ATOM   5364  C CA  . ALA D 1 154 ? 84.065  27.639 141.432 1.00 37.38  ? 154 ALA D CA  1 
ATOM   5365  C C   . ALA D 1 154 ? 84.710  26.304 141.770 1.00 37.38  ? 154 ALA D C   1 
ATOM   5366  O O   . ALA D 1 154 ? 84.905  25.472 140.883 1.00 37.38  ? 154 ALA D O   1 
ATOM   5367  C CB  . ALA D 1 154 ? 85.115  28.781 141.417 1.00 30.13  ? 154 ALA D CB  1 
ATOM   5368  N N   . LEU D 1 155 ? 85.014  26.099 143.056 1.00 52.72  ? 155 LEU D N   1 
ATOM   5369  C CA  . LEU D 1 155 ? 85.620  24.851 143.528 1.00 52.72  ? 155 LEU D CA  1 
ATOM   5370  C C   . LEU D 1 155 ? 84.752  23.623 143.230 1.00 52.72  ? 155 LEU D C   1 
ATOM   5371  O O   . LEU D 1 155 ? 85.269  22.547 142.977 1.00 52.72  ? 155 LEU D O   1 
ATOM   5372  C CB  . LEU D 1 155 ? 85.897  24.945 145.020 1.00 48.86  ? 155 LEU D CB  1 
ATOM   5373  C CG  . LEU D 1 155 ? 87.096  25.811 145.393 1.00 48.86  ? 155 LEU D CG  1 
ATOM   5374  C CD1 . LEU D 1 155 ? 87.115  26.065 146.884 1.00 48.86  ? 155 LEU D CD1 1 
ATOM   5375  C CD2 . LEU D 1 155 ? 88.363  25.113 144.966 1.00 48.86  ? 155 LEU D CD2 1 
ATOM   5376  N N   . ARG D 1 156 ? 83.436  23.772 143.256 1.00 50.05  ? 156 ARG D N   1 
ATOM   5377  C CA  . ARG D 1 156 ? 82.581  22.634 142.949 1.00 50.05  ? 156 ARG D CA  1 
ATOM   5378  C C   . ARG D 1 156 ? 82.991  22.013 141.604 1.00 50.05  ? 156 ARG D C   1 
ATOM   5379  O O   . ARG D 1 156 ? 82.893  20.803 141.400 1.00 50.05  ? 156 ARG D O   1 
ATOM   5380  C CB  . ARG D 1 156 ? 81.107  23.048 142.825 1.00 91.79  ? 156 ARG D CB  1 
ATOM   5381  C CG  . ARG D 1 156 ? 80.401  23.406 144.106 1.00 91.79  ? 156 ARG D CG  1 
ATOM   5382  C CD  . ARG D 1 156 ? 78.926  23.671 143.817 1.00 91.79  ? 156 ARG D CD  1 
ATOM   5383  N NE  . ARG D 1 156 ? 78.316  24.537 144.822 1.00 91.79  ? 156 ARG D NE  1 
ATOM   5384  C CZ  . ARG D 1 156 ? 77.147  25.145 144.664 1.00 91.79  ? 156 ARG D CZ  1 
ATOM   5385  N NH1 . ARG D 1 156 ? 76.455  24.975 143.542 1.00 91.79  ? 156 ARG D NH1 1 
ATOM   5386  N NH2 . ARG D 1 156 ? 76.686  25.950 145.611 1.00 91.79  ? 156 ARG D NH2 1 
ATOM   5387  N N   . SER D 1 157 ? 83.448  22.844 140.679 1.00 60.50  ? 157 SER D N   1 
ATOM   5388  C CA  . SER D 1 157 ? 83.792  22.343 139.360 1.00 60.50  ? 157 SER D CA  1 
ATOM   5389  C C   . SER D 1 157 ? 84.837  21.247 139.348 1.00 60.50  ? 157 SER D C   1 
ATOM   5390  O O   . SER D 1 157 ? 84.912  20.477 138.397 1.00 60.50  ? 157 SER D O   1 
ATOM   5391  C CB  . SER D 1 157 ? 84.201  23.507 138.460 1.00 49.06  ? 157 SER D CB  1 
ATOM   5392  O OG  . SER D 1 157 ? 83.087  24.378 138.276 1.00 49.06  ? 157 SER D OG  1 
ATOM   5393  N N   . PHE D 1 158 ? 85.617  21.147 140.415 1.00 44.34  ? 158 PHE D N   1 
ATOM   5394  C CA  . PHE D 1 158 ? 86.664  20.131 140.482 1.00 44.34  ? 158 PHE D CA  1 
ATOM   5395  C C   . PHE D 1 158 ? 86.194  18.733 140.864 1.00 44.34  ? 158 PHE D C   1 
ATOM   5396  O O   . PHE D 1 158 ? 86.942  17.767 140.681 1.00 44.34  ? 158 PHE D O   1 
ATOM   5397  C CB  . PHE D 1 158 ? 87.758  20.553 141.457 1.00 62.61  ? 158 PHE D CB  1 
ATOM   5398  C CG  . PHE D 1 158 ? 88.640  21.655 140.942 1.00 62.61  ? 158 PHE D CG  1 
ATOM   5399  C CD1 . PHE D 1 158 ? 88.663  22.902 141.557 1.00 62.61  ? 158 PHE D CD1 1 
ATOM   5400  C CD2 . PHE D 1 158 ? 89.473  21.435 139.856 1.00 62.61  ? 158 PHE D CD2 1 
ATOM   5401  C CE1 . PHE D 1 158 ? 89.504  23.897 141.094 1.00 62.61  ? 158 PHE D CE1 1 
ATOM   5402  C CE2 . PHE D 1 158 ? 90.319  22.435 139.390 1.00 62.61  ? 158 PHE D CE2 1 
ATOM   5403  C CZ  . PHE D 1 158 ? 90.333  23.660 140.009 1.00 62.61  ? 158 PHE D CZ  1 
ATOM   5404  N N   . GLY D 1 159 ? 84.978  18.616 141.398 1.00 65.67  ? 159 GLY D N   1 
ATOM   5405  C CA  . GLY D 1 159 ? 84.485  17.305 141.790 1.00 65.67  ? 159 GLY D CA  1 
ATOM   5406  C C   . GLY D 1 159 ? 83.487  17.286 142.935 1.00 65.67  ? 159 GLY D C   1 
ATOM   5407  O O   . GLY D 1 159 ? 83.183  18.315 143.537 1.00 65.67  ? 159 GLY D O   1 
ATOM   5408  N N   . ASN D 1 160 ? 82.979  16.100 143.248 1.00 64.30  ? 160 ASN D N   1 
ATOM   5409  C CA  . ASN D 1 160 ? 81.992  15.977 144.302 1.00 64.30  ? 160 ASN D CA  1 
ATOM   5410  C C   . ASN D 1 160 ? 82.582  16.343 145.641 1.00 64.30  ? 160 ASN D C   1 
ATOM   5411  O O   . ASN D 1 160 ? 81.948  17.034 146.432 1.00 64.30  ? 160 ASN D O   1 
ATOM   5412  C CB  . ASN D 1 160 ? 81.451  14.555 144.361 1.00 60.83  ? 160 ASN D CB  1 
ATOM   5413  C CG  . ASN D 1 160 ? 80.710  14.160 143.103 1.00 60.83  ? 160 ASN D CG  1 
ATOM   5414  O OD1 . ASN D 1 160 ? 79.790  14.853 142.654 1.00 60.83  ? 160 ASN D OD1 1 
ATOM   5415  N ND2 . ASN D 1 160 ? 81.098  13.031 142.531 1.00 60.83  ? 160 ASN D ND2 1 
ATOM   5416  N N   . ALA D 1 161 ? 83.804  15.880 145.877 1.00 66.26  ? 161 ALA D N   1 
ATOM   5417  C CA  . ALA D 1 161 ? 84.491  16.119 147.134 1.00 66.26  ? 161 ALA D CA  1 
ATOM   5418  C C   . ALA D 1 161 ? 84.634  17.603 147.487 1.00 66.26  ? 161 ALA D C   1 
ATOM   5419  O O   . ALA D 1 161 ? 84.951  17.947 148.629 1.00 66.26  ? 161 ALA D O   1 
ATOM   5420  C CB  . ALA D 1 161 ? 85.862  15.441 147.109 1.00 55.69  ? 161 ALA D CB  1 
ATOM   5421  N N   . LEU D 1 162 ? 84.414  18.488 146.522 1.00 53.21  ? 162 LEU D N   1 
ATOM   5422  C CA  . LEU D 1 162 ? 84.521  19.906 146.814 1.00 53.21  ? 162 LEU D CA  1 
ATOM   5423  C C   . LEU D 1 162 ? 83.176  20.579 146.702 1.00 53.21  ? 162 LEU D C   1 
ATOM   5424  O O   . LEU D 1 162 ? 83.096  21.803 146.615 1.00 53.21  ? 162 LEU D O   1 
ATOM   5425  C CB  . LEU D 1 162 ? 85.537  20.582 145.901 1.00 57.68  ? 162 LEU D CB  1 
ATOM   5426  C CG  . LEU D 1 162 ? 87.001  20.357 146.291 1.00 57.68  ? 162 LEU D CG  1 
ATOM   5427  C CD1 . LEU D 1 162 ? 87.933  20.822 145.183 1.00 57.68  ? 162 LEU D CD1 1 
ATOM   5428  C CD2 . LEU D 1 162 ? 87.310  21.106 147.559 1.00 57.68  ? 162 LEU D CD2 1 
ATOM   5429  N N   . GLY D 1 163 ? 82.115  19.776 146.707 1.00 38.11  ? 163 GLY D N   1 
ATOM   5430  C CA  . GLY D 1 163 ? 80.774  20.336 146.651 1.00 38.11  ? 163 GLY D CA  1 
ATOM   5431  C C   . GLY D 1 163 ? 79.872  20.044 145.463 1.00 38.11  ? 163 GLY D C   1 
ATOM   5432  O O   . GLY D 1 163 ? 78.696  20.388 145.502 1.00 38.11  ? 163 GLY D O   1 
ATOM   5433  N N   . ASN D 1 164 ? 80.369  19.397 144.415 1.00 60.90  ? 164 ASN D N   1 
ATOM   5434  C CA  . ASN D 1 164 ? 79.507  19.156 143.266 1.00 60.90  ? 164 ASN D CA  1 
ATOM   5435  C C   . ASN D 1 164 ? 78.290  18.283 143.560 1.00 60.90  ? 164 ASN D C   1 
ATOM   5436  O O   . ASN D 1 164 ? 77.299  18.326 142.838 1.00 60.90  ? 164 ASN D O   1 
ATOM   5437  C CB  . ASN D 1 164 ? 80.311  18.576 142.102 1.00 56.69  ? 164 ASN D CB  1 
ATOM   5438  C CG  . ASN D 1 164 ? 79.573  18.700 140.783 1.00 56.69  ? 164 ASN D CG  1 
ATOM   5439  O OD1 . ASN D 1 164 ? 78.988  19.748 140.482 1.00 56.69  ? 164 ASN D OD1 1 
ATOM   5440  N ND2 . ASN D 1 164 ? 79.591  17.636 139.990 1.00 56.69  ? 164 ASN D ND2 1 
ATOM   5441  N N   . CYS D 1 165 ? 78.348  17.495 144.626 1.00 87.36  ? 165 CYS D N   1 
ATOM   5442  C CA  . CYS D 1 165 ? 77.211  16.650 144.974 1.00 87.36  ? 165 CYS D CA  1 
ATOM   5443  C C   . CYS D 1 165 ? 76.064  17.475 145.566 1.00 87.36  ? 165 CYS D C   1 
ATOM   5444  O O   . CYS D 1 165 ? 74.895  17.217 145.278 1.00 87.36  ? 165 CYS D O   1 
ATOM   5445  C CB  . CYS D 1 165 ? 77.637  15.555 145.957 1.00 69.34  ? 165 CYS D CB  1 
ATOM   5446  S SG  . CYS D 1 165 ? 78.649  16.120 147.346 1.00 69.34  ? 165 CYS D SG  1 
ATOM   5447  N N   . ILE D 1 166 ? 76.410  18.480 146.368 1.00 89.49  ? 166 ILE D N   1 
ATOM   5448  C CA  . ILE D 1 166 ? 75.432  19.353 147.028 1.00 89.49  ? 166 ILE D CA  1 
ATOM   5449  C C   . ILE D 1 166 ? 74.229  19.733 146.166 1.00 89.49  ? 166 ILE D C   1 
ATOM   5450  O O   . ILE D 1 166 ? 73.189  20.130 146.687 1.00 89.49  ? 166 ILE D O   1 
ATOM   5451  C CB  . ILE D 1 166 ? 76.095  20.670 147.507 1.00 96.10  ? 166 ILE D CB  1 
ATOM   5452  C CG1 . ILE D 1 166 ? 75.245  21.332 148.591 1.00 96.10  ? 166 ILE D CG1 1 
ATOM   5453  C CG2 . ILE D 1 166 ? 76.216  21.638 146.352 1.00 96.10  ? 166 ILE D CG2 1 
ATOM   5454  C CD1 . ILE D 1 166 ? 75.255  20.595 149.918 1.00 96.10  ? 166 ILE D CD1 1 
ATOM   5455  N N   . LEU D 1 167 ? 74.382  19.616 144.852 1.00 58.07  ? 167 LEU D N   1 
ATOM   5456  C CA  . LEU D 1 167 ? 73.326  19.969 143.905 1.00 58.07  ? 167 LEU D CA  1 
ATOM   5457  C C   . LEU D 1 167 ? 72.462  18.756 143.588 1.00 58.07  ? 167 LEU D C   1 
ATOM   5458  O O   . LEU D 1 167 ? 71.260  18.883 143.375 1.00 58.07  ? 167 LEU D O   1 
ATOM   5459  C CB  . LEU D 1 167 ? 73.963  20.483 142.615 1.00 112.82 ? 167 LEU D CB  1 
ATOM   5460  C CG  . LEU D 1 167 ? 74.903  21.680 142.756 1.00 112.82 ? 167 LEU D CG  1 
ATOM   5461  C CD1 . LEU D 1 167 ? 75.803  21.807 141.527 1.00 112.82 ? 167 LEU D CD1 1 
ATOM   5462  C CD2 . LEU D 1 167 ? 74.066  22.927 142.962 1.00 112.82 ? 167 LEU D CD2 1 
ATOM   5463  N N   . ASP D 1 168 ? 73.101  17.587 143.551 1.00 84.92  ? 168 ASP D N   1 
ATOM   5464  C CA  . ASP D 1 168 ? 72.439  16.320 143.247 1.00 84.92  ? 168 ASP D CA  1 
ATOM   5465  C C   . ASP D 1 168 ? 71.243  16.050 144.154 1.00 84.92  ? 168 ASP D C   1 
ATOM   5466  O O   . ASP D 1 168 ? 71.384  15.935 145.373 1.00 84.92  ? 168 ASP D O   1 
ATOM   5467  C CB  . ASP D 1 168 ? 73.436  15.171 143.380 1.00 69.97  ? 168 ASP D CB  1 
ATOM   5468  C CG  . ASP D 1 168 ? 72.928  13.892 142.767 1.00 69.97  ? 168 ASP D CG  1 
ATOM   5469  O OD1 . ASP D 1 168 ? 71.695  13.751 142.628 1.00 69.97  ? 168 ASP D OD1 1 
ATOM   5470  O OD2 . ASP D 1 168 ? 73.761  13.022 142.432 1.00 69.97  ? 168 ASP D OD2 1 
ATOM   5471  N N   . LYS D 1 169 ? 70.067  15.938 143.555 1.00 81.47  ? 169 LYS D N   1 
ATOM   5472  C CA  . LYS D 1 169 ? 68.864  15.679 144.324 1.00 81.47  ? 169 LYS D CA  1 
ATOM   5473  C C   . LYS D 1 169 ? 68.931  14.291 144.965 1.00 81.47  ? 169 LYS D C   1 
ATOM   5474  O O   . LYS D 1 169 ? 68.688  14.137 146.167 1.00 81.47  ? 169 LYS D O   1 
ATOM   5475  C CB  . LYS D 1 169 ? 67.639  15.805 143.417 1.00 103.09 ? 169 LYS D CB  1 
ATOM   5476  C CG  . LYS D 1 169 ? 67.512  17.187 142.801 1.00 103.09 ? 169 LYS D CG  1 
ATOM   5477  C CD  . LYS D 1 169 ? 66.420  17.242 141.759 1.00 103.09 ? 169 LYS D CD  1 
ATOM   5478  C CE  . LYS D 1 169 ? 66.390  18.601 141.087 1.00 103.09 ? 169 LYS D CE  1 
ATOM   5479  N NZ  . LYS D 1 169 ? 65.403  18.629 139.972 1.00 103.09 ? 169 LYS D NZ  1 
ATOM   5480  N N   . ASP D 1 170 ? 69.278  13.288 144.165 1.00 80.84  ? 170 ASP D N   1 
ATOM   5481  C CA  . ASP D 1 170 ? 69.385  11.922 144.656 1.00 80.84  ? 170 ASP D CA  1 
ATOM   5482  C C   . ASP D 1 170 ? 70.315  11.885 145.862 1.00 80.84  ? 170 ASP D C   1 
ATOM   5483  O O   . ASP D 1 170 ? 70.062  11.178 146.837 1.00 80.84  ? 170 ASP D O   1 
ATOM   5484  C CB  . ASP D 1 170 ? 69.929  11.003 143.559 1.00 119.85 ? 170 ASP D CB  1 
ATOM   5485  C CG  . ASP D 1 170 ? 69.023  10.946 142.342 1.00 119.85 ? 170 ASP D CG  1 
ATOM   5486  O OD1 . ASP D 1 170 ? 67.831  10.617 142.503 1.00 119.85 ? 170 ASP D OD1 1 
ATOM   5487  O OD2 . ASP D 1 170 ? 69.499  11.226 141.221 1.00 119.85 ? 170 ASP D OD2 1 
ATOM   5488  N N   . TYR D 1 171 ? 71.394  12.654 145.790 1.00 73.67  ? 171 TYR D N   1 
ATOM   5489  C CA  . TYR D 1 171 ? 72.358  12.703 146.876 1.00 73.67  ? 171 TYR D CA  1 
ATOM   5490  C C   . TYR D 1 171 ? 71.681  13.207 148.126 1.00 73.67  ? 171 TYR D C   1 
ATOM   5491  O O   . TYR D 1 171 ? 71.818  12.610 149.188 1.00 73.67  ? 171 TYR D O   1 
ATOM   5492  C CB  . TYR D 1 171 ? 73.511  13.639 146.524 1.00 58.86  ? 171 TYR D CB  1 
ATOM   5493  C CG  . TYR D 1 171 ? 74.379  14.034 147.700 1.00 58.86  ? 171 TYR D CG  1 
ATOM   5494  C CD1 . TYR D 1 171 ? 75.289  13.132 148.261 1.00 58.86  ? 171 TYR D CD1 1 
ATOM   5495  C CD2 . TYR D 1 171 ? 74.320  15.329 148.225 1.00 58.86  ? 171 TYR D CD2 1 
ATOM   5496  C CE1 . TYR D 1 171 ? 76.139  13.516 149.319 1.00 58.86  ? 171 TYR D CE1 1 
ATOM   5497  C CE2 . TYR D 1 171 ? 75.160  15.730 149.284 1.00 58.86  ? 171 TYR D CE2 1 
ATOM   5498  C CZ  . TYR D 1 171 ? 76.072  14.820 149.822 1.00 58.86  ? 171 TYR D CZ  1 
ATOM   5499  O OH  . TYR D 1 171 ? 76.935  15.228 150.820 1.00 58.86  ? 171 TYR D OH  1 
ATOM   5500  N N   . LEU D 1 172 ? 70.952  14.311 147.988 1.00 94.30  ? 172 LEU D N   1 
ATOM   5501  C CA  . LEU D 1 172 ? 70.259  14.924 149.110 1.00 94.30  ? 172 LEU D CA  1 
ATOM   5502  C C   . LEU D 1 172 ? 69.287  13.989 149.832 1.00 94.30  ? 172 LEU D C   1 
ATOM   5503  O O   . LEU D 1 172 ? 69.317  13.901 151.062 1.00 94.30  ? 172 LEU D O   1 
ATOM   5504  C CB  . LEU D 1 172 ? 69.531  16.185 148.644 1.00 70.46  ? 172 LEU D CB  1 
ATOM   5505  C CG  . LEU D 1 172 ? 70.404  17.385 148.247 1.00 70.46  ? 172 LEU D CG  1 
ATOM   5506  C CD1 . LEU D 1 172 ? 69.514  18.513 147.788 1.00 70.46  ? 172 LEU D CD1 1 
ATOM   5507  C CD2 . LEU D 1 172 ? 71.251  17.839 149.421 1.00 70.46  ? 172 LEU D CD2 1 
ATOM   5508  N N   . ARG D 1 173 ? 68.429  13.293 149.086 1.00 99.69  ? 173 ARG D N   1 
ATOM   5509  C CA  . ARG D 1 173 ? 67.482  12.370 149.712 1.00 99.69  ? 173 ARG D CA  1 
ATOM   5510  C C   . ARG D 1 173 ? 68.230  11.359 150.569 1.00 99.69  ? 173 ARG D C   1 
ATOM   5511  O O   . ARG D 1 173 ? 67.831  11.072 151.696 1.00 99.69  ? 173 ARG D O   1 
ATOM   5512  C CB  . ARG D 1 173 ? 66.654  11.633 148.661 1.00 126.37 ? 173 ARG D CB  1 
ATOM   5513  C CG  . ARG D 1 173 ? 65.686  12.523 147.917 1.00 126.37 ? 173 ARG D CG  1 
ATOM   5514  C CD  . ARG D 1 173 ? 64.757  11.734 147.001 1.00 126.37 ? 173 ARG D CD  1 
ATOM   5515  N NE  . ARG D 1 173 ? 65.452  11.045 145.912 1.00 126.37 ? 173 ARG D NE  1 
ATOM   5516  C CZ  . ARG D 1 173 ? 66.088  9.884  146.039 1.00 126.37 ? 173 ARG D CZ  1 
ATOM   5517  N NH1 . ARG D 1 173 ? 66.122  9.267  147.214 1.00 126.37 ? 173 ARG D NH1 1 
ATOM   5518  N NH2 . ARG D 1 173 ? 66.689  9.335  144.990 1.00 126.37 ? 173 ARG D NH2 1 
ATOM   5519  N N   . SER D 1 174 ? 69.322  10.825 150.037 1.00 90.49  ? 174 SER D N   1 
ATOM   5520  C CA  . SER D 1 174 ? 70.122  9.859  150.773 1.00 90.49  ? 174 SER D CA  1 
ATOM   5521  C C   . SER D 1 174 ? 70.704  10.478 152.042 1.00 90.49  ? 174 SER D C   1 
ATOM   5522  O O   . SER D 1 174 ? 71.144  9.760  152.933 1.00 90.49  ? 174 SER D O   1 
ATOM   5523  C CB  . SER D 1 174 ? 71.254  9.326  149.890 1.00 146.51 ? 174 SER D CB  1 
ATOM   5524  O OG  . SER D 1 174 ? 70.738  8.623  148.771 1.00 146.51 ? 174 SER D OG  1 
ATOM   5525  N N   . LEU D 1 175 ? 70.709  11.805 152.126 1.00 112.09 ? 175 LEU D N   1 
ATOM   5526  C CA  . LEU D 1 175 ? 71.239  12.482 153.305 1.00 112.09 ? 175 LEU D CA  1 
ATOM   5527  C C   . LEU D 1 175 ? 70.234  12.530 154.443 1.00 112.09 ? 175 LEU D C   1 
ATOM   5528  O O   . LEU D 1 175 ? 70.610  12.435 155.610 1.00 112.09 ? 175 LEU D O   1 
ATOM   5529  C CB  . LEU D 1 175 ? 71.677  13.902 152.966 1.00 84.66  ? 175 LEU D CB  1 
ATOM   5530  C CG  . LEU D 1 175 ? 73.094  14.073 152.435 1.00 84.66  ? 175 LEU D CG  1 
ATOM   5531  C CD1 . LEU D 1 175 ? 73.295  15.516 152.061 1.00 84.66  ? 175 LEU D CD1 1 
ATOM   5532  C CD2 . LEU D 1 175 ? 74.107  13.663 153.489 1.00 84.66  ? 175 LEU D CD2 1 
ATOM   5533  N N   . ASN D 1 176 ? 68.958  12.697 154.111 1.00 79.06  ? 176 ASN D N   1 
ATOM   5534  C CA  . ASN D 1 176 ? 67.916  12.730 155.134 1.00 79.06  ? 176 ASN D CA  1 
ATOM   5535  C C   . ASN D 1 176 ? 67.764  11.329 155.726 1.00 79.06  ? 176 ASN D C   1 
ATOM   5536  O O   . ASN D 1 176 ? 67.598  11.160 156.934 1.00 79.06  ? 176 ASN D O   1 
ATOM   5537  C CB  . ASN D 1 176 ? 66.606  13.180 154.511 1.00 118.74 ? 176 ASN D CB  1 
ATOM   5538  C CG  . ASN D 1 176 ? 66.738  14.505 153.806 1.00 118.74 ? 176 ASN D CG  1 
ATOM   5539  O OD1 . ASN D 1 176 ? 67.113  15.508 154.413 1.00 118.74 ? 176 ASN D OD1 1 
ATOM   5540  N ND2 . ASN D 1 176 ? 66.437  14.520 152.514 1.00 118.74 ? 176 ASN D ND2 1 
ATOM   5541  N N   . LYS D 1 177 ? 67.846  10.327 154.860 1.00 174.23 ? 177 LYS D N   1 
ATOM   5542  C CA  . LYS D 1 177 ? 67.731  8.940  155.279 1.00 174.23 ? 177 LYS D CA  1 
ATOM   5543  C C   . LYS D 1 177 ? 68.927  8.527  156.133 1.00 174.23 ? 177 LYS D C   1 
ATOM   5544  O O   . LYS D 1 177 ? 69.223  7.338  156.258 1.00 174.23 ? 177 LYS D O   1 
ATOM   5545  C CB  . LYS D 1 177 ? 67.645  8.026  154.055 1.00 106.01 ? 177 LYS D CB  1 
ATOM   5546  C CG  . LYS D 1 177 ? 66.463  8.295  153.146 1.00 106.01 ? 177 LYS D CG  1 
ATOM   5547  C CD  . LYS D 1 177 ? 66.491  7.369  151.941 1.00 106.01 ? 177 LYS D CD  1 
ATOM   5548  C CE  . LYS D 1 177 ? 65.344  7.666  150.993 1.00 106.01 ? 177 LYS D CE  1 
ATOM   5549  N NZ  . LYS D 1 177 ? 65.408  6.837  149.753 1.00 106.01 ? 177 LYS D NZ  1 
ATOM   5550  N N   . LEU D 1 178 ? 69.619  9.506  156.712 1.00 106.29 ? 178 LEU D N   1 
ATOM   5551  C CA  . LEU D 1 178 ? 70.778  9.215  157.552 1.00 106.29 ? 178 LEU D CA  1 
ATOM   5552  C C   . LEU D 1 178 ? 70.643  9.783  158.964 1.00 106.29 ? 178 LEU D C   1 
ATOM   5553  O O   . LEU D 1 178 ? 69.909  10.752 159.199 1.00 106.29 ? 178 LEU D O   1 
ATOM   5554  C CB  . LEU D 1 178 ? 72.072  9.733  156.900 1.00 155.06 ? 178 LEU D CB  1 
ATOM   5555  C CG  . LEU D 1 178 ? 72.733  8.866  155.816 1.00 155.06 ? 178 LEU D CG  1 
ATOM   5556  C CD1 . LEU D 1 178 ? 73.976  9.565  155.294 1.00 155.06 ? 178 LEU D CD1 1 
ATOM   5557  C CD2 . LEU D 1 178 ? 73.106  7.503  156.386 1.00 155.06 ? 178 LEU D CD2 1 
ATOM   5558  N N   . PRO D 1 179 ? 71.343  9.163  159.932 1.00 185.60 ? 179 PRO D N   1 
ATOM   5559  C CA  . PRO D 1 179 ? 71.328  9.579  161.336 1.00 185.60 ? 179 PRO D CA  1 
ATOM   5560  C C   . PRO D 1 179 ? 71.760  11.025 161.476 1.00 185.60 ? 179 PRO D C   1 
ATOM   5561  O O   . PRO D 1 179 ? 72.950  11.329 161.400 1.00 185.60 ? 179 PRO D O   1 
ATOM   5562  C CB  . PRO D 1 179 ? 72.326  8.627  161.988 1.00 161.02 ? 179 PRO D CB  1 
ATOM   5563  C CG  . PRO D 1 179 ? 72.199  7.391  161.160 1.00 161.02 ? 179 PRO D CG  1 
ATOM   5564  C CD  . PRO D 1 179 ? 72.167  7.951  159.762 1.00 161.02 ? 179 PRO D CD  1 
ATOM   5565  N N   . ARG D 1 180 ? 70.796  11.915 161.677 1.00 102.61 ? 180 ARG D N   1 
ATOM   5566  C CA  . ARG D 1 180 ? 71.114  13.327 161.828 1.00 102.61 ? 180 ARG D CA  1 
ATOM   5567  C C   . ARG D 1 180 ? 72.041  13.504 163.035 1.00 102.61 ? 180 ARG D C   1 
ATOM   5568  O O   . ARG D 1 180 ? 71.587  13.870 164.120 1.00 102.61 ? 180 ARG D O   1 
ATOM   5569  C CB  . ARG D 1 180 ? 69.827  14.132 162.025 1.00 199.34 ? 180 ARG D CB  1 
ATOM   5570  C CG  . ARG D 1 180 ? 69.767  15.428 161.232 1.00 199.34 ? 180 ARG D CG  1 
ATOM   5571  C CD  . ARG D 1 180 ? 70.922  16.347 161.580 1.00 199.34 ? 180 ARG D CD  1 
ATOM   5572  N NE  . ARG D 1 180 ? 70.943  16.680 163.001 1.00 199.34 ? 180 ARG D NE  1 
ATOM   5573  C CZ  . ARG D 1 180 ? 71.861  17.452 163.572 1.00 199.34 ? 180 ARG D CZ  1 
ATOM   5574  N NH1 . ARG D 1 180 ? 72.839  17.976 162.841 1.00 199.34 ? 180 ARG D NH1 1 
ATOM   5575  N NH2 . ARG D 1 180 ? 71.805  17.700 164.874 1.00 199.34 ? 180 ARG D NH2 1 
ATOM   5576  N N   . GLN D 1 181 ? 73.336  13.247 162.839 1.00 142.94 ? 181 GLN D N   1 
ATOM   5577  C CA  . GLN D 1 181 ? 74.334  13.351 163.909 1.00 142.94 ? 181 GLN D CA  1 
ATOM   5578  C C   . GLN D 1 181 ? 74.382  14.724 164.567 1.00 142.94 ? 181 GLN D C   1 
ATOM   5579  O O   . GLN D 1 181 ? 73.958  15.718 163.983 1.00 142.94 ? 181 GLN D O   1 
ATOM   5580  C CB  . GLN D 1 181 ? 75.726  13.009 163.372 1.00 166.25 ? 181 GLN D CB  1 
ATOM   5581  C CG  . GLN D 1 181 ? 76.226  13.957 162.292 1.00 166.25 ? 181 GLN D CG  1 
ATOM   5582  C CD  . GLN D 1 181 ? 77.673  13.704 161.919 1.00 166.25 ? 181 GLN D CD  1 
ATOM   5583  O OE1 . GLN D 1 181 ? 78.586  13.928 162.718 1.00 166.25 ? 181 GLN D OE1 1 
ATOM   5584  N NE2 . GLN D 1 181 ? 77.891  13.227 160.700 1.00 166.25 ? 181 GLN D NE2 1 
ATOM   5585  N N   . LEU D 1 182 ? 74.921  14.774 165.782 1.00 119.02 ? 182 LEU D N   1 
ATOM   5586  C CA  . LEU D 1 182 ? 75.013  16.024 166.529 1.00 119.02 ? 182 LEU D CA  1 
ATOM   5587  C C   . LEU D 1 182 ? 76.391  16.665 166.385 1.00 119.02 ? 182 LEU D C   1 
ATOM   5588  O O   . LEU D 1 182 ? 77.397  15.964 166.268 1.00 119.02 ? 182 LEU D O   1 
ATOM   5589  C CB  . LEU D 1 182 ? 74.717  15.764 168.007 1.00 151.29 ? 182 LEU D CB  1 
ATOM   5590  C CG  . LEU D 1 182 ? 74.281  16.955 168.863 1.00 151.29 ? 182 LEU D CG  1 
ATOM   5591  C CD1 . LEU D 1 182 ? 72.992  17.552 168.298 1.00 151.29 ? 182 LEU D CD1 1 
ATOM   5592  C CD2 . LEU D 1 182 ? 74.071  16.501 170.299 1.00 151.29 ? 182 LEU D CD2 1 
ATOM   5593  N N   . PRO D 1 183 ? 76.452  18.009 166.398 1.00 100.00 ? 183 PRO D N   1 
ATOM   5594  C CA  . PRO D 1 183 ? 77.704  18.760 166.269 1.00 100.00 ? 183 PRO D CA  1 
ATOM   5595  C C   . PRO D 1 183 ? 78.919  18.083 166.892 1.00 100.00 ? 183 PRO D C   1 
ATOM   5596  O O   . PRO D 1 183 ? 78.843  17.507 167.978 1.00 100.00 ? 183 PRO D O   1 
ATOM   5597  C CB  . PRO D 1 183 ? 77.362  20.088 166.927 1.00 156.04 ? 183 PRO D CB  1 
ATOM   5598  C CG  . PRO D 1 183 ? 75.965  20.305 166.446 1.00 156.04 ? 183 PRO D CG  1 
ATOM   5599  C CD  . PRO D 1 183 ? 75.323  18.934 166.620 1.00 156.04 ? 183 PRO D CD  1 
ATOM   5600  N N   . LEU D 1 184 ? 80.041  18.160 166.188 1.00 145.39 ? 184 LEU D N   1 
ATOM   5601  C CA  . LEU D 1 184 ? 81.277  17.552 166.650 1.00 145.39 ? 184 LEU D CA  1 
ATOM   5602  C C   . LEU D 1 184 ? 81.936  18.423 167.714 1.00 145.39 ? 184 LEU D C   1 
ATOM   5603  O O   . LEU D 1 184 ? 81.971  19.649 167.592 1.00 145.39 ? 184 LEU D O   1 
ATOM   5604  C CB  . LEU D 1 184 ? 82.242  17.359 165.472 1.00 145.57 ? 184 LEU D CB  1 
ATOM   5605  C CG  . LEU D 1 184 ? 81.741  16.689 164.182 1.00 145.57 ? 184 LEU D CG  1 
ATOM   5606  C CD1 . LEU D 1 184 ? 81.012  15.394 164.521 1.00 145.57 ? 184 LEU D CD1 1 
ATOM   5607  C CD2 . LEU D 1 184 ? 80.823  17.635 163.423 1.00 145.57 ? 184 LEU D CD2 1 
ATOM   5608  N N   . GLU D 1 185 ? 82.446  17.788 168.764 1.00 144.34 ? 185 GLU D N   1 
ATOM   5609  C CA  . GLU D 1 185 ? 83.120  18.515 169.832 1.00 144.34 ? 185 GLU D CA  1 
ATOM   5610  C C   . GLU D 1 185 ? 84.533  18.825 169.360 1.00 144.34 ? 185 GLU D C   1 
ATOM   5611  O O   . GLU D 1 185 ? 85.230  17.942 168.857 1.00 144.34 ? 185 GLU D O   1 
ATOM   5612  C CB  . GLU D 1 185 ? 83.180  17.670 171.103 1.00 199.55 ? 185 GLU D CB  1 
ATOM   5613  C CG  . GLU D 1 185 ? 83.896  18.353 172.258 1.00 199.55 ? 185 GLU D CG  1 
ATOM   5614  C CD  . GLU D 1 185 ? 84.064  17.444 173.459 1.00 199.55 ? 185 GLU D CD  1 
ATOM   5615  O OE1 . GLU D 1 185 ? 84.720  16.391 173.322 1.00 199.55 ? 185 GLU D OE1 1 
ATOM   5616  O OE2 . GLU D 1 185 ? 83.541  17.783 174.541 1.00 199.55 ? 185 GLU D OE2 1 
ATOM   5617  N N   . VAL D 1 186 ? 84.954  20.074 169.523 1.00 98.30  ? 186 VAL D N   1 
ATOM   5618  C CA  . VAL D 1 186 ? 86.286  20.486 169.090 1.00 98.30  ? 186 VAL D CA  1 
ATOM   5619  C C   . VAL D 1 186 ? 87.319  20.435 170.220 1.00 98.30  ? 186 VAL D C   1 
ATOM   5620  O O   . VAL D 1 186 ? 87.280  21.238 171.152 1.00 98.30  ? 186 VAL D O   1 
ATOM   5621  C CB  . VAL D 1 186 ? 86.253  21.918 168.492 1.00 64.84  ? 186 VAL D CB  1 
ATOM   5622  C CG1 . VAL D 1 186 ? 87.638  22.299 167.971 1.00 64.84  ? 186 VAL D CG1 1 
ATOM   5623  C CG2 . VAL D 1 186 ? 85.205  21.997 167.370 1.00 64.84  ? 186 VAL D CG2 1 
ATOM   5624  N N   . ASP D 1 187 ? 88.245  19.487 170.130 1.00 156.88 ? 187 ASP D N   1 
ATOM   5625  C CA  . ASP D 1 187 ? 89.282  19.338 171.143 1.00 156.88 ? 187 ASP D CA  1 
ATOM   5626  C C   . ASP D 1 187 ? 90.392  20.370 170.944 1.00 156.88 ? 187 ASP D C   1 
ATOM   5627  O O   . ASP D 1 187 ? 91.229  20.225 170.055 1.00 156.88 ? 187 ASP D O   1 
ATOM   5628  C CB  . ASP D 1 187 ? 89.865  17.927 171.083 1.00 200.00 ? 187 ASP D CB  1 
ATOM   5629  C CG  . ASP D 1 187 ? 91.016  17.735 172.042 1.00 200.00 ? 187 ASP D CG  1 
ATOM   5630  O OD1 . ASP D 1 187 ? 90.848  18.058 173.236 1.00 200.00 ? 187 ASP D OD1 1 
ATOM   5631  O OD2 . ASP D 1 187 ? 92.086  17.259 171.606 1.00 200.00 ? 187 ASP D OD2 1 
ATOM   5632  N N   . LEU D 1 188 ? 90.402  21.401 171.785 1.00 93.33  ? 188 LEU D N   1 
ATOM   5633  C CA  . LEU D 1 188 ? 91.394  22.474 171.682 1.00 93.33  ? 188 LEU D CA  1 
ATOM   5634  C C   . LEU D 1 188 ? 92.642  22.255 172.531 1.00 93.33  ? 188 LEU D C   1 
ATOM   5635  O O   . LEU D 1 188 ? 93.355  23.205 172.851 1.00 93.33  ? 188 LEU D O   1 
ATOM   5636  C CB  . LEU D 1 188 ? 90.747  23.801 172.081 1.00 110.99 ? 188 LEU D CB  1 
ATOM   5637  C CG  . LEU D 1 188 ? 89.435  24.120 171.366 1.00 110.99 ? 188 LEU D CG  1 
ATOM   5638  C CD1 . LEU D 1 188 ? 88.840  25.408 171.906 1.00 110.99 ? 188 LEU D CD1 1 
ATOM   5639  C CD2 . LEU D 1 188 ? 89.699  24.233 169.872 1.00 110.99 ? 188 LEU D CD2 1 
ATOM   5640  N N   . THR D 1 189 ? 92.912  21.005 172.890 1.00 149.40 ? 189 THR D N   1 
ATOM   5641  C CA  . THR D 1 189 ? 94.069  20.702 173.721 1.00 149.40 ? 189 THR D CA  1 
ATOM   5642  C C   . THR D 1 189 ? 95.390  20.951 173.015 1.00 149.40 ? 189 THR D C   1 
ATOM   5643  O O   . THR D 1 189 ? 96.273  21.618 173.552 1.00 149.40 ? 189 THR D O   1 
ATOM   5644  C CB  . THR D 1 189 ? 94.041  19.243 174.207 1.00 153.17 ? 189 THR D CB  1 
ATOM   5645  O OG1 . THR D 1 189 ? 93.995  18.362 173.080 1.00 153.17 ? 189 THR D OG1 1 
ATOM   5646  C CG2 . THR D 1 189 ? 92.827  19.006 175.093 1.00 153.17 ? 189 THR D CG2 1 
ATOM   5647  N N   . LYS D 1 190 ? 95.526  20.415 171.810 1.00 138.06 ? 190 LYS D N   1 
ATOM   5648  C CA  . LYS D 1 190 ? 96.754  20.587 171.050 1.00 138.06 ? 190 LYS D CA  1 
ATOM   5649  C C   . LYS D 1 190 ? 96.679  21.826 170.165 1.00 138.06 ? 190 LYS D C   1 
ATOM   5650  O O   . LYS D 1 190 ? 97.397  21.934 169.166 1.00 138.06 ? 190 LYS D O   1 
ATOM   5651  C CB  . LYS D 1 190 ? 97.018  19.339 170.202 1.00 137.49 ? 190 LYS D CB  1 
ATOM   5652  C CG  . LYS D 1 190 ? 97.212  18.078 171.030 1.00 137.49 ? 190 LYS D CG  1 
ATOM   5653  C CD  . LYS D 1 190 ? 97.466  16.858 170.159 1.00 137.49 ? 190 LYS D CD  1 
ATOM   5654  C CE  . LYS D 1 190 ? 97.705  15.622 171.017 1.00 137.49 ? 190 LYS D CE  1 
ATOM   5655  N NZ  . LYS D 1 190 ? 97.880  14.386 170.209 1.00 137.49 ? 190 LYS D NZ  1 
ATOM   5656  N N   . ALA D 1 191 ? 95.811  22.762 170.543 1.00 140.83 ? 191 ALA D N   1 
ATOM   5657  C CA  . ALA D 1 191 ? 95.633  23.996 169.785 1.00 140.83 ? 191 ALA D CA  1 
ATOM   5658  C C   . ALA D 1 191 ? 96.883  24.871 169.840 1.00 140.83 ? 191 ALA D C   1 
ATOM   5659  O O   . ALA D 1 191 ? 97.627  24.846 170.819 1.00 140.83 ? 191 ALA D O   1 
ATOM   5660  C CB  . ALA D 1 191 ? 94.435  24.763 170.317 1.00 55.90  ? 191 ALA D CB  1 
ATOM   5661  N N   . LYS D 1 192 ? 97.109  25.640 168.778 1.00 115.86 ? 192 LYS D N   1 
ATOM   5662  C CA  . LYS D 1 192 ? 98.268  26.521 168.702 1.00 115.86 ? 192 LYS D CA  1 
ATOM   5663  C C   . LYS D 1 192 ? 98.108  27.598 169.759 1.00 115.86 ? 192 LYS D C   1 
ATOM   5664  O O   . LYS D 1 192 ? 97.067  28.256 169.841 1.00 115.86 ? 192 LYS D O   1 
ATOM   5665  C CB  . LYS D 1 192 ? 98.368  27.146 167.308 1.00 104.46 ? 192 LYS D CB  1 
ATOM   5666  C CG  . LYS D 1 192 ? 99.598  28.008 167.094 1.00 104.46 ? 192 LYS D CG  1 
ATOM   5667  C CD  . LYS D 1 192 ? 99.654  28.503 165.661 1.00 104.46 ? 192 LYS D CD  1 
ATOM   5668  C CE  . LYS D 1 192 ? 100.809 29.455 165.457 1.00 104.46 ? 192 LYS D CE  1 
ATOM   5669  N NZ  . LYS D 1 192 ? 102.097 28.811 165.796 1.00 104.46 ? 192 LYS D NZ  1 
ATOM   5670  N N   . ARG D 1 193 ? 99.140  27.770 170.575 1.00 107.89 ? 193 ARG D N   1 
ATOM   5671  C CA  . ARG D 1 193 ? 99.076  28.757 171.640 1.00 107.89 ? 193 ARG D CA  1 
ATOM   5672  C C   . ARG D 1 193 ? 100.070 29.896 171.539 1.00 107.89 ? 193 ARG D C   1 
ATOM   5673  O O   . ARG D 1 193 ? 99.985  30.861 172.295 1.00 107.89 ? 193 ARG D O   1 
ATOM   5674  C CB  . ARG D 1 193 ? 99.202  28.066 172.996 1.00 164.17 ? 193 ARG D CB  1 
ATOM   5675  C CG  . ARG D 1 193 ? 97.973  27.248 173.342 1.00 164.17 ? 193 ARG D CG  1 
ATOM   5676  C CD  . ARG D 1 193 ? 97.864  26.987 174.832 1.00 164.17 ? 193 ARG D CD  1 
ATOM   5677  N NE  . ARG D 1 193 ? 96.488  26.677 175.218 1.00 164.17 ? 193 ARG D NE  1 
ATOM   5678  C CZ  . ARG D 1 193 ? 95.816  25.599 174.822 1.00 164.17 ? 193 ARG D CZ  1 
ATOM   5679  N NH1 . ARG D 1 193 ? 96.391  24.708 174.023 1.00 164.17 ? 193 ARG D NH1 1 
ATOM   5680  N NH2 . ARG D 1 193 ? 94.563  25.416 175.218 1.00 164.17 ? 193 ARG D NH2 1 
ATOM   5681  N N   . GLN D 1 194 ? 101.011 29.787 170.612 1.00 102.27 ? 194 GLN D N   1 
ATOM   5682  C CA  . GLN D 1 194 ? 101.985 30.848 170.406 1.00 102.27 ? 194 GLN D CA  1 
ATOM   5683  C C   . GLN D 1 194 ? 102.374 30.933 168.930 1.00 102.27 ? 194 GLN D C   1 
ATOM   5684  O O   . GLN D 1 194 ? 102.100 30.020 168.153 1.00 102.27 ? 194 GLN D O   1 
ATOM   5685  C CB  . GLN D 1 194 ? 103.209 30.637 171.309 1.00 140.70 ? 194 GLN D CB  1 
ATOM   5686  C CG  . GLN D 1 194 ? 103.675 29.202 171.435 1.00 140.70 ? 194 GLN D CG  1 
ATOM   5687  C CD  . GLN D 1 194 ? 104.412 28.720 170.209 1.00 140.70 ? 194 GLN D CD  1 
ATOM   5688  O OE1 . GLN D 1 194 ? 105.477 29.234 169.869 1.00 140.70 ? 194 GLN D OE1 1 
ATOM   5689  N NE2 . GLN D 1 194 ? 103.849 27.725 169.535 1.00 140.70 ? 194 GLN D NE2 1 
ATOM   5690  N N   . ASP D 1 195 ? 102.997 32.038 168.544 1.00 83.98  ? 195 ASP D N   1 
ATOM   5691  C CA  . ASP D 1 195 ? 103.380 32.243 167.158 1.00 83.98  ? 195 ASP D CA  1 
ATOM   5692  C C   . ASP D 1 195 ? 104.382 31.244 166.567 1.00 83.98  ? 195 ASP D C   1 
ATOM   5693  O O   . ASP D 1 195 ? 104.047 30.501 165.647 1.00 83.98  ? 195 ASP D O   1 
ATOM   5694  C CB  . ASP D 1 195 ? 103.904 33.677 166.964 1.00 109.08 ? 195 ASP D CB  1 
ATOM   5695  C CG  . ASP D 1 195 ? 102.843 34.746 167.267 1.00 109.08 ? 195 ASP D CG  1 
ATOM   5696  O OD1 . ASP D 1 195 ? 101.636 34.470 167.092 1.00 109.08 ? 195 ASP D OD1 1 
ATOM   5697  O OD2 . ASP D 1 195 ? 103.218 35.870 167.666 1.00 109.08 ? 195 ASP D OD2 1 
ATOM   5698  N N   . LEU D 1 196 ? 105.603 31.215 167.087 1.00 98.30  ? 196 LEU D N   1 
ATOM   5699  C CA  . LEU D 1 196 ? 106.637 30.327 166.552 1.00 98.30  ? 196 LEU D CA  1 
ATOM   5700  C C   . LEU D 1 196 ? 106.211 28.908 166.151 1.00 98.30  ? 196 LEU D C   1 
ATOM   5701  O O   . LEU D 1 196 ? 105.276 28.330 166.714 1.00 98.30  ? 196 LEU D O   1 
ATOM   5702  C CB  . LEU D 1 196 ? 107.816 30.252 167.525 1.00 109.79 ? 196 LEU D CB  1 
ATOM   5703  C CG  . LEU D 1 196 ? 109.086 29.581 166.990 1.00 109.79 ? 196 LEU D CG  1 
ATOM   5704  C CD1 . LEU D 1 196 ? 109.464 30.157 165.634 1.00 109.79 ? 196 LEU D CD1 1 
ATOM   5705  C CD2 . LEU D 1 196 ? 110.220 29.786 167.982 1.00 109.79 ? 196 LEU D CD2 1 
ATOM   5706  N N   . GLU D 1 197 ? 106.917 28.375 165.153 1.00 118.75 ? 197 GLU D N   1 
ATOM   5707  C CA  . GLU D 1 197 ? 106.705 27.033 164.596 1.00 118.75 ? 197 GLU D CA  1 
ATOM   5708  C C   . GLU D 1 197 ? 108.088 26.451 164.301 1.00 118.75 ? 197 GLU D C   1 
ATOM   5709  O O   . GLU D 1 197 ? 108.576 26.524 163.173 1.00 118.75 ? 197 GLU D O   1 
ATOM   5710  C CB  . GLU D 1 197 ? 105.926 27.118 163.287 1.00 91.37  ? 197 GLU D CB  1 
ATOM   5711  C CG  . GLU D 1 197 ? 104.480 27.509 163.433 1.00 91.37  ? 197 GLU D CG  1 
ATOM   5712  C CD  . GLU D 1 197 ? 103.631 26.372 163.950 1.00 91.37  ? 197 GLU D CD  1 
ATOM   5713  O OE1 . GLU D 1 197 ? 103.927 25.211 163.583 1.00 91.37  ? 197 GLU D OE1 1 
ATOM   5714  O OE2 . GLU D 1 197 ? 102.663 26.632 164.703 1.00 91.37  ? 197 GLU D OE2 1 
ATOM   5715  N N   . PRO D 1 198 ? 108.732 25.857 165.315 1.00 90.30  ? 198 PRO D N   1 
ATOM   5716  C CA  . PRO D 1 198 ? 110.069 25.263 165.197 1.00 90.30  ? 198 PRO D CA  1 
ATOM   5717  C C   . PRO D 1 198 ? 110.219 24.307 164.028 1.00 90.30  ? 198 PRO D C   1 
ATOM   5718  O O   . PRO D 1 198 ? 111.192 24.374 163.271 1.00 90.30  ? 198 PRO D O   1 
ATOM   5719  C CB  . PRO D 1 198 ? 110.252 24.565 166.538 1.00 99.05  ? 198 PRO D CB  1 
ATOM   5720  C CG  . PRO D 1 198 ? 109.425 25.404 167.471 1.00 99.05  ? 198 PRO D CG  1 
ATOM   5721  C CD  . PRO D 1 198 ? 108.178 25.621 166.660 1.00 99.05  ? 198 PRO D CD  1 
ATOM   5722  N N   . SER D 1 199 ? 109.251 23.409 163.896 1.00 120.82 ? 199 SER D N   1 
ATOM   5723  C CA  . SER D 1 199 ? 109.265 22.427 162.827 1.00 120.82 ? 199 SER D CA  1 
ATOM   5724  C C   . SER D 1 199 ? 109.466 23.143 161.495 1.00 120.82 ? 199 SER D C   1 
ATOM   5725  O O   . SER D 1 199 ? 110.389 22.830 160.731 1.00 120.82 ? 199 SER D O   1 
ATOM   5726  C CB  . SER D 1 199 ? 107.940 21.661 162.822 1.00 174.65 ? 199 SER D CB  1 
ATOM   5727  O OG  . SER D 1 199 ? 107.936 20.653 161.830 1.00 174.65 ? 199 SER D OG  1 
ATOM   5728  N N   . VAL D 1 200 ? 108.598 24.120 161.243 1.00 89.48  ? 200 VAL D N   1 
ATOM   5729  C CA  . VAL D 1 200 ? 108.625 24.909 160.020 1.00 89.48  ? 200 VAL D CA  1 
ATOM   5730  C C   . VAL D 1 200 ? 109.901 25.727 159.906 1.00 89.48  ? 200 VAL D C   1 
ATOM   5731  O O   . VAL D 1 200 ? 110.654 25.585 158.940 1.00 89.48  ? 200 VAL D O   1 
ATOM   5732  C CB  . VAL D 1 200 ? 107.410 25.857 159.963 1.00 68.68  ? 200 VAL D CB  1 
ATOM   5733  C CG1 . VAL D 1 200 ? 107.484 26.733 158.738 1.00 68.68  ? 200 VAL D CG1 1 
ATOM   5734  C CG2 . VAL D 1 200 ? 106.114 25.040 159.968 1.00 68.68  ? 200 VAL D CG2 1 
ATOM   5735  N N   . GLU D 1 201 ? 110.144 26.576 160.901 1.00 74.33  ? 201 GLU D N   1 
ATOM   5736  C CA  . GLU D 1 201 ? 111.335 27.432 160.912 1.00 74.33  ? 201 GLU D CA  1 
ATOM   5737  C C   . GLU D 1 201 ? 112.598 26.652 160.525 1.00 74.33  ? 201 GLU D C   1 
ATOM   5738  O O   . GLU D 1 201 ? 113.480 27.162 159.821 1.00 74.33  ? 201 GLU D O   1 
ATOM   5739  C CB  . GLU D 1 201 ? 111.505 28.069 162.300 1.00 149.11 ? 201 GLU D CB  1 
ATOM   5740  C CG  . GLU D 1 201 ? 112.740 28.957 162.463 1.00 149.11 ? 201 GLU D CG  1 
ATOM   5741  C CD  . GLU D 1 201 ? 112.785 30.106 161.473 1.00 149.11 ? 201 GLU D CD  1 
ATOM   5742  O OE1 . GLU D 1 201 ? 111.772 30.828 161.356 1.00 149.11 ? 201 GLU D OE1 1 
ATOM   5743  O OE2 . GLU D 1 201 ? 113.837 30.288 160.819 1.00 149.11 ? 201 GLU D OE2 1 
ATOM   5744  N N   . GLU D 1 202 ? 112.663 25.404 160.975 1.00 101.52 ? 202 GLU D N   1 
ATOM   5745  C CA  . GLU D 1 202 ? 113.811 24.560 160.695 1.00 101.52 ? 202 GLU D CA  1 
ATOM   5746  C C   . GLU D 1 202 ? 113.893 24.209 159.223 1.00 101.52 ? 202 GLU D C   1 
ATOM   5747  O O   . GLU D 1 202 ? 114.896 24.488 158.564 1.00 101.52 ? 202 GLU D O   1 
ATOM   5748  C CB  . GLU D 1 202 ? 113.731 23.281 161.526 1.00 146.97 ? 202 GLU D CB  1 
ATOM   5749  C CG  . GLU D 1 202 ? 114.944 22.390 161.377 1.00 146.97 ? 202 GLU D CG  1 
ATOM   5750  C CD  . GLU D 1 202 ? 114.916 21.223 162.335 1.00 146.97 ? 202 GLU D CD  1 
ATOM   5751  O OE1 . GLU D 1 202 ? 113.975 20.407 162.258 1.00 146.97 ? 202 GLU D OE1 1 
ATOM   5752  O OE2 . GLU D 1 202 ? 115.837 21.124 163.169 1.00 146.97 ? 202 GLU D OE2 1 
ATOM   5753  N N   . ALA D 1 203 ? 112.822 23.599 158.721 1.00 75.15  ? 203 ALA D N   1 
ATOM   5754  C CA  . ALA D 1 203 ? 112.744 23.179 157.327 1.00 75.15  ? 203 ALA D CA  1 
ATOM   5755  C C   . ALA D 1 203 ? 113.059 24.333 156.392 1.00 75.15  ? 203 ALA D C   1 
ATOM   5756  O O   . ALA D 1 203 ? 113.719 24.164 155.359 1.00 75.15  ? 203 ALA D O   1 
ATOM   5757  C CB  . ALA D 1 203 ? 111.352 22.633 157.037 1.00 64.30  ? 203 ALA D CB  1 
ATOM   5758  N N   . ARG D 1 204 ? 112.580 25.510 156.772 1.00 111.22 ? 204 ARG D N   1 
ATOM   5759  C CA  . ARG D 1 204 ? 112.787 26.717 155.990 1.00 111.22 ? 204 ARG D CA  1 
ATOM   5760  C C   . ARG D 1 204 ? 114.256 27.105 155.931 1.00 111.22 ? 204 ARG D C   1 
ATOM   5761  O O   . ARG D 1 204 ? 114.803 27.342 154.855 1.00 111.22 ? 204 ARG D O   1 
ATOM   5762  C CB  . ARG D 1 204 ? 111.981 27.865 156.592 1.00 64.64  ? 204 ARG D CB  1 
ATOM   5763  C CG  . ARG D 1 204 ? 112.130 29.189 155.850 1.00 64.64  ? 204 ARG D CG  1 
ATOM   5764  C CD  . ARG D 1 204 ? 111.244 30.230 156.475 1.00 64.64  ? 204 ARG D CD  1 
ATOM   5765  N NE  . ARG D 1 204 ? 109.852 29.801 156.509 1.00 64.64  ? 204 ARG D NE  1 
ATOM   5766  C CZ  . ARG D 1 204 ? 109.076 29.845 157.590 1.00 64.64  ? 204 ARG D CZ  1 
ATOM   5767  N NH1 . ARG D 1 204 ? 109.558 30.296 158.750 1.00 64.64  ? 204 ARG D NH1 1 
ATOM   5768  N NH2 . ARG D 1 204 ? 107.806 29.461 157.511 1.00 64.64  ? 204 ARG D NH2 1 
ATOM   5769  N N   . TYR D 1 205 ? 114.890 27.174 157.097 1.00 107.11 ? 205 TYR D N   1 
ATOM   5770  C CA  . TYR D 1 205 ? 116.296 27.541 157.166 1.00 107.11 ? 205 TYR D CA  1 
ATOM   5771  C C   . TYR D 1 205 ? 117.159 26.638 156.283 1.00 107.11 ? 205 TYR D C   1 
ATOM   5772  O O   . TYR D 1 205 ? 118.096 27.097 155.628 1.00 107.11 ? 205 TYR D O   1 
ATOM   5773  C CB  . TYR D 1 205 ? 116.793 27.474 158.612 1.00 108.70 ? 205 TYR D CB  1 
ATOM   5774  C CG  . TYR D 1 205 ? 118.244 27.866 158.729 1.00 108.70 ? 205 TYR D CG  1 
ATOM   5775  C CD1 . TYR D 1 205 ? 118.664 29.155 158.394 1.00 108.70 ? 205 TYR D CD1 1 
ATOM   5776  C CD2 . TYR D 1 205 ? 119.209 26.938 159.116 1.00 108.70 ? 205 TYR D CD2 1 
ATOM   5777  C CE1 . TYR D 1 205 ? 120.010 29.510 158.435 1.00 108.70 ? 205 TYR D CE1 1 
ATOM   5778  C CE2 . TYR D 1 205 ? 120.560 27.282 159.162 1.00 108.70 ? 205 TYR D CE2 1 
ATOM   5779  C CZ  . TYR D 1 205 ? 120.953 28.569 158.819 1.00 108.70 ? 205 TYR D CZ  1 
ATOM   5780  O OH  . TYR D 1 205 ? 122.283 28.922 158.860 1.00 108.70 ? 205 TYR D OH  1 
ATOM   5781  N N   . ASN D 1 206 ? 116.833 25.351 156.269 1.00 129.37 ? 206 ASN D N   1 
ATOM   5782  C CA  . ASN D 1 206 ? 117.575 24.380 155.474 1.00 129.37 ? 206 ASN D CA  1 
ATOM   5783  C C   . ASN D 1 206 ? 117.204 24.494 154.004 1.00 129.37 ? 206 ASN D C   1 
ATOM   5784  O O   . ASN D 1 206 ? 117.775 23.813 153.153 1.00 129.37 ? 206 ASN D O   1 
ATOM   5785  C CB  . ASN D 1 206 ? 117.272 22.966 155.968 1.00 103.74 ? 206 ASN D CB  1 
ATOM   5786  C CG  . ASN D 1 206 ? 117.488 22.813 157.461 1.00 103.74 ? 206 ASN D CG  1 
ATOM   5787  O OD1 . ASN D 1 206 ? 118.572 23.088 157.967 1.00 103.74 ? 206 ASN D OD1 1 
ATOM   5788  N ND2 . ASN D 1 206 ? 116.456 22.371 158.173 1.00 103.74 ? 206 ASN D ND2 1 
ATOM   5789  N N   . SER D 1 207 ? 116.238 25.360 153.719 1.00 159.60 ? 207 SER D N   1 
ATOM   5790  C CA  . SER D 1 207 ? 115.762 25.580 152.361 1.00 159.60 ? 207 SER D CA  1 
ATOM   5791  C C   . SER D 1 207 ? 116.532 26.711 151.680 1.00 159.60 ? 207 SER D C   1 
ATOM   5792  O O   . SER D 1 207 ? 116.294 27.015 150.512 1.00 159.60 ? 207 SER D O   1 
ATOM   5793  C CB  . SER D 1 207 ? 114.261 25.903 152.389 1.00 122.47 ? 207 SER D CB  1 
ATOM   5794  O OG  . SER D 1 207 ? 113.743 26.125 151.091 1.00 122.47 ? 207 SER D OG  1 
ATOM   5795  N N   . CYS D 1 208 ? 117.458 27.329 152.409 1.00 137.26 ? 208 CYS D N   1 
ATOM   5796  C CA  . CYS D 1 208 ? 118.252 28.429 151.862 1.00 137.26 ? 208 CYS D CA  1 
ATOM   5797  C C   . CYS D 1 208 ? 119.686 27.989 151.595 1.00 137.26 ? 208 CYS D C   1 
ATOM   5798  O O   . CYS D 1 208 ? 119.995 26.811 151.871 1.00 137.26 ? 208 CYS D O   1 
ATOM   5799  C CB  . CYS D 1 208 ? 118.261 29.623 152.828 1.00 120.21 ? 208 CYS D CB  1 
ATOM   5800  S SG  . CYS D 1 208 ? 116.652 30.428 153.154 1.00 120.21 ? 208 CYS D SG  1 
ATOM   5801  N N   . CYS E 1 25  ? 113.619 33.900 143.311 1.00 128.36 ? 25  CYS E N   1 
ATOM   5802  C CA  . CYS E 1 25  ? 113.145 34.993 144.209 1.00 128.36 ? 25  CYS E CA  1 
ATOM   5803  C C   . CYS E 1 25  ? 111.696 34.777 144.631 1.00 128.36 ? 25  CYS E C   1 
ATOM   5804  O O   . CYS E 1 25  ? 111.252 33.642 144.781 1.00 128.36 ? 25  CYS E O   1 
ATOM   5805  C CB  . CYS E 1 25  ? 113.276 36.347 143.508 1.00 122.74 ? 25  CYS E CB  1 
ATOM   5806  S SG  . CYS E 1 25  ? 112.253 36.536 142.026 1.00 122.74 ? 25  CYS E SG  1 
ATOM   5807  N N   . PHE E 1 26  ? 110.959 35.868 144.822 1.00 88.11  ? 26  PHE E N   1 
ATOM   5808  C CA  . PHE E 1 26  ? 109.565 35.770 145.230 1.00 88.11  ? 26  PHE E CA  1 
ATOM   5809  C C   . PHE E 1 26  ? 108.667 35.525 144.033 1.00 88.11  ? 26  PHE E C   1 
ATOM   5810  O O   . PHE E 1 26  ? 108.813 36.173 143.001 1.00 88.11  ? 26  PHE E O   1 
ATOM   5811  C CB  . PHE E 1 26  ? 109.116 37.039 145.914 1.00 41.00  ? 26  PHE E CB  1 
ATOM   5812  C CG  . PHE E 1 26  ? 107.881 36.857 146.708 1.00 41.00  ? 26  PHE E CG  1 
ATOM   5813  C CD1 . PHE E 1 26  ? 107.954 36.372 148.014 1.00 41.00  ? 26  PHE E CD1 1 
ATOM   5814  C CD2 . PHE E 1 26  ? 106.640 37.117 146.150 1.00 41.00  ? 26  PHE E CD2 1 
ATOM   5815  C CE1 . PHE E 1 26  ? 106.806 36.145 148.762 1.00 41.00  ? 26  PHE E CE1 1 
ATOM   5816  C CE2 . PHE E 1 26  ? 105.473 36.896 146.886 1.00 41.00  ? 26  PHE E CE2 1 
ATOM   5817  C CZ  . PHE E 1 26  ? 105.554 36.405 148.204 1.00 41.00  ? 26  PHE E CZ  1 
ATOM   5818  N N   . GLY E 1 27  ? 107.714 34.613 144.181 1.00 61.31  ? 27  GLY E N   1 
ATOM   5819  C CA  . GLY E 1 27  ? 106.846 34.277 143.067 1.00 61.31  ? 27  GLY E CA  1 
ATOM   5820  C C   . GLY E 1 27  ? 107.540 33.185 142.257 1.00 61.31  ? 27  GLY E C   1 
ATOM   5821  O O   . GLY E 1 27  ? 106.903 32.423 141.541 1.00 61.31  ? 27  GLY E O   1 
ATOM   5822  N N   . GLN E 1 28  ? 108.861 33.114 142.389 1.00 75.80  ? 28  GLN E N   1 
ATOM   5823  C CA  . GLN E 1 28  ? 109.669 32.121 141.697 1.00 75.80  ? 28  GLN E CA  1 
ATOM   5824  C C   . GLN E 1 28  ? 109.883 30.882 142.569 1.00 75.80  ? 28  GLN E C   1 
ATOM   5825  O O   . GLN E 1 28  ? 109.551 29.764 142.169 1.00 75.80  ? 28  GLN E O   1 
ATOM   5826  C CB  . GLN E 1 28  ? 111.036 32.702 141.351 1.00 155.60 ? 28  GLN E CB  1 
ATOM   5827  C CG  . GLN E 1 28  ? 110.999 33.955 140.514 1.00 155.60 ? 28  GLN E CG  1 
ATOM   5828  C CD  . GLN E 1 28  ? 110.494 33.713 139.112 1.00 155.60 ? 28  GLN E CD  1 
ATOM   5829  O OE1 . GLN E 1 28  ? 110.573 34.594 138.259 1.00 155.60 ? 28  GLN E OE1 1 
ATOM   5830  N NE2 . GLN E 1 28  ? 109.967 32.520 138.863 1.00 155.60 ? 28  GLN E NE2 1 
ATOM   5831  N N   . CYS E 1 29  ? 110.441 31.088 143.761 1.00 80.87  ? 29  CYS E N   1 
ATOM   5832  C CA  . CYS E 1 29  ? 110.735 29.997 144.695 1.00 80.87  ? 29  CYS E CA  1 
ATOM   5833  C C   . CYS E 1 29  ? 109.637 28.948 144.854 1.00 80.87  ? 29  CYS E C   1 
ATOM   5834  O O   . CYS E 1 29  ? 108.450 29.271 144.909 1.00 80.87  ? 29  CYS E O   1 
ATOM   5835  C CB  . CYS E 1 29  ? 111.098 30.567 146.068 1.00 108.27 ? 29  CYS E CB  1 
ATOM   5836  S SG  . CYS E 1 29  ? 112.666 31.463 146.088 1.00 108.27 ? 29  CYS E SG  1 
ATOM   5837  N N   . GLN E 1 30  ? 110.063 27.687 144.916 1.00 92.11  ? 30  GLN E N   1 
ATOM   5838  C CA  . GLN E 1 30  ? 109.165 26.552 145.083 1.00 92.11  ? 30  GLN E CA  1 
ATOM   5839  C C   . GLN E 1 30  ? 109.448 25.938 146.448 1.00 92.11  ? 30  GLN E C   1 
ATOM   5840  O O   . GLN E 1 30  ? 110.606 25.774 146.824 1.00 92.11  ? 30  GLN E O   1 
ATOM   5841  C CB  . GLN E 1 30  ? 109.400 25.518 143.975 1.00 148.08 ? 30  GLN E CB  1 
ATOM   5842  C CG  . GLN E 1 30  ? 109.011 26.015 142.586 1.00 148.08 ? 30  GLN E CG  1 
ATOM   5843  C CD  . GLN E 1 30  ? 109.210 24.979 141.494 1.00 148.08 ? 30  GLN E CD  1 
ATOM   5844  O OE1 . GLN E 1 30  ? 108.764 23.838 141.616 1.00 148.08 ? 30  GLN E OE1 1 
ATOM   5845  N NE2 . GLN E 1 30  ? 109.870 25.379 140.410 1.00 148.08 ? 30  GLN E NE2 1 
ATOM   5846  N N   . TYR E 1 31  ? 108.396 25.626 147.201 1.00 58.60  ? 31  TYR E N   1 
ATOM   5847  C CA  . TYR E 1 31  ? 108.570 25.029 148.513 1.00 58.60  ? 31  TYR E CA  1 
ATOM   5848  C C   . TYR E 1 31  ? 109.287 23.675 148.430 1.00 58.60  ? 31  TYR E C   1 
ATOM   5849  O O   . TYR E 1 31  ? 109.057 22.896 147.506 1.00 58.60  ? 31  TYR E O   1 
ATOM   5850  C CB  . TYR E 1 31  ? 107.213 24.825 149.202 1.00 97.98  ? 31  TYR E CB  1 
ATOM   5851  C CG  . TYR E 1 31  ? 106.626 26.072 149.801 1.00 97.98  ? 31  TYR E CG  1 
ATOM   5852  C CD1 . TYR E 1 31  ? 105.606 26.765 149.161 1.00 97.98  ? 31  TYR E CD1 1 
ATOM   5853  C CD2 . TYR E 1 31  ? 107.107 26.574 151.003 1.00 97.98  ? 31  TYR E CD2 1 
ATOM   5854  C CE1 . TYR E 1 31  ? 105.078 27.934 149.705 1.00 97.98  ? 31  TYR E CE1 1 
ATOM   5855  C CE2 . TYR E 1 31  ? 106.590 27.741 151.555 1.00 97.98  ? 31  TYR E CE2 1 
ATOM   5856  C CZ  . TYR E 1 31  ? 105.576 28.415 150.901 1.00 97.98  ? 31  TYR E CZ  1 
ATOM   5857  O OH  . TYR E 1 31  ? 105.072 29.574 151.440 1.00 97.98  ? 31  TYR E OH  1 
ATOM   5858  N N   . THR E 1 32  ? 110.156 23.398 149.401 1.00 61.78  ? 32  THR E N   1 
ATOM   5859  C CA  . THR E 1 32  ? 110.864 22.124 149.465 1.00 61.78  ? 32  THR E CA  1 
ATOM   5860  C C   . THR E 1 32  ? 109.937 21.160 150.189 1.00 61.78  ? 32  THR E C   1 
ATOM   5861  O O   . THR E 1 32  ? 109.032 21.585 150.929 1.00 61.78  ? 32  THR E O   1 
ATOM   5862  C CB  . THR E 1 32  ? 112.155 22.240 150.273 1.00 63.59  ? 32  THR E CB  1 
ATOM   5863  O OG1 . THR E 1 32  ? 111.854 22.749 151.583 1.00 63.59  ? 32  THR E OG1 1 
ATOM   5864  C CG2 . THR E 1 32  ? 113.133 23.167 149.574 1.00 63.59  ? 32  THR E CG2 1 
ATOM   5865  N N   . ALA E 1 33  ? 110.164 19.868 149.986 1.00 51.72  ? 33  ALA E N   1 
ATOM   5866  C CA  . ALA E 1 33  ? 109.327 18.843 150.618 1.00 51.72  ? 33  ALA E CA  1 
ATOM   5867  C C   . ALA E 1 33  ? 109.210 19.021 152.129 1.00 51.72  ? 33  ALA E C   1 
ATOM   5868  O O   . ALA E 1 33  ? 108.128 18.838 152.710 1.00 51.72  ? 33  ALA E O   1 
ATOM   5869  C CB  . ALA E 1 33  ? 109.875 17.457 150.292 1.00 39.32  ? 33  ALA E CB  1 
ATOM   5870  N N   . GLU E 1 34  ? 110.329 19.388 152.755 1.00 69.32  ? 34  GLU E N   1 
ATOM   5871  C CA  . GLU E 1 34  ? 110.366 19.584 154.201 1.00 69.32  ? 34  GLU E CA  1 
ATOM   5872  C C   . GLU E 1 34  ? 109.475 20.749 154.645 1.00 69.32  ? 34  GLU E C   1 
ATOM   5873  O O   . GLU E 1 34  ? 108.601 20.588 155.523 1.00 69.32  ? 34  GLU E O   1 
ATOM   5874  C CB  . GLU E 1 34  ? 111.803 19.837 154.670 1.00 102.13 ? 34  GLU E CB  1 
ATOM   5875  C CG  . GLU E 1 34  ? 112.818 18.794 154.230 1.00 102.13 ? 34  GLU E CG  1 
ATOM   5876  C CD  . GLU E 1 34  ? 113.547 19.182 152.953 1.00 102.13 ? 34  GLU E CD  1 
ATOM   5877  O OE1 . GLU E 1 34  ? 114.257 20.216 152.955 1.00 102.13 ? 34  GLU E OE1 1 
ATOM   5878  O OE2 . GLU E 1 34  ? 113.414 18.453 151.948 1.00 102.13 ? 34  GLU E OE2 1 
ATOM   5879  N N   . GLU E 1 35  ? 109.694 21.915 154.029 1.00 53.60  ? 35  GLU E N   1 
ATOM   5880  C CA  . GLU E 1 35  ? 108.924 23.094 154.377 1.00 53.60  ? 35  GLU E CA  1 
ATOM   5881  C C   . GLU E 1 35  ? 107.460 22.889 154.042 1.00 53.60  ? 35  GLU E C   1 
ATOM   5882  O O   . GLU E 1 35  ? 106.571 23.260 154.827 1.00 53.60  ? 35  GLU E O   1 
ATOM   5883  C CB  . GLU E 1 35  ? 109.462 24.326 153.657 1.00 79.91  ? 35  GLU E CB  1 
ATOM   5884  C CG  . GLU E 1 35  ? 108.843 25.614 154.204 1.00 79.91  ? 35  GLU E CG  1 
ATOM   5885  C CD  . GLU E 1 35  ? 109.522 26.876 153.697 1.00 79.91  ? 35  GLU E CD  1 
ATOM   5886  O OE1 . GLU E 1 35  ? 109.125 27.972 154.147 1.00 79.91  ? 35  GLU E OE1 1 
ATOM   5887  O OE2 . GLU E 1 35  ? 110.448 26.774 152.856 1.00 79.91  ? 35  GLU E OE2 1 
ATOM   5888  N N   . TYR E 1 36  ? 107.204 22.288 152.881 1.00 53.47  ? 36  TYR E N   1 
ATOM   5889  C CA  . TYR E 1 36  ? 105.820 22.049 152.483 1.00 53.47  ? 36  TYR E CA  1 
ATOM   5890  C C   . TYR E 1 36  ? 105.051 21.271 153.566 1.00 53.47  ? 36  TYR E C   1 
ATOM   5891  O O   . TYR E 1 36  ? 104.006 21.713 154.073 1.00 53.47  ? 36  TYR E O   1 
ATOM   5892  C CB  . TYR E 1 36  ? 105.734 21.273 151.148 1.00 55.58  ? 36  TYR E CB  1 
ATOM   5893  C CG  . TYR E 1 36  ? 104.352 20.668 150.971 1.00 55.58  ? 36  TYR E CG  1 
ATOM   5894  C CD1 . TYR E 1 36  ? 103.231 21.481 150.766 1.00 55.58  ? 36  TYR E CD1 1 
ATOM   5895  C CD2 . TYR E 1 36  ? 104.138 19.310 151.213 1.00 55.58  ? 36  TYR E CD2 1 
ATOM   5896  C CE1 . TYR E 1 36  ? 101.939 20.955 150.833 1.00 55.58  ? 36  TYR E CE1 1 
ATOM   5897  C CE2 . TYR E 1 36  ? 102.858 18.783 151.281 1.00 55.58  ? 36  TYR E CE2 1 
ATOM   5898  C CZ  . TYR E 1 36  ? 101.766 19.609 151.098 1.00 55.58  ? 36  TYR E CZ  1 
ATOM   5899  O OH  . TYR E 1 36  ? 100.498 19.087 151.224 1.00 55.58  ? 36  TYR E OH  1 
ATOM   5900  N N   . GLN E 1 37  ? 105.588 20.106 153.910 1.00 82.17  ? 37  GLN E N   1 
ATOM   5901  C CA  . GLN E 1 37  ? 104.965 19.238 154.893 1.00 82.17  ? 37  GLN E CA  1 
ATOM   5902  C C   . GLN E 1 37  ? 104.757 19.928 156.239 1.00 82.17  ? 37  GLN E C   1 
ATOM   5903  O O   . GLN E 1 37  ? 103.673 19.843 156.838 1.00 82.17  ? 37  GLN E O   1 
ATOM   5904  C CB  . GLN E 1 37  ? 105.814 17.990 155.075 1.00 139.16 ? 37  GLN E CB  1 
ATOM   5905  C CG  . GLN E 1 37  ? 105.035 16.812 155.604 1.00 139.16 ? 37  GLN E CG  1 
ATOM   5906  C CD  . GLN E 1 37  ? 105.896 15.586 155.766 1.00 139.16 ? 37  GLN E CD  1 
ATOM   5907  O OE1 . GLN E 1 37  ? 105.388 14.475 155.902 1.00 139.16 ? 37  GLN E OE1 1 
ATOM   5908  N NE2 . GLN E 1 37  ? 107.211 15.779 155.761 1.00 139.16 ? 37  GLN E NE2 1 
ATOM   5909  N N   . ALA E 1 38  ? 105.794 20.611 156.718 1.00 58.44  ? 38  ALA E N   1 
ATOM   5910  C CA  . ALA E 1 38  ? 105.688 21.298 157.997 1.00 58.44  ? 38  ALA E CA  1 
ATOM   5911  C C   . ALA E 1 38  ? 104.508 22.271 157.990 1.00 58.44  ? 38  ALA E C   1 
ATOM   5912  O O   . ALA E 1 38  ? 103.577 22.169 158.821 1.00 58.44  ? 38  ALA E O   1 
ATOM   5913  C CB  . ALA E 1 38  ? 106.971 22.042 158.294 1.00 35.58  ? 38  ALA E CB  1 
ATOM   5914  N N   . ILE E 1 39  ? 104.552 23.197 157.029 1.00 53.50  ? 39  ILE E N   1 
ATOM   5915  C CA  . ILE E 1 39  ? 103.525 24.215 156.892 1.00 53.50  ? 39  ILE E CA  1 
ATOM   5916  C C   . ILE E 1 39  ? 102.160 23.603 156.668 1.00 53.50  ? 39  ILE E C   1 
ATOM   5917  O O   . ILE E 1 39  ? 101.172 24.047 157.258 1.00 53.50  ? 39  ILE E O   1 
ATOM   5918  C CB  . ILE E 1 39  ? 103.849 25.181 155.742 1.00 64.45  ? 39  ILE E CB  1 
ATOM   5919  C CG1 . ILE E 1 39  ? 105.091 26.005 156.095 1.00 64.45  ? 39  ILE E CG1 1 
ATOM   5920  C CG2 . ILE E 1 39  ? 102.648 26.089 155.480 1.00 64.45  ? 39  ILE E CG2 1 
ATOM   5921  C CD1 . ILE E 1 39  ? 105.687 26.800 154.938 1.00 64.45  ? 39  ILE E CD1 1 
ATOM   5922  N N   . GLN E 1 40  ? 102.103 22.580 155.822 1.00 52.92  ? 40  GLN E N   1 
ATOM   5923  C CA  . GLN E 1 40  ? 100.835 21.927 155.548 1.00 52.92  ? 40  GLN E CA  1 
ATOM   5924  C C   . GLN E 1 40  ? 100.202 21.392 156.842 1.00 52.92  ? 40  GLN E C   1 
ATOM   5925  O O   . GLN E 1 40  ? 98.988  21.518 157.052 1.00 52.92  ? 40  GLN E O   1 
ATOM   5926  C CB  . GLN E 1 40  ? 101.020 20.793 154.528 1.00 69.91  ? 40  GLN E CB  1 
ATOM   5927  C CG  . GLN E 1 40  ? 99.761  19.939 154.315 1.00 69.91  ? 40  GLN E CG  1 
ATOM   5928  C CD  . GLN E 1 40  ? 98.603  20.689 153.660 1.00 69.91  ? 40  GLN E CD  1 
ATOM   5929  O OE1 . GLN E 1 40  ? 98.541  21.917 153.686 1.00 69.91  ? 40  GLN E OE1 1 
ATOM   5930  N NE2 . GLN E 1 40  ? 97.668  19.940 153.082 1.00 69.91  ? 40  GLN E NE2 1 
ATOM   5931  N N   . LYS E 1 41  ? 101.023 20.809 157.715 1.00 97.32  ? 41  LYS E N   1 
ATOM   5932  C CA  . LYS E 1 41  ? 100.512 20.282 158.977 1.00 97.32  ? 41  LYS E CA  1 
ATOM   5933  C C   . LYS E 1 41  ? 100.143 21.430 159.903 1.00 97.32  ? 41  LYS E C   1 
ATOM   5934  O O   . LYS E 1 41  ? 99.018  21.506 160.406 1.00 97.32  ? 41  LYS E O   1 
ATOM   5935  C CB  . LYS E 1 41  ? 101.559 19.401 159.651 1.00 121.21 ? 41  LYS E CB  1 
ATOM   5936  C CG  . LYS E 1 41  ? 101.887 18.142 158.882 1.00 121.21 ? 41  LYS E CG  1 
ATOM   5937  C CD  . LYS E 1 41  ? 102.778 17.220 159.693 1.00 121.21 ? 41  LYS E CD  1 
ATOM   5938  C CE  . LYS E 1 41  ? 103.146 15.980 158.900 1.00 121.21 ? 41  LYS E CE  1 
ATOM   5939  N NZ  . LYS E 1 41  ? 101.937 15.281 158.397 1.00 121.21 ? 41  LYS E NZ  1 
ATOM   5940  N N   . ALA E 1 42  ? 101.107 22.322 160.105 1.00 84.49  ? 42  ALA E N   1 
ATOM   5941  C CA  . ALA E 1 42  ? 100.939 23.486 160.960 1.00 84.49  ? 42  ALA E CA  1 
ATOM   5942  C C   . ALA E 1 42  ? 99.638  24.256 160.724 1.00 84.49  ? 42  ALA E C   1 
ATOM   5943  O O   . ALA E 1 42  ? 98.884  24.529 161.663 1.00 84.49  ? 42  ALA E O   1 
ATOM   5944  C CB  . ALA E 1 42  ? 102.125 24.410 160.777 1.00 37.84  ? 42  ALA E CB  1 
ATOM   5945  N N   . LEU E 1 43  ? 99.377  24.607 159.472 1.00 85.67  ? 43  LEU E N   1 
ATOM   5946  C CA  . LEU E 1 43  ? 98.175  25.362 159.137 1.00 85.67  ? 43  LEU E CA  1 
ATOM   5947  C C   . LEU E 1 43  ? 96.881  24.726 159.632 1.00 85.67  ? 43  LEU E C   1 
ATOM   5948  O O   . LEU E 1 43  ? 95.879  25.426 159.812 1.00 85.67  ? 43  LEU E O   1 
ATOM   5949  C CB  . LEU E 1 43  ? 98.107  25.592 157.619 1.00 67.36  ? 43  LEU E CB  1 
ATOM   5950  C CG  . LEU E 1 43  ? 99.084  26.649 157.082 1.00 67.36  ? 43  LEU E CG  1 
ATOM   5951  C CD1 . LEU E 1 43  ? 99.170  26.595 155.576 1.00 67.36  ? 43  LEU E CD1 1 
ATOM   5952  C CD2 . LEU E 1 43  ? 98.618  28.017 157.549 1.00 67.36  ? 43  LEU E CD2 1 
ATOM   5953  N N   . ARG E 1 44  ? 96.904  23.412 159.861 1.00 88.07  ? 44  ARG E N   1 
ATOM   5954  C CA  . ARG E 1 44  ? 95.722  22.686 160.334 1.00 88.07  ? 44  ARG E CA  1 
ATOM   5955  C C   . ARG E 1 44  ? 95.320  23.058 161.757 1.00 88.07  ? 44  ARG E C   1 
ATOM   5956  O O   . ARG E 1 44  ? 94.131  23.078 162.076 1.00 88.07  ? 44  ARG E O   1 
ATOM   5957  C CB  . ARG E 1 44  ? 95.948  21.168 160.247 1.00 73.27  ? 44  ARG E CB  1 
ATOM   5958  C CG  . ARG E 1 44  ? 95.670  20.564 158.873 1.00 73.27  ? 44  ARG E CG  1 
ATOM   5959  C CD  . ARG E 1 44  ? 95.648  19.047 158.925 1.00 73.27  ? 44  ARG E CD  1 
ATOM   5960  N NE  . ARG E 1 44  ? 96.961  18.446 158.718 1.00 73.27  ? 44  ARG E NE  1 
ATOM   5961  C CZ  . ARG E 1 44  ? 97.378  17.965 157.550 1.00 73.27  ? 44  ARG E CZ  1 
ATOM   5962  N NH1 . ARG E 1 44  ? 96.571  18.022 156.499 1.00 73.27  ? 44  ARG E NH1 1 
ATOM   5963  N NH2 . ARG E 1 44  ? 98.592  17.429 157.423 1.00 73.27  ? 44  ARG E NH2 1 
ATOM   5964  N N   . GLN E 1 45  ? 96.316  23.353 162.597 1.00 97.49  ? 45  GLN E N   1 
ATOM   5965  C CA  . GLN E 1 45  ? 96.109  23.727 164.000 1.00 97.49  ? 45  GLN E CA  1 
ATOM   5966  C C   . GLN E 1 45  ? 94.996  24.737 164.194 1.00 97.49  ? 45  GLN E C   1 
ATOM   5967  O O   . GLN E 1 45  ? 94.771  25.583 163.339 1.00 97.49  ? 45  GLN E O   1 
ATOM   5968  C CB  . GLN E 1 45  ? 97.377  24.347 164.578 1.00 85.69  ? 45  GLN E CB  1 
ATOM   5969  C CG  . GLN E 1 45  ? 98.554  23.425 164.729 1.00 85.69  ? 45  GLN E CG  1 
ATOM   5970  C CD  . GLN E 1 45  ? 99.804  24.187 165.136 1.00 85.69  ? 45  GLN E CD  1 
ATOM   5971  O OE1 . GLN E 1 45  ? 100.369 24.941 164.343 1.00 85.69  ? 45  GLN E OE1 1 
ATOM   5972  N NE2 . GLN E 1 45  ? 100.231 24.011 166.382 1.00 85.69  ? 45  GLN E NE2 1 
ATOM   5973  N N   . ARG E 1 46  ? 94.302  24.659 165.321 1.00 104.44 ? 46  ARG E N   1 
ATOM   5974  C CA  . ARG E 1 46  ? 93.252  25.625 165.610 1.00 104.44 ? 46  ARG E CA  1 
ATOM   5975  C C   . ARG E 1 46  ? 93.868  26.634 166.576 1.00 104.44 ? 46  ARG E C   1 
ATOM   5976  O O   . ARG E 1 46  ? 94.771  26.284 167.334 1.00 104.44 ? 46  ARG E O   1 
ATOM   5977  C CB  . ARG E 1 46  ? 92.048  24.938 166.244 1.00 97.68  ? 46  ARG E CB  1 
ATOM   5978  C CG  . ARG E 1 46  ? 91.246  24.097 165.270 1.00 97.68  ? 46  ARG E CG  1 
ATOM   5979  C CD  . ARG E 1 46  ? 89.779  24.252 165.589 1.00 97.68  ? 46  ARG E CD  1 
ATOM   5980  N NE  . ARG E 1 46  ? 88.883  23.647 164.609 1.00 97.68  ? 46  ARG E NE  1 
ATOM   5981  C CZ  . ARG E 1 46  ? 88.790  22.343 164.376 1.00 97.68  ? 46  ARG E CZ  1 
ATOM   5982  N NH1 . ARG E 1 46  ? 89.551  21.489 165.050 1.00 97.68  ? 46  ARG E NH1 1 
ATOM   5983  N NH2 . ARG E 1 46  ? 87.909  21.892 163.489 1.00 97.68  ? 46  ARG E NH2 1 
ATOM   5984  N N   . LEU E 1 47  ? 93.411  27.882 166.548 1.00 125.69 ? 47  LEU E N   1 
ATOM   5985  C CA  . LEU E 1 47  ? 93.985  28.883 167.441 1.00 125.69 ? 47  LEU E CA  1 
ATOM   5986  C C   . LEU E 1 47  ? 93.488  28.771 168.864 1.00 125.69 ? 47  LEU E C   1 
ATOM   5987  O O   . LEU E 1 47  ? 92.327  28.448 169.103 1.00 125.69 ? 47  LEU E O   1 
ATOM   5988  C CB  . LEU E 1 47  ? 93.706  30.301 166.942 1.00 85.81  ? 47  LEU E CB  1 
ATOM   5989  C CG  . LEU E 1 47  ? 94.453  30.776 165.698 1.00 85.81  ? 47  LEU E CG  1 
ATOM   5990  C CD1 . LEU E 1 47  ? 95.951  30.492 165.834 1.00 85.81  ? 47  LEU E CD1 1 
ATOM   5991  C CD2 . LEU E 1 47  ? 93.880  30.069 164.492 1.00 85.81  ? 47  LEU E CD2 1 
ATOM   5992  N N   . GLY E 1 48  ? 94.381  29.040 169.810 1.00 174.82 ? 48  GLY E N   1 
ATOM   5993  C CA  . GLY E 1 48  ? 94.005  28.986 171.207 1.00 174.82 ? 48  GLY E CA  1 
ATOM   5994  C C   . GLY E 1 48  ? 93.238  30.243 171.568 1.00 174.82 ? 48  GLY E C   1 
ATOM   5995  O O   . GLY E 1 48  ? 93.110  31.141 170.736 1.00 174.82 ? 48  GLY E O   1 
ATOM   5996  N N   . PRO E 1 49  ? 92.698  30.338 172.792 1.00 91.59  ? 49  PRO E N   1 
ATOM   5997  C CA  . PRO E 1 49  ? 91.945  31.527 173.213 1.00 91.59  ? 49  PRO E CA  1 
ATOM   5998  C C   . PRO E 1 49  ? 92.825  32.777 173.321 1.00 91.59  ? 49  PRO E C   1 
ATOM   5999  O O   . PRO E 1 49  ? 92.313  33.882 173.491 1.00 91.59  ? 49  PRO E O   1 
ATOM   6000  C CB  . PRO E 1 49  ? 91.370  31.108 174.566 1.00 200.00 ? 49  PRO E CB  1 
ATOM   6001  C CG  . PRO E 1 49  ? 91.227  29.619 174.428 1.00 200.00 ? 49  PRO E CG  1 
ATOM   6002  C CD  . PRO E 1 49  ? 92.528  29.246 173.766 1.00 200.00 ? 49  PRO E CD  1 
ATOM   6003  N N   . GLU E 1 50  ? 94.143  32.594 173.223 1.00 116.82 ? 50  GLU E N   1 
ATOM   6004  C CA  . GLU E 1 50  ? 95.095  33.702 173.306 1.00 116.82 ? 50  GLU E CA  1 
ATOM   6005  C C   . GLU E 1 50  ? 95.070  34.545 172.041 1.00 116.82 ? 50  GLU E C   1 
ATOM   6006  O O   . GLU E 1 50  ? 95.743  35.571 171.963 1.00 116.82 ? 50  GLU E O   1 
ATOM   6007  C CB  . GLU E 1 50  ? 96.531  33.197 173.489 1.00 139.38 ? 50  GLU E CB  1 
ATOM   6008  C CG  . GLU E 1 50  ? 96.724  32.200 174.597 1.00 139.38 ? 50  GLU E CG  1 
ATOM   6009  C CD  . GLU E 1 50  ? 96.446  30.777 174.156 1.00 139.38 ? 50  GLU E CD  1 
ATOM   6010  O OE1 . GLU E 1 50  ? 95.362  30.518 173.593 1.00 139.38 ? 50  GLU E OE1 1 
ATOM   6011  O OE2 . GLU E 1 50  ? 97.319  29.913 174.378 1.00 139.38 ? 50  GLU E OE2 1 
ATOM   6012  N N   . TYR E 1 51  ? 94.301  34.112 171.049 1.00 72.74  ? 51  TYR E N   1 
ATOM   6013  C CA  . TYR E 1 51  ? 94.230  34.823 169.781 1.00 72.74  ? 51  TYR E CA  1 
ATOM   6014  C C   . TYR E 1 51  ? 92.884  35.504 169.558 1.00 72.74  ? 51  TYR E C   1 
ATOM   6015  O O   . TYR E 1 51  ? 92.807  36.592 168.976 1.00 72.74  ? 51  TYR E O   1 
ATOM   6016  C CB  . TYR E 1 51  ? 94.534  33.850 168.628 1.00 56.81  ? 51  TYR E CB  1 
ATOM   6017  C CG  . TYR E 1 51  ? 96.001  33.428 168.510 1.00 56.81  ? 51  TYR E CG  1 
ATOM   6018  C CD1 . TYR E 1 51  ? 96.442  32.182 168.976 1.00 56.81  ? 51  TYR E CD1 1 
ATOM   6019  C CD2 . TYR E 1 51  ? 96.942  34.275 167.919 1.00 56.81  ? 51  TYR E CD2 1 
ATOM   6020  C CE1 . TYR E 1 51  ? 97.787  31.792 168.855 1.00 56.81  ? 51  TYR E CE1 1 
ATOM   6021  C CE2 . TYR E 1 51  ? 98.283  33.895 167.794 1.00 56.81  ? 51  TYR E CE2 1 
ATOM   6022  C CZ  . TYR E 1 51  ? 98.701  32.653 168.266 1.00 56.81  ? 51  TYR E CZ  1 
ATOM   6023  O OH  . TYR E 1 51  ? 100.036 32.298 168.166 1.00 56.81  ? 51  TYR E OH  1 
ATOM   6024  N N   . ILE E 1 52  ? 91.828  34.873 170.047 1.00 105.63 ? 52  ILE E N   1 
ATOM   6025  C CA  . ILE E 1 52  ? 90.486  35.402 169.876 1.00 105.63 ? 52  ILE E CA  1 
ATOM   6026  C C   . ILE E 1 52  ? 90.197  36.648 170.712 1.00 105.63 ? 52  ILE E C   1 
ATOM   6027  O O   . ILE E 1 52  ? 90.827  36.875 171.744 1.00 105.63 ? 52  ILE E O   1 
ATOM   6028  C CB  . ILE E 1 52  ? 89.444  34.325 170.217 1.00 88.76  ? 52  ILE E CB  1 
ATOM   6029  C CG1 . ILE E 1 52  ? 89.893  32.980 169.644 1.00 88.76  ? 52  ILE E CG1 1 
ATOM   6030  C CG2 . ILE E 1 52  ? 88.083  34.706 169.653 1.00 88.76  ? 52  ILE E CG2 1 
ATOM   6031  C CD1 . ILE E 1 52  ? 90.202  33.010 168.168 1.00 88.76  ? 52  ILE E CD1 1 
ATOM   6032  N N   . SER E 1 53  ? 89.244  37.454 170.245 1.00 94.23  ? 53  SER E N   1 
ATOM   6033  C CA  . SER E 1 53  ? 88.805  38.681 170.922 1.00 94.23  ? 53  SER E CA  1 
ATOM   6034  C C   . SER E 1 53  ? 87.308  38.774 170.691 1.00 94.23  ? 53  SER E C   1 
ATOM   6035  O O   . SER E 1 53  ? 86.715  37.879 170.088 1.00 94.23  ? 53  SER E O   1 
ATOM   6036  C CB  . SER E 1 53  ? 89.457  39.929 170.322 1.00 54.79  ? 53  SER E CB  1 
ATOM   6037  O OG  . SER E 1 53  ? 90.865  39.908 170.450 1.00 54.79  ? 53  SER E OG  1 
ATOM   6038  N N   . SER E 1 54  ? 86.692  39.854 171.155 1.00 90.79  ? 54  SER E N   1 
ATOM   6039  C CA  . SER E 1 54  ? 85.259  40.012 170.949 1.00 90.79  ? 54  SER E CA  1 
ATOM   6040  C C   . SER E 1 54  ? 84.789  41.460 170.991 1.00 90.79  ? 54  SER E C   1 
ATOM   6041  O O   . SER E 1 54  ? 85.462  42.347 171.528 1.00 90.79  ? 54  SER E O   1 
ATOM   6042  C CB  . SER E 1 54  ? 84.468  39.180 171.963 1.00 165.80 ? 54  SER E CB  1 
ATOM   6043  O OG  . SER E 1 54  ? 84.721  39.599 173.289 1.00 165.80 ? 54  SER E OG  1 
ATOM   6044  N N   . ARG E 1 55  ? 83.625  41.675 170.390 1.00 82.66  ? 55  ARG E N   1 
ATOM   6045  C CA  . ARG E 1 55  ? 82.991  42.983 170.301 1.00 82.66  ? 55  ARG E CA  1 
ATOM   6046  C C   . ARG E 1 55  ? 81.517  42.708 170.465 1.00 82.66  ? 55  ARG E C   1 
ATOM   6047  O O   . ARG E 1 55  ? 81.067  41.575 170.276 1.00 82.66  ? 55  ARG E O   1 
ATOM   6048  C CB  . ARG E 1 55  ? 83.213  43.612 168.923 1.00 136.17 ? 55  ARG E CB  1 
ATOM   6049  C CG  . ARG E 1 55  ? 84.617  44.118 168.631 1.00 136.17 ? 55  ARG E CG  1 
ATOM   6050  C CD  . ARG E 1 55  ? 84.938  43.907 167.159 1.00 136.17 ? 55  ARG E CD  1 
ATOM   6051  N NE  . ARG E 1 55  ? 83.753  44.049 166.316 1.00 136.17 ? 55  ARG E NE  1 
ATOM   6052  C CZ  . ARG E 1 55  ? 83.684  43.653 165.048 1.00 136.17 ? 55  ARG E CZ  1 
ATOM   6053  N NH1 . ARG E 1 55  ? 84.735  43.086 164.470 1.00 136.17 ? 55  ARG E NH1 1 
ATOM   6054  N NH2 . ARG E 1 55  ? 82.562  43.822 164.357 1.00 136.17 ? 55  ARG E NH2 1 
ATOM   6055  N N   . MET E 1 56  ? 80.760  43.741 170.803 1.00 140.41 ? 56  MET E N   1 
ATOM   6056  C CA  . MET E 1 56  ? 79.334  43.564 170.992 1.00 140.41 ? 56  MET E CA  1 
ATOM   6057  C C   . MET E 1 56  ? 78.577  44.005 169.760 1.00 140.41 ? 56  MET E C   1 
ATOM   6058  O O   . MET E 1 56  ? 78.388  45.198 169.524 1.00 140.41 ? 56  MET E O   1 
ATOM   6059  C CB  . MET E 1 56  ? 78.858  44.350 172.212 1.00 200.00 ? 56  MET E CB  1 
ATOM   6060  C CG  . MET E 1 56  ? 77.648  43.727 172.873 1.00 200.00 ? 56  MET E CG  1 
ATOM   6061  S SD  . MET E 1 56  ? 77.893  41.948 173.084 1.00 200.00 ? 56  MET E SD  1 
ATOM   6062  C CE  . MET E 1 56  ? 79.208  41.920 174.327 1.00 200.00 ? 56  MET E CE  1 
ATOM   6063  N N   . ALA E 1 57  ? 78.156  43.026 168.969 1.00 138.31 ? 57  ALA E N   1 
ATOM   6064  C CA  . ALA E 1 57  ? 77.416  43.301 167.751 1.00 138.31 ? 57  ALA E CA  1 
ATOM   6065  C C   . ALA E 1 57  ? 76.274  44.252 168.065 1.00 138.31 ? 57  ALA E C   1 
ATOM   6066  O O   . ALA E 1 57  ? 75.564  44.072 169.055 1.00 138.31 ? 57  ALA E O   1 
ATOM   6067  C CB  . ALA E 1 57  ? 76.875  42.004 167.168 1.00 139.16 ? 57  ALA E CB  1 
ATOM   6068  N N   . GLY E 1 58  ? 76.109  45.272 167.230 1.00 164.81 ? 58  GLY E N   1 
ATOM   6069  C CA  . GLY E 1 58  ? 75.037  46.224 167.446 1.00 164.81 ? 58  GLY E CA  1 
ATOM   6070  C C   . GLY E 1 58  ? 73.703  45.505 167.512 1.00 164.81 ? 58  GLY E C   1 
ATOM   6071  O O   . GLY E 1 58  ? 73.108  45.194 166.479 1.00 164.81 ? 58  GLY E O   1 
ATOM   6072  N N   . GLY E 1 59  ? 73.235  45.237 168.728 1.00 198.22 ? 59  GLY E N   1 
ATOM   6073  C CA  . GLY E 1 59  ? 71.973  44.541 168.903 1.00 198.22 ? 59  GLY E CA  1 
ATOM   6074  C C   . GLY E 1 59  ? 72.190  43.041 168.923 1.00 198.22 ? 59  GLY E C   1 
ATOM   6075  O O   . GLY E 1 59  ? 71.508  42.311 169.641 1.00 198.22 ? 59  GLY E O   1 
ATOM   6076  N N   . GLY E 1 60  ? 73.153  42.585 168.128 1.00 200.00 ? 60  GLY E N   1 
ATOM   6077  C CA  . GLY E 1 60  ? 73.456  41.169 168.066 1.00 200.00 ? 60  GLY E CA  1 
ATOM   6078  C C   . GLY E 1 60  ? 74.193  40.696 169.303 1.00 200.00 ? 60  GLY E C   1 
ATOM   6079  O O   . GLY E 1 60  ? 74.269  41.412 170.302 1.00 200.00 ? 60  GLY E O   1 
ATOM   6080  N N   . GLN E 1 61  ? 74.743  39.489 169.232 1.00 143.78 ? 61  GLN E N   1 
ATOM   6081  C CA  . GLN E 1 61  ? 75.471  38.912 170.355 1.00 143.78 ? 61  GLN E CA  1 
ATOM   6082  C C   . GLN E 1 61  ? 76.946  39.298 170.358 1.00 143.78 ? 61  GLN E C   1 
ATOM   6083  O O   . GLN E 1 61  ? 77.343  40.336 169.822 1.00 143.78 ? 61  GLN E O   1 
ATOM   6084  C CB  . GLN E 1 61  ? 75.362  37.380 170.340 1.00 200.00 ? 61  GLN E CB  1 
ATOM   6085  C CG  . GLN E 1 61  ? 73.940  36.822 170.343 1.00 200.00 ? 61  GLN E CG  1 
ATOM   6086  C CD  . GLN E 1 61  ? 73.346  36.691 168.950 1.00 200.00 ? 61  GLN E CD  1 
ATOM   6087  O OE1 . GLN E 1 61  ? 73.186  37.677 168.231 1.00 200.00 ? 61  GLN E OE1 1 
ATOM   6088  N NE2 . GLN E 1 61  ? 73.014  35.462 168.563 1.00 200.00 ? 61  GLN E NE2 1 
ATOM   6089  N N   . LYS E 1 62  ? 77.746  38.441 170.980 1.00 190.39 ? 62  LYS E N   1 
ATOM   6090  C CA  . LYS E 1 62  ? 79.182  38.631 171.080 1.00 190.39 ? 62  LYS E CA  1 
ATOM   6091  C C   . LYS E 1 62  ? 79.831  38.078 169.817 1.00 190.39 ? 62  LYS E C   1 
ATOM   6092  O O   . LYS E 1 62  ? 79.640  36.911 169.475 1.00 190.39 ? 62  LYS E O   1 
ATOM   6093  C CB  . LYS E 1 62  ? 79.703  37.887 172.308 1.00 149.89 ? 62  LYS E CB  1 
ATOM   6094  C CG  . LYS E 1 62  ? 81.211  37.814 172.423 1.00 149.89 ? 62  LYS E CG  1 
ATOM   6095  C CD  . LYS E 1 62  ? 81.599  36.893 173.571 1.00 149.89 ? 62  LYS E CD  1 
ATOM   6096  C CE  . LYS E 1 62  ? 83.102  36.670 173.642 1.00 149.89 ? 62  LYS E CE  1 
ATOM   6097  N NZ  . LYS E 1 62  ? 83.473  35.733 174.745 1.00 149.89 ? 62  LYS E NZ  1 
ATOM   6098  N N   . VAL E 1 63  ? 80.588  38.917 169.118 1.00 124.13 ? 63  VAL E N   1 
ATOM   6099  C CA  . VAL E 1 63  ? 81.255  38.484 167.898 1.00 124.13 ? 63  VAL E CA  1 
ATOM   6100  C C   . VAL E 1 63  ? 82.755  38.331 168.121 1.00 124.13 ? 63  VAL E C   1 
ATOM   6101  O O   . VAL E 1 63  ? 83.441  39.270 168.530 1.00 124.13 ? 63  VAL E O   1 
ATOM   6102  C CB  . VAL E 1 63  ? 81.014  39.476 166.748 1.00 121.87 ? 63  VAL E CB  1 
ATOM   6103  C CG1 . VAL E 1 63  ? 81.742  39.006 165.502 1.00 121.87 ? 63  VAL E CG1 1 
ATOM   6104  C CG2 . VAL E 1 63  ? 79.523  39.597 166.470 1.00 121.87 ? 63  VAL E CG2 1 
ATOM   6105  N N   . CYS E 1 64  ? 83.258  37.135 167.849 1.00 102.96 ? 64  CYS E N   1 
ATOM   6106  C CA  . CYS E 1 64  ? 84.670  36.850 168.034 1.00 102.96 ? 64  CYS E CA  1 
ATOM   6107  C C   . CYS E 1 64  ? 85.438  37.203 166.778 1.00 102.96 ? 64  CYS E C   1 
ATOM   6108  O O   . CYS E 1 64  ? 84.885  37.167 165.683 1.00 102.96 ? 64  CYS E O   1 
ATOM   6109  C CB  . CYS E 1 64  ? 84.849  35.372 168.368 1.00 132.59 ? 64  CYS E CB  1 
ATOM   6110  S SG  . CYS E 1 64  ? 83.819  34.838 169.753 1.00 132.59 ? 64  CYS E SG  1 
ATOM   6111  N N   . TYR E 1 65  ? 86.711  37.547 166.937 1.00 82.49  ? 65  TYR E N   1 
