data_1KOJ
# 
_entry.id   1KOJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KOJ         
RCSB  RCSB015173   
WWPDB D_1000015173 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1DQR 'Complex of rabbit phosphoglucose isomerase with 6-phosphogluconate'   unspecified 
PDB 1HOX 'Complex of rabbit phosphoglucose isomerase with fructose 6-phosphate' unspecified 
PDB 1HM5 'Rabbit phosphoglucose isomerase'                                      unspecified 
PDB 1IAT 'Human phosphoglucose isomerase'                                       unspecified 
PDB 1G98 'Rabbit phosphoglucose isomerase complexed with 5-phosphoarabinonate'  unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KOJ 
_pdbx_database_status.recvd_initial_deposition_date   2001-12-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Arsenieva, D.' 1 
'Hardre, R.'    2 
'Salmon, L.'    3 
'Jeffery, C.J.' 4 
# 
_citation.id                        primary 
_citation.title                     
'The crystal structure of rabbit phosphoglucose isomerase complexed with 5-phospho-D-arabinonohydroxamic acid.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            99 
_citation.page_first                5872 
_citation.page_last                 5877 
_citation.year                      2002 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11983887 
_citation.pdbx_database_id_DOI      10.1073/pnas.052131799 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Arsenieva, D.' 1 
primary 'Hardre, R.'    2 
primary 'Salmon, L.'    3 
primary 'Jeffery, C.J.' 4 
# 
_cell.entry_id           1KOJ 
_cell.length_a           82.69 
_cell.length_b           115.97 
_cell.length_c           271.85 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KOJ 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     orthorhombic 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Glucose-6-phosphate isomerase'      62696.418 2   5.3.1.9 ? ? ? 
2 non-polymer syn '5-PHOSPHO-D-ARABINOHYDROXAMIC ACID' 261.124   2   ?       ? ? ? 
3 water       nat water                                18.015    802 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GPI; Phosphoglucose isomerase; PGI; Phosphohexose isomerase; PHI' 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.5.3.1.9 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AALTRNPQFQKLQQWHREHGSELNLRHLFDTDKERFNHFSLTLNTNHGHILLDYSKNLVTEEVMHMLLDLAKSRGVEAAR
ESMFNGEKINSTEDRAVLHVALRNRSNTPIVVDGKDVMPEVNKVLDKMKAFCQRVRSGDWKGYTGKTITDVINIGIGGSD
LGPLMVTEALKPYSSGGPRVWFVSNIDGTHIAKTLACLNPESSLFIIASKTFTTQETITNAKTAKDWFLLSAKDPSTVAK
HFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLA
MLGIWYINCFGCETQAVLPYDQYLHRFAAYFQQGDMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKM
IPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKSTEEARKELQAAGKSPEDLMKLLPHKVFEGNRPTNSIVFTK
LTPFILGALIAMYEHKIFVQGVVWDINSFDQWGVELGKQLAKKIEPELDGSSPVTSHDSSTNGLINFIKQQREAKIQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AALTRNPQFQKLQQWHREHGSELNLRHLFDTDKERFNHFSLTLNTNHGHILLDYSKNLVTEEVMHMLLDLAKSRGVEAAR
ESMFNGEKINSTEDRAVLHVALRNRSNTPIVVDGKDVMPEVNKVLDKMKAFCQRVRSGDWKGYTGKTITDVINIGIGGSD
LGPLMVTEALKPYSSGGPRVWFVSNIDGTHIAKTLACLNPESSLFIIASKTFTTQETITNAKTAKDWFLLSAKDPSTVAK
HFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLA
MLGIWYINCFGCETQAVLPYDQYLHRFAAYFQQGDMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKM
IPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKSTEEARKELQAAGKSPEDLMKLLPHKVFEGNRPTNSIVFTK
LTPFILGALIAMYEHKIFVQGVVWDINSFDQWGVELGKQLAKKIEPELDGSSPVTSHDSSTNGLINFIKQQREAKIQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ALA n 
1 3   LEU n 
1 4   THR n 
1 5   ARG n 
1 6   ASN n 
1 7   PRO n 
1 8   GLN n 
1 9   PHE n 
1 10  GLN n 
1 11  LYS n 
1 12  LEU n 
1 13  GLN n 
1 14  GLN n 
1 15  TRP n 
1 16  HIS n 
1 17  ARG n 
1 18  GLU n 
1 19  HIS n 
1 20  GLY n 
1 21  SER n 
1 22  GLU n 
1 23  LEU n 
1 24  ASN n 
1 25  LEU n 
1 26  ARG n 
1 27  HIS n 
1 28  LEU n 
1 29  PHE n 
1 30  ASP n 
1 31  THR n 
1 32  ASP n 
1 33  LYS n 
1 34  GLU n 
1 35  ARG n 
1 36  PHE n 
1 37  ASN n 
1 38  HIS n 
1 39  PHE n 
1 40  SER n 
1 41  LEU n 
1 42  THR n 
1 43  LEU n 
1 44  ASN n 
1 45  THR n 
1 46  ASN n 
1 47  HIS n 
1 48  GLY n 
1 49  HIS n 
1 50  ILE n 
1 51  LEU n 
1 52  LEU n 
1 53  ASP n 
1 54  TYR n 
1 55  SER n 
1 56  LYS n 
1 57  ASN n 
1 58  LEU n 
1 59  VAL n 
1 60  THR n 
1 61  GLU n 
1 62  GLU n 
1 63  VAL n 
1 64  MET n 
1 65  HIS n 
1 66  MET n 
1 67  LEU n 
1 68  LEU n 
1 69  ASP n 
1 70  LEU n 
1 71  ALA n 
1 72  LYS n 
1 73  SER n 
1 74  ARG n 
1 75  GLY n 
1 76  VAL n 
1 77  GLU n 
1 78  ALA n 
1 79  ALA n 
1 80  ARG n 
1 81  GLU n 
1 82  SER n 
1 83  MET n 
1 84  PHE n 
1 85  ASN n 
1 86  GLY n 
1 87  GLU n 
1 88  LYS n 
1 89  ILE n 
1 90  ASN n 
1 91  SER n 
1 92  THR n 
1 93  GLU n 
1 94  ASP n 
1 95  ARG n 
1 96  ALA n 
1 97  VAL n 
1 98  LEU n 
1 99  HIS n 
1 100 VAL n 
1 101 ALA n 
1 102 LEU n 
1 103 ARG n 
1 104 ASN n 
1 105 ARG n 
1 106 SER n 
1 107 ASN n 
1 108 THR n 
1 109 PRO n 
1 110 ILE n 
1 111 VAL n 
1 112 VAL n 
1 113 ASP n 
1 114 GLY n 
1 115 LYS n 
1 116 ASP n 
1 117 VAL n 
1 118 MET n 
1 119 PRO n 
1 120 GLU n 
1 121 VAL n 
1 122 ASN n 
1 123 LYS n 
1 124 VAL n 
1 125 LEU n 
1 126 ASP n 
1 127 LYS n 
1 128 MET n 
1 129 LYS n 
1 130 ALA n 
1 131 PHE n 
1 132 CYS n 
1 133 GLN n 
1 134 ARG n 
1 135 VAL n 
1 136 ARG n 
1 137 SER n 
1 138 GLY n 
1 139 ASP n 
1 140 TRP n 
1 141 LYS n 
1 142 GLY n 
1 143 TYR n 
1 144 THR n 
1 145 GLY n 
1 146 LYS n 
1 147 THR n 
1 148 ILE n 
1 149 THR n 
1 150 ASP n 
1 151 VAL n 
1 152 ILE n 
1 153 ASN n 
1 154 ILE n 
1 155 GLY n 
1 156 ILE n 
1 157 GLY n 
1 158 GLY n 
1 159 SER n 
1 160 ASP n 
1 161 LEU n 
1 162 GLY n 
1 163 PRO n 
1 164 LEU n 
1 165 MET n 
1 166 VAL n 
1 167 THR n 
1 168 GLU n 
1 169 ALA n 
1 170 LEU n 
1 171 LYS n 
1 172 PRO n 
1 173 TYR n 
1 174 SER n 
1 175 SER n 
1 176 GLY n 
1 177 GLY n 
1 178 PRO n 
1 179 ARG n 
1 180 VAL n 
1 181 TRP n 
1 182 PHE n 
1 183 VAL n 
1 184 SER n 
1 185 ASN n 
1 186 ILE n 
1 187 ASP n 
1 188 GLY n 
1 189 THR n 
1 190 HIS n 
1 191 ILE n 
1 192 ALA n 
1 193 LYS n 
1 194 THR n 
1 195 LEU n 
1 196 ALA n 
1 197 CYS n 
1 198 LEU n 
1 199 ASN n 
1 200 PRO n 
1 201 GLU n 
1 202 SER n 
1 203 SER n 
1 204 LEU n 
1 205 PHE n 
1 206 ILE n 
1 207 ILE n 
1 208 ALA n 
1 209 SER n 
1 210 LYS n 
1 211 THR n 
1 212 PHE n 
1 213 THR n 
1 214 THR n 
1 215 GLN n 
1 216 GLU n 
1 217 THR n 
1 218 ILE n 
1 219 THR n 
1 220 ASN n 
1 221 ALA n 
1 222 LYS n 
1 223 THR n 
1 224 ALA n 
1 225 LYS n 
1 226 ASP n 
1 227 TRP n 
1 228 PHE n 
1 229 LEU n 
1 230 LEU n 
1 231 SER n 
1 232 ALA n 
1 233 LYS n 
1 234 ASP n 
1 235 PRO n 
1 236 SER n 
1 237 THR n 
1 238 VAL n 
1 239 ALA n 
1 240 LYS n 
1 241 HIS n 
1 242 PHE n 
1 243 VAL n 
1 244 ALA n 
1 245 LEU n 
1 246 SER n 
1 247 THR n 
1 248 ASN n 
1 249 THR n 
1 250 ALA n 
1 251 LYS n 
1 252 VAL n 
1 253 LYS n 
1 254 GLU n 
1 255 PHE n 
1 256 GLY n 
1 257 ILE n 
1 258 ASP n 
1 259 PRO n 
1 260 GLN n 
1 261 ASN n 
1 262 MET n 
1 263 PHE n 
1 264 GLU n 
1 265 PHE n 
1 266 TRP n 
1 267 ASP n 
1 268 TRP n 
1 269 VAL n 
1 270 GLY n 
1 271 GLY n 
1 272 ARG n 
1 273 TYR n 
1 274 SER n 
1 275 LEU n 
1 276 TRP n 
1 277 SER n 
1 278 ALA n 
1 279 ILE n 
1 280 GLY n 
1 281 LEU n 
1 282 SER n 
1 283 ILE n 
1 284 ALA n 
1 285 LEU n 
1 286 HIS n 
1 287 VAL n 
1 288 GLY n 
1 289 PHE n 
1 290 ASP n 
1 291 ASN n 
1 292 PHE n 
1 293 GLU n 
1 294 GLN n 
1 295 LEU n 
1 296 LEU n 
1 297 SER n 
1 298 GLY n 
1 299 ALA n 
1 300 HIS n 
1 301 TRP n 
1 302 MET n 
1 303 ASP n 
1 304 GLN n 
1 305 HIS n 
1 306 PHE n 
1 307 ARG n 
1 308 THR n 
1 309 THR n 
1 310 PRO n 
1 311 LEU n 
1 312 GLU n 
1 313 LYS n 
1 314 ASN n 
1 315 ALA n 
1 316 PRO n 
1 317 VAL n 
1 318 LEU n 
1 319 LEU n 
1 320 ALA n 
1 321 MET n 
1 322 LEU n 
1 323 GLY n 
1 324 ILE n 
1 325 TRP n 
1 326 TYR n 
1 327 ILE n 
1 328 ASN n 
1 329 CYS n 
1 330 PHE n 
1 331 GLY n 
1 332 CYS n 
1 333 GLU n 
1 334 THR n 
1 335 GLN n 
1 336 ALA n 
1 337 VAL n 
1 338 LEU n 
1 339 PRO n 
1 340 TYR n 
1 341 ASP n 
1 342 GLN n 
1 343 TYR n 
1 344 LEU n 
1 345 HIS n 
1 346 ARG n 
1 347 PHE n 
1 348 ALA n 
1 349 ALA n 
1 350 TYR n 
1 351 PHE n 
1 352 GLN n 
1 353 GLN n 
1 354 GLY n 
1 355 ASP n 
1 356 MET n 
1 357 GLU n 
1 358 SER n 
1 359 ASN n 
1 360 GLY n 
1 361 LYS n 
1 362 TYR n 
1 363 ILE n 
1 364 THR n 
1 365 LYS n 
1 366 SER n 
1 367 GLY n 
1 368 ALA n 
1 369 ARG n 
1 370 VAL n 
1 371 ASP n 
1 372 HIS n 
1 373 GLN n 
1 374 THR n 
1 375 GLY n 
1 376 PRO n 
1 377 ILE n 
1 378 VAL n 
1 379 TRP n 
1 380 GLY n 
1 381 GLU n 
1 382 PRO n 
1 383 GLY n 
1 384 THR n 
1 385 ASN n 
1 386 GLY n 
1 387 GLN n 
1 388 HIS n 
1 389 ALA n 
1 390 PHE n 
1 391 TYR n 
1 392 GLN n 
1 393 LEU n 
1 394 ILE n 
1 395 HIS n 
1 396 GLN n 
1 397 GLY n 
1 398 THR n 
1 399 LYS n 
1 400 MET n 
1 401 ILE n 
1 402 PRO n 
1 403 CYS n 
1 404 ASP n 
1 405 PHE n 
1 406 LEU n 
1 407 ILE n 
1 408 PRO n 
1 409 VAL n 
1 410 GLN n 
1 411 THR n 
1 412 GLN n 
1 413 HIS n 
1 414 PRO n 
1 415 ILE n 
1 416 ARG n 
1 417 LYS n 
1 418 GLY n 
1 419 LEU n 
1 420 HIS n 
1 421 HIS n 
1 422 LYS n 
1 423 ILE n 
1 424 LEU n 
1 425 LEU n 
1 426 ALA n 
1 427 ASN n 
1 428 PHE n 
1 429 LEU n 
1 430 ALA n 
1 431 GLN n 
1 432 THR n 
1 433 GLU n 
1 434 ALA n 
1 435 LEU n 
1 436 MET n 
1 437 LYS n 
1 438 GLY n 
1 439 LYS n 
1 440 SER n 
1 441 THR n 
1 442 GLU n 
1 443 GLU n 
1 444 ALA n 
1 445 ARG n 
1 446 LYS n 
1 447 GLU n 
1 448 LEU n 
1 449 GLN n 
1 450 ALA n 
1 451 ALA n 
1 452 GLY n 
1 453 LYS n 
1 454 SER n 
1 455 PRO n 
1 456 GLU n 
1 457 ASP n 
1 458 LEU n 
1 459 MET n 
1 460 LYS n 
1 461 LEU n 
1 462 LEU n 
1 463 PRO n 
1 464 HIS n 
1 465 LYS n 
1 466 VAL n 
1 467 PHE n 
1 468 GLU n 
1 469 GLY n 
1 470 ASN n 
1 471 ARG n 
1 472 PRO n 
1 473 THR n 
1 474 ASN n 
1 475 SER n 
1 476 ILE n 
1 477 VAL n 
1 478 PHE n 
1 479 THR n 
1 480 LYS n 
1 481 LEU n 
1 482 THR n 
1 483 PRO n 
1 484 PHE n 
1 485 ILE n 
1 486 LEU n 
1 487 GLY n 
1 488 ALA n 
1 489 LEU n 
1 490 ILE n 
1 491 ALA n 
1 492 MET n 
1 493 TYR n 
1 494 GLU n 
1 495 HIS n 
1 496 LYS n 
1 497 ILE n 
1 498 PHE n 
1 499 VAL n 
1 500 GLN n 
1 501 GLY n 
1 502 VAL n 
1 503 VAL n 
1 504 TRP n 
1 505 ASP n 
1 506 ILE n 
1 507 ASN n 
1 508 SER n 
1 509 PHE n 
1 510 ASP n 
1 511 GLN n 
1 512 TRP n 
1 513 GLY n 
1 514 VAL n 
1 515 GLU n 
1 516 LEU n 
1 517 GLY n 
1 518 LYS n 
1 519 GLN n 
1 520 LEU n 
1 521 ALA n 
1 522 LYS n 
1 523 LYS n 
1 524 ILE n 
1 525 GLU n 
1 526 PRO n 
1 527 GLU n 
1 528 LEU n 
1 529 ASP n 
1 530 GLY n 
1 531 SER n 
1 532 SER n 
1 533 PRO n 
1 534 VAL n 
1 535 THR n 
1 536 SER n 
1 537 HIS n 
1 538 ASP n 
1 539 SER n 
1 540 SER n 
1 541 THR n 
1 542 ASN n 
1 543 GLY n 
1 544 LEU n 
1 545 ILE n 
1 546 ASN n 
1 547 PHE n 
1 548 ILE n 
1 549 LYS n 
1 550 GLN n 
1 551 GLN n 
1 552 ARG n 
1 553 GLU n 
1 554 ALA n 
1 555 LYS n 
1 556 ILE n 
1 557 GLN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                rabbit 
_entity_src_nat.pdbx_organism_scientific   'Oryctolagus cuniculus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9986 
_entity_src_nat.genus                      Oryctolagus 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     'skeletal muscle' 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     Cytoplasmic 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G6PI_RABIT 
_struct_ref.pdbx_db_accession          Q9N1E2 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;AALTRNPQFQKLQQWHREHGSELNLRHLFDTDKERFNHFSLTLNTNHGHILLDYSKNLVTEEVMHMLLDLAKSRGVEAAR
ESMFNGEKINSTEDRAVLHVALRNRSNTPIVVDGKDVMPEVNKVLDKMKAFCQRVRSGDWKGYTGKTITDVINIGIGGSD
LGPLMVTEALKPYSSGGPRVWFVSNIDGTHIAKTLACLNPESSLFIIASKTFTTQETITNAETAKDWFLLSAKDPSTVAK
HFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLA
MLGIWYINCFGCETQAVLPYDQYLHRFAAYFQQGDMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKM
IPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKSTEEARKELQAAGKSPEDLMKLLPHKVFEGNRPTNSIVFTK
LTPFILGALIAMYEHKIFVQGVVWDINSFDQWGVELGKQLAKKIEPELDGSSPVTSHDSSTNGLINFIKQQREAKIQ
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KOJ A 1 ? 557 ? Q9N1E2 1 ? 557 ? 1 557 
2 1 1KOJ B 1 ? 557 ? Q9N1E2 1 ? 557 ? 1 557 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1KOJ LYS A 222 ? UNP Q9N1E2 GLU 222 CONFLICT 222 1 
2 1KOJ LYS B 222 ? UNP Q9N1E2 GLU 222 CONFLICT 222 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'  149.211 
PAN non-polymer         . '5-PHOSPHO-D-ARABINOHYDROXAMIC ACID' ? 'C5 H12 N O9 P'  261.124 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1KOJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   52.65 
_exptl_crystal.density_Matthews      2.60 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
;14% PEG 8000, 250mM magnesium acetate, 100 mM sodium cacodylate, pH 6.5, 
VAPOR DIFFUSION, HANGING DROP at 298K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           114 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2000-08-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    synchrotron 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-BM-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-BM-C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
# 
_reflns.entry_id                     1KOJ 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             25 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   96961 
_reflns.number_all                   96961 
_reflns.percent_possible_obs         93.4 
_reflns.pdbx_Rmerge_I_obs            0.0570000 
_reflns.pdbx_Rsym_value              0.0570000 
_reflns.pdbx_netI_over_sigmaI        23.1 
_reflns.B_iso_Wilson_estimate        35.98 
_reflns.pdbx_redundancy              4.1 
_reflns.R_free_details               ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.9 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   89.0 
_reflns_shell.Rmerge_I_obs           0.3270000 
_reflns_shell.pdbx_Rsym_value        0.3270000 
_reflns_shell.meanI_over_sigI_obs    4.0 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      9158 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1KOJ 
_refine.ls_number_reflns_obs                     94416 
_refine.ls_number_reflns_all                     94416 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             12. 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    92.1 
_refine.ls_R_factor_obs                          0.2230000 
_refine.ls_R_factor_all                          0.2230000 
_refine.ls_R_factor_R_work                       0.2200000 
_refine.ls_R_factor_R_free                       0.2540000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10. 
_refine.ls_number_reflns_R_free                  9418 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1DQR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       CNS 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1KOJ 
_refine_analyze.Luzzati_coordinate_error_obs    0.26 
_refine_analyze.Luzzati_sigma_a_obs             0.25 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.30 
_refine_analyze.Luzzati_sigma_a_free            0.27 
_refine_analyze.Luzzati_d_res_low_free          5.0 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8877 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             802 
_refine_hist.number_atoms_total               9711 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        12. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
10 1.90 1.97 . 0.3070000 . 0.3350000 . 10 860 8812 . . 'X-RAY DIFFRACTION' . 
10 1.97 2.05 . 0.2720000 . 0.2990000 . .  950 9597 . . 'X-RAY DIFFRACTION' . 
10 2.05 2.14 . 0.2640000 . 0.2940000 . .  946 9725 . . 'X-RAY DIFFRACTION' . 
10 2.14 2.25 . 0.2580000 . 0.2950000 . .  955 9810 . . 'X-RAY DIFFRACTION' . 
10 2.25 2.39 . 0.2420000 . 0.2950000 . .  961 9845 . . 'X-RAY DIFFRACTION' . 
10 2.39 2.57 . 0.2330000 . 0.2620000 . .  951 9756 . . 'X-RAY DIFFRACTION' . 
10 2.57 2.83 . 0.2340000 . 0.2770000 . .  982 9636 . . 'X-RAY DIFFRACTION' . 
10 2.83 3.23 . 0.2170000 . 0.2560000 . .  994 9628 . . 'X-RAY DIFFRACTION' . 
10 3.23 4.05 . 0.1970000 . 0.2290000 . .  929 9021 . . 'X-RAY DIFFRACTION' . 
10 4.05 12.0 . 0.1970000 . 0.2270000 . .  890 8586 . . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  1KOJ 
_struct.title                     
'Crystal structure of rabbit phosphoglucose isomerase complexed with 5-phospho-D-arabinonohydroxamic acid' 
_struct.pdbx_descriptor           'Glucose-6-phosphate isomerase (E.C.5.3.1.9)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KOJ 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            'protein - inhibitor complex, isomerase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 6   ? GLU A 18  ? ASN A 6   GLU A 18  1 ? 13 
HELX_P HELX_P2  2  ASN A 24  ? ASP A 30  ? ASN A 24  ASP A 30  1 ? 7  
HELX_P HELX_P3  3  GLU A 34  ? PHE A 39  ? GLU A 34  PHE A 39  1 ? 6  
HELX_P HELX_P4  4  THR A 60  ? ARG A 74  ? THR A 60  ARG A 74  1 ? 15 
HELX_P HELX_P5  5  GLY A 75  ? ASN A 85  ? GLY A 75  ASN A 85  1 ? 11 
HELX_P HELX_P6  6  ASN A 90  ? ASP A 94  ? ASN A 90  ASP A 94  5 ? 5  
HELX_P HELX_P7  7  LEU A 98  ? ARG A 103 ? LEU A 98  ARG A 103 1 ? 6  
HELX_P HELX_P8  8  VAL A 117 ? GLY A 138 ? VAL A 117 GLY A 138 1 ? 22 
HELX_P HELX_P9  9  ILE A 156 ? SER A 159 ? ILE A 156 SER A 159 5 ? 4  
HELX_P HELX_P10 10 ASP A 160 ? LEU A 170 ? ASP A 160 LEU A 170 1 ? 11 
HELX_P HELX_P11 11 LYS A 171 ? SER A 174 ? LYS A 171 SER A 174 5 ? 4  
HELX_P HELX_P12 12 ASP A 187 ? ALA A 196 ? ASP A 187 ALA A 196 1 ? 10 
HELX_P HELX_P13 13 CYS A 197 ? LEU A 198 ? CYS A 197 LEU A 198 5 ? 2  
HELX_P HELX_P14 14 ASN A 199 ? GLU A 201 ? ASN A 199 GLU A 201 5 ? 3  
HELX_P HELX_P15 15 THR A 214 ? LEU A 230 ? THR A 214 LEU A 230 1 ? 17 
HELX_P HELX_P16 16 SER A 236 ? LYS A 240 ? SER A 236 LYS A 240 5 ? 5  
HELX_P HELX_P17 17 ASN A 248 ? GLU A 254 ? ASN A 248 GLU A 254 1 ? 7  
HELX_P HELX_P18 18 ASP A 258 ? GLN A 260 ? ASP A 258 GLN A 260 5 ? 3  
HELX_P HELX_P19 19 GLY A 270 ? SER A 274 ? GLY A 270 SER A 274 5 ? 5  
HELX_P HELX_P20 20 SER A 277 ? ILE A 279 ? SER A 277 ILE A 279 5 ? 3  
HELX_P HELX_P21 21 GLY A 280 ? GLY A 288 ? GLY A 280 GLY A 288 1 ? 9  
HELX_P HELX_P22 22 GLY A 288 ? THR A 309 ? GLY A 288 THR A 309 1 ? 22 
HELX_P HELX_P23 23 PRO A 310 ? LYS A 313 ? PRO A 310 LYS A 313 5 ? 4  
HELX_P HELX_P24 24 ASN A 314 ? CYS A 329 ? ASN A 314 CYS A 329 1 ? 16 
HELX_P HELX_P25 25 ASP A 341 ? HIS A 345 ? ASP A 341 HIS A 345 5 ? 5  
HELX_P HELX_P26 26 ARG A 346 ? GLY A 360 ? ARG A 346 GLY A 360 1 ? 15 
HELX_P HELX_P27 27 THR A 384 ? ALA A 389 ? THR A 384 ALA A 389 5 ? 6  
HELX_P HELX_P28 28 PHE A 390 ? GLY A 397 ? PHE A 390 GLY A 397 1 ? 8  
HELX_P HELX_P29 29 PRO A 414 ? LYS A 417 ? PRO A 414 LYS A 417 5 ? 4  
HELX_P HELX_P30 30 GLY A 418 ? GLY A 438 ? GLY A 418 GLY A 438 1 ? 21 
HELX_P HELX_P31 31 SER A 440 ? ALA A 451 ? SER A 440 ALA A 451 1 ? 12 
HELX_P HELX_P32 32 SER A 454 ? LEU A 462 ? SER A 454 LEU A 462 1 ? 9  
HELX_P HELX_P33 33 PRO A 463 ? VAL A 466 ? PRO A 463 VAL A 466 5 ? 4  
HELX_P HELX_P34 34 THR A 482 ? ASP A 505 ? THR A 482 ASP A 505 1 ? 24 
HELX_P HELX_P35 35 GLN A 511 ? GLU A 515 ? GLN A 511 GLU A 515 5 ? 5  
HELX_P HELX_P36 36 LEU A 516 ? ALA A 521 ? LEU A 516 ALA A 521 1 ? 6  
HELX_P HELX_P37 37 GLU A 525 ? ASP A 529 ? GLU A 525 ASP A 529 5 ? 5  
HELX_P HELX_P38 38 ASP A 538 ? ARG A 552 ? ASP A 538 ARG A 552 1 ? 15 
HELX_P HELX_P39 39 ALA B 1   ? ASN B 6   ? ALA B 1   ASN B 6   1 ? 6  
HELX_P HELX_P40 40 ASN B 6   ? GLY B 20  ? ASN B 6   GLY B 20  1 ? 15 
HELX_P HELX_P41 41 ASN B 24  ? ASP B 32  ? ASN B 24  ASP B 32  1 ? 9  
HELX_P HELX_P42 42 GLU B 34  ? PHE B 39  ? GLU B 34  PHE B 39  1 ? 6  
HELX_P HELX_P43 43 THR B 60  ? ARG B 74  ? THR B 60  ARG B 74  1 ? 15 
HELX_P HELX_P44 44 GLY B 75  ? ASN B 85  ? GLY B 75  ASN B 85  1 ? 11 
HELX_P HELX_P45 45 LEU B 98  ? ARG B 103 ? LEU B 98  ARG B 103 1 ? 6  
HELX_P HELX_P46 46 VAL B 117 ? SER B 137 ? VAL B 117 SER B 137 1 ? 21 
HELX_P HELX_P47 47 ILE B 156 ? SER B 159 ? ILE B 156 SER B 159 5 ? 4  
HELX_P HELX_P48 48 ASP B 160 ? LEU B 170 ? ASP B 160 LEU B 170 1 ? 11 
HELX_P HELX_P49 49 LYS B 171 ? SER B 174 ? LYS B 171 SER B 174 5 ? 4  
HELX_P HELX_P50 50 ASP B 187 ? ALA B 196 ? ASP B 187 ALA B 196 1 ? 10 
HELX_P HELX_P51 51 CYS B 197 ? LEU B 198 ? CYS B 197 LEU B 198 5 ? 2  
HELX_P HELX_P52 52 ASN B 199 ? GLU B 201 ? ASN B 199 GLU B 201 5 ? 3  
HELX_P HELX_P53 53 THR B 214 ? LYS B 233 ? THR B 214 LYS B 233 1 ? 20 
HELX_P HELX_P54 54 ASP B 234 ? LYS B 240 ? ASP B 234 LYS B 240 5 ? 7  
HELX_P HELX_P55 55 ASN B 248 ? GLY B 256 ? ASN B 248 GLY B 256 1 ? 9  
HELX_P HELX_P56 56 GLY B 270 ? SER B 274 ? GLY B 270 SER B 274 5 ? 5  
HELX_P HELX_P57 57 SER B 277 ? ILE B 279 ? SER B 277 ILE B 279 5 ? 3  
HELX_P HELX_P58 58 GLY B 280 ? GLY B 288 ? GLY B 280 GLY B 288 1 ? 9  
HELX_P HELX_P59 59 GLY B 288 ? THR B 309 ? GLY B 288 THR B 309 1 ? 22 
HELX_P HELX_P60 60 PRO B 310 ? LYS B 313 ? PRO B 310 LYS B 313 5 ? 4  
HELX_P HELX_P61 61 ASN B 314 ? CYS B 329 ? ASN B 314 CYS B 329 1 ? 16 
HELX_P HELX_P62 62 ASP B 341 ? HIS B 345 ? ASP B 341 HIS B 345 5 ? 5  
HELX_P HELX_P63 63 ARG B 346 ? GLY B 360 ? ARG B 346 GLY B 360 1 ? 15 
HELX_P HELX_P64 64 THR B 384 ? ALA B 389 ? THR B 384 ALA B 389 5 ? 6  
HELX_P HELX_P65 65 PHE B 390 ? GLY B 397 ? PHE B 390 GLY B 397 1 ? 8  
HELX_P HELX_P66 66 PRO B 414 ? LYS B 417 ? PRO B 414 LYS B 417 5 ? 4  
HELX_P HELX_P67 67 GLY B 418 ? GLY B 438 ? GLY B 418 GLY B 438 1 ? 21 
HELX_P HELX_P68 68 SER B 440 ? ALA B 451 ? SER B 440 ALA B 451 1 ? 12 
HELX_P HELX_P69 69 SER B 454 ? LEU B 462 ? SER B 454 LEU B 462 1 ? 9  
HELX_P HELX_P70 70 PRO B 463 ? VAL B 466 ? PRO B 463 VAL B 466 5 ? 4  
HELX_P HELX_P71 71 THR B 482 ? ASP B 505 ? THR B 482 ASP B 505 1 ? 24 
HELX_P HELX_P72 72 GLN B 511 ? LYS B 518 ? GLN B 511 LYS B 518 1 ? 8  
HELX_P HELX_P73 73 LYS B 523 ? ASP B 529 ? LYS B 523 ASP B 529 1 ? 7  
HELX_P HELX_P74 74 ASP B 538 ? ALA B 554 ? ASP B 538 ALA B 554 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 383 A . ? GLY 383 A THR 384 A ? THR 384 A 1 11.42 
2 GLY 383 B . ? GLY 383 B THR 384 B ? THR 384 B 1 10.94 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 5 ? 
D ? 6 ? 
E ? 2 ? 
F ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 40  ? ASN A 44  ? SER A 40  ASN A 44  
A 2 HIS A 49  ? ASP A 53  ? HIS A 49  ASP A 53  
A 3 THR A 473 ? LYS A 480 ? THR A 473 LYS A 480 
A 4 CYS A 403 ? GLN A 410 ? CYS A 403 GLN A 410 
A 5 THR A 334 ? PRO A 339 ? THR A 334 PRO A 339 
A 6 ILE A 377 ? TRP A 379 ? ILE A 377 TRP A 379 
B 1 VAL A 111 ? VAL A 112 ? VAL A 111 VAL A 112 
B 2 LYS A 115 ? ASP A 116 ? LYS A 115 ASP A 116 
C 1 ARG A 179 ? VAL A 183 ? ARG A 179 VAL A 183 
C 2 ASP A 150 ? ILE A 154 ? ASP A 150 ILE A 154 
C 3 SER A 203 ? ALA A 208 ? SER A 203 ALA A 208 
C 4 PHE A 242 ? SER A 246 ? PHE A 242 SER A 246 
C 5 MET A 262 ? GLU A 264 ? MET A 262 GLU A 264 
D 1 SER B 40  ? ASN B 44  ? SER B 40  ASN B 44  
D 2 HIS B 49  ? ASP B 53  ? HIS B 49  ASP B 53  
D 3 THR B 473 ? LYS B 480 ? THR B 473 LYS B 480 
D 4 CYS B 403 ? GLN B 410 ? CYS B 403 GLN B 410 
D 5 THR B 334 ? PRO B 339 ? THR B 334 PRO B 339 
D 6 ILE B 377 ? TRP B 379 ? ILE B 377 TRP B 379 
E 1 VAL B 111 ? VAL B 112 ? VAL B 111 VAL B 112 
E 2 LYS B 115 ? ASP B 116 ? LYS B 115 ASP B 116 
F 1 ARG B 179 ? VAL B 183 ? ARG B 179 VAL B 183 
F 2 ASP B 150 ? ILE B 154 ? ASP B 150 ILE B 154 
F 3 SER B 203 ? ALA B 208 ? SER B 203 ALA B 208 
F 4 PHE B 242 ? SER B 246 ? PHE B 242 SER B 246 
F 5 MET B 262 ? GLU B 264 ? MET B 262 GLU B 264 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 43  ? N LEU A 43  O ILE A 50  ? O ILE A 50  
A 2 3 N LEU A 51  ? N LEU A 51  O VAL A 477 ? O VAL A 477 
A 3 4 O ILE A 476 ? O ILE A 476 N PHE A 405 ? N PHE A 405 
A 4 5 O ASP A 404 ? O ASP A 404 N LEU A 338 ? N LEU A 338 
A 5 6 N GLN A 335 ? N GLN A 335 O ILE A 377 ? O ILE A 377 
B 1 2 N VAL A 112 ? N VAL A 112 O LYS A 115 ? O LYS A 115 
C 1 2 O TRP A 181 ? O TRP A 181 N ASN A 153 ? N ASN A 153 
C 2 3 N ILE A 154 ? N ILE A 154 O ILE A 206 ? O ILE A 206 
C 3 4 N ILE A 207 ? N ILE A 207 O VAL A 243 ? O VAL A 243 
C 4 5 N ALA A 244 ? N ALA A 244 O PHE A 263 ? O PHE A 263 
D 1 2 N LEU B 41  ? N LEU B 41  O LEU B 52  ? O LEU B 52  
D 2 3 N LEU B 51  ? N LEU B 51  O VAL B 477 ? O VAL B 477 
D 3 4 O ILE B 476 ? O ILE B 476 N PHE B 405 ? N PHE B 405 
D 4 5 O ASP B 404 ? O ASP B 404 N LEU B 338 ? N LEU B 338 
D 5 6 N GLN B 335 ? N GLN B 335 O ILE B 377 ? O ILE B 377 
E 1 2 N VAL B 112 ? N VAL B 112 O LYS B 115 ? O LYS B 115 
F 1 2 O TRP B 181 ? O TRP B 181 N ASN B 153 ? N ASN B 153 
F 2 3 N ILE B 152 ? N ILE B 152 O ILE B 206 ? O ILE B 206 
F 3 4 N ILE B 207 ? N ILE B 207 O VAL B 243 ? O VAL B 243 
F 4 5 N ALA B 244 ? N ALA B 244 O PHE B 263 ? O PHE B 263 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE PAN B 901' 
AC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE PAN A 902' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 19 HIS A 388 ? HIS A 388  . ? 1_555 ? 
2  AC1 19 ILE B 156 ? ILE B 156  . ? 1_555 ? 
3  AC1 19 GLY B 157 ? GLY B 157  . ? 1_555 ? 
4  AC1 19 GLY B 158 ? GLY B 158  . ? 1_555 ? 
5  AC1 19 SER B 159 ? SER B 159  . ? 1_555 ? 
6  AC1 19 SER B 209 ? SER B 209  . ? 1_555 ? 
7  AC1 19 LYS B 210 ? LYS B 210  . ? 1_555 ? 
8  AC1 19 THR B 211 ? THR B 211  . ? 1_555 ? 
9  AC1 19 THR B 214 ? THR B 214  . ? 1_555 ? 
10 AC1 19 GLY B 271 ? GLY B 271  . ? 1_555 ? 
11 AC1 19 ARG B 272 ? ARG B 272  . ? 1_555 ? 
12 AC1 19 GLN B 353 ? GLN B 353  . ? 1_555 ? 
13 AC1 19 GLU B 357 ? GLU B 357  . ? 1_555 ? 
14 AC1 19 LYS B 518 ? LYS B 518  . ? 1_555 ? 
15 AC1 19 HOH F .   ? HOH B 948  . ? 1_555 ? 
16 AC1 19 HOH F .   ? HOH B 1015 . ? 1_555 ? 
17 AC1 19 HOH F .   ? HOH B 1094 . ? 1_555 ? 
18 AC1 19 HOH F .   ? HOH B 1130 . ? 1_555 ? 
19 AC1 19 HOH F .   ? HOH B 1159 . ? 1_555 ? 
20 AC2 18 ILE A 156 ? ILE A 156  . ? 1_555 ? 
21 AC2 18 GLY A 157 ? GLY A 157  . ? 1_555 ? 
22 AC2 18 GLY A 158 ? GLY A 158  . ? 1_555 ? 
23 AC2 18 SER A 159 ? SER A 159  . ? 1_555 ? 
24 AC2 18 SER A 209 ? SER A 209  . ? 1_555 ? 
25 AC2 18 LYS A 210 ? LYS A 210  . ? 1_555 ? 
26 AC2 18 THR A 211 ? THR A 211  . ? 1_555 ? 
27 AC2 18 THR A 214 ? THR A 214  . ? 1_555 ? 
28 AC2 18 GLY A 271 ? GLY A 271  . ? 1_555 ? 
29 AC2 18 ARG A 272 ? ARG A 272  . ? 1_555 ? 
30 AC2 18 GLN A 353 ? GLN A 353  . ? 1_555 ? 
31 AC2 18 GLU A 357 ? GLU A 357  . ? 1_555 ? 
32 AC2 18 LYS A 518 ? LYS A 518  . ? 1_555 ? 
33 AC2 18 HOH E .   ? HOH A 1011 . ? 1_555 ? 
34 AC2 18 HOH E .   ? HOH A 1012 . ? 1_555 ? 
35 AC2 18 HOH E .   ? HOH A 1082 . ? 1_555 ? 
36 AC2 18 HOH E .   ? HOH A 1225 . ? 1_555 ? 
37 AC2 18 HIS B 388 ? HIS B 388  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1KOJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KOJ 
_atom_sites.fract_transf_matrix[1][1]   0.012093 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008623 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003678 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? -2.959  26.948  25.811 1.00 74.94 ? 1    ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? -4.165  27.373  25.037 1.00 74.02 ? 1    ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? -3.771  27.832  23.639 1.00 73.61 ? 1    ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? -2.980  28.763  23.476 1.00 74.19 ? 1    ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? -4.890  28.492  25.777 1.00 74.49 ? 1    ALA A CB  1 
ATOM   6    N N   . ALA A 1 2   ? -4.344  27.169  22.642 1.00 72.09 ? 2    ALA A N   1 
ATOM   7    C CA  . ALA A 1 2   ? -4.095  27.460  21.238 1.00 69.78 ? 2    ALA A CA  1 
ATOM   8    C C   . ALA A 1 2   ? -5.062  26.581  20.467 1.00 68.17 ? 2    ALA A C   1 
ATOM   9    O O   . ALA A 1 2   ? -5.581  26.956  19.415 1.00 67.97 ? 2    ALA A O   1 
ATOM   10   C CB  . ALA A 1 2   ? -2.668  27.114  20.866 1.00 70.53 ? 2    ALA A CB  1 
ATOM   11   N N   . LEU A 1 3   ? -5.296  25.395  21.012 1.00 65.97 ? 3    LEU A N   1 
ATOM   12   C CA  . LEU A 1 3   ? -6.208  24.432  20.415 1.00 64.00 ? 3    LEU A CA  1 
ATOM   13   C C   . LEU A 1 3   ? -7.615  24.939  20.701 1.00 63.15 ? 3    LEU A C   1 
ATOM   14   O O   . LEU A 1 3   ? -8.531  24.769  19.898 1.00 61.84 ? 3    LEU A O   1 
ATOM   15   C CB  . LEU A 1 3   ? -6.009  23.062  21.069 1.00 63.31 ? 3    LEU A CB  1 
ATOM   16   C CG  . LEU A 1 3   ? -6.128  21.816  20.195 1.00 62.82 ? 3    LEU A CG  1 
ATOM   17   C CD1 . LEU A 1 3   ? -6.133  20.587  21.088 1.00 61.64 ? 3    LEU A CD1 1 
ATOM   18   C CD2 . LEU A 1 3   ? -7.390  21.871  19.364 1.00 62.10 ? 3    LEU A CD2 1 
ATOM   19   N N   . THR A 1 4   ? -7.763  25.572  21.861 1.00 63.27 ? 4    THR A N   1 
ATOM   20   C CA  . THR A 1 4   ? -9.037  26.123  22.301 1.00 63.24 ? 4    THR A CA  1 
ATOM   21   C C   . THR A 1 4   ? -9.549  27.181  21.331 1.00 62.61 ? 4    THR A C   1 
ATOM   22   O O   . THR A 1 4   ? -10.754 27.329  21.142 1.00 61.31 ? 4    THR A O   1 
ATOM   23   C CB  . THR A 1 4   ? -8.909  26.801  23.678 1.00 63.63 ? 4    THR A CB  1 
ATOM   24   O OG1 . THR A 1 4   ? -8.062  26.020  24.528 1.00 65.83 ? 4    THR A OG1 1 
ATOM   25   C CG2 . THR A 1 4   ? -10.277 26.940  24.322 1.00 64.02 ? 4    THR A CG2 1 
ATOM   26   N N   . ARG A 1 5   ? -8.621  27.913  20.724 1.00 62.94 ? 5    ARG A N   1 
ATOM   27   C CA  . ARG A 1 5   ? -8.963  28.982  19.791 1.00 63.42 ? 5    ARG A CA  1 
ATOM   28   C C   . ARG A 1 5   ? -9.156  28.509  18.346 1.00 61.44 ? 5    ARG A C   1 
ATOM   29   O O   . ARG A 1 5   ? -9.447  29.315  17.462 1.00 61.86 ? 5    ARG A O   1 
ATOM   30   C CB  . ARG A 1 5   ? -7.873  30.055  19.832 1.00 66.03 ? 5    ARG A CB  1 
ATOM   31   C CG  . ARG A 1 5   ? -6.510  29.536  19.402 1.00 69.60 ? 5    ARG A CG  1 
ATOM   32   C CD  . ARG A 1 5   ? -5.357  30.365  19.953 1.00 72.63 ? 5    ARG A CD  1 
ATOM   33   N NE  . ARG A 1 5   ? -4.155  30.209  19.136 1.00 74.63 ? 5    ARG A NE  1 
ATOM   34   C CZ  . ARG A 1 5   ? -2.978  30.762  19.415 1.00 75.17 ? 5    ARG A CZ  1 
ATOM   35   N NH1 . ARG A 1 5   ? -2.832  31.512  20.499 1.00 75.87 ? 5    ARG A NH1 1 
ATOM   36   N NH2 . ARG A 1 5   ? -1.946  30.574  18.601 1.00 74.74 ? 5    ARG A NH2 1 
ATOM   37   N N   . ASN A 1 6   ? -8.999  27.211  18.105 1.00 58.60 ? 6    ASN A N   1 
ATOM   38   C CA  . ASN A 1 6   ? -9.148  26.665  16.757 1.00 55.91 ? 6    ASN A CA  1 
ATOM   39   C C   . ASN A 1 6   ? -10.616 26.383  16.416 1.00 54.81 ? 6    ASN A C   1 
ATOM   40   O O   . ASN A 1 6   ? -11.314 25.691  17.156 1.00 54.61 ? 6    ASN A O   1 
ATOM   41   C CB  . ASN A 1 6   ? -8.312  25.387  16.628 1.00 53.38 ? 6    ASN A CB  1 
ATOM   42   C CG  . ASN A 1 6   ? -8.317  24.818  15.222 1.00 52.61 ? 6    ASN A CG  1 
ATOM   43   O OD1 . ASN A 1 6   ? -9.327  24.293  14.752 1.00 49.89 ? 6    ASN A OD1 1 
ATOM   44   N ND2 . ASN A 1 6   ? -7.180  24.919  14.542 1.00 51.07 ? 6    ASN A ND2 1 
ATOM   45   N N   . PRO A 1 7   ? -11.101 26.923  15.283 1.00 53.57 ? 7    PRO A N   1 
ATOM   46   C CA  . PRO A 1 7   ? -12.486 26.737  14.837 1.00 52.17 ? 7    PRO A CA  1 
ATOM   47   C C   . PRO A 1 7   ? -12.878 25.290  14.528 1.00 50.66 ? 7    PRO A C   1 
ATOM   48   O O   . PRO A 1 7   ? -14.018 24.892  14.758 1.00 49.77 ? 7    PRO A O   1 
ATOM   49   C CB  . PRO A 1 7   ? -12.581 27.655  13.616 1.00 52.12 ? 7    PRO A CB  1 
ATOM   50   C CG  . PRO A 1 7   ? -11.189 27.647  13.081 1.00 53.06 ? 7    PRO A CG  1 
ATOM   51   C CD  . PRO A 1 7   ? -10.357 27.770  14.334 1.00 53.51 ? 7    PRO A CD  1 
ATOM   52   N N   . GLN A 1 8   ? -11.946 24.507  13.995 1.00 50.40 ? 8    GLN A N   1 
ATOM   53   C CA  . GLN A 1 8   ? -12.247 23.110  13.704 1.00 49.61 ? 8    GLN A CA  1 
ATOM   54   C C   . GLN A 1 8   ? -12.478 22.385  15.029 1.00 48.13 ? 8    GLN A C   1 
ATOM   55   O O   . GLN A 1 8   ? -13.393 21.572  15.152 1.00 47.21 ? 8    GLN A O   1 
ATOM   56   C CB  . GLN A 1 8   ? -11.099 22.451  12.936 1.00 50.53 ? 8    GLN A CB  1 
ATOM   57   C CG  . GLN A 1 8   ? -11.046 22.815  11.457 1.00 50.97 ? 8    GLN A CG  1 
ATOM   58   C CD  . GLN A 1 8   ? -10.899 24.306  11.226 1.00 52.29 ? 8    GLN A CD  1 
ATOM   59   O OE1 . GLN A 1 8   ? -9.923  24.919  11.659 1.00 51.29 ? 8    GLN A OE1 1 
ATOM   60   N NE2 . GLN A 1 8   ? -11.872 24.899  10.539 1.00 51.06 ? 8    GLN A NE2 1 
ATOM   61   N N   . PHE A 1 9   ? -11.651 22.701  16.022 1.00 47.20 ? 9    PHE A N   1 
ATOM   62   C CA  . PHE A 1 9   ? -11.772 22.090  17.343 1.00 47.83 ? 9    PHE A CA  1 
ATOM   63   C C   . PHE A 1 9   ? -13.108 22.466  17.979 1.00 48.19 ? 9    PHE A C   1 
ATOM   64   O O   . PHE A 1 9   ? -13.740 21.652  18.653 1.00 47.52 ? 9    PHE A O   1 
ATOM   65   C CB  . PHE A 1 9   ? -10.640 22.555  18.258 1.00 47.16 ? 9    PHE A CB  1 
ATOM   66   C CG  . PHE A 1 9   ? -10.695 21.952  19.635 1.00 48.06 ? 9    PHE A CG  1 
ATOM   67   C CD1 . PHE A 1 9   ? -10.327 20.625  19.844 1.00 48.63 ? 9    PHE A CD1 1 
ATOM   68   C CD2 . PHE A 1 9   ? -11.153 22.696  20.717 1.00 48.23 ? 9    PHE A CD2 1 
ATOM   69   C CE1 . PHE A 1 9   ? -10.415 20.048  21.110 1.00 48.73 ? 9    PHE A CE1 1 
ATOM   70   C CE2 . PHE A 1 9   ? -11.245 22.130  21.987 1.00 49.56 ? 9    PHE A CE2 1 
ATOM   71   C CZ  . PHE A 1 9   ? -10.875 20.801  22.183 1.00 48.71 ? 9    PHE A CZ  1 
ATOM   72   N N   . GLN A 1 10  ? -13.527 23.711  17.772 1.00 48.55 ? 10   GLN A N   1 
ATOM   73   C CA  . GLN A 1 10  ? -14.789 24.188  18.324 1.00 49.21 ? 10   GLN A CA  1 
ATOM   74   C C   . GLN A 1 10  ? -15.941 23.465  17.636 1.00 48.53 ? 10   GLN A C   1 
ATOM   75   O O   . GLN A 1 10  ? -16.932 23.099  18.272 1.00 47.72 ? 10   GLN A O   1 
ATOM   76   C CB  . GLN A 1 10  ? -14.914 25.704  18.122 1.00 50.82 ? 10   GLN A CB  1 
ATOM   77   C CG  . GLN A 1 10  ? -13.780 26.495  18.761 1.00 53.88 ? 10   GLN A CG  1 
ATOM   78   C CD  . GLN A 1 10  ? -13.930 27.998  18.590 1.00 55.74 ? 10   GLN A CD  1 
ATOM   79   O OE1 . GLN A 1 10  ? -14.056 28.498  17.472 1.00 56.53 ? 10   GLN A OE1 1 
ATOM   80   N NE2 . GLN A 1 10  ? -13.910 28.725  19.702 1.00 55.97 ? 10   GLN A NE2 1 
ATOM   81   N N   . LYS A 1 11  ? -15.797 23.257  16.332 1.00 47.79 ? 11   LYS A N   1 
ATOM   82   C CA  . LYS A 1 11  ? -16.812 22.568  15.547 1.00 49.94 ? 11   LYS A CA  1 
ATOM   83   C C   . LYS A 1 11  ? -16.981 21.158  16.115 1.00 49.93 ? 11   LYS A C   1 
ATOM   84   O O   . LYS A 1 11  ? -18.101 20.693  16.344 1.00 50.23 ? 11   LYS A O   1 
ATOM   85   C CB  . LYS A 1 11  ? -16.372 22.497  14.079 1.00 49.68 ? 11   LYS A CB  1 
ATOM   86   C CG  . LYS A 1 11  ? -17.475 22.143  13.093 1.00 50.61 ? 11   LYS A CG  1 
ATOM   87   C CD  . LYS A 1 11  ? -16.941 22.133  11.666 1.00 51.17 ? 11   LYS A CD  1 
ATOM   88   C CE  . LYS A 1 11  ? -18.062 22.090  10.635 1.00 51.25 ? 11   LYS A CE  1 
ATOM   89   N NZ  . LYS A 1 11  ? -18.927 20.884  10.775 1.00 52.97 ? 11   LYS A NZ  1 
ATOM   90   N N   . LEU A 1 12  ? -15.855 20.489  16.346 1.00 49.79 ? 12   LEU A N   1 
ATOM   91   C CA  . LEU A 1 12  ? -15.855 19.139  16.894 1.00 49.53 ? 12   LEU A CA  1 
ATOM   92   C C   . LEU A 1 12  ? -16.601 19.076  18.218 1.00 50.12 ? 12   LEU A C   1 
ATOM   93   O O   . LEU A 1 12  ? -17.498 18.250  18.393 1.00 49.23 ? 12   LEU A O   1 
ATOM   94   C CB  . LEU A 1 12  ? -14.419 18.647  17.102 1.00 49.28 ? 12   LEU A CB  1 
ATOM   95   C CG  . LEU A 1 12  ? -13.920 17.574  16.135 1.00 50.05 ? 12   LEU A CG  1 
ATOM   96   C CD1 . LEU A 1 12  ? -12.510 17.154  16.516 1.00 51.66 ? 12   LEU A CD1 1 
ATOM   97   C CD2 . LEU A 1 12  ? -14.856 16.380  16.179 1.00 49.59 ? 12   LEU A CD2 1 
ATOM   98   N N   . GLN A 1 13  ? -16.229 19.953  19.146 1.00 49.52 ? 13   GLN A N   1 
ATOM   99   C CA  . GLN A 1 13  ? -16.860 19.985  20.457 1.00 50.74 ? 13   GLN A CA  1 
ATOM   100  C C   . GLN A 1 13  ? -18.356 20.259  20.403 1.00 50.85 ? 13   GLN A C   1 
ATOM   101  O O   . GLN A 1 13  ? -19.128 19.626  21.115 1.00 48.50 ? 13   GLN A O   1 
ATOM   102  C CB  . GLN A 1 13  ? -16.178 21.020  21.360 1.00 52.15 ? 13   GLN A CB  1 
ATOM   103  C CG  . GLN A 1 13  ? -14.718 20.703  21.660 1.00 54.96 ? 13   GLN A CG  1 
ATOM   104  C CD  . GLN A 1 13  ? -14.248 21.247  23.002 1.00 57.27 ? 13   GLN A CD  1 
ATOM   105  O OE1 . GLN A 1 13  ? -14.294 22.453  23.253 1.00 58.60 ? 13   GLN A OE1 1 
ATOM   106  N NE2 . GLN A 1 13  ? -13.788 20.353  23.872 1.00 59.07 ? 13   GLN A NE2 1 
ATOM   107  N N   . GLN A 1 14  ? -18.773 21.200  19.561 1.00 52.52 ? 14   GLN A N   1 
ATOM   108  C CA  . GLN A 1 14  ? -20.193 21.515  19.463 1.00 54.33 ? 14   GLN A CA  1 
ATOM   109  C C   . GLN A 1 14  ? -20.964 20.291  18.988 1.00 54.03 ? 14   GLN A C   1 
ATOM   110  O O   . GLN A 1 14  ? -22.024 19.963  19.524 1.00 53.30 ? 14   GLN A O   1 
ATOM   111  C CB  . GLN A 1 14  ? -20.422 22.682  18.497 1.00 55.88 ? 14   GLN A CB  1 
ATOM   112  C CG  . GLN A 1 14  ? -21.855 23.193  18.489 1.00 59.27 ? 14   GLN A CG  1 
ATOM   113  C CD  . GLN A 1 14  ? -22.350 23.578  19.878 1.00 61.67 ? 14   GLN A CD  1 
ATOM   114  O OE1 . GLN A 1 14  ? -21.812 24.489  20.514 1.00 63.65 ? 14   GLN A OE1 1 
ATOM   115  N NE2 . GLN A 1 14  ? -23.377 22.881  20.356 1.00 61.76 ? 14   GLN A NE2 1 
ATOM   116  N N   . TRP A 1 15  ? -20.418 19.617  17.982 1.00 54.89 ? 15   TRP A N   1 
ATOM   117  C CA  . TRP A 1 15  ? -21.039 18.424  17.427 1.00 56.56 ? 15   TRP A CA  1 
ATOM   118  C C   . TRP A 1 15  ? -21.173 17.351  18.506 1.00 56.78 ? 15   TRP A C   1 
ATOM   119  O O   . TRP A 1 15  ? -22.251 16.792  18.712 1.00 56.99 ? 15   TRP A O   1 
ATOM   120  C CB  . TRP A 1 15  ? -20.193 17.878  16.279 1.00 57.10 ? 15   TRP A CB  1 
ATOM   121  C CG  . TRP A 1 15  ? -20.874 16.804  15.501 1.00 59.09 ? 15   TRP A CG  1 
ATOM   122  C CD1 . TRP A 1 15  ? -21.666 16.965  14.401 1.00 59.39 ? 15   TRP A CD1 1 
ATOM   123  C CD2 . TRP A 1 15  ? -20.852 15.398  15.777 1.00 60.11 ? 15   TRP A CD2 1 
ATOM   124  N NE1 . TRP A 1 15  ? -22.140 15.748  13.975 1.00 60.75 ? 15   TRP A NE1 1 
ATOM   125  C CE2 . TRP A 1 15  ? -21.658 14.769  14.802 1.00 60.78 ? 15   TRP A CE2 1 
ATOM   126  C CE3 . TRP A 1 15  ? -20.234 14.609  16.758 1.00 59.61 ? 15   TRP A CE3 1 
ATOM   127  C CZ2 . TRP A 1 15  ? -21.859 13.383  14.776 1.00 60.70 ? 15   TRP A CZ2 1 
ATOM   128  C CZ3 . TRP A 1 15  ? -20.436 13.230  16.732 1.00 59.48 ? 15   TRP A CZ3 1 
ATOM   129  C CH2 . TRP A 1 15  ? -21.244 12.634  15.748 1.00 60.06 ? 15   TRP A CH2 1 
ATOM   130  N N   . HIS A 1 16  ? -20.069 17.069  19.190 1.00 57.26 ? 16   HIS A N   1 
ATOM   131  C CA  . HIS A 1 16  ? -20.060 16.059  20.243 1.00 58.36 ? 16   HIS A CA  1 
ATOM   132  C C   . HIS A 1 16  ? -20.908 16.484  21.430 1.00 59.71 ? 16   HIS A C   1 
ATOM   133  O O   . HIS A 1 16  ? -21.590 15.664  22.039 1.00 58.83 ? 16   HIS A O   1 
ATOM   134  C CB  . HIS A 1 16  ? -18.624 15.785  20.709 1.00 57.62 ? 16   HIS A CB  1 
ATOM   135  C CG  . HIS A 1 16  ? -18.528 14.796  21.832 1.00 57.16 ? 16   HIS A CG  1 
ATOM   136  N ND1 . HIS A 1 16  ? -18.921 15.090  23.120 1.00 57.30 ? 16   HIS A ND1 1 
ATOM   137  C CD2 . HIS A 1 16  ? -18.107 13.509  21.853 1.00 57.35 ? 16   HIS A CD2 1 
ATOM   138  C CE1 . HIS A 1 16  ? -18.746 14.028  23.886 1.00 57.34 ? 16   HIS A CE1 1 
ATOM   139  N NE2 . HIS A 1 16  ? -18.253 13.054  23.141 1.00 56.67 ? 16   HIS A NE2 1 
ATOM   140  N N   . ARG A 1 17  ? -20.867 17.773  21.749 1.00 62.07 ? 17   ARG A N   1 
ATOM   141  C CA  . ARG A 1 17  ? -21.622 18.309  22.872 1.00 65.56 ? 17   ARG A CA  1 
ATOM   142  C C   . ARG A 1 17  ? -23.079 17.861  22.848 1.00 67.24 ? 17   ARG A C   1 
ATOM   143  O O   . ARG A 1 17  ? -23.662 17.577  23.895 1.00 67.86 ? 17   ARG A O   1 
ATOM   144  C CB  . ARG A 1 17  ? -21.564 19.838  22.871 1.00 65.74 ? 17   ARG A CB  1 
ATOM   145  C CG  . ARG A 1 17  ? -21.056 20.442  24.171 1.00 66.93 ? 17   ARG A CG  1 
ATOM   146  C CD  . ARG A 1 17  ? -21.447 21.909  24.282 1.00 68.26 ? 17   ARG A CD  1 
ATOM   147  N NE  . ARG A 1 17  ? -21.002 22.703  23.138 1.00 69.49 ? 17   ARG A NE  1 
ATOM   148  C CZ  . ARG A 1 17  ? -19.742 23.066  22.913 1.00 70.27 ? 17   ARG A CZ  1 
ATOM   149  N NH1 . ARG A 1 17  ? -18.781 22.707  23.756 1.00 70.37 ? 17   ARG A NH1 1 
ATOM   150  N NH2 . ARG A 1 17  ? -19.443 23.796  21.846 1.00 69.35 ? 17   ARG A NH2 1 
ATOM   151  N N   . GLU A 1 18  ? -23.662 17.794  21.654 1.00 69.52 ? 18   GLU A N   1 
ATOM   152  C CA  . GLU A 1 18  ? -25.058 17.392  21.518 1.00 72.39 ? 18   GLU A CA  1 
ATOM   153  C C   . GLU A 1 18  ? -25.293 16.156  20.652 1.00 73.35 ? 18   GLU A C   1 
ATOM   154  O O   . GLU A 1 18  ? -26.426 15.879  20.260 1.00 73.81 ? 18   GLU A O   1 
ATOM   155  C CB  . GLU A 1 18  ? -25.885 18.564  20.980 1.00 74.04 ? 18   GLU A CB  1 
ATOM   156  C CG  . GLU A 1 18  ? -26.136 19.664  22.007 1.00 76.45 ? 18   GLU A CG  1 
ATOM   157  C CD  . GLU A 1 18  ? -27.164 19.270  23.060 1.00 77.50 ? 18   GLU A CD  1 
ATOM   158  O OE1 . GLU A 1 18  ? -27.048 18.164  23.633 1.00 78.05 ? 18   GLU A OE1 1 
ATOM   159  O OE2 . GLU A 1 18  ? -28.086 20.073  23.318 1.00 78.73 ? 18   GLU A OE2 1 
ATOM   160  N N   . HIS A 1 19  ? -24.231 15.411  20.362 1.00 74.13 ? 19   HIS A N   1 
ATOM   161  C CA  . HIS A 1 19  ? -24.352 14.202  19.551 1.00 74.38 ? 19   HIS A CA  1 
ATOM   162  C C   . HIS A 1 19  ? -23.377 13.104  19.955 1.00 73.74 ? 19   HIS A C   1 
ATOM   163  O O   . HIS A 1 19  ? -23.696 11.919  19.859 1.00 73.61 ? 19   HIS A O   1 
ATOM   164  C CB  . HIS A 1 19  ? -24.156 14.529  18.069 1.00 75.73 ? 19   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 19  ? -25.424 14.872  17.356 1.00 77.12 ? 19   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 19  ? -26.505 14.017  17.312 1.00 78.05 ? 19   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 19  ? -25.782 15.968  16.645 1.00 77.88 ? 19   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 19  ? -27.474 14.572  16.606 1.00 78.88 ? 19   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 19  ? -27.061 15.756  16.190 1.00 78.17 ? 19   HIS A NE2 1 
ATOM   170  N N   . GLY A 1 20  ? -22.191 13.502  20.401 1.00 73.48 ? 20   GLY A N   1 
ATOM   171  C CA  . GLY A 1 20  ? -21.185 12.538  20.807 1.00 73.42 ? 20   GLY A CA  1 
ATOM   172  C C   . GLY A 1 20  ? -21.541 11.834  22.100 1.00 73.36 ? 20   GLY A C   1 
ATOM   173  O O   . GLY A 1 20  ? -20.737 11.776  23.032 1.00 74.10 ? 20   GLY A O   1 
ATOM   174  N N   . SER A 1 21  ? -22.754 11.298  22.152 1.00 72.37 ? 21   SER A N   1 
ATOM   175  C CA  . SER A 1 21  ? -23.244 10.593  23.326 1.00 71.25 ? 21   SER A CA  1 
ATOM   176  C C   . SER A 1 21  ? -24.329 9.625   22.875 1.00 70.44 ? 21   SER A C   1 
ATOM   177  O O   . SER A 1 21  ? -24.712 8.712   23.606 1.00 70.55 ? 21   SER A O   1 
ATOM   178  C CB  . SER A 1 21  ? -23.814 11.588  24.338 1.00 71.71 ? 21   SER A CB  1 
ATOM   179  O OG  . SER A 1 21  ? -24.205 10.938  25.532 1.00 72.56 ? 21   SER A OG  1 
ATOM   180  N N   . GLU A 1 22  ? -24.820 9.837   21.660 1.00 69.04 ? 22   GLU A N   1 
ATOM   181  C CA  . GLU A 1 22  ? -25.850 8.981   21.093 1.00 67.87 ? 22   GLU A CA  1 
ATOM   182  C C   . GLU A 1 22  ? -25.185 7.939   20.201 1.00 65.43 ? 22   GLU A C   1 
ATOM   183  O O   . GLU A 1 22  ? -25.807 6.949   19.815 1.00 66.58 ? 22   GLU A O   1 
ATOM   184  C CB  . GLU A 1 22  ? -26.840 9.806   20.271 1.00 68.97 ? 22   GLU A CB  1 
ATOM   185  C CG  . GLU A 1 22  ? -28.001 8.994   19.721 1.00 71.34 ? 22   GLU A CG  1 
ATOM   186  C CD  . GLU A 1 22  ? -28.974 9.834   18.920 1.00 73.51 ? 22   GLU A CD  1 
ATOM   187  O OE1 . GLU A 1 22  ? -29.484 10.837  19.464 1.00 74.28 ? 22   GLU A OE1 1 
ATOM   188  O OE2 . GLU A 1 22  ? -29.231 9.489   17.747 1.00 74.26 ? 22   GLU A OE2 1 
ATOM   189  N N   . LEU A 1 23  ? -23.918 8.178   19.876 1.00 61.82 ? 23   LEU A N   1 
ATOM   190  C CA  . LEU A 1 23  ? -23.149 7.267   19.035 1.00 57.70 ? 23   LEU A CA  1 
ATOM   191  C C   . LEU A 1 23  ? -23.129 5.881   19.665 1.00 55.91 ? 23   LEU A C   1 
ATOM   192  O O   . LEU A 1 23  ? -22.532 5.683   20.722 1.00 56.30 ? 23   LEU A O   1 
ATOM   193  C CB  . LEU A 1 23  ? -21.713 7.774   18.881 1.00 56.04 ? 23   LEU A CB  1 
ATOM   194  C CG  . LEU A 1 23  ? -21.485 9.043   18.059 1.00 55.31 ? 23   LEU A CG  1 
ATOM   195  C CD1 . LEU A 1 23  ? -20.058 9.534   18.240 1.00 53.69 ? 23   LEU A CD1 1 
ATOM   196  C CD2 . LEU A 1 23  ? -21.770 8.749   16.597 1.00 55.43 ? 23   LEU A CD2 1 
ATOM   197  N N   . ASN A 1 24  ? -23.786 4.926   19.017 1.00 53.41 ? 24   ASN A N   1 
ATOM   198  C CA  . ASN A 1 24  ? -23.835 3.563   19.526 1.00 51.29 ? 24   ASN A CA  1 
ATOM   199  C C   . ASN A 1 24  ? -23.285 2.586   18.496 1.00 48.47 ? 24   ASN A C   1 
ATOM   200  O O   . ASN A 1 24  ? -23.900 2.349   17.456 1.00 48.78 ? 24   ASN A O   1 
ATOM   201  C CB  . ASN A 1 24  ? -25.272 3.194   19.902 1.00 52.05 ? 24   ASN A CB  1 
ATOM   202  C CG  . ASN A 1 24  ? -25.369 1.828   20.554 1.00 52.92 ? 24   ASN A CG  1 
ATOM   203  O OD1 . ASN A 1 24  ? -25.367 0.800   19.875 1.00 52.28 ? 24   ASN A OD1 1 
ATOM   204  N ND2 . ASN A 1 24  ? -25.440 1.810   21.882 1.00 51.79 ? 24   ASN A ND2 1 
ATOM   205  N N   . LEU A 1 25  ? -22.118 2.027   18.798 1.00 46.16 ? 25   LEU A N   1 
ATOM   206  C CA  . LEU A 1 25  ? -21.437 1.082   17.917 1.00 44.31 ? 25   LEU A CA  1 
ATOM   207  C C   . LEU A 1 25  ? -22.320 0.003   17.304 1.00 44.69 ? 25   LEU A C   1 
ATOM   208  O O   . LEU A 1 25  ? -22.325 -0.185  16.089 1.00 43.52 ? 25   LEU A O   1 
ATOM   209  C CB  . LEU A 1 25  ? -20.282 0.409   18.665 1.00 44.84 ? 25   LEU A CB  1 
ATOM   210  C CG  . LEU A 1 25  ? -19.068 1.271   19.019 1.00 43.77 ? 25   LEU A CG  1 
ATOM   211  C CD1 . LEU A 1 25  ? -18.090 0.470   19.876 1.00 43.98 ? 25   LEU A CD1 1 
ATOM   212  C CD2 . LEU A 1 25  ? -18.395 1.733   17.743 1.00 43.41 ? 25   LEU A CD2 1 
ATOM   213  N N   . ARG A 1 26  ? -23.063 -0.715  18.135 1.00 45.70 ? 26   ARG A N   1 
ATOM   214  C CA  . ARG A 1 26  ? -23.911 -1.776  17.614 1.00 48.86 ? 26   ARG A CA  1 
ATOM   215  C C   . ARG A 1 26  ? -24.870 -1.232  16.554 1.00 49.50 ? 26   ARG A C   1 
ATOM   216  O O   . ARG A 1 26  ? -25.146 -1.896  15.555 1.00 48.69 ? 26   ARG A O   1 
ATOM   217  C CB  . ARG A 1 26  ? -24.682 -2.451  18.754 1.00 50.07 ? 26   ARG A CB  1 
ATOM   218  C CG  . ARG A 1 26  ? -25.293 -3.778  18.357 1.00 53.38 ? 26   ARG A CG  1 
ATOM   219  C CD  . ARG A 1 26  ? -25.776 -4.579  19.552 1.00 54.61 ? 26   ARG A CD  1 
ATOM   220  N NE  . ARG A 1 26  ? -26.196 -5.917  19.141 1.00 58.97 ? 26   ARG A NE  1 
ATOM   221  C CZ  . ARG A 1 26  ? -26.617 -6.866  19.973 1.00 60.07 ? 26   ARG A CZ  1 
ATOM   222  N NH1 . ARG A 1 26  ? -26.678 -6.632  21.278 1.00 60.50 ? 26   ARG A NH1 1 
ATOM   223  N NH2 . ARG A 1 26  ? -26.976 -8.052  19.499 1.00 62.44 ? 26   ARG A NH2 1 
ATOM   224  N N   . HIS A 1 27  ? -25.354 -0.010  16.762 1.00 49.57 ? 27   HIS A N   1 
ATOM   225  C CA  . HIS A 1 27  ? -26.278 0.612   15.819 1.00 49.81 ? 27   HIS A CA  1 
ATOM   226  C C   . HIS A 1 27  ? -25.579 0.995   14.517 1.00 49.66 ? 27   HIS A C   1 
ATOM   227  O O   . HIS A 1 27  ? -26.133 0.824   13.424 1.00 48.15 ? 27   HIS A O   1 
ATOM   228  C CB  . HIS A 1 27  ? -26.915 1.857   16.444 1.00 52.29 ? 27   HIS A CB  1 
ATOM   229  C CG  . HIS A 1 27  ? -27.879 2.558   15.539 1.00 54.34 ? 27   HIS A CG  1 
ATOM   230  N ND1 . HIS A 1 27  ? -29.003 1.944   15.031 1.00 55.82 ? 27   HIS A ND1 1 
ATOM   231  C CD2 . HIS A 1 27  ? -27.881 3.819   15.043 1.00 55.64 ? 27   HIS A CD2 1 
ATOM   232  C CE1 . HIS A 1 27  ? -29.657 2.796   14.260 1.00 56.54 ? 27   HIS A CE1 1 
ATOM   233  N NE2 . HIS A 1 27  ? -28.997 3.940   14.250 1.00 56.39 ? 27   HIS A NE2 1 
ATOM   234  N N   . LEU A 1 28  ? -24.362 1.513   14.638 1.00 47.47 ? 28   LEU A N   1 
ATOM   235  C CA  . LEU A 1 28  ? -23.594 1.918   13.472 1.00 49.18 ? 28   LEU A CA  1 
ATOM   236  C C   . LEU A 1 28  ? -23.334 0.740   12.540 1.00 49.09 ? 28   LEU A C   1 
ATOM   237  O O   . LEU A 1 28  ? -23.381 0.891   11.322 1.00 48.69 ? 28   LEU A O   1 
ATOM   238  C CB  . LEU A 1 28  ? -22.269 2.559   13.906 1.00 49.08 ? 28   LEU A CB  1 
ATOM   239  C CG  . LEU A 1 28  ? -22.385 3.898   14.643 1.00 50.56 ? 28   LEU A CG  1 
ATOM   240  C CD1 . LEU A 1 28  ? -21.015 4.352   15.129 1.00 50.19 ? 28   LEU A CD1 1 
ATOM   241  C CD2 . LEU A 1 28  ? -22.990 4.941   13.713 1.00 50.95 ? 28   LEU A CD2 1 
ATOM   242  N N   . PHE A 1 29  ? -23.069 -0.436  13.105 1.00 49.33 ? 29   PHE A N   1 
ATOM   243  C CA  . PHE A 1 29  ? -22.816 -1.612  12.279 1.00 49.63 ? 29   PHE A CA  1 
ATOM   244  C C   . PHE A 1 29  ? -24.093 -2.152  11.636 1.00 51.64 ? 29   PHE A C   1 
ATOM   245  O O   . PHE A 1 29  ? -24.077 -2.588  10.484 1.00 49.26 ? 29   PHE A O   1 
ATOM   246  C CB  . PHE A 1 29  ? -22.155 -2.724  13.100 1.00 47.35 ? 29   PHE A CB  1 
ATOM   247  C CG  . PHE A 1 29  ? -20.693 -2.505  13.346 1.00 45.88 ? 29   PHE A CG  1 
ATOM   248  C CD1 . PHE A 1 29  ? -20.255 -1.800  14.464 1.00 44.24 ? 29   PHE A CD1 1 
ATOM   249  C CD2 . PHE A 1 29  ? -19.750 -2.979  12.440 1.00 43.44 ? 29   PHE A CD2 1 
ATOM   250  C CE1 . PHE A 1 29  ? -18.900 -1.571  14.676 1.00 42.62 ? 29   PHE A CE1 1 
ATOM   251  C CE2 . PHE A 1 29  ? -18.386 -2.753  12.644 1.00 44.88 ? 29   PHE A CE2 1 
ATOM   252  C CZ  . PHE A 1 29  ? -17.963 -2.046  13.765 1.00 42.09 ? 29   PHE A CZ  1 
ATOM   253  N N   . ASP A 1 30  ? -25.191 -2.119  12.388 1.00 54.08 ? 30   ASP A N   1 
ATOM   254  C CA  . ASP A 1 30  ? -26.479 -2.605  11.903 1.00 57.77 ? 30   ASP A CA  1 
ATOM   255  C C   . ASP A 1 30  ? -27.197 -1.595  11.011 1.00 59.21 ? 30   ASP A C   1 
ATOM   256  O O   . ASP A 1 30  ? -28.430 -1.528  11.009 1.00 61.36 ? 30   ASP A O   1 
ATOM   257  C CB  . ASP A 1 30  ? -27.388 -2.951  13.080 1.00 59.16 ? 30   ASP A CB  1 
ATOM   258  C CG  . ASP A 1 30  ? -26.816 -4.038  13.957 1.00 61.72 ? 30   ASP A CG  1 
ATOM   259  O OD1 . ASP A 1 30  ? -27.508 -4.448  14.911 1.00 62.93 ? 30   ASP A OD1 1 
ATOM   260  O OD2 . ASP A 1 30  ? -25.676 -4.481  13.695 1.00 64.65 ? 30   ASP A OD2 1 
ATOM   261  N N   . THR A 1 31  ? -26.433 -0.810  10.260 1.00 59.09 ? 31   THR A N   1 
ATOM   262  C CA  . THR A 1 31  ? -27.013 0.190   9.368  1.00 58.81 ? 31   THR A CA  1 
ATOM   263  C C   . THR A 1 31  ? -25.998 0.549   8.285  1.00 58.52 ? 31   THR A C   1 
ATOM   264  O O   . THR A 1 31  ? -26.233 1.422   7.449  1.00 58.00 ? 31   THR A O   1 
ATOM   265  C CB  . THR A 1 31  ? -27.428 1.460   10.160 1.00 59.58 ? 31   THR A CB  1 
ATOM   266  O OG1 . THR A 1 31  ? -28.368 1.097   11.180 1.00 59.95 ? 31   THR A OG1 1 
ATOM   267  C CG2 . THR A 1 31  ? -28.083 2.487   9.242  1.00 60.09 ? 31   THR A CG2 1 
ATOM   268  N N   . ASP A 1 32  ? -24.867 -0.147  8.303  1.00 57.82 ? 32   ASP A N   1 
ATOM   269  C CA  . ASP A 1 32  ? -23.809 0.079   7.329  1.00 57.93 ? 32   ASP A CA  1 
ATOM   270  C C   . ASP A 1 32  ? -22.969 -1.182  7.208  1.00 57.87 ? 32   ASP A C   1 
ATOM   271  O O   . ASP A 1 32  ? -22.119 -1.454  8.054  1.00 57.61 ? 32   ASP A O   1 
ATOM   272  C CB  . ASP A 1 32  ? -22.938 1.262   7.762  1.00 58.37 ? 32   ASP A CB  1 
ATOM   273  C CG  . ASP A 1 32  ? -21.761 1.498   6.830  1.00 59.53 ? 32   ASP A CG  1 
ATOM   274  O OD1 . ASP A 1 32  ? -21.814 1.050   5.663  1.00 59.26 ? 32   ASP A OD1 1 
ATOM   275  O OD2 . ASP A 1 32  ? -20.784 2.148   7.263  1.00 60.10 ? 32   ASP A OD2 1 
ATOM   276  N N   . LYS A 1 33  ? -23.221 -1.949  6.151  1.00 56.65 ? 33   LYS A N   1 
ATOM   277  C CA  . LYS A 1 33  ? -22.509 -3.198  5.909  1.00 55.67 ? 33   LYS A CA  1 
ATOM   278  C C   . LYS A 1 33  ? -21.097 -2.975  5.378  1.00 53.79 ? 33   LYS A C   1 
ATOM   279  O O   . LYS A 1 33  ? -20.292 -3.904  5.314  1.00 53.50 ? 33   LYS A O   1 
ATOM   280  C CB  . LYS A 1 33  ? -23.306 -4.071  4.929  1.00 56.92 ? 33   LYS A CB  1 
ATOM   281  C CG  . LYS A 1 33  ? -24.547 -4.727  5.534  1.00 59.47 ? 33   LYS A CG  1 
ATOM   282  C CD  . LYS A 1 33  ? -25.560 -3.705  6.031  1.00 62.49 ? 33   LYS A CD  1 
ATOM   283  C CE  . LYS A 1 33  ? -26.667 -4.367  6.841  1.00 63.17 ? 33   LYS A CE  1 
ATOM   284  N NZ  . LYS A 1 33  ? -27.396 -5.406  6.058  1.00 64.82 ? 33   LYS A NZ  1 
ATOM   285  N N   . GLU A 1 34  ? -20.798 -1.739  4.999  1.00 52.14 ? 34   GLU A N   1 
ATOM   286  C CA  . GLU A 1 34  ? -19.480 -1.402  4.478  1.00 52.14 ? 34   GLU A CA  1 
ATOM   287  C C   . GLU A 1 34  ? -18.626 -0.731  5.552  1.00 50.47 ? 34   GLU A C   1 
ATOM   288  O O   . GLU A 1 34  ? -17.524 -0.257  5.268  1.00 49.99 ? 34   GLU A O   1 
ATOM   289  C CB  . GLU A 1 34  ? -19.615 -0.457  3.280  1.00 54.23 ? 34   GLU A CB  1 
ATOM   290  C CG  . GLU A 1 34  ? -20.249 -1.075  2.039  1.00 56.22 ? 34   GLU A CG  1 
ATOM   291  C CD  . GLU A 1 34  ? -19.303 -1.994  1.291  1.00 58.28 ? 34   GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 34  ? -18.183 -1.547  0.953  1.00 57.43 ? 34   GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 34  ? -19.682 -3.158  1.034  1.00 60.40 ? 34   GLU A OE2 1 
ATOM   294  N N   . ARG A 1 35  ? -19.133 -0.693  6.781  1.00 47.64 ? 35   ARG A N   1 
ATOM   295  C CA  . ARG A 1 35  ? -18.402 -0.047  7.864  1.00 46.50 ? 35   ARG A CA  1 
ATOM   296  C C   . ARG A 1 35  ? -16.976 -0.561  8.002  1.00 44.41 ? 35   ARG A C   1 
ATOM   297  O O   . ARG A 1 35  ? -16.041 0.230   8.090  1.00 43.03 ? 35   ARG A O   1 
ATOM   298  C CB  . ARG A 1 35  ? -19.143 -0.196  9.197  1.00 45.45 ? 35   ARG A CB  1 
ATOM   299  C CG  . ARG A 1 35  ? -18.570 0.709   10.287 1.00 45.09 ? 35   ARG A CG  1 
ATOM   300  C CD  . ARG A 1 35  ? -19.388 0.693   11.568 1.00 43.96 ? 35   ARG A CD  1 
ATOM   301  N NE  . ARG A 1 35  ? -18.735 1.452   12.636 1.00 45.80 ? 35   ARG A NE  1 
ATOM   302  C CZ  . ARG A 1 35  ? -18.702 2.781   12.720 1.00 46.11 ? 35   ARG A CZ  1 
ATOM   303  N NH1 . ARG A 1 35  ? -19.291 3.531   11.799 1.00 41.61 ? 35   ARG A NH1 1 
ATOM   304  N NH2 . ARG A 1 35  ? -18.072 3.363   13.734 1.00 44.46 ? 35   ARG A NH2 1 
ATOM   305  N N   . PHE A 1 36  ? -16.796 -1.878  8.011  1.00 44.37 ? 36   PHE A N   1 
ATOM   306  C CA  . PHE A 1 36  ? -15.450 -2.426  8.134  1.00 44.05 ? 36   PHE A CA  1 
ATOM   307  C C   . PHE A 1 36  ? -14.548 -1.941  7.001  1.00 44.86 ? 36   PHE A C   1 
ATOM   308  O O   . PHE A 1 36  ? -13.429 -1.489  7.235  1.00 43.88 ? 36   PHE A O   1 
ATOM   309  C CB  . PHE A 1 36  ? -15.471 -3.956  8.126  1.00 43.85 ? 36   PHE A CB  1 
ATOM   310  C CG  . PHE A 1 36  ? -14.101 -4.570  8.058  1.00 43.60 ? 36   PHE A CG  1 
ATOM   311  C CD1 . PHE A 1 36  ? -13.238 -4.502  9.151  1.00 43.78 ? 36   PHE A CD1 1 
ATOM   312  C CD2 . PHE A 1 36  ? -13.656 -5.182  6.890  1.00 42.38 ? 36   PHE A CD2 1 
ATOM   313  C CE1 . PHE A 1 36  ? -11.949 -5.034  9.081  1.00 42.67 ? 36   PHE A CE1 1 
ATOM   314  C CE2 . PHE A 1 36  ? -12.369 -5.718  6.809  1.00 44.60 ? 36   PHE A CE2 1 
ATOM   315  C CZ  . PHE A 1 36  ? -11.513 -5.642  7.906  1.00 41.99 ? 36   PHE A CZ  1 
ATOM   316  N N   . ASN A 1 37  ? -15.032 -2.036  5.768  1.00 46.14 ? 37   ASN A N   1 
ATOM   317  C CA  . ASN A 1 37  ? -14.231 -1.608  4.631  1.00 47.02 ? 37   ASN A CA  1 
ATOM   318  C C   . ASN A 1 37  ? -13.969 -0.107  4.618  1.00 45.63 ? 37   ASN A C   1 
ATOM   319  O O   . ASN A 1 37  ? -12.912 0.335   4.167  1.00 46.45 ? 37   ASN A O   1 
ATOM   320  C CB  . ASN A 1 37  ? -14.894 -2.048  3.324  1.00 49.37 ? 37   ASN A CB  1 
ATOM   321  C CG  . ASN A 1 37  ? -14.451 -3.431  2.889  1.00 53.36 ? 37   ASN A CG  1 
ATOM   322  O OD1 . ASN A 1 37  ? -15.275 -4.310  2.645  1.00 57.92 ? 37   ASN A OD1 1 
ATOM   323  N ND2 . ASN A 1 37  ? -13.140 -3.626  2.774  1.00 56.13 ? 37   ASN A ND2 1 
ATOM   324  N N   . HIS A 1 38  ? -14.915 0.673   5.128  1.00 44.86 ? 38   HIS A N   1 
ATOM   325  C CA  . HIS A 1 38  ? -14.751 2.123   5.157  1.00 44.93 ? 38   HIS A CA  1 
ATOM   326  C C   . HIS A 1 38  ? -13.952 2.625   6.353  1.00 44.75 ? 38   HIS A C   1 
ATOM   327  O O   . HIS A 1 38  ? -13.367 3.707   6.297  1.00 43.34 ? 38   HIS A O   1 
ATOM   328  C CB  . HIS A 1 38  ? -16.116 2.824   5.138  1.00 46.05 ? 38   HIS A CB  1 
ATOM   329  C CG  . HIS A 1 38  ? -16.806 2.770   3.810  1.00 47.49 ? 38   HIS A CG  1 
ATOM   330  N ND1 . HIS A 1 38  ? -18.052 3.318   3.596  1.00 47.78 ? 38   HIS A ND1 1 
ATOM   331  C CD2 . HIS A 1 38  ? -16.423 2.233   2.627  1.00 48.45 ? 38   HIS A CD2 1 
ATOM   332  C CE1 . HIS A 1 38  ? -18.408 3.121   2.338  1.00 48.22 ? 38   HIS A CE1 1 
ATOM   333  N NE2 . HIS A 1 38  ? -17.437 2.465   1.729  1.00 48.58 ? 38   HIS A NE2 1 
ATOM   334  N N   . PHE A 1 39  ? -13.920 1.850   7.433  1.00 42.42 ? 39   PHE A N   1 
ATOM   335  C CA  . PHE A 1 39  ? -13.186 2.280   8.618  1.00 43.20 ? 39   PHE A CA  1 
ATOM   336  C C   . PHE A 1 39  ? -12.021 1.372   9.001  1.00 42.45 ? 39   PHE A C   1 
ATOM   337  O O   . PHE A 1 39  ? -11.833 1.038   10.171 1.00 41.45 ? 39   PHE A O   1 
ATOM   338  C CB  . PHE A 1 39  ? -14.137 2.426   9.811  1.00 42.17 ? 39   PHE A CB  1 
ATOM   339  C CG  . PHE A 1 39  ? -15.215 3.458   9.612  1.00 44.69 ? 39   PHE A CG  1 
ATOM   340  C CD1 . PHE A 1 39  ? -16.418 3.122   8.998  1.00 45.40 ? 39   PHE A CD1 1 
ATOM   341  C CD2 . PHE A 1 39  ? -15.029 4.767   10.043 1.00 45.84 ? 39   PHE A CD2 1 
ATOM   342  C CE1 . PHE A 1 39  ? -17.422 4.075   8.818  1.00 46.49 ? 39   PHE A CE1 1 
ATOM   343  C CE2 . PHE A 1 39  ? -16.027 5.729   9.868  1.00 45.83 ? 39   PHE A CE2 1 
ATOM   344  C CZ  . PHE A 1 39  ? -17.225 5.380   9.255  1.00 45.43 ? 39   PHE A CZ  1 
ATOM   345  N N   . SER A 1 40  ? -11.237 0.975   8.009  1.00 42.44 ? 40   SER A N   1 
ATOM   346  C CA  . SER A 1 40  ? -10.077 0.131   8.250  1.00 41.51 ? 40   SER A CA  1 