ATOM   6112  C CA  . TYR E 1 65  ? 87.552  37.912 165.802 1.00 82.49  ? 65  TYR E CA  1 
ATOM   6113  C C   . TYR E 1 65  ? 89.004  37.903 166.232 1.00 82.49  ? 65  TYR E C   1 
ATOM   6114  O O   . TYR E 1 65  ? 89.296  37.839 167.416 1.00 82.49  ? 65  TYR E O   1 
ATOM   6115  C CB  . TYR E 1 65  ? 87.182  39.306 165.302 1.00 126.70 ? 65  TYR E CB  1 
ATOM   6116  C CG  . TYR E 1 65  ? 87.601  40.406 166.242 1.00 126.70 ? 65  TYR E CG  1 
ATOM   6117  C CD1 . TYR E 1 65  ? 88.887  40.947 166.189 1.00 126.70 ? 65  TYR E CD1 1 
ATOM   6118  C CD2 . TYR E 1 65  ? 86.720  40.890 167.208 1.00 126.70 ? 65  TYR E CD2 1 
ATOM   6119  C CE1 . TYR E 1 65  ? 89.287  41.948 167.075 1.00 126.70 ? 65  TYR E CE1 1 
ATOM   6120  C CE2 . TYR E 1 65  ? 87.109  41.886 168.101 1.00 126.70 ? 65  TYR E CE2 1 
ATOM   6121  C CZ  . TYR E 1 65  ? 88.391  42.413 168.030 1.00 126.70 ? 65  TYR E CZ  1 
ATOM   6122  O OH  . TYR E 1 65  ? 88.768  43.404 168.908 1.00 126.70 ? 65  TYR E OH  1 
ATOM   6123  N N   . ILE E 1 66  ? 89.917  37.978 165.275 1.00 74.16  ? 66  ILE E N   1 
ATOM   6124  C CA  . ILE E 1 66  ? 91.332  37.981 165.600 1.00 74.16  ? 66  ILE E CA  1 
ATOM   6125  C C   . ILE E 1 66  ? 91.889  39.338 165.245 1.00 74.16  ? 66  ILE E C   1 
ATOM   6126  O O   . ILE E 1 66  ? 91.696  39.831 164.137 1.00 74.16  ? 66  ILE E O   1 
ATOM   6127  C CB  . ILE E 1 66  ? 92.095  36.902 164.809 1.00 80.43  ? 66  ILE E CB  1 
ATOM   6128  C CG1 . ILE E 1 66  ? 91.411  35.549 165.019 1.00 80.43  ? 66  ILE E CG1 1 
ATOM   6129  C CG2 . ILE E 1 66  ? 93.568  36.870 165.238 1.00 80.43  ? 66  ILE E CG2 1 
ATOM   6130  C CD1 . ILE E 1 66  ? 92.001  34.417 164.203 1.00 80.43  ? 66  ILE E CD1 1 
ATOM   6131  N N   . GLU E 1 67  ? 92.579  39.950 166.193 1.00 98.59  ? 67  GLU E N   1 
ATOM   6132  C CA  . GLU E 1 67  ? 93.149  41.257 165.947 1.00 98.59  ? 67  GLU E CA  1 
ATOM   6133  C C   . GLU E 1 67  ? 94.191  41.182 164.830 1.00 98.59  ? 67  GLU E C   1 
ATOM   6134  O O   . GLU E 1 67  ? 94.902  40.186 164.690 1.00 98.59  ? 67  GLU E O   1 
ATOM   6135  C CB  . GLU E 1 67  ? 93.763  41.811 167.239 1.00 168.55 ? 67  GLU E CB  1 
ATOM   6136  C CG  . GLU E 1 67  ? 92.734  42.041 168.350 1.00 168.55 ? 67  GLU E CG  1 
ATOM   6137  C CD  . GLU E 1 67  ? 93.331  42.648 169.610 1.00 168.55 ? 67  GLU E CD  1 
ATOM   6138  O OE1 . GLU E 1 67  ? 93.863  43.775 169.544 1.00 168.55 ? 67  GLU E OE1 1 
ATOM   6139  O OE2 . GLU E 1 67  ? 93.264  41.997 170.672 1.00 168.55 ? 67  GLU E OE2 1 
ATOM   6140  N N   . GLY E 1 68  ? 94.251  42.249 164.038 1.00 81.33  ? 68  GLY E N   1 
ATOM   6141  C CA  . GLY E 1 68  ? 95.182  42.337 162.931 1.00 81.33  ? 68  GLY E CA  1 
ATOM   6142  C C   . GLY E 1 68  ? 96.634  41.983 163.203 1.00 81.33  ? 68  GLY E C   1 
ATOM   6143  O O   . GLY E 1 68  ? 97.181  41.101 162.544 1.00 81.33  ? 68  GLY E O   1 
ATOM   6144  N N   . HIS E 1 69  ? 97.277  42.659 164.149 1.00 78.09  ? 69  HIS E N   1 
ATOM   6145  C CA  . HIS E 1 69  ? 98.682  42.369 164.432 1.00 78.09  ? 69  HIS E CA  1 
ATOM   6146  C C   . HIS E 1 69  ? 98.903  40.885 164.735 1.00 78.09  ? 69  HIS E C   1 
ATOM   6147  O O   . HIS E 1 69  ? 100.007 40.366 164.540 1.00 78.09  ? 69  HIS E O   1 
ATOM   6148  C CB  . HIS E 1 69  ? 99.190  43.224 165.600 1.00 174.53 ? 69  HIS E CB  1 
ATOM   6149  C CG  . HIS E 1 69  ? 98.542  42.907 166.912 1.00 174.53 ? 69  HIS E CG  1 
ATOM   6150  N ND1 . HIS E 1 69  ? 97.218  43.186 167.178 1.00 174.53 ? 69  HIS E ND1 1 
ATOM   6151  C CD2 . HIS E 1 69  ? 99.037  42.330 168.033 1.00 174.53 ? 69  HIS E CD2 1 
ATOM   6152  C CE1 . HIS E 1 69  ? 96.926  42.795 168.406 1.00 174.53 ? 69  HIS E CE1 1 
ATOM   6153  N NE2 . HIS E 1 69  ? 98.012  42.272 168.947 1.00 174.53 ? 69  HIS E NE2 1 
ATOM   6154  N N   . ARG E 1 70  ? 97.854  40.209 165.211 1.00 94.90  ? 70  ARG E N   1 
ATOM   6155  C CA  . ARG E 1 70  ? 97.933  38.781 165.527 1.00 94.90  ? 70  ARG E CA  1 
ATOM   6156  C C   . ARG E 1 70  ? 98.162  38.018 164.235 1.00 94.90  ? 70  ARG E C   1 
ATOM   6157  O O   . ARG E 1 70  ? 99.199  37.367 164.046 1.00 94.90  ? 70  ARG E O   1 
ATOM   6158  C CB  . ARG E 1 70  ? 96.630  38.299 166.170 1.00 130.65 ? 70  ARG E CB  1 
ATOM   6159  C CG  . ARG E 1 70  ? 96.399  38.818 167.580 1.00 130.65 ? 70  ARG E CG  1 
ATOM   6160  C CD  . ARG E 1 70  ? 97.215  38.050 168.627 1.00 130.65 ? 70  ARG E CD  1 
ATOM   6161  N NE  . ARG E 1 70  ? 97.264  38.763 169.903 1.00 130.65 ? 70  ARG E NE  1 
ATOM   6162  C CZ  . ARG E 1 70  ? 96.193  39.177 170.573 1.00 130.65 ? 70  ARG E CZ  1 
ATOM   6163  N NH1 . ARG E 1 70  ? 94.976  38.945 170.092 1.00 130.65 ? 70  ARG E NH1 1 
ATOM   6164  N NH2 . ARG E 1 70  ? 96.340  39.842 171.713 1.00 130.65 ? 70  ARG E NH2 1 
ATOM   6165  N N   . VAL E 1 71  ? 97.176  38.116 163.348 1.00 63.25  ? 71  VAL E N   1 
ATOM   6166  C CA  . VAL E 1 71  ? 97.216  37.466 162.046 1.00 63.25  ? 71  VAL E CA  1 
ATOM   6167  C C   . VAL E 1 71  ? 98.522  37.796 161.327 1.00 63.25  ? 71  VAL E C   1 
ATOM   6168  O O   . VAL E 1 71  ? 99.108  36.939 160.675 1.00 63.25  ? 71  VAL E O   1 
ATOM   6169  C CB  . VAL E 1 71  ? 96.018  37.908 161.173 1.00 66.13  ? 71  VAL E CB  1 
ATOM   6170  C CG1 . VAL E 1 71  ? 96.055  37.189 159.840 1.00 66.13  ? 71  VAL E CG1 1 
ATOM   6171  C CG2 . VAL E 1 71  ? 94.700  37.615 161.897 1.00 66.13  ? 71  VAL E CG2 1 
ATOM   6172  N N   . ILE E 1 72  ? 98.989  39.028 161.450 1.00 56.85  ? 72  ILE E N   1 
ATOM   6173  C CA  . ILE E 1 72  ? 100.231 39.374 160.786 1.00 56.85  ? 72  ILE E CA  1 
ATOM   6174  C C   . ILE E 1 72  ? 101.380 38.530 161.321 1.00 56.85  ? 72  ILE E C   1 
ATOM   6175  O O   . ILE E 1 72  ? 102.158 37.952 160.547 1.00 56.85  ? 72  ILE E O   1 
ATOM   6176  C CB  . ILE E 1 72  ? 100.605 40.866 160.967 1.00 41.82  ? 72  ILE E CB  1 
ATOM   6177  C CG1 . ILE E 1 72  ? 99.526  41.744 160.341 1.00 41.82  ? 72  ILE E CG1 1 
ATOM   6178  C CG2 . ILE E 1 72  ? 102.001 41.138 160.353 1.00 41.82  ? 72  ILE E CG2 1 
ATOM   6179  C CD1 . ILE E 1 72  ? 99.829  43.233 160.381 1.00 41.82  ? 72  ILE E CD1 1 
ATOM   6180  N N   . ASN E 1 73  ? 101.499 38.460 162.644 1.00 71.52  ? 73  ASN E N   1 
ATOM   6181  C CA  . ASN E 1 73  ? 102.585 37.690 163.221 1.00 71.52  ? 73  ASN E CA  1 
ATOM   6182  C C   . ASN E 1 73  ? 102.431 36.221 162.883 1.00 71.52  ? 73  ASN E C   1 
ATOM   6183  O O   . ASN E 1 73  ? 103.402 35.558 162.516 1.00 71.52  ? 73  ASN E O   1 
ATOM   6184  C CB  . ASN E 1 73  ? 102.662 37.916 164.731 1.00 89.70  ? 73  ASN E CB  1 
ATOM   6185  C CG  . ASN E 1 73  ? 103.338 39.233 165.080 1.00 89.70  ? 73  ASN E CG  1 
ATOM   6186  O OD1 . ASN E 1 73  ? 104.416 39.552 164.562 1.00 89.70  ? 73  ASN E OD1 1 
ATOM   6187  N ND2 . ASN E 1 73  ? 102.717 39.998 165.964 1.00 89.70  ? 73  ASN E ND2 1 
ATOM   6188  N N   . LEU E 1 74  ? 101.207 35.719 162.981 1.00 75.61  ? 74  LEU E N   1 
ATOM   6189  C CA  . LEU E 1 74  ? 100.956 34.328 162.655 1.00 75.61  ? 74  LEU E CA  1 
ATOM   6190  C C   . LEU E 1 74  ? 101.576 34.010 161.298 1.00 75.61  ? 74  LEU E C   1 
ATOM   6191  O O   . LEU E 1 74  ? 102.312 33.024 161.143 1.00 75.61  ? 74  LEU E O   1 
ATOM   6192  C CB  . LEU E 1 74  ? 99.458  34.062 162.603 1.00 65.55  ? 74  LEU E CB  1 
ATOM   6193  C CG  . LEU E 1 74  ? 98.831  33.629 163.921 1.00 65.55  ? 74  LEU E CG  1 
ATOM   6194  C CD1 . LEU E 1 74  ? 97.335  33.448 163.776 1.00 65.55  ? 74  LEU E CD1 1 
ATOM   6195  C CD2 . LEU E 1 74  ? 99.477  32.334 164.342 1.00 65.55  ? 74  LEU E CD2 1 
ATOM   6196  N N   . ALA E 1 75  ? 101.277 34.859 160.316 1.00 55.34  ? 75  ALA E N   1 
ATOM   6197  C CA  . ALA E 1 75  ? 101.796 34.686 158.963 1.00 55.34  ? 75  ALA E CA  1 
ATOM   6198  C C   . ALA E 1 75  ? 103.323 34.730 158.943 1.00 55.34  ? 75  ALA E C   1 
ATOM   6199  O O   . ALA E 1 75  ? 103.974 33.817 158.455 1.00 55.34  ? 75  ALA E O   1 
ATOM   6200  C CB  . ALA E 1 75  ? 101.221 35.766 158.046 1.00 59.94  ? 75  ALA E CB  1 
ATOM   6201  N N   . ASN E 1 76  ? 103.896 35.794 159.484 1.00 77.78  ? 76  ASN E N   1 
ATOM   6202  C CA  . ASN E 1 76  ? 105.341 35.919 159.495 1.00 77.78  ? 76  ASN E CA  1 
ATOM   6203  C C   . ASN E 1 76  ? 106.008 34.673 160.054 1.00 77.78  ? 76  ASN E C   1 
ATOM   6204  O O   . ASN E 1 76  ? 107.142 34.346 159.693 1.00 77.78  ? 76  ASN E O   1 
ATOM   6205  C CB  . ASN E 1 76  ? 105.746 37.145 160.304 1.00 81.32  ? 76  ASN E CB  1 
ATOM   6206  C CG  . ASN E 1 76  ? 105.398 38.431 159.604 1.00 81.32  ? 76  ASN E CG  1 
ATOM   6207  O OD1 . ASN E 1 76  ? 105.925 38.717 158.529 1.00 81.32  ? 76  ASN E OD1 1 
ATOM   6208  N ND2 . ASN E 1 76  ? 104.505 39.215 160.202 1.00 81.32  ? 76  ASN E ND2 1 
ATOM   6209  N N   . GLU E 1 77  ? 105.307 33.975 160.937 1.00 92.78  ? 77  GLU E N   1 
ATOM   6210  C CA  . GLU E 1 77  ? 105.873 32.768 161.512 1.00 92.78  ? 77  GLU E CA  1 
ATOM   6211  C C   . GLU E 1 77  ? 105.665 31.589 160.575 1.00 92.78  ? 77  GLU E C   1 
ATOM   6212  O O   . GLU E 1 77  ? 106.609 30.843 160.279 1.00 92.78  ? 77  GLU E O   1 
ATOM   6213  C CB  . GLU E 1 77  ? 105.259 32.473 162.887 1.00 97.73  ? 77  GLU E CB  1 
ATOM   6214  C CG  . GLU E 1 77  ? 105.853 33.302 164.034 1.00 97.73  ? 77  GLU E CG  1 
ATOM   6215  C CD  . GLU E 1 77  ? 107.377 33.395 163.977 1.00 97.73  ? 77  GLU E CD  1 
ATOM   6216  O OE1 . GLU E 1 77  ? 108.045 32.365 163.741 1.00 97.73  ? 77  GLU E OE1 1 
ATOM   6217  O OE2 . GLU E 1 77  ? 107.915 34.502 164.175 1.00 97.73  ? 77  GLU E OE2 1 
ATOM   6218  N N   . MET E 1 78  ? 104.432 31.436 160.098 1.00 70.58  ? 78  MET E N   1 
ATOM   6219  C CA  . MET E 1 78  ? 104.102 30.350 159.182 1.00 70.58  ? 78  MET E CA  1 
ATOM   6220  C C   . MET E 1 78  ? 104.922 30.345 157.903 1.00 70.58  ? 78  MET E C   1 
ATOM   6221  O O   . MET E 1 78  ? 105.337 29.284 157.462 1.00 70.58  ? 78  MET E O   1 
ATOM   6222  C CB  . MET E 1 78  ? 102.622 30.394 158.805 1.00 98.65  ? 78  MET E CB  1 
ATOM   6223  C CG  . MET E 1 78  ? 101.704 29.635 159.740 1.00 98.65  ? 78  MET E CG  1 
ATOM   6224  S SD  . MET E 1 78  ? 102.108 27.884 159.815 1.00 98.65  ? 78  MET E SD  1 
ATOM   6225  C CE  . MET E 1 78  ? 102.058 27.461 158.146 1.00 98.65  ? 78  MET E CE  1 
ATOM   6226  N N   . PHE E 1 79  ? 105.168 31.518 157.316 1.00 62.21  ? 79  PHE E N   1 
ATOM   6227  C CA  . PHE E 1 79  ? 105.911 31.600 156.044 1.00 62.21  ? 79  PHE E CA  1 
ATOM   6228  C C   . PHE E 1 79  ? 107.224 32.351 156.080 1.00 62.21  ? 79  PHE E C   1 
ATOM   6229  O O   . PHE E 1 79  ? 108.018 32.267 155.132 1.00 62.21  ? 79  PHE E O   1 
ATOM   6230  C CB  . PHE E 1 79  ? 105.046 32.243 154.939 1.00 31.20  ? 79  PHE E CB  1 
ATOM   6231  C CG  . PHE E 1 79  ? 103.634 31.770 154.937 1.00 31.20  ? 79  PHE E CG  1 
ATOM   6232  C CD1 . PHE E 1 79  ? 102.613 32.593 155.379 1.00 31.20  ? 79  PHE E CD1 1 
ATOM   6233  C CD2 . PHE E 1 79  ? 103.330 30.488 154.492 1.00 31.20  ? 79  PHE E CD2 1 
ATOM   6234  C CE1 . PHE E 1 79  ? 101.302 32.163 155.382 1.00 31.20  ? 79  PHE E CE1 1 
ATOM   6235  C CE2 . PHE E 1 79  ? 102.015 30.023 154.480 1.00 31.20  ? 79  PHE E CE2 1 
ATOM   6236  C CZ  . PHE E 1 79  ? 100.984 30.868 154.928 1.00 31.20  ? 79  PHE E CZ  1 
ATOM   6237  N N   . GLY E 1 80  ? 107.453 33.088 157.160 1.00 125.87 ? 80  GLY E N   1 
ATOM   6238  C CA  . GLY E 1 80  ? 108.671 33.861 157.254 1.00 125.87 ? 80  GLY E CA  1 
ATOM   6239  C C   . GLY E 1 80  ? 108.363 35.250 156.745 1.00 125.87 ? 80  GLY E C   1 
ATOM   6240  O O   . GLY E 1 80  ? 107.491 35.440 155.902 1.00 125.87 ? 80  GLY E O   1 
ATOM   6241  N N   . TYR E 1 81  ? 109.083 36.228 157.260 1.00 77.55  ? 81  TYR E N   1 
ATOM   6242  C CA  . TYR E 1 81  ? 108.878 37.604 156.877 1.00 77.55  ? 81  TYR E CA  1 
ATOM   6243  C C   . TYR E 1 81  ? 108.827 37.849 155.363 1.00 77.55  ? 81  TYR E C   1 
ATOM   6244  O O   . TYR E 1 81  ? 108.105 38.742 154.894 1.00 77.55  ? 81  TYR E O   1 
ATOM   6245  C CB  . TYR E 1 81  ? 109.981 38.430 157.506 1.00 40.58  ? 81  TYR E CB  1 
ATOM   6246  C CG  . TYR E 1 81  ? 111.324 38.271 156.851 1.00 40.58  ? 81  TYR E CG  1 
ATOM   6247  C CD1 . TYR E 1 81  ? 111.731 39.140 155.840 1.00 40.58  ? 81  TYR E CD1 1 
ATOM   6248  C CD2 . TYR E 1 81  ? 112.225 37.307 157.290 1.00 40.58  ? 81  TYR E CD2 1 
ATOM   6249  C CE1 . TYR E 1 81  ? 113.015 39.063 155.291 1.00 40.58  ? 81  TYR E CE1 1 
ATOM   6250  C CE2 . TYR E 1 81  ? 113.510 37.223 156.747 1.00 40.58  ? 81  TYR E CE2 1 
ATOM   6251  C CZ  . TYR E 1 81  ? 113.900 38.107 155.752 1.00 40.58  ? 81  TYR E CZ  1 
ATOM   6252  O OH  . TYR E 1 81  ? 115.182 38.062 155.233 1.00 40.58  ? 81  TYR E OH  1 
ATOM   6253  N N   . ASN E 1 82  ? 109.587 37.053 154.611 1.00 51.60  ? 82  ASN E N   1 
ATOM   6254  C CA  . ASN E 1 82  ? 109.655 37.186 153.153 1.00 51.60  ? 82  ASN E CA  1 
ATOM   6255  C C   . ASN E 1 82  ? 109.016 36.008 152.388 1.00 51.60  ? 82  ASN E C   1 
ATOM   6256  O O   . ASN E 1 82  ? 109.370 35.744 151.234 1.00 51.60  ? 82  ASN E O   1 
ATOM   6257  C CB  . ASN E 1 82  ? 111.122 37.310 152.727 1.00 48.48  ? 82  ASN E CB  1 
ATOM   6258  C CG  . ASN E 1 82  ? 111.853 35.988 152.797 1.00 48.48  ? 82  ASN E CG  1 
ATOM   6259  O OD1 . ASN E 1 82  ? 111.507 35.107 153.607 1.00 48.48  ? 82  ASN E OD1 1 
ATOM   6260  N ND2 . ASN E 1 82  ? 112.873 35.833 151.959 1.00 48.48  ? 82  ASN E ND2 1 
ATOM   6261  N N   . GLY E 1 83  ? 108.086 35.308 153.026 1.00 66.12  ? 83  GLY E N   1 
ATOM   6262  C CA  . GLY E 1 83  ? 107.476 34.164 152.382 1.00 66.12  ? 83  GLY E CA  1 
ATOM   6263  C C   . GLY E 1 83  ? 106.047 34.388 151.970 1.00 66.12  ? 83  GLY E C   1 
ATOM   6264  O O   . GLY E 1 83  ? 105.450 33.547 151.294 1.00 66.12  ? 83  GLY E O   1 
ATOM   6265  N N   . TRP E 1 84  ? 105.483 35.511 152.391 1.00 57.40  ? 84  TRP E N   1 
ATOM   6266  C CA  . TRP E 1 84  ? 104.116 35.852 152.031 1.00 57.40  ? 84  TRP E CA  1 
ATOM   6267  C C   . TRP E 1 84  ? 104.115 37.334 151.724 1.00 57.40  ? 84  TRP E C   1 
ATOM   6268  O O   . TRP E 1 84  ? 105.022 38.064 152.130 1.00 57.40  ? 84  TRP E O   1 
ATOM   6269  C CB  . TRP E 1 84  ? 103.149 35.546 153.173 1.00 75.38  ? 84  TRP E CB  1 
ATOM   6270  C CG  . TRP E 1 84  ? 103.288 36.472 154.316 1.00 75.38  ? 84  TRP E CG  1 
ATOM   6271  C CD1 . TRP E 1 84  ? 104.360 36.590 155.148 1.00 75.38  ? 84  TRP E CD1 1 
ATOM   6272  C CD2 . TRP E 1 84  ? 102.356 37.479 154.714 1.00 75.38  ? 84  TRP E CD2 1 
ATOM   6273  N NE1 . TRP E 1 84  ? 104.158 37.613 156.034 1.00 75.38  ? 84  TRP E NE1 1 
ATOM   6274  C CE2 . TRP E 1 84  ? 102.933 38.178 155.789 1.00 75.38  ? 84  TRP E CE2 1 
ATOM   6275  C CE3 . TRP E 1 84  ? 101.087 37.863 154.263 1.00 75.38  ? 84  TRP E CE3 1 
ATOM   6276  C CZ2 . TRP E 1 84  ? 102.285 39.243 156.422 1.00 75.38  ? 84  TRP E CZ2 1 
ATOM   6277  C CZ3 . TRP E 1 84  ? 100.443 38.924 154.893 1.00 75.38  ? 84  TRP E CZ3 1 
ATOM   6278  C CH2 . TRP E 1 84  ? 101.045 39.599 155.958 1.00 75.38  ? 84  TRP E CH2 1 
ATOM   6279  N N   . ALA E 1 85  ? 103.104 37.781 150.995 1.00 49.39  ? 85  ALA E N   1 
ATOM   6280  C CA  . ALA E 1 85  ? 103.014 39.185 150.620 1.00 49.39  ? 85  ALA E CA  1 
ATOM   6281  C C   . ALA E 1 85  ? 101.577 39.519 150.331 1.00 49.39  ? 85  ALA E C   1 
ATOM   6282  O O   . ALA E 1 85  ? 100.769 38.632 150.068 1.00 49.39  ? 85  ALA E O   1 
ATOM   6283  C CB  . ALA E 1 85  ? 103.868 39.446 149.389 1.00 17.85  ? 85  ALA E CB  1 
ATOM   6284  N N   . HIS E 1 86  ? 101.233 40.793 150.411 1.00 51.88  ? 86  HIS E N   1 
ATOM   6285  C CA  . HIS E 1 86  ? 99.869  41.156 150.099 1.00 51.88  ? 86  HIS E CA  1 
ATOM   6286  C C   . HIS E 1 86  ? 99.874  42.497 149.413 1.00 51.88  ? 86  HIS E C   1 
ATOM   6287  O O   . HIS E 1 86  ? 100.848 43.246 149.509 1.00 51.88  ? 86  HIS E O   1 
ATOM   6288  C CB  . HIS E 1 86  ? 98.997  41.203 151.348 1.00 67.11  ? 86  HIS E CB  1 
ATOM   6289  C CG  . HIS E 1 86  ? 99.307  42.344 152.256 1.00 67.11  ? 86  HIS E CG  1 
ATOM   6290  N ND1 . HIS E 1 86  ? 98.325  43.104 152.855 1.00 67.11  ? 86  HIS E ND1 1 
ATOM   6291  C CD2 . HIS E 1 86  ? 100.487 42.854 152.671 1.00 67.11  ? 86  HIS E CD2 1 
ATOM   6292  C CE1 . HIS E 1 86  ? 98.890  44.037 153.598 1.00 67.11  ? 86  HIS E CE1 1 
ATOM   6293  N NE2 . HIS E 1 86  ? 100.201 43.907 153.503 1.00 67.11  ? 86  HIS E NE2 1 
ATOM   6294  N N   . SER E 1 87  ? 98.799  42.778 148.683 1.00 41.37  ? 87  SER E N   1 
ATOM   6295  C CA  . SER E 1 87  ? 98.683  44.037 147.978 1.00 41.37  ? 87  SER E CA  1 
ATOM   6296  C C   . SER E 1 87  ? 97.204  44.360 147.946 1.00 41.37  ? 87  SER E C   1 
ATOM   6297  O O   . SER E 1 87  ? 96.357  43.458 148.108 1.00 41.37  ? 87  SER E O   1 
ATOM   6298  C CB  . SER E 1 87  ? 99.222  43.904 146.565 1.00 55.59  ? 87  SER E CB  1 
ATOM   6299  O OG  . SER E 1 87  ? 98.396  43.026 145.836 1.00 55.59  ? 87  SER E OG  1 
ATOM   6300  N N   . ILE E 1 88  ? 96.891  45.648 147.787 1.00 51.49  ? 88  ILE E N   1 
ATOM   6301  C CA  . ILE E 1 88  ? 95.500  46.081 147.712 1.00 51.49  ? 88  ILE E CA  1 
ATOM   6302  C C   . ILE E 1 88  ? 95.171  46.228 146.241 1.00 51.49  ? 88  ILE E C   1 
ATOM   6303  O O   . ILE E 1 88  ? 95.685  47.111 145.557 1.00 51.49  ? 88  ILE E O   1 
ATOM   6304  C CB  . ILE E 1 88  ? 95.273  47.427 148.390 1.00 57.71  ? 88  ILE E CB  1 
ATOM   6305  C CG1 . ILE E 1 88  ? 95.722  47.362 149.849 1.00 57.71  ? 88  ILE E CG1 1 
ATOM   6306  C CG2 . ILE E 1 88  ? 93.806  47.785 148.294 1.00 57.71  ? 88  ILE E CG2 1 
ATOM   6307  C CD1 . ILE E 1 88  ? 95.807  48.725 150.558 1.00 57.71  ? 88  ILE E CD1 1 
ATOM   6308  N N   . THR E 1 89  ? 94.327  45.334 145.760 1.00 49.23  ? 89  THR E N   1 
ATOM   6309  C CA  . THR E 1 89  ? 93.930  45.334 144.372 1.00 49.23  ? 89  THR E CA  1 
ATOM   6310  C C   . THR E 1 89  ? 93.090  46.572 144.138 1.00 49.23  ? 89  THR E C   1 
ATOM   6311  O O   . THR E 1 89  ? 93.273  47.292 143.150 1.00 49.23  ? 89  THR E O   1 
ATOM   6312  C CB  . THR E 1 89  ? 93.135  44.061 144.056 1.00 43.03  ? 89  THR E CB  1 
ATOM   6313  O OG1 . THR E 1 89  ? 94.024  42.940 144.137 1.00 43.03  ? 89  THR E OG1 1 
ATOM   6314  C CG2 . THR E 1 89  ? 92.526  44.118 142.669 1.00 43.03  ? 89  THR E CG2 1 
ATOM   6315  N N   . GLN E 1 90  ? 92.191  46.836 145.078 1.00 65.59  ? 90  GLN E N   1 
ATOM   6316  C CA  . GLN E 1 90  ? 91.320  47.980 144.961 1.00 65.59  ? 90  GLN E CA  1 
ATOM   6317  C C   . GLN E 1 90  ? 90.558  48.270 146.242 1.00 65.59  ? 90  GLN E C   1 
ATOM   6318  O O   . GLN E 1 90  ? 90.186  47.356 146.982 1.00 65.59  ? 90  GLN E O   1 
ATOM   6319  C CB  . GLN E 1 90  ? 90.319  47.757 143.827 1.00 82.15  ? 90  GLN E CB  1 
ATOM   6320  C CG  . GLN E 1 90  ? 89.318  48.880 143.688 1.00 82.15  ? 90  GLN E CG  1 
ATOM   6321  C CD  . GLN E 1 90  ? 88.425  48.739 142.475 1.00 82.15  ? 90  GLN E CD  1 
ATOM   6322  O OE1 . GLN E 1 90  ? 87.557  47.858 142.410 1.00 82.15  ? 90  GLN E OE1 1 
ATOM   6323  N NE2 . GLN E 1 90  ? 88.634  49.613 141.496 1.00 82.15  ? 90  GLN E NE2 1 
ATOM   6324  N N   . GLN E 1 91  ? 90.349  49.560 146.500 1.00 61.29  ? 91  GLN E N   1 
ATOM   6325  C CA  . GLN E 1 91  ? 89.584  50.015 147.651 1.00 61.29  ? 91  GLN E CA  1 
ATOM   6326  C C   . GLN E 1 91  ? 88.591  51.007 147.112 1.00 61.29  ? 91  GLN E C   1 
ATOM   6327  O O   . GLN E 1 91  ? 88.970  51.960 146.447 1.00 61.29  ? 91  GLN E O   1 
ATOM   6328  C CB  . GLN E 1 91  ? 90.454  50.712 148.688 1.00 65.84  ? 91  GLN E CB  1 
ATOM   6329  C CG  . GLN E 1 91  ? 89.601  51.379 149.777 1.00 65.84  ? 91  GLN E CG  1 
ATOM   6330  C CD  . GLN E 1 91  ? 90.390  51.792 151.013 1.00 65.84  ? 91  GLN E CD  1 
ATOM   6331  O OE1 . GLN E 1 91  ? 90.363  51.114 152.032 1.00 65.84  ? 91  GLN E OE1 1 
ATOM   6332  N NE2 . GLN E 1 91  ? 91.098  52.903 150.919 1.00 65.84  ? 91  GLN E NE2 1 
ATOM   6333  N N   . ASN E 1 92  ? 87.318  50.780 147.384 1.00 67.42  ? 92  ASN E N   1 
ATOM   6334  C CA  . ASN E 1 92  ? 86.299  51.685 146.902 1.00 67.42  ? 92  ASN E CA  1 
ATOM   6335  C C   . ASN E 1 92  ? 85.447  52.183 148.054 1.00 67.42  ? 92  ASN E C   1 
ATOM   6336  O O   . ASN E 1 92  ? 84.944  51.396 148.856 1.00 67.42  ? 92  ASN E O   1 
ATOM   6337  C CB  . ASN E 1 92  ? 85.414  50.985 145.876 1.00 112.67 ? 92  ASN E CB  1 
ATOM   6338  C CG  . ASN E 1 92  ? 84.338  51.893 145.332 1.00 112.67 ? 92  ASN E CG  1 
ATOM   6339  O OD1 . ASN E 1 92  ? 84.633  52.888 144.667 1.00 112.67 ? 92  ASN E OD1 1 
ATOM   6340  N ND2 . ASN E 1 92  ? 83.080  51.566 145.620 1.00 112.67 ? 92  ASN E ND2 1 
ATOM   6341  N N   . VAL E 1 93  ? 85.300  53.498 148.149 1.00 50.63  ? 93  VAL E N   1 
ATOM   6342  C CA  . VAL E 1 93  ? 84.482  54.083 149.198 1.00 50.63  ? 93  VAL E CA  1 
ATOM   6343  C C   . VAL E 1 93  ? 83.017  53.949 148.782 1.00 50.63  ? 93  VAL E C   1 
ATOM   6344  O O   . VAL E 1 93  ? 82.553  54.673 147.914 1.00 50.63  ? 93  VAL E O   1 
ATOM   6345  C CB  . VAL E 1 93  ? 84.802  55.571 149.369 1.00 41.54  ? 93  VAL E CB  1 
ATOM   6346  C CG1 . VAL E 1 93  ? 83.864  56.182 150.386 1.00 41.54  ? 93  VAL E CG1 1 
ATOM   6347  C CG2 . VAL E 1 93  ? 86.246  55.748 149.796 1.00 41.54  ? 93  VAL E CG2 1 
ATOM   6348  N N   . ASP E 1 94  ? 82.281  53.028 149.383 1.00 68.34  ? 94  ASP E N   1 
ATOM   6349  C CA  . ASP E 1 94  ? 80.881  52.878 149.005 1.00 68.34  ? 94  ASP E CA  1 
ATOM   6350  C C   . ASP E 1 94  ? 80.019  54.132 149.182 1.00 68.34  ? 94  ASP E C   1 
ATOM   6351  O O   . ASP E 1 94  ? 79.285  54.520 148.273 1.00 68.34  ? 94  ASP E O   1 
ATOM   6352  C CB  . ASP E 1 94  ? 80.241  51.723 149.771 1.00 99.26  ? 94  ASP E CB  1 
ATOM   6353  C CG  . ASP E 1 94  ? 80.646  50.387 149.226 1.00 99.26  ? 94  ASP E CG  1 
ATOM   6354  O OD1 . ASP E 1 94  ? 80.909  50.321 148.010 1.00 99.26  ? 94  ASP E OD1 1 
ATOM   6355  O OD2 . ASP E 1 94  ? 80.688  49.409 149.999 1.00 99.26  ? 94  ASP E OD2 1 
ATOM   6356  N N   . PHE E 1 95  ? 80.101  54.762 150.349 1.00 77.57  ? 95  PHE E N   1 
ATOM   6357  C CA  . PHE E 1 95  ? 79.298  55.946 150.613 1.00 77.57  ? 95  PHE E CA  1 
ATOM   6358  C C   . PHE E 1 95  ? 79.827  56.750 151.778 1.00 77.57  ? 95  PHE E C   1 
ATOM   6359  O O   . PHE E 1 95  ? 80.651  56.284 152.571 1.00 77.57  ? 95  PHE E O   1 
ATOM   6360  C CB  . PHE E 1 95  ? 77.840  55.541 150.902 1.00 95.26  ? 95  PHE E CB  1 
ATOM   6361  C CG  . PHE E 1 95  ? 77.672  54.666 152.129 1.00 95.26  ? 95  PHE E CG  1 
ATOM   6362  C CD1 . PHE E 1 95  ? 77.708  55.215 153.409 1.00 95.26  ? 95  PHE E CD1 1 
ATOM   6363  C CD2 . PHE E 1 95  ? 77.495  53.289 152.003 1.00 95.26  ? 95  PHE E CD2 1 
ATOM   6364  C CE1 . PHE E 1 95  ? 77.571  54.411 154.538 1.00 95.26  ? 95  PHE E CE1 1 
ATOM   6365  C CE2 . PHE E 1 95  ? 77.357  52.476 153.131 1.00 95.26  ? 95  PHE E CE2 1 
ATOM   6366  C CZ  . PHE E 1 95  ? 77.396  53.040 154.399 1.00 95.26  ? 95  PHE E CZ  1 
ATOM   6367  N N   . VAL E 1 96  ? 79.349  57.980 151.861 1.00 78.87  ? 96  VAL E N   1 
ATOM   6368  C CA  . VAL E 1 96  ? 79.712  58.867 152.947 1.00 78.87  ? 96  VAL E CA  1 
ATOM   6369  C C   . VAL E 1 96  ? 78.489  59.733 153.190 1.00 78.87  ? 96  VAL E C   1 
ATOM   6370  O O   . VAL E 1 96  ? 78.326  60.790 152.586 1.00 78.87  ? 96  VAL E O   1 
ATOM   6371  C CB  . VAL E 1 96  ? 80.929  59.742 152.606 1.00 40.37  ? 96  VAL E CB  1 
ATOM   6372  C CG1 . VAL E 1 96  ? 81.194  60.700 153.745 1.00 40.37  ? 96  VAL E CG1 1 
ATOM   6373  C CG2 . VAL E 1 96  ? 82.143  58.874 152.401 1.00 40.37  ? 96  VAL E CG2 1 
ATOM   6374  N N   . ASP E 1 97  ? 77.615  59.254 154.067 1.00 87.56  ? 97  ASP E N   1 
ATOM   6375  C CA  . ASP E 1 97  ? 76.398  59.973 154.380 1.00 87.56  ? 97  ASP E CA  1 
ATOM   6376  C C   . ASP E 1 97  ? 76.471  60.816 155.646 1.00 87.56  ? 97  ASP E C   1 
ATOM   6377  O O   . ASP E 1 97  ? 77.203  60.494 156.591 1.00 87.56  ? 97  ASP E O   1 
ATOM   6378  C CB  . ASP E 1 97  ? 75.239  58.992 154.476 1.00 97.20  ? 97  ASP E CB  1 
ATOM   6379  C CG  . ASP E 1 97  ? 75.014  58.246 153.181 1.00 97.20  ? 97  ASP E CG  1 
ATOM   6380  O OD1 . ASP E 1 97  ? 75.225  58.856 152.106 1.00 97.20  ? 97  ASP E OD1 1 
ATOM   6381  O OD2 . ASP E 1 97  ? 74.614  57.062 153.237 1.00 97.20  ? 97  ASP E OD2 1 
ATOM   6382  N N   . LEU E 1 98  ? 75.705  61.907 155.643 1.00 84.05  ? 98  LEU E N   1 
ATOM   6383  C CA  . LEU E 1 98  ? 75.651  62.821 156.782 1.00 84.05  ? 98  LEU E CA  1 
ATOM   6384  C C   . LEU E 1 98  ? 74.246  62.953 157.377 1.00 84.05  ? 98  LEU E C   1 
ATOM   6385  O O   . LEU E 1 98  ? 73.343  63.532 156.765 1.00 84.05  ? 98  LEU E O   1 
ATOM   6386  C CB  . LEU E 1 98  ? 76.167  64.209 156.384 1.00 74.78  ? 98  LEU E CB  1 
ATOM   6387  C CG  . LEU E 1 98  ? 76.134  65.268 157.494 1.00 74.78  ? 98  LEU E CG  1 
ATOM   6388  C CD1 . LEU E 1 98  ? 76.849  64.756 158.749 1.00 74.78  ? 98  LEU E CD1 1 
ATOM   6389  C CD2 . LEU E 1 98  ? 76.782  66.549 156.976 1.00 74.78  ? 98  LEU E CD2 1 
ATOM   6390  N N   . ASN E 1 99  ? 74.079  62.394 158.571 1.00 137.68 ? 99  ASN E N   1 
ATOM   6391  C CA  . ASN E 1 99  ? 72.813  62.447 159.286 1.00 137.68 ? 99  ASN E CA  1 
ATOM   6392  C C   . ASN E 1 99  ? 73.032  63.268 160.546 1.00 137.68 ? 99  ASN E C   1 
ATOM   6393  O O   . ASN E 1 99  ? 73.655  62.805 161.504 1.00 137.68 ? 99  ASN E O   1 
ATOM   6394  C CB  . ASN E 1 99  ? 72.330  61.042 159.664 1.00 168.16 ? 99  ASN E CB  1 
ATOM   6395  C CG  . ASN E 1 99  ? 71.823  60.253 158.469 1.00 168.16 ? 99  ASN E CG  1 
ATOM   6396  O OD1 . ASN E 1 99  ? 70.969  60.724 157.717 1.00 168.16 ? 99  ASN E OD1 1 
ATOM   6397  N ND2 . ASN E 1 99  ? 72.340  59.041 158.297 1.00 168.16 ? 99  ASN E ND2 1 
ATOM   6398  N N   . ASN E 1 100 ? 72.513  64.492 160.527 1.00 189.32 ? 100 ASN E N   1 
ATOM   6399  C CA  . ASN E 1 100 ? 72.631  65.425 161.639 1.00 189.32 ? 100 ASN E CA  1 
ATOM   6400  C C   . ASN E 1 100 ? 74.007  65.433 162.306 1.00 189.32 ? 100 ASN E C   1 
ATOM   6401  O O   . ASN E 1 100 ? 74.201  64.840 163.368 1.00 189.32 ? 100 ASN E O   1 
ATOM   6402  C CB  . ASN E 1 100 ? 71.537  65.161 162.687 1.00 188.71 ? 100 ASN E CB  1 
ATOM   6403  C CG  . ASN E 1 100 ? 71.593  63.759 163.264 1.00 188.71 ? 100 ASN E CG  1 
ATOM   6404  O OD1 . ASN E 1 100 ? 71.328  62.776 162.572 1.00 188.71 ? 100 ASN E OD1 1 
ATOM   6405  N ND2 . ASN E 1 100 ? 71.939  63.661 164.543 1.00 188.71 ? 100 ASN E ND2 1 
ATOM   6406  N N   . GLY E 1 101 ? 74.956  66.111 161.664 1.00 78.36  ? 101 GLY E N   1 
ATOM   6407  C CA  . GLY E 1 101 ? 76.307  66.232 162.195 1.00 78.36  ? 101 GLY E CA  1 
ATOM   6408  C C   . GLY E 1 101 ? 77.125  64.966 162.392 1.00 78.36  ? 101 GLY E C   1 
ATOM   6409  O O   . GLY E 1 101 ? 78.292  65.041 162.792 1.00 78.36  ? 101 GLY E O   1 
ATOM   6410  N N   . LYS E 1 102 ? 76.528  63.806 162.123 1.00 127.56 ? 102 LYS E N   1 
ATOM   6411  C CA  . LYS E 1 102 ? 77.225  62.532 162.275 1.00 127.56 ? 102 LYS E CA  1 
ATOM   6412  C C   . LYS E 1 102 ? 77.471  61.901 160.913 1.00 127.56 ? 102 LYS E C   1 
ATOM   6413  O O   . LYS E 1 102 ? 76.634  61.995 160.017 1.00 127.56 ? 102 LYS E O   1 
ATOM   6414  C CB  . LYS E 1 102 ? 76.403  61.581 163.142 1.00 99.17  ? 102 LYS E CB  1 
ATOM   6415  C CG  . LYS E 1 102 ? 76.145  62.089 164.546 1.00 99.17  ? 102 LYS E CG  1 
ATOM   6416  C CD  . LYS E 1 102 ? 75.152  61.197 165.262 1.00 99.17  ? 102 LYS E CD  1 
ATOM   6417  C CE  . LYS E 1 102 ? 74.735  61.782 166.597 1.00 99.17  ? 102 LYS E CE  1 
ATOM   6418  N NZ  . LYS E 1 102 ? 73.647  60.980 167.239 1.00 99.17  ? 102 LYS E NZ  1 
ATOM   6419  N N   . PHE E 1 103 ? 78.623  61.256 160.765 1.00 116.65 ? 103 PHE E N   1 
ATOM   6420  C CA  . PHE E 1 103 ? 78.983  60.617 159.508 1.00 116.65 ? 103 PHE E CA  1 
ATOM   6421  C C   . PHE E 1 103 ? 78.889  59.101 159.495 1.00 116.65 ? 103 PHE E C   1 
ATOM   6422  O O   . PHE E 1 103 ? 79.355  58.423 160.413 1.00 116.65 ? 103 PHE E O   1 
ATOM   6423  C CB  . PHE E 1 103 ? 80.392  61.016 159.116 1.00 89.12  ? 103 PHE E CB  1 
ATOM   6424  C CG  . PHE E 1 103 ? 80.486  62.389 158.582 1.00 89.12  ? 103 PHE E CG  1 
ATOM   6425  C CD1 . PHE E 1 103 ? 81.283  63.333 159.209 1.00 89.12  ? 103 PHE E CD1 1 
ATOM   6426  C CD2 . PHE E 1 103 ? 79.789  62.742 157.435 1.00 89.12  ? 103 PHE E CD2 1 
ATOM   6427  C CE1 . PHE E 1 103 ? 81.392  64.626 158.700 1.00 89.12  ? 103 PHE E CE1 1 
ATOM   6428  C CE2 . PHE E 1 103 ? 79.886  64.029 156.912 1.00 89.12  ? 103 PHE E CE2 1 
ATOM   6429  C CZ  . PHE E 1 103 ? 80.692  64.978 157.547 1.00 89.12  ? 103 PHE E CZ  1 
ATOM   6430  N N   . TYR E 1 104 ? 78.291  58.585 158.426 1.00 103.15 ? 104 TYR E N   1 
ATOM   6431  C CA  . TYR E 1 104 ? 78.124  57.154 158.223 1.00 103.15 ? 104 TYR E CA  1 
ATOM   6432  C C   . TYR E 1 104 ? 78.862  56.780 156.933 1.00 103.15 ? 104 TYR E C   1 
ATOM   6433  O O   . TYR E 1 104 ? 78.389  57.056 155.829 1.00 103.15 ? 104 TYR E O   1 
ATOM   6434  C CB  . TYR E 1 104 ? 76.638  56.815 158.106 1.00 119.81 ? 104 TYR E CB  1 
ATOM   6435  C CG  . TYR E 1 104 ? 75.834  57.199 159.328 1.00 119.81 ? 104 TYR E CG  1 
ATOM   6436  C CD1 . TYR E 1 104 ? 75.811  58.513 159.786 1.00 119.81 ? 104 TYR E CD1 1 
ATOM   6437  C CD2 . TYR E 1 104 ? 75.105  56.247 160.033 1.00 119.81 ? 104 TYR E CD2 1 
ATOM   6438  C CE1 . TYR E 1 104 ? 75.088  58.869 160.913 1.00 119.81 ? 104 TYR E CE1 1 
ATOM   6439  C CE2 . TYR E 1 104 ? 74.378  56.592 161.161 1.00 119.81 ? 104 TYR E CE2 1 
ATOM   6440  C CZ  . TYR E 1 104 ? 74.374  57.903 161.596 1.00 119.81 ? 104 TYR E CZ  1 
ATOM   6441  O OH  . TYR E 1 104 ? 73.657  58.243 162.718 1.00 119.81 ? 104 TYR E OH  1 
ATOM   6442  N N   . VAL E 1 105 ? 80.027  56.155 157.085 1.00 75.68  ? 105 VAL E N   1 
ATOM   6443  C CA  . VAL E 1 105 ? 80.858  55.757 155.956 1.00 75.68  ? 105 VAL E CA  1 
ATOM   6444  C C   . VAL E 1 105 ? 81.015  54.253 155.775 1.00 75.68  ? 105 VAL E C   1 
ATOM   6445  O O   . VAL E 1 105 ? 81.265  53.520 156.729 1.00 75.68  ? 105 VAL E O   1 
ATOM   6446  C CB  . VAL E 1 105 ? 82.261  56.363 156.095 1.00 76.04  ? 105 VAL E CB  1 
ATOM   6447  C CG1 . VAL E 1 105 ? 83.152  55.896 154.965 1.00 76.04  ? 105 VAL E CG1 1 
ATOM   6448  C CG2 . VAL E 1 105 ? 82.156  57.874 156.118 1.00 76.04  ? 105 VAL E CG2 1 
ATOM   6449  N N   . GLY E 1 106 ? 80.870  53.806 154.534 1.00 80.12  ? 106 GLY E N   1 
ATOM   6450  C CA  . GLY E 1 106 ? 81.037  52.397 154.208 1.00 80.12  ? 106 GLY E CA  1 
ATOM   6451  C C   . GLY E 1 106 ? 82.145  52.214 153.170 1.00 80.12  ? 106 GLY E C   1 
ATOM   6452  O O   . GLY E 1 106 ? 82.086  52.784 152.084 1.00 80.12  ? 106 GLY E O   1 
ATOM   6453  N N   . VAL E 1 107 ? 83.163  51.425 153.493 1.00 59.49  ? 107 VAL E N   1 
ATOM   6454  C CA  . VAL E 1 107 ? 84.265  51.206 152.569 1.00 59.49  ? 107 VAL E CA  1 
ATOM   6455  C C   . VAL E 1 107 ? 84.625  49.737 152.403 1.00 59.49  ? 107 VAL E C   1 
ATOM   6456  O O   . VAL E 1 107 ? 84.556  48.967 153.354 1.00 59.49  ? 107 VAL E O   1 
ATOM   6457  C CB  . VAL E 1 107 ? 85.511  51.951 153.023 1.00 44.47  ? 107 VAL E CB  1 
ATOM   6458  C CG1 . VAL E 1 107 ? 86.675  51.613 152.106 1.00 44.47  ? 107 VAL E CG1 1 
ATOM   6459  C CG2 . VAL E 1 107 ? 85.242  53.441 153.012 1.00 44.47  ? 107 VAL E CG2 1 
ATOM   6460  N N   . CYS E 1 108 ? 85.000  49.353 151.182 1.00 58.43  ? 108 CYS E N   1 
ATOM   6461  C CA  . CYS E 1 108 ? 85.384  47.974 150.893 1.00 58.43  ? 108 CYS E CA  1 
ATOM   6462  C C   . CYS E 1 108 ? 86.758  47.985 150.271 1.00 58.43  ? 108 CYS E C   1 
ATOM   6463  O O   . CYS E 1 108 ? 87.137  48.940 149.595 1.00 58.43  ? 108 CYS E O   1 
ATOM   6464  C CB  . CYS E 1 108 ? 84.391  47.308 149.930 1.00 67.74  ? 108 CYS E CB  1 
ATOM   6465  S SG  . CYS E 1 108 ? 84.476  47.864 148.204 1.00 67.74  ? 108 CYS E SG  1 
ATOM   6466  N N   . ALA E 1 109 ? 87.518  46.934 150.527 1.00 56.84  ? 109 ALA E N   1 
ATOM   6467  C CA  . ALA E 1 109 ? 88.840  46.839 149.952 1.00 56.84  ? 109 ALA E CA  1 
ATOM   6468  C C   . ALA E 1 109 ? 89.132  45.400 149.529 1.00 56.84  ? 109 ALA E C   1 
ATOM   6469  O O   . ALA E 1 109 ? 88.743  44.445 150.209 1.00 56.84  ? 109 ALA E O   1 
ATOM   6470  C CB  . ALA E 1 109 ? 89.868  47.345 150.939 1.00 23.36  ? 109 ALA E CB  1 
ATOM   6471  N N   . PHE E 1 110 ? 89.793  45.252 148.388 1.00 40.97  ? 110 PHE E N   1 
ATOM   6472  C CA  . PHE E 1 110 ? 90.118  43.930 147.881 1.00 40.97  ? 110 PHE E CA  1 
ATOM   6473  C C   . PHE E 1 110 ? 91.589  43.649 148.070 1.00 40.97  ? 110 PHE E C   1 
ATOM   6474  O O   . PHE E 1 110 ? 92.431  44.296 147.462 1.00 40.97  ? 110 PHE E O   1 
ATOM   6475  C CB  . PHE E 1 110 ? 89.734  43.820 146.404 1.00 28.41  ? 110 PHE E CB  1 
ATOM   6476  C CG  . PHE E 1 110 ? 88.250  43.951 146.159 1.00 28.41  ? 110 PHE E CG  1 
ATOM   6477  C CD1 . PHE E 1 110 ? 87.667  45.201 145.989 1.00 28.41  ? 110 PHE E CD1 1 
ATOM   6478  C CD2 . PHE E 1 110 ? 87.426  42.839 146.189 1.00 28.41  ? 110 PHE E CD2 1 
ATOM   6479  C CE1 . PHE E 1 110 ? 86.279  45.348 145.864 1.00 28.41  ? 110 PHE E CE1 1 
ATOM   6480  C CE2 . PHE E 1 110 ? 86.029  42.979 146.065 1.00 28.41  ? 110 PHE E CE2 1 
ATOM   6481  C CZ  . PHE E 1 110 ? 85.463  44.241 145.906 1.00 28.41  ? 110 PHE E CZ  1 
ATOM   6482  N N   . VAL E 1 111 ? 91.894  42.679 148.921 1.00 53.26  ? 111 VAL E N   1 
ATOM   6483  C CA  . VAL E 1 111 ? 93.280  42.343 149.197 1.00 53.26  ? 111 VAL E CA  1 
ATOM   6484  C C   . VAL E 1 111 ? 93.636  40.983 148.643 1.00 53.26  ? 111 VAL E C   1 
ATOM   6485  O O   . VAL E 1 111 ? 92.823  40.049 148.662 1.00 53.26  ? 111 VAL E O   1 
ATOM   6486  C CB  . VAL E 1 111 ? 93.553  42.350 150.703 1.00 42.68  ? 111 VAL E CB  1 
ATOM   6487  C CG1 . VAL E 1 111 ? 95.037  42.151 150.968 1.00 42.68  ? 111 VAL E CG1 1 
ATOM   6488  C CG2 . VAL E 1 111 ? 93.065  43.667 151.300 1.00 42.68  ? 111 VAL E CG2 1 
ATOM   6489  N N   . ARG E 1 112 ? 94.864  40.882 148.156 1.00 52.97  ? 112 ARG E N   1 
ATOM   6490  C CA  . ARG E 1 112 ? 95.357  39.659 147.563 1.00 52.97  ? 112 ARG E CA  1 
ATOM   6491  C C   . ARG E 1 112 ? 96.665  39.288 148.225 1.00 52.97  ? 112 ARG E C   1 
ATOM   6492  O O   . ARG E 1 112 ? 97.643  40.055 148.183 1.00 52.97  ? 112 ARG E O   1 
ATOM   6493  C CB  . ARG E 1 112 ? 95.597  39.862 146.065 1.00 63.03  ? 112 ARG E CB  1 
ATOM   6494  C CG  . ARG E 1 112 ? 95.741  38.578 145.282 1.00 63.03  ? 112 ARG E CG  1 
ATOM   6495  C CD  . ARG E 1 112 ? 96.204  38.844 143.864 1.00 63.03  ? 112 ARG E CD  1 
ATOM   6496  N NE  . ARG E 1 112 ? 97.553  38.340 143.663 1.00 63.03  ? 112 ARG E NE  1 
ATOM   6497  C CZ  . ARG E 1 112 ? 97.896  37.519 142.679 1.00 63.03  ? 112 ARG E CZ  1 
ATOM   6498  N NH1 . ARG E 1 112 ? 96.977  37.121 141.793 1.00 63.03  ? 112 ARG E NH1 1 
ATOM   6499  N NH2 . ARG E 1 112 ? 99.147  37.068 142.604 1.00 63.03  ? 112 ARG E NH2 1 
ATOM   6500  N N   . VAL E 1 113 ? 96.681  38.100 148.822 1.00 50.56  ? 113 VAL E N   1 
ATOM   6501  C CA  . VAL E 1 113 ? 97.869  37.603 149.487 1.00 50.56  ? 113 VAL E CA  1 
ATOM   6502  C C   . VAL E 1 113 ? 98.546  36.578 148.601 1.00 50.56  ? 113 VAL E C   1 
ATOM   6503  O O   . VAL E 1 113 ? 97.892  35.778 147.954 1.00 50.56  ? 113 VAL E O   1 
ATOM   6504  C CB  . VAL E 1 113 ? 97.535  36.925 150.801 1.00 53.65  ? 113 VAL E CB  1 
ATOM   6505  C CG1 . VAL E 1 113 ? 98.812  36.727 151.577 1.00 53.65  ? 113 VAL E CG1 1 
ATOM   6506  C CG2 . VAL E 1 113 ? 96.530  37.745 151.600 1.00 53.65  ? 113 VAL E CG2 1 
ATOM   6507  N N   . GLN E 1 114 ? 99.864  36.591 148.591 1.00 61.05  ? 114 GLN E N   1 
ATOM   6508  C CA  . GLN E 1 114 ? 100.597 35.660 147.773 1.00 61.05  ? 114 GLN E CA  1 
ATOM   6509  C C   . GLN E 1 114 ? 101.808 35.070 148.501 1.00 61.05  ? 114 GLN E C   1 
ATOM   6510  O O   . GLN E 1 114 ? 102.548 35.788 149.165 1.00 61.05  ? 114 GLN E O   1 
ATOM   6511  C CB  . GLN E 1 114 ? 101.072 36.377 146.520 1.00 55.54  ? 114 GLN E CB  1 
ATOM   6512  C CG  . GLN E 1 114 ? 101.715 35.457 145.534 1.00 55.54  ? 114 GLN E CG  1 
ATOM   6513  C CD  . GLN E 1 114 ? 102.389 36.190 144.424 1.00 55.54  ? 114 GLN E CD  1 
ATOM   6514  O OE1 . GLN E 1 114 ? 103.534 36.614 144.547 1.00 55.54  ? 114 GLN E OE1 1 
ATOM   6515  N NE2 . GLN E 1 114 ? 101.676 36.359 143.321 1.00 55.54  ? 114 GLN E NE2 1 
ATOM   6516  N N   . LEU E 1 115 ? 102.015 33.761 148.373 1.00 60.01  ? 115 LEU E N   1 
ATOM   6517  C CA  . LEU E 1 115 ? 103.165 33.111 148.991 1.00 60.01  ? 115 LEU E CA  1 
ATOM   6518  C C   . LEU E 1 115 ? 104.328 33.181 148.012 1.00 60.01  ? 115 LEU E C   1 
ATOM   6519  O O   . LEU E 1 115 ? 104.149 33.483 146.832 1.00 60.01  ? 115 LEU E O   1 
ATOM   6520  C CB  . LEU E 1 115 ? 102.853 31.658 149.323 1.00 53.82  ? 115 LEU E CB  1 
ATOM   6521  C CG  . LEU E 1 115 ? 101.618 31.483 150.209 1.00 53.82  ? 115 LEU E CG  1 
ATOM   6522  C CD1 . LEU E 1 115 ? 101.317 30.013 150.431 1.00 53.82  ? 115 LEU E CD1 1 
ATOM   6523  C CD2 . LEU E 1 115 ? 101.847 32.182 151.532 1.00 53.82  ? 115 LEU E CD2 1 
ATOM   6524  N N   . LYS E 1 116 ? 105.524 32.896 148.502 1.00 53.88  ? 116 LYS E N   1 
ATOM   6525  C CA  . LYS E 1 116 ? 106.715 32.957 147.667 1.00 53.88  ? 116 LYS E CA  1 
ATOM   6526  C C   . LYS E 1 116 ? 106.717 32.018 146.462 1.00 53.88  ? 116 LYS E C   1 
ATOM   6527  O O   . LYS E 1 116 ? 107.540 32.165 145.562 1.00 53.88  ? 116 LYS E O   1 
ATOM   6528  C CB  . LYS E 1 116 ? 107.958 32.689 148.519 1.00 81.74  ? 116 LYS E CB  1 
ATOM   6529  C CG  . LYS E 1 116 ? 107.912 31.377 149.276 1.00 81.74  ? 116 LYS E CG  1 
ATOM   6530  C CD  . LYS E 1 116 ? 109.224 31.101 149.973 1.00 81.74  ? 116 LYS E CD  1 
ATOM   6531  C CE  . LYS E 1 116 ? 109.170 29.799 150.757 1.00 81.74  ? 116 LYS E CE  1 
ATOM   6532  N NZ  . LYS E 1 116 ? 110.460 29.520 151.454 1.00 81.74  ? 116 LYS E NZ  1 
ATOM   6533  N N   . ASP E 1 117 ? 105.805 31.055 146.434 1.00 58.15  ? 117 ASP E N   1 
ATOM   6534  C CA  . ASP E 1 117 ? 105.782 30.112 145.321 1.00 58.15  ? 117 ASP E CA  1 
ATOM   6535  C C   . ASP E 1 117 ? 104.776 30.468 144.223 1.00 58.15  ? 117 ASP E C   1 
ATOM   6536  O O   . ASP E 1 117 ? 104.620 29.736 143.256 1.00 58.15  ? 117 ASP E O   1 
ATOM   6537  C CB  . ASP E 1 117 ? 105.514 28.703 145.844 1.00 68.25  ? 117 ASP E CB  1 
ATOM   6538  C CG  . ASP E 1 117 ? 104.058 28.470 146.169 1.00 68.25  ? 117 ASP E CG  1 
ATOM   6539  O OD1 . ASP E 1 117 ? 103.394 29.395 146.690 1.00 68.25  ? 117 ASP E OD1 1 
ATOM   6540  O OD2 . ASP E 1 117 ? 103.577 27.343 145.908 1.00 68.25  ? 117 ASP E OD2 1 
ATOM   6541  N N   . GLY E 1 118 ? 104.104 31.599 144.366 1.00 37.45  ? 118 GLY E N   1 
ATOM   6542  C CA  . GLY E 1 118 ? 103.142 32.006 143.370 1.00 37.45  ? 118 GLY E CA  1 
ATOM   6543  C C   . GLY E 1 118 ? 101.726 31.811 143.841 1.00 37.45  ? 118 GLY E C   1 
ATOM   6544  O O   . GLY E 1 118 ? 100.815 32.469 143.343 1.00 37.45  ? 118 GLY E O   1 
ATOM   6545  N N   . SER E 1 119 ? 101.551 30.897 144.793 1.00 55.09  ? 119 SER E N   1 
ATOM   6546  C CA  . SER E 1 119 ? 100.248 30.575 145.370 1.00 55.09  ? 119 SER E CA  1 
ATOM   6547  C C   . SER E 1 119 ? 99.602  31.870 145.868 1.00 55.09  ? 119 SER E C   1 
ATOM   6548  O O   . SER E 1 119 ? 100.306 32.761 146.337 1.00 55.09  ? 119 SER E O   1 
ATOM   6549  C CB  . SER E 1 119 ? 100.451 29.592 146.517 1.00 47.90  ? 119 SER E CB  1 
ATOM   6550  O OG  . SER E 1 119 ? 99.215  29.167 147.034 1.00 47.90  ? 119 SER E OG  1 
ATOM   6551  N N   . TYR E 1 120 ? 98.275  31.984 145.774 1.00 34.28  ? 120 TYR E N   1 
ATOM   6552  C CA  . TYR E 1 120 ? 97.613  33.218 146.193 1.00 34.28  ? 120 TYR E CA  1 
ATOM   6553  C C   . TYR E 1 120 ? 96.154  33.052 146.551 1.00 34.28  ? 120 TYR E C   1 
ATOM   6554  O O   . TYR E 1 120 ? 95.521  32.081 146.167 1.00 34.28  ? 120 TYR E O   1 
ATOM   6555  C CB  . TYR E 1 120 ? 97.733  34.256 145.060 1.00 43.97  ? 120 TYR E CB  1 
ATOM   6556  C CG  . TYR E 1 120 ? 97.027  33.864 143.774 1.00 43.97  ? 120 TYR E CG  1 
ATOM   6557  C CD1 . TYR E 1 120 ? 95.640  33.986 143.654 1.00 43.97  ? 120 TYR E CD1 1 
ATOM   6558  C CD2 . TYR E 1 120 ? 97.734  33.314 142.697 1.00 43.97  ? 120 TYR E CD2 1 
ATOM   6559  C CE1 . TYR E 1 120 ? 94.970  33.567 142.502 1.00 43.97  ? 120 TYR E CE1 1 
ATOM   6560  C CE2 . TYR E 1 120 ? 97.070  32.883 141.523 1.00 43.97  ? 120 TYR E CE2 1 
ATOM   6561  C CZ  . TYR E 1 120 ? 95.686  33.015 141.441 1.00 43.97  ? 120 TYR E CZ  1 
ATOM   6562  O OH  . TYR E 1 120 ? 94.990  32.609 140.321 1.00 43.97  ? 120 TYR E OH  1 
ATOM   6563  N N   . HIS E 1 121 ? 95.624  34.016 147.284 1.00 55.47  ? 121 HIS E N   1 
ATOM   6564  C CA  . HIS E 1 121 ? 94.218  34.030 147.659 1.00 55.47  ? 121 HIS E CA  1 
ATOM   6565  C C   . HIS E 1 121 ? 93.842  35.507 147.804 1.00 55.47  ? 121 HIS E C   1 
ATOM   6566  O O   . HIS E 1 121 ? 94.633  36.295 148.320 1.00 55.47  ? 121 HIS E O   1 
ATOM   6567  C CB  . HIS E 1 121 ? 93.976  33.293 148.981 1.00 51.47  ? 121 HIS E CB  1 
ATOM   6568  C CG  . HIS E 1 121 ? 94.137  31.804 148.896 1.00 51.47  ? 121 HIS E CG  1 
ATOM   6569  N ND1 . HIS E 1 121 ? 95.226  31.139 149.419 1.00 51.47  ? 121 HIS E ND1 1 
ATOM   6570  C CD2 . HIS E 1 121 ? 93.333  30.848 148.374 1.00 51.47  ? 121 HIS E CD2 1 
ATOM   6571  C CE1 . HIS E 1 121 ? 95.085  29.841 149.224 1.00 51.47  ? 121 HIS E CE1 1 
ATOM   6572  N NE2 . HIS E 1 121 ? 93.943  29.638 148.592 1.00 51.47  ? 121 HIS E NE2 1 
ATOM   6573  N N   . GLU E 1 122 ? 92.651  35.881 147.339 1.00 55.89  ? 122 GLU E N   1 
ATOM   6574  C CA  . GLU E 1 122 ? 92.201  37.264 147.400 1.00 55.89  ? 122 GLU E CA  1 
ATOM   6575  C C   . GLU E 1 122 ? 90.784  37.332 147.981 1.00 55.89  ? 122 GLU E C   1 
ATOM   6576  O O   . GLU E 1 122 ? 89.966  36.446 147.723 1.00 55.89  ? 122 GLU E O   1 
ATOM   6577  C CB  . GLU E 1 122 ? 92.259  37.858 145.994 1.00 64.42  ? 122 GLU E CB  1 
ATOM   6578  C CG  . GLU E 1 122 ? 91.494  39.143 145.805 1.00 64.42  ? 122 GLU E CG  1 
ATOM   6579  C CD  . GLU E 1 122 ? 91.638  39.701 144.402 1.00 64.42  ? 122 GLU E CD  1 
ATOM   6580  O OE1 . GLU E 1 122 ? 91.585  38.912 143.427 1.00 64.42  ? 122 GLU E OE1 1 
ATOM   6581  O OE2 . GLU E 1 122 ? 91.790  40.932 144.279 1.00 64.42  ? 122 GLU E OE2 1 
ATOM   6582  N N   . ASP E 1 123 ? 90.503  38.367 148.780 1.00 68.61  ? 123 ASP E N   1 
ATOM   6583  C CA  . ASP E 1 123 ? 89.186  38.515 149.402 1.00 68.61  ? 123 ASP E CA  1 
ATOM   6584  C C   . ASP E 1 123 ? 88.792  39.976 149.621 1.00 68.61  ? 123 ASP E C   1 
ATOM   6585  O O   . ASP E 1 123 ? 89.604  40.883 149.430 1.00 68.61  ? 123 ASP E O   1 
ATOM   6586  C CB  . ASP E 1 123 ? 89.158  37.782 150.745 1.00 60.55  ? 123 ASP E CB  1 
ATOM   6587  C CG  . ASP E 1 123 ? 87.815  37.114 151.022 1.00 60.55  ? 123 ASP E CG  1 
ATOM   6588  O OD1 . ASP E 1 123 ? 86.780  37.818 151.051 1.00 60.55  ? 123 ASP E OD1 1 
ATOM   6589  O OD2 . ASP E 1 123 ? 87.803  35.872 151.211 1.00 60.55  ? 123 ASP E OD2 1 
ATOM   6590  N N   . VAL E 1 124 ? 87.542  40.195 150.022 1.00 66.23  ? 124 VAL E N   1 
ATOM   6591  C CA  . VAL E 1 124 ? 87.044  41.541 150.263 1.00 66.23  ? 124 VAL E CA  1 
ATOM   6592  C C   . VAL E 1 124 ? 87.141  41.871 151.734 1.00 66.23  ? 124 VAL E C   1 
ATOM   6593  O O   . VAL E 1 124 ? 86.907  41.009 152.576 1.00 66.23  ? 124 VAL E O   1 
ATOM   6594  C CB  . VAL E 1 124 ? 85.546  41.698 149.935 1.00 93.39  ? 124 VAL E CB  1 
ATOM   6595  C CG1 . VAL E 1 124 ? 85.307  43.023 149.246 1.00 93.39  ? 124 VAL E CG1 1 
ATOM   6596  C CG2 . VAL E 1 124 ? 85.057  40.556 149.122 1.00 93.39  ? 124 VAL E CG2 1 
ATOM   6597  N N   . GLY E 1 125 ? 87.471  43.119 152.042 1.00 76.49  ? 125 GLY E N   1 
ATOM   6598  C CA  . GLY E 1 125 ? 87.528  43.551 153.424 1.00 76.49  ? 125 GLY E CA  1 
ATOM   6599  C C   . GLY E 1 125 ? 86.524  44.683 153.488 1.00 76.49  ? 125 GLY E C   1 
ATOM   6600  O O   . GLY E 1 125 ? 86.236  45.274 152.453 1.00 76.49  ? 125 GLY E O   1 
ATOM   6601  N N   . TYR E 1 126 ? 85.964  44.984 154.658 1.00 77.64  ? 126 TYR E N   1 
ATOM   6602  C CA  . TYR E 1 126 ? 85.009  46.085 154.755 1.00 77.64  ? 126 TYR E CA  1 
ATOM   6603  C C   . TYR E 1 126 ? 85.287  46.910 155.989 1.00 77.64  ? 126 TYR E C   1 
ATOM   6604  O O   . TYR E 1 126 ? 85.515  46.363 157.061 1.00 77.64  ? 126 TYR E O   1 
ATOM   6605  C CB  . TYR E 1 126 ? 83.572  45.579 154.811 1.00 79.71  ? 126 TYR E CB  1 
ATOM   6606  C CG  . TYR E 1 126 ? 82.595  46.549 154.192 1.00 79.71  ? 126 TYR E CG  1 
ATOM   6607  C CD1 . TYR E 1 126 ? 82.462  46.641 152.805 1.00 79.71  ? 126 TYR E CD1 1 
ATOM   6608  C CD2 . TYR E 1 126 ? 81.829  47.404 154.979 1.00 79.71  ? 126 TYR E CD2 1 
ATOM   6609  C CE1 . TYR E 1 126 ? 81.589  47.562 152.217 1.00 79.71  ? 126 TYR E CE1 1 
ATOM   6610  C CE2 . TYR E 1 126 ? 80.955  48.327 154.399 1.00 79.71  ? 126 TYR E CE2 1 
ATOM   6611  C CZ  . TYR E 1 126 ? 80.842  48.397 153.021 1.00 79.71  ? 126 TYR E CZ  1 
ATOM   6612  O OH  . TYR E 1 126 ? 79.978  49.293 152.448 1.00 79.71  ? 126 TYR E OH  1 
ATOM   6613  N N   . GLY E 1 127 ? 85.279  48.229 155.824 1.00 96.46  ? 127 GLY E N   1 
ATOM   6614  C CA  . GLY E 1 127 ? 85.522  49.137 156.933 1.00 96.46  ? 127 GLY E CA  1 
ATOM   6615  C C   . GLY E 1 127 ? 84.273  49.955 157.204 1.00 96.46  ? 127 GLY E C   1 
ATOM   6616  O O   . GLY E 1 127 ? 83.527  50.275 156.279 1.00 96.46  ? 127 GLY E O   1 
ATOM   6617  N N   . VAL E 1 128 ? 84.022  50.287 158.465 1.00 89.28  ? 128 VAL E N   1 
ATOM   6618  C CA  . VAL E 1 128 ? 82.836  51.069 158.792 1.00 89.28  ? 128 VAL E CA  1 
ATOM   6619  C C   . VAL E 1 128 ? 83.076  52.081 159.902 1.00 89.28  ? 128 VAL E C   1 
ATOM   6620  O O   . VAL E 1 128 ? 83.899  51.866 160.782 1.00 89.28  ? 128 VAL E O   1 
ATOM   6621  C CB  . VAL E 1 128 ? 81.674  50.176 159.237 1.00 53.97  ? 128 VAL E CB  1 
ATOM   6622  C CG1 . VAL E 1 128 ? 80.399  50.987 159.269 1.00 53.97  ? 128 VAL E CG1 1 
ATOM   6623  C CG2 . VAL E 1 128 ? 81.524  48.989 158.313 1.00 53.97  ? 128 VAL E CG2 1 
ATOM   6624  N N   . SER E 1 129 ? 82.339  53.184 159.845 1.00 124.09 ? 129 SER E N   1 
ATOM   6625  C CA  . SER E 1 129 ? 82.408  54.260 160.835 1.00 124.09 ? 129 SER E CA  1 
ATOM   6626  C C   . SER E 1 129 ? 81.023  54.880 160.840 1.00 124.09 ? 129 SER E C   1 
ATOM   6627  O O   . SER E 1 129 ? 80.626  55.492 159.854 1.00 124.09 ? 129 SER E O   1 
ATOM   6628  C CB  . SER E 1 129 ? 83.419  55.322 160.417 1.00 66.55  ? 129 SER E CB  1 
ATOM   6629  O OG  . SER E 1 129 ? 83.245  56.492 161.202 1.00 66.55  ? 129 SER E OG  1 
ATOM   6630  N N   . GLU E 1 130 ? 80.284  54.750 161.935 1.00 85.58  ? 130 GLU E N   1 
ATOM   6631  C CA  . GLU E 1 130 ? 78.929  55.291 161.932 1.00 85.58  ? 130 GLU E CA  1 
ATOM   6632  C C   . GLU E 1 130 ? 78.593  56.393 162.934 1.00 85.58  ? 130 GLU E C   1 
ATOM   6633  O O   . GLU E 1 130 ? 77.473  56.915 162.942 1.00 85.58  ? 130 GLU E O   1 
ATOM   6634  C CB  . GLU E 1 130 ? 77.924  54.139 162.067 1.00 119.52 ? 130 GLU E CB  1 
ATOM   6635  C CG  . GLU E 1 130 ? 78.227  52.963 161.132 1.00 119.52 ? 130 GLU E CG  1 
ATOM   6636  C CD  . GLU E 1 130 ? 77.008  52.114 160.809 1.00 119.52 ? 130 GLU E CD  1 
ATOM   6637  O OE1 . GLU E 1 130 ? 76.138  52.584 160.045 1.00 119.52 ? 130 GLU E OE1 1 
ATOM   6638  O OE2 . GLU E 1 130 ? 76.920  50.975 161.316 1.00 119.52 ? 130 GLU E OE2 1 
ATOM   6639  N N   . GLY E 1 131 ? 79.553  56.774 163.762 1.00 82.57  ? 131 GLY E N   1 
ATOM   6640  C CA  . GLY E 1 131 ? 79.260  57.808 164.735 1.00 82.57  ? 131 GLY E CA  1 
ATOM   6641  C C   . GLY E 1 131 ? 79.898  59.161 164.495 1.00 82.57  ? 131 GLY E C   1 
ATOM   6642  O O   . GLY E 1 131 ? 79.211  60.135 164.181 1.00 82.57  ? 131 GLY E O   1 
ATOM   6643  N N   . LEU E 1 132 ? 81.217  59.204 164.665 1.00 92.14  ? 132 LEU E N   1 
ATOM   6644  C CA  . LEU E 1 132 ? 82.033  60.402 164.515 1.00 92.14  ? 132 LEU E CA  1 
ATOM   6645  C C   . LEU E 1 132 ? 81.419  61.633 163.839 1.00 92.14  ? 132 LEU E C   1 
ATOM   6646  O O   . LEU E 1 132 ? 80.588  61.531 162.930 1.00 92.14  ? 132 LEU E O   1 
ATOM   6647  C CB  . LEU E 1 132 ? 83.333  60.023 163.811 1.00 98.93  ? 132 LEU E CB  1 
ATOM   6648  C CG  . LEU E 1 132 ? 84.178  59.018 164.593 1.00 98.93  ? 132 LEU E CG  1 
ATOM   6649  C CD1 . LEU E 1 132 ? 85.327  58.518 163.738 1.00 98.93  ? 132 LEU E CD1 1 
ATOM   6650  C CD2 . LEU E 1 132 ? 84.706  59.685 165.851 1.00 98.93  ? 132 LEU E CD2 1 
ATOM   6651  N N   . LYS E 1 133 ? 81.846  62.804 164.303 1.00 132.38 ? 133 LYS E N   1 
ATOM   6652  C CA  . LYS E 1 133 ? 81.381  64.071 163.756 1.00 132.38 ? 133 LYS E CA  1 
ATOM   6653  C C   . LYS E 1 133 ? 82.403  64.524 162.731 1.00 132.38 ? 133 LYS E C   1 
ATOM   6654  O O   . LYS E 1 133 ? 82.120  65.377 161.895 1.00 132.38 ? 133 LYS E O   1 
ATOM   6655  C CB  . LYS E 1 133 ? 81.267  65.127 164.857 1.00 141.12 ? 133 LYS E CB  1 
ATOM   6656  C CG  . LYS E 1 133 ? 80.215  64.830 165.910 1.00 141.12 ? 133 LYS E CG  1 
ATOM   6657  C CD  . LYS E 1 133 ? 80.254  65.860 167.031 1.00 141.12 ? 133 LYS E CD  1 
ATOM   6658  C CE  . LYS E 1 133 ? 79.997  67.270 166.514 1.00 141.12 ? 133 LYS E CE  1 
ATOM   6659  N NZ  . LYS E 1 133 ? 78.654  67.400 165.877 1.00 141.12 ? 133 LYS E NZ  1 
ATOM   6660  N N   . SER E 1 134 ? 83.598  63.947 162.813 1.00 164.62 ? 134 SER E N   1 
ATOM   6661  C CA  . SER E 1 134 ? 84.673  64.278 161.890 1.00 164.62 ? 134 SER E CA  1 
ATOM   6662  C C   . SER E 1 134 ? 84.615  63.397 160.652 1.00 164.62 ? 134 SER E C   1 
ATOM   6663  O O   . SER E 1 134 ? 84.619  62.171 160.752 1.00 164.62 ? 134 SER E O   1 
ATOM   6664  C CB  . SER E 1 134 ? 86.030  64.095 162.567 1.00 92.04  ? 134 SER E CB  1 
ATOM   6665  O OG  . SER E 1 134 ? 87.084  64.290 161.639 1.00 92.04  ? 134 SER E OG  1 
ATOM   6666  N N   . LYS E 1 135 ? 84.555  64.022 159.483 1.00 101.26 ? 135 LYS E N   1 
ATOM   6667  C CA  . LYS E 1 135 ? 84.513  63.265 158.249 1.00 101.26 ? 135 LYS E CA  1 
ATOM   6668  C C   . LYS E 1 135 ? 85.865  62.585 158.059 1.00 101.26 ? 135 LYS E C   1 
ATOM   6669  O O   . LYS E 1 135 ? 85.926  61.384 157.809 1.00 101.26 ? 135 LYS E O   1 
ATOM   6670  C CB  . LYS E 1 135 ? 84.198  64.190 157.070 1.00 80.21  ? 135 LYS E CB  1 
ATOM   6671  C CG  . LYS E 1 135 ? 84.053  63.469 155.738 1.00 80.21  ? 135 LYS E CG  1 
ATOM   6672  C CD  . LYS E 1 135 ? 83.119  64.201 154.772 1.00 80.21  ? 135 LYS E CD  1 
ATOM   6673  C CE  . LYS E 1 135 ? 83.702  65.485 154.219 1.00 80.21  ? 135 LYS E CE  1 
ATOM   6674  N NZ  . LYS E 1 135 ? 82.769  66.067 153.216 1.00 80.21  ? 135 LYS E NZ  1 
ATOM   6675  N N   . ALA E 1 136 ? 86.949  63.343 158.206 1.00 72.77  ? 136 ALA E N   1 
ATOM   6676  C CA  . ALA E 1 136 ? 88.276  62.766 158.037 1.00 72.77  ? 136 ALA E CA  1 
ATOM   6677  C C   . ALA E 1 136 ? 88.436  61.512 158.889 1.00 72.77  ? 136 ALA E C   1 
ATOM   6678  O O   . ALA E 1 136 ? 88.756  60.447 158.370 1.00 72.77  ? 136 ALA E O   1 
ATOM   6679  C CB  . ALA E 1 136 ? 89.382  63.795 158.386 1.00 43.04  ? 136 ALA E CB  1 
ATOM   6680  N N   . LEU E 1 137 ? 88.199  61.625 160.190 1.00 66.04  ? 137 LEU E N   1 
ATOM   6681  C CA  . LEU E 1 137 ? 88.351  60.479 161.058 1.00 66.04  ? 137 LEU E CA  1 
ATOM   6682  C C   . LEU E 1 137 ? 87.440  59.311 160.683 1.00 66.04  ? 137 LEU E C   1 
ATOM   6683  O O   . LEU E 1 137 ? 87.803  58.146 160.887 1.00 66.04  ? 137 LEU E O   1 
ATOM   6684  C CB  . LEU E 1 137 ? 88.117  60.885 162.511 1.00 118.59 ? 137 LEU E CB  1 
ATOM   6685  C CG  . LEU E 1 137 ? 89.351  61.415 163.245 1.00 118.59 ? 137 LEU E CG  1 
ATOM   6686  C CD1 . LEU E 1 137 ? 89.990  62.557 162.470 1.00 118.59 ? 137 LEU E CD1 1 
ATOM   6687  C CD2 . LEU E 1 137 ? 88.939  61.866 164.630 1.00 118.59 ? 137 LEU E CD2 1 
ATOM   6688  N N   . SER E 1 138 ? 86.263  59.602 160.137 1.00 80.07  ? 138 SER E N   1 
ATOM   6689  C CA  . SER E 1 138 ? 85.351  58.531 159.743 1.00 80.07  ? 138 SER E CA  1 
ATOM   6690  C C   . SER E 1 138 ? 85.928  57.759 158.556 1.00 80.07  ? 138 SER E C   1 
ATOM   6691  O O   . SER E 1 138 ? 85.867  56.529 158.514 1.00 80.07  ? 138 SER E O   1 
ATOM   6692  C CB  . SER E 1 138 ? 83.972  59.095 159.380 1.00 76.44  ? 138 SER E CB  1 
ATOM   6693  O OG  . SER E 1 138 ? 83.163  59.308 160.529 1.00 76.44  ? 138 SER E OG  1 
ATOM   6694  N N   . LEU E 1 139 ? 86.486  58.481 157.591 1.00 68.72  ? 139 LEU E N   1 
ATOM   6695  C CA  . LEU E 1 139 ? 87.084  57.832 156.441 1.00 68.72  ? 139 LEU E CA  1 
ATOM   6696  C C   . LEU E 1 139 ? 88.334  57.069 156.863 1.00 68.72  ? 139 LEU E C   1 
ATOM   6697  O O   . LEU E 1 139 ? 88.455  55.873 156.601 1.00 68.72  ? 139 LEU E O   1 
ATOM   6698  C CB  . LEU E 1 139 ? 87.443  58.859 155.366 1.00 65.04  ? 139 LEU E CB  1 
ATOM   6699  C CG  . LEU E 1 139 ? 86.268  59.420 154.555 1.00 65.04  ? 139 LEU E CG  1 
ATOM   6700  C CD1 . LEU E 1 139 ? 86.792  60.523 153.661 1.00 65.04  ? 139 LEU E CD1 1 
ATOM   6701  C CD2 . LEU E 1 139 ? 85.581  58.324 153.734 1.00 65.04  ? 139 LEU E CD2 1 
ATOM   6702  N N   . GLU E 1 140 ? 89.264  57.752 157.519 1.00 84.23  ? 140 GLU E N   1 
ATOM   6703  C CA  . GLU E 1 140 ? 90.486  57.091 157.958 1.00 84.23  ? 140 GLU E CA  1 
ATOM   6704  C C   . GLU E 1 140 ? 90.169  55.759 158.616 1.00 84.23  ? 140 GLU E C   1 
ATOM   6705  O O   . GLU E 1 140 ? 90.853  54.760 158.386 1.00 84.23  ? 140 GLU E O   1 
ATOM   6706  C CB  . GLU E 1 140 ? 91.254  57.959 158.956 1.00 102.60 ? 140 GLU E CB  1 
ATOM   6707  C CG  . GLU E 1 140 ? 92.406  57.219 159.627 1.00 102.60 ? 140 GLU E CG  1 
ATOM   6708  C CD  . GLU E 1 140 ? 93.170  58.079 160.610 1.00 102.60 ? 140 GLU E CD  1 
ATOM   6709  O OE1 . GLU E 1 140 ? 92.520  58.753 161.438 1.00 102.60 ? 140 GLU E OE1 1 
ATOM   6710  O OE2 . GLU E 1 140 ? 94.421  58.076 160.560 1.00 102.60 ? 140 GLU E OE2 1 
ATOM   6711  N N   . LYS E 1 141 ? 89.121  55.744 159.427 1.00 77.58  ? 141 LYS E N   1 
ATOM   6712  C CA  . LYS E 1 141 ? 88.754  54.529 160.129 1.00 77.58  ? 141 LYS E CA  1 
ATOM   6713  C C   . LYS E 1 141 ? 88.275  53.448 159.165 1.00 77.58  ? 141 LYS E C   1 
ATOM   6714  O O   . LYS E 1 141 ? 88.801  52.332 159.168 1.00 77.58  ? 141 LYS E O   1 
ATOM   6715  C CB  . LYS E 1 141 ? 87.672  54.832 161.173 1.00 63.69  ? 141 LYS E CB  1 
ATOM   6716  C CG  . LYS E 1 141 ? 87.526  53.767 162.257 1.00 63.69  ? 141 LYS E CG  1 
ATOM   6717  C CD  . LYS E 1 141 ? 86.108  53.225 162.332 1.00 63.69  ? 141 LYS E CD  1 
ATOM   6718  C CE  . LYS E 1 141 ? 85.955  52.218 163.467 1.00 63.69  ? 141 LYS E CE  1 
ATOM   6719  N NZ  . LYS E 1 141 ? 84.702  51.415 163.383 1.00 63.69  ? 141 LYS E NZ  1 
ATOM   6720  N N   . ALA E 1 142 ? 87.292  53.786 158.332 1.00 90.27  ? 142 ALA E N   1 
ATOM   6721  C CA  . ALA E 1 142 ? 86.729  52.836 157.371 1.00 90.27  ? 142 ALA E CA  1 
ATOM   6722  C C   . ALA E 1 142 ? 87.739  52.316 156.354 1.00 90.27  ? 142 ALA E C   1 
ATOM   6723  O O   . ALA E 1 142 ? 87.750  51.124 156.054 1.00 90.27  ? 142 ALA E O   1 
ATOM   6724  C CB  . ALA E 1 142 ? 85.543  53.464 156.652 1.00 56.26  ? 142 ALA E CB  1 
ATOM   6725  N N   . ARG E 1 143 ? 88.584  53.202 155.826 1.00 62.33  ? 143 ARG E N   1 
ATOM   6726  C CA  . ARG E 1 143 ? 89.585  52.800 154.844 1.00 62.33  ? 143 ARG E CA  1 
ATOM   6727  C C   . ARG E 1 143 ? 90.583  51.830 155.445 1.00 62.33  ? 143 ARG E C   1 
ATOM   6728  O O   . ARG E 1 143 ? 90.822  50.765 154.885 1.00 62.33  ? 143 ARG E O   1 
ATOM   6729  C CB  . ARG E 1 143 ? 90.329  54.018 154.264 1.00 85.41  ? 143 ARG E CB  1 
ATOM   6730  C CG  . ARG E 1 143 ? 89.410  55.064 153.647 1.00 85.41  ? 143 ARG E CG  1 
ATOM   6731  C CD  . ARG E 1 143 ? 90.117  55.997 152.662 1.00 85.41  ? 143 ARG E CD  1 
ATOM   6732  N NE  . ARG E 1 143 ? 90.048  55.482 151.297 1.00 85.41  ? 143 ARG E NE  1 
ATOM   6733  C CZ  . ARG E 1 143 ? 89.676  56.194 150.238 1.00 85.41  ? 143 ARG E CZ  1 
ATOM   6734  N NH1 . ARG E 1 143 ? 89.340  57.461 150.385 1.00 85.41  ? 143 ARG E NH1 1 
ATOM   6735  N NH2 . ARG E 1 143 ? 89.618  55.634 149.035 1.00 85.41  ? 143 ARG E NH2 1 
ATOM   6736  N N   . LYS E 1 144 ? 91.162  52.185 156.587 1.00 64.83  ? 144 LYS E N   1 
ATOM   6737  C CA  . LYS E 1 144 ? 92.142  51.315 157.232 1.00 64.83  ? 144 LYS E CA  1 
ATOM   6738  C C   . LYS E 1 144 ? 91.547  49.964 157.642 1.00 64.83  ? 144 LYS E C   1 
ATOM   6739  O O   . LYS E 1 144 ? 92.157  48.906 157.436 1.00 64.83  ? 144 LYS E O   1 
ATOM   6740  C CB  . LYS E 1 144 ? 92.747  52.019 158.440 1.00 64.87  ? 144 LYS E CB  1 
ATOM   6741  C CG  . LYS E 1 144 ? 93.493  53.279 158.058 1.00 64.87  ? 144 LYS E CG  1 
ATOM   6742  C CD  . LYS E 1 144 ? 94.310  53.831 159.204 1.00 64.87  ? 144 LYS E CD  1 
ATOM   6743  C CE  . LYS E 1 144 ? 95.121  55.024 158.742 1.00 64.87  ? 144 LYS E CE  1 
ATOM   6744  N NZ  . LYS E 1 144 ? 95.995  55.573 159.813 1.00 64.87  ? 144 LYS E NZ  1 
ATOM   6745  N N   . GLU E 1 145 ? 90.351  49.996 158.213 1.00 68.14  ? 145 GLU E N   1 
ATOM   6746  C CA  . GLU E 1 145 ? 89.710  48.764 158.619 1.00 68.14  ? 145 GLU E CA  1 
ATOM   6747  C C   . GLU E 1 145 ? 89.407  47.862 157.425 1.00 68.14  ? 145 GLU E C   1 
ATOM   6748  O O   . GLU E 1 145 ? 89.718  46.671 157.454 1.00 68.14  ? 145 GLU E O   1 
ATOM   6749  C CB  . GLU E 1 145 ? 88.451  49.070 159.428 1.00 89.29  ? 145 GLU E CB  1 
ATOM   6750  C CG  . GLU E 1 145 ? 88.731  49.083 160.930 1.00 89.29  ? 145 GLU E CG  1 
ATOM   6751  C CD  . GLU E 1 145 ? 87.616  49.703 161.755 1.00 89.29  ? 145 GLU E CD  1 
ATOM   6752  O OE1 . GLU E 1 145 ? 86.430  49.350 161.541 1.00 89.29  ? 145 GLU E OE1 1 
ATOM   6753  O OE2 . GLU E 1 145 ? 87.940  50.539 162.627 1.00 89.29  ? 145 GLU E OE2 1 
ATOM   6754  N N   . ALA E 1 146 ? 88.822  48.419 156.369 1.00 63.68  ? 146 ALA E N   1 
ATOM   6755  C CA  . ALA E 1 146 ? 88.522  47.630 155.175 1.00 63.68  ? 146 ALA E CA  1 
ATOM   6756  C C   . ALA E 1 146 ? 89.748  46.819 154.717 1.00 63.68  ? 146 ALA E C   1 
ATOM   6757  O O   . ALA E 1 146 ? 89.633  45.633 154.431 1.00 63.68  ? 146 ALA E O   1 
ATOM   6758  C CB  . ALA E 1 146 ? 88.050  48.540 154.057 1.00 113.13 ? 146 ALA E CB  1 
ATOM   6759  N N   . VAL E 1 147 ? 90.913  47.455 154.650 1.00 53.30  ? 147 VAL E N   1 
ATOM   6760  C CA  . VAL E 1 147 ? 92.132  46.762 154.247 1.00 53.30  ? 147 VAL E CA  1 
ATOM   6761  C C   . VAL E 1 147 ? 92.461  45.619 155.196 1.00 53.30  ? 147 VAL E C   1 
ATOM   6762  O O   . VAL E 1 147 ? 92.486  44.450 154.806 1.00 53.30  ? 147 VAL E O   1 
ATOM   6763  C CB  . VAL E 1 147 ? 93.342  47.712 154.212 1.00 37.44  ? 147 VAL E CB  1 
ATOM   6764  C CG1 . VAL E 1 147 ? 94.651  46.925 154.162 1.00 37.44  ? 147 VAL E CG1 1 
ATOM   6765  C CG2 . VAL E 1 147 ? 93.228  48.598 153.004 1.00 37.44  ? 147 VAL E CG2 1 
ATOM   6766  N N   . THR E 1 148 ? 92.721  45.946 156.449 1.00 61.31  ? 148 THR E N   1 
ATOM   6767  C CA  . THR E 1 148 ? 93.042  44.907 157.399 1.00 61.31  ? 148 THR E CA  1 
ATOM   6768  C C   . THR E 1 148 ? 91.992  43.797 157.361 1.00 61.31  ? 148 THR E C   1 
ATOM   6769  O O   . THR E 1 148 ? 92.332  42.623 157.377 1.00 61.31  ? 148 THR E O   1 
ATOM   6770  C CB  . THR E 1 148 ? 93.162  45.484 158.810 1.00 62.20  ? 148 THR E CB  1 
ATOM   6771  O OG1 . THR E 1 148 ? 94.194  46.478 158.814 1.00 62.20  ? 148 THR E OG1 1 
ATOM   6772  C CG2 . THR E 1 148 ? 93.518  44.389 159.806 1.00 62.20  ? 148 THR E CG2 1 
ATOM   6773  N N   . ASP E 1 149 ? 90.721  44.158 157.285 1.00 50.99  ? 149 ASP E N   1 
ATOM   6774  C CA  . ASP E 1 149 ? 89.673  43.143 157.245 1.00 50.99  ? 149 ASP E CA  1 
ATOM   6775  C C   . ASP E 1 149 ? 89.823  42.281 155.994 1.00 50.99  ? 149 ASP E C   1 
ATOM   6776  O O   . ASP E 1 149 ? 89.473  41.090 155.987 1.00 50.99  ? 149 ASP E O   1 
ATOM   6777  C CB  . ASP E 1 149 ? 88.305  43.798 157.244 1.00 60.02  ? 149 ASP E CB  1 
ATOM   6778  C CG  . ASP E 1 149 ? 87.194  42.800 157.346 1.00 60.02  ? 149 ASP E CG  1 
ATOM   6779  O OD1 . ASP E 1 149 ? 87.231  41.948 158.260 1.00 60.02  ? 149 ASP E OD1 1 
ATOM   6780  O OD2 . ASP E 1 149 ? 86.273  42.875 156.516 1.00 60.02  ? 149 ASP E OD2 1 
ATOM   6781  N N   . GLY E 1 150 ? 90.347  42.889 154.935 1.00 62.64  ? 150 GLY E N   1 
ATOM   6782  C CA  . GLY E 1 150 ? 90.555  42.156 153.709 1.00 62.64  ? 150 GLY E CA  1 
ATOM   6783  C C   . GLY E 1 150 ? 91.733  41.214 153.876 1.00 62.64  ? 150 GLY E C   1 
ATOM   6784  O O   . GLY E 1 150 ? 91.639  40.011 153.615 1.00 62.64  ? 150 GLY E O   1 
ATOM   6785  N N   . LEU E 1 151 ? 92.859  41.749 154.318 1.00 50.35  ? 151 LEU E N   1 
ATOM   6786  C CA  . LEU E 1 151 ? 94.028  40.905 154.519 1.00 50.35  ? 151 LEU E CA  1 
ATOM   6787  C C   . LEU E 1 151 ? 93.724  39.702 155.420 1.00 50.35  ? 151 LEU E C   1 
ATOM   6788  O O   . LEU E 1 151 ? 94.194  38.594 155.174 1.00 50.35  ? 151 LEU E O   1 
ATOM   6789  C CB  . LEU E 1 151 ? 95.156  41.716 155.135 1.00 34.74  ? 151 LEU E CB  1 
ATOM   6790  C CG  . LEU E 1 151 ? 96.361  40.918 155.627 1.00 34.74  ? 151 LEU E CG  1 
ATOM   6791  C CD1 . LEU E 1 151 ? 96.809  39.901 154.605 1.00 34.74  ? 151 LEU E CD1 1 
ATOM   6792  C CD2 . LEU E 1 151 ? 97.496  41.885 155.910 1.00 34.74  ? 151 LEU E CD2 1 
ATOM   6793  N N   . LYS E 1 152 ? 92.942  39.918 156.471 1.00 68.19  ? 152 LYS E N   1 
ATOM   6794  C CA  . LYS E 1 152 ? 92.628  38.826 157.367 1.00 68.19  ? 152 LYS E CA  1 
ATOM   6795  C C   . LYS E 1 152 ? 91.771  37.803 156.659 1.00 68.19  ? 152 LYS E C   1 
ATOM   6796  O O   . LYS E 1 152 ? 92.041  36.605 156.729 1.00 68.19  ? 152 LYS E O   1 
ATOM   6797  C CB  . LYS E 1 152 ? 91.895  39.323 158.619 1.00 73.06  ? 152 LYS E CB  1 
ATOM   6798  C CG  . LYS E 1 152 ? 92.781  39.999 159.661 1.00 73.06  ? 152 LYS E CG  1 
ATOM   6799  C CD  . LYS E 1 152 ? 92.019  40.226 160.960 1.00 73.06  ? 152 LYS E CD  1 
ATOM   6800  C CE  . LYS E 1 152 ? 90.726  40.988 160.733 1.00 73.06  ? 152 LYS E CE  1 
ATOM   6801  N NZ  . LYS E 1 152 ? 90.033  41.268 162.011 1.00 73.06  ? 152 LYS E NZ  1 
ATOM   6802  N N   . ARG E 1 153 ? 90.737  38.273 155.974 1.00 55.93  ? 153 ARG E N   1 
ATOM   6803  C CA  . ARG E 1 153 ? 89.851  37.353 155.285 1.00 55.93  ? 153 ARG E CA  1 
ATOM   6804  C C   . ARG E 1 153 ? 90.566  36.565 154.200 1.00 55.93  ? 153 ARG E C   1 
ATOM   6805  O O   . ARG E 1 153 ? 90.180  35.427 153.886 1.00 55.93  ? 153 ARG E O   1 
ATOM   6806  C CB  . ARG E 1 153 ? 88.663  38.103 154.699 1.00 57.88  ? 153 ARG E CB  1 
ATOM   6807  C CG  . ARG E 1 153 ? 87.511  38.278 155.667 1.00 57.88  ? 153 ARG E CG  1 
ATOM   6808  C CD  . ARG E 1 153 ? 86.445  39.147 155.067 1.00 57.88  ? 153 ARG E CD  1 
ATOM   6809  N NE  . ARG E 1 153 ? 85.873  38.567 153.851 1.00 57.88  ? 153 ARG E NE  1 
ATOM   6810  C CZ  . ARG E 1 153 ? 84.910  37.648 153.838 1.00 57.88  ? 153 ARG E CZ  1 
ATOM   6811  N NH1 . ARG E 1 153 ? 84.416  37.198 154.987 1.00 57.88  ? 153 ARG E NH1 1 
ATOM   6812  N NH2 . ARG E 1 153 ? 84.418  37.199 152.683 1.00 57.88  ? 153 ARG E NH2 1 
ATOM   6813  N N   . ALA E 1 154 ? 91.614  37.163 153.640 1.00 62.01  ? 154 ALA E N   1 
ATOM   6814  C CA  . ALA E 1 154 ? 92.360  36.492 152.596 1.00 62.01  ? 154 ALA E CA  1 
ATOM   6815  C C   . ALA E 1 154 ? 93.217  35.393 153.196 1.00 62.01  ? 154 ALA E C   1 
ATOM   6816  O O   . ALA E 1 154 ? 93.227  34.279 152.684 1.00 62.01  ? 154 ALA E O   1 
ATOM   6817  C CB  . ALA E 1 154 ? 93.225  37.478 151.845 1.00 60.48  ? 154 ALA E CB  1 
ATOM   6818  N N   . LEU E 1 155 ? 93.924  35.698 154.284 1.00 52.24  ? 155 LEU E N   1 
ATOM   6819  C CA  . LEU E 1 155 ? 94.792  34.716 154.921 1.00 52.24  ? 155 LEU E CA  1 
ATOM   6820  C C   . LEU E 1 155 ? 94.020  33.543 155.508 1.00 52.24  ? 155 LEU E C   1 
ATOM   6821  O O   . LEU E 1 155 ? 94.565  32.458 155.676 1.00 52.24  ? 155 LEU E O   1 
ATOM   6822  C CB  . LEU E 1 155 ? 95.631  35.384 155.993 1.00 49.35  ? 155 LEU E CB  1 
ATOM   6823  C CG  . LEU E 1 155 ? 96.764  36.278 155.473 1.00 49.35  ? 155 LEU E CG  1 
ATOM   6824  C CD1 . LEU E 1 155 ? 97.207  37.254 156.564 1.00 49.35  ? 155 LEU E CD1 1 
ATOM   6825  C CD2 . LEU E 1 155 ? 97.944  35.416 155.026 1.00 49.35  ? 155 LEU E CD2 1 
ATOM   6826  N N   . ARG E 1 156 ? 92.747  33.741 155.817 1.00 79.69  ? 156 ARG E N   1 
ATOM   6827  C CA  . ARG E 1 156 ? 91.970  32.637 156.358 1.00 79.69  ? 156 ARG E CA  1 
ATOM   6828  C C   . ARG E 1 156 ? 91.926  31.509 155.338 1.00 79.69  ? 156 ARG E C   1 
ATOM   6829  O O   . ARG E 1 156 ? 91.744  30.349 155.695 1.00 79.69  ? 156 ARG E O   1 
ATOM   6830  C CB  . ARG E 1 156 ? 90.529  33.042 156.643 1.00 82.11  ? 156 ARG E CB  1 
ATOM   6831  C CG  . ARG E 1 156 ? 90.287  33.895 157.861 1.00 82.11  ? 156 ARG E CG  1 
ATOM   6832  C CD  . ARG E 1 156 ? 88.779  34.136 157.977 1.00 82.11  ? 156 ARG E CD  1 
ATOM   6833  N NE  . ARG E 1 156 ? 88.448  35.361 158.709 1.00 82.11  ? 156 ARG E NE  1 
ATOM   6834  C CZ  . ARG E 1 156 ? 87.246  35.935 158.694 1.00 82.11  ? 156 ARG E CZ  1 
ATOM   6835  N NH1 . ARG E 1 156 ? 86.266  35.386 157.987 1.00 82.11  ? 156 ARG E NH1 1 
ATOM   6836  N NH2 . ARG E 1 156 ? 87.026  37.061 159.366 1.00 82.11  ? 156 ARG E NH2 1 
ATOM   6837  N N   . SER E 1 157 ? 92.068  31.847 154.063 1.00 95.44  ? 157 SER E N   1 
ATOM   6838  C CA  . SER E 1 157 ? 92.013  30.839 153.014 1.00 95.44  ? 157 SER E CA  1 
ATOM   6839  C C   . SER E 1 157 ? 93.130  29.812 153.113 1.00 95.44  ? 157 SER E C   1 
ATOM   6840  O O   . SER E 1 157 ? 93.008  28.707 152.587 1.00 95.44  ? 157 SER E O   1 
ATOM   6841  C CB  . SER E 1 157 ? 92.036  31.511 151.645 1.00 85.56  ? 157 SER E CB  1 
ATOM   6842  O OG  . SER E 1 157 ? 90.882  32.320 151.467 1.00 85.56  ? 157 SER E OG  1 
ATOM   6843  N N   . PHE E 1 158 ? 94.213  30.165 153.794 1.00 56.01  ? 158 PHE E N   1 
ATOM   6844  C CA  . PHE E 1 158 ? 95.328  29.239 153.941 1.00 56.01  ? 158 PHE E CA  1 
ATOM   6845  C C   . PHE E 1 158 ? 95.156  28.148 155.007 1.00 56.01  ? 158 PHE E C   1 
ATOM   6846  O O   . PHE E 1 158 ? 95.938  27.195 155.051 1.00 56.01  ? 158 PHE E O   1 
ATOM   6847  C CB  . PHE E 1 158 ? 96.615  30.009 154.207 1.00 67.53  ? 158 PHE E CB  1 
ATOM   6848  C CG  . PHE E 1 158 ? 97.172  30.681 152.995 1.00 67.53  ? 158 PHE E CG  1 
ATOM   6849  C CD1 . PHE E 1 158 ? 97.317  32.056 152.959 1.00 67.53  ? 158 PHE E CD1 1 
ATOM   6850  C CD2 . PHE E 1 158 ? 97.574  29.933 151.885 1.00 67.53  ? 158 PHE E CD2 1 
ATOM   6851  C CE1 . PHE E 1 158 ? 97.856  32.675 151.836 1.00 67.53  ? 158 PHE E CE1 1 
ATOM   6852  C CE2 . PHE E 1 158 ? 98.115  30.545 150.761 1.00 67.53  ? 158 PHE E CE2 1 
ATOM   6853  C CZ  . PHE E 1 158 ? 98.256  31.911 150.737 1.00 67.53  ? 158 PHE E CZ  1 
ATOM   6854  N N   . GLY E 1 159 ? 94.149  28.279 155.863 1.00 100.45 ? 159 GLY E N   1 
ATOM   6855  C CA  . GLY E 1 159 ? 93.936  27.267 156.882 1.00 100.45 ? 159 GLY E CA  1 
ATOM   6856  C C   . GLY E 1 159 ? 93.436  27.779 158.219 1.00 100.45 ? 159 GLY E C   1 
ATOM   6857  O O   . GLY E 1 159 ? 93.284  28.984 158.423 1.00 100.45 ? 159 GLY E O   1 
ATOM   6858  N N   . ASN E 1 160 ? 93.181  26.855 159.140 1.00 86.89  ? 160 ASN E N   1 