ATOM   347  C C   . SER A 1 40  ? -9.092  0.356   7.123  1.00 42.28 ? 40   SER A C   1 
ATOM   348  O O   . SER A 1 40  ? -9.442  0.918   6.081  1.00 40.22 ? 40   SER A O   1 
ATOM   349  C CB  . SER A 1 40  ? -10.473 -1.354  8.308  1.00 40.48 ? 40   SER A CB  1 
ATOM   350  O OG  . SER A 1 40  ? -10.906 -1.835  7.045  1.00 41.68 ? 40   SER A OG  1 
ATOM   351  N N   . LEU A 1 41  ? -7.852  -0.062  7.333  1.00 41.41 ? 41   LEU A N   1 
ATOM   352  C CA  . LEU A 1 41  ? -6.842  0.082   6.306  1.00 42.87 ? 41   LEU A CA  1 
ATOM   353  C C   . LEU A 1 41  ? -5.886  -1.095  6.369  1.00 42.93 ? 41   LEU A C   1 
ATOM   354  O O   . LEU A 1 41  ? -5.512  -1.547  7.449  1.00 42.12 ? 41   LEU A O   1 
ATOM   355  C CB  . LEU A 1 41  ? -6.082  1.413   6.466  1.00 43.97 ? 41   LEU A CB  1 
ATOM   356  C CG  . LEU A 1 41  ? -5.207  1.721   7.684  1.00 45.37 ? 41   LEU A CG  1 
ATOM   357  C CD1 . LEU A 1 41  ? -3.978  0.830   7.690  1.00 46.49 ? 41   LEU A CD1 1 
ATOM   358  C CD2 . LEU A 1 41  ? -4.772  3.185   7.639  1.00 43.96 ? 41   LEU A CD2 1 
ATOM   359  N N   . THR A 1 42  ? -5.514  -1.609  5.205  1.00 44.04 ? 42   THR A N   1 
ATOM   360  C CA  . THR A 1 42  ? -4.584  -2.726  5.140  1.00 45.85 ? 42   THR A CA  1 
ATOM   361  C C   . THR A 1 42  ? -3.287  -2.220  4.523  1.00 46.53 ? 42   THR A C   1 
ATOM   362  O O   . THR A 1 42  ? -3.293  -1.629  3.442  1.00 49.43 ? 42   THR A O   1 
ATOM   363  C CB  . THR A 1 42  ? -5.154  -3.869  4.289  1.00 46.24 ? 42   THR A CB  1 
ATOM   364  O OG1 . THR A 1 42  ? -6.432  -4.253  4.809  1.00 47.94 ? 42   THR A OG1 1 
ATOM   365  C CG2 . THR A 1 42  ? -4.228  -5.071  4.329  1.00 48.29 ? 42   THR A CG2 1 
ATOM   366  N N   . LEU A 1 43  ? -2.178  -2.430  5.219  1.00 46.51 ? 43   LEU A N   1 
ATOM   367  C CA  . LEU A 1 43  ? -0.884  -1.978  4.729  1.00 45.93 ? 43   LEU A CA  1 
ATOM   368  C C   . LEU A 1 43  ? -0.011  -3.153  4.320  1.00 45.84 ? 43   LEU A C   1 
ATOM   369  O O   . LEU A 1 43  ? 0.313   -4.010  5.140  1.00 45.85 ? 43   LEU A O   1 
ATOM   370  C CB  . LEU A 1 43  ? -0.155  -1.173  5.811  1.00 47.31 ? 43   LEU A CB  1 
ATOM   371  C CG  . LEU A 1 43  ? -0.911  -0.046  6.520  1.00 47.27 ? 43   LEU A CG  1 
ATOM   372  C CD1 . LEU A 1 43  ? -0.043  0.537   7.627  1.00 47.80 ? 43   LEU A CD1 1 
ATOM   373  C CD2 . LEU A 1 43  ? -1.307  1.024   5.515  1.00 48.84 ? 43   LEU A CD2 1 
ATOM   374  N N   . ASN A 1 44  ? 0.370   -3.197  3.048  1.00 44.73 ? 44   ASN A N   1 
ATOM   375  C CA  . ASN A 1 44  ? 1.238   -4.261  2.563  1.00 43.16 ? 44   ASN A CA  1 
ATOM   376  C C   . ASN A 1 44  ? 2.648   -3.686  2.598  1.00 42.98 ? 44   ASN A C   1 
ATOM   377  O O   . ASN A 1 44  ? 2.971   -2.777  1.839  1.00 42.61 ? 44   ASN A O   1 
ATOM   378  C CB  . ASN A 1 44  ? 0.857   -4.656  1.131  1.00 43.20 ? 44   ASN A CB  1 
ATOM   379  C CG  . ASN A 1 44  ? 1.745   -5.761  0.565  1.00 44.33 ? 44   ASN A CG  1 
ATOM   380  O OD1 . ASN A 1 44  ? 1.586   -6.167  -0.591 1.00 43.56 ? 44   ASN A OD1 1 
ATOM   381  N ND2 . ASN A 1 44  ? 2.682   -6.248  1.372  1.00 40.91 ? 44   ASN A ND2 1 
ATOM   382  N N   . THR A 1 45  ? 3.479   -4.208  3.493  1.00 41.71 ? 45   THR A N   1 
ATOM   383  C CA  . THR A 1 45  ? 4.849   -3.727  3.632  1.00 43.11 ? 45   THR A CA  1 
ATOM   384  C C   . THR A 1 45  ? 5.844   -4.512  2.782  1.00 44.29 ? 45   THR A C   1 
ATOM   385  O O   . THR A 1 45  ? 7.034   -4.186  2.768  1.00 45.30 ? 45   THR A O   1 
ATOM   386  C CB  . THR A 1 45  ? 5.326   -3.847  5.079  1.00 42.21 ? 45   THR A CB  1 
ATOM   387  O OG1 . THR A 1 45  ? 5.568   -5.230  5.374  1.00 39.14 ? 45   THR A OG1 1 
ATOM   388  C CG2 . THR A 1 45  ? 4.268   -3.313  6.036  1.00 43.04 ? 45   THR A CG2 1 
ATOM   389  N N   . ASN A 1 46  ? 5.360   -5.543  2.091  1.00 46.00 ? 46   ASN A N   1 
ATOM   390  C CA  . ASN A 1 46  ? 6.209   -6.404  1.264  1.00 45.69 ? 46   ASN A CA  1 
ATOM   391  C C   . ASN A 1 46  ? 6.953   -7.408  2.149  1.00 46.08 ? 46   ASN A C   1 
ATOM   392  O O   . ASN A 1 46  ? 7.676   -8.271  1.654  1.00 44.25 ? 46   ASN A O   1 
ATOM   393  C CB  . ASN A 1 46  ? 7.229   -5.580  0.468  1.00 48.02 ? 46   ASN A CB  1 
ATOM   394  C CG  . ASN A 1 46  ? 6.598   -4.780  -0.651 1.00 47.38 ? 46   ASN A CG  1 
ATOM   395  O OD1 . ASN A 1 46  ? 7.184   -3.812  -1.131 1.00 52.13 ? 46   ASN A OD1 1 
ATOM   396  N ND2 . ASN A 1 46  ? 5.409   -5.185  -1.085 1.00 46.56 ? 46   ASN A ND2 1 
ATOM   397  N N   . HIS A 1 47  ? 6.778   -7.280  3.461  1.00 46.09 ? 47   HIS A N   1 
ATOM   398  C CA  . HIS A 1 47  ? 7.415   -8.177  4.425  1.00 45.90 ? 47   HIS A CA  1 
ATOM   399  C C   . HIS A 1 47  ? 6.363   -8.553  5.469  1.00 45.45 ? 47   HIS A C   1 
ATOM   400  O O   . HIS A 1 47  ? 6.678   -8.863  6.621  1.00 44.09 ? 47   HIS A O   1 
ATOM   401  C CB  . HIS A 1 47  ? 8.602   -7.478  5.096  1.00 48.19 ? 47   HIS A CB  1 
ATOM   402  C CG  . HIS A 1 47  ? 9.678   -7.063  4.139  1.00 50.65 ? 47   HIS A CG  1 
ATOM   403  N ND1 . HIS A 1 47  ? 10.482  -7.970  3.483  1.00 52.55 ? 47   HIS A ND1 1 
ATOM   404  C CD2 . HIS A 1 47  ? 10.073  -5.837  3.719  1.00 50.96 ? 47   HIS A CD2 1 
ATOM   405  C CE1 . HIS A 1 47  ? 11.328  -7.320  2.702  1.00 52.69 ? 47   HIS A CE1 1 
ATOM   406  N NE2 . HIS A 1 47  ? 11.101  -6.025  2.827  1.00 51.56 ? 47   HIS A NE2 1 
ATOM   407  N N   . GLY A 1 48  ? 5.108   -8.519  5.034  1.00 43.57 ? 48   GLY A N   1 
ATOM   408  C CA  . GLY A 1 48  ? 3.985   -8.830  5.898  1.00 42.22 ? 48   GLY A CA  1 
ATOM   409  C C   . GLY A 1 48  ? 2.957   -7.717  5.797  1.00 41.80 ? 48   GLY A C   1 
ATOM   410  O O   . GLY A 1 48  ? 3.293   -6.589  5.431  1.00 41.80 ? 48   GLY A O   1 
ATOM   411  N N   . HIS A 1 49  ? 1.704   -8.028  6.107  1.00 40.55 ? 49   HIS A N   1 
ATOM   412  C CA  . HIS A 1 49  ? 0.640   -7.036  6.060  1.00 39.98 ? 49   HIS A CA  1 
ATOM   413  C C   . HIS A 1 49  ? 0.255   -6.590  7.463  1.00 40.44 ? 49   HIS A C   1 
ATOM   414  O O   . HIS A 1 49  ? 0.425   -7.333  8.436  1.00 39.98 ? 49   HIS A O   1 
ATOM   415  C CB  . HIS A 1 49  ? -0.602  -7.608  5.365  1.00 40.52 ? 49   HIS A CB  1 
ATOM   416  C CG  . HIS A 1 49  ? -0.425  -7.828  3.894  1.00 40.47 ? 49   HIS A CG  1 
ATOM   417  N ND1 . HIS A 1 49  ? 0.533   -8.672  3.377  1.00 39.97 ? 49   HIS A ND1 1 
ATOM   418  C CD2 . HIS A 1 49  ? -1.083  -7.307  2.831  1.00 42.78 ? 49   HIS A CD2 1 
ATOM   419  C CE1 . HIS A 1 49  ? 0.458   -8.662  2.058  1.00 41.68 ? 49   HIS A CE1 1 
ATOM   420  N NE2 . HIS A 1 49  ? -0.514  -7.842  1.701  1.00 41.66 ? 49   HIS A NE2 1 
ATOM   421  N N   . ILE A 1 50  ? -0.261  -5.371  7.559  1.00 38.96 ? 50   ILE A N   1 
ATOM   422  C CA  . ILE A 1 50  ? -0.711  -4.832  8.833  1.00 39.67 ? 50   ILE A CA  1 
ATOM   423  C C   . ILE A 1 50  ? -2.122  -4.307  8.658  1.00 39.83 ? 50   ILE A C   1 
ATOM   424  O O   . ILE A 1 50  ? -2.357  -3.380  7.884  1.00 40.99 ? 50   ILE A O   1 
ATOM   425  C CB  . ILE A 1 50  ? 0.154   -3.658  9.320  1.00 38.43 ? 50   ILE A CB  1 
ATOM   426  C CG1 . ILE A 1 50  ? 1.575   -4.133  9.623  1.00 37.48 ? 50   ILE A CG1 1 
ATOM   427  C CG2 . ILE A 1 50  ? -0.475  -3.049  10.568 1.00 39.10 ? 50   ILE A CG2 1 
ATOM   428  C CD1 . ILE A 1 50  ? 2.531   -3.007  9.975  1.00 37.15 ? 50   ILE A CD1 1 
ATOM   429  N N   . LEU A 1 51  ? -3.063  -4.905  9.374  1.00 37.51 ? 51   LEU A N   1 
ATOM   430  C CA  . LEU A 1 51  ? -4.441  -4.465  9.297  1.00 36.93 ? 51   LEU A CA  1 
ATOM   431  C C   . LEU A 1 51  ? -4.825  -3.632  10.513 1.00 37.61 ? 51   LEU A C   1 
ATOM   432  O O   . LEU A 1 51  ? -4.803  -4.123  11.646 1.00 36.53 ? 51   LEU A O   1 
ATOM   433  C CB  . LEU A 1 51  ? -5.379  -5.665  9.189  1.00 35.38 ? 51   LEU A CB  1 
ATOM   434  C CG  . LEU A 1 51  ? -6.867  -5.376  9.394  1.00 37.53 ? 51   LEU A CG  1 
ATOM   435  C CD1 . LEU A 1 51  ? -7.369  -4.335  8.384  1.00 35.26 ? 51   LEU A CD1 1 
ATOM   436  C CD2 . LEU A 1 51  ? -7.636  -6.676  9.266  1.00 37.96 ? 51   LEU A CD2 1 
ATOM   437  N N   . LEU A 1 52  ? -5.155  -2.367  10.266 1.00 36.30 ? 52   LEU A N   1 
ATOM   438  C CA  . LEU A 1 52  ? -5.595  -1.462  11.315 1.00 37.31 ? 52   LEU A CA  1 
ATOM   439  C C   . LEU A 1 52  ? -7.102  -1.325  11.141 1.00 38.73 ? 52   LEU A C   1 
ATOM   440  O O   . LEU A 1 52  ? -7.581  -0.655  10.218 1.00 37.30 ? 52   LEU A O   1 
ATOM   441  C CB  . LEU A 1 52  ? -4.930  -0.089  11.181 1.00 39.06 ? 52   LEU A CB  1 
ATOM   442  C CG  . LEU A 1 52  ? -5.564  1.070   11.969 1.00 42.88 ? 52   LEU A CG  1 
ATOM   443  C CD1 . LEU A 1 52  ? -5.612  0.733   13.456 1.00 41.92 ? 52   LEU A CD1 1 
ATOM   444  C CD2 . LEU A 1 52  ? -4.768  2.354   11.737 1.00 44.08 ? 52   LEU A CD2 1 
ATOM   445  N N   . ASP A 1 53  ? -7.847  -1.997  12.010 1.00 37.54 ? 53   ASP A N   1 
ATOM   446  C CA  . ASP A 1 53  ? -9.301  -1.953  11.971 1.00 36.76 ? 53   ASP A CA  1 
ATOM   447  C C   . ASP A 1 53  ? -9.778  -1.027  13.081 1.00 37.12 ? 53   ASP A C   1 
ATOM   448  O O   . ASP A 1 53  ? -9.723  -1.380  14.263 1.00 35.58 ? 53   ASP A O   1 
ATOM   449  C CB  . ASP A 1 53  ? -9.859  -3.362  12.175 1.00 37.35 ? 53   ASP A CB  1 
ATOM   450  C CG  . ASP A 1 53  ? -11.376 -3.400  12.209 1.00 37.59 ? 53   ASP A CG  1 
ATOM   451  O OD1 . ASP A 1 53  ? -12.027 -2.333  12.135 1.00 38.59 ? 53   ASP A OD1 1 
ATOM   452  O OD2 . ASP A 1 53  ? -11.920 -4.517  12.323 1.00 38.51 ? 53   ASP A OD2 1 
ATOM   453  N N   . TYR A 1 54  ? -10.240 0.163   12.706 1.00 34.49 ? 54   TYR A N   1 
ATOM   454  C CA  . TYR A 1 54  ? -10.715 1.124   13.688 1.00 34.24 ? 54   TYR A CA  1 
ATOM   455  C C   . TYR A 1 54  ? -12.220 1.346   13.563 1.00 34.52 ? 54   TYR A C   1 
ATOM   456  O O   . TYR A 1 54  ? -12.744 2.377   13.975 1.00 34.86 ? 54   TYR A O   1 
ATOM   457  C CB  . TYR A 1 54  ? -9.946  2.447   13.543 1.00 34.90 ? 54   TYR A CB  1 
ATOM   458  C CG  . TYR A 1 54  ? -10.082 3.141   12.201 1.00 37.01 ? 54   TYR A CG  1 
ATOM   459  C CD1 . TYR A 1 54  ? -11.068 4.107   11.988 1.00 37.36 ? 54   TYR A CD1 1 
ATOM   460  C CD2 . TYR A 1 54  ? -9.225  2.833   11.146 1.00 37.23 ? 54   TYR A CD2 1 
ATOM   461  C CE1 . TYR A 1 54  ? -11.193 4.750   10.754 1.00 39.08 ? 54   TYR A CE1 1 
ATOM   462  C CE2 . TYR A 1 54  ? -9.344  3.466   9.910  1.00 39.26 ? 54   TYR A CE2 1 
ATOM   463  C CZ  . TYR A 1 54  ? -10.329 4.423   9.722  1.00 40.85 ? 54   TYR A CZ  1 
ATOM   464  O OH  . TYR A 1 54  ? -10.451 5.041   8.497  1.00 41.98 ? 54   TYR A OH  1 
ATOM   465  N N   . SER A 1 55  ? -12.911 0.347   13.022 1.00 35.90 ? 55   SER A N   1 
ATOM   466  C CA  . SER A 1 55  ? -14.354 0.423   12.824 1.00 36.48 ? 55   SER A CA  1 
ATOM   467  C C   . SER A 1 55  ? -15.150 0.312   14.116 1.00 36.19 ? 55   SER A C   1 
ATOM   468  O O   . SER A 1 55  ? -16.299 0.753   14.178 1.00 36.36 ? 55   SER A O   1 
ATOM   469  C CB  . SER A 1 55  ? -14.817 -0.651  11.830 1.00 36.80 ? 55   SER A CB  1 
ATOM   470  O OG  . SER A 1 55  ? -14.629 -1.964  12.333 1.00 36.12 ? 55   SER A OG  1 
ATOM   471  N N   . LYS A 1 56  ? -14.553 -0.279  15.147 1.00 35.80 ? 56   LYS A N   1 
ATOM   472  C CA  . LYS A 1 56  ? -15.237 -0.411  16.426 1.00 33.19 ? 56   LYS A CA  1 
ATOM   473  C C   . LYS A 1 56  ? -15.031 0.826   17.307 1.00 34.91 ? 56   LYS A C   1 
ATOM   474  O O   . LYS A 1 56  ? -14.992 0.727   18.536 1.00 35.04 ? 56   LYS A O   1 
ATOM   475  C CB  . LYS A 1 56  ? -14.769 -1.668  17.178 1.00 33.90 ? 56   LYS A CB  1 
ATOM   476  C CG  . LYS A 1 56  ? -15.061 -3.006  16.468 1.00 32.60 ? 56   LYS A CG  1 
ATOM   477  C CD  . LYS A 1 56  ? -15.040 -4.165  17.471 1.00 31.19 ? 56   LYS A CD  1 
ATOM   478  C CE  . LYS A 1 56  ? -15.087 -5.552  16.808 1.00 32.06 ? 56   LYS A CE  1 
ATOM   479  N NZ  . LYS A 1 56  ? -13.815 -5.897  16.095 1.00 29.87 ? 56   LYS A NZ  1 
ATOM   480  N N   . ASN A 1 57  ? -14.901 1.989   16.674 1.00 35.22 ? 57   ASN A N   1 
ATOM   481  C CA  . ASN A 1 57  ? -14.734 3.251   17.394 1.00 33.57 ? 57   ASN A CA  1 
ATOM   482  C C   . ASN A 1 57  ? -15.999 4.093   17.261 1.00 34.56 ? 57   ASN A C   1 
ATOM   483  O O   . ASN A 1 57  ? -16.725 3.984   16.275 1.00 35.93 ? 57   ASN A O   1 
ATOM   484  C CB  . ASN A 1 57  ? -13.528 4.027   16.862 1.00 33.28 ? 57   ASN A CB  1 
ATOM   485  C CG  . ASN A 1 57  ? -12.219 3.529   17.445 1.00 34.42 ? 57   ASN A CG  1 
ATOM   486  O OD1 . ASN A 1 57  ? -11.988 3.632   18.650 1.00 33.66 ? 57   ASN A OD1 1 
ATOM   487  N ND2 . ASN A 1 57  ? -11.362 2.981   16.596 1.00 32.98 ? 57   ASN A ND2 1 
ATOM   488  N N   . LEU A 1 58  ? -16.257 4.926   18.262 1.00 33.97 ? 58   LEU A N   1 
ATOM   489  C CA  . LEU A 1 58  ? -17.443 5.773   18.280 1.00 35.75 ? 58   LEU A CA  1 
ATOM   490  C C   . LEU A 1 58  ? -17.300 6.943   17.319 1.00 36.77 ? 58   LEU A C   1 
ATOM   491  O O   . LEU A 1 58  ? -17.260 8.104   17.730 1.00 36.47 ? 58   LEU A O   1 
ATOM   492  C CB  . LEU A 1 58  ? -17.699 6.276   19.705 1.00 35.54 ? 58   LEU A CB  1 
ATOM   493  C CG  . LEU A 1 58  ? -18.071 5.189   20.724 1.00 38.05 ? 58   LEU A CG  1 
ATOM   494  C CD1 . LEU A 1 58  ? -18.145 5.781   22.131 1.00 37.56 ? 58   LEU A CD1 1 
ATOM   495  C CD2 . LEU A 1 58  ? -19.409 4.570   20.335 1.00 37.59 ? 58   LEU A CD2 1 
ATOM   496  N N   . VAL A 1 59  ? -17.233 6.624   16.032 1.00 37.94 ? 59   VAL A N   1 
ATOM   497  C CA  . VAL A 1 59  ? -17.086 7.637   14.996 1.00 39.41 ? 59   VAL A CA  1 
ATOM   498  C C   . VAL A 1 59  ? -17.956 7.335   13.785 1.00 40.84 ? 59   VAL A C   1 
ATOM   499  O O   . VAL A 1 59  ? -18.367 6.194   13.558 1.00 41.06 ? 59   VAL A O   1 
ATOM   500  C CB  . VAL A 1 59  ? -15.635 7.715   14.496 1.00 38.24 ? 59   VAL A CB  1 
ATOM   501  C CG1 . VAL A 1 59  ? -14.700 8.008   15.653 1.00 40.54 ? 59   VAL A CG1 1 
ATOM   502  C CG2 . VAL A 1 59  ? -15.257 6.406   13.815 1.00 36.87 ? 59   VAL A CG2 1 
ATOM   503  N N   . THR A 1 60  ? -18.229 8.377   13.011 1.00 41.81 ? 60   THR A N   1 
ATOM   504  C CA  . THR A 1 60  ? -19.014 8.252   11.795 1.00 41.81 ? 60   THR A CA  1 
ATOM   505  C C   . THR A 1 60  ? -18.207 8.977   10.738 1.00 43.91 ? 60   THR A C   1 
ATOM   506  O O   . THR A 1 60  ? -17.152 9.542   11.035 1.00 40.35 ? 60   THR A O   1 
ATOM   507  C CB  . THR A 1 60  ? -20.395 8.940   11.911 1.00 42.04 ? 60   THR A CB  1 
ATOM   508  O OG1 . THR A 1 60  ? -20.219 10.349  12.093 1.00 38.00 ? 60   THR A OG1 1 
ATOM   509  C CG2 . THR A 1 60  ? -21.174 8.384   13.084 1.00 42.79 ? 60   THR A CG2 1 
ATOM   510  N N   . GLU A 1 61  ? -18.701 8.954   9.505  1.00 44.81 ? 61   GLU A N   1 
ATOM   511  C CA  . GLU A 1 61  ? -18.038 9.629   8.402  1.00 47.53 ? 61   GLU A CA  1 
ATOM   512  C C   . GLU A 1 61  ? -17.785 11.086  8.780  1.00 45.02 ? 61   GLU A C   1 
ATOM   513  O O   . GLU A 1 61  ? -16.668 11.586  8.653  1.00 44.84 ? 61   GLU A O   1 
ATOM   514  C CB  . GLU A 1 61  ? -18.918 9.568   7.151  1.00 50.44 ? 61   GLU A CB  1 
ATOM   515  C CG  . GLU A 1 61  ? -20.022 8.516   7.234  1.00 56.86 ? 61   GLU A CG  1 
ATOM   516  C CD  . GLU A 1 61  ? -21.187 8.943   8.116  1.00 59.95 ? 61   GLU A CD  1 
ATOM   517  O OE1 . GLU A 1 61  ? -22.232 8.261   8.076  1.00 62.76 ? 61   GLU A OE1 1 
ATOM   518  O OE2 . GLU A 1 61  ? -21.066 9.959   8.841  1.00 60.96 ? 61   GLU A OE2 1 
ATOM   519  N N   . GLU A 1 62  ? -18.834 11.758  9.245  1.00 45.93 ? 62   GLU A N   1 
ATOM   520  C CA  . GLU A 1 62  ? -18.737 13.158  9.642  1.00 46.60 ? 62   GLU A CA  1 
ATOM   521  C C   . GLU A 1 62  ? -17.591 13.382  10.614 1.00 44.93 ? 62   GLU A C   1 
ATOM   522  O O   . GLU A 1 62  ? -16.707 14.204  10.372 1.00 44.92 ? 62   GLU A O   1 
ATOM   523  C CB  . GLU A 1 62  ? -20.023 13.625  10.321 1.00 50.52 ? 62   GLU A CB  1 
ATOM   524  C CG  . GLU A 1 62  ? -21.107 14.137  9.408  1.00 56.01 ? 62   GLU A CG  1 
ATOM   525  C CD  . GLU A 1 62  ? -22.037 15.094  10.130 1.00 58.09 ? 62   GLU A CD  1 
ATOM   526  O OE1 . GLU A 1 62  ? -22.036 16.297  9.779  1.00 59.27 ? 62   GLU A OE1 1 
ATOM   527  O OE2 . GLU A 1 62  ? -22.759 14.650  11.053 1.00 61.04 ? 62   GLU A OE2 1 
ATOM   528  N N   . VAL A 1 63  ? -17.621 12.642  11.718 1.00 42.78 ? 63   VAL A N   1 
ATOM   529  C CA  . VAL A 1 63  ? -16.604 12.760  12.757 1.00 40.96 ? 63   VAL A CA  1 
ATOM   530  C C   . VAL A 1 63  ? -15.182 12.621  12.237 1.00 41.72 ? 63   VAL A C   1 
ATOM   531  O O   . VAL A 1 63  ? -14.320 13.428  12.574 1.00 42.52 ? 63   VAL A O   1 
ATOM   532  C CB  . VAL A 1 63  ? -16.829 11.717  13.874 1.00 41.13 ? 63   VAL A CB  1 
ATOM   533  C CG1 . VAL A 1 63  ? -15.787 11.896  14.978 1.00 37.60 ? 63   VAL A CG1 1 
ATOM   534  C CG2 . VAL A 1 63  ? -18.223 11.871  14.445 1.00 39.24 ? 63   VAL A CG2 1 
ATOM   535  N N   . MET A 1 64  ? -14.924 11.599  11.426 1.00 42.10 ? 64   MET A N   1 
ATOM   536  C CA  . MET A 1 64  ? -13.583 11.407  10.891 1.00 43.17 ? 64   MET A CA  1 
ATOM   537  C C   . MET A 1 64  ? -13.195 12.605  10.027 1.00 44.80 ? 64   MET A C   1 
ATOM   538  O O   . MET A 1 64  ? -12.032 13.016  10.008 1.00 44.62 ? 64   MET A O   1 
ATOM   539  C CB  . MET A 1 64  ? -13.506 10.117  10.070 1.00 43.55 ? 64   MET A CB  1 
ATOM   540  C CG  . MET A 1 64  ? -13.650 8.844   10.894 1.00 42.78 ? 64   MET A CG  1 
ATOM   541  S SD  . MET A 1 64  ? -12.503 8.767   12.299 1.00 42.07 ? 64   MET A SD  1 
ATOM   542  C CE  . MET A 1 64  ? -10.955 8.563   11.459 1.00 37.11 ? 64   MET A CE  1 
ATOM   543  N N   . HIS A 1 65  ? -14.175 13.168  9.326  1.00 45.13 ? 65   HIS A N   1 
ATOM   544  C CA  . HIS A 1 65  ? -13.932 14.329  8.474  1.00 46.94 ? 65   HIS A CA  1 
ATOM   545  C C   . HIS A 1 65  ? -13.506 15.523  9.325  1.00 45.07 ? 65   HIS A C   1 
ATOM   546  O O   . HIS A 1 65  ? -12.525 16.202  9.012  1.00 45.20 ? 65   HIS A O   1 
ATOM   547  C CB  . HIS A 1 65  ? -15.194 14.692  7.687  1.00 49.40 ? 65   HIS A CB  1 
ATOM   548  C CG  . HIS A 1 65  ? -15.011 15.850  6.756  1.00 54.04 ? 65   HIS A CG  1 
ATOM   549  N ND1 . HIS A 1 65  ? -14.135 15.819  5.691  1.00 55.38 ? 65   HIS A ND1 1 
ATOM   550  C CD2 . HIS A 1 65  ? -15.587 17.076  6.733  1.00 55.84 ? 65   HIS A CD2 1 
ATOM   551  C CE1 . HIS A 1 65  ? -14.180 16.975  5.053  1.00 56.31 ? 65   HIS A CE1 1 
ATOM   552  N NE2 . HIS A 1 65  ? -15.053 17.756  5.664  1.00 56.71 ? 65   HIS A NE2 1 
ATOM   553  N N   . MET A 1 66  ? -14.249 15.776  10.398 1.00 43.19 ? 66   MET A N   1 
ATOM   554  C CA  . MET A 1 66  ? -13.933 16.885  11.288 1.00 42.08 ? 66   MET A CA  1 
ATOM   555  C C   . MET A 1 66  ? -12.586 16.676  11.960 1.00 41.43 ? 66   MET A C   1 
ATOM   556  O O   . MET A 1 66  ? -11.825 17.628  12.140 1.00 39.95 ? 66   MET A O   1 
ATOM   557  C CB  . MET A 1 66  ? -15.022 17.051  12.352 1.00 44.08 ? 66   MET A CB  1 
ATOM   558  C CG  . MET A 1 66  ? -16.366 17.495  11.796 1.00 45.50 ? 66   MET A CG  1 
ATOM   559  S SD  . MET A 1 66  ? -17.603 17.835  13.058 1.00 50.45 ? 66   MET A SD  1 
ATOM   560  C CE  . MET A 1 66  ? -18.226 16.187  13.374 1.00 47.40 ? 66   MET A CE  1 
ATOM   561  N N   . LEU A 1 67  ? -12.290 15.429  12.330 1.00 40.13 ? 67   LEU A N   1 
ATOM   562  C CA  . LEU A 1 67  ? -11.022 15.110  12.982 1.00 39.48 ? 67   LEU A CA  1 
ATOM   563  C C   . LEU A 1 67  ? -9.847  15.335  12.045 1.00 39.09 ? 67   LEU A C   1 
ATOM   564  O O   . LEU A 1 67  ? -8.783  15.795  12.465 1.00 37.70 ? 67   LEU A O   1 
ATOM   565  C CB  . LEU A 1 67  ? -11.008 13.655  13.469 1.00 37.77 ? 67   LEU A CB  1 
ATOM   566  C CG  . LEU A 1 67  ? -11.908 13.289  14.651 1.00 39.12 ? 67   LEU A CG  1 
ATOM   567  C CD1 . LEU A 1 67  ? -11.835 11.792  14.892 1.00 40.46 ? 67   LEU A CD1 1 
ATOM   568  C CD2 . LEU A 1 67  ? -11.470 14.037  15.893 1.00 36.80 ? 67   LEU A CD2 1 
ATOM   569  N N   . LEU A 1 68  ? -10.031 15.000  10.775 1.00 39.52 ? 68   LEU A N   1 
ATOM   570  C CA  . LEU A 1 68  ? -8.962  15.192  9.818  1.00 42.20 ? 68   LEU A CA  1 
ATOM   571  C C   . LEU A 1 68  ? -8.812  16.678  9.493  1.00 42.58 ? 68   LEU A C   1 
ATOM   572  O O   . LEU A 1 68  ? -7.708  17.144  9.220  1.00 42.95 ? 68   LEU A O   1 
ATOM   573  C CB  . LEU A 1 68  ? -9.222  14.357  8.562  1.00 41.68 ? 68   LEU A CB  1 
ATOM   574  C CG  . LEU A 1 68  ? -9.134  12.853  8.860  1.00 43.04 ? 68   LEU A CG  1 
ATOM   575  C CD1 . LEU A 1 68  ? -9.539  12.043  7.644  1.00 44.83 ? 68   LEU A CD1 1 
ATOM   576  C CD2 . LEU A 1 68  ? -7.715  12.501  9.288  1.00 44.43 ? 68   LEU A CD2 1 
ATOM   577  N N   . ASP A 1 69  ? -9.916  17.424  9.553  1.00 44.58 ? 69   ASP A N   1 
ATOM   578  C CA  . ASP A 1 69  ? -9.872  18.863  9.280  1.00 45.89 ? 69   ASP A CA  1 
ATOM   579  C C   . ASP A 1 69  ? -9.075  19.573  10.366 1.00 46.33 ? 69   ASP A C   1 
ATOM   580  O O   . ASP A 1 69  ? -8.348  20.531  10.094 1.00 47.24 ? 69   ASP A O   1 
ATOM   581  C CB  . ASP A 1 69  ? -11.282 19.465  9.225  1.00 46.71 ? 69   ASP A CB  1 
ATOM   582  C CG  . ASP A 1 69  ? -12.043 19.073  7.967  1.00 49.76 ? 69   ASP A CG  1 
ATOM   583  O OD1 . ASP A 1 69  ? -11.403 18.866  6.915  1.00 48.64 ? 69   ASP A OD1 1 
ATOM   584  O OD2 . ASP A 1 69  ? -13.290 18.989  8.027  1.00 52.27 ? 69   ASP A OD2 1 
ATOM   585  N N   . LEU A 1 70  ? -9.221  19.097  11.600 1.00 45.78 ? 70   LEU A N   1 
ATOM   586  C CA  . LEU A 1 70  ? -8.516  19.673  12.741 1.00 44.40 ? 70   LEU A CA  1 
ATOM   587  C C   . LEU A 1 70  ? -7.020  19.413  12.600 1.00 43.27 ? 70   LEU A C   1 
ATOM   588  O O   . LEU A 1 70  ? -6.194  20.272  12.903 1.00 41.51 ? 70   LEU A O   1 
ATOM   589  C CB  . LEU A 1 70  ? -9.037  19.048  14.042 1.00 46.87 ? 70   LEU A CB  1 
ATOM   590  C CG  . LEU A 1 70  ? -8.604  19.615  15.396 1.00 47.61 ? 70   LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 70  ? -9.413  18.934  16.497 1.00 50.15 ? 70   LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 70  ? -7.121  19.394  15.622 1.00 49.93 ? 70   LEU A CD2 1 
ATOM   593  N N   . ALA A 1 71  ? -6.680  18.216  12.142 1.00 43.79 ? 71   ALA A N   1 
ATOM   594  C CA  . ALA A 1 71  ? -5.290  17.841  11.962 1.00 44.88 ? 71   ALA A CA  1 
ATOM   595  C C   . ALA A 1 71  ? -4.563  18.811  11.033 1.00 46.68 ? 71   ALA A C   1 
ATOM   596  O O   . ALA A 1 71  ? -3.429  19.202  11.304 1.00 45.82 ? 71   ALA A O   1 
ATOM   597  C CB  . ALA A 1 71  ? -5.205  16.430  11.409 1.00 45.46 ? 71   ALA A CB  1 
ATOM   598  N N   . LYS A 1 72  ? -5.217  19.203  9.941  1.00 48.77 ? 72   LYS A N   1 
ATOM   599  C CA  . LYS A 1 72  ? -4.593  20.115  8.982  1.00 49.84 ? 72   LYS A CA  1 
ATOM   600  C C   . LYS A 1 72  ? -4.592  21.586  9.389  1.00 49.72 ? 72   LYS A C   1 
ATOM   601  O O   . LYS A 1 72  ? -3.683  22.325  9.018  1.00 50.82 ? 72   LYS A O   1 
ATOM   602  C CB  . LYS A 1 72  ? -5.226  19.949  7.595  1.00 51.18 ? 72   LYS A CB  1 
ATOM   603  C CG  . LYS A 1 72  ? -6.574  19.265  7.591  1.00 54.12 ? 72   LYS A CG  1 
ATOM   604  C CD  . LYS A 1 72  ? -6.792  18.520  6.280  1.00 56.65 ? 72   LYS A CD  1 
ATOM   605  C CE  . LYS A 1 72  ? -8.012  17.614  6.348  1.00 58.55 ? 72   LYS A CE  1 
ATOM   606  N NZ  . LYS A 1 72  ? -8.056  16.670  5.196  1.00 59.54 ? 72   LYS A NZ  1 
ATOM   607  N N   . SER A 1 73  ? -5.595  22.022  10.143 1.00 49.94 ? 73   SER A N   1 
ATOM   608  C CA  . SER A 1 73  ? -5.620  23.417  10.571 1.00 50.06 ? 73   SER A CA  1 
ATOM   609  C C   . SER A 1 73  ? -4.613  23.604  11.705 1.00 49.54 ? 73   SER A C   1 
ATOM   610  O O   . SER A 1 73  ? -4.245  24.729  12.044 1.00 49.46 ? 73   SER A O   1 
ATOM   611  C CB  . SER A 1 73  ? -7.018  23.829  11.040 1.00 50.33 ? 73   SER A CB  1 
ATOM   612  O OG  . SER A 1 73  ? -7.283  23.363  12.349 1.00 54.97 ? 73   SER A OG  1 
ATOM   613  N N   . ARG A 1 74  ? -4.167  22.495  12.291 1.00 47.69 ? 74   ARG A N   1 
ATOM   614  C CA  . ARG A 1 74  ? -3.187  22.563  13.368 1.00 45.15 ? 74   ARG A CA  1 
ATOM   615  C C   . ARG A 1 74  ? -1.784  22.367  12.804 1.00 43.32 ? 74   ARG A C   1 
ATOM   616  O O   . ARG A 1 74  ? -0.806  22.324  13.542 1.00 40.53 ? 74   ARG A O   1 
ATOM   617  C CB  . ARG A 1 74  ? -3.487  21.515  14.445 1.00 46.05 ? 74   ARG A CB  1 
ATOM   618  C CG  . ARG A 1 74  ? -4.769  21.779  15.236 1.00 45.72 ? 74   ARG A CG  1 
ATOM   619  C CD  . ARG A 1 74  ? -4.678  23.032  16.104 1.00 47.16 ? 74   ARG A CD  1 
ATOM   620  N NE  . ARG A 1 74  ? -3.481  23.026  16.942 1.00 49.14 ? 74   ARG A NE  1 
ATOM   621  C CZ  . ARG A 1 74  ? -2.368  23.699  16.664 1.00 51.48 ? 74   ARG A CZ  1 
ATOM   622  N NH1 . ARG A 1 74  ? -2.296  24.449  15.569 1.00 51.65 ? 74   ARG A NH1 1 
ATOM   623  N NH2 . ARG A 1 74  ? -1.319  23.612  17.471 1.00 53.22 ? 74   ARG A NH2 1 
ATOM   624  N N   . GLY A 1 75  ? -1.704  22.237  11.483 1.00 43.15 ? 75   GLY A N   1 
ATOM   625  C CA  . GLY A 1 75  ? -0.425  22.093  10.814 1.00 42.99 ? 75   GLY A CA  1 
ATOM   626  C C   . GLY A 1 75  ? 0.364   20.811  10.976 1.00 43.24 ? 75   GLY A C   1 
ATOM   627  O O   . GLY A 1 75  ? 1.595   20.847  10.946 1.00 43.51 ? 75   GLY A O   1 
ATOM   628  N N   . VAL A 1 76  ? -0.322  19.682  11.133 1.00 42.00 ? 76   VAL A N   1 
ATOM   629  C CA  . VAL A 1 76  ? 0.361   18.401  11.289 1.00 42.90 ? 76   VAL A CA  1 
ATOM   630  C C   . VAL A 1 76  ? 1.384   18.164  10.183 1.00 43.66 ? 76   VAL A C   1 
ATOM   631  O O   . VAL A 1 76  ? 2.550   17.890  10.452 1.00 43.14 ? 76   VAL A O   1 
ATOM   632  C CB  . VAL A 1 76  ? -0.650  17.220  11.293 1.00 42.03 ? 76   VAL A CB  1 
ATOM   633  C CG1 . VAL A 1 76  ? 0.085   15.890  11.193 1.00 41.83 ? 76   VAL A CG1 1 
ATOM   634  C CG2 . VAL A 1 76  ? -1.476  17.255  12.562 1.00 41.81 ? 76   VAL A CG2 1 
ATOM   635  N N   . GLU A 1 77  ? 0.940   18.276  8.935  1.00 46.34 ? 77   GLU A N   1 
ATOM   636  C CA  . GLU A 1 77  ? 1.814   18.052  7.790  1.00 46.09 ? 77   GLU A CA  1 
ATOM   637  C C   . GLU A 1 77  ? 3.050   18.947  7.793  1.00 44.98 ? 77   GLU A C   1 
ATOM   638  O O   . GLU A 1 77  ? 4.167   18.479  7.570  1.00 44.28 ? 77   GLU A O   1 
ATOM   639  C CB  . GLU A 1 77  ? 1.018   18.235  6.500  1.00 48.99 ? 77   GLU A CB  1 
ATOM   640  C CG  . GLU A 1 77  ? -0.035  17.156  6.296  1.00 53.37 ? 77   GLU A CG  1 
ATOM   641  C CD  . GLU A 1 77  ? -0.855  17.363  5.042  1.00 56.07 ? 77   GLU A CD  1 
ATOM   642  O OE1 . GLU A 1 77  ? -1.676  18.306  5.012  1.00 59.85 ? 77   GLU A OE1 1 
ATOM   643  O OE2 . GLU A 1 77  ? -0.674  16.586  4.084  1.00 56.84 ? 77   GLU A OE2 1 
ATOM   644  N N   . ALA A 1 78  ? 2.852   20.233  8.049  1.00 43.97 ? 78   ALA A N   1 
ATOM   645  C CA  . ALA A 1 78  ? 3.967   21.167  8.088  1.00 43.53 ? 78   ALA A CA  1 
ATOM   646  C C   . ALA A 1 78  ? 4.935   20.725  9.178  1.00 42.81 ? 78   ALA A C   1 
ATOM   647  O O   . ALA A 1 78  ? 6.141   20.626  8.960  1.00 41.26 ? 78   ALA A O   1 
ATOM   648  C CB  . ALA A 1 78  ? 3.460   22.577  8.377  1.00 43.67 ? 78   ALA A CB  1 
ATOM   649  N N   . ALA A 1 79  ? 4.390   20.452  10.357 1.00 42.63 ? 79   ALA A N   1 
ATOM   650  C CA  . ALA A 1 79  ? 5.195   20.019  11.489 1.00 41.92 ? 79   ALA A CA  1 
ATOM   651  C C   . ALA A 1 79  ? 5.984   18.758  11.154 1.00 41.18 ? 79   ALA A C   1 
ATOM   652  O O   . ALA A 1 79  ? 7.143   18.621  11.538 1.00 40.55 ? 79   ALA A O   1 
ATOM   653  C CB  . ALA A 1 79  ? 4.296   19.769  12.696 1.00 42.87 ? 79   ALA A CB  1 
ATOM   654  N N   . ARG A 1 80  ? 5.349   17.841  10.431 1.00 43.53 ? 80   ARG A N   1 
ATOM   655  C CA  . ARG A 1 80  ? 5.989   16.587  10.055 1.00 43.85 ? 80   ARG A CA  1 
ATOM   656  C C   . ARG A 1 80  ? 7.224   16.806  9.183  1.00 45.14 ? 80   ARG A C   1 
ATOM   657  O O   . ARG A 1 80  ? 8.294   16.261  9.461  1.00 44.78 ? 80   ARG A O   1 
ATOM   658  C CB  . ARG A 1 80  ? 4.998   15.697  9.311  1.00 44.25 ? 80   ARG A CB  1 
ATOM   659  C CG  . ARG A 1 80  ? 5.568   14.342  8.914  1.00 45.55 ? 80   ARG A CG  1 
ATOM   660  C CD  . ARG A 1 80  ? 4.650   13.663  7.929  1.00 47.96 ? 80   ARG A CD  1 
ATOM   661  N NE  . ARG A 1 80  ? 4.454   14.508  6.758  1.00 48.05 ? 80   ARG A NE  1 
ATOM   662  C CZ  . ARG A 1 80  ? 3.353   14.517  6.017  1.00 48.79 ? 80   ARG A CZ  1 
ATOM   663  N NH1 . ARG A 1 80  ? 2.337   13.719  6.325  1.00 48.77 ? 80   ARG A NH1 1 
ATOM   664  N NH2 . ARG A 1 80  ? 3.264   15.335  4.976  1.00 45.83 ? 80   ARG A NH2 1 
ATOM   665  N N   . GLU A 1 81  ? 7.073   17.595  8.121  1.00 45.08 ? 81   GLU A N   1 
ATOM   666  C CA  . GLU A 1 81  ? 8.195   17.868  7.230  1.00 46.54 ? 81   GLU A CA  1 
ATOM   667  C C   . GLU A 1 81  ? 9.349   18.508  7.990  1.00 45.51 ? 81   GLU A C   1 
ATOM   668  O O   . GLU A 1 81  ? 10.516  18.199  7.740  1.00 43.90 ? 81   GLU A O   1 
ATOM   669  C CB  . GLU A 1 81  ? 7.750   18.774  6.080  1.00 48.56 ? 81   GLU A CB  1 
ATOM   670  C CG  . GLU A 1 81  ? 7.016   18.033  4.978  1.00 52.60 ? 81   GLU A CG  1 
ATOM   671  C CD  . GLU A 1 81  ? 7.901   17.002  4.291  1.00 55.54 ? 81   GLU A CD  1 
ATOM   672  O OE1 . GLU A 1 81  ? 7.415   16.316  3.371  1.00 58.45 ? 81   GLU A OE1 1 
ATOM   673  O OE2 . GLU A 1 81  ? 9.086   16.876  4.668  1.00 57.24 ? 81   GLU A OE2 1 
ATOM   674  N N   . SER A 1 82  ? 9.013   19.387  8.931  1.00 46.05 ? 82   SER A N   1 
ATOM   675  C CA  . SER A 1 82  ? 10.016  20.065  9.747  1.00 45.94 ? 82   SER A CA  1 
ATOM   676  C C   . SER A 1 82  ? 10.856  19.064  10.541 1.00 46.77 ? 82   SER A C   1 
ATOM   677  O O   . SER A 1 82  ? 12.071  19.236  10.705 1.00 46.67 ? 82   SER A O   1 
ATOM   678  C CB  . SER A 1 82  ? 9.342   21.052  10.703 1.00 47.03 ? 82   SER A CB  1 
ATOM   679  O OG  . SER A 1 82  ? 8.663   22.057  9.965  1.00 47.38 ? 82   SER A OG  1 
ATOM   680  N N   . MET A 1 83  ? 10.205  18.027  11.031 1.00 46.93 ? 83   MET A N   1 
ATOM   681  C CA  . MET A 1 83  ? 10.904  16.986  11.797 1.00 46.89 ? 83   MET A CA  1 
ATOM   682  C C   . MET A 1 83  ? 11.846  16.223  10.880 1.00 46.21 ? 83   MET A C   1 
ATOM   683  O O   . MET A 1 83  ? 13.027  16.062  11.184 1.00 46.30 ? 83   MET A O   1 
ATOM   684  C CB  . MET A 1 83  ? 9.924   15.986  12.406 1.00 48.68 ? 83   MET A CB  1 
ATOM   685  C CG  . MET A 1 83  ? 10.636  14.743  12.951 1.00 50.94 ? 83   MET A CG  1 
ATOM   686  S SD  . MET A 1 83  ? 9.568   13.674  13.886 1.00 52.35 ? 83   MET A SD  1 
ATOM   687  C CE  . MET A 1 83  ? 10.341  13.235  15.428 1.00 56.34 ? 83   MET A CE  1 
ATOM   688  N N   . PHE A 1 84  ? 11.316  15.745  9.758  1.00 45.90 ? 84   PHE A N   1 
ATOM   689  C CA  . PHE A 1 84  ? 12.121  14.990  8.810  1.00 47.70 ? 84   PHE A CA  1 
ATOM   690  C C   . PHE A 1 84  ? 13.244  15.808  8.171  1.00 48.63 ? 84   PHE A C   1 
ATOM   691  O O   . PHE A 1 84  ? 14.236  15.243  7.715  1.00 48.82 ? 84   PHE A O   1 
ATOM   692  C CB  . PHE A 1 84  ? 11.237  14.393  7.708  1.00 47.73 ? 84   PHE A CB  1 
ATOM   693  C CG  . PHE A 1 84  ? 10.467  13.170  8.138  1.00 48.91 ? 84   PHE A CG  1 
ATOM   694  C CD1 . PHE A 1 84  ? 9.364   13.281  8.982  1.00 48.53 ? 84   PHE A CD1 1 
ATOM   695  C CD2 . PHE A 1 84  ? 10.851  11.905  7.699  1.00 48.25 ? 84   PHE A CD2 1 
ATOM   696  C CE1 . PHE A 1 84  ? 8.654   12.151  9.381  1.00 48.03 ? 84   PHE A CE1 1 
ATOM   697  C CE2 . PHE A 1 84  ? 10.148  10.767  8.091  1.00 49.09 ? 84   PHE A CE2 1 
ATOM   698  C CZ  . PHE A 1 84  ? 9.045   10.891  8.935  1.00 48.14 ? 84   PHE A CZ  1 
ATOM   699  N N   . ASN A 1 85  ? 13.098  17.131  8.151  1.00 49.54 ? 85   ASN A N   1 
ATOM   700  C CA  . ASN A 1 85  ? 14.111  17.991  7.542  1.00 51.81 ? 85   ASN A CA  1 
ATOM   701  C C   . ASN A 1 85  ? 15.245  18.431  8.457  1.00 52.22 ? 85   ASN A C   1 
ATOM   702  O O   . ASN A 1 85  ? 16.133  19.165  8.027  1.00 53.05 ? 85   ASN A O   1 
ATOM   703  C CB  . ASN A 1 85  ? 13.460  19.234  6.920  1.00 51.47 ? 85   ASN A CB  1 
ATOM   704  C CG  . ASN A 1 85  ? 12.660  18.910  5.675  1.00 52.65 ? 85   ASN A CG  1 
ATOM   705  O OD1 . ASN A 1 85  ? 13.046  18.049  4.886  1.00 52.98 ? 85   ASN A OD1 1 
ATOM   706  N ND2 . ASN A 1 85  ? 11.548  19.613  5.482  1.00 53.37 ? 85   ASN A ND2 1 
ATOM   707  N N   . GLY A 1 86  ? 15.217  18.004  9.714  1.00 52.22 ? 86   GLY A N   1 
ATOM   708  C CA  . GLY A 1 86  ? 16.287  18.372  10.625 1.00 51.87 ? 86   GLY A CA  1 
ATOM   709  C C   . GLY A 1 86  ? 16.123  19.687  11.365 1.00 52.48 ? 86   GLY A C   1 
ATOM   710  O O   . GLY A 1 86  ? 17.022  20.104  12.096 1.00 52.80 ? 86   GLY A O   1 
ATOM   711  N N   . GLU A 1 87  ? 14.989  20.350  11.178 1.00 52.65 ? 87   GLU A N   1 
ATOM   712  C CA  . GLU A 1 87  ? 14.735  21.610  11.864 1.00 53.09 ? 87   GLU A CA  1 
ATOM   713  C C   . GLU A 1 87  ? 14.650  21.337  13.363 1.00 53.80 ? 87   GLU A C   1 
ATOM   714  O O   . GLU A 1 87  ? 14.158  20.285  13.773 1.00 53.15 ? 87   GLU A O   1 
ATOM   715  C CB  . GLU A 1 87  ? 13.422  22.221  11.370 1.00 55.03 ? 87   GLU A CB  1 