ATOM   6859  C CA  . ASN E 1 160 ? 92.699  27.224 160.461 1.00 86.89  ? 160 ASN E CA  1 
ATOM   6860  C C   . ASN E 1 160 ? 93.718  28.068 161.211 1.00 86.89  ? 160 ASN E C   1 
ATOM   6861  O O   . ASN E 1 160 ? 93.359  29.056 161.837 1.00 86.89  ? 160 ASN E O   1 
ATOM   6862  C CB  . ASN E 1 160 ? 92.377  25.977 161.275 1.00 100.27 ? 160 ASN E CB  1 
ATOM   6863  C CG  . ASN E 1 160 ? 91.318  25.120 160.628 1.00 100.27 ? 160 ASN E CG  1 
ATOM   6864  O OD1 . ASN E 1 160 ? 90.197  25.571 160.380 1.00 100.27 ? 160 ASN E OD1 1 
ATOM   6865  N ND2 . ASN E 1 160 ? 91.666  23.870 160.352 1.00 100.27 ? 160 ASN E ND2 1 
ATOM   6866  N N   . ALA E 1 161 ? 94.988  27.680 161.137 1.00 68.20  ? 161 ALA E N   1 
ATOM   6867  C CA  . ALA E 1 161 ? 96.059  28.399 161.822 1.00 68.20  ? 161 ALA E CA  1 
ATOM   6868  C C   . ALA E 1 161 ? 96.134  29.879 161.506 1.00 68.20  ? 161 ALA E C   1 
ATOM   6869  O O   . ALA E 1 161 ? 96.842  30.609 162.190 1.00 68.20  ? 161 ALA E O   1 
ATOM   6870  C CB  . ALA E 1 161 ? 97.405  27.770 161.504 1.00 34.46  ? 161 ALA E CB  1 
ATOM   6871  N N   . LEU E 1 162 ? 95.444  30.327 160.461 1.00 63.95  ? 162 LEU E N   1 
ATOM   6872  C CA  . LEU E 1 162 ? 95.481  31.736 160.097 1.00 63.95  ? 162 LEU E CA  1 
ATOM   6873  C C   . LEU E 1 162 ? 94.106  32.343 160.192 1.00 63.95  ? 162 LEU E C   1 
ATOM   6874  O O   . LEU E 1 162 ? 93.860  33.443 159.704 1.00 63.95  ? 162 LEU E O   1 
ATOM   6875  C CB  . LEU E 1 162 ? 96.054  31.917 158.697 1.00 63.11  ? 162 LEU E CB  1 
ATOM   6876  C CG  . LEU E 1 162 ? 97.572  31.777 158.636 1.00 63.11  ? 162 LEU E CG  1 
ATOM   6877  C CD1 . LEU E 1 162 ? 98.041  31.690 157.200 1.00 63.11  ? 162 LEU E CD1 1 
ATOM   6878  C CD2 . LEU E 1 162 ? 98.197  32.968 159.303 1.00 63.11  ? 162 LEU E CD2 1 
ATOM   6879  N N   . GLY E 1 163 ? 93.198  31.609 160.815 1.00 50.78  ? 163 GLY E N   1 
ATOM   6880  C CA  . GLY E 1 163 ? 91.872  32.140 161.012 1.00 50.78  ? 163 GLY E CA  1 
ATOM   6881  C C   . GLY E 1 163 ? 90.691  31.424 160.411 1.00 50.78  ? 163 GLY E C   1 
ATOM   6882  O O   . GLY E 1 163 ? 89.559  31.847 160.623 1.00 50.78  ? 163 GLY E O   1 
ATOM   6883  N N   . ASN E 1 164 ? 90.896  30.342 159.683 1.00 86.16  ? 164 ASN E N   1 
ATOM   6884  C CA  . ASN E 1 164 ? 89.726  29.718 159.100 1.00 86.16  ? 164 ASN E CA  1 
ATOM   6885  C C   . ASN E 1 164 ? 88.784  29.098 160.134 1.00 86.16  ? 164 ASN E C   1 
ATOM   6886  O O   . ASN E 1 164 ? 87.613  28.848 159.842 1.00 86.16  ? 164 ASN E O   1 
ATOM   6887  C CB  . ASN E 1 164 ? 90.128  28.692 158.041 1.00 84.58  ? 164 ASN E CB  1 
ATOM   6888  C CG  . ASN E 1 164 ? 88.945  28.250 157.206 1.00 84.58  ? 164 ASN E CG  1 
ATOM   6889  O OD1 . ASN E 1 164 ? 88.149  29.077 156.753 1.00 84.58  ? 164 ASN E OD1 1 
ATOM   6890  N ND2 . ASN E 1 164 ? 88.815  26.944 157.000 1.00 84.58  ? 164 ASN E ND2 1 
ATOM   6891  N N   . CYS E 1 165 ? 89.281  28.870 161.346 1.00 95.74  ? 165 CYS E N   1 
ATOM   6892  C CA  . CYS E 1 165 ? 88.462  28.285 162.410 1.00 95.74  ? 165 CYS E CA  1 
ATOM   6893  C C   . CYS E 1 165 ? 87.485  29.292 163.016 1.00 95.74  ? 165 CYS E C   1 
ATOM   6894  O O   . CYS E 1 165 ? 86.356  28.941 163.376 1.00 95.74  ? 165 CYS E O   1 
ATOM   6895  C CB  . CYS E 1 165 ? 89.358  27.719 163.514 1.00 81.94  ? 165 CYS E CB  1 
ATOM   6896  S SG  . CYS E 1 165 ? 90.626  28.866 164.129 1.00 81.94  ? 165 CYS E SG  1 
ATOM   6897  N N   . ILE E 1 166 ? 87.929  30.542 163.116 1.00 70.02  ? 166 ILE E N   1 
ATOM   6898  C CA  . ILE E 1 166 ? 87.134  31.630 163.682 1.00 70.02  ? 166 ILE E CA  1 
ATOM   6899  C C   . ILE E 1 166 ? 85.681  31.644 163.206 1.00 70.02  ? 166 ILE E C   1 
ATOM   6900  O O   . ILE E 1 166 ? 84.824  32.274 163.819 1.00 70.02  ? 166 ILE E O   1 
ATOM   6901  C CB  . ILE E 1 166 ? 87.754  32.987 163.336 1.00 98.26  ? 166 ILE E CB  1 
ATOM   6902  C CG1 . ILE E 1 166 ? 87.239  34.053 164.295 1.00 98.26  ? 166 ILE E CG1 1 
ATOM   6903  C CG2 . ILE E 1 166 ? 87.389  33.375 161.913 1.00 98.26  ? 166 ILE E CG2 1 
ATOM   6904  C CD1 . ILE E 1 166 ? 87.748  33.882 165.694 1.00 98.26  ? 166 ILE E CD1 1 
ATOM   6905  N N   . LEU E 1 167 ? 85.411  30.957 162.105 1.00 96.91  ? 167 LEU E N   1 
ATOM   6906  C CA  . LEU E 1 167 ? 84.068  30.904 161.546 1.00 96.91  ? 167 LEU E CA  1 
ATOM   6907  C C   . LEU E 1 167 ? 83.296  29.697 162.074 1.00 96.91  ? 167 LEU E C   1 
ATOM   6908  O O   . LEU E 1 167 ? 82.076  29.748 162.238 1.00 96.91  ? 167 LEU E O   1 
ATOM   6909  C CB  . LEU E 1 167 ? 84.154  30.815 160.019 1.00 160.88 ? 167 LEU E CB  1 
ATOM   6910  C CG  . LEU E 1 167 ? 84.884  31.944 159.290 1.00 160.88 ? 167 LEU E CG  1 
ATOM   6911  C CD1 . LEU E 1 167 ? 85.223  31.524 157.860 1.00 160.88 ? 167 LEU E CD1 1 
ATOM   6912  C CD2 . LEU E 1 167 ? 84.010  33.186 159.312 1.00 160.88 ? 167 LEU E CD2 1 
ATOM   6913  N N   . ASP E 1 168 ? 84.022  28.612 162.329 1.00 111.70 ? 168 ASP E N   1 
ATOM   6914  C CA  . ASP E 1 168 ? 83.436  27.364 162.810 1.00 111.70 ? 168 ASP E CA  1 
ATOM   6915  C C   . ASP E 1 168 ? 82.654  27.549 164.099 1.00 111.70 ? 168 ASP E C   1 
ATOM   6916  O O   . ASP E 1 168 ? 83.215  27.928 165.125 1.00 111.70 ? 168 ASP E O   1 
ATOM   6917  C CB  . ASP E 1 168 ? 84.537  26.326 163.036 1.00 88.26  ? 168 ASP E CB  1 
ATOM   6918  C CG  . ASP E 1 168 ? 83.997  24.915 163.118 1.00 88.26  ? 168 ASP E CG  1 
ATOM   6919  O OD1 . ASP E 1 168 ? 82.806  24.760 163.453 1.00 88.26  ? 168 ASP E OD1 1 
ATOM   6920  O OD2 . ASP E 1 168 ? 84.767  23.962 162.855 1.00 88.26  ? 168 ASP E OD2 1 
ATOM   6921  N N   . LYS E 1 169 ? 81.358  27.272 164.049 1.00 143.82 ? 169 LYS E N   1 
ATOM   6922  C CA  . LYS E 1 169 ? 80.521  27.405 165.230 1.00 143.82 ? 169 LYS E CA  1 
ATOM   6923  C C   . LYS E 1 169 ? 80.965  26.409 166.297 1.00 143.82 ? 169 LYS E C   1 
ATOM   6924  O O   . LYS E 1 169 ? 81.140  26.778 167.457 1.00 143.82 ? 169 LYS E O   1 
ATOM   6925  C CB  . LYS E 1 169 ? 79.059  27.182 164.850 1.00 118.89 ? 169 LYS E CB  1 
ATOM   6926  C CG  . LYS E 1 169 ? 78.586  28.169 163.797 1.00 118.89 ? 169 LYS E CG  1 
ATOM   6927  C CD  . LYS E 1 169 ? 77.178  27.869 163.295 1.00 118.89 ? 169 LYS E CD  1 
ATOM   6928  C CE  . LYS E 1 169 ? 76.767  28.847 162.188 1.00 118.89 ? 169 LYS E CE  1 
ATOM   6929  N NZ  . LYS E 1 169 ? 75.423  28.552 161.604 1.00 118.89 ? 169 LYS E NZ  1 
ATOM   6930  N N   . ASP E 1 170 ? 81.158  25.152 165.900 1.00 96.90  ? 170 ASP E N   1 
ATOM   6931  C CA  . ASP E 1 170 ? 81.599  24.105 166.821 1.00 96.90  ? 170 ASP E CA  1 
ATOM   6932  C C   . ASP E 1 170 ? 82.874  24.543 167.522 1.00 96.90  ? 170 ASP E C   1 
ATOM   6933  O O   . ASP E 1 170 ? 83.064  24.273 168.703 1.00 96.90  ? 170 ASP E O   1 
ATOM   6934  C CB  . ASP E 1 170 ? 81.867  22.792 166.074 1.00 90.36  ? 170 ASP E CB  1 
ATOM   6935  C CG  . ASP E 1 170 ? 80.624  22.234 165.389 1.00 90.36  ? 170 ASP E CG  1 
ATOM   6936  O OD1 . ASP E 1 170 ? 79.583  22.079 166.063 1.00 90.36  ? 170 ASP E OD1 1 
ATOM   6937  O OD2 . ASP E 1 170 ? 80.691  21.941 164.176 1.00 90.36  ? 170 ASP E OD2 1 
ATOM   6938  N N   . TYR E 1 171 ? 83.747  25.216 166.782 1.00 134.69 ? 171 TYR E N   1 
ATOM   6939  C CA  . TYR E 1 171 ? 85.009  25.706 167.327 1.00 134.69 ? 171 TYR E CA  1 
ATOM   6940  C C   . TYR E 1 171 ? 84.754  26.720 168.422 1.00 134.69 ? 171 TYR E C   1 
ATOM   6941  O O   . TYR E 1 171 ? 85.349  26.661 169.499 1.00 134.69 ? 171 TYR E O   1 
ATOM   6942  C CB  . TYR E 1 171 ? 85.827  26.385 166.235 1.00 58.36  ? 171 TYR E CB  1 
ATOM   6943  C CG  . TYR E 1 171 ? 87.006  27.180 166.754 1.00 58.36  ? 171 TYR E CG  1 
ATOM   6944  C CD1 . TYR E 1 171 ? 88.132  26.533 167.266 1.00 58.36  ? 171 TYR E CD1 1 
ATOM   6945  C CD2 . TYR E 1 171 ? 87.017  28.583 166.681 1.00 58.36  ? 171 TYR E CD2 1 
ATOM   6946  C CE1 . TYR E 1 171 ? 89.249  27.250 167.681 1.00 58.36  ? 171 TYR E CE1 1 
ATOM   6947  C CE2 . TYR E 1 171 ? 88.135  29.320 167.097 1.00 58.36  ? 171 TYR E CE2 1 
ATOM   6948  C CZ  . TYR E 1 171 ? 89.255  28.642 167.596 1.00 58.36  ? 171 TYR E CZ  1 
ATOM   6949  O OH  . TYR E 1 171 ? 90.399  29.321 167.995 1.00 58.36  ? 171 TYR E OH  1 
ATOM   6950  N N   . LEU E 1 172 ? 83.871  27.664 168.122 1.00 132.26 ? 172 LEU E N   1 
ATOM   6951  C CA  . LEU E 1 172 ? 83.528  28.717 169.059 1.00 132.26 ? 172 LEU E CA  1 
ATOM   6952  C C   . LEU E 1 172 ? 83.014  28.184 170.394 1.00 132.26 ? 172 LEU E C   1 
ATOM   6953  O O   . LEU E 1 172 ? 83.519  28.566 171.450 1.00 132.26 ? 172 LEU E O   1 
ATOM   6954  C CB  . LEU E 1 172 ? 82.500  29.660 168.426 1.00 113.79 ? 172 LEU E CB  1 
ATOM   6955  C CG  . LEU E 1 172 ? 83.023  30.547 167.287 1.00 113.79 ? 172 LEU E CG  1 
ATOM   6956  C CD1 . LEU E 1 172 ? 81.901  31.414 166.752 1.00 113.79 ? 172 LEU E CD1 1 
ATOM   6957  C CD2 . LEU E 1 172 ? 84.165  31.424 167.790 1.00 113.79 ? 172 LEU E CD2 1 
ATOM   6958  N N   . ARG E 1 173 ? 82.017  27.304 170.353 1.00 174.36 ? 173 ARG E N   1 
ATOM   6959  C CA  . ARG E 1 173 ? 81.471  26.742 171.583 1.00 174.36 ? 173 ARG E CA  1 
ATOM   6960  C C   . ARG E 1 173 ? 82.590  26.157 172.438 1.00 174.36 ? 173 ARG E C   1 
ATOM   6961  O O   . ARG E 1 173 ? 82.624  26.366 173.649 1.00 174.36 ? 173 ARG E O   1 
ATOM   6962  C CB  . ARG E 1 173 ? 80.433  25.662 171.272 1.00 150.70 ? 173 ARG E CB  1 
ATOM   6963  C CG  . ARG E 1 173 ? 79.187  26.190 170.582 1.00 150.70 ? 173 ARG E CG  1 
ATOM   6964  C CD  . ARG E 1 173 ? 78.085  25.136 170.451 1.00 150.70 ? 173 ARG E CD  1 
ATOM   6965  N NE  . ARG E 1 173 ? 78.448  24.009 169.592 1.00 150.70 ? 173 ARG E NE  1 
ATOM   6966  C CZ  . ARG E 1 173 ? 79.202  22.979 169.970 1.00 150.70 ? 173 ARG E CZ  1 
ATOM   6967  N NH1 . ARG E 1 173 ? 79.687  22.917 171.204 1.00 150.70 ? 173 ARG E NH1 1 
ATOM   6968  N NH2 . ARG E 1 173 ? 79.466  22.003 169.112 1.00 150.70 ? 173 ARG E NH2 1 
ATOM   6969  N N   . SER E 1 174 ? 83.506  25.433 171.800 1.00 95.52  ? 174 SER E N   1 
ATOM   6970  C CA  . SER E 1 174 ? 84.635  24.828 172.498 1.00 95.52  ? 174 SER E CA  1 
ATOM   6971  C C   . SER E 1 174 ? 85.570  25.878 173.092 1.00 95.52  ? 174 SER E C   1 
ATOM   6972  O O   . SER E 1 174 ? 86.443  25.560 173.899 1.00 95.52  ? 174 SER E O   1 
ATOM   6973  C CB  . SER E 1 174 ? 85.420  23.920 171.553 1.00 105.38 ? 174 SER E CB  1 
ATOM   6974  O OG  . SER E 1 174 ? 84.621  22.827 171.135 1.00 105.38 ? 174 SER E OG  1 
ATOM   6975  N N   . LEU E 1 175 ? 85.392  27.131 172.695 1.00 161.70 ? 175 LEU E N   1 
ATOM   6976  C CA  . LEU E 1 175 ? 86.221  28.202 173.228 1.00 161.70 ? 175 LEU E CA  1 
ATOM   6977  C C   . LEU E 1 175 ? 85.653  28.726 174.543 1.00 161.70 ? 175 LEU E C   1 
ATOM   6978  O O   . LEU E 1 175 ? 86.401  29.036 175.468 1.00 161.70 ? 175 LEU E O   1 
ATOM   6979  C CB  . LEU E 1 175 ? 86.335  29.340 172.217 1.00 100.21 ? 175 LEU E CB  1 
ATOM   6980  C CG  . LEU E 1 175 ? 87.412  29.163 171.148 1.00 100.21 ? 175 LEU E CG  1 
ATOM   6981  C CD1 . LEU E 1 175 ? 87.319  30.308 170.163 1.00 100.21 ? 175 LEU E CD1 1 
ATOM   6982  C CD2 . LEU E 1 175 ? 88.794  29.129 171.800 1.00 100.21 ? 175 LEU E CD2 1 
ATOM   6983  N N   . ASN E 1 176 ? 84.329  28.825 174.623 1.00 132.32 ? 176 ASN E N   1 
ATOM   6984  C CA  . ASN E 1 176 ? 83.670  29.300 175.835 1.00 132.32 ? 176 ASN E CA  1 
ATOM   6985  C C   . ASN E 1 176 ? 83.901  28.291 176.954 1.00 132.32 ? 176 ASN E C   1 
ATOM   6986  O O   . ASN E 1 176 ? 84.138  28.658 178.103 1.00 132.32 ? 176 ASN E O   1 
ATOM   6987  C CB  . ASN E 1 176 ? 82.170  29.463 175.593 1.00 143.30 ? 176 ASN E CB  1 
ATOM   6988  C CG  . ASN E 1 176 ? 81.865  30.397 174.439 1.00 143.30 ? 176 ASN E CG  1 
ATOM   6989  O OD1 . ASN E 1 176 ? 82.271  31.559 174.439 1.00 143.30 ? 176 ASN E OD1 1 
ATOM   6990  N ND2 . ASN E 1 176 ? 81.143  29.892 173.446 1.00 143.30 ? 176 ASN E ND2 1 
ATOM   6991  N N   . LYS E 1 177 ? 83.836  27.013 176.598 1.00 153.01 ? 177 LYS E N   1 
ATOM   6992  C CA  . LYS E 1 177 ? 84.039  25.932 177.551 1.00 153.01 ? 177 LYS E CA  1 
ATOM   6993  C C   . LYS E 1 177 ? 85.497  25.867 178.009 1.00 153.01 ? 177 LYS E C   1 
ATOM   6994  O O   . LYS E 1 177 ? 85.956  24.833 178.495 1.00 153.01 ? 177 LYS E O   1 
ATOM   6995  C CB  . LYS E 1 177 ? 83.641  24.589 176.922 1.00 135.39 ? 177 LYS E CB  1 
ATOM   6996  C CG  . LYS E 1 177 ? 82.186  24.496 176.456 1.00 135.39 ? 177 LYS E CG  1 
ATOM   6997  C CD  . LYS E 1 177 ? 81.887  23.128 175.836 1.00 135.39 ? 177 LYS E CD  1 
ATOM   6998  C CE  . LYS E 1 177 ? 80.451  23.039 175.338 1.00 135.39 ? 177 LYS E CE  1 
ATOM   6999  N NZ  . LYS E 1 177 ? 80.163  21.732 174.680 1.00 135.39 ? 177 LYS E NZ  1 
ATOM   7000  N N   . LEU E 1 178 ? 86.225  26.968 177.847 1.00 168.89 ? 178 LEU E N   1 
ATOM   7001  C CA  . LEU E 1 178 ? 87.625  27.013 178.259 1.00 168.89 ? 178 LEU E CA  1 
ATOM   7002  C C   . LEU E 1 178 ? 87.909  28.126 179.260 1.00 168.89 ? 178 LEU E C   1 
ATOM   7003  O O   . LEU E 1 178 ? 87.195  29.130 179.316 1.00 168.89 ? 178 LEU E O   1 
ATOM   7004  C CB  . LEU E 1 178 ? 88.543  27.183 177.046 1.00 150.92 ? 178 LEU E CB  1 
ATOM   7005  C CG  . LEU E 1 178 ? 88.929  25.915 176.287 1.00 150.92 ? 178 LEU E CG  1 
ATOM   7006  C CD1 . LEU E 1 178 ? 89.821  26.281 175.115 1.00 150.92 ? 178 LEU E CD1 1 
ATOM   7007  C CD2 . LEU E 1 178 ? 89.649  24.956 177.221 1.00 150.92 ? 178 LEU E CD2 1 
ATOM   7008  N N   . PRO E 1 179 ? 88.965  27.953 180.073 1.00 199.51 ? 179 PRO E N   1 
ATOM   7009  C CA  . PRO E 1 179 ? 89.366  28.934 181.085 1.00 199.51 ? 179 PRO E CA  1 
ATOM   7010  C C   . PRO E 1 179 ? 89.648  30.287 180.454 1.00 199.51 ? 179 PRO E C   1 
ATOM   7011  O O   . PRO E 1 179 ? 90.690  30.477 179.827 1.00 199.51 ? 179 PRO E O   1 
ATOM   7012  C CB  . PRO E 1 179 ? 90.624  28.313 181.684 1.00 150.77 ? 179 PRO E CB  1 
ATOM   7013  C CG  . PRO E 1 179 ? 90.366  26.846 181.546 1.00 150.77 ? 179 PRO E CG  1 
ATOM   7014  C CD  . PRO E 1 179 ? 89.817  26.753 180.147 1.00 150.77 ? 179 PRO E CD  1 
ATOM   7015  N N   . ARG E 1 180 ? 88.715  31.220 180.616 1.00 199.90 ? 180 ARG E N   1 
ATOM   7016  C CA  . ARG E 1 180 ? 88.874  32.557 180.059 1.00 199.90 ? 180 ARG E CA  1 
ATOM   7017  C C   . ARG E 1 180 ? 90.114  33.191 180.687 1.00 199.90 ? 180 ARG E C   1 
ATOM   7018  O O   . ARG E 1 180 ? 90.009  33.982 181.624 1.00 199.90 ? 180 ARG E O   1 
ATOM   7019  C CB  . ARG E 1 180 ? 87.633  33.405 180.362 1.00 177.38 ? 180 ARG E CB  1 
ATOM   7020  C CG  . ARG E 1 180 ? 87.160  34.267 179.198 1.00 177.38 ? 180 ARG E CG  1 
ATOM   7021  C CD  . ARG E 1 180 ? 88.255  35.200 178.696 1.00 177.38 ? 180 ARG E CD  1 
ATOM   7022  N NE  . ARG E 1 180 ? 88.719  36.115 179.736 1.00 177.38 ? 180 ARG E NE  1 
ATOM   7023  C CZ  . ARG E 1 180 ? 89.656  37.042 179.556 1.00 177.38 ? 180 ARG E CZ  1 
ATOM   7024  N NH1 . ARG E 1 180 ? 90.235  37.182 178.372 1.00 177.38 ? 180 ARG E NH1 1 
ATOM   7025  N NH2 . ARG E 1 180 ? 90.018  37.829 180.562 1.00 177.38 ? 180 ARG E NH2 1 
ATOM   7026  N N   . GLN E 1 181 ? 91.287  32.832 180.168 1.00 199.68 ? 181 GLN E N   1 
ATOM   7027  C CA  . GLN E 1 181 ? 92.556  33.345 180.678 1.00 199.68 ? 181 GLN E CA  1 
ATOM   7028  C C   . GLN E 1 181 ? 92.629  34.869 180.647 1.00 199.68 ? 181 GLN E C   1 
ATOM   7029  O O   . GLN E 1 181 ? 91.886  35.525 179.919 1.00 199.68 ? 181 GLN E O   1 
ATOM   7030  C CB  . GLN E 1 181 ? 93.725  32.763 179.880 1.00 199.72 ? 181 GLN E CB  1 
ATOM   7031  C CG  . GLN E 1 181 ? 93.710  33.129 178.408 1.00 199.72 ? 181 GLN E CG  1 
ATOM   7032  C CD  . GLN E 1 181 ? 94.964  32.685 177.687 1.00 199.72 ? 181 GLN E CD  1 
ATOM   7033  O OE1 . GLN E 1 181 ? 96.058  33.192 177.941 1.00 199.72 ? 181 GLN E OE1 1 
ATOM   7034  N NE2 . GLN E 1 181 ? 94.812  31.728 176.783 1.00 199.72 ? 181 GLN E NE2 1 
ATOM   7035  N N   . LEU E 1 182 ? 93.546  35.421 181.436 1.00 122.95 ? 182 LEU E N   1 
ATOM   7036  C CA  . LEU E 1 182 ? 93.723  36.864 181.534 1.00 122.95 ? 182 LEU E CA  1 
ATOM   7037  C C   . LEU E 1 182 ? 94.889  37.325 180.667 1.00 122.95 ? 182 LEU E C   1 
ATOM   7038  O O   . LEU E 1 182 ? 95.857  36.589 180.472 1.00 122.95 ? 182 LEU E O   1 
ATOM   7039  C CB  . LEU E 1 182 ? 93.974  37.251 182.995 1.00 192.87 ? 182 LEU E CB  1 
ATOM   7040  C CG  . LEU E 1 182 ? 93.704  38.699 183.407 1.00 192.87 ? 182 LEU E CG  1 
ATOM   7041  C CD1 . LEU E 1 182 ? 92.245  39.041 183.135 1.00 192.87 ? 182 LEU E CD1 1 
ATOM   7042  C CD2 . LEU E 1 182 ? 94.024  38.882 184.881 1.00 192.87 ? 182 LEU E CD2 1 
ATOM   7043  N N   . PRO E 1 183 ? 94.806  38.555 180.134 1.00 173.44 ? 183 PRO E N   1 
ATOM   7044  C CA  . PRO E 1 183 ? 95.846  39.134 179.282 1.00 173.44 ? 183 PRO E CA  1 
ATOM   7045  C C   . PRO E 1 183 ? 97.272  38.733 179.656 1.00 173.44 ? 183 PRO E C   1 
ATOM   7046  O O   . PRO E 1 183 ? 97.632  38.677 180.831 1.00 173.44 ? 183 PRO E O   1 
ATOM   7047  C CB  . PRO E 1 183 ? 95.591  40.626 179.426 1.00 154.96 ? 183 PRO E CB  1 
ATOM   7048  C CG  . PRO E 1 183 ? 94.097  40.670 179.418 1.00 154.96 ? 183 PRO E CG  1 
ATOM   7049  C CD  . PRO E 1 183 ? 93.714  39.525 180.342 1.00 154.96 ? 183 PRO E CD  1 
ATOM   7050  N N   . LEU E 1 184 ? 98.076  38.453 178.636 1.00 123.82 ? 184 LEU E N   1 
ATOM   7051  C CA  . LEU E 1 184 ? 99.459  38.046 178.826 1.00 123.82 ? 184 LEU E CA  1 
ATOM   7052  C C   . LEU E 1 184 ? 100.338 39.255 179.121 1.00 123.82 ? 184 LEU E C   1 
ATOM   7053  O O   . LEU E 1 184 ? 100.189 40.310 178.507 1.00 123.82 ? 184 LEU E O   1 
ATOM   7054  C CB  . LEU E 1 184 ? 99.977  37.337 177.567 1.00 152.12 ? 184 LEU E CB  1 
ATOM   7055  C CG  . LEU E 1 184 ? 99.156  36.207 176.926 1.00 152.12 ? 184 LEU E CG  1 
ATOM   7056  C CD1 . LEU E 1 184 ? 98.743  35.204 177.994 1.00 152.12 ? 184 LEU E CD1 1 
ATOM   7057  C CD2 . LEU E 1 184 ? 97.931  36.775 176.224 1.00 152.12 ? 184 LEU E CD2 1 
ATOM   7058  N N   . GLU E 1 185 ? 101.253 39.097 180.069 1.00 138.51 ? 185 GLU E N   1 
ATOM   7059  C CA  . GLU E 1 185 ? 102.162 40.176 180.427 1.00 138.51 ? 185 GLU E CA  1 
ATOM   7060  C C   . GLU E 1 185 ? 103.282 40.200 179.394 1.00 138.51 ? 185 GLU E C   1 
ATOM   7061  O O   . GLU E 1 185 ? 103.863 39.164 179.077 1.00 138.51 ? 185 GLU E O   1 
ATOM   7062  C CB  . GLU E 1 185 ? 102.743 39.934 181.820 1.00 200.00 ? 185 GLU E CB  1 
ATOM   7063  C CG  . GLU E 1 185 ? 103.721 41.000 182.276 1.00 200.00 ? 185 GLU E CG  1 
ATOM   7064  C CD  . GLU E 1 185 ? 104.380 40.654 183.596 1.00 200.00 ? 185 GLU E CD  1 
ATOM   7065  O OE1 . GLU E 1 185 ? 105.058 39.607 183.670 1.00 200.00 ? 185 GLU E OE1 1 
ATOM   7066  O OE2 . GLU E 1 185 ? 104.221 41.430 184.561 1.00 200.00 ? 185 GLU E OE2 1 
ATOM   7067  N N   . VAL E 1 186 ? 103.585 41.381 178.870 1.00 142.56 ? 186 VAL E N   1 
ATOM   7068  C CA  . VAL E 1 186 ? 104.631 41.513 177.861 1.00 142.56 ? 186 VAL E CA  1 
ATOM   7069  C C   . VAL E 1 186 ? 105.984 41.897 178.458 1.00 142.56 ? 186 VAL E C   1 
ATOM   7070  O O   . VAL E 1 186 ? 106.176 43.025 178.917 1.00 142.56 ? 186 VAL E O   1 
ATOM   7071  C CB  . VAL E 1 186 ? 104.236 42.566 176.802 1.00 157.36 ? 186 VAL E CB  1 
ATOM   7072  C CG1 . VAL E 1 186 ? 105.299 42.646 175.718 1.00 157.36 ? 186 VAL E CG1 1 
ATOM   7073  C CG2 . VAL E 1 186 ? 102.885 42.210 176.203 1.00 157.36 ? 186 VAL E CG2 1 
ATOM   7074  N N   . ASP E 1 187 ? 106.923 40.955 178.441 1.00 135.64 ? 187 ASP E N   1 
ATOM   7075  C CA  . ASP E 1 187 ? 108.258 41.196 178.981 1.00 135.64 ? 187 ASP E CA  1 
ATOM   7076  C C   . ASP E 1 187 ? 109.115 42.000 178.013 1.00 135.64 ? 187 ASP E C   1 
ATOM   7077  O O   . ASP E 1 187 ? 109.679 41.458 177.066 1.00 135.64 ? 187 ASP E O   1 
ATOM   7078  C CB  . ASP E 1 187 ? 108.950 39.870 179.290 1.00 184.38 ? 187 ASP E CB  1 
ATOM   7079  C CG  . ASP E 1 187 ? 110.386 40.056 179.729 1.00 184.38 ? 187 ASP E CG  1 
ATOM   7080  O OD1 . ASP E 1 187 ? 110.616 40.846 180.668 1.00 184.38 ? 187 ASP E OD1 1 
ATOM   7081  O OD2 . ASP E 1 187 ? 111.280 39.414 179.138 1.00 184.38 ? 187 ASP E OD2 1 
ATOM   7082  N N   . LEU E 1 188 ? 109.228 43.296 178.269 1.00 118.70 ? 188 LEU E N   1 
ATOM   7083  C CA  . LEU E 1 188 ? 109.996 44.174 177.402 1.00 118.70 ? 188 LEU E CA  1 
ATOM   7084  C C   . LEU E 1 188 ? 111.463 44.287 177.802 1.00 118.70 ? 188 LEU E C   1 
ATOM   7085  O O   . LEU E 1 188 ? 112.104 45.294 177.512 1.00 118.70 ? 188 LEU E O   1 
ATOM   7086  C CB  . LEU E 1 188 ? 109.357 45.565 177.400 1.00 102.67 ? 188 LEU E CB  1 
ATOM   7087  C CG  . LEU E 1 188 ? 107.844 45.604 177.151 1.00 102.67 ? 188 LEU E CG  1 
ATOM   7088  C CD1 . LEU E 1 188 ? 107.331 47.035 177.259 1.00 102.67 ? 188 LEU E CD1 1 
ATOM   7089  C CD2 . LEU E 1 188 ? 107.545 45.030 175.782 1.00 102.67 ? 188 LEU E CD2 1 
ATOM   7090  N N   . THR E 1 189 ? 112.002 43.261 178.453 1.00 140.82 ? 189 THR E N   1 
ATOM   7091  C CA  . THR E 1 189 ? 113.397 43.307 178.885 1.00 140.82 ? 189 THR E CA  1 
ATOM   7092  C C   . THR E 1 189 ? 114.377 43.185 177.729 1.00 140.82 ? 189 THR E C   1 
ATOM   7093  O O   . THR E 1 189 ? 115.324 43.963 177.621 1.00 140.82 ? 189 THR E O   1 
ATOM   7094  C CB  . THR E 1 189 ? 113.710 42.200 179.900 1.00 138.08 ? 189 THR E CB  1 
ATOM   7095  O OG1 . THR E 1 189 ? 113.358 40.928 179.343 1.00 138.08 ? 189 THR E OG1 1 
ATOM   7096  C CG2 . THR E 1 189 ? 112.940 42.434 181.192 1.00 138.08 ? 189 THR E CG2 1 
ATOM   7097  N N   . LYS E 1 190 ? 114.154 42.206 176.864 1.00 200.00 ? 190 LYS E N   1 
ATOM   7098  C CA  . LYS E 1 190 ? 115.037 42.009 175.724 1.00 200.00 ? 190 LYS E CA  1 
ATOM   7099  C C   . LYS E 1 190 ? 114.506 42.750 174.505 1.00 200.00 ? 190 LYS E C   1 
ATOM   7100  O O   . LYS E 1 190 ? 114.789 42.378 173.366 1.00 200.00 ? 190 LYS E O   1 
ATOM   7101  C CB  . LYS E 1 190 ? 115.173 40.518 175.417 1.00 111.61 ? 190 LYS E CB  1 
ATOM   7102  C CG  . LYS E 1 190 ? 115.766 39.723 176.559 1.00 111.61 ? 190 LYS E CG  1 
ATOM   7103  C CD  . LYS E 1 190 ? 115.878 38.256 176.213 1.00 111.61 ? 190 LYS E CD  1 
ATOM   7104  C CE  . LYS E 1 190 ? 116.482 37.478 177.368 1.00 111.61 ? 190 LYS E CE  1 
ATOM   7105  N NZ  . LYS E 1 190 ? 116.601 36.036 177.046 1.00 111.61 ? 190 LYS E NZ  1 
ATOM   7106  N N   . ALA E 1 191 ? 113.737 43.806 174.756 1.00 200.00 ? 191 ALA E N   1 
ATOM   7107  C CA  . ALA E 1 191 ? 113.159 44.610 173.685 1.00 200.00 ? 191 ALA E CA  1 
ATOM   7108  C C   . ALA E 1 191 ? 114.239 45.393 172.943 1.00 200.00 ? 191 ALA E C   1 
ATOM   7109  O O   . ALA E 1 191 ? 115.257 45.774 173.523 1.00 200.00 ? 191 ALA E O   1 
ATOM   7110  C CB  . ALA E 1 191 ? 112.101 45.569 174.256 1.00 50.09  ? 191 ALA E CB  1 
ATOM   7111  N N   . LYS E 1 192 ? 114.013 45.622 171.654 1.00 116.18 ? 192 LYS E N   1 
ATOM   7112  C CA  . LYS E 1 192 ? 114.958 46.359 170.830 1.00 116.18 ? 192 LYS E CA  1 
ATOM   7113  C C   . LYS E 1 192 ? 115.012 47.799 171.329 1.00 116.18 ? 192 LYS E C   1 
ATOM   7114  O O   . LYS E 1 192 ? 113.978 48.454 171.480 1.00 116.18 ? 192 LYS E O   1 
ATOM   7115  C CB  . LYS E 1 192 ? 114.514 46.317 169.370 1.00 94.20  ? 192 LYS E CB  1 
ATOM   7116  C CG  . LYS E 1 192 ? 115.482 46.978 168.415 1.00 94.20  ? 192 LYS E CG  1 
ATOM   7117  C CD  . LYS E 1 192 ? 114.992 46.847 166.984 1.00 94.20  ? 192 LYS E CD  1 
ATOM   7118  C CE  . LYS E 1 192 ? 115.903 47.584 166.020 1.00 94.20  ? 192 LYS E CE  1 
ATOM   7119  N NZ  . LYS E 1 192 ? 117.305 47.110 166.098 1.00 94.20  ? 192 LYS E NZ  1 
ATOM   7120  N N   . ARG E 1 193 ? 116.220 48.289 171.583 1.00 104.02 ? 193 ARG E N   1 
ATOM   7121  C CA  . ARG E 1 193 ? 116.387 49.641 172.100 1.00 104.02 ? 193 ARG E CA  1 
ATOM   7122  C C   . ARG E 1 193 ? 117.147 50.606 171.206 1.00 104.02 ? 193 ARG E C   1 
ATOM   7123  O O   . ARG E 1 193 ? 117.169 51.808 171.471 1.00 104.02 ? 193 ARG E O   1 
ATOM   7124  C CB  . ARG E 1 193 ? 117.049 49.588 173.477 1.00 123.78 ? 193 ARG E CB  1 
ATOM   7125  C CG  . ARG E 1 193 ? 116.147 49.002 174.544 1.00 123.78 ? 193 ARG E CG  1 
ATOM   7126  C CD  . ARG E 1 193 ? 116.577 49.426 175.932 1.00 123.78 ? 193 ARG E CD  1 
ATOM   7127  N NE  . ARG E 1 193 ? 115.452 49.383 176.859 1.00 123.78 ? 193 ARG E NE  1 
ATOM   7128  C CZ  . ARG E 1 193 ? 114.807 48.272 177.196 1.00 123.78 ? 193 ARG E CZ  1 
ATOM   7129  N NH1 . ARG E 1 193 ? 115.183 47.106 176.685 1.00 123.78 ? 193 ARG E NH1 1 
ATOM   7130  N NH2 . ARG E 1 193 ? 113.782 48.331 178.037 1.00 123.78 ? 193 ARG E NH2 1 
ATOM   7131  N N   . GLN E 1 194 ? 117.784 50.080 170.165 1.00 128.59 ? 194 GLN E N   1 
ATOM   7132  C CA  . GLN E 1 194 ? 118.516 50.911 169.215 1.00 128.59 ? 194 GLN E CA  1 
ATOM   7133  C C   . GLN E 1 194 ? 118.383 50.323 167.813 1.00 128.59 ? 194 GLN E C   1 
ATOM   7134  O O   . GLN E 1 194 ? 117.996 49.166 167.651 1.00 128.59 ? 194 GLN E O   1 
ATOM   7135  C CB  . GLN E 1 194 ? 119.984 51.059 169.628 1.00 116.88 ? 194 GLN E CB  1 
ATOM   7136  C CG  . GLN E 1 194 ? 120.624 49.802 170.173 1.00 116.88 ? 194 GLN E CG  1 
ATOM   7137  C CD  . GLN E 1 194 ? 120.984 48.810 169.092 1.00 116.88 ? 194 GLN E CD  1 
ATOM   7138  O OE1 . GLN E 1 194 ? 121.816 49.090 168.225 1.00 116.88 ? 194 GLN E OE1 1 
ATOM   7139  N NE2 . GLN E 1 194 ? 120.359 47.638 169.136 1.00 116.88 ? 194 GLN E NE2 1 
ATOM   7140  N N   . ASP E 1 195 ? 118.689 51.128 166.803 1.00 91.97  ? 195 ASP E N   1 
ATOM   7141  C CA  . ASP E 1 195 ? 118.551 50.696 165.418 1.00 91.97  ? 195 ASP E CA  1 
ATOM   7142  C C   . ASP E 1 195 ? 119.391 49.503 164.964 1.00 91.97  ? 195 ASP E C   1 
ATOM   7143  O O   . ASP E 1 195 ? 118.847 48.457 164.606 1.00 91.97  ? 195 ASP E O   1 
ATOM   7144  C CB  . ASP E 1 195 ? 118.812 51.873 164.463 1.00 72.41  ? 195 ASP E CB  1 
ATOM   7145  C CG  . ASP E 1 195 ? 117.764 52.969 164.577 1.00 72.41  ? 195 ASP E CG  1 
ATOM   7146  O OD1 . ASP E 1 195 ? 116.611 52.677 164.988 1.00 72.41  ? 195 ASP E OD1 1 
ATOM   7147  O OD2 . ASP E 1 195 ? 118.100 54.126 164.235 1.00 72.41  ? 195 ASP E OD2 1 
ATOM   7148  N N   . LEU E 1 196 ? 120.711 49.666 164.970 1.00 102.47 ? 196 LEU E N   1 
ATOM   7149  C CA  . LEU E 1 196 ? 121.620 48.621 164.505 1.00 102.47 ? 196 LEU E CA  1 
ATOM   7150  C C   . LEU E 1 196 ? 121.251 47.184 164.871 1.00 102.47 ? 196 LEU E C   1 
ATOM   7151  O O   . LEU E 1 196 ? 120.620 46.928 165.894 1.00 102.47 ? 196 LEU E O   1 
ATOM   7152  C CB  . LEU E 1 196 ? 123.048 48.925 164.965 1.00 128.97 ? 196 LEU E CB  1 
ATOM   7153  C CG  . LEU E 1 196 ? 124.144 48.034 164.366 1.00 128.97 ? 196 LEU E CG  1 
ATOM   7154  C CD1 . LEU E 1 196 ? 123.977 47.911 162.854 1.00 128.97 ? 196 LEU E CD1 1 
ATOM   7155  C CD2 . LEU E 1 196 ? 125.499 48.623 164.707 1.00 128.97 ? 196 LEU E CD2 1 
ATOM   7156  N N   . GLU E 1 197 ? 121.640 46.258 163.996 1.00 104.64 ? 197 GLU E N   1 
ATOM   7157  C CA  . GLU E 1 197 ? 121.405 44.821 164.160 1.00 104.64 ? 197 GLU E CA  1 
ATOM   7158  C C   . GLU E 1 197 ? 122.661 44.130 163.657 1.00 104.64 ? 197 GLU E C   1 
ATOM   7159  O O   . GLU E 1 197 ? 122.737 43.725 162.496 1.00 104.64 ? 197 GLU E O   1 
ATOM   7160  C CB  . GLU E 1 197 ? 120.227 44.361 163.314 1.00 94.67  ? 197 GLU E CB  1 
ATOM   7161  C CG  . GLU E 1 197 ? 118.877 44.831 163.794 1.00 94.67  ? 197 GLU E CG  1 
ATOM   7162  C CD  . GLU E 1 197 ? 118.382 44.034 164.969 1.00 94.67  ? 197 GLU E CD  1 
ATOM   7163  O OE1 . GLU E 1 197 ? 118.664 42.819 165.015 1.00 94.67  ? 197 GLU E OE1 1 
ATOM   7164  O OE2 . GLU E 1 197 ? 117.701 44.615 165.837 1.00 94.67  ? 197 GLU E OE2 1 
ATOM   7165  N N   . PRO E 1 198 ? 123.665 43.983 164.535 1.00 137.11 ? 198 PRO E N   1 
ATOM   7166  C CA  . PRO E 1 198 ? 124.941 43.348 164.196 1.00 137.11 ? 198 PRO E CA  1 
ATOM   7167  C C   . PRO E 1 198 ? 124.794 41.971 163.579 1.00 137.11 ? 198 PRO E C   1 
ATOM   7168  O O   . PRO E 1 198 ? 125.439 41.662 162.581 1.00 137.11 ? 198 PRO E O   1 
ATOM   7169  C CB  . PRO E 1 198 ? 125.661 43.296 165.530 1.00 58.15  ? 198 PRO E CB  1 
ATOM   7170  C CG  . PRO E 1 198 ? 125.053 44.457 166.298 1.00 58.15  ? 198 PRO E CG  1 
ATOM   7171  C CD  . PRO E 1 198 ? 123.610 44.296 165.975 1.00 58.15  ? 198 PRO E CD  1 
ATOM   7172  N N   . SER E 1 199 ? 123.955 41.142 164.187 1.00 106.42 ? 199 SER E N   1 
ATOM   7173  C CA  . SER E 1 199 ? 123.722 39.795 163.689 1.00 106.42 ? 199 SER E CA  1 
ATOM   7174  C C   . SER E 1 199 ? 123.345 39.854 162.209 1.00 106.42 ? 199 SER E C   1 
ATOM   7175  O O   . SER E 1 199 ? 123.939 39.168 161.371 1.00 106.42 ? 199 SER E O   1 
ATOM   7176  C CB  . SER E 1 199 ? 122.597 39.134 164.486 1.00 115.63 ? 199 SER E CB  1 
ATOM   7177  O OG  . SER E 1 199 ? 122.352 37.819 164.028 1.00 115.63 ? 199 SER E OG  1 
ATOM   7178  N N   . VAL E 1 200 ? 122.359 40.694 161.902 1.00 91.03  ? 200 VAL E N   1 
ATOM   7179  C CA  . VAL E 1 200 ? 121.862 40.882 160.541 1.00 91.03  ? 200 VAL E CA  1 
ATOM   7180  C C   . VAL E 1 200 ? 122.919 41.521 159.636 1.00 91.03  ? 200 VAL E C   1 
ATOM   7181  O O   . VAL E 1 200 ? 123.315 40.948 158.619 1.00 91.03  ? 200 VAL E O   1 
ATOM   7182  C CB  . VAL E 1 200 ? 120.588 41.763 160.562 1.00 88.47  ? 200 VAL E CB  1 
ATOM   7183  C CG1 . VAL E 1 200 ? 120.096 42.010 159.152 1.00 88.47  ? 200 VAL E CG1 1 
ATOM   7184  C CG2 . VAL E 1 200 ? 119.500 41.089 161.401 1.00 88.47  ? 200 VAL E CG2 1 
ATOM   7185  N N   . GLU E 1 201 ? 123.378 42.709 160.019 1.00 84.83  ? 201 GLU E N   1 
ATOM   7186  C CA  . GLU E 1 201 ? 124.393 43.432 159.254 1.00 84.83  ? 201 GLU E CA  1 
ATOM   7187  C C   . GLU E 1 201 ? 125.544 42.518 158.817 1.00 84.83  ? 201 GLU E C   1 
ATOM   7188  O O   . GLU E 1 201 ? 126.087 42.658 157.720 1.00 84.83  ? 201 GLU E O   1 
ATOM   7189  C CB  . GLU E 1 201 ? 124.933 44.605 160.094 1.00 141.79 ? 201 GLU E CB  1 
ATOM   7190  C CG  . GLU E 1 201 ? 126.061 45.423 159.447 1.00 141.79 ? 201 GLU E CG  1 
ATOM   7191  C CD  . GLU E 1 201 ? 125.655 46.084 158.137 1.00 141.79 ? 201 GLU E CD  1 
ATOM   7192  O OE1 . GLU E 1 201 ? 124.594 46.746 158.111 1.00 141.79 ? 201 GLU E OE1 1 
ATOM   7193  O OE2 . GLU E 1 201 ? 126.405 45.950 157.140 1.00 141.79 ? 201 GLU E OE2 1 
ATOM   7194  N N   . GLU E 1 202 ? 125.910 41.577 159.678 1.00 116.87 ? 202 GLU E N   1 
ATOM   7195  C CA  . GLU E 1 202 ? 127.002 40.666 159.379 1.00 116.87 ? 202 GLU E CA  1 
ATOM   7196  C C   . GLU E 1 202 ? 126.629 39.722 158.247 1.00 116.87 ? 202 GLU E C   1 
ATOM   7197  O O   . GLU E 1 202 ? 127.315 39.666 157.224 1.00 116.87 ? 202 GLU E O   1 
ATOM   7198  C CB  . GLU E 1 202 ? 127.367 39.870 160.633 1.00 143.02 ? 202 GLU E CB  1 
ATOM   7199  C CG  . GLU E 1 202 ? 128.584 38.982 160.473 1.00 143.02 ? 202 GLU E CG  1 
ATOM   7200  C CD  . GLU E 1 202 ? 128.994 38.319 161.775 1.00 143.02 ? 202 GLU E CD  1 
ATOM   7201  O OE1 . GLU E 1 202 ? 128.193 37.536 162.331 1.00 143.02 ? 202 GLU E OE1 1 
ATOM   7202  O OE2 . GLU E 1 202 ? 130.122 38.584 162.241 1.00 143.02 ? 202 GLU E OE2 1 
ATOM   7203  N N   . ALA E 1 203 ? 125.534 38.991 158.445 1.00 159.51 ? 203 ALA E N   1 
ATOM   7204  C CA  . ALA E 1 203 ? 125.033 38.022 157.472 1.00 159.51 ? 203 ALA E CA  1 
ATOM   7205  C C   . ALA E 1 203 ? 124.868 38.634 156.095 1.00 159.51 ? 203 ALA E C   1 
ATOM   7206  O O   . ALA E 1 203 ? 125.155 38.001 155.076 1.00 159.51 ? 203 ALA E O   1 
ATOM   7207  C CB  . ALA E 1 203 ? 123.702 37.468 157.940 1.00 71.06  ? 203 ALA E CB  1 
ATOM   7208  N N   . ARG E 1 204 ? 124.383 39.867 156.080 1.00 106.98 ? 204 ARG E N   1 
ATOM   7209  C CA  . ARG E 1 204 ? 124.167 40.598 154.842 1.00 106.98 ? 204 ARG E CA  1 
ATOM   7210  C C   . ARG E 1 204 ? 125.482 40.935 154.135 1.00 106.98 ? 204 ARG E C   1 
ATOM   7211  O O   . ARG E 1 204 ? 125.614 40.753 152.925 1.00 106.98 ? 204 ARG E O   1 
ATOM   7212  C CB  . ARG E 1 204 ? 123.394 41.881 155.144 1.00 71.93  ? 204 ARG E CB  1 
ATOM   7213  C CG  . ARG E 1 204 ? 123.257 42.848 153.971 1.00 71.93  ? 204 ARG E CG  1 
ATOM   7214  C CD  . ARG E 1 204 ? 122.580 44.092 154.460 1.00 71.93  ? 204 ARG E CD  1 
ATOM   7215  N NE  . ARG E 1 204 ? 121.341 43.776 155.154 1.00 71.93  ? 204 ARG E NE  1 
ATOM   7216  C CZ  . ARG E 1 204 ? 120.957 44.355 156.283 1.00 71.93  ? 204 ARG E CZ  1 
ATOM   7217  N NH1 . ARG E 1 204 ? 121.727 45.280 156.851 1.00 71.93  ? 204 ARG E NH1 1 
ATOM   7218  N NH2 . ARG E 1 204 ? 119.800 44.022 156.838 1.00 71.93  ? 204 ARG E NH2 1 
ATOM   7219  N N   . TYR E 1 205 ? 126.455 41.433 154.888 1.00 98.00  ? 205 TYR E N   1 
ATOM   7220  C CA  . TYR E 1 205 ? 127.731 41.775 154.291 1.00 98.00  ? 205 TYR E CA  1 
ATOM   7221  C C   . TYR E 1 205 ? 128.337 40.548 153.611 1.00 98.00  ? 205 TYR E C   1 
ATOM   7222  O O   . TYR E 1 205 ? 128.935 40.653 152.535 1.00 98.00  ? 205 TYR E O   1 
ATOM   7223  C CB  . TYR E 1 205 ? 128.702 42.309 155.344 1.00 142.65 ? 205 TYR E CB  1 
ATOM   7224  C CG  . TYR E 1 205 ? 130.048 42.634 154.748 1.00 142.65 ? 205 TYR E CG  1 
ATOM   7225  C CD1 . TYR E 1 205 ? 130.197 43.689 153.854 1.00 142.65 ? 205 TYR E CD1 1 
ATOM   7226  C CD2 . TYR E 1 205 ? 131.160 41.847 155.024 1.00 142.65 ? 205 TYR E CD2 1 
ATOM   7227  C CE1 . TYR E 1 205 ? 131.420 43.946 153.249 1.00 142.65 ? 205 TYR E CE1 1 
ATOM   7228  C CE2 . TYR E 1 205 ? 132.386 42.096 154.431 1.00 142.65 ? 205 TYR E CE2 1 
ATOM   7229  C CZ  . TYR E 1 205 ? 132.509 43.144 153.543 1.00 142.65 ? 205 TYR E CZ  1 
ATOM   7230  O OH  . TYR E 1 205 ? 133.715 43.380 152.937 1.00 142.65 ? 205 TYR E OH  1 
ATOM   7231  N N   . ASN E 1 206 ? 128.178 39.389 154.249 1.00 149.01 ? 206 ASN E N   1 
ATOM   7232  C CA  . ASN E 1 206 ? 128.704 38.132 153.724 1.00 149.01 ? 206 ASN E CA  1 
ATOM   7233  C C   . ASN E 1 206 ? 127.838 37.630 152.577 1.00 149.01 ? 206 ASN E C   1 
ATOM   7234  O O   . ASN E 1 206 ? 128.134 36.608 151.959 1.00 149.01 ? 206 ASN E O   1 
ATOM   7235  C CB  . ASN E 1 206 ? 128.748 37.070 154.825 1.00 171.91 ? 206 ASN E CB  1 
ATOM   7236  C CG  . ASN E 1 206 ? 129.524 37.524 156.043 1.00 171.91 ? 206 ASN E CG  1 
ATOM   7237  O OD1 . ASN E 1 206 ? 130.682 37.930 155.941 1.00 171.91 ? 206 ASN E OD1 1 
ATOM   7238  N ND2 . ASN E 1 206 ? 128.890 37.453 157.206 1.00 171.91 ? 206 ASN E ND2 1 
ATOM   7239  N N   . SER E 1 207 ? 126.765 38.359 152.300 1.00 136.70 ? 207 SER E N   1 
ATOM   7240  C CA  . SER E 1 207 ? 125.843 38.003 151.231 1.00 136.70 ? 207 SER E CA  1 
ATOM   7241  C C   . SER E 1 207 ? 126.214 38.716 149.926 1.00 136.70 ? 207 SER E C   1 
ATOM   7242  O O   . SER E 1 207 ? 125.552 38.536 148.905 1.00 136.70 ? 207 SER E O   1 
ATOM   7243  C CB  . SER E 1 207 ? 124.409 38.367 151.646 1.00 143.22 ? 207 SER E CB  1 
ATOM   7244  O OG  . SER E 1 207 ? 123.455 38.011 150.657 1.00 143.22 ? 207 SER E OG  1 
ATOM   7245  N N   . CYS E 1 208 ? 127.275 39.518 149.960 1.00 105.51 ? 208 CYS E N   1 
ATOM   7246  C CA  . CYS E 1 208 ? 127.719 40.251 148.775 1.00 105.51 ? 208 CYS E CA  1 
ATOM   7247  C C   . CYS E 1 208 ? 129.001 39.655 148.196 1.00 105.51 ? 208 CYS E C   1 
ATOM   7248  O O   . CYS E 1 208 ? 129.529 38.697 148.806 1.00 105.51 ? 208 CYS E O   1 
ATOM   7249  C CB  . CYS E 1 208 ? 127.949 41.733 149.111 1.00 124.50 ? 208 CYS E CB  1 
ATOM   7250  S SG  . CYS E 1 208 ? 126.470 42.697 149.571 1.00 124.50 ? 208 CYS E SG  1 
ATOM   7251  N N   . CYS F 1 25  ? 119.999 41.902 140.967 1.00 98.56  ? 25  CYS F N   1 
ATOM   7252  C CA  . CYS F 1 25  ? 119.748 43.287 141.459 1.00 98.56  ? 25  CYS F CA  1 
ATOM   7253  C C   . CYS F 1 25  ? 118.540 43.341 142.386 1.00 98.56  ? 25  CYS F C   1 
ATOM   7254  O O   . CYS F 1 25  ? 118.277 42.398 143.125 1.00 98.56  ? 25  CYS F O   1 
ATOM   7255  C CB  . CYS F 1 25  ? 119.512 44.214 140.285 1.00 84.97  ? 25  CYS F CB  1 
ATOM   7256  S SG  . CYS F 1 25  ? 118.022 43.793 139.407 1.00 84.97  ? 25  CYS F SG  1 
ATOM   7257  N N   . PHE F 1 26  ? 117.794 44.440 142.345 1.00 70.62  ? 26  PHE F N   1 
ATOM   7258  C CA  . PHE F 1 26  ? 116.638 44.576 143.226 1.00 70.62  ? 26  PHE F CA  1 
ATOM   7259  C C   . PHE F 1 26  ? 115.441 43.848 142.655 1.00 70.62  ? 26  PHE F C   1 
ATOM   7260  O O   . PHE F 1 26  ? 115.140 44.006 141.484 1.00 70.62  ? 26  PHE F O   1 
ATOM   7261  C CB  . PHE F 1 26  ? 116.279 46.053 143.445 1.00 47.30  ? 26  PHE F CB  1 
ATOM   7262  C CG  . PHE F 1 26  ? 115.427 46.279 144.653 1.00 47.30  ? 26  PHE F CG  1 
ATOM   7263  C CD1 . PHE F 1 26  ? 115.998 46.346 145.910 1.00 47.30  ? 26  PHE F CD1 1 
ATOM   7264  C CD2 . PHE F 1 26  ? 114.044 46.345 144.540 1.00 47.30  ? 26  PHE F CD2 1 
ATOM   7265  C CE1 . PHE F 1 26  ? 115.199 46.473 147.047 1.00 47.30  ? 26  PHE F CE1 1 
ATOM   7266  C CE2 . PHE F 1 26  ? 113.219 46.473 145.674 1.00 47.30  ? 26  PHE F CE2 1 
ATOM   7267  C CZ  . PHE F 1 26  ? 113.796 46.537 146.928 1.00 47.30  ? 26  PHE F CZ  1 
ATOM   7268  N N   . GLY F 1 27  ? 114.752 43.068 143.485 1.00 141.80 ? 27  GLY F N   1 
ATOM   7269  C CA  . GLY F 1 27  ? 113.598 42.320 143.011 1.00 141.80 ? 27  GLY F CA  1 
ATOM   7270  C C   . GLY F 1 27  ? 114.046 40.956 142.520 1.00 141.80 ? 27  GLY F C   1 
ATOM   7271  O O   . GLY F 1 27  ? 113.261 40.011 142.447 1.00 141.80 ? 27  GLY F O   1 
ATOM   7272  N N   . GLN F 1 28  ? 115.325 40.873 142.168 1.00 76.14  ? 28  GLN F N   1 
ATOM   7273  C CA  . GLN F 1 28  ? 115.941 39.644 141.702 1.00 76.14  ? 28  GLN F CA  1 
ATOM   7274  C C   . GLN F 1 28  ? 116.544 38.923 142.916 1.00 76.14  ? 28  GLN F C   1 
ATOM   7275  O O   . GLN F 1 28  ? 116.060 37.873 143.323 1.00 76.14  ? 28  GLN F O   1 
ATOM   7276  C CB  . GLN F 1 28  ? 117.050 39.955 140.695 1.00 144.22 ? 28  GLN F CB  1 
ATOM   7277  C CG  . GLN F 1 28  ? 116.618 40.779 139.492 1.00 144.22 ? 28  GLN F CG  1 
ATOM   7278  C CD  . GLN F 1 28  ? 115.674 40.039 138.566 1.00 144.22 ? 28  GLN F CD  1 
ATOM   7279  O OE1 . GLN F 1 28  ? 115.371 40.509 137.466 1.00 144.22 ? 28  GLN F OE1 1 
ATOM   7280  N NE2 . GLN F 1 28  ? 115.200 38.878 139.004 1.00 144.22 ? 28  GLN F NE2 1 
ATOM   7281  N N   . CYS F 1 29  ? 117.589 39.508 143.499 1.00 101.21 ? 29  CYS F N   1 
ATOM   7282  C CA  . CYS F 1 29  ? 118.285 38.941 144.655 1.00 101.21 ? 29  CYS F CA  1 
ATOM   7283  C C   . CYS F 1 29  ? 117.416 38.127 145.610 1.00 101.21 ? 29  CYS F C   1 
ATOM   7284  O O   . CYS F 1 29  ? 116.294 38.516 145.936 1.00 101.21 ? 29  CYS F O   1 
ATOM   7285  C CB  . CYS F 1 29  ? 118.984 40.059 145.429 1.00 104.95 ? 29  CYS F CB  1 
ATOM   7286  S SG  . CYS F 1 29  ? 120.258 40.924 144.459 1.00 104.95 ? 29  CYS F SG  1 
ATOM   7287  N N   . GLN F 1 30  ? 117.950 36.987 146.046 1.00 93.92  ? 30  GLN F N   1 
ATOM   7288  C CA  . GLN F 1 30  ? 117.257 36.096 146.973 1.00 93.92  ? 30  GLN F CA  1 
ATOM   7289  C C   . GLN F 1 30  ? 118.050 36.088 148.271 1.00 93.92  ? 30  GLN F C   1 
ATOM   7290  O O   . GLN F 1 30  ? 119.280 36.071 148.241 1.00 93.92  ? 30  GLN F O   1 
ATOM   7291  C CB  . GLN F 1 30  ? 117.190 34.677 146.394 1.00 198.44 ? 30  GLN F CB  1 
ATOM   7292  C CG  . GLN F 1 30  ? 116.313 34.549 145.152 1.00 198.44 ? 30  GLN F CG  1 
ATOM   7293  C CD  . GLN F 1 30  ? 116.284 33.139 144.580 1.00 198.44 ? 30  GLN F CD  1 
ATOM   7294  O OE1 . GLN F 1 30  ? 116.032 32.170 145.296 1.00 198.44 ? 30  GLN F OE1 1 
ATOM   7295  N NE2 . GLN F 1 30  ? 116.530 33.023 143.278 1.00 198.44 ? 30  GLN F NE2 1 
ATOM   7296  N N   . TYR F 1 31  ? 117.356 36.114 149.406 1.00 101.36 ? 31  TYR F N   1 
ATOM   7297  C CA  . TYR F 1 31  ? 118.023 36.105 150.706 1.00 101.36 ? 31  TYR F CA  1 
ATOM   7298  C C   . TYR F 1 31  ? 118.800 34.816 150.954 1.00 101.36 ? 31  TYR F C   1 
ATOM   7299  O O   . TYR F 1 31  ? 118.288 33.725 150.696 1.00 101.36 ? 31  TYR F O   1 
ATOM   7300  C CB  . TYR F 1 31  ? 117.011 36.260 151.846 1.00 98.10  ? 31  TYR F CB  1 
ATOM   7301  C CG  . TYR F 1 31  ? 116.531 37.665 152.073 1.00 98.10  ? 31  TYR F CG  1 
ATOM   7302  C CD1 . TYR F 1 31  ? 115.272 38.065 151.649 1.00 98.10  ? 31  TYR F CD1 1 
ATOM   7303  C CD2 . TYR F 1 31  ? 117.343 38.606 152.695 1.00 98.10  ? 31  TYR F CD2 1 
ATOM   7304  C CE1 . TYR F 1 31  ? 114.833 39.372 151.838 1.00 98.10  ? 31  TYR F CE1 1 
ATOM   7305  C CE2 . TYR F 1 31  ? 116.911 39.914 152.885 1.00 98.10  ? 31  TYR F CE2 1 
ATOM   7306  C CZ  . TYR F 1 31  ? 115.657 40.287 152.452 1.00 98.10  ? 31  TYR F CZ  1 
ATOM   7307  O OH  . TYR F 1 31  ? 115.231 41.581 152.604 1.00 98.10  ? 31  TYR F OH  1 
ATOM   7308  N N   . THR F 1 32  ? 120.031 34.944 151.457 1.00 77.10  ? 32  THR F N   1 
ATOM   7309  C CA  . THR F 1 32  ? 120.846 33.774 151.786 1.00 77.10  ? 32  THR F CA  1 
ATOM   7310  C C   . THR F 1 32  ? 120.340 33.257 153.142 1.00 77.10  ? 32  THR F C   1 
ATOM   7311  O O   . THR F 1 32  ? 119.654 33.979 153.880 1.00 77.10  ? 32  THR F O   1 
ATOM   7312  C CB  . THR F 1 32  ? 122.356 34.112 151.921 1.00 64.72  ? 32  THR F CB  1 
ATOM   7313  O OG1 . THR F 1 32  ? 122.544 35.043 153.000 1.00 64.72  ? 32  THR F OG1 1 
ATOM   7314  C CG2 . THR F 1 32  ? 122.910 34.696 150.618 1.00 64.72  ? 32  THR F CG2 1 
ATOM   7315  N N   . ALA F 1 33  ? 120.676 32.011 153.464 1.00 72.54  ? 33  ALA F N   1 
ATOM   7316  C CA  . ALA F 1 33  ? 120.241 31.403 154.722 1.00 72.54  ? 33  ALA F CA  1 
ATOM   7317  C C   . ALA F 1 33  ? 120.604 32.230 155.956 1.00 72.54  ? 33  ALA F C   1 
ATOM   7318  O O   . ALA F 1 33  ? 119.788 32.423 156.857 1.00 72.54  ? 33  ALA F O   1 
ATOM   7319  C CB  . ALA F 1 33  ? 120.828 30.003 154.842 1.00 110.52 ? 33  ALA F CB  1 
ATOM   7320  N N   . GLU F 1 34  ? 121.839 32.711 155.988 1.00 71.95  ? 34  GLU F N   1 
ATOM   7321  C CA  . GLU F 1 34  ? 122.326 33.507 157.106 1.00 71.95  ? 34  GLU F CA  1 
ATOM   7322  C C   . GLU F 1 34  ? 121.460 34.753 157.324 1.00 71.95  ? 34  GLU F C   1 
ATOM   7323  O O   . GLU F 1 34  ? 120.884 34.947 158.408 1.00 71.95  ? 34  GLU F O   1 
ATOM   7324  C CB  . GLU F 1 34  ? 123.785 33.925 156.862 1.00 94.86  ? 34  GLU F CB  1 
ATOM   7325  C CG  . GLU F 1 34  ? 124.731 32.785 156.486 1.00 94.86  ? 34  GLU F CG  1 
ATOM   7326  C CD  . GLU F 1 34  ? 124.904 32.628 154.973 1.00 94.86  ? 34  GLU F CD  1 
ATOM   7327  O OE1 . GLU F 1 34  ? 125.435 33.563 154.332 1.00 94.86  ? 34  GLU F OE1 1 
ATOM   7328  O OE2 . GLU F 1 34  ? 124.510 31.572 154.422 1.00 94.86  ? 34  GLU F OE2 1 
ATOM   7329  N N   . GLU F 1 35  ? 121.368 35.587 156.287 1.00 65.52  ? 35  GLU F N   1 
ATOM   7330  C CA  . GLU F 1 35  ? 120.597 36.820 156.360 1.00 65.52  ? 35  GLU F CA  1 
ATOM   7331  C C   . GLU F 1 35  ? 119.134 36.561 156.674 1.00 65.52  ? 35  GLU F C   1 
ATOM   7332  O O   . GLU F 1 35  ? 118.548 37.240 157.524 1.00 65.52  ? 35  GLU F O   1 
ATOM   7333  C CB  . GLU F 1 35  ? 120.724 37.616 155.058 1.00 110.10 ? 35  GLU F CB  1 
ATOM   7334  C CG  . GLU F 1 35  ? 120.148 39.020 155.167 1.00 110.10 ? 35  GLU F CG  1 
ATOM   7335  C CD  . GLU F 1 35  ? 120.453 39.888 153.961 1.00 110.10 ? 35  GLU F CD  1 
ATOM   7336  O OE1 . GLU F 1 35  ? 120.077 41.082 153.991 1.00 110.10 ? 35  GLU F OE1 1 
ATOM   7337  O OE2 . GLU F 1 35  ? 121.064 39.382 152.989 1.00 110.10 ? 35  GLU F OE2 1 
ATOM   7338  N N   . TYR F 1 36  ? 118.549 35.581 155.994 1.00 62.74  ? 36  TYR F N   1 
ATOM   7339  C CA  . TYR F 1 36  ? 117.154 35.251 156.229 1.00 62.74  ? 36  TYR F CA  1 
ATOM   7340  C C   . TYR F 1 36  ? 116.930 34.958 157.708 1.00 62.74  ? 36  TYR F C   1 
ATOM   7341  O O   . TYR F 1 36  ? 116.056 35.540 158.357 1.00 62.74  ? 36  TYR F O   1 
ATOM   7342  C CB  . TYR F 1 36  ? 116.711 34.016 155.426 1.00 57.88  ? 36  TYR F CB  1 
ATOM   7343  C CG  . TYR F 1 36  ? 115.468 33.412 156.037 1.00 57.88  ? 36  TYR F CG  1 
ATOM   7344  C CD1 . TYR F 1 36  ? 114.257 34.095 155.998 1.00 57.88  ? 36  TYR F CD1 1 
ATOM   7345  C CD2 . TYR F 1 36  ? 115.542 32.257 156.812 1.00 57.88  ? 36  TYR F CD2 1 
ATOM   7346  C CE1 . TYR F 1 36  ? 113.164 33.660 156.729 1.00 57.88  ? 36  TYR F CE1 1 
ATOM   7347  C CE2 . TYR F 1 36  ? 114.459 31.812 157.544 1.00 57.88  ? 36  TYR F CE2 1 
ATOM   7348  C CZ  . TYR F 1 36  ? 113.274 32.520 157.507 1.00 57.88  ? 36  TYR F CZ  1 
ATOM   7349  O OH  . TYR F 1 36  ? 112.210 32.113 158.294 1.00 57.88  ? 36  TYR F OH  1 
ATOM   7350  N N   . GLN F 1 37  ? 117.723 34.037 158.238 1.00 104.67 ? 37  GLN F N   1 
ATOM   7351  C CA  . GLN F 1 37  ? 117.574 33.647 159.626 1.00 104.67 ? 37  GLN F CA  1 
ATOM   7352  C C   . GLN F 1 37  ? 117.719 34.823 160.566 1.00 104.67 ? 37  GLN F C   1 
ATOM   7353  O O   . GLN F 1 37  ? 116.893 35.030 161.452 1.00 104.67 ? 37  GLN F O   1 
ATOM   7354  C CB  . GLN F 1 37  ? 118.595 32.581 159.984 1.00 123.48 ? 37  GLN F CB  1 
ATOM   7355  C CG  . GLN F 1 37  ? 118.181 31.766 161.183 1.00 123.48 ? 37  GLN F CG  1 
ATOM   7356  C CD  . GLN F 1 37  ? 119.192 30.707 161.537 1.00 123.48 ? 37  GLN F CD  1 
ATOM   7357  O OE1 . GLN F 1 37  ? 118.881 29.762 162.262 1.00 123.48 ? 37  GLN F OE1 1 
ATOM   7358  N NE2 . GLN F 1 37  ? 120.417 30.860 161.037 1.00 123.48 ? 37  GLN F NE2 1 
ATOM   7359  N N   . ALA F 1 38  ? 118.778 35.593 160.365 1.00 80.47  ? 38  ALA F N   1 
ATOM   7360  C CA  . ALA F 1 38  ? 119.036 36.752 161.200 1.00 80.47  ? 38  ALA F CA  1 
ATOM   7361  C C   . ALA F 1 38  ? 117.851 37.712 161.210 1.00 80.47  ? 38  ALA F C   1 
ATOM   7362  O O   . ALA F 1 38  ? 117.331 38.072 162.274 1.00 80.47  ? 38  ALA F O   1 
ATOM   7363  C CB  . ALA F 1 38  ? 120.284 37.463 160.703 1.00 35.08  ? 38  ALA F CB  1 
ATOM   7364  N N   . ILE F 1 39  ? 117.425 38.117 160.017 1.00 56.94  ? 39  ILE F N   1 
ATOM   7365  C CA  . ILE F 1 39  ? 116.325 39.052 159.884 1.00 56.94  ? 39  ILE F CA  1 
ATOM   7366  C C   . ILE F 1 39  ? 115.014 38.498 160.449 1.00 56.94  ? 39  ILE F C   1 
ATOM   7367  O O   . ILE F 1 39  ? 114.238 39.232 161.077 1.00 56.94  ? 39  ILE F O   1 
ATOM   7368  C CB  . ILE F 1 39  ? 116.151 39.438 158.404 1.00 46.37  ? 39  ILE F CB  1 
ATOM   7369  C CG1 . ILE F 1 39  ? 117.370 40.231 157.942 1.00 46.37  ? 39  ILE F CG1 1 
ATOM   7370  C CG2 . ILE F 1 39  ? 114.854 40.221 158.196 1.00 46.37  ? 39  ILE F CG2 1 
ATOM   7371  C CD1 . ILE F 1 39  ? 117.381 40.550 156.448 1.00 46.37  ? 39  ILE F CD1 1 
ATOM   7372  N N   . GLN F 1 40  ? 114.779 37.205 160.228 1.00 76.09  ? 40  GLN F N   1 
ATOM   7373  C CA  . GLN F 1 40  ? 113.555 36.549 160.688 1.00 76.09  ? 40  GLN F CA  1 
ATOM   7374  C C   . GLN F 1 40  ? 113.427 36.598 162.210 1.00 76.09  ? 40  GLN F C   1 
ATOM   7375  O O   . GLN F 1 40  ? 112.330 36.773 162.747 1.00 76.09  ? 40  GLN F O   1 
ATOM   7376  C CB  . GLN F 1 40  ? 113.518 35.095 160.178 1.00 66.15  ? 40  GLN F CB  1 
ATOM   7377  C CG  . GLN F 1 40  ? 112.393 34.229 160.763 1.00 66.15  ? 40  GLN F CG  1 
ATOM   7378  C CD  . GLN F 1 40  ? 111.010 34.686 160.364 1.00 66.15  ? 40  GLN F CD  1 
ATOM   7379  O OE1 . GLN F 1 40  ? 110.824 35.832 159.967 1.00 66.15  ? 40  GLN F OE1 1 
ATOM   7380  N NE2 . GLN F 1 40  ? 110.026 33.798 160.488 1.00 66.15  ? 40  GLN F NE2 1 
ATOM   7381  N N   . LYS F 1 41  ? 114.554 36.443 162.901 1.00 89.87  ? 41  LYS F N   1 
ATOM   7382  C CA  . LYS F 1 41  ? 114.565 36.486 164.360 1.00 89.87  ? 41  LYS F CA  1 
ATOM   7383  C C   . LYS F 1 41  ? 114.424 37.937 164.784 1.00 89.87  ? 41  LYS F C   1 
ATOM   7384  O O   . LYS F 1 41  ? 113.524 38.302 165.540 1.00 89.87  ? 41  LYS F O   1 
ATOM   7385  C CB  . LYS F 1 41  ? 115.880 35.923 164.906 1.00 137.98 ? 41  LYS F CB  1 
ATOM   7386  C CG  . LYS F 1 41  ? 116.106 34.454 164.596 1.00 137.98 ? 41  LYS F CG  1 
ATOM   7387  C CD  . LYS F 1 41  ? 117.345 33.924 165.306 1.00 137.98 ? 41  LYS F CD  1 
ATOM   7388  C CE  . LYS F 1 41  ? 117.593 32.456 164.980 1.00 137.98 ? 41  LYS F CE  1 
ATOM   7389  N NZ  . LYS F 1 41  ? 116.423 31.602 165.321 1.00 137.98 ? 41  LYS F NZ  1 
ATOM   7390  N N   . ALA F 1 42  ? 115.326 38.762 164.273 1.00 81.64  ? 42  ALA F N   1 
ATOM   7391  C CA  . ALA F 1 42  ? 115.322 40.173 164.589 1.00 81.64  ? 42  ALA F CA  1 
ATOM   7392  C C   . ALA F 1 42  ? 113.922 40.781 164.520 1.00 81.64  ? 42  ALA F C   1 
ATOM   7393  O O   . ALA F 1 42  ? 113.473 41.396 165.481 1.00 81.64  ? 42  ALA F O   1 
ATOM   7394  C CB  . ALA F 1 42  ? 116.288 40.914 163.653 1.00 8.38   ? 42  ALA F CB  1 
ATOM   7395  N N   . LEU F 1 43  ? 113.228 40.596 163.400 1.00 62.19  ? 43  LEU F N   1 
ATOM   7396  C CA  . LEU F 1 43  ? 111.882 41.149 163.224 1.00 62.19  ? 43  LEU F CA  1 
ATOM   7397  C C   . LEU F 1 43  ? 110.874 40.804 164.306 1.00 62.19  ? 43  LEU F C   1 
ATOM   7398  O O   . LEU F 1 43  ? 109.818 41.438 164.389 1.00 62.19  ? 43  LEU F O   1 
ATOM   7399  C CB  . LEU F 1 43  ? 111.300 40.728 161.878 1.00 99.99  ? 43  LEU F CB  1 
ATOM   7400  C CG  . LEU F 1 43  ? 111.816 41.495 160.667 1.00 99.99  ? 43  LEU F CG  1 
ATOM   7401  C CD1 . LEU F 1 43  ? 111.266 40.857 159.407 1.00 99.99  ? 43  LEU F CD1 1 
ATOM   7402  C CD2 . LEU F 1 43  ? 111.402 42.962 160.764 1.00 99.99  ? 43  LEU F CD2 1 
ATOM   7403  N N   . ARG F 1 44  ? 111.190 39.803 165.128 1.00 74.70  ? 44  ARG F N   1 
ATOM   7404  C CA  . ARG F 1 44  ? 110.293 39.386 166.206 1.00 74.70  ? 44  ARG F CA  1 
ATOM   7405  C C   . ARG F 1 44  ? 110.361 40.340 167.388 1.00 74.70  ? 44  ARG F C   1 
ATOM   7406  O O   . ARG F 1 44  ? 109.357 40.566 168.069 1.00 74.70  ? 44  ARG F O   1 
ATOM   7407  C CB  . ARG F 1 44  ? 110.632 37.963 166.667 1.00 110.57 ? 44  ARG F CB  1 
ATOM   7408  C CG  . ARG F 1 44  ? 110.031 36.860 165.800 1.00 110.57 ? 44  ARG F CG  1 
ATOM   7409  C CD  . ARG F 1 44  ? 110.225 35.480 166.427 1.00 110.57 ? 44  ARG F CD  1 
ATOM   7410  N NE  . ARG F 1 44  ? 111.445 34.822 165.970 1.00 110.57 ? 44  ARG F NE  1 
ATOM   7411  C CZ  . ARG F 1 44  ? 111.473 33.867 165.046 1.00 110.57 ? 44  ARG F CZ  1 
ATOM   7412  N NH1 . ARG F 1 44  ? 110.345 33.451 164.481 1.00 110.57 ? 44  ARG F NH1 1 
ATOM   7413  N NH2 . ARG F 1 44  ? 112.630 33.333 164.679 1.00 110.57 ? 44  ARG F NH2 1 
ATOM   7414  N N   . GLN F 1 45  ? 111.551 40.893 167.621 1.00 122.68 ? 45  GLN F N   1 
ATOM   7415  C CA  . GLN F 1 45  ? 111.790 41.838 168.710 1.00 122.68 ? 45  GLN F CA  1 
ATOM   7416  C C   . GLN F 1 45  ? 110.689 42.874 168.825 1.00 122.68 ? 45  GLN F C   1 
ATOM   7417  O O   . GLN F 1 45  ? 110.098 43.269 167.822 1.00 122.68 ? 45  GLN F O   1 
ATOM   7418  C CB  . GLN F 1 45  ? 113.098 42.595 168.484 1.00 78.87  ? 45  GLN F CB  1 
ATOM   7419  C CG  . GLN F 1 45  ? 114.357 41.780 168.648 1.00 78.87  ? 45  GLN F CG  1 
ATOM   7420  C CD  . GLN F 1 45  ? 115.600 42.565 168.272 1.00 78.87  ? 45  GLN F CD  1 
ATOM   7421  O OE1 . GLN F 1 45  ? 115.818 42.878 167.104 1.00 78.87  ? 45  GLN F OE1 1 
ATOM   7422  N NE2 . GLN F 1 45  ? 116.418 42.895 169.266 1.00 78.87  ? 45  GLN F NE2 1 
ATOM   7423  N N   . ARG F 1 46  ? 110.415 43.313 170.048 1.00 102.56 ? 46  ARG F N   1 
ATOM   7424  C CA  . ARG F 1 46  ? 109.423 44.355 170.267 1.00 102.56 ? 46  ARG F CA  1 
ATOM   7425  C C   . ARG F 1 46  ? 110.223 45.639 170.457 1.00 102.56 ? 46  ARG F C   1 
ATOM   7426  O O   . ARG F 1 46  ? 111.389 45.593 170.854 1.00 102.56 ? 46  ARG F O   1 
ATOM   7427  C CB  . ARG F 1 46  ? 108.578 44.061 171.502 1.00 90.19  ? 46  ARG F CB  1 
ATOM   7428  C CG  . ARG F 1 46  ? 107.578 42.943 171.305 1.00 90.19  ? 46  ARG F CG  1 
ATOM   7429  C CD  . ARG F 1 46  ? 106.322 43.261 172.080 1.00 90.19  ? 46  ARG F CD  1 
ATOM   7430  N NE  . ARG F 1 46  ? 105.226 42.334 171.818 1.00 90.19  ? 46  ARG F NE  1 
ATOM   7431  C CZ  . ARG F 1 46  ? 105.240 41.048 172.146 1.00 90.19  ? 46  ARG F CZ  1 
ATOM   7432  N NH1 . ARG F 1 46  ? 106.303 40.527 172.748 1.00 90.19  ? 46  ARG F NH1 1 
ATOM   7433  N NH2 . ARG F 1 46  ? 104.182 40.289 171.891 1.00 90.19  ? 46  ARG F NH2 1 
ATOM   7434  N N   . LEU F 1 47  ? 109.624 46.784 170.156 1.00 127.21 ? 47  LEU F N   1 
ATOM   7435  C CA  . LEU F 1 47  ? 110.351 48.037 170.302 1.00 127.21 ? 47  LEU F CA  1 
ATOM   7436  C C   . LEU F 1 47  ? 110.383 48.521 171.736 1.00 127.21 ? 47  LEU F C   1 
ATOM   7437  O O   . LEU F 1 47  ? 109.430 48.325 172.490 1.00 127.21 ? 47  LEU F O   1 
ATOM   7438  C CB  . LEU F 1 47  ? 109.746 49.128 169.417 1.00 83.67  ? 47  LEU F CB  1 
ATOM   7439  C CG  . LEU F 1 47  ? 109.941 49.019 167.905 1.00 83.67  ? 47  LEU F CG  1 
ATOM   7440  C CD1 . LEU F 1 47  ? 111.422 48.799 167.573 1.00 83.67  ? 47  LEU F CD1 1 
ATOM   7441  C CD2 . LEU F 1 47  ? 109.100 47.884 167.395 1.00 83.67  ? 47  LEU F CD2 1 
ATOM   7442  N N   . GLY F 1 48  ? 111.493 49.148 172.107 1.00 179.86 ? 48  GLY F N   1 
ATOM   7443  C CA  . GLY F 1 48  ? 111.624 49.674 173.450 1.00 179.86 ? 48  GLY F CA  1 
ATOM   7444  C C   . GLY F 1 48  ? 110.878 50.991 173.540 1.00 179.86 ? 48  GLY F C   1 
ATOM   7445  O O   . GLY F 1 48  ? 110.372 51.475 172.528 1.00 179.86 ? 48  GLY F O   1 
ATOM   7446  N N   . PRO F 1 49  ? 110.774 51.592 174.734 1.00 132.53 ? 49  PRO F N   1 
ATOM   7447  C CA  . PRO F 1 49  ? 110.066 52.868 174.874 1.00 132.53 ? 49  PRO F CA  1 
ATOM   7448  C C   . PRO F 1 49  ? 110.764 54.014 174.134 1.00 132.53 ? 49  PRO F C   1 
ATOM   7449  O O   . PRO F 1 49  ? 110.181 55.082 173.950 1.00 132.53 ? 49  PRO F O   1 
ATOM   7450  C CB  . PRO F 1 49  ? 110.044 53.083 176.386 1.00 165.01 ? 49  PRO F CB  1 
ATOM   7451  C CG  . PRO F 1 49  ? 110.039 51.686 176.926 1.00 165.01 ? 49  PRO F CG  1 
ATOM   7452  C CD  . PRO F 1 49  ? 111.073 51.018 176.057 1.00 165.01 ? 49  PRO F CD  1 
ATOM   7453  N N   . GLU F 1 50  ? 112.009 53.789 173.714 1.00 88.39  ? 50  GLU F N   1 
ATOM   7454  C CA  . GLU F 1 50  ? 112.778 54.806 172.996 1.00 88.39  ? 50  GLU F CA  1 
ATOM   7455  C C   . GLU F 1 50  ? 112.196 55.080 171.616 1.00 88.39  ? 50  GLU F C   1 
ATOM   7456  O O   . GLU F 1 50  ? 112.572 56.052 170.962 1.00 88.39  ? 50  GLU F O   1 
ATOM   7457  C CB  . GLU F 1 50  ? 114.240 54.370 172.807 1.00 113.38 ? 50  GLU F CB  1 
ATOM   7458  C CG  . GLU F 1 50  ? 114.945 53.927 174.064 1.00 113.38 ? 50  GLU F CG  1 
ATOM   7459  C CD  . GLU F 1 50  ? 114.758 52.456 174.347 1.00 113.38 ? 50  GLU F CD  1 
ATOM   7460  O OE1 . GLU F 1 50  ? 113.607 51.972 174.344 1.00 113.38 ? 50  GLU F OE1 1 
ATOM   7461  O OE2 . GLU F 1 50  ? 115.776 51.786 174.583 1.00 113.38 ? 50  GLU F OE2 1 
ATOM   7462  N N   . TYR F 1 51  ? 111.286 54.221 171.173 1.00 114.24 ? 51  TYR F N   1 
ATOM   7463  C CA  . TYR F 1 51  ? 110.692 54.355 169.854 1.00 114.24 ? 51  TYR F CA  1 
ATOM   7464  C C   . TYR F 1 51  ? 109.279 54.912 169.867 1.00 114.24 ? 51  TYR F C   1 
ATOM   7465  O O   . TYR F 1 51  ? 108.868 55.602 168.933 1.00 114.24 ? 51  TYR F O   1 
ATOM   7466  C CB  . TYR F 1 51  ? 110.708 52.993 169.145 1.00 73.31  ? 51  TYR F CB  1 
ATOM   7467  C CG  . TYR F 1 51  ? 112.090 52.547 168.690 1.00 73.31  ? 51  TYR F CG  1 
ATOM   7468  C CD1 . TYR F 1 51  ? 112.766 51.510 169.331 1.00 73.31  ? 51  TYR F CD1 1 
ATOM   7469  C CD2 . TYR F 1 51  ? 112.711 53.158 167.599 1.00 73.31  ? 51  TYR F CD2 1 
ATOM   7470  C CE1 . TYR F 1 51  ? 114.024 51.091 168.887 1.00 73.31  ? 51  TYR F CE1 1 
ATOM   7471  C CE2 . TYR F 1 51  ? 113.966 52.748 167.150 1.00 73.31  ? 51  TYR F CE2 1 
ATOM   7472  C CZ  . TYR F 1 51  ? 114.616 51.717 167.792 1.00 73.31  ? 51  TYR F CZ  1 
ATOM   7473  O OH  . TYR F 1 51  ? 115.847 51.314 167.311 1.00 73.31  ? 51  TYR F OH  1 
ATOM   7474  N N   . ILE F 1 52  ? 108.544 54.626 170.932 1.00 90.37  ? 52  ILE F N   1 
ATOM   7475  C CA  . ILE F 1 52  ? 107.161 55.077 171.037 1.00 90.37  ? 52  ILE F CA  1 
ATOM   7476  C C   . ILE F 1 52  ? 107.014 56.571 171.323 1.00 90.37  ? 52  ILE F C   1 
ATOM   7477  O O   . ILE F 1 52  ? 107.922 57.208 171.855 1.00 90.37  ? 52  ILE F O   1 
ATOM   7478  C CB  . ILE F 1 52  ? 106.412 54.283 172.127 1.00 90.44  ? 52  ILE F CB  1 
ATOM   7479  C CG1 . ILE F 1 52  ? 106.781 52.801 172.028 1.00 90.44  ? 52  ILE F CG1 1 
ATOM   7480  C CG2 . ILE F 1 52  ? 104.908 54.447 171.965 1.00 90.44  ? 52  ILE F CG2 1 
ATOM   7481  C CD1 . ILE F 1 52  ? 106.565 52.184 170.651 1.00 90.44  ? 52  ILE F CD1 1 
ATOM   7482  N N   . SER F 1 53  ? 105.864 57.119 170.940 1.00 83.57  ? 53  SER F N   1 
ATOM   7483  C CA  . SER F 1 53  ? 105.532 58.530 171.143 1.00 83.57  ? 53  SER F CA  1 
ATOM   7484  C C   . SER F 1 53  ? 104.035 58.589 171.439 1.00 83.57  ? 53  SER F C   1 
ATOM   7485  O O   . SER F 1 53  ? 103.355 57.556 171.463 1.00 83.57  ? 53  SER F O   1 
ATOM   7486  C CB  . SER F 1 53  ? 105.837 59.346 169.882 1.00 75.42  ? 53  SER F CB  1 
ATOM   7487  O OG  . SER F 1 53  ? 107.187 59.179 169.468 1.00 75.42  ? 53  SER F OG  1 
ATOM   7488  N N   . SER F 1 54  ? 103.503 59.779 171.675 1.00 95.04  ? 54  SER F N   1 
ATOM   7489  C CA  . SER F 1 54  ? 102.076 59.862 171.943 1.00 95.04  ? 54  SER F CA  1 
ATOM   7490  C C   . SER F 1 54  ? 101.467 61.206 171.603 1.00 95.04  ? 54  SER F C   1 
ATOM   7491  O O   . SER F 1 54  ? 102.151 62.231 171.550 1.00 95.04  ? 54  SER F O   1 
ATOM   7492  C CB  . SER F 1 54  ? 101.777 59.519 173.404 1.00 136.70 ? 54  SER F CB  1 
ATOM   7493  O OG  . SER F 1 54  ? 102.382 60.448 174.281 1.00 136.70 ? 54  SER F OG  1 
ATOM   7494  N N   . ARG F 1 55  ? 100.164 61.169 171.356 1.00 74.74  ? 55  ARG F N   1 
ATOM   7495  C CA  . ARG F 1 55  ? 99.374  62.345 171.013 1.00 74.74  ? 55  ARG F CA  1 
ATOM   7496  C C   . ARG F 1 55  ? 98.097  62.224 171.834 1.00 74.74  ? 55  ARG F C   1 
ATOM   7497  O O   . ARG F 1 55  ? 97.801  61.155 172.387 1.00 74.74  ? 55  ARG F O   1 
ATOM   7498  C CB  . ARG F 1 55  ? 99.023  62.344 169.521 1.00 155.33 ? 55  ARG F CB  1 
ATOM   7499  C CG  . ARG F 1 55  ? 100.174 62.640 168.567 1.00 155.33 ? 55  ARG F CG  1 
ATOM   7500  C CD  . ARG F 1 55  ? 100.018 61.818 167.293 1.00 155.33 ? 55  ARG F CD  1 
ATOM   7501  N NE  . ARG F 1 55  ? 98.614  61.636 166.933 1.00 155.33 ? 55  ARG F NE  1 
ATOM   7502  C CZ  . ARG F 1 55  ? 98.180  60.761 166.031 1.00 155.33 ? 55  ARG F CZ  1 
ATOM   7503  N NH1 . ARG F 1 55  ? 99.042  59.982 165.392 1.00 155.33 ? 55  ARG F NH1 1 
ATOM   7504  N NH2 . ARG F 1 55  ? 96.882  60.662 165.773 1.00 155.33 ? 55  ARG F NH2 1 
ATOM   7505  N N   . MET F 1 56  ? 97.346  63.314 171.921 1.00 135.84 ? 56  MET F N   1 
ATOM   7506  C CA  . MET F 1 56  ? 96.114  63.296 172.685 1.00 135.84 ? 56  MET F CA  1 
ATOM   7507  C C   . MET F 1 56  ? 94.939  63.199 171.735 1.00 135.84 ? 56  MET F C   1 
ATOM   7508  O O   . MET F 1 56  ? 94.547  64.182 171.110 1.00 135.84 ? 56  MET F O   1 
ATOM   7509  C CB  . MET F 1 56  ? 96.002  64.556 173.545 1.00 152.84 ? 56  MET F CB  1 
ATOM   7510  C CG  . MET F 1 56  ? 95.181  64.347 174.798 1.00 152.84 ? 56  MET F CG  1 
ATOM   7511  S SD  . MET F 1 56  ? 95.684  62.835 175.648 1.00 152.84 ? 56  MET F SD  1 
ATOM   7512  C CE  . MET F 1 56  ? 97.347  63.270 176.195 1.00 152.84 ? 56  MET F CE  1 
ATOM   7513  N N   . ALA F 1 57  ? 94.392  61.997 171.619 1.00 161.94 ? 57  ALA F N   1 
ATOM   7514  C CA  . ALA F 1 57  ? 93.258  61.769 170.741 1.00 161.94 ? 57  ALA F CA  1 
ATOM   7515  C C   . ALA F 1 57  ? 92.176  62.800 171.034 1.00 161.94 ? 57  ALA F C   1 
ATOM   7516  O O   . ALA F 1 57  ? 91.860  63.062 172.194 1.00 161.94 ? 57  ALA F O   1 
ATOM   7517  C CB  . ALA F 1 57  ? 92.716  60.360 170.950 1.00 166.33 ? 57  ALA F CB  1 
ATOM   7518  N N   . GLY F 1 58  ? 91.624  63.394 169.980 1.00 128.77 ? 58  GLY F N   1 
ATOM   7519  C CA  . GLY F 1 58  ? 90.573  64.382 170.155 1.00 128.77 ? 58  GLY F CA  1 
ATOM   7520  C C   . GLY F 1 58  ? 89.430  63.807 170.972 1.00 128.77 ? 58  GLY F C   1 
ATOM   7521  O O   . GLY F 1 58  ? 88.555  63.120 170.441 1.00 128.77 ? 58  GLY F O   1 
ATOM   7522  N N   . GLY F 1 59  ? 89.437  64.088 172.270 1.00 193.92 ? 59  GLY F N   1 
ATOM   7523  C CA  . GLY F 1 59  ? 88.400  63.571 173.142 1.00 193.92 ? 59  GLY F CA  1 
ATOM   7524  C C   . GLY F 1 59  ? 88.809  62.214 173.678 1.00 193.92 ? 59  GLY F C   1 
ATOM   7525  O O   . GLY F 1 59  ? 88.527  61.875 174.829 1.00 193.92 ? 59  GLY F O   1 
ATOM   7526  N N   . GLY F 1 60  ? 89.482  61.436 172.835 1.00 165.41 ? 60  GLY F N   1 
ATOM   7527  C CA  . GLY F 1 60  ? 89.933  60.115 173.234 1.00 165.41 ? 60  GLY F CA  1 
ATOM   7528  C C   . GLY F 1 60  ? 91.083  60.181 174.221 1.00 165.41 ? 60  GLY F C   1 
ATOM   7529  O O   . GLY F 1 60  ? 91.383  61.243 174.770 1.00 165.41 ? 60  GLY F O   1 
ATOM   7530  N N   . GLN F 1 61  ? 91.735  59.044 174.445 1.00 173.23 ? 61  GLN F N   1 
ATOM   7531  C CA  . GLN F 1 61  ? 92.851  58.983 175.379 1.00 173.23 ? 61  GLN F CA  1 
ATOM   7532  C C   . GLN F 1 61  ? 94.183  59.270 174.695 1.00 173.23 ? 61  GLN F C   1 
ATOM   7533  O O   . GLN F 1 61  ? 94.252  59.972 173.684 1.00 173.23 ? 61  GLN F O   1 
ATOM   7534  C CB  . GLN F 1 61  ? 92.924  57.603 176.045 1.00 157.30 ? 61  GLN F CB  1 
ATOM   7535  C CG  . GLN F 1 61  ? 91.639  57.134 176.722 1.00 157.30 ? 61  GLN F CG  1 
ATOM   7536  C CD  . GLN F 1 61  ? 90.690  56.414 175.771 1.00 157.30 ? 61  GLN F CD  1 
ATOM   7537  O OE1 . GLN F 1 61  ? 90.189  56.999 174.810 1.00 157.30 ? 61  GLN F OE1 1 
ATOM   7538  N NE2 . GLN F 1 61  ? 90.442  55.135 176.039 1.00 157.30 ? 61  GLN F NE2 1 
ATOM   7539  N N   . LYS F 1 62  ? 95.239  58.712 175.274 1.00 198.93 ? 62  LYS F N   1 
ATOM   7540  C CA  . LYS F 1 62  ? 96.592  58.865 174.766 1.00 198.93 ? 62  LYS F CA  1 
ATOM   7541  C C   . LYS F 1 62  ? 96.839  57.821 173.686 1.00 198.93 ? 62  LYS F C   1 
ATOM   7542  O O   . LYS F 1 62  ? 96.686  56.622 173.923 1.00 198.93 ? 62  LYS F O   1 
ATOM   7543  C CB  . LYS F 1 62  ? 97.588  58.678 175.913 1.00 140.54 ? 62  LYS F CB  1 
ATOM   7544  C CG  . LYS F 1 62  ? 99.050  58.606 175.500 1.00 140.54 ? 62  LYS F CG  1 
ATOM   7545  C CD  . LYS F 1 62  ? 99.916  58.253 176.698 1.00 140.54 ? 62  LYS F CD  1 
ATOM   7546  C CE  . LYS F 1 62  ? 101.355 58.012 176.295 1.00 140.54 ? 62  LYS F CE  1 
ATOM   7547  N NZ  . LYS F 1 62  ? 102.179 57.626 177.468 1.00 140.54 ? 62  LYS F NZ  1 
ATOM   7548  N N   . VAL F 1 63  ? 97.217  58.278 172.498 1.00 137.65 ? 63  VAL F N   1 
ATOM   7549  C CA  . VAL F 1 63  ? 97.483  57.369 171.395 1.00 137.65 ? 63  VAL F CA  1 
ATOM   7550  C C   . VAL F 1 63  ? 98.982  57.271 171.119 1.00 137.65 ? 63  VAL F C   1 
ATOM   7551  O O   . VAL F 1 63  ? 99.655  58.277 170.879 1.00 137.65 ? 63  VAL F O   1 
ATOM   7552  C CB  . VAL F 1 63  ? 96.746  57.822 170.110 1.00 107.85 ? 63  VAL F CB  1 
ATOM   7553  C CG1 . VAL F 1 63  ? 97.021  56.843 168.978 1.00 107.85 ? 63  VAL F CG1 1 
ATOM   7554  C CG2 . VAL F 1 63  ? 95.250  57.910 170.373 1.00 107.85 ? 63  VAL F CG2 1 
ATOM   7555  N N   . CYS F 1 64  ? 99.497  56.047 171.166 1.00 103.74 ? 64  CYS F N   1 
ATOM   7556  C CA  . CYS F 1 64  ? 100.909 55.798 170.917 1.00 103.74 ? 64  CYS F CA  1 
ATOM   7557  C C   . CYS F 1 64  ? 101.143 55.527 169.430 1.00 103.74 ? 64  CYS F C   1 
ATOM   7558  O O   . CYS F 1 64  ? 100.272 55.001 168.729 1.00 103.74 ? 64  CYS F O   1 
ATOM   7559  C CB  . CYS F 1 64  ? 101.380 54.610 171.753 1.00 114.40 ? 64  CYS F CB  1 
ATOM   7560  S SG  . CYS F 1 64  ? 101.009 54.783 173.506 1.00 114.40 ? 64  CYS F SG  1 
ATOM   7561  N N   . TYR F 1 65  ? 102.328 55.886 168.954 1.00 76.92  ? 65  TYR F N   1 
ATOM   7562  C CA  . TYR F 1 65  ? 102.677 55.707 167.554 1.00 76.92  ? 65  TYR F CA  1 
ATOM   7563  C C   . TYR F 1 65  ? 104.191 55.811 167.433 1.00 76.92  ? 65  TYR F C   1 
ATOM   7564  O O   . TYR F 1 65  ? 104.869 56.192 168.381 1.00 76.92  ? 65  TYR F O   1 
ATOM   7565  C CB  . TYR F 1 65  ? 102.014 56.809 166.726 1.00 110.16 ? 65  TYR F CB  1 
ATOM   7566  C CG  . TYR F 1 65  ? 102.597 58.189 166.977 1.00 110.16 ? 65  TYR F CG  1 
ATOM   7567  C CD1 . TYR F 1 65  ? 103.733 58.622 166.286 1.00 110.16 ? 65  TYR F CD1 1 
ATOM   7568  C CD2 . TYR F 1 65  ? 102.040 59.047 167.929 1.00 110.16 ? 65  TYR F CD2 1 
ATOM   7569  C CE1 . TYR F 1 65  ? 104.301 59.873 166.536 1.00 110.16 ? 65  TYR F CE1 1 
ATOM   7570  C CE2 . TYR F 1 65  ? 102.604 60.299 168.187 1.00 110.16 ? 65  TYR F CE2 1 
ATOM   7571  C CZ  . TYR F 1 65  ? 103.732 60.705 167.486 1.00 110.16 ? 65  TYR F CZ  1 
ATOM   7572  O OH  . TYR F 1 65  ? 104.289 61.942 167.724 1.00 110.16 ? 65  TYR F OH  1 
ATOM   7573  N N   . ILE F 1 66  ? 104.736 55.477 166.276 1.00 76.77  ? 66  ILE F N   1 
ATOM   7574  C CA  . ILE F 1 66  ? 106.172 55.594 166.115 1.00 76.77  ? 66  ILE F CA  1 
ATOM   7575  C C   . ILE F 1 66  ? 106.404 56.651 165.063 1.00 76.77  ? 66  ILE F C   1 
ATOM   7576  O O   . ILE F 1 66  ? 105.770 56.645 164.014 1.00 76.77  ? 66  ILE F O   1 
ATOM   7577  C CB  . ILE F 1 66  ? 106.815 54.267 165.669 1.00 57.51  ? 66  ILE F CB  1 
ATOM   7578  C CG1 . ILE F 1 66  ? 106.430 53.151 166.658 1.00 57.51  ? 66  ILE F CG1 1 
ATOM   7579  C CG2 . ILE F 1 66  ? 108.336 54.420 165.591 1.00 57.51  ? 66  ILE F CG2 1 
ATOM   7580  C CD1 . ILE F 1 66  ? 106.906 51.738 166.265 1.00 57.51  ? 66  ILE F CD1 1 
ATOM   7581  N N   . GLU F 1 67  ? 107.302 57.578 165.351 1.00 72.00  ? 67  GLU F N   1 
ATOM   7582  C CA  . GLU F 1 67  ? 107.593 58.634 164.407 1.00 72.00  ? 67  GLU F CA  1 
ATOM   7583  C C   . GLU F 1 67  ? 108.223 58.062 163.140 1.00 72.00  ? 67  GLU F C   1 
ATOM   7584  O O   . GLU F 1 67  ? 109.003 57.106 163.183 1.00 72.00  ? 67  GLU F O   1 
ATOM   7585  C CB  . GLU F 1 67  ? 108.514 59.675 165.054 1.00 133.80 ? 67  GLU F CB  1 
ATOM   7586  C CG  . GLU F 1 67  ? 107.873 60.379 166.243 1.00 133.80 ? 67  GLU F CG  1 
ATOM   7587  C CD  . GLU F 1 67  ? 108.771 61.420 166.861 1.00 133.80 ? 67  GLU F CD  1 
ATOM   7588  O OE1 . GLU F 1 67  ? 109.132 62.387 166.160 1.00 133.80 ? 67  GLU F OE1 1 
ATOM   7589  O OE2 . GLU F 1 67  ? 109.116 61.270 168.050 1.00 133.80 ? 67  GLU F OE2 1 
ATOM   7590  N N   . GLY F 1 68  ? 107.854 58.662 162.014 1.00 60.29  ? 68  GLY F N   1 
ATOM   7591  C CA  . GLY F 1 68  ? 108.363 58.252 160.723 1.00 60.29  ? 68  GLY F CA  1 
ATOM   7592  C C   . GLY F 1 68  ? 109.858 58.033 160.609 1.00 60.29  ? 68  GLY F C   1 
ATOM   7593  O O   . GLY F 1 68  ? 110.278 56.929 160.308 1.00 60.29  ? 68  GLY F O   1 
ATOM   7594  N N   . HIS F 1 69  ? 110.673 59.054 160.834 1.00 69.34  ? 69  HIS F N   1 
ATOM   7595  C CA  . HIS F 1 69  ? 112.120 58.873 160.695 1.00 69.34  ? 69  HIS F CA  1 
ATOM   7596  C C   . HIS F 1 69  ? 112.614 57.637 161.440 1.00 69.34  ? 69  HIS F C   1 
ATOM   7597  O O   . HIS F 1 69  ? 113.612 57.031 161.048 1.00 69.34  ? 69  HIS F O   1 
ATOM   7598  C CB  . HIS F 1 69  ? 112.881 60.111 161.185 1.00 165.54 ? 69  HIS F CB  1 
ATOM   7599  C CG  . HIS F 1 69  ? 112.756 60.361 162.655 1.00 165.54 ? 69  HIS F CG  1 
ATOM   7600  N ND1 . HIS F 1 69  ? 111.575 60.754 163.247 1.00 165.54 ? 69  HIS F ND1 1 
ATOM   7601  C CD2 . HIS F 1 69  ? 113.666 60.274 163.653 1.00 165.54 ? 69  HIS F CD2 1 
ATOM   7602  C CE1 . HIS F 1 69  ? 111.763 60.900 164.546 1.00 165.54 ? 69  HIS F CE1 1 
ATOM   7603  N NE2 . HIS F 1 69  ? 113.023 60.614 164.818 1.00 165.54 ? 69  HIS F NE2 1 
ATOM   7604  N N   . ARG F 1 70  ? 111.919 57.277 162.517 1.00 66.72  ? 70  ARG F N   1 
ATOM   7605  C CA  . ARG F 1 70  ? 112.281 56.095 163.299 1.00 66.72  ? 70  ARG F CA  1 
ATOM   7606  C C   . ARG F 1 70  ? 112.129 54.866 162.390 1.00 66.72  ? 70  ARG F C   1 