ATOM   716  C CG  . GLU A 1 87  ? 13.473  22.755  9.940  1.00 56.52 ? 87   GLU A CG  1 
ATOM   717  C CD  . GLU A 1 87  ? 12.112  23.209  9.435  1.00 58.26 ? 87   GLU A CD  1 
ATOM   718  O OE1 . GLU A 1 87  ? 11.393  23.892  10.199 1.00 58.70 ? 87   GLU A OE1 1 
ATOM   719  O OE2 . GLU A 1 87  ? 11.765  22.892  8.274  1.00 57.56 ? 87   GLU A OE2 1 
ATOM   720  N N   . LYS A 1 88  ? 15.130  22.272  14.180 1.00 53.06 ? 88   LYS A N   1 
ATOM   721  C CA  . LYS A 1 88  ? 15.091  22.102  15.632 1.00 52.57 ? 88   LYS A CA  1 
ATOM   722  C C   . LYS A 1 88  ? 13.689  22.294  16.210 1.00 51.08 ? 88   LYS A C   1 
ATOM   723  O O   . LYS A 1 88  ? 13.406  23.314  16.841 1.00 50.85 ? 88   LYS A O   1 
ATOM   724  C CB  . LYS A 1 88  ? 16.052  23.080  16.321 1.00 54.12 ? 88   LYS A CB  1 
ATOM   725  C CG  . LYS A 1 88  ? 17.521  22.684  16.265 1.00 57.50 ? 88   LYS A CG  1 
ATOM   726  C CD  . LYS A 1 88  ? 18.225  23.228  15.035 1.00 59.99 ? 88   LYS A CD  1 
ATOM   727  C CE  . LYS A 1 88  ? 18.480  24.726  15.155 1.00 62.39 ? 88   LYS A CE  1 
ATOM   728  N NZ  . LYS A 1 88  ? 17.226  25.526  15.250 1.00 64.45 ? 88   LYS A NZ  1 
ATOM   729  N N   . ILE A 1 89  ? 12.814  21.312  16.007 1.00 49.97 ? 89   ILE A N   1 
ATOM   730  C CA  . ILE A 1 89  ? 11.452  21.410  16.524 1.00 49.21 ? 89   ILE A CA  1 
ATOM   731  C C   . ILE A 1 89  ? 11.386  21.226  18.041 1.00 48.80 ? 89   ILE A C   1 
ATOM   732  O O   . ILE A 1 89  ? 10.344  21.451  18.654 1.00 48.63 ? 89   ILE A O   1 
ATOM   733  C CB  . ILE A 1 89  ? 10.506  20.395  15.845 1.00 49.51 ? 89   ILE A CB  1 
ATOM   734  C CG1 . ILE A 1 89  ? 11.035  18.970  16.027 1.00 48.99 ? 89   ILE A CG1 1 
ATOM   735  C CG2 . ILE A 1 89  ? 10.355  20.744  14.369 1.00 49.31 ? 89   ILE A CG2 1 
ATOM   736  C CD1 . ILE A 1 89  ? 10.081  17.901  15.522 1.00 47.68 ? 89   ILE A CD1 1 
ATOM   737  N N   . ASN A 1 90  ? 12.497  20.808  18.641 1.00 47.82 ? 90   ASN A N   1 
ATOM   738  C CA  . ASN A 1 90  ? 12.566  20.642  20.090 1.00 46.98 ? 90   ASN A CA  1 
ATOM   739  C C   . ASN A 1 90  ? 12.969  22.025  20.597 1.00 47.45 ? 90   ASN A C   1 
ATOM   740  O O   . ASN A 1 90  ? 14.083  22.228  21.088 1.00 45.37 ? 90   ASN A O   1 
ATOM   741  C CB  . ASN A 1 90  ? 13.625  19.594  20.455 1.00 46.32 ? 90   ASN A CB  1 
ATOM   742  C CG  . ASN A 1 90  ? 13.778  19.405  21.959 1.00 46.30 ? 90   ASN A CG  1 
ATOM   743  O OD1 . ASN A 1 90  ? 14.492  18.510  22.410 1.00 48.29 ? 90   ASN A OD1 1 
ATOM   744  N ND2 . ASN A 1 90  ? 13.117  20.250  22.736 1.00 43.95 ? 90   ASN A ND2 1 
ATOM   745  N N   . SER A 1 91  ? 12.038  22.966  20.453 1.00 48.14 ? 91   SER A N   1 
ATOM   746  C CA  . SER A 1 91  ? 12.226  24.365  20.824 1.00 49.89 ? 91   SER A CA  1 
ATOM   747  C C   . SER A 1 91  ? 12.916  24.662  22.152 1.00 49.66 ? 91   SER A C   1 
ATOM   748  O O   . SER A 1 91  ? 13.958  25.318  22.174 1.00 50.06 ? 91   SER A O   1 
ATOM   749  C CB  . SER A 1 91  ? 10.879  25.099  20.777 1.00 50.93 ? 91   SER A CB  1 
ATOM   750  O OG  . SER A 1 91  ? 9.951   24.557  21.701 1.00 52.93 ? 91   SER A OG  1 
ATOM   751  N N   . THR A 1 92  ? 12.339  24.192  23.253 1.00 48.29 ? 92   THR A N   1 
ATOM   752  C CA  . THR A 1 92  ? 12.907  24.442  24.573 1.00 47.68 ? 92   THR A CA  1 
ATOM   753  C C   . THR A 1 92  ? 14.393  24.091  24.680 1.00 48.96 ? 92   THR A C   1 
ATOM   754  O O   . THR A 1 92  ? 15.142  24.712  25.448 1.00 50.59 ? 92   THR A O   1 
ATOM   755  C CB  . THR A 1 92  ? 12.137  23.674  25.665 1.00 49.04 ? 92   THR A CB  1 
ATOM   756  O OG1 . THR A 1 92  ? 12.143  22.284  25.377 1.00 47.36 ? 92   THR A OG1 1 
ATOM   757  C CG2 . THR A 1 92  ? 10.676  24.111  25.784 1.00 45.65 ? 92   THR A CG2 1 
ATOM   758  N N   . GLU A 1 93  ? 14.820  23.109  23.924 1.00 49.80 ? 93   GLU A N   1 
ATOM   759  C CA  . GLU A 1 93  ? 16.225  22.679  23.960 1.00 50.35 ? 93   GLU A CA  1 
ATOM   760  C C   . GLU A 1 93  ? 16.937  23.035  22.655 1.00 51.27 ? 93   GLU A C   1 
ATOM   761  O O   . GLU A 1 93  ? 18.105  22.674  22.445 1.00 51.66 ? 93   GLU A O   1 
ATOM   762  C CB  . GLU A 1 93  ? 16.310  21.168  24.159 1.00 49.90 ? 93   GLU A CB  1 
ATOM   763  C CG  . GLU A 1 93  ? 15.811  20.712  25.531 1.00 50.31 ? 93   GLU A CG  1 
ATOM   764  C CD  . GLU A 1 93  ? 15.972  19.207  25.749 1.00 48.78 ? 93   GLU A CD  1 
ATOM   765  O OE1 . GLU A 1 93  ? 15.531  18.377  24.865 1.00 49.13 ? 93   GLU A OE1 1 
ATOM   766  O OE2 . GLU A 1 93  ? 16.551  18.768  26.814 1.00 49.38 ? 93   GLU A OE2 1 
ATOM   767  N N   . ASP A 1 94  ? 16.219  23.743  21.802 1.00 51.96 ? 94   ASP A N   1 
ATOM   768  C CA  . ASP A 1 94  ? 16.742  24.139  20.486 1.00 52.97 ? 94   ASP A CA  1 
ATOM   769  C C   . ASP A 1 94  ? 17.575  22.996  19.924 1.00 52.47 ? 94   ASP A C   1 
ATOM   770  O O   . ASP A 1 94  ? 18.768  23.137  19.649 1.00 53.23 ? 94   ASP A O   1 
ATOM   771  C CB  . ASP A 1 94  ? 17.643  25.368  20.615 1.00 55.21 ? 94   ASP A CB  1 
ATOM   772  C CG  . ASP A 1 94  ? 18.194  25.834  19.267 1.00 56.48 ? 94   ASP A CG  1 
ATOM   773  O OD1 . ASP A 1 94  ? 17.386  26.034  18.281 1.00 58.00 ? 94   ASP A OD1 1 
ATOM   774  O OD2 . ASP A 1 94  ? 19.460  26.027  19.114 1.00 59.79 ? 94   ASP A OD2 1 
ATOM   775  N N   . ARG A 1 95  ? 16.928  21.874  19.764 1.00 51.35 ? 95   ARG A N   1 
ATOM   776  C CA  . ARG A 1 95  ? 17.595  20.665  19.288 1.00 49.29 ? 95   ARG A CA  1 
ATOM   777  C C   . ARG A 1 95  ? 16.749  20.022  18.201 1.00 48.74 ? 95   ARG A C   1 
ATOM   778  O O   . ARG A 1 95  ? 15.517  20.163  18.185 1.00 46.44 ? 95   ARG A O   1 
ATOM   779  C CB  . ARG A 1 95  ? 17.716  19.695  20.469 1.00 50.23 ? 95   ARG A CB  1 
ATOM   780  C CG  . ARG A 1 95  ? 18.740  18.580  20.270 1.00 52.04 ? 95   ARG A CG  1 
ATOM   781  C CD  . ARG A 1 95  ? 19.005  17.799  21.563 1.00 51.48 ? 95   ARG A CD  1 
ATOM   782  N NE  . ARG A 1 95  ? 19.252  18.679  22.717 1.00 52.01 ? 95   ARG A NE  1 
ATOM   783  C CZ  . ARG A 1 95  ? 19.292  18.266  23.993 1.00 52.98 ? 95   ARG A CZ  1 
ATOM   784  N NH1 . ARG A 1 95  ? 19.096  16.980  24.312 1.00 53.39 ? 95   ARG A NH1 1 
ATOM   785  N NH2 . ARG A 1 95  ? 19.529  19.077  25.035 1.00 54.39 ? 95   ARG A NH2 1 
ATOM   786  N N   . ALA A 1 96  ? 17.388  19.345  17.293 1.00 47.02 ? 96   ALA A N   1 
ATOM   787  C CA  . ALA A 1 96  ? 16.656  18.655  16.237 1.00 46.18 ? 96   ALA A CA  1 
ATOM   788  C C   . ALA A 1 96  ? 16.030  17.400  16.840 1.00 44.04 ? 96   ALA A C   1 
ATOM   789  O O   . ALA A 1 96  ? 16.409  16.960  17.932 1.00 43.02 ? 96   ALA A O   1 
ATOM   790  C CB  . ALA A 1 96  ? 17.605  18.280  15.100 1.00 44.73 ? 96   ALA A CB  1 
ATOM   791  N N   . VAL A 1 97  ? 15.078  16.860  16.124 1.00 43.51 ? 97   VAL A N   1 
ATOM   792  C CA  . VAL A 1 97  ? 14.401  15.618  16.515 1.00 42.48 ? 97   VAL A CA  1 
ATOM   793  C C   . VAL A 1 97  ? 14.504  14.668  15.342 1.00 41.41 ? 97   VAL A C   1 
ATOM   794  O O   . VAL A 1 97  ? 13.643  14.655  14.468 1.00 43.49 ? 97   VAL A O   1 
ATOM   795  C CB  . VAL A 1 97  ? 12.938  15.907  16.849 1.00 41.41 ? 97   VAL A CB  1 
ATOM   796  C CG1 . VAL A 1 97  ? 12.157  14.652  17.242 1.00 40.91 ? 97   VAL A CG1 1 
ATOM   797  C CG2 . VAL A 1 97  ? 12.775  16.882  18.017 1.00 38.58 ? 97   VAL A CG2 1 
ATOM   798  N N   . LEU A 1 98  ? 15.561  13.863  15.333 1.00 42.21 ? 98   LEU A N   1 
ATOM   799  C CA  . LEU A 1 98  ? 15.799  12.971  14.211 1.00 42.26 ? 98   LEU A CA  1 
ATOM   800  C C   . LEU A 1 98  ? 15.960  11.478  14.442 1.00 42.26 ? 98   LEU A C   1 
ATOM   801  O O   . LEU A 1 98  ? 16.904  10.879  13.924 1.00 41.22 ? 98   LEU A O   1 
ATOM   802  C CB  . LEU A 1 98  ? 17.016  13.475  13.427 1.00 43.12 ? 98   LEU A CB  1 
ATOM   803  C CG  . LEU A 1 98  ? 16.845  14.783  12.653 1.00 42.19 ? 98   LEU A CG  1 
ATOM   804  C CD1 . LEU A 1 98  ? 18.184  15.224  12.098 1.00 44.03 ? 98   LEU A CD1 1 
ATOM   805  C CD2 . LEU A 1 98  ? 15.842  14.585  11.532 1.00 42.36 ? 98   LEU A CD2 1 
ATOM   806  N N   . HIS A 1 99  ? 15.059  10.852  15.194 1.00 42.56 ? 99   HIS A N   1 
ATOM   807  C CA  . HIS A 1 99  ? 15.195  9.409   15.362 1.00 41.58 ? 99   HIS A CA  1 
ATOM   808  C C   . HIS A 1 99  ? 14.948  8.782   13.988 1.00 41.80 ? 99   HIS A C   1 
ATOM   809  O O   . HIS A 1 99  ? 15.385  7.662   13.714 1.00 42.33 ? 99   HIS A O   1 
ATOM   810  C CB  . HIS A 1 99  ? 14.215  8.845   16.416 1.00 38.69 ? 99   HIS A CB  1 
ATOM   811  C CG  . HIS A 1 99  ? 12.874  9.517   16.439 1.00 37.53 ? 99   HIS A CG  1 
ATOM   812  N ND1 . HIS A 1 99  ? 12.657  10.730  17.059 1.00 37.22 ? 99   HIS A ND1 1 
ATOM   813  C CD2 . HIS A 1 99  ? 11.684  9.149   15.907 1.00 36.16 ? 99   HIS A CD2 1 
ATOM   814  C CE1 . HIS A 1 99  ? 11.393  11.083  16.903 1.00 35.37 ? 99   HIS A CE1 1 
ATOM   815  N NE2 . HIS A 1 99  ? 10.781  10.140  16.206 1.00 37.72 ? 99   HIS A NE2 1 
ATOM   816  N N   . VAL A 1 100 ? 14.266  9.515   13.112 1.00 41.27 ? 100  VAL A N   1 
ATOM   817  C CA  . VAL A 1 100 ? 13.994  9.006   11.766 1.00 42.84 ? 100  VAL A CA  1 
ATOM   818  C C   . VAL A 1 100 ? 15.294  8.886   10.973 1.00 43.37 ? 100  VAL A C   1 
ATOM   819  O O   . VAL A 1 100 ? 15.414  8.047   10.080 1.00 44.83 ? 100  VAL A O   1 
ATOM   820  C CB  . VAL A 1 100 ? 13.019  9.922   10.978 1.00 42.11 ? 100  VAL A CB  1 
ATOM   821  C CG1 . VAL A 1 100 ? 11.660  9.952   11.663 1.00 43.01 ? 100  VAL A CG1 1 
ATOM   822  C CG2 . VAL A 1 100 ? 13.586  11.331  10.873 1.00 45.05 ? 100  VAL A CG2 1 
ATOM   823  N N   . ALA A 1 101 ? 16.265  9.726   11.310 1.00 43.39 ? 101  ALA A N   1 
ATOM   824  C CA  . ALA A 1 101 ? 17.556  9.714   10.634 1.00 44.19 ? 101  ALA A CA  1 
ATOM   825  C C   . ALA A 1 101 ? 18.293  8.411   10.935 1.00 44.58 ? 101  ALA A C   1 
ATOM   826  O O   . ALA A 1 101 ? 18.958  7.840   10.065 1.00 42.42 ? 101  ALA A O   1 
ATOM   827  C CB  . ALA A 1 101 ? 18.388  10.901  11.091 1.00 44.97 ? 101  ALA A CB  1 
ATOM   828  N N   . LEU A 1 102 ? 18.163  7.947   12.174 1.00 42.71 ? 102  LEU A N   1 
ATOM   829  C CA  . LEU A 1 102 ? 18.811  6.716   12.616 1.00 42.99 ? 102  LEU A CA  1 
ATOM   830  C C   . LEU A 1 102 ? 18.461  5.506   11.755 1.00 41.78 ? 102  LEU A C   1 
ATOM   831  O O   . LEU A 1 102 ? 19.306  4.640   11.527 1.00 41.93 ? 102  LEU A O   1 
ATOM   832  C CB  . LEU A 1 102 ? 18.444  6.430   14.076 1.00 43.53 ? 102  LEU A CB  1 
ATOM   833  C CG  . LEU A 1 102 ? 18.910  7.476   15.096 1.00 44.44 ? 102  LEU A CG  1 
ATOM   834  C CD1 . LEU A 1 102 ? 18.300  7.181   16.464 1.00 45.08 ? 102  LEU A CD1 1 
ATOM   835  C CD2 . LEU A 1 102 ? 20.435  7.477   15.170 1.00 43.00 ? 102  LEU A CD2 1 
ATOM   836  N N   . ARG A 1 103 ? 17.220  5.446   11.279 1.00 42.27 ? 103  ARG A N   1 
ATOM   837  C CA  . ARG A 1 103 ? 16.771  4.329   10.455 1.00 42.87 ? 103  ARG A CA  1 
ATOM   838  C C   . ARG A 1 103 ? 16.516  4.740   9.003  1.00 43.86 ? 103  ARG A C   1 
ATOM   839  O O   . ARG A 1 103 ? 15.802  4.056   8.273  1.00 43.25 ? 103  ARG A O   1 
ATOM   840  C CB  . ARG A 1 103 ? 15.497  3.703   11.055 1.00 39.72 ? 103  ARG A CB  1 
ATOM   841  C CG  . ARG A 1 103 ? 14.265  4.617   11.070 1.00 38.90 ? 103  ARG A CG  1 
ATOM   842  C CD  . ARG A 1 103 ? 13.777  4.900   12.500 1.00 38.52 ? 103  ARG A CD  1 
ATOM   843  N NE  . ARG A 1 103 ? 12.475  5.569   12.534 1.00 35.05 ? 103  ARG A NE  1 
ATOM   844  C CZ  . ARG A 1 103 ? 11.821  5.888   13.650 1.00 36.53 ? 103  ARG A CZ  1 
ATOM   845  N NH1 . ARG A 1 103 ? 12.347  5.604   14.834 1.00 34.68 ? 103  ARG A NH1 1 
ATOM   846  N NH2 . ARG A 1 103 ? 10.634  6.481   13.584 1.00 35.38 ? 103  ARG A NH2 1 
ATOM   847  N N   . ASN A 1 104 ? 17.101  5.859   8.590  1.00 45.85 ? 104  ASN A N   1 
ATOM   848  C CA  . ASN A 1 104 ? 16.939  6.343   7.222  1.00 48.56 ? 104  ASN A CA  1 
ATOM   849  C C   . ASN A 1 104 ? 17.857  5.551   6.295  1.00 50.45 ? 104  ASN A C   1 
ATOM   850  O O   . ASN A 1 104 ? 18.908  6.036   5.872  1.00 49.18 ? 104  ASN A O   1 
ATOM   851  C CB  . ASN A 1 104 ? 17.270  7.839   7.143  1.00 49.40 ? 104  ASN A CB  1 
ATOM   852  C CG  . ASN A 1 104 ? 17.310  8.355   5.713  1.00 50.87 ? 104  ASN A CG  1 
ATOM   853  O OD1 . ASN A 1 104 ? 16.396  8.107   4.923  1.00 50.69 ? 104  ASN A OD1 1 
ATOM   854  N ND2 . ASN A 1 104 ? 18.370  9.083   5.377  1.00 51.29 ? 104  ASN A ND2 1 
ATOM   855  N N   . ARG A 1 105 ? 17.442  4.329   5.977  1.00 51.70 ? 105  ARG A N   1 
ATOM   856  C CA  . ARG A 1 105 ? 18.229  3.455   5.123  1.00 54.19 ? 105  ARG A CA  1 
ATOM   857  C C   . ARG A 1 105 ? 18.245  3.868   3.652  1.00 54.96 ? 105  ARG A C   1 
ATOM   858  O O   . ARG A 1 105 ? 19.004  3.313   2.862  1.00 54.50 ? 105  ARG A O   1 
ATOM   859  C CB  . ARG A 1 105 ? 17.747  2.013   5.286  1.00 54.84 ? 105  ARG A CB  1 
ATOM   860  C CG  . ARG A 1 105 ? 17.701  1.587   6.754  1.00 55.96 ? 105  ARG A CG  1 
ATOM   861  C CD  . ARG A 1 105 ? 17.861  0.093   6.933  1.00 55.82 ? 105  ARG A CD  1 
ATOM   862  N NE  . ARG A 1 105 ? 19.205  -0.367  6.587  1.00 55.87 ? 105  ARG A NE  1 
ATOM   863  C CZ  . ARG A 1 105 ? 20.317  0.011   7.209  1.00 55.62 ? 105  ARG A CZ  1 
ATOM   864  N NH1 . ARG A 1 105 ? 20.267  0.866   8.220  1.00 55.81 ? 105  ARG A NH1 1 
ATOM   865  N NH2 . ARG A 1 105 ? 21.487  -0.476  6.825  1.00 58.73 ? 105  ARG A NH2 1 
ATOM   866  N N   . SER A 1 106 ? 17.409  4.836   3.287  1.00 55.68 ? 106  SER A N   1 
ATOM   867  C CA  . SER A 1 106 ? 17.391  5.339   1.916  1.00 57.61 ? 106  SER A CA  1 
ATOM   868  C C   . SER A 1 106 ? 18.609  6.250   1.794  1.00 58.86 ? 106  SER A C   1 
ATOM   869  O O   . SER A 1 106 ? 19.000  6.655   0.698  1.00 58.43 ? 106  SER A O   1 
ATOM   870  C CB  . SER A 1 106 ? 16.122  6.154   1.643  1.00 57.39 ? 106  SER A CB  1 
ATOM   871  O OG  . SER A 1 106 ? 14.969  5.331   1.610  1.00 59.86 ? 106  SER A OG  1 
ATOM   872  N N   . ASN A 1 107 ? 19.195  6.561   2.948  1.00 59.71 ? 107  ASN A N   1 
ATOM   873  C CA  . ASN A 1 107 ? 20.373  7.416   3.047  1.00 61.98 ? 107  ASN A CA  1 
ATOM   874  C C   . ASN A 1 107 ? 20.188  8.813   2.476  1.00 62.59 ? 107  ASN A C   1 
ATOM   875  O O   . ASN A 1 107 ? 21.162  9.531   2.248  1.00 63.25 ? 107  ASN A O   1 
ATOM   876  C CB  . ASN A 1 107 ? 21.580  6.743   2.392  1.00 62.64 ? 107  ASN A CB  1 
ATOM   877  C CG  . ASN A 1 107 ? 22.111  5.591   3.214  1.00 62.85 ? 107  ASN A CG  1 
ATOM   878  O OD1 . ASN A 1 107 ? 22.319  5.723   4.419  1.00 63.76 ? 107  ASN A OD1 1 
ATOM   879  N ND2 . ASN A 1 107 ? 22.339  4.454   2.568  1.00 63.40 ? 107  ASN A ND2 1 
ATOM   880  N N   . THR A 1 108 ? 18.938  9.197   2.248  1.00 62.68 ? 108  THR A N   1 
ATOM   881  C CA  . THR A 1 108 ? 18.643  10.524  1.732  1.00 62.94 ? 108  THR A CA  1 
ATOM   882  C C   . THR A 1 108 ? 19.166  11.546  2.737  1.00 63.34 ? 108  THR A C   1 
ATOM   883  O O   . THR A 1 108 ? 19.036  11.363  3.947  1.00 64.11 ? 108  THR A O   1 
ATOM   884  C CB  . THR A 1 108 ? 17.129  10.719  1.538  1.00 62.84 ? 108  THR A CB  1 
ATOM   885  O OG1 . THR A 1 108 ? 16.674  9.858   0.486  1.00 63.68 ? 108  THR A OG1 1 
ATOM   886  C CG2 . THR A 1 108 ? 16.810  12.166  1.184  1.00 62.30 ? 108  THR A CG2 1 
ATOM   887  N N   . PRO A 1 109 ? 19.776  12.633  2.243  1.00 62.77 ? 109  PRO A N   1 
ATOM   888  C CA  . PRO A 1 109 ? 20.341  13.711  3.060  1.00 61.95 ? 109  PRO A CA  1 
ATOM   889  C C   . PRO A 1 109 ? 19.397  14.396  4.044  1.00 61.08 ? 109  PRO A C   1 
ATOM   890  O O   . PRO A 1 109 ? 18.229  14.639  3.744  1.00 60.25 ? 109  PRO A O   1 
ATOM   891  C CB  . PRO A 1 109 ? 20.870  14.687  2.011  1.00 62.45 ? 109  PRO A CB  1 
ATOM   892  C CG  . PRO A 1 109 ? 21.283  13.779  0.904  1.00 63.16 ? 109  PRO A CG  1 
ATOM   893  C CD  . PRO A 1 109 ? 20.104  12.841  0.822  1.00 63.62 ? 109  PRO A CD  1 
ATOM   894  N N   . ILE A 1 110 ? 19.937  14.703  5.220  1.00 61.12 ? 110  ILE A N   1 
ATOM   895  C CA  . ILE A 1 110 ? 19.218  15.391  6.286  1.00 61.65 ? 110  ILE A CA  1 
ATOM   896  C C   . ILE A 1 110 ? 20.225  16.309  6.996  1.00 62.73 ? 110  ILE A C   1 
ATOM   897  O O   . ILE A 1 110 ? 20.813  15.942  8.021  1.00 62.91 ? 110  ILE A O   1 
ATOM   898  C CB  . ILE A 1 110 ? 18.652  14.403  7.337  1.00 60.95 ? 110  ILE A CB  1 
ATOM   899  C CG1 . ILE A 1 110 ? 17.632  13.439  6.726  1.00 61.04 ? 110  ILE A CG1 1 
ATOM   900  C CG2 . ILE A 1 110 ? 17.940  15.106  8.494  1.00 60.73 ? 110  ILE A CG2 1 
ATOM   901  C CD1 . ILE A 1 110 ? 17.068  12.439  7.731  1.00 60.73 ? 110  ILE A CD1 1 
ATOM   902  N N   . VAL A 1 111 ? 20.419  17.485  6.420  1.00 64.41 ? 111  VAL A N   1 
ATOM   903  C CA  . VAL A 1 111 ? 21.385  18.473  6.944  1.00 65.68 ? 111  VAL A CA  1 
ATOM   904  C C   . VAL A 1 111 ? 20.940  18.998  8.310  1.00 66.17 ? 111  VAL A C   1 
ATOM   905  O O   . VAL A 1 111 ? 19.799  19.447  8.484  1.00 64.90 ? 111  VAL A O   1 
ATOM   906  C CB  . VAL A 1 111 ? 21.515  19.656  5.986  1.00 66.05 ? 111  VAL A CB  1 
ATOM   907  C CG1 . VAL A 1 111 ? 20.207  20.424  5.800  1.00 66.61 ? 111  VAL A CG1 1 
ATOM   908  C CG2 . VAL A 1 111 ? 22.542  20.690  6.457  1.00 66.31 ? 111  VAL A CG2 1 
ATOM   909  N N   . VAL A 1 112 ? 21.873  18.932  9.244  1.00 67.36 ? 112  VAL A N   1 
ATOM   910  C CA  . VAL A 1 112 ? 21.636  19.372  10.623 1.00 69.04 ? 112  VAL A CA  1 
ATOM   911  C C   . VAL A 1 112 ? 22.587  20.512  10.999 1.00 70.83 ? 112  VAL A C   1 
ATOM   912  O O   . VAL A 1 112 ? 23.796  20.299  11.188 1.00 70.34 ? 112  VAL A O   1 
ATOM   913  C CB  . VAL A 1 112 ? 21.856  18.220  11.602 1.00 69.00 ? 112  VAL A CB  1 
ATOM   914  C CG1 . VAL A 1 112 ? 22.066  18.691  13.042 1.00 69.16 ? 112  VAL A CG1 1 
ATOM   915  C CG2 . VAL A 1 112 ? 20.678  17.245  11.652 1.00 68.84 ? 112  VAL A CG2 1 
ATOM   916  N N   . ASP A 1 113 ? 21.972  21.671  11.092 1.00 72.60 ? 113  ASP A N   1 
ATOM   917  C CA  . ASP A 1 113 ? 22.624  22.941  11.440 1.00 74.49 ? 113  ASP A CA  1 
ATOM   918  C C   . ASP A 1 113 ? 24.071  22.966  10.899 1.00 74.74 ? 113  ASP A C   1 
ATOM   919  O O   . ASP A 1 113 ? 24.983  23.518  11.536 1.00 75.47 ? 113  ASP A O   1 
ATOM   920  C CB  . ASP A 1 113 ? 22.495  23.169  12.974 1.00 75.56 ? 113  ASP A CB  1 
ATOM   921  C CG  . ASP A 1 113 ? 23.743  22.866  13.824 1.00 76.87 ? 113  ASP A CG  1 
ATOM   922  O OD1 . ASP A 1 113 ? 23.926  21.686  14.318 1.00 78.34 ? 113  ASP A OD1 1 
ATOM   923  O OD2 . ASP A 1 113 ? 24.600  23.801  14.072 1.00 78.85 ? 113  ASP A OD2 1 
ATOM   924  N N   . GLY A 1 114 ? 24.247  22.367  9.700  1.00 74.35 ? 114  GLY A N   1 
ATOM   925  C CA  . GLY A 1 114 ? 25.566  22.351  9.007  1.00 72.86 ? 114  GLY A CA  1 
ATOM   926  C C   . GLY A 1 114 ? 25.704  21.277  7.922  1.00 72.49 ? 114  GLY A C   1 
ATOM   927  O O   . GLY A 1 114 ? 25.404  21.512  6.745  1.00 72.33 ? 114  GLY A O   1 
ATOM   928  N N   . LYS A 1 115 ? 26.186  20.120  8.346  1.00 71.29 ? 115  LYS A N   1 
ATOM   929  C CA  . LYS A 1 115 ? 26.426  18.985  7.437  1.00 70.19 ? 115  LYS A CA  1 
ATOM   930  C C   . LYS A 1 115 ? 25.345  17.916  7.604  1.00 68.60 ? 115  LYS A C   1 
ATOM   931  O O   . LYS A 1 115 ? 24.565  17.939  8.565  1.00 68.01 ? 115  LYS A O   1 
ATOM   932  C CB  . LYS A 1 115 ? 27.787  18.354  7.734  1.00 71.38 ? 115  LYS A CB  1 
ATOM   933  C CG  . LYS A 1 115 ? 28.569  18.001  6.467  1.00 72.30 ? 115  LYS A CG  1 
ATOM   934  C CD  . LYS A 1 115 ? 29.743  17.058  6.733  1.00 73.21 ? 115  LYS A CD  1 
ATOM   935  C CE  . LYS A 1 115 ? 29.302  15.676  7.220  1.00 73.35 ? 115  LYS A CE  1 
ATOM   936  N NZ  . LYS A 1 115 ? 30.432  14.789  7.529  1.00 73.73 ? 115  LYS A NZ  1 
ATOM   937  N N   . ASP A 1 116 ? 25.338  17.006  6.645  1.00 66.48 ? 116  ASP A N   1 
ATOM   938  C CA  . ASP A 1 116 ? 24.388  15.886  6.619  1.00 65.05 ? 116  ASP A CA  1 
ATOM   939  C C   . ASP A 1 116 ? 24.749  14.889  7.715  1.00 63.54 ? 116  ASP A C   1 
ATOM   940  O O   . ASP A 1 116 ? 25.923  14.583  7.921  1.00 63.29 ? 116  ASP A O   1 
ATOM   941  C CB  . ASP A 1 116 ? 24.435  15.188  5.262  1.00 65.35 ? 116  ASP A CB  1 
ATOM   942  C CG  . ASP A 1 116 ? 23.535  13.955  5.202  1.00 66.58 ? 116  ASP A CG  1 
ATOM   943  O OD1 . ASP A 1 116 ? 22.356  13.992  5.725  1.00 66.40 ? 116  ASP A OD1 1 
ATOM   944  O OD2 . ASP A 1 116 ? 23.956  12.879  4.631  1.00 67.24 ? 116  ASP A OD2 1 
ATOM   945  N N   . VAL A 1 117 ? 23.737  14.380  8.414  1.00 61.65 ? 117  VAL A N   1 
ATOM   946  C CA  . VAL A 1 117 ? 23.964  13.442  9.508  1.00 59.61 ? 117  VAL A CA  1 
ATOM   947  C C   . VAL A 1 117 ? 24.110  11.971  9.129  1.00 58.37 ? 117  VAL A C   1 
ATOM   948  O O   . VAL A 1 117 ? 24.735  11.208  9.863  1.00 57.65 ? 117  VAL A O   1 
ATOM   949  C CB  . VAL A 1 117 ? 22.847  13.554  10.569 1.00 59.81 ? 117  VAL A CB  1 
ATOM   950  C CG1 . VAL A 1 117 ? 22.851  14.943  11.173 1.00 60.00 ? 117  VAL A CG1 1 
ATOM   951  C CG2 . VAL A 1 117 ? 21.494  13.246  9.943  1.00 59.20 ? 117  VAL A CG2 1 
ATOM   952  N N   . MET A 1 118 ? 23.549  11.569  7.993  1.00 58.10 ? 118  MET A N   1 
ATOM   953  C CA  . MET A 1 118 ? 23.632  10.172  7.572  1.00 57.27 ? 118  MET A CA  1 
ATOM   954  C C   . MET A 1 118 ? 25.034  9.562   7.597  1.00 57.97 ? 118  MET A C   1 
ATOM   955  O O   . MET A 1 118 ? 25.211  8.435   8.064  1.00 58.01 ? 118  MET A O   1 
ATOM   956  C CB  . MET A 1 118 ? 23.024  9.987   6.179  1.00 55.97 ? 118  MET A CB  1 
ATOM   957  C CG  . MET A 1 118 ? 21.516  10.164  6.127  1.00 55.93 ? 118  MET A CG  1 
ATOM   958  S SD  . MET A 1 118 ? 20.642  9.360   7.505  1.00 53.83 ? 118  MET A SD  1 
ATOM   959  C CE  . MET A 1 118 ? 19.917  10.778  8.262  1.00 53.36 ? 118  MET A CE  1 
ATOM   960  N N   . PRO A 1 119 ? 26.052  10.288  7.097  1.00 58.34 ? 119  PRO A N   1 
ATOM   961  C CA  . PRO A 1 119 ? 27.401  9.711   7.115  1.00 58.51 ? 119  PRO A CA  1 
ATOM   962  C C   . PRO A 1 119 ? 27.842  9.264   8.513  1.00 58.03 ? 119  PRO A C   1 
ATOM   963  O O   . PRO A 1 119 ? 28.487  8.224   8.670  1.00 57.99 ? 119  PRO A O   1 
ATOM   964  C CB  . PRO A 1 119 ? 28.268  10.837  6.543  1.00 59.01 ? 119  PRO A CB  1 
ATOM   965  C CG  . PRO A 1 119 ? 27.509  12.075  6.916  1.00 60.12 ? 119  PRO A CG  1 
ATOM   966  C CD  . PRO A 1 119 ? 26.087  11.680  6.615  1.00 58.83 ? 119  PRO A CD  1 
ATOM   967  N N   . GLU A 1 120 ? 27.490  10.048  9.526  1.00 57.56 ? 120  GLU A N   1 
ATOM   968  C CA  . GLU A 1 120 ? 27.845  9.706   10.897 1.00 57.81 ? 120  GLU A CA  1 
ATOM   969  C C   . GLU A 1 120 ? 26.914  8.617   11.425 1.00 56.03 ? 120  GLU A C   1 
ATOM   970  O O   . GLU A 1 120 ? 27.334  7.732   12.174 1.00 56.10 ? 120  GLU A O   1 
ATOM   971  C CB  . GLU A 1 120 ? 27.778  10.948  11.788 1.00 60.13 ? 120  GLU A CB  1 
ATOM   972  C CG  . GLU A 1 120 ? 29.068  11.759  11.797 1.00 64.74 ? 120  GLU A CG  1 
ATOM   973  C CD  . GLU A 1 120 ? 30.238  10.986  12.396 1.00 67.08 ? 120  GLU A CD  1 
ATOM   974  O OE1 . GLU A 1 120 ? 31.371  11.508  12.380 1.00 69.21 ? 120  GLU A OE1 1 
ATOM   975  O OE2 . GLU A 1 120 ? 30.025  9.855   12.887 1.00 69.23 ? 120  GLU A OE2 1 
ATOM   976  N N   . VAL A 1 121 ? 25.650  8.688   11.023 1.00 54.05 ? 121  VAL A N   1 
ATOM   977  C CA  . VAL A 1 121 ? 24.660  7.701   11.432 1.00 52.08 ? 121  VAL A CA  1 
ATOM   978  C C   . VAL A 1 121 ? 25.097  6.320   10.954 1.00 51.33 ? 121  VAL A C   1 
ATOM   979  O O   . VAL A 1 121 ? 25.090  5.354   11.719 1.00 50.37 ? 121  VAL A O   1 
ATOM   980  C CB  . VAL A 1 121 ? 23.276  8.016   10.826 1.00 50.38 ? 121  VAL A CB  1 
ATOM   981  C CG1 . VAL A 1 121 ? 22.288  6.913   11.175 1.00 51.02 ? 121  VAL A CG1 1 
ATOM   982  C CG2 . VAL A 1 121 ? 22.782  9.353   11.337 1.00 50.61 ? 121  VAL A CG2 1 
ATOM   983  N N   . ASN A 1 122 ? 25.487  6.238   9.684  1.00 51.48 ? 122  ASN A N   1 
ATOM   984  C CA  . ASN A 1 122 ? 25.919  4.975   9.100  1.00 50.90 ? 122  ASN A CA  1 
ATOM   985  C C   . ASN A 1 122 ? 27.296  4.542   9.583  1.00 49.62 ? 122  ASN A C   1 
ATOM   986  O O   . ASN A 1 122 ? 27.638  3.360   9.526  1.00 48.53 ? 122  ASN A O   1 
ATOM   987  C CB  . ASN A 1 122 ? 25.909  5.064   7.572  1.00 52.45 ? 122  ASN A CB  1 
ATOM   988  C CG  . ASN A 1 122 ? 24.511  5.202   7.006  1.00 53.66 ? 122  ASN A CG  1 
ATOM   989  O OD1 . ASN A 1 122 ? 23.603  4.445   7.362  1.00 53.49 ? 122  ASN A OD1 1 
ATOM   990  N ND2 . ASN A 1 122 ? 24.330  6.166   6.110  1.00 55.70 ? 122  ASN A ND2 1 
ATOM   991  N N   . LYS A 1 123 ? 28.086  5.498   10.058 1.00 50.28 ? 123  LYS A N   1 
ATOM   992  C CA  . LYS A 1 123 ? 29.418  5.186   10.556 1.00 50.30 ? 123  LYS A CA  1 
ATOM   993  C C   . LYS A 1 123 ? 29.316  4.372   11.841 1.00 50.10 ? 123  LYS A C   1 
ATOM   994  O O   . LYS A 1 123 ? 30.004  3.365   12.007 1.00 50.54 ? 123  LYS A O   1 
ATOM   995  C CB  . LYS A 1 123 ? 30.213  6.472   10.807 1.00 50.09 ? 123  LYS A CB  1 
ATOM   996  C CG  . LYS A 1 123 ? 31.579  6.231   11.436 1.00 50.26 ? 123  LYS A CG  1 
ATOM   997  C CD  . LYS A 1 123 ? 32.304  5.090   10.736 1.00 51.20 ? 123  LYS A CD  1 
ATOM   998  C CE  . LYS A 1 123 ? 32.837  4.079   11.746 1.00 52.48 ? 123  LYS A CE  1 
ATOM   999  N NZ  . LYS A 1 123 ? 33.025  2.731   11.137 1.00 51.21 ? 123  LYS A NZ  1 
ATOM   1000 N N   . VAL A 1 124 ? 28.452  4.811   12.750 1.00 49.85 ? 124  VAL A N   1 
ATOM   1001 C CA  . VAL A 1 124 ? 28.262  4.099   14.005 1.00 49.59 ? 124  VAL A CA  1 
ATOM   1002 C C   . VAL A 1 124 ? 27.700  2.710   13.717 1.00 48.11 ? 124  VAL A C   1 
ATOM   1003 O O   . VAL A 1 124 ? 28.167  1.713   14.271 1.00 47.36 ? 124  VAL A O   1 
ATOM   1004 C CB  . VAL A 1 124 ? 27.298  4.857   14.934 1.00 49.92 ? 124  VAL A CB  1 
ATOM   1005 C CG1 . VAL A 1 124 ? 27.036  4.038   16.189 1.00 50.92 ? 124  VAL A CG1 1 
ATOM   1006 C CG2 . VAL A 1 124 ? 27.890  6.212   15.295 1.00 51.28 ? 124  VAL A CG2 1 
ATOM   1007 N N   . LEU A 1 125 ? 26.701  2.655   12.840 1.00 48.03 ? 125  LEU A N   1 
ATOM   1008 C CA  . LEU A 1 125 ? 26.075  1.392   12.459 1.00 47.91 ? 125  LEU A CA  1 
ATOM   1009 C C   . LEU A 1 125 ? 27.117  0.391   11.981 1.00 47.83 ? 125  LEU A C   1 
ATOM   1010 O O   . LEU A 1 125 ? 27.103  -0.772  12.381 1.00 46.12 ? 125  LEU A O   1 
ATOM   1011 C CB  . LEU A 1 125 ? 25.037  1.625   11.360 1.00 48.39 ? 125  LEU A CB  1 
ATOM   1012 C CG  . LEU A 1 125 ? 23.765  2.345   11.815 1.00 48.18 ? 125  LEU A CG  1 
ATOM   1013 C CD1 . LEU A 1 125 ? 22.904  2.706   10.617 1.00 48.90 ? 125  LEU A CD1 1 
ATOM   1014 C CD2 . LEU A 1 125 ? 23.000  1.440   12.779 1.00 49.32 ? 125  LEU A CD2 1 
ATOM   1015 N N   . ASP A 1 126 ? 28.027  0.840   11.122 1.00 49.04 ? 126  ASP A N   1 
ATOM   1016 C CA  . ASP A 1 126 ? 29.067  -0.050  10.627 1.00 50.23 ? 126  ASP A CA  1 
ATOM   1017 C C   . ASP A 1 126 ? 29.941  -0.511  11.790 1.00 48.90 ? 126  ASP A C   1 
ATOM   1018 O O   . ASP A 1 126 ? 30.277  -1.690  11.894 1.00 49.82 ? 126  ASP A O   1 
ATOM   1019 C CB  . ASP A 1 126 ? 29.930  0.650   9.570  1.00 51.05 ? 126  ASP A CB  1 
ATOM   1020 C CG  . ASP A 1 126 ? 29.141  1.033   8.333  1.00 52.77 ? 126  ASP A CG  1 
ATOM   1021 O OD1 . ASP A 1 126 ? 28.290  0.230   7.896  1.00 54.01 ? 126  ASP A OD1 1 
ATOM   1022 O OD2 . ASP A 1 126 ? 29.379  2.134   7.790  1.00 54.89 ? 126  ASP A OD2 1 
ATOM   1023 N N   . LYS A 1 127 ? 30.304  0.420   12.667 1.00 48.60 ? 127  LYS A N   1 
ATOM   1024 C CA  . LYS A 1 127 ? 31.137  0.084   13.817 1.00 48.60 ? 127  LYS A CA  1 
ATOM   1025 C C   . LYS A 1 127 ? 30.409  -0.915  14.705 1.00 48.82 ? 127  LYS A C   1 
ATOM   1026 O O   . LYS A 1 127 ? 31.015  -1.853  15.226 1.00 48.61 ? 127  LYS A O   1 
ATOM   1027 C CB  . LYS A 1 127 ? 31.485  1.345   14.618 1.00 48.87 ? 127  LYS A CB  1 
ATOM   1028 C CG  . LYS A 1 127 ? 32.393  1.091   15.822 1.00 49.03 ? 127  LYS A CG  1 
ATOM   1029 C CD  . LYS A 1 127 ? 32.862  2.398   16.452 1.00 49.46 ? 127  LYS A CD  1 
ATOM   1030 C CE  . LYS A 1 127 ? 33.858  2.147   17.574 1.00 50.81 ? 127  LYS A CE  1 
ATOM   1031 N NZ  . LYS A 1 127 ? 34.405  3.412   18.132 1.00 51.79 ? 127  LYS A NZ  1 
ATOM   1032 N N   . MET A 1 128 ? 29.104  -0.711  14.869 1.00 49.08 ? 128  MET A N   1 
ATOM   1033 C CA  . MET A 1 128 ? 28.288  -1.604  15.685 1.00 47.98 ? 128  MET A CA  1 
ATOM   1034 C C   . MET A 1 128 ? 28.332  -3.016  15.128 1.00 47.19 ? 128  MET A C   1 
ATOM   1035 O O   . MET A 1 128 ? 28.557  -3.973  15.865 1.00 46.71 ? 128  MET A O   1 
ATOM   1036 C CB  . MET A 1 128 ? 26.838  -1.113  15.730 1.00 47.13 ? 128  MET A CB  1 
ATOM   1037 C CG  . MET A 1 128 ? 26.627  0.116   16.603 1.00 46.81 ? 128  MET A CG  1 
ATOM   1038 S SD  . MET A 1 128 ? 24.959  0.795   16.473 1.00 44.56 ? 128  MET A SD  1 
ATOM   1039 C CE  . MET A 1 128 ? 24.018  -0.465  17.367 1.00 44.29 ? 128  MET A CE  1 
ATOM   1040 N N   . LYS A 1 129 ? 28.119  -3.145  13.822 1.00 48.62 ? 129  LYS A N   1 
ATOM   1041 C CA  . LYS A 1 129 ? 28.140  -4.453  13.178 1.00 49.76 ? 129  LYS A CA  1 
ATOM   1042 C C   . LYS A 1 129 ? 29.501  -5.107  13.378 1.00 50.61 ? 129  LYS A C   1 
ATOM   1043 O O   . LYS A 1 129 ? 29.589  -6.271  13.765 1.00 51.02 ? 129  LYS A O   1 
ATOM   1044 C CB  . LYS A 1 129 ? 27.840  -4.317  11.679 1.00 50.13 ? 129  LYS A CB  1 
ATOM   1045 C CG  . LYS A 1 129 ? 27.724  -5.651  10.944 1.00 49.04 ? 129  LYS A CG  1 
ATOM   1046 C CD  . LYS A 1 129 ? 27.213  -5.465  9.515  1.00 49.85 ? 129  LYS A CD  1 
ATOM   1047 C CE  . LYS A 1 129 ? 27.043  -6.800  8.800  1.00 47.41 ? 129  LYS A CE  1 
ATOM   1048 N NZ  . LYS A 1 129 ? 26.503  -6.629  7.418  1.00 49.49 ? 129  LYS A NZ  1 
ATOM   1049 N N   . ALA A 1 130 ? 30.560  -4.345  13.124 1.00 51.79 ? 130  ALA A N   1 
ATOM   1050 C CA  . ALA A 1 130 ? 31.922  -4.847  13.273 1.00 53.25 ? 130  ALA A CA  1 
ATOM   1051 C C   . ALA A 1 130 ? 32.135  -5.453  14.657 1.00 53.44 ? 130  ALA A C   1 
ATOM   1052 O O   . ALA A 1 130 ? 32.681  -6.549  14.791 1.00 52.42 ? 130  ALA A O   1 
ATOM   1053 C CB  . ALA A 1 130 ? 32.920  -3.719  13.037 1.00 53.93 ? 130  ALA A CB  1 
ATOM   1054 N N   . PHE A 1 131 ? 31.698  -4.734  15.685 1.00 54.06 ? 131  PHE A N   1 
ATOM   1055 C CA  . PHE A 1 131 ? 31.843  -5.200  17.059 1.00 54.62 ? 131  PHE A CA  1 
ATOM   1056 C C   . PHE A 1 131 ? 31.060  -6.494  17.296 1.00 55.90 ? 131  PHE A C   1 
ATOM   1057 O O   . PHE A 1 131 ? 31.589  -7.450  17.863 1.00 55.30 ? 131  PHE A O   1 
ATOM   1058 C CB  . PHE A 1 131 ? 31.372  -4.112  18.032 1.00 53.99 ? 131  PHE A CB  1 
ATOM   1059 C CG  . PHE A 1 131 ? 31.514  -4.489  19.482 1.00 53.88 ? 131  PHE A CG  1 
ATOM   1060 C CD1 . PHE A 1 131 ? 32.765  -4.788  20.021 1.00 53.39 ? 131  PHE A CD1 1 
ATOM   1061 C CD2 . PHE A 1 131 ? 30.398  -4.551  20.309 1.00 53.39 ? 131  PHE A CD2 1 
ATOM   1062 C CE1 . PHE A 1 131 ? 32.899  -5.144  21.360 1.00 52.59 ? 131  PHE A CE1 1 
ATOM   1063 C CE2 . PHE A 1 131 ? 30.523  -4.908  21.653 1.00 52.63 ? 131  PHE A CE2 1 
ATOM   1064 C CZ  . PHE A 1 131 ? 31.775  -5.204  22.178 1.00 51.64 ? 131  PHE A CZ  1 
ATOM   1065 N N   . CYS A 1 132 ? 29.806  -6.524  16.853 1.00 57.11 ? 132  CYS A N   1 
ATOM   1066 C CA  . CYS A 1 132 ? 28.963  -7.705  17.026 1.00 58.82 ? 132  CYS A CA  1 
ATOM   1067 C C   . CYS A 1 132 ? 29.579  -8.954  16.412 1.00 57.70 ? 132  CYS A C   1 
ATOM   1068 O O   . CYS A 1 132 ? 29.581  -10.020 17.028 1.00 56.69 ? 132  CYS A O   1 
ATOM   1069 C CB  . CYS A 1 132 ? 27.581  -7.471  16.410 1.00 61.28 ? 132  CYS A CB  1 
ATOM   1070 S SG  . CYS A 1 132 ? 26.581  -6.257  17.281 1.00 69.01 ? 132  CYS A SG  1 
ATOM   1071 N N   . GLN A 1 133 ? 30.099  -8.817  15.197 1.00 57.44 ? 133  GLN A N   1 
ATOM   1072 C CA  . GLN A 1 133 ? 30.715  -9.936  14.495 1.00 57.54 ? 133  GLN A CA  1 
ATOM   1073 C C   . GLN A 1 133 ? 31.825  -10.537 15.351 1.00 56.48 ? 133  GLN A C   1 
ATOM   1074 O O   . GLN A 1 133 ? 31.947  -11.758 15.467 1.00 55.88 ? 133  GLN A O   1 
ATOM   1075 C CB  . GLN A 1 133 ? 31.288  -9.459  13.155 1.00 59.33 ? 133  GLN A CB  1 
ATOM   1076 C CG  . GLN A 1 133 ? 31.541  -10.563 12.130 1.00 61.89 ? 133  GLN A CG  1 
ATOM   1077 C CD  . GLN A 1 133 ? 32.559  -11.593 12.593 1.00 63.74 ? 133  GLN A CD  1 
ATOM   1078 O OE1 . GLN A 1 133 ? 33.703  -11.257 12.910 1.00 65.31 ? 133  GLN A OE1 1 
ATOM   1079 N NE2 . GLN A 1 133 ? 32.147  -12.857 12.630 1.00 63.76 ? 133  GLN A NE2 1 
ATOM   1080 N N   . ARG A 1 134 ? 32.628  -9.666  15.956 1.00 55.51 ? 134  ARG A N   1 
ATOM   1081 C CA  . ARG A 1 134 ? 33.739  -10.090 16.800 1.00 54.80 ? 134  ARG A CA  1 
ATOM   1082 C C   . ARG A 1 134 ? 33.311  -10.821 18.071 1.00 55.00 ? 134  ARG A C   1 
ATOM   1083 O O   . ARG A 1 134 ? 33.926  -11.813 18.461 1.00 54.89 ? 134  ARG A O   1 
ATOM   1084 C CB  . ARG A 1 134 ? 34.598  -8.879  17.171 1.00 54.35 ? 134  ARG A CB  1 
ATOM   1085 C CG  . ARG A 1 134 ? 35.388  -8.314  16.003 1.00 53.65 ? 134  ARG A CG  1 
ATOM   1086 C CD  . ARG A 1 134 ? 36.853  -8.200  16.361 1.00 54.41 ? 134  ARG A CD  1 
ATOM   1087 N NE  . ARG A 1 134 ? 37.127  -7.058  17.224 1.00 54.33 ? 134  ARG A NE  1 
ATOM   1088 C CZ  . ARG A 1 134 ? 38.135  -7.001  18.088 1.00 55.00 ? 134  ARG A CZ  1 
ATOM   1089 N NH1 . ARG A 1 134 ? 38.964  -8.030  18.214 1.00 55.36 ? 134  ARG A NH1 1 
ATOM   1090 N NH2 . ARG A 1 134 ? 38.325  -5.908  18.813 1.00 54.87 ? 134  ARG A NH2 1 
ATOM   1091 N N   . VAL A 1 135 ? 32.259  -10.332 18.714 1.00 54.76 ? 135  VAL A N   1 
ATOM   1092 C CA  . VAL A 1 135 ? 31.768  -10.944 19.940 1.00 54.37 ? 135  VAL A CA  1 
ATOM   1093 C C   . VAL A 1 135 ? 31.009  -12.247 19.701 1.00 54.90 ? 135  VAL A C   1 
ATOM   1094 O O   . VAL A 1 135 ? 31.189  -13.218 20.435 1.00 55.17 ? 135  VAL A O   1 
ATOM   1095 C CB  . VAL A 1 135 ? 30.855  -9.964  20.707 1.00 53.45 ? 135  VAL A CB  1 
ATOM   1096 C CG1 . VAL A 1 135 ? 30.256  -10.647 21.926 1.00 52.91 ? 135  VAL A CG1 1 
ATOM   1097 C CG2 . VAL A 1 135 ? 31.655  -8.742  21.126 1.00 52.53 ? 135  VAL A CG2 1 
ATOM   1098 N N   . ARG A 1 136 ? 30.167  -12.272 18.671 1.00 56.32 ? 136  ARG A N   1 
ATOM   1099 C CA  . ARG A 1 136 ? 29.368  -13.457 18.362 1.00 57.36 ? 136  ARG A CA  1 
ATOM   1100 C C   . ARG A 1 136 ? 30.176  -14.610 17.765 1.00 58.48 ? 136  ARG A C   1 
ATOM   1101 O O   . ARG A 1 136 ? 29.842  -15.780 17.966 1.00 58.18 ? 136  ARG A O   1 
ATOM   1102 C CB  . ARG A 1 136 ? 28.234  -13.092 17.398 1.00 58.15 ? 136  ARG A CB  1 
ATOM   1103 C CG  . ARG A 1 136 ? 27.409  -11.885 17.822 1.00 57.80 ? 136  ARG A CG  1 
ATOM   1104 C CD  . ARG A 1 136 ? 25.934  -12.227 17.930 1.00 58.98 ? 136  ARG A CD  1 
ATOM   1105 N NE  . ARG A 1 136 ? 25.430  -12.910 16.742 1.00 57.34 ? 136  ARG A NE  1 
ATOM   1106 C CZ  . ARG A 1 136 ? 24.178  -13.331 16.598 1.00 56.71 ? 136  ARG A CZ  1 
ATOM   1107 N NH1 . ARG A 1 136 ? 23.296  -13.136 17.568 1.00 56.40 ? 136  ARG A NH1 1 
ATOM   1108 N NH2 . ARG A 1 136 ? 23.810  -13.958 15.491 1.00 57.61 ? 136  ARG A NH2 1 
ATOM   1109 N N   . SER A 1 137 ? 31.231  -14.279 17.029 1.00 59.72 ? 137  SER A N   1 
ATOM   1110 C CA  . SER A 1 137 ? 32.071  -15.292 16.396 1.00 61.29 ? 137  SER A CA  1 
ATOM   1111 C C   . SER A 1 137 ? 33.019  -15.941 17.393 1.00 62.77 ? 137  SER A C   1 
ATOM   1112 O O   . SER A 1 137 ? 33.389  -17.106 17.246 1.00 63.45 ? 137  SER A O   1 
ATOM   1113 C CB  . SER A 1 137 ? 32.891  -14.669 15.266 1.00 60.41 ? 137  SER A CB  1 
ATOM   1114 O OG  . SER A 1 137 ? 33.887  -13.803 15.781 1.00 58.89 ? 137  SER A OG  1 
ATOM   1115 N N   . GLY A 1 138 ? 33.409  -15.178 18.407 1.00 63.97 ? 138  GLY A N   1 
ATOM   1116 C CA  . GLY A 1 138 ? 34.328  -15.689 19.406 1.00 65.48 ? 138  GLY A CA  1 
ATOM   1117 C C   . GLY A 1 138 ? 35.646  -14.948 19.303 1.00 66.27 ? 138  GLY A C   1 
ATOM   1118 O O   . GLY A 1 138 ? 36.573  -15.193 20.073 1.00 66.45 ? 138  GLY A O   1 
ATOM   1119 N N   . ASP A 1 139 ? 35.722  -14.040 18.335 1.00 66.52 ? 139  ASP A N   1 
ATOM   1120 C CA  . ASP A 1 139 ? 36.916  -13.237 18.112 1.00 67.37 ? 139  ASP A CA  1 
ATOM   1121 C C   . ASP A 1 139 ? 37.241  -12.444 19.378 1.00 67.73 ? 139  ASP A C   1 
ATOM   1122 O O   . ASP A 1 139 ? 38.340  -12.552 19.924 1.00 67.25 ? 139  ASP A O   1 
ATOM   1123 C CB  . ASP A 1 139 ? 36.686  -12.279 16.940 1.00 68.93 ? 139  ASP A CB  1 
ATOM   1124 C CG  . ASP A 1 139 ? 37.902  -11.424 16.634 1.00 70.62 ? 139  ASP A CG  1 
ATOM   1125 O OD1 . ASP A 1 139 ? 38.411  -10.752 17.556 1.00 71.43 ? 139  ASP A OD1 1 
ATOM   1126 O OD2 . ASP A 1 139 ? 38.345  -11.418 15.467 1.00 71.16 ? 139  ASP A OD2 1 
ATOM   1127 N N   . TRP A 1 140 ? 36.279  -11.646 19.838 1.00 67.44 ? 140  TRP A N   1 
ATOM   1128 C CA  . TRP A 1 140 ? 36.465  -10.848 21.044 1.00 66.56 ? 140  TRP A CA  1 
ATOM   1129 C C   . TRP A 1 140 ? 36.638  -11.807 22.210 1.00 67.09 ? 140  TRP A C   1 
ATOM   1130 O O   . TRP A 1 140 ? 35.777  -12.648 22.468 1.00 66.92 ? 140  TRP A O   1 
ATOM   1131 C CB  . TRP A 1 140 ? 35.259  -9.941  21.279 1.00 65.31 ? 140  TRP A CB  1 
ATOM   1132 C CG  . TRP A 1 140 ? 35.468  -8.975  22.395 1.00 64.14 ? 140  TRP A CG  1 
ATOM   1133 C CD1 . TRP A 1 140 ? 35.331  -9.219  23.730 1.00 63.87 ? 140  TRP A CD1 1 
ATOM   1134 C CD2 . TRP A 1 140 ? 35.891  -7.613  22.277 1.00 63.38 ? 140  TRP A CD2 1 
ATOM   1135 N NE1 . TRP A 1 140 ? 35.643  -8.093  24.452 1.00 63.60 ? 140  TRP A NE1 1 
ATOM   1136 C CE2 . TRP A 1 140 ? 35.990  -7.091  23.585 1.00 62.89 ? 140  TRP A CE2 1 
ATOM   1137 C CE3 . TRP A 1 140 ? 36.197  -6.781  21.192 1.00 62.96 ? 140  TRP A CE3 1 
ATOM   1138 C CZ2 . TRP A 1 140 ? 36.381  -5.774  23.839 1.00 63.34 ? 140  TRP A CZ2 1 
ATOM   1139 C CZ3 . TRP A 1 140 ? 36.587  -5.469  21.445 1.00 63.50 ? 140  TRP A CZ3 1 
ATOM   1140 C CH2 . TRP A 1 140 ? 36.675  -4.980  22.760 1.00 63.36 ? 140  TRP A CH2 1 
ATOM   1141 N N   . LYS A 1 141 ? 37.750  -11.670 22.921 1.00 67.84 ? 141  LYS A N   1 
ATOM   1142 C CA  . LYS A 1 141 ? 38.049  -12.571 24.024 1.00 69.16 ? 141  LYS A CA  1 
ATOM   1143 C C   . LYS A 1 141 ? 38.041  -11.941 25.414 1.00 69.68 ? 141  LYS A C   1 
ATOM   1144 O O   . LYS A 1 141 ? 38.345  -10.761 25.580 1.00 69.64 ? 141  LYS A O   1 
ATOM   1145 C CB  . LYS A 1 141 ? 39.413  -13.214 23.773 1.00 69.77 ? 141  LYS A CB  1 
ATOM   1146 C CG  . LYS A 1 141 ? 39.544  -14.613 24.313 1.00 70.93 ? 141  LYS A CG  1 
ATOM   1147 C CD  . LYS A 1 141 ? 38.634  -15.581 23.573 1.00 71.43 ? 141  LYS A CD  1 
ATOM   1148 C CE  . LYS A 1 141 ? 39.038  -15.714 22.116 1.00 71.48 ? 141  LYS A CE  1 
ATOM   1149 N NZ  . LYS A 1 141 ? 38.205  -16.719 21.408 1.00 72.12 ? 141  LYS A NZ  1 
ATOM   1150 N N   . GLY A 1 142 ? 37.687  -12.750 26.410 1.00 70.54 ? 142  GLY A N   1 
ATOM   1151 C CA  . GLY A 1 142 ? 37.676  -12.285 27.785 1.00 71.61 ? 142  GLY A CA  1 
ATOM   1152 C C   . GLY A 1 142 ? 39.113  -12.343 28.264 1.00 72.38 ? 142  GLY A C   1 
ATOM   1153 O O   . GLY A 1 142 ? 39.920  -13.060 27.675 1.00 73.23 ? 142  GLY A O   1 
ATOM   1154 N N   . TYR A 1 143 ? 39.443  -11.613 29.324 1.00 72.29 ? 143  TYR A N   1 
ATOM   1155 C CA  . TYR A 1 143 ? 40.814  -11.594 29.815 1.00 72.40 ? 143  TYR A CA  1 
ATOM   1156 C C   . TYR A 1 143 ? 41.420  -12.986 30.022 1.00 71.86 ? 143  TYR A C   1 
ATOM   1157 O O   . TYR A 1 143 ? 42.639  -13.146 29.955 1.00 71.44 ? 143  TYR A O   1 
ATOM   1158 C CB  . TYR A 1 143 ? 40.904  -10.746 31.096 1.00 73.78 ? 143  TYR A CB  1 
ATOM   1159 C CG  . TYR A 1 143 ? 40.597  -11.460 32.394 1.00 75.30 ? 143  TYR A CG  1 
ATOM   1160 C CD1 . TYR A 1 143 ? 41.598  -12.137 33.091 1.00 75.66 ? 143  TYR A CD1 1 
ATOM   1161 C CD2 . TYR A 1 143 ? 39.315  -11.433 32.943 1.00 76.11 ? 143  TYR A CD2 1 
ATOM   1162 C CE1 . TYR A 1 143 ? 41.334  -12.765 34.306 1.00 75.96 ? 143  TYR A CE1 1 
ATOM   1163 C CE2 . TYR A 1 143 ? 39.039  -12.062 34.159 1.00 76.25 ? 143  TYR A CE2 1 
ATOM   1164 C CZ  . TYR A 1 143 ? 40.055  -12.724 34.833 1.00 76.09 ? 143  TYR A CZ  1 
ATOM   1165 O OH  . TYR A 1 143 ? 39.794  -13.342 36.035 1.00 76.30 ? 143  TYR A OH  1 
ATOM   1166 N N   . THR A 1 144 ? 40.578  -13.990 30.257 1.00 71.06 ? 144  THR A N   1 
ATOM   1167 C CA  . THR A 1 144 ? 41.068  -15.356 30.444 1.00 70.54 ? 144  THR A CA  1 
ATOM   1168 C C   . THR A 1 144 ? 40.969  -16.151 29.147 1.00 69.65 ? 144  THR A C   1 
ATOM   1169 O O   . THR A 1 144 ? 40.936  -17.383 29.161 1.00 70.02 ? 144  THR A O   1 
ATOM   1170 C CB  . THR A 1 144 ? 40.281  -16.127 31.529 1.00 70.81 ? 144  THR A CB  1 
ATOM   1171 O OG1 . THR A 1 144 ? 38.907  -16.246 31.143 1.00 71.78 ? 144  THR A OG1 1 
ATOM   1172 C CG2 . THR A 1 144 ? 40.377  -15.420 32.861 1.00 71.47 ? 144  THR A CG2 1 
ATOM   1173 N N   . GLY A 1 145 ? 40.912  -15.443 28.027 1.00 68.28 ? 145  GLY A N   1 
ATOM   1174 C CA  . GLY A 1 145 ? 40.829  -16.110 26.741 1.00 67.09 ? 145  GLY A CA  1 
ATOM   1175 C C   . GLY A 1 145 ? 39.528  -16.843 26.464 1.00 66.05 ? 145  GLY A C   1 
ATOM   1176 O O   . GLY A 1 145 ? 39.484  -17.703 25.583 1.00 65.81 ? 145  GLY A O   1 
ATOM   1177 N N   . LYS A 1 146 ? 38.470  -16.510 27.200 1.00 64.56 ? 146  LYS A N   1 
ATOM   1178 C CA  . LYS A 1 146 ? 37.173  -17.157 27.003 1.00 63.21 ? 146  LYS A CA  1 
ATOM   1179 C C   . LYS A 1 146 ? 36.226  -16.361 26.113 1.00 61.72 ? 146  LYS A C   1 
ATOM   1180 O O   . LYS A 1 146 ? 36.341  -15.142 25.995 1.00 61.31 ? 146  LYS A O   1 
ATOM   1181 C CB  . LYS A 1 146 ? 36.492  -17.421 28.348 1.00 63.85 ? 146  LYS A CB  1 
ATOM   1182 C CG  . LYS A 1 146 ? 36.999  -18.655 29.065 1.00 65.39 ? 146  LYS A CG  1 
ATOM   1183 C CD  . LYS A 1 146 ? 36.184  -18.937 30.314 1.00 66.39 ? 146  LYS A CD  1 
ATOM   1184 C CE  . LYS A 1 146 ? 36.563  -20.278 30.914 1.00 67.24 ? 146  LYS A CE  1 
ATOM   1185 N NZ  . LYS A 1 146 ? 38.021  -20.357 31.206 1.00 68.21 ? 146  LYS A NZ  1 
ATOM   1186 N N   . THR A 1 147 ? 35.288  -17.068 25.489 1.00 60.46 ? 147  THR A N   1 
ATOM   1187 C CA  . THR A 1 147 ? 34.305  -16.446 24.610 1.00 60.00 ? 147  THR A CA  1 
ATOM   1188 C C   . THR A 1 147 ? 33.181  -15.832 25.439 1.00 57.89 ? 147  THR A C   1 
ATOM   1189 O O   . THR A 1 147 ? 32.837  -16.342 26.503 1.00 58.78 ? 147  THR A O   1 
ATOM   1190 C CB  . THR A 1 147 ? 33.697  -17.480 23.638 1.00 61.08 ? 147  THR A CB  1 
ATOM   1191 O OG1 . THR A 1 147 ? 34.744  -18.093 22.875 1.00 62.68 ? 147  THR A OG1 1 
ATOM   1192 C CG2 . THR A 1 147 ? 32.721  -16.808 22.684 1.00 62.48 ? 147  THR A CG2 1 
ATOM   1193 N N   . ILE A 1 148 ? 32.615  -14.735 24.947 1.00 56.58 ? 148  ILE A N   1 
ATOM   1194 C CA  . ILE A 1 148 ? 31.529  -14.051 25.645 1.00 54.63 ? 148  ILE A CA  1 
ATOM   1195 C C   . ILE A 1 148 ? 30.260  -14.901 25.638 1.00 53.19 ? 148  ILE A C   1 
ATOM   1196 O O   . ILE A 1 148 ? 29.801  -15.323 24.581 1.00 53.54 ? 148  ILE A O   1 
ATOM   1197 C CB  . ILE A 1 148 ? 31.219  -12.685 24.986 1.00 53.62 ? 148  ILE A CB  1 
ATOM   1198 C CG1 . ILE A 1 148 ? 32.468  -11.799 25.010 1.00 53.38 ? 148  ILE A CG1 1 
ATOM   1199 C CG2 . ILE A 1 148 ? 30.070  -11.998 25.708 1.00 53.35 ? 148  ILE A CG2 1 
ATOM   1200 C CD1 . ILE A 1 148 ? 33.046  -11.574 26.397 1.00 51.55 ? 148  ILE A CD1 1 
ATOM   1201 N N   . THR A 1 149 ? 29.706  -15.158 26.820 1.00 51.74 ? 149  THR A N   1 
ATOM   1202 C CA  . THR A 1 149 ? 28.485  -15.951 26.935 1.00 49.48 ? 149  THR A CA  1 
ATOM   1203 C C   . THR A 1 149 ? 27.331  -15.108 27.460 1.00 48.49 ? 149  THR A C   1 
ATOM   1204 O O   . THR A 1 149 ? 26.165  -15.447 27.260 1.00 46.47 ? 149  THR A O   1 
ATOM   1205 C CB  . THR A 1 149 ? 28.661  -17.145 27.896 1.00 49.89 ? 149  THR A CB  1 
ATOM   1206 O OG1 . THR A 1 149 ? 29.042  -16.664 29.192 1.00 48.76 ? 149  THR A OG1 1 
ATOM   1207 C CG2 . THR A 1 149 ? 29.714  -18.108 27.366 1.00 48.43 ? 149  THR A CG2 1 
ATOM   1208 N N   . ASP A 1 150 ? 27.662  -14.014 28.140 1.00 47.16 ? 150  ASP A N   1 
ATOM   1209 C CA  . ASP A 1 150 ? 26.647  -13.129 28.699 1.00 45.12 ? 150  ASP A CA  1 
ATOM   1210 C C   . ASP A 1 150 ? 26.942  -11.651 28.478 1.00 44.76 ? 150  ASP A C   1 
ATOM   1211 O O   . ASP A 1 150 ? 28.049  -11.183 28.733 1.00 43.97 ? 150  ASP A O   1 
ATOM   1212 C CB  . ASP A 1 150 ? 26.490  -13.377 30.201 1.00 45.00 ? 150  ASP A CB  1 
ATOM   1213 C CG  . ASP A 1 150 ? 25.965  -14.763 30.514 1.00 46.27 ? 150  ASP A CG  1 
ATOM   1214 O OD1 . ASP A 1 150 ? 26.779  -15.706 30.606 1.00 45.58 ? 150  ASP A OD1 1 
ATOM   1215 O OD2 . ASP A 1 150 ? 24.734  -14.908 30.660 1.00 46.24 ? 150  ASP A OD2 1 
ATOM   1216 N N   . VAL A 1 151 ? 25.933  -10.923 28.008 1.00 44.04 ? 151  VAL A N   1 
ATOM   1217 C CA  . VAL A 1 151 ? 26.051  -9.489  27.769 1.00 42.41 ? 151  VAL A CA  1 
ATOM   1218 C C   . VAL A 1 151 ? 25.088  -8.782  28.719 1.00 41.89 ? 151  VAL A C   1 
ATOM   1219 O O   . VAL A 1 151 ? 23.894  -9.084  28.739 1.00 42.37 ? 151  VAL A O   1 
ATOM   1220 C CB  . VAL A 1 151 ? 25.689  -9.133  26.315 1.00 43.54 ? 151  VAL A CB  1 
ATOM   1221 C CG1 . VAL A 1 151 ? 25.652  -7.617  26.136 1.00 44.03 ? 151  VAL A CG1 1 
ATOM   1222 C CG2 . VAL A 1 151 ? 26.711  -9.739  25.373 1.00 44.04 ? 151  VAL A CG2 1 
ATOM   1223 N N   . ILE A 1 152 ? 25.612  -7.853  29.510 1.00 39.85 ? 152  ILE A N   1 
ATOM   1224 C CA  . ILE A 1 152 ? 24.795  -7.126  30.472 1.00 37.96 ? 152  ILE A CA  1 
ATOM   1225 C C   . ILE A 1 152 ? 24.695  -5.653  30.113 1.00 37.18 ? 152  ILE A C   1 
ATOM   1226 O O   . ILE A 1 152 ? 25.701  -4.942  30.056 1.00 37.39 ? 152  ILE A O   1 
ATOM   1227 C CB  . ILE A 1 152 ? 25.363  -7.241  31.916 1.00 36.79 ? 152  ILE A CB  1 
ATOM   1228 C CG1 . ILE A 1 152 ? 25.516  -8.712  32.319 1.00 37.42 ? 152  ILE A CG1 1 
ATOM   1229 C CG2 . ILE A 1 152 ? 24.427  -6.566  32.900 1.00 38.08 ? 152  ILE A CG2 1 
ATOM   1230 C CD1 . ILE A 1 152 ? 26.740  -9.388  31.730 1.00 37.98 ? 152  ILE A CD1 1 
ATOM   1231 N N   . ASN A 1 153 ? 23.473  -5.200  29.863 1.00 35.67 ? 153  ASN A N   1 
ATOM   1232 C CA  . ASN A 1 153 ? 23.244  -3.809  29.523 1.00 36.84 ? 153  ASN A CA  1 
ATOM   1233 C C   . ASN A 1 153 ? 22.890  -3.058  30.801 1.00 39.32 ? 153  ASN A C   1 
ATOM   1234 O O   . ASN A 1 153 ? 22.027  -3.489  31.571 1.00 38.76 ? 153  ASN A O   1 
ATOM   1235 C CB  . ASN A 1 153 ? 22.115  -3.711  28.494 1.00 39.16 ? 153  ASN A CB  1 
ATOM   1236 C CG  . ASN A 1 153 ? 21.870  -2.298  28.031 1.00 37.51 ? 153  ASN A CG  1 
ATOM   1237 O OD1 . ASN A 1 153 ? 21.128  -1.540  28.660 1.00 42.11 ? 153  ASN A OD1 1 
ATOM   1238 N ND2 . ASN A 1 153 ? 22.504  -1.925  26.928 1.00 36.52 ? 153  ASN A ND2 1 
ATOM   1239 N N   . ILE A 1 154 ? 23.582  -1.949  31.043 1.00 39.78 ? 154  ILE A N   1 
ATOM   1240 C CA  . ILE A 1 154 ? 23.323  -1.146  32.229 1.00 39.19 ? 154  ILE A CA  1 
ATOM   1241 C C   . ILE A 1 154 ? 22.910  0.260   31.810 1.00 37.86 ? 154  ILE A C   1 
ATOM   1242 O O   . ILE A 1 154 ? 23.697  1.013   31.242 1.00 37.90 ? 154  ILE A O   1 
ATOM   1243 C CB  . ILE A 1 154 ? 24.564  -1.085  33.149 1.00 39.33 ? 154  ILE A CB  1 
ATOM   1244 C CG1 . ILE A 1 154 ? 24.896  -2.492  33.659 1.00 41.32 ? 154  ILE A CG1 1 
ATOM   1245 C CG2 . ILE A 1 154 ? 24.304  -0.158  34.330 1.00 40.05 ? 154  ILE A CG2 1 
ATOM   1246 C CD1 . ILE A 1 154 ? 26.066  -2.547  34.636 1.00 41.94 ? 154  ILE A CD1 1 
ATOM   1247 N N   . GLY A 1 155 ? 21.653  0.592   32.073 1.00 37.19 ? 155  GLY A N   1 
ATOM   1248 C CA  . GLY A 1 155 ? 21.133  1.900   31.725 1.00 35.67 ? 155  GLY A CA  1 
ATOM   1249 C C   . GLY A 1 155 ? 19.752  2.044   32.325 1.00 34.65 ? 155  GLY A C   1 
ATOM   1250 O O   . GLY A 1 155 ? 19.219  1.091   32.888 1.00 34.85 ? 155  GLY A O   1 
ATOM   1251 N N   . ILE A 1 156 ? 19.154  3.219   32.207 1.00 35.24 ? 156  ILE A N   1 
ATOM   1252 C CA  . ILE A 1 156 ? 17.823  3.406   32.770 1.00 36.26 ? 156  ILE A CA  1 
ATOM   1253 C C   . ILE A 1 156 ? 16.993  4.277   31.832 1.00 36.94 ? 156  ILE A C   1 
ATOM   1254 O O   . ILE A 1 156 ? 17.546  5.038   31.039 1.00 36.37 ? 156  ILE A O   1 
ATOM   1255 C CB  . ILE A 1 156 ? 17.926  4.049   34.182 1.00 37.33 ? 156  ILE A CB  1 
ATOM   1256 C CG1 . ILE A 1 156 ? 16.686  3.713   35.008 1.00 37.33 ? 156  ILE A CG1 1 
ATOM   1257 C CG2 . ILE A 1 156 ? 18.095  5.555   34.062 1.00 38.23 ? 156  ILE A CG2 1 
ATOM   1258 C CD1 . ILE A 1 156 ? 16.825  4.061   36.484 1.00 38.37 ? 156  ILE A CD1 1 
ATOM   1259 N N   . GLY A 1 157 ? 15.670  4.156   31.916 1.00 35.61 ? 157  GLY A N   1 
ATOM   1260 C CA  . GLY A 1 157 ? 14.805  4.939   31.052 1.00 35.53 ? 157  GLY A CA  1 
ATOM   1261 C C   . GLY A 1 157 ? 15.001  4.574   29.589 1.00 35.75 ? 157  GLY A C   1 
ATOM   1262 O O   . GLY A 1 157 ? 14.948  3.402   29.223 1.00 35.41 ? 157  GLY A O   1 
ATOM   1263 N N   . GLY A 1 158 ? 15.244  5.573   28.748 1.00 36.30 ? 158  GLY A N   1 
ATOM   1264 C CA  . GLY A 1 158 ? 15.448  5.306   27.334 1.00 34.41 ? 158  GLY A CA  1 
ATOM   1265 C C   . GLY A 1 158 ? 16.657  4.431   27.045 1.00 34.40 ? 158  GLY A C   1 
ATOM   1266 O O   . GLY A 1 158 ? 16.742  3.806   25.989 1.00 35.39 ? 158  GLY A O   1 
ATOM   1267 N N   . SER A 1 159 ? 17.601  4.381   27.977 1.00 33.31 ? 159  SER A N   1 
ATOM   1268 C CA  . SER A 1 159 ? 18.796  3.571   27.781 1.00 33.33 ? 159  SER A CA  1 
ATOM   1269 C C   . SER A 1 159 ? 18.579  2.153   28.279 1.00 33.38 ? 159  SER A C   1 
ATOM   1270 O O   . SER A 1 159 ? 19.521  1.366   28.354 1.00 34.12 ? 159  SER A O   1 
ATOM   1271 C CB  . SER A 1 159 ? 19.989  4.191   28.512 1.00 33.92 ? 159  SER A CB  1 
ATOM   1272 O OG  . SER A 1 159 ? 20.374  5.413   27.910 1.00 35.29 ? 159  SER A OG  1 
ATOM   1273 N N   . ASP A 1 160 ? 17.334  1.824   28.606 1.00 33.88 ? 160  ASP A N   1 
ATOM   1274 C CA  . ASP A 1 160 ? 17.023  0.495   29.119 1.00 34.68 ? 160  ASP A CA  1 
ATOM   1275 C C   . ASP A 1 160 ? 15.813  -0.209  28.516 1.00 34.56 ? 160  ASP A C   1 
ATOM   1276 O O   . ASP A 1 160 ? 15.931  -1.307  27.968 1.00 33.69 ? 160  ASP A O   1 
ATOM   1277 C CB  . ASP A 1 160 ? 16.827  0.568   30.639 1.00 34.75 ? 160  ASP A CB  1 
ATOM   1278 C CG  . ASP A 1 160 ? 16.068  -0.631  31.193 1.00 39.78 ? 160  ASP A CG  1 
ATOM   1279 O OD1 . ASP A 1 160 ? 16.578  -1.772  31.080 1.00 39.47 ? 160  ASP A OD1 1 
ATOM   1280 O OD2 . ASP A 1 160 ? 14.955  -0.429  31.744 1.00 40.22 ? 160  ASP A OD2 1 
ATOM   1281 N N   . LEU A 1 161 ? 14.652  0.433   28.621 1.00 35.11 ? 161  LEU A N   1 
ATOM   1282 C CA  . LEU A 1 161 ? 13.398  -0.170  28.174 1.00 34.46 ? 161  LEU A CA  1 
ATOM   1283 C C   . LEU A 1 161 ? 13.307  -0.614  26.715 1.00 34.86 ? 161  LEU A C   1 
ATOM   1284 O O   . LEU A 1 161 ? 12.741  -1.681  26.423 1.00 34.04 ? 161  LEU A O   1 
ATOM   1285 C CB  . LEU A 1 161 ? 12.232  0.764   28.539 1.00 33.65 ? 161  LEU A CB  1 
ATOM   1286 C CG  . LEU A 1 161 ? 10.810  0.182   28.514 1.00 35.83 ? 161  LEU A CG  1 
ATOM   1287 C CD1 . LEU A 1 161 ? 10.789  -1.212  29.127 1.00 34.44 ? 161  LEU A CD1 1 
ATOM   1288 C CD2 . LEU A 1 161 ? 9.865   1.124   29.281 1.00 35.38 ? 161  LEU A CD2 1 
ATOM   1289 N N   . GLY A 1 162 ? 13.859  0.182   25.806 1.00 34.33 ? 162  GLY A N   1 
ATOM   1290 C CA  . GLY A 1 162 ? 13.824  -0.162  24.391 1.00 36.31 ? 162  GLY A CA  1 
ATOM   1291 C C   . GLY A 1 162 ? 14.496  -1.492  24.088 1.00 35.84 ? 162  GLY A C   1 
ATOM   1292 O O   . GLY A 1 162 ? 13.863  -2.407  23.564 1.00 35.85 ? 162  GLY A O   1 
ATOM   1293 N N   . PRO A 1 163 ? 15.793  -1.625  24.397 1.00 35.98 ? 163  PRO A N   1 
ATOM   1294 C CA  . PRO A 1 163 ? 16.540  -2.862  24.155 1.00 35.08 ? 163  PRO A CA  1 
ATOM   1295 C C   . PRO A 1 163 ? 15.951  -4.067  24.902 1.00 35.62 ? 163  PRO A C   1 
ATOM   1296 O O   . PRO A 1 163 ? 15.996  -5.195  24.409 1.00 33.92 ? 163  PRO A O   1 
ATOM   1297 C CB  . PRO A 1 163 ? 17.944  -2.507  24.634 1.00 35.84 ? 163  PRO A CB  1 
ATOM   1298 C CG  . PRO A 1 163 ? 18.034  -1.044  24.307 1.00 36.22 ? 163  PRO A CG  1 
ATOM   1299 C CD  . PRO A 1 163 ? 16.699  -0.534  24.789 1.00 34.67 ? 163  PRO A CD  1 
ATOM   1300 N N   . LEU A 1 164 ? 15.406  -3.831  26.093 1.00 34.43 ? 164  LEU A N   1 
ATOM   1301 C CA  . LEU A 1 164 ? 14.799  -4.912  26.869 1.00 35.41 ? 164  LEU A CA  1 
ATOM   1302 C C   . LEU A 1 164 ? 13.519  -5.392  26.184 1.00 32.16 ? 164  LEU A C   1 
ATOM   1303 O O   . LEU A 1 164 ? 13.311  -6.587  26.000 1.00 30.27 ? 164  LEU A O   1 
ATOM   1304 C CB  . LEU A 1 164 ? 14.482  -4.429  28.291 1.00 37.36 ? 164  LEU A CB  1 
ATOM   1305 C CG  . LEU A 1 164 ? 13.699  -5.292  29.291 1.00 41.49 ? 164  LEU A CG  1 
ATOM   1306 C CD1 . LEU A 1 164 ? 12.227  -5.292  28.936 1.00 44.08 ? 164  LEU A CD1 1 
ATOM   1307 C CD2 . LEU A 1 164 ? 14.253  -6.708  29.319 1.00 41.25 ? 164  LEU A CD2 1 
ATOM   1308 N N   . MET A 1 165 ? 12.661  -4.450  25.805 1.00 32.96 ? 165  MET A N   1 
ATOM   1309 C CA  . MET A 1 165 ? 11.397  -4.793  25.163 1.00 31.50 ? 165  MET A CA  1 
ATOM   1310 C C   . MET A 1 165 ? 11.593  -5.491  23.820 1.00 32.47 ? 165  MET A C   1 
ATOM   1311 O O   . MET A 1 165 ? 10.889  -6.454  23.502 1.00 30.02 ? 165  MET A O   1 
ATOM   1312 C CB  . MET A 1 165 ? 10.548  -3.527  24.977 1.00 32.83 ? 165  MET A CB  1 
ATOM   1313 C CG  . MET A 1 165 ? 9.175   -3.758  24.354 1.00 33.60 ? 165  MET A CG  1 
ATOM   1314 S SD  . MET A 1 165 ? 9.187   -3.812  22.536 1.00 35.63 ? 165  MET A SD  1 
ATOM   1315 C CE  . MET A 1 165 ? 9.297   -2.052  22.186 1.00 33.87 ? 165  MET A CE  1 
ATOM   1316 N N   . VAL A 1 166 ? 12.552  -5.016  23.035 1.00 29.41 ? 166  VAL A N   1 
ATOM   1317 C CA  . VAL A 1 166 ? 12.799  -5.616  21.730 1.00 32.06 ? 166  VAL A CA  1 
ATOM   1318 C C   . VAL A 1 166 ? 13.454  -6.999  21.812 1.00 32.50 ? 166  VAL A C   1 
ATOM   1319 O O   . VAL A 1 166 ? 13.037  -7.925  21.117 1.00 34.53 ? 166  VAL A O   1 
ATOM   1320 C CB  . VAL A 1 166 ? 13.643  -4.675  20.853 1.00 29.96 ? 166  VAL A CB  1 
ATOM   1321 C CG1 . VAL A 1 166 ? 14.045  -5.365  19.575 1.00 30.24 ? 166  VAL A CG1 1 
ATOM   1322 C CG2 . VAL A 1 166 ? 12.834  -3.418  20.534 1.00 31.10 ? 166  VAL A CG2 1 
ATOM   1323 N N   . THR A 1 167 ? 14.464  -7.158  22.661 1.00 34.42 ? 167  THR A N   1 
ATOM   1324 C CA  . THR A 1 167 ? 15.112  -8.462  22.768 1.00 35.19 ? 167  THR A CA  1 
ATOM   1325 C C   . THR A 1 167 ? 14.129  -9.501  23.304 1.00 34.63 ? 167  THR A C   1 
ATOM   1326 O O   . THR A 1 167 ? 14.249  -10.691 23.012 1.00 37.24 ? 167  THR A O   1 
ATOM   1327 C CB  . THR A 1 167 ? 16.351  -8.415  23.680 1.00 34.98 ? 167  THR A CB  1 
ATOM   1328 O OG1 . THR A 1 167 ? 15.993  -7.859  24.950 1.00 35.63 ? 167  THR A OG1 1 
ATOM   1329 C CG2 . THR A 1 167 ? 17.454  -7.576  23.040 1.00 35.84 ? 167  THR A CG2 1 
ATOM   1330 N N   . GLU A 1 168 ? 13.162  -9.059  24.099 1.00 35.92 ? 168  GLU A N   1 
ATOM   1331 C CA  . GLU A 1 168 ? 12.169  -9.984  24.628 1.00 34.30 ? 168  GLU A CA  1 
ATOM   1332 C C   . GLU A 1 168 ? 11.229  -10.376 23.494 1.00 33.92 ? 168  GLU A C   1 
ATOM   1333 O O   . GLU A 1 168 ? 10.883  -11.545 23.328 1.00 33.77 ? 168  GLU A O   1 
ATOM   1334 C CB  . GLU A 1 168 ? 11.372  -9.336  25.761 1.00 36.13 ? 168  GLU A CB  1 
ATOM   1335 C CG  . GLU A 1 168 ? 12.107  -9.295  27.092 1.00 37.39 ? 168  GLU A CG  1 
ATOM   1336 C CD  . GLU A 1 168 ? 12.383  -10.691 27.645 1.00 41.40 ? 168  GLU A CD  1 
ATOM   1337 O OE1 . GLU A 1 168 ? 13.568  -11.086 27.720 1.00 41.76 ? 168  GLU A OE1 1 
ATOM   1338 O OE2 . GLU A 1 168 ? 11.413  -11.393 28.004 1.00 38.86 ? 168  GLU A OE2 1 
ATOM   1339 N N   . ALA A 1 169 ? 10.836  -9.389  22.701 1.00 32.28 ? 169  ALA A N   1 
ATOM   1340 C CA  . ALA A 1 169 ? 9.917   -9.626  21.590 1.00 33.15 ? 169  ALA A CA  1 
ATOM   1341 C C   . ALA A 1 169 ? 10.503  -10.464 20.454 1.00 33.77 ? 169  ALA A C   1 
ATOM   1342 O O   . ALA A 1 169 ? 9.778   -11.216 19.799 1.00 33.72 ? 169  ALA A O   1 
ATOM   1343 C CB  . ALA A 1 169 ? 9.416   -8.283  21.041 1.00 32.02 ? 169  ALA A CB  1 
ATOM   1344 N N   . LEU A 1 170 ? 11.808  -10.333 20.227 1.00 34.09 ? 170  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 170 ? 12.483  -11.044 19.141 1.00 36.65 ? 170  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 170 ? 13.361  -12.195 19.609 1.00 38.13 ? 170  LEU A C   1 
ATOM   1347 O O   . LEU A 1 170 ? 14.350  -12.533 18.962 1.00 38.41 ? 170  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 170 ? 13.338  -10.063 18.329 1.00 35.77 ? 170  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 170 ? 12.613  -8.850  17.730 1.00 37.04 ? 170  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 170 ? 13.618  -7.980  16.974 1.00 35.62 ? 170  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 170 ? 11.490  -9.313  16.795 1.00 33.33 ? 170  LEU A CD2 1 
ATOM   1352 N N   . LYS A 1 171 ? 13.000  -12.796 20.732 1.00 39.60 ? 171  LYS A N   1 
ATOM   1353 C CA  . LYS A 1 171 ? 13.768  -13.907 21.271 1.00 42.95 ? 171  LYS A CA  1 
ATOM   1354 C C   . LYS A 1 171 ? 13.932  -15.064 20.278 1.00 43.49 ? 171  LYS A C   1 
ATOM   1355 O O   . LYS A 1 171 ? 14.982  -15.702 20.233 1.00 44.01 ? 171  LYS A O   1 
ATOM   1356 C CB  . LYS A 1 171 ? 13.110  -14.407 22.559 1.00 44.86 ? 171  LYS A CB  1 
ATOM   1357 C CG  . LYS A 1 171 ? 14.078  -15.031 23.546 1.00 50.64 ? 171  LYS A CG  1 
ATOM   1358 C CD  . LYS A 1 171 ? 13.603  -14.799 24.971 1.00 53.13 ? 171  LYS A CD  1 
ATOM   1359 C CE  . LYS A 1 171 ? 14.723  -14.235 25.823 1.00 54.91 ? 171  LYS A CE  1 
ATOM   1360 N NZ  . LYS A 1 171 ? 15.331  -13.029 25.189 1.00 54.26 ? 171  LYS A NZ  1 
ATOM   1361 N N   . PRO A 1 172 ? 12.903  -15.344 19.459 1.00 42.96 ? 172  PRO A N   1 
ATOM   1362 C CA  . PRO A 1 172 ? 13.019  -16.447 18.495 1.00 43.84 ? 172  PRO A CA  1 
ATOM   1363 C C   . PRO A 1 172 ? 14.117  -16.264 17.448 1.00 44.84 ? 172  PRO A C   1 
ATOM   1364 O O   . PRO A 1 172 ? 14.459  -17.203 16.729 1.00 45.55 ? 172  PRO A O   1 
ATOM   1365 C CB  . PRO A 1 172 ? 11.628  -16.502 17.863 1.00 44.19 ? 172  PRO A CB  1 
ATOM   1366 C CG  . PRO A 1 172 ? 10.740  -16.009 18.967 1.00 42.98 ? 172  PRO A CG  1 
ATOM   1367 C CD  . PRO A 1 172 ? 11.524  -14.829 19.492 1.00 43.15 ? 172  PRO A CD  1 
ATOM   1368 N N   . TYR A 1 173 ? 14.667  -15.059 17.359 1.00 45.09 ? 173  TYR A N   1 
ATOM   1369 C CA  . TYR A 1 173 ? 15.716  -14.783 16.387 1.00 45.31 ? 173  TYR A CA  1 
ATOM   1370 C C   . TYR A 1 173 ? 17.093  -14.668 17.031 1.00 46.20 ? 173  TYR A C   1 
ATOM   1371 O O   . TYR A 1 173 ? 18.035  -14.183 16.401 1.00 45.82 ? 173  TYR A O   1 
ATOM   1372 C CB  . TYR A 1 173 ? 15.401  -13.488 15.630 1.00 44.23 ? 173  TYR A CB  1 
ATOM   1373 C CG  . TYR A 1 173 ? 14.065  -13.507 14.922 1.00 42.25 ? 173  TYR A CG  1 
ATOM   1374 C CD1 . TYR A 1 173 ? 12.885  -13.190 15.601 1.00 39.75 ? 173  TYR A CD1 1 
ATOM   1375 C CD2 . TYR A 1 173 ? 13.974  -13.889 13.585 1.00 40.16 ? 173  TYR A CD2 1 
ATOM   1376 C CE1 . TYR A 1 173 ? 11.647  -13.258 14.962 1.00 40.45 ? 173  TYR A CE1 1 
ATOM   1377 C CE2 . TYR A 1 173 ? 12.744  -13.964 12.938 1.00 41.47 ? 173  TYR A CE2 1 
ATOM   1378 C CZ  . TYR A 1 173 ? 11.586  -13.650 13.631 1.00 40.94 ? 173  TYR A CZ  1 
ATOM   1379 O OH  . TYR A 1 173 ? 10.376  -13.752 12.995 1.00 41.64 ? 173  TYR A OH  1 
ATOM   1380 N N   . SER A 1 174 ? 17.215  -15.134 18.272 1.00 48.07 ? 174  SER A N   1 
ATOM   1381 C CA  . SER A 1 174 ? 18.477  -15.039 19.008 1.00 48.81 ? 174  SER A CA  1 
ATOM   1382 C C   . SER A 1 174 ? 19.396  -16.257 18.938 1.00 50.66 ? 174  SER A C   1 
ATOM   1383 O O   . SER A 1 174 ? 20.246  -16.441 19.808 1.00 50.68 ? 174  SER A O   1 
ATOM   1384 C CB  . SER A 1 174 ? 18.192  -14.727 20.476 1.00 47.13 ? 174  SER A CB  1 
ATOM   1385 O OG  . SER A 1 174 ? 17.521  -15.805 21.103 1.00 44.64 ? 174  SER A OG  1 
ATOM   1386 N N   . SER A 1 175 ? 19.235  -17.086 17.913 1.00 51.83 ? 175  SER A N   1 
ATOM   1387 C CA  . SER A 1 175 ? 20.075  -18.271 17.773 1.00 53.80 ? 175  SER A CA  1 
ATOM   1388 C C   . SER A 1 175 ? 21.529  -17.877 17.537 1.00 54.52 ? 175  SER A C   1 
ATOM   1389 O O   . SER A 1 175 ? 21.830  -17.092 16.635 1.00 54.52 ? 175  SER A O   1 
ATOM   1390 C CB  . SER A 1 175 ? 19.582  -19.134 16.606 1.00 55.29 ? 175  SER A CB  1 
ATOM   1391 O OG  . SER A 1 175 ? 20.386  -20.291 16.445 1.00 57.18 ? 175  SER A OG  1 
ATOM   1392 N N   . GLY A 1 176 ? 22.427  -18.415 18.357 1.00 54.82 ? 176  GLY A N   1 
ATOM   1393 C CA  . GLY A 1 176 ? 23.841  -18.115 18.205 1.00 55.91 ? 176  GLY A CA  1 
ATOM   1394 C C   . GLY A 1 176 ? 24.365  -16.955 19.037 1.00 56.32 ? 176  GLY A C   1 
ATOM   1395 O O   . GLY A 1 176 ? 25.548  -16.919 19.377 1.00 58.03 ? 176  GLY A O   1 
ATOM   1396 N N   . GLY A 1 177 ? 23.498  -16.002 19.365 1.00 54.95 ? 177  GLY A N   1 
ATOM   1397 C CA  . GLY A 1 177 ? 23.937  -14.867 20.157 1.00 53.96 ? 177  GLY A CA  1 
ATOM   1398 C C   . GLY A 1 177 ? 24.068  -15.199 21.632 1.00 53.04 ? 177  GLY A C   1 
ATOM   1399 O O   . GLY A 1 177 ? 23.500  -16.192 22.094 1.00 53.24 ? 177  GLY A O   1 
ATOM   1400 N N   . PRO A 1 178 ? 24.818  -14.394 22.403 1.00 52.00 ? 178  PRO A N   1 
ATOM   1401 C CA  . PRO A 1 178 ? 24.988  -14.647 23.837 1.00 51.65 ? 178  PRO A CA  1 
ATOM   1402 C C   . PRO A 1 178 ? 23.729  -14.225 24.586 1.00 51.23 ? 178  PRO A C   1 
ATOM   1403 O O   . PRO A 1 178 ? 22.840  -13.598 24.007 1.00 50.72 ? 178  PRO A O   1 
ATOM   1404 C CB  . PRO A 1 178 ? 26.185  -13.775 24.193 1.00 50.71 ? 178  PRO A CB  1 
ATOM   1405 C CG  . PRO A 1 178 ? 25.960  -12.577 23.329 1.00 52.66 ? 178  PRO A CG  1 
ATOM   1406 C CD  . PRO A 1 178 ? 25.591  -13.208 21.990 1.00 52.19 ? 178  PRO A CD  1 
ATOM   1407 N N   . ARG A 1 179 ? 23.645  -14.576 25.864 1.00 50.48 ? 179  ARG A N   1 
ATOM   1408 C CA  . ARG A 1 179 ? 22.488  -14.195 26.660 1.00 49.09 ? 179  ARG A CA  1 
ATOM   1409 C C   . ARG A 1 179 ? 22.578  -12.700 26.941 1.00 47.54 ? 179  ARG A C   1 
ATOM   1410 O O   . ARG A 1 179 ? 23.673  -12.149 27.040 1.00 46.78 ? 179  ARG A O   1 
ATOM   1411 C CB  . ARG A 1 179 ? 22.463  -14.970 27.978 1.00 50.74 ? 179  ARG A CB  1 
ATOM   1412 C CG  . ARG A 1 179 ? 22.162  -16.446 27.821 1.00 52.82 ? 179  ARG A CG  1 
ATOM   1413 C CD  . ARG A 1 179 ? 22.158  -17.149 29.170 1.00 55.59 ? 179  ARG A CD  1 
ATOM   1414 N NE  . ARG A 1 179 ? 23.489  -17.206 29.769 1.00 56.42 ? 179  ARG A NE  1 
ATOM   1415 C CZ  . ARG A 1 179 ? 24.507  -17.892 29.256 1.00 57.38 ? 179  ARG A CZ  1 
ATOM   1416 N NH1 . ARG A 1 179 ? 24.345  -18.579 28.133 1.00 58.39 ? 179  ARG A NH1 1 
ATOM   1417 N NH2 . ARG A 1 179 ? 25.682  -17.899 29.868 1.00 56.50 ? 179  ARG A NH2 1 
ATOM   1418 N N   . VAL A 1 180 ? 21.430  -12.043 27.060 1.00 44.77 ? 180  VAL A N   1 
ATOM   1419 C CA  . VAL A 1 180 ? 21.417  -10.616 27.337 1.00 44.06 ? 180  VAL A CA  1 
ATOM   1420 C C   . VAL A 1 180 ? 20.726  -10.339 28.671 1.00 43.74 ? 180  VAL A C   1 
ATOM   1421 O O   . VAL A 1 180 ? 19.711  -10.951 28.995 1.00 42.42 ? 180  VAL A O   1 
ATOM   1422 C CB  . VAL A 1 180 ? 20.709  -9.840  26.213 1.00 44.46 ? 180  VAL A CB  1 
ATOM   1423 C CG1 . VAL A 1 180 ? 20.824  -8.344  26.461 1.00 45.65 ? 180  VAL A CG1 1 
ATOM   1424 C CG2 . VAL A 1 180 ? 21.332  -10.192 24.874 1.00 44.60 ? 180  VAL A CG2 1 
ATOM   1425 N N   . TRP A 1 181 ? 21.300  -9.432  29.452 1.00 42.63 ? 181  TRP A N   1 
ATOM   1426 C CA  . TRP A 1 181 ? 20.740  -9.073  30.750 1.00 42.23 ? 181  TRP A CA  1 
ATOM   1427 C C   . TRP A 1 181 ? 20.561  -7.564  30.804 1.00 39.01 ? 181  TRP A C   1 
ATOM   1428 O O   . TRP A 1 181 ? 21.325  -6.828  30.190 1.00 38.33 ? 181  TRP A O   1 
ATOM   1429 C CB  . TRP A 1 181 ? 21.675  -9.513  31.885 1.00 42.65 ? 181  TRP A CB  1 
ATOM   1430 C CG  . TRP A 1 181 ? 22.071  -10.967 31.832 1.00 45.56 ? 181  TRP A CG  1 
ATOM   1431 C CD1 . TRP A 1 181 ? 22.963  -11.545 30.977 1.00 45.29 ? 181  TRP A CD1 1 
ATOM   1432 C CD2 . TRP A 1 181 ? 21.576  -12.022 32.667 1.00 47.37 ? 181  TRP A CD2 1 
ATOM   1433 N NE1 . TRP A 1 181 ? 23.056  -12.895 31.227 1.00 46.55 ? 181  TRP A NE1 1 
ATOM   1434 C CE2 . TRP A 1 181 ? 22.213  -13.214 32.258 1.00 48.31 ? 181  TRP A CE2 1 
ATOM   1435 C CE3 . TRP A 1 181 ? 20.653  -12.075 33.720 1.00 49.95 ? 181  TRP A CE3 1 
ATOM   1436 C CZ2 . TRP A 1 181 ? 21.959  -14.448 32.868 1.00 50.68 ? 181  TRP A CZ2 1 
ATOM   1437 C CZ3 . TRP A 1 181 ? 20.399  -13.302 34.326 1.00 51.23 ? 181  TRP A CZ3 1 
ATOM   1438 C CH2 . TRP A 1 181 ? 21.051  -14.472 33.896 1.00 51.12 ? 181  TRP A CH2 1 
ATOM   1439 N N   . PHE A 1 182 ? 19.543  -7.103  31.521 1.00 36.79 ? 182  PHE A N   1 
ATOM   1440 C CA  . PHE A 1 182 ? 19.319  -5.670  31.640 1.00 35.19 ? 182  PHE A CA  1 
ATOM   1441 C C   . PHE A 1 182 ? 19.232  -5.270  33.104 1.00 35.63 ? 182  PHE A C   1 
ATOM   1442 O O   . PHE A 1 182 ? 18.408  -5.792  33.847 1.00 36.63 ? 182  PHE A O   1 
ATOM   1443 C CB  . PHE A 1 182 ? 18.040  -5.255  30.903 1.00 36.08 ? 182  PHE A CB  1 
ATOM   1444 C CG  . PHE A 1 182 ? 18.108  -5.470  29.419 1.00 34.78 ? 182  PHE A CG  1 
ATOM   1445 C CD1 . PHE A 1 182 ? 17.826  -6.711  28.870 1.00 30.53 ? 182  PHE A CD1 1 
ATOM   1446 C CD2 . PHE A 1 182 ? 18.530  -4.446  28.578 1.00 35.15 ? 182  PHE A CD2 1 
ATOM   1447 C CE1 . PHE A 1 182 ? 17.968  -6.935  27.503 1.00 34.14 ? 182  PHE A CE1 1 
ATOM   1448 C CE2 . PHE A 1 182 ? 18.678  -4.661  27.205 1.00 34.57 ? 182  PHE A CE2 1 
ATOM   1449 C CZ  . PHE A 1 182 ? 18.397  -5.908  26.670 1.00 33.95 ? 182  PHE A CZ  1 
ATOM   1450 N N   . VAL A 1 183 ? 20.105  -4.353  33.510 1.00 33.89 ? 183  VAL A N   1 
ATOM   1451 C CA  . VAL A 1 183 ? 20.130  -3.849  34.880 1.00 34.85 ? 183  VAL A CA  1 
ATOM   1452 C C   . VAL A 1 183 ? 19.818  -2.366  34.755 1.00 34.65 ? 183  VAL A C   1 
ATOM   1453 O O   . VAL A 1 183 ? 20.429  -1.662  33.946 1.00 34.09 ? 183  VAL A O   1 
ATOM   1454 C CB  . VAL A 1 183 ? 21.524  -4.026  35.526 1.00 34.37 ? 183  VAL A CB  1 