ATOM   7607  O O   . ARG F 1 70  ? 113.115 54.203 162.026 1.00 66.72  ? 70  ARG F O   1 
ATOM   7608  C CB  . ARG F 1 70  ? 111.352 55.956 164.516 1.00 134.92 ? 70  ARG F CB  1 
ATOM   7609  C CG  . ARG F 1 70  ? 111.525 57.036 165.574 1.00 134.92 ? 70  ARG F CG  1 
ATOM   7610  C CD  . ARG F 1 70  ? 112.718 56.758 166.484 1.00 134.92 ? 70  ARG F CD  1 
ATOM   7611  N NE  . ARG F 1 70  ? 113.083 57.927 167.281 1.00 134.92 ? 70  ARG F NE  1 
ATOM   7612  C CZ  . ARG F 1 70  ? 112.243 58.602 168.061 1.00 134.92 ? 70  ARG F CZ  1 
ATOM   7613  N NH1 . ARG F 1 70  ? 110.971 58.229 168.163 1.00 134.92 ? 70  ARG F NH1 1 
ATOM   7614  N NH2 . ARG F 1 70  ? 112.674 59.661 168.735 1.00 134.92 ? 70  ARG F NH2 1 
ATOM   7615  N N   . VAL F 1 71  ? 110.874 54.588 162.030 1.00 68.00  ? 71  VAL F N   1 
ATOM   7616  C CA  . VAL F 1 71  ? 110.521 53.473 161.162 1.00 68.00  ? 71  VAL F CA  1 
ATOM   7617  C C   . VAL F 1 71  ? 111.454 53.392 159.954 1.00 68.00  ? 71  VAL F C   1 
ATOM   7618  O O   . VAL F 1 71  ? 111.818 52.307 159.525 1.00 68.00  ? 71  VAL F O   1 
ATOM   7619  C CB  . VAL F 1 71  ? 109.070 53.611 160.665 1.00 78.91  ? 71  VAL F CB  1 
ATOM   7620  C CG1 . VAL F 1 71  ? 108.698 52.419 159.819 1.00 78.91  ? 71  VAL F CG1 1 
ATOM   7621  C CG2 . VAL F 1 71  ? 108.128 53.722 161.836 1.00 78.91  ? 71  VAL F CG2 1 
ATOM   7622  N N   . ILE F 1 72  ? 111.841 54.535 159.403 1.00 44.71  ? 72  ILE F N   1 
ATOM   7623  C CA  . ILE F 1 72  ? 112.728 54.521 158.258 1.00 44.71  ? 72  ILE F CA  1 
ATOM   7624  C C   . ILE F 1 72  ? 114.066 53.937 158.655 1.00 44.71  ? 72  ILE F C   1 
ATOM   7625  O O   . ILE F 1 72  ? 114.545 53.000 158.022 1.00 44.71  ? 72  ILE F O   1 
ATOM   7626  C CB  . ILE F 1 72  ? 112.946 55.938 157.659 1.00 51.41  ? 72  ILE F CB  1 
ATOM   7627  C CG1 . ILE F 1 72  ? 111.639 56.440 157.025 1.00 51.41  ? 72  ILE F CG1 1 
ATOM   7628  C CG2 . ILE F 1 72  ? 114.085 55.905 156.620 1.00 51.41  ? 72  ILE F CG2 1 
ATOM   7629  C CD1 . ILE F 1 72  ? 111.772 57.752 156.225 1.00 51.41  ? 72  ILE F CD1 1 
ATOM   7630  N N   . ASN F 1 73  ? 114.673 54.476 159.708 1.00 75.87  ? 73  ASN F N   1 
ATOM   7631  C CA  . ASN F 1 73  ? 115.967 53.974 160.154 1.00 75.87  ? 73  ASN F CA  1 
ATOM   7632  C C   . ASN F 1 73  ? 115.890 52.512 160.566 1.00 75.87  ? 73  ASN F C   1 
ATOM   7633  O O   . ASN F 1 73  ? 116.786 51.736 160.253 1.00 75.87  ? 73  ASN F O   1 
ATOM   7634  C CB  . ASN F 1 73  ? 116.504 54.832 161.294 1.00 80.24  ? 73  ASN F CB  1 
ATOM   7635  C CG  . ASN F 1 73  ? 117.046 56.154 160.805 1.00 80.24  ? 73  ASN F CG  1 
ATOM   7636  O OD1 . ASN F 1 73  ? 117.767 56.210 159.801 1.00 80.24  ? 73  ASN F OD1 1 
ATOM   7637  N ND2 . ASN F 1 73  ? 116.715 57.225 161.513 1.00 80.24  ? 73  ASN F ND2 1 
ATOM   7638  N N   . LEU F 1 74  ? 114.825 52.131 161.261 1.00 69.91  ? 74  LEU F N   1 
ATOM   7639  C CA  . LEU F 1 74  ? 114.654 50.736 161.656 1.00 69.91  ? 74  LEU F CA  1 
ATOM   7640  C C   . LEU F 1 74  ? 114.809 49.833 160.428 1.00 69.91  ? 74  LEU F C   1 
ATOM   7641  O O   . LEU F 1 74  ? 115.536 48.839 160.462 1.00 69.91  ? 74  LEU F O   1 
ATOM   7642  C CB  . LEU F 1 74  ? 113.267 50.516 162.266 1.00 82.35  ? 74  LEU F CB  1 
ATOM   7643  C CG  . LEU F 1 74  ? 113.126 50.720 163.778 1.00 82.35  ? 74  LEU F CG  1 
ATOM   7644  C CD1 . LEU F 1 74  ? 111.671 50.563 164.226 1.00 82.35  ? 74  LEU F CD1 1 
ATOM   7645  C CD2 . LEU F 1 74  ? 114.007 49.701 164.479 1.00 82.35  ? 74  LEU F CD2 1 
ATOM   7646  N N   . ALA F 1 75  ? 114.125 50.198 159.344 1.00 61.07  ? 75  ALA F N   1 
ATOM   7647  C CA  . ALA F 1 75  ? 114.163 49.448 158.095 1.00 61.07  ? 75  ALA F CA  1 
ATOM   7648  C C   . ALA F 1 75  ? 115.538 49.494 157.418 1.00 61.07  ? 75  ALA F C   1 
ATOM   7649  O O   . ALA F 1 75  ? 116.033 48.487 156.904 1.00 61.07  ? 75  ALA F O   1 
ATOM   7650  C CB  . ALA F 1 75  ? 113.093 49.982 157.147 1.00 79.16  ? 75  ALA F CB  1 
ATOM   7651  N N   . ASN F 1 76  ? 116.162 50.661 157.401 1.00 59.35  ? 76  ASN F N   1 
ATOM   7652  C CA  . ASN F 1 76  ? 117.461 50.756 156.764 1.00 59.35  ? 76  ASN F CA  1 
ATOM   7653  C C   . ASN F 1 76  ? 118.443 49.825 157.452 1.00 59.35  ? 76  ASN F C   1 
ATOM   7654  O O   . ASN F 1 76  ? 119.451 49.421 156.866 1.00 59.35  ? 76  ASN F O   1 
ATOM   7655  C CB  . ASN F 1 76  ? 117.969 52.195 156.818 1.00 87.24  ? 76  ASN F CB  1 
ATOM   7656  C CG  . ASN F 1 76  ? 117.205 53.106 155.898 1.00 87.24  ? 76  ASN F CG  1 
ATOM   7657  O OD1 . ASN F 1 76  ? 117.096 52.841 154.698 1.00 87.24  ? 76  ASN F OD1 1 
ATOM   7658  N ND2 . ASN F 1 76  ? 116.669 54.186 156.447 1.00 87.24  ? 76  ASN F ND2 1 
ATOM   7659  N N   . GLU F 1 77  ? 118.152 49.507 158.711 1.00 94.75  ? 77  GLU F N   1 
ATOM   7660  C CA  . GLU F 1 77  ? 119.013 48.624 159.473 1.00 94.75  ? 77  GLU F CA  1 
ATOM   7661  C C   . GLU F 1 77  ? 118.613 47.188 159.228 1.00 94.75  ? 77  GLU F C   1 
ATOM   7662  O O   . GLU F 1 77  ? 119.444 46.363 158.860 1.00 94.75  ? 77  GLU F O   1 
ATOM   7663  C CB  . GLU F 1 77  ? 118.946 48.946 160.968 1.00 134.11 ? 77  GLU F CB  1 
ATOM   7664  C CG  . GLU F 1 77  ? 119.744 50.186 161.363 1.00 134.11 ? 77  GLU F CG  1 
ATOM   7665  C CD  . GLU F 1 77  ? 121.134 50.216 160.736 1.00 134.11 ? 77  GLU F CD  1 
ATOM   7666  O OE1 . GLU F 1 77  ? 121.808 49.162 160.727 1.00 134.11 ? 77  GLU F OE1 1 
ATOM   7667  O OE2 . GLU F 1 77  ? 121.556 51.294 160.257 1.00 134.11 ? 77  GLU F OE2 1 
ATOM   7668  N N   . MET F 1 78  ? 117.333 46.896 159.415 1.00 79.16  ? 78  MET F N   1 
ATOM   7669  C CA  . MET F 1 78  ? 116.829 45.552 159.202 1.00 79.16  ? 78  MET F CA  1 
ATOM   7670  C C   . MET F 1 78  ? 117.169 44.988 157.835 1.00 79.16  ? 78  MET F C   1 
ATOM   7671  O O   . MET F 1 78  ? 117.550 43.827 157.746 1.00 79.16  ? 78  MET F O   1 
ATOM   7672  C CB  . MET F 1 78  ? 115.313 45.514 159.378 1.00 111.09 ? 78  MET F CB  1 
ATOM   7673  C CG  . MET F 1 78  ? 114.847 45.276 160.796 1.00 111.09 ? 78  MET F CG  1 
ATOM   7674  S SD  . MET F 1 78  ? 115.457 43.713 161.443 1.00 111.09 ? 78  MET F SD  1 
ATOM   7675  C CE  . MET F 1 78  ? 114.923 42.607 160.206 1.00 111.09 ? 78  MET F CE  1 
ATOM   7676  N N   . PHE F 1 79  ? 117.049 45.802 156.782 1.00 73.75  ? 79  PHE F N   1 
ATOM   7677  C CA  . PHE F 1 79  ? 117.300 45.340 155.402 1.00 73.75  ? 79  PHE F CA  1 
ATOM   7678  C C   . PHE F 1 79  ? 118.436 45.997 154.642 1.00 73.75  ? 79  PHE F C   1 
ATOM   7679  O O   . PHE F 1 79  ? 118.804 45.521 153.568 1.00 73.75  ? 79  PHE F O   1 
ATOM   7680  C CB  . PHE F 1 79  ? 116.049 45.517 154.536 1.00 45.99  ? 79  PHE F CB  1 
ATOM   7681  C CG  . PHE F 1 79  ? 114.765 45.155 155.230 1.00 45.99  ? 79  PHE F CG  1 
ATOM   7682  C CD1 . PHE F 1 79  ? 113.853 46.141 155.620 1.00 45.99  ? 79  PHE F CD1 1 
ATOM   7683  C CD2 . PHE F 1 79  ? 114.460 43.827 155.485 1.00 45.99  ? 79  PHE F CD2 1 
ATOM   7684  C CE1 . PHE F 1 79  ? 112.645 45.800 156.256 1.00 45.99  ? 79  PHE F CE1 1 
ATOM   7685  C CE2 . PHE F 1 79  ? 113.258 43.473 156.120 1.00 45.99  ? 79  PHE F CE2 1 
ATOM   7686  C CZ  . PHE F 1 79  ? 112.350 44.458 156.505 1.00 45.99  ? 79  PHE F CZ  1 
ATOM   7687  N N   . GLY F 1 80  ? 118.964 47.096 155.170 1.00 83.19  ? 80  GLY F N   1 
ATOM   7688  C CA  . GLY F 1 80  ? 120.035 47.797 154.484 1.00 83.19  ? 80  GLY F CA  1 
ATOM   7689  C C   . GLY F 1 80  ? 119.400 48.885 153.648 1.00 83.19  ? 80  GLY F C   1 
ATOM   7690  O O   . GLY F 1 80  ? 118.246 48.758 153.242 1.00 83.19  ? 80  GLY F O   1 
ATOM   7691  N N   . TYR F 1 81  ? 120.137 49.955 153.388 1.00 81.05  ? 81  TYR F N   1 
ATOM   7692  C CA  . TYR F 1 81  ? 119.614 51.057 152.590 1.00 81.05  ? 81  TYR F CA  1 
ATOM   7693  C C   . TYR F 1 81  ? 119.042 50.620 151.244 1.00 81.05  ? 81  TYR F C   1 
ATOM   7694  O O   . TYR F 1 81  ? 118.112 51.245 150.733 1.00 81.05  ? 81  TYR F O   1 
ATOM   7695  C CB  . TYR F 1 81  ? 120.714 52.066 152.341 1.00 57.60  ? 81  TYR F CB  1 
ATOM   7696  C CG  . TYR F 1 81  ? 121.775 51.594 151.367 1.00 57.60  ? 81  TYR F CG  1 
ATOM   7697  C CD1 . TYR F 1 81  ? 121.706 51.930 150.014 1.00 57.60  ? 81  TYR F CD1 1 
ATOM   7698  C CD2 . TYR F 1 81  ? 122.902 50.905 151.810 1.00 57.60  ? 81  TYR F CD2 1 
ATOM   7699  C CE1 . TYR F 1 81  ? 122.741 51.612 149.131 1.00 57.60  ? 81  TYR F CE1 1 
ATOM   7700  C CE2 . TYR F 1 81  ? 123.941 50.575 150.929 1.00 57.60  ? 81  TYR F CE2 1 
ATOM   7701  C CZ  . TYR F 1 81  ? 123.855 50.936 149.596 1.00 57.60  ? 81  TYR F CZ  1 
ATOM   7702  O OH  . TYR F 1 81  ? 124.878 50.639 148.724 1.00 57.60  ? 81  TYR F OH  1 
ATOM   7703  N N   . ASN F 1 82  ? 119.608 49.555 150.677 1.00 54.36  ? 82  ASN F N   1 
ATOM   7704  C CA  . ASN F 1 82  ? 119.180 49.030 149.382 1.00 54.36  ? 82  ASN F CA  1 
ATOM   7705  C C   . ASN F 1 82  ? 118.485 47.660 149.460 1.00 54.36  ? 82  ASN F C   1 
ATOM   7706  O O   . ASN F 1 82  ? 118.410 46.928 148.477 1.00 54.36  ? 82  ASN F O   1 
ATOM   7707  C CB  . ASN F 1 82  ? 120.395 48.934 148.456 1.00 65.88  ? 82  ASN F CB  1 
ATOM   7708  C CG  . ASN F 1 82  ? 121.241 47.719 148.741 1.00 65.88  ? 82  ASN F CG  1 
ATOM   7709  O OD1 . ASN F 1 82  ? 121.324 47.258 149.882 1.00 65.88  ? 82  ASN F OD1 1 
ATOM   7710  N ND2 . ASN F 1 82  ? 121.885 47.195 147.705 1.00 65.88  ? 82  ASN F ND2 1 
ATOM   7711  N N   . GLY F 1 83  ? 117.968 47.323 150.630 1.00 63.89  ? 83  GLY F N   1 
ATOM   7712  C CA  . GLY F 1 83  ? 117.309 46.046 150.790 1.00 63.89  ? 83  GLY F CA  1 
ATOM   7713  C C   . GLY F 1 83  ? 115.813 46.181 150.870 1.00 63.89  ? 83  GLY F C   1 
ATOM   7714  O O   . GLY F 1 83  ? 115.097 45.189 150.959 1.00 63.89  ? 83  GLY F O   1 
ATOM   7715  N N   . TRP F 1 84  ? 115.327 47.411 150.874 1.00 84.59  ? 84  TRP F N   1 
ATOM   7716  C CA  . TRP F 1 84  ? 113.891 47.633 150.914 1.00 84.59  ? 84  TRP F CA  1 
ATOM   7717  C C   . TRP F 1 84  ? 113.583 48.853 150.051 1.00 84.59  ? 84  TRP F C   1 
ATOM   7718  O O   . TRP F 1 84  ? 114.464 49.684 149.793 1.00 84.59  ? 84  TRP F O   1 
ATOM   7719  C CB  . TRP F 1 84  ? 113.398 47.842 152.356 1.00 79.07  ? 84  TRP F CB  1 
ATOM   7720  C CG  . TRP F 1 84  ? 113.785 49.147 152.935 1.00 79.07  ? 84  TRP F CG  1 
ATOM   7721  C CD1 . TRP F 1 84  ? 115.041 49.554 153.266 1.00 79.07  ? 84  TRP F CD1 1 
ATOM   7722  C CD2 . TRP F 1 84  ? 112.926 50.267 153.158 1.00 79.07  ? 84  TRP F CD2 1 
ATOM   7723  N NE1 . TRP F 1 84  ? 115.024 50.867 153.674 1.00 79.07  ? 84  TRP F NE1 1 
ATOM   7724  C CE2 . TRP F 1 84  ? 113.736 51.329 153.617 1.00 79.07  ? 84  TRP F CE2 1 
ATOM   7725  C CE3 . TRP F 1 84  ? 111.549 50.480 153.010 1.00 79.07  ? 84  TRP F CE3 1 
ATOM   7726  C CZ2 . TRP F 1 84  ? 113.214 52.589 153.931 1.00 79.07  ? 84  TRP F CZ2 1 
ATOM   7727  C CZ3 . TRP F 1 84  ? 111.030 51.735 153.322 1.00 79.07  ? 84  TRP F CZ3 1 
ATOM   7728  C CH2 . TRP F 1 84  ? 111.865 52.773 153.776 1.00 79.07  ? 84  TRP F CH2 1 
ATOM   7729  N N   . ALA F 1 85  ? 112.339 48.940 149.585 1.00 64.28  ? 85  ALA F N   1 
ATOM   7730  C CA  . ALA F 1 85  ? 111.918 50.054 148.749 1.00 64.28  ? 85  ALA F CA  1 
ATOM   7731  C C   . ALA F 1 85  ? 110.430 50.271 148.886 1.00 64.28  ? 85  ALA F C   1 
ATOM   7732  O O   . ALA F 1 85  ? 109.697 49.381 149.327 1.00 64.28  ? 85  ALA F O   1 
ATOM   7733  C CB  . ALA F 1 85  ? 112.281 49.780 147.302 1.00 36.91  ? 85  ALA F CB  1 
ATOM   7734  N N   . HIS F 1 86  ? 109.981 51.470 148.553 1.00 54.88  ? 86  HIS F N   1 
ATOM   7735  C CA  . HIS F 1 86  ? 108.557 51.734 148.623 1.00 54.88  ? 86  HIS F CA  1 
ATOM   7736  C C   . HIS F 1 86  ? 108.162 52.675 147.498 1.00 54.88  ? 86  HIS F C   1 
ATOM   7737  O O   . HIS F 1 86  ? 109.005 53.401 146.944 1.00 54.88  ? 86  HIS F O   1 
ATOM   7738  C CB  . HIS F 1 86  ? 108.135 52.307 149.992 1.00 52.76  ? 86  HIS F CB  1 
ATOM   7739  C CG  . HIS F 1 86  ? 108.592 53.710 150.238 1.00 52.76  ? 86  HIS F CG  1 
ATOM   7740  N ND1 . HIS F 1 86  ? 107.751 54.694 150.711 1.00 52.76  ? 86  HIS F ND1 1 
ATOM   7741  C CD2 . HIS F 1 86  ? 109.804 54.292 150.082 1.00 52.76  ? 86  HIS F CD2 1 
ATOM   7742  C CE1 . HIS F 1 86  ? 108.428 55.823 150.832 1.00 52.76  ? 86  HIS F CE1 1 
ATOM   7743  N NE2 . HIS F 1 86  ? 109.676 55.605 150.456 1.00 52.76  ? 86  HIS F NE2 1 
ATOM   7744  N N   . SER F 1 87  ? 106.879 52.620 147.143 1.00 42.99  ? 87  SER F N   1 
ATOM   7745  C CA  . SER F 1 87  ? 106.347 53.460 146.094 1.00 42.99  ? 87  SER F CA  1 
ATOM   7746  C C   . SER F 1 87  ? 104.937 53.784 146.493 1.00 42.99  ? 87  SER F C   1 
ATOM   7747  O O   . SER F 1 87  ? 104.338 53.065 147.293 1.00 42.99  ? 87  SER F O   1 
ATOM   7748  C CB  . SER F 1 87  ? 106.352 52.718 144.766 1.00 68.51  ? 87  SER F CB  1 
ATOM   7749  O OG  . SER F 1 87  ? 105.458 51.628 144.824 1.00 68.51  ? 87  SER F OG  1 
ATOM   7750  N N   . ILE F 1 88  ? 104.423 54.887 145.959 1.00 54.63  ? 88  ILE F N   1 
ATOM   7751  C CA  . ILE F 1 88  ? 103.065 55.303 146.254 1.00 54.63  ? 88  ILE F CA  1 
ATOM   7752  C C   . ILE F 1 88  ? 102.230 54.801 145.090 1.00 54.63  ? 88  ILE F C   1 
ATOM   7753  O O   . ILE F 1 88  ? 102.377 55.262 143.956 1.00 54.63  ? 88  ILE F O   1 
ATOM   7754  C CB  . ILE F 1 88  ? 102.958 56.845 146.360 1.00 41.87  ? 88  ILE F CB  1 
ATOM   7755  C CG1 . ILE F 1 88  ? 103.833 57.346 147.495 1.00 41.87  ? 88  ILE F CG1 1 
ATOM   7756  C CG2 . ILE F 1 88  ? 101.503 57.269 146.618 1.00 41.87  ? 88  ILE F CG2 1 
ATOM   7757  C CD1 . ILE F 1 88  ? 103.944 58.847 147.551 1.00 41.87  ? 88  ILE F CD1 1 
ATOM   7758  N N   . THR F 1 89  ? 101.374 53.830 145.368 1.00 63.44  ? 89  THR F N   1 
ATOM   7759  C CA  . THR F 1 89  ? 100.525 53.269 144.337 1.00 63.44  ? 89  THR F CA  1 
ATOM   7760  C C   . THR F 1 89  ? 99.532  54.336 143.898 1.00 63.44  ? 89  THR F C   1 
ATOM   7761  O O   . THR F 1 89  ? 99.246  54.491 142.710 1.00 63.44  ? 89  THR F O   1 
ATOM   7762  C CB  . THR F 1 89  ? 99.752  52.038 144.865 1.00 53.76  ? 89  THR F CB  1 
ATOM   7763  O OG1 . THR F 1 89  ? 100.680 51.012 145.237 1.00 53.76  ? 89  THR F OG1 1 
ATOM   7764  C CG2 . THR F 1 89  ? 98.820  51.491 143.794 1.00 53.76  ? 89  THR F CG2 1 
ATOM   7765  N N   . GLN F 1 90  ? 99.016  55.084 144.865 1.00 65.73  ? 90  GLN F N   1 
ATOM   7766  C CA  . GLN F 1 90  ? 98.047  56.113 144.565 1.00 65.73  ? 90  GLN F CA  1 
ATOM   7767  C C   . GLN F 1 90  ? 97.702  56.936 145.781 1.00 65.73  ? 90  GLN F C   1 
ATOM   7768  O O   . GLN F 1 90  ? 97.679  56.426 146.899 1.00 65.73  ? 90  GLN F O   1 
ATOM   7769  C CB  . GLN F 1 90  ? 96.768  55.478 144.032 1.00 75.52  ? 90  GLN F CB  1 
ATOM   7770  C CG  . GLN F 1 90  ? 95.627  56.461 143.865 1.00 75.52  ? 90  GLN F CG  1 
ATOM   7771  C CD  . GLN F 1 90  ? 94.408  55.833 143.232 1.00 75.52  ? 90  GLN F CD  1 
ATOM   7772  O OE1 . GLN F 1 90  ? 93.707  55.038 143.858 1.00 75.52  ? 90  GLN F OE1 1 
ATOM   7773  N NE2 . GLN F 1 90  ? 94.154  56.177 141.974 1.00 75.52  ? 90  GLN F NE2 1 
ATOM   7774  N N   . GLN F 1 91  ? 97.429  58.217 145.547 1.00 67.74  ? 91  GLN F N   1 
ATOM   7775  C CA  . GLN F 1 91  ? 97.037  59.137 146.604 1.00 67.74  ? 91  GLN F CA  1 
ATOM   7776  C C   . GLN F 1 91  ? 95.789  59.872 146.165 1.00 67.74  ? 91  GLN F C   1 
ATOM   7777  O O   . GLN F 1 91  ? 95.759  60.504 145.106 1.00 67.74  ? 91  GLN F O   1 
ATOM   7778  C CB  . GLN F 1 91  ? 98.138  60.150 146.907 1.00 55.02  ? 91  GLN F CB  1 
ATOM   7779  C CG  . GLN F 1 91  ? 97.683  61.226 147.905 1.00 55.02  ? 91  GLN F CG  1 
ATOM   7780  C CD  . GLN F 1 91  ? 98.836  62.038 148.475 1.00 55.02  ? 91  GLN F CD  1 
ATOM   7781  O OE1 . GLN F 1 91  ? 99.365  61.719 149.538 1.00 55.02  ? 91  GLN F OE1 1 
ATOM   7782  N NE2 . GLN F 1 91  ? 99.239  63.078 147.760 1.00 55.02  ? 91  GLN F NE2 1 
ATOM   7783  N N   . ASN F 1 92  ? 94.754  59.791 146.984 1.00 68.49  ? 92  ASN F N   1 
ATOM   7784  C CA  . ASN F 1 92  ? 93.507  60.445 146.657 1.00 68.49  ? 92  ASN F CA  1 
ATOM   7785  C C   . ASN F 1 92  ? 93.039  61.411 147.754 1.00 68.49  ? 92  ASN F C   1 
ATOM   7786  O O   . ASN F 1 92  ? 92.910  61.041 148.928 1.00 68.49  ? 92  ASN F O   1 
ATOM   7787  C CB  . ASN F 1 92  ? 92.428  59.393 146.383 1.00 104.12 ? 92  ASN F CB  1 
ATOM   7788  C CG  . ASN F 1 92  ? 91.123  60.007 145.931 1.00 104.12 ? 92  ASN F CG  1 
ATOM   7789  O OD1 . ASN F 1 92  ? 91.051  60.625 144.872 1.00 104.12 ? 92  ASN F OD1 1 
ATOM   7790  N ND2 . ASN F 1 92  ? 90.082  59.848 146.738 1.00 104.12 ? 92  ASN F ND2 1 
ATOM   7791  N N   . VAL F 1 93  ? 92.800  62.659 147.359 1.00 46.49  ? 93  VAL F N   1 
ATOM   7792  C CA  . VAL F 1 93  ? 92.309  63.673 148.270 1.00 46.49  ? 93  VAL F CA  1 
ATOM   7793  C C   . VAL F 1 93  ? 90.811  63.423 148.449 1.00 46.49  ? 93  VAL F C   1 
ATOM   7794  O O   . VAL F 1 93  ? 90.020  63.739 147.568 1.00 46.49  ? 93  VAL F O   1 
ATOM   7795  C CB  . VAL F 1 93  ? 92.510  65.062 147.675 1.00 47.26  ? 93  VAL F CB  1 
ATOM   7796  C CG1 . VAL F 1 93  ? 91.886  66.083 148.564 1.00 47.26  ? 93  VAL F CG1 1 
ATOM   7797  C CG2 . VAL F 1 93  ? 93.977  65.347 147.516 1.00 47.26  ? 93  VAL F CG2 1 
ATOM   7798  N N   . ASP F 1 94  ? 90.414  62.850 149.579 1.00 63.97  ? 94  ASP F N   1 
ATOM   7799  C CA  . ASP F 1 94  ? 88.998  62.575 149.813 1.00 63.97  ? 94  ASP F CA  1 
ATOM   7800  C C   . ASP F 1 94  ? 88.110  63.808 149.787 1.00 63.97  ? 94  ASP F C   1 
ATOM   7801  O O   . ASP F 1 94  ? 87.085  63.819 149.110 1.00 63.97  ? 94  ASP F O   1 
ATOM   7802  C CB  . ASP F 1 94  ? 88.796  61.844 151.136 1.00 90.87  ? 94  ASP F CB  1 
ATOM   7803  C CG  . ASP F 1 94  ? 89.172  60.393 151.047 1.00 90.87  ? 94  ASP F CG  1 
ATOM   7804  O OD1 . ASP F 1 94  ? 89.116  59.862 149.925 1.00 90.87  ? 94  ASP F OD1 1 
ATOM   7805  O OD2 . ASP F 1 94  ? 89.508  59.779 152.084 1.00 90.87  ? 94  ASP F OD2 1 
ATOM   7806  N N   . PHE F 1 95  ? 88.497  64.844 150.523 1.00 81.82  ? 95  PHE F N   1 
ATOM   7807  C CA  . PHE F 1 95  ? 87.704  66.064 150.568 1.00 81.82  ? 95  PHE F CA  1 
ATOM   7808  C C   . PHE F 1 95  ? 88.490  67.267 151.056 1.00 81.82  ? 95  PHE F C   1 
ATOM   7809  O O   . PHE F 1 95  ? 89.546  67.138 151.670 1.00 81.82  ? 95  PHE F O   1 
ATOM   7810  C CB  . PHE F 1 95  ? 86.487  65.858 151.473 1.00 82.67  ? 95  PHE F CB  1 
ATOM   7811  C CG  . PHE F 1 95  ? 86.838  65.584 152.904 1.00 82.67  ? 95  PHE F CG  1 
ATOM   7812  C CD1 . PHE F 1 95  ? 87.197  66.620 153.755 1.00 82.67  ? 95  PHE F CD1 1 
ATOM   7813  C CD2 . PHE F 1 95  ? 86.836  64.285 153.396 1.00 82.67  ? 95  PHE F CD2 1 
ATOM   7814  C CE1 . PHE F 1 95  ? 87.553  66.370 155.073 1.00 82.67  ? 95  PHE F CE1 1 
ATOM   7815  C CE2 . PHE F 1 95  ? 87.189  64.019 154.711 1.00 82.67  ? 95  PHE F CE2 1 
ATOM   7816  C CZ  . PHE F 1 95  ? 87.549  65.066 155.553 1.00 82.67  ? 95  PHE F CZ  1 
ATOM   7817  N N   . VAL F 1 96  ? 87.960  68.445 150.764 1.00 80.70  ? 96  VAL F N   1 
ATOM   7818  C CA  . VAL F 1 96  ? 88.561  69.697 151.196 1.00 80.70  ? 96  VAL F CA  1 
ATOM   7819  C C   . VAL F 1 96  ? 87.404  70.630 151.475 1.00 80.70  ? 96  VAL F C   1 
ATOM   7820  O O   . VAL F 1 96  ? 86.947  71.347 150.588 1.00 80.70  ? 96  VAL F O   1 
ATOM   7821  C CB  . VAL F 1 96  ? 89.445  70.309 150.119 1.00 51.38  ? 96  VAL F CB  1 
ATOM   7822  C CG1 . VAL F 1 96  ? 89.969  71.657 150.593 1.00 51.38  ? 96  VAL F CG1 1 
ATOM   7823  C CG2 . VAL F 1 96  ? 90.595  69.383 149.827 1.00 51.38  ? 96  VAL F CG2 1 
ATOM   7824  N N   . ASP F 1 97  ? 86.927  70.595 152.714 1.00 101.83 ? 97  ASP F N   1 
ATOM   7825  C CA  . ASP F 1 97  ? 85.804  71.418 153.130 1.00 101.83 ? 97  ASP F CA  1 
ATOM   7826  C C   . ASP F 1 97  ? 86.195  72.716 153.832 1.00 101.83 ? 97  ASP F C   1 
ATOM   7827  O O   . ASP F 1 97  ? 87.233  72.807 154.506 1.00 101.83 ? 97  ASP F O   1 
ATOM   7828  C CB  . ASP F 1 97  ? 84.875  70.606 154.029 1.00 119.61 ? 97  ASP F CB  1 
ATOM   7829  C CG  . ASP F 1 97  ? 84.340  69.374 153.337 1.00 119.61 ? 97  ASP F CG  1 
ATOM   7830  O OD1 . ASP F 1 97  ? 83.994  69.471 152.143 1.00 119.61 ? 97  ASP F OD1 1 
ATOM   7831  O OD2 . ASP F 1 97  ? 84.256  68.312 153.986 1.00 119.61 ? 97  ASP F OD2 1 
ATOM   7832  N N   . LEU F 1 98  ? 85.341  73.722 153.659 1.00 77.60  ? 98  LEU F N   1 
ATOM   7833  C CA  . LEU F 1 98  ? 85.562  75.030 154.250 1.00 77.60  ? 98  LEU F CA  1 
ATOM   7834  C C   . LEU F 1 98  ? 84.436  75.427 155.191 1.00 77.60  ? 98  LEU F C   1 
ATOM   7835  O O   . LEU F 1 98  ? 83.330  75.715 154.751 1.00 77.60  ? 98  LEU F O   1 
ATOM   7836  C CB  . LEU F 1 98  ? 85.699  76.079 153.151 1.00 51.95  ? 98  LEU F CB  1 
ATOM   7837  C CG  . LEU F 1 98  ? 85.960  77.502 153.641 1.00 51.95  ? 98  LEU F CG  1 
ATOM   7838  C CD1 . LEU F 1 98  ? 87.096  77.527 154.679 1.00 51.95  ? 98  LEU F CD1 1 
ATOM   7839  C CD2 . LEU F 1 98  ? 86.311  78.371 152.456 1.00 51.95  ? 98  LEU F CD2 1 
ATOM   7840  N N   . ASN F 1 99  ? 84.733  75.419 156.488 1.00 121.68 ? 99  ASN F N   1 
ATOM   7841  C CA  . ASN F 1 99  ? 83.775  75.798 157.520 1.00 121.68 ? 99  ASN F CA  1 
ATOM   7842  C C   . ASN F 1 99  ? 84.297  77.063 158.172 1.00 121.68 ? 99  ASN F C   1 
ATOM   7843  O O   . ASN F 1 99  ? 85.255  77.019 158.948 1.00 121.68 ? 99  ASN F O   1 
ATOM   7844  C CB  . ASN F 1 99  ? 83.640  74.703 158.585 1.00 148.24 ? 99  ASN F CB  1 
ATOM   7845  C CG  . ASN F 1 99  ? 82.892  73.484 158.082 1.00 148.24 ? 99  ASN F CG  1 
ATOM   7846  O OD1 . ASN F 1 99  ? 81.773  73.592 157.581 1.00 148.24 ? 99  ASN F OD1 1 
ATOM   7847  N ND2 . ASN F 1 99  ? 83.503  72.314 158.223 1.00 148.24 ? 99  ASN F ND2 1 
ATOM   7848  N N   . ASN F 1 100 ? 83.661  78.183 157.848 1.00 103.42 ? 100 ASN F N   1 
ATOM   7849  C CA  . ASN F 1 100 ? 84.035  79.492 158.373 1.00 103.42 ? 100 ASN F CA  1 
ATOM   7850  C C   . ASN F 1 100 ? 85.543  79.746 158.426 1.00 103.42 ? 100 ASN F C   1 
ATOM   7851  O O   . ASN F 1 100 ? 86.149  79.744 159.501 1.00 103.42 ? 100 ASN F O   1 
ATOM   7852  C CB  . ASN F 1 100 ? 83.405  79.732 159.764 1.00 175.76 ? 100 ASN F CB  1 
ATOM   7853  C CG  . ASN F 1 100 ? 83.826  78.701 160.804 1.00 175.76 ? 100 ASN F CG  1 
ATOM   7854  O OD1 . ASN F 1 100 ? 83.474  77.524 160.712 1.00 175.76 ? 100 ASN F OD1 1 
ATOM   7855  N ND2 . ASN F 1 100 ? 84.576  79.146 161.807 1.00 175.76 ? 100 ASN F ND2 1 
ATOM   7856  N N   . GLY F 1 101 ? 86.134  79.957 157.249 1.00 64.79  ? 101 GLY F N   1 
ATOM   7857  C CA  . GLY F 1 101 ? 87.562  80.248 157.140 1.00 64.79  ? 101 GLY F CA  1 
ATOM   7858  C C   . GLY F 1 101 ? 88.575  79.190 157.545 1.00 64.79  ? 101 GLY F C   1 
ATOM   7859  O O   . GLY F 1 101 ? 89.786  79.394 157.381 1.00 64.79  ? 101 GLY F O   1 
ATOM   7860  N N   . LYS F 1 102 ? 88.086  78.073 158.086 1.00 90.85  ? 102 LYS F N   1 
ATOM   7861  C CA  . LYS F 1 102 ? 88.937  76.963 158.504 1.00 90.85  ? 102 LYS F CA  1 
ATOM   7862  C C   . LYS F 1 102 ? 88.787  75.806 157.516 1.00 90.85  ? 102 LYS F C   1 
ATOM   7863  O O   . LYS F 1 102 ? 87.685  75.526 157.040 1.00 90.85  ? 102 LYS F O   1 
ATOM   7864  C CB  . LYS F 1 102 ? 88.544  76.492 159.900 1.00 125.93 ? 102 LYS F CB  1 
ATOM   7865  C CG  . LYS F 1 102 ? 88.720  77.539 160.973 1.00 125.93 ? 102 LYS F CG  1 
ATOM   7866  C CD  . LYS F 1 102 ? 88.138  77.049 162.283 1.00 125.93 ? 102 LYS F CD  1 
ATOM   7867  C CE  . LYS F 1 102 ? 88.140  78.143 163.330 1.00 125.93 ? 102 LYS F CE  1 
ATOM   7868  N NZ  . LYS F 1 102 ? 87.437  77.700 164.561 1.00 125.93 ? 102 LYS F NZ  1 
ATOM   7869  N N   . PHE F 1 103 ? 89.900  75.138 157.212 1.00 98.93  ? 103 PHE F N   1 
ATOM   7870  C CA  . PHE F 1 103 ? 89.891  74.021 156.273 1.00 98.93  ? 103 PHE F CA  1 
ATOM   7871  C C   . PHE F 1 103 ? 89.962  72.654 156.910 1.00 98.93  ? 103 PHE F C   1 
ATOM   7872  O O   . PHE F 1 103 ? 90.776  72.407 157.801 1.00 98.93  ? 103 PHE F O   1 
ATOM   7873  C CB  . PHE F 1 103 ? 91.039  74.153 155.280 1.00 71.89  ? 103 PHE F CB  1 
ATOM   7874  C CG  . PHE F 1 103 ? 90.800  75.183 154.233 1.00 71.89  ? 103 PHE F CG  1 
ATOM   7875  C CD1 . PHE F 1 103 ? 91.612  76.308 154.147 1.00 71.89  ? 103 PHE F CD1 1 
ATOM   7876  C CD2 . PHE F 1 103 ? 89.742  75.037 153.330 1.00 71.89  ? 103 PHE F CD2 1 
ATOM   7877  C CE1 . PHE F 1 103 ? 91.376  77.280 153.172 1.00 71.89  ? 103 PHE F CE1 1 
ATOM   7878  C CE2 . PHE F 1 103 ? 89.499  76.000 152.357 1.00 71.89  ? 103 PHE F CE2 1 
ATOM   7879  C CZ  . PHE F 1 103 ? 90.319  77.126 152.277 1.00 71.89  ? 103 PHE F CZ  1 
ATOM   7880  N N   . TYR F 1 104 ? 89.101  71.767 156.424 1.00 70.20  ? 104 TYR F N   1 
ATOM   7881  C CA  . TYR F 1 104 ? 89.025  70.383 156.893 1.00 70.20  ? 104 TYR F CA  1 
ATOM   7882  C C   . TYR F 1 104 ? 89.351  69.455 155.717 1.00 70.20  ? 104 TYR F C   1 
ATOM   7883  O O   . TYR F 1 104 ? 88.518  69.228 154.847 1.00 70.20  ? 104 TYR F O   1 
ATOM   7884  C CB  . TYR F 1 104 ? 87.621  70.097 157.437 1.00 128.85 ? 104 TYR F CB  1 
ATOM   7885  C CG  . TYR F 1 104 ? 87.238  70.997 158.596 1.00 128.85 ? 104 TYR F CG  1 
ATOM   7886  C CD1 . TYR F 1 104 ? 87.226  72.386 158.449 1.00 128.85 ? 104 TYR F CD1 1 
ATOM   7887  C CD2 . TYR F 1 104 ? 86.924  70.467 159.848 1.00 128.85 ? 104 TYR F CD2 1 
ATOM   7888  C CE1 . TYR F 1 104 ? 86.920  73.225 159.514 1.00 128.85 ? 104 TYR F CE1 1 
ATOM   7889  C CE2 . TYR F 1 104 ? 86.615  71.302 160.924 1.00 128.85 ? 104 TYR F CE2 1 
ATOM   7890  C CZ  . TYR F 1 104 ? 86.618  72.681 160.746 1.00 128.85 ? 104 TYR F CZ  1 
ATOM   7891  O OH  . TYR F 1 104 ? 86.336  73.523 161.796 1.00 128.85 ? 104 TYR F OH  1 
ATOM   7892  N N   . VAL F 1 105 ? 90.570  68.927 155.697 1.00 84.51  ? 105 VAL F N   1 
ATOM   7893  C CA  . VAL F 1 105 ? 91.008  68.059 154.610 1.00 84.51  ? 105 VAL F CA  1 
ATOM   7894  C C   . VAL F 1 105 ? 91.283  66.605 154.977 1.00 84.51  ? 105 VAL F C   1 
ATOM   7895  O O   . VAL F 1 105 ? 91.937  66.313 155.979 1.00 84.51  ? 105 VAL F O   1 
ATOM   7896  C CB  . VAL F 1 105 ? 92.273  68.617 153.969 1.00 67.84  ? 105 VAL F CB  1 
ATOM   7897  C CG1 . VAL F 1 105 ? 92.779  67.660 152.917 1.00 67.84  ? 105 VAL F CG1 1 
ATOM   7898  C CG2 . VAL F 1 105 ? 91.982  69.981 153.383 1.00 67.84  ? 105 VAL F CG2 1 
ATOM   7899  N N   . GLY F 1 106 ? 90.783  65.700 154.142 1.00 89.94  ? 106 GLY F N   1 
ATOM   7900  C CA  . GLY F 1 106 ? 90.993  64.278 154.351 1.00 89.94  ? 106 GLY F CA  1 
ATOM   7901  C C   . GLY F 1 106 ? 91.705  63.671 153.149 1.00 89.94  ? 106 GLY F C   1 
ATOM   7902  O O   . GLY F 1 106 ? 91.241  63.806 152.023 1.00 89.94  ? 106 GLY F O   1 
ATOM   7903  N N   . VAL F 1 107 ? 92.831  63.005 153.377 1.00 76.12  ? 107 VAL F N   1 
ATOM   7904  C CA  . VAL F 1 107 ? 93.592  62.400 152.289 1.00 76.12  ? 107 VAL F CA  1 
ATOM   7905  C C   . VAL F 1 107 ? 94.005  60.963 152.606 1.00 76.12  ? 107 VAL F C   1 
ATOM   7906  O O   . VAL F 1 107 ? 94.269  60.622 153.756 1.00 76.12  ? 107 VAL F O   1 
ATOM   7907  C CB  . VAL F 1 107 ? 94.863  63.212 152.003 1.00 34.14  ? 107 VAL F CB  1 
ATOM   7908  C CG1 . VAL F 1 107 ? 95.746  62.469 151.039 1.00 34.14  ? 107 VAL F CG1 1 
ATOM   7909  C CG2 . VAL F 1 107 ? 94.493  64.563 151.466 1.00 34.14  ? 107 VAL F CG2 1 
ATOM   7910  N N   . CYS F 1 108 ? 94.051  60.114 151.587 1.00 65.89  ? 108 CYS F N   1 
ATOM   7911  C CA  . CYS F 1 108 ? 94.467  58.728 151.789 1.00 65.89  ? 108 CYS F CA  1 
ATOM   7912  C C   . CYS F 1 108 ? 95.541  58.425 150.785 1.00 65.89  ? 108 CYS F C   1 
ATOM   7913  O O   . CYS F 1 108 ? 95.581  59.019 149.717 1.00 65.89  ? 108 CYS F O   1 
ATOM   7914  C CB  . CYS F 1 108 ? 93.301  57.742 151.608 1.00 71.57  ? 108 CYS F CB  1 
ATOM   7915  S SG  . CYS F 1 108 ? 92.587  57.640 149.944 1.00 71.57  ? 108 CYS F SG  1 
ATOM   7916  N N   . ALA F 1 109 ? 96.436  57.524 151.139 1.00 59.00  ? 109 ALA F N   1 
ATOM   7917  C CA  . ALA F 1 109 ? 97.493  57.160 150.227 1.00 59.00  ? 109 ALA F CA  1 
ATOM   7918  C C   . ALA F 1 109 ? 97.742  55.673 150.346 1.00 59.00  ? 109 ALA F C   1 
ATOM   7919  O O   . ALA F 1 109 ? 97.577  55.098 151.423 1.00 59.00  ? 109 ALA F O   1 
ATOM   7920  C CB  . ALA F 1 109 ? 98.755  57.945 150.534 1.00 24.41  ? 109 ALA F CB  1 
ATOM   7921  N N   . PHE F 1 110 ? 98.115  55.051 149.229 1.00 47.00  ? 110 PHE F N   1 
ATOM   7922  C CA  . PHE F 1 110 ? 98.395  53.630 149.203 1.00 47.00  ? 110 PHE F CA  1 
ATOM   7923  C C   . PHE F 1 110 ? 99.853  53.466 148.952 1.00 47.00  ? 110 PHE F C   1 
ATOM   7924  O O   . PHE F 1 110 ? 100.369 53.909 147.935 1.00 47.00  ? 110 PHE F O   1 
ATOM   7925  C CB  . PHE F 1 110 ? 97.575  52.953 148.119 1.00 33.35  ? 110 PHE F CB  1 
ATOM   7926  C CG  . PHE F 1 110 ? 96.104  53.044 148.366 1.00 33.35  ? 110 PHE F CG  1 
ATOM   7927  C CD1 . PHE F 1 110 ? 95.415  54.216 148.088 1.00 33.35  ? 110 PHE F CD1 1 
ATOM   7928  C CD2 . PHE F 1 110 ? 95.420  51.983 148.945 1.00 33.35  ? 110 PHE F CD2 1 
ATOM   7929  C CE1 . PHE F 1 110 ? 94.062  54.343 148.381 1.00 33.35  ? 110 PHE F CE1 1 
ATOM   7930  C CE2 . PHE F 1 110 ? 94.065  52.090 149.245 1.00 33.35  ? 110 PHE F CE2 1 
ATOM   7931  C CZ  . PHE F 1 110 ? 93.382  53.282 148.960 1.00 33.35  ? 110 PHE F CZ  1 
ATOM   7932  N N   . VAL F 1 111 ? 100.530 52.849 149.905 1.00 66.09  ? 111 VAL F N   1 
ATOM   7933  C CA  . VAL F 1 111 ? 101.957 52.642 149.775 1.00 66.09  ? 111 VAL F CA  1 
ATOM   7934  C C   . VAL F 1 111 ? 102.277 51.167 149.715 1.00 66.09  ? 111 VAL F C   1 
ATOM   7935  O O   . VAL F 1 111 ? 101.685 50.348 150.436 1.00 66.09  ? 111 VAL F O   1 
ATOM   7936  C CB  . VAL F 1 111 ? 102.731 53.287 150.952 1.00 40.21  ? 111 VAL F CB  1 
ATOM   7937  C CG1 . VAL F 1 111 ? 104.251 53.104 150.761 1.00 40.21  ? 111 VAL F CG1 1 
ATOM   7938  C CG2 . VAL F 1 111 ? 102.375 54.775 151.044 1.00 40.21  ? 111 VAL F CG2 1 
ATOM   7939  N N   . ARG F 1 112 ? 103.219 50.843 148.837 1.00 52.63  ? 112 ARG F N   1 
ATOM   7940  C CA  . ARG F 1 112 ? 103.648 49.479 148.650 1.00 52.63  ? 112 ARG F CA  1 
ATOM   7941  C C   . ARG F 1 112 ? 105.126 49.401 148.940 1.00 52.63  ? 112 ARG F C   1 
ATOM   7942  O O   . ARG F 1 112 ? 105.932 50.112 148.311 1.00 52.63  ? 112 ARG F O   1 
ATOM   7943  C CB  . ARG F 1 112 ? 103.403 49.034 147.219 1.00 71.20  ? 112 ARG F CB  1 
ATOM   7944  C CG  . ARG F 1 112 ? 103.436 47.546 147.074 1.00 71.20  ? 112 ARG F CG  1 
ATOM   7945  C CD  . ARG F 1 112 ? 103.331 47.122 145.639 1.00 71.20  ? 112 ARG F CD  1 
ATOM   7946  N NE  . ARG F 1 112 ? 104.585 46.541 145.167 1.00 71.20  ? 112 ARG F NE  1 
ATOM   7947  C CZ  . ARG F 1 112 ? 104.673 45.379 144.522 1.00 71.20  ? 112 ARG F CZ  1 
ATOM   7948  N NH1 . ARG F 1 112 ? 103.570 44.660 144.263 1.00 71.20  ? 112 ARG F NH1 1 
ATOM   7949  N NH2 . ARG F 1 112 ? 105.867 44.928 144.149 1.00 71.20  ? 112 ARG F NH2 1 
ATOM   7950  N N   . VAL F 1 113 ? 105.471 48.536 149.896 1.00 42.58  ? 113 VAL F N   1 
ATOM   7951  C CA  . VAL F 1 113 ? 106.865 48.325 150.291 1.00 42.58  ? 113 VAL F CA  1 
ATOM   7952  C C   . VAL F 1 113 ? 107.323 46.982 149.720 1.00 42.58  ? 113 VAL F C   1 
ATOM   7953  O O   . VAL F 1 113 ? 106.593 45.982 149.787 1.00 42.58  ? 113 VAL F O   1 
ATOM   7954  C CB  . VAL F 1 113 ? 107.040 48.265 151.850 1.00 72.59  ? 113 VAL F CB  1 
ATOM   7955  C CG1 . VAL F 1 113 ? 108.511 48.178 152.194 1.00 72.59  ? 113 VAL F CG1 1 
ATOM   7956  C CG2 . VAL F 1 113 ? 106.417 49.474 152.527 1.00 72.59  ? 113 VAL F CG2 1 
ATOM   7957  N N   . GLN F 1 114 ? 108.540 46.962 149.196 1.00 48.90  ? 114 GLN F N   1 
ATOM   7958  C CA  . GLN F 1 114 ? 109.091 45.755 148.619 1.00 48.90  ? 114 GLN F CA  1 
ATOM   7959  C C   . GLN F 1 114 ? 110.516 45.510 149.104 1.00 48.90  ? 114 GLN F C   1 
ATOM   7960  O O   . GLN F 1 114 ? 111.283 46.461 149.270 1.00 48.90  ? 114 GLN F O   1 
ATOM   7961  C CB  . GLN F 1 114 ? 109.095 45.875 147.099 1.00 71.89  ? 114 GLN F CB  1 
ATOM   7962  C CG  . GLN F 1 114 ? 109.392 44.591 146.384 1.00 71.89  ? 114 GLN F CG  1 
ATOM   7963  C CD  . GLN F 1 114 ? 109.553 44.794 144.902 1.00 71.89  ? 114 GLN F CD  1 
ATOM   7964  O OE1 . GLN F 1 114 ? 110.555 45.334 144.450 1.00 71.89  ? 114 GLN F OE1 1 
ATOM   7965  N NE2 . GLN F 1 114 ? 108.560 44.368 144.133 1.00 71.89  ? 114 GLN F NE2 1 
ATOM   7966  N N   . LEU F 1 115 ? 110.871 44.241 149.332 1.00 61.37  ? 115 LEU F N   1 
ATOM   7967  C CA  . LEU F 1 115 ? 112.228 43.900 149.759 1.00 61.37  ? 115 LEU F CA  1 
ATOM   7968  C C   . LEU F 1 115 ? 112.979 43.528 148.503 1.00 61.37  ? 115 LEU F C   1 
ATOM   7969  O O   . LEU F 1 115 ? 112.374 43.317 147.464 1.00 61.37  ? 115 LEU F O   1 
ATOM   7970  C CB  . LEU F 1 115 ? 112.226 42.731 150.742 1.00 51.61  ? 115 LEU F CB  1 
ATOM   7971  C CG  . LEU F 1 115 ? 111.408 42.980 152.017 1.00 51.61  ? 115 LEU F CG  1 
ATOM   7972  C CD1 . LEU F 1 115 ? 111.370 41.750 152.903 1.00 51.61  ? 115 LEU F CD1 1 
ATOM   7973  C CD2 . LEU F 1 115 ? 112.029 44.143 152.747 1.00 51.61  ? 115 LEU F CD2 1 
ATOM   7974  N N   . LYS F 1 116 ? 114.294 43.451 148.589 1.00 55.88  ? 116 LYS F N   1 
ATOM   7975  C CA  . LYS F 1 116 ? 115.111 43.130 147.431 1.00 55.88  ? 116 LYS F CA  1 
ATOM   7976  C C   . LYS F 1 116 ? 114.818 41.763 146.802 1.00 55.88  ? 116 LYS F C   1 
ATOM   7977  O O   . LYS F 1 116 ? 115.246 41.490 145.680 1.00 55.88  ? 116 LYS F O   1 
ATOM   7978  C CB  . LYS F 1 116 ? 116.585 43.191 147.813 1.00 76.12  ? 116 LYS F CB  1 
ATOM   7979  C CG  . LYS F 1 116 ? 116.958 42.252 148.961 1.00 76.12  ? 116 LYS F CG  1 
ATOM   7980  C CD  . LYS F 1 116 ? 118.465 42.248 149.197 1.00 76.12  ? 116 LYS F CD  1 
ATOM   7981  C CE  . LYS F 1 116 ? 118.892 41.342 150.354 1.00 76.12  ? 116 LYS F CE  1 
ATOM   7982  N NZ  . LYS F 1 116 ? 120.389 41.310 150.470 1.00 76.12  ? 116 LYS F NZ  1 
ATOM   7983  N N   . ASP F 1 117 ? 114.092 40.903 147.512 1.00 97.76  ? 117 ASP F N   1 
ATOM   7984  C CA  . ASP F 1 117 ? 113.801 39.568 146.992 1.00 97.76  ? 117 ASP F CA  1 
ATOM   7985  C C   . ASP F 1 117 ? 112.467 39.449 146.263 1.00 97.76  ? 117 ASP F C   1 
ATOM   7986  O O   . ASP F 1 117 ? 112.124 38.386 145.759 1.00 97.76  ? 117 ASP F O   1 
ATOM   7987  C CB  . ASP F 1 117 ? 113.848 38.550 148.134 1.00 59.08  ? 117 ASP F CB  1 
ATOM   7988  C CG  . ASP F 1 117 ? 112.578 38.541 148.962 1.00 59.08  ? 117 ASP F CG  1 
ATOM   7989  O OD1 . ASP F 1 117 ? 112.053 39.633 149.266 1.00 59.08  ? 117 ASP F OD1 1 
ATOM   7990  O OD2 . ASP F 1 117 ? 112.102 37.437 149.324 1.00 59.08  ? 117 ASP F OD2 1 
ATOM   7991  N N   . GLY F 1 118 ? 111.720 40.542 146.202 1.00 44.93  ? 118 GLY F N   1 
ATOM   7992  C CA  . GLY F 1 118 ? 110.432 40.516 145.547 1.00 44.93  ? 118 GLY F CA  1 
ATOM   7993  C C   . GLY F 1 118 ? 109.297 40.535 146.542 1.00 44.93  ? 118 GLY F C   1 
ATOM   7994  O O   . GLY F 1 118 ? 108.170 40.871 146.203 1.00 44.93  ? 118 GLY F O   1 
ATOM   7995  N N   . SER F 1 119 ? 109.592 40.155 147.775 1.00 50.20  ? 119 SER F N   1 
ATOM   7996  C CA  . SER F 1 119 ? 108.596 40.147 148.841 1.00 50.20  ? 119 SER F CA  1 
ATOM   7997  C C   . SER F 1 119 ? 107.969 41.546 148.925 1.00 50.20  ? 119 SER F C   1 
ATOM   7998  O O   . SER F 1 119 ? 108.640 42.547 148.675 1.00 50.20  ? 119 SER F O   1 
ATOM   7999  C CB  . SER F 1 119 ? 109.286 39.784 150.163 1.00 82.23  ? 119 SER F CB  1 
ATOM   8000  O OG  . SER F 1 119 ? 108.348 39.647 151.214 1.00 82.23  ? 119 SER F OG  1 
ATOM   8001  N N   . TYR F 1 120 ? 106.699 41.636 149.292 1.00 33.59  ? 120 TYR F N   1 
ATOM   8002  C CA  . TYR F 1 120 ? 106.080 42.953 149.348 1.00 33.59  ? 120 TYR F CA  1 
ATOM   8003  C C   . TYR F 1 120 ? 104.801 43.038 150.192 1.00 33.59  ? 120 TYR F C   1 
ATOM   8004  O O   . TYR F 1 120 ? 104.056 42.053 150.314 1.00 33.59  ? 120 TYR F O   1 
ATOM   8005  C CB  . TYR F 1 120 ? 105.767 43.422 147.895 1.00 44.54  ? 120 TYR F CB  1 
ATOM   8006  C CG  . TYR F 1 120 ? 104.691 42.601 147.193 1.00 44.54  ? 120 TYR F CG  1 
ATOM   8007  C CD1 . TYR F 1 120 ? 103.347 42.749 147.517 1.00 44.54  ? 120 TYR F CD1 1 
ATOM   8008  C CD2 . TYR F 1 120 ? 105.043 41.586 146.310 1.00 44.54  ? 120 TYR F CD2 1 
ATOM   8009  C CE1 . TYR F 1 120 ? 102.387 41.900 146.990 1.00 44.54  ? 120 TYR F CE1 1 
ATOM   8010  C CE2 . TYR F 1 120 ? 104.103 40.730 145.785 1.00 44.54  ? 120 TYR F CE2 1 
ATOM   8011  C CZ  . TYR F 1 120 ? 102.778 40.882 146.125 1.00 44.54  ? 120 TYR F CZ  1 
ATOM   8012  O OH  . TYR F 1 120 ? 101.844 39.996 145.627 1.00 44.54  ? 120 TYR F OH  1 
ATOM   8013  N N   . HIS F 1 121 ? 104.555 44.219 150.767 1.00 57.75  ? 121 HIS F N   1 
ATOM   8014  C CA  . HIS F 1 121 ? 103.333 44.473 151.537 1.00 57.75  ? 121 HIS F CA  1 
ATOM   8015  C C   . HIS F 1 121 ? 102.868 45.878 151.143 1.00 57.75  ? 121 HIS F C   1 
ATOM   8016  O O   . HIS F 1 121 ? 103.699 46.752 150.865 1.00 57.75  ? 121 HIS F O   1 
ATOM   8017  C CB  . HIS F 1 121 ? 103.573 44.397 153.049 1.00 54.47  ? 121 HIS F CB  1 
ATOM   8018  C CG  . HIS F 1 121 ? 103.891 43.019 153.548 1.00 54.47  ? 121 HIS F CG  1 
ATOM   8019  N ND1 . HIS F 1 121 ? 105.162 42.634 153.929 1.00 54.47  ? 121 HIS F ND1 1 
ATOM   8020  C CD2 . HIS F 1 121 ? 103.102 41.932 153.722 1.00 54.47  ? 121 HIS F CD2 1 
ATOM   8021  C CE1 . HIS F 1 121 ? 105.139 41.370 154.316 1.00 54.47  ? 121 HIS F CE1 1 
ATOM   8022  N NE2 . HIS F 1 121 ? 103.902 40.921 154.200 1.00 54.47  ? 121 HIS F NE2 1 
ATOM   8023  N N   . GLU F 1 122 ? 101.552 46.089 151.102 1.00 47.90  ? 122 GLU F N   1 
ATOM   8024  C CA  . GLU F 1 122 ? 100.982 47.372 150.710 1.00 47.90  ? 122 GLU F CA  1 
ATOM   8025  C C   . GLU F 1 122 ? 99.835  47.717 151.659 1.00 47.90  ? 122 GLU F C   1 
ATOM   8026  O O   . GLU F 1 122 ? 99.046  46.835 152.018 1.00 47.90  ? 122 GLU F O   1 
ATOM   8027  C CB  . GLU F 1 122 ? 100.472 47.280 149.263 1.00 87.58  ? 122 GLU F CB  1 
ATOM   8028  C CG  . GLU F 1 122 ? 99.500  48.369 148.851 1.00 87.58  ? 122 GLU F CG  1 
ATOM   8029  C CD  . GLU F 1 122 ? 99.066  48.258 147.402 1.00 87.58  ? 122 GLU F CD  1 
ATOM   8030  O OE1 . GLU F 1 122 ? 98.647  47.160 146.989 1.00 87.58  ? 122 GLU F OE1 1 
ATOM   8031  O OE2 . GLU F 1 122 ? 99.137  49.274 146.677 1.00 87.58  ? 122 GLU F OE2 1 
ATOM   8032  N N   . ASP F 1 123 ? 99.738  48.986 152.069 1.00 54.49  ? 123 ASP F N   1 
ATOM   8033  C CA  . ASP F 1 123 ? 98.666  49.399 152.979 1.00 54.49  ? 123 ASP F CA  1 
ATOM   8034  C C   . ASP F 1 123 ? 98.199  50.833 152.723 1.00 54.49  ? 123 ASP F C   1 
ATOM   8035  O O   . ASP F 1 123 ? 98.812  51.544 151.926 1.00 54.49  ? 123 ASP F O   1 
ATOM   8036  C CB  . ASP F 1 123 ? 99.133  49.262 154.431 1.00 75.36  ? 123 ASP F CB  1 
ATOM   8037  C CG  . ASP F 1 123 ? 98.034  48.766 155.352 1.00 75.36  ? 123 ASP F CG  1 
ATOM   8038  O OD1 . ASP F 1 123 ? 96.968  49.410 155.399 1.00 75.36  ? 123 ASP F OD1 1 
ATOM   8039  O OD2 . ASP F 1 123 ? 98.238  47.728 156.025 1.00 75.36  ? 123 ASP F OD2 1 
ATOM   8040  N N   . VAL F 1 124 ? 97.115  51.247 153.391 1.00 60.25  ? 124 VAL F N   1 
ATOM   8041  C CA  . VAL F 1 124 ? 96.575  52.602 153.234 1.00 60.25  ? 124 VAL F CA  1 
ATOM   8042  C C   . VAL F 1 124 ? 97.105  53.504 154.319 1.00 60.25  ? 124 VAL F C   1 
ATOM   8043  O O   . VAL F 1 124 ? 97.273  53.083 155.454 1.00 60.25  ? 124 VAL F O   1 
ATOM   8044  C CB  . VAL F 1 124 ? 95.051  52.702 153.422 1.00 52.03  ? 124 VAL F CB  1 
ATOM   8045  C CG1 . VAL F 1 124 ? 94.487  53.669 152.436 1.00 52.03  ? 124 VAL F CG1 1 
ATOM   8046  C CG2 . VAL F 1 124 ? 94.407  51.385 153.318 1.00 52.03  ? 124 VAL F CG2 1 
ATOM   8047  N N   . GLY F 1 125 ? 97.349  54.754 153.978 1.00 82.02  ? 125 GLY F N   1 
ATOM   8048  C CA  . GLY F 1 125 ? 97.797  55.701 154.974 1.00 82.02  ? 125 GLY F CA  1 
ATOM   8049  C C   . GLY F 1 125 ? 96.715  56.761 154.943 1.00 82.02  ? 125 GLY F C   1 
ATOM   8050  O O   . GLY F 1 125 ? 95.954  56.802 153.977 1.00 82.02  ? 125 GLY F O   1 
ATOM   8051  N N   . TYR F 1 126 ? 96.601  57.587 155.979 1.00 89.30  ? 126 TYR F N   1 
ATOM   8052  C CA  . TYR F 1 126 ? 95.599  58.648 155.966 1.00 89.30  ? 126 TYR F CA  1 
ATOM   8053  C C   . TYR F 1 126 ? 96.177  59.926 156.554 1.00 89.30  ? 126 TYR F C   1 
ATOM   8054  O O   . TYR F 1 126 ? 96.831  59.899 157.591 1.00 89.30  ? 126 TYR F O   1 
ATOM   8055  C CB  . TYR F 1 126 ? 94.346  58.252 156.743 1.00 82.59  ? 126 TYR F CB  1 
ATOM   8056  C CG  . TYR F 1 126 ? 93.109  58.905 156.181 1.00 82.59  ? 126 TYR F CG  1 
ATOM   8057  C CD1 . TYR F 1 126 ? 92.489  58.395 155.044 1.00 82.59  ? 126 TYR F CD1 1 
ATOM   8058  C CD2 . TYR F 1 126 ? 92.600  60.070 156.735 1.00 82.59  ? 126 TYR F CD2 1 
ATOM   8059  C CE1 . TYR F 1 126 ? 91.396  59.027 154.470 1.00 82.59  ? 126 TYR F CE1 1 
ATOM   8060  C CE2 . TYR F 1 126 ? 91.503  60.718 156.169 1.00 82.59  ? 126 TYR F CE2 1 
ATOM   8061  C CZ  . TYR F 1 126 ? 90.908  60.189 155.037 1.00 82.59  ? 126 TYR F CZ  1 
ATOM   8062  O OH  . TYR F 1 126 ? 89.822  60.821 154.476 1.00 82.59  ? 126 TYR F OH  1 
ATOM   8063  N N   . GLY F 1 127 ? 95.953  61.041 155.870 1.00 79.85  ? 127 GLY F N   1 
ATOM   8064  C CA  . GLY F 1 127 ? 96.453  62.318 156.344 1.00 79.85  ? 127 GLY F CA  1 
ATOM   8065  C C   . GLY F 1 127 ? 95.274  63.199 156.700 1.00 79.85  ? 127 GLY F C   1 
ATOM   8066  O O   . GLY F 1 127 ? 94.220  63.105 156.070 1.00 79.85  ? 127 GLY F O   1 
ATOM   8067  N N   . VAL F 1 128 ? 95.428  64.047 157.713 1.00 76.17  ? 128 VAL F N   1 
ATOM   8068  C CA  . VAL F 1 128 ? 94.336  64.925 158.111 1.00 76.17  ? 128 VAL F CA  1 
ATOM   8069  C C   . VAL F 1 128 ? 94.814  66.304 158.542 1.00 76.17  ? 128 VAL F C   1 
ATOM   8070  O O   . VAL F 1 128 ? 95.922  66.461 159.044 1.00 76.17  ? 128 VAL F O   1 
ATOM   8071  C CB  . VAL F 1 128 ? 93.535  64.323 159.270 1.00 68.97  ? 128 VAL F CB  1 
ATOM   8072  C CG1 . VAL F 1 128 ? 92.270  65.113 159.471 1.00 68.97  ? 128 VAL F CG1 1 
ATOM   8073  C CG2 . VAL F 1 128 ? 93.200  62.874 158.992 1.00 68.97  ? 128 VAL F CG2 1 
ATOM   8074  N N   . SER F 1 129 ? 93.966  67.300 158.328 1.00 72.39  ? 129 SER F N   1 
ATOM   8075  C CA  . SER F 1 129 ? 94.235  68.689 158.709 1.00 72.39  ? 129 SER F CA  1 
ATOM   8076  C C   . SER F 1 129 ? 92.861  69.308 158.931 1.00 72.39  ? 129 SER F C   1 
ATOM   8077  O O   . SER F 1 129 ? 92.075  69.436 157.988 1.00 72.39  ? 129 SER F O   1 
ATOM   8078  C CB  . SER F 1 129 ? 94.954  69.442 157.596 1.00 77.65  ? 129 SER F CB  1 
ATOM   8079  O OG  . SER F 1 129 ? 95.086  70.810 157.942 1.00 77.65  ? 129 SER F OG  1 
ATOM   8080  N N   . GLU F 1 130 ? 92.559  69.697 160.164 1.00 115.08 ? 130 GLU F N   1 
ATOM   8081  C CA  . GLU F 1 130 ? 91.237  70.243 160.436 1.00 115.08 ? 130 GLU F CA  1 
ATOM   8082  C C   . GLU F 1 130 ? 91.164  71.661 160.988 1.00 115.08 ? 130 GLU F C   1 
ATOM   8083  O O   . GLU F 1 130 ? 90.073  72.189 161.200 1.00 115.08 ? 130 GLU F O   1 
ATOM   8084  C CB  . GLU F 1 130 ? 90.480  69.298 161.373 1.00 107.06 ? 130 GLU F CB  1 
ATOM   8085  C CG  . GLU F 1 130 ? 90.578  67.833 160.978 1.00 107.06 ? 130 GLU F CG  1 
ATOM   8086  C CD  . GLU F 1 130 ? 89.417  67.001 161.498 1.00 107.06 ? 130 GLU F CD  1 
ATOM   8087  O OE1 . GLU F 1 130 ? 88.290  67.175 160.989 1.00 107.06 ? 130 GLU F OE1 1 
ATOM   8088  O OE2 . GLU F 1 130 ? 89.627  66.174 162.412 1.00 107.06 ? 130 GLU F OE2 1 
ATOM   8089  N N   . GLY F 1 131 ? 92.304  72.295 161.213 1.00 91.28  ? 131 GLY F N   1 
ATOM   8090  C CA  . GLY F 1 131 ? 92.249  73.637 161.752 1.00 91.28  ? 131 GLY F CA  1 
ATOM   8091  C C   . GLY F 1 131 ? 92.577  74.735 160.762 1.00 91.28  ? 131 GLY F C   1 
ATOM   8092  O O   . GLY F 1 131 ? 91.709  75.508 160.358 1.00 91.28  ? 131 GLY F O   1 
ATOM   8093  N N   . LEU F 1 132 ? 93.850  74.788 160.383 1.00 96.57  ? 132 LEU F N   1 
ATOM   8094  C CA  . LEU F 1 132 ? 94.407  75.781 159.469 1.00 96.57  ? 132 LEU F CA  1 
ATOM   8095  C C   . LEU F 1 132 ? 93.461  76.627 158.625 1.00 96.57  ? 132 LEU F C   1 
ATOM   8096  O O   . LEU F 1 132 ? 92.402  76.175 158.189 1.00 96.57  ? 132 LEU F O   1 
ATOM   8097  C CB  . LEU F 1 132 ? 95.430  75.101 158.566 1.00 126.95 ? 132 LEU F CB  1 
ATOM   8098  C CG  . LEU F 1 132 ? 96.613  74.510 159.336 1.00 126.95 ? 132 LEU F CG  1 
ATOM   8099  C CD1 . LEU F 1 132 ? 97.445  73.655 158.409 1.00 126.95 ? 132 LEU F CD1 1 
ATOM   8100  C CD2 . LEU F 1 132 ? 97.452  75.629 159.932 1.00 126.95 ? 132 LEU F CD2 1 
ATOM   8101  N N   . LYS F 1 133 ? 93.872  77.873 158.409 1.00 95.08  ? 133 LYS F N   1 
ATOM   8102  C CA  . LYS F 1 133 ? 93.112  78.823 157.612 1.00 95.08  ? 133 LYS F CA  1 
ATOM   8103  C C   . LYS F 1 133 ? 93.683  78.779 156.204 1.00 95.08  ? 133 LYS F C   1 
ATOM   8104  O O   . LYS F 1 133 ? 93.047  79.224 155.251 1.00 95.08  ? 133 LYS F O   1 
ATOM   8105  C CB  . LYS F 1 133 ? 93.255  80.241 158.180 1.00 182.25 ? 133 LYS F CB  1 
ATOM   8106  C CG  . LYS F 1 133 ? 92.632  80.443 159.556 1.00 182.25 ? 133 LYS F CG  1 
ATOM   8107  C CD  . LYS F 1 133 ? 92.914  81.840 160.107 1.00 182.25 ? 133 LYS F CD  1 
ATOM   8108  C CE  . LYS F 1 133 ? 92.318  82.933 159.230 1.00 182.25 ? 133 LYS F CE  1 
ATOM   8109  N NZ  . LYS F 1 133 ? 90.832  82.854 159.153 1.00 182.25 ? 133 LYS F NZ  1 
ATOM   8110  N N   . SER F 1 134 ? 94.893  78.243 156.078 1.00 92.50  ? 134 SER F N   1 
ATOM   8111  C CA  . SER F 1 134 ? 95.535  78.141 154.774 1.00 92.50  ? 134 SER F CA  1 
ATOM   8112  C C   . SER F 1 134 ? 95.159  76.839 154.100 1.00 92.50  ? 134 SER F C   1 
ATOM   8113  O O   . SER F 1 134 ? 95.271  75.764 154.689 1.00 92.50  ? 134 SER F O   1 
ATOM   8114  C CB  . SER F 1 134 ? 97.056  78.208 154.897 1.00 51.85  ? 134 SER F CB  1 
ATOM   8115  O OG  . SER F 1 134 ? 97.644  78.022 153.620 1.00 51.85  ? 134 SER F OG  1 
ATOM   8116  N N   . LYS F 1 135 ? 94.704  76.937 152.858 1.00 71.10  ? 135 LYS F N   1 
ATOM   8117  C CA  . LYS F 1 135 ? 94.325  75.747 152.122 1.00 71.10  ? 135 LYS F CA  1 
ATOM   8118  C C   . LYS F 1 135 ? 95.612  75.017 151.783 1.00 71.10  ? 135 LYS F C   1 
ATOM   8119  O O   . LYS F 1 135 ? 95.737  73.830 152.045 1.00 71.10  ? 135 LYS F O   1 
ATOM   8120  C CB  . LYS F 1 135 ? 93.553  76.118 150.851 1.00 85.32  ? 135 LYS F CB  1 
ATOM   8121  C CG  . LYS F 1 135 ? 93.068  74.916 150.071 1.00 85.32  ? 135 LYS F CG  1 
ATOM   8122  C CD  . LYS F 1 135 ? 91.774  75.185 149.310 1.00 85.32  ? 135 LYS F CD  1 
ATOM   8123  C CE  . LYS F 1 135 ? 91.962  76.149 148.159 1.00 85.32  ? 135 LYS F CE  1 
ATOM   8124  N NZ  . LYS F 1 135 ? 90.700  76.301 147.379 1.00 85.32  ? 135 LYS F NZ  1 
ATOM   8125  N N   . ALA F 1 136 ? 96.586  75.740 151.243 1.00 61.96  ? 136 ALA F N   1 
ATOM   8126  C CA  . ALA F 1 136 ? 97.858  75.132 150.870 1.00 61.96  ? 136 ALA F CA  1 
ATOM   8127  C C   . ALA F 1 136 ? 98.426  74.321 152.018 1.00 61.96  ? 136 ALA F C   1 
ATOM   8128  O O   . ALA F 1 136 ? 98.685  73.125 151.883 1.00 61.96  ? 136 ALA F O   1 
ATOM   8129  C CB  . ALA F 1 136 ? 98.870  76.199 150.439 1.00 43.55  ? 136 ALA F CB  1 
ATOM   8130  N N   . LEU F 1 137 ? 98.619  74.968 153.155 1.00 68.79  ? 137 LEU F N   1 
ATOM   8131  C CA  . LEU F 1 137 ? 99.170  74.277 154.303 1.00 68.79  ? 137 LEU F CA  1 
ATOM   8132  C C   . LEU F 1 137 ? 98.322  73.094 154.758 1.00 68.79  ? 137 LEU F C   1 
ATOM   8133  O O   . LEU F 1 137 ? 98.852  72.092 155.234 1.00 68.79  ? 137 LEU F O   1 
ATOM   8134  C CB  . LEU F 1 137 ? 99.367  75.262 155.452 1.00 90.51  ? 137 LEU F CB  1 
ATOM   8135  C CG  . LEU F 1 137 ? 100.703 76.011 155.426 1.00 90.51  ? 137 LEU F CG  1 
ATOM   8136  C CD1 . LEU F 1 137 ? 100.967 76.654 154.061 1.00 90.51  ? 137 LEU F CD1 1 
ATOM   8137  C CD2 . LEU F 1 137 ? 100.677 77.051 156.533 1.00 90.51  ? 137 LEU F CD2 1 
ATOM   8138  N N   . SER F 1 138 ? 97.010  73.196 154.612 1.00 54.89  ? 138 SER F N   1 
ATOM   8139  C CA  . SER F 1 138 ? 96.154  72.105 155.029 1.00 54.89  ? 138 SER F CA  1 
ATOM   8140  C C   . SER F 1 138 ? 96.363  70.862 154.162 1.00 54.89  ? 138 SER F C   1 
ATOM   8141  O O   . SER F 1 138 ? 96.377  69.737 154.676 1.00 54.89  ? 138 SER F O   1 
ATOM   8142  C CB  . SER F 1 138 ? 94.694  72.541 154.982 1.00 80.89  ? 138 SER F CB  1 
ATOM   8143  O OG  . SER F 1 138 ? 94.409  73.439 156.037 1.00 80.89  ? 138 SER F OG  1 
ATOM   8144  N N   . LEU F 1 139 ? 96.518  71.068 152.854 1.00 74.22  ? 139 LEU F N   1 
ATOM   8145  C CA  . LEU F 1 139 ? 96.740  69.972 151.923 1.00 74.22  ? 139 LEU F CA  1 
ATOM   8146  C C   . LEU F 1 139 ? 98.134  69.396 152.117 1.00 74.22  ? 139 LEU F C   1 
ATOM   8147  O O   . LEU F 1 139 ? 98.296  68.188 152.263 1.00 74.22  ? 139 LEU F O   1 
ATOM   8148  C CB  . LEU F 1 139 ? 96.576  70.453 150.486 1.00 59.95  ? 139 LEU F CB  1 
ATOM   8149  C CG  . LEU F 1 139 ? 95.143  70.731 150.032 1.00 59.95  ? 139 LEU F CG  1 
ATOM   8150  C CD1 . LEU F 1 139 ? 95.187  71.342 148.653 1.00 59.95  ? 139 LEU F CD1 1 
ATOM   8151  C CD2 . LEU F 1 139 ? 94.312  69.445 150.032 1.00 59.95  ? 139 LEU F CD2 1 
ATOM   8152  N N   . GLU F 1 140 ? 99.143  70.255 152.122 1.00 60.61  ? 140 GLU F N   1 
ATOM   8153  C CA  . GLU F 1 140 ? 100.513 69.785 152.318 1.00 60.61  ? 140 GLU F CA  1 
ATOM   8154  C C   . GLU F 1 140 ? 100.602 68.841 153.517 1.00 60.61  ? 140 GLU F C   1 
ATOM   8155  O O   . GLU F 1 140 ? 101.244 67.793 153.458 1.00 60.61  ? 140 GLU F O   1 
ATOM   8156  C CB  . GLU F 1 140 ? 101.456 70.963 152.555 1.00 78.26  ? 140 GLU F CB  1 
ATOM   8157  C CG  . GLU F 1 140 ? 102.839 70.549 153.031 1.00 78.26  ? 140 GLU F CG  1 
ATOM   8158  C CD  . GLU F 1 140 ? 103.771 71.727 153.185 1.00 78.26  ? 140 GLU F CD  1 
ATOM   8159  O OE1 . GLU F 1 140 ? 103.345 72.736 153.792 1.00 78.26  ? 140 GLU F OE1 1 
ATOM   8160  O OE2 . GLU F 1 140 ? 104.925 71.640 152.705 1.00 78.26  ? 140 GLU F OE2 1 
ATOM   8161  N N   . LYS F 1 141 ? 99.952  69.222 154.605 1.00 68.11  ? 141 LYS F N   1 
ATOM   8162  C CA  . LYS F 1 141 ? 99.974  68.427 155.817 1.00 68.11  ? 141 LYS F CA  1 
ATOM   8163  C C   . LYS F 1 141 ? 99.295  67.072 155.622 1.00 68.11  ? 141 LYS F C   1 
ATOM   8164  O O   . LYS F 1 141 ? 99.836  66.035 155.999 1.00 68.11  ? 141 LYS F O   1 
ATOM   8165  C CB  . LYS F 1 141 ? 99.289  69.201 156.940 1.00 71.82  ? 141 LYS F CB  1 
ATOM   8166  C CG  . LYS F 1 141 ? 99.628  68.731 158.335 1.00 71.82  ? 141 LYS F CG  1 
ATOM   8167  C CD  . LYS F 1 141 ? 98.409  68.171 159.031 1.00 71.82  ? 141 LYS F CD  1 
ATOM   8168  C CE  . LYS F 1 141 ? 98.680  67.938 160.510 1.00 71.82  ? 141 LYS F CE  1 
ATOM   8169  N NZ  . LYS F 1 141 ? 97.609  67.127 161.173 1.00 71.82  ? 141 LYS F NZ  1 
ATOM   8170  N N   . ALA F 1 142 ? 98.113  67.085 155.020 1.00 88.53  ? 142 ALA F N   1 
ATOM   8171  C CA  . ALA F 1 142 ? 97.354  65.864 154.789 1.00 88.53  ? 142 ALA F CA  1 
ATOM   8172  C C   . ALA F 1 142 ? 97.988  64.923 153.766 1.00 88.53  ? 142 ALA F C   1 
ATOM   8173  O O   . ALA F 1 142 ? 97.968  63.705 153.946 1.00 88.53  ? 142 ALA F O   1 
ATOM   8174  C CB  . ALA F 1 142 ? 95.954  66.225 154.357 1.00 31.30  ? 142 ALA F CB  1 
ATOM   8175  N N   . ARG F 1 143 ? 98.543  65.484 152.696 1.00 81.94  ? 143 ARG F N   1 
ATOM   8176  C CA  . ARG F 1 143 ? 99.168  64.675 151.657 1.00 81.94  ? 143 ARG F CA  1 
ATOM   8177  C C   . ARG F 1 143 ? 100.441 64.020 152.169 1.00 81.94  ? 143 ARG F C   1 
ATOM   8178  O O   . ARG F 1 143 ? 100.668 62.835 151.951 1.00 81.94  ? 143 ARG F O   1 
ATOM   8179  C CB  . ARG F 1 143 ? 99.502  65.517 150.412 1.00 72.60  ? 143 ARG F CB  1 
ATOM   8180  C CG  . ARG F 1 143 ? 98.318  66.250 149.811 1.00 72.60  ? 143 ARG F CG  1 
ATOM   8181  C CD  . ARG F 1 143 ? 98.551  66.664 148.363 1.00 72.60  ? 143 ARG F CD  1 
ATOM   8182  N NE  . ARG F 1 143 ? 98.114  65.617 147.449 1.00 72.60  ? 143 ARG F NE  1 
ATOM   8183  C CZ  . ARG F 1 143 ? 97.321  65.811 146.402 1.00 72.60  ? 143 ARG F CZ  1 
ATOM   8184  N NH1 . ARG F 1 143 ? 96.870  67.018 146.121 1.00 72.60  ? 143 ARG F NH1 1 
ATOM   8185  N NH2 . ARG F 1 143 ? 96.968  64.788 145.640 1.00 72.60  ? 143 ARG F NH2 1 
ATOM   8186  N N   . LYS F 1 144 ? 101.279 64.788 152.849 1.00 59.97  ? 144 LYS F N   1 
ATOM   8187  C CA  . LYS F 1 144 ? 102.518 64.227 153.365 1.00 59.97  ? 144 LYS F CA  1 
ATOM   8188  C C   . LYS F 1 144 ? 102.266 63.173 154.429 1.00 59.97  ? 144 LYS F C   1 
ATOM   8189  O O   . LYS F 1 144 ? 102.859 62.097 154.389 1.00 59.97  ? 144 LYS F O   1 
ATOM   8190  C CB  . LYS F 1 144 ? 103.405 65.333 153.909 1.00 47.66  ? 144 LYS F CB  1 
ATOM   8191  C CG  . LYS F 1 144 ? 103.801 66.315 152.840 1.00 47.66  ? 144 LYS F CG  1 
ATOM   8192  C CD  . LYS F 1 144 ? 104.966 67.189 153.255 1.00 47.66  ? 144 LYS F CD  1 
ATOM   8193  C CE  . LYS F 1 144 ? 105.427 68.052 152.089 1.00 47.66  ? 144 LYS F CE  1 
ATOM   8194  N NZ  . LYS F 1 144 ? 106.672 68.785 152.423 1.00 47.66  ? 144 LYS F NZ  1 
ATOM   8195  N N   . GLU F 1 145 ? 101.376 63.482 155.367 1.00 96.05  ? 145 GLU F N   1 
ATOM   8196  C CA  . GLU F 1 145 ? 101.038 62.555 156.437 1.00 96.05  ? 145 GLU F CA  1 
ATOM   8197  C C   . GLU F 1 145 ? 100.435 61.258 155.927 1.00 96.05  ? 145 GLU F C   1 
ATOM   8198  O O   . GLU F 1 145 ? 100.811 60.179 156.381 1.00 96.05  ? 145 GLU F O   1 
ATOM   8199  C CB  . GLU F 1 145 ? 100.082 63.214 157.423 1.00 110.17 ? 145 GLU F CB  1 
ATOM   8200  C CG  . GLU F 1 145 ? 100.804 63.798 158.607 1.00 110.17 ? 145 GLU F CG  1 
ATOM   8201  C CD  . GLU F 1 145 ? 99.934  64.700 159.440 1.00 110.17 ? 145 GLU F CD  1 
ATOM   8202  O OE1 . GLU F 1 145 ? 98.790  64.304 159.757 1.00 110.17 ? 145 GLU F OE1 1 
ATOM   8203  O OE2 . GLU F 1 145 ? 100.411 65.803 159.782 1.00 110.17 ? 145 GLU F OE2 1 
ATOM   8204  N N   . ALA F 1 146 ? 99.497  61.354 154.991 1.00 64.55  ? 146 ALA F N   1 
ATOM   8205  C CA  . ALA F 1 146 ? 98.886  60.150 154.444 1.00 64.55  ? 146 ALA F CA  1 
ATOM   8206  C C   . ALA F 1 146 ? 99.971  59.193 153.928 1.00 64.55  ? 146 ALA F C   1 
ATOM   8207  O O   . ALA F 1 146 ? 99.903  57.994 154.181 1.00 64.55  ? 146 ALA F O   1 
ATOM   8208  C CB  . ALA F 1 146 ? 97.892  60.510 153.324 1.00 57.82  ? 146 ALA F CB  1 
ATOM   8209  N N   . VAL F 1 147 ? 100.975 59.720 153.230 1.00 54.25  ? 147 VAL F N   1 
ATOM   8210  C CA  . VAL F 1 147 ? 102.047 58.880 152.711 1.00 54.25  ? 147 VAL F CA  1 
ATOM   8211  C C   . VAL F 1 147 ? 102.818 58.229 153.843 1.00 54.25  ? 147 VAL F C   1 
ATOM   8212  O O   . VAL F 1 147 ? 102.872 57.008 153.939 1.00 54.25  ? 147 VAL F O   1 
ATOM   8213  C CB  . VAL F 1 147 ? 103.039 59.677 151.821 1.00 46.70  ? 147 VAL F CB  1 
ATOM   8214  C CG1 . VAL F 1 147 ? 104.364 58.900 151.652 1.00 46.70  ? 147 VAL F CG1 1 
ATOM   8215  C CG2 . VAL F 1 147 ? 102.414 59.904 150.460 1.00 46.70  ? 147 VAL F CG2 1 
ATOM   8216  N N   . THR F 1 148 ? 103.413 59.034 154.711 1.00 54.04  ? 148 THR F N   1 
ATOM   8217  C CA  . THR F 1 148 ? 104.167 58.472 155.808 1.00 54.04  ? 148 THR F CA  1 
ATOM   8218  C C   . THR F 1 148 ? 103.310 57.481 156.597 1.00 54.04  ? 148 THR F C   1 
ATOM   8219  O O   . THR F 1 148 ? 103.785 56.426 156.987 1.00 54.04  ? 148 THR F O   1 
ATOM   8220  C CB  . THR F 1 148 ? 104.678 59.571 156.732 1.00 89.66  ? 148 THR F CB  1 
ATOM   8221  O OG1 . THR F 1 148 ? 105.481 60.485 155.976 1.00 89.66  ? 148 THR F OG1 1 
ATOM   8222  C CG2 . THR F 1 148 ? 105.522 58.975 157.842 1.00 89.66  ? 148 THR F CG2 1 
ATOM   8223  N N   . ASP F 1 149 ? 102.045 57.802 156.819 1.00 61.55  ? 149 ASP F N   1 
ATOM   8224  C CA  . ASP F 1 149 ? 101.180 56.892 157.562 1.00 61.55  ? 149 ASP F CA  1 
ATOM   8225  C C   . ASP F 1 149 ? 101.033 55.587 156.800 1.00 61.55  ? 149 ASP F C   1 
ATOM   8226  O O   . ASP F 1 149 ? 100.899 54.515 157.397 1.00 61.55  ? 149 ASP F O   1 
ATOM   8227  C CB  . ASP F 1 149 ? 99.798  57.503 157.772 1.00 78.51  ? 149 ASP F CB  1 
ATOM   8228  C CG  . ASP F 1 149 ? 98.917  56.654 158.680 1.00 78.51  ? 149 ASP F CG  1 
ATOM   8229  O OD1 . ASP F 1 149 ? 99.366  56.293 159.789 1.00 78.51  ? 149 ASP F OD1 1 
ATOM   8230  O OD2 . ASP F 1 149 ? 97.771  56.353 158.291 1.00 78.51  ? 149 ASP F OD2 1 
ATOM   8231  N N   . GLY F 1 150 ? 101.044 55.686 155.475 1.00 92.51  ? 150 GLY F N   1 
ATOM   8232  C CA  . GLY F 1 150 ? 100.923 54.504 154.646 1.00 92.51  ? 150 GLY F CA  1 
ATOM   8233  C C   . GLY F 1 150 ? 102.176 53.652 154.722 1.00 92.51  ? 150 GLY F C   1 
ATOM   8234  O O   . GLY F 1 150 ? 102.091 52.444 154.933 1.00 92.51  ? 150 GLY F O   1 
ATOM   8235  N N   . LEU F 1 151 ? 103.340 54.278 154.556 1.00 59.38  ? 151 LEU F N   1 
ATOM   8236  C CA  . LEU F 1 151 ? 104.603 53.560 154.610 1.00 59.38  ? 151 LEU F CA  1 
ATOM   8237  C C   . LEU F 1 151 ? 104.776 52.844 155.945 1.00 59.38  ? 151 LEU F C   1 
ATOM   8238  O O   . LEU F 1 151 ? 105.283 51.722 156.001 1.00 59.38  ? 151 LEU F O   1 
ATOM   8239  C CB  . LEU F 1 151 ? 105.768 54.517 154.395 1.00 33.21  ? 151 LEU F CB  1 
ATOM   8240  C CG  . LEU F 1 151 ? 107.180 53.969 154.704 1.00 33.21  ? 151 LEU F CG  1 
ATOM   8241  C CD1 . LEU F 1 151 ? 107.446 52.637 154.015 1.00 33.21  ? 151 LEU F CD1 1 
ATOM   8242  C CD2 . LEU F 1 151 ? 108.215 54.980 154.219 1.00 33.21  ? 151 LEU F CD2 1 
ATOM   8243  N N   . LYS F 1 152 ? 104.363 53.486 157.031 1.00 74.99  ? 152 LYS F N   1 
ATOM   8244  C CA  . LYS F 1 152 ? 104.497 52.851 158.329 1.00 74.99  ? 152 LYS F CA  1 
ATOM   8245  C C   . LYS F 1 152 ? 103.601 51.614 158.417 1.00 74.99  ? 152 LYS F C   1 
ATOM   8246  O O   . LYS F 1 152 ? 104.065 50.533 158.760 1.00 74.99  ? 152 LYS F O   1 
ATOM   8247  C CB  . LYS F 1 152 ? 104.166 53.838 159.458 1.00 96.30  ? 152 LYS F CB  1 
ATOM   8248  C CG  . LYS F 1 152 ? 105.209 54.938 159.660 1.00 96.30  ? 152 LYS F CG  1 
ATOM   8249  C CD  . LYS F 1 152 ? 104.992 55.714 160.968 1.00 96.30  ? 152 LYS F CD  1 
ATOM   8250  C CE  . LYS F 1 152 ? 103.620 56.376 161.032 1.00 96.30  ? 152 LYS F CE  1 
ATOM   8251  N NZ  . LYS F 1 152 ? 103.429 57.171 162.273 1.00 96.30  ? 152 LYS F NZ  1 
ATOM   8252  N N   . ARG F 1 153 ? 102.322 51.767 158.099 1.00 64.71  ? 153 ARG F N   1 
ATOM   8253  C CA  . ARG F 1 153 ? 101.389 50.645 158.162 1.00 64.71  ? 153 ARG F CA  1 
ATOM   8254  C C   . ARG F 1 153 ? 101.828 49.486 157.273 1.00 64.71  ? 153 ARG F C   1 
ATOM   8255  O O   . ARG F 1 153 ? 101.490 48.321 157.535 1.00 64.71  ? 153 ARG F O   1 
ATOM   8256  C CB  . ARG F 1 153 ? 99.981  51.089 157.748 1.00 66.56  ? 153 ARG F CB  1 
ATOM   8257  C CG  . ARG F 1 153 ? 99.211  51.788 158.838 1.00 66.56  ? 153 ARG F CG  1 
ATOM   8258  C CD  . ARG F 1 153 ? 97.974  52.457 158.285 1.00 66.56  ? 153 ARG F CD  1 
ATOM   8259  N NE  . ARG F 1 153 ? 96.996  51.505 157.775 1.00 66.56  ? 153 ARG F NE  1 
ATOM   8260  C CZ  . ARG F 1 153 ? 96.201  50.775 158.547 1.00 66.56  ? 153 ARG F CZ  1 
ATOM   8261  N NH1 . ARG F 1 153 ? 96.281  50.896 159.863 1.00 66.56  ? 153 ARG F NH1 1 
ATOM   8262  N NH2 . ARG F 1 153 ? 95.319  49.938 158.008 1.00 66.56  ? 153 ARG F NH2 1 
ATOM   8263  N N   . ALA F 1 154 ? 102.586 49.811 156.227 1.00 64.05  ? 154 ALA F N   1 
ATOM   8264  C CA  . ALA F 1 154 ? 103.058 48.808 155.282 1.00 64.05  ? 154 ALA F CA  1 
ATOM   8265  C C   . ALA F 1 154 ? 104.179 47.990 155.883 1.00 64.05  ? 154 ALA F C   1 
ATOM   8266  O O   . ALA F 1 154 ? 104.153 46.761 155.831 1.00 64.05  ? 154 ALA F O   1 
ATOM   8267  C CB  . ALA F 1 154 ? 103.530 49.480 153.996 1.00 30.15  ? 154 ALA F CB  1 
ATOM   8268  N N   . LEU F 1 155 ? 105.169 48.673 156.448 1.00 63.07  ? 155 LEU F N   1 
ATOM   8269  C CA  . LEU F 1 155 ? 106.290 47.988 157.062 1.00 63.07  ? 155 LEU F CA  1 
ATOM   8270  C C   . LEU F 1 155 ? 105.877 47.193 158.302 1.00 63.07  ? 155 LEU F C   1 
ATOM   8271  O O   . LEU F 1 155 ? 106.553 46.222 158.663 1.00 63.07  ? 155 LEU F O   1 
ATOM   8272  C CB  . LEU F 1 155 ? 107.355 48.978 157.443 1.00 35.14  ? 155 LEU F CB  1 
ATOM   8273  C CG  . LEU F 1 155 ? 108.078 49.662 156.299 1.00 35.14  ? 155 LEU F CG  1 
ATOM   8274  C CD1 . LEU F 1 155 ? 108.690 50.952 156.850 1.00 35.14  ? 155 LEU F CD1 1 
ATOM   8275  C CD2 . LEU F 1 155 ? 109.163 48.772 155.702 1.00 35.14  ? 155 LEU F CD2 1 
ATOM   8276  N N   . ARG F 1 156 ? 104.781 47.593 158.954 1.00 79.59  ? 156 ARG F N   1 
ATOM   8277  C CA  . ARG F 1 156 ? 104.305 46.879 160.143 1.00 79.59  ? 156 ARG F CA  1 
ATOM   8278  C C   . ARG F 1 156 ? 104.076 45.423 159.802 1.00 79.59  ? 156 ARG F C   1 
ATOM   8279  O O   . ARG F 1 156 ? 104.236 44.542 160.643 1.00 79.59  ? 156 ARG F O   1 
ATOM   8280  C CB  . ARG F 1 156 ? 102.975 47.434 160.658 1.00 75.21  ? 156 ARG F CB  1 
ATOM   8281  C CG  . ARG F 1 156 ? 103.045 48.749 161.394 1.00 75.21  ? 156 ARG F CG  1 
ATOM   8282  C CD  . ARG F 1 156 ? 101.681 49.032 162.004 1.00 75.21  ? 156 ARG F CD  1 
ATOM   8283  N NE  . ARG F 1 156 ? 101.439 50.462 162.221 1.00 75.21  ? 156 ARG F NE  1 
ATOM   8284  C CZ  . ARG F 1 156 ? 100.249 50.978 162.535 1.00 75.21  ? 156 ARG F CZ  1 
ATOM   8285  N NH1 . ARG F 1 156 ? 99.194  50.186 162.674 1.00 75.21  ? 156 ARG F NH1 1 
ATOM   8286  N NH2 . ARG F 1 156 ? 100.102 52.285 162.692 1.00 75.21  ? 156 ARG F NH2 1 
ATOM   8287  N N   . SER F 1 157 ? 103.685 45.179 158.560 1.00 95.42  ? 157 SER F N   1 
ATOM   8288  C CA  . SER F 1 157 ? 103.404 43.831 158.104 1.00 95.42  ? 157 SER F CA  1 
ATOM   8289  C C   . SER F 1 157 ? 104.595 42.897 158.212 1.00 95.42  ? 157 SER F C   1 
ATOM   8290  O O   . SER F 1 157 ? 104.419 41.686 158.319 1.00 95.42  ? 157 SER F O   1 
ATOM   8291  C CB  . SER F 1 157 ? 102.896 43.879 156.670 1.00 74.14  ? 157 SER F CB  1 
ATOM   8292  O OG  . SER F 1 157 ? 101.697 44.635 156.603 1.00 74.14  ? 157 SER F OG  1 
ATOM   8293  N N   . PHE F 1 158 ? 105.803 43.452 158.204 1.00 77.06  ? 158 PHE F N   1 
ATOM   8294  C CA  . PHE F 1 158 ? 106.998 42.625 158.301 1.00 77.06  ? 158 PHE F CA  1 
ATOM   8295  C C   . PHE F 1 158 ? 107.302 42.061 159.690 1.00 77.06  ? 158 PHE F C   1 
ATOM   8296  O O   . PHE F 1 158 ? 108.112 41.144 159.818 1.00 77.06  ? 158 PHE F O   1 
ATOM   8297  C CB  . PHE F 1 158 ? 108.207 43.389 157.766 1.00 102.20 ? 158 PHE F CB  1 
ATOM   8298  C CG  . PHE F 1 158 ? 108.223 43.507 156.269 1.00 102.20 ? 158 PHE F CG  1 
ATOM   8299  C CD1 . PHE F 1 158 ? 108.138 44.746 155.653 1.00 102.20 ? 158 PHE F CD1 1 
ATOM   8300  C CD2 . PHE F 1 158 ? 108.308 42.369 155.473 1.00 102.20 ? 158 PHE F CD2 1 
ATOM   8301  C CE1 . PHE F 1 158 ? 108.137 44.849 154.267 1.00 102.20 ? 158 PHE F CE1 1 
ATOM   8302  C CE2 . PHE F 1 158 ? 108.308 42.466 154.089 1.00 102.20 ? 158 PHE F CE2 1 
ATOM   8303  C CZ  . PHE F 1 158 ? 108.222 43.706 153.486 1.00 102.20 ? 158 PHE F CZ  1 
ATOM   8304  N N   . GLY F 1 159 ? 106.655 42.594 160.723 1.00 132.33 ? 159 GLY F N   1 
ATOM   8305  C CA  . GLY F 1 159 ? 106.892 42.096 162.069 1.00 132.33 ? 159 GLY F CA  1 
ATOM   8306  C C   . GLY F 1 159 ? 106.826 43.139 163.171 1.00 132.33 ? 159 GLY F C   1 
ATOM   8307  O O   . GLY F 1 159 ? 106.607 44.323 162.919 1.00 132.33 ? 159 GLY F O   1 
ATOM   8308  N N   . ASN F 1 160 ? 107.020 42.695 164.407 1.00 96.11  ? 160 ASN F N   1 
ATOM   8309  C CA  . ASN F 1 160 ? 106.979 43.598 165.548 1.00 96.11  ? 160 ASN F CA  1 
ATOM   8310  C C   . ASN F 1 160 ? 108.074 44.648 165.475 1.00 96.11  ? 160 ASN F C   1 
ATOM   8311  O O   . ASN F 1 160 ? 107.812 45.827 165.691 1.00 96.11  ? 160 ASN F O   1 
ATOM   8312  C CB  . ASN F 1 160 ? 107.129 42.823 166.852 1.00 69.04  ? 160 ASN F CB  1 
ATOM   8313  C CG  . ASN F 1 160 ? 106.005 41.834 167.079 1.00 69.04  ? 160 ASN F CG  1 
ATOM   8314  O OD1 . ASN F 1 160 ? 104.830 42.185 167.023 1.00 69.04  ? 160 ASN F OD1 1 
ATOM   8315  N ND2 . ASN F 1 160 ? 106.367 40.588 167.352 1.00 69.04  ? 160 ASN F ND2 1 
ATOM   8316  N N   . ALA F 1 161 ? 109.296 44.214 165.174 1.00 63.14  ? 161 ALA F N   1 
ATOM   8317  C CA  . ALA F 1 161 ? 110.438 45.121 165.082 1.00 63.14  ? 161 ALA F CA  1 
ATOM   8318  C C   . ALA F 1 161 ? 110.226 46.339 164.175 1.00 63.14  ? 161 ALA F C   1 
ATOM   8319  O O   . ALA F 1 161 ? 110.993 47.300 164.246 1.00 63.14  ? 161 ALA F O   1 
ATOM   8320  C CB  . ALA F 1 161 ? 111.684 44.354 164.637 1.00 37.82  ? 161 ALA F CB  1 
ATOM   8321  N N   . LEU F 1 162 ? 109.212 46.307 163.318 1.00 78.62  ? 162 LEU F N   1 
ATOM   8322  C CA  . LEU F 1 162 ? 108.968 47.446 162.449 1.00 78.62  ? 162 LEU F CA  1 
ATOM   8323  C C   . LEU F 1 162 ? 107.658 48.114 162.788 1.00 78.62  ? 162 LEU F C   1 
ATOM   8324  O O   . LEU F 1 162 ? 107.140 48.924 162.018 1.00 78.62  ? 162 LEU F O   1 
ATOM   8325  C CB  . LEU F 1 162 ? 108.998 47.032 160.984 1.00 75.38  ? 162 LEU F CB  1 
ATOM   8326  C CG  . LEU F 1 162 ? 110.412 46.805 160.447 1.00 75.38  ? 162 LEU F CG  1 
ATOM   8327  C CD1 . LEU F 1 162 ? 110.330 46.222 159.042 1.00 75.38  ? 162 LEU F CD1 1 
ATOM   8328  C CD2 . LEU F 1 162 ? 111.180 48.115 160.435 1.00 75.38  ? 162 LEU F CD2 1 
ATOM   8329  N N   . GLY F 1 163 ? 107.121 47.762 163.951 1.00 66.67  ? 163 GLY F N   1 
ATOM   8330  C CA  . GLY F 1 163 ? 105.897 48.384 164.405 1.00 66.67  ? 163 GLY F CA  1 
ATOM   8331  C C   . GLY F 1 163 ? 104.647 47.550 164.566 1.00 66.67  ? 163 GLY F C   1 
ATOM   8332  O O   . GLY F 1 163 ? 103.612 48.120 164.909 1.00 66.67  ? 163 GLY F O   1 
ATOM   8333  N N   . ASN F 1 164 ? 104.697 46.234 164.352 1.00 75.30  ? 164 ASN F N   1 
ATOM   8334  C CA  . ASN F 1 164 ? 103.466 45.450 164.489 1.00 75.30  ? 164 ASN F CA  1 
ATOM   8335  C C   . ASN F 1 164 ? 102.992 45.314 165.935 1.00 75.30  ? 164 ASN F C   1 
ATOM   8336  O O   . ASN F 1 164 ? 101.832 44.963 166.188 1.00 75.30  ? 164 ASN F O   1 
ATOM   8337  C CB  . ASN F 1 164 ? 103.604 44.059 163.847 1.00 80.75  ? 164 ASN F CB  1 
ATOM   8338  C CG  . ASN F 1 164 ? 102.261 43.315 163.778 1.00 80.75  ? 164 ASN F CG  1 
ATOM   8339  O OD1 . ASN F 1 164 ? 101.225 43.896 163.420 1.00 80.75  ? 164 ASN F OD1 1 
ATOM   8340  N ND2 . ASN F 1 164 ? 102.277 42.031 164.114 1.00 80.75  ? 164 ASN F ND2 1 
ATOM   8341  N N   . CYS F 1 165 ? 103.886 45.601 166.879 1.00 115.32 ? 165 CYS F N   1 
ATOM   8342  C CA  . CYS F 1 165 ? 103.558 45.524 168.303 1.00 115.32 ? 165 CYS F CA  1 
ATOM   8343  C C   . CYS F 1 165 ? 102.731 46.736 168.760 1.00 115.32 ? 165 CYS F C   1 
ATOM   8344  O O   . CYS F 1 165 ? 101.838 46.609 169.597 1.00 115.32 ? 165 CYS F O   1 
ATOM   8345  C CB  . CYS F 1 165 ? 104.846 45.415 169.132 1.00 92.42  ? 165 CYS F CB  1 
ATOM   8346  S SG  . CYS F 1 165 ? 106.118 46.668 168.764 1.00 92.42  ? 165 CYS F SG  1 
ATOM   8347  N N   . ILE F 1 166 ? 103.031 47.900 168.186 1.00 77.91  ? 166 ILE F N   1 
ATOM   8348  C CA  . ILE F 1 166 ? 102.349 49.158 168.499 1.00 77.91  ? 166 ILE F CA  1 
ATOM   8349  C C   . ILE F 1 166 ? 100.831 49.018 168.579 1.00 77.91  ? 166 ILE F C   1 
ATOM   8350  O O   . ILE F 1 166 ? 100.142 49.884 169.108 1.00 77.91  ? 166 ILE F O   1 
ATOM   8351  C CB  . ILE F 1 166 ? 102.655 50.234 167.436 1.00 101.16 ? 166 ILE F CB  1 
ATOM   8352  C CG1 . ILE F 1 166 ? 102.358 51.623 167.997 1.00 101.16 ? 166 ILE F CG1 1 
ATOM   8353  C CG2 . ILE F 1 166 ? 101.794 50.009 166.207 1.00 101.16 ? 166 ILE F CG2 1 