ATOM   1455 C CG1 . VAL A 1 183 ? 21.532  -3.403  36.909 1.00 36.68 ? 183  VAL A CG1 1 
ATOM   1456 C CG2 . VAL A 1 183 ? 21.873  -5.508  35.616 1.00 36.11 ? 183  VAL A CG2 1 
ATOM   1457 N N   . SER A 1 184 ? 18.876  -1.884  35.553 1.00 33.08 ? 184  SER A N   1 
ATOM   1458 C CA  . SER A 1 184 ? 18.489  -0.489  35.448 1.00 34.15 ? 184  SER A CA  1 
ATOM   1459 C C   . SER A 1 184 ? 18.219  0.213   36.766 1.00 34.46 ? 184  SER A C   1 
ATOM   1460 O O   . SER A 1 184 ? 18.631  1.356   36.963 1.00 34.67 ? 184  SER A O   1 
ATOM   1461 C CB  . SER A 1 184 ? 17.249  -0.398  34.557 1.00 35.20 ? 184  SER A CB  1 
ATOM   1462 O OG  . SER A 1 184 ? 16.265  -1.312  35.002 1.00 31.89 ? 184  SER A OG  1 
ATOM   1463 N N   . ASN A 1 185 ? 17.517  -0.465  37.664 1.00 35.02 ? 185  ASN A N   1 
ATOM   1464 C CA  . ASN A 1 185 ? 17.178  0.116   38.958 1.00 35.62 ? 185  ASN A CA  1 
ATOM   1465 C C   . ASN A 1 185 ? 18.430  0.350   39.799 1.00 37.07 ? 185  ASN A C   1 
ATOM   1466 O O   . ASN A 1 185 ? 19.381  -0.432  39.735 1.00 36.19 ? 185  ASN A O   1 
ATOM   1467 C CB  . ASN A 1 185 ? 16.236  -0.820  39.718 1.00 34.19 ? 185  ASN A CB  1 
ATOM   1468 C CG  . ASN A 1 185 ? 15.319  -0.080  40.677 1.00 34.92 ? 185  ASN A CG  1 
ATOM   1469 O OD1 . ASN A 1 185 ? 15.677  0.964   41.228 1.00 34.72 ? 185  ASN A OD1 1 
ATOM   1470 N ND2 . ASN A 1 185 ? 14.130  -0.630  40.889 1.00 30.91 ? 185  ASN A ND2 1 
ATOM   1471 N N   . ILE A 1 186 ? 18.436  1.429   40.575 1.00 37.42 ? 186  ILE A N   1 
ATOM   1472 C CA  . ILE A 1 186 ? 19.568  1.697   41.451 1.00 37.41 ? 186  ILE A CA  1 
ATOM   1473 C C   . ILE A 1 186 ? 19.452  0.709   42.605 1.00 37.79 ? 186  ILE A C   1 
ATOM   1474 O O   . ILE A 1 186 ? 20.448  0.365   43.239 1.00 37.95 ? 186  ILE A O   1 
ATOM   1475 C CB  . ILE A 1 186 ? 19.560  3.143   41.999 1.00 36.45 ? 186  ILE A CB  1 
ATOM   1476 C CG1 . ILE A 1 186 ? 20.781  3.361   42.902 1.00 35.42 ? 186  ILE A CG1 1 
ATOM   1477 C CG2 . ILE A 1 186 ? 18.273  3.409   42.764 1.00 37.54 ? 186  ILE A CG2 1 
ATOM   1478 C CD1 . ILE A 1 186 ? 22.100  3.051   42.226 1.00 34.83 ? 186  ILE A CD1 1 
ATOM   1479 N N   . ASP A 1 187 ? 18.227  0.244   42.863 1.00 35.94 ? 187  ASP A N   1 
ATOM   1480 C CA  . ASP A 1 187 ? 17.973  -0.740  43.919 1.00 36.55 ? 187  ASP A CA  1 
ATOM   1481 C C   . ASP A 1 187 ? 18.988  -1.873  43.775 1.00 36.00 ? 187  ASP A C   1 
ATOM   1482 O O   . ASP A 1 187 ? 18.960  -2.619  42.794 1.00 37.14 ? 187  ASP A O   1 
ATOM   1483 C CB  . ASP A 1 187 ? 16.546  -1.295  43.786 1.00 36.19 ? 187  ASP A CB  1 
ATOM   1484 C CG  . ASP A 1 187 ? 16.231  -2.376  44.806 1.00 36.00 ? 187  ASP A CG  1 
ATOM   1485 O OD1 . ASP A 1 187 ? 15.124  -2.954  44.727 1.00 36.08 ? 187  ASP A OD1 1 
ATOM   1486 O OD2 . ASP A 1 187 ? 17.077  -2.654  45.687 1.00 35.90 ? 187  ASP A OD2 1 
ATOM   1487 N N   . GLY A 1 188 ? 19.869  -1.990  44.767 1.00 36.18 ? 188  GLY A N   1 
ATOM   1488 C CA  . GLY A 1 188 ? 20.924  -2.991  44.765 1.00 34.70 ? 188  GLY A CA  1 
ATOM   1489 C C   . GLY A 1 188 ? 20.521  -4.402  44.397 1.00 35.48 ? 188  GLY A C   1 
ATOM   1490 O O   . GLY A 1 188 ? 21.343  -5.188  43.929 1.00 35.11 ? 188  GLY A O   1 
ATOM   1491 N N   . THR A 1 189 ? 19.258  -4.730  44.624 1.00 36.23 ? 189  THR A N   1 
ATOM   1492 C CA  . THR A 1 189 ? 18.740  -6.050  44.302 1.00 35.00 ? 189  THR A CA  1 
ATOM   1493 C C   . THR A 1 189 ? 18.914  -6.363  42.816 1.00 34.05 ? 189  THR A C   1 
ATOM   1494 O O   . THR A 1 189 ? 19.224  -7.498  42.443 1.00 32.54 ? 189  THR A O   1 
ATOM   1495 C CB  . THR A 1 189 ? 17.239  -6.143  44.638 1.00 35.57 ? 189  THR A CB  1 
ATOM   1496 O OG1 . THR A 1 189 ? 17.062  -6.136  46.058 1.00 33.37 ? 189  THR A OG1 1 
ATOM   1497 C CG2 . THR A 1 189 ? 16.635  -7.409  44.051 1.00 35.34 ? 189  THR A CG2 1 
ATOM   1498 N N   . HIS A 1 190 ? 18.721  -5.359  41.967 1.00 32.89 ? 190  HIS A N   1 
ATOM   1499 C CA  . HIS A 1 190 ? 18.828  -5.584  40.526 1.00 35.39 ? 190  HIS A CA  1 
ATOM   1500 C C   . HIS A 1 190 ? 20.206  -6.062  40.075 1.00 35.91 ? 190  HIS A C   1 
ATOM   1501 O O   . HIS A 1 190 ? 20.335  -7.128  39.483 1.00 37.48 ? 190  HIS A O   1 
ATOM   1502 C CB  . HIS A 1 190 ? 18.440  -4.323  39.746 1.00 35.61 ? 190  HIS A CB  1 
ATOM   1503 C CG  . HIS A 1 190 ? 17.729  -4.613  38.457 1.00 34.94 ? 190  HIS A CG  1 
ATOM   1504 N ND1 . HIS A 1 190 ? 17.330  -3.622  37.587 1.00 33.89 ? 190  HIS A ND1 1 
ATOM   1505 C CD2 . HIS A 1 190 ? 17.307  -5.781  37.915 1.00 34.75 ? 190  HIS A CD2 1 
ATOM   1506 C CE1 . HIS A 1 190 ? 16.691  -4.166  36.565 1.00 34.55 ? 190  HIS A CE1 1 
ATOM   1507 N NE2 . HIS A 1 190 ? 16.663  -5.475  36.740 1.00 34.11 ? 190  HIS A NE2 1 
ATOM   1508 N N   . ILE A 1 191 ? 21.247  -5.295  40.358 1.00 37.13 ? 191  ILE A N   1 
ATOM   1509 C CA  . ILE A 1 191 ? 22.561  -5.727  39.920 1.00 38.32 ? 191  ILE A CA  1 
ATOM   1510 C C   . ILE A 1 191 ? 23.016  -6.980  40.675 1.00 39.63 ? 191  ILE A C   1 
ATOM   1511 O O   . ILE A 1 191 ? 23.606  -7.885  40.085 1.00 37.78 ? 191  ILE A O   1 
ATOM   1512 C CB  . ILE A 1 191 ? 23.596  -4.579  40.054 1.00 38.94 ? 191  ILE A CB  1 
ATOM   1513 C CG1 . ILE A 1 191 ? 24.882  -4.962  39.324 1.00 39.87 ? 191  ILE A CG1 1 
ATOM   1514 C CG2 . ILE A 1 191 ? 23.858  -4.262  41.520 1.00 37.54 ? 191  ILE A CG2 1 
ATOM   1515 C CD1 . ILE A 1 191 ? 25.728  -3.779  38.937 1.00 42.96 ? 191  ILE A CD1 1 
ATOM   1516 N N   . ALA A 1 192 ? 22.704  -7.056  41.966 1.00 40.17 ? 192  ALA A N   1 
ATOM   1517 C CA  . ALA A 1 192 ? 23.103  -8.206  42.778 1.00 42.90 ? 192  ALA A CA  1 
ATOM   1518 C C   . ALA A 1 192 ? 22.614  -9.556  42.255 1.00 43.77 ? 192  ALA A C   1 
ATOM   1519 O O   . ALA A 1 192 ? 23.403  -10.487 42.107 1.00 44.04 ? 192  ALA A O   1 
ATOM   1520 C CB  . ALA A 1 192 ? 22.639  -8.014  44.228 1.00 42.30 ? 192  ALA A CB  1 
ATOM   1521 N N   . LYS A 1 193 ? 21.319  -9.674  41.979 1.00 44.66 ? 193  LYS A N   1 
ATOM   1522 C CA  . LYS A 1 193 ? 20.784  -10.944 41.495 1.00 46.03 ? 193  LYS A CA  1 
ATOM   1523 C C   . LYS A 1 193 ? 21.207  -11.249 40.066 1.00 45.82 ? 193  LYS A C   1 
ATOM   1524 O O   . LYS A 1 193 ? 21.117  -12.390 39.618 1.00 44.88 ? 193  LYS A O   1 
ATOM   1525 C CB  . LYS A 1 193 ? 19.255  -10.969 41.587 1.00 48.28 ? 193  LYS A CB  1 
ATOM   1526 C CG  . LYS A 1 193 ? 18.549  -9.905  40.761 1.00 51.76 ? 193  LYS A CG  1 
ATOM   1527 C CD  . LYS A 1 193 ? 17.198  -10.399 40.249 1.00 54.13 ? 193  LYS A CD  1 
ATOM   1528 C CE  . LYS A 1 193 ? 16.368  -11.046 41.349 1.00 55.74 ? 193  LYS A CE  1 
ATOM   1529 N NZ  . LYS A 1 193 ? 15.060  -11.535 40.832 1.00 56.01 ? 193  LYS A NZ  1 
ATOM   1530 N N   . THR A 1 194 ? 21.662  -10.229 39.350 1.00 45.74 ? 194  THR A N   1 
ATOM   1531 C CA  . THR A 1 194 ? 22.100  -10.419 37.975 1.00 47.86 ? 194  THR A CA  1 
ATOM   1532 C C   . THR A 1 194 ? 23.534  -10.924 37.931 1.00 49.62 ? 194  THR A C   1 
ATOM   1533 O O   . THR A 1 194 ? 23.853  -11.830 37.164 1.00 49.34 ? 194  THR A O   1 
ATOM   1534 C CB  . THR A 1 194 ? 22.019  -9.108  37.166 1.00 46.94 ? 194  THR A CB  1 
ATOM   1535 O OG1 . THR A 1 194 ? 20.646  -8.730  37.007 1.00 46.49 ? 194  THR A OG1 1 
ATOM   1536 C CG2 . THR A 1 194 ? 22.657  -9.290  35.792 1.00 47.10 ? 194  THR A CG2 1 
ATOM   1537 N N   . LEU A 1 195 ? 24.393  -10.334 38.756 1.00 51.21 ? 195  LEU A N   1 
ATOM   1538 C CA  . LEU A 1 195 ? 25.799  -10.721 38.799 1.00 52.81 ? 195  LEU A CA  1 
ATOM   1539 C C   . LEU A 1 195 ? 26.018  -12.083 39.456 1.00 53.97 ? 195  LEU A C   1 
ATOM   1540 O O   . LEU A 1 195 ? 27.012  -12.759 39.190 1.00 53.72 ? 195  LEU A O   1 
ATOM   1541 C CB  . LEU A 1 195 ? 26.615  -9.650  39.536 1.00 53.62 ? 195  LEU A CB  1 
ATOM   1542 C CG  . LEU A 1 195 ? 26.731  -8.280  38.856 1.00 53.89 ? 195  LEU A CG  1 
ATOM   1543 C CD1 . LEU A 1 195 ? 27.481  -7.310  39.760 1.00 55.45 ? 195  LEU A CD1 1 
ATOM   1544 C CD2 . LEU A 1 195 ? 27.451  -8.430  37.532 1.00 53.64 ? 195  LEU A CD2 1 
ATOM   1545 N N   . ALA A 1 196 ? 25.080  -12.487 40.303 1.00 55.07 ? 196  ALA A N   1 
ATOM   1546 C CA  . ALA A 1 196 ? 25.181  -13.761 41.003 1.00 56.28 ? 196  ALA A CA  1 
ATOM   1547 C C   . ALA A 1 196 ? 25.128  -14.962 40.065 1.00 57.34 ? 196  ALA A C   1 
ATOM   1548 O O   . ALA A 1 196 ? 25.506  -16.068 40.447 1.00 57.23 ? 196  ALA A O   1 
ATOM   1549 C CB  . ALA A 1 196 ? 24.073  -13.868 42.038 1.00 56.34 ? 196  ALA A CB  1 
ATOM   1550 N N   . CYS A 1 197 ? 24.666  -14.739 38.839 1.00 58.63 ? 197  CYS A N   1 
ATOM   1551 C CA  . CYS A 1 197 ? 24.541  -15.813 37.856 1.00 59.75 ? 197  CYS A CA  1 
ATOM   1552 C C   . CYS A 1 197 ? 25.655  -15.792 36.813 1.00 59.19 ? 197  CYS A C   1 
ATOM   1553 O O   . CYS A 1 197 ? 25.838  -16.755 36.070 1.00 59.57 ? 197  CYS A O   1 
ATOM   1554 C CB  . CYS A 1 197 ? 23.194  -15.700 37.137 1.00 60.08 ? 197  CYS A CB  1 
ATOM   1555 S SG  . CYS A 1 197 ? 21.786  -15.405 38.227 1.00 62.86 ? 197  CYS A SG  1 
ATOM   1556 N N   . LEU A 1 198 ? 26.402  -14.696 36.768 1.00 58.63 ? 198  LEU A N   1 
ATOM   1557 C CA  . LEU A 1 198 ? 27.472  -14.534 35.789 1.00 57.82 ? 198  LEU A CA  1 
ATOM   1558 C C   . LEU A 1 198 ? 28.858  -15.006 36.199 1.00 57.51 ? 198  LEU A C   1 
ATOM   1559 O O   . LEU A 1 198 ? 29.146  -15.227 37.373 1.00 55.91 ? 198  LEU A O   1 
ATOM   1560 C CB  . LEU A 1 198 ? 27.578  -13.064 35.383 1.00 58.08 ? 198  LEU A CB  1 
ATOM   1561 C CG  . LEU A 1 198 ? 26.562  -12.465 34.412 1.00 59.38 ? 198  LEU A CG  1 
ATOM   1562 C CD1 . LEU A 1 198 ? 25.163  -13.029 34.649 1.00 58.47 ? 198  LEU A CD1 1 
ATOM   1563 C CD2 . LEU A 1 198 ? 26.589  -10.956 34.594 1.00 58.88 ? 198  LEU A CD2 1 
ATOM   1564 N N   . ASN A 1 199 ? 29.710  -15.143 35.190 1.00 57.39 ? 199  ASN A N   1 
ATOM   1565 C CA  . ASN A 1 199 ? 31.101  -15.534 35.356 1.00 57.65 ? 199  ASN A CA  1 
ATOM   1566 C C   . ASN A 1 199 ? 31.887  -14.338 34.829 1.00 56.68 ? 199  ASN A C   1 
ATOM   1567 O O   . ASN A 1 199 ? 31.830  -14.031 33.638 1.00 56.80 ? 199  ASN A O   1 
ATOM   1568 C CB  . ASN A 1 199 ? 31.417  -16.767 34.508 1.00 58.96 ? 199  ASN A CB  1 
ATOM   1569 C CG  . ASN A 1 199 ? 32.889  -17.130 34.535 1.00 60.10 ? 199  ASN A CG  1 
ATOM   1570 O OD1 . ASN A 1 199 ? 33.755  -16.276 34.344 1.00 60.41 ? 199  ASN A OD1 1 
ATOM   1571 N ND2 . ASN A 1 199 ? 33.180  -18.405 34.762 1.00 61.10 ? 199  ASN A ND2 1 
ATOM   1572 N N   . PRO A 1 200 ? 32.627  -13.643 35.706 1.00 56.45 ? 200  PRO A N   1 
ATOM   1573 C CA  . PRO A 1 200 ? 33.409  -12.475 35.288 1.00 56.30 ? 200  PRO A CA  1 
ATOM   1574 C C   . PRO A 1 200 ? 34.202  -12.674 33.997 1.00 56.68 ? 200  PRO A C   1 
ATOM   1575 O O   . PRO A 1 200 ? 34.303  -11.765 33.176 1.00 56.12 ? 200  PRO A O   1 
ATOM   1576 C CB  . PRO A 1 200 ? 34.322  -12.226 36.487 1.00 56.25 ? 200  PRO A CB  1 
ATOM   1577 C CG  . PRO A 1 200 ? 33.480  -12.666 37.640 1.00 57.45 ? 200  PRO A CG  1 
ATOM   1578 C CD  . PRO A 1 200 ? 32.864  -13.954 37.127 1.00 56.08 ? 200  PRO A CD  1 
ATOM   1579 N N   . GLU A 1 201 ? 34.753  -13.871 33.821 1.00 57.34 ? 201  GLU A N   1 
ATOM   1580 C CA  . GLU A 1 201 ? 35.567  -14.180 32.652 1.00 57.47 ? 201  GLU A CA  1 
ATOM   1581 C C   . GLU A 1 201 ? 34.850  -14.132 31.308 1.00 55.90 ? 201  GLU A C   1 
ATOM   1582 O O   . GLU A 1 201 ? 35.456  -13.758 30.306 1.00 55.95 ? 201  GLU A O   1 
ATOM   1583 C CB  . GLU A 1 201 ? 36.229  -15.553 32.826 1.00 60.66 ? 201  GLU A CB  1 
ATOM   1584 C CG  . GLU A 1 201 ? 37.108  -15.660 34.067 1.00 64.51 ? 201  GLU A CG  1 
ATOM   1585 C CD  . GLU A 1 201 ? 37.994  -16.897 34.065 1.00 67.19 ? 201  GLU A CD  1 
ATOM   1586 O OE1 . GLU A 1 201 ? 38.684  -17.134 35.080 1.00 68.98 ? 201  GLU A OE1 1 
ATOM   1587 O OE2 . GLU A 1 201 ? 38.001  -17.631 33.053 1.00 69.32 ? 201  GLU A OE2 1 
ATOM   1588 N N   . SER A 1 202 ? 33.573  -14.503 31.272 1.00 53.73 ? 202  SER A N   1 
ATOM   1589 C CA  . SER A 1 202 ? 32.837  -14.495 30.008 1.00 52.74 ? 202  SER A CA  1 
ATOM   1590 C C   . SER A 1 202 ? 31.639  -13.545 29.986 1.00 52.58 ? 202  SER A C   1 
ATOM   1591 O O   . SER A 1 202 ? 30.644  -13.808 29.307 1.00 51.91 ? 202  SER A O   1 
ATOM   1592 C CB  . SER A 1 202 ? 32.369  -15.912 29.663 1.00 52.22 ? 202  SER A CB  1 
ATOM   1593 O OG  . SER A 1 202 ? 31.470  -16.405 30.638 1.00 51.61 ? 202  SER A OG  1 
ATOM   1594 N N   . SER A 1 203 ? 31.744  -12.440 30.719 1.00 50.92 ? 203  SER A N   1 
ATOM   1595 C CA  . SER A 1 203 ? 30.671  -11.452 30.783 1.00 50.08 ? 203  SER A CA  1 
ATOM   1596 C C   . SER A 1 203 ? 31.129  -10.090 30.272 1.00 49.95 ? 203  SER A C   1 
ATOM   1597 O O   . SER A 1 203 ? 32.160  -9.574  30.704 1.00 49.77 ? 203  SER A O   1 
ATOM   1598 C CB  . SER A 1 203 ? 30.174  -11.305 32.222 1.00 47.94 ? 203  SER A CB  1 
ATOM   1599 O OG  . SER A 1 203 ? 29.555  -12.496 32.672 1.00 47.07 ? 203  SER A OG  1 
ATOM   1600 N N   . LEU A 1 204 ? 30.358  -9.509  29.356 1.00 49.07 ? 204  LEU A N   1 
ATOM   1601 C CA  . LEU A 1 204 ? 30.686  -8.199  28.803 1.00 47.92 ? 204  LEU A CA  1 
ATOM   1602 C C   . LEU A 1 204 ? 29.605  -7.187  29.171 1.00 47.50 ? 204  LEU A C   1 
ATOM   1603 O O   . LEU A 1 204 ? 28.420  -7.406  28.914 1.00 47.87 ? 204  LEU A O   1 
ATOM   1604 C CB  . LEU A 1 204 ? 30.830  -8.279  27.279 1.00 48.18 ? 204  LEU A CB  1 
ATOM   1605 C CG  . LEU A 1 204 ? 31.298  -7.005  26.559 1.00 48.95 ? 204  LEU A CG  1 
ATOM   1606 C CD1 . LEU A 1 204 ? 31.883  -7.369  25.200 1.00 50.32 ? 204  LEU A CD1 1 
ATOM   1607 C CD2 . LEU A 1 204 ? 30.143  -6.030  26.403 1.00 49.85 ? 204  LEU A CD2 1 
ATOM   1608 N N   . PHE A 1 205 ? 30.020  -6.079  29.775 1.00 45.96 ? 205  PHE A N   1 
ATOM   1609 C CA  . PHE A 1 205 ? 29.087  -5.038  30.176 1.00 44.71 ? 205  PHE A CA  1 
ATOM   1610 C C   . PHE A 1 205 ? 29.003  -3.888  29.185 1.00 44.45 ? 205  PHE A C   1 
ATOM   1611 O O   . PHE A 1 205 ? 30.006  -3.471  28.607 1.00 43.62 ? 205  PHE A O   1 
ATOM   1612 C CB  . PHE A 1 205 ? 29.463  -4.478  31.550 1.00 43.68 ? 205  PHE A CB  1 
ATOM   1613 C CG  . PHE A 1 205 ? 29.371  -5.482  32.662 1.00 44.07 ? 205  PHE A CG  1 
ATOM   1614 C CD1 . PHE A 1 205 ? 30.434  -6.336  32.939 1.00 44.56 ? 205  PHE A CD1 1 
ATOM   1615 C CD2 . PHE A 1 205 ? 28.214  -5.582  33.430 1.00 42.62 ? 205  PHE A CD2 1 
ATOM   1616 C CE1 . PHE A 1 205 ? 30.347  -7.274  33.966 1.00 45.45 ? 205  PHE A CE1 1 
ATOM   1617 C CE2 . PHE A 1 205 ? 28.116  -6.514  34.456 1.00 44.51 ? 205  PHE A CE2 1 
ATOM   1618 C CZ  . PHE A 1 205 ? 29.185  -7.363  34.726 1.00 44.69 ? 205  PHE A CZ  1 
ATOM   1619 N N   . ILE A 1 206 ? 27.786  -3.387  28.989 1.00 43.62 ? 206  ILE A N   1 
ATOM   1620 C CA  . ILE A 1 206 ? 27.546  -2.261  28.105 1.00 42.26 ? 206  ILE A CA  1 
ATOM   1621 C C   . ILE A 1 206 ? 26.938  -1.156  28.961 1.00 43.25 ? 206  ILE A C   1 
ATOM   1622 O O   . ILE A 1 206 ? 25.821  -1.298  29.467 1.00 43.01 ? 206  ILE A O   1 
ATOM   1623 C CB  . ILE A 1 206 ? 26.546  -2.609  26.980 1.00 42.38 ? 206  ILE A CB  1 
ATOM   1624 C CG1 . ILE A 1 206 ? 27.099  -3.736  26.113 1.00 40.95 ? 206  ILE A CG1 1 
ATOM   1625 C CG2 . ILE A 1 206 ? 26.274  -1.373  26.129 1.00 41.02 ? 206  ILE A CG2 1 
ATOM   1626 C CD1 . ILE A 1 206 ? 26.148  -4.183  25.030 1.00 41.14 ? 206  ILE A CD1 1 
ATOM   1627 N N   . ILE A 1 207 ? 27.678  -0.065  29.135 1.00 41.87 ? 207  ILE A N   1 
ATOM   1628 C CA  . ILE A 1 207 ? 27.194  1.059   29.925 1.00 42.48 ? 207  ILE A CA  1 
ATOM   1629 C C   . ILE A 1 207 ? 26.470  1.999   28.962 1.00 42.78 ? 207  ILE A C   1 
ATOM   1630 O O   . ILE A 1 207 ? 27.096  2.652   28.126 1.00 42.27 ? 207  ILE A O   1 
ATOM   1631 C CB  . ILE A 1 207 ? 28.366  1.799   30.612 1.00 42.91 ? 207  ILE A CB  1 
ATOM   1632 C CG1 . ILE A 1 207 ? 29.313  0.786   31.257 1.00 40.04 ? 207  ILE A CG1 1 
ATOM   1633 C CG2 . ILE A 1 207 ? 27.839  2.733   31.691 1.00 41.95 ? 207  ILE A CG2 1 
ATOM   1634 C CD1 . ILE A 1 207 ? 28.673  -0.081  32.326 1.00 42.22 ? 207  ILE A CD1 1 
ATOM   1635 N N   . ALA A 1 208 ? 25.145  2.050   29.077 1.00 42.12 ? 208  ALA A N   1 
ATOM   1636 C CA  . ALA A 1 208 ? 24.326  2.877   28.197 1.00 42.54 ? 208  ALA A CA  1 
ATOM   1637 C C   . ALA A 1 208 ? 23.821  4.136   28.905 1.00 43.50 ? 208  ALA A C   1 
ATOM   1638 O O   . ALA A 1 208 ? 22.956  4.072   29.787 1.00 41.37 ? 208  ALA A O   1 
ATOM   1639 C CB  . ALA A 1 208 ? 23.131  2.067   27.693 1.00 42.88 ? 208  ALA A CB  1 
ATOM   1640 N N   . SER A 1 209 ? 24.380  5.256   28.475 1.00 43.75 ? 209  SER A N   1 
ATOM   1641 C CA  . SER A 1 209 ? 24.032  6.578   29.018 1.00 43.91 ? 209  SER A CA  1 
ATOM   1642 C C   . SER A 1 209 ? 24.370  7.677   28.009 1.00 45.99 ? 209  SER A C   1 
ATOM   1643 O O   . SER A 1 209 ? 25.534  7.857   27.623 1.00 47.15 ? 209  SER A O   1 
ATOM   1644 C CB  . SER A 1 209 ? 24.814  6.838   30.306 1.00 42.96 ? 209  SER A CB  1 
ATOM   1645 O OG  . SER A 1 209 ? 24.414  8.078   30.872 1.00 40.74 ? 209  SER A OG  1 
ATOM   1646 N N   . LYS A 1 210 ? 23.328  8.383   27.616 1.00 47.64 ? 210  LYS A N   1 
ATOM   1647 C CA  . LYS A 1 210 ? 23.434  9.486   26.655 1.00 49.24 ? 210  LYS A CA  1 
ATOM   1648 C C   . LYS A 1 210 ? 24.375  10.565  27.195 1.00 50.24 ? 210  LYS A C   1 
ATOM   1649 O O   . LYS A 1 210 ? 25.251  11.068  26.479 1.00 52.64 ? 210  LYS A O   1 
ATOM   1650 C CB  . LYS A 1 210 ? 22.058  10.107  26.411 1.00 47.99 ? 210  LYS A CB  1 
ATOM   1651 C CG  . LYS A 1 210 ? 22.076  11.196  25.336 1.00 47.41 ? 210  LYS A CG  1 
ATOM   1652 C CD  . LYS A 1 210 ? 20.679  11.717  24.992 1.00 47.48 ? 210  LYS A CD  1 
ATOM   1653 C CE  . LYS A 1 210 ? 20.700  12.871  23.989 1.00 49.20 ? 210  LYS A CE  1 
ATOM   1654 N NZ  . LYS A 1 210 ? 19.362  13.407  23.704 1.00 47.85 ? 210  LYS A NZ  1 
ATOM   1655 N N   . THR A 1 211 ? 24.172  10.896  28.459 1.00 50.75 ? 211  THR A N   1 
ATOM   1656 C CA  . THR A 1 211 ? 24.974  11.927  29.133 1.00 50.61 ? 211  THR A CA  1 
ATOM   1657 C C   . THR A 1 211 ? 26.147  11.310  29.881 1.00 49.94 ? 211  THR A C   1 
ATOM   1658 O O   . THR A 1 211 ? 27.193  11.935  30.037 1.00 49.52 ? 211  THR A O   1 
ATOM   1659 C CB  . THR A 1 211 ? 24.126  12.714  30.135 1.00 49.81 ? 211  THR A CB  1 
ATOM   1660 O OG1 . THR A 1 211 ? 23.671  11.857  31.169 1.00 50.80 ? 211  THR A OG1 1 
ATOM   1661 C CG2 . THR A 1 211 ? 22.897  13.364  29.498 1.00 50.89 ? 211  THR A CG2 1 
ATOM   1662 N N   . PHE A 1 212 ? 25.955  10.082  30.345 1.00 49.94 ? 212  PHE A N   1 
ATOM   1663 C CA  . PHE A 1 212 ? 26.965  9.354   31.105 1.00 49.35 ? 212  PHE A CA  1 
ATOM   1664 C C   . PHE A 1 212 ? 27.179  9.990   32.481 1.00 49.68 ? 212  PHE A C   1 
ATOM   1665 O O   . PHE A 1 212 ? 28.273  9.916   33.050 1.00 48.60 ? 212  PHE A O   1 
ATOM   1666 C CB  . PHE A 1 212 ? 28.292  9.294   30.338 1.00 50.36 ? 212  PHE A CB  1 
ATOM   1667 C CG  . PHE A 1 212 ? 28.969  7.949   30.407 1.00 51.50 ? 212  PHE A CG  1 
ATOM   1668 C CD1 . PHE A 1 212 ? 28.469  6.866   29.681 1.00 51.04 ? 212  PHE A CD1 1 
ATOM   1669 C CD2 . PHE A 1 212 ? 30.080  7.751   31.221 1.00 50.68 ? 212  PHE A CD2 1 
ATOM   1670 C CE1 . PHE A 1 212 ? 29.066  5.607   29.765 1.00 50.25 ? 212  PHE A CE1 1 
ATOM   1671 C CE2 . PHE A 1 212 ? 30.685  6.495   31.314 1.00 50.75 ? 212  PHE A CE2 1 
ATOM   1672 C CZ  . PHE A 1 212 ? 30.175  5.421   30.585 1.00 51.30 ? 212  PHE A CZ  1 
ATOM   1673 N N   . THR A 1 213 ? 26.132  10.620  33.011 1.00 48.30 ? 213  THR A N   1 
ATOM   1674 C CA  . THR A 1 213 ? 26.202  11.244  34.332 1.00 48.35 ? 213  THR A CA  1 
ATOM   1675 C C   . THR A 1 213 ? 25.027  10.827  35.207 1.00 47.26 ? 213  THR A C   1 
ATOM   1676 O O   . THR A 1 213 ? 24.923  11.251  36.356 1.00 47.23 ? 213  THR A O   1 
ATOM   1677 C CB  . THR A 1 213 ? 26.194  12.787  34.257 1.00 47.42 ? 213  THR A CB  1 
ATOM   1678 O OG1 . THR A 1 213 ? 24.979  13.232  33.642 1.00 48.01 ? 213  THR A OG1 1 
ATOM   1679 C CG2 . THR A 1 213 ? 27.386  13.289  33.473 1.00 49.49 ? 213  THR A CG2 1 
ATOM   1680 N N   . THR A 1 214 ? 24.136  10.005  34.663 1.00 47.42 ? 214  THR A N   1 
ATOM   1681 C CA  . THR A 1 214 ? 22.976  9.550   35.427 1.00 47.00 ? 214  THR A CA  1 
ATOM   1682 C C   . THR A 1 214 ? 23.439  8.743   36.630 1.00 44.80 ? 214  THR A C   1 
ATOM   1683 O O   . THR A 1 214 ? 24.159  7.757   36.487 1.00 45.49 ? 214  THR A O   1 
ATOM   1684 C CB  . THR A 1 214 ? 22.040  8.684   34.562 1.00 46.95 ? 214  THR A CB  1 
ATOM   1685 O OG1 . THR A 1 214 ? 21.424  9.505   33.567 1.00 47.16 ? 214  THR A OG1 1 
ATOM   1686 C CG2 . THR A 1 214 ? 20.956  8.050   35.424 1.00 47.68 ? 214  THR A CG2 1 
ATOM   1687 N N   . GLN A 1 215 ? 23.013  9.162   37.816 1.00 44.22 ? 215  GLN A N   1 
ATOM   1688 C CA  . GLN A 1 215 ? 23.413  8.495   39.045 1.00 42.75 ? 215  GLN A CA  1 
ATOM   1689 C C   . GLN A 1 215 ? 23.171  6.992   39.050 1.00 42.13 ? 215  GLN A C   1 
ATOM   1690 O O   . GLN A 1 215 ? 24.074  6.226   39.380 1.00 40.46 ? 215  GLN A O   1 
ATOM   1691 C CB  . GLN A 1 215 ? 22.711  9.128   40.244 1.00 44.84 ? 215  GLN A CB  1 
ATOM   1692 C CG  . GLN A 1 215 ? 23.302  8.711   41.578 1.00 45.72 ? 215  GLN A CG  1 
ATOM   1693 C CD  . GLN A 1 215 ? 22.750  9.517   42.735 1.00 47.26 ? 215  GLN A CD  1 
ATOM   1694 O OE1 . GLN A 1 215 ? 23.283  9.480   43.843 1.00 49.66 ? 215  GLN A OE1 1 
ATOM   1695 N NE2 . GLN A 1 215 ? 21.676  10.250  42.484 1.00 47.82 ? 215  GLN A NE2 1 
ATOM   1696 N N   . GLU A 1 216 ? 21.963  6.562   38.687 1.00 41.83 ? 216  GLU A N   1 
ATOM   1697 C CA  . GLU A 1 216 ? 21.665  5.132   38.672 1.00 41.38 ? 216  GLU A CA  1 
ATOM   1698 C C   . GLU A 1 216 ? 22.641  4.340   37.812 1.00 39.79 ? 216  GLU A C   1 
ATOM   1699 O O   . GLU A 1 216 ? 23.260  3.386   38.285 1.00 39.92 ? 216  GLU A O   1 
ATOM   1700 C CB  . GLU A 1 216 ? 20.248  4.860   38.154 1.00 44.21 ? 216  GLU A CB  1 
ATOM   1701 C CG  . GLU A 1 216 ? 19.117  5.201   39.106 1.00 46.30 ? 216  GLU A CG  1 
ATOM   1702 C CD  . GLU A 1 216 ? 18.331  6.421   38.674 1.00 48.40 ? 216  GLU A CD  1 
ATOM   1703 O OE1 . GLU A 1 216 ? 17.180  6.573   39.144 1.00 47.12 ? 216  GLU A OE1 1 
ATOM   1704 O OE2 . GLU A 1 216 ? 18.857  7.227   37.874 1.00 48.79 ? 216  GLU A OE2 1 
ATOM   1705 N N   . THR A 1 217 ? 22.768  4.736   36.550 1.00 38.56 ? 217  THR A N   1 
ATOM   1706 C CA  . THR A 1 217 ? 23.641  4.042   35.610 1.00 38.78 ? 217  THR A CA  1 
ATOM   1707 C C   . THR A 1 217 ? 25.111  4.087   36.016 1.00 39.19 ? 217  THR A C   1 
ATOM   1708 O O   . THR A 1 217 ? 25.774  3.053   36.051 1.00 36.69 ? 217  THR A O   1 
ATOM   1709 C CB  . THR A 1 217 ? 23.472  4.613   34.192 1.00 40.75 ? 217  THR A CB  1 
ATOM   1710 O OG1 . THR A 1 217 ? 22.098  4.479   33.795 1.00 41.07 ? 217  THR A OG1 1 
ATOM   1711 C CG2 . THR A 1 217 ? 24.358  3.866   33.196 1.00 38.73 ? 217  THR A CG2 1 
ATOM   1712 N N   . ILE A 1 218 ? 25.615  5.275   36.335 1.00 40.64 ? 218  ILE A N   1 
ATOM   1713 C CA  . ILE A 1 218 ? 27.010  5.411   36.743 1.00 43.16 ? 218  ILE A CA  1 
ATOM   1714 C C   . ILE A 1 218 ? 27.319  4.526   37.948 1.00 42.85 ? 218  ILE A C   1 
ATOM   1715 O O   . ILE A 1 218 ? 28.319  3.810   37.958 1.00 44.83 ? 218  ILE A O   1 
ATOM   1716 C CB  . ILE A 1 218 ? 27.353  6.876   37.105 1.00 45.71 ? 218  ILE A CB  1 
ATOM   1717 C CG1 . ILE A 1 218 ? 27.162  7.771   35.878 1.00 47.45 ? 218  ILE A CG1 1 
ATOM   1718 C CG2 . ILE A 1 218 ? 28.787  6.970   37.619 1.00 47.77 ? 218  ILE A CG2 1 
ATOM   1719 C CD1 . ILE A 1 218 ? 28.006  7.365   34.687 1.00 51.98 ? 218  ILE A CD1 1 
ATOM   1720 N N   . THR A 1 219 ? 26.453  4.571   38.959 1.00 42.66 ? 219  THR A N   1 
ATOM   1721 C CA  . THR A 1 219 ? 26.647  3.776   40.169 1.00 40.83 ? 219  THR A CA  1 
ATOM   1722 C C   . THR A 1 219 ? 26.629  2.275   39.883 1.00 41.79 ? 219  THR A C   1 
ATOM   1723 O O   . THR A 1 219 ? 27.501  1.541   40.356 1.00 40.80 ? 219  THR A O   1 
ATOM   1724 C CB  . THR A 1 219 ? 25.577  4.116   41.233 1.00 41.35 ? 219  THR A CB  1 
ATOM   1725 O OG1 . THR A 1 219 ? 25.592  5.525   41.489 1.00 39.88 ? 219  THR A OG1 1 
ATOM   1726 C CG2 . THR A 1 219 ? 25.869  3.392   42.533 1.00 40.22 ? 219  THR A CG2 1 
ATOM   1727 N N   . ASN A 1 220 ? 25.640  1.809   39.120 1.00 40.74 ? 220  ASN A N   1 
ATOM   1728 C CA  . ASN A 1 220 ? 25.577  0.388   38.779 1.00 39.96 ? 220  ASN A CA  1 
ATOM   1729 C C   . ASN A 1 220 ? 26.836  -0.007  38.007 1.00 39.82 ? 220  ASN A C   1 
ATOM   1730 O O   . ASN A 1 220 ? 27.372  -1.107  38.181 1.00 37.92 ? 220  ASN A O   1 
ATOM   1731 C CB  . ASN A 1 220 ? 24.340  0.076   37.920 1.00 38.40 ? 220  ASN A CB  1 
ATOM   1732 C CG  . ASN A 1 220 ? 23.084  -0.135  38.752 1.00 38.03 ? 220  ASN A CG  1 
ATOM   1733 O OD1 . ASN A 1 220 ? 23.110  -0.846  39.754 1.00 38.13 ? 220  ASN A OD1 1 
ATOM   1734 N ND2 . ASN A 1 220 ? 21.976  0.468   38.330 1.00 36.43 ? 220  ASN A ND2 1 
ATOM   1735 N N   . ALA A 1 221 ? 27.299  0.897   37.152 1.00 39.32 ? 221  ALA A N   1 
ATOM   1736 C CA  . ALA A 1 221 ? 28.487  0.646   36.343 1.00 41.39 ? 221  ALA A CA  1 
ATOM   1737 C C   . ALA A 1 221 ? 29.723  0.466   37.223 1.00 41.79 ? 221  ALA A C   1 
ATOM   1738 O O   . ALA A 1 221 ? 30.546  -0.415  36.973 1.00 42.29 ? 221  ALA A O   1 
ATOM   1739 C CB  . ALA A 1 221 ? 28.700  1.791   35.364 1.00 38.70 ? 221  ALA A CB  1 
ATOM   1740 N N   . LYS A 1 222 ? 29.843  1.298   38.253 1.00 44.24 ? 222  LYS A N   1 
ATOM   1741 C CA  . LYS A 1 222 ? 30.982  1.223   39.164 1.00 44.57 ? 222  LYS A CA  1 
ATOM   1742 C C   . LYS A 1 222 ? 30.919  -0.061  39.984 1.00 44.98 ? 222  LYS A C   1 
ATOM   1743 O O   . LYS A 1 222 ? 31.935  -0.715  40.214 1.00 44.16 ? 222  LYS A O   1 
ATOM   1744 C CB  . LYS A 1 222 ? 30.996  2.430   40.102 1.00 47.05 ? 222  LYS A CB  1 
ATOM   1745 C CG  . LYS A 1 222 ? 30.741  3.764   39.411 1.00 49.17 ? 222  LYS A CG  1 
ATOM   1746 C CD  . LYS A 1 222 ? 31.754  4.833   39.817 1.00 49.80 ? 222  LYS A CD  1 
ATOM   1747 C CE  . LYS A 1 222 ? 33.030  4.728   38.992 1.00 50.19 ? 222  LYS A CE  1 
ATOM   1748 N NZ  . LYS A 1 222 ? 33.650  3.374   39.062 1.00 49.38 ? 222  LYS A NZ  1 
ATOM   1749 N N   . THR A 1 223 ? 29.717  -0.419  40.427 1.00 43.11 ? 223  THR A N   1 
ATOM   1750 C CA  . THR A 1 223 ? 29.532  -1.632  41.209 1.00 43.42 ? 223  THR A CA  1 
ATOM   1751 C C   . THR A 1 223 ? 29.849  -2.866  40.367 1.00 43.25 ? 223  THR A C   1 
ATOM   1752 O O   . THR A 1 223 ? 30.387  -3.850  40.876 1.00 43.54 ? 223  THR A O   1 
ATOM   1753 C CB  . THR A 1 223 ? 28.089  -1.726  41.741 1.00 41.66 ? 223  THR A CB  1 
ATOM   1754 O OG1 . THR A 1 223 ? 27.870  -0.670  42.679 1.00 44.26 ? 223  THR A OG1 1 
ATOM   1755 C CG2 . THR A 1 223 ? 27.849  -3.053  42.431 1.00 40.81 ? 223  THR A CG2 1 
ATOM   1756 N N   . ALA A 1 224 ? 29.519  -2.803  39.078 1.00 43.18 ? 224  ALA A N   1 
ATOM   1757 C CA  . ALA A 1 224 ? 29.773  -3.908  38.158 1.00 43.55 ? 224  ALA A CA  1 
ATOM   1758 C C   . ALA A 1 224 ? 31.278  -4.115  38.001 1.00 44.76 ? 224  ALA A C   1 
ATOM   1759 O O   . ALA A 1 224 ? 31.774  -5.243  38.046 1.00 42.86 ? 224  ALA A O   1 
ATOM   1760 C CB  . ALA A 1 224 ? 29.138  -3.614  36.798 1.00 40.83 ? 224  ALA A CB  1 
ATOM   1761 N N   . LYS A 1 225 ? 31.996  -3.016  37.810 1.00 46.77 ? 225  LYS A N   1 
ATOM   1762 C CA  . LYS A 1 225 ? 33.444  -3.063  37.657 1.00 51.42 ? 225  LYS A CA  1 
ATOM   1763 C C   . LYS A 1 225 ? 34.049  -3.657  38.928 1.00 53.61 ? 225  LYS A C   1 
ATOM   1764 O O   . LYS A 1 225 ? 34.997  -4.444  38.871 1.00 54.65 ? 225  LYS A O   1 
ATOM   1765 C CB  . LYS A 1 225 ? 33.986  -1.651  37.417 1.00 52.64 ? 225  LYS A CB  1 
ATOM   1766 C CG  . LYS A 1 225 ? 35.438  -1.594  36.965 1.00 54.94 ? 225  LYS A CG  1 
ATOM   1767 C CD  . LYS A 1 225 ? 35.836  -0.166  36.640 1.00 56.59 ? 225  LYS A CD  1 
ATOM   1768 C CE  . LYS A 1 225 ? 37.227  -0.094  36.036 1.00 58.93 ? 225  LYS A CE  1 
ATOM   1769 N NZ  . LYS A 1 225 ? 37.606  1.307   35.690 1.00 61.14 ? 225  LYS A NZ  1 
ATOM   1770 N N   . ASP A 1 226 ? 33.488  -3.288  40.077 1.00 56.03 ? 226  ASP A N   1 
ATOM   1771 C CA  . ASP A 1 226 ? 33.967  -3.798  41.356 1.00 57.77 ? 226  ASP A CA  1 
ATOM   1772 C C   . ASP A 1 226 ? 33.823  -5.308  41.403 1.00 58.71 ? 226  ASP A C   1 
ATOM   1773 O O   . ASP A 1 226 ? 34.787  -6.019  41.679 1.00 59.43 ? 226  ASP A O   1 
ATOM   1774 C CB  . ASP A 1 226 ? 33.179  -3.169  42.507 1.00 59.73 ? 226  ASP A CB  1 
ATOM   1775 C CG  . ASP A 1 226 ? 33.878  -1.967  43.102 1.00 61.66 ? 226  ASP A CG  1 
ATOM   1776 O OD1 . ASP A 1 226 ? 34.300  -1.074  42.337 1.00 62.96 ? 226  ASP A OD1 1 
ATOM   1777 O OD2 . ASP A 1 226 ? 34.003  -1.913  44.345 1.00 65.41 ? 226  ASP A OD2 1 
ATOM   1778 N N   . TRP A 1 227 ? 32.615  -5.790  41.129 1.00 58.04 ? 227  TRP A N   1 
ATOM   1779 C CA  . TRP A 1 227 ? 32.337  -7.223  41.128 1.00 58.28 ? 227  TRP A CA  1 
ATOM   1780 C C   . TRP A 1 227 ? 33.328  -7.953  40.232 1.00 59.25 ? 227  TRP A C   1 
ATOM   1781 O O   . TRP A 1 227 ? 33.788  -9.047  40.559 1.00 59.19 ? 227  TRP A O   1 
ATOM   1782 C CB  . TRP A 1 227 ? 30.916  -7.477  40.619 1.00 56.32 ? 227  TRP A CB  1 
ATOM   1783 C CG  . TRP A 1 227 ? 30.586  -8.925  40.380 1.00 54.37 ? 227  TRP A CG  1 
ATOM   1784 C CD1 . TRP A 1 227 ? 30.192  -9.845  41.313 1.00 54.06 ? 227  TRP A CD1 1 
ATOM   1785 C CD2 . TRP A 1 227 ? 30.594  -9.610  39.124 1.00 53.17 ? 227  TRP A CD2 1 
ATOM   1786 N NE1 . TRP A 1 227 ? 29.946  -11.056 40.714 1.00 52.89 ? 227  TRP A NE1 1 
ATOM   1787 C CE2 . TRP A 1 227 ? 30.185  -10.939 39.370 1.00 52.98 ? 227  TRP A CE2 1 
ATOM   1788 C CE3 . TRP A 1 227 ? 30.904  -9.230  37.813 1.00 53.08 ? 227  TRP A CE3 1 
ATOM   1789 C CZ2 . TRP A 1 227 ? 30.076  -11.891 38.346 1.00 53.65 ? 227  TRP A CZ2 1 
ATOM   1790 C CZ3 . TRP A 1 227 ? 30.796  -10.175 36.799 1.00 52.94 ? 227  TRP A CZ3 1 
ATOM   1791 C CH2 . TRP A 1 227 ? 30.385  -11.489 37.072 1.00 53.72 ? 227  TRP A CH2 1 
ATOM   1792 N N   . PHE A 1 228 ? 33.654  -7.333  39.103 1.00 61.02 ? 228  PHE A N   1 
ATOM   1793 C CA  . PHE A 1 228 ? 34.577  -7.916  38.136 1.00 62.95 ? 228  PHE A CA  1 
ATOM   1794 C C   . PHE A 1 228 ? 36.039  -7.983  38.608 1.00 64.42 ? 228  PHE A C   1 
ATOM   1795 O O   . PHE A 1 228 ? 36.758  -8.952  38.321 1.00 64.08 ? 228  PHE A O   1 
ATOM   1796 C CB  . PHE A 1 228 ? 34.516  -7.131  36.822 1.00 61.85 ? 228  PHE A CB  1 
ATOM   1797 C CG  . PHE A 1 228 ? 35.537  -7.597  35.790 1.00 61.11 ? 228  PHE A CG  1 
ATOM   1798 C CD1 . PHE A 1 228 ? 35.440  -8.881  35.242 1.00 59.83 ? 228  PHE A CD1 1 
ATOM   1799 C CD2 . PHE A 1 228 ? 36.565  -6.737  35.393 1.00 60.89 ? 228  PHE A CD2 1 
ATOM   1800 C CE1 . PHE A 1 228 ? 36.376  -9.306  34.294 1.00 60.70 ? 228  PHE A CE1 1 
ATOM   1801 C CE2 . PHE A 1 228 ? 37.502  -7.162  34.445 1.00 60.24 ? 228  PHE A CE2 1 
ATOM   1802 C CZ  . PHE A 1 228 ? 37.408  -8.447  33.896 1.00 59.41 ? 228  PHE A CZ  1 
ATOM   1803 N N   . LEU A 1 229 ? 36.473  -6.976  39.328 1.00 66.77 ? 229  LEU A N   1 
ATOM   1804 C CA  . LEU A 1 229 ? 37.885  -6.876  39.750 1.00 69.91 ? 229  LEU A CA  1 
ATOM   1805 C C   . LEU A 1 229 ? 38.239  -7.745  40.968 1.00 71.60 ? 229  LEU A C   1 
ATOM   1806 O O   . LEU A 1 229 ? 39.416  -8.022  41.234 1.00 71.54 ? 229  LEU A O   1 
ATOM   1807 C CB  . LEU A 1 229 ? 38.230  -5.443  40.127 1.00 70.24 ? 229  LEU A CB  1 
ATOM   1808 C CG  . LEU A 1 229 ? 38.744  -4.623  38.945 1.00 71.30 ? 229  LEU A CG  1 
ATOM   1809 C CD1 . LEU A 1 229 ? 37.662  -4.348  37.900 1.00 71.97 ? 229  LEU A CD1 1 
ATOM   1810 C CD2 . LEU A 1 229 ? 39.280  -3.252  39.362 1.00 71.55 ? 229  LEU A CD2 1 
ATOM   1811 N N   . LEU A 1 230 ? 37.248  -8.167  41.732 1.00 73.80 ? 230  LEU A N   1 
ATOM   1812 C CA  . LEU A 1 230 ? 37.536  -8.989  42.925 1.00 76.12 ? 230  LEU A CA  1 
ATOM   1813 C C   . LEU A 1 230 ? 37.557  -10.474 42.543 1.00 77.61 ? 230  LEU A C   1 
ATOM   1814 O O   . LEU A 1 230 ? 37.404  -11.363 43.378 1.00 78.58 ? 230  LEU A O   1 
ATOM   1815 C CB  . LEU A 1 230 ? 36.486  -8.824  44.039 1.00 75.97 ? 230  LEU A CB  1 
ATOM   1816 C CG  . LEU A 1 230 ? 35.497  -7.675  43.841 1.00 76.36 ? 230  LEU A CG  1 
ATOM   1817 C CD1 . LEU A 1 230 ? 34.200  -7.876  44.639 1.00 76.74 ? 230  LEU A CD1 1 
ATOM   1818 C CD2 . LEU A 1 230 ? 36.047  -6.321  44.293 1.00 75.78 ? 230  LEU A CD2 1 
ATOM   1819 N N   . SER A 1 231 ? 37.708  -10.648 41.218 1.00 78.91 ? 231  SER A N   1 
ATOM   1820 C CA  . SER A 1 231 ? 37.747  -11.964 40.550 1.00 80.40 ? 231  SER A CA  1 
ATOM   1821 C C   . SER A 1 231 ? 38.889  -11.992 39.525 1.00 81.28 ? 231  SER A C   1 
ATOM   1822 O O   . SER A 1 231 ? 39.185  -13.036 38.926 1.00 82.21 ? 231  SER A O   1 
ATOM   1823 C CB  . SER A 1 231 ? 36.421  -12.227 39.829 1.00 80.56 ? 231  SER A CB  1 