ATOM   8354  C CD1 . ILE F 1 166 ? 103.299 52.041 169.101 1.00 101.16 ? 166 ILE F CD1 1 
ATOM   8355  N N   . LEU F 1 167 ? 100.315 47.930 168.033 1.00 129.11 ? 167 LEU F N   1 
ATOM   8356  C CA  . LEU F 1 167 ? 98.884  47.698 168.039 1.00 129.11 ? 167 LEU F CA  1 
ATOM   8357  C C   . LEU F 1 167 ? 98.489  46.865 169.248 1.00 129.11 ? 167 LEU F C   1 
ATOM   8358  O O   . LEU F 1 167 ? 97.406  47.040 169.808 1.00 129.11 ? 167 LEU F O   1 
ATOM   8359  C CB  . LEU F 1 167 ? 98.478  46.970 166.752 1.00 186.35 ? 167 LEU F CB  1 
ATOM   8360  C CG  . LEU F 1 167 ? 98.768  47.674 165.422 1.00 186.35 ? 167 LEU F CG  1 
ATOM   8361  C CD1 . LEU F 1 167 ? 98.669  46.683 164.266 1.00 186.35 ? 167 LEU F CD1 1 
ATOM   8362  C CD2 . LEU F 1 167 ? 97.793  48.827 165.242 1.00 186.35 ? 167 LEU F CD2 1 
ATOM   8363  N N   . ASP F 1 168 ? 99.379  45.960 169.643 1.00 140.27 ? 168 ASP F N   1 
ATOM   8364  C CA  . ASP F 1 168 ? 99.140  45.064 170.769 1.00 140.27 ? 168 ASP F CA  1 
ATOM   8365  C C   . ASP F 1 168 ? 98.817  45.820 172.057 1.00 140.27 ? 168 ASP F C   1 
ATOM   8366  O O   . ASP F 1 168 ? 99.624  46.615 172.539 1.00 140.27 ? 168 ASP F O   1 
ATOM   8367  C CB  . ASP F 1 168 ? 100.368 44.174 170.993 1.00 120.13 ? 168 ASP F CB  1 
ATOM   8368  C CG  . ASP F 1 168 ? 100.052 42.940 171.818 1.00 120.13 ? 168 ASP F CG  1 
ATOM   8369  O OD1 . ASP F 1 168 ? 99.087  42.996 172.611 1.00 120.13 ? 168 ASP F OD1 1 
ATOM   8370  O OD2 . ASP F 1 168 ? 100.772 41.923 171.682 1.00 120.13 ? 168 ASP F OD2 1 
ATOM   8371  N N   . LYS F 1 169 ? 97.635  45.567 172.612 1.00 104.58 ? 169 LYS F N   1 
ATOM   8372  C CA  . LYS F 1 169 ? 97.222  46.222 173.847 1.00 104.58 ? 169 LYS F CA  1 
ATOM   8373  C C   . LYS F 1 169 ? 98.100  45.750 175.001 1.00 104.58 ? 169 LYS F C   1 
ATOM   8374  O O   . LYS F 1 169 ? 98.574  46.557 175.798 1.00 104.58 ? 169 LYS F O   1 
ATOM   8375  C CB  . LYS F 1 169 ? 95.757  45.910 174.127 1.00 125.03 ? 169 LYS F CB  1 
ATOM   8376  C CG  . LYS F 1 169 ? 94.849  46.356 173.002 1.00 125.03 ? 169 LYS F CG  1 
ATOM   8377  C CD  . LYS F 1 169 ? 93.422  45.875 173.192 1.00 125.03 ? 169 LYS F CD  1 
ATOM   8378  C CE  . LYS F 1 169 ? 92.551  46.298 172.011 1.00 125.03 ? 169 LYS F CE  1 
ATOM   8379  N NZ  . LYS F 1 169 ? 91.143  45.816 172.107 1.00 125.03 ? 169 LYS F NZ  1 
ATOM   8380  N N   . ASP F 1 170 ? 98.325  44.442 175.081 1.00 177.33 ? 170 ASP F N   1 
ATOM   8381  C CA  . ASP F 1 170 ? 99.163  43.881 176.135 1.00 177.33 ? 170 ASP F CA  1 
ATOM   8382  C C   . ASP F 1 170 ? 100.544 44.525 176.101 1.00 177.33 ? 170 ASP F C   1 
ATOM   8383  O O   . ASP F 1 170 ? 101.138 44.794 177.144 1.00 177.33 ? 170 ASP F O   1 
ATOM   8384  C CB  . ASP F 1 170 ? 99.310  42.367 175.962 1.00 114.16 ? 170 ASP F CB  1 
ATOM   8385  C CG  . ASP F 1 170 ? 97.983  41.641 176.030 1.00 114.16 ? 170 ASP F CG  1 
ATOM   8386  O OD1 . ASP F 1 170 ? 97.245  41.846 177.012 1.00 114.16 ? 170 ASP F OD1 1 
ATOM   8387  O OD2 . ASP F 1 170 ? 97.679  40.859 175.105 1.00 114.16 ? 170 ASP F OD2 1 
ATOM   8388  N N   . TYR F 1 171 ? 101.050 44.762 174.895 1.00 125.00 ? 171 TYR F N   1 
ATOM   8389  C CA  . TYR F 1 171 ? 102.358 45.380 174.706 1.00 125.00 ? 171 TYR F CA  1 
ATOM   8390  C C   . TYR F 1 171 ? 102.364 46.775 175.296 1.00 125.00 ? 171 TYR F C   1 
ATOM   8391  O O   . TYR F 1 171 ? 103.308 47.166 175.985 1.00 125.00 ? 171 TYR F O   1 
ATOM   8392  C CB  . TYR F 1 171 ? 102.683 45.478 173.218 1.00 85.09  ? 171 TYR F CB  1 
ATOM   8393  C CG  . TYR F 1 171 ? 103.841 46.401 172.892 1.00 85.09  ? 171 TYR F CG  1 
ATOM   8394  C CD1 . TYR F 1 171 ? 105.158 46.041 173.195 1.00 85.09  ? 171 TYR F CD1 1 
ATOM   8395  C CD2 . TYR F 1 171 ? 103.620 47.631 172.252 1.00 85.09  ? 171 TYR F CD2 1 
ATOM   8396  C CE1 . TYR F 1 171 ? 106.234 46.883 172.858 1.00 85.09  ? 171 TYR F CE1 1 
ATOM   8397  C CE2 . TYR F 1 171 ? 104.684 48.483 171.916 1.00 85.09  ? 171 TYR F CE2 1 
ATOM   8398  C CZ  . TYR F 1 171 ? 105.987 48.102 172.218 1.00 85.09  ? 171 TYR F CZ  1 
ATOM   8399  O OH  . TYR F 1 171 ? 107.033 48.931 171.870 1.00 85.09  ? 171 TYR F OH  1 
ATOM   8400  N N   . LEU F 1 172 ? 101.305 47.522 175.006 1.00 137.53 ? 172 LEU F N   1 
ATOM   8401  C CA  . LEU F 1 172 ? 101.170 48.888 175.489 1.00 137.53 ? 172 LEU F CA  1 
ATOM   8402  C C   . LEU F 1 172 ? 101.197 48.984 177.010 1.00 137.53 ? 172 LEU F C   1 
ATOM   8403  O O   . LEU F 1 172 ? 101.966 49.763 177.571 1.00 137.53 ? 172 LEU F O   1 
ATOM   8404  C CB  . LEU F 1 172 ? 99.882  49.517 174.947 1.00 103.36 ? 172 LEU F CB  1 
ATOM   8405  C CG  . LEU F 1 172 ? 99.879  49.888 173.459 1.00 103.36 ? 172 LEU F CG  1 
ATOM   8406  C CD1 . LEU F 1 172 ? 98.537  50.490 173.095 1.00 103.36 ? 172 LEU F CD1 1 
ATOM   8407  C CD2 . LEU F 1 172 ? 101.007 50.876 173.157 1.00 103.36 ? 172 LEU F CD2 1 
ATOM   8408  N N   . ARG F 1 173 ? 100.358 48.200 177.678 1.00 158.31 ? 173 ARG F N   1 
ATOM   8409  C CA  . ARG F 1 173 ? 100.324 48.225 179.134 1.00 158.31 ? 173 ARG F CA  1 
ATOM   8410  C C   . ARG F 1 173 ? 101.721 48.013 179.699 1.00 158.31 ? 173 ARG F C   1 
ATOM   8411  O O   . ARG F 1 173 ? 102.122 48.695 180.639 1.00 158.31 ? 173 ARG F O   1 
ATOM   8412  C CB  . ARG F 1 173 ? 99.377  47.151 179.664 1.00 144.26 ? 173 ARG F CB  1 
ATOM   8413  C CG  . ARG F 1 173 ? 97.926  47.387 179.295 1.00 144.26 ? 173 ARG F CG  1 
ATOM   8414  C CD  . ARG F 1 173 ? 96.991  46.420 179.998 1.00 144.26 ? 173 ARG F CD  1 
ATOM   8415  N NE  . ARG F 1 173 ? 97.227  45.032 179.611 1.00 144.26 ? 173 ARG F NE  1 
ATOM   8416  C CZ  . ARG F 1 173 ? 98.192  44.259 180.102 1.00 144.26 ? 173 ARG F CZ  1 
ATOM   8417  N NH1 . ARG F 1 173 ? 99.032  44.726 181.018 1.00 144.26 ? 173 ARG F NH1 1 
ATOM   8418  N NH2 . ARG F 1 173 ? 98.318  43.009 179.675 1.00 144.26 ? 173 ARG F NH2 1 
ATOM   8419  N N   . SER F 1 174 ? 102.458 47.072 179.111 1.00 100.97 ? 174 SER F N   1 
ATOM   8420  C CA  . SER F 1 174 ? 103.823 46.758 179.538 1.00 100.97 ? 174 SER F CA  1 
ATOM   8421  C C   . SER F 1 174 ? 104.784 47.918 179.302 1.00 100.97 ? 174 SER F C   1 
ATOM   8422  O O   . SER F 1 174 ? 105.909 47.908 179.799 1.00 100.97 ? 174 SER F O   1 
ATOM   8423  C CB  . SER F 1 174 ? 104.342 45.513 178.808 1.00 87.08  ? 174 SER F CB  1 
ATOM   8424  O OG  . SER F 1 174 ? 103.567 44.369 179.138 1.00 87.08  ? 174 SER F OG  1 
ATOM   8425  N N   . LEU F 1 175 ? 104.342 48.910 178.536 1.00 153.42 ? 175 LEU F N   1 
ATOM   8426  C CA  . LEU F 1 175 ? 105.162 50.084 178.262 1.00 153.42 ? 175 LEU F CA  1 
ATOM   8427  C C   . LEU F 1 175 ? 105.008 51.138 179.355 1.00 153.42 ? 175 LEU F C   1 
ATOM   8428  O O   . LEU F 1 175 ? 105.970 51.828 179.697 1.00 153.42 ? 175 LEU F O   1 
ATOM   8429  C CB  . LEU F 1 175 ? 104.789 50.695 176.918 1.00 142.60 ? 175 LEU F CB  1 
ATOM   8430  C CG  . LEU F 1 175 ? 105.456 50.063 175.706 1.00 142.60 ? 175 LEU F CG  1 
ATOM   8431  C CD1 . LEU F 1 175 ? 104.901 50.704 174.445 1.00 142.60 ? 175 LEU F CD1 1 
ATOM   8432  C CD2 . LEU F 1 175 ? 106.967 50.257 175.801 1.00 142.60 ? 175 LEU F CD2 1 
ATOM   8433  N N   . ASN F 1 176 ? 103.795 51.267 179.890 1.00 138.76 ? 176 ASN F N   1 
ATOM   8434  C CA  . ASN F 1 176 ? 103.512 52.228 180.958 1.00 138.76 ? 176 ASN F CA  1 
ATOM   8435  C C   . ASN F 1 176 ? 104.230 51.778 182.227 1.00 138.76 ? 176 ASN F C   1 
ATOM   8436  O O   . ASN F 1 176 ? 104.785 52.590 182.968 1.00 138.76 ? 176 ASN F O   1 
ATOM   8437  C CB  . ASN F 1 176 ? 102.007 52.299 181.227 1.00 180.77 ? 176 ASN F CB  1 
ATOM   8438  C CG  . ASN F 1 176 ? 101.209 52.651 179.988 1.00 180.77 ? 176 ASN F CG  1 
ATOM   8439  O OD1 . ASN F 1 176 ? 101.437 53.684 179.361 1.00 180.77 ? 176 ASN F OD1 1 
ATOM   8440  N ND2 . ASN F 1 176 ? 100.264 51.791 179.630 1.00 180.77 ? 176 ASN F ND2 1 
ATOM   8441  N N   . LYS F 1 177 ? 104.210 50.469 182.459 1.00 198.31 ? 177 LYS F N   1 
ATOM   8442  C CA  . LYS F 1 177 ? 104.854 49.870 183.621 1.00 198.31 ? 177 LYS F CA  1 
ATOM   8443  C C   . LYS F 1 177 ? 106.372 49.952 183.494 1.00 198.31 ? 177 LYS F C   1 
ATOM   8444  O O   . LYS F 1 177 ? 107.093 49.184 184.127 1.00 198.31 ? 177 LYS F O   1 
ATOM   8445  C CB  . LYS F 1 177 ? 104.441 48.398 183.760 1.00 121.11 ? 177 LYS F CB  1 
ATOM   8446  C CG  . LYS F 1 177 ? 102.942 48.167 183.930 1.00 121.11 ? 177 LYS F CG  1 
ATOM   8447  C CD  . LYS F 1 177 ? 102.602 46.680 184.036 1.00 121.11 ? 177 LYS F CD  1 
ATOM   8448  C CE  . LYS F 1 177 ? 101.093 46.468 184.146 1.00 121.11 ? 177 LYS F CE  1 
ATOM   8449  N NZ  . LYS F 1 177 ? 100.704 45.028 184.190 1.00 121.11 ? 177 LYS F NZ  1 
ATOM   8450  N N   . LEU F 1 178 ? 106.857 50.877 182.672 1.00 136.53 ? 178 LEU F N   1 
ATOM   8451  C CA  . LEU F 1 178 ? 108.294 51.037 182.483 1.00 136.53 ? 178 LEU F CA  1 
ATOM   8452  C C   . LEU F 1 178 ? 108.767 52.455 182.768 1.00 136.53 ? 178 LEU F C   1 
ATOM   8453  O O   . LEU F 1 178 ? 108.000 53.414 182.653 1.00 136.53 ? 178 LEU F O   1 
ATOM   8454  C CB  . LEU F 1 178 ? 108.704 50.645 181.057 1.00 103.50 ? 178 LEU F CB  1 
ATOM   8455  C CG  . LEU F 1 178 ? 108.925 49.157 180.764 1.00 103.50 ? 178 LEU F CG  1 
ATOM   8456  C CD1 . LEU F 1 178 ? 109.372 48.982 179.318 1.00 103.50 ? 178 LEU F CD1 1 
ATOM   8457  C CD2 . LEU F 1 178 ? 109.979 48.598 181.712 1.00 103.50 ? 178 LEU F CD2 1 
ATOM   8458  N N   . PRO F 1 179 ? 110.050 52.602 183.148 1.00 200.00 ? 179 PRO F N   1 
ATOM   8459  C CA  . PRO F 1 179 ? 110.660 53.897 183.457 1.00 200.00 ? 179 PRO F CA  1 
ATOM   8460  C C   . PRO F 1 179 ? 110.538 54.856 182.286 1.00 200.00 ? 179 PRO F C   1 
ATOM   8461  O O   . PRO F 1 179 ? 111.262 54.727 181.299 1.00 200.00 ? 179 PRO F O   1 
ATOM   8462  C CB  . PRO F 1 179 ? 112.114 53.535 183.736 1.00 112.18 ? 179 PRO F CB  1 
ATOM   8463  C CG  . PRO F 1 179 ? 112.012 52.158 184.299 1.00 112.18 ? 179 PRO F CG  1 
ATOM   8464  C CD  . PRO F 1 179 ? 111.018 51.512 183.373 1.00 112.18 ? 179 PRO F CD  1 
ATOM   8465  N N   . ARG F 1 180 ? 109.619 55.808 182.394 1.00 149.24 ? 180 ARG F N   1 
ATOM   8466  C CA  . ARG F 1 180 ? 109.424 56.787 181.335 1.00 149.24 ? 180 ARG F CA  1 
ATOM   8467  C C   . ARG F 1 180 ? 110.730 57.576 181.184 1.00 149.24 ? 180 ARG F C   1 
ATOM   8468  O O   . ARG F 1 180 ? 110.875 58.671 181.728 1.00 149.24 ? 180 ARG F O   1 
ATOM   8469  C CB  . ARG F 1 180 ? 108.263 57.726 181.695 1.00 189.02 ? 180 ARG F CB  1 
ATOM   8470  C CG  . ARG F 1 180 ? 107.314 58.041 180.540 1.00 189.02 ? 180 ARG F CG  1 
ATOM   8471  C CD  . ARG F 1 180 ? 108.042 58.659 179.348 1.00 189.02 ? 180 ARG F CD  1 
ATOM   8472  N NE  . ARG F 1 180 ? 108.724 59.904 179.697 1.00 189.02 ? 180 ARG F NE  1 
ATOM   8473  C CZ  . ARG F 1 180 ? 109.444 60.630 178.846 1.00 189.02 ? 180 ARG F CZ  1 
ATOM   8474  N NH1 . ARG F 1 180 ? 109.580 60.239 177.587 1.00 189.02 ? 180 ARG F NH1 1 
ATOM   8475  N NH2 . ARG F 1 180 ? 110.036 61.745 179.257 1.00 189.02 ? 180 ARG F NH2 1 
ATOM   8476  N N   . GLN F 1 181 ? 111.680 57.005 180.447 1.00 200.00 ? 181 GLN F N   1 
ATOM   8477  C CA  . GLN F 1 181 ? 112.979 57.639 180.230 1.00 200.00 ? 181 GLN F CA  1 
ATOM   8478  C C   . GLN F 1 181 ? 112.857 59.009 179.575 1.00 200.00 ? 181 GLN F C   1 
ATOM   8479  O O   . GLN F 1 181 ? 111.841 59.330 178.961 1.00 200.00 ? 181 GLN F O   1 
ATOM   8480  C CB  . GLN F 1 181 ? 113.870 56.748 179.363 1.00 199.01 ? 181 GLN F CB  1 
ATOM   8481  C CG  . GLN F 1 181 ? 113.318 56.482 177.974 1.00 199.01 ? 181 GLN F CG  1 
ATOM   8482  C CD  . GLN F 1 181 ? 114.303 55.745 177.093 1.00 199.01 ? 181 GLN F CD  1 
ATOM   8483  O OE1 . GLN F 1 181 ? 115.339 56.288 176.708 1.00 199.01 ? 181 GLN F OE1 1 
ATOM   8484  N NE2 . GLN F 1 181 ? 113.989 54.497 176.774 1.00 199.01 ? 181 GLN F NE2 1 
ATOM   8485  N N   . LEU F 1 182 ? 113.911 59.807 179.699 1.00 186.04 ? 182 LEU F N   1 
ATOM   8486  C CA  . LEU F 1 182 ? 113.923 61.148 179.132 1.00 186.04 ? 182 LEU F CA  1 
ATOM   8487  C C   . LEU F 1 182 ? 114.652 61.155 177.789 1.00 186.04 ? 182 LEU F C   1 
ATOM   8488  O O   . LEU F 1 182 ? 115.560 60.352 177.565 1.00 186.04 ? 182 LEU F O   1 
ATOM   8489  C CB  . LEU F 1 182 ? 114.603 62.111 180.110 1.00 198.31 ? 182 LEU F CB  1 
ATOM   8490  C CG  . LEU F 1 182 ? 114.292 63.603 179.972 1.00 198.31 ? 182 LEU F CG  1 
ATOM   8491  C CD1 . LEU F 1 182 ? 112.796 63.836 180.150 1.00 198.31 ? 182 LEU F CD1 1 
ATOM   8492  C CD2 . LEU F 1 182 ? 115.078 64.384 181.010 1.00 198.31 ? 182 LEU F CD2 1 
ATOM   8493  N N   . PRO F 1 183 ? 114.255 62.062 176.875 1.00 200.00 ? 183 PRO F N   1 
ATOM   8494  C CA  . PRO F 1 183 ? 114.858 62.190 175.546 1.00 200.00 ? 183 PRO F CA  1 
ATOM   8495  C C   . PRO F 1 183 ? 116.363 61.952 175.507 1.00 200.00 ? 183 PRO F C   1 
ATOM   8496  O O   . PRO F 1 183 ? 117.104 62.413 176.376 1.00 200.00 ? 183 PRO F O   1 
ATOM   8497  C CB  . PRO F 1 183 ? 114.476 63.607 175.144 1.00 145.98 ? 183 PRO F CB  1 
ATOM   8498  C CG  . PRO F 1 183 ? 113.080 63.696 175.665 1.00 145.98 ? 183 PRO F CG  1 
ATOM   8499  C CD  . PRO F 1 183 ? 113.191 63.071 177.052 1.00 145.98 ? 183 PRO F CD  1 
ATOM   8500  N N   . LEU F 1 184 ? 116.800 61.225 174.484 1.00 150.12 ? 184 LEU F N   1 
ATOM   8501  C CA  . LEU F 1 184 ? 118.208 60.901 174.309 1.00 150.12 ? 184 LEU F CA  1 
ATOM   8502  C C   . LEU F 1 184 ? 118.985 62.098 173.765 1.00 150.12 ? 184 LEU F C   1 
ATOM   8503  O O   . LEU F 1 184 ? 118.511 62.813 172.881 1.00 150.12 ? 184 LEU F O   1 
ATOM   8504  C CB  . LEU F 1 184 ? 118.359 59.711 173.348 1.00 121.79 ? 184 LEU F CB  1 
ATOM   8505  C CG  . LEU F 1 184 ? 117.505 58.449 173.544 1.00 121.79 ? 184 LEU F CG  1 
ATOM   8506  C CD1 . LEU F 1 184 ? 117.608 57.964 174.982 1.00 121.79 ? 184 LEU F CD1 1 
ATOM   8507  C CD2 . LEU F 1 184 ? 116.052 58.742 173.189 1.00 121.79 ? 184 LEU F CD2 1 
ATOM   8508  N N   . GLU F 1 185 ? 120.178 62.317 174.306 1.00 112.26 ? 185 GLU F N   1 
ATOM   8509  C CA  . GLU F 1 185 ? 121.025 63.413 173.856 1.00 112.26 ? 185 GLU F CA  1 
ATOM   8510  C C   . GLU F 1 185 ? 121.731 62.954 172.590 1.00 112.26 ? 185 GLU F C   1 
ATOM   8511  O O   . GLU F 1 185 ? 122.316 61.872 172.554 1.00 112.26 ? 185 GLU F O   1 
ATOM   8512  C CB  . GLU F 1 185 ? 122.064 63.769 174.921 1.00 188.97 ? 185 GLU F CB  1 
ATOM   8513  C CG  . GLU F 1 185 ? 122.990 64.905 174.518 1.00 188.97 ? 185 GLU F CG  1 
ATOM   8514  C CD  . GLU F 1 185 ? 124.095 65.140 175.524 1.00 188.97 ? 185 GLU F CD  1 
ATOM   8515  O OE1 . GLU F 1 185 ? 124.893 64.207 175.757 1.00 188.97 ? 185 GLU F OE1 1 
ATOM   8516  O OE2 . GLU F 1 185 ? 124.163 66.256 176.080 1.00 188.97 ? 185 GLU F OE2 1 
ATOM   8517  N N   . VAL F 1 186 ? 121.679 63.781 171.554 1.00 162.44 ? 186 VAL F N   1 
ATOM   8518  C CA  . VAL F 1 186 ? 122.303 63.439 170.283 1.00 162.44 ? 186 VAL F CA  1 
ATOM   8519  C C   . VAL F 1 186 ? 123.718 63.991 170.144 1.00 162.44 ? 186 VAL F C   1 
ATOM   8520  O O   . VAL F 1 186 ? 123.920 65.198 170.009 1.00 162.44 ? 186 VAL F O   1 
ATOM   8521  C CB  . VAL F 1 186 ? 121.448 63.945 169.103 1.00 129.29 ? 186 VAL F CB  1 
ATOM   8522  C CG1 . VAL F 1 186 ? 122.086 63.537 167.786 1.00 129.29 ? 186 VAL F CG1 1 
ATOM   8523  C CG2 . VAL F 1 186 ? 120.027 63.395 169.219 1.00 129.29 ? 186 VAL F CG2 1 
ATOM   8524  N N   . ASP F 1 187 ? 124.696 63.093 170.170 1.00 116.76 ? 187 ASP F N   1 
ATOM   8525  C CA  . ASP F 1 187 ? 126.088 63.493 170.047 1.00 116.76 ? 187 ASP F CA  1 
ATOM   8526  C C   . ASP F 1 187 ? 126.460 63.790 168.599 1.00 116.76 ? 187 ASP F C   1 
ATOM   8527  O O   . ASP F 1 187 ? 126.705 62.877 167.811 1.00 116.76 ? 187 ASP F O   1 
ATOM   8528  C CB  . ASP F 1 187 ? 127.004 62.400 170.601 1.00 141.28 ? 187 ASP F CB  1 
ATOM   8529  C CG  . ASP F 1 187 ? 128.474 62.721 170.407 1.00 141.28 ? 187 ASP F CG  1 
ATOM   8530  O OD1 . ASP F 1 187 ? 128.899 63.827 170.803 1.00 141.28 ? 187 ASP F OD1 1 
ATOM   8531  O OD2 . ASP F 1 187 ? 129.203 61.867 169.861 1.00 141.28 ? 187 ASP F OD2 1 
ATOM   8532  N N   . LEU F 1 188 ? 126.520 65.075 168.265 1.00 128.06 ? 188 LEU F N   1 
ATOM   8533  C CA  . LEU F 1 188 ? 126.850 65.512 166.914 1.00 128.06 ? 188 LEU F CA  1 
ATOM   8534  C C   . LEU F 1 188 ? 128.347 65.759 166.702 1.00 128.06 ? 188 LEU F C   1 
ATOM   8535  O O   . LEU F 1 188 ? 128.736 66.563 165.854 1.00 128.06 ? 188 LEU F O   1 
ATOM   8536  C CB  . LEU F 1 188 ? 126.073 66.791 166.600 1.00 114.93 ? 188 LEU F CB  1 
ATOM   8537  C CG  . LEU F 1 188 ? 124.569 66.754 166.885 1.00 114.93 ? 188 LEU F CG  1 
ATOM   8538  C CD1 . LEU F 1 188 ? 123.950 68.115 166.599 1.00 114.93 ? 188 LEU F CD1 1 
ATOM   8539  C CD2 . LEU F 1 188 ? 123.924 65.687 166.028 1.00 114.93 ? 188 LEU F CD2 1 
ATOM   8540  N N   . THR F 1 189 ? 129.187 65.064 167.460 1.00 94.52  ? 189 THR F N   1 
ATOM   8541  C CA  . THR F 1 189 ? 130.630 65.250 167.337 1.00 94.52  ? 189 THR F CA  1 
ATOM   8542  C C   . THR F 1 189 ? 131.188 64.647 166.063 1.00 94.52  ? 189 THR F C   1 
ATOM   8543  O O   . THR F 1 189 ? 131.974 65.285 165.356 1.00 94.52  ? 189 THR F O   1 
ATOM   8544  C CB  . THR F 1 189 ? 131.371 64.636 168.530 1.00 152.81 ? 189 THR F CB  1 
ATOM   8545  O OG1 . THR F 1 189 ? 131.009 63.258 168.658 1.00 152.81 ? 189 THR F OG1 1 
ATOM   8546  C CG2 . THR F 1 189 ? 131.021 65.383 169.811 1.00 152.81 ? 189 THR F CG2 1 
ATOM   8547  N N   . LYS F 1 190 ? 130.779 63.415 165.780 1.00 102.89 ? 190 LYS F N   1 
ATOM   8548  C CA  . LYS F 1 190 ? 131.228 62.708 164.585 1.00 102.89 ? 190 LYS F CA  1 
ATOM   8549  C C   . LYS F 1 190 ? 130.230 62.882 163.442 1.00 102.89 ? 190 LYS F C   1 
ATOM   8550  O O   . LYS F 1 190 ? 130.172 62.066 162.521 1.00 102.89 ? 190 LYS F O   1 
ATOM   8551  C CB  . LYS F 1 190 ? 131.415 61.223 164.892 1.00 116.81 ? 190 LYS F CB  1 
ATOM   8552  C CG  . LYS F 1 190 ? 132.469 60.947 165.944 1.00 116.81 ? 190 LYS F CG  1 
ATOM   8553  C CD  . LYS F 1 190 ? 132.625 59.460 166.202 1.00 116.81 ? 190 LYS F CD  1 
ATOM   8554  C CE  . LYS F 1 190 ? 133.698 59.191 167.245 1.00 116.81 ? 190 LYS F CE  1 
ATOM   8555  N NZ  . LYS F 1 190 ? 133.854 57.737 167.514 1.00 116.81 ? 190 LYS F NZ  1 
ATOM   8556  N N   . ALA F 1 191 ? 129.451 63.957 163.511 1.00 115.34 ? 191 ALA F N   1 
ATOM   8557  C CA  . ALA F 1 191 ? 128.456 64.254 162.491 1.00 115.34 ? 191 ALA F CA  1 
ATOM   8558  C C   . ALA F 1 191 ? 129.128 64.604 161.161 1.00 115.34 ? 191 ALA F C   1 
ATOM   8559  O O   . ALA F 1 191 ? 130.256 65.100 161.136 1.00 115.34 ? 191 ALA F O   1 
ATOM   8560  C CB  . ALA F 1 191 ? 127.565 65.403 162.956 1.00 66.54  ? 191 ALA F CB  1 
ATOM   8561  N N   . LYS F 1 192 ? 128.430 64.330 160.059 1.00 82.93  ? 192 LYS F N   1 
ATOM   8562  C CA  . LYS F 1 192 ? 128.948 64.600 158.725 1.00 82.93  ? 192 LYS F CA  1 
ATOM   8563  C C   . LYS F 1 192 ? 129.015 66.107 158.526 1.00 82.93  ? 192 LYS F C   1 
ATOM   8564  O O   . LYS F 1 192 ? 128.012 66.806 158.709 1.00 82.93  ? 192 LYS F O   1 
ATOM   8565  C CB  . LYS F 1 192 ? 128.043 63.955 157.678 1.00 83.24  ? 192 LYS F CB  1 
ATOM   8566  C CG  . LYS F 1 192 ? 128.580 64.077 156.270 1.00 83.24  ? 192 LYS F CG  1 
ATOM   8567  C CD  . LYS F 1 192 ? 127.685 63.357 155.286 1.00 83.24  ? 192 LYS F CD  1 
ATOM   8568  C CE  . LYS F 1 192 ? 128.094 63.658 153.852 1.00 83.24  ? 192 LYS F CE  1 
ATOM   8569  N NZ  . LYS F 1 192 ? 129.470 63.209 153.530 1.00 83.24  ? 192 LYS F NZ  1 
ATOM   8570  N N   . ARG F 1 193 ? 130.197 66.600 158.152 1.00 94.30  ? 193 ARG F N   1 
ATOM   8571  C CA  . ARG F 1 193 ? 130.397 68.035 157.980 1.00 94.30  ? 193 ARG F CA  1 
ATOM   8572  C C   . ARG F 1 193 ? 130.699 68.511 156.572 1.00 94.30  ? 193 ARG F C   1 
ATOM   8573  O O   . ARG F 1 193 ? 130.701 69.711 156.309 1.00 94.30  ? 193 ARG F O   1 
ATOM   8574  C CB  . ARG F 1 193 ? 131.490 68.529 158.936 1.00 141.44 ? 193 ARG F CB  1 
ATOM   8575  C CG  . ARG F 1 193 ? 131.050 68.532 160.396 1.00 141.44 ? 193 ARG F CG  1 
ATOM   8576  C CD  . ARG F 1 193 ? 131.889 69.465 161.259 1.00 141.44 ? 193 ARG F CD  1 
ATOM   8577  N NE  . ARG F 1 193 ? 131.185 69.853 162.483 1.00 141.44 ? 193 ARG F NE  1 
ATOM   8578  C CZ  . ARG F 1 193 ? 130.859 69.017 163.466 1.00 141.44 ? 193 ARG F CZ  1 
ATOM   8579  N NH1 . ARG F 1 193 ? 131.176 67.732 163.383 1.00 141.44 ? 193 ARG F NH1 1 
ATOM   8580  N NH2 . ARG F 1 193 ? 130.210 69.466 164.533 1.00 141.44 ? 193 ARG F NH2 1 
ATOM   8581  N N   . GLN F 1 194 ? 130.974 67.583 155.669 1.00 122.73 ? 194 GLN F N   1 
ATOM   8582  C CA  . GLN F 1 194 ? 131.235 67.960 154.290 1.00 122.73 ? 194 GLN F CA  1 
ATOM   8583  C C   . GLN F 1 194 ? 130.735 66.859 153.364 1.00 122.73 ? 194 GLN F C   1 
ATOM   8584  O O   . GLN F 1 194 ? 130.479 65.739 153.806 1.00 122.73 ? 194 GLN F O   1 
ATOM   8585  C CB  . GLN F 1 194 ? 132.720 68.268 154.089 1.00 111.07 ? 194 GLN F CB  1 
ATOM   8586  C CG  . GLN F 1 194 ? 133.644 67.318 154.776 1.00 111.07 ? 194 GLN F CG  1 
ATOM   8587  C CD  . GLN F 1 194 ? 133.662 65.970 154.110 1.00 111.07 ? 194 GLN F CD  1 
ATOM   8588  O OE1 . GLN F 1 194 ? 134.004 65.854 152.932 1.00 111.07 ? 194 GLN F OE1 1 
ATOM   8589  N NE2 . GLN F 1 194 ? 133.289 64.936 154.857 1.00 111.07 ? 194 GLN F NE2 1 
ATOM   8590  N N   . ASP F 1 195 ? 130.571 67.188 152.087 1.00 119.16 ? 195 ASP F N   1 
ATOM   8591  C CA  . ASP F 1 195 ? 130.040 66.241 151.119 1.00 119.16 ? 195 ASP F CA  1 
ATOM   8592  C C   . ASP F 1 195 ? 130.805 64.948 150.896 1.00 119.16 ? 195 ASP F C   1 
ATOM   8593  O O   . ASP F 1 195 ? 130.302 63.859 151.190 1.00 119.16 ? 195 ASP F O   1 
ATOM   8594  C CB  . ASP F 1 195 ? 129.839 66.927 149.764 1.00 96.34  ? 195 ASP F CB  1 
ATOM   8595  C CG  . ASP F 1 195 ? 128.762 68.000 149.802 1.00 96.34  ? 195 ASP F CG  1 
ATOM   8596  O OD1 . ASP F 1 195 ? 127.843 67.903 150.650 1.00 96.34  ? 195 ASP F OD1 1 
ATOM   8597  O OD2 . ASP F 1 195 ? 128.835 68.932 148.965 1.00 96.34  ? 195 ASP F OD2 1 
ATOM   8598  N N   . LEU F 1 196 ? 132.016 65.069 150.368 1.00 72.18  ? 196 LEU F N   1 
ATOM   8599  C CA  . LEU F 1 196 ? 132.813 63.893 150.056 1.00 72.18  ? 196 LEU F CA  1 
ATOM   8600  C C   . LEU F 1 196 ? 132.750 62.750 151.083 1.00 72.18  ? 196 LEU F C   1 
ATOM   8601  O O   . LEU F 1 196 ? 132.473 62.966 152.261 1.00 72.18  ? 196 LEU F O   1 
ATOM   8602  C CB  . LEU F 1 196 ? 134.262 64.311 149.782 1.00 82.46  ? 196 LEU F CB  1 
ATOM   8603  C CG  . LEU F 1 196 ? 135.166 63.258 149.124 1.00 82.46  ? 196 LEU F CG  1 
ATOM   8604  C CD1 . LEU F 1 196 ? 134.435 62.535 147.996 1.00 82.46  ? 196 LEU F CD1 1 
ATOM   8605  C CD2 . LEU F 1 196 ? 136.422 63.934 148.598 1.00 82.46  ? 196 LEU F CD2 1 
ATOM   8606  N N   . GLU F 1 197 ? 132.970 61.529 150.590 1.00 154.15 ? 197 GLU F N   1 
ATOM   8607  C CA  . GLU F 1 197 ? 132.974 60.303 151.389 1.00 154.15 ? 197 GLU F CA  1 
ATOM   8608  C C   . GLU F 1 197 ? 134.063 59.412 150.800 1.00 154.15 ? 197 GLU F C   1 
ATOM   8609  O O   . GLU F 1 197 ? 133.787 58.564 149.956 1.00 154.15 ? 197 GLU F O   1 
ATOM   8610  C CB  . GLU F 1 197 ? 131.636 59.577 151.275 1.00 93.38  ? 197 GLU F CB  1 
ATOM   8611  C CG  . GLU F 1 197 ? 130.482 60.210 152.012 1.00 93.38  ? 197 GLU F CG  1 
ATOM   8612  C CD  . GLU F 1 197 ? 130.553 59.965 153.499 1.00 93.38  ? 197 GLU F CD  1 
ATOM   8613  O OE1 . GLU F 1 197 ? 130.998 58.870 153.892 1.00 93.38  ? 197 GLU F OE1 1 
ATOM   8614  O OE2 . GLU F 1 197 ? 130.152 60.853 154.278 1.00 93.38  ? 197 GLU F OE2 1 
ATOM   8615  N N   . PRO F 1 198 ? 135.318 59.599 151.234 1.00 163.37 ? 198 PRO F N   1 
ATOM   8616  C CA  . PRO F 1 198 ? 136.464 58.820 150.751 1.00 163.37 ? 198 PRO F CA  1 
ATOM   8617  C C   . PRO F 1 198 ? 136.264 57.308 150.820 1.00 163.37 ? 198 PRO F C   1 
ATOM   8618  O O   . PRO F 1 198 ? 136.563 56.595 149.861 1.00 163.37 ? 198 PRO F O   1 
ATOM   8619  C CB  . PRO F 1 198 ? 137.604 59.290 151.651 1.00 120.71 ? 198 PRO F CB  1 
ATOM   8620  C CG  . PRO F 1 198 ? 137.209 60.693 151.986 1.00 120.71 ? 198 PRO F CG  1 
ATOM   8621  C CD  . PRO F 1 198 ? 135.740 60.552 152.274 1.00 120.71 ? 198 PRO F CD  1 
ATOM   8622  N N   . SER F 1 199 ? 135.762 56.826 151.956 1.00 117.06 ? 199 SER F N   1 
ATOM   8623  C CA  . SER F 1 199 ? 135.526 55.398 152.152 1.00 117.06 ? 199 SER F CA  1 
ATOM   8624  C C   . SER F 1 199 ? 134.680 54.856 151.009 1.00 117.06 ? 199 SER F C   1 
ATOM   8625  O O   . SER F 1 199 ? 135.036 53.875 150.350 1.00 117.06 ? 199 SER F O   1 
ATOM   8626  C CB  . SER F 1 199 ? 134.806 55.162 153.481 1.00 117.67 ? 199 SER F CB  1 
ATOM   8627  O OG  . SER F 1 199 ? 134.602 53.778 153.710 1.00 117.67 ? 199 SER F OG  1 
ATOM   8628  N N   . VAL F 1 200 ? 133.553 55.518 150.785 1.00 116.58 ? 200 VAL F N   1 
ATOM   8629  C CA  . VAL F 1 200 ? 132.626 55.145 149.731 1.00 116.58 ? 200 VAL F CA  1 
ATOM   8630  C C   . VAL F 1 200 ? 133.250 55.347 148.353 1.00 116.58 ? 200 VAL F C   1 
ATOM   8631  O O   . VAL F 1 200 ? 133.363 54.406 147.580 1.00 116.58 ? 200 VAL F O   1 
ATOM   8632  C CB  . VAL F 1 200 ? 131.335 55.977 149.832 1.00 103.00 ? 200 VAL F CB  1 
ATOM   8633  C CG1 . VAL F 1 200 ? 130.397 55.618 148.701 1.00 103.00 ? 200 VAL F CG1 1 
ATOM   8634  C CG2 . VAL F 1 200 ? 130.667 55.736 151.190 1.00 103.00 ? 200 VAL F CG2 1 
ATOM   8635  N N   . GLU F 1 201 ? 133.657 56.575 148.051 1.00 74.19  ? 201 GLU F N   1 
ATOM   8636  C CA  . GLU F 1 201 ? 134.269 56.888 146.760 1.00 74.19  ? 201 GLU F CA  1 
ATOM   8637  C C   . GLU F 1 201 ? 135.292 55.833 146.330 1.00 74.19  ? 201 GLU F C   1 
ATOM   8638  O O   . GLU F 1 201 ? 135.429 55.534 145.134 1.00 74.19  ? 201 GLU F O   1 
ATOM   8639  C CB  . GLU F 1 201 ? 134.932 58.271 146.819 1.00 128.57 ? 201 GLU F CB  1 
ATOM   8640  C CG  . GLU F 1 201 ? 135.652 58.703 145.536 1.00 128.57 ? 201 GLU F CG  1 
ATOM   8641  C CD  . GLU F 1 201 ? 134.744 58.745 144.311 1.00 128.57 ? 201 GLU F CD  1 
ATOM   8642  O OE1 . GLU F 1 201 ? 133.654 59.351 144.394 1.00 128.57 ? 201 GLU F OE1 1 
ATOM   8643  O OE2 . GLU F 1 201 ? 135.128 58.180 143.261 1.00 128.57 ? 201 GLU F OE2 1 
ATOM   8644  N N   . GLU F 1 202 ? 136.004 55.268 147.304 1.00 115.61 ? 202 GLU F N   1 
ATOM   8645  C CA  . GLU F 1 202 ? 137.019 54.254 147.026 1.00 115.61 ? 202 GLU F CA  1 
ATOM   8646  C C   . GLU F 1 202 ? 136.406 52.923 146.587 1.00 115.61 ? 202 GLU F C   1 
ATOM   8647  O O   . GLU F 1 202 ? 136.674 52.440 145.482 1.00 115.61 ? 202 GLU F O   1 
ATOM   8648  C CB  . GLU F 1 202 ? 137.897 54.036 148.264 1.00 142.75 ? 202 GLU F CB  1 
ATOM   8649  C CG  . GLU F 1 202 ? 139.070 53.090 148.037 1.00 142.75 ? 202 GLU F CG  1 
ATOM   8650  C CD  . GLU F 1 202 ? 139.996 53.004 149.236 1.00 142.75 ? 202 GLU F CD  1 
ATOM   8651  O OE1 . GLU F 1 202 ? 139.546 52.552 150.311 1.00 142.75 ? 202 GLU F OE1 1 
ATOM   8652  O OE2 . GLU F 1 202 ? 141.174 53.392 149.100 1.00 142.75 ? 202 GLU F OE2 1 
ATOM   8653  N N   . ALA F 1 203 ? 135.587 52.336 147.458 1.00 165.88 ? 203 ALA F N   1 
ATOM   8654  C CA  . ALA F 1 203 ? 134.934 51.060 147.167 1.00 165.88 ? 203 ALA F CA  1 
ATOM   8655  C C   . ALA F 1 203 ? 134.215 51.102 145.820 1.00 165.88 ? 203 ALA F C   1 
ATOM   8656  O O   . ALA F 1 203 ? 134.154 50.101 145.110 1.00 165.88 ? 203 ALA F O   1 
ATOM   8657  C CB  . ALA F 1 203 ? 133.939 50.696 148.291 1.00 54.32  ? 203 ALA F CB  1 
ATOM   8658  N N   . ARG F 1 204 ? 133.675 52.268 145.476 1.00 131.12 ? 204 ARG F N   1 
ATOM   8659  C CA  . ARG F 1 204 ? 132.956 52.453 144.217 1.00 131.12 ? 204 ARG F CA  1 
ATOM   8660  C C   . ARG F 1 204 ? 133.899 52.399 143.031 1.00 131.12 ? 204 ARG F C   1 
ATOM   8661  O O   . ARG F 1 204 ? 133.650 51.694 142.055 1.00 131.12 ? 204 ARG F O   1 
ATOM   8662  C CB  . ARG F 1 204 ? 132.233 53.804 144.202 1.00 61.09  ? 204 ARG F CB  1 
ATOM   8663  C CG  . ARG F 1 204 ? 131.548 54.156 142.857 1.00 61.09  ? 204 ARG F CG  1 
ATOM   8664  C CD  . ARG F 1 204 ? 130.870 55.515 142.927 1.00 61.09  ? 204 ARG F CD  1 
ATOM   8665  N NE  . ARG F 1 204 ? 129.997 55.592 144.085 1.00 61.09  ? 204 ARG F NE  1 
ATOM   8666  C CZ  . ARG F 1 204 ? 130.018 56.588 144.956 1.00 61.09  ? 204 ARG F CZ  1 
ATOM   8667  N NH1 . ARG F 1 204 ? 130.874 57.589 144.785 1.00 61.09  ? 204 ARG F NH1 1 
ATOM   8668  N NH2 . ARG F 1 204 ? 129.194 56.573 145.996 1.00 61.09  ? 204 ARG F NH2 1 
ATOM   8669  N N   . TYR F 1 205 ? 134.978 53.165 143.110 1.00 94.20  ? 205 TYR F N   1 
ATOM   8670  C CA  . TYR F 1 205 ? 135.938 53.191 142.030 1.00 94.20  ? 205 TYR F CA  1 
ATOM   8671  C C   . TYR F 1 205 ? 136.426 51.779 141.730 1.00 94.20  ? 205 TYR F C   1 
ATOM   8672  O O   . TYR F 1 205 ? 136.615 51.418 140.566 1.00 94.20  ? 205 TYR F O   1 
ATOM   8673  C CB  . TYR F 1 205 ? 137.124 54.091 142.381 1.00 115.77 ? 205 TYR F CB  1 
ATOM   8674  C CG  . TYR F 1 205 ? 138.138 54.137 141.267 1.00 115.77 ? 205 TYR F CG  1 
ATOM   8675  C CD1 . TYR F 1 205 ? 137.792 54.634 140.010 1.00 115.77 ? 205 TYR F CD1 1 
ATOM   8676  C CD2 . TYR F 1 205 ? 139.423 53.618 141.441 1.00 115.77 ? 205 TYR F CD2 1 
ATOM   8677  C CE1 . TYR F 1 205 ? 138.696 54.607 138.949 1.00 115.77 ? 205 TYR F CE1 1 
ATOM   8678  C CE2 . TYR F 1 205 ? 140.338 53.587 140.382 1.00 115.77 ? 205 TYR F CE2 1 
ATOM   8679  C CZ  . TYR F 1 205 ? 139.963 54.082 139.138 1.00 115.77 ? 205 TYR F CZ  1 
ATOM   8680  O OH  . TYR F 1 205 ? 140.838 54.048 138.075 1.00 115.77 ? 205 TYR F OH  1 
ATOM   8681  N N   . ASN F 1 206 ? 136.622 50.983 142.779 1.00 178.47 ? 206 ASN F N   1 
ATOM   8682  C CA  . ASN F 1 206 ? 137.087 49.606 142.627 1.00 178.47 ? 206 ASN F CA  1 
ATOM   8683  C C   . ASN F 1 206 ? 135.961 48.690 142.165 1.00 178.47 ? 206 ASN F C   1 
ATOM   8684  O O   . ASN F 1 206 ? 136.170 47.500 141.936 1.00 178.47 ? 206 ASN F O   1 
ATOM   8685  C CB  . ASN F 1 206 ? 137.641 49.086 143.952 1.00 159.29 ? 206 ASN F CB  1 
ATOM   8686  C CG  . ASN F 1 206 ? 138.698 49.991 144.531 1.00 159.29 ? 206 ASN F CG  1 
ATOM   8687  O OD1 . ASN F 1 206 ? 139.671 50.333 143.862 1.00 159.29 ? 206 ASN F OD1 1 
ATOM   8688  N ND2 . ASN F 1 206 ? 138.517 50.385 145.785 1.00 159.29 ? 206 ASN F ND2 1 
ATOM   8689  N N   . SER F 1 207 ? 134.766 49.256 142.039 1.00 113.82 ? 207 SER F N   1 
ATOM   8690  C CA  . SER F 1 207 ? 133.590 48.509 141.606 1.00 113.82 ? 207 SER F CA  1 
ATOM   8691  C C   . SER F 1 207 ? 133.407 48.605 140.091 1.00 113.82 ? 207 SER F C   1 
ATOM   8692  O O   . SER F 1 207 ? 132.465 48.039 139.539 1.00 113.82 ? 207 SER F O   1 
ATOM   8693  C CB  . SER F 1 207 ? 132.340 49.044 142.319 1.00 122.87 ? 207 SER F CB  1 
ATOM   8694  O OG  . SER F 1 207 ? 131.167 48.356 141.918 1.00 122.87 ? 207 SER F OG  1 
ATOM   8695  N N   . CYS F 1 208 ? 134.312 49.318 139.424 1.00 116.61 ? 208 CYS F N   1 
ATOM   8696  C CA  . CYS F 1 208 ? 134.246 49.487 137.970 1.00 116.61 ? 208 CYS F CA  1 
ATOM   8697  C C   . CYS F 1 208 ? 135.319 48.659 137.267 1.00 116.61 ? 208 CYS F C   1 
ATOM   8698  O O   . CYS F 1 208 ? 136.112 48.014 137.985 1.00 116.61 ? 208 CYS F O   1 
ATOM   8699  C CB  . CYS F 1 208 ? 134.428 50.964 137.591 1.00 82.98  ? 208 CYS F CB  1 
ATOM   8700  S SG  . CYS F 1 208 ? 133.284 52.112 138.377 1.00 82.98  ? 208 CYS F SG  1 
ATOM   8701  N N   . CYS G 1 25  ? 124.126 47.938 133.318 1.00 142.80 ? 25  CYS G N   1 
ATOM   8702  C CA  . CYS G 1 25  ? 123.880 49.410 133.275 1.00 142.80 ? 25  CYS G CA  1 
ATOM   8703  C C   . CYS G 1 25  ? 123.082 49.883 134.494 1.00 142.80 ? 25  CYS G C   1 
ATOM   8704  O O   . CYS G 1 25  ? 123.170 49.289 135.567 1.00 142.80 ? 25  CYS G O   1 
ATOM   8705  C CB  . CYS G 1 25  ? 123.141 49.785 131.980 1.00 92.36  ? 25  CYS G CB  1 
ATOM   8706  S SG  . CYS G 1 25  ? 121.480 49.060 131.781 1.00 92.36  ? 25  CYS G SG  1 
ATOM   8707  N N   . PHE G 1 26  ? 122.309 50.953 134.330 1.00 66.62  ? 26  PHE G N   1 
ATOM   8708  C CA  . PHE G 1 26  ? 121.515 51.487 135.427 1.00 66.62  ? 26  PHE G CA  1 
ATOM   8709  C C   . PHE G 1 26  ? 120.270 50.626 135.647 1.00 66.62  ? 26  PHE G C   1 
ATOM   8710  O O   . PHE G 1 26  ? 119.577 50.287 134.693 1.00 66.62  ? 26  PHE G O   1 
ATOM   8711  C CB  . PHE G 1 26  ? 121.099 52.934 135.121 1.00 63.19  ? 26  PHE G CB  1 
ATOM   8712  C CG  . PHE G 1 26  ? 120.669 53.700 136.334 1.00 63.19  ? 26  PHE G CG  1 
ATOM   8713  C CD1 . PHE G 1 26  ? 121.613 54.292 137.164 1.00 63.19  ? 26  PHE G CD1 1 
ATOM   8714  C CD2 . PHE G 1 26  ? 119.336 53.756 136.697 1.00 63.19  ? 26  PHE G CD2 1 
ATOM   8715  C CE1 . PHE G 1 26  ? 121.233 54.928 138.352 1.00 63.19  ? 26  PHE G CE1 1 
ATOM   8716  C CE2 . PHE G 1 26  ? 118.942 54.386 137.880 1.00 63.19  ? 26  PHE G CE2 1 
ATOM   8717  C CZ  . PHE G 1 26  ? 119.890 54.973 138.712 1.00 63.19  ? 26  PHE G CZ  1 
ATOM   8718  N N   . GLY G 1 27  ? 119.976 50.292 136.901 1.00 77.66  ? 27  GLY G N   1 
ATOM   8719  C CA  . GLY G 1 27  ? 118.814 49.466 137.190 1.00 77.66  ? 27  GLY G CA  1 
ATOM   8720  C C   . GLY G 1 27  ? 119.252 48.017 137.153 1.00 77.66  ? 27  GLY G C   1 
ATOM   8721  O O   . GLY G 1 27  ? 118.630 47.144 137.757 1.00 77.66  ? 27  GLY G O   1 
ATOM   8722  N N   . GLN G 1 28  ? 120.341 47.777 136.424 1.00 72.51  ? 28  GLN G N   1 
ATOM   8723  C CA  . GLN G 1 28  ? 120.931 46.455 136.289 1.00 72.51  ? 28  GLN G CA  1 
ATOM   8724  C C   . GLN G 1 28  ? 121.974 46.246 137.407 1.00 72.51  ? 28  GLN G C   1 
ATOM   8725  O O   . GLN G 1 28  ? 121.761 45.465 138.338 1.00 72.51  ? 28  GLN G O   1 
ATOM   8726  C CB  . GLN G 1 28  ? 121.618 46.318 134.925 1.00 128.39 ? 28  GLN G CB  1 
ATOM   8727  C CG  . GLN G 1 28  ? 120.727 46.569 133.717 1.00 128.39 ? 28  GLN G CG  1 
ATOM   8728  C CD  . GLN G 1 28  ? 119.648 45.519 133.536 1.00 128.39 ? 28  GLN G CD  1 
ATOM   8729  O OE1 . GLN G 1 28  ? 118.971 45.488 132.507 1.00 128.39 ? 28  GLN G OE1 1 
ATOM   8730  N NE2 . GLN G 1 28  ? 119.478 44.656 134.535 1.00 128.39 ? 28  GLN G NE2 1 
ATOM   8731  N N   . CYS G 1 29  ? 123.095 46.958 137.304 1.00 74.56  ? 29  CYS G N   1 
ATOM   8732  C CA  . CYS G 1 29  ? 124.190 46.879 138.269 1.00 74.56  ? 29  CYS G CA  1 
ATOM   8733  C C   . CYS G 1 29  ? 123.783 46.558 139.707 1.00 74.56  ? 29  CYS G C   1 
ATOM   8734  O O   . CYS G 1 29  ? 122.773 47.045 140.216 1.00 74.56  ? 29  CYS G O   1 
ATOM   8735  C CB  . CYS G 1 29  ? 124.996 48.183 138.243 1.00 88.73  ? 29  CYS G CB  1 
ATOM   8736  S SG  . CYS G 1 29  ? 125.826 48.519 136.661 1.00 88.73  ? 29  CYS G SG  1 
ATOM   8737  N N   . GLN G 1 30  ? 124.582 45.713 140.350 1.00 95.90  ? 30  GLN G N   1 
ATOM   8738  C CA  . GLN G 1 30  ? 124.343 45.312 141.727 1.00 95.90  ? 30  GLN G CA  1 
ATOM   8739  C C   . GLN G 1 30  ? 125.525 45.839 142.520 1.00 95.90  ? 30  GLN G C   1 
ATOM   8740  O O   . GLN G 1 30  ? 126.649 45.869 142.014 1.00 95.90  ? 30  GLN G O   1 
ATOM   8741  C CB  . GLN G 1 30  ? 124.254 43.783 141.828 1.00 131.33 ? 30  GLN G CB  1 
ATOM   8742  C CG  . GLN G 1 30  ? 123.028 43.195 141.122 1.00 131.33 ? 30  GLN G CG  1 
ATOM   8743  C CD  . GLN G 1 30  ? 122.926 41.678 141.221 1.00 131.33 ? 30  GLN G CD  1 
ATOM   8744  O OE1 . GLN G 1 30  ? 123.004 41.109 142.311 1.00 131.33 ? 30  GLN G OE1 1 
ATOM   8745  N NE2 . GLN G 1 30  ? 122.732 41.019 140.078 1.00 131.33 ? 30  GLN G NE2 1 
ATOM   8746  N N   . TYR G 1 31  ? 125.275 46.277 143.750 1.00 80.75  ? 31  TYR G N   1 
ATOM   8747  C CA  . TYR G 1 31  ? 126.347 46.813 144.592 1.00 80.75  ? 31  TYR G CA  1 
ATOM   8748  C C   . TYR G 1 31  ? 127.327 45.740 145.038 1.00 80.75  ? 31  TYR G C   1 
ATOM   8749  O O   . TYR G 1 31  ? 126.922 44.656 145.457 1.00 80.75  ? 31  TYR G O   1 
ATOM   8750  C CB  . TYR G 1 31  ? 125.788 47.500 145.852 1.00 90.28  ? 31  TYR G CB  1 
ATOM   8751  C CG  . TYR G 1 31  ? 125.249 48.906 145.648 1.00 90.28  ? 31  TYR G CG  1 
ATOM   8752  C CD1 . TYR G 1 31  ? 123.877 49.154 145.653 1.00 90.28  ? 31  TYR G CD1 1 
ATOM   8753  C CD2 . TYR G 1 31  ? 126.112 49.981 145.420 1.00 90.28  ? 31  TYR G CD2 1 
ATOM   8754  C CE1 . TYR G 1 31  ? 123.378 50.428 145.432 1.00 90.28  ? 31  TYR G CE1 1 
ATOM   8755  C CE2 . TYR G 1 31  ? 125.620 51.257 145.195 1.00 90.28  ? 31  TYR G CE2 1 
ATOM   8756  C CZ  . TYR G 1 31  ? 124.252 51.473 145.199 1.00 90.28  ? 31  TYR G CZ  1 
ATOM   8757  O OH  . TYR G 1 31  ? 123.752 52.728 144.943 1.00 90.28  ? 31  TYR G OH  1 
ATOM   8758  N N   . THR G 1 32  ? 128.619 46.049 144.952 1.00 92.11  ? 32  THR G N   1 
ATOM   8759  C CA  . THR G 1 32  ? 129.638 45.105 145.386 1.00 92.11  ? 32  THR G CA  1 
ATOM   8760  C C   . THR G 1 32  ? 129.695 45.216 146.900 1.00 92.11  ? 32  THR G C   1 
ATOM   8761  O O   . THR G 1 32  ? 129.302 46.235 147.466 1.00 92.11  ? 32  THR G O   1 
ATOM   8762  C CB  . THR G 1 32  ? 131.024 45.444 144.822 1.00 74.48  ? 32  THR G CB  1 
ATOM   8763  O OG1 . THR G 1 32  ? 131.465 46.694 145.366 1.00 74.48  ? 32  THR G OG1 1 
ATOM   8764  C CG2 . THR G 1 32  ? 130.983 45.522 143.296 1.00 74.48  ? 32  THR G CG2 1 
ATOM   8765  N N   . ALA G 1 33  ? 130.177 44.167 147.555 1.00 101.12 ? 33  ALA G N   1 
ATOM   8766  C CA  . ALA G 1 33  ? 130.271 44.155 149.008 1.00 101.12 ? 33  ALA G CA  1 
ATOM   8767  C C   . ALA G 1 33  ? 130.967 45.398 149.553 1.00 101.12 ? 33  ALA G C   1 
ATOM   8768  O O   . ALA G 1 33  ? 130.506 45.993 150.526 1.00 101.12 ? 33  ALA G O   1 
ATOM   8769  C CB  . ALA G 1 33  ? 131.005 42.905 149.465 1.00 80.87  ? 33  ALA G CB  1 
ATOM   8770  N N   . GLU G 1 34  ? 132.069 45.796 148.919 1.00 60.20  ? 34  GLU G N   1 
ATOM   8771  C CA  . GLU G 1 34  ? 132.820 46.965 149.378 1.00 60.20  ? 34  GLU G CA  1 
ATOM   8772  C C   . GLU G 1 34  ? 131.950 48.215 149.425 1.00 60.20  ? 34  GLU G C   1 
ATOM   8773  O O   . GLU G 1 34  ? 131.739 48.812 150.500 1.00 60.20  ? 34  GLU G O   1 
ATOM   8774  C CB  . GLU G 1 34  ? 134.039 47.222 148.484 1.00 156.64 ? 34  GLU G CB  1 
ATOM   8775  C CG  . GLU G 1 34  ? 134.976 46.036 148.338 1.00 156.64 ? 34  GLU G CG  1 
ATOM   8776  C CD  . GLU G 1 34  ? 134.648 45.193 147.124 1.00 156.64 ? 34  GLU G CD  1 
ATOM   8777  O OE1 . GLU G 1 34  ? 134.759 45.718 145.995 1.00 156.64 ? 34  GLU G OE1 1 
ATOM   8778  O OE2 . GLU G 1 34  ? 134.278 44.013 147.295 1.00 156.64 ? 34  GLU G OE2 1 
ATOM   8779  N N   . GLU G 1 35  ? 131.442 48.602 148.252 1.00 74.40  ? 35  GLU G N   1 
ATOM   8780  C CA  . GLU G 1 35  ? 130.585 49.779 148.120 1.00 74.40  ? 35  GLU G CA  1 
ATOM   8781  C C   . GLU G 1 35  ? 129.340 49.698 148.994 1.00 74.40  ? 35  GLU G C   1 
ATOM   8782  O O   . GLU G 1 35  ? 128.947 50.684 149.599 1.00 74.40  ? 35  GLU G O   1 
ATOM   8783  C CB  . GLU G 1 35  ? 130.177 49.977 146.663 1.00 76.52  ? 35  GLU G CB  1 
ATOM   8784  C CG  . GLU G 1 35  ? 129.470 51.304 146.419 1.00 76.52  ? 35  GLU G CG  1 
ATOM   8785  C CD  . GLU G 1 35  ? 129.297 51.621 144.942 1.00 76.52  ? 35  GLU G CD  1 
ATOM   8786  O OE1 . GLU G 1 35  ? 128.915 52.768 144.627 1.00 76.52  ? 35  GLU G OE1 1 
ATOM   8787  O OE2 . GLU G 1 35  ? 129.544 50.730 144.096 1.00 76.52  ? 35  GLU G OE2 1 
ATOM   8788  N N   . TYR G 1 36  ? 128.720 48.527 149.058 1.00 45.68  ? 36  TYR G N   1 
ATOM   8789  C CA  . TYR G 1 36  ? 127.527 48.362 149.878 1.00 45.68  ? 36  TYR G CA  1 
ATOM   8790  C C   . TYR G 1 36  ? 127.811 48.724 151.332 1.00 45.68  ? 36  TYR G C   1 
ATOM   8791  O O   . TYR G 1 36  ? 127.078 49.494 151.962 1.00 45.68  ? 36  TYR G O   1 
ATOM   8792  C CB  . TYR G 1 36  ? 127.001 46.920 149.851 1.00 48.32  ? 36  TYR G CB  1 
ATOM   8793  C CG  . TYR G 1 36  ? 126.114 46.663 151.043 1.00 48.32  ? 36  TYR G CG  1 
ATOM   8794  C CD1 . TYR G 1 36  ? 124.849 47.233 151.128 1.00 48.32  ? 36  TYR G CD1 1 
ATOM   8795  C CD2 . TYR G 1 36  ? 126.591 45.969 152.142 1.00 48.32  ? 36  TYR G CD2 1 
ATOM   8796  C CE1 . TYR G 1 36  ? 124.082 47.129 152.286 1.00 48.32  ? 36  TYR G CE1 1 
ATOM   8797  C CE2 . TYR G 1 36  ? 125.838 45.860 153.306 1.00 48.32  ? 36  TYR G CE2 1 
ATOM   8798  C CZ  . TYR G 1 36  ? 124.582 46.443 153.376 1.00 48.32  ? 36  TYR G CZ  1 
ATOM   8799  O OH  . TYR G 1 36  ? 123.843 46.337 154.548 1.00 48.32  ? 36  TYR G OH  1 
ATOM   8800  N N   . GLN G 1 37  ? 128.869 48.134 151.872 1.00 93.56  ? 37  GLN G N   1 
ATOM   8801  C CA  . GLN G 1 37  ? 129.237 48.370 153.259 1.00 93.56  ? 37  GLN G CA  1 
ATOM   8802  C C   . GLN G 1 37  ? 129.569 49.836 153.540 1.00 93.56  ? 37  GLN G C   1 
ATOM   8803  O O   . GLN G 1 37  ? 129.127 50.388 154.548 1.00 93.56  ? 37  GLN G O   1 
ATOM   8804  C CB  . GLN G 1 37  ? 130.420 47.491 153.629 1.00 186.47 ? 37  GLN G CB  1 
ATOM   8805  C CG  . GLN G 1 37  ? 130.516 47.237 155.102 1.00 186.47 ? 37  GLN G CG  1 
ATOM   8806  C CD  . GLN G 1 37  ? 131.667 46.338 155.445 1.00 186.47 ? 37  GLN G CD  1 
ATOM   8807  O OE1 . GLN G 1 37  ? 131.679 45.725 156.504 1.00 186.47 ? 37  GLN G OE1 1 
ATOM   8808  N NE2 . GLN G 1 37  ? 132.652 46.257 154.555 1.00 186.47 ? 37  GLN G NE2 1 
ATOM   8809  N N   . ALA G 1 38  ? 130.348 50.458 152.652 1.00 82.63  ? 38  ALA G N   1 
ATOM   8810  C CA  . ALA G 1 38  ? 130.727 51.868 152.803 1.00 82.63  ? 38  ALA G CA  1 
ATOM   8811  C C   . ALA G 1 38  ? 129.483 52.731 152.899 1.00 82.63  ? 38  ALA G C   1 
ATOM   8812  O O   . ALA G 1 38  ? 129.237 53.395 153.913 1.00 82.63  ? 38  ALA G O   1 
ATOM   8813  C CB  . ALA G 1 38  ? 131.561 52.330 151.617 1.00 20.59  ? 38  ALA G CB  1 
ATOM   8814  N N   . ILE G 1 39  ? 128.713 52.724 151.816 1.00 59.97  ? 39  ILE G N   1 
ATOM   8815  C CA  . ILE G 1 39  ? 127.479 53.475 151.743 1.00 59.97  ? 39  ILE G CA  1 
ATOM   8816  C C   . ILE G 1 39  ? 126.564 53.151 152.923 1.00 59.97  ? 39  ILE G C   1 
ATOM   8817  O O   . ILE G 1 39  ? 126.004 54.053 153.537 1.00 59.97  ? 39  ILE G O   1 
ATOM   8818  C CB  . ILE G 1 39  ? 126.752 53.184 150.395 1.00 46.87  ? 39  ILE G CB  1 
ATOM   8819  C CG1 . ILE G 1 39  ? 127.550 53.820 149.259 1.00 46.87  ? 39  ILE G CG1 1 
ATOM   8820  C CG2 . ILE G 1 39  ? 125.309 53.722 150.400 1.00 46.87  ? 39  ILE G CG2 1 
ATOM   8821  C CD1 . ILE G 1 39  ? 127.093 53.428 147.865 1.00 46.87  ? 39  ILE G CD1 1 
ATOM   8822  N N   . GLN G 1 40  ? 126.417 51.874 153.256 1.00 62.46  ? 40  GLN G N   1 
ATOM   8823  C CA  . GLN G 1 40  ? 125.528 51.501 154.359 1.00 62.46  ? 40  GLN G CA  1 
ATOM   8824  C C   . GLN G 1 40  ? 125.933 52.176 155.664 1.00 62.46  ? 40  GLN G C   1 
ATOM   8825  O O   . GLN G 1 40  ? 125.072 52.580 156.446 1.00 62.46  ? 40  GLN G O   1 
ATOM   8826  C CB  . GLN G 1 40  ? 125.480 49.969 154.548 1.00 65.31  ? 40  GLN G CB  1 
ATOM   8827  C CG  . GLN G 1 40  ? 124.755 49.520 155.832 1.00 65.31  ? 40  GLN G CG  1 
ATOM   8828  C CD  . GLN G 1 40  ? 123.256 49.744 155.783 1.00 65.31  ? 40  GLN G CD  1 
ATOM   8829  O OE1 . GLN G 1 40  ? 122.779 50.613 155.060 1.00 65.31  ? 40  GLN G OE1 1 
ATOM   8830  N NE2 . GLN G 1 40  ? 122.505 48.964 156.565 1.00 65.31  ? 40  GLN G NE2 1 
ATOM   8831  N N   . LYS G 1 41  ? 127.241 52.287 155.896 1.00 99.02  ? 41  LYS G N   1 
ATOM   8832  C CA  . LYS G 1 41  ? 127.740 52.920 157.109 1.00 99.02  ? 41  LYS G CA  1 
ATOM   8833  C C   . LYS G 1 41  ? 127.599 54.418 156.974 1.00 99.02  ? 41  LYS G C   1 
ATOM   8834  O O   . LYS G 1 41  ? 127.001 55.070 157.828 1.00 99.02  ? 41  LYS G O   1 
ATOM   8835  C CB  . LYS G 1 41  ? 129.202 52.561 157.339 1.00 199.96 ? 41  LYS G CB  1 
ATOM   8836  C CG  . LYS G 1 41  ? 129.400 51.096 157.605 1.00 199.96 ? 41  LYS G CG  1 
ATOM   8837  C CD  . LYS G 1 41  ? 130.830 50.776 157.928 1.00 199.96 ? 41  LYS G CD  1 
ATOM   8838  C CE  . LYS G 1 41  ? 130.986 49.277 158.102 1.00 199.96 ? 41  LYS G CE  1 
ATOM   8839  N NZ  . LYS G 1 41  ? 130.177 48.762 159.234 1.00 199.96 ? 41  LYS G NZ  1 
ATOM   8840  N N   . ALA G 1 42  ? 128.146 54.956 155.890 1.00 73.21  ? 42  ALA G N   1 
ATOM   8841  C CA  . ALA G 1 42  ? 128.077 56.388 155.625 1.00 73.21  ? 42  ALA G CA  1 
ATOM   8842  C C   . ALA G 1 42  ? 126.655 56.959 155.817 1.00 73.21  ? 42  ALA G C   1 
ATOM   8843  O O   . ALA G 1 42  ? 126.463 57.929 156.543 1.00 73.21  ? 42  ALA G O   1 
ATOM   8844  C CB  . ALA G 1 42  ? 128.609 56.681 154.194 1.00 19.25  ? 42  ALA G CB  1 
ATOM   8845  N N   . LEU G 1 43  ? 125.659 56.354 155.185 1.00 70.33  ? 43  LEU G N   1 
ATOM   8846  C CA  . LEU G 1 43  ? 124.284 56.827 155.318 1.00 70.33  ? 43  LEU G CA  1 
ATOM   8847  C C   . LEU G 1 43  ? 123.766 56.969 156.749 1.00 70.33  ? 43  LEU G C   1 
ATOM   8848  O O   . LEU G 1 43  ? 122.743 57.618 156.967 1.00 70.33  ? 43  LEU G O   1 
ATOM   8849  C CB  . LEU G 1 43  ? 123.336 55.907 154.552 1.00 123.91 ? 43  LEU G CB  1 
ATOM   8850  C CG  . LEU G 1 43  ? 123.366 56.049 153.036 1.00 123.91 ? 43  LEU G CG  1 
ATOM   8851  C CD1 . LEU G 1 43  ? 122.535 54.952 152.402 1.00 123.91 ? 43  LEU G CD1 1 
ATOM   8852  C CD2 . LEU G 1 43  ? 122.846 57.421 152.655 1.00 123.91 ? 43  LEU G CD2 1 
ATOM   8853  N N   . ARG G 1 44  ? 124.445 56.355 157.715 1.00 76.33  ? 44  ARG G N   1 
ATOM   8854  C CA  . ARG G 1 44  ? 124.014 56.441 159.115 1.00 76.33  ? 44  ARG G CA  1 
ATOM   8855  C C   . ARG G 1 44  ? 124.345 57.805 159.716 1.00 76.33  ? 44  ARG G C   1 
ATOM   8856  O O   . ARG G 1 44  ? 123.617 58.294 160.586 1.00 76.33  ? 44  ARG G O   1 
ATOM   8857  C CB  . ARG G 1 44  ? 124.659 55.331 159.964 1.00 115.47 ? 44  ARG G CB  1 
ATOM   8858  C CG  . ARG G 1 44  ? 123.874 54.019 159.997 1.00 115.47 ? 44  ARG G CG  1 
ATOM   8859  C CD  . ARG G 1 44  ? 124.459 53.024 161.001 1.00 115.47 ? 44  ARG G CD  1 
ATOM   8860  N NE  . ARG G 1 44  ? 125.533 52.202 160.444 1.00 115.47 ? 44  ARG G NE  1 
ATOM   8861  C CZ  . ARG G 1 44  ? 125.358 50.980 159.951 1.00 115.47 ? 44  ARG G CZ  1 
ATOM   8862  N NH1 . ARG G 1 44  ? 124.150 50.429 159.945 1.00 115.47 ? 44  ARG G NH1 1 
ATOM   8863  N NH2 . ARG G 1 44  ? 126.392 50.304 159.468 1.00 115.47 ? 44  ARG G NH2 1 
ATOM   8864  N N   . GLN G 1 45  ? 125.441 58.405 159.239 1.00 108.84 ? 45  GLN G N   1 
ATOM   8865  C CA  . GLN G 1 45  ? 125.913 59.717 159.699 1.00 108.84 ? 45  GLN G CA  1 
ATOM   8866  C C   . GLN G 1 45  ? 124.799 60.731 159.822 1.00 108.84 ? 45  GLN G C   1 
ATOM   8867  O O   . GLN G 1 45  ? 123.840 60.706 159.062 1.00 108.84 ? 45  GLN G O   1 
ATOM   8868  C CB  . GLN G 1 45  ? 126.949 60.295 158.731 1.00 65.80  ? 45  GLN G CB  1 
ATOM   8869  C CG  . GLN G 1 45  ? 128.259 59.560 158.702 1.00 65.80  ? 45  GLN G CG  1 
ATOM   8870  C CD  . GLN G 1 45  ? 129.201 60.087 157.641 1.00 65.80  ? 45  GLN G CD  1 
ATOM   8871  O OE1 . GLN G 1 45  ? 129.040 59.811 156.446 1.00 65.80  ? 45  GLN G OE1 1 
ATOM   8872  N NE2 . GLN G 1 45  ? 130.193 60.863 158.071 1.00 65.80  ? 45  GLN G NE2 1 
ATOM   8873  N N   . ARG G 1 46  ? 124.924 61.625 160.787 1.00 86.67  ? 46  ARG G N   1 
ATOM   8874  C CA  . ARG G 1 46  ? 123.934 62.669 160.950 1.00 86.67  ? 46  ARG G CA  1 
ATOM   8875  C C   . ARG G 1 46  ? 124.558 63.894 160.309 1.00 86.67  ? 46  ARG G C   1 
ATOM   8876  O O   . ARG G 1 46  ? 125.785 63.988 160.225 1.00 86.67  ? 46  ARG G O   1 
ATOM   8877  C CB  . ARG G 1 46  ? 123.663 62.910 162.421 1.00 77.50  ? 46  ARG G CB  1 
ATOM   8878  C CG  . ARG G 1 46  ? 122.872 61.812 163.066 1.00 77.50  ? 46  ARG G CG  1 
ATOM   8879  C CD  . ARG G 1 46  ? 121.885 62.458 163.995 1.00 77.50  ? 46  ARG G CD  1 
ATOM   8880  N NE  . ARG G 1 46  ? 120.871 61.546 164.504 1.00 77.50  ? 46  ARG G NE  1 
ATOM   8881  C CZ  . ARG G 1 46  ? 121.128 60.529 165.314 1.00 77.50  ? 46  ARG G CZ  1 
ATOM   8882  N NH1 . ARG G 1 46  ? 122.380 60.295 165.698 1.00 77.50  ? 46  ARG G NH1 1 
ATOM   8883  N NH2 . ARG G 1 46  ? 120.128 59.767 165.752 1.00 77.50  ? 46  ARG G NH2 1 
ATOM   8884  N N   . LEU G 1 47  ? 123.742 64.826 159.832 1.00 68.19  ? 47  LEU G N   1 
ATOM   8885  C CA  . LEU G 1 47  ? 124.319 66.007 159.197 1.00 68.19  ? 47  LEU G CA  1 
ATOM   8886  C C   . LEU G 1 47  ? 124.826 67.022 160.209 1.00 68.19  ? 47  LEU G C   1 
ATOM   8887  O O   . LEU G 1 47  ? 124.275 67.149 161.303 1.00 68.19  ? 47  LEU G O   1 
ATOM   8888  C CB  . LEU G 1 47  ? 123.307 66.683 158.261 1.00 99.25  ? 47  LEU G CB  1 
ATOM   8889  C CG  . LEU G 1 47  ? 123.012 65.987 156.937 1.00 99.25  ? 47  LEU G CG  1 
ATOM   8890  C CD1 . LEU G 1 47  ? 124.320 65.652 156.222 1.00 99.25  ? 47  LEU G CD1 1 
ATOM   8891  C CD2 . LEU G 1 47  ? 122.218 64.736 157.215 1.00 99.25  ? 47  LEU G CD2 1 
ATOM   8892  N N   . GLY G 1 48  ? 125.889 67.726 159.834 1.00 187.80 ? 48  GLY G N   1 
ATOM   8893  C CA  . GLY G 1 48  ? 126.442 68.744 160.703 1.00 187.80 ? 48  GLY G CA  1 
ATOM   8894  C C   . GLY G 1 48  ? 125.637 70.014 160.514 1.00 187.80 ? 48  GLY G C   1 
ATOM   8895  O O   . GLY G 1 48  ? 124.786 70.073 159.628 1.00 187.80 ? 48  GLY G O   1 
ATOM   8896  N N   . PRO G 1 49  ? 125.866 71.046 161.332 1.00 118.08 ? 49  PRO G N   1 
ATOM   8897  C CA  . PRO G 1 49  ? 125.113 72.292 161.185 1.00 118.08 ? 49  PRO G CA  1 
ATOM   8898  C C   . PRO G 1 49  ? 125.362 72.998 159.843 1.00 118.08 ? 49  PRO G C   1 
ATOM   8899  O O   . PRO G 1 49  ? 124.620 73.908 159.471 1.00 118.08 ? 49  PRO G O   1 
ATOM   8900  C CB  . PRO G 1 49  ? 125.594 73.116 162.375 1.00 152.70 ? 49  PRO G CB  1 
ATOM   8901  C CG  . PRO G 1 49  ? 125.921 72.066 163.398 1.00 152.70 ? 49  PRO G CG  1 
ATOM   8902  C CD  . PRO G 1 49  ? 126.664 71.062 162.569 1.00 152.70 ? 49  PRO G CD  1 
ATOM   8903  N N   . GLU G 1 50  ? 126.402 72.575 159.124 1.00 89.09  ? 50  GLU G N   1 
ATOM   8904  C CA  . GLU G 1 50  ? 126.751 73.168 157.834 1.00 89.09  ? 50  GLU G CA  1 
ATOM   8905  C C   . GLU G 1 50  ? 125.709 72.859 156.774 1.00 89.09  ? 50  GLU G C   1 
ATOM   8906  O O   . GLU G 1 50  ? 125.723 73.440 155.691 1.00 89.09  ? 50  GLU G O   1 
ATOM   8907  C CB  . GLU G 1 50  ? 128.095 72.637 157.342 1.00 88.15  ? 50  GLU G CB  1 
ATOM   8908  C CG  . GLU G 1 50  ? 129.215 72.763 158.337 1.00 88.15  ? 50  GLU G CG  1 
ATOM   8909  C CD  . GLU G 1 50  ? 129.280 71.605 159.309 1.00 88.15  ? 50  GLU G CD  1 
ATOM   8910  O OE1 . GLU G 1 50  ? 128.242 71.234 159.900 1.00 88.15  ? 50  GLU G OE1 1 
ATOM   8911  O OE2 . GLU G 1 50  ? 130.392 71.071 159.484 1.00 88.15  ? 50  GLU G OE2 1 
ATOM   8912  N N   . TYR G 1 51  ? 124.812 71.931 157.085 1.00 125.17 ? 51  TYR G N   1 
ATOM   8913  C CA  . TYR G 1 51  ? 123.783 71.525 156.142 1.00 125.17 ? 51  TYR G CA  1 
ATOM   8914  C C   . TYR G 1 51  ? 122.413 72.102 156.450 1.00 125.17 ? 51  TYR G C   1 
ATOM   8915  O O   . TYR G 1 51  ? 121.609 72.323 155.544 1.00 125.17 ? 51  TYR G O   1 
ATOM   8916  C CB  . TYR G 1 51  ? 123.692 69.992 156.091 1.00 91.43  ? 51  TYR G CB  1 
ATOM   8917  C CG  . TYR G 1 51  ? 124.867 69.330 155.394 1.00 91.43  ? 51  TYR G CG  1 
ATOM   8918  C CD1 . TYR G 1 51  ? 125.872 68.692 156.118 1.00 91.43  ? 51  TYR G CD1 1 
ATOM   8919  C CD2 . TYR G 1 51  ? 124.982 69.367 154.002 1.00 91.43  ? 51  TYR G CD2 1 
ATOM   8920  C CE1 . TYR G 1 51  ? 126.959 68.110 155.472 1.00 91.43  ? 51  TYR G CE1 1 
ATOM   8921  C CE2 . TYR G 1 51  ? 126.062 68.791 153.349 1.00 91.43  ? 51  TYR G CE2 1 
ATOM   8922  C CZ  . TYR G 1 51  ? 127.045 68.165 154.086 1.00 91.43  ? 51  TYR G CZ  1 
ATOM   8923  O OH  . TYR G 1 51  ? 128.112 67.600 153.430 1.00 91.43  ? 51  TYR G OH  1 
ATOM   8924  N N   . ILE G 1 52  ? 122.152 72.358 157.725 1.00 94.31  ? 52  ILE G N   1 
ATOM   8925  C CA  . ILE G 1 52  ? 120.853 72.877 158.124 1.00 94.31  ? 52  ILE G CA  1 
ATOM   8926  C C   . ILE G 1 52  ? 120.635 74.357 157.836 1.00 94.31  ? 52  ILE G C   1 
ATOM   8927  O O   . ILE G 1 52  ? 121.586 75.129 157.683 1.00 94.31  ? 52  ILE G O   1 
ATOM   8928  C CB  . ILE G 1 52  ? 120.593 72.631 159.615 1.00 74.72  ? 52  ILE G CB  1 
ATOM   8929  C CG1 . ILE G 1 52  ? 121.086 71.236 159.997 1.00 74.72  ? 52  ILE G CG1 1 
ATOM   8930  C CG2 . ILE G 1 52  ? 119.096 72.772 159.914 1.00 74.72  ? 52  ILE G CG2 1 
ATOM   8931  C CD1 . ILE G 1 52  ? 120.503 70.120 159.152 1.00 74.72  ? 52  ILE G CD1 1 
ATOM   8932  N N   . SER G 1 53  ? 119.360 74.726 157.758 1.00 87.17  ? 53  SER G N   1 
ATOM   8933  C CA  . SER G 1 53  ? 118.930 76.091 157.493 1.00 87.17  ? 53  SER G CA  1 
ATOM   8934  C C   . SER G 1 53  ? 117.645 76.278 158.283 1.00 87.17  ? 53  SER G C   1 
ATOM   8935  O O   . SER G 1 53  ? 117.209 75.366 158.998 1.00 87.17  ? 53  SER G O   1 
ATOM   8936  C CB  . SER G 1 53  ? 118.630 76.291 155.999 1.00 68.59  ? 53  SER G CB  1 
ATOM   8937  O OG  . SER G 1 53  ? 119.763 76.033 155.190 1.00 68.59  ? 53  SER G OG  1 
ATOM   8938  N N   . SER G 1 54  ? 117.038 77.455 158.153 1.00 108.40 ? 54  SER G N   1 
ATOM   8939  C CA  . SER G 1 54  ? 115.785 77.738 158.843 1.00 108.40 ? 54  SER G CA  1 
ATOM   8940  C C   . SER G 1 54  ? 114.932 78.838 158.199 1.00 108.40 ? 54  SER G C   1 
ATOM   8941  O O   . SER G 1 54  ? 115.427 79.720 157.490 1.00 108.40 ? 54  SER G O   1 
ATOM   8942  C CB  . SER G 1 54  ? 116.051 78.075 160.314 1.00 111.64 ? 54  SER G CB  1 
ATOM   8943  O OG  . SER G 1 54  ? 116.933 79.172 160.442 1.00 111.64 ? 54  SER G OG  1 
ATOM   8944  N N   . ARG G 1 55  ? 113.632 78.742 158.447 1.00 106.48 ? 55  ARG G N   1 
ATOM   8945  C CA  . ARG G 1 55  ? 112.644 79.685 157.946 1.00 106.48 ? 55  ARG G CA  1 
ATOM   8946  C C   . ARG G 1 55  ? 111.730 79.955 159.125 1.00 106.48 ? 55  ARG G C   1 
ATOM   8947  O O   . ARG G 1 55  ? 111.692 79.166 160.072 1.00 106.48 ? 55  ARG G O   1 
ATOM   8948  C CB  . ARG G 1 55  ? 111.826 79.063 156.820 1.00 142.20 ? 55  ARG G CB  1 
ATOM   8949  C CG  . ARG G 1 55  ? 112.545 78.913 155.496 1.00 142.20 ? 55  ARG G CG  1 
ATOM   8950  C CD  . ARG G 1 55  ? 112.056 77.657 154.786 1.00 142.20 ? 55  ARG G CD  1 
ATOM   8951  N NE  . ARG G 1 55  ? 110.653 77.369 155.079 1.00 142.20 ? 55  ARG G NE  1 
ATOM   8952  C CZ  . ARG G 1 55  ? 110.055 76.209 154.823 1.00 142.20 ? 55  ARG G CZ  1 
ATOM   8953  N NH1 . ARG G 1 55  ? 110.736 75.216 154.264 1.00 142.20 ? 55  ARG G NH1 1 
ATOM   8954  N NH2 . ARG G 1 55  ? 108.775 76.039 155.134 1.00 142.20 ? 55  ARG G NH2 1 
ATOM   8955  N N   . MET G 1 56  ? 110.988 81.054 159.078 1.00 138.83 ? 56  MET G N   1 
ATOM   8956  C CA  . MET G 1 56  ? 110.095 81.370 160.179 1.00 138.83 ? 56  MET G CA  1 
ATOM   8957  C C   . MET G 1 56  ? 108.686 80.916 159.850 1.00 138.83 ? 56  MET G C   1 
ATOM   8958  O O   . MET G 1 56  ? 107.994 81.553 159.064 1.00 138.83 ? 56  MET G O   1 
ATOM   8959  C CB  . MET G 1 56  ? 110.115 82.870 160.466 1.00 144.59 ? 56  MET G CB  1 
ATOM   8960  C CG  . MET G 1 56  ? 109.807 83.205 161.911 1.00 144.59 ? 56  MET G CG  1 
ATOM   8961  S SD  . MET G 1 56  ? 110.771 82.160 163.034 1.00 144.59 ? 56  MET G SD  1 
ATOM   8962  C CE  . MET G 1 56  ? 112.450 82.723 162.705 1.00 144.59 ? 56  MET G CE  1 
ATOM   8963  N N   . ALA G 1 57  ? 108.273 79.802 160.447 1.00 199.94 ? 57  ALA G N   1 
ATOM   8964  C CA  . ALA G 1 57  ? 106.942 79.254 160.220 1.00 199.94 ? 57  ALA G CA  1 
ATOM   8965  C C   . ALA G 1 57  ? 105.889 80.335 160.421 1.00 199.94 ? 57  ALA G C   1 
ATOM   8966  O O   . ALA G 1 57  ? 105.938 81.072 161.406 1.00 199.94 ? 57  ALA G O   1 
ATOM   8967  C CB  . ALA G 1 57  ? 106.688 78.095 161.177 1.00 88.01  ? 57  ALA G CB  1 
ATOM   8968  N N   . GLY G 1 58  ? 104.945 80.431 159.488 1.00 174.00 ? 58  GLY G N   1 
ATOM   8969  C CA  . GLY G 1 58  ? 103.895 81.429 159.602 1.00 174.00 ? 58  GLY G CA  1 
ATOM   8970  C C   . GLY G 1 58  ? 103.181 81.301 160.934 1.00 174.00 ? 58  GLY G C   1 
ATOM   8971  O O   . GLY G 1 58  ? 102.262 80.495 161.077 1.00 174.00 ? 58  GLY G O   1 
ATOM   8972  N N   . GLY G 1 59  ? 103.604 82.098 161.911 1.00 183.90 ? 59  GLY G N   1 
ATOM   8973  C CA  . GLY G 1 59  ? 103.003 82.038 163.230 1.00 183.90 ? 59  GLY G CA  1 
ATOM   8974  C C   . GLY G 1 59  ? 103.737 81.023 164.086 1.00 183.90 ? 59  GLY G C   1 
ATOM   8975  O O   . GLY G 1 59  ? 103.923 81.220 165.288 1.00 183.90 ? 59  GLY G O   1 
ATOM   8976  N N   . GLY G 1 60  ? 104.163 79.933 163.454 1.00 170.09 ? 60  GLY G N   1 
ATOM   8977  C CA  . GLY G 1 60  ? 104.880 78.890 164.162 1.00 170.09 ? 60  GLY G CA  1 
ATOM   8978  C C   . GLY G 1 60  ? 106.284 79.308 164.546 1.00 170.09 ? 60  GLY G C   1 
ATOM   8979  O O   . GLY G 1 60  ? 106.635 80.487 164.471 1.00 170.09 ? 60  GLY G O   1 
ATOM   8980  N N   . GLN G 1 61  ? 107.093 78.337 164.954 1.00 167.21 ? 61  GLN G N   1 
ATOM   8981  C CA  . GLN G 1 61  ? 108.464 78.614 165.358 1.00 167.21 ? 61  GLN G CA  1 
ATOM   8982  C C   . GLN G 1 61  ? 109.431 78.556 164.182 1.00 167.21 ? 61  GLN G C   1 
ATOM   8983  O O   . GLN G 1 61  ? 109.055 78.753 163.025 1.00 167.21 ? 61  GLN G O   1 
ATOM   8984  C CB  . GLN G 1 61  ? 108.928 77.613 166.427 1.00 169.53 ? 61  GLN G CB  1 
ATOM   8985  C CG  . GLN G 1 61  ? 108.056 77.527 167.675 1.00 169.53 ? 61  GLN G CG  1 
ATOM   8986  C CD  . GLN G 1 61  ? 106.915 76.540 167.528 1.00 169.53 ? 61  GLN G CD  1 
ATOM   8987  O OE1 . GLN G 1 61  ? 106.046 76.704 166.674 1.00 169.53 ? 61  GLN G OE1 1 
ATOM   8988  N NE2 . GLN G 1 61  ? 106.915 75.504 168.361 1.00 169.53 ? 61  GLN G NE2 1 
ATOM   8989  N N   . LYS G 1 62  ? 110.687 78.284 164.510 1.00 138.02 ? 62  LYS G N   1 
ATOM   8990  C CA  . LYS G 1 62  ? 111.755 78.175 163.534 1.00 138.02 ? 62  LYS G CA  1 
ATOM   8991  C C   . LYS G 1 62  ? 111.727 76.768 162.949 1.00 138.02 ? 62  LYS G C   1 
ATOM   8992  O O   . LYS G 1 62  ? 111.782 75.786 163.687 1.00 138.02 ? 62  LYS G O   1 
ATOM   8993  C CB  . LYS G 1 62  ? 113.096 78.432 164.228 1.00 125.69 ? 62  LYS G CB  1 
ATOM   8994  C CG  . LYS G 1 62  ? 114.328 78.124 163.394 1.00 125.69 ? 62  LYS G CG  1 
ATOM   8995  C CD  . LYS G 1 62  ? 115.585 78.225 164.247 1.00 125.69 ? 62  LYS G CD  1 
ATOM   8996  C CE  . LYS G 1 62  ? 116.830 77.807 163.477 1.00 125.69 ? 62  LYS G CE  1 
ATOM   8997  N NZ  . LYS G 1 62  ? 118.063 77.932 164.306 1.00 125.69 ? 62  LYS G NZ  1 
ATOM   8998  N N   . VAL G 1 63  ? 111.631 76.668 161.627 1.00 94.93  ? 63  VAL G N   1 
ATOM   8999  C CA  . VAL G 1 63  ? 111.606 75.368 160.973 1.00 94.93  ? 63  VAL G CA  1 
ATOM   9000  C C   . VAL G 1 63  ? 112.921 75.102 160.249 1.00 94.93  ? 63  VAL G C   1 
ATOM   9001  O O   . VAL G 1 63  ? 113.347 75.892 159.407 1.00 94.93  ? 63  VAL G O   1 
ATOM   9002  C CB  . VAL G 1 63  ? 110.448 75.279 159.973 1.00 88.36  ? 63  VAL G CB  1 
ATOM   9003  C CG1 . VAL G 1 63  ? 110.466 73.934 159.282 1.00 88.36  ? 63  VAL G CG1 1 
ATOM   9004  C CG2 . VAL G 1 63  ? 109.133 75.468 160.699 1.00 88.36  ? 63  VAL G CG2 1 
ATOM   9005  N N   . CYS G 1 64  ? 113.561 73.986 160.593 1.00 91.73  ? 64  CYS G N   1 
ATOM   9006  C CA  . CYS G 1 64  ? 114.833 73.608 159.988 1.00 91.73  ? 64  CYS G CA  1 
ATOM   9007  C C   . CYS G 1 64  ? 114.603 72.780 158.735 1.00 91.73  ? 64  CYS G C   1 
ATOM   9008  O O   . CYS G 1 64  ? 113.619 72.050 158.633 1.00 91.73  ? 64  CYS G O   1 
ATOM   9009  C CB  . CYS G 1 64  ? 115.674 72.805 160.978 1.00 109.61 ? 64  CYS G CB  1 
ATOM   9010  S SG  . CYS G 1 64  ? 116.067 73.688 162.479 1.00 109.61 ? 64  CYS G SG  1 
ATOM   9011  N N   . TYR G 1 65  ? 115.525 72.887 157.788 1.00 84.03  ? 65  TYR G N   1 
ATOM   9012  C CA  . TYR G 1 65  ? 115.408 72.151 156.542 1.00 84.03  ? 65  TYR G CA  1 
ATOM   9013  C C   . TYR G 1 65  ? 116.757 72.140 155.843 1.00 84.03  ? 65  TYR G C   1 
ATOM   9014  O O   . TYR G 1 65  ? 117.658 72.875 156.234 1.00 84.03  ? 65  TYR G O   1 
ATOM   9015  C CB  . TYR G 1 65  ? 114.373 72.833 155.648 1.00 79.62  ? 65  TYR G CB  1 
ATOM   9016  C CG  . TYR G 1 65  ? 114.830 74.162 155.071 1.00 79.62  ? 65  TYR G CG  1 
ATOM   9017  C CD1 . TYR G 1 65  ? 115.559 74.223 153.876 1.00 79.62  ? 65  TYR G CD1 1 
ATOM   9018  C CD2 . TYR G 1 65  ? 114.533 75.354 155.716 1.00 79.62  ? 65  TYR G CD2 1 
ATOM   9019  C CE1 . TYR G 1 65  ? 115.970 75.438 153.343 1.00 79.62  ? 65  TYR G CE1 1 
ATOM   9020  C CE2 . TYR G 1 65  ? 114.942 76.572 155.193 1.00 79.62  ? 65  TYR G CE2 1 
ATOM   9021  C CZ  . TYR G 1 65  ? 115.652 76.614 154.009 1.00 79.62  ? 65  TYR G CZ  1 
ATOM   9022  O OH  . TYR G 1 65  ? 115.995 77.840 153.481 1.00 79.62  ? 65  TYR G OH  1 
ATOM   9023  N N   . ILE G 1 66  ? 116.896 71.314 154.809 1.00 79.74  ? 66  ILE G N   1 
ATOM   9024  C CA  . ILE G 1 66  ? 118.148 71.259 154.063 1.00 79.74  ? 66  ILE G CA  1 
ATOM   9025  C C   . ILE G 1 66  ? 117.901 71.774 152.656 1.00 79.74  ? 66  ILE G C   1 
ATOM   9026  O O   . ILE G 1 66  ? 117.016 71.286 151.947 1.00 79.74  ? 66  ILE G O   1 
ATOM   9027  C CB  . ILE G 1 66  ? 118.709 69.822 153.990 1.00 63.79  ? 66  ILE G CB  1 
ATOM   9028  C CG1 . ILE G 1 66  ? 118.770 69.233 155.402 1.00 63.79  ? 66  ILE G CG1 1 
ATOM   9029  C CG2 . ILE G 1 66  ? 120.107 69.825 153.343 1.00 63.79  ? 66  ILE G CG2 1 
ATOM   9030  C CD1 . ILE G 1 66  ? 119.179 67.789 155.431 1.00 63.79  ? 66  ILE G CD1 1 
ATOM   9031  N N   . GLU G 1 67  ? 118.681 72.775 152.262 1.00 103.01 ? 67  GLU G N   1 
ATOM   9032  C CA  . GLU G 1 67  ? 118.543 73.362 150.943 1.00 103.01 ? 67  GLU G CA  1 
ATOM   9033  C C   . GLU G 1 67  ? 118.742 72.317 149.860 1.00 103.01 ? 67  GLU G C   1 
ATOM   9034  O O   . GLU G 1 67  ? 119.561 71.408 149.992 1.00 103.01 ? 67  GLU G O   1 
ATOM   9035  C CB  . GLU G 1 67  ? 119.539 74.508 150.764 1.00 112.49 ? 67  GLU G CB  1 
ATOM   9036  C CG  . GLU G 1 67  ? 119.287 75.670 151.711 1.00 112.49 ? 67  GLU G CG  1 
ATOM   9037  C CD  . GLU G 1 67  ? 120.213 76.843 151.461 1.00 112.49 ? 67  GLU G CD  1 
ATOM   9038  O OE1 . GLU G 1 67  ? 120.151 77.438 150.363 1.00 112.49 ? 67  GLU G OE1 1 
ATOM   9039  O OE2 . GLU G 1 67  ? 121.006 77.168 152.369 1.00 112.49 ? 67  GLU G OE2 1 
ATOM   9040  N N   . GLY G 1 68  ? 117.972 72.463 148.791 1.00 87.20  ? 68  GLY G N   1 
ATOM   9041  C CA  . GLY G 1 68  ? 118.044 71.538 147.683 1.00 87.20  ? 68  GLY G CA  1 
ATOM   9042  C C   . GLY G 1 68  ? 119.426 71.198 147.154 1.00 87.20  ? 68  GLY G C   1 
ATOM   9043  O O   . GLY G 1 68  ? 119.818 70.037 147.175 1.00 87.20  ? 68  GLY G O   1 
ATOM   9044  N N   . HIS G 1 69  ? 120.171 72.186 146.674 1.00 70.27  ? 69  HIS G N   1 
ATOM   9045  C CA  . HIS G 1 69  ? 121.489 71.898 146.120 1.00 70.27  ? 69  HIS G CA  1 
ATOM   9046  C C   . HIS G 1 69  ? 122.347 71.067 147.079 1.00 70.27  ? 69  HIS G C   1 
ATOM   9047  O O   . HIS G 1 69  ? 123.257 70.351 146.651 1.00 70.27  ? 69  HIS G O   1 
ATOM   9048  C CB  . HIS G 1 69  ? 122.217 73.198 145.748 1.00 125.08 ? 69  HIS G CB  1 
ATOM   9049  C CG  . HIS G 1 69  ? 122.561 74.065 146.922 1.00 125.08 ? 69  HIS G CG  1 
ATOM   9050  N ND1 . HIS G 1 69  ? 121.607 74.696 147.691 1.00 125.08 ? 69  HIS G ND1 1 
ATOM   9051  C CD2 . HIS G 1 69  ? 123.759 74.407 147.454 1.00 125.08 ? 69  HIS G CD2 1 
ATOM   9052  C CE1 . HIS G 1 69  ? 122.201 75.390 148.645 1.00 125.08 ? 69  HIS G CE1 1 
ATOM   9053  N NE2 . HIS G 1 69  ? 123.506 75.231 148.524 1.00 125.08 ? 69  HIS G NE2 1 
ATOM   9054  N N   . ARG G 1 70  ? 122.056 71.169 148.374 1.00 97.73  ? 70  ARG G N   1 
ATOM   9055  C CA  . ARG G 1 70  ? 122.794 70.409 149.379 1.00 97.73  ? 70  ARG G CA  1 
ATOM   9056  C C   . ARG G 1 70  ? 122.487 68.931 149.172 1.00 97.73  ? 70  ARG G C   1 
ATOM   9057  O O   . ARG G 1 70  ? 123.381 68.124 148.897 1.00 97.73  ? 70  ARG G O   1 
ATOM   9058  C CB  . ARG G 1 70  ? 122.363 70.826 150.791 1.00 107.72 ? 70  ARG G CB  1 
ATOM   9059  C CG  . ARG G 1 70  ? 122.776 72.236 151.178 1.00 107.72 ? 70  ARG G CG  1 
ATOM   9060  C CD  . ARG G 1 70  ? 124.260 72.338 151.535 1.00 107.72 ? 70  ARG G CD  1 
ATOM   9061  N NE  . ARG G 1 70  ? 124.713 73.727 151.578 1.00 107.72 ? 70  ARG G NE  1 
ATOM   9062  C CZ  . ARG G 1 70  ? 124.110 74.696 152.264 1.00 107.72 ? 70  ARG G CZ  1 
ATOM   9063  N NH1 . ARG G 1 70  ? 123.018 74.434 152.978 1.00 107.72 ? 70  ARG G NH1 1 
ATOM   9064  N NH2 . ARG G 1 70  ? 124.592 75.933 152.227 1.00 107.72 ? 70  ARG G NH2 1 
ATOM   9065  N N   . VAL G 1 71  ? 121.207 68.596 149.306 1.00 64.61  ? 71  VAL G N   1 
ATOM   9066  C CA  . VAL G 1 71  ? 120.730 67.234 149.140 1.00 64.61  ? 71  VAL G CA  1 
ATOM   9067  C C   . VAL G 1 71  ? 121.215 66.628 147.822 1.00 64.61  ? 71  VAL G C   1 
ATOM   9068  O O   . VAL G 1 71  ? 121.551 65.446 147.764 1.00 64.61  ? 71  VAL G O   1 
ATOM   9069  C CB  . VAL G 1 71  ? 119.193 67.195 149.207 1.00 52.60  ? 71  VAL G CB  1 
ATOM   9070  C CG1 . VAL G 1 71  ? 118.692 65.793 148.957 1.00 52.60  ? 71  VAL G CG1 1 
ATOM   9071  C CG2 . VAL G 1 71  ? 118.729 67.641 150.581 1.00 52.60  ? 71  VAL G CG2 1 
ATOM   9072  N N   . ILE G 1 72  ? 121.265 67.429 146.763 1.00 57.80  ? 72  ILE G N   1 
ATOM   9073  C CA  . ILE G 1 72  ? 121.748 66.910 145.491 1.00 57.80  ? 72  ILE G CA  1 
ATOM   9074  C C   . ILE G 1 72  ? 123.185 66.475 145.675 1.00 57.80  ? 72  ILE G C   1 
ATOM   9075  O O   . ILE G 1 72  ? 123.486 65.299 145.528 1.00 57.80  ? 72  ILE G O   1 
ATOM   9076  C CB  . ILE G 1 72  ? 121.639 67.954 144.332 1.00 55.54  ? 72  ILE G CB  1 
ATOM   9077  C CG1 . ILE G 1 72  ? 120.182 68.051 143.883 1.00 55.54  ? 72  ILE G CG1 1 
ATOM   9078  C CG2 . ILE G 1 72  ? 122.511 67.560 143.136 1.00 55.54  ? 72  ILE G CG2 1 
ATOM   9079  C CD1 . ILE G 1 72  ? 119.961 69.026 142.737 1.00 55.54  ? 72  ILE G CD1 1 
ATOM   9080  N N   . ASN G 1 73  ? 124.069 67.401 146.032 1.00 69.12  ? 73  ASN G N   1 
ATOM   9081  C CA  . ASN G 1 73  ? 125.480 67.052 146.218 1.00 69.12  ? 73  ASN G CA  1 
ATOM   9082  C C   . ASN G 1 73  ? 125.723 65.910 147.217 1.00 69.12  ? 73  ASN G C   1 
ATOM   9083  O O   . ASN G 1 73  ? 126.623 65.084 147.026 1.00 69.12  ? 73  ASN G O   1 
ATOM   9084  C CB  . ASN G 1 73  ? 126.280 68.293 146.608 1.00 70.71  ? 73  ASN G CB  1 
ATOM   9085  C CG  . ASN G 1 73  ? 126.440 69.253 145.450 1.00 70.71  ? 73  ASN G CG  1 
ATOM   9086  O OD1 . ASN G 1 73  ? 126.744 68.840 144.328 1.00 70.71  ? 73  ASN G OD1 1 
ATOM   9087  N ND2 . ASN G 1 73  ? 126.246 70.540 145.712 1.00 70.71  ? 73  ASN G ND2 1 
ATOM   9088  N N   . LEU G 1 74  ? 124.929 65.854 148.278 1.00 86.12  ? 74  LEU G N   1 
ATOM   9089  C CA  . LEU G 1 74  ? 125.088 64.767 149.225 1.00 86.12  ? 74  LEU G CA  1 
ATOM   9090  C C   . LEU G 1 74  ? 124.913 63.471 148.447 1.00 86.12  ? 74  LEU G C   1 
ATOM   9091  O O   . LEU G 1 74  ? 125.745 62.569 148.536 1.00 86.12  ? 74  LEU G O   1 
ATOM   9092  C CB  . LEU G 1 74  ? 124.037 64.839 150.333 1.00 71.86  ? 74  LEU G CB  1 
ATOM   9093  C CG  . LEU G 1 74  ? 124.395 65.652 151.581 1.00 71.86  ? 74  LEU G CG  1 
ATOM   9094  C CD1 . LEU G 1 74  ? 123.227 65.700 152.563 1.00 71.86  ? 74  LEU G CD1 1 
ATOM   9095  C CD2 . LEU G 1 74  ? 125.594 65.018 152.240 1.00 71.86  ? 74  LEU G CD2 1 
ATOM   9096  N N   . ALA G 1 75  ? 123.839 63.398 147.663 1.00 79.19  ? 75  ALA G N   1 
ATOM   9097  C CA  . ALA G 1 75  ? 123.539 62.217 146.865 1.00 79.19  ? 75  ALA G CA  1 
ATOM   9098  C C   . ALA G 1 75  ? 124.604 61.907 145.815 1.00 79.19  ? 75  ALA G C   1 
ATOM   9099  O O   . ALA G 1 75  ? 125.022 60.764 145.680 1.00 79.19  ? 75  ALA G O   1 
ATOM   9100  C CB  . ALA G 1 75  ? 122.200 62.380 146.207 1.00 67.37  ? 75  ALA G CB  1 
ATOM   9101  N N   . ASN G 1 76  ? 125.044 62.906 145.060 1.00 77.02  ? 76  ASN G N   1 
ATOM   9102  C CA  . ASN G 1 76  ? 126.070 62.657 144.057 1.00 77.02  ? 76  ASN G CA  1 
ATOM   9103  C C   . ASN G 1 76  ? 127.328 62.100 144.705 1.00 77.02  ? 76  ASN G C   1 
ATOM   9104  O O   . ASN G 1 76  ? 128.147 61.459 144.042 1.00 77.02  ? 76  ASN G O   1 
ATOM   9105  C CB  . ASN G 1 76  ? 126.428 63.937 143.313 1.00 94.47  ? 76  ASN G CB  1 
ATOM   9106  C CG  . ASN G 1 76  ? 125.337 64.392 142.406 1.00 94.47  ? 76  ASN G CG  1 
ATOM   9107  O OD1 . ASN G 1 76  ? 124.868 63.630 141.563 1.00 94.47  ? 76  ASN G OD1 1 
ATOM   9108  N ND2 . ASN G 1 76  ? 124.917 65.642 142.562 1.00 94.47  ? 76  ASN G ND2 1 
ATOM   9109  N N   . GLU G 1 77  ? 127.500 62.358 145.996 1.00 77.91  ? 77  GLU G N   1 
ATOM   9110  C CA  . GLU G 1 77  ? 128.681 61.855 146.671 1.00 77.91  ? 77  GLU G CA  1 
ATOM   9111  C C   . GLU G 1 77  ? 128.454 60.444 147.178 1.00 77.91  ? 77  GLU G C   1 
ATOM   9112  O O   . GLU G 1 77  ? 129.250 59.549 146.915 1.00 77.91  ? 77  GLU G O   1 
ATOM   9113  C CB  . GLU G 1 77  ? 129.092 62.790 147.809 1.00 84.70  ? 77  GLU G CB  1 
ATOM   9114  C CG  . GLU G 1 77  ? 129.850 64.034 147.322 1.00 84.70  ? 77  GLU G CG  1 
ATOM   9115  C CD  . GLU G 1 77  ? 130.940 63.722 146.283 1.00 84.70  ? 77  GLU G CD  1 
ATOM   9116  O OE1 . GLU G 1 77  ? 131.675 62.719 146.439 1.00 84.70  ? 77  GLU G OE1 1 
ATOM   9117  O OE2 . GLU G 1 77  ? 131.073 64.493 145.308 1.00 84.70  ? 77  GLU G OE2 1 
ATOM   9118  N N   . MET G 1 78  ? 127.357 60.243 147.889 1.00 81.33  ? 78  MET G N   1 
ATOM   9119  C CA  . MET G 1 78  ? 127.025 58.927 148.406 1.00 81.33  ? 78  MET G CA  1 
ATOM   9120  C C   . MET G 1 78  ? 126.945 57.862 147.320 1.00 81.33  ? 78  MET G C   1 
ATOM   9121  O O   . MET G 1 78  ? 127.414 56.749 147.535 1.00 81.33  ? 78  MET G O   1 
ATOM   9122  C CB  . MET G 1 78  ? 125.680 58.962 149.132 1.00 99.80  ? 78  MET G CB  1 
ATOM   9123  C CG  . MET G 1 78  ? 125.755 59.333 150.594 1.00 99.80  ? 78  MET G CG  1 
ATOM   9124  S SD  . MET G 1 78  ? 126.719 58.158 151.543 1.00 99.80  ? 78  MET G SD  1 
ATOM   9125  C CE  . MET G 1 78  ? 125.851 56.710 151.190 1.00 99.80  ? 78  MET G CE  1 
ATOM   9126  N N   . PHE G 1 79  ? 126.365 58.204 146.162 1.00 66.05  ? 79  PHE G N   1 
ATOM   9127  C CA  . PHE G 1 79  ? 126.162 57.250 145.054 1.00 66.05  ? 79  PHE G CA  1 
ATOM   9128  C C   . PHE G 1 79  ? 126.888 57.488 143.748 1.00 66.05  ? 79  PHE G C   1 
ATOM   9129  O O   . PHE G 1 79  ? 126.908 56.611 142.898 1.00 66.05  ? 79  PHE G O   1 
ATOM   9130  C CB  . PHE G 1 79  ? 124.674 57.153 144.704 1.00 35.34  ? 79  PHE G CB  1 
ATOM   9131  C CG  . PHE G 1 79  ? 123.773 57.065 145.899 1.00 35.34  ? 79  PHE G CG  1 
ATOM   9132  C CD1 . PHE G 1 79  ? 122.863 58.079 146.170 1.00 35.34  ? 79  PHE G CD1 1 
ATOM   9133  C CD2 . PHE G 1 79  ? 123.822 55.971 146.742 1.00 35.34  ? 79  PHE G CD2 1 
ATOM   9134  C CE1 . PHE G 1 79  ? 121.994 58.009 147.279 1.00 35.34  ? 79  PHE G CE1 1 
ATOM   9135  C CE2 . PHE G 1 79  ? 122.962 55.884 147.854 1.00 35.34  ? 79  PHE G CE2 1 
ATOM   9136  C CZ  . PHE G 1 79  ? 122.038 56.914 148.125 1.00 35.34  ? 79  PHE G CZ  1 
ATOM   9137  N N   . GLY G 1 80  ? 127.465 58.661 143.557 1.00 61.43  ? 80  GLY G N   1 
ATOM   9138  C CA  . GLY G 1 80  ? 128.145 58.912 142.294 1.00 61.43  ? 80  GLY G CA  1 
ATOM   9139  C C   . GLY G 1 80  ? 127.155 59.567 141.351 1.00 61.43  ? 80  GLY G C   1 
ATOM   9140  O O   . GLY G 1 80  ? 125.964 59.260 141.372 1.00 61.43  ? 80  GLY G O   1 
ATOM   9141  N N   . TYR G 1 81  ? 127.622 60.473 140.516 1.00 84.54  ? 81  TYR G N   1 
ATOM   9142  C CA  . TYR G 1 81  ? 126.708 61.156 139.627 1.00 84.54  ? 81  TYR G CA  1 
ATOM   9143  C C   . TYR G 1 81  ? 125.759 60.226 138.889 1.00 84.54  ? 81  TYR G C   1 
ATOM   9144  O O   . TYR G 1 81  ? 124.629 60.600 138.574 1.00 84.54  ? 81  TYR G O   1 
ATOM   9145  C CB  . TYR G 1 81  ? 127.492 61.971 138.621 1.00 57.03  ? 81  TYR G CB  1 
ATOM   9146  C CG  . TYR G 1 81  ? 128.237 61.146 137.617 1.00 57.03  ? 81  TYR G CG  1 
ATOM   9147  C CD1 . TYR G 1 81  ? 127.644 60.775 136.419 1.00 57.03  ? 81  TYR G CD1 1 
ATOM   9148  C CD2 . TYR G 1 81  ? 129.561 60.787 137.837 1.00 57.03  ? 81  TYR G CD2 1 
ATOM   9149  C CE1 . TYR G 1 81  ? 128.363 60.074 135.449 1.00 57.03  ? 81  TYR G CE1 1 
ATOM   9150  C CE2 . TYR G 1 81  ? 130.294 60.082 136.877 1.00 57.03  ? 81  TYR G CE2 1 
ATOM   9151  C CZ  . TYR G 1 81  ? 129.698 59.733 135.681 1.00 57.03  ? 81  TYR G CZ  1 
ATOM   9152  O OH  . TYR G 1 81  ? 130.453 59.097 134.710 1.00 57.03  ? 81  TYR G OH  1 
ATOM   9153  N N   . ASN G 1 82  ? 126.210 59.008 138.629 1.00 67.03  ? 82  ASN G N   1 
ATOM   9154  C CA  . ASN G 1 82  ? 125.402 58.053 137.887 1.00 67.03  ? 82  ASN G CA  1 
ATOM   9155  C C   . ASN G 1 82  ? 124.945 56.867 138.709 1.00 67.03  ? 82  ASN G C   1 
ATOM   9156  O O   . ASN G 1 82  ? 124.657 55.814 138.155 1.00 67.03  ? 82  ASN G O   1 
ATOM   9157  C CB  . ASN G 1 82  ? 126.197 57.555 136.683 1.00 72.19  ? 82  ASN G CB  1 
ATOM   9158  C CG  . ASN G 1 82  ? 127.283 56.592 137.071 1.00 72.19  ? 82  ASN G CG  1 
ATOM   9159  O OD1 . ASN G 1 82  ? 127.828 56.657 138.169 1.00 72.19  ? 82  ASN G OD1 1 
ATOM   9160  N ND2 . ASN G 1 82  ? 127.616 55.694 136.164 1.00 72.19  ? 82  ASN G ND2 1 
ATOM   9161  N N   . GLY G 1 83  ? 124.861 57.036 140.022 1.00 42.50  ? 83  GLY G N   1 
ATOM   9162  C CA  . GLY G 1 83  ? 124.463 55.936 140.873 1.00 42.50  ? 83  GLY G CA  1 
ATOM   9163  C C   . GLY G 1 83  ? 123.095 56.120 141.475 1.00 42.50  ? 83  GLY G C   1 
ATOM   9164  O O   . GLY G 1 83  ? 122.623 55.293 142.266 1.00 42.50  ? 83  GLY G O   1 
ATOM   9165  N N   . TRP G 1 84  ? 122.455 57.225 141.126 1.00 51.82  ? 84  TRP G N   1 
ATOM   9166  C CA  . TRP G 1 84  ? 121.116 57.501 141.621 1.00 51.82  ? 84  TRP G CA  1 
ATOM   9167  C C   . TRP G 1 84  ? 120.397 58.277 140.534 1.00 51.82  ? 84  TRP G C   1 
ATOM   9168  O O   . TRP G 1 84  ? 121.032 58.889 139.644 1.00 51.82  ? 84  TRP G O   1 
ATOM   9169  C CB  . TRP G 1 84  ? 121.151 58.312 142.928 1.00 76.14  ? 84  TRP G CB  1 
ATOM   9170  C CG  . TRP G 1 84  ? 121.557 59.752 142.759 1.00 76.14  ? 84  TRP G CG  1 
ATOM   9171  C CD1 . TRP G 1 84  ? 122.801 60.229 142.454 1.00 76.14  ? 84  TRP G CD1 1 
ATOM   9172  C CD2 . TRP G 1 84  ? 120.694 60.895 142.807 1.00 76.14  ? 84  TRP G CD2 1 
ATOM   9173  N NE1 . TRP G 1 84  ? 122.767 61.597 142.299 1.00 76.14  ? 84  TRP G NE1 1 
ATOM   9174  C CE2 . TRP G 1 84  ? 121.485 62.030 142.511 1.00 76.14  ? 84  TRP G CE2 1 
ATOM   9175  C CE3 . TRP G 1 84  ? 119.327 61.070 143.067 1.00 76.14  ? 84  TRP G CE3 1 
ATOM   9176  C CZ2 . TRP G 1 84  ? 120.955 63.317 142.468 1.00 76.14  ? 84  TRP G CZ2 1 
ATOM   9177  C CZ3 . TRP G 1 84  ? 118.804 62.347 143.023 1.00 76.14  ? 84  TRP G CZ3 1 
ATOM   9178  C CH2 . TRP G 1 84  ? 119.616 63.455 142.725 1.00 76.14  ? 84  TRP G CH2 1 
ATOM   9179  N N   . ALA G 1 85  ? 119.068 58.226 140.592 1.00 40.14  ? 85  ALA G N   1 
ATOM   9180  C CA  . ALA G 1 85  ? 118.253 58.925 139.624 1.00 40.14  ? 85  ALA G CA  1 
ATOM   9181  C C   . ALA G 1 85  ? 116.910 59.215 140.232 1.00 40.14  ? 85  ALA G C   1 
ATOM   9182  O O   . ALA G 1 85  ? 116.527 58.644 141.267 1.00 40.14  ? 85  ALA G O   1 
ATOM   9183  C CB  . ALA G 1 85  ? 118.103 58.092 138.372 1.00 26.38  ? 85  ALA G CB  1 
ATOM   9184  N N   . HIS G 1 86  ? 116.200 60.140 139.607 1.00 40.69  ? 86  HIS G N   1 
ATOM   9185  C CA  . HIS G 1 86  ? 114.873 60.493 140.089 1.00 40.69  ? 86  HIS G CA  1 
ATOM   9186  C C   . HIS G 1 86  ? 114.032 60.937 138.898 1.00 40.69  ? 86  HIS G C   1 
ATOM   9187  O O   . HIS G 1 86  ? 114.558 61.366 137.861 1.00 40.69  ? 86  HIS G O   1 
ATOM   9188  C CB  . HIS G 1 86  ? 114.941 61.602 141.162 1.00 57.94  ? 86  HIS G CB  1 
ATOM   9189  C CG  . HIS G 1 86  ? 115.300 62.956 140.625 1.00 57.94  ? 86  HIS G CG  1 
ATOM   9190  N ND1 . HIS G 1 86  ? 114.632 64.103 140.994 1.00 57.94  ? 86  HIS G ND1 1 
ATOM   9191  C CD2 . HIS G 1 86  ? 116.238 63.339 139.727 1.00 57.94  ? 86  HIS G CD2 1 
ATOM   9192  C CE1 . HIS G 1 86  ? 115.140 65.134 140.341 1.00 57.94  ? 86  HIS G CE1 1 
ATOM   9193  N NE2 . HIS G 1 86  ? 116.117 64.695 139.566 1.00 57.94  ? 86  HIS G NE2 1 
ATOM   9194  N N   . SER G 1 87  ? 112.726 60.788 139.050 1.00 41.26  ? 87  SER G N   1 
ATOM   9195  C CA  . SER G 1 87  ? 111.791 61.154 138.006 1.00 41.26  ? 87  SER G CA  1 
ATOM   9196  C C   . SER G 1 87  ? 110.524 61.643 138.694 1.00 41.26  ? 87  SER G C   1 
ATOM   9197  O O   . SER G 1 87  ? 110.267 61.331 139.873 1.00 41.26  ? 87  SER G O   1 
ATOM   9198  C CB  . SER G 1 87  ? 111.460 59.945 137.120 1.00 51.86  ? 87  SER G CB  1 
ATOM   9199  O OG  . SER G 1 87  ? 110.723 58.974 137.850 1.00 51.86  ? 87  SER G OG  1 
ATOM   9200  N N   . ILE G 1 88  ? 109.745 62.424 137.954 1.00 52.66  ? 88  ILE G N   1 
ATOM   9201  C CA  . ILE G 1 88  ? 108.504 62.953 138.477 1.00 52.66  ? 88  ILE G CA  1 
ATOM   9202  C C   . ILE G 1 88  ? 107.415 62.012 138.003 1.00 52.66  ? 88  ILE G C   1 
ATOM   9203  O O   . ILE G 1 88  ? 107.108 61.930 136.810 1.00 52.66  ? 88  ILE G O   1 
ATOM   9204  C CB  . ILE G 1 88  ? 108.234 64.376 137.948 1.00 56.68  ? 88  ILE G CB  1 
ATOM   9205  C CG1 . ILE G 1 88  ? 109.396 65.291 138.317 1.00 56.68  ? 88  ILE G CG1 1 
ATOM   9206  C CG2 . ILE G 1 88  ? 106.935 64.915 138.525 1.00 56.68  ? 88  ILE G CG2 1 
ATOM   9207  C CD1 . ILE G 1 88  ? 109.351 66.616 137.598 1.00 56.68  ? 88  ILE G CD1 1 
ATOM   9208  N N   . THR G 1 89  ? 106.864 61.266 138.945 1.00 48.95  ? 89  THR G N   1 
ATOM   9209  C CA  . THR G 1 89  ? 105.803 60.338 138.619 1.00 48.95  ? 89  THR G CA  1 
ATOM   9210  C C   . THR G 1 89  ? 104.619 61.180 138.184 1.00 48.95  ? 89  THR G C   1 
ATOM   9211  O O   . THR G 1 89  ? 104.002 60.916 137.156 1.00 48.95  ? 89  THR G O   1 
ATOM   9212  C CB  . THR G 1 89  ? 105.408 59.492 139.850 1.00 40.16  ? 89  THR G CB  1 
ATOM   9213  O OG1 . THR G 1 89  ? 106.500 58.627 140.180 1.00 40.16  ? 89  THR G OG1 1 
ATOM   9214  C CG2 . THR G 1 89  ? 104.130 58.674 139.586 1.00 40.16  ? 89  THR G CG2 1 
ATOM   9215  N N   . GLN G 1 90  ? 104.328 62.214 138.967 1.00 72.68  ? 90  GLN G N   1 
ATOM   9216  C CA  . GLN G 1 90  ? 103.215 63.084 138.662 1.00 72.68  ? 90  GLN G CA  1 
ATOM   9217  C C   . GLN G 1 90  ? 103.213 64.359 139.480 1.00 72.68  ? 90  GLN G C   1 
ATOM   9218  O O   . GLN G 1 90  ? 103.638 64.365 140.633 1.00 72.68  ? 90  GLN G O   1 
ATOM   9219  C CB  . GLN G 1 90  ? 101.913 62.338 138.905 1.00 59.44  ? 90  GLN G CB  1 
ATOM   9220  C CG  . GLN G 1 90  ? 100.710 63.201 138.737 1.00 59.44  ? 90  GLN G CG  1 
ATOM   9221  C CD  . GLN G 1 90  ? 99.437  62.461 138.994 1.00 59.44  ? 90  GLN G CD  1 
ATOM   9222  O OE1 . GLN G 1 90  ? 99.128  62.100 140.131 1.00 59.44  ? 90  GLN G OE1 1 
ATOM   9223  N NE2 . GLN G 1 90  ? 98.678  62.220 137.932 1.00 59.44  ? 90  GLN G NE2 1 
ATOM   9224  N N   . GLN G 1 91  ? 102.742 65.440 138.858 1.00 56.53  ? 91  GLN G N   1 
ATOM   9225  C CA  . GLN G 1 91  ? 102.611 66.735 139.519 1.00 56.53  ? 91  GLN G CA  1 
ATOM   9226  C C   . GLN G 1 91  ? 101.224 67.260 139.243 1.00 56.53  ? 91  GLN G C   1 
ATOM   9227  O O   . GLN G 1 91  ? 100.833 67.430 138.096 1.00 56.53  ? 91  GLN G O   1 
ATOM   9228  C CB  . GLN G 1 91  ? 103.624 67.756 139.015 1.00 53.72  ? 91  GLN G CB  1 
ATOM   9229  C CG  . GLN G 1 91  ? 103.341 69.148 139.588 1.00 53.72  ? 91  GLN G CG  1 
ATOM   9230  C CD  . GLN G 1 91  ? 104.467 70.125 139.359 1.00 53.72  ? 91  GLN G CD  1 
ATOM   9231  O OE1 . GLN G 1 91  ? 105.308 70.319 140.231 1.00 53.72  ? 91  GLN G OE1 1 
ATOM   9232  N NE2 . GLN G 1 91  ? 104.504 70.732 138.179 1.00 53.72  ? 91  GLN G NE2 1 
ATOM   9233  N N   . ASN G 1 92  ? 100.482 67.517 140.307 1.00 51.32  ? 92  ASN G N   1 
ATOM   9234  C CA  . ASN G 1 92  ? 99.137  68.017 140.184 1.00 51.32  ? 92  ASN G CA  1 
ATOM   9235  C C   . ASN G 1 92  ? 98.987  69.338 140.911 1.00 51.32  ? 92  ASN G C   1 
ATOM   9236  O O   . ASN G 1 92  ? 99.318  69.430 142.092 1.00 51.32  ? 92  ASN G O   1 
ATOM   9237  C CB  . ASN G 1 92  ? 98.165  67.008 140.771 1.00 84.49  ? 92  ASN G CB  1 
ATOM   9238  C CG  . ASN G 1 92  ? 96.746  67.497 140.731 1.00 84.49  ? 92  ASN G CG  1 
ATOM   9239  O OD1 . ASN G 1 92  ? 96.164  67.655 139.657 1.00 84.49  ? 92  ASN G OD1 1 
ATOM   9240  N ND2 . ASN G 1 92  ? 96.177  67.761 141.902 1.00 84.49  ? 92  ASN G ND2 1 
ATOM   9241  N N   . VAL G 1 93  ? 98.508  70.361 140.201 1.00 46.49  ? 93  VAL G N   1 
ATOM   9242  C CA  . VAL G 1 93  ? 98.247  71.681 140.783 1.00 46.49  ? 93  VAL G CA  1 
ATOM   9243  C C   . VAL G 1 93  ? 96.951  71.602 141.596 1.00 46.49  ? 93  VAL G C   1 
ATOM   9244  O O   . VAL G 1 93  ? 95.875  71.571 141.012 1.00 46.49  ? 93  VAL G O   1 
ATOM   9245  C CB  . VAL G 1 93  ? 98.005  72.717 139.700 1.00 27.66  ? 93  VAL G CB  1 
ATOM   9246  C CG1 . VAL G 1 93  ? 97.485  73.976 140.326 1.00 27.66  ? 93  VAL G CG1 1 
ATOM   9247  C CG2 . VAL G 1 93  ? 99.286  73.001 138.945 1.00 27.66  ? 93  VAL G CG2 1 
ATOM   9248  N N   . ASP G 1 94  ? 97.036  71.582 142.925 1.00 60.87  ? 94  ASP G N   1 
ATOM   9249  C CA  . ASP G 1 94  ? 95.831  71.491 143.756 1.00 60.87  ? 94  ASP G CA  1 
ATOM   9250  C C   . ASP G 1 94  ? 94.824  72.615 143.609 1.00 60.87  ? 94  ASP G C   1 
ATOM   9251  O O   . ASP G 1 94  ? 93.622  72.363 143.533 1.00 60.87  ? 94  ASP G O   1 
ATOM   9252  C CB  . ASP G 1 94  ? 96.189  71.384 145.231 1.00 77.00  ? 94  ASP G CB  1 
ATOM   9253  C CG  . ASP G 1 94  ? 96.632  70.008 145.610 1.00 77.00  ? 94  ASP G CG  1 
ATOM   9254  O OD1 . ASP G 1 94  ? 96.220  69.057 144.915 1.00 77.00  ? 94  ASP G OD1 1 
ATOM   9255  O OD2 . ASP G 1 94  ? 97.376  69.877 146.602 1.00 77.00  ? 94  ASP G OD2 1 
ATOM   9256  N N   . PHE G 1 95  ? 95.300  73.857 143.599 1.00 58.95  ? 95  PHE G N   1 
ATOM   9257  C CA  . PHE G 1 95  ? 94.397  74.991 143.458 1.00 58.95  ? 95  PHE G CA  1 
ATOM   9258  C C   . PHE G 1 95  ? 95.137  76.269 143.110 1.00 58.95  ? 95  PHE G C   1 
ATOM   9259  O O   . PHE G 1 95  ? 96.329  76.374 143.334 1.00 58.95  ? 95  PHE G O   1 
ATOM   9260  C CB  . PHE G 1 95  ? 93.612  75.189 144.758 1.00 75.33  ? 95  PHE G CB  1 
ATOM   9261  C CG  . PHE G 1 95  ? 94.478  75.527 145.950 1.00 75.33  ? 95  PHE G CG  1 
ATOM   9262  C CD1 . PHE G 1 95  ? 94.993  76.818 146.120 1.00 75.33  ? 95  PHE G CD1 1 
ATOM   9263  C CD2 . PHE G 1 95  ? 94.803  74.551 146.893 1.00 75.33  ? 95  PHE G CD2 1 
ATOM   9264  C CE1 . PHE G 1 95  ? 95.814  77.122 147.206 1.00 75.33  ? 95  PHE G CE1 1 
ATOM   9265  C CE2 . PHE G 1 95  ? 95.622  74.850 147.977 1.00 75.33  ? 95  PHE G CE2 1 
ATOM   9266  C CZ  . PHE G 1 95  ? 96.127  76.134 148.133 1.00 75.33  ? 95  PHE G CZ  1 
ATOM   9267  N N   . VAL G 1 96  ? 94.421  77.225 142.532 1.00 58.91  ? 96  VAL G N   1 
ATOM   9268  C CA  . VAL G 1 96  ? 94.973  78.538 142.201 1.00 58.91  ? 96  VAL G CA  1 
ATOM   9269  C C   . VAL G 1 96  ? 93.872  79.537 142.514 1.00 58.91  ? 96  VAL G C   1 
ATOM   9270  O O   . VAL G 1 96  ? 93.006  79.818 141.677 1.00 58.91  ? 96  VAL G O   1 
ATOM   9271  C CB  . VAL G 1 96  ? 95.352  78.661 140.736 1.00 39.27  ? 96  VAL G CB  1 
ATOM   9272  C CG1 . VAL G 1 96  ? 95.806  80.102 140.428 1.00 39.27  ? 96  VAL G CG1 1 
ATOM   9273  C CG2 . VAL G 1 96  ? 96.454  77.671 140.427 1.00 39.27  ? 96  VAL G CG2 1 
ATOM   9274  N N   . ASP G 1 97  ? 93.899  80.035 143.748 1.00 65.58  ? 97  ASP G N   1 
ATOM   9275  C CA  . ASP G 1 97  ? 92.908  80.985 144.221 1.00 65.58  ? 97  ASP G CA  1 
ATOM   9276  C C   . ASP G 1 97  ? 93.365  82.445 144.127 1.00 65.58  ? 97  ASP G C   1 
ATOM   9277  O O   . ASP G 1 97  ? 94.561  82.766 144.197 1.00 65.58  ? 97  ASP G O   1 
ATOM   9278  C CB  . ASP G 1 97  ? 92.504  80.650 145.659 1.00 73.27  ? 97  ASP G CB  1 
ATOM   9279  C CG  . ASP G 1 97  ? 91.821  79.292 145.779 1.00 73.27  ? 97  ASP G CG  1 
ATOM   9280  O OD1 . ASP G 1 97  ? 91.067  78.905 144.859 1.00 73.27  ? 97  ASP G OD1 1 
ATOM   9281  O OD2 . ASP G 1 97  ? 92.020  78.614 146.808 1.00 73.27  ? 97  ASP G OD2 1 
ATOM   9282  N N   . LEU G 1 98  ? 92.392  83.328 143.939 1.00 95.17  ? 98  LEU G N   1 
ATOM   9283  C CA  . LEU G 1 98  ? 92.674  84.746 143.832 1.00 95.17  ? 98  LEU G CA  1 
ATOM   9284  C C   . LEU G 1 98  ? 91.886  85.525 144.872 1.00 95.17  ? 98  LEU G C   1 
ATOM   9285  O O   . LEU G 1 98  ? 90.661  85.615 144.797 1.00 95.17  ? 98  LEU G O   1 
ATOM   9286  C CB  . LEU G 1 98  ? 92.325  85.247 142.431 1.00 56.68  ? 98  LEU G CB  1 
ATOM   9287  C CG  . LEU G 1 98  ? 92.537  86.733 142.171 1.00 56.68  ? 98  LEU G CG  1 
ATOM   9288  C CD1 . LEU G 1 98  ? 93.930  87.135 142.588 1.00 56.68  ? 98  LEU G CD1 1 
ATOM   9289  C CD2 . LEU G 1 98  ? 92.310  87.010 140.706 1.00 56.68  ? 98  LEU G CD2 1 
ATOM   9290  N N   . ASN G 1 99  ? 92.603  86.062 145.854 1.00 102.86 ? 99  ASN G N   1 
ATOM   9291  C CA  . ASN G 1 99  ? 91.995  86.855 146.913 1.00 102.86 ? 99  ASN G CA  1 
ATOM   9292  C C   . ASN G 1 99  ? 92.540  88.262 146.795 1.00 102.86 ? 99  ASN G C   1 
ATOM   9293  O O   . ASN G 1 99  ? 93.695  88.525 147.134 1.00 102.86 ? 99  ASN G O   1 
ATOM   9294  C CB  . ASN G 1 99  ? 92.328  86.279 148.286 1.00 106.03 ? 99  ASN G CB  1 
ATOM   9295  C CG  . ASN G 1 99  ? 91.627  84.961 148.545 1.00 106.03 ? 99  ASN G CG  1 
ATOM   9296  O OD1 . ASN G 1 99  ? 90.407  84.869 148.438 1.00 106.03 ? 99  ASN G OD1 1 
ATOM   9297  N ND2 . ASN G 1 99  ? 92.396  83.933 148.890 1.00 106.03 ? 99  ASN G ND2 1 
ATOM   9298  N N   . ASN G 1 100 ? 91.692  89.158 146.303 1.00 95.62  ? 100 ASN G N   1 
ATOM   9299  C CA  . ASN G 1 100 ? 92.051  90.549 146.097 1.00 95.62  ? 100 ASN G CA  1 
ATOM   9300  C C   . ASN G 1 100 ? 93.450  90.731 145.514 1.00 95.62  ? 100 ASN G C   1 
ATOM   9301  O O   . ASN G 1 100 ? 94.405  91.005 146.236 1.00 95.62  ? 100 ASN G O   1 
ATOM   9302  C CB  . ASN G 1 100 ? 91.900  91.354 147.401 1.00 152.73 ? 100 ASN G CB  1 
ATOM   9303  C CG  . ASN G 1 100 ? 92.746  90.811 148.537 1.00 152.73 ? 100 ASN G CG  1 
ATOM   9304  O OD1 . ASN G 1 100 ? 92.500  89.718 149.046 1.00 152.73 ? 100 ASN G OD1 1 
ATOM   9305  N ND2 . ASN G 1 100 ? 93.749  91.580 148.943 1.00 152.73 ? 100 ASN G ND2 1 
ATOM   9306  N N   . GLY G 1 101 ? 93.555  90.562 144.197 1.00 113.11 ? 101 GLY G N   1 
ATOM   9307  C CA  . GLY G 1 101 ? 94.819  90.749 143.507 1.00 113.11 ? 101 GLY G CA  1 
ATOM   9308  C C   . GLY G 1 101 ? 95.993  89.888 143.923 1.00 113.11 ? 101 GLY G C   1 
ATOM   9309  O O   . GLY G 1 101 ? 97.075  90.014 143.343 1.00 113.11 ? 101 GLY G O   1 
ATOM   9310  N N   . LYS G 1 102 ? 95.801  89.025 144.917 1.00 79.44  ? 102 LYS G N   1 
ATOM   9311  C CA  . LYS G 1 102 ? 96.873  88.135 145.373 1.00 79.44  ? 102 LYS G CA  1 
ATOM   9312  C C   . LYS G 1 102 ? 96.541  86.663 145.057 1.00 79.44  ? 102 LYS G C   1 
ATOM   9313  O O   . LYS G 1 102 ? 95.385  86.238 145.174 1.00 79.44  ? 102 LYS G O   1 
ATOM   9314  C CB  . LYS G 1 102 ? 97.095  88.304 146.878 1.00 92.59  ? 102 LYS G CB  1 
ATOM   9315  C CG  . LYS G 1 102 ? 97.539  89.687 147.289 1.00 92.59  ? 102 LYS G CG  1 
ATOM   9316  C CD  . LYS G 1 102 ? 97.452  89.858 148.799 1.00 92.59  ? 102 LYS G CD  1 
ATOM   9317  C CE  . LYS G 1 102 ? 97.712  91.306 149.218 1.00 92.59  ? 102 LYS G CE  1 
ATOM   9318  N NZ  . LYS G 1 102 ? 97.513  91.499 150.680 1.00 92.59  ? 102 LYS G NZ  1 
ATOM   9319  N N   . PHE G 1 103 ? 97.560  85.898 144.657 1.00 64.05  ? 103 PHE G N   1 
ATOM   9320  C CA  . PHE G 1 103 ? 97.405  84.472 144.323 1.00 64.05  ? 103 PHE G CA  1 
ATOM   9321  C C   . PHE G 1 103 ? 97.891  83.497 145.386 1.00 64.05  ? 103 PHE G C   1 
ATOM   9322  O O   . PHE G 1 103 ? 99.000  83.619 145.902 1.00 64.05  ? 103 PHE G O   1 
ATOM   9323  C CB  . PHE G 1 103 ? 98.126  84.152 143.016 1.00 52.68  ? 103 PHE G CB  1 
ATOM   9324  C CG  . PHE G 1 103 ? 97.409  84.646 141.811 1.00 52.68  ? 103 PHE G CG  1 
ATOM   9325  C CD1 . PHE G 1 103 ? 98.010  85.555 140.964 1.00 52.68  ? 103 PHE G CD1 1 
ATOM   9326  C CD2 . PHE G 1 103 ? 96.096  84.240 141.554 1.00 52.68  ? 103 PHE G CD2 1 
ATOM   9327  C CE1 . PHE G 1 103 ? 97.314  86.059 139.878 1.00 52.68  ? 103 PHE G CE1 1 
ATOM   9328  C CE2 . PHE G 1 103 ? 95.394  84.735 140.477 1.00 52.68  ? 103 PHE G CE2 1 
ATOM   9329  C CZ  . PHE G 1 103 ? 95.997  85.646 139.635 1.00 52.68  ? 103 PHE G CZ  1 
ATOM   9330  N N   . TYR G 1 104 ? 97.045  82.516 145.681 1.00 72.24  ? 104 TYR G N   1 
ATOM   9331  C CA  . TYR G 1 104 ? 97.316  81.474 146.671 1.00 72.24  ? 104 TYR G CA  1 
ATOM   9332  C C   . TYR G 1 104 ? 97.338  80.126 145.951 1.00 72.24  ? 104 TYR G C   1 
ATOM   9333  O O   . TYR G 1 104 ? 96.286  79.528 145.694 1.00 72.24  ? 104 TYR G O   1 
ATOM   9334  C CB  . TYR G 1 104 ? 96.219  81.484 147.738 1.00 106.77 ? 104 TYR G CB  1 
ATOM   9335  C CG  . TYR G 1 104 ? 96.126  82.803 148.476 1.00 106.77 ? 104 TYR G CG  1 
ATOM   9336  C CD1 . TYR G 1 104 ? 95.920  84.002 147.785 1.00 106.77 ? 104 TYR G CD1 1 
ATOM   9337  C CD2 . TYR G 1 104 ? 96.294  82.864 149.857 1.00 106.77 ? 104 TYR G CD2 1 
ATOM   9338  C CE1 . TYR G 1 104 ? 95.893  85.225 148.448 1.00 106.77 ? 104 TYR G CE1 1 
ATOM   9339  C CE2 . TYR G 1 104 ? 96.266  84.086 150.532 1.00 106.77 ? 104 TYR G CE2 1 
ATOM   9340  C CZ  . TYR G 1 104 ? 96.068  85.263 149.821 1.00 106.77 ? 104 TYR G CZ  1 
ATOM   9341  O OH  . TYR G 1 104 ? 96.050  86.479 150.474 1.00 106.77 ? 104 TYR G OH  1 
ATOM   9342  N N   . VAL G 1 105 ? 98.540  79.651 145.631 1.00 63.14  ? 105 VAL G N   1 
ATOM   9343  C CA  . VAL G 1 105 ? 98.704  78.390 144.910 1.00 63.14  ? 105 VAL G CA  1 
ATOM   9344  C C   . VAL G 1 105 ? 99.245  77.205 145.701 1.00 63.14  ? 105 VAL G C   1 
ATOM   9345  O O   . VAL G 1 105 ? 100.217 77.327 146.435 1.00 63.14  ? 105 VAL G O   1 
ATOM   9346  C CB  . VAL G 1 105 ? 99.611  78.607 143.691 1.00 55.64  ? 105 VAL G CB  1 
ATOM   9347  C CG1 . VAL G 1 105 ? 99.871  77.290 142.959 1.00 55.64  ? 105 VAL G CG1 1 
ATOM   9348  C CG2 . VAL G 1 105 ? 98.955  79.628 142.781 1.00 55.64  ? 105 VAL G CG2 1 
ATOM   9349  N N   . GLY G 1 106 ? 98.606  76.054 145.527 1.00 69.65  ? 106 GLY G N   1 
ATOM   9350  C CA  . GLY G 1 106 ? 99.032  74.837 146.196 1.00 69.65  ? 106 GLY G CA  1 
ATOM   9351  C C   . GLY G 1 106 ? 99.309  73.736 145.179 1.00 69.65  ? 106 GLY G C   1 
ATOM   9352  O O   . GLY G 1 106 ? 98.408  73.333 144.439 1.00 69.65  ? 106 GLY G O   1 
ATOM   9353  N N   . VAL G 1 107 ? 100.545 73.243 145.137 1.00 62.47  ? 107 VAL G N   1 
ATOM   9354  C CA  . VAL G 1 107 ? 100.925 72.194 144.188 1.00 62.47  ? 107 VAL G CA  1 
ATOM   9355  C C   . VAL G 1 107 ? 101.618 71.009 144.839 1.00 62.47  ? 107 VAL G C   1 
ATOM   9356  O O   . VAL G 1 107 ? 102.384 71.176 145.780 1.00 62.47  ? 107 VAL G O   1 
ATOM   9357  C CB  . VAL G 1 107 ? 101.851 72.759 143.120 1.00 53.38  ? 107 VAL G CB  1 
ATOM   9358  C CG1 . VAL G 1 107 ? 102.403 71.659 142.266 1.00 53.38  ? 107 VAL G CG1 1 
ATOM   9359  C CG2 . VAL G 1 107 ? 101.085 73.740 142.279 1.00 53.38  ? 107 VAL G CG2 1 
ATOM   9360  N N   . CYS G 1 108 ? 101.340 69.809 144.339 1.00 63.57  ? 108 CYS G N   1 
ATOM   9361  C CA  . CYS G 1 108 ? 101.963 68.597 144.876 1.00 63.57  ? 108 CYS G CA  1 
ATOM   9362  C C   . CYS G 1 108 ? 102.664 67.828 143.773 1.00 63.57  ? 108 CYS G C   1 
ATOM   9363  O O   . CYS G 1 108 ? 102.220 67.819 142.635 1.00 63.57  ? 108 CYS G O   1 
ATOM   9364  C CB  . CYS G 1 108 ? 100.929 67.681 145.562 1.00 51.40  ? 108 CYS G CB  1 
ATOM   9365  S SG  . CYS G 1 108 ? 99.853  66.693 144.478 1.00 51.40  ? 108 CYS G SG  1 
ATOM   9366  N N   . ALA G 1 109 ? 103.777 67.197 144.110 1.00 58.56  ? 109 ALA G N   1 
ATOM   9367  C CA  . ALA G 1 109 ? 104.502 66.426 143.126 1.00 58.56  ? 109 ALA G CA  1 
ATOM   9368  C C   . ALA G 1 109 ? 105.003 65.127 143.725 1.00 58.56  ? 109 ALA G C   1 
ATOM   9369  O O   . ALA G 1 109 ? 105.429 65.096 144.870 1.00 58.56  ? 109 ALA G O   1 
ATOM   9370  C CB  . ALA G 1 109 ? 105.631 67.215 142.609 1.00 21.05  ? 109 ALA G CB  1 
ATOM   9371  N N   . PHE G 1 110 ? 104.930 64.052 142.945 1.00 46.68  ? 110 PHE G N   1 
ATOM   9372  C CA  . PHE G 1 110 ? 105.387 62.746 143.392 1.00 46.68  ? 110 PHE G CA  1 
ATOM   9373  C C   . PHE G 1 110 ? 106.677 62.426 142.689 1.00 46.68  ? 110 PHE G C   1 
ATOM   9374  O O   . PHE G 1 110 ? 106.726 62.329 141.465 1.00 46.68  ? 110 PHE G O   1 
ATOM   9375  C CB  . PHE G 1 110 ? 104.343 61.691 143.102 1.00 38.02  ? 110 PHE G CB  1 
ATOM   9376  C CG  . PHE G 1 110 ? 103.055 61.926 143.829 1.00 38.02  ? 110 PHE G CG  1 
ATOM   9377  C CD1 . PHE G 1 110 ? 102.151 62.871 143.364 1.00 38.02  ? 110 PHE G CD1 1 
ATOM   9378  C CD2 . PHE G 1 110 ? 102.756 61.220 144.998 1.00 38.02  ? 110 PHE G CD2 1 
ATOM   9379  C CE1 . PHE G 1 110 ? 100.950 63.112 144.063 1.00 38.02  ? 110 PHE G CE1 1 
ATOM   9380  C CE2 . PHE G 1 110 ? 101.570 61.450 145.702 1.00 38.02  ? 110 PHE G CE2 1 
ATOM   9381  C CZ  . PHE G 1 110 ? 100.660 62.397 145.240 1.00 38.02  ? 110 PHE G CZ  1 
ATOM   9382  N N   . VAL G 1 111 ? 107.732 62.291 143.480 1.00 44.78  ? 111 VAL G N   1 
ATOM   9383  C CA  . VAL G 1 111 ? 109.042 62.021 142.942 1.00 44.78  ? 111 VAL G CA  1 
ATOM   9384  C C   . VAL G 1 111 ? 109.514 60.664 143.382 1.00 44.78  ? 111 VAL G C   1 
ATOM   9385  O O   . VAL G 1 111 ? 109.292 60.249 144.531 1.00 44.78  ? 111 VAL G O   1 
ATOM   9386  C CB  . VAL G 1 111 ? 110.033 63.072 143.411 1.00 28.29  ? 111 VAL G CB  1 
ATOM   9387  C CG1 . VAL G 1 111 ? 111.403 62.877 142.729 1.00 28.29  ? 111 VAL G CG1 1 
ATOM   9388  C CG2 . VAL G 1 111 ? 109.482 64.431 143.093 1.00 28.29  ? 111 VAL G CG2 1 
ATOM   9389  N N   . ARG G 1 112 ? 110.166 59.974 142.455 1.00 53.81  ? 112 ARG G N   1 
ATOM   9390  C CA  . ARG G 1 112 ? 110.672 58.642 142.713 1.00 53.81  ? 112 ARG G CA  1 
ATOM   9391  C C   . ARG G 1 112 ? 112.169 58.646 142.491 1.00 53.81  ? 112 ARG G C   1 
ATOM   9392  O O   . ARG G 1 112 ? 112.668 59.097 141.448 1.00 53.81  ? 112 ARG G O   1 
ATOM   9393  C CB  . ARG G 1 112 ? 110.018 57.632 141.771 1.00 75.30  ? 112 ARG G CB  1 
ATOM   9394  C CG  . ARG G 1 112 ? 110.127 56.202 142.245 1.00 75.30  ? 112 ARG G CG  1 
ATOM   9395  C CD  . ARG G 1 112 ? 109.601 55.207 141.229 1.00 75.30  ? 112 ARG G CD  1 
ATOM   9396  N NE  . ARG G 1 112 ? 110.685 54.430 140.633 1.00 75.30  ? 112 ARG G NE  1 
ATOM   9397  C CZ  . ARG G 1 112 ? 110.682 53.101 140.538 1.00 75.30  ? 112 ARG G CZ  1 
ATOM   9398  N NH1 . ARG G 1 112 ? 109.643 52.403 141.001 1.00 75.30  ? 112 ARG G NH1 1 
ATOM   9399  N NH2 . ARG G 1 112 ? 111.720 52.467 139.994 1.00 75.30  ? 112 ARG G NH2 1 
ATOM   9400  N N   . VAL G 1 113 ? 112.894 58.152 143.485 1.00 55.76  ? 113 VAL G N   1 
ATOM   9401  C CA  . VAL G 1 113 ? 114.334 58.091 143.366 1.00 55.76  ? 113 VAL G CA  1 
ATOM   9402  C C   . VAL G 1 113 ? 114.711 56.643 143.267 1.00 55.76  ? 113 VAL G C   1 
ATOM   9403  O O   . VAL G 1 113 ? 114.159 55.795 143.991 1.00 55.76  ? 113 VAL G O   1 
ATOM   9404  C CB  . VAL G 1 113 ? 115.048 58.667 144.582 1.00 60.49  ? 113 VAL G CB  1 
ATOM   9405  C CG1 . VAL G 1 113 ? 116.537 58.748 144.277 1.00 60.49  ? 113 VAL G CG1 1 
ATOM   9406  C CG2 . VAL G 1 113 ? 114.479 60.033 144.936 1.00 60.49  ? 113 VAL G CG2 1 
ATOM   9407  N N   . GLN G 1 114 ? 115.665 56.377 142.379 1.00 71.38  ? 114 GLN G N   1 
ATOM   9408  C CA  . GLN G 1 114 ? 116.145 55.031 142.151 1.00 71.38  ? 114 GLN G CA  1 
ATOM   9409  C C   . GLN G 1 114 ? 117.662 54.961 142.099 1.00 71.38  ? 114 GLN G C   1 
ATOM   9410  O O   . GLN G 1 114 ? 118.304 55.795 141.454 1.00 71.38  ? 114 GLN G O   1 
ATOM   9411  C CB  . GLN G 1 114 ? 115.603 54.502 140.832 1.00 60.28  ? 114 GLN G CB  1 
ATOM   9412  C CG  . GLN G 1 114 ? 115.907 53.040 140.619 1.00 60.28  ? 114 GLN G CG  1 
ATOM   9413  C CD  . GLN G 1 114 ? 115.444 52.526 139.279 1.00 60.28  ? 114 GLN G CD  1 
ATOM   9414  O OE1 . GLN G 1 114 ? 116.105 52.714 138.262 1.00 60.28  ? 114 GLN G OE1 1 
ATOM   9415  N NE2 . GLN G 1 114 ? 114.294 51.870 139.272 1.00 60.28  ? 114 GLN G NE2 1 
ATOM   9416  N N   . LEU G 1 115 ? 118.227 53.956 142.772 1.00 76.73  ? 115 LEU G N   1 
ATOM   9417  C CA  . LEU G 1 115 ? 119.673 53.741 142.772 1.00 76.73  ? 115 LEU G CA  1 
ATOM   9418  C C   . LEU G 1 115 ? 119.989 52.834 141.596 1.00 76.73  ? 115 LEU G C   1 
ATOM   9419  O O   . LEU G 1 115 ? 119.100 52.221 141.022 1.00 76.73  ? 115 LEU G O   1 
ATOM   9420  C CB  . LEU G 1 115 ? 120.133 53.083 144.074 1.00 50.84  ? 115 LEU G CB  1 
ATOM   9421  C CG  . LEU G 1 115 ? 119.794 53.886 145.330 1.00 50.84  ? 115 LEU G CG  1 
ATOM   9422  C CD1 . LEU G 1 115 ? 120.191 53.128 146.548 1.00 50.84  ? 115 LEU G CD1 1 
ATOM   9423  C CD2 . LEU G 1 115 ? 120.494 55.227 145.277 1.00 50.84  ? 115 LEU G CD2 1 
ATOM   9424  N N   . LYS G 1 116 ? 121.259 52.748 141.240 1.00 48.40  ? 116 LYS G N   1 
ATOM   9425  C CA  . LYS G 1 116 ? 121.683 51.936 140.119 1.00 48.40  ? 116 LYS G CA  1 
ATOM   9426  C C   . LYS G 1 116 ? 121.358 50.444 140.218 1.00 48.40  ? 116 LYS G C   1 
ATOM   9427  O O   . LYS G 1 116 ? 121.382 49.736 139.212 1.00 48.40  ? 116 LYS G O   1 
ATOM   9428  C CB  . LYS G 1 116 ? 123.175 52.109 139.915 1.00 57.93  ? 116 LYS G CB  1 
ATOM   9429  C CG  . LYS G 1 116 ? 124.009 51.691 141.089 1.00 57.93  ? 116 LYS G CG  1 
ATOM   9430  C CD  . LYS G 1 116 ? 125.470 51.704 140.679 1.00 57.93  ? 116 LYS G CD  1 
ATOM   9431  C CE  . LYS G 1 116 ? 126.393 51.348 141.842 1.00 57.93  ? 116 LYS G CE  1 
ATOM   9432  N NZ  . LYS G 1 116 ? 127.815 51.444 141.396 1.00 57.93  ? 116 LYS G NZ  1 
ATOM   9433  N N   . ASP G 1 117 ? 121.047 49.960 141.412 1.00 73.12  ? 117 ASP G N   1 
ATOM   9434  C CA  . ASP G 1 117 ? 120.755 48.547 141.559 1.00 73.12  ? 117 ASP G CA  1 
ATOM   9435  C C   . ASP G 1 117 ? 119.265 48.216 141.479 1.00 73.12  ? 117 ASP G C   1 
ATOM   9436  O O   . ASP G 1 117 ? 118.869 47.069 141.659 1.00 73.12  ? 117 ASP G O   1 
ATOM   9437  C CB  . ASP G 1 117 ? 121.321 48.047 142.881 1.00 61.74  ? 117 ASP G CB  1 
ATOM   9438  C CG  . ASP G 1 117 ? 120.445 48.420 144.062 1.00 61.74  ? 117 ASP G CG  1 
ATOM   9439  O OD1 . ASP G 1 117 ? 119.900 49.557 144.051 1.00 61.74  ? 117 ASP G OD1 1 
ATOM   9440  O OD2 . ASP G 1 117 ? 120.312 47.582 145.002 1.00 61.74  ? 117 ASP G OD2 1 
ATOM   9441  N N   . GLY G 1 118 ? 118.436 49.217 141.216 1.00 42.29  ? 118 GLY G N   1 
ATOM   9442  C CA  . GLY G 1 118 ? 117.007 48.993 141.123 1.00 42.29  ? 118 GLY G CA  1 
ATOM   9443  C C   . GLY G 1 118 ? 116.277 49.422 142.370 1.00 42.29  ? 118 GLY G C   1 
ATOM   9444  O O   . GLY G 1 118 ? 115.042 49.527 142.374 1.00 42.29  ? 118 GLY G O   1 
ATOM   9445  N N   . SER G 1 119 ? 117.038 49.664 143.434 1.00 68.09  ? 119 SER G N   1 
ATOM   9446  C CA  . SER G 1 119 ? 116.478 50.094 144.715 1.00 68.09  ? 119 SER G CA  1 
ATOM   9447  C C   . SER G 1 119 ? 115.710 51.417 144.528 1.00 68.09  ? 119 SER G C   1 
ATOM   9448  O O   . SER G 1 119 ? 116.130 52.286 143.751 1.00 68.09  ? 119 SER G O   1 
ATOM   9449  C CB  . SER G 1 119 ? 117.614 50.268 145.728 1.00 82.56  ? 119 SER G CB  1 
ATOM   9450  O OG  . SER G 1 119 ? 117.105 50.504 147.025 1.00 82.56  ? 119 SER G OG  1 
ATOM   9451  N N   . TYR G 1 120 ? 114.597 51.594 145.235 1.00 46.35  ? 120 TYR G N   1 
ATOM   9452  C CA  . TYR G 1 120 ? 113.855 52.833 145.040 1.00 46.35  ? 120 TYR G CA  1 
ATOM   9453  C C   . TYR G 1 120 ? 112.978 53.307 146.203 1.00 46.35  ? 120 TYR G C   1 
ATOM   9454  O O   . TYR G 1 120 ? 112.535 52.517 147.050 1.00 46.35  ? 120 TYR G O   1 
ATOM   9455  C CB  . TYR G 1 120 ? 112.969 52.687 143.792 1.00 37.50  ? 120 TYR G CB  1 
ATOM   9456  C CG  . TYR G 1 120 ? 111.864 51.655 143.972 1.00 37.50  ? 120 TYR G CG  1 
ATOM   9457  C CD1 . TYR G 1 120 ? 110.708 51.965 144.677 1.00 37.50  ? 120 TYR G CD1 1 
ATOM   9458  C CD2 . TYR G 1 120 ? 112.021 50.345 143.510 1.00 37.50  ? 120 TYR G CD2 1 
ATOM   9459  C CE1 . TYR G 1 120 ? 109.739 51.003 144.928 1.00 37.50  ? 120 TYR G CE1 1 
ATOM   9460  C CE2 . TYR G 1 120 ? 111.060 49.372 143.752 1.00 37.50  ? 120 TYR G CE2 1 
ATOM   9461  C CZ  . TYR G 1 120 ? 109.919 49.701 144.464 1.00 37.50  ? 120 TYR G CZ  1 
ATOM   9462  O OH  . TYR G 1 120 ? 108.943 48.749 144.734 1.00 37.50  ? 120 TYR G OH  1 
ATOM   9463  N N   . HIS G 1 121 ? 112.723 54.611 146.224 1.00 68.45  ? 121 HIS G N   1 
ATOM   9464  C CA  . HIS G 1 121 ? 111.845 55.201 147.220 1.00 68.45  ? 121 HIS G CA  1 
ATOM   9465  C C   . HIS G 1 121 ? 111.140 56.342 146.503 1.00 68.45  ? 121 HIS G C   1 
ATOM   9466  O O   . HIS G 1 121 ? 111.730 57.012 145.647 1.00 68.45  ? 121 HIS G O   1 
ATOM   9467  C CB  . HIS G 1 121 ? 112.620 55.741 148.419 1.00 57.02  ? 121 HIS G CB  1 
ATOM   9468  C CG  . HIS G 1 121 ? 113.188 54.685 149.314 1.00 57.02  ? 121 HIS G CG  1 
ATOM   9469  N ND1 . HIS G 1 121 ? 114.545 54.450 149.414 1.00 57.02  ? 121 HIS G ND1 1 
ATOM   9470  C CD2 . HIS G 1 121 ? 112.592 53.834 150.181 1.00 57.02  ? 121 HIS G CD2 1 
ATOM   9471  C CE1 . HIS G 1 121 ? 114.756 53.500 150.309 1.00 57.02  ? 121 HIS G CE1 1 
ATOM   9472  N NE2 . HIS G 1 121 ? 113.587 53.109 150.789 1.00 57.02  ? 121 HIS G NE2 1 
ATOM   9473  N N   . GLU G 1 122 ? 109.879 56.556 146.852 1.00 51.63  ? 122 GLU G N   1 
ATOM   9474  C CA  . GLU G 1 122 ? 109.064 57.600 146.235 1.00 51.63  ? 122 GLU G CA  1 
ATOM   9475  C C   . GLU G 1 122 ? 108.309 58.373 147.330 1.00 51.63  ? 122 GLU G C   1 
ATOM   9476  O O   . GLU G 1 122 ? 107.889 57.786 148.338 1.00 51.63  ? 122 GLU G O   1 
ATOM   9477  C CB  . GLU G 1 122 ? 108.088 56.932 145.242 1.00 73.36  ? 122 GLU G CB  1 
ATOM   9478  C CG  . GLU G 1 122 ? 106.899 57.768 144.796 1.00 73.36  ? 122 GLU G CG  1 
ATOM   9479  C CD  . GLU G 1 122 ? 106.077 57.104 143.692 1.00 73.36  ? 122 GLU G CD  1 
ATOM   9480  O OE1 . GLU G 1 122 ? 105.806 55.884 143.797 1.00 73.36  ? 122 GLU G OE1 1 
ATOM   9481  O OE2 . GLU G 1 122 ? 105.691 57.813 142.732 1.00 73.36  ? 122 GLU G OE2 1 
ATOM   9482  N N   . ASP G 1 123 ? 108.150 59.684 147.148 1.00 75.85  ? 123 ASP G N   1 
ATOM   9483  C CA  . ASP G 1 123 ? 107.445 60.505 148.139 1.00 75.85  ? 123 ASP G CA  1 
ATOM   9484  C C   . ASP G 1 123 ? 106.734 61.713 147.520 1.00 75.85  ? 123 ASP G C   1 
ATOM   9485  O O   . ASP G 1 123 ? 106.953 62.043 146.355 1.00 75.85  ? 123 ASP G O   1 
ATOM   9486  C CB  . ASP G 1 123 ? 108.429 61.009 149.206 1.00 71.26  ? 123 ASP G CB  1 
ATOM   9487  C CG  . ASP G 1 123 ? 107.828 61.001 150.608 1.00 71.26  ? 123 ASP G CG  1 
ATOM   9488  O OD1 . ASP G 1 123 ? 106.725 61.554 150.814 1.00 71.26  ? 123 ASP G OD1 1 
ATOM   9489  O OD2 . ASP G 1 123 ? 108.467 60.431 151.512 1.00 71.26  ? 123 ASP G OD2 1 
ATOM   9490  N N   . VAL G 1 124 ? 105.886 62.369 148.316 1.00 65.50  ? 124 VAL G N   1 
ATOM   9491  C CA  . VAL G 1 124 ? 105.158 63.559 147.877 1.00 65.50  ? 124 VAL G CA  1 
ATOM   9492  C C   . VAL G 1 124 ? 105.922 64.813 148.248 1.00 65.50  ? 124 VAL G C   1 
ATOM   9493  O O   . VAL G 1 124 ? 106.479 64.910 149.331 1.00 65.50  ? 124 VAL G O   1 
ATOM   9494  C CB  . VAL G 1 124 ? 103.803 63.746 148.574 1.00 47.46  ? 124 VAL G CB  1 
ATOM   9495  C CG1 . VAL G 1 124 ? 102.773 64.149 147.564 1.00 47.46  ? 124 VAL G CG1 1 
ATOM   9496  C CG2 . VAL G 1 124 ? 103.394 62.522 149.324 1.00 47.46  ? 124 VAL G CG2 1 
ATOM   9497  N N   . GLY G 1 125 ? 105.922 65.781 147.348 1.00 89.53  ? 125 GLY G N   1 
ATOM   9498  C CA  . GLY G 1 125 ? 106.564 67.050 147.619 1.00 89.53  ? 125 GLY G CA  1 
ATOM   9499  C C   . GLY G 1 125 ? 105.425 68.046 147.521 1.00 89.53  ? 125 GLY G C   1 
ATOM   9500  O O   . GLY G 1 125 ? 104.419 67.743 146.887 1.00 89.53  ? 125 GLY G O   1 
ATOM   9501  N N   . TYR G 1 126 ? 105.540 69.207 148.154 1.00 73.58  ? 126 TYR G N   1 
ATOM   9502  C CA  . TYR G 1 126 ? 104.473 70.194 148.061 1.00 73.58  ? 126 TYR G CA  1 
ATOM   9503  C C   . TYR G 1 126 ? 105.051 71.577 147.835 1.00 73.58  ? 126 TYR G C   1 
ATOM   9504  O O   . TYR G 1 126 ? 106.029 71.950 148.463 1.00 73.58  ? 126 TYR G O   1 
ATOM   9505  C CB  . TYR G 1 126 ? 103.619 70.206 149.320 1.00 66.52  ? 126 TYR G CB  1 
ATOM   9506  C CG  . TYR G 1 126 ? 102.197 70.594 149.029 1.00 66.52  ? 126 TYR G CG  1 
ATOM   9507  C CD1 . TYR G 1 126 ? 101.291 69.653 148.560 1.00 66.52  ? 126 TYR G CD1 1 
ATOM   9508  C CD2 . TYR G 1 126 ? 101.772 71.914 149.145 1.00 66.52  ? 126 TYR G CD2 1 
ATOM   9509  C CE1 . TYR G 1 126 ? 100.000 70.008 148.205 1.00 66.52  ? 126 TYR G CE1 1 
ATOM   9510  C CE2 . TYR G 1 126 ? 100.477 72.285 148.793 1.00 66.52  ? 126 TYR G CE2 1 
ATOM   9511  C CZ  . TYR G 1 126 ? 99.597  71.320 148.321 1.00 66.52  ? 126 TYR G CZ  1 
ATOM   9512  O OH  . TYR G 1 126 ? 98.316  71.646 147.958 1.00 66.52  ? 126 TYR G OH  1 
ATOM   9513  N N   . GLY G 1 127 ? 104.453 72.330 146.921 1.00 101.12 ? 127 GLY G N   1 
ATOM   9514  C CA  . GLY G 1 127 ? 104.934 73.668 146.634 1.00 101.12 ? 127 GLY G CA  1 
ATOM   9515  C C   . GLY G 1 127 ? 103.860 74.672 146.980 1.00 101.12 ? 127 GLY G C   1 
ATOM   9516  O O   . GLY G 1 127 ? 102.676 74.401 146.779 1.00 101.12 ? 127 GLY G O   1 
ATOM   9517  N N   . VAL G 1 128 ? 104.263 75.827 147.503 1.00 76.08  ? 128 VAL G N   1 
ATOM   9518  C CA  . VAL G 1 128 ? 103.305 76.855 147.883 1.00 76.08  ? 128 VAL G CA  1 
ATOM   9519  C C   . VAL G 1 128 ? 103.752 78.257 147.474 1.00 76.08  ? 128 VAL G C   1 
ATOM   9520  O O   . VAL G 1 128 ? 104.937 78.529 147.323 1.00 76.08  ? 128 VAL G O   1 
ATOM   9521  C CB  . VAL G 1 128 ? 103.061 76.846 149.413 1.00 40.23  ? 128 VAL G CB  1 
ATOM   9522  C CG1 . VAL G 1 128 ? 101.895 77.734 149.752 1.00 40.23  ? 128 VAL G CG1 1 
ATOM   9523  C CG2 . VAL G 1 128 ? 102.766 75.420 149.901 1.00 40.23  ? 128 VAL G CG2 1 
ATOM   9524  N N   . SER G 1 129 ? 102.775 79.131 147.272 1.00 83.61  ? 129 SER G N   1 
ATOM   9525  C CA  . SER G 1 129 ? 102.994 80.529 146.925 1.00 83.61  ? 129 SER G CA  1 
ATOM   9526  C C   . SER G 1 129 ? 101.705 81.193 147.372 1.00 83.61  ? 129 SER G C   1 
ATOM   9527  O O   . SER G 1 129 ? 100.634 80.880 146.846 1.00 83.61  ? 129 SER G O   1 
ATOM   9528  C CB  . SER G 1 129 ? 103.178 80.709 145.429 1.00 80.37  ? 129 SER G CB  1 
ATOM   9529  O OG  . SER G 1 129 ? 103.212 82.089 145.123 1.00 80.37  ? 129 SER G OG  1 
ATOM   9530  N N   . GLU G 1 130 ? 101.795 82.096 148.344 1.00 120.20 ? 130 GLU G N   1 
ATOM   9531  C CA  . GLU G 1 130 ? 100.590 82.728 148.863 1.00 120.20 ? 130 GLU G CA  1 
ATOM   9532  C C   . GLU G 1 130 ? 100.516 84.245 148.771 1.00 120.20 ? 130 GLU G C   1 
ATOM   9533  O O   . GLU G 1 130 ? 99.479  84.836 149.082 1.00 120.20 ? 130 GLU G O   1 
ATOM   9534  C CB  . GLU G 1 130 ? 100.380 82.289 150.317 1.00 71.91  ? 130 GLU G CB  1 
ATOM   9535  C CG  . GLU G 1 130 ? 100.505 80.780 150.510 1.00 71.91  ? 130 GLU G CG  1 
ATOM   9536  C CD  . GLU G 1 130 ? 99.670  80.233 151.669 1.00 71.91  ? 130 GLU G CD  1 
ATOM   9537  O OE1 . GLU G 1 130 ? 98.427  80.155 151.545 1.00 71.91  ? 130 GLU G OE1 1 
ATOM   9538  O OE2 . GLU G 1 130 ? 100.257 79.872 152.710 1.00 71.91  ? 130 GLU G OE2 1 
ATOM   9539  N N   . GLY G 1 131 ? 101.593 84.882 148.330 1.00 87.15  ? 131 GLY G N   1 
ATOM   9540  C CA  . GLY G 1 131 ? 101.574 86.333 148.253 1.00 87.15  ? 131 GLY G CA  1 
ATOM   9541  C C   . GLY G 1 131 ? 101.407 86.937 146.875 1.00 87.15  ? 131 GLY G C   1 
ATOM   9542  O O   . GLY G 1 131 ? 100.355 87.485 146.551 1.00 87.15  ? 131 GLY G O   1 
ATOM   9543  N N   . LEU G 1 132 ? 102.465 86.841 146.078 1.00 61.96  ? 132 LEU G N   1 
ATOM   9544  C CA  . LEU G 1 132 ? 102.531 87.362 144.712 1.00 61.96  ? 132 LEU G CA  1 
ATOM   9545  C C   . LEU G 1 132 ? 101.257 87.839 143.981 1.00 61.96  ? 132 LEU G C   1 
ATOM   9546  O O   . LEU G 1 132 ? 100.152 87.306 144.141 1.00 61.96  ? 132 LEU G O   1 
ATOM   9547  C CB  . LEU G 1 132 ? 103.264 86.336 143.843 1.00 90.19  ? 132 LEU G CB  1 
ATOM   9548  C CG  . LEU G 1 132 ? 104.697 86.037 144.297 1.00 90.19  ? 132 LEU G CG  1 
ATOM   9549  C CD1 . LEU G 1 132 ? 105.248 84.862 143.518 1.00 90.19  ? 132 LEU G CD1 1 
ATOM   9550  C CD2 . LEU G 1 132 ? 105.570 87.266 144.090 1.00 90.19  ? 132 LEU G CD2 1 
ATOM   9551  N N   . LYS G 1 133 ? 101.435 88.866 143.166 1.00 99.30  ? 133 LYS G N   1 
ATOM   9552  C CA  . LYS G 1 133 ? 100.328 89.392 142.400 1.00 99.30  ? 133 LYS G CA  1 
ATOM   9553  C C   . LYS G 1 133 ? 100.378 88.716 141.044 1.00 99.30  ? 133 LYS G C   1 
ATOM   9554  O O   . LYS G 1 133 ? 99.378  88.672 140.326 1.00 99.30  ? 133 LYS G O   1 
ATOM   9555  C CB  . LYS G 1 133 ? 100.457 90.904 142.238 1.00 115.14 ? 133 LYS G CB  1 
ATOM   9556  C CG  . LYS G 1 133 ? 100.293 91.677 143.530 1.00 115.14 ? 133 LYS G CG  1 
ATOM   9557  C CD  . LYS G 1 133 ? 100.540 93.162 143.313 1.00 115.14 ? 133 LYS G CD  1 
ATOM   9558  C CE  . LYS G 1 133 ? 99.536  93.773 142.338 1.00 115.14 ? 133 LYS G CE  1 
ATOM   9559  N NZ  . LYS G 1 133 ? 98.133  93.714 142.842 1.00 115.14 ? 133 LYS G NZ  1 
ATOM   9560  N N   . SER G 1 134 ? 101.549 88.182 140.701 1.00 82.59  ? 134 SER G N   1 
ATOM   9561  C CA  . SER G 1 134 ? 101.730 87.497 139.424 1.00 82.59  ? 134 SER G CA  1 
ATOM   9562  C C   . SER G 1 134 ? 101.311 86.024 139.485 1.00 82.59  ? 134 SER G C   1 
ATOM   9563  O O   . SER G 1 134 ? 101.777 85.266 140.344 1.00 82.59  ? 134 SER G O   1 
ATOM   9564  C CB  . SER G 1 134 ? 103.186 87.591 138.971 1.00 76.16  ? 134 SER G CB  1 
ATOM   9565  O OG  . SER G 1 134 ? 103.353 86.957 137.716 1.00 76.16  ? 134 SER G OG  1 
ATOM   9566  N N   . LYS G 1 135 ? 100.422 85.631 138.573 1.00 86.93  ? 135 LYS G N   1 
ATOM   9567  C CA  . LYS G 1 135 ? 99.948  84.256 138.524 1.00 86.93  ? 135 LYS G CA  1 
ATOM   9568  C C   . LYS G 1 135 ? 101.113 83.390 138.081 1.00 86.93  ? 135 LYS G C   1 
ATOM   9569  O O   . LYS G 1 135 ? 101.452 82.410 138.741 1.00 86.93  ? 135 LYS G O   1 
ATOM   9570  C CB  . LYS G 1 135 ? 98.768  84.117 137.546 1.00 56.74  ? 135 LYS G CB  1 
ATOM   9571  C CG  . LYS G 1 135 ? 98.223  82.710 137.459 1.00 56.74  ? 135 LYS G CG  1 
ATOM   9572  C CD  . LYS G 1 135 ? 96.728  82.665 137.234 1.00 56.74  ? 135 LYS G CD  1 
ATOM   9573  C CE  . LYS G 1 135 ? 96.339  83.026 135.823 1.00 56.74  ? 135 LYS G CE  1 
ATOM   9574  N NZ  . LYS G 1 135 ? 94.876  82.794 135.620 1.00 56.74  ? 135 LYS G NZ  1 
ATOM   9575  N N   . ALA G 1 136 ? 101.740 83.775 136.974 1.00 60.05  ? 136 ALA G N   1 
ATOM   9576  C CA  . ALA G 1 136 ? 102.875 83.037 136.444 1.00 60.05  ? 136 ALA G CA  1 
ATOM   9577  C C   . ALA G 1 136 ? 103.912 82.745 137.521 1.00 60.05  ? 136 ALA G C   1 
ATOM   9578  O O   . ALA G 1 136 ? 104.294 81.598 137.726 1.00 60.05  ? 136 ALA G O   1 
ATOM   9579  C CB  . ALA G 1 136 ? 103.525 83.809 135.317 1.00 47.85  ? 136 ALA G CB  1 
ATOM   9580  N N   . LEU G 1 137 ? 104.383 83.780 138.204 1.00 62.78  ? 137 LEU G N   1 
ATOM   9581  C CA  . LEU G 1 137 ? 105.382 83.589 139.252 1.00 62.78  ? 137 LEU G CA  1 
ATOM   9582  C C   . LEU G 1 137 ? 104.886 82.732 140.414 1.00 62.78  ? 137 LEU G C   1 
ATOM   9583  O O   . LEU G 1 137 ? 105.665 81.999 141.014 1.00 62.78  ? 137 LEU G O   1 
ATOM   9584  C CB  . LEU G 1 137 ? 105.886 84.940 139.770 1.00 88.22  ? 137 LEU G CB  1 
ATOM   9585  C CG  . LEU G 1 137 ? 107.049 85.545 138.969 1.00 88.22  ? 137 LEU G CG  1 
ATOM   9586  C CD1 . LEU G 1 137 ? 106.711 85.647 137.474 1.00 88.22  ? 137 LEU G CD1 1 
ATOM   9587  C CD2 . LEU G 1 137 ? 107.370 86.908 139.545 1.00 88.22  ? 137 LEU G CD2 1 
ATOM   9588  N N   . SER G 1 138 ? 103.602 82.808 140.738 1.00 65.96  ? 138 SER G N   1 
ATOM   9589  C CA  . SER G 1 138 ? 103.092 81.989 141.831 1.00 65.96  ? 138 SER G CA  1 
ATOM   9590  C C   . SER G 1 138 ? 103.147 80.492 141.479 1.00 65.96  ? 138 SER G C   1 
ATOM   9591  O O   . SER G 1 138 ? 103.488 79.663 142.323 1.00 65.96  ? 138 SER G O   1 
ATOM   9592  C CB  . SER G 1 138 ? 101.658 82.394 142.191 1.00 70.25  ? 138 SER G CB  1 
ATOM   9593  O OG  . SER G 1 138 ? 101.632 83.628 142.891 1.00 70.25  ? 138 SER G OG  1 
ATOM   9594  N N   . LEU G 1 139 ? 102.817 80.145 140.236 1.00 64.07  ? 139 LEU G N   1 
ATOM   9595  C CA  . LEU G 1 139 ? 102.845 78.751 139.805 1.00 64.07  ? 139 LEU G CA  1 
ATOM   9596  C C   . LEU G 1 139 ? 104.286 78.272 139.665 1.00 64.07  ? 139 LEU G C   1 
ATOM   9597  O O   . LEU G 1 139 ? 104.649 77.215 140.181 1.00 64.07  ? 139 LEU G O   1 
ATOM   9598  C CB  . LEU G 1 139 ? 102.110 78.582 138.472 1.00 44.84  ? 139 LEU G CB  1 
ATOM   9599  C CG  . LEU G 1 139 ? 100.587 78.701 138.489 1.00 44.84  ? 139 LEU G CG  1 
ATOM   9600  C CD1 . LEU G 1 139 ? 100.061 78.794 137.076 1.00 44.84  ? 139 LEU G CD1 1 
ATOM   9601  C CD2 . LEU G 1 139 ? 99.997  77.511 139.193 1.00 44.84  ? 139 LEU G CD2 1 
ATOM   9602  N N   . GLU G 1 140 ? 105.113 79.046 138.972 1.00 54.96  ? 140 GLU G N   1 
ATOM   9603  C CA  . GLU G 1 140 ? 106.517 78.669 138.800 1.00 54.96  ? 140 GLU G CA  1 
ATOM   9604  C C   . GLU G 1 140 ? 107.137 78.311 140.157 1.00 54.96  ? 140 GLU G C   1 
ATOM   9605  O O   . GLU G 1 140 ? 107.862 77.328 140.302 1.00 54.96  ? 140 GLU G O   1 
ATOM   9606  C CB  . GLU G 1 140 ? 107.310 79.813 138.170 1.00 61.45  ? 140 GLU G CB  1 
ATOM   9607  C CG  . GLU G 1 140 ? 108.811 79.590 138.212 1.00 61.45  ? 140 GLU G CG  1 
ATOM   9608  C CD  . GLU G 1 140 ? 109.605 80.704 137.535 1.00 61.45  ? 140 GLU G CD  1 
ATOM   9609  O OE1 . GLU G 1 140 ? 109.398 81.899 137.893 1.00 61.45  ? 140 GLU G OE1 1 
ATOM   9610  O OE2 . GLU G 1 140 ? 110.444 80.376 136.655 1.00 61.45  ? 140 GLU G OE2 1 
ATOM   9611  N N   . LYS G 1 141 ? 106.829 79.119 141.157 1.00 68.24  ? 141 LYS G N   1 
ATOM   9612  C CA  . LYS G 1 141 ? 107.348 78.888 142.487 1.00 68.24  ? 141 LYS G CA  1 
ATOM   9613  C C   . LYS G 1 141 ? 106.781 77.587 143.071 1.00 68.24  ? 141 LYS G C   1 
ATOM   9614  O O   . LYS G 1 141 ? 107.532 76.717 143.483 1.00 68.24  ? 141 LYS G O   1 
ATOM   9615  C CB  . LYS G 1 141 ? 107.001 80.090 143.371 1.00 47.46  ? 141 LYS G CB  1 
ATOM   9616  C CG  . LYS G 1 141 ? 107.815 80.231 144.646 1.00 47.46  ? 141 LYS G CG  1 
ATOM   9617  C CD  . LYS G 1 141 ? 106.946 80.040 145.889 1.00 47.46  ? 141 LYS G CD  1 
ATOM   9618  C CE  . LYS G 1 141 ? 107.712 80.440 147.137 1.00 47.46  ? 141 LYS G CE  1 
ATOM   9619  N NZ  . LYS G 1 141 ? 107.028 80.033 148.402 1.00 47.46  ? 141 LYS G NZ  1 
ATOM   9620  N N   . ALA G 1 142 ? 105.461 77.440 143.090 1.00 54.02  ? 142 ALA G N   1 
ATOM   9621  C CA  . ALA G 1 142 ? 104.841 76.236 143.653 1.00 54.02  ? 142 ALA G CA  1 
ATOM   9622  C C   . ALA G 1 142 ? 105.196 74.932 142.936 1.00 54.02  ? 142 ALA G C   1 
ATOM   9623  O O   . ALA G 1 142 ? 105.367 73.900 143.577 1.00 54.02  ? 142 ALA G O   1 
ATOM   9624  C CB  . ALA G 1 142 ? 103.328 76.403 143.687 1.00 74.71  ? 142 ALA G CB  1 
ATOM   9625  N N   . ARG G 1 143 ? 105.291 74.978 141.609 1.00 75.38  ? 143 ARG G N   1 
ATOM   9626  C CA  . ARG G 1 143 ? 105.613 73.782 140.849 1.00 75.38  ? 143 ARG G CA  1 
ATOM   9627  C C   . ARG G 1 143 ? 107.040 73.361 141.135 1.00 75.38  ? 143 ARG G C   1 
ATOM   9628  O O   . ARG G 1 143 ? 107.289 72.212 141.482 1.00 75.38  ? 143 ARG G O   1 
ATOM   9629  C CB  . ARG G 1 143 ? 105.433 74.013 139.341 1.00 61.30  ? 143 ARG G CB  1 
ATOM   9630  C CG  . ARG G 1 143 ? 104.046 74.503 138.954 1.00 61.30  ? 143 ARG G CG  1 
ATOM   9631  C CD  . ARG G 1 143 ? 103.686 74.274 137.485 1.00 61.30  ? 143 ARG G CD  1 
ATOM   9632  N NE  . ARG G 1 143 ? 103.015 72.991 137.338 1.00 61.30  ? 143 ARG G NE  1 
ATOM   9633  C CZ  . ARG G 1 143 ? 101.945 72.771 136.585 1.00 61.30  ? 143 ARG G CZ  1 
ATOM   9634  N NH1 . ARG G 1 143 ? 101.403 73.754 135.889 1.00 61.30  ? 143 ARG G NH1 1 
ATOM   9635  N NH2 . ARG G 1 143 ? 101.410 71.561 136.541 1.00 61.30  ? 143 ARG G NH2 1 
ATOM   9636  N N   . LYS G 1 144 ? 107.977 74.293 141.010 1.00 49.70  ? 144 LYS G N   1 
ATOM   9637  C CA  . LYS G 1 144 ? 109.377 73.975 141.248 1.00 49.70  ? 144 LYS G CA  1 
ATOM   9638  C C   . LYS G 1 144 ? 109.640 73.491 142.659 1.00 49.70  ? 144 LYS G C   1 
ATOM   9639  O O   . LYS G 1 144 ? 110.361 72.518 142.868 1.00 49.70  ? 144 LYS G O   1 
ATOM   9640  C CB  . LYS G 1 144 ? 110.253 75.178 140.950 1.00 42.93  ? 144 LYS G CB  1 
ATOM   9641  C CG  . LYS G 1 144 ? 110.190 75.581 139.501 1.00 42.93  ? 144 LYS G CG  1 
ATOM   9642  C CD  . LYS G 1 144 ? 111.332 76.482 139.082 1.00 42.93  ? 144 LYS G CD  1 
ATOM   9643  C CE  . LYS G 1 144 ? 111.207 76.860 137.619 1.00 42.93  ? 144 LYS G CE  1 
ATOM   9644  N NZ  . LYS G 1 144 ? 112.369 77.681 137.183 1.00 42.93  ? 144 LYS G NZ  1 
ATOM   9645  N N   . GLU G 1 145 ? 109.059 74.159 143.638 1.00 60.47  ? 145 GLU G N   1 
ATOM   9646  C CA  . GLU G 1 145 ? 109.275 73.745 145.007 1.00 60.47  ? 145 GLU G CA  1 
ATOM   9647  C C   . GLU G 1 145 ? 108.698 72.365 145.282 1.00 60.47  ? 145 GLU G C   1 
ATOM   9648  O O   . GLU G 1 145 ? 109.346 71.540 145.922 1.00 60.47  ? 145 GLU G O   1 
ATOM   9649  C CB  . GLU G 1 145 ? 108.694 74.780 145.973 1.00 87.14  ? 145 GLU G CB  1 
ATOM   9650  C CG  . GLU G 1 145 ? 109.746 75.747 146.495 1.00 87.14  ? 145 GLU G CG  1 
ATOM   9651  C CD  . GLU G 1 145 ? 109.158 77.000 147.102 1.00 87.14  ? 145 GLU G CD  1 
ATOM   9652  O OE1 . GLU G 1 145 ? 108.268 76.878 147.982 1.00 87.14  ? 145 GLU G OE1 1 
ATOM   9653  O OE2 . GLU G 1 145 ? 109.600 78.101 146.696 1.00 87.14  ? 145 GLU G OE2 1 
ATOM   9654  N N   . ALA G 1 146 ? 107.492 72.098 144.792 1.00 78.67  ? 146 ALA G N   1 
ATOM   9655  C CA  . ALA G 1 146 ? 106.868 70.795 145.014 1.00 78.67  ? 146 ALA G CA  1 
ATOM   9656  C C   . ALA G 1 146 ? 107.805 69.658 144.591 1.00 78.67  ? 146 ALA G C   1 
ATOM   9657  O O   . ALA G 1 146 ? 107.944 68.652 145.290 1.00 78.67  ? 146 ALA G O   1 
ATOM   9658  C CB  . ALA G 1 146 ? 105.528 70.705 144.243 1.00 35.64  ? 146 ALA G CB  1 
ATOM   9659  N N   . VAL G 1 147 ? 108.453 69.834 143.447 1.00 37.69  ? 147 VAL G N   1 
ATOM   9660  C CA  . VAL G 1 147 ? 109.358 68.832 142.930 1.00 37.69  ? 147 VAL G CA  1 
ATOM   9661  C C   . VAL G 1 147 ? 110.534 68.666 143.859 1.00 37.69  ? 147 VAL G C   1 
ATOM   9662  O O   . VAL G 1 147 ? 110.778 67.570 144.380 1.00 37.69  ? 147 VAL G O   1 
ATOM   9663  C CB  . VAL G 1 147 ? 109.842 69.205 141.507 1.00 40.92  ? 147 VAL G CB  1 
ATOM   9664  C CG1 . VAL G 1 147 ? 111.074 68.408 141.120 1.00 40.92  ? 147 VAL G CG1 1 
ATOM   9665  C CG2 . VAL G 1 147 ? 108.733 68.906 140.524 1.00 40.92  ? 147 VAL G CG2 1 
ATOM   9666  N N   . THR G 1 148 ? 111.272 69.744 144.081 1.00 53.79  ? 148 THR G N   1 
ATOM   9667  C CA  . THR G 1 148 ? 112.410 69.654 144.972 1.00 53.79  ? 148 THR G CA  1 
ATOM   9668  C C   . THR G 1 148 ? 111.991 69.101 146.359 1.00 53.79  ? 148 THR G C   1 
ATOM   9669  O O   . THR G 1 148 ? 112.659 68.238 146.928 1.00 53.79  ? 148 THR G O   1 
ATOM   9670  C CB  . THR G 1 148 ? 113.073 71.013 145.092 1.00 72.46  ? 148 THR G CB  1 
ATOM   9671  O OG1 . THR G 1 148 ? 113.490 71.435 143.786 1.00 72.46  ? 148 THR G OG1 1 
ATOM   9672  C CG2 . THR G 1 148 ? 114.279 70.937 146.012 1.00 72.46  ? 148 THR G CG2 1 
ATOM   9673  N N   . ASP G 1 149 ? 110.874 69.565 146.896 1.00 59.07  ? 149 ASP G N   1 
ATOM   9674  C CA  . ASP G 1 149 ? 110.441 69.056 148.189 1.00 59.07  ? 149 ASP G CA  1 
ATOM   9675  C C   . ASP G 1 149 ? 110.205 67.540 148.078 1.00 59.07  ? 149 ASP G C   1 
ATOM   9676  O O   . ASP G 1 149 ? 110.429 66.771 149.038 1.00 59.07  ? 149 ASP G O   1 
ATOM   9677  C CB  . ASP G 1 149 ? 109.154 69.762 148.637 1.00 65.98  ? 149 ASP G CB  1 
ATOM   9678  C CG  . ASP G 1 149 ? 108.717 69.358 150.053 1.00 65.98  ? 149 ASP G CG  1 
ATOM   9679  O OD1 . ASP G 1 149 ? 109.527 69.461 151.010 1.00 65.98  ? 149 ASP G OD1 1 
ATOM   9680  O OD2 . ASP G 1 149 ? 107.552 68.941 150.213 1.00 65.98  ? 149 ASP G OD2 1 
ATOM   9681  N N   . GLY G 1 150 ? 109.741 67.110 146.906 1.00 65.35  ? 150 GLY G N   1 
ATOM   9682  C CA  . GLY G 1 150 ? 109.496 65.698 146.694 1.00 65.35  ? 150 GLY G CA  1 
ATOM   9683  C C   . GLY G 1 150 ? 110.820 64.960 146.662 1.00 65.35  ? 150 GLY G C   1 
ATOM   9684  O O   . GLY G 1 150 ? 111.015 63.972 147.366 1.00 65.35  ? 150 GLY G O   1 
ATOM   9685  N N   . LEU G 1 151 ? 111.741 65.444 145.845 1.00 56.75  ? 151 LEU G N   1 
ATOM   9686  C CA  . LEU G 1 151 ? 113.049 64.815 145.751 1.00 56.75  ? 151 LEU G CA  1 
ATOM   9687  C C   . LEU G 1 151 ? 113.718 64.692 147.124 1.00 56.75  ? 151 LEU G C   1 
ATOM   9688  O O   . LEU G 1 151 ? 114.283 63.652 147.469 1.00 56.75  ? 151 LEU G O   1 
ATOM   9689  C CB  . LEU G 1 151 ? 113.961 65.607 144.812 1.00 28.27  ? 151 LEU G CB  1 
ATOM   9690  C CG  . LEU G 1 151 ? 115.392 65.091 144.808 1.00 28.27  ? 151 LEU G CG  1 
ATOM   9691  C CD1 . LEU G 1 151 ? 115.372 63.595 144.704 1.00 28.27  ? 151 LEU G CD1 1 
ATOM   9692  C CD2 . LEU G 1 151 ? 116.168 65.667 143.629 1.00 28.27  ? 151 LEU G CD2 1 
ATOM   9693  N N   . LYS G 1 152 ? 113.664 65.756 147.913 1.00 68.84  ? 152 LYS G N   1 
ATOM   9694  C CA  . LYS G 1 152 ? 114.279 65.697 149.221 1.00 68.84  ? 152 LYS G CA  1 
ATOM   9695  C C   . LYS G 1 152 ? 113.592 64.643 150.062 1.00 68.84  ? 152 LYS G C   1 
ATOM   9696  O O   . LYS G 1 152 ? 114.252 63.765 150.603 1.00 68.84  ? 152 LYS G O   1 
ATOM   9697  C CB  . LYS G 1 152 ? 114.226 67.058 149.928 1.00 81.18  ? 152 LYS G CB  1 
ATOM   9698  C CG  . LYS G 1 152 ? 115.128 68.120 149.301 1.00 81.18  ? 152 LYS G CG  1 
ATOM   9699  C CD  . LYS G 1 152 ? 115.269 69.354 150.189 1.00 81.18  ? 152 LYS G CD  1 
ATOM   9700  C CE  . LYS G 1 152 ? 113.918 69.970 150.531 1.00 81.18  ? 152 LYS G CE  1 
ATOM   9701  N NZ  . LYS G 1 152 ? 114.055 71.208 151.338 1.00 81.18  ? 152 LYS G NZ  1 
ATOM   9702  N N   . ARG G 1 153 ? 112.271 64.709 150.164 1.00 86.12  ? 153 ARG G N   1 
ATOM   9703  C CA  . ARG G 1 153 ? 111.549 63.735 150.973 1.00 86.12  ? 153 ARG G CA  1 
ATOM   9704  C C   . ARG G 1 153 ? 111.785 62.284 150.549 1.00 86.12  ? 153 ARG G C   1 
ATOM   9705  O O   . ARG G 1 153 ? 111.706 61.366 151.367 1.00 86.12  ? 153 ARG G O   1 
ATOM   9706  C CB  . ARG G 1 153 ? 110.055 64.042 150.962 1.00 68.54  ? 153 ARG G CB  1 
ATOM   9707  C CG  . ARG G 1 153 ? 109.662 65.107 151.932 1.00 68.54  ? 153 ARG G CG  1 
ATOM   9708  C CD  . ARG G 1 153 ? 108.240 65.525 151.708 1.00 68.54  ? 153 ARG G CD  1 
ATOM   9709  N NE  . ARG G 1 153 ? 107.275 64.463 151.967 1.00 68.54  ? 153 ARG G NE  1 
ATOM   9710  C CZ  . ARG G 1 153 ? 106.868 64.111 153.178 1.00 68.54  ? 153 ARG G CZ  1 
ATOM   9711  N NH1 . ARG G 1 153 ? 107.356 64.738 154.237 1.00 68.54  ? 153 ARG G NH1 1 
ATOM   9712  N NH2 . ARG G 1 153 ? 105.954 63.159 153.333 1.00 68.54  ? 153 ARG G NH2 1 
ATOM   9713  N N   . ALA G 1 154 ? 112.080 62.069 149.274 1.00 75.86  ? 154 ALA G N   1 
ATOM   9714  C CA  . ALA G 1 154 ? 112.317 60.715 148.811 1.00 75.86  ? 154 ALA G CA  1 
ATOM   9715  C C   . ALA G 1 154 ? 113.685 60.232 149.272 1.00 75.86  ? 154 ALA G C   1 
ATOM   9716  O O   . ALA G 1 154 ? 113.806 59.136 149.816 1.00 75.86  ? 154 ALA G O   1 
ATOM   9717  C CB  . ALA G 1 154 ? 112.206 60.646 147.285 1.00 38.41  ? 154 ALA G CB  1 
ATOM   9718  N N   . LEU G 1 155 ? 114.712 61.053 149.070 1.00 53.68  ? 155 LEU G N   1 
ATOM   9719  C CA  . LEU G 1 155 ? 116.065 60.673 149.464 1.00 53.68  ? 155 LEU G CA  1 
ATOM   9720  C C   . LEU G 1 155 ? 116.190 60.430 150.969 1.00 53.68  ? 155 LEU G C   1 
ATOM   9721  O O   . LEU G 1 155 ? 116.986 59.601 151.398 1.00 53.68  ? 155 LEU G O   1 
ATOM   9722  C CB  . LEU G 1 155 ? 117.062 61.736 149.015 1.00 42.71  ? 155 LEU G CB  1 
ATOM   9723  C CG  . LEU G 1 155 ? 117.252 61.812 147.504 1.00 42.71  ? 155 LEU G CG  1 
ATOM   9724  C CD1 . LEU G 1 155 ? 117.918 63.096 147.129 1.00 42.71  ? 155 LEU G CD1 1 
ATOM   9725  C CD2 . LEU G 1 155 ? 118.107 60.656 147.059 1.00 42.71  ? 155 LEU G CD2 1 
ATOM   9726  N N   . ARG G 1 156 ? 115.395 61.132 151.770 1.00 95.33  ? 156 ARG G N   1 
ATOM   9727  C CA  . ARG G 1 156 ? 115.455 60.946 153.218 1.00 95.33  ? 156 ARG G CA  1 
ATOM   9728  C C   . ARG G 1 156 ? 115.295 59.484 153.591 1.00 95.33  ? 156 ARG G C   1 
ATOM   9729  O O   . ARG G 1 156 ? 115.823 59.028 154.604 1.00 95.33  ? 156 ARG G O   1 
ATOM   9730  C CB  . ARG G 1 156 ? 114.341 61.706 153.933 1.00 98.92  ? 156 ARG G CB  1 
ATOM   9731  C CG  . ARG G 1 156 ? 114.491 63.203 154.017 1.00 98.92  ? 156 ARG G CG  1 
ATOM   9732  C CD  . ARG G 1 156 ? 113.399 63.741 154.926 1.00 98.92  ? 156 ARG G CD  1 
ATOM   9733  N NE  . ARG G 1 156 ? 113.090 65.132 154.640 1.00 98.92  ? 156 ARG G NE  1 
ATOM   9734  C CZ  . ARG G 1 156 ? 111.981 65.734 155.046 1.00 98.92  ? 156 ARG G CZ  1 
ATOM   9735  N NH1 . ARG G 1 156 ? 111.091 65.053 155.758 1.00 98.92  ? 156 ARG G NH1 1 
ATOM   9736  N NH2 . ARG G 1 156 ? 111.749 67.002 154.724 1.00 98.92  ? 156 ARG G NH2 1 
ATOM   9737  N N   . SER G 1 157 ? 114.542 58.755 152.780 1.00 97.02  ? 157 SER G N   1 
ATOM   9738  C CA  . SER G 1 157 ? 114.286 57.354 153.055 1.00 97.02  ? 157 SER G CA  1 
ATOM   9739  C C   . SER G 1 157 ? 115.546 56.510 153.077 1.00 97.02  ? 157 SER G C   1 
ATOM   9740  O O   . SER G 1 157 ? 115.573 55.460 153.706 1.00 97.02  ? 157 SER G O   1 
ATOM   9741  C CB  . SER G 1 157 ? 113.298 56.806 152.031 1.00 99.98  ? 157 SER G CB  1 
ATOM   9742  O OG  . SER G 1 157 ? 112.056 57.480 152.140 1.00 99.98  ? 157 SER G OG  1 
ATOM   9743  N N   . PHE G 1 158 ? 116.592 56.975 152.404 1.00 84.51  ? 158 PHE G N   1 
ATOM   9744  C CA  . PHE G 1 158 ? 117.838 56.230 152.362 1.00 84.51  ? 158 PHE G CA  1 
ATOM   9745  C C   . PHE G 1 158 ? 118.673 56.294 153.644 1.00 84.51  ? 158 PHE G C   1 
ATOM   9746  O O   . PHE G 1 158 ? 119.569 55.473 153.850 1.00 84.51  ? 158 PHE G O   1 
ATOM   9747  C CB  . PHE G 1 158 ? 118.668 56.683 151.166 1.00 112.22 ? 158 PHE G CB  1 
ATOM   9748  C CG  . PHE G 1 158 ? 118.158 56.163 149.857 1.00 112.22 ? 158 PHE G CG  1 
ATOM   9749  C CD1 . PHE G 1 158 ? 117.806 57.033 148.838 1.00 112.22 ? 158 PHE G CD1 1 
ATOM   9750  C CD2 . PHE G 1 158 ? 118.035 54.795 149.639 1.00 112.22 ? 158 PHE G CD2 1 
ATOM   9751  C CE1 . PHE G 1 158 ? 117.340 56.547 147.619 1.00 112.22 ? 158 PHE G CE1 1 
ATOM   9752  C CE2 . PHE G 1 158 ? 117.572 54.304 148.422 1.00 112.22 ? 158 PHE G CE2 1 
ATOM   9753  C CZ  . PHE G 1 158 ? 117.225 55.180 147.414 1.00 112.22 ? 158 PHE G CZ  1 
ATOM   9754  N N   . GLY G 1 159 ? 118.384 57.255 154.512 1.00 190.00 ? 159 GLY G N   1 
ATOM   9755  C CA  . GLY G 1 159 ? 119.143 57.345 155.745 1.00 190.00 ? 159 GLY G CA  1 
ATOM   9756  C C   . GLY G 1 159 ? 119.331 58.749 156.274 1.00 190.00 ? 159 GLY G C   1 
ATOM   9757  O O   . GLY G 1 159 ? 118.924 59.728 155.649 1.00 190.00 ? 159 GLY G O   1 
ATOM   9758  N N   . ASN G 1 160 ? 119.959 58.845 157.439 1.00 106.30 ? 160 ASN G N   1 
ATOM   9759  C CA  . ASN G 1 160 ? 120.200 60.135 158.065 1.00 106.30 ? 160 ASN G CA  1 
ATOM   9760  C C   . ASN G 1 160 ? 121.041 61.068 157.194 1.00 106.30 ? 160 ASN G C   1 
ATOM   9761  O O   . ASN G 1 160 ? 120.719 62.242 157.047 1.00 106.30 ? 160 ASN G O   1 
ATOM   9762  C CB  . ASN G 1 160 ? 120.890 59.946 159.425 1.00 75.87  ? 160 ASN G CB  1 
ATOM   9763  C CG  . ASN G 1 160 ? 120.057 59.126 160.403 1.00 75.87  ? 160 ASN G CG  1 
ATOM   9764  O OD1 . ASN G 1 160 ? 118.878 59.405 160.628 1.00 75.87  ? 160 ASN G OD1 1 
ATOM   9765  N ND2 . ASN G 1 160 ? 120.675 58.115 160.996 1.00 75.87  ? 160 ASN G ND2 1 
ATOM   9766  N N   . ALA G 1 161 ? 122.105 60.534 156.605 1.00 53.26  ? 161 ALA G N   1 
ATOM   9767  C CA  . ALA G 1 161 ? 123.019 61.325 155.784 1.00 53.26  ? 161 ALA G CA  1 
ATOM   9768  C C   . ALA G 1 161 ? 122.359 62.064 154.638 1.00 53.26  ? 161 ALA G C   1 
ATOM   9769  O O   . ALA G 1 161 ? 122.957 62.965 154.048 1.00 53.26  ? 161 ALA G O   1 
ATOM   9770  C CB  . ALA G 1 161 ? 124.134 60.434 155.238 1.00 59.95  ? 161 ALA G CB  1 
ATOM   9771  N N   . LEU G 1 162 ? 121.143 61.671 154.286 1.00 95.16  ? 162 LEU G N   1 
ATOM   9772  C CA  . LEU G 1 162 ? 120.459 62.343 153.194 1.00 95.16  ? 162 LEU G CA  1 
ATOM   9773  C C   . LEU G 1 162 ? 119.244 63.089 153.702 1.00 95.16  ? 162 LEU G C   1 
ATOM   9774  O O   . LEU G 1 162 ? 118.353 63.451 152.938 1.00 95.16  ? 162 LEU G O   1 
ATOM   9775  C CB  . LEU G 1 162 ? 120.066 61.348 152.103 1.00 66.95  ? 162 LEU G CB  1 
ATOM   9776  C CG  . LEU G 1 162 ? 121.232 60.823 151.266 1.00 66.95  ? 162 LEU G CG  1 
ATOM   9777  C CD1 . LEU G 1 162 ? 120.751 59.704 150.377 1.00 66.95  ? 162 LEU G CD1 1 
ATOM   9778  C CD2 . LEU G 1 162 ? 121.813 61.943 150.437 1.00 66.95  ? 162 LEU G CD2 1 
ATOM   9779  N N   . GLY G 1 163 ? 119.210 63.301 155.010 1.00 67.69  ? 163 GLY G N   1 
ATOM   9780  C CA  . GLY G 1 163 ? 118.128 64.060 155.596 1.00 67.69  ? 163 GLY G CA  1 
ATOM   9781  C C   . GLY G 1 163 ? 117.181 63.408 156.574 1.00 67.69  ? 163 GLY G C   1 
ATOM   9782  O O   . GLY G 1 163 ? 116.339 64.117 157.118 1.00 67.69  ? 163 GLY G O   1 
ATOM   9783  N N   . ASN G 1 164 ? 117.286 62.106 156.834 1.00 75.85  ? 164 ASN G N   1 
ATOM   9784  C CA  . ASN G 1 164 ? 116.320 61.499 157.751 1.00 75.85  ? 164 ASN G CA  1 
ATOM   9785  C C   . ASN G 1 164 ? 116.413 61.989 159.198 1.00 75.85  ? 164 ASN G C   1 
ATOM   9786  O O   . ASN G 1 164 ? 115.482 61.795 159.986 1.00 75.85  ? 164 ASN G O   1 
ATOM   9787  C CB  . ASN G 1 164 ? 116.386 59.963 157.714 1.00 76.74  ? 164 ASN G CB  1 
ATOM   9788  C CG  . ASN G 1 164 ? 115.212 59.312 158.473 1.00 76.74  ? 164 ASN G CG  1 
ATOM   9789  O OD1 . ASN G 1 164 ? 114.058 59.735 158.331 1.00 76.74  ? 164 ASN G OD1 1 
ATOM   9790  N ND2 . ASN G 1 164 ? 115.505 58.287 159.276 1.00 76.74  ? 164 ASN G ND2 1 
ATOM   9791  N N   . CYS G 1 165 ? 117.519 62.632 159.558 1.00 94.98  ? 165 CYS G N   1 
ATOM   9792  C CA  . CYS G 1 165 ? 117.656 63.136 160.922 1.00 94.98  ? 165 CYS G CA  1 
ATOM   9793  C C   . CYS G 1 165 ? 116.884 64.447 161.098 1.00 94.98  ? 165 CYS G C   1 
ATOM   9794  O O   . CYS G 1 165 ? 116.324 64.703 162.164 1.00 94.98  ? 165 CYS G O   1 
ATOM   9795  C CB  . CYS G 1 165 ? 119.133 63.337 161.284 1.00 59.89  ? 165 CYS G CB  1 
ATOM   9796  S SG  . CYS G 1 165 ? 120.068 64.378 160.156 1.00 59.89  ? 165 CYS G SG  1 
ATOM   9797  N N   . ILE G 1 166 ? 116.847 65.258 160.041 1.00 80.56  ? 166 ILE G N   1 
ATOM   9798  C CA  . ILE G 1 166 ? 116.154 66.549 160.041 1.00 80.56  ? 166 ILE G CA  1 
ATOM   9799  C C   . ILE G 1 166 ? 114.790 66.491 160.727 1.00 80.56  ? 166 ILE G C   1 
ATOM   9800  O O   . ILE G 1 166 ? 114.245 67.509 161.133 1.00 80.56  ? 166 ILE G O   1 
ATOM   9801  C CB  . ILE G 1 166 ? 115.937 67.064 158.599 1.00 115.51 ? 166 ILE G CB  1 
ATOM   9802  C CG1 . ILE G 1 166 ? 115.717 68.575 158.603 1.00 115.51 ? 166 ILE G CG1 1 
ATOM   9803  C CG2 . ILE G 1 166 ? 114.712 66.404 157.988 1.00 115.51 ? 166 ILE G CG2 1 
ATOM   9804  C CD1 . ILE G 1 166 ? 116.949 69.364 158.953 1.00 115.51 ? 166 ILE G CD1 1 
ATOM   9805  N N   . LEU G 1 167 ? 114.232 65.299 160.848 1.00 144.16 ? 167 LEU G N   1 
ATOM   9806  C CA  . LEU G 1 167 ? 112.932 65.145 161.483 1.00 144.16 ? 167 LEU G CA  1 
ATOM   9807  C C   . LEU G 1 167 ? 113.087 64.903 162.987 1.00 144.16 ? 167 LEU G C   1 
ATOM   9808  O O   . LEU G 1 167 ? 112.264 65.351 163.792 1.00 144.16 ? 167 LEU G O   1 
ATOM   9809  C CB  . LEU G 1 167 ? 112.188 63.972 160.838 1.00 176.51 ? 167 LEU G CB  1 
ATOM   9810  C CG  . LEU G 1 167 ? 111.957 64.067 159.327 1.00 176.51 ? 167 LEU G CG  1 
ATOM   9811  C CD1 . LEU G 1 167 ? 111.584 62.703 158.757 1.00 176.51 ? 167 LEU G CD1 1 
ATOM   9812  C CD2 . LEU G 1 167 ? 110.871 65.093 159.058 1.00 176.51 ? 167 LEU G CD2 1 
ATOM   9813  N N   . ASP G 1 168 ? 114.155 64.196 163.349 1.00 183.93 ? 168 ASP G N   1 
ATOM   9814  C CA  . ASP G 1 168 ? 114.450 63.851 164.737 1.00 183.93 ? 168 ASP G CA  1 
ATOM   9815  C C   . ASP G 1 168 ? 114.513 65.070 165.646 1.00 183.93 ? 168 ASP G C   1 
ATOM   9816  O O   . ASP G 1 168 ? 115.368 65.940 165.478 1.00 183.93 ? 168 ASP G O   1 
ATOM   9817  C CB  . ASP G 1 168 ? 115.780 63.097 164.818 1.00 189.29 ? 168 ASP G CB  1 
ATOM   9818  C CG  . ASP G 1 168 ? 115.948 62.351 166.126 1.00 189.29 ? 168 ASP G CG  1 
ATOM   9819  O OD1 . ASP G 1 168 ? 115.411 62.823 167.151 1.00 189.29 ? 168 ASP G OD1 1 
ATOM   9820  O OD2 . ASP G 1 168 ? 116.625 61.300 166.128 1.00 189.29 ? 168 ASP G OD2 1 
ATOM   9821  N N   . LYS G 1 169 ? 113.610 65.120 166.616 1.00 126.89 ? 169 LYS G N   1 
ATOM   9822  C CA  . LYS G 1 169 ? 113.572 66.227 167.557 1.00 126.89 ? 169 LYS G CA  1 
ATOM   9823  C C   . LYS G 1 169 ? 114.839 66.238 168.410 1.00 126.89 ? 169 LYS G C   1 
ATOM   9824  O O   . LYS G 1 169 ? 115.453 67.287 168.612 1.00 126.89 ? 169 LYS G O   1 
ATOM   9825  C CB  . LYS G 1 169 ? 112.332 66.106 168.436 1.00 120.49 ? 169 LYS G CB  1 
ATOM   9826  C CG  . LYS G 1 169 ? 111.046 66.122 167.628 1.00 120.49 ? 169 LYS G CG  1 
ATOM   9827  C CD  . LYS G 1 169 ? 109.828 65.853 168.491 1.00 120.49 ? 169 LYS G CD  1 
ATOM   9828  C CE  . LYS G 1 169 ? 108.560 65.812 167.650 1.00 120.49 ? 169 LYS G CE  1 
ATOM   9829  N NZ  . LYS G 1 169 ? 107.360 65.444 168.456 1.00 120.49 ? 169 LYS G NZ  1 
ATOM   9830  N N   . ASP G 1 170 ? 115.234 65.068 168.903 1.00 153.63 ? 170 ASP G N   1 
ATOM   9831  C CA  . ASP G 1 170 ? 116.439 64.965 169.716 1.00 153.63 ? 170 ASP G CA  1 
ATOM   9832  C C   . ASP G 1 170 ? 117.614 65.490 168.912 1.00 153.63 ? 170 ASP G C   1 
ATOM   9833  O O   . ASP G 1 170 ? 118.492 66.157 169.451 1.00 153.63 ? 170 ASP G O   1 
ATOM   9834  C CB  . ASP G 1 170 ? 116.704 63.513 170.117 1.00 147.50 ? 170 ASP G CB  1 
ATOM   9835  C CG  . ASP G 1 170 ? 115.597 62.935 170.970 1.00 147.50 ? 170 ASP G CG  1 
ATOM   9836  O OD1 . ASP G 1 170 ? 115.283 63.534 172.020 1.00 147.50 ? 170 ASP G OD1 1 
ATOM   9837  O OD2 . ASP G 1 170 ? 115.040 61.881 170.594 1.00 147.50 ? 170 ASP G OD2 1 
ATOM   9838  N N   . TYR G 1 171 ? 117.621 65.186 167.618 1.00 104.65 ? 171 TYR G N   1 
ATOM   9839  C CA  . TYR G 1 171 ? 118.688 65.638 166.733 1.00 104.65 ? 171 TYR G CA  1 
ATOM   9840  C C   . TYR G 1 171 ? 118.748 67.152 166.701 1.00 104.65 ? 171 TYR G C   1 
ATOM   9841  O O   . TYR G 1 171 ? 119.822 67.750 166.794 1.00 104.65 ? 171 TYR G O   1 
ATOM   9842  C CB  . TYR G 1 171 ? 118.455 65.145 165.310 1.00 61.52  ? 171 TYR G CB  1 
ATOM   9843  C CG  . TYR G 1 171 ? 119.367 65.800 164.289 1.00 61.52  ? 171 TYR G CG  1 
ATOM   9844  C CD1 . TYR G 1 171 ? 120.730 65.511 164.246 1.00 61.52  ? 171 TYR G CD1 1 
ATOM   9845  C CD2 . TYR G 1 171 ? 118.861 66.703 163.359 1.00 61.52  ? 171 TYR G CD2 1 
ATOM   9846  C CE1 . TYR G 1 171 ? 121.573 66.101 163.293 1.00 61.52  ? 171 TYR G CE1 1 
ATOM   9847  C CE2 . TYR G 1 171 ? 119.689 67.303 162.401 1.00 61.52  ? 171 TYR G CE2 1 
ATOM   9848  C CZ  . TYR G 1 171 ? 121.046 66.993 162.372 1.00 61.52  ? 171 TYR G CZ  1 