ATOM   1824 O OG  . SER A 1 231 ? 35.687  -13.229 40.518 1.00 80.61 ? 231  SER A OG  1 
ATOM   1825 N N   . ALA A 1 232 ? 39.476  -10.825 39.377 1.00 82.21 ? 232  ALA A N   1 
ATOM   1826 C CA  . ALA A 1 232 ? 40.620  -10.573 38.488 1.00 83.16 ? 232  ALA A CA  1 
ATOM   1827 C C   . ALA A 1 232 ? 41.376  -9.376  39.050 1.00 83.73 ? 232  ALA A C   1 
ATOM   1828 O O   . ALA A 1 232 ? 41.430  -9.176  40.269 1.00 84.29 ? 232  ALA A O   1 
ATOM   1829 C CB  . ALA A 1 232 ? 40.125  -10.273 37.072 1.00 83.16 ? 232  ALA A CB  1 
ATOM   1830 N N   . LYS A 1 233 ? 41.946  -8.587  38.167 1.00 84.44 ? 233  LYS A N   1 
ATOM   1831 C CA  . LYS A 1 233 ? 42.665  -7.370  38.578 1.00 84.90 ? 233  LYS A CA  1 
ATOM   1832 C C   . LYS A 1 233 ? 43.359  -6.730  37.375 1.00 85.14 ? 233  LYS A C   1 
ATOM   1833 O O   . LYS A 1 233 ? 43.352  -7.282  36.266 1.00 85.00 ? 233  LYS A O   1 
ATOM   1834 C CB  . LYS A 1 233 ? 43.685  -7.687  39.665 1.00 85.67 ? 233  LYS A CB  1 
ATOM   1835 C CG  . LYS A 1 233 ? 43.791  -6.585  40.721 1.00 86.42 ? 233  LYS A CG  1 
ATOM   1836 C CD  . LYS A 1 233 ? 45.236  -6.180  41.017 1.00 87.01 ? 233  LYS A CD  1 
ATOM   1837 C CE  . LYS A 1 233 ? 45.373  -4.715  41.436 1.00 87.19 ? 233  LYS A CE  1 
ATOM   1838 N NZ  . LYS A 1 233 ? 46.773  -4.283  41.558 1.00 87.48 ? 233  LYS A NZ  1 
ATOM   1839 N N   . ASP A 1 234 ? 43.945  -5.580  37.648 1.00 85.48 ? 234  ASP A N   1 
ATOM   1840 C CA  . ASP A 1 234 ? 44.587  -4.748  36.623 1.00 85.78 ? 234  ASP A CA  1 
ATOM   1841 C C   . ASP A 1 234 ? 43.462  -4.058  35.858 1.00 85.21 ? 234  ASP A C   1 
ATOM   1842 O O   . ASP A 1 234 ? 42.862  -4.656  34.941 1.00 85.20 ? 234  ASP A O   1 
ATOM   1843 C CB  . ASP A 1 234 ? 45.459  -5.607  35.707 1.00 86.55 ? 234  ASP A CB  1 
ATOM   1844 C CG  . ASP A 1 234 ? 46.660  -4.836  35.151 1.00 88.18 ? 234  ASP A CG  1 
ATOM   1845 O OD1 . ASP A 1 234 ? 47.755  -5.456  34.867 1.00 88.58 ? 234  ASP A OD1 1 
ATOM   1846 O OD2 . ASP A 1 234 ? 46.574  -3.562  34.963 1.00 88.67 ? 234  ASP A OD2 1 
ATOM   1847 N N   . PRO A 1 235 ? 43.202  -2.809  36.255 1.00 84.62 ? 235  PRO A N   1 
ATOM   1848 C CA  . PRO A 1 235 ? 42.106  -2.005  35.739 1.00 84.02 ? 235  PRO A CA  1 
ATOM   1849 C C   . PRO A 1 235 ? 42.189  -1.850  34.256 1.00 83.17 ? 235  PRO A C   1 
ATOM   1850 O O   . PRO A 1 235 ? 41.324  -1.132  33.664 1.00 83.23 ? 235  PRO A O   1 
ATOM   1851 C CB  . PRO A 1 235 ? 42.258  -0.681  36.454 1.00 84.28 ? 235  PRO A CB  1 
ATOM   1852 C CG  . PRO A 1 235 ? 43.454  -0.790  37.386 1.00 84.60 ? 235  PRO A CG  1 
ATOM   1853 C CD  . PRO A 1 235 ? 44.038  -2.153  37.257 1.00 84.81 ? 235  PRO A CD  1 
ATOM   1854 N N   . SER A 1 236 ? 43.183  -2.499  33.699 1.00 81.93 ? 236  SER A N   1 
ATOM   1855 C CA  . SER A 1 236 ? 43.416  -2.478  32.255 1.00 80.19 ? 236  SER A CA  1 
ATOM   1856 C C   . SER A 1 236 ? 42.489  -3.489  31.569 1.00 78.51 ? 236  SER A C   1 
ATOM   1857 O O   . SER A 1 236 ? 41.922  -3.217  30.501 1.00 78.91 ? 236  SER A O   1 
ATOM   1858 C CB  . SER A 1 236 ? 44.872  -2.839  31.953 1.00 80.56 ? 236  SER A CB  1 
ATOM   1859 O OG  . SER A 1 236 ? 45.094  -4.217  32.207 1.00 81.59 ? 236  SER A OG  1 
ATOM   1860 N N   . THR A 1 237 ? 42.353  -4.638  32.212 1.00 76.08 ? 237  THR A N   1 
ATOM   1861 C CA  . THR A 1 237 ? 41.530  -5.747  31.695 1.00 73.83 ? 237  THR A CA  1 
ATOM   1862 C C   . THR A 1 237 ? 40.076  -5.316  31.508 1.00 72.33 ? 237  THR A C   1 
ATOM   1863 O O   . THR A 1 237 ? 39.304  -5.984  30.816 1.00 72.09 ? 237  THR A O   1 
ATOM   1864 C CB  . THR A 1 237 ? 41.560  -6.940  32.653 1.00 73.62 ? 237  THR A CB  1 
ATOM   1865 O OG1 . THR A 1 237 ? 41.044  -6.564  33.919 1.00 73.76 ? 237  THR A OG1 1 
ATOM   1866 C CG2 . THR A 1 237 ? 42.969  -7.494  32.874 1.00 73.58 ? 237  THR A CG2 1 
ATOM   1867 N N   . VAL A 1 238 ? 39.707  -4.204  32.134 1.00 70.08 ? 238  VAL A N   1 
ATOM   1868 C CA  . VAL A 1 238 ? 38.350  -3.680  32.027 1.00 67.17 ? 238  VAL A CA  1 
ATOM   1869 C C   . VAL A 1 238 ? 37.999  -3.465  30.560 1.00 66.03 ? 238  VAL A C   1 
ATOM   1870 O O   . VAL A 1 238 ? 36.865  -3.702  30.140 1.00 66.21 ? 238  VAL A O   1 
ATOM   1871 C CB  . VAL A 1 238 ? 38.221  -2.337  32.770 1.00 66.86 ? 238  VAL A CB  1 
ATOM   1872 C CG1 . VAL A 1 238 ? 36.829  -1.758  32.582 1.00 65.88 ? 238  VAL A CG1 1 
ATOM   1873 C CG2 . VAL A 1 238 ? 38.520  -2.536  34.249 1.00 66.62 ? 238  VAL A CG2 1 
ATOM   1874 N N   . ALA A 1 239 ? 38.988  -3.035  29.783 1.00 63.87 ? 239  ALA A N   1 
ATOM   1875 C CA  . ALA A 1 239 ? 38.808  -2.776  28.360 1.00 62.01 ? 239  ALA A CA  1 
ATOM   1876 C C   . ALA A 1 239 ? 38.252  -3.976  27.599 1.00 60.78 ? 239  ALA A C   1 
ATOM   1877 O O   . ALA A 1 239 ? 37.640  -3.815  26.545 1.00 61.32 ? 239  ALA A O   1 
ATOM   1878 C CB  . ALA A 1 239 ? 40.134  -2.340  27.746 1.00 61.89 ? 239  ALA A CB  1 
ATOM   1879 N N   . LYS A 1 240 ? 38.469  -5.176  28.125 1.00 59.14 ? 240  LYS A N   1 
ATOM   1880 C CA  . LYS A 1 240 ? 37.985  -6.385  27.466 1.00 58.06 ? 240  LYS A CA  1 
ATOM   1881 C C   . LYS A 1 240 ? 36.595  -6.787  27.958 1.00 56.99 ? 240  LYS A C   1 
ATOM   1882 O O   . LYS A 1 240 ? 35.998  -7.728  27.433 1.00 56.29 ? 240  LYS A O   1 
ATOM   1883 C CB  . LYS A 1 240 ? 38.946  -7.554  27.718 1.00 59.27 ? 240  LYS A CB  1 
ATOM   1884 C CG  . LYS A 1 240 ? 40.399  -7.318  27.318 1.00 59.78 ? 240  LYS A CG  1 
ATOM   1885 C CD  . LYS A 1 240 ? 40.556  -7.122  25.821 1.00 61.23 ? 240  LYS A CD  1 
ATOM   1886 C CE  . LYS A 1 240 ? 42.024  -7.178  25.417 1.00 61.17 ? 240  LYS A CE  1 
ATOM   1887 N NZ  . LYS A 1 240 ? 42.624  -8.509  25.731 1.00 60.71 ? 240  LYS A NZ  1 
ATOM   1888 N N   . HIS A 1 241 ? 36.078  -6.079  28.959 1.00 55.41 ? 241  HIS A N   1 
ATOM   1889 C CA  . HIS A 1 241 ? 34.773  -6.425  29.516 1.00 54.35 ? 241  HIS A CA  1 
ATOM   1890 C C   . HIS A 1 241 ? 33.759  -5.292  29.636 1.00 53.12 ? 241  HIS A C   1 
ATOM   1891 O O   . HIS A 1 241 ? 32.614  -5.523  30.026 1.00 52.59 ? 241  HIS A O   1 
ATOM   1892 C CB  . HIS A 1 241 ? 34.972  -7.078  30.880 1.00 54.87 ? 241  HIS A CB  1 
ATOM   1893 C CG  . HIS A 1 241 ? 35.619  -8.425  30.810 1.00 56.79 ? 241  HIS A CG  1 
ATOM   1894 N ND1 . HIS A 1 241 ? 34.898  -9.588  30.644 1.00 56.35 ? 241  HIS A ND1 1 
ATOM   1895 C CD2 . HIS A 1 241 ? 36.922  -8.793  30.848 1.00 57.70 ? 241  HIS A CD2 1 
ATOM   1896 C CE1 . HIS A 1 241 ? 35.729  -10.614 30.585 1.00 58.18 ? 241  HIS A CE1 1 
ATOM   1897 N NE2 . HIS A 1 241 ? 36.963  -10.159 30.706 1.00 58.36 ? 241  HIS A NE2 1 
ATOM   1898 N N   . PHE A 1 242 ? 34.169  -4.073  29.310 1.00 51.68 ? 242  PHE A N   1 
ATOM   1899 C CA  . PHE A 1 242 ? 33.261  -2.938  29.384 1.00 49.82 ? 242  PHE A CA  1 
ATOM   1900 C C   . PHE A 1 242 ? 33.314  -2.065  28.132 1.00 49.71 ? 242  PHE A C   1 
ATOM   1901 O O   . PHE A 1 242 ? 34.392  -1.735  27.637 1.00 49.51 ? 242  PHE A O   1 
ATOM   1902 C CB  . PHE A 1 242 ? 33.571  -2.078  30.617 1.00 50.26 ? 242  PHE A CB  1 
ATOM   1903 C CG  . PHE A 1 242 ? 33.193  -2.719  31.924 1.00 48.53 ? 242  PHE A CG  1 
ATOM   1904 C CD1 . PHE A 1 242 ? 33.973  -3.729  32.476 1.00 48.84 ? 242  PHE A CD1 1 
ATOM   1905 C CD2 . PHE A 1 242 ? 32.049  -2.310  32.604 1.00 48.05 ? 242  PHE A CD2 1 
ATOM   1906 C CE1 . PHE A 1 242 ? 33.623  -4.324  33.684 1.00 47.31 ? 242  PHE A CE1 1 
ATOM   1907 C CE2 . PHE A 1 242 ? 31.686  -2.897  33.813 1.00 47.75 ? 242  PHE A CE2 1 
ATOM   1908 C CZ  . PHE A 1 242 ? 32.474  -3.905  34.357 1.00 49.72 ? 242  PHE A CZ  1 
ATOM   1909 N N   . VAL A 1 243 ? 32.139  -1.709  27.618 1.00 49.14 ? 243  VAL A N   1 
ATOM   1910 C CA  . VAL A 1 243 ? 32.021  -0.851  26.441 1.00 48.02 ? 243  VAL A CA  1 
ATOM   1911 C C   . VAL A 1 243 ? 30.927  0.171   26.742 1.00 48.12 ? 243  VAL A C   1 
ATOM   1912 O O   . VAL A 1 243 ? 30.101  -0.054  27.628 1.00 47.85 ? 243  VAL A O   1 
ATOM   1913 C CB  . VAL A 1 243 ? 31.642  -1.654  25.174 1.00 48.86 ? 243  VAL A CB  1 
ATOM   1914 C CG1 . VAL A 1 243 ? 32.695  -2.716  24.902 1.00 48.46 ? 243  VAL A CG1 1 
ATOM   1915 C CG2 . VAL A 1 243 ? 30.263  -2.285  25.340 1.00 48.64 ? 243  VAL A CG2 1 
ATOM   1916 N N   . ALA A 1 244 ? 30.909  1.287   26.019 1.00 47.68 ? 244  ALA A N   1 
ATOM   1917 C CA  . ALA A 1 244 ? 29.907  2.312   26.285 1.00 47.71 ? 244  ALA A CA  1 
ATOM   1918 C C   . ALA A 1 244 ? 29.119  2.839   25.084 1.00 47.58 ? 244  ALA A C   1 
ATOM   1919 O O   . ALA A 1 244 ? 29.587  2.821   23.941 1.00 47.26 ? 244  ALA A O   1 
ATOM   1920 C CB  . ALA A 1 244 ? 30.560  3.479   27.029 1.00 47.15 ? 244  ALA A CB  1 
ATOM   1921 N N   . LEU A 1 245 ? 27.907  3.305   25.370 1.00 46.69 ? 245  LEU A N   1 
ATOM   1922 C CA  . LEU A 1 245 ? 27.015  3.876   24.366 1.00 46.72 ? 245  LEU A CA  1 
ATOM   1923 C C   . LEU A 1 245 ? 26.671  5.253   24.918 1.00 48.27 ? 245  LEU A C   1 
ATOM   1924 O O   . LEU A 1 245 ? 25.877  5.365   25.853 1.00 47.64 ? 245  LEU A O   1 
ATOM   1925 C CB  . LEU A 1 245 ? 25.737  3.037   24.240 1.00 45.13 ? 245  LEU A CB  1 
ATOM   1926 C CG  . LEU A 1 245 ? 25.884  1.511   24.221 1.00 43.86 ? 245  LEU A CG  1 
ATOM   1927 C CD1 . LEU A 1 245 ? 24.501  0.872   24.175 1.00 42.52 ? 245  LEU A CD1 1 
ATOM   1928 C CD2 . LEU A 1 245 ? 26.716  1.072   23.027 1.00 42.37 ? 245  LEU A CD2 1 
ATOM   1929 N N   . SER A 1 246 ? 27.266  6.300   24.354 1.00 49.63 ? 246  SER A N   1 
ATOM   1930 C CA  . SER A 1 246 ? 27.018  7.648   24.851 1.00 52.64 ? 246  SER A CA  1 
ATOM   1931 C C   . SER A 1 246 ? 27.302  8.744   23.833 1.00 53.49 ? 246  SER A C   1 
ATOM   1932 O O   . SER A 1 246 ? 27.706  8.474   22.707 1.00 54.56 ? 246  SER A O   1 
ATOM   1933 C CB  . SER A 1 246 ? 27.874  7.895   26.100 1.00 51.28 ? 246  SER A CB  1 
ATOM   1934 O OG  . SER A 1 246 ? 27.723  9.224   26.573 1.00 53.75 ? 246  SER A OG  1 
ATOM   1935 N N   . THR A 1 247 ? 27.076  9.987   24.246 1.00 55.29 ? 247  THR A N   1 
ATOM   1936 C CA  . THR A 1 247 ? 27.334  11.148  23.401 1.00 56.89 ? 247  THR A CA  1 
ATOM   1937 C C   . THR A 1 247 ? 28.390  11.996  24.110 1.00 58.41 ? 247  THR A C   1 
ATOM   1938 O O   . THR A 1 247 ? 28.818  13.032  23.601 1.00 58.60 ? 247  THR A O   1 
ATOM   1939 C CB  . THR A 1 247 ? 26.068  12.011  23.198 1.00 56.24 ? 247  THR A CB  1 
ATOM   1940 O OG1 . THR A 1 247 ? 25.712  12.643  24.434 1.00 54.96 ? 247  THR A OG1 1 
ATOM   1941 C CG2 . THR A 1 247 ? 24.906  11.149  22.719 1.00 57.14 ? 247  THR A CG2 1 
ATOM   1942 N N   . ASN A 1 248 ? 28.801  11.535  25.290 1.00 59.58 ? 248  ASN A N   1 
ATOM   1943 C CA  . ASN A 1 248 ? 29.800  12.223  26.105 1.00 61.53 ? 248  ASN A CA  1 
ATOM   1944 C C   . ASN A 1 248 ? 31.127  11.468  26.122 1.00 61.86 ? 248  ASN A C   1 
ATOM   1945 O O   . ASN A 1 248 ? 31.483  10.847  27.121 1.00 59.78 ? 248  ASN A O   1 
ATOM   1946 C CB  . ASN A 1 248 ? 29.289  12.377  27.540 1.00 62.53 ? 248  ASN A CB  1 
ATOM   1947 C CG  . ASN A 1 248 ? 29.082  13.824  27.933 1.00 64.81 ? 248  ASN A CG  1 
ATOM   1948 O OD1 . ASN A 1 248 ? 30.009  14.634  27.881 1.00 64.98 ? 248  ASN A OD1 1 
ATOM   1949 N ND2 . ASN A 1 248 ? 27.861  14.156  28.339 1.00 65.80 ? 248  ASN A ND2 1 
ATOM   1950 N N   . THR A 1 249 ? 31.855  11.536  25.013 1.00 63.97 ? 249  THR A N   1 
ATOM   1951 C CA  . THR A 1 249 ? 33.144  10.862  24.877 1.00 66.47 ? 249  THR A CA  1 
ATOM   1952 C C   . THR A 1 249 ? 34.074  10.996  26.087 1.00 67.38 ? 249  THR A C   1 
ATOM   1953 O O   . THR A 1 249 ? 34.473  10.002  26.691 1.00 67.17 ? 249  THR A O   1 
ATOM   1954 C CB  . THR A 1 249 ? 33.900  11.376  23.628 1.00 67.42 ? 249  THR A CB  1 
ATOM   1955 O OG1 . THR A 1 249 ? 33.611  12.767  23.435 1.00 69.36 ? 249  THR A OG1 1 
ATOM   1956 C CG2 . THR A 1 249 ? 33.492  10.598  22.388 1.00 67.68 ? 249  THR A CG2 1 
ATOM   1957 N N   . ALA A 1 250 ? 34.413  12.231  26.434 1.00 69.17 ? 250  ALA A N   1 
ATOM   1958 C CA  . ALA A 1 250 ? 35.315  12.510  27.546 1.00 70.79 ? 250  ALA A CA  1 
ATOM   1959 C C   . ALA A 1 250 ? 34.984  11.798  28.856 1.00 71.82 ? 250  ALA A C   1 
ATOM   1960 O O   . ALA A 1 250 ? 35.759  10.964  29.326 1.00 72.28 ? 250  ALA A O   1 
ATOM   1961 C CB  . ALA A 1 250 ? 35.389  14.017  27.778 1.00 69.81 ? 250  ALA A CB  1 
ATOM   1962 N N   . LYS A 1 251 ? 33.840  12.126  29.449 1.00 73.07 ? 251  LYS A N   1 
ATOM   1963 C CA  . LYS A 1 251 ? 33.459  11.515  30.718 1.00 74.50 ? 251  LYS A CA  1 
ATOM   1964 C C   . LYS A 1 251 ? 33.324  9.997   30.644 1.00 75.42 ? 251  LYS A C   1 
ATOM   1965 O O   . LYS A 1 251 ? 33.302  9.321   31.673 1.00 75.31 ? 251  LYS A O   1 
ATOM   1966 C CB  . LYS A 1 251 ? 32.161  12.133  31.242 1.00 74.68 ? 251  LYS A CB  1 
ATOM   1967 C CG  . LYS A 1 251 ? 30.940  11.842  30.407 1.00 75.07 ? 251  LYS A CG  1 
ATOM   1968 C CD  . LYS A 1 251 ? 29.720  12.546  30.973 1.00 75.61 ? 251  LYS A CD  1 
ATOM   1969 C CE  . LYS A 1 251 ? 29.887  14.056  30.947 1.00 76.05 ? 251  LYS A CE  1 
ATOM   1970 N NZ  . LYS A 1 251 ? 28.616  14.759  31.270 1.00 76.65 ? 251  LYS A NZ  1 
ATOM   1971 N N   . VAL A 1 252 ? 33.232  9.461   29.430 1.00 76.21 ? 252  VAL A N   1 
ATOM   1972 C CA  . VAL A 1 252 ? 33.131  8.014   29.247 1.00 76.80 ? 252  VAL A CA  1 
ATOM   1973 C C   . VAL A 1 252 ? 34.534  7.427   29.359 1.00 77.39 ? 252  VAL A C   1 
ATOM   1974 O O   . VAL A 1 252 ? 34.710  6.257   29.701 1.00 76.93 ? 252  VAL A O   1 
ATOM   1975 C CB  . VAL A 1 252 ? 32.550  7.651   27.856 1.00 77.22 ? 252  VAL A CB  1 
ATOM   1976 C CG1 . VAL A 1 252 ? 32.682  6.157   27.609 1.00 77.21 ? 252  VAL A CG1 1 
ATOM   1977 C CG2 . VAL A 1 252 ? 31.086  8.061   27.775 1.00 77.26 ? 252  VAL A CG2 1 
ATOM   1978 N N   . LYS A 1 253 ? 35.532  8.256   29.072 1.00 78.60 ? 253  LYS A N   1 
ATOM   1979 C CA  . LYS A 1 253 ? 36.922  7.829   29.134 1.00 79.80 ? 253  LYS A CA  1 
ATOM   1980 C C   . LYS A 1 253 ? 37.460  7.839   30.559 1.00 80.18 ? 253  LYS A C   1 
ATOM   1981 O O   . LYS A 1 253 ? 38.154  6.908   30.970 1.00 79.63 ? 253  LYS A O   1 
ATOM   1982 C CB  . LYS A 1 253 ? 37.794  8.729   28.256 1.00 80.54 ? 253  LYS A CB  1 
ATOM   1983 C CG  . LYS A 1 253 ? 39.258  8.326   28.242 1.00 81.89 ? 253  LYS A CG  1 
ATOM   1984 C CD  . LYS A 1 253 ? 40.074  9.207   27.313 1.00 83.13 ? 253  LYS A CD  1 
ATOM   1985 C CE  . LYS A 1 253 ? 41.526  8.755   27.269 1.00 83.91 ? 253  LYS A CE  1 
ATOM   1986 N NZ  . LYS A 1 253 ? 41.657  7.342   26.811 1.00 84.43 ? 253  LYS A NZ  1 
ATOM   1987 N N   . GLU A 1 254 ? 37.142  8.888   31.312 1.00 80.73 ? 254  GLU A N   1 
ATOM   1988 C CA  . GLU A 1 254 ? 37.617  8.984   32.687 1.00 82.37 ? 254  GLU A CA  1 
ATOM   1989 C C   . GLU A 1 254 ? 37.011  7.900   33.568 1.00 82.83 ? 254  GLU A C   1 
ATOM   1990 O O   . GLU A 1 254 ? 37.199  7.903   34.784 1.00 83.09 ? 254  GLU A O   1 
ATOM   1991 C CB  . GLU A 1 254 ? 37.313  10.364  33.281 1.00 83.07 ? 254  GLU A CB  1 
ATOM   1992 C CG  . GLU A 1 254 ? 35.839  10.695  33.416 1.00 84.24 ? 254  GLU A CG  1 
ATOM   1993 C CD  . GLU A 1 254 ? 35.603  11.916  34.287 1.00 84.65 ? 254  GLU A CD  1 
ATOM   1994 O OE1 . GLU A 1 254 ? 35.877  11.843  35.504 1.00 84.08 ? 254  GLU A OE1 1 
ATOM   1995 O OE2 . GLU A 1 254 ? 35.152  12.951  33.753 1.00 85.74 ? 254  GLU A OE2 1 
ATOM   1996 N N   . PHE A 1 255 ? 36.279  6.977   32.949 1.00 83.22 ? 255  PHE A N   1 
ATOM   1997 C CA  . PHE A 1 255 ? 35.662  5.869   33.669 1.00 83.60 ? 255  PHE A CA  1 
ATOM   1998 C C   . PHE A 1 255 ? 36.532  4.626   33.514 1.00 84.21 ? 255  PHE A C   1 
ATOM   1999 O O   . PHE A 1 255 ? 36.745  3.882   34.472 1.00 84.57 ? 255  PHE A O   1 
ATOM   2000 C CB  . PHE A 1 255 ? 34.260  5.577   33.122 1.00 83.49 ? 255  PHE A CB  1 
ATOM   2001 C CG  . PHE A 1 255 ? 33.646  4.313   33.669 1.00 82.96 ? 255  PHE A CG  1 
ATOM   2002 C CD1 . PHE A 1 255 ? 33.260  4.228   35.005 1.00 82.96 ? 255  PHE A CD1 1 
ATOM   2003 C CD2 . PHE A 1 255 ? 33.474  3.199   32.853 1.00 82.48 ? 255  PHE A CD2 1 
ATOM   2004 C CE1 . PHE A 1 255 ? 32.713  3.051   35.519 1.00 82.47 ? 255  PHE A CE1 1 
ATOM   2005 C CE2 . PHE A 1 255 ? 32.928  2.018   33.358 1.00 82.75 ? 255  PHE A CE2 1 
ATOM   2006 C CZ  . PHE A 1 255 ? 32.547  1.944   34.694 1.00 82.05 ? 255  PHE A CZ  1 
ATOM   2007 N N   . GLY A 1 256 ? 37.029  4.407   32.300 1.00 84.38 ? 256  GLY A N   1 
ATOM   2008 C CA  . GLY A 1 256 ? 37.868  3.251   32.039 1.00 84.29 ? 256  GLY A CA  1 
ATOM   2009 C C   . GLY A 1 256 ? 37.607  2.632   30.679 1.00 84.33 ? 256  GLY A C   1 
ATOM   2010 O O   . GLY A 1 256 ? 38.137  1.566   30.361 1.00 84.15 ? 256  GLY A O   1 
ATOM   2011 N N   . ILE A 1 257 ? 36.783  3.297   29.876 1.00 84.38 ? 257  ILE A N   1 
ATOM   2012 C CA  . ILE A 1 257 ? 36.457  2.807   28.542 1.00 84.28 ? 257  ILE A CA  1 
ATOM   2013 C C   . ILE A 1 257 ? 37.023  3.743   27.481 1.00 84.42 ? 257  ILE A C   1 
ATOM   2014 O O   . ILE A 1 257 ? 36.534  4.859   27.295 1.00 84.18 ? 257  ILE A O   1 
ATOM   2015 C CB  . ILE A 1 257 ? 34.929  2.692   28.339 1.00 84.00 ? 257  ILE A CB  1 
ATOM   2016 C CG1 . ILE A 1 257 ? 34.340  1.714   29.358 1.00 83.33 ? 257  ILE A CG1 1 
ATOM   2017 C CG2 . ILE A 1 257 ? 34.625  2.217   26.925 1.00 83.64 ? 257  ILE A CG2 1 
ATOM   2018 C CD1 . ILE A 1 257 ? 32.837  1.572   29.273 1.00 83.79 ? 257  ILE A CD1 1 
ATOM   2019 N N   . ASP A 1 258 ? 38.063  3.283   26.794 1.00 84.35 ? 258  ASP A N   1 
ATOM   2020 C CA  . ASP A 1 258 ? 38.698  4.067   25.742 1.00 84.12 ? 258  ASP A CA  1 
ATOM   2021 C C   . ASP A 1 258 ? 37.685  4.405   24.654 1.00 83.26 ? 258  ASP A C   1 
ATOM   2022 O O   . ASP A 1 258 ? 36.801  3.603   24.347 1.00 83.36 ? 258  ASP A O   1 
ATOM   2023 C CB  . ASP A 1 258 ? 39.880  3.288   25.153 1.00 85.30 ? 258  ASP A CB  1 
ATOM   2024 C CG  . ASP A 1 258 ? 39.863  1.816   25.541 1.00 86.43 ? 258  ASP A CG  1 
ATOM   2025 O OD1 . ASP A 1 258 ? 40.938  1.285   25.892 1.00 86.96 ? 258  ASP A OD1 1 
ATOM   2026 O OD2 . ASP A 1 258 ? 38.783  1.189   25.490 1.00 86.76 ? 258  ASP A OD2 1 
ATOM   2027 N N   . PRO A 1 259 ? 37.801  5.601   24.053 1.00 82.10 ? 259  PRO A N   1 
ATOM   2028 C CA  . PRO A 1 259 ? 36.871  6.019   22.998 1.00 80.86 ? 259  PRO A CA  1 
ATOM   2029 C C   . PRO A 1 259 ? 36.779  4.985   21.885 1.00 79.37 ? 259  PRO A C   1 
ATOM   2030 O O   . PRO A 1 259 ? 35.896  5.047   21.030 1.00 79.72 ? 259  PRO A O   1 
ATOM   2031 C CB  . PRO A 1 259 ? 37.463  7.343   22.521 1.00 81.61 ? 259  PRO A CB  1 
ATOM   2032 C CG  . PRO A 1 259 ? 38.933  7.147   22.743 1.00 82.01 ? 259  PRO A CG  1 
ATOM   2033 C CD  . PRO A 1 259 ? 38.958  6.511   24.115 1.00 82.02 ? 259  PRO A CD  1 
ATOM   2034 N N   . GLN A 1 260 ? 37.704  4.033   21.911 1.00 77.13 ? 260  GLN A N   1 
ATOM   2035 C CA  . GLN A 1 260 ? 37.751  2.968   20.924 1.00 75.08 ? 260  GLN A CA  1 
ATOM   2036 C C   . GLN A 1 260 ? 36.475  2.141   21.033 1.00 73.07 ? 260  GLN A C   1 
ATOM   2037 O O   . GLN A 1 260 ? 35.824  1.844   20.033 1.00 72.90 ? 260  GLN A O   1 
ATOM   2038 C CB  . GLN A 1 260 ? 38.956  2.068   21.192 1.00 76.60 ? 260  GLN A CB  1 
ATOM   2039 C CG  . GLN A 1 260 ? 39.372  1.220   20.012 1.00 78.52 ? 260  GLN A CG  1 
ATOM   2040 C CD  . GLN A 1 260 ? 40.232  1.991   19.034 1.00 80.17 ? 260  GLN A CD  1 
ATOM   2041 O OE1 . GLN A 1 260 ? 39.838  3.047   18.540 1.00 80.98 ? 260  GLN A OE1 1 
ATOM   2042 N NE2 . GLN A 1 260 ? 41.420  1.466   18.752 1.00 80.98 ? 260  GLN A NE2 1 
ATOM   2043 N N   . ASN A 1 261 ? 36.126  1.776   22.263 1.00 70.25 ? 261  ASN A N   1 
ATOM   2044 C CA  . ASN A 1 261 ? 34.940  0.971   22.515 1.00 67.65 ? 261  ASN A CA  1 
ATOM   2045 C C   . ASN A 1 261 ? 33.706  1.811   22.827 1.00 66.08 ? 261  ASN A C   1 
ATOM   2046 O O   . ASN A 1 261 ? 32.830  1.382   23.579 1.00 65.75 ? 261  ASN A O   1 
ATOM   2047 C CB  . ASN A 1 261 ? 35.208  -0.001  23.666 1.00 67.83 ? 261  ASN A CB  1 
ATOM   2048 C CG  . ASN A 1 261 ? 36.370  -0.933  23.379 1.00 68.32 ? 261  ASN A CG  1 
ATOM   2049 O OD1 . ASN A 1 261 ? 36.357  -1.673  22.397 1.00 68.46 ? 261  ASN A OD1 1 
ATOM   2050 N ND2 . ASN A 1 261 ? 37.383  -0.900  24.237 1.00 69.45 ? 261  ASN A ND2 1 
ATOM   2051 N N   . MET A 1 262 ? 33.634  3.006   22.250 1.00 63.45 ? 262  MET A N   1 
ATOM   2052 C CA  . MET A 1 262 ? 32.483  3.869   22.479 1.00 62.17 ? 262  MET A CA  1 
ATOM   2053 C C   . MET A 1 262 ? 31.649  4.033   21.215 1.00 60.66 ? 262  MET A C   1 
ATOM   2054 O O   . MET A 1 262 ? 32.153  4.457   20.175 1.00 60.42 ? 262  MET A O   1 
ATOM   2055 C CB  . MET A 1 262 ? 32.919  5.248   22.969 1.00 63.32 ? 262  MET A CB  1 
ATOM   2056 C CG  . MET A 1 262 ? 31.751  6.096   23.443 1.00 64.06 ? 262  MET A CG  1 
ATOM   2057 S SD  . MET A 1 262 ? 32.191  7.795   23.817 1.00 66.91 ? 262  MET A SD  1 
ATOM   2058 C CE  . MET A 1 262 ? 30.950  8.677   22.872 1.00 66.12 ? 262  MET A CE  1 
ATOM   2059 N N   . PHE A 1 263 ? 30.370  3.689   21.319 1.00 57.65 ? 263  PHE A N   1 
ATOM   2060 C CA  . PHE A 1 263 ? 29.440  3.798   20.205 1.00 55.66 ? 263  PHE A CA  1 
ATOM   2061 C C   . PHE A 1 263 ? 28.512  4.967   20.524 1.00 55.82 ? 263  PHE A C   1 
ATOM   2062 O O   . PHE A 1 263 ? 27.628  4.867   21.382 1.00 56.04 ? 263  PHE A O   1 
ATOM   2063 C CB  . PHE A 1 263 ? 28.635  2.505   20.066 1.00 53.58 ? 263  PHE A CB  1 
ATOM   2064 C CG  . PHE A 1 263 ? 29.516  1.272   19.917 1.00 51.44 ? 263  PHE A CG  1 
ATOM   2065 C CD1 . PHE A 1 263 ? 30.134  0.717   21.042 1.00 50.76 ? 263  PHE A CD1 1 
ATOM   2066 C CD2 . PHE A 1 263 ? 29.702  0.701   18.656 1.00 50.03 ? 263  PHE A CD2 1 
ATOM   2067 C CE1 . PHE A 1 263 ? 30.947  -0.411  20.903 1.00 50.78 ? 263  PHE A CE1 1 
ATOM   2068 C CE2 . PHE A 1 263 ? 30.517  -0.427  18.517 1.00 50.43 ? 263  PHE A CE2 1 
ATOM   2069 C CZ  . PHE A 1 263 ? 31.140  -0.983  19.640 1.00 49.13 ? 263  PHE A CZ  1 
ATOM   2070 N N   . GLU A 1 264 ? 28.733  6.061   19.832 1.00 55.08 ? 264  GLU A N   1 
ATOM   2071 C CA  . GLU A 1 264 ? 28.003  7.304   20.104 1.00 55.21 ? 264  GLU A CA  1 
ATOM   2072 C C   . GLU A 1 264 ? 26.746  7.484   19.245 1.00 53.18 ? 264  GLU A C   1 
ATOM   2073 O O   . GLU A 1 264 ? 26.579  6.831   18.204 1.00 53.56 ? 264  GLU A O   1 
ATOM   2074 C CB  . GLU A 1 264 ? 28.903  8.508   19.821 1.00 58.12 ? 264  GLU A CB  1 
ATOM   2075 C CG  . GLU A 1 264 ? 29.310  8.625   18.350 1.00 62.55 ? 264  GLU A CG  1 
ATOM   2076 C CD  . GLU A 1 264 ? 28.975  9.991   17.746 1.00 66.10 ? 264  GLU A CD  1 
ATOM   2077 O OE1 . GLU A 1 264 ? 27.792  10.484  17.889 1.00 69.06 ? 264  GLU A OE1 1 
ATOM   2078 O OE2 . GLU A 1 264 ? 29.874  10.649  17.097 1.00 66.94 ? 264  GLU A OE2 1 
ATOM   2079 N N   . PHE A 1 265 ? 25.924  8.380   19.776 1.00 52.30 ? 265  PHE A N   1 
ATOM   2080 C CA  . PHE A 1 265 ? 24.703  8.887   19.133 1.00 51.76 ? 265  PHE A CA  1 
ATOM   2081 C C   . PHE A 1 265 ? 24.718  10.405  19.343 1.00 52.45 ? 265  PHE A C   1 
ATOM   2082 O O   . PHE A 1 265 ? 25.716  10.977  19.800 1.00 53.01 ? 265  PHE A O   1 
ATOM   2083 C CB  . PHE A 1 265 ? 23.430  8.188   19.659 1.00 51.43 ? 265  PHE A CB  1 
ATOM   2084 C CG  . PHE A 1 265 ? 23.300  8.036   21.183 1.00 50.55 ? 265  PHE A CG  1 
ATOM   2085 C CD1 . PHE A 1 265 ? 22.161  8.532   21.831 1.00 50.15 ? 265  PHE A CD1 1 
ATOM   2086 C CD2 . PHE A 1 265 ? 24.292  7.385   21.927 1.00 50.73 ? 265  PHE A CD2 1 
ATOM   2087 C CE1 . PHE A 1 265 ? 22.009  8.371   23.212 1.00 49.08 ? 265  PHE A CE1 1 
ATOM   2088 C CE2 . PHE A 1 265 ? 24.138  7.219   23.309 1.00 50.39 ? 265  PHE A CE2 1 
ATOM   2089 C CZ  . PHE A 1 265 ? 22.995  7.711   23.951 1.00 51.04 ? 265  PHE A CZ  1 
ATOM   2090 N N   . TRP A 1 266 ? 23.636  11.083  19.027 1.00 51.76 ? 266  TRP A N   1 
ATOM   2091 C CA  . TRP A 1 266 ? 23.647  12.554  19.113 1.00 51.05 ? 266  TRP A CA  1 
ATOM   2092 C C   . TRP A 1 266 ? 22.473  13.087  19.923 1.00 50.92 ? 266  TRP A C   1 
ATOM   2093 O O   . TRP A 1 266 ? 21.570  12.335  20.314 1.00 49.57 ? 266  TRP A O   1 
ATOM   2094 C CB  . TRP A 1 266 ? 23.685  13.098  17.699 1.00 51.43 ? 266  TRP A CB  1 
ATOM   2095 C CG  . TRP A 1 266 ? 24.873  12.494  16.962 1.00 52.21 ? 266  TRP A CG  1 
ATOM   2096 C CD1 . TRP A 1 266 ? 26.077  13.048  16.795 1.00 52.65 ? 266  TRP A CD1 1 
ATOM   2097 C CD2 . TRP A 1 266 ? 24.884  11.215  16.346 1.00 52.51 ? 266  TRP A CD2 1 
ATOM   2098 N NE1 . TRP A 1 266 ? 26.881  12.096  16.092 1.00 52.15 ? 266  TRP A NE1 1 
ATOM   2099 C CE2 . TRP A 1 266 ? 26.166  11.024  15.850 1.00 52.70 ? 266  TRP A CE2 1 
ATOM   2100 C CE3 . TRP A 1 266 ? 23.930  10.204  16.178 1.00 53.06 ? 266  TRP A CE3 1 
ATOM   2101 C CZ2 . TRP A 1 266 ? 26.573  9.847   15.211 1.00 53.01 ? 266  TRP A CZ2 1 
ATOM   2102 C CZ3 . TRP A 1 266 ? 24.343  9.028   15.516 1.00 53.47 ? 266  TRP A CZ3 1 
ATOM   2103 C CH2 . TRP A 1 266 ? 25.604  8.858   15.059 1.00 54.41 ? 266  TRP A CH2 1 
ATOM   2104 N N   . ASP A 1 267 ? 22.538  14.392  20.152 1.00 50.99 ? 267  ASP A N   1 
ATOM   2105 C CA  . ASP A 1 267 ? 21.549  15.088  20.977 1.00 50.45 ? 267  ASP A CA  1 
ATOM   2106 C C   . ASP A 1 267 ? 20.160  15.050  20.351 1.00 48.57 ? 267  ASP A C   1 
ATOM   2107 O O   . ASP A 1 267 ? 19.167  15.105  21.072 1.00 48.39 ? 267  ASP A O   1 
ATOM   2108 C CB  . ASP A 1 267 ? 21.949  16.542  21.249 1.00 54.90 ? 267  ASP A CB  1 
ATOM   2109 C CG  . ASP A 1 267 ? 22.981  17.098  20.280 1.00 58.55 ? 267  ASP A CG  1 
ATOM   2110 O OD1 . ASP A 1 267 ? 22.814  16.958  19.012 1.00 60.51 ? 267  ASP A OD1 1 
ATOM   2111 O OD2 . ASP A 1 267 ? 24.018  17.713  20.738 1.00 62.45 ? 267  ASP A OD2 1 
ATOM   2112 N N   . TRP A 1 268 ? 20.076  14.954  19.025 1.00 46.85 ? 268  TRP A N   1 
ATOM   2113 C CA  . TRP A 1 268 ? 18.767  14.882  18.378 1.00 47.27 ? 268  TRP A CA  1 
ATOM   2114 C C   . TRP A 1 268 ? 18.186  13.472  18.479 1.00 46.63 ? 268  TRP A C   1 
ATOM   2115 O O   . TRP A 1 268 ? 17.234  13.120  17.773 1.00 46.39 ? 268  TRP A O   1 
ATOM   2116 C CB  . TRP A 1 268 ? 18.822  15.328  16.904 1.00 46.60 ? 268  TRP A CB  1 
ATOM   2117 C CG  . TRP A 1 268 ? 20.072  14.982  16.146 1.00 46.80 ? 268  TRP A CG  1 
ATOM   2118 C CD1 . TRP A 1 268 ? 21.138  15.808  15.903 1.00 47.46 ? 268  TRP A CD1 1 
ATOM   2119 C CD2 . TRP A 1 268 ? 20.364  13.745  15.479 1.00 46.42 ? 268  TRP A CD2 1 
ATOM   2120 N NE1 . TRP A 1 268 ? 22.069  15.164  15.120 1.00 46.50 ? 268  TRP A NE1 1 
ATOM   2121 C CE2 . TRP A 1 268 ? 21.621  13.898  14.845 1.00 46.59 ? 268  TRP A CE2 1 
ATOM   2122 C CE3 . TRP A 1 268 ? 19.686  12.525  15.352 1.00 43.51 ? 268  TRP A CE3 1 
ATOM   2123 C CZ2 . TRP A 1 268 ? 22.214  12.873  14.097 1.00 45.41 ? 268  TRP A CZ2 1 
ATOM   2124 C CZ3 . TRP A 1 268 ? 20.274  11.507  14.607 1.00 46.07 ? 268  TRP A CZ3 1 
ATOM   2125 C CH2 . TRP A 1 268 ? 21.529  11.689  13.987 1.00 43.88 ? 268  TRP A CH2 1 
ATOM   2126 N N   . VAL A 1 269 ? 18.777  12.668  19.359 1.00 45.76 ? 269  VAL A N   1 
ATOM   2127 C CA  . VAL A 1 269 ? 18.316  11.304  19.606 1.00 45.41 ? 269  VAL A CA  1 
ATOM   2128 C C   . VAL A 1 269 ? 17.723  11.242  21.012 1.00 43.64 ? 269  VAL A C   1 
ATOM   2129 O O   . VAL A 1 269 ? 18.448  11.072  21.989 1.00 42.77 ? 269  VAL A O   1 
ATOM   2130 C CB  . VAL A 1 269 ? 19.476  10.284  19.512 1.00 46.26 ? 269  VAL A CB  1 
ATOM   2131 C CG1 . VAL A 1 269 ? 19.004  8.907   19.981 1.00 46.19 ? 269  VAL A CG1 1 
ATOM   2132 C CG2 . VAL A 1 269 ? 19.981  10.203  18.076 1.00 45.67 ? 269  VAL A CG2 1 
ATOM   2133 N N   . GLY A 1 270 ? 16.407  11.411  21.109 1.00 43.66 ? 270  GLY A N   1 
ATOM   2134 C CA  . GLY A 1 270 ? 15.746  11.355  22.402 1.00 41.38 ? 270  GLY A CA  1 
ATOM   2135 C C   . GLY A 1 270 ? 15.912  9.977   23.013 1.00 39.84 ? 270  GLY A C   1 
ATOM   2136 O O   . GLY A 1 270 ? 15.886  8.974   22.296 1.00 40.36 ? 270  GLY A O   1 
ATOM   2137 N N   . GLY A 1 271 ? 16.089  9.916   24.330 1.00 38.75 ? 271  GLY A N   1 
ATOM   2138 C CA  . GLY A 1 271 ? 16.270  8.628   24.981 1.00 36.72 ? 271  GLY A CA  1 
ATOM   2139 C C   . GLY A 1 271 ? 15.140  7.654   24.701 1.00 36.91 ? 271  GLY A C   1 
ATOM   2140 O O   . GLY A 1 271 ? 15.377  6.485   24.381 1.00 36.48 ? 271  GLY A O   1 
ATOM   2141 N N   . ARG A 1 272 ? 13.907  8.137   24.822 1.00 37.00 ? 272  ARG A N   1 
ATOM   2142 C CA  . ARG A 1 272 ? 12.730  7.307   24.593 1.00 37.81 ? 272  ARG A CA  1 
ATOM   2143 C C   . ARG A 1 272 ? 12.516  7.001   23.101 1.00 37.93 ? 272  ARG A C   1 
ATOM   2144 O O   . ARG A 1 272 ? 11.515  6.379   22.714 1.00 37.01 ? 272  ARG A O   1 
ATOM   2145 C CB  . ARG A 1 272 ? 11.477  7.990   25.170 1.00 38.25 ? 272  ARG A CB  1 
ATOM   2146 C CG  . ARG A 1 272 ? 11.302  9.464   24.817 1.00 38.81 ? 272  ARG A CG  1 
ATOM   2147 C CD  . ARG A 1 272 ? 10.027  10.035  25.450 1.00 36.75 ? 272  ARG A CD  1 
ATOM   2148 N NE  . ARG A 1 272 ? 9.793   11.450  25.149 1.00 35.18 ? 272  ARG A NE  1 
ATOM   2149 C CZ  . ARG A 1 272 ? 10.521  12.453  25.650 1.00 35.20 ? 272  ARG A CZ  1 
ATOM   2150 N NH1 . ARG A 1 272 ? 11.547  12.214  26.477 1.00 30.21 ? 272  ARG A NH1 1 
ATOM   2151 N NH2 . ARG A 1 272 ? 10.298  13.746  25.380 1.00 34.16 ? 272  ARG A NH2 1 
ATOM   2152 N N   . TYR A 1 273 ? 13.466  7.434   22.299 1.00 38.13 ? 273  TYR A N   1 
ATOM   2153 C CA  . TYR A 1 273 ? 13.449  7.210   20.840 1.00 39.09 ? 273  TYR A CA  1 
ATOM   2154 C C   . TYR A 1 273 ? 14.846  6.797   20.357 1.00 38.98 ? 273  TYR A C   1 
ATOM   2155 O O   . TYR A 1 273 ? 15.242  7.092   19.222 1.00 39.14 ? 273  TYR A O   1 
ATOM   2156 C CB  . TYR A 1 273 ? 13.118  8.516   20.086 1.00 38.03 ? 273  TYR A CB  1 
ATOM   2157 C CG  . TYR A 1 273 ? 11.722  9.097   20.359 1.00 35.28 ? 273  TYR A CG  1 
ATOM   2158 C CD1 . TYR A 1 273 ? 11.573  10.189  21.227 1.00 35.44 ? 273  TYR A CD1 1 
ATOM   2159 C CD2 . TYR A 1 273 ? 10.595  8.553   19.729 1.00 35.95 ? 273  TYR A CD2 1 
ATOM   2160 C CE1 . TYR A 1 273 ? 10.301  10.730  21.464 1.00 34.41 ? 273  TYR A CE1 1 
ATOM   2161 C CE2 . TYR A 1 273 ? 9.325   9.094   19.966 1.00 34.03 ? 273  TYR A CE2 1 
ATOM   2162 C CZ  . TYR A 1 273 ? 9.178   10.183  20.834 1.00 35.43 ? 273  TYR A CZ  1 
ATOM   2163 O OH  . TYR A 1 273 ? 7.944   10.708  21.064 1.00 35.24 ? 273  TYR A OH  1 
ATOM   2164 N N   . SER A 1 274 ? 15.580  6.100   21.218 1.00 38.94 ? 274  SER A N   1 
ATOM   2165 C CA  . SER A 1 274 ? 16.998  5.787   20.935 1.00 37.91 ? 274  SER A CA  1 
ATOM   2166 C C   . SER A 1 274 ? 17.328  4.305   20.625 1.00 39.55 ? 274  SER A C   1 
ATOM   2167 O O   . SER A 1 274 ? 18.446  3.975   20.212 1.00 39.89 ? 274  SER A O   1 
ATOM   2168 C CB  . SER A 1 274 ? 17.870  6.158   22.137 1.00 37.71 ? 274  SER A CB  1 
ATOM   2169 O OG  . SER A 1 274 ? 17.477  5.409   23.278 1.00 36.24 ? 274  SER A OG  1 
ATOM   2170 N N   . LEU A 1 275 ? 16.405  3.379   20.799 1.00 39.18 ? 275  LEU A N   1 
ATOM   2171 C CA  . LEU A 1 275 ? 16.736  1.945   20.560 1.00 37.34 ? 275  LEU A CA  1 
ATOM   2172 C C   . LEU A 1 275 ? 17.219  1.724   19.130 1.00 38.31 ? 275  LEU A C   1 
ATOM   2173 O O   . LEU A 1 275 ? 17.833  0.691   18.824 1.00 37.76 ? 275  LEU A O   1 
ATOM   2174 C CB  . LEU A 1 275 ? 15.537  1.040   20.881 1.00 36.48 ? 275  LEU A CB  1 
ATOM   2175 C CG  . LEU A 1 275 ? 14.360  1.177   19.917 1.00 37.15 ? 275  LEU A CG  1 
ATOM   2176 C CD1 . LEU A 1 275 ? 14.488  0.281   18.684 1.00 37.08 ? 275  LEU A CD1 1 
ATOM   2177 C CD2 . LEU A 1 275 ? 13.022  0.798   20.563 1.00 36.39 ? 275  LEU A CD2 1 
ATOM   2178 N N   . TRP A 1 276 ? 16.945  2.694   18.260 1.00 38.58 ? 276  TRP A N   1 
ATOM   2179 C CA  . TRP A 1 276 ? 17.343  2.610   16.854 1.00 38.53 ? 276  TRP A CA  1 
ATOM   2180 C C   . TRP A 1 276 ? 18.790  3.054   16.642 1.00 38.67 ? 276  TRP A C   1 
ATOM   2181 O O   . TRP A 1 276 ? 19.348  2.877   15.560 1.00 38.48 ? 276  TRP A O   1 
ATOM   2182 C CB  . TRP A 1 276 ? 16.433  3.486   15.990 1.00 37.43 ? 276  TRP A CB  1 
ATOM   2183 C CG  . TRP A 1 276 ? 14.990  3.447   16.375 1.00 37.28 ? 276  TRP A CG  1 
ATOM   2184 C CD1 . TRP A 1 276 ? 14.324  4.347   17.162 1.00 36.96 ? 276  TRP A CD1 1 
ATOM   2185 C CD2 . TRP A 1 276 ? 14.028  2.466   15.983 1.00 36.78 ? 276  TRP A CD2 1 
ATOM   2186 N NE1 . TRP A 1 276 ? 13.004  3.987   17.278 1.00 36.51 ? 276  TRP A NE1 1 
ATOM   2187 C CE2 . TRP A 1 276 ? 12.793  2.835   16.566 1.00 36.18 ? 276  TRP A CE2 1 
ATOM   2188 C CE3 . TRP A 1 276 ? 14.086  1.308   15.195 1.00 35.25 ? 276  TRP A CE3 1 
ATOM   2189 C CZ2 . TRP A 1 276 ? 11.625  2.085   16.386 1.00 34.52 ? 276  TRP A CZ2 1 
ATOM   2190 C CZ3 . TRP A 1 276 ? 12.924  0.564   15.016 1.00 35.60 ? 276  TRP A CZ3 1 
ATOM   2191 C CH2 . TRP A 1 276 ? 11.710  0.957   15.611 1.00 35.83 ? 276  TRP A CH2 1 
ATOM   2192 N N   . SER A 1 277 ? 19.385  3.640   17.677 1.00 39.28 ? 277  SER A N   1 
ATOM   2193 C CA  . SER A 1 277 ? 20.760  4.129   17.617 1.00 38.75 ? 277  SER A CA  1 