ATOM   9849  O OH  . TYR G 1 171 ? 121.869 67.543 161.408 1.00 61.52  ? 171 TYR G OH  1 
ATOM   9850  N N   . LEU G 1 172 ? 117.582 67.765 166.548 1.00 95.69  ? 172 LEU G N   1 
ATOM   9851  C CA  . LEU G 1 172 ? 117.485 69.216 166.488 1.00 95.69  ? 172 LEU G CA  1 
ATOM   9852  C C   . LEU G 1 172 ? 118.036 69.916 167.729 1.00 95.69  ? 172 LEU G C   1 
ATOM   9853  O O   . LEU G 1 172 ? 118.883 70.804 167.617 1.00 95.69  ? 172 LEU G O   1 
ATOM   9854  C CB  . LEU G 1 172 ? 116.030 69.632 166.246 1.00 93.68  ? 172 LEU G CB  1 
ATOM   9855  C CG  . LEU G 1 172 ? 115.505 69.308 164.842 1.00 93.68  ? 172 LEU G CG  1 
ATOM   9856  C CD1 . LEU G 1 172 ? 114.033 69.674 164.758 1.00 93.68  ? 172 LEU G CD1 1 
ATOM   9857  C CD2 . LEU G 1 172 ? 116.323 70.060 163.784 1.00 93.68  ? 172 LEU G CD2 1 
ATOM   9858  N N   . ARG G 1 173 ? 117.564 69.523 168.906 1.00 179.60 ? 173 ARG G N   1 
ATOM   9859  C CA  . ARG G 1 173 ? 118.042 70.140 170.136 1.00 179.60 ? 173 ARG G CA  1 
ATOM   9860  C C   . ARG G 1 173 ? 119.567 70.147 170.183 1.00 179.60 ? 173 ARG G C   1 
ATOM   9861  O O   . ARG G 1 173 ? 120.179 71.159 170.521 1.00 179.60 ? 173 ARG G O   1 
ATOM   9862  C CB  . ARG G 1 173 ? 117.480 69.409 171.357 1.00 148.64 ? 173 ARG G CB  1 
ATOM   9863  C CG  . ARG G 1 173 ? 115.974 69.548 171.510 1.00 148.64 ? 173 ARG G CG  1 
ATOM   9864  C CD  . ARG G 1 173 ? 115.461 69.002 172.840 1.00 148.64 ? 173 ARG G CD  1 
ATOM   9865  N NE  . ARG G 1 173 ? 115.660 67.562 172.985 1.00 148.64 ? 173 ARG G NE  1 
ATOM   9866  C CZ  . ARG G 1 173 ? 116.811 66.990 173.326 1.00 148.64 ? 173 ARG G CZ  1 
ATOM   9867  N NH1 . ARG G 1 173 ? 117.883 67.735 173.562 1.00 148.64 ? 173 ARG G NH1 1 
ATOM   9868  N NH2 . ARG G 1 173 ? 116.891 65.670 173.434 1.00 148.64 ? 173 ARG G NH2 1 
ATOM   9869  N N   . SER G 1 174 ? 120.176 69.018 169.830 1.00 98.21  ? 174 SER G N   1 
ATOM   9870  C CA  . SER G 1 174 ? 121.631 68.893 169.822 1.00 98.21  ? 174 SER G CA  1 
ATOM   9871  C C   . SER G 1 174 ? 122.287 69.829 168.814 1.00 98.21  ? 174 SER G C   1 
ATOM   9872  O O   . SER G 1 174 ? 123.499 70.045 168.849 1.00 98.21  ? 174 SER G O   1 
ATOM   9873  C CB  . SER G 1 174 ? 122.037 67.454 169.509 1.00 158.25 ? 174 SER G CB  1 
ATOM   9874  O OG  . SER G 1 174 ? 121.594 66.577 170.528 1.00 158.25 ? 174 SER G OG  1 
ATOM   9875  N N   . LEU G 1 175 ? 121.492 70.377 167.906 1.00 91.94  ? 175 LEU G N   1 
ATOM   9876  C CA  . LEU G 1 175 ? 122.025 71.294 166.913 1.00 91.94  ? 175 LEU G CA  1 
ATOM   9877  C C   . LEU G 1 175 ? 122.143 72.695 167.484 1.00 91.94  ? 175 LEU G C   1 
ATOM   9878  O O   . LEU G 1 175 ? 123.120 73.399 167.208 1.00 91.94  ? 175 LEU G O   1 
ATOM   9879  C CB  . LEU G 1 175 ? 121.134 71.317 165.680 1.00 90.93  ? 175 LEU G CB  1 
ATOM   9880  C CG  . LEU G 1 175 ? 121.401 70.212 164.670 1.00 90.93  ? 175 LEU G CG  1 
ATOM   9881  C CD1 . LEU G 1 175 ? 120.340 70.309 163.596 1.00 90.93  ? 175 LEU G CD1 1 
ATOM   9882  C CD2 . LEU G 1 175 ? 122.811 70.350 164.076 1.00 90.93  ? 175 LEU G CD2 1 
ATOM   9883  N N   . ASN G 1 176 ? 121.141 73.092 168.270 1.00 130.52 ? 176 ASN G N   1 
ATOM   9884  C CA  . ASN G 1 176 ? 121.121 74.406 168.905 1.00 130.52 ? 176 ASN G CA  1 
ATOM   9885  C C   . ASN G 1 176 ? 122.269 74.482 169.898 1.00 130.52 ? 176 ASN G C   1 
ATOM   9886  O O   . ASN G 1 176 ? 122.943 75.506 170.009 1.00 130.52 ? 176 ASN G O   1 
ATOM   9887  C CB  . ASN G 1 176 ? 119.801 74.628 169.645 1.00 118.09 ? 176 ASN G CB  1 
ATOM   9888  C CG  . ASN G 1 176 ? 118.599 74.489 168.742 1.00 118.09 ? 176 ASN G CG  1 
ATOM   9889  O OD1 . ASN G 1 176 ? 118.509 75.139 167.703 1.00 118.09 ? 176 ASN G OD1 1 
ATOM   9890  N ND2 . ASN G 1 176 ? 117.659 73.643 169.139 1.00 118.09 ? 176 ASN G ND2 1 
ATOM   9891  N N   . LYS G 1 177 ? 122.484 73.384 170.619 1.00 112.79 ? 177 LYS G N   1 
ATOM   9892  C CA  . LYS G 1 177 ? 123.554 73.301 171.603 1.00 112.79 ? 177 LYS G CA  1 
ATOM   9893  C C   . LYS G 1 177 ? 124.913 73.262 170.915 1.00 112.79 ? 177 LYS G C   1 
ATOM   9894  O O   . LYS G 1 177 ? 125.892 72.779 171.486 1.00 112.79 ? 177 LYS G O   1 
ATOM   9895  C CB  . LYS G 1 177 ? 123.392 72.049 172.469 1.00 100.69 ? 177 LYS G CB  1 
ATOM   9896  C CG  . LYS G 1 177 ? 122.099 71.995 173.266 1.00 100.69 ? 177 LYS G CG  1 
ATOM   9897  C CD  . LYS G 1 177 ? 122.005 70.703 174.069 1.00 100.69 ? 177 LYS G CD  1 
ATOM   9898  C CE  . LYS G 1 177 ? 120.689 70.600 174.834 1.00 100.69 ? 177 LYS G CE  1 
ATOM   9899  N NZ  . LYS G 1 177 ? 120.556 69.284 175.532 1.00 100.69 ? 177 LYS G NZ  1 
ATOM   9900  N N   . LEU G 1 178 ? 124.969 73.763 169.686 1.00 113.03 ? 178 LEU G N   1 
ATOM   9901  C CA  . LEU G 1 178 ? 126.214 73.795 168.936 1.00 113.03 ? 178 LEU G CA  1 
ATOM   9902  C C   . LEU G 1 178 ? 126.574 75.187 168.446 1.00 113.03 ? 178 LEU G C   1 
ATOM   9903  O O   . LEU G 1 178 ? 125.703 76.033 168.218 1.00 113.03 ? 178 LEU G O   1 
ATOM   9904  C CB  . LEU G 1 178 ? 126.147 72.847 167.743 1.00 136.01 ? 178 LEU G CB  1 
ATOM   9905  C CG  . LEU G 1 178 ? 126.464 71.386 168.044 1.00 136.01 ? 178 LEU G CG  1 
ATOM   9906  C CD1 . LEU G 1 178 ? 126.329 70.584 166.772 1.00 136.01 ? 178 LEU G CD1 1 
ATOM   9907  C CD2 . LEU G 1 178 ? 127.877 71.267 168.607 1.00 136.01 ? 178 LEU G CD2 1 
ATOM   9908  N N   . PRO G 1 179 ? 127.877 75.439 168.275 1.00 163.63 ? 179 PRO G N   1 
ATOM   9909  C CA  . PRO G 1 179 ? 128.385 76.726 167.807 1.00 163.63 ? 179 PRO G CA  1 
ATOM   9910  C C   . PRO G 1 179 ? 127.771 77.116 166.471 1.00 163.63 ? 179 PRO G C   1 
ATOM   9911  O O   . PRO G 1 179 ? 128.134 76.569 165.430 1.00 163.63 ? 179 PRO G O   1 
ATOM   9912  C CB  . PRO G 1 179 ? 129.876 76.471 167.686 1.00 195.54 ? 179 PRO G CB  1 
ATOM   9913  C CG  . PRO G 1 179 ? 130.134 75.479 168.770 1.00 195.54 ? 179 PRO G CG  1 
ATOM   9914  C CD  . PRO G 1 179 ? 128.990 74.524 168.585 1.00 195.54 ? 179 PRO G CD  1 
ATOM   9915  N N   . ARG G 1 180 ? 126.836 78.057 166.504 1.00 200.00 ? 180 ARG G N   1 
ATOM   9916  C CA  . ARG G 1 180 ? 126.190 78.517 165.285 1.00 200.00 ? 180 ARG G CA  1 
ATOM   9917  C C   . ARG G 1 180 ? 127.280 79.133 164.402 1.00 200.00 ? 180 ARG G C   1 
ATOM   9918  O O   . ARG G 1 180 ? 127.468 80.345 164.397 1.00 200.00 ? 180 ARG G O   1 
ATOM   9919  C CB  . ARG G 1 180 ? 125.121 79.562 165.629 1.00 199.70 ? 180 ARG G CB  1 
ATOM   9920  C CG  . ARG G 1 180 ? 123.800 79.397 164.886 1.00 199.70 ? 180 ARG G CG  1 
ATOM   9921  C CD  . ARG G 1 180 ? 123.992 79.443 163.376 1.00 199.70 ? 180 ARG G CD  1 
ATOM   9922  N NE  . ARG G 1 180 ? 124.605 80.693 162.931 1.00 199.70 ? 180 ARG G NE  1 
ATOM   9923  C CZ  . ARG G 1 180 ? 124.906 80.971 161.665 1.00 199.70 ? 180 ARG G CZ  1 
ATOM   9924  N NH1 . ARG G 1 180 ? 124.648 80.087 160.711 1.00 199.70 ? 180 ARG G NH1 1 
ATOM   9925  N NH2 . ARG G 1 180 ? 125.474 82.128 161.349 1.00 199.70 ? 180 ARG G NH2 1 
ATOM   9926  N N   . GLN G 1 181 ? 128.004 78.289 163.670 1.00 134.22 ? 181 GLN G N   1 
ATOM   9927  C CA  . GLN G 1 181 ? 129.084 78.744 162.790 1.00 134.22 ? 181 GLN G CA  1 
ATOM   9928  C C   . GLN G 1 181 ? 128.586 79.710 161.717 1.00 134.22 ? 181 GLN G C   1 
ATOM   9929  O O   . GLN G 1 181 ? 127.390 79.773 161.433 1.00 134.22 ? 181 GLN G O   1 
ATOM   9930  C CB  . GLN G 1 181 ? 129.735 77.554 162.102 1.00 135.56 ? 181 GLN G CB  1 
ATOM   9931  C CG  . GLN G 1 181 ? 128.760 76.798 161.232 1.00 135.56 ? 181 GLN G CG  1 
ATOM   9932  C CD  . GLN G 1 181 ? 129.432 75.763 160.377 1.00 135.56 ? 181 GLN G CD  1 
ATOM   9933  O OE1 . GLN G 1 181 ? 130.172 76.092 159.449 1.00 135.56 ? 181 GLN G OE1 1 
ATOM   9934  N NE2 . GLN G 1 181 ? 129.187 74.496 160.689 1.00 135.56 ? 181 GLN G NE2 1 
ATOM   9935  N N   . LEU G 1 182 ? 129.512 80.442 161.104 1.00 156.62 ? 182 LEU G N   1 
ATOM   9936  C CA  . LEU G 1 182 ? 129.154 81.412 160.074 1.00 156.62 ? 182 LEU G CA  1 
ATOM   9937  C C   . LEU G 1 182 ? 129.383 80.876 158.661 1.00 156.62 ? 182 LEU G C   1 
ATOM   9938  O O   . LEU G 1 182 ? 130.277 80.058 158.444 1.00 156.62 ? 182 LEU G O   1 
ATOM   9939  C CB  . LEU G 1 182 ? 129.962 82.696 160.271 1.00 200.00 ? 182 LEU G CB  1 
ATOM   9940  C CG  . LEU G 1 182 ? 129.465 83.914 159.490 1.00 200.00 ? 182 LEU G CG  1 
ATOM   9941  C CD1 . LEU G 1 182 ? 128.014 84.164 159.784 1.00 200.00 ? 182 LEU G CD1 1 
ATOM   9942  C CD2 . LEU G 1 182 ? 130.240 85.108 159.864 1.00 200.00 ? 182 LEU G CD2 1 
ATOM   9943  N N   . PRO G 1 183 ? 128.568 81.327 157.683 1.00 125.55 ? 183 PRO G N   1 
ATOM   9944  C CA  . PRO G 1 183 ? 128.678 80.900 156.290 1.00 125.55 ? 183 PRO G CA  1 
ATOM   9945  C C   . PRO G 1 183 ? 130.098 80.628 155.833 1.00 125.55 ? 183 PRO G C   1 
ATOM   9946  O O   . PRO G 1 183 ? 131.026 81.380 156.130 1.00 125.55 ? 183 PRO G O   1 
ATOM   9947  C CB  . PRO G 1 183 ? 128.031 82.052 155.541 1.00 158.54 ? 183 PRO G CB  1 
ATOM   9948  C CG  . PRO G 1 183 ? 126.872 82.347 156.411 1.00 158.54 ? 183 PRO G CG  1 
ATOM   9949  C CD  . PRO G 1 183 ? 127.441 82.268 157.822 1.00 158.54 ? 183 PRO G CD  1 
ATOM   9950  N N   . LEU G 1 184 ? 130.252 79.534 155.103 1.00 200.00 ? 184 LEU G N   1 
ATOM   9951  C CA  . LEU G 1 184 ? 131.547 79.126 154.596 1.00 200.00 ? 184 LEU G CA  1 
ATOM   9952  C C   . LEU G 1 184 ? 131.939 79.979 153.394 1.00 200.00 ? 184 LEU G C   1 
ATOM   9953  O O   . LEU G 1 184 ? 131.114 80.264 152.527 1.00 200.00 ? 184 LEU G O   1 
ATOM   9954  C CB  . LEU G 1 184 ? 131.500 77.647 154.192 1.00 171.84 ? 184 LEU G CB  1 
ATOM   9955  C CG  . LEU G 1 184 ? 130.909 76.620 155.171 1.00 171.84 ? 184 LEU G CG  1 
ATOM   9956  C CD1 . LEU G 1 184 ? 131.536 76.809 156.547 1.00 171.84 ? 184 LEU G CD1 1 
ATOM   9957  C CD2 . LEU G 1 184 ? 129.395 76.768 155.253 1.00 171.84 ? 184 LEU G CD2 1 
ATOM   9958  N N   . GLU G 1 185 ? 133.197 80.401 153.354 1.00 125.17 ? 185 GLU G N   1 
ATOM   9959  C CA  . GLU G 1 185 ? 133.686 81.195 152.237 1.00 125.17 ? 185 GLU G CA  1 
ATOM   9960  C C   . GLU G 1 185 ? 133.954 80.237 151.083 1.00 125.17 ? 185 GLU G C   1 
ATOM   9961  O O   . GLU G 1 185 ? 134.568 79.188 151.272 1.00 125.17 ? 185 GLU G O   1 
ATOM   9962  C CB  . GLU G 1 185 ? 134.979 81.913 152.621 1.00 200.00 ? 185 GLU G CB  1 
ATOM   9963  C CG  . GLU G 1 185 ? 135.588 82.735 151.496 1.00 200.00 ? 185 GLU G CG  1 
ATOM   9964  C CD  . GLU G 1 185 ? 136.933 83.331 151.872 1.00 200.00 ? 185 GLU G CD  1 
ATOM   9965  O OE1 . GLU G 1 185 ? 137.868 82.554 152.167 1.00 200.00 ? 185 GLU G OE1 1 
ATOM   9966  O OE2 . GLU G 1 185 ? 137.054 84.575 151.873 1.00 200.00 ? 185 GLU G OE2 1 
ATOM   9967  N N   . VAL G 1 186 ? 133.497 80.593 149.889 1.00 93.03  ? 186 VAL G N   1 
ATOM   9968  C CA  . VAL G 1 186 ? 133.696 79.732 148.726 1.00 93.03  ? 186 VAL G CA  1 
ATOM   9969  C C   . VAL G 1 186 ? 134.905 80.144 147.889 1.00 93.03  ? 186 VAL G C   1 
ATOM   9970  O O   . VAL G 1 186 ? 134.904 81.187 147.238 1.00 93.03  ? 186 VAL G O   1 
ATOM   9971  C CB  . VAL G 1 186 ? 132.434 79.721 147.825 1.00 81.91  ? 186 VAL G CB  1 
ATOM   9972  C CG1 . VAL G 1 186 ? 132.641 78.796 146.633 1.00 81.91  ? 186 VAL G CG1 1 
ATOM   9973  C CG2 . VAL G 1 186 ? 131.220 79.291 148.649 1.00 81.91  ? 186 VAL G CG2 1 
ATOM   9974  N N   . ASP G 1 187 ? 135.940 79.314 147.914 1.00 100.42 ? 187 ASP G N   1 
ATOM   9975  C CA  . ASP G 1 187 ? 137.142 79.592 147.148 1.00 100.42 ? 187 ASP G CA  1 
ATOM   9976  C C   . ASP G 1 187 ? 136.937 79.220 145.677 1.00 100.42 ? 187 ASP G C   1 
ATOM   9977  O O   . ASP G 1 187 ? 136.954 78.048 145.308 1.00 100.42 ? 187 ASP G O   1 
ATOM   9978  C CB  . ASP G 1 187 ? 138.321 78.810 147.721 1.00 143.25 ? 187 ASP G CB  1 
ATOM   9979  C CG  . ASP G 1 187 ? 139.569 78.952 146.879 1.00 143.25 ? 187 ASP G CG  1 
ATOM   9980  O OD1 . ASP G 1 187 ? 139.957 80.101 146.593 1.00 143.25 ? 187 ASP G OD1 1 
ATOM   9981  O OD2 . ASP G 1 187 ? 140.163 77.920 146.501 1.00 143.25 ? 187 ASP G OD2 1 
ATOM   9982  N N   . LEU G 1 188 ? 136.754 80.228 144.836 1.00 75.14  ? 188 LEU G N   1 
ATOM   9983  C CA  . LEU G 1 188 ? 136.529 80.013 143.411 1.00 75.14  ? 188 LEU G CA  1 
ATOM   9984  C C   . LEU G 1 188 ? 137.814 80.066 142.585 1.00 75.14  ? 188 LEU G C   1 
ATOM   9985  O O   . LEU G 1 188 ? 137.765 80.348 141.391 1.00 75.14  ? 188 LEU G O   1 
ATOM   9986  C CB  . LEU G 1 188 ? 135.543 81.069 142.887 1.00 94.68  ? 188 LEU G CB  1 
ATOM   9987  C CG  . LEU G 1 188 ? 134.240 81.275 143.677 1.00 94.68  ? 188 LEU G CG  1 
ATOM   9988  C CD1 . LEU G 1 188 ? 133.425 82.393 143.041 1.00 94.68  ? 188 LEU G CD1 1 
ATOM   9989  C CD2 . LEU G 1 188 ? 133.434 79.981 143.714 1.00 94.68  ? 188 LEU G CD2 1 
ATOM   9990  N N   . THR G 1 189 ? 138.960 79.799 143.202 1.00 75.83  ? 189 THR G N   1 
ATOM   9991  C CA  . THR G 1 189 ? 140.221 79.860 142.465 1.00 75.83  ? 189 THR G CA  1 
ATOM   9992  C C   . THR G 1 189 ? 140.338 78.753 141.424 1.00 75.83  ? 189 THR G C   1 
ATOM   9993  O O   . THR G 1 189 ? 140.643 79.010 140.250 1.00 75.83  ? 189 THR G O   1 
ATOM   9994  C CB  . THR G 1 189 ? 141.438 79.791 143.415 1.00 114.09 ? 189 THR G CB  1 
ATOM   9995  O OG1 . THR G 1 189 ? 141.367 78.605 144.215 1.00 114.09 ? 189 THR G OG1 1 
ATOM   9996  C CG2 . THR G 1 189 ? 141.468 81.006 144.318 1.00 114.09 ? 189 THR G CG2 1 
ATOM   9997  N N   . LYS G 1 190 ? 140.087 77.524 141.862 1.00 177.81 ? 190 LYS G N   1 
ATOM   9998  C CA  . LYS G 1 190 ? 140.162 76.361 140.991 1.00 177.81 ? 190 LYS G CA  1 
ATOM   9999  C C   . LYS G 1 190 ? 138.818 76.074 140.334 1.00 177.81 ? 190 LYS G C   1 
ATOM   10000 O O   . LYS G 1 190 ? 138.533 74.939 139.950 1.00 177.81 ? 190 LYS G O   1 
ATOM   10001 C CB  . LYS G 1 190 ? 140.616 75.143 141.794 1.00 118.75 ? 190 LYS G CB  1 
ATOM   10002 C CG  . LYS G 1 190 ? 141.991 75.301 142.411 1.00 118.75 ? 190 LYS G CG  1 
ATOM   10003 C CD  . LYS G 1 190 ? 142.401 74.058 143.178 1.00 118.75 ? 190 LYS G CD  1 
ATOM   10004 C CE  . LYS G 1 190 ? 143.807 74.203 143.736 1.00 118.75 ? 190 LYS G CE  1 
ATOM   10005 N NZ  . LYS G 1 190 ? 144.247 72.974 144.449 1.00 118.75 ? 190 LYS G NZ  1 
ATOM   10006 N N   . ALA G 1 191 ? 137.993 77.107 140.207 1.00 92.48  ? 191 ALA G N   1 
ATOM   10007 C CA  . ALA G 1 191 ? 136.683 76.959 139.591 1.00 92.48  ? 191 ALA G CA  1 
ATOM   10008 C C   . ALA G 1 191 ? 136.813 76.765 138.077 1.00 92.48  ? 191 ALA G C   1 
ATOM   10009 O O   . ALA G 1 191 ? 137.752 77.262 137.440 1.00 92.48  ? 191 ALA G O   1 
ATOM   10010 C CB  . ALA G 1 191 ? 135.804 78.182 139.907 1.00 47.68  ? 191 ALA G CB  1 
ATOM   10011 N N   . LYS G 1 192 ? 135.864 76.021 137.515 1.00 133.83 ? 192 LYS G N   1 
ATOM   10012 C CA  . LYS G 1 192 ? 135.843 75.731 136.089 1.00 133.83 ? 192 LYS G CA  1 
ATOM   10013 C C   . LYS G 1 192 ? 135.661 77.016 135.295 1.00 133.83 ? 192 LYS G C   1 
ATOM   10014 O O   . LYS G 1 192 ? 134.696 77.747 135.511 1.00 133.83 ? 192 LYS G O   1 
ATOM   10015 C CB  . LYS G 1 192 ? 134.708 74.758 135.780 1.00 83.99  ? 192 LYS G CB  1 
ATOM   10016 C CG  . LYS G 1 192 ? 134.659 74.333 134.326 1.00 83.99  ? 192 LYS G CG  1 
ATOM   10017 C CD  . LYS G 1 192 ? 133.556 73.323 134.093 1.00 83.99  ? 192 LYS G CD  1 
ATOM   10018 C CE  . LYS G 1 192 ? 133.452 72.968 132.622 1.00 83.99  ? 192 LYS G CE  1 
ATOM   10019 N NZ  . LYS G 1 192 ? 134.704 72.369 132.104 1.00 83.99  ? 192 LYS G NZ  1 
ATOM   10020 N N   . ARG G 1 193 ? 136.580 77.285 134.370 1.00 86.38  ? 193 ARG G N   1 
ATOM   10021 C CA  . ARG G 1 193 ? 136.506 78.508 133.576 1.00 86.38  ? 193 ARG G CA  1 
ATOM   10022 C C   . ARG G 1 193 ? 136.232 78.346 132.084 1.00 86.38  ? 193 ARG G C   1 
ATOM   10023 O O   . ARG G 1 193 ? 135.975 79.329 131.380 1.00 86.38  ? 193 ARG G O   1 
ATOM   10024 C CB  . ARG G 1 193 ? 137.774 79.336 133.785 1.00 133.98 ? 193 ARG G CB  1 
ATOM   10025 C CG  . ARG G 1 193 ? 137.852 79.925 135.177 1.00 133.98 ? 193 ARG G CG  1 
ATOM   10026 C CD  . ARG G 1 193 ? 138.764 81.131 135.234 1.00 133.98 ? 193 ARG G CD  1 
ATOM   10027 N NE  . ARG G 1 193 ? 138.474 81.953 136.407 1.00 133.98 ? 193 ARG G NE  1 
ATOM   10028 C CZ  . ARG G 1 193 ? 138.607 81.547 137.668 1.00 133.98 ? 193 ARG G CZ  1 
ATOM   10029 N NH1 . ARG G 1 193 ? 139.032 80.319 137.946 1.00 133.98 ? 193 ARG G NH1 1 
ATOM   10030 N NH2 . ARG G 1 193 ? 138.308 82.374 138.659 1.00 133.98 ? 193 ARG G NH2 1 
ATOM   10031 N N   . GLN G 1 194 ? 136.296 77.115 131.594 1.00 111.27 ? 194 GLN G N   1 
ATOM   10032 C CA  . GLN G 1 194 ? 136.010 76.863 130.190 1.00 111.27 ? 194 GLN G CA  1 
ATOM   10033 C C   . GLN G 1 194 ? 135.327 75.509 130.054 1.00 111.27 ? 194 GLN G C   1 
ATOM   10034 O O   . GLN G 1 194 ? 135.328 74.714 130.996 1.00 111.27 ? 194 GLN G O   1 
ATOM   10035 C CB  . GLN G 1 194 ? 137.289 76.953 129.350 1.00 149.87 ? 194 GLN G CB  1 
ATOM   10036 C CG  . GLN G 1 194 ? 138.510 76.355 129.999 1.00 149.87 ? 194 GLN G CG  1 
ATOM   10037 C CD  . GLN G 1 194 ? 138.482 74.851 129.982 1.00 149.87 ? 194 GLN G CD  1 
ATOM   10038 O OE1 . GLN G 1 194 ? 138.499 74.236 128.915 1.00 149.87 ? 194 GLN G OE1 1 
ATOM   10039 N NE2 . GLN G 1 194 ? 138.432 74.244 131.164 1.00 149.87 ? 194 GLN G NE2 1 
ATOM   10040 N N   . ASP G 1 195 ? 134.726 75.261 128.893 1.00 99.20  ? 195 ASP G N   1 
ATOM   10041 C CA  . ASP G 1 195 ? 133.995 74.022 128.656 1.00 99.20  ? 195 ASP G CA  1 
ATOM   10042 C C   . ASP G 1 195 ? 134.772 72.704 128.702 1.00 99.20  ? 195 ASP G C   1 
ATOM   10043 O O   . ASP G 1 195 ? 134.462 71.829 129.510 1.00 99.20  ? 195 ASP G O   1 
ATOM   10044 C CB  . ASP G 1 195 ? 133.254 74.096 127.317 1.00 83.00  ? 195 ASP G CB  1 
ATOM   10045 C CG  . ASP G 1 195 ? 132.121 75.106 127.321 1.00 83.00  ? 195 ASP G CG  1 
ATOM   10046 O OD1 . ASP G 1 195 ? 131.500 75.318 128.386 1.00 83.00  ? 195 ASP G OD1 1 
ATOM   10047 O OD2 . ASP G 1 195 ? 131.837 75.669 126.243 1.00 83.00  ? 195 ASP G OD2 1 
ATOM   10048 N N   . LEU G 1 196 ? 135.765 72.562 127.829 1.00 90.78  ? 196 LEU G N   1 
ATOM   10049 C CA  . LEU G 1 196 ? 136.552 71.334 127.732 1.00 90.78  ? 196 LEU G CA  1 
ATOM   10050 C C   . LEU G 1 196 ? 137.026 70.721 129.052 1.00 90.78  ? 196 LEU G C   1 
ATOM   10051 O O   . LEU G 1 196 ? 137.255 71.422 130.040 1.00 90.78  ? 196 LEU G O   1 
ATOM   10052 C CB  . LEU G 1 196 ? 137.746 71.561 126.805 1.00 99.47  ? 196 LEU G CB  1 
ATOM   10053 C CG  . LEU G 1 196 ? 138.562 70.318 126.449 1.00 99.47  ? 196 LEU G CG  1 
ATOM   10054 C CD1 . LEU G 1 196 ? 137.643 69.215 125.953 1.00 99.47  ? 196 LEU G CD1 1 
ATOM   10055 C CD2 . LEU G 1 196 ? 139.591 70.674 125.389 1.00 99.47  ? 196 LEU G CD2 1 
ATOM   10056 N N   . GLU G 1 197 ? 137.151 69.396 129.048 1.00 107.44 ? 197 GLU G N   1 
ATOM   10057 C CA  . GLU G 1 197 ? 137.596 68.616 130.201 1.00 107.44 ? 197 GLU G CA  1 
ATOM   10058 C C   . GLU G 1 197 ? 138.522 67.526 129.668 1.00 107.44 ? 197 GLU G C   1 
ATOM   10059 O O   . GLU G 1 197 ? 138.082 66.411 129.403 1.00 107.44 ? 197 GLU G O   1 
ATOM   10060 C CB  . GLU G 1 197 ? 136.406 67.946 130.882 1.00 85.54  ? 197 GLU G CB  1 
ATOM   10061 C CG  . GLU G 1 197 ? 135.491 68.865 131.636 1.00 85.54  ? 197 GLU G CG  1 
ATOM   10062 C CD  . GLU G 1 197 ? 136.084 69.293 132.948 1.00 85.54  ? 197 GLU G CD  1 
ATOM   10063 O OE1 . GLU G 1 197 ? 136.728 68.449 133.598 1.00 85.54  ? 197 GLU G OE1 1 
ATOM   10064 O OE2 . GLU G 1 197 ? 135.900 70.463 133.340 1.00 85.54  ? 197 GLU G OE2 1 
ATOM   10065 N N   . PRO G 1 198 ? 139.819 67.833 129.506 1.00 68.94  ? 198 PRO G N   1 
ATOM   10066 C CA  . PRO G 1 198 ? 140.828 66.893 128.997 1.00 68.94  ? 198 PRO G CA  1 
ATOM   10067 C C   . PRO G 1 198 ? 140.867 65.548 129.729 1.00 68.94  ? 198 PRO G C   1 
ATOM   10068 O O   . PRO G 1 198 ? 140.928 64.489 129.102 1.00 68.94  ? 198 PRO G O   1 
ATOM   10069 C CB  . PRO G 1 198 ? 142.124 67.674 129.156 1.00 91.78  ? 198 PRO G CB  1 
ATOM   10070 C CG  . PRO G 1 198 ? 141.674 69.096 129.007 1.00 91.78  ? 198 PRO G CG  1 
ATOM   10071 C CD  . PRO G 1 198 ? 140.442 69.118 129.858 1.00 91.78  ? 198 PRO G CD  1 
ATOM   10072 N N   . SER G 1 199 ? 140.839 65.594 131.056 1.00 90.60  ? 199 SER G N   1 
ATOM   10073 C CA  . SER G 1 199 ? 140.862 64.374 131.851 1.00 90.60  ? 199 SER G CA  1 
ATOM   10074 C C   . SER G 1 199 ? 139.718 63.442 131.424 1.00 90.60  ? 199 SER G C   1 
ATOM   10075 O O   . SER G 1 199 ? 139.919 62.250 131.179 1.00 90.60  ? 199 SER G O   1 
ATOM   10076 C CB  . SER G 1 199 ? 140.728 64.722 133.335 1.00 99.72  ? 199 SER G CB  1 
ATOM   10077 O OG  . SER G 1 199 ? 140.830 63.562 134.144 1.00 99.72  ? 199 SER G OG  1 
ATOM   10078 N N   . VAL G 1 200 ? 138.515 64.001 131.338 1.00 80.08  ? 200 VAL G N   1 
ATOM   10079 C CA  . VAL G 1 200 ? 137.337 63.250 130.928 1.00 80.08  ? 200 VAL G CA  1 
ATOM   10080 C C   . VAL G 1 200 ? 137.414 62.855 129.435 1.00 80.08  ? 200 VAL G C   1 
ATOM   10081 O O   . VAL G 1 200 ? 137.381 61.678 129.093 1.00 80.08  ? 200 VAL G O   1 
ATOM   10082 C CB  . VAL G 1 200 ? 136.059 64.085 131.193 1.00 100.60 ? 200 VAL G CB  1 
ATOM   10083 C CG1 . VAL G 1 200 ? 134.824 63.314 130.764 1.00 100.60 ? 200 VAL G CG1 1 
ATOM   10084 C CG2 . VAL G 1 200 ? 135.979 64.451 132.672 1.00 100.60 ? 200 VAL G CG2 1 
ATOM   10085 N N   . GLU G 1 201 ? 137.520 63.841 128.553 1.00 63.68  ? 201 GLU G N   1 
ATOM   10086 C CA  . GLU G 1 201 ? 137.611 63.596 127.121 1.00 63.68  ? 201 GLU G CA  1 
ATOM   10087 C C   . GLU G 1 201 ? 138.549 62.442 126.799 1.00 63.68  ? 201 GLU G C   1 
ATOM   10088 O O   . GLU G 1 201 ? 138.341 61.727 125.814 1.00 63.68  ? 201 GLU G O   1 
ATOM   10089 C CB  . GLU G 1 201 ? 138.110 64.855 126.406 1.00 126.07 ? 201 GLU G CB  1 
ATOM   10090 C CG  . GLU G 1 201 ? 138.386 64.675 124.920 1.00 126.07 ? 201 GLU G CG  1 
ATOM   10091 C CD  . GLU G 1 201 ? 137.159 64.240 124.151 1.00 126.07 ? 201 GLU G CD  1 
ATOM   10092 O OE1 . GLU G 1 201 ? 136.087 64.850 124.361 1.00 126.07 ? 201 GLU G OE1 1 
ATOM   10093 O OE2 . GLU G 1 201 ? 137.267 63.299 123.334 1.00 126.07 ? 201 GLU G OE2 1 
ATOM   10094 N N   . GLU G 1 202 ? 139.592 62.274 127.614 1.00 91.50  ? 202 GLU G N   1 
ATOM   10095 C CA  . GLU G 1 202 ? 140.574 61.208 127.410 1.00 91.50  ? 202 GLU G CA  1 
ATOM   10096 C C   . GLU G 1 202 ? 140.003 59.844 127.807 1.00 91.50  ? 202 GLU G C   1 
ATOM   10097 O O   . GLU G 1 202 ? 139.909 58.940 126.980 1.00 91.50  ? 202 GLU G O   1 
ATOM   10098 C CB  . GLU G 1 202 ? 141.846 61.502 128.220 1.00 119.66 ? 202 GLU G CB  1 
ATOM   10099 C CG  . GLU G 1 202 ? 142.970 60.491 128.025 1.00 119.66 ? 202 GLU G CG  1 
ATOM   10100 C CD  . GLU G 1 202 ? 144.232 60.870 128.776 1.00 119.66 ? 202 GLU G CD  1 
ATOM   10101 O OE1 . GLU G 1 202 ? 144.175 60.991 130.018 1.00 119.66 ? 202 GLU G OE1 1 
ATOM   10102 O OE2 . GLU G 1 202 ? 145.281 61.049 128.120 1.00 119.66 ? 202 GLU G OE2 1 
ATOM   10103 N N   . ALA G 1 203 ? 139.615 59.708 129.072 1.00 94.67  ? 203 ALA G N   1 
ATOM   10104 C CA  . ALA G 1 203 ? 139.062 58.456 129.572 1.00 94.67  ? 203 ALA G CA  1 
ATOM   10105 C C   . ALA G 1 203 ? 137.955 57.950 128.664 1.00 94.67  ? 203 ALA G C   1 
ATOM   10106 O O   . ALA G 1 203 ? 137.832 56.749 128.429 1.00 94.67  ? 203 ALA G O   1 
ATOM   10107 C CB  . ALA G 1 203 ? 138.526 58.637 131.000 1.00 41.78  ? 203 ALA G CB  1 
ATOM   10108 N N   . ARG G 1 204 ? 137.150 58.873 128.153 1.00 135.97 ? 204 ARG G N   1 
ATOM   10109 C CA  . ARG G 1 204 ? 136.045 58.523 127.270 1.00 135.97 ? 204 ARG G CA  1 
ATOM   10110 C C   . ARG G 1 204 ? 136.547 57.967 125.949 1.00 135.97 ? 204 ARG G C   1 
ATOM   10111 O O   . ARG G 1 204 ? 136.078 56.930 125.492 1.00 135.97 ? 204 ARG G O   1 
ATOM   10112 C CB  . ARG G 1 204 ? 135.174 59.751 127.006 1.00 59.85  ? 204 ARG G CB  1 
ATOM   10113 C CG  . ARG G 1 204 ? 134.034 59.549 126.004 1.00 59.85  ? 204 ARG G CG  1 
ATOM   10114 C CD  . ARG G 1 204 ? 133.315 60.867 125.760 1.00 59.85  ? 204 ARG G CD  1 
ATOM   10115 N NE  . ARG G 1 204 ? 132.866 61.456 127.018 1.00 59.85  ? 204 ARG G NE  1 
ATOM   10116 C CZ  . ARG G 1 204 ? 133.031 62.730 127.350 1.00 59.85  ? 204 ARG G CZ  1 
ATOM   10117 N NH1 . ARG G 1 204 ? 133.634 63.564 126.520 1.00 59.85  ? 204 ARG G NH1 1 
ATOM   10118 N NH2 . ARG G 1 204 ? 132.606 63.163 128.519 1.00 59.85  ? 204 ARG G NH2 1 
ATOM   10119 N N   . TYR G 1 205 ? 137.496 58.658 125.330 1.00 78.00  ? 205 TYR G N   1 
ATOM   10120 C CA  . TYR G 1 205 ? 138.025 58.193 124.063 1.00 78.00  ? 205 TYR G CA  1 
ATOM   10121 C C   . TYR G 1 205 ? 138.578 56.784 124.195 1.00 78.00  ? 205 TYR G C   1 
ATOM   10122 O O   . TYR G 1 205 ? 138.432 55.977 123.280 1.00 78.00  ? 205 TYR G O   1 
ATOM   10123 C CB  . TYR G 1 205 ? 139.121 59.117 123.551 1.00 82.83  ? 205 TYR G CB  1 
ATOM   10124 C CG  . TYR G 1 205 ? 139.676 58.646 122.230 1.00 82.83  ? 205 TYR G CG  1 
ATOM   10125 C CD1 . TYR G 1 205 ? 138.869 58.593 121.099 1.00 82.83  ? 205 TYR G CD1 1 
ATOM   10126 C CD2 . TYR G 1 205 ? 141.003 58.219 122.119 1.00 82.83  ? 205 TYR G CD2 1 
ATOM   10127 C CE1 . TYR G 1 205 ? 139.363 58.129 119.889 1.00 82.83  ? 205 TYR G CE1 1 
ATOM   10128 C CE2 . TYR G 1 205 ? 141.510 57.748 120.909 1.00 82.83  ? 205 TYR G CE2 1 
ATOM   10129 C CZ  . TYR G 1 205 ? 140.682 57.705 119.795 1.00 82.83  ? 205 TYR G CZ  1 
ATOM   10130 O OH  . TYR G 1 205 ? 141.158 57.236 118.585 1.00 82.83  ? 205 TYR G OH  1 
ATOM   10131 N N   . ASN G 1 206 ? 139.207 56.490 125.333 1.00 124.95 ? 206 ASN G N   1 
ATOM   10132 C CA  . ASN G 1 206 ? 139.772 55.162 125.578 1.00 124.95 ? 206 ASN G CA  1 
ATOM   10133 C C   . ASN G 1 206 ? 138.677 54.179 125.962 1.00 124.95 ? 206 ASN G C   1 
ATOM   10134 O O   . ASN G 1 206 ? 138.946 53.007 126.221 1.00 124.95 ? 206 ASN G O   1 
ATOM   10135 C CB  . ASN G 1 206 ? 140.810 55.200 126.706 1.00 84.40  ? 206 ASN G CB  1 
ATOM   10136 C CG  . ASN G 1 206 ? 141.900 56.222 126.466 1.00 84.40  ? 206 ASN G CG  1 
ATOM   10137 O OD1 . ASN G 1 206 ? 142.483 56.290 125.379 1.00 84.40  ? 206 ASN G OD1 1 
ATOM   10138 N ND2 . ASN G 1 206 ? 142.190 57.021 127.488 1.00 84.40  ? 206 ASN G ND2 1 
ATOM   10139 N N   . SER G 1 207 ? 137.444 54.667 126.010 1.00 132.97 ? 207 SER G N   1 
ATOM   10140 C CA  . SER G 1 207 ? 136.303 53.833 126.359 1.00 132.97 ? 207 SER G CA  1 
ATOM   10141 C C   . SER G 1 207 ? 135.594 53.325 125.102 1.00 132.97 ? 207 SER G C   1 
ATOM   10142 O O   . SER G 1 207 ? 134.568 52.657 125.198 1.00 132.97 ? 207 SER G O   1 
ATOM   10143 C CB  . SER G 1 207 ? 135.321 54.626 127.232 1.00 147.93 ? 207 SER G CB  1 
ATOM   10144 O OG  . SER G 1 207 ? 134.205 53.838 127.614 1.00 147.93 ? 207 SER G OG  1 
ATOM   10145 N N   . CYS G 1 208 ? 136.144 53.639 123.929 1.00 115.50 ? 208 CYS G N   1 
ATOM   10146 C CA  . CYS G 1 208 ? 135.561 53.208 122.652 1.00 115.50 ? 208 CYS G CA  1 
ATOM   10147 C C   . CYS G 1 208 ? 136.428 52.152 121.963 1.00 115.50 ? 208 CYS G C   1 
ATOM   10148 O O   . CYS G 1 208 ? 137.463 51.775 122.551 1.00 115.50 ? 208 CYS G O   1 
ATOM   10149 C CB  . CYS G 1 208 ? 135.386 54.401 121.702 1.00 96.13  ? 208 CYS G CB  1 
ATOM   10150 S SG  . CYS G 1 208 ? 134.280 55.714 122.275 1.00 96.13  ? 208 CYS G SG  1 
ATOM   10151 N N   . CYS H 1 25  ? 124.845 50.197 123.237 1.00 128.83 ? 25  CYS H N   1 
ATOM   10152 C CA  . CYS H 1 25  ? 124.452 51.517 122.664 1.00 128.83 ? 25  CYS H CA  1 
ATOM   10153 C C   . CYS H 1 25  ? 124.029 52.492 123.765 1.00 128.83 ? 25  CYS H C   1 
ATOM   10154 O O   . CYS H 1 25  ? 124.558 52.440 124.878 1.00 128.83 ? 25  CYS H O   1 
ATOM   10155 C CB  . CYS H 1 25  ? 123.314 51.326 121.652 1.00 96.23  ? 25  CYS H CB  1 
ATOM   10156 S SG  . CYS H 1 25  ? 121.852 50.446 122.266 1.00 96.23  ? 25  CYS H SG  1 
ATOM   10157 N N   . PHE H 1 26  ? 123.086 53.381 123.454 1.00 81.31  ? 26  PHE H N   1 
ATOM   10158 C CA  . PHE H 1 26  ? 122.604 54.354 124.434 1.00 81.31  ? 26  PHE H CA  1 
ATOM   10159 C C   . PHE H 1 26  ? 121.612 53.724 125.417 1.00 81.31  ? 26  PHE H C   1 
ATOM   10160 O O   . PHE H 1 26  ? 120.615 53.134 125.012 1.00 81.31  ? 26  PHE H O   1 
ATOM   10161 C CB  . PHE H 1 26  ? 121.930 55.543 123.737 1.00 59.54  ? 26  PHE H CB  1 
ATOM   10162 C CG  . PHE H 1 26  ? 121.836 56.757 124.609 1.00 59.54  ? 26  PHE H CG  1 
ATOM   10163 C CD1 . PHE H 1 26  ? 122.918 57.623 124.724 1.00 59.54  ? 26  PHE H CD1 1 
ATOM   10164 C CD2 . PHE H 1 26  ? 120.723 56.969 125.408 1.00 59.54  ? 26  PHE H CD2 1 
ATOM   10165 C CE1 . PHE H 1 26  ? 122.895 58.677 125.632 1.00 59.54  ? 26  PHE H CE1 1 
ATOM   10166 C CE2 . PHE H 1 26  ? 120.689 58.022 126.323 1.00 59.54  ? 26  PHE H CE2 1 
ATOM   10167 C CZ  . PHE H 1 26  ? 121.780 58.878 126.437 1.00 59.54  ? 26  PHE H CZ  1 
ATOM   10168 N N   . GLY H 1 27  ? 121.873 53.869 126.710 1.00 72.36  ? 27  GLY H N   1 
ATOM   10169 C CA  . GLY H 1 27  ? 120.991 53.281 127.709 1.00 72.36  ? 27  GLY H CA  1 
ATOM   10170 C C   . GLY H 1 27  ? 121.556 51.933 128.117 1.00 72.36  ? 27  GLY H C   1 
ATOM   10171 O O   . GLY H 1 27  ? 121.242 51.381 129.169 1.00 72.36  ? 27  GLY H O   1 
ATOM   10172 N N   . GLN H 1 28  ? 122.409 51.406 127.247 1.00 99.16  ? 28  GLN H N   1 
ATOM   10173 C CA  . GLN H 1 28  ? 123.062 50.131 127.464 1.00 99.16  ? 28  GLN H CA  1 
ATOM   10174 C C   . GLN H 1 28  ? 124.437 50.384 128.076 1.00 99.16  ? 28  GLN H C   1 
ATOM   10175 O O   . GLN H 1 28  ? 124.691 50.018 129.227 1.00 99.16  ? 28  GLN H O   1 
ATOM   10176 C CB  . GLN H 1 28  ? 123.218 49.393 126.134 1.00 123.69 ? 28  GLN H CB  1 
ATOM   10177 C CG  . GLN H 1 28  ? 121.911 49.124 125.390 1.00 123.69 ? 28  GLN H CG  1 
ATOM   10178 C CD  . GLN H 1 28  ? 120.973 48.168 126.124 1.00 123.69 ? 28  GLN H CD  1 
ATOM   10179 O OE1 . GLN H 1 28  ? 119.964 47.728 125.569 1.00 123.69 ? 28  GLN H OE1 1 
ATOM   10180 N NE2 . GLN H 1 28  ? 121.299 47.850 127.375 1.00 123.69 ? 28  GLN H NE2 1 
ATOM   10181 N N   . CYS H 1 29  ? 125.314 51.021 127.300 1.00 75.95  ? 29  CYS H N   1 
ATOM   10182 C CA  . CYS H 1 29  ? 126.675 51.331 127.738 1.00 75.95  ? 29  CYS H CA  1 
ATOM   10183 C C   . CYS H 1 29  ? 126.834 51.609 129.230 1.00 75.95  ? 29  CYS H C   1 
ATOM   10184 O O   . CYS H 1 29  ? 125.990 52.245 129.845 1.00 75.95  ? 29  CYS H O   1 
ATOM   10185 C CB  . CYS H 1 29  ? 127.216 52.524 126.956 1.00 89.10  ? 29  CYS H CB  1 
ATOM   10186 S SG  . CYS H 1 29  ? 127.449 52.182 125.219 1.00 89.10  ? 29  CYS H SG  1 
ATOM   10187 N N   . GLN H 1 30  ? 127.919 51.110 129.810 1.00 95.20  ? 30  GLN H N   1 
ATOM   10188 C CA  . GLN H 1 30  ? 128.201 51.332 131.218 1.00 95.20  ? 30  GLN H CA  1 
ATOM   10189 C C   . GLN H 1 30  ? 129.497 52.138 131.263 1.00 95.20  ? 30  GLN H C   1 
ATOM   10190 O O   . GLN H 1 30  ? 130.389 51.960 130.418 1.00 95.20  ? 30  GLN H O   1 
ATOM   10191 C CB  . GLN H 1 30  ? 128.346 49.993 131.953 1.00 125.97 ? 30  GLN H CB  1 
ATOM   10192 C CG  . GLN H 1 30  ? 127.036 49.211 132.046 1.00 125.97 ? 30  GLN H CG  1 
ATOM   10193 C CD  . GLN H 1 30  ? 127.169 47.880 132.772 1.00 125.97 ? 30  GLN H CD  1 
ATOM   10194 O OE1 . GLN H 1 30  ? 127.686 47.817 133.887 1.00 125.97 ? 30  GLN H OE1 1 
ATOM   10195 N NE2 . GLN H 1 30  ? 126.686 46.810 132.144 1.00 125.97 ? 30  GLN H NE2 1 
ATOM   10196 N N   . TYR H 1 31  ? 129.591 53.054 132.217 1.00 82.81  ? 31  TYR H N   1 
ATOM   10197 C CA  . TYR H 1 31  ? 130.795 53.863 132.321 1.00 82.81  ? 31  TYR H CA  1 
ATOM   10198 C C   . TYR H 1 31  ? 131.995 53.026 132.756 1.00 82.81  ? 31  TYR H C   1 
ATOM   10199 O O   . TYR H 1 31  ? 131.871 52.162 133.628 1.00 82.81  ? 31  TYR H O   1 
ATOM   10200 C CB  . TYR H 1 31  ? 130.593 55.009 133.325 1.00 75.52  ? 31  TYR H CB  1 
ATOM   10201 C CG  . TYR H 1 31  ? 129.831 56.193 132.788 1.00 75.52  ? 31  TYR H CG  1 
ATOM   10202 C CD1 . TYR H 1 31  ? 128.524 56.450 133.200 1.00 75.52  ? 31  TYR H CD1 1 
ATOM   10203 C CD2 . TYR H 1 31  ? 130.416 57.057 131.854 1.00 75.52  ? 31  TYR H CD2 1 
ATOM   10204 C CE1 . TYR H 1 31  ? 127.820 57.536 132.699 1.00 75.52  ? 31  TYR H CE1 1 
ATOM   10205 C CE2 . TYR H 1 31  ? 129.721 58.143 131.345 1.00 75.52  ? 31  TYR H CE2 1 
ATOM   10206 C CZ  . TYR H 1 31  ? 128.426 58.378 131.772 1.00 75.52  ? 31  TYR H CZ  1 
ATOM   10207 O OH  . TYR H 1 31  ? 127.735 59.459 131.285 1.00 75.52  ? 31  TYR H OH  1 
ATOM   10208 N N   . THR H 1 32  ? 133.151 53.276 132.145 1.00 114.91 ? 32  THR H N   1 
ATOM   10209 C CA  . THR H 1 32  ? 134.369 52.567 132.524 1.00 114.91 ? 32  THR H CA  1 
ATOM   10210 C C   . THR H 1 32  ? 134.939 53.306 133.738 1.00 114.91 ? 32  THR H C   1 
ATOM   10211 O O   . THR H 1 32  ? 134.690 54.499 133.912 1.00 114.91 ? 32  THR H O   1 
ATOM   10212 C CB  . THR H 1 32  ? 135.411 52.588 131.396 1.00 61.83  ? 32  THR H CB  1 
ATOM   10213 O OG1 . THR H 1 32  ? 135.959 53.903 131.264 1.00 61.83  ? 32  THR H OG1 1 
ATOM   10214 C CG2 . THR H 1 32  ? 134.771 52.198 130.082 1.00 61.83  ? 32  THR H CG2 1 
ATOM   10215 N N   . ALA H 1 33  ? 135.696 52.610 134.577 1.00 104.38 ? 33  ALA H N   1 
ATOM   10216 C CA  . ALA H 1 33  ? 136.264 53.239 135.760 1.00 104.38 ? 33  ALA H CA  1 
ATOM   10217 C C   . ALA H 1 33  ? 136.975 54.566 135.455 1.00 104.38 ? 33  ALA H C   1 
ATOM   10218 O O   . ALA H 1 33  ? 136.831 55.532 136.206 1.00 104.38 ? 33  ALA H O   1 
ATOM   10219 C CB  . ALA H 1 33  ? 137.215 52.278 136.447 1.00 72.24  ? 33  ALA H CB  1 
ATOM   10220 N N   . GLU H 1 34  ? 137.733 54.623 134.360 1.00 105.60 ? 34  GLU H N   1 
ATOM   10221 C CA  . GLU H 1 34  ? 138.446 55.850 133.996 1.00 105.60 ? 34  GLU H CA  1 
ATOM   10222 C C   . GLU H 1 34  ? 137.480 57.013 133.776 1.00 105.60 ? 34  GLU H C   1 
ATOM   10223 O O   . GLU H 1 34  ? 137.618 58.077 134.384 1.00 105.60 ? 34  GLU H O   1 
ATOM   10224 C CB  . GLU H 1 34  ? 139.272 55.643 132.723 1.00 139.15 ? 34  GLU H CB  1 
ATOM   10225 C CG  . GLU H 1 34  ? 140.206 54.446 132.762 1.00 139.15 ? 34  GLU H CG  1 
ATOM   10226 C CD  . GLU H 1 34  ? 139.586 53.203 132.151 1.00 139.15 ? 34  GLU H CD  1 
ATOM   10227 O OE1 . GLU H 1 34  ? 139.274 53.235 130.938 1.00 139.15 ? 34  GLU H OE1 1 
ATOM   10228 O OE2 . GLU H 1 34  ? 139.411 52.199 132.879 1.00 139.15 ? 34  GLU H OE2 1 
ATOM   10229 N N   . GLU H 1 35  ? 136.500 56.804 132.903 1.00 71.16  ? 35  GLU H N   1 
ATOM   10230 C CA  . GLU H 1 35  ? 135.525 57.836 132.611 1.00 71.16  ? 35  GLU H CA  1 
ATOM   10231 C C   . GLU H 1 35  ? 134.690 58.181 133.826 1.00 71.16  ? 35  GLU H C   1 
ATOM   10232 O O   . GLU H 1 35  ? 134.423 59.348 134.083 1.00 71.16  ? 35  GLU H O   1 
ATOM   10233 C CB  . GLU H 1 35  ? 134.608 57.414 131.467 1.00 92.79  ? 35  GLU H CB  1 
ATOM   10234 C CG  . GLU H 1 35  ? 133.745 58.561 130.968 1.00 92.79  ? 35  GLU H CG  1 
ATOM   10235 C CD  . GLU H 1 35  ? 132.981 58.232 129.699 1.00 92.79  ? 35  GLU H CD  1 
ATOM   10236 O OE1 . GLU H 1 35  ? 132.401 59.165 129.101 1.00 92.79  ? 35  GLU H OE1 1 
ATOM   10237 O OE2 . GLU H 1 35  ? 132.958 57.048 129.303 1.00 92.79  ? 35  GLU H OE2 1 
ATOM   10238 N N   . TYR H 1 36  ? 134.270 57.180 134.582 1.00 74.72  ? 36  TYR H N   1 
ATOM   10239 C CA  . TYR H 1 36  ? 133.463 57.481 135.750 1.00 74.72  ? 36  TYR H CA  1 
ATOM   10240 C C   . TYR H 1 36  ? 134.171 58.430 136.694 1.00 74.72  ? 36  TYR H C   1 
ATOM   10241 O O   . TYR H 1 36  ? 133.617 59.459 137.092 1.00 74.72  ? 36  TYR H O   1 
ATOM   10242 C CB  . TYR H 1 36  ? 133.125 56.239 136.547 1.00 60.43  ? 36  TYR H CB  1 
ATOM   10243 C CG  . TYR H 1 36  ? 132.767 56.595 137.968 1.00 60.43  ? 36  TYR H CG  1 
ATOM   10244 C CD1 . TYR H 1 36  ? 131.531 57.154 138.277 1.00 60.43  ? 36  TYR H CD1 1 
ATOM   10245 C CD2 . TYR H 1 36  ? 133.692 56.439 138.996 1.00 60.43  ? 36  TYR H CD2 1 
ATOM   10246 C CE1 . TYR H 1 36  ? 131.228 57.550 139.578 1.00 60.43  ? 36  TYR H CE1 1 
ATOM   10247 C CE2 . TYR H 1 36  ? 133.401 56.828 140.295 1.00 60.43  ? 36  TYR H CE2 1 
ATOM   10248 C CZ  . TYR H 1 36  ? 132.169 57.381 140.585 1.00 60.43  ? 36  TYR H CZ  1 
ATOM   10249 O OH  . TYR H 1 36  ? 131.886 57.752 141.887 1.00 60.43  ? 36  TYR H OH  1 
ATOM   10250 N N   . GLN H 1 37  ? 135.388 58.059 137.079 1.00 79.08  ? 37  GLN H N   1 
ATOM   10251 C CA  . GLN H 1 37  ? 136.189 58.863 137.996 1.00 79.08  ? 37  GLN H CA  1 
ATOM   10252 C C   . GLN H 1 37  ? 136.398 60.292 137.487 1.00 79.08  ? 37  GLN H C   1 
ATOM   10253 O O   . GLN H 1 37  ? 136.178 61.250 138.223 1.00 79.08  ? 37  GLN H O   1 
ATOM   10254 C CB  . GLN H 1 37  ? 137.540 58.192 138.216 1.00 132.31 ? 37  GLN H CB  1 
ATOM   10255 C CG  . GLN H 1 37  ? 138.209 58.584 139.508 1.00 132.31 ? 37  GLN H CG  1 
ATOM   10256 C CD  . GLN H 1 37  ? 139.566 57.943 139.664 1.00 132.31 ? 37  GLN H CD  1 
ATOM   10257 O OE1 . GLN H 1 37  ? 140.123 57.915 140.759 1.00 132.31 ? 37  GLN H OE1 1 
ATOM   10258 N NE2 . GLN H 1 37  ? 140.113 57.430 138.564 1.00 132.31 ? 37  GLN H NE2 1 
ATOM   10259 N N   . ALA H 1 38  ? 136.819 60.430 136.232 1.00 69.56  ? 38  ALA H N   1 
ATOM   10260 C CA  . ALA H 1 38  ? 137.044 61.750 135.645 1.00 69.56  ? 38  ALA H CA  1 
ATOM   10261 C C   . ALA H 1 38  ? 135.808 62.647 135.745 1.00 69.56  ? 38  ALA H C   1 
ATOM   10262 O O   . ALA H 1 38  ? 135.857 63.751 136.295 1.00 69.56  ? 38  ALA H O   1 
ATOM   10263 C CB  . ALA H 1 38  ? 137.469 61.610 134.180 1.00 22.79  ? 38  ALA H CB  1 
ATOM   10264 N N   . ILE H 1 39  ? 134.703 62.167 135.198 1.00 60.34  ? 39  ILE H N   1 
ATOM   10265 C CA  . ILE H 1 39  ? 133.463 62.910 135.231 1.00 60.34  ? 39  ILE H CA  1 
ATOM   10266 C C   . ILE H 1 39  ? 133.036 63.167 136.667 1.00 60.34  ? 39  ILE H C   1 
ATOM   10267 O O   . ILE H 1 39  ? 132.621 64.267 136.986 1.00 60.34  ? 39  ILE H O   1 
ATOM   10268 C CB  . ILE H 1 39  ? 132.361 62.143 134.488 1.00 72.11  ? 39  ILE H CB  1 
ATOM   10269 C CG1 . ILE H 1 39  ? 132.628 62.210 132.987 1.00 72.11  ? 39  ILE H CG1 1 
ATOM   10270 C CG2 . ILE H 1 39  ? 131.002 62.702 134.834 1.00 72.11  ? 39  ILE H CG2 1 
ATOM   10271 C CD1 . ILE H 1 39  ? 131.769 61.275 132.166 1.00 72.11  ? 39  ILE H CD1 1 
ATOM   10272 N N   . GLN H 1 40  ? 133.143 62.159 137.531 1.00 71.72  ? 40  GLN H N   1 
ATOM   10273 C CA  . GLN H 1 40  ? 132.740 62.313 138.927 1.00 71.72  ? 40  GLN H CA  1 
ATOM   10274 C C   . GLN H 1 40  ? 133.445 63.496 139.571 1.00 71.72  ? 40  GLN H C   1 
ATOM   10275 O O   . GLN H 1 40  ? 132.825 64.265 140.306 1.00 71.72  ? 40  GLN H O   1 
ATOM   10276 C CB  . GLN H 1 40  ? 133.036 61.040 139.730 1.00 73.54  ? 40  GLN H CB  1 
ATOM   10277 C CG  . GLN H 1 40  ? 132.826 61.194 141.240 1.00 73.54  ? 40  GLN H CG  1 
ATOM   10278 C CD  . GLN H 1 40  ? 131.372 61.382 141.616 1.00 73.54  ? 40  GLN H CD  1 
ATOM   10279 O OE1 . GLN H 1 40  ? 130.578 61.854 140.807 1.00 73.54  ? 40  GLN H OE1 1 
ATOM   10280 N NE2 . GLN H 1 40  ? 131.014 61.027 142.852 1.00 73.54  ? 40  GLN H NE2 1 
ATOM   10281 N N   . LYS H 1 41  ? 134.737 63.645 139.288 1.00 78.60  ? 41  LYS H N   1 
ATOM   10282 C CA  . LYS H 1 41  ? 135.531 64.742 139.853 1.00 78.60  ? 41  LYS H CA  1 
ATOM   10283 C C   . LYS H 1 41  ? 135.152 66.081 139.213 1.00 78.60  ? 41  LYS H C   1 
ATOM   10284 O O   . LYS H 1 41  ? 134.816 67.051 139.914 1.00 78.60  ? 41  LYS H O   1 
ATOM   10285 C CB  . LYS H 1 41  ? 137.031 64.486 139.645 1.00 148.81 ? 41  LYS H CB  1 
ATOM   10286 C CG  . LYS H 1 41  ? 137.585 63.282 140.398 1.00 148.81 ? 41  LYS H CG  1 
ATOM   10287 C CD  . LYS H 1 41  ? 139.104 63.197 140.276 1.00 148.81 ? 41  LYS H CD  1 
ATOM   10288 C CE  . LYS H 1 41  ? 139.644 61.968 140.989 1.00 148.81 ? 41  LYS H CE  1 
ATOM   10289 N NZ  . LYS H 1 41  ? 139.197 61.911 142.409 1.00 148.81 ? 41  LYS H NZ  1 
ATOM   10290 N N   . ALA H 1 42  ? 135.212 66.116 137.881 1.00 68.56  ? 42  ALA H N   1 
ATOM   10291 C CA  . ALA H 1 42  ? 134.877 67.308 137.109 1.00 68.56  ? 42  ALA H CA  1 
ATOM   10292 C C   . ALA H 1 42  ? 133.539 67.933 137.536 1.00 68.56  ? 42  ALA H C   1 
ATOM   10293 O O   . ALA H 1 42  ? 133.455 69.140 137.762 1.00 68.56  ? 42  ALA H O   1 
ATOM   10294 C CB  . ALA H 1 42  ? 134.849 66.970 135.628 1.00 49.61  ? 42  ALA H CB  1 
ATOM   10295 N N   . LEU H 1 43  ? 132.499 67.117 137.658 1.00 63.30  ? 43  LEU H N   1 
ATOM   10296 C CA  . LEU H 1 43  ? 131.186 67.620 138.056 1.00 63.30  ? 43  LEU H CA  1 
ATOM   10297 C C   . LEU H 1 43  ? 131.175 68.374 139.396 1.00 63.30  ? 43  LEU H C   1 
ATOM   10298 O O   . LEU H 1 43  ? 130.219 69.105 139.698 1.00 63.30  ? 43  LEU H O   1 
ATOM   10299 C CB  . LEU H 1 43  ? 130.161 66.471 138.102 1.00 85.24  ? 43  LEU H CB  1 
ATOM   10300 C CG  . LEU H 1 43  ? 129.640 65.955 136.756 1.00 85.24  ? 43  LEU H CG  1 
ATOM   10301 C CD1 . LEU H 1 43  ? 128.819 64.717 136.973 1.00 85.24  ? 43  LEU H CD1 1 
ATOM   10302 C CD2 . LEU H 1 43  ? 128.813 67.019 136.073 1.00 85.24  ? 43  LEU H CD2 1 
ATOM   10303 N N   . ARG H 1 44  ? 132.224 68.197 140.199 1.00 72.32  ? 44  ARG H N   1 
ATOM   10304 C CA  . ARG H 1 44  ? 132.303 68.887 141.490 1.00 72.32  ? 44  ARG H CA  1 
ATOM   10305 C C   . ARG H 1 44  ? 132.718 70.353 141.326 1.00 72.32  ? 44  ARG H C   1 
ATOM   10306 O O   . ARG H 1 44  ? 132.386 71.195 142.162 1.00 72.32  ? 44  ARG H O   1 
ATOM   10307 C CB  . ARG H 1 44  ? 133.274 68.171 142.427 1.00 86.19  ? 44  ARG H CB  1 
ATOM   10308 C CG  . ARG H 1 44  ? 132.637 67.043 143.204 1.00 86.19  ? 44  ARG H CG  1 
ATOM   10309 C CD  . ARG H 1 44  ? 133.587 66.488 144.243 1.00 86.19  ? 44  ARG H CD  1 
ATOM   10310 N NE  . ARG H 1 44  ? 134.518 65.509 143.685 1.00 86.19  ? 44  ARG H NE  1 
ATOM   10311 C CZ  . ARG H 1 44  ? 134.404 64.196 143.854 1.00 86.19  ? 44  ARG H CZ  1 
ATOM   10312 N NH1 . ARG H 1 44  ? 133.397 63.709 144.570 1.00 86.19  ? 44  ARG H NH1 1 
ATOM   10313 N NH2 . ARG H 1 44  ? 135.294 63.373 143.310 1.00 86.19  ? 44  ARG H NH2 1 
ATOM   10314 N N   . GLN H 1 45  ? 133.438 70.644 140.243 1.00 64.68  ? 45  GLN H N   1 
ATOM   10315 C CA  . GLN H 1 45  ? 133.874 72.001 139.952 1.00 64.68  ? 45  GLN H CA  1 
ATOM   10316 C C   . GLN H 1 45  ? 132.729 72.995 140.076 1.00 64.68  ? 45  GLN H C   1 
ATOM   10317 O O   . GLN H 1 45  ? 131.557 72.628 139.946 1.00 64.68  ? 45  GLN H O   1 
ATOM   10318 C CB  . GLN H 1 45  ? 134.416 72.090 138.532 1.00 85.14  ? 45  GLN H CB  1 
ATOM   10319 C CG  . GLN H 1 45  ? 135.732 71.416 138.330 1.00 85.14  ? 45  GLN H CG  1 
ATOM   10320 C CD  . GLN H 1 45  ? 136.138 71.425 136.881 1.00 85.14  ? 45  GLN H CD  1 
ATOM   10321 O OE1 . GLN H 1 45  ? 135.526 70.750 136.054 1.00 85.14  ? 45  GLN H OE1 1 
ATOM   10322 N NE2 . GLN H 1 45  ? 137.168 72.198 136.555 1.00 85.14  ? 45  GLN H NE2 1 
ATOM   10323 N N   . ARG H 1 46  ? 133.063 74.254 140.341 1.00 83.01  ? 46  ARG H N   1 
ATOM   10324 C CA  . ARG H 1 46  ? 132.061 75.308 140.420 1.00 83.01  ? 46  ARG H CA  1 
ATOM   10325 C C   . ARG H 1 46  ? 132.250 76.125 139.138 1.00 83.01  ? 46  ARG H C   1 
ATOM   10326 O O   . ARG H 1 46  ? 133.350 76.143 138.573 1.00 83.01  ? 46  ARG H O   1 
ATOM   10327 C CB  . ARG H 1 46  ? 132.287 76.167 141.660 1.00 71.65  ? 46  ARG H CB  1 
ATOM   10328 C CG  . ARG H 1 46  ? 131.888 75.484 142.952 1.00 71.65  ? 46  ARG H CG  1 
ATOM   10329 C CD  . ARG H 1 46  ? 131.101 76.454 143.807 1.00 71.65  ? 46  ARG H CD  1 
ATOM   10330 N NE  . ARG H 1 46  ? 130.475 75.834 144.971 1.00 71.65  ? 46  ARG H NE  1 
ATOM   10331 C CZ  . ARG H 1 46  ? 131.151 75.296 145.981 1.00 71.65  ? 46  ARG H CZ  1 
ATOM   10332 N NH1 . ARG H 1 46  ? 132.482 75.302 145.966 1.00 71.65  ? 46  ARG H NH1 1 
ATOM   10333 N NH2 . ARG H 1 46  ? 130.497 74.762 147.006 1.00 71.65  ? 46  ARG H NH2 1 
ATOM   10334 N N   . LEU H 1 47  ? 131.193 76.766 138.645 1.00 77.33  ? 47  LEU H N   1 
ATOM   10335 C CA  . LEU H 1 47  ? 131.336 77.545 137.418 1.00 77.33  ? 47  LEU H CA  1 
ATOM   10336 C C   . LEU H 1 47  ? 131.969 78.904 137.654 1.00 77.33  ? 47  LEU H C   1 
ATOM   10337 O O   . LEU H 1 47  ? 131.717 79.558 138.668 1.00 77.33  ? 47  LEU H O   1 
ATOM   10338 C CB  . LEU H 1 47  ? 129.985 77.751 136.729 1.00 93.62  ? 47  LEU H CB  1 
ATOM   10339 C CG  . LEU H 1 47  ? 129.362 76.553 136.024 1.00 93.62  ? 47  LEU H CG  1 
ATOM   10340 C CD1 . LEU H 1 47  ? 130.381 75.913 135.083 1.00 93.62  ? 47  LEU H CD1 1 
ATOM   10341 C CD2 . LEU H 1 47  ? 128.896 75.570 137.073 1.00 93.62  ? 47  LEU H CD2 1 
ATOM   10342 N N   . GLY H 1 48  ? 132.796 79.325 136.707 1.00 95.17  ? 48  GLY H N   1 
ATOM   10343 C CA  . GLY H 1 48  ? 133.434 80.618 136.826 1.00 95.17  ? 48  GLY H CA  1 
ATOM   10344 C C   . GLY H 1 48  ? 132.441 81.701 136.450 1.00 95.17  ? 48  GLY H C   1 
ATOM   10345 O O   . GLY H 1 48  ? 131.316 81.394 136.058 1.00 95.17  ? 48  GLY H O   1 
ATOM   10346 N N   . PRO H 1 49  ? 132.816 82.982 136.580 1.00 129.87 ? 49  PRO H N   1 
ATOM   10347 C CA  . PRO H 1 49  ? 131.908 84.079 136.230 1.00 129.87 ? 49  PRO H CA  1 
ATOM   10348 C C   . PRO H 1 49  ? 131.617 84.161 134.727 1.00 129.87 ? 49  PRO H C   1 
ATOM   10349 O O   . PRO H 1 49  ? 130.718 84.887 134.306 1.00 129.87 ? 49  PRO H O   1 
ATOM   10350 C CB  . PRO H 1 49  ? 132.650 85.310 136.747 1.00 74.41  ? 49  PRO H CB  1 
ATOM   10351 C CG  . PRO H 1 49  ? 133.405 84.764 137.930 1.00 74.41  ? 49  PRO H CG  1 
ATOM   10352 C CD  . PRO H 1 49  ? 133.955 83.487 137.368 1.00 74.41  ? 49  PRO H CD  1 
ATOM   10353 N N   . GLU H 1 50  ? 132.379 83.416 133.927 1.00 69.20  ? 50  GLU H N   1 
ATOM   10354 C CA  . GLU H 1 50  ? 132.204 83.403 132.476 1.00 69.20  ? 50  GLU H CA  1 
ATOM   10355 C C   . GLU H 1 50  ? 130.933 82.648 132.087 1.00 69.20  ? 50  GLU H C   1 
ATOM   10356 O O   . GLU H 1 50  ? 130.548 82.634 130.925 1.00 69.20  ? 50  GLU H O   1 
ATOM   10357 C CB  . GLU H 1 50  ? 133.392 82.719 131.791 1.00 94.49  ? 50  GLU H CB  1 
ATOM   10358 C CG  . GLU H 1 50  ? 134.754 83.209 132.230 1.00 94.49  ? 50  GLU H CG  1 
ATOM   10359 C CD  . GLU H 1 50  ? 135.277 82.492 133.461 1.00 94.49  ? 50  GLU H CD  1 
ATOM   10360 O OE1 . GLU H 1 50  ? 134.532 82.373 134.458 1.00 94.49  ? 50  GLU H OE1 1 
ATOM   10361 O OE2 . GLU H 1 50  ? 136.445 82.051 133.429 1.00 94.49  ? 50  GLU H OE2 1 
ATOM   10362 N N   . TYR H 1 51  ? 130.296 82.005 133.061 1.00 98.83  ? 51  TYR H N   1 
ATOM   10363 C CA  . TYR H 1 51  ? 129.083 81.235 132.809 1.00 98.83  ? 51  TYR H CA  1 
ATOM   10364 C C   . TYR H 1 51  ? 127.821 81.920 133.323 1.00 98.83  ? 51  TYR H C   1 
ATOM   10365 O O   . TYR H 1 51  ? 126.742 81.766 132.739 1.00 98.83  ? 51  TYR H O   1 
ATOM   10366 C CB  . TYR H 1 51  ? 129.205 79.842 133.447 1.00 84.96  ? 51  TYR H CB  1 
ATOM   10367 C CG  . TYR H 1 51  ? 130.149 78.906 132.713 1.00 84.96  ? 51  TYR H CG  1 
ATOM   10368 C CD1 . TYR H 1 51  ? 131.409 78.595 133.231 1.00 84.96  ? 51  TYR H CD1 1 
ATOM   10369 C CD2 . TYR H 1 51  ? 129.795 78.367 131.468 1.00 84.96  ? 51  TYR H CD2 1 
ATOM   10370 C CE1 . TYR H 1 51  ? 132.294 77.776 132.523 1.00 84.96  ? 51  TYR H CE1 1 
ATOM   10371 C CE2 . TYR H 1 51  ? 130.669 77.550 130.755 1.00 84.96  ? 51  TYR H CE2 1 
ATOM   10372 C CZ  . TYR H 1 51  ? 131.916 77.260 131.283 1.00 84.96  ? 51  TYR H CZ  1 
ATOM   10373 O OH  . TYR H 1 51  ? 132.777 76.465 130.558 1.00 84.96  ? 51  TYR H OH  1 
ATOM   10374 N N   . ILE H 1 52  ? 127.969 82.682 134.407 1.00 62.04  ? 52  ILE H N   1 
ATOM   10375 C CA  . ILE H 1 52  ? 126.859 83.389 135.046 1.00 62.04  ? 52  ILE H CA  1 
ATOM   10376 C C   . ILE H 1 52  ? 126.331 84.645 134.329 1.00 62.04  ? 52  ILE H C   1 
ATOM   10377 O O   . ILE H 1 52  ? 127.071 85.372 133.650 1.00 62.04  ? 52  ILE H O   1 
ATOM   10378 C CB  . ILE H 1 52  ? 127.234 83.783 136.479 1.00 52.91  ? 52  ILE H CB  1 
ATOM   10379 C CG1 . ILE H 1 52  ? 127.974 82.623 137.163 1.00 52.91  ? 52  ILE H CG1 1 
ATOM   10380 C CG2 . ILE H 1 52  ? 125.987 84.165 137.253 1.00 52.91  ? 52  ILE H CG2 1 
ATOM   10381 C CD1 . ILE H 1 52  ? 127.236 81.285 137.192 1.00 52.91  ? 52  ILE H CD1 1 
ATOM   10382 N N   . SER H 1 53  ? 125.033 84.883 134.490 1.00 85.31  ? 53  SER H N   1 
ATOM   10383 C CA  . SER H 1 53  ? 124.352 86.026 133.888 1.00 85.31  ? 53  SER H CA  1 
ATOM   10384 C C   . SER H 1 53  ? 123.361 86.555 134.911 1.00 85.31  ? 53  SER H C   1 
ATOM   10385 O O   . SER H 1 53  ? 123.233 86.006 136.004 1.00 85.31  ? 53  SER H O   1 
ATOM   10386 C CB  . SER H 1 53  ? 123.595 85.609 132.617 1.00 74.18  ? 53  SER H CB  1 
ATOM   10387 O OG  . SER H 1 53  ? 124.479 85.167 131.598 1.00 74.18  ? 53  SER H OG  1 
ATOM   10388 N N   . SER H 1 54  ? 122.654 87.620 134.565 1.00 84.69  ? 54  SER H N   1 
ATOM   10389 C CA  . SER H 1 54  ? 121.691 88.171 135.499 1.00 84.69  ? 54  SER H CA  1 
ATOM   10390 C C   . SER H 1 54  ? 120.569 88.942 134.830 1.00 84.69  ? 54  SER H C   1 
ATOM   10391 O O   . SER H 1 54  ? 120.716 89.480 133.728 1.00 84.69  ? 54  SER H O   1 
ATOM   10392 C CB  . SER H 1 54  ? 122.396 89.078 136.500 1.00 119.91 ? 54  SER H CB  1 
ATOM   10393 O OG  . SER H 1 54  ? 123.037 90.151 135.837 1.00 119.91 ? 54  SER H OG  1 
ATOM   10394 N N   . ARG H 1 55  ? 119.440 88.976 135.518 1.00 119.12 ? 55  ARG H N   1 
ATOM   10395 C CA  . ARG H 1 55  ? 118.257 89.674 135.051 1.00 119.12 ? 55  ARG H CA  1 
ATOM   10396 C C   . ARG H 1 55  ? 117.781 90.476 136.245 1.00 119.12 ? 55  ARG H C   1 
ATOM   10397 O O   . ARG H 1 55  ? 118.208 90.219 137.371 1.00 119.12 ? 55  ARG H O   1 
ATOM   10398 C CB  . ARG H 1 55  ? 117.176 88.673 134.655 1.00 145.17 ? 55  ARG H CB  1 
ATOM   10399 C CG  . ARG H 1 55  ? 117.417 87.936 133.353 1.00 145.17 ? 55  ARG H CG  1 
ATOM   10400 C CD  . ARG H 1 55  ? 116.886 86.521 133.457 1.00 145.17 ? 55  ARG H CD  1 
ATOM   10401 N NE  . ARG H 1 55  ? 115.718 86.444 134.328 1.00 145.17 ? 55  ARG H NE  1 
ATOM   10402 C CZ  . ARG H 1 55  ? 115.226 85.310 134.814 1.00 145.17 ? 55  ARG H CZ  1 
ATOM   10403 N NH1 . ARG H 1 55  ? 115.800 84.153 134.513 1.00 145.17 ? 55  ARG H NH1 1 
ATOM   10404 N NH2 . ARG H 1 55  ? 114.162 85.334 135.602 1.00 145.17 ? 55  ARG H NH2 1 
ATOM   10405 N N   . MET H 1 56  ? 116.898 91.440 136.017 1.00 149.77 ? 56  MET H N   1 
ATOM   10406 C CA  . MET H 1 56  ? 116.396 92.233 137.123 1.00 149.77 ? 56  MET H CA  1 
ATOM   10407 C C   . MET H 1 56  ? 115.008 91.757 137.533 1.00 149.77 ? 56  MET H C   1 
ATOM   10408 O O   . MET H 1 56  ? 114.015 92.062 136.871 1.00 149.77 ? 56  MET H O   1 
ATOM   10409 C CB  . MET H 1 56  ? 116.358 93.709 136.744 1.00 125.37 ? 56  MET H CB  1 
ATOM   10410 C CG  . MET H 1 56  ? 116.484 94.618 137.946 1.00 125.37 ? 56  MET H CG  1 
ATOM   10411 S SD  . MET H 1 56  ? 117.858 94.087 138.994 1.00 125.37 ? 56  MET H SD  1 
ATOM   10412 C CE  . MET H 1 56  ? 119.263 94.432 137.915 1.00 125.37 ? 56  MET H CE  1 
ATOM   10413 N N   . ALA H 1 57  ? 114.951 90.998 138.624 1.00 173.14 ? 57  ALA H N   1 
ATOM   10414 C CA  . ALA H 1 57  ? 113.689 90.468 139.127 1.00 173.14 ? 57  ALA H CA  1 
ATOM   10415 C C   . ALA H 1 57  ? 112.656 91.574 139.225 1.00 173.14 ? 57  ALA H C   1 
ATOM   10416 O O   . ALA H 1 57  ? 112.944 92.650 139.748 1.00 173.14 ? 57  ALA H O   1 
ATOM   10417 C CB  . ALA H 1 57  ? 113.891 89.835 140.497 1.00 61.71  ? 57  ALA H CB  1 
ATOM   10418 N N   . GLY H 1 58  ? 111.458 91.310 138.714 1.00 162.16 ? 58  GLY H N   1 
ATOM   10419 C CA  . GLY H 1 58  ? 110.399 92.299 138.775 1.00 162.16 ? 58  GLY H CA  1 
ATOM   10420 C C   . GLY H 1 58  ? 110.195 92.737 140.212 1.00 162.16 ? 58  GLY H C   1 
ATOM   10421 O O   . GLY H 1 58  ? 109.470 92.090 140.970 1.00 162.16 ? 58  GLY H O   1 
ATOM   10422 N N   . GLY H 1 59  ? 110.842 93.837 140.587 1.00 197.89 ? 59  GLY H N   1 
ATOM   10423 C CA  . GLY H 1 59  ? 110.734 94.338 141.944 1.00 197.89 ? 59  GLY H CA  1 
ATOM   10424 C C   . GLY H 1 59  ? 111.828 93.758 142.821 1.00 197.89 ? 59  GLY H C   1 
ATOM   10425 O O   . GLY H 1 59  ? 112.364 94.432 143.701 1.00 197.89 ? 59  GLY H O   1 
ATOM   10426 N N   . GLY H 1 60  ? 112.162 92.496 142.575 1.00 140.72 ? 60  GLY H N   1 
ATOM   10427 C CA  . GLY H 1 60  ? 113.194 91.841 143.353 1.00 140.72 ? 60  GLY H CA  1 
ATOM   10428 C C   . GLY H 1 60  ? 114.572 92.365 143.013 1.00 140.72 ? 60  GLY H C   1 
ATOM   10429 O O   . GLY H 1 60  ? 114.714 93.407 142.370 1.00 140.72 ? 60  GLY H O   1 
ATOM   10430 N N   . GLN H 1 61  ? 115.593 91.636 143.445 1.00 126.36 ? 61  GLN H N   1 
ATOM   10431 C CA  . GLN H 1 61  ? 116.968 92.031 143.186 1.00 126.36 ? 61  GLN H CA  1 
ATOM   10432 C C   . GLN H 1 61  ? 117.489 91.445 141.879 1.00 126.36 ? 61  GLN H C   1 
ATOM   10433 O O   . GLN H 1 61  ? 116.731 91.185 140.944 1.00 126.36 ? 61  GLN H O   1 
ATOM   10434 C CB  . GLN H 1 61  ? 117.889 91.581 144.329 1.00 186.46 ? 61  GLN H CB  1 
ATOM   10435 C CG  . GLN H 1 61  ? 117.508 92.077 145.716 1.00 186.46 ? 61  GLN H CG  1 
ATOM   10436 C CD  . GLN H 1 61  ? 116.511 91.173 146.403 1.00 186.46 ? 61  GLN H CD  1 
ATOM   10437 O OE1 . GLN H 1 61  ? 115.387 90.997 145.935 1.00 186.46 ? 61  GLN H OE1 1 
ATOM   10438 N NE2 . GLN H 1 61  ? 116.921 90.589 147.523 1.00 186.46 ? 61  GLN H NE2 1 
ATOM   10439 N N   . LYS H 1 62  ? 118.802 91.246 141.842 1.00 141.09 ? 62  LYS H N   1 
ATOM   10440 C CA  . LYS H 1 62  ? 119.496 90.693 140.692 1.00 141.09 ? 62  LYS H CA  1 
ATOM   10441 C C   . LYS H 1 62  ? 119.490 89.174 140.772 1.00 141.09 ? 62  LYS H C   1 
ATOM   10442 O O   . LYS H 1 62  ? 119.947 88.595 141.762 1.00 141.09 ? 62  LYS H O   1 
ATOM   10443 C CB  . LYS H 1 62  ? 120.937 91.203 140.677 1.00 106.63 ? 62  LYS H CB  1 
ATOM   10444 C CG  . LYS H 1 62  ? 121.856 90.530 139.686 1.00 106.63 ? 62  LYS H CG  1 
ATOM   10445 C CD  . LYS H 1 62  ? 123.278 91.002 139.911 1.00 106.63 ? 62  LYS H CD  1 
ATOM   10446 C CE  . LYS H 1 62  ? 124.256 90.320 138.977 1.00 106.63 ? 62  LYS H CE  1 
ATOM   10447 N NZ  . LYS H 1 62  ? 125.648 90.798 139.211 1.00 106.63 ? 62  LYS H NZ  1 
ATOM   10448 N N   . VAL H 1 63  ? 118.962 88.535 139.731 1.00 95.99  ? 63  VAL H N   1 
ATOM   10449 C CA  . VAL H 1 63  ? 118.912 87.081 139.680 1.00 95.99  ? 63  VAL H CA  1 
ATOM   10450 C C   . VAL H 1 63  ? 119.943 86.525 138.704 1.00 95.99  ? 63  VAL H C   1 
ATOM   10451 O O   . VAL H 1 63  ? 119.994 86.907 137.530 1.00 95.99  ? 63  VAL H O   1 
ATOM   10452 C CB  . VAL H 1 63  ? 117.524 86.583 139.281 1.00 64.97  ? 63  VAL H CB  1 
ATOM   10453 C CG1 . VAL H 1 63  ? 117.522 85.071 139.239 1.00 64.97  ? 63  VAL H CG1 1 
ATOM   10454 C CG2 . VAL H 1 63  ? 116.495 87.084 140.281 1.00 64.97  ? 63  VAL H CG2 1 
ATOM   10455 N N   . CYS H 1 64  ? 120.766 85.620 139.223 1.00 76.99  ? 64  CYS H N   1 
ATOM   10456 C CA  . CYS H 1 64  ? 121.825 84.981 138.455 1.00 76.99  ? 64  CYS H CA  1 
ATOM   10457 C C   . CYS H 1 64  ? 121.333 83.679 137.842 1.00 76.99  ? 64  CYS H C   1 
ATOM   10458 O O   . CYS H 1 64  ? 120.562 82.938 138.452 1.00 76.99  ? 64  CYS H O   1 
ATOM   10459 C CB  . CYS H 1 64  ? 123.027 84.706 139.357 1.00 101.45 ? 64  CYS H CB  1 
ATOM   10460 S SG  . CYS H 1 64  ? 123.619 86.164 140.256 1.00 101.45 ? 64  CYS H SG  1 
ATOM   10461 N N   . TYR H 1 65  ? 121.802 83.398 136.634 1.00 90.78  ? 65  TYR H N   1 
ATOM   10462 C CA  . TYR H 1 65  ? 121.382 82.205 135.924 1.00 90.78  ? 65  TYR H CA  1 
ATOM   10463 C C   . TYR H 1 65  ? 122.392 81.884 134.831 1.00 90.78  ? 65  TYR H C   1 
ATOM   10464 O O   . TYR H 1 65  ? 123.210 82.730 134.477 1.00 90.78  ? 65  TYR H O   1 
ATOM   10465 C CB  . TYR H 1 65  ? 120.015 82.464 135.293 1.00 58.98  ? 65  TYR H CB  1 
ATOM   10466 C CG  . TYR H 1 65  ? 120.072 83.424 134.127 1.00 58.98  ? 65  TYR H CG  1 
ATOM   10467 C CD1 . TYR H 1 65  ? 120.331 82.961 132.834 1.00 58.98  ? 65  TYR H CD1 1 
ATOM   10468 C CD2 . TYR H 1 65  ? 119.891 84.797 134.314 1.00 58.98  ? 65  TYR H CD2 1 
ATOM   10469 C CE1 . TYR H 1 65  ? 120.406 83.839 131.746 1.00 58.98  ? 65  TYR H CE1 1 
ATOM   10470 C CE2 . TYR H 1 65  ? 119.969 85.686 133.230 1.00 58.98  ? 65  TYR H CE2 1 
ATOM   10471 C CZ  . TYR H 1 65  ? 120.224 85.197 131.950 1.00 58.98  ? 65  TYR H CZ  1 
ATOM   10472 O OH  . TYR H 1 65  ? 120.280 86.053 130.876 1.00 58.98  ? 65  TYR H OH  1 
ATOM   10473 N N   . ILE H 1 66  ? 122.327 80.667 134.291 1.00 59.01  ? 66  ILE H N   1 
ATOM   10474 C CA  . ILE H 1 66  ? 123.239 80.261 133.224 1.00 59.01  ? 66  ILE H CA  1 
ATOM   10475 C C   . ILE H 1 66  ? 122.436 80.174 131.929 1.00 59.01  ? 66  ILE H C   1 
ATOM   10476 O O   . ILE H 1 66  ? 121.388 79.521 131.872 1.00 59.01  ? 66  ILE H O   1 
ATOM   10477 C CB  . ILE H 1 66  ? 123.885 78.887 133.527 1.00 45.12  ? 66  ILE H CB  1 
ATOM   10478 C CG1 . ILE H 1 66  ? 124.457 78.882 134.950 1.00 45.12  ? 66  ILE H CG1 1 
ATOM   10479 C CG2 . ILE H 1 66  ? 124.972 78.588 132.509 1.00 45.12  ? 66  ILE H CG2 1 
ATOM   10480 C CD1 . ILE H 1 66  ? 124.995 77.539 135.420 1.00 45.12  ? 66  ILE H CD1 1 
ATOM   10481 N N   . GLU H 1 67  ? 122.910 80.858 130.897 1.00 74.32  ? 67  GLU H N   1 
ATOM   10482 C CA  . GLU H 1 67  ? 122.209 80.845 129.630 1.00 74.32  ? 67  GLU H CA  1 
ATOM   10483 C C   . GLU H 1 67  ? 122.137 79.429 129.097 1.00 74.32  ? 67  GLU H C   1 
ATOM   10484 O O   . GLU H 1 67  ? 123.038 78.630 129.331 1.00 74.32  ? 67  GLU H O   1 
ATOM   10485 C CB  . GLU H 1 67  ? 122.910 81.758 128.633 1.00 124.34 ? 67  GLU H CB  1 
ATOM   10486 C CG  . GLU H 1 67  ? 122.853 83.212 129.038 1.00 124.34 ? 67  GLU H CG  1 
ATOM   10487 C CD  . GLU H 1 67  ? 123.489 84.125 128.018 1.00 124.34 ? 67  GLU H CD  1 
ATOM   10488 O OE1 . GLU H 1 67  ? 122.990 84.187 126.872 1.00 124.34 ? 67  GLU H OE1 1 
ATOM   10489 O OE2 . GLU H 1 67  ? 124.494 84.781 128.362 1.00 124.34 ? 67  GLU H OE2 1 
ATOM   10490 N N   . GLY H 1 68  ? 121.056 79.126 128.389 1.00 83.72  ? 68  GLY H N   1 
ATOM   10491 C CA  . GLY H 1 68  ? 120.865 77.802 127.830 1.00 83.72  ? 68  GLY H CA  1 
ATOM   10492 C C   . GLY H 1 68  ? 122.012 77.207 127.028 1.00 83.72  ? 68  GLY H C   1 
ATOM   10493 O O   . GLY H 1 68  ? 122.521 76.153 127.397 1.00 83.72  ? 68  GLY H O   1 
ATOM   10494 N N   . HIS H 1 69  ? 122.425 77.855 125.940 1.00 66.30  ? 69  HIS H N   1 
ATOM   10495 C CA  . HIS H 1 69  ? 123.507 77.308 125.126 1.00 66.30  ? 69  HIS H CA  1 
ATOM   10496 C C   . HIS H 1 69  ? 124.740 76.971 125.965 1.00 66.30  ? 69  HIS H C   1 
ATOM   10497 O O   . HIS H 1 69  ? 125.556 76.143 125.570 1.00 66.30  ? 69  HIS H O   1 
ATOM   10498 C CB  . HIS H 1 69  ? 123.895 78.280 124.013 1.00 105.34 ? 69  HIS H CB  1 
ATOM   10499 C CG  . HIS H 1 69  ? 124.515 79.542 124.512 1.00 105.34 ? 69  HIS H CG  1 
ATOM   10500 N ND1 . HIS H 1 69  ? 123.815 80.470 125.252 1.00 105.34 ? 69  HIS H ND1 1 
ATOM   10501 C CD2 . HIS H 1 69  ? 125.776 80.020 124.399 1.00 105.34 ? 69  HIS H CD2 1 
ATOM   10502 C CE1 . HIS H 1 69  ? 124.617 81.467 125.573 1.00 105.34 ? 69  HIS H CE1 1 
ATOM   10503 N NE2 . HIS H 1 69  ? 125.812 81.219 125.068 1.00 105.34 ? 69  HIS H NE2 1 
ATOM   10504 N N   . ARG H 1 70  ? 124.874 77.613 127.120 1.00 67.12  ? 70  ARG H N   1 
ATOM   10505 C CA  . ARG H 1 70  ? 126.010 77.351 128.001 1.00 67.12  ? 70  ARG H CA  1 
ATOM   10506 C C   . ARG H 1 70  ? 125.881 75.946 128.578 1.00 67.12  ? 70  ARG H C   1 
ATOM   10507 O O   . ARG H 1 70  ? 126.790 75.116 128.441 1.00 67.12  ? 70  ARG H O   1 
ATOM   10508 C CB  . ARG H 1 70  ? 126.052 78.363 129.156 1.00 132.91 ? 70  ARG H CB  1 
ATOM   10509 C CG  . ARG H 1 70  ? 126.403 79.784 128.754 1.00 132.91 ? 70  ARG H CG  1 
ATOM   10510 C CD  . ARG H 1 70  ? 127.909 80.003 128.629 1.00 132.91 ? 70  ARG H CD  1 
ATOM   10511 N NE  . ARG H 1 70  ? 128.200 81.261 127.947 1.00 132.91 ? 70  ARG H NE  1 
ATOM   10512 C CZ  . ARG H 1 70  ? 127.718 82.444 128.320 1.00 132.91 ? 70  ARG H CZ  1 
ATOM   10513 N NH1 . ARG H 1 70  ? 126.921 82.535 129.380 1.00 132.91 ? 70  ARG H NH1 1 
ATOM   10514 N NH2 . ARG H 1 70  ? 128.013 83.533 127.617 1.00 132.91 ? 70  ARG H NH2 1 
ATOM   10515 N N   . VAL H 1 71  ? 124.744 75.697 129.230 1.00 55.49  ? 71  VAL H N   1 
ATOM   10516 C CA  . VAL H 1 71  ? 124.462 74.406 129.835 1.00 55.49  ? 71  VAL H CA  1 
ATOM   10517 C C   . VAL H 1 71  ? 124.535 73.292 128.794 1.00 55.49  ? 71  VAL H C   1 
ATOM   10518 O O   . VAL H 1 71  ? 124.926 72.171 129.096 1.00 55.49  ? 71  VAL H O   1 
ATOM   10519 C CB  . VAL H 1 71  ? 123.076 74.384 130.462 1.00 47.69  ? 71  VAL H CB  1 
ATOM   10520 C CG1 . VAL H 1 71  ? 122.850 73.054 131.127 1.00 47.69  ? 71  VAL H CG1 1 
ATOM   10521 C CG2 . VAL H 1 71  ? 122.947 75.494 131.492 1.00 47.69  ? 71  VAL H CG2 1 
ATOM   10522 N N   . ILE H 1 72  ? 124.166 73.603 127.560 1.00 45.70  ? 72  ILE H N   1 
ATOM   10523 C CA  . ILE H 1 72  ? 124.213 72.607 126.518 1.00 45.70  ? 72  ILE H CA  1 
ATOM   10524 C C   . ILE H 1 72  ? 125.644 72.211 126.308 1.00 45.70  ? 72  ILE H C   1 
ATOM   10525 O O   . ILE H 1 72  ? 125.976 71.047 126.462 1.00 45.70  ? 72  ILE H O   1 
ATOM   10526 C CB  . ILE H 1 72  ? 123.593 73.122 125.193 1.00 58.39  ? 72  ILE H CB  1 
ATOM   10527 C CG1 . ILE H 1 72  ? 122.067 73.072 125.324 1.00 58.39  ? 72  ILE H CG1 1 
ATOM   10528 C CG2 . ILE H 1 72  ? 124.084 72.288 123.997 1.00 58.39  ? 72  ILE H CG2 1 
ATOM   10529 C CD1 . ILE H 1 72  ? 121.291 73.593 124.114 1.00 58.39  ? 72  ILE H CD1 1 
ATOM   10530 N N   . ASN H 1 73  ? 126.498 73.174 125.968 1.00 59.01  ? 73  ASN H N   1 
ATOM   10531 C CA  . ASN H 1 73  ? 127.912 72.880 125.733 1.00 59.01  ? 73  ASN H CA  1 
ATOM   10532 C C   . ASN H 1 73  ? 128.603 72.255 126.939 1.00 59.01  ? 73  ASN H C   1 
ATOM   10533 O O   . ASN H 1 73  ? 129.444 71.380 126.774 1.00 59.01  ? 73  ASN H O   1 
ATOM   10534 C CB  . ASN H 1 73  ? 128.652 74.132 125.282 1.00 62.73  ? 73  ASN H CB  1 
ATOM   10535 C CG  . ASN H 1 73  ? 128.274 74.539 123.885 1.00 62.73  ? 73  ASN H CG  1 
ATOM   10536 O OD1 . ASN H 1 73  ? 128.229 73.705 122.975 1.00 62.73  ? 73  ASN H OD1 1 
ATOM   10537 N ND2 . ASN H 1 73  ? 128.005 75.827 123.693 1.00 62.73  ? 73  ASN H ND2 1 
ATOM   10538 N N   . LEU H 1 74  ? 128.246 72.688 128.143 1.00 65.80  ? 74  LEU H N   1 
ATOM   10539 C CA  . LEU H 1 74  ? 128.838 72.108 129.342 1.00 65.80  ? 74  LEU H CA  1 
ATOM   10540 C C   . LEU H 1 74  ? 128.597 70.605 129.361 1.00 65.80  ? 74  LEU H C   1 
ATOM   10541 O O   . LEU H 1 74  ? 129.484 69.827 129.693 1.00 65.80  ? 74  LEU H O   1 
ATOM   10542 C CB  . LEU H 1 74  ? 128.218 72.700 130.598 1.00 51.98  ? 74  LEU H CB  1 
ATOM   10543 C CG  . LEU H 1 74  ? 128.885 73.928 131.201 1.00 51.98  ? 74  LEU H CG  1 
ATOM   10544 C CD1 . LEU H 1 74  ? 128.159 74.311 132.474 1.00 51.98  ? 74  LEU H CD1 1 
ATOM   10545 C CD2 . LEU H 1 74  ? 130.336 73.624 131.488 1.00 51.98  ? 74  LEU H CD2 1 
ATOM   10546 N N   . ALA H 1 75  ? 127.380 70.210 129.014 1.00 53.83  ? 75  ALA H N   1 
ATOM   10547 C CA  . ALA H 1 75  ? 126.998 68.812 128.967 1.00 53.83  ? 75  ALA H CA  1 
ATOM   10548 C C   . ALA H 1 75  ? 127.655 68.076 127.790 1.00 53.83  ? 75  ALA H C   1 
ATOM   10549 O O   . ALA H 1 75  ? 128.096 66.941 127.941 1.00 53.83  ? 75  ALA H O   1 
ATOM   10550 C CB  . ALA H 1 75  ? 125.475 68.701 128.875 1.00 52.61  ? 75  ALA H CB  1 
ATOM   10551 N N   . ASN H 1 76  ? 127.716 68.700 126.619 1.00 47.73  ? 76  ASN H N   1 
ATOM   10552 C CA  . ASN H 1 76  ? 128.321 68.031 125.482 1.00 47.73  ? 76  ASN H CA  1 
ATOM   10553 C C   . ASN H 1 76  ? 129.777 67.745 125.771 1.00 47.73  ? 76  ASN H C   1 
ATOM   10554 O O   . ASN H 1 76  ? 130.391 66.905 125.105 1.00 47.73  ? 76  ASN H O   1 
ATOM   10555 C CB  . ASN H 1 76  ? 128.233 68.880 124.212 1.00 72.36  ? 76  ASN H CB  1 
ATOM   10556 C CG  . ASN H 1 76  ? 126.844 68.895 123.611 1.00 72.36  ? 76  ASN H CG  1 
ATOM   10557 O OD1 . ASN H 1 76  ? 126.291 67.851 123.281 1.00 72.36  ? 76  ASN H OD1 1 
ATOM   10558 N ND2 . ASN H 1 76  ? 126.272 70.085 123.461 1.00 72.36  ? 76  ASN H ND2 1 
ATOM   10559 N N   . GLU H 1 77  ? 130.348 68.457 126.745 1.00 69.84  ? 77  GLU H N   1 
ATOM   10560 C CA  . GLU H 1 77  ? 131.747 68.246 127.099 1.00 69.84  ? 77  GLU H CA  1 
ATOM   10561 C C   . GLU H 1 77  ? 131.884 67.200 128.192 1.00 69.84  ? 77  GLU H C   1 
ATOM   10562 O O   . GLU H 1 77  ? 132.680 66.273 128.070 1.00 69.84  ? 77  GLU H O   1 
ATOM   10563 C CB  . GLU H 1 77  ? 132.402 69.556 127.530 1.00 75.87  ? 77  GLU H CB  1 
ATOM   10564 C CG  . GLU H 1 77  ? 132.745 70.462 126.357 1.00 75.87  ? 77  GLU H CG  1 
ATOM   10565 C CD  . GLU H 1 77  ? 133.359 69.710 125.179 1.00 75.87  ? 77  GLU H CD  1 
ATOM   10566 O OE1 . GLU H 1 77  ? 134.179 68.793 125.409 1.00 75.87  ? 77  GLU H OE1 1 
ATOM   10567 O OE2 . GLU H 1 77  ? 133.032 70.041 124.021 1.00 75.87  ? 77  GLU H OE2 1 
ATOM   10568 N N   . MET H 1 78  ? 131.095 67.347 129.251 1.00 79.83  ? 78  MET H N   1 
ATOM   10569 C CA  . MET H 1 78  ? 131.099 66.404 130.364 1.00 79.83  ? 78  MET H CA  1 
ATOM   10570 C C   . MET H 1 78  ? 130.730 64.970 129.971 1.00 79.83  ? 78  MET H C   1 
ATOM   10571 O O   . MET H 1 78  ? 131.210 64.028 130.592 1.00 79.83  ? 78  MET H O   1 
ATOM   10572 C CB  . MET H 1 78  ? 130.117 66.850 131.441 1.00 97.74  ? 78  MET H CB  1 
ATOM   10573 C CG  . MET H 1 78  ? 130.671 67.814 132.456 1.00 97.74  ? 78  MET H CG  1 
ATOM   10574 S SD  . MET H 1 78  ? 132.030 67.115 133.393 1.00 97.74  ? 78  MET H SD  1 
ATOM   10575 C CE  . MET H 1 78  ? 131.291 65.671 134.005 1.00 97.74  ? 78  MET H CE  1 
ATOM   10576 N N   . PHE H 1 79  ? 129.884 64.799 128.952 1.00 57.46  ? 79  PHE H N   1 
ATOM   10577 C CA  . PHE H 1 79  ? 129.427 63.462 128.529 1.00 57.46  ? 79  PHE H CA  1 
ATOM   10578 C C   . PHE H 1 79  ? 129.630 63.102 127.061 1.00 57.46  ? 79  PHE H C   1 
ATOM   10579 O O   . PHE H 1 79  ? 129.407 61.965 126.673 1.00 57.46  ? 79  PHE H O   1 
ATOM   10580 C CB  . PHE H 1 79  ? 127.931 63.288 128.821 1.00 37.00  ? 79  PHE H CB  1 
ATOM   10581 C CG  . PHE H 1 79  ? 127.513 63.733 130.202 1.00 37.00  ? 79  PHE H CG  1 
ATOM   10582 C CD1 . PHE H 1 79  ? 126.663 64.825 130.361 1.00 37.00  ? 79  PHE H CD1 1 
ATOM   10583 C CD2 . PHE H 1 79  ? 127.944 63.051 131.339 1.00 37.00  ? 79  PHE H CD2 1 
ATOM   10584 C CE1 . PHE H 1 79  ? 126.233 65.240 131.635 1.00 37.00  ? 79  PHE H CE1 1 
ATOM   10585 C CE2 . PHE H 1 79  ? 127.528 63.445 132.623 1.00 37.00  ? 79  PHE H CE2 1 
ATOM   10586 C CZ  . PHE H 1 79  ? 126.663 64.548 132.769 1.00 37.00  ? 79  PHE H CZ  1 
ATOM   10587 N N   . GLY H 1 80  ? 130.041 64.053 126.237 1.00 54.43  ? 80  GLY H N   1 
ATOM   10588 C CA  . GLY H 1 80  ? 130.198 63.747 124.824 1.00 54.43  ? 80  GLY H CA  1 
ATOM   10589 C C   . GLY H 1 80  ? 128.855 63.941 124.140 1.00 54.43  ? 80  GLY H C   1 
ATOM   10590 O O   . GLY H 1 80  ? 127.796 63.626 124.704 1.00 54.43  ? 80  GLY H O   1 
ATOM   10591 N N   . TYR H 1 81  ? 128.884 64.438 122.914 1.00 66.21  ? 81  TYR H N   1 
ATOM   10592 C CA  . TYR H 1 81  ? 127.646 64.705 122.209 1.00 66.21  ? 81  TYR H CA  1 
ATOM   10593 C C   . TYR H 1 81  ? 126.623 63.581 122.298 1.00 66.21  ? 81  TYR H C   1 
ATOM   10594 O O   . TYR H 1 81  ? 125.407 63.824 122.280 1.00 66.21  ? 81  TYR H O   1 
ATOM   10595 C CB  . TYR H 1 81  ? 127.946 65.015 120.749 1.00 74.51  ? 81  TYR H CB  1 
ATOM   10596 C CG  . TYR H 1 81  ? 128.380 63.823 119.951 1.00 74.51  ? 81  TYR H CG  1 
ATOM   10597 C CD1 . TYR H 1 81  ? 127.447 63.014 119.310 1.00 74.51  ? 81  TYR H CD1 1 
ATOM   10598 C CD2 . TYR H 1 81  ? 129.724 63.522 119.805 1.00 74.51  ? 81  TYR H CD2 1 
ATOM   10599 C CE1 . TYR H 1 81  ? 127.841 61.940 118.535 1.00 74.51  ? 81  TYR H CE1 1 
ATOM   10600 C CE2 . TYR H 1 81  ? 130.134 62.451 119.032 1.00 74.51  ? 81  TYR H CE2 1 
ATOM   10601 C CZ  . TYR H 1 81  ? 129.187 61.663 118.394 1.00 74.51  ? 81  TYR H CZ  1 
ATOM   10602 O OH  . TYR H 1 81  ? 129.588 60.615 117.594 1.00 74.51  ? 81  TYR H OH  1 
ATOM   10603 N N   . ASN H 1 82  ? 127.115 62.354 122.410 1.00 69.29  ? 82  ASN H N   1 
ATOM   10604 C CA  . ASN H 1 82  ? 126.245 61.190 122.453 1.00 69.29  ? 82  ASN H CA  1 
ATOM   10605 C C   . ASN H 1 82  ? 126.198 60.519 123.814 1.00 69.29  ? 82  ASN H C   1 
ATOM   10606 O O   . ASN H 1 82  ? 125.776 59.368 123.930 1.00 69.29  ? 82  ASN H O   1 
ATOM   10607 C CB  . ASN H 1 82  ? 126.718 60.180 121.413 1.00 78.22  ? 82  ASN H CB  1 
ATOM   10608 C CG  . ASN H 1 82  ? 127.951 59.427 121.861 1.00 78.22  ? 82  ASN H CG  1 
ATOM   10609 O OD1 . ASN H 1 82  ? 128.783 59.959 122.600 1.00 78.22  ? 82  ASN H OD1 1 
ATOM   10610 N ND2 . ASN H 1 82  ? 128.083 58.180 121.410 1.00 78.22  ? 82  ASN H ND2 1 
ATOM   10611 N N   . GLY H 1 83  ? 126.606 61.234 124.846 1.00 37.57  ? 83  GLY H N   1 
ATOM   10612 C CA  . GLY H 1 83  ? 126.614 60.610 126.147 1.00 37.57  ? 83  GLY H CA  1 
ATOM   10613 C C   . GLY H 1 83  ? 125.474 60.991 127.049 1.00 37.57  ? 83  GLY H C   1 
ATOM   10614 O O   . GLY H 1 83  ? 125.328 60.446 128.154 1.00 37.57  ? 83  GLY H O   1 
ATOM   10615 N N   . TRP H 1 84  ? 124.673 61.944 126.593 1.00 46.39  ? 84  TRP H N   1 
ATOM   10616 C CA  . TRP H 1 84  ? 123.533 62.401 127.373 1.00 46.39  ? 84  TRP H CA  1 
ATOM   10617 C C   . TRP H 1 84  ? 122.380 62.676 126.405 1.00 46.39  ? 84  TRP H C   1 
ATOM   10618 O O   . TRP H 1 84  ? 122.583 62.891 125.200 1.00 46.39  ? 84  TRP H O   1 
ATOM   10619 C CB  . TRP H 1 84  ? 123.890 63.676 128.170 1.00 59.23  ? 84  TRP H CB  1 
ATOM   10620 C CG  . TRP H 1 84  ? 124.051 64.903 127.301 1.00 59.23  ? 84  TRP H CG  1 
ATOM   10621 C CD1 . TRP H 1 84  ? 125.029 65.127 126.375 1.00 59.23  ? 84  TRP H CD1 1 
ATOM   10622 C CD2 . TRP H 1 84  ? 123.117 65.975 127.164 1.00 59.23  ? 84  TRP H CD2 1 
ATOM   10623 N NE1 . TRP H 1 84  ? 124.752 66.261 125.659 1.00 59.23  ? 84  TRP H NE1 1 
ATOM   10624 C CE2 . TRP H 1 84  ? 123.582 66.803 126.119 1.00 59.23  ? 84  TRP H CE2 1 
ATOM   10625 C CE3 . TRP H 1 84  ? 121.925 66.312 127.818 1.00 59.23  ? 84  TRP H CE3 1 
ATOM   10626 C CZ2 . TRP H 1 84  ? 122.897 67.947 125.705 1.00 59.23  ? 84  TRP H CZ2 1 
ATOM   10627 C CZ3 . TRP H 1 84  ? 121.242 67.448 127.410 1.00 59.23  ? 84  TRP H CZ3 1 
ATOM   10628 C CH2 . TRP H 1 84  ? 121.734 68.254 126.357 1.00 59.23  ? 84  TRP H CH2 1 
ATOM   10629 N N   . ALA H 1 85  ? 121.167 62.657 126.938 1.00 50.28  ? 85  ALA H N   1 
ATOM   10630 C CA  . ALA H 1 85  ? 120.001 62.905 126.116 1.00 50.28  ? 85  ALA H CA  1 
ATOM   10631 C C   . ALA H 1 85  ? 118.867 63.401 126.988 1.00 50.28  ? 85  ALA H C   1 
ATOM   10632 O O   . ALA H 1 85  ? 118.854 63.201 128.211 1.00 50.28  ? 85  ALA H O   1 
ATOM   10633 C CB  . ALA H 1 85  ? 119.589 61.630 125.392 1.00 85.95  ? 85  ALA H CB  1 
ATOM   10634 N N   . HIS H 1 86  ? 117.915 64.070 126.360 1.00 50.92  ? 86  HIS H N   1 
ATOM   10635 C CA  . HIS H 1 86  ? 116.781 64.571 127.108 1.00 50.92  ? 86  HIS H CA  1 
ATOM   10636 C C   . HIS H 1 86  ? 115.541 64.456 126.241 1.00 50.92  ? 86  HIS H C   1 
ATOM   10637 O O   . HIS H 1 86  ? 115.604 64.389 125.006 1.00 50.92  ? 86  HIS H O   1 
ATOM   10638 C CB  . HIS H 1 86  ? 117.005 66.034 127.517 1.00 50.28  ? 86  HIS H CB  1 
ATOM   10639 C CG  . HIS H 1 86  ? 116.957 66.999 126.371 1.00 50.28  ? 86  HIS H CG  1 
ATOM   10640 N ND1 . HIS H 1 86  ? 116.144 68.112 126.371 1.00 50.28  ? 86  HIS H ND1 1 
ATOM   10641 C CD2 . HIS H 1 86  ? 117.588 66.992 125.173 1.00 50.28  ? 86  HIS H CD2 1 
ATOM   10642 C CE1 . HIS H 1 86  ? 116.274 68.746 125.218 1.00 50.28  ? 86  HIS H CE1 1 
ATOM   10643 N NE2 . HIS H 1 86  ? 117.144 68.086 124.472 1.00 50.28  ? 86  HIS H NE2 1 
ATOM   10644 N N   . SER H 1 87  ? 114.405 64.425 126.901 1.00 38.11  ? 87  SER H N   1 
ATOM   10645 C CA  . SER H 1 87  ? 113.157 64.344 126.188 1.00 38.11  ? 87  SER H CA  1 
ATOM   10646 C C   . SER H 1 87  ? 112.134 65.142 126.977 1.00 38.11  ? 87  SER H C   1 
ATOM   10647 O O   . SER H 1 87  ? 112.309 65.371 128.180 1.00 38.11  ? 87  SER H O   1 
ATOM   10648 C CB  . SER H 1 87  ? 112.707 62.899 126.077 1.00 40.24  ? 87  SER H CB  1 
ATOM   10649 O OG  . SER H 1 87  ? 112.328 62.416 127.351 1.00 40.24  ? 87  SER H OG  1 
ATOM   10650 N N   . ILE H 1 88  ? 111.076 65.577 126.298 1.00 36.10  ? 88  ILE H N   1 
ATOM   10651 C CA  . ILE H 1 88  ? 110.029 66.345 126.953 1.00 36.10  ? 88  ILE H CA  1 
ATOM   10652 C C   . ILE H 1 88  ? 108.972 65.350 127.360 1.00 36.10  ? 88  ILE H C   1 
ATOM   10653 O O   . ILE H 1 88  ? 108.282 64.798 126.513 1.00 36.10  ? 88  ILE H O   1 
ATOM   10654 C CB  . ILE H 1 88  ? 109.422 67.434 125.995 1.00 23.68  ? 88  ILE H CB  1 
ATOM   10655 C CG1 . ILE H 1 88  ? 110.515 68.437 125.598 1.00 23.68  ? 88  ILE H CG1 1 
ATOM   10656 C CG2 . ILE H 1 88  ? 108.292 68.183 126.701 1.00 23.68  ? 88  ILE H CG2 1 
ATOM   10657 C CD1 . ILE H 1 88  ? 110.125 69.402 124.538 1.00 23.68  ? 88  ILE H CD1 1 
ATOM   10658 N N   . THR H 1 89  ? 108.879 65.105 128.662 1.00 36.28  ? 89  THR H N   1 
ATOM   10659 C CA  . THR H 1 89  ? 107.904 64.159 129.181 1.00 36.28  ? 89  THR H CA  1 
ATOM   10660 C C   . THR H 1 89  ? 106.541 64.742 128.937 1.00 36.28  ? 89  THR H C   1 
ATOM   10661 O O   . THR H 1 89  ? 105.636 64.048 128.517 1.00 36.28  ? 89  THR H O   1 
ATOM   10662 C CB  . THR H 1 89  ? 108.058 63.932 130.705 1.00 36.05  ? 89  THR H CB  1 
ATOM   10663 O OG1 . THR H 1 89  ? 109.321 63.330 130.978 1.00 36.05  ? 89  THR H OG1 1 
ATOM   10664 C CG2 . THR H 1 89  ? 106.988 63.020 131.213 1.00 36.05  ? 89  THR H CG2 1 
ATOM   10665 N N   . GLN H 1 90  ? 106.406 66.032 129.210 1.00 58.57  ? 90  GLN H N   1 
ATOM   10666 C CA  . GLN H 1 90  ? 105.138 66.709 129.035 1.00 58.57  ? 90  GLN H CA  1 
ATOM   10667 C C   . GLN H 1 90  ? 105.239 68.219 129.204 1.00 58.57  ? 90  GLN H C   1 
ATOM   10668 O O   . GLN H 1 90  ? 106.010 68.715 130.027 1.00 58.57  ? 90  GLN H O   1 
ATOM   10669 C CB  . GLN H 1 90  ? 104.124 66.162 130.038 1.00 54.79  ? 90  GLN H CB  1 
ATOM   10670 C CG  . GLN H 1 90  ? 102.812 66.893 129.995 1.00 54.79  ? 90  GLN H CG  1 
ATOM   10671 C CD  . GLN H 1 90  ? 101.768 66.294 130.911 1.00 54.79  ? 90  GLN H CD  1 
ATOM   10672 O OE1 . GLN H 1 90  ? 101.868 66.369 132.148 1.00 54.79  ? 90  GLN H OE1 1 
ATOM   10673 N NE2 . GLN H 1 90  ? 100.749 65.687 130.310 1.00 54.79  ? 90  GLN H NE2 1 
ATOM   10674 N N   . GLN H 1 91  ? 104.457 68.940 128.405 1.00 42.19  ? 91  GLN H N   1 
ATOM   10675 C CA  . GLN H 1 91  ? 104.385 70.391 128.481 1.00 42.19  ? 91  GLN H CA  1 
ATOM   10676 C C   . GLN H 1 91  ? 102.921 70.797 128.610 1.00 42.19  ? 91  GLN H C   1 
ATOM   10677 O O   . GLN H 1 91  ? 102.095 70.475 127.767 1.00 42.19  ? 91  GLN H O   1 
ATOM   10678 C CB  . GLN H 1 91  ? 104.989 71.067 127.241 1.00 34.37  ? 91  GLN H CB  1 
ATOM   10679 C CG  . GLN H 1 91  ? 104.758 72.595 127.240 1.00 34.37  ? 91  GLN H CG  1 
ATOM   10680 C CD  . GLN H 1 91  ? 105.582 73.350 126.197 1.00 34.37  ? 91  GLN H CD  1 
ATOM   10681 O OE1 . GLN H 1 91  ? 106.664 73.861 126.498 1.00 34.37  ? 91  GLN H OE1 1 
ATOM   10682 N NE2 . GLN H 1 91  ? 105.084 73.412 124.975 1.00 34.37  ? 91  GLN H NE2 1 
ATOM   10683 N N   . ASN H 1 92  ? 102.597 71.508 129.674 1.00 50.08  ? 92  ASN H N   1 
ATOM   10684 C CA  . ASN H 1 92  ? 101.240 71.952 129.860 1.00 50.08  ? 92  ASN H CA  1 
ATOM   10685 C C   . ASN H 1 92  ? 101.140 73.478 129.913 1.00 50.08  ? 92  ASN H C   1 
ATOM   10686 O O   . ASN H 1 92  ? 101.867 74.123 130.660 1.00 50.08  ? 92  ASN H O   1 
ATOM   10687 C CB  . ASN H 1 92  ? 100.672 71.349 131.126 1.00 96.06  ? 92  ASN H CB  1 
ATOM   10688 C CG  . ASN H 1 92  ? 99.241  71.725 131.324 1.00 96.06  ? 92  ASN H CG  1 
ATOM   10689 O OD1 . ASN H 1 92  ? 98.385  71.379 130.513 1.00 96.06  ? 92  ASN H OD1 1 
ATOM   10690 N ND2 . ASN H 1 92  ? 98.962  72.454 132.395 1.00 96.06  ? 92  ASN H ND2 1 
ATOM   10691 N N   . VAL H 1 93  ? 100.255 74.058 129.105 1.00 40.93  ? 93  VAL H N   1 
ATOM   10692 C CA  . VAL H 1 93  ? 100.077 75.508 129.097 1.00 40.93  ? 93  VAL H CA  1 
ATOM   10693 C C   . VAL H 1 93  ? 99.156  75.751 130.258 1.00 40.93  ? 93  VAL H C   1 
ATOM   10694 O O   . VAL H 1 93  ? 98.018  75.326 130.206 1.00 40.93  ? 93  VAL H O   1 
ATOM   10695 C CB  . VAL H 1 93  ? 99.373  76.007 127.807 1.00 50.17  ? 93  VAL H CB  1 
ATOM   10696 C CG1 . VAL H 1 93  ? 99.125  77.492 127.907 1.00 50.17  ? 93  VAL H CG1 1 
ATOM   10697 C CG2 . VAL H 1 93  ? 100.219 75.711 126.574 1.00 50.17  ? 93  VAL H CG2 1 
ATOM   10698 N N   . ASP H 1 94  ? 99.643  76.406 131.308 1.00 61.12  ? 94  ASP H N   1 
ATOM   10699 C CA  . ASP H 1 94  ? 98.823  76.668 132.493 1.00 61.12  ? 94  ASP H CA  1 
ATOM   10700 C C   . ASP H 1 94  ? 97.704  77.666 132.252 1.00 61.12  ? 94  ASP H C   1 
ATOM   10701 O O   . ASP H 1 94  ? 96.582  77.473 132.715 1.00 61.12  ? 94  ASP H O   1 
ATOM   10702 C CB  . ASP H 1 94  ? 99.677  77.180 133.667 1.00 58.50  ? 94  ASP H CB  1 
ATOM   10703 C CG  . ASP H 1 94  ? 100.414 76.066 134.394 1.00 58.50  ? 94  ASP H CG  1 
ATOM   10704 O OD1 . ASP H 1 94  ? 99.903  74.929 134.396 1.00 58.50  ? 94  ASP H OD1 1 
ATOM   10705 O OD2 . ASP H 1 94  ? 101.489 76.329 134.981 1.00 58.50  ? 94  ASP H OD2 1 
ATOM   10706 N N   . PHE H 1 95  ? 98.003  78.742 131.537 1.00 51.80  ? 95  PHE H N   1 
ATOM   10707 C CA  . PHE H 1 95  ? 96.987  79.741 131.288 1.00 51.80  ? 95  PHE H CA  1 
ATOM   10708 C C   . PHE H 1 95  ? 97.415  80.710 130.220 1.00 51.80  ? 95  PHE H C   1 
ATOM   10709 O O   . PHE H 1 95  ? 98.596  80.819 129.907 1.00 51.80  ? 95  PHE H O   1 
ATOM   10710 C CB  . PHE H 1 95  ? 96.670  80.514 132.580 1.00 53.15  ? 95  PHE H CB  1 
ATOM   10711 C CG  . PHE H 1 95  ? 97.828  81.302 133.121 1.00 53.15  ? 95  PHE H CG  1 
ATOM   10712 C CD1 . PHE H 1 95  ? 98.198  82.513 132.541 1.00 53.15  ? 95  PHE H CD1 1 
ATOM   10713 C CD2 . PHE H 1 95  ? 98.578  80.811 134.187 1.00 53.15  ? 95  PHE H CD2 1 
ATOM   10714 C CE1 . PHE H 1 95  ? 99.305  83.223 133.013 1.00 53.15  ? 95  PHE H CE1 1 
ATOM   10715 C CE2 . PHE H 1 95  ? 99.690  81.508 134.670 1.00 53.15  ? 95  PHE H CE2 1 
ATOM   10716 C CZ  . PHE H 1 95  ? 100.057 82.714 134.085 1.00 53.15  ? 95  PHE H CZ  1 
ATOM   10717 N N   . VAL H 1 96  ? 96.432  81.405 129.661 1.00 53.81  ? 96  VAL H N   1 
ATOM   10718 C CA  . VAL H 1 96  ? 96.671  82.405 128.635 1.00 53.81  ? 96  VAL H CA  1 
ATOM   10719 C C   . VAL H 1 96  ? 95.641  83.474 128.885 1.00 53.81  ? 96  VAL H C   1 
ATOM   10720 O O   . VAL H 1 96  ? 94.536  83.418 128.359 1.00 53.81  ? 96  VAL H O   1 
ATOM   10721 C CB  . VAL H 1 96  ? 96.493  81.836 127.212 1.00 42.79  ? 96  VAL H CB  1 
ATOM   10722 C CG1 . VAL H 1 96  ? 96.672  82.940 126.173 1.00 42.79  ? 96  VAL H CG1 1 
ATOM   10723 C CG2 . VAL H 1 96  ? 97.512  80.748 126.973 1.00 42.79  ? 96  VAL H CG2 1 
ATOM   10724 N N   . ASP H 1 97  ? 96.007  84.438 129.717 1.00 51.37  ? 97  ASP H N   1 
ATOM   10725 C CA  . ASP H 1 97  ? 95.116  85.534 130.056 1.00 51.37  ? 97  ASP H CA  1 
ATOM   10726 C C   . ASP H 1 97  ? 95.333  86.802 129.217 1.00 51.37  ? 97  ASP H C   1 
ATOM   10727 O O   . ASP H 1 97  ? 96.455  87.114 128.802 1.00 51.37  ? 97  ASP H O   1 
ATOM   10728 C CB  . ASP H 1 97  ? 95.243  85.857 131.540 1.00 53.83  ? 97  ASP H CB  1 
ATOM   10729 C CG  . ASP H 1 97  ? 94.846  84.695 132.415 1.00 53.83  ? 97  ASP H CG  1 
ATOM   10730 O OD1 . ASP H 1 97  ? 93.844  84.012 132.092 1.00 53.83  ? 97  ASP H OD1 1 
ATOM   10731 O OD2 . ASP H 1 97  ? 95.527  84.468 133.437 1.00 53.83  ? 97  ASP H OD2 1 
ATOM   10732 N N   . LEU H 1 98  ? 94.236  87.515 128.961 1.00 67.74  ? 98  LEU H N   1 
ATOM   10733 C CA  . LEU H 1 98  ? 94.286  88.743 128.192 1.00 67.74  ? 98  LEU H CA  1 
ATOM   10734 C C   . LEU H 1 98  ? 93.814  89.937 129.010 1.00 67.74  ? 98  LEU H C   1 
ATOM   10735 O O   . LEU H 1 98  ? 92.621  90.080 129.275 1.00 67.74  ? 98  LEU H O   1 
ATOM   10736 C CB  . LEU H 1 98  ? 93.431  88.609 126.944 1.00 45.12  ? 98  LEU H CB  1 
ATOM   10737 C CG  . LEU H 1 98  ? 93.372  89.878 126.098 1.00 45.12  ? 98  LEU H CG  1 
ATOM   10738 C CD1 . LEU H 1 98  ? 94.777  90.344 125.776 1.00 45.12  ? 98  LEU H CD1 1 
ATOM   10739 C CD2 . LEU H 1 98  ? 92.600  89.607 124.827 1.00 45.12  ? 98  LEU H CD2 1 
ATOM   10740 N N   . ASN H 1 99  ? 94.754  90.783 129.421 1.00 81.90  ? 99  ASN H N   1 
ATOM   10741 C CA  . ASN H 1 99  ? 94.423  91.975 130.192 1.00 81.90  ? 99  ASN H CA  1 
ATOM   10742 C C   . ASN H 1 99  ? 94.692  93.200 129.347 1.00 81.90  ? 99  ASN H C   1 
ATOM   10743 O O   . ASN H 1 99  ? 95.842  93.587 129.155 1.00 81.90  ? 99  ASN H O   1 
ATOM   10744 C CB  . ASN H 1 99  ? 95.238  92.041 131.478 1.00 115.78 ? 99  ASN H CB  1 
ATOM   10745 C CG  . ASN H 1 99  ? 94.794  91.012 132.495 1.00 115.78 ? 99  ASN H CG  1 
ATOM   10746 O OD1 . ASN H 1 99  ? 93.623  90.970 132.882 1.00 115.78 ? 99  ASN H OD1 1 
ATOM   10747 N ND2 . ASN H 1 99  ? 95.725  90.174 132.935 1.00 115.78 ? 99  ASN H ND2 1 
ATOM   10748 N N   . ASN H 1 100 ? 93.612  93.800 128.849 1.00 107.43 ? 100 ASN H N   1 
ATOM   10749 C CA  . ASN H 1 100 ? 93.671  94.979 127.991 1.00 107.43 ? 100 ASN H CA  1 
ATOM   10750 C C   . ASN H 1 100 ? 94.767  94.891 126.931 1.00 107.43 ? 100 ASN H C   1 
ATOM   10751 O O   . ASN H 1 100 ? 95.836  95.488 127.069 1.00 107.43 ? 100 ASN H O   1 
ATOM   10752 C CB  . ASN H 1 100 ? 93.836  96.269 128.821 1.00 155.78 ? 100 ASN H CB  1 
ATOM   10753 C CG  . ASN H 1 100 ? 95.092  96.272 129.676 1.00 155.78 ? 100 ASN H CG  1 
ATOM   10754 O OD1 . ASN H 1 100 ? 95.204  95.515 130.638 1.00 155.78 ? 100 ASN H OD1 1 
ATOM   10755 N ND2 . ASN H 1 100 ? 96.044  97.131 129.327 1.00 155.78 ? 100 ASN H ND2 1 
ATOM   10756 N N   . GLY H 1 101 ? 94.485  94.120 125.881 1.00 72.06  ? 101 GLY H N   1 
ATOM   10757 C CA  . GLY H 1 101 ? 95.408  93.966 124.764 1.00 72.06  ? 101 GLY H CA  1 
ATOM   10758 C C   . GLY H 1 101 ? 96.756  93.323 125.010 1.00 72.06  ? 101 GLY H C   1 
ATOM   10759 O O   . GLY H 1 101 ? 97.512  93.127 124.068 1.00 72.06  ? 101 GLY H O   1 
ATOM   10760 N N   . LYS H 1 102 ? 97.061  93.002 126.263 1.00 71.31  ? 102 LYS H N   1 
ATOM   10761 C CA  . LYS H 1 102 ? 98.335  92.374 126.616 1.00 71.31  ? 102 LYS H CA  1 
ATOM   10762 C C   . LYS H 1 102 ? 98.096  90.939 127.069 1.00 71.31  ? 102 LYS H C   1 
ATOM   10763 O O   . LYS H 1 102 ? 97.112  90.665 127.760 1.00 71.31  ? 102 LYS H O   1 
ATOM   10764 C CB  . LYS H 1 102 ? 99.008  93.151 127.744 1.00 121.18 ? 102 LYS H CB  1 
ATOM   10765 C CG  . LYS H 1 102 ? 99.289  94.598 127.404 1.00 121.18 ? 102 LYS H CG  1 
ATOM   10766 C CD  . LYS H 1 102 ? 99.711  95.375 128.633 1.00 121.18 ? 102 LYS H CD  1 
ATOM   10767 C CE  . LYS H 1 102 ? 99.849  96.850 128.326 1.00 121.18 ? 102 LYS H CE  1 
ATOM   10768 N NZ  . LYS H 1 102 ? 100.098 97.604 129.579 1.00 121.18 ? 102 LYS H NZ  1 
ATOM   10769 N N   . PHE H 1 103 ? 98.998  90.035 126.684 1.00 63.48  ? 103 PHE H N   1 
ATOM   10770 C CA  . PHE H 1 103 ? 98.885  88.617 127.042 1.00 63.48  ? 103 PHE H CA  1 
ATOM   10771 C C   . PHE H 1 103 ? 99.821  88.150 128.139 1.00 63.48  ? 103 PHE H C   1 
ATOM   10772 O O   . PHE H 1 103 ? 101.021 88.417 128.095 1.00 63.48  ? 103 PHE H O   1 
ATOM   10773 C CB  . PHE H 1 103 ? 99.118  87.737 125.831 1.00 44.41  ? 103 PHE H CB  1 
ATOM   10774 C CG  . PHE H 1 103 ? 97.955  87.671 124.907 1.00 44.41  ? 103 PHE H CG  1 
ATOM   10775 C CD1 . PHE H 1 103 ? 98.051  88.180 123.622 1.00 44.41  ? 103 PHE H CD1 1 
ATOM   10776 C CD2 . PHE H 1 103 ? 96.756  87.084 125.308 1.00 44.41  ? 103 PHE H CD2 1 
ATOM   10777 C CE1 . PHE H 1 103 ? 96.967  88.107 122.736 1.00 44.41  ? 103 PHE H CE1 1 
ATOM   10778 C CE2 . PHE H 1 103 ? 95.667  87.006 124.424 1.00 44.41  ? 103 PHE H CE2 1 
ATOM   10779 C CZ  . PHE H 1 103 ? 95.782  87.520 123.138 1.00 44.41  ? 103 PHE H CZ  1 
ATOM   10780 N N   . TYR H 1 104 ? 99.243  87.438 129.105 1.00 71.27  ? 104 TYR H N   1 
ATOM   10781 C CA  . TYR H 1 104 ? 99.952  86.884 130.252 1.00 71.27  ? 104 TYR H CA  1 
ATOM   10782 C C   . TYR H 1 104 ? 99.859  85.360 130.141 1.00 71.27  ? 104 TYR H C   1 
ATOM   10783 O O   . TYR H 1 104 ? 98.820  84.759 130.441 1.00 71.27  ? 104 TYR H O   1 
ATOM   10784 C CB  . TYR H 1 104 ? 99.303  87.361 131.556 1.00 122.87 ? 104 TYR H CB  1 
ATOM   10785 C CG  . TYR H 1 104 ? 99.295  88.862 131.695 1.00 122.87 ? 104 TYR H CG  1 
ATOM   10786 C CD1 . TYR H 1 104 ? 98.702  89.666 130.720 1.00 122.87 ? 104 TYR H CD1 1 
ATOM   10787 C CD2 . TYR H 1 104 ? 99.922  89.484 132.769 1.00 122.87 ? 104 TYR H CD2 1 
ATOM   10788 C CE1 . TYR H 1 104 ? 98.742  91.047 130.805 1.00 122.87 ? 104 TYR H CE1 1 
ATOM   10789 C CE2 . TYR H 1 104 ? 99.965  90.872 132.864 1.00 122.87 ? 104 TYR H CE2 1 
ATOM   10790 C CZ  . TYR H 1 104 ? 99.376  91.643 131.876 1.00 122.87 ? 104 TYR H CZ  1 
ATOM   10791 O OH  . TYR H 1 104 ? 99.434  93.011 131.940 1.00 122.87 ? 104 TYR H OH  1 
ATOM   10792 N N   . VAL H 1 105 ? 100.958 84.744 129.708 1.00 47.15  ? 105 VAL H N   1 
ATOM   10793 C CA  . VAL H 1 105 ? 101.037 83.302 129.518 1.00 47.15  ? 105 VAL H CA  1 
ATOM   10794 C C   . VAL H 1 105 ? 102.020 82.597 130.454 1.00 47.15  ? 105 VAL H C   1 
ATOM   10795 O O   . VAL H 1 105 ? 103.161 83.030 130.593 1.00 47.15  ? 105 VAL H O   1 
ATOM   10796 C CB  . VAL H 1 105 ? 101.443 82.999 128.077 1.00 53.79  ? 105 VAL H CB  1 
ATOM   10797 C CG1 . VAL H 1 105 ? 101.603 81.510 127.867 1.00 53.79  ? 105 VAL H CG1 1 
ATOM   10798 C CG2 . VAL H 1 105 ? 100.411 83.560 127.152 1.00 53.79  ? 105 VAL H CG2 1 
ATOM   10799 N N   . GLY H 1 106 ? 101.558 81.515 131.080 1.00 51.19  ? 106 GLY H N   1 
ATOM   10800 C CA  . GLY H 1 106 ? 102.383 80.729 131.982 1.00 51.19  ? 106 GLY H CA  1 
ATOM   10801 C C   . GLY H 1 106 ? 102.379 79.269 131.541 1.00 51.19  ? 106 GLY H C   1 
ATOM   10802 O O   . GLY H 1 106 ? 101.326 78.624 131.507 1.00 51.19  ? 106 GLY H O   1 
ATOM   10803 N N   . VAL H 1 107 ? 103.555 78.741 131.209 1.00 54.54  ? 107 VAL H N   1 
ATOM   10804 C CA  . VAL H 1 107 ? 103.681 77.363 130.736 1.00 54.54  ? 107 VAL H CA  1 
ATOM   10805 C C   . VAL H 1 107 ? 104.708 76.551 131.506 1.00 54.54  ? 107 VAL H C   1 
ATOM   10806 O O   . VAL H 1 107 ? 105.743 77.070 131.894 1.00 54.54  ? 107 VAL H O   1 
ATOM   10807 C CB  . VAL H 1 107 ? 104.080 77.340 129.248 1.00 44.63  ? 107 VAL H CB  1 
ATOM   10808 C CG1 . VAL H 1 107 ? 104.310 75.926 128.785 1.00 44.63  ? 107 VAL H CG1 1 
ATOM   10809 C CG2 . VAL H 1 107 ? 103.004 77.983 128.423 1.00 44.63  ? 107 VAL H CG2 1 
ATOM   10810 N N   . CYS H 1 108 ? 104.428 75.272 131.729 1.00 48.41  ? 108 CYS H N   1 
ATOM   10811 C CA  . CYS H 1 108 ? 105.378 74.413 132.436 1.00 48.41  ? 108 CYS H CA  1 
ATOM   10812 C C   . CYS H 1 108 ? 105.776 73.232 131.564 1.00 48.41  ? 108 CYS H C   1 
ATOM   10813 O O   . CYS H 1 108 ? 105.041 72.825 130.677 1.00 48.41  ? 108 CYS H O   1 
ATOM   10814 C CB  . CYS H 1 108 ? 104.789 73.909 133.759 1.00 55.70  ? 108 CYS H CB  1 
ATOM   10815 S SG  . CYS H 1 108 ? 103.511 72.639 133.635 1.00 55.70  ? 108 CYS H SG  1 
ATOM   10816 N N   . ALA H 1 109 ? 106.966 72.706 131.790 1.00 50.97  ? 109 ALA H N   1 
ATOM   10817 C CA  . ALA H 1 109 ? 107.427 71.559 131.023 1.00 50.97  ? 109 ALA H CA  1 
ATOM   10818 C C   . ALA H 1 109 ? 108.221 70.597 131.901 1.00 50.97  ? 109 ALA H C   1 
ATOM   10819 O O   . ALA H 1 109 ? 108.947 71.004 132.806 1.00 50.97  ? 109 ALA H O   1 
ATOM   10820 C CB  . ALA H 1 109 ? 108.275 72.014 129.836 1.00 28.07  ? 109 ALA H CB  1 
ATOM   10821 N N   . PHE H 1 110 ? 108.042 69.309 131.657 1.00 41.42  ? 110 PHE H N   1 
ATOM   10822 C CA  . PHE H 1 110 ? 108.782 68.313 132.400 1.00 41.42  ? 110 PHE H CA  1 
ATOM   10823 C C   . PHE H 1 110 ? 109.793 67.716 131.447 1.00 41.42  ? 110 PHE H C   1 
ATOM   10824 O O   . PHE H 1 110 ? 109.442 67.198 130.375 1.00 41.42  ? 110 PHE H O   1 
ATOM   10825 C CB  . PHE H 1 110 ? 107.853 67.256 132.953 1.00 35.72  ? 110 PHE H CB  1 
ATOM   10826 C CG  . PHE H 1 110 ? 106.827 67.813 133.890 1.00 35.72  ? 110 PHE H CG  1 
ATOM   10827 C CD1 . PHE H 1 110 ? 105.695 68.469 133.406 1.00 35.72  ? 110 PHE H CD1 1 
ATOM   10828 C CD2 . PHE H 1 110 ? 107.004 67.730 135.257 1.00 35.72  ? 110 PHE H CD2 1 
ATOM   10829 C CE1 . PHE H 1 110 ? 104.758 69.034 134.287 1.00 35.72  ? 110 PHE H CE1 1 
ATOM   10830 C CE2 . PHE H 1 110 ? 106.069 68.297 136.147 1.00 35.72  ? 110 PHE H CE2 1 
ATOM   10831 C CZ  . PHE H 1 110 ? 104.952 68.944 135.662 1.00 35.72  ? 110 PHE H CZ  1 
ATOM   10832 N N   . VAL H 1 111 ? 111.060 67.851 131.819 1.00 44.31  ? 111 VAL H N   1 
ATOM   10833 C CA  . VAL H 1 111 ? 112.129 67.333 130.999 1.00 44.31  ? 111 VAL H CA  1 
ATOM   10834 C C   . VAL H 1 111 ? 112.904 66.272 131.742 1.00 44.31  ? 111 VAL H C   1 
ATOM   10835 O O   . VAL H 1 111 ? 113.166 66.389 132.952 1.00 44.31  ? 111 VAL H O   1 
ATOM   10836 C CB  . VAL H 1 111 ? 113.106 68.419 130.572 1.00 33.45  ? 111 VAL H CB  1 
ATOM   10837 C CG1 . VAL H 1 111 ? 114.170 67.812 129.669 1.00 33.45  ? 111 VAL H CG1 1 
ATOM   10838 C CG2 . VAL H 1 111 ? 112.360 69.552 129.875 1.00 33.45  ? 111 VAL H CG2 1 
ATOM   10839 N N   . ARG H 1 112 ? 113.270 65.231 131.003 1.00 48.10  ? 112 ARG H N   1 
ATOM   10840 C CA  . ARG H 1 112 ? 114.013 64.136 131.584 1.00 48.10  ? 112 ARG H CA  1 
ATOM   10841 C C   . ARG H 1 112 ? 115.340 64.019 130.873 1.00 48.10  ? 112 ARG H C   1 
ATOM   10842 O O   . ARG H 1 112 ? 115.389 63.921 129.636 1.00 48.10  ? 112 ARG H O   1 
ATOM   10843 C CB  . ARG H 1 112 ? 113.240 62.840 131.429 1.00 70.67  ? 112 ARG H CB  1 
ATOM   10844 C CG  . ARG H 1 112 ? 113.659 61.771 132.406 1.00 70.67  ? 112 ARG H CG  1 
ATOM   10845 C CD  . ARG H 1 112 ? 112.892 60.468 132.177 1.00 70.67  ? 112 ARG H CD  1 
ATOM   10846 N NE  . ARG H 1 112 ? 113.728 59.445 131.548 1.00 70.67  ? 112 ARG H NE  1 
ATOM   10847 C CZ  . ARG H 1 112 ? 113.882 58.213 132.029 1.00 70.67  ? 112 ARG H CZ  1 
ATOM   10848 N NH1 . ARG H 1 112 ? 113.250 57.851 133.143 1.00 70.67  ? 112 ARG H NH1 1 
ATOM   10849 N NH2 . ARG H 1 112 ? 114.689 57.353 131.414 1.00 70.67  ? 112 ARG H NH2 1 
ATOM   10850 N N   . VAL H 1 113 ? 116.422 64.062 131.646 1.00 49.59  ? 113 VAL H N   1 
ATOM   10851 C CA  . VAL H 1 113 ? 117.740 63.927 131.057 1.00 49.59  ? 113 VAL H CA  1 
ATOM   10852 C C   . VAL H 1 113 ? 118.255 62.549 131.422 1.00 49.59  ? 113 VAL H C   1 
ATOM   10853 O O   . VAL H 1 113 ? 118.068 62.082 132.560 1.00 49.59  ? 113 VAL H O   1 
ATOM   10854 C CB  . VAL H 1 113 ? 118.710 64.976 131.580 1.00 71.57  ? 113 VAL H CB  1 
ATOM   10855 C CG1 . VAL H 1 113 ? 120.023 64.870 130.825 1.00 71.57  ? 113 VAL H CG1 1 
ATOM   10856 C CG2 . VAL H 1 113 ? 118.123 66.358 131.403 1.00 71.57  ? 113 VAL H CG2 1 
ATOM   10857 N N   . GLN H 1 114 ? 118.888 61.896 130.453 1.00 48.93  ? 114 GLN H N   1 
ATOM   10858 C CA  . GLN H 1 114 ? 119.399 60.556 130.656 1.00 48.93  ? 114 GLN H CA  1 
ATOM   10859 C C   . GLN H 1 114 ? 120.801 60.401 130.103 1.00 48.93  ? 114 GLN H C   1 
ATOM   10860 O O   . GLN H 1 114 ? 121.086 60.843 128.976 1.00 48.93  ? 114 GLN H O   1 
ATOM   10861 C CB  . GLN H 1 114 ? 118.494 59.558 129.960 1.00 62.34  ? 114 GLN H CB  1 
ATOM   10862 C CG  . GLN H 1 114 ? 118.783 58.130 130.319 1.00 62.34  ? 114 GLN H CG  1 
ATOM   10863 C CD  . GLN H 1 114 ? 118.089 57.148 129.392 1.00 62.34  ? 114 GLN H CD  1 
ATOM   10864 O OE1 . GLN H 1 114 ? 118.445 57.028 128.221 1.00 62.34  ? 114 GLN H OE1 1 
ATOM   10865 N NE2 . GLN H 1 114 ? 117.090 56.443 129.912 1.00 62.34  ? 114 GLN H NE2 1 
ATOM   10866 N N   . LEU H 1 115 ? 121.670 59.758 130.883 1.00 68.65  ? 115 LEU H N   1 
ATOM   10867 C CA  . LEU H 1 115 ? 123.044 59.516 130.450 1.00 68.65  ? 115 LEU H CA  1 
ATOM   10868 C C   . LEU H 1 115 ? 123.096 58.201 129.650 1.00 68.65  ? 115 LEU H C   1 
ATOM   10869 O O   . LEU H 1 115 ? 122.163 57.400 129.706 1.00 68.65  ? 115 LEU H O   1 
ATOM   10870 C CB  . LEU H 1 115 ? 123.973 59.459 131.672 1.00 65.15  ? 115 LEU H CB  1 
ATOM   10871 C CG  . LEU H 1 115 ? 124.000 60.730 132.538 1.00 65.15  ? 115 LEU H CG  1 
ATOM   10872 C CD1 . LEU H 1 115 ? 124.932 60.554 133.700 1.00 65.15  ? 115 LEU H CD1 1 
ATOM   10873 C CD2 . LEU H 1 115 ? 124.442 61.913 131.706 1.00 65.15  ? 115 LEU H CD2 1 
ATOM   10874 N N   . LYS H 1 116 ? 124.170 57.982 128.896 1.00 54.46  ? 116 LYS H N   1 
ATOM   10875 C CA  . LYS H 1 116 ? 124.297 56.762 128.106 1.00 54.46  ? 116 LYS H CA  1 
ATOM   10876 C C   . LYS H 1 116 ? 124.262 55.467 128.940 1.00 54.46  ? 116 LYS H C   1 
ATOM   10877 O O   . LYS H 1 116 ? 124.070 54.387 128.389 1.00 54.46  ? 116 LYS H O   1 
ATOM   10878 C CB  . LYS H 1 116 ? 125.584 56.797 127.289 1.00 63.30  ? 116 LYS H CB  1 
ATOM   10879 C CG  . LYS H 1 116 ? 126.833 56.867 128.137 1.00 63.30  ? 116 LYS H CG  1 
ATOM   10880 C CD  . LYS H 1 116 ? 128.105 56.762 127.293 1.00 63.30  ? 116 LYS H CD  1 
ATOM   10881 C CE  . LYS H 1 116 ? 129.367 56.838 128.170 1.00 63.30  ? 116 LYS H CE  1 
ATOM   10882 N NZ  . LYS H 1 116 ? 130.583 56.707 127.322 1.00 63.30  ? 116 LYS H NZ  1 
ATOM   10883 N N   . ASP H 1 117 ? 124.435 55.562 130.254 1.00 53.96  ? 117 ASP H N   1 
ATOM   10884 C CA  . ASP H 1 117 ? 124.409 54.368 131.074 1.00 53.96  ? 117 ASP H CA  1 
ATOM   10885 C C   . ASP H 1 117 ? 123.020 54.066 131.656 1.00 53.96  ? 117 ASP H C   1 
ATOM   10886 O O   . ASP H 1 117 ? 122.839 53.073 132.385 1.00 53.96  ? 117 ASP H O   1 
ATOM   10887 C CB  . ASP H 1 117 ? 125.439 54.486 132.198 1.00 65.25  ? 117 ASP H CB  1 
ATOM   10888 C CG  . ASP H 1 117 ? 124.902 55.219 133.392 1.00 65.25  ? 117 ASP H CG  1 
ATOM   10889 O OD1 . ASP H 1 117 ? 124.219 56.248 133.182 1.00 65.25  ? 117 ASP H OD1 1 
ATOM   10890 O OD2 . ASP H 1 117 ? 125.159 54.771 134.535 1.00 65.25  ? 117 ASP H OD2 1 
ATOM   10891 N N   . GLY H 1 118 ? 122.044 54.916 131.339 1.00 63.83  ? 118 GLY H N   1 
ATOM   10892 C CA  . GLY H 1 118 ? 120.690 54.713 131.840 1.00 63.83  ? 118 GLY H CA  1 
ATOM   10893 C C   . GLY H 1 118 ? 120.335 55.632 132.992 1.00 63.83  ? 118 GLY H C   1 
ATOM   10894 O O   . GLY H 1 118 ? 119.164 55.772 133.364 1.00 63.83  ? 118 GLY H O   1 
ATOM   10895 N N   . SER H 1 119 ? 121.362 56.251 133.564 1.00 52.67  ? 119 SER H N   1 
ATOM   10896 C CA  . SER H 1 119 ? 121.199 57.180 134.672 1.00 52.67  ? 119 SER H CA  1 
ATOM   10897 C C   . SER H 1 119 ? 120.258 58.301 134.214 1.00 52.67  ? 119 SER H C   1 
ATOM   10898 O O   . SER H 1 119 ? 120.279 58.704 133.037 1.00 52.67  ? 119 SER H O   1 
ATOM   10899 C CB  . SER H 1 119 ? 122.570 57.748 135.050 1.00 83.32  ? 119 SER H CB  1 
ATOM   10900 O OG  . SER H 1 119 ? 122.491 58.572 136.196 1.00 83.32  ? 119 SER H OG  1 
ATOM   10901 N N   . TYR H 1 120 ? 119.441 58.817 135.131 1.00 41.60  ? 120 TYR H N   1 
ATOM   10902 C CA  . TYR H 1 120 ? 118.513 59.878 134.739 1.00 41.60  ? 120 TYR H CA  1 
ATOM   10903 C C   . TYR H 1 120 ? 117.972 60.786 135.852 1.00 41.60  ? 120 TYR H C   1 
ATOM   10904 O O   . TYR H 1 120 ? 117.820 60.385 137.010 1.00 41.60  ? 120 TYR H O   1 
ATOM   10905 C CB  . TYR H 1 120 ? 117.314 59.248 134.009 1.00 35.81  ? 120 TYR H CB  1 
ATOM   10906 C CG  . TYR H 1 120 ? 116.459 58.398 134.936 1.00 35.81  ? 120 TYR H CG  1 
ATOM   10907 C CD1 . TYR H 1 120 ? 115.550 58.979 135.821 1.00 35.81  ? 120 TYR H CD1 1 
ATOM   10908 C CD2 . TYR H 1 120 ? 116.631 57.018 134.983 1.00 35.81  ? 120 TYR H CD2 1 
ATOM   10909 C CE1 . TYR H 1 120 ? 114.847 58.211 136.723 1.00 35.81  ? 120 TYR H CE1 1 
ATOM   10910 C CE2 . TYR H 1 120 ? 115.938 56.233 135.890 1.00 35.81  ? 120 TYR H CE2 1 
ATOM   10911 C CZ  . TYR H 1 120 ? 115.055 56.833 136.756 1.00 35.81  ? 120 TYR H CZ  1 
ATOM   10912 O OH  . TYR H 1 120 ? 114.430 56.038 137.686 1.00 35.81  ? 120 TYR H OH  1 
ATOM   10913 N N   . HIS H 1 121 ? 117.656 62.016 135.457 1.00 53.21  ? 121 HIS H N   1 
ATOM   10914 C CA  . HIS H 1 121 ? 117.055 63.005 136.348 1.00 53.21  ? 121 HIS H CA  1 
ATOM   10915 C C   . HIS H 1 121 ? 116.027 63.762 135.506 1.00 53.21  ? 121 HIS H C   1 
ATOM   10916 O O   . HIS H 1 121 ? 116.248 64.036 134.320 1.00 53.21  ? 121 HIS H O   1 
ATOM   10917 C CB  . HIS H 1 121 ? 118.097 63.986 136.898 1.00 42.59  ? 121 HIS H CB  1 
ATOM   10918 C CG  . HIS H 1 121 ? 119.093 63.367 137.825 1.00 42.59  ? 121 HIS H CG  1 
ATOM   10919 N ND1 . HIS H 1 121 ? 120.412 63.165 137.472 1.00 42.59  ? 121 HIS H ND1 1 
ATOM   10920 C CD2 . HIS H 1 121 ? 118.971 62.932 139.101 1.00 42.59  ? 121 HIS H CD2 1 
ATOM   10921 C CE1 . HIS H 1 121 ? 121.058 62.636 138.496 1.00 42.59  ? 121 HIS H CE1 1 
ATOM   10922 N NE2 . HIS H 1 121 ? 120.205 62.485 139.497 1.00 42.59  ? 121 HIS H NE2 1 
ATOM   10923 N N   . GLU H 1 122 ? 114.904 64.083 136.127 1.00 46.20  ? 122 GLU H N   1 
ATOM   10924 C CA  . GLU H 1 122 ? 113.808 64.788 135.472 1.00 46.20  ? 122 GLU H CA  1 
ATOM   10925 C C   . GLU H 1 122 ? 113.357 65.947 136.381 1.00 46.20  ? 122 GLU H C   1 
ATOM   10926 O O   . GLU H 1 122 ? 113.298 65.794 137.603 1.00 46.20  ? 122 GLU H O   1 
ATOM   10927 C CB  . GLU H 1 122 ? 112.664 63.793 135.237 1.00 75.62  ? 122 GLU H CB  1 
ATOM   10928 C CG  . GLU H 1 122 ? 111.307 64.398 134.918 1.00 75.62  ? 122 GLU H CG  1 
ATOM   10929 C CD  . GLU H 1 122 ? 110.230 63.345 134.617 1.00 75.62  ? 122 GLU H CD  1 
ATOM   10930 O OE1 . GLU H 1 122 ? 110.097 62.370 135.393 1.00 75.62  ? 122 GLU H OE1 1 
ATOM   10931 O OE2 . GLU H 1 122 ? 109.506 63.502 133.608 1.00 75.62  ? 122 GLU H OE2 1 
ATOM   10932 N N   . ASP H 1 123 ? 113.055 67.103 135.787 1.00 68.34  ? 123 ASP H N   1 
ATOM   10933 C CA  . ASP H 1 123 ? 112.618 68.267 136.560 1.00 68.34  ? 123 ASP H CA  1 
ATOM   10934 C C   . ASP H 1 123 ? 111.598 69.130 135.801 1.00 68.34  ? 123 ASP H C   1 
ATOM   10935 O O   . ASP H 1 123 ? 111.380 68.929 134.610 1.00 68.34  ? 123 ASP H O   1 
ATOM   10936 C CB  . ASP H 1 123 ? 113.833 69.122 136.931 1.00 72.34  ? 123 ASP H CB  1 
ATOM   10937 C CG  . ASP H 1 123 ? 113.721 69.699 138.317 1.00 72.34  ? 123 ASP H CG  1 
ATOM   10938 O OD1 . ASP H 1 123 ? 112.657 70.270 138.625 1.00 72.34  ? 123 ASP H OD1 1 
ATOM   10939 O OD2 . ASP H 1 123 ? 114.685 69.576 139.103 1.00 72.34  ? 123 ASP H OD2 1 
ATOM   10940 N N   . VAL H 1 124 ? 110.976 70.086 136.493 1.00 45.05  ? 124 VAL H N   1 
ATOM   10941 C CA  . VAL H 1 124 ? 110.006 70.987 135.869 1.00 45.05  ? 124 VAL H CA  1 
ATOM   10942 C C   . VAL H 1 124 ? 110.677 72.264 135.410 1.00 45.05  ? 124 VAL H C   1 
ATOM   10943 O O   . VAL H 1 124 ? 111.578 72.783 136.075 1.00 45.05  ? 124 VAL H O   1 
ATOM   10944 C CB  . VAL H 1 124 ? 108.928 71.463 136.824 1.00 70.03  ? 124 VAL H CB  1 
ATOM   10945 C CG1 . VAL H 1 124 ? 107.601 71.513 136.104 1.00 70.03  ? 124 VAL H CG1 1 
ATOM   10946 C CG2 . VAL H 1 124 ? 108.883 70.596 138.029 1.00 70.03  ? 124 VAL H CG2 1 
ATOM   10947 N N   . GLY H 1 125 ? 110.216 72.776 134.278 1.00 53.98  ? 125 GLY H N   1 
ATOM   10948 C CA  . GLY H 1 125 ? 110.745 74.016 133.756 1.00 53.98  ? 125 GLY H CA  1 
ATOM   10949 C C   . GLY H 1 125 ? 109.526 74.906 133.682 1.00 53.98  ? 125 GLY H C   1 
ATOM   10950 O O   . GLY H 1 125 ? 108.409 74.388 133.709 1.00 53.98  ? 125 GLY H O   1 
ATOM   10951 N N   . TYR H 1 126 ? 109.711 76.224 133.624 1.00 76.68  ? 126 TYR H N   1 
ATOM   10952 C CA  . TYR H 1 126 ? 108.570 77.131 133.527 1.00 76.68  ? 126 TYR H CA  1 
ATOM   10953 C C   . TYR H 1 126 ? 108.864 78.281 132.586 1.00 76.68  ? 126 TYR H C   1 
ATOM   10954 O O   . TYR H 1 126 ? 109.922 78.905 132.661 1.00 76.68  ? 126 TYR H O   1 
ATOM   10955 C CB  . TYR H 1 126 ? 108.175 77.693 134.896 1.00 53.67  ? 126 TYR H CB  1 
ATOM   10956 C CG  . TYR H 1 126 ? 106.690 77.971 134.998 1.00 53.67  ? 126 TYR H CG  1 
ATOM   10957 C CD1 . TYR H 1 126 ? 105.793 76.956 135.293 1.00 53.67  ? 126 TYR H CD1 1 
ATOM   10958 C CD2 . TYR H 1 126 ? 106.175 79.235 134.721 1.00 53.67  ? 126 TYR H CD2 1 
ATOM   10959 C CE1 . TYR H 1 126 ? 104.421 77.194 135.308 1.00 53.67  ? 126 TYR H CE1 1 
ATOM   10960 C CE2 . TYR H 1 126 ? 104.797 79.482 134.733 1.00 53.67  ? 126 TYR H CE2 1 
ATOM   10961 C CZ  . TYR H 1 126 ? 103.932 78.462 135.031 1.00 53.67  ? 126 TYR H CZ  1 
ATOM   10962 O OH  . TYR H 1 126 ? 102.586 78.715 135.098 1.00 53.67  ? 126 TYR H OH  1 
ATOM   10963 N N   . GLY H 1 127 ? 107.914 78.544 131.695 1.00 75.39  ? 127 GLY H N   1 
ATOM   10964 C CA  . GLY H 1 127 ? 108.047 79.622 130.728 1.00 75.39  ? 127 GLY H CA  1 
ATOM   10965 C C   . GLY H 1 127 ? 107.006 80.689 131.001 1.00 75.39  ? 127 GLY H C   1 
ATOM   10966 O O   . GLY H 1 127 ? 105.873 80.390 131.377 1.00 75.39  ? 127 GLY H O   1 
ATOM   10967 N N   . VAL H 1 128 ? 107.389 81.943 130.812 1.00 48.28  ? 128 VAL H N   1 
ATOM   10968 C CA  . VAL H 1 128 ? 106.484 83.049 131.072 1.00 48.28  ? 128 VAL H CA  1 
ATOM   10969 C C   . VAL H 1 128 ? 106.590 84.153 130.038 1.00 48.28  ? 128 VAL H C   1 
ATOM   10970 O O   . VAL H 1 128 ? 107.652 84.383 129.480 1.00 48.28  ? 128 VAL H O   1 
ATOM   10971 C CB  . VAL H 1 128 ? 106.773 83.671 132.452 1.00 66.52  ? 128 VAL H CB  1 
ATOM   10972 C CG1 . VAL H 1 128 ? 105.711 84.678 132.796 1.00 66.52  ? 128 VAL H CG1 1 
ATOM   10973 C CG2 . VAL H 1 128 ? 106.838 82.591 133.513 1.00 66.52  ? 128 VAL H CG2 1 
ATOM   10974 N N   . SER H 1 129 ? 105.465 84.803 129.772 1.00 61.87  ? 129 SER H N   1 
ATOM   10975 C CA  . SER H 1 129 ? 105.401 85.943 128.861 1.00 61.87  ? 129 SER H CA  1 
ATOM   10976 C C   . SER H 1 129 ? 104.294 86.821 129.422 1.00 61.87  ? 129 SER H C   1 
ATOM   10977 O O   . SER H 1 129 ? 103.151 86.395 129.472 1.00 61.87  ? 129 SER H O   1 
ATOM   10978 C CB  . SER H 1 129 ? 105.049 85.521 127.451 1.00 63.44  ? 129 SER H CB  1 
ATOM   10979 O OG  . SER H 1 129 ? 104.775 86.686 126.698 1.00 63.44  ? 129 SER H OG  1 
ATOM   10980 N N   . GLU H 1 130 ? 104.623 88.034 129.854 1.00 101.28 ? 130 GLU H N   1 
ATOM   10981 C CA  . GLU H 1 130 ? 103.606 88.878 130.456 1.00 101.28 ? 130 GLU H CA  1 
ATOM   10982 C C   . GLU H 1 130 ? 103.337 90.209 129.785 1.00 101.28 ? 130 GLU H C   1 
ATOM   10983 O O   . GLU H 1 130 ? 102.442 90.942 130.210 1.00 101.28 ? 130 GLU H O   1 
ATOM   10984 C CB  . GLU H 1 130 ? 103.942 89.109 131.935 1.00 92.17  ? 130 GLU H CB  1 
ATOM   10985 C CG  . GLU H 1 130 ? 104.273 87.817 132.691 1.00 92.17  ? 130 GLU H CG  1 
ATOM   10986 C CD  . GLU H 1 130 ? 103.910 87.845 134.185 1.00 92.17  ? 130 GLU H CD  1 
ATOM   10987 O OE1 . GLU H 1 130 ? 102.702 87.784 134.520 1.00 92.17  ? 130 GLU H OE1 1 
ATOM   10988 O OE2 . GLU H 1 130 ? 104.836 87.915 135.027 1.00 92.17  ? 130 GLU H OE2 1 
ATOM   10989 N N   . GLY H 1 131 ? 104.079 90.522 128.732 1.00 63.38  ? 131 GLY H N   1 
ATOM   10990 C CA  . GLY H 1 131 ? 103.866 91.800 128.072 1.00 63.38  ? 131 GLY H CA  1 
ATOM   10991 C C   . GLY H 1 131 ? 103.148 91.774 126.738 1.00 63.38  ? 131 GLY H C   1 
ATOM   10992 O O   . GLY H 1 131 ? 102.000 92.177 126.621 1.00 63.38  ? 131 GLY H O   1 
ATOM   10993 N N   . LEU H 1 132 ? 103.854 91.301 125.727 1.00 59.13  ? 132 LEU H N   1 
ATOM   10994 C CA  . LEU H 1 132 ? 103.373 91.184 124.354 1.00 59.13  ? 132 LEU H CA  1 
ATOM   10995 C C   . LEU H 1 132 ? 101.893 91.329 124.034 1.00 59.13  ? 132 LEU H C   1 
ATOM   10996 O O   . LEU H 1 132 ? 101.013 90.935 124.808 1.00 59.13  ? 132 LEU H O   1 
ATOM   10997 C CB  . LEU H 1 132 ? 103.863 89.863 123.781 1.00 70.91  ? 132 LEU H CB  1 
ATOM   10998 C CG  . LEU H 1 132 ? 105.382 89.763 123.861 1.00 70.91  ? 132 LEU H CG  1 
ATOM   10999 C CD1 . LEU H 1 132 ? 105.803 88.368 123.503 1.00 70.91  ? 132 LEU H CD1 1 
ATOM   11000 C CD2 . LEU H 1 132 ? 106.011 90.776 122.930 1.00 70.91  ? 132 LEU H CD2 1 
ATOM   11001 N N   . LYS H 1 133 ? 101.644 91.893 122.852 1.00 80.97  ? 133 LYS H N   1 
ATOM   11002 C CA  . LYS H 1 133 ? 100.297 92.109 122.344 1.00 80.97  ? 133 LYS H CA  1 
ATOM   11003 C C   . LYS H 1 133 ? 99.942  90.938 121.447 1.00 80.97  ? 133 LYS H C   1 
ATOM   11004 O O   . LYS H 1 133 ? 98.771  90.677 121.184 1.00 80.97  ? 133 LYS H O   1 
ATOM   11005 C CB  . LYS H 1 133 ? 100.213 93.431 121.565 1.00 119.44 ? 133 LYS H CB  1 
ATOM   11006 C CG  . LYS H 1 133 ? 100.355 94.683 122.439 1.00 119.44 ? 133 LYS H CG  1 
ATOM   11007 C CD  . LYS H 1 133 ? 100.360 95.968 121.614 1.00 119.44 ? 133 LYS H CD  1 
ATOM   11008 C CE  . LYS H 1 133 ? 99.041  96.199 120.887 1.00 119.44 ? 133 LYS H CE  1 
ATOM   11009 N NZ  . LYS H 1 133 ? 97.900  96.410 121.825 1.00 119.44 ? 133 LYS H NZ  1 
ATOM   11010 N N   . SER H 1 134 ? 100.961 90.225 120.984 1.00 69.60  ? 134 SER H N   1 
ATOM   11011 C CA  . SER H 1 134 ? 100.731 89.058 120.142 1.00 69.60  ? 134 SER H CA  1 
ATOM   11012 C C   . SER H 1 134 ? 100.580 87.806 120.986 1.00 69.60  ? 134 SER H C   1 
ATOM   11013 O O   . SER H 1 134 ? 101.422 87.510 121.834 1.00 69.60  ? 134 SER H O   1 
ATOM   11014 C CB  . SER H 1 134 ? 101.886 88.832 119.172 1.00 44.26  ? 134 SER H CB  1 
ATOM   11015 O OG  . SER H 1 134 ? 101.701 87.602 118.467 1.00 44.26  ? 134 SER H OG  1 
ATOM   11016 N N   . LYS H 1 135 ? 99.506  87.068 120.744 1.00 65.24  ? 135 LYS H N   1 
ATOM   11017 C CA  . LYS H 1 135 ? 99.266  85.834 121.470 1.00 65.24  ? 135 LYS H CA  1 
ATOM   11018 C C   . LYS H 1 135 ? 100.279 84.776 120.991 1.00 65.24  ? 135 LYS H C   1 
ATOM   11019 O O   . LYS H 1 135 ? 100.922 84.108 121.807 1.00 65.24  ? 135 LYS H O   1 
ATOM   11020 C CB  . LYS H 1 135 ? 97.825  85.356 121.237 1.00 42.34  ? 135 LYS H CB  1 
ATOM   11021 C CG  . LYS H 1 135 ? 97.506  84.063 121.944 1.00 42.34  ? 135 LYS H CG  1 
ATOM   11022 C CD  . LYS H 1 135 ? 96.044  83.903 122.234 1.00 42.34  ? 135 LYS H CD  1 
ATOM   11023 C CE  . LYS H 1 135 ? 95.215  83.596 121.013 1.00 42.34  ? 135 LYS H CE  1 
ATOM   11024 N NZ  . LYS H 1 135 ? 93.803  83.350 121.482 1.00 42.34  ? 135 LYS H NZ  1 
ATOM   11025 N N   . ALA H 1 136 ? 100.426 84.638 119.674 1.00 50.51  ? 136 ALA H N   1 
ATOM   11026 C CA  . ALA H 1 136 ? 101.373 83.692 119.118 1.00 50.51  ? 136 ALA H CA  1 
ATOM   11027 C C   . ALA H 1 136 ? 102.757 83.874 119.744 1.00 50.51  ? 136 ALA H C   1 
ATOM   11028 O O   . ALA H 1 136 ? 103.328 82.928 120.279 1.00 50.51  ? 136 ALA H O   1 
ATOM   11029 C CB  . ALA H 1 136 ? 101.466 83.873 117.633 1.00 50.86  ? 136 ALA H CB  1 
ATOM   11030 N N   . LEU H 1 137 ? 103.303 85.082 119.680 1.00 51.56  ? 137 LEU H N   1 
ATOM   11031 C CA  . LEU H 1 137 ? 104.611 85.313 120.257 1.00 51.56  ? 137 LEU H CA  1 
ATOM   11032 C C   . LEU H 1 137 ? 104.628 85.034 121.744 1.00 51.56  ? 137 LEU H C   1 
ATOM   11033 O O   . LEU H 1 137 ? 105.630 84.544 122.265 1.00 51.56  ? 137 LEU H O   1 
ATOM   11034 C CB  . LEU H 1 137 ? 105.072 86.742 120.001 1.00 52.74  ? 137 LEU H CB  1 
ATOM   11035 C CG  . LEU H 1 137 ? 105.812 86.937 118.681 1.00 52.74  ? 137 LEU H CG  1 
ATOM   11036 C CD1 . LEU H 1 137 ? 104.995 86.454 117.506 1.00 52.74  ? 137 LEU H CD1 1 
ATOM   11037 C CD2 . LEU H 1 137 ? 106.126 88.395 118.533 1.00 52.74  ? 137 LEU H CD2 1 
ATOM   11038 N N   . SER H 1 138 ? 103.535 85.340 122.439 1.00 43.99  ? 138 SER H N   1 
ATOM   11039 C CA  . SER H 1 138 ? 103.511 85.096 123.877 1.00 43.99  ? 138 SER H CA  1 
ATOM   11040 C C   . SER H 1 138 ? 103.653 83.605 124.204 1.00 43.99  ? 138 SER H C   1 
ATOM   11041 O O   . SER H 1 138 ? 104.327 83.249 125.169 1.00 43.99  ? 138 SER H O   1 
ATOM   11042 C CB  . SER H 1 138 ? 102.239 85.660 124.512 1.00 109.37 ? 138 SER H CB  1 
ATOM   11043 O OG  . SER H 1 138 ? 102.389 87.044 124.792 1.00 109.37 ? 138 SER H OG  1 
ATOM   11044 N N   . LEU H 1 139 ? 103.019 82.746 123.406 1.00 50.87  ? 139 LEU H N   1 
ATOM   11045 C CA  . LEU H 1 139 ? 103.097 81.298 123.618 1.00 50.87  ? 139 LEU H CA  1 
ATOM   11046 C C   . LEU H 1 139 ? 104.455 80.753 123.189 1.00 50.87  ? 139 LEU H C   1 
ATOM   11047 O O   . LEU H 1 139 ? 105.057 79.950 123.903 1.00 50.87  ? 139 LEU H O   1 
ATOM   11048 C CB  . LEU H 1 139 ? 102.006 80.555 122.843 1.00 42.97  ? 139 LEU H CB  1 
ATOM   11049 C CG  . LEU H 1 139 ? 100.593 80.626 123.411 1.00 42.97  ? 139 LEU H CG  1 
ATOM   11050 C CD1 . LEU H 1 139 ? 99.625  80.001 122.434 1.00 42.97  ? 139 LEU H CD1 1 
ATOM   11051 C CD2 . LEU H 1 139 ? 100.530 79.938 124.745 1.00 42.97  ? 139 LEU H CD2 1 
ATOM   11052 N N   . GLU H 1 140 ? 104.933 81.172 122.020 1.00 55.77  ? 140 GLU H N   1 
ATOM   11053 C CA  . GLU H 1 140 ? 106.234 80.714 121.548 1.00 55.77  ? 140 GLU H CA  1 
ATOM   11054 C C   . GLU H 1 140 ? 107.306 80.984 122.616 1.00 55.77  ? 140 GLU H C   1 
ATOM   11055 O O   . GLU H 1 140 ? 108.171 80.149 122.888 1.00 55.77  ? 140 GLU H O   1 
ATOM   11056 C CB  . GLU H 1 140 ? 106.604 81.424 120.251 1.00 68.06  ? 140 GLU H CB  1 
ATOM   11057 C CG  . GLU H 1 140 ? 108.013 81.148 119.789 1.00 68.06  ? 140 GLU H CG  1 
ATOM   11058 C CD  . GLU H 1 140 ? 108.364 81.870 118.496 1.00 68.06  ? 140 GLU H CD  1 
ATOM   11059 O OE1 . GLU H 1 140 ? 108.117 83.094 118.402 1.00 68.06  ? 140 GLU H OE1 1 
ATOM   11060 O OE2 . GLU H 1 140 ? 108.898 81.220 117.572 1.00 68.06  ? 140 GLU H OE2 1 
ATOM   11061 N N   . LYS H 1 141 ? 107.237 82.151 123.236 1.00 61.95  ? 141 LYS H N   1 
ATOM   11062 C CA  . LYS H 1 141 ? 108.200 82.504 124.263 1.00 61.95  ? 141 LYS H CA  1 
ATOM   11063 C C   . LYS H 1 141 ? 108.077 81.550 125.466 1.00 61.95  ? 141 LYS H C   1 
ATOM   11064 O O   . LYS H 1 141 ? 109.028 80.852 125.800 1.00 61.95  ? 141 LYS H O   1 
ATOM   11065 C CB  . LYS H 1 141 ? 107.987 83.977 124.673 1.00 46.66  ? 141 LYS H CB  1 
ATOM   11066 C CG  . LYS H 1 141 ? 109.186 84.688 125.287 1.00 46.66  ? 141 LYS H CG  1 
ATOM   11067 C CD  . LYS H 1 141 ? 109.013 84.866 126.779 1.00 46.66  ? 141 LYS H CD  1 
ATOM   11068 C CE  . LYS H 1 141 ? 110.042 85.837 127.323 1.00 46.66  ? 141 LYS H CE  1 
ATOM   11069 N NZ  . LYS H 1 141 ? 110.068 85.847 128.815 1.00 46.66  ? 141 LYS H NZ  1 
ATOM   11070 N N   . ALA H 1 142 ? 106.906 81.492 126.093 1.00 66.24  ? 142 ALA H N   1 
ATOM   11071 C CA  . ALA H 1 142 ? 106.699 80.630 127.264 1.00 66.24  ? 142 ALA H CA  1 
ATOM   11072 C C   . ALA H 1 142 ? 106.940 79.130 127.030 1.00 66.24  ? 142 ALA H C   1 
ATOM   11073 O O   . ALA H 1 142 ? 107.501 78.459 127.890 1.00 66.24  ? 142 ALA H O   1 
ATOM   11074 C CB  . ALA H 1 142 ? 105.280 80.850 127.845 1.00 42.07  ? 142 ALA H CB  1 
ATOM   11075 N N   . ARG H 1 143 ? 106.510 78.599 125.889 1.00 54.50  ? 143 ARG H N   1 
ATOM   11076 C CA  . ARG H 1 143 ? 106.709 77.185 125.610 1.00 54.50  ? 143 ARG H CA  1 
ATOM   11077 C C   . ARG H 1 143 ? 108.194 76.855 125.464 1.00 54.50  ? 143 ARG H C   1 
ATOM   11078 O O   . ARG H 1 143 ? 108.672 75.889 126.054 1.00 54.50  ? 143 ARG H O   1 
ATOM   11079 C CB  . ARG H 1 143 ? 105.971 76.739 124.332 1.00 44.31  ? 143 ARG H CB  1 
ATOM   11080 C CG  . ARG H 1 143 ? 104.495 77.019 124.318 1.00 44.31  ? 143 ARG H CG  1 
ATOM   11081 C CD  . ARG H 1 143 ? 103.728 76.185 123.295 1.00 44.31  ? 143 ARG H CD  1 
ATOM   11082 N NE  . ARG H 1 143 ? 103.204 74.993 123.956 1.00 44.31  ? 143 ARG H NE  1 
ATOM   11083 C CZ  . ARG H 1 143 ? 101.959 74.541 123.859 1.00 44.31  ? 143 ARG H CZ  1 
ATOM   11084 N NH1 . ARG H 1 143 ? 101.072 75.172 123.116 1.00 44.31  ? 143 ARG H NH1 1 
ATOM   11085 N NH2 . ARG H 1 143 ? 101.599 73.460 124.524 1.00 44.31  ? 143 ARG H NH2 1 
ATOM   11086 N N   . LYS H 1 144 ? 108.929 77.634 124.677 1.00 43.76  ? 144 LYS H N   1 
ATOM   11087 C CA  . LYS H 1 144 ? 110.357 77.355 124.502 1.00 43.76  ? 144 LYS H CA  1 
ATOM   11088 C C   . LYS H 1 144 ? 111.137 77.563 125.801 1.00 43.76  ? 144 LYS H C   1 
ATOM   11089 O O   . LYS H 1 144 ? 111.982 76.751 126.160 1.00 43.76  ? 144 LYS H O   1 
ATOM   11090 C CB  . LYS H 1 144 ? 110.941 78.220 123.396 1.00 30.93  ? 144 LYS H CB  1 
ATOM   11091 C CG  . LYS H 1 144 ? 110.264 78.000 122.091 1.00 30.93  ? 144 LYS H CG  1 
ATOM   11092 C CD  . LYS H 1 144 ? 111.008 78.728 121.003 1.00 30.93  ? 144 LYS H CD  1 
ATOM   11093 C CE  . LYS H 1 144 ? 110.477 78.356 119.638 1.00 30.93  ? 144 LYS H CE  1 
ATOM   11094 N NZ  . LYS H 1 144 ? 111.187 79.025 118.506 1.00 30.93  ? 144 LYS H NZ  1 
ATOM   11095 N N   . GLU H 1 145 ? 110.848 78.648 126.509 1.00 44.55  ? 145 GLU H N   1 
ATOM   11096 C CA  . GLU H 1 145 ? 111.525 78.899 127.760 1.00 44.55  ? 145 GLU H CA  1 
ATOM   11097 C C   . GLU H 1 145 ? 111.250 77.778 128.746 1.00 44.55  ? 145 GLU H C   1 
ATOM   11098 O O   . GLU H 1 145 ? 112.176 77.240 129.331 1.00 44.55  ? 145 GLU H O   1 
ATOM   11099 C CB  . GLU H 1 145 ? 111.107 80.249 128.339 1.00 83.58  ? 145 GLU H CB  1 
ATOM   11100 C CG  . GLU H 1 145 ? 112.153 81.323 128.087 1.00 83.58  ? 145 GLU H CG  1 
ATOM   11101 C CD  . GLU H 1 145 ? 111.630 82.730 128.266 1.00 83.58  ? 145 GLU H CD  1 
ATOM   11102 O OE1 . GLU H 1 145 ? 110.999 83.016 129.312 1.00 83.58  ? 145 GLU H OE1 1 
ATOM   11103 O OE2 . GLU H 1 145 ? 111.865 83.549 127.351 1.00 83.58  ? 145 GLU H OE2 1 
ATOM   11104 N N   . ALA H 1 146 ? 109.993 77.404 128.922 1.00 56.54  ? 146 ALA H N   1 
ATOM   11105 C CA  . ALA H 1 146 ? 109.669 76.335 129.853 1.00 56.54  ? 146 ALA H CA  1 
ATOM   11106 C C   . ALA H 1 146 ? 110.539 75.093 129.620 1.00 56.54  ? 146 ALA H C   1 
ATOM   11107 O O   . ALA H 1 146 ? 111.009 74.471 130.586 1.00 56.54  ? 146 ALA H O   1 
ATOM   11108 C CB  . ALA H 1 146 ? 108.193 75.973 129.739 1.00 56.43  ? 146 ALA H CB  1 
ATOM   11109 N N   . VAL H 1 147 ? 110.760 74.740 128.350 1.00 42.15  ? 147 VAL H N   1 
ATOM   11110 C CA  . VAL H 1 147 ? 111.560 73.566 128.003 1.00 42.15  ? 147 VAL H CA  1 
ATOM   11111 C C   . VAL H 1 147 ? 113.001 73.743 128.443 1.00 42.15  ? 147 VAL H C   1 
ATOM   11112 O O   . VAL H 1 147 ? 113.535 72.942 129.222 1.00 42.15  ? 147 VAL H O   1 
ATOM   11113 C CB  . VAL H 1 147 ? 111.505 73.291 126.483 1.00 49.37  ? 147 VAL H CB  1 
ATOM   11114 C CG1 . VAL H 1 147 ? 112.632 72.340 126.040 1.00 49.37  ? 147 VAL H CG1 1 
ATOM   11115 C CG2 . VAL H 1 147 ? 110.176 72.685 126.157 1.00 49.37  ? 147 VAL H CG2 1 
ATOM   11116 N N   . THR H 1 148 ? 113.630 74.800 127.952 1.00 52.25  ? 148 THR H N   1 
ATOM   11117 C CA  . THR H 1 148 ? 115.007 75.069 128.311 1.00 52.25  ? 148 THR H CA  1 
ATOM   11118 C C   . THR H 1 148 ? 115.185 75.135 129.833 1.00 52.25  ? 148 THR H C   1 
ATOM   11119 O O   . THR H 1 148 ? 116.106 74.535 130.382 1.00 52.25  ? 148 THR H O   1 
ATOM   11120 C CB  . THR H 1 148 ? 115.470 76.361 127.670 1.00 54.07  ? 148 THR H CB  1 
ATOM   11121 O OG1 . THR H 1 148 ? 115.247 76.283 126.255 1.00 54.07  ? 148 THR H OG1 1 
ATOM   11122 C CG2 . THR H 1 148 ? 116.939 76.564 127.923 1.00 54.07  ? 148 THR H CG2 1 
ATOM   11123 N N   . ASP H 1 149 ? 114.298 75.848 130.517 1.00 46.64  ? 149 ASP H N   1 
ATOM   11124 C CA  . ASP H 1 149 ? 114.374 75.952 131.975 1.00 46.64  ? 149 ASP H CA  1 
ATOM   11125 C C   . ASP H 1 149 ? 114.311 74.527 132.561 1.00 46.64  ? 149 ASP H C   1 
ATOM   11126 O O   . ASP H 1 149 ? 115.034 74.181 133.510 1.00 46.64  ? 149 ASP H O   1 
ATOM   11127 C CB  . ASP H 1 149 ? 113.207 76.803 132.491 1.00 50.13  ? 149 ASP H CB  1 
ATOM   11128 C CG  . ASP H 1 149 ? 113.301 77.112 133.980 1.00 50.13  ? 149 ASP H CG  1 
ATOM   11129 O OD1 . ASP H 1 149 ? 114.357 77.607 134.435 1.00 50.13  ? 149 ASP H OD1 1 
ATOM   11130 O OD2 . ASP H 1 149 ? 112.304 76.877 134.694 1.00 50.13  ? 149 ASP H OD2 1 
ATOM   11131 N N   . GLY H 1 150 ? 113.451 73.694 131.986 1.00 58.42  ? 150 GLY H N   1 
ATOM   11132 C CA  . GLY H 1 150 ? 113.347 72.334 132.472 1.00 58.42  ? 150 GLY H CA  1 
ATOM   11133 C C   . GLY H 1 150 ? 114.644 71.571 132.263 1.00 58.42  ? 150 GLY H C   1 
ATOM   11134 O O   . GLY H 1 150 ? 115.145 70.937 133.185 1.00 58.42  ? 150 GLY H O   1 
ATOM   11135 N N   . LEU H 1 151 ? 115.187 71.625 131.049 1.00 46.94  ? 151 LEU H N   1 
ATOM   11136 C CA  . LEU H 1 151 ? 116.432 70.936 130.758 1.00 46.94  ? 151 LEU H CA  1 
ATOM   11137 C C   . LEU H 1 151 ? 117.554 71.402 131.691 1.00 46.94  ? 151 LEU H C   1 
ATOM   11138 O O   . LEU H 1 151 ? 118.308 70.572 132.219 1.00 46.94  ? 151 LEU H O   1 
ATOM   11139 C CB  . LEU H 1 151 ? 116.829 71.152 129.302 1.00 35.85  ? 151 LEU H CB  1 
ATOM   11140 C CG  . LEU H 1 151 ? 118.252 70.758 128.915 1.00 35.85  ? 151 LEU H CG  1 
ATOM   11141 C CD1 . LEU H 1 151 ? 118.563 69.391 129.430 1.00 35.85  ? 151 LEU H CD1 1 
ATOM   11142 C CD2 . LEU H 1 151 ? 118.394 70.798 127.405 1.00 35.85  ? 151 LEU H CD2 1 
ATOM   11143 N N   . LYS H 1 152 ? 117.664 72.717 131.903 1.00 49.22  ? 152 LYS H N   1 
ATOM   11144 C CA  . LYS H 1 152 ? 118.686 73.247 132.807 1.00 49.22  ? 152 LYS H CA  1 
ATOM   11145 C C   . LYS H 1 152 ? 118.493 72.727 134.226 1.00 49.22  ? 152 LYS H C   1 
ATOM   11146 O O   . LYS H 1 152 ? 119.444 72.273 134.837 1.00 49.22  ? 152 LYS H O   1 
ATOM   11147 C CB  . LYS H 1 152 ? 118.677 74.779 132.839 1.00 56.88  ? 152 LYS H CB  1 
ATOM   11148 C CG  . LYS H 1 152 ? 119.252 75.419 131.607 1.00 56.88  ? 152 LYS H CG  1 
ATOM   11149 C CD  . LYS H 1 152 ? 119.505 76.891 131.828 1.00 56.88  ? 152 LYS H CD  1 
ATOM   11150 C CE  . LYS H 1 152 ? 118.257 77.642 132.220 1.00 56.88  ? 152 LYS H CE  1 
ATOM   11151 N NZ  . LYS H 1 152 ? 118.510 79.109 132.205 1.00 56.88  ? 152 LYS H NZ  1 
ATOM   11152 N N   . ARG H 1 153 ? 117.277 72.801 134.758 1.00 50.32  ? 153 ARG H N   1 
ATOM   11153 C CA  . ARG H 1 153 ? 117.036 72.309 136.111 1.00 50.32  ? 153 ARG H CA  1 
ATOM   11154 C C   . ARG H 1 153 ? 117.272 70.803 136.250 1.00 50.32  ? 153 ARG H C   1 
ATOM   11155 O O   . ARG H 1 153 ? 117.533 70.300 137.344 1.00 50.32  ? 153 ARG H O   1 
ATOM   11156 C CB  . ARG H 1 153 ? 115.610 72.617 136.552 1.00 61.26  ? 153 ARG H CB  1 
ATOM   11157 C CG  . ARG H 1 153 ? 115.419 74.009 137.027 1.00 61.26  ? 153 ARG H CG  1 
ATOM   11158 C CD  . ARG H 1 153 ? 113.967 74.286 137.186 1.00 61.26  ? 153 ARG H CD  1 
ATOM   11159 N NE  . ARG H 1 153 ? 113.360 73.454 138.211 1.00 61.26  ? 153 ARG H NE  1 
ATOM   11160 C CZ  . ARG H 1 153 ? 113.482 73.685 139.511 1.00 61.26  ? 153 ARG H CZ  1 
ATOM   11161 N NH1 . ARG H 1 153 ? 114.207 74.727 139.914 1.00 61.26  ? 153 ARG H NH1 1 
ATOM   11162 N NH2 . ARG H 1 153 ? 112.844 72.912 140.400 1.00 61.26  ? 153 ARG H NH2 1 
ATOM   11163 N N   . ALA H 1 154 ? 117.169 70.081 135.143 1.00 62.51  ? 154 ALA H N   1 
ATOM   11164 C CA  . ALA H 1 154 ? 117.367 68.641 135.181 1.00 62.51  ? 154 ALA H CA  1 
ATOM   11165 C C   . ALA H 1 154 ? 118.848 68.341 135.284 1.00 62.51  ? 154 ALA H C   1 
ATOM   11166 O O   . ALA H 1 154 ? 119.272 67.537 136.118 1.00 62.51  ? 154 ALA H O   1 
ATOM   11167 C CB  . ALA H 1 154 ? 116.784 68.002 133.931 1.00 53.73  ? 154 ALA H CB  1 
ATOM   11168 N N   . LEU H 1 155 ? 119.629 68.996 134.428 1.00 49.26  ? 155 LEU H N   1 
ATOM   11169 C CA  . LEU H 1 155 ? 121.072 68.814 134.410 1.00 49.26  ? 155 LEU H CA  1 
ATOM   11170 C C   . LEU H 1 155 ? 121.708 69.228 135.736 1.00 49.26  ? 155 LEU H C   1 
ATOM   11171 O O   . LEU H 1 155 ? 122.697 68.648 136.162 1.00 49.26  ? 155 LEU H O   1 
ATOM   11172 C CB  . LEU H 1 155 ? 121.678 69.594 133.243 1.00 38.71  ? 155 LEU H CB  1 
ATOM   11173 C CG  . LEU H 1 155 ? 121.382 68.960 131.884 1.00 38.71  ? 155 LEU H CG  1 
ATOM   11174 C CD1 . LEU H 1 155 ? 121.743 69.890 130.746 1.00 38.71  ? 155 LEU H CD1 1 
ATOM   11175 C CD2 . LEU H 1 155 ? 122.181 67.680 131.763 1.00 38.71  ? 155 LEU H CD2 1 
ATOM   11176 N N   . ARG H 1 156 ? 121.132 70.216 136.404 1.00 66.39  ? 156 ARG H N   1 
ATOM   11177 C CA  . ARG H 1 156 ? 121.677 70.644 137.684 1.00 66.39  ? 156 ARG H CA  1 
ATOM   11178 C C   . ARG H 1 156 ? 121.813 69.462 138.632 1.00 66.39  ? 156 ARG H C   1 
ATOM   11179 O O   . ARG H 1 156 ? 122.675 69.447 139.502 1.00 66.39  ? 156 ARG H O   1 
ATOM   11180 C CB  . ARG H 1 156 ? 120.770 71.667 138.370 1.00 70.93  ? 156 ARG H CB  1 
ATOM   11181 C CG  . ARG H 1 156 ? 120.800 73.069 137.813 1.00 70.93  ? 156 ARG H CG  1 
ATOM   11182 C CD  . ARG H 1 156 ? 119.975 73.959 138.721 1.00 70.93  ? 156 ARG H CD  1 
ATOM   11183 N NE  . ARG H 1 156 ? 119.453 75.137 138.033 1.00 70.93  ? 156 ARG H NE  1 
ATOM   11184 C CZ  . ARG H 1 156 ? 118.473 75.897 138.513 1.00 70.93  ? 156 ARG H CZ  1 
ATOM   11185 N NH1 . ARG H 1 156 ? 117.908 75.604 139.681 1.00 70.93  ? 156 ARG H NH1 1 
ATOM   11186 N NH2 . ARG H 1 156 ? 118.052 76.948 137.824 1.00 70.93  ? 156 ARG H NH2 1 
ATOM   11187 N N   . SER H 1 157 ? 120.951 68.470 138.480 1.00 71.83  ? 157 SER H N   1 
ATOM   11188 C CA  . SER H 1 157 ? 120.998 67.339 139.377 1.00 71.83  ? 157 SER H CA  1 
ATOM   11189 C C   . SER H 1 157 ? 122.281 66.556 139.287 1.00 71.83  ? 157 SER H C   1 
ATOM   11190 O O   . SER H 1 157 ? 122.618 65.835 140.215 1.00 71.83  ? 157 SER H O   1 
ATOM   11191 C CB  . SER H 1 157 ? 119.807 66.427 139.134 1.00 61.95  ? 157 SER H CB  1 
ATOM   11192 O OG  . SER H 1 157 ? 118.607 67.092 139.491 1.00 61.95  ? 157 SER H OG  1 
ATOM   11193 N N   . PHE H 1 158 ? 123.009 66.705 138.188 1.00 61.58  ? 158 PHE H N   1 
ATOM   11194 C CA  . PHE H 1 158 ? 124.255 65.969 138.038 1.00 61.58  ? 158 PHE H CA  1 
ATOM   11195 C C   . PHE H 1 158 ? 125.434 66.519 138.848 1.00 61.58  ? 158 PHE H C   1 
ATOM   11196 O O   . PHE H 1 158 ? 126.355 65.774 139.206 1.00 61.58  ? 158 PHE H O   1 
ATOM   11197 C CB  . PHE H 1 158 ? 124.616 65.849 136.555 1.00 98.97  ? 158 PHE H CB  1 
ATOM   11198 C CG  . PHE H 1 158 ? 123.792 64.823 135.824 1.00 98.97  ? 158 PHE H CG  1 
ATOM   11199 C CD1 . PHE H 1 158 ? 123.007 65.180 134.741 1.00 98.97  ? 158 PHE H CD1 1 
ATOM   11200 C CD2 . PHE H 1 158 ? 123.781 63.495 136.243 1.00 98.97  ? 158 PHE H CD2 1 
ATOM   11201 C CE1 . PHE H 1 158 ? 122.224 64.232 134.090 1.00 98.97  ? 158 PHE H CE1 1 
ATOM   11202 C CE2 . PHE H 1 158 ? 122.999 62.544 135.595 1.00 98.97  ? 158 PHE H CE2 1 
ATOM   11203 C CZ  . PHE H 1 158 ? 122.223 62.915 134.520 1.00 98.97  ? 158 PHE H CZ  1 
ATOM   11204 N N   . GLY H 1 159 ? 125.403 67.810 139.159 1.00 80.76  ? 159 GLY H N   1 
ATOM   11205 C CA  . GLY H 1 159 ? 126.482 68.395 139.934 1.00 80.76  ? 159 GLY H CA  1 
ATOM   11206 C C   . GLY H 1 159 ? 126.676 69.885 139.735 1.00 80.76  ? 159 GLY H C   1 
ATOM   11207 O O   . GLY H 1 159 ? 126.020 70.519 138.908 1.00 80.76  ? 159 GLY H O   1 
ATOM   11208 N N   . ASN H 1 160 ? 127.603 70.446 140.499 1.00 75.52  ? 160 ASN H N   1 
ATOM   11209 C CA  . ASN H 1 160 ? 127.890 71.862 140.423 1.00 75.52  ? 160 ASN H CA  1 
ATOM   11210 C C   . ASN H 1 160 ? 128.286 72.285 139.023 1.00 75.52  ? 160 ASN H C   1 
ATOM   11211 O O   . ASN H 1 160 ? 127.749 73.247 138.493 1.00 75.52  ? 160 ASN H O   1 
ATOM   11212 C CB  . ASN H 1 160 ? 128.994 72.214 141.403 1.00 62.40  ? 160 ASN H CB  1 
ATOM   11213 C CG  . ASN H 1 160 ? 128.631 71.859 142.840 1.00 62.40  ? 160 ASN H CG  1 
ATOM   11214 O OD1 . ASN H 1 160 ? 127.591 72.276 143.356 1.00 62.40  ? 160 ASN H OD1 1 
ATOM   11215 N ND2 . ASN H 1 160 ? 129.489 71.092 143.494 1.00 62.40  ? 160 ASN H ND2 1 
ATOM   11216 N N   . ALA H 1 161 ? 129.217 71.560 138.416 1.00 47.48  ? 161 ALA H N   1 
ATOM   11217 C CA  . ALA H 1 161 ? 129.681 71.888 137.074 1.00 47.48  ? 161 ALA H CA  1 
ATOM   11218 C C   . ALA H 1 161 ? 128.577 72.024 136.033 1.00 47.48  ? 161 ALA H C   1 
ATOM   11219 O O   . ALA H 1 161 ? 128.838 72.475 134.910 1.00 47.48  ? 161 ALA H O   1 
ATOM   11220 C CB  . ALA H 1 161 ? 130.686 70.856 136.612 1.00 57.89  ? 161 ALA H CB  1 
ATOM   11221 N N   . LEU H 1 162 ? 127.360 71.601 136.365 1.00 89.88  ? 162 LEU H N   1 
ATOM   11222 C CA  . LEU H 1 162 ? 126.254 71.736 135.418 1.00 89.88  ? 162 LEU H CA  1 
ATOM   11223 C C   . LEU H 1 162 ? 125.187 72.665 135.984 1.00 89.88  ? 162 LEU H C   1 
ATOM   11224 O O   . LEU H 1 162 ? 124.034 72.668 135.543 1.00 89.88  ? 162 LEU H O   1 
ATOM   11225 C CB  . LEU H 1 162 ? 125.659 70.374 135.058 1.00 76.80  ? 162 LEU H CB  1 
ATOM   11226 C CG  . LEU H 1 162 ? 126.467 69.543 134.059 1.00 76.80  ? 162 LEU H CG  1 
ATOM   11227 C CD1 . LEU H 1 162 ? 125.840 68.164 133.935 1.00 76.80  ? 162 LEU H CD1 1 
ATOM   11228 C CD2 . LEU H 1 162 ? 126.505 70.236 132.707 1.00 76.80  ? 162 LEU H CD2 1 
ATOM   11229 N N   . GLY H 1 163 ? 125.591 73.444 136.983 1.00 58.44  ? 163 GLY H N   1 
ATOM   11230 C CA  . GLY H 1 163 ? 124.707 74.422 137.566 1.00 58.44  ? 163 GLY H CA  1 
ATOM   11231 C C   . GLY H 1 163 ? 124.140 74.201 138.947 1.00 58.44  ? 163 GLY H C   1 
ATOM   11232 O O   . GLY H 1 163 ? 123.278 74.979 139.360 1.00 58.44  ? 163 GLY H O   1 
ATOM   11233 N N   . ASN H 1 164 ? 124.572 73.188 139.692 1.00 69.90  ? 164 ASN H N   1 
ATOM   11234 C CA  . ASN H 1 164 ? 123.965 73.036 141.013 1.00 69.90  ? 164 ASN H CA  1 
ATOM   11235 C C   . ASN H 1 164 ? 124.473 74.112 141.975 1.00 69.90  ? 164 ASN H C   1 
ATOM   11236 O O   . ASN H 1 164 ? 123.886 74.342 143.042 1.00 69.90  ? 164 ASN H O   1 
ATOM   11237 C CB  . ASN H 1 164 ? 124.206 71.637 141.593 1.00 56.80  ? 164 ASN H CB  1 
ATOM   11238 C CG  . ASN H 1 164 ? 123.446 71.407 142.915 1.00 56.80  ? 164 ASN H CG  1 
ATOM   11239 O OD1 . ASN H 1 164 ? 122.248 71.686 143.019 1.00 56.80  ? 164 ASN H OD1 1 
ATOM   11240 N ND2 . ASN H 1 164 ? 124.145 70.896 143.924 1.00 56.80  ? 164 ASN H ND2 1 
ATOM   11241 N N   . CYS H 1 165 ? 125.552 74.788 141.589 1.00 64.24  ? 165 CYS H N   1 
ATOM   11242 C CA  . CYS H 1 165 ? 126.114 75.839 142.427 1.00 64.24  ? 165 CYS H CA  1 
ATOM   11243 C C   . CYS H 1 165 ? 125.303 77.143 142.350 1.00 64.24  ? 165 CYS H C   1 
ATOM   11244 O O   . CYS H 1 165 ? 125.124 77.829 143.356 1.00 64.24  ? 165 CYS H O   1 
ATOM   11245 C CB  . CYS H 1 165 ? 127.586 76.078 142.058 1.00 71.05  ? 165 CYS H CB  1 
ATOM   11246 S SG  . CYS H 1 165 ? 127.946 76.379 140.302 1.00 71.05  ? 165 CYS H SG  1 
ATOM   11247 N N   . ILE H 1 166 ? 124.800 77.454 141.157 1.00 67.07  ? 166 ILE H N   1 
ATOM   11248 C CA  . ILE H 1 166 ? 123.999 78.659 140.888 1.00 67.07  ? 166 ILE H CA  1 
ATOM   11249 C C   . ILE H 1 166 ? 122.978 78.926 141.989 1.00 67.07  ? 166 ILE H C   1 
ATOM   11250 O O   . ILE H 1 166 ? 122.508 80.042 142.160 1.00 67.07  ? 166 ILE H O   1 
ATOM   11251 C CB  . ILE H 1 166 ? 123.232 78.518 139.545 1.00 72.41  ? 166 ILE H CB  1 
ATOM   11252 C CG1 . ILE H 1 166 ? 122.859 79.884 139.004 1.00 72.41  ? 166 ILE H CG1 1 
ATOM   11253 C CG2 . ILE H 1 166 ? 121.954 77.714 139.743 1.00 72.41  ? 166 ILE H CG2 1 
ATOM   11254 C CD1 . ILE H 1 166 ? 124.030 80.641 138.504 1.00 72.41  ? 166 ILE H CD1 1 
ATOM   11255 N N   . LEU H 1 167 ? 122.634 77.888 142.733 1.00 82.07  ? 167 LEU H N   1 
ATOM   11256 C CA  . LEU H 1 167 ? 121.663 78.017 143.803 1.00 82.07  ? 167 LEU H CA  1 
ATOM   11257 C C   . LEU H 1 167 ? 122.324 78.414 145.125 1.00 82.07  ? 167 LEU H C   1 
ATOM   11258 O O   . LEU H 1 167 ? 121.736 79.133 145.940 1.00 82.07  ? 167 LEU H O   1 
ATOM   11259 C CB  . LEU H 1 167 ? 120.925 76.688 143.976 1.00 118.00 ? 167 LEU H CB  1 
ATOM   11260 C CG  . LEU H 1 167 ? 120.149 76.161 142.769 1.00 118.00 ? 167 LEU H CG  1 
ATOM   11261 C CD1 . LEU H 1 167 ? 119.823 74.683 142.973 1.00 118.00 ? 167 LEU H CD1 1 
ATOM   11262 C CD2 . LEU H 1 167 ? 118.883 77.002 142.575 1.00 118.00 ? 167 LEU H CD2 1 
ATOM   11263 N N   . ASP H 1 168 ? 123.547 77.937 145.336 1.00 122.01 ? 168 ASP H N   1 
ATOM   11264 C CA  . ASP H 1 168 ? 124.284 78.225 146.561 1.00 122.01 ? 168 ASP H CA  1 
ATOM   11265 C C   . ASP H 1 168 ? 124.475 79.719 146.786 1.00 122.01 ? 168 ASP H C   1 
ATOM   11266 O O   . ASP H 1 168 ? 125.088 80.411 145.971 1.00 122.01 ? 168 ASP H O   1 
ATOM   11267 C CB  . ASP H 1 168 ? 125.655 77.559 146.523 1.00 106.28 ? 168 ASP H CB  1 
ATOM   11268 C CG  . ASP H 1 168 ? 126.281 77.446 147.896 1.00 106.28 ? 168 ASP H CG  1 
ATOM   11269 O OD1 . ASP H 1 168 ? 125.961 78.285 148.765 1.00 106.28 ? 168 ASP H OD1 1 
ATOM   11270 O OD2 . ASP H 1 168 ? 127.097 76.523 148.105 1.00 106.28 ? 168 ASP H OD2 1 
ATOM   11271 N N   . LYS H 1 169 ? 123.960 80.210 147.905 1.00 105.41 ? 169 LYS H N   1 
ATOM   11272 C CA  . LYS H 1 169 ? 124.082 81.620 148.237 1.00 105.41 ? 169 LYS H CA  1 
ATOM   11273 C C   . LYS H 1 169 ? 125.548 81.958 148.462 1.00 105.41 ? 169 LYS H C   1 
ATOM   11274 O O   . LYS H 1 169 ? 126.057 82.936 147.917 1.00 105.41 ? 169 LYS H O   1 
ATOM   11275 C CB  . LYS H 1 169 ? 123.255 81.927 149.485 1.00 108.23 ? 169 LYS H CB  1 
ATOM   11276 C CG  . LYS H 1 169 ? 121.782 81.600 149.292 1.00 108.23 ? 169 LYS H CG  1 
ATOM   11277 C CD  . LYS H 1 169 ? 120.987 81.717 150.572 1.00 108.23 ? 169 LYS H CD  1 
ATOM   11278 C CE  . LYS H 1 169 ? 119.545 81.318 150.338 1.00 108.23 ? 169 LYS H CE  1 
ATOM   11279 N NZ  . LYS H 1 169 ? 118.756 81.373 151.597 1.00 108.23 ? 169 LYS H NZ  1 
ATOM   11280 N N   . ASP H 1 170 ? 126.224 81.129 149.254 1.00 91.83  ? 170 ASP H N   1 
ATOM   11281 C CA  . ASP H 1 170 ? 127.639 81.328 149.548 1.00 91.83  ? 170 ASP H CA  1 
ATOM   11282 C C   . ASP H 1 170 ? 128.436 81.425 148.250 1.00 91.83  ? 170 ASP H C   1 
ATOM   11283 O O   . ASP H 1 170 ? 129.368 82.220 148.136 1.00 91.83  ? 170 ASP H O   1 
ATOM   11284 C CB  . ASP H 1 170 ? 128.165 80.169 150.401 1.00 96.21  ? 170 ASP H CB  1 
ATOM   11285 C CG  . ASP H 1 170 ? 127.414 80.022 151.717 1.00 96.21  ? 170 ASP H CG  1 
ATOM   11286 O OD1 . ASP H 1 170 ? 127.392 80.993 152.505 1.00 96.21  ? 170 ASP H OD1 1 
ATOM   11287 O OD2 . ASP H 1 170 ? 126.849 78.936 151.968 1.00 96.21  ? 170 ASP H OD2 1 
ATOM   11288 N N   . TYR H 1 171 ? 128.055 80.609 147.275 1.00 83.25  ? 171 TYR H N   1 
ATOM   11289 C CA  . TYR H 1 171 ? 128.718 80.594 145.976 1.00 83.25  ? 171 TYR H CA  1 
ATOM   11290 C C   . TYR H 1 171 ? 128.553 81.950 145.307 1.00 83.25  ? 171 TYR H C   1 
ATOM   11291 O O   . TYR H 1 171 ? 129.505 82.514 144.766 1.00 83.25  ? 171 TYR H O   1 
ATOM   11292 C CB  . TYR H 1 171 ? 128.106 79.500 145.080 1.00 60.40  ? 171 TYR H CB  1 
ATOM   11293 C CG  . TYR H 1 171 ? 128.456 79.638 143.605 1.00 60.40  ? 171 TYR H CG  1 
ATOM   11294 C CD1 . TYR H 1 171 ? 129.749 79.374 143.137 1.00 60.40  ? 171 TYR H CD1 1 
ATOM   11295 C CD2 . TYR H 1 171 ? 127.500 80.068 142.685 1.00 60.40  ? 171 TYR H CD2 1 
ATOM   11296 C CE1 . TYR H 1 171 ? 130.078 79.541 141.791 1.00 60.40  ? 171 TYR H CE1 1 
ATOM   11297 C CE2 . TYR H 1 171 ? 127.818 80.239 141.340 1.00 60.40  ? 171 TYR H CE2 1 
ATOM   11298 C CZ  . TYR H 1 171 ? 129.103 79.980 140.898 1.00 60.40  ? 171 TYR H CZ  1 
ATOM   11299 O OH  . TYR H 1 171 ? 129.394 80.196 139.563 1.00 60.40  ? 171 TYR H OH  1 
ATOM   11300 N N   . LEU H 1 172 ? 127.329 82.459 145.352 1.00 132.23 ? 172 LEU H N   1 
ATOM   11301 C CA  . LEU H 1 172 ? 127.005 83.741 144.751 1.00 132.23 ? 172 LEU H CA  1 
ATOM   11302 C C   . LEU H 1 172 ? 127.831 84.907 145.304 1.00 132.23 ? 172 LEU H C   1 
ATOM   11303 O O   . LEU H 1 172 ? 128.455 85.642 144.537 1.00 132.23 ? 172 LEU H O   1 
ATOM   11304 C CB  . LEU H 1 172 ? 125.507 84.011 144.912 1.00 82.71  ? 172 LEU H CB  1 
ATOM   11305 C CG  . LEU H 1 172 ? 124.609 83.135 144.029 1.00 82.71  ? 172 LEU H CG  1 
ATOM   11306 C CD1 . LEU H 1 172 ? 123.151 83.427 144.337 1.00 82.71  ? 172 LEU H CD1 1 
ATOM   11307 C CD2 . LEU H 1 172 ? 124.914 83.397 142.547 1.00 82.71  ? 172 LEU H CD2 1 
ATOM   11308 N N   . ARG H 1 173 ? 127.838 85.083 146.625 1.00 87.68  ? 173 ARG H N   1 
ATOM   11309 C CA  . ARG H 1 173 ? 128.606 86.164 147.236 1.00 87.68  ? 173 ARG H CA  1 
ATOM   11310 C C   . ARG H 1 173 ? 130.038 86.137 146.715 1.00 87.68  ? 173 ARG H C   1 
ATOM   11311 O O   . ARG H 1 173 ? 130.573 87.159 146.293 1.00 87.68  ? 173 ARG H O   1 
ATOM   11312 C CB  . ARG H 1 173 ? 128.594 86.039 148.759 1.00 118.12 ? 173 ARG H CB  1 
ATOM   11313 C CG  . ARG H 1 173 ? 127.217 86.254 149.367 1.00 118.12 ? 173 ARG H CG  1 
ATOM   11314 C CD  . ARG H 1 173 ? 127.238 86.353 150.895 1.00 118.12 ? 173 ARG H CD  1 
ATOM   11315 N NE  . ARG H 1 173 ? 127.667 85.121 151.553 1.00 118.12 ? 173 ARG H NE  1 
ATOM   11316 C CZ  . ARG H 1 173 ? 128.936 84.748 151.709 1.00 118.12 ? 173 ARG H CZ  1 
ATOM   11317 N NH1 . ARG H 1 173 ? 129.921 85.515 151.257 1.00 118.12 ? 173 ARG H NH1 1 
ATOM   11318 N NH2 . ARG H 1 173 ? 129.222 83.603 152.318 1.00 118.12 ? 173 ARG H NH2 1 
ATOM   11319 N N   . SER H 1 174 ? 130.654 84.962 146.734 1.00 76.81  ? 174 SER H N   1 
ATOM   11320 C CA  . SER H 1 174 ? 132.017 84.807 146.235 1.00 76.81  ? 174 SER H CA  1 
ATOM   11321 C C   . SER H 1 174 ? 132.139 85.256 144.772 1.00 76.81  ? 174 SER H C   1 
ATOM   11322 O O   . SER H 1 174 ? 133.234 85.543 144.294 1.00 76.81  ? 174 SER H O   1 
ATOM   11323 C CB  . SER H 1 174 ? 132.452 83.341 146.346 1.00 77.17  ? 174 SER H CB  1 
ATOM   11324 O OG  . SER H 1 174 ? 132.424 82.905 147.691 1.00 77.17  ? 174 SER H OG  1 
ATOM   11325 N N   . LEU H 1 175 ? 131.019 85.301 144.058 1.00 98.65  ? 175 LEU H N   1 
ATOM   11326 C CA  . LEU H 1 175 ? 131.047 85.707 142.660 1.00 98.65  ? 175 LEU H CA  1 
ATOM   11327 C C   . LEU H 1 175 ? 131.151 87.208 142.508 1.00 98.65  ? 175 LEU H C   1 
ATOM   11328 O O   . LEU H 1 175 ? 131.825 87.695 141.601 1.00 98.65  ? 175 LEU H O   1 
ATOM   11329 C CB  . LEU H 1 175 ? 129.804 85.209 141.923 1.00 90.74  ? 175 LEU H CB  1 
ATOM   11330 C CG  . LEU H 1 175 ? 129.868 83.791 141.359 1.00 90.74  ? 175 LEU H CG  1 
ATOM   11331 C CD1 . LEU H 1 175 ? 128.539 83.447 140.728 1.00 90.74  ? 175 LEU H CD1 1 
ATOM   11332 C CD2 . LEU H 1 175 ? 130.985 83.692 140.332 1.00 90.74  ? 175 LEU H CD2 1 
ATOM   11333 N N   . ASN H 1 176 ? 130.473 87.939 143.388 1.00 159.82 ? 176 ASN H N   1 
ATOM   11334 C CA  . ASN H 1 176 ? 130.501 89.396 143.351 1.00 159.82 ? 176 ASN H CA  1 
ATOM   11335 C C   . ASN H 1 176 ? 131.901 89.869 143.723 1.00 159.82 ? 176 ASN H C   1 
ATOM   11336 O O   . ASN H 1 176 ? 132.431 90.811 143.128 1.00 159.82 ? 176 ASN H O   1 
ATOM   11337 C CB  . ASN H 1 176 ? 129.481 89.973 144.336 1.00 117.76 ? 176 ASN H CB  1 
ATOM   11338 C CG  . ASN H 1 176 ? 128.070 89.502 144.053 1.00 117.76 ? 176 ASN H CG  1 
ATOM   11339 O OD1 . ASN H 1 176 ? 127.554 89.674 142.947 1.00 117.76 ? 176 ASN H OD1 1 
ATOM   11340 N ND2 . ASN H 1 176 ? 127.434 88.906 145.055 1.00 117.76 ? 176 ASN H ND2 1 
ATOM   11341 N N   . LYS H 1 177 ? 132.492 89.196 144.708 1.00 141.08 ? 177 LYS H N   1 
ATOM   11342 C CA  . LYS H 1 177 ? 133.835 89.514 145.183 1.00 141.08 ? 177 LYS H CA  1 
ATOM   11343 C C   . LYS H 1 177 ? 134.892 89.172 144.129 1.00 141.08 ? 177 LYS H C   1 
AT