ATOM   2194 C C   . SER A 1 277 ? 21.721  3.131   18.235 1.00 38.40 ? 277  SER A C   1 
ATOM   2195 O O   . SER A 1 277 ? 21.432  1.938   18.304 1.00 39.18 ? 277  SER A O   1 
ATOM   2196 C CB  . SER A 1 277 ? 20.872  5.446   18.375 1.00 38.93 ? 277  SER A CB  1 
ATOM   2197 O OG  . SER A 1 277 ? 20.628  5.232   19.756 1.00 40.42 ? 277  SER A OG  1 
ATOM   2198 N N   . ALA A 1 278 ? 22.869  3.630   18.688 1.00 39.38 ? 278  ALA A N   1 
ATOM   2199 C CA  . ALA A 1 278 ? 23.872  2.783   19.325 1.00 40.09 ? 278  ALA A CA  1 
ATOM   2200 C C   . ALA A 1 278 ? 23.254  2.099   20.546 1.00 40.30 ? 278  ALA A C   1 
ATOM   2201 O O   . ALA A 1 278 ? 23.680  1.017   20.948 1.00 40.31 ? 278  ALA A O   1 
ATOM   2202 C CB  . ALA A 1 278 ? 25.072  3.617   19.746 1.00 41.31 ? 278  ALA A CB  1 
ATOM   2203 N N   . ILE A 1 279 ? 22.244  2.739   21.127 1.00 39.72 ? 279  ILE A N   1 
ATOM   2204 C CA  . ILE A 1 279 ? 21.563  2.188   22.295 1.00 39.65 ? 279  ILE A CA  1 
ATOM   2205 C C   . ILE A 1 279 ? 21.058  0.778   21.989 1.00 39.22 ? 279  ILE A C   1 
ATOM   2206 O O   . ILE A 1 279 ? 20.907  -0.047  22.889 1.00 39.82 ? 279  ILE A O   1 
ATOM   2207 C CB  . ILE A 1 279 ? 20.376  3.099   22.723 1.00 39.78 ? 279  ILE A CB  1 
ATOM   2208 C CG1 . ILE A 1 279 ? 20.918  4.411   23.302 1.00 37.82 ? 279  ILE A CG1 1 
ATOM   2209 C CG2 . ILE A 1 279 ? 19.504  2.398   23.763 1.00 40.16 ? 279  ILE A CG2 1 
ATOM   2210 C CD1 . ILE A 1 279 ? 21.760  4.226   24.552 1.00 38.74 ? 279  ILE A CD1 1 
ATOM   2211 N N   . GLY A 1 280 ? 20.828  0.501   20.709 1.00 39.47 ? 280  GLY A N   1 
ATOM   2212 C CA  . GLY A 1 280 ? 20.343  -0.809  20.310 1.00 39.05 ? 280  GLY A CA  1 
ATOM   2213 C C   . GLY A 1 280 ? 21.399  -1.895  20.188 1.00 38.52 ? 280  GLY A C   1 
ATOM   2214 O O   . GLY A 1 280 ? 21.094  -3.000  19.746 1.00 38.72 ? 280  GLY A O   1 
ATOM   2215 N N   . LEU A 1 281 ? 22.635  -1.603  20.586 1.00 39.11 ? 281  LEU A N   1 
ATOM   2216 C CA  . LEU A 1 281 ? 23.713  -2.590  20.488 1.00 38.40 ? 281  LEU A CA  1 
ATOM   2217 C C   . LEU A 1 281 ? 23.371  -3.953  21.091 1.00 39.35 ? 281  LEU A C   1 
ATOM   2218 O O   . LEU A 1 281 ? 23.713  -4.988  20.516 1.00 38.11 ? 281  LEU A O   1 
ATOM   2219 C CB  . LEU A 1 281 ? 24.992  -2.063  21.147 1.00 39.16 ? 281  LEU A CB  1 
ATOM   2220 C CG  . LEU A 1 281 ? 26.219  -2.962  20.965 1.00 40.28 ? 281  LEU A CG  1 
ATOM   2221 C CD1 . LEU A 1 281 ? 26.502  -3.141  19.472 1.00 40.60 ? 281  LEU A CD1 1 
ATOM   2222 C CD2 . LEU A 1 281 ? 27.424  -2.348  21.668 1.00 39.96 ? 281  LEU A CD2 1 
ATOM   2223 N N   . SER A 1 282 ? 22.723  -3.964  22.254 1.00 38.24 ? 282  SER A N   1 
ATOM   2224 C CA  . SER A 1 282 ? 22.365  -5.231  22.887 1.00 38.29 ? 282  SER A CA  1 
ATOM   2225 C C   . SER A 1 282 ? 21.396  -6.007  22.001 1.00 37.68 ? 282  SER A C   1 
ATOM   2226 O O   . SER A 1 282 ? 21.351  -7.240  22.044 1.00 38.79 ? 282  SER A O   1 
ATOM   2227 C CB  . SER A 1 282 ? 21.740  -4.992  24.267 1.00 39.55 ? 282  SER A CB  1 
ATOM   2228 O OG  . SER A 1 282 ? 20.565  -4.209  24.169 1.00 40.02 ? 282  SER A OG  1 
ATOM   2229 N N   . ILE A 1 283 ? 20.619  -5.281  21.201 1.00 37.96 ? 283  ILE A N   1 
ATOM   2230 C CA  . ILE A 1 283 ? 19.669  -5.908  20.287 1.00 38.70 ? 283  ILE A CA  1 
ATOM   2231 C C   . ILE A 1 283 ? 20.448  -6.594  19.166 1.00 38.81 ? 283  ILE A C   1 
ATOM   2232 O O   . ILE A 1 283 ? 20.221  -7.769  18.866 1.00 39.74 ? 283  ILE A O   1 
ATOM   2233 C CB  . ILE A 1 283 ? 18.711  -4.870  19.659 1.00 37.36 ? 283  ILE A CB  1 
ATOM   2234 C CG1 . ILE A 1 283 ? 17.905  -4.174  20.757 1.00 37.95 ? 283  ILE A CG1 1 
ATOM   2235 C CG2 . ILE A 1 283 ? 17.762  -5.557  18.681 1.00 36.95 ? 283  ILE A CG2 1 
ATOM   2236 C CD1 . ILE A 1 283 ? 16.931  -3.136  20.240 1.00 38.70 ? 283  ILE A CD1 1 
ATOM   2237 N N   . ALA A 1 284 ? 21.366  -5.857  18.549 1.00 39.87 ? 284  ALA A N   1 
ATOM   2238 C CA  . ALA A 1 284 ? 22.181  -6.408  17.469 1.00 41.41 ? 284  ALA A CA  1 
ATOM   2239 C C   . ALA A 1 284 ? 22.981  -7.613  17.974 1.00 42.45 ? 284  ALA A C   1 
ATOM   2240 O O   . ALA A 1 284 ? 23.118  -8.614  17.279 1.00 42.96 ? 284  ALA A O   1 
ATOM   2241 C CB  . ALA A 1 284 ? 23.123  -5.340  16.925 1.00 42.71 ? 284  ALA A CB  1 
ATOM   2242 N N   . LEU A 1 285 ? 23.496  -7.513  19.194 1.00 43.44 ? 285  LEU A N   1 
ATOM   2243 C CA  . LEU A 1 285 ? 24.278  -8.596  19.786 1.00 44.11 ? 285  LEU A CA  1 
ATOM   2244 C C   . LEU A 1 285 ? 23.461  -9.857  20.036 1.00 43.87 ? 285  LEU A C   1 
ATOM   2245 O O   . LEU A 1 285 ? 23.983  -10.972 19.971 1.00 44.44 ? 285  LEU A O   1 
ATOM   2246 C CB  . LEU A 1 285 ? 24.895  -8.127  21.108 1.00 44.73 ? 285  LEU A CB  1 
ATOM   2247 C CG  . LEU A 1 285 ? 26.229  -7.378  21.008 1.00 45.18 ? 285  LEU A CG  1 
ATOM   2248 C CD1 . LEU A 1 285 ? 26.487  -6.560  22.264 1.00 43.20 ? 285  LEU A CD1 1 
ATOM   2249 C CD2 . LEU A 1 285 ? 27.334  -8.393  20.783 1.00 44.38 ? 285  LEU A CD2 1 
ATOM   2250 N N   . HIS A 1 286 ? 22.175  -9.679  20.312 1.00 43.00 ? 286  HIS A N   1 
ATOM   2251 C CA  . HIS A 1 286 ? 21.296  -10.802 20.616 1.00 42.52 ? 286  HIS A CA  1 
ATOM   2252 C C   . HIS A 1 286 ? 20.669  -11.493 19.406 1.00 42.49 ? 286  HIS A C   1 
ATOM   2253 O O   . HIS A 1 286 ? 20.552  -12.724 19.377 1.00 43.07 ? 286  HIS A O   1 
ATOM   2254 C CB  . HIS A 1 286 ? 20.193  -10.325 21.571 1.00 42.00 ? 286  HIS A CB  1 
ATOM   2255 C CG  . HIS A 1 286 ? 19.397  -11.433 22.188 1.00 43.41 ? 286  HIS A CG  1 
ATOM   2256 N ND1 . HIS A 1 286 ? 19.983  -12.507 22.823 1.00 43.95 ? 286  HIS A ND1 1 
ATOM   2257 C CD2 . HIS A 1 286 ? 18.060  -11.617 22.294 1.00 42.54 ? 286  HIS A CD2 1 
ATOM   2258 C CE1 . HIS A 1 286 ? 19.041  -13.306 23.292 1.00 45.01 ? 286  HIS A CE1 1 
ATOM   2259 N NE2 . HIS A 1 286 ? 17.865  -12.788 22.985 1.00 43.14 ? 286  HIS A NE2 1 
ATOM   2260 N N   . VAL A 1 287 ? 20.266  -10.716 18.408 1.00 41.64 ? 287  VAL A N   1 
ATOM   2261 C CA  . VAL A 1 287 ? 19.625  -11.297 17.232 1.00 42.22 ? 287  VAL A CA  1 
ATOM   2262 C C   . VAL A 1 287 ? 20.433  -11.182 15.942 1.00 41.96 ? 287  VAL A C   1 
ATOM   2263 O O   . VAL A 1 287 ? 20.005  -11.665 14.894 1.00 41.41 ? 287  VAL A O   1 
ATOM   2264 C CB  . VAL A 1 287 ? 18.227  -10.667 17.009 1.00 41.22 ? 287  VAL A CB  1 
ATOM   2265 C CG1 . VAL A 1 287 ? 17.378  -10.842 18.271 1.00 41.57 ? 287  VAL A CG1 1 
ATOM   2266 C CG2 . VAL A 1 287 ? 18.364  -9.188  16.665 1.00 39.78 ? 287  VAL A CG2 1 
ATOM   2267 N N   . GLY A 1 288 ? 21.599  -10.549 16.021 1.00 43.85 ? 288  GLY A N   1 
ATOM   2268 C CA  . GLY A 1 288 ? 22.431  -10.392 14.837 1.00 45.47 ? 288  GLY A CA  1 
ATOM   2269 C C   . GLY A 1 288 ? 22.185  -9.058  14.159 1.00 46.09 ? 288  GLY A C   1 
ATOM   2270 O O   . GLY A 1 288 ? 21.135  -8.442  14.351 1.00 45.41 ? 288  GLY A O   1 
ATOM   2271 N N   . PHE A 1 289 ? 23.134  -8.611  13.343 1.00 46.07 ? 289  PHE A N   1 
ATOM   2272 C CA  . PHE A 1 289 ? 22.973  -7.321  12.686 1.00 46.13 ? 289  PHE A CA  1 
ATOM   2273 C C   . PHE A 1 289 ? 21.985  -7.298  11.521 1.00 46.15 ? 289  PHE A C   1 
ATOM   2274 O O   . PHE A 1 289 ? 21.412  -6.251  11.219 1.00 46.15 ? 289  PHE A O   1 
ATOM   2275 C CB  . PHE A 1 289 ? 24.325  -6.779  12.222 1.00 46.25 ? 289  PHE A CB  1 
ATOM   2276 C CG  . PHE A 1 289 ? 24.410  -5.284  12.272 1.00 47.21 ? 289  PHE A CG  1 
ATOM   2277 C CD1 . PHE A 1 289 ? 24.510  -4.628  13.493 1.00 48.56 ? 289  PHE A CD1 1 
ATOM   2278 C CD2 . PHE A 1 289 ? 24.319  -4.529  11.113 1.00 48.27 ? 289  PHE A CD2 1 
ATOM   2279 C CE1 . PHE A 1 289 ? 24.516  -3.235  13.561 1.00 49.51 ? 289  PHE A CE1 1 
ATOM   2280 C CE2 . PHE A 1 289 ? 24.323  -3.140  11.169 1.00 50.59 ? 289  PHE A CE2 1 
ATOM   2281 C CZ  . PHE A 1 289 ? 24.421  -2.492  12.402 1.00 49.74 ? 289  PHE A CZ  1 
ATOM   2282 N N   . ASP A 1 290 ? 21.785  -8.436  10.860 1.00 45.69 ? 290  ASP A N   1 
ATOM   2283 C CA  . ASP A 1 290 ? 20.837  -8.488  9.751  1.00 46.21 ? 290  ASP A CA  1 
ATOM   2284 C C   . ASP A 1 290 ? 19.430  -8.255  10.300 1.00 45.17 ? 290  ASP A C   1 
ATOM   2285 O O   . ASP A 1 290 ? 18.633  -7.525  9.711  1.00 45.80 ? 290  ASP A O   1 
ATOM   2286 C CB  . ASP A 1 290 ? 20.900  -9.842  9.036  1.00 48.62 ? 290  ASP A CB  1 
ATOM   2287 C CG  . ASP A 1 290 ? 22.136  -9.989  8.156  1.00 50.78 ? 290  ASP A CG  1 
ATOM   2288 O OD1 . ASP A 1 290 ? 22.995  -9.083  8.155  1.00 51.27 ? 290  ASP A OD1 1 
ATOM   2289 O OD2 . ASP A 1 290 ? 22.246  -11.022 7.463  1.00 53.74 ? 290  ASP A OD2 1 
ATOM   2290 N N   . ASN A 1 291 ? 19.132  -8.873  11.438 1.00 44.13 ? 291  ASN A N   1 
ATOM   2291 C CA  . ASN A 1 291 ? 17.824  -8.708  12.053 1.00 42.41 ? 291  ASN A CA  1 
ATOM   2292 C C   . ASN A 1 291 ? 17.635  -7.278  12.545 1.00 42.08 ? 291  ASN A C   1 
ATOM   2293 O O   . ASN A 1 291 ? 16.543  -6.715  12.444 1.00 42.41 ? 291  ASN A O   1 
ATOM   2294 C CB  . ASN A 1 291 ? 17.651  -9.702  13.199 1.00 42.07 ? 291  ASN A CB  1 
ATOM   2295 C CG  . ASN A 1 291 ? 17.334  -11.098 12.704 1.00 41.65 ? 291  ASN A CG  1 
ATOM   2296 O OD1 . ASN A 1 291 ? 16.585  -11.261 11.746 1.00 41.48 ? 291  ASN A OD1 1 
ATOM   2297 N ND2 . ASN A 1 291 ? 17.884  -12.109 13.363 1.00 44.06 ? 291  ASN A ND2 1 
ATOM   2298 N N   . PHE A 1 292 ? 18.706  -6.692  13.070 1.00 41.81 ? 292  PHE A N   1 
ATOM   2299 C CA  . PHE A 1 292 ? 18.667  -5.319  13.558 1.00 41.93 ? 292  PHE A CA  1 
ATOM   2300 C C   . PHE A 1 292 ? 18.363  -4.389  12.387 1.00 41.88 ? 292  PHE A C   1 
ATOM   2301 O O   . PHE A 1 292 ? 17.619  -3.416  12.529 1.00 40.95 ? 292  PHE A O   1 
ATOM   2302 C CB  . PHE A 1 292 ? 20.014  -4.939  14.187 1.00 41.61 ? 292  PHE A CB  1 
ATOM   2303 C CG  . PHE A 1 292 ? 20.008  -3.602  14.872 1.00 42.55 ? 292  PHE A CG  1 
ATOM   2304 C CD1 . PHE A 1 292 ? 19.223  -3.387  16.002 1.00 40.95 ? 292  PHE A CD1 1 
ATOM   2305 C CD2 . PHE A 1 292 ? 20.779  -2.551  14.381 1.00 44.02 ? 292  PHE A CD2 1 
ATOM   2306 C CE1 . PHE A 1 292 ? 19.206  -2.147  16.632 1.00 42.22 ? 292  PHE A CE1 1 
ATOM   2307 C CE2 . PHE A 1 292 ? 20.770  -1.304  15.005 1.00 43.56 ? 292  PHE A CE2 1 
ATOM   2308 C CZ  . PHE A 1 292 ? 19.981  -1.101  16.133 1.00 43.63 ? 292  PHE A CZ  1 
ATOM   2309 N N   . GLU A 1 293 ? 18.941  -4.691  11.223 1.00 42.41 ? 293  GLU A N   1 
ATOM   2310 C CA  . GLU A 1 293 ? 18.708  -3.870  10.039 1.00 41.71 ? 293  GLU A CA  1 
ATOM   2311 C C   . GLU A 1 293 ? 17.268  -4.051  9.584  1.00 41.31 ? 293  GLU A C   1 
ATOM   2312 O O   . GLU A 1 293 ? 16.655  -3.125  9.061  1.00 40.82 ? 293  GLU A O   1 
ATOM   2313 C CB  . GLU A 1 293 ? 19.689  -4.244  8.916  1.00 43.19 ? 293  GLU A CB  1 
ATOM   2314 C CG  . GLU A 1 293 ? 21.151  -4.009  9.288  1.00 46.57 ? 293  GLU A CG  1 
ATOM   2315 C CD  . GLU A 1 293 ? 22.100  -4.109  8.102  1.00 49.62 ? 293  GLU A CD  1 
ATOM   2316 O OE1 . GLU A 1 293 ? 22.066  -5.137  7.387  1.00 48.58 ? 293  GLU A OE1 1 
ATOM   2317 O OE2 . GLU A 1 293 ? 22.885  -3.156  7.894  1.00 50.06 ? 293  GLU A OE2 1 
ATOM   2318 N N   . GLN A 1 294 ? 16.726  -5.249  9.793  1.00 41.36 ? 294  GLN A N   1 
ATOM   2319 C CA  . GLN A 1 294 ? 15.341  -5.523  9.434  1.00 42.47 ? 294  GLN A CA  1 
ATOM   2320 C C   . GLN A 1 294 ? 14.445  -4.664  10.324 1.00 41.04 ? 294  GLN A C   1 
ATOM   2321 O O   . GLN A 1 294 ? 13.444  -4.114  9.872  1.00 40.64 ? 294  GLN A O   1 
ATOM   2322 C CB  . GLN A 1 294 ? 15.014  -7.002  9.648  1.00 44.16 ? 294  GLN A CB  1 
ATOM   2323 C CG  . GLN A 1 294 ? 15.597  -7.935  8.610  1.00 48.20 ? 294  GLN A CG  1 
ATOM   2324 C CD  . GLN A 1 294 ? 15.035  -7.682  7.228  1.00 51.01 ? 294  GLN A CD  1 
ATOM   2325 O OE1 . GLN A 1 294 ? 15.623  -6.954  6.425  1.00 55.00 ? 294  GLN A OE1 1 
ATOM   2326 N NE2 . GLN A 1 294 ? 13.880  -8.273  6.946  1.00 53.98 ? 294  GLN A NE2 1 
ATOM   2327 N N   . LEU A 1 295 ? 14.816  -4.559  11.596 1.00 40.73 ? 295  LEU A N   1 
ATOM   2328 C CA  . LEU A 1 295 ? 14.062  -3.754  12.553 1.00 39.84 ? 295  LEU A CA  1 
ATOM   2329 C C   . LEU A 1 295 ? 14.051  -2.304  12.085 1.00 39.22 ? 295  LEU A C   1 
ATOM   2330 O O   . LEU A 1 295 ? 13.002  -1.666  12.056 1.00 40.85 ? 295  LEU A O   1 
ATOM   2331 C CB  . LEU A 1 295 ? 14.709  -3.832  13.939 1.00 38.40 ? 295  LEU A CB  1 
ATOM   2332 C CG  . LEU A 1 295 ? 14.177  -2.904  15.043 1.00 38.85 ? 295  LEU A CG  1 
ATOM   2333 C CD1 . LEU A 1 295 ? 12.759  -3.294  15.434 1.00 39.77 ? 295  LEU A CD1 1 
ATOM   2334 C CD2 . LEU A 1 295 ? 15.103  -2.985  16.253 1.00 35.75 ? 295  LEU A CD2 1 
ATOM   2335 N N   . LEU A 1 296 ? 15.225  -1.792  11.723 1.00 39.99 ? 296  LEU A N   1 
ATOM   2336 C CA  . LEU A 1 296 ? 15.354  -0.413  11.257 1.00 40.18 ? 296  LEU A CA  1 
ATOM   2337 C C   . LEU A 1 296 ? 14.573  -0.213  9.967  1.00 40.12 ? 296  LEU A C   1 
ATOM   2338 O O   . LEU A 1 296 ? 13.910  0.806   9.778  1.00 39.49 ? 296  LEU A O   1 
ATOM   2339 C CB  . LEU A 1 296 ? 16.823  -0.065  11.011 1.00 40.87 ? 296  LEU A CB  1 
ATOM   2340 C CG  . LEU A 1 296 ? 17.805  -0.121  12.184 1.00 41.44 ? 296  LEU A CG  1 
ATOM   2341 C CD1 . LEU A 1 296 ? 19.184  0.262   11.680 1.00 42.46 ? 296  LEU A CD1 1 
ATOM   2342 C CD2 . LEU A 1 296 ? 17.371  0.819   13.294 1.00 41.65 ? 296  LEU A CD2 1 
ATOM   2343 N N   . SER A 1 297 ? 14.667  -1.198  9.081  1.00 41.38 ? 297  SER A N   1 
ATOM   2344 C CA  . SER A 1 297 ? 13.974  -1.157  7.798  1.00 41.32 ? 297  SER A CA  1 
ATOM   2345 C C   . SER A 1 297 ? 12.474  -1.061  8.038  1.00 38.90 ? 297  SER A C   1 
ATOM   2346 O O   . SER A 1 297 ? 11.772  -0.331  7.339  1.00 37.36 ? 297  SER A O   1 
ATOM   2347 C CB  . SER A 1 297 ? 14.298  -2.417  6.989  1.00 44.27 ? 297  SER A CB  1 
ATOM   2348 O OG  . SER A 1 297 ? 13.265  -2.703  6.061  1.00 50.46 ? 297  SER A OG  1 
ATOM   2349 N N   . GLY A 1 298 ? 11.994  -1.801  9.036  1.00 37.82 ? 298  GLY A N   1 
ATOM   2350 C CA  . GLY A 1 298 ? 10.579  -1.780  9.372  1.00 36.84 ? 298  GLY A CA  1 
ATOM   2351 C C   . GLY A 1 298 ? 10.121  -0.392  9.771  1.00 35.47 ? 298  GLY A C   1 
ATOM   2352 O O   . GLY A 1 298 ? 9.091   0.086   9.306  1.00 37.32 ? 298  GLY A O   1 
ATOM   2353 N N   . ALA A 1 299 ? 10.886  0.263   10.634 1.00 36.20 ? 299  ALA A N   1 
ATOM   2354 C CA  . ALA A 1 299 ? 10.545  1.610   11.071 1.00 37.52 ? 299  ALA A CA  1 
ATOM   2355 C C   . ALA A 1 299 ? 10.620  2.573   9.885  1.00 37.25 ? 299  ALA A C   1 
ATOM   2356 O O   . ALA A 1 299 ? 9.796   3.476   9.757  1.00 37.41 ? 299  ALA A O   1 
ATOM   2357 C CB  . ALA A 1 299 ? 11.492  2.058   12.159 1.00 35.53 ? 299  ALA A CB  1 
ATOM   2358 N N   . HIS A 1 300 ? 11.606  2.368   9.017  1.00 38.69 ? 300  HIS A N   1 
ATOM   2359 C CA  . HIS A 1 300 ? 11.782  3.228   7.846  1.00 40.43 ? 300  HIS A CA  1 
ATOM   2360 C C   . HIS A 1 300 ? 10.565  3.169   6.928  1.00 40.33 ? 300  HIS A C   1 
ATOM   2361 O O   . HIS A 1 300 ? 10.150  4.184   6.368  1.00 40.54 ? 300  HIS A O   1 
ATOM   2362 C CB  . HIS A 1 300 ? 13.050  2.822   7.085  1.00 41.44 ? 300  HIS A CB  1 
ATOM   2363 C CG  . HIS A 1 300 ? 13.420  3.756   5.975  1.00 44.09 ? 300  HIS A CG  1 
ATOM   2364 N ND1 . HIS A 1 300 ? 13.423  5.127   6.122  1.00 42.71 ? 300  HIS A ND1 1 
ATOM   2365 C CD2 . HIS A 1 300 ? 13.839  3.513   4.709  1.00 44.78 ? 300  HIS A CD2 1 
ATOM   2366 C CE1 . HIS A 1 300 ? 13.826  5.688   4.996  1.00 45.04 ? 300  HIS A CE1 1 
ATOM   2367 N NE2 . HIS A 1 300 ? 14.086  4.731   4.123  1.00 43.35 ? 300  HIS A NE2 1 
ATOM   2368 N N   . TRP A 1 301 ? 9.984   1.985   6.775  1.00 39.34 ? 301  TRP A N   1 
ATOM   2369 C CA  . TRP A 1 301 ? 8.807   1.850   5.925  1.00 40.29 ? 301  TRP A CA  1 
ATOM   2370 C C   . TRP A 1 301 ? 7.665   2.670   6.517  1.00 39.96 ? 301  TRP A C   1 
ATOM   2371 O O   . TRP A 1 301 ? 6.994   3.420   5.811  1.00 39.59 ? 301  TRP A O   1 
ATOM   2372 C CB  . TRP A 1 301 ? 8.378   0.387   5.825  1.00 41.59 ? 301  TRP A CB  1 
ATOM   2373 C CG  . TRP A 1 301 ? 7.212   0.162   4.903  1.00 43.39 ? 301  TRP A CG  1 
ATOM   2374 C CD1 . TRP A 1 301 ? 7.267   -0.156  3.577  1.00 44.18 ? 301  TRP A CD1 1 
ATOM   2375 C CD2 . TRP A 1 301 ? 5.819   0.276   5.230  1.00 43.54 ? 301  TRP A CD2 1 
ATOM   2376 N NE1 . TRP A 1 301 ? 5.996   -0.249  3.057  1.00 43.84 ? 301  TRP A NE1 1 
ATOM   2377 C CE2 . TRP A 1 301 ? 5.089   0.013   4.049  1.00 44.78 ? 301  TRP A CE2 1 
ATOM   2378 C CE3 . TRP A 1 301 ? 5.117   0.576   6.407  1.00 44.04 ? 301  TRP A CE3 1 
ATOM   2379 C CZ2 . TRP A 1 301 ? 3.687   0.041   4.009  1.00 44.42 ? 301  TRP A CZ2 1 
ATOM   2380 C CZ3 . TRP A 1 301 ? 3.726   0.605   6.367  1.00 43.74 ? 301  TRP A CZ3 1 
ATOM   2381 C CH2 . TRP A 1 301 ? 3.026   0.338   5.174  1.00 44.29 ? 301  TRP A CH2 1 
ATOM   2382 N N   . MET A 1 302 ? 7.442   2.523   7.822  1.00 38.58 ? 302  MET A N   1 
ATOM   2383 C CA  . MET A 1 302 ? 6.371   3.259   8.478  1.00 36.46 ? 302  MET A CA  1 
ATOM   2384 C C   . MET A 1 302 ? 6.605   4.759   8.386  1.00 34.87 ? 302  MET A C   1 
ATOM   2385 O O   . MET A 1 302 ? 5.649   5.527   8.253  1.00 35.67 ? 302  MET A O   1 
ATOM   2386 C CB  . MET A 1 302 ? 6.240   2.829   9.945  1.00 35.51 ? 302  MET A CB  1 
ATOM   2387 C CG  . MET A 1 302 ? 5.024   3.405   10.675 1.00 35.23 ? 302  MET A CG  1 
ATOM   2388 S SD  . MET A 1 302 ? 3.423   3.179   9.853  1.00 35.95 ? 302  MET A SD  1 
ATOM   2389 C CE  . MET A 1 302 ? 3.205   1.396   9.941  1.00 35.22 ? 302  MET A CE  1 
ATOM   2390 N N   . ASP A 1 303 ? 7.866   5.182   8.465  1.00 35.24 ? 303  ASP A N   1 
ATOM   2391 C CA  . ASP A 1 303 ? 8.179   6.608   8.371  1.00 36.97 ? 303  ASP A CA  1 
ATOM   2392 C C   . ASP A 1 303 ? 7.723   7.147   7.021  1.00 37.69 ? 303  ASP A C   1 
ATOM   2393 O O   . ASP A 1 303 ? 7.133   8.228   6.936  1.00 37.50 ? 303  ASP A O   1 
ATOM   2394 C CB  . ASP A 1 303 ? 9.682   6.861   8.524  1.00 38.75 ? 303  ASP A CB  1 
ATOM   2395 C CG  . ASP A 1 303 ? 10.174  6.635   9.937  1.00 42.15 ? 303  ASP A CG  1 
ATOM   2396 O OD1 . ASP A 1 303 ? 9.332   6.663   10.863 1.00 41.23 ? 303  ASP A OD1 1 
ATOM   2397 O OD2 . ASP A 1 303 ? 11.398  6.451   10.121 1.00 39.79 ? 303  ASP A OD2 1 
ATOM   2398 N N   . GLN A 1 304 ? 8.008   6.388   5.968  1.00 39.23 ? 304  GLN A N   1 
ATOM   2399 C CA  . GLN A 1 304 ? 7.626   6.781   4.616  1.00 41.21 ? 304  GLN A CA  1 
ATOM   2400 C C   . GLN A 1 304 ? 6.113   6.765   4.451  1.00 40.67 ? 304  GLN A C   1 
ATOM   2401 O O   . GLN A 1 304 ? 5.557   7.606   3.754  1.00 40.44 ? 304  GLN A O   1 
ATOM   2402 C CB  . GLN A 1 304 ? 8.290   5.860   3.590  1.00 43.17 ? 304  GLN A CB  1 
ATOM   2403 C CG  . GLN A 1 304 ? 9.773   6.152   3.401  1.00 48.45 ? 304  GLN A CG  1 
ATOM   2404 C CD  . GLN A 1 304 ? 10.387  5.337   2.284  1.00 52.27 ? 304  GLN A CD  1 
ATOM   2405 O OE1 . GLN A 1 304 ? 10.746  4.173   2.470  1.00 54.28 ? 304  GLN A OE1 1 
ATOM   2406 N NE2 . GLN A 1 304 ? 10.495  5.940   1.107  1.00 52.68 ? 304  GLN A NE2 1 
ATOM   2407 N N   . HIS A 1 305 ? 5.449   5.807   5.092  1.00 39.07 ? 305  HIS A N   1 
ATOM   2408 C CA  . HIS A 1 305 ? 3.994   5.727   5.041  1.00 38.36 ? 305  HIS A CA  1 
ATOM   2409 C C   . HIS A 1 305 ? 3.439   7.011   5.652  1.00 39.18 ? 305  HIS A C   1 
ATOM   2410 O O   . HIS A 1 305 ? 2.572   7.675   5.077  1.00 41.04 ? 305  HIS A O   1 
ATOM   2411 C CB  . HIS A 1 305 ? 3.503   4.525   5.858  1.00 36.92 ? 305  HIS A CB  1 
ATOM   2412 C CG  . HIS A 1 305 ? 2.031   4.537   6.134  1.00 36.36 ? 305  HIS A CG  1 
ATOM   2413 N ND1 . HIS A 1 305 ? 1.093   4.147   5.203  1.00 36.87 ? 305  HIS A ND1 1 
ATOM   2414 C CD2 . HIS A 1 305 ? 1.335   4.914   7.233  1.00 34.36 ? 305  HIS A CD2 1 
ATOM   2415 C CE1 . HIS A 1 305 ? -0.116  4.282   5.714  1.00 37.18 ? 305  HIS A CE1 1 
ATOM   2416 N NE2 . HIS A 1 305 ? 0.002   4.746   6.945  1.00 36.43 ? 305  HIS A NE2 1 
ATOM   2417 N N   . PHE A 1 306 ? 3.956   7.353   6.826  1.00 40.24 ? 306  PHE A N   1 
ATOM   2418 C CA  . PHE A 1 306 ? 3.531   8.541   7.552  1.00 39.87 ? 306  PHE A CA  1 
ATOM   2419 C C   . PHE A 1 306 ? 3.794   9.831   6.778  1.00 41.40 ? 306  PHE A C   1 
ATOM   2420 O O   . PHE A 1 306 ? 2.996   10.770  6.822  1.00 39.61 ? 306  PHE A O   1 
ATOM   2421 C CB  . PHE A 1 306 ? 4.253   8.583   8.906  1.00 41.29 ? 306  PHE A CB  1 
ATOM   2422 C CG  . PHE A 1 306 ? 4.029   9.854   9.687  1.00 40.14 ? 306  PHE A CG  1 
ATOM   2423 C CD1 . PHE A 1 306 ? 2.748   10.363  9.871  1.00 39.79 ? 306  PHE A CD1 1 
ATOM   2424 C CD2 . PHE A 1 306 ? 5.104   10.518  10.271 1.00 39.52 ? 306  PHE A CD2 1 
ATOM   2425 C CE1 . PHE A 1 306 ? 2.538   11.516  10.627 1.00 38.99 ? 306  PHE A CE1 1 
ATOM   2426 C CE2 . PHE A 1 306 ? 4.909   11.668  11.028 1.00 38.85 ? 306  PHE A CE2 1 
ATOM   2427 C CZ  . PHE A 1 306 ? 3.622   12.169  11.208 1.00 38.58 ? 306  PHE A CZ  1 
ATOM   2428 N N   . ARG A 1 307 ? 4.907   9.866   6.056  1.00 42.55 ? 307  ARG A N   1 
ATOM   2429 C CA  . ARG A 1 307 ? 5.283   11.055  5.306  1.00 44.45 ? 307  ARG A CA  1 
ATOM   2430 C C   . ARG A 1 307 ? 4.612   11.252  3.945  1.00 44.15 ? 307  ARG A C   1 
ATOM   2431 O O   . ARG A 1 307 ? 4.387   12.388  3.525  1.00 42.23 ? 307  ARG A O   1 
ATOM   2432 C CB  . ARG A 1 307 ? 6.800   11.077  5.118  1.00 46.63 ? 307  ARG A CB  1 
ATOM   2433 C CG  . ARG A 1 307 ? 7.329   12.398  4.584  1.00 49.71 ? 307  ARG A CG  1 
ATOM   2434 C CD  . ARG A 1 307 ? 8.843   12.396  4.511  1.00 51.46 ? 307  ARG A CD  1 
ATOM   2435 N NE  . ARG A 1 307 ? 9.373   13.744  4.330  1.00 53.18 ? 307  ARG A NE  1 
ATOM   2436 C CZ  . ARG A 1 307 ? 10.667  14.041  4.285  1.00 53.88 ? 307  ARG A CZ  1 
ATOM   2437 N NH1 . ARG A 1 307 ? 11.576  13.082  4.405  1.00 53.55 ? 307  ARG A NH1 1 
ATOM   2438 N NH2 . ARG A 1 307 ? 11.051  15.302  4.132  1.00 54.49 ? 307  ARG A NH2 1 
ATOM   2439 N N   . THR A 1 308 ? 4.267   10.163  3.265  1.00 44.28 ? 308  THR A N   1 
ATOM   2440 C CA  . THR A 1 308 ? 3.680   10.273  1.930  1.00 44.30 ? 308  THR A CA  1 
ATOM   2441 C C   . THR A 1 308 ? 2.194   9.953   1.773  1.00 45.13 ? 308  THR A C   1 
ATOM   2442 O O   . THR A 1 308 ? 1.624   10.164  0.700  1.00 45.82 ? 308  THR A O   1 
ATOM   2443 C CB  . THR A 1 308 ? 4.458   9.384   0.944  1.00 43.90 ? 308  THR A CB  1 
ATOM   2444 O OG1 . THR A 1 308 ? 4.257   8.005   1.281  1.00 42.89 ? 308  THR A OG1 1 
ATOM   2445 C CG2 . THR A 1 308 ? 5.953   9.696   1.015  1.00 40.91 ? 308  THR A CG2 1 
ATOM   2446 N N   . THR A 1 309 ? 1.558   9.467   2.833  1.00 44.09 ? 309  THR A N   1 
ATOM   2447 C CA  . THR A 1 309 ? 0.149   9.092   2.763  1.00 42.02 ? 309  THR A CA  1 
ATOM   2448 C C   . THR A 1 309 ? -0.870  10.167  3.132  1.00 42.96 ? 309  THR A C   1 
ATOM   2449 O O   . THR A 1 309 ? -0.751  10.811  4.169  1.00 44.03 ? 309  THR A O   1 
ATOM   2450 C CB  . THR A 1 309 ? -0.120  7.865   3.654  1.00 41.60 ? 309  THR A CB  1 
ATOM   2451 O OG1 . THR A 1 309 ? 0.776   6.809   3.288  1.00 41.37 ? 309  THR A OG1 1 
ATOM   2452 C CG2 . THR A 1 309 ? -1.558  7.390   3.493  1.00 39.29 ? 309  THR A CG2 1 
ATOM   2453 N N   . PRO A 1 310 ? -1.892  10.371  2.279  1.00 43.39 ? 310  PRO A N   1 
ATOM   2454 C CA  . PRO A 1 310 ? -2.921  11.378  2.568  1.00 44.76 ? 310  PRO A CA  1 
ATOM   2455 C C   . PRO A 1 310 ? -3.510  11.085  3.954  1.00 45.83 ? 310  PRO A C   1 
ATOM   2456 O O   . PRO A 1 310 ? -3.812  9.935   4.270  1.00 45.58 ? 310  PRO A O   1 
ATOM   2457 C CB  . PRO A 1 310 ? -3.940  11.155  1.456  1.00 44.10 ? 310  PRO A CB  1 
ATOM   2458 C CG  . PRO A 1 310 ? -3.093  10.719  0.313  1.00 43.53 ? 310  PRO A CG  1 
ATOM   2459 C CD  . PRO A 1 310 ? -2.116  9.757   0.957  1.00 42.70 ? 310  PRO A CD  1 
ATOM   2460 N N   . LEU A 1 311 ? -3.681  12.122  4.769  1.00 46.56 ? 311  LEU A N   1 
ATOM   2461 C CA  . LEU A 1 311 ? -4.201  11.957  6.130  1.00 47.06 ? 311  LEU A CA  1 
ATOM   2462 C C   . LEU A 1 311 ? -5.341  10.950  6.320  1.00 46.97 ? 311  LEU A C   1 
ATOM   2463 O O   . LEU A 1 311 ? -5.295  10.131  7.240  1.00 47.19 ? 311  LEU A O   1 
ATOM   2464 C CB  . LEU A 1 311 ? -4.630  13.315  6.693  1.00 47.99 ? 311  LEU A CB  1 
ATOM   2465 C CG  . LEU A 1 311 ? -3.573  14.420  6.666  1.00 49.60 ? 311  LEU A CG  1 
ATOM   2466 C CD1 . LEU A 1 311 ? -4.075  15.611  7.469  1.00 49.73 ? 311  LEU A CD1 1 
ATOM   2467 C CD2 . LEU A 1 311 ? -2.257  13.910  7.238  1.00 49.84 ? 311  LEU A CD2 1 
ATOM   2468 N N   . GLU A 1 312 ? -6.354  11.004  5.459  1.00 45.64 ? 312  GLU A N   1 
ATOM   2469 C CA  . GLU A 1 312 ? -7.506  10.102  5.558  1.00 47.18 ? 312  GLU A CA  1 
ATOM   2470 C C   . GLU A 1 312 ? -7.132  8.620   5.547  1.00 45.21 ? 312  GLU A C   1 
ATOM   2471 O O   . GLU A 1 312 ? -7.922  7.771   5.954  1.00 45.90 ? 312  GLU A O   1 
ATOM   2472 C CB  . GLU A 1 312 ? -8.491  10.370  4.410  1.00 50.62 ? 312  GLU A CB  1 
ATOM   2473 C CG  . GLU A 1 312 ? -8.006  9.866   3.053  1.00 54.62 ? 312  GLU A CG  1 
ATOM   2474 C CD  . GLU A 1 312 ? -8.890  10.302  1.893  1.00 58.51 ? 312  GLU A CD  1 
ATOM   2475 O OE1 . GLU A 1 312 ? -8.981  9.542   0.905  1.00 60.01 ? 312  GLU A OE1 1 
ATOM   2476 O OE2 . GLU A 1 312 ? -9.489  11.398  1.962  1.00 60.95 ? 312  GLU A OE2 1 
ATOM   2477 N N   . LYS A 1 313 ? -5.931  8.310   5.077  1.00 45.34 ? 313  LYS A N   1 
ATOM   2478 C CA  . LYS A 1 313 ? -5.479  6.927   5.004  1.00 45.56 ? 313  LYS A CA  1 
ATOM   2479 C C   . LYS A 1 313 ? -4.123  6.754   5.676  1.00 44.74 ? 313  LYS A C   1 
ATOM   2480 O O   . LYS A 1 313 ? -3.415  5.776   5.429  1.00 43.72 ? 313  LYS A O   1 
ATOM   2481 C CB  . LYS A 1 313 ? -5.389  6.499   3.539  1.00 47.41 ? 313  LYS A CB  1 
ATOM   2482 C CG  . LYS A 1 313 ? -6.732  6.346   2.849  1.00 50.55 ? 313  LYS A CG  1 
ATOM   2483 C CD  . LYS A 1 313 ? -7.164  4.886   2.841  1.00 54.24 ? 313  LYS A CD  1 
ATOM   2484 C CE  . LYS A 1 313 ? -5.973  3.970   2.540  1.00 56.69 ? 313  LYS A CE  1 
ATOM   2485 N NZ  . LYS A 1 313 ? -6.357  2.532   2.401  1.00 57.78 ? 313  LYS A NZ  1 
ATOM   2486 N N   . ASN A 1 314 ? -3.779  7.709   6.535  1.00 42.66 ? 314  ASN A N   1 
ATOM   2487 C CA  . ASN A 1 314 ? -2.507  7.706   7.244  1.00 42.32 ? 314  ASN A CA  1 
ATOM   2488 C C   . ASN A 1 314 ? -2.665  7.033   8.615  1.00 41.25 ? 314  ASN A C   1 
ATOM   2489 O O   . ASN A 1 314 ? -3.337  7.561   9.503  1.00 40.35 ? 314  ASN A O   1 
ATOM   2490 C CB  . ASN A 1 314 ? -2.029  9.151   7.406  1.00 42.17 ? 314  ASN A CB  1 
ATOM   2491 C CG  . ASN A 1 314 ? -0.561  9.246   7.729  1.00 43.34 ? 314  ASN A CG  1 
ATOM   2492 O OD1 . ASN A 1 314 ? -0.086  8.653   8.697  1.00 42.64 ? 314  ASN A OD1 1 
ATOM   2493 N ND2 . ASN A 1 314 ? 0.174   10.002  6.919  1.00 44.06 ? 314  ASN A ND2 1 
ATOM   2494 N N   . ALA A 1 315 ? -2.034  5.871   8.780  1.00 40.41 ? 315  ALA A N   1 
ATOM   2495 C CA  . ALA A 1 315 ? -2.131  5.100   10.020 1.00 39.07 ? 315  ALA A CA  1 
ATOM   2496 C C   . ALA A 1 315 ? -1.872  5.874   11.315 1.00 37.34 ? 315  ALA A C   1 
ATOM   2497 O O   . ALA A 1 315 ? -2.754  5.959   12.175 1.00 36.12 ? 315  ALA A O   1 
ATOM   2498 C CB  . ALA A 1 315 ? -1.206  3.878   9.949  1.00 39.65 ? 315  ALA A CB  1 
ATOM   2499 N N   . PRO A 1 316 ? -0.665  6.447   11.475 1.00 37.38 ? 316  PRO A N   1 
ATOM   2500 C CA  . PRO A 1 316 ? -0.335  7.204   12.690 1.00 37.33 ? 316  PRO A CA  1 
ATOM   2501 C C   . PRO A 1 316 ? -1.287  8.365   12.965 1.00 38.15 ? 316  PRO A C   1 
ATOM   2502 O O   . PRO A 1 316 ? -1.597  8.668   14.120 1.00 37.35 ? 316  PRO A O   1 
ATOM   2503 C CB  . PRO A 1 316 ? 1.084   7.697   12.422 1.00 38.29 ? 316  PRO A CB  1 
ATOM   2504 C CG  . PRO A 1 316 ? 1.635   6.682   11.473 1.00 39.03 ? 316  PRO A CG  1 
ATOM   2505 C CD  . PRO A 1 316 ? 0.476   6.438   10.545 1.00 36.83 ? 316  PRO A CD  1 
ATOM   2506 N N   . VAL A 1 317 ? -1.732  9.024   11.902 1.00 36.36 ? 317  VAL A N   1 
ATOM   2507 C CA  . VAL A 1 317 ? -2.641  10.155  12.038 1.00 33.74 ? 317  VAL A CA  1 
ATOM   2508 C C   . VAL A 1 317 ? -4.034  9.719   12.478 1.00 32.76 ? 317  VAL A C   1 
ATOM   2509 O O   . VAL A 1 317 ? -4.666  10.382  13.301 1.00 33.16 ? 317  VAL A O   1 
ATOM   2510 C CB  . VAL A 1 317 ? -2.751  10.937  10.713 1.00 33.66 ? 317  VAL A CB  1 
ATOM   2511 C CG1 . VAL A 1 317 ? -3.779  12.050  10.848 1.00 33.81 ? 317  VAL A CG1 1 
ATOM   2512 C CG2 . VAL A 1 317 ? -1.390  11.513  10.346 1.00 34.24 ? 317  VAL A CG2 1 
ATOM   2513 N N   . LEU A 1 318 ? -4.508  8.608   11.925 1.00 32.69 ? 318  LEU A N   1 
ATOM   2514 C CA  . LEU A 1 318 ? -5.826  8.076   12.264 1.00 33.33 ? 318  LEU A CA  1 
ATOM   2515 C C   . LEU A 1 318 ? -5.841  7.678   13.742 1.00 33.98 ? 318  LEU A C   1 
ATOM   2516 O O   . LEU A 1 318 ? -6.781  7.998   14.467 1.00 31.93 ? 318  LEU A O   1 
ATOM   2517 C CB  . LEU A 1 318 ? -6.142  6.857   11.392 1.00 34.53 ? 318  LEU A CB  1 
ATOM   2518 C CG  . LEU A 1 318 ? -6.389  7.136   9.902  1.00 35.83 ? 318  LEU A CG  1 
ATOM   2519 C CD1 . LEU A 1 318 ? -6.482  5.829   9.139  1.00 36.45 ? 318  LEU A CD1 1 
ATOM   2520 C CD2 . LEU A 1 318 ? -7.666  7.940   9.738  1.00 34.77 ? 318  LEU A CD2 1 
ATOM   2521 N N   . LEU A 1 319 ? -4.796  6.975   14.174 1.00 34.43 ? 319  LEU A N   1 
ATOM   2522 C CA  . LEU A 1 319 ? -4.679  6.560   15.575 1.00 33.51 ? 319  LEU A CA  1 
ATOM   2523 C C   . LEU A 1 319 ? -4.616  7.782   16.480 1.00 32.64 ? 319  LEU A C   1 
ATOM   2524 O O   . LEU A 1 319 ? -5.238  7.809   17.538 1.00 32.60 ? 319  LEU A O   1 
ATOM   2525 C CB  . LEU A 1 319 ? -3.417  5.714   15.787 1.00 32.43 ? 319  LEU A CB  1 
ATOM   2526 C CG  . LEU A 1 319 ? -3.417  4.313   15.179 1.00 33.22 ? 319  LEU A CG  1 
ATOM   2527 C CD1 . LEU A 1 319 ? -2.061  3.673   15.381 1.00 36.30 ? 319  LEU A CD1 1 
ATOM   2528 C CD2 . LEU A 1 319 ? -4.497  3.470   15.828 1.00 35.65 ? 319  LEU A CD2 1 
ATOM   2529 N N   . ALA A 1 320 ? -3.857  8.792   16.063 1.00 32.07 ? 320  ALA A N   1 
ATOM   2530 C CA  . ALA A 1 320 ? -3.727  10.012  16.856 1.00 32.98 ? 320  ALA A CA  1 
ATOM   2531 C C   . ALA A 1 320 ? -5.051  10.752  17.022 1.00 32.23 ? 320  ALA A C   1 
ATOM   2532 O O   . ALA A 1 320 ? -5.447  11.086  18.138 1.00 31.57 ? 320  ALA A O   1 
ATOM   2533 C CB  . ALA A 1 320 ? -2.691  10.945  16.232 1.00 30.25 ? 320  ALA A CB  1 
ATOM   2534 N N   . MET A 1 321 ? -5.732  11.018  15.911 1.00 33.25 ? 321  MET A N   1 
ATOM   2535 C CA  . MET A 1 321 ? -6.989  11.743  15.970 1.00 32.53 ? 321  MET A CA  1 
ATOM   2536 C C   . MET A 1 321 ? -8.080  10.972  16.700 1.00 32.45 ? 321  MET A C   1 
ATOM   2537 O O   . MET A 1 321 ? -8.927  11.574  17.349 1.00 31.97 ? 321  MET A O   1 
ATOM   2538 C CB  . MET A 1 321 ? -7.449  12.140  14.560 1.00 36.40 ? 321  MET A CB  1 
ATOM   2539 C CG  . MET A 1 321 ? -6.434  13.021  13.813 1.00 36.30 ? 321  MET A CG  1 
ATOM   2540 S SD  . MET A 1 321 ? -5.636  14.279  14.861 1.00 37.68 ? 321  MET A SD  1 
ATOM   2541 C CE  . MET A 1 321 ? -7.022  15.362  15.235 1.00 38.27 ? 321  MET A CE  1 
ATOM   2542 N N   . LEU A 1 322 ? -8.072  9.645   16.610 1.00 32.19 ? 322  LEU A N   1 
ATOM   2543 C CA  . LEU A 1 322 ? -9.074  8.875   17.336 1.00 32.42 ? 322  LEU A CA  1 
ATOM   2544 C C   . LEU A 1 322 ? -8.788  9.098   18.824 1.00 31.93 ? 322  LEU A C   1 
ATOM   2545 O O   . LEU A 1 322 ? -9.708  9.211   19.635 1.00 32.23 ? 322  LEU A O   1 
ATOM   2546 C CB  . LEU A 1 322 ? -8.982  7.385   16.979 1.00 34.56 ? 322  LEU A CB  1 
ATOM   2547 C CG  . LEU A 1 322 ? -9.571  7.000   15.614 1.00 33.89 ? 322  LEU A CG  1 
ATOM   2548 C CD1 . LEU A 1 322 ? -9.168  5.582   15.246 1.00 32.63 ? 322  LEU A CD1 1 
ATOM   2549 C CD2 . LEU A 1 322 ? -11.086 7.121   15.666 1.00 35.72 ? 322  LEU A CD2 1 
ATOM   2550 N N   . GLY A 1 323 ? -7.505  9.185   19.167 1.00 31.61 ? 323  GLY A N   1 
ATOM   2551 C CA  . GLY A 1 323 ? -7.112  9.427   20.548 1.00 31.01 ? 323  GLY A CA  1 
ATOM   2552 C C   . GLY A 1 323 ? -7.555  10.802  21.020 1.00 32.14 ? 323  GLY A C   1 
ATOM   2553 O O   . GLY A 1 323 ? -8.054  10.952  22.134 1.00 34.64 ? 323  GLY A O   1 
ATOM   2554 N N   . ILE A 1 324 ? -7.363  11.816  20.178 1.00 32.99 ? 324  ILE A N   1 
ATOM   2555 C CA  . ILE A 1 324 ? -7.765  13.187  20.509 1.00 31.93 ? 324  ILE A CA  1 
ATOM   2556 C C   . ILE A 1 324 ? -9.262  13.206  20.819 1.00 32.45 ? 324  ILE A C   1 
ATOM   2557 O O   . ILE A 1 324 ? -9.709  13.828  21.781 1.00 31.28 ? 324  ILE A O   1 
ATOM   2558 C CB  . ILE A 1 324 ? -7.494  14.156  19.324 1.00 31.73 ? 324  ILE A CB  1 
ATOM   2559 C CG1 . ILE A 1 324 ? -5.993  14.272  19.063 1.00 34.25 ? 324  ILE A CG1 1 
ATOM   2560 C CG2 . ILE A 1 324 ? -8.084  15.533  19.625 1.00 32.01 ? 324  ILE A CG2 1 
ATOM   2561 C CD1 . ILE A 1 324 ? -5.178  14.671  20.274 1.00 31.67 ? 324  ILE A CD1 1 
ATOM   2562 N N   . TRP A 1 325 ? -10.023 12.510  19.982 1.00 32.36 ? 325  TRP A N   1 
ATOM   2563 C CA  . TRP A 1 325 ? -11.467 12.392  20.116 1.00 33.13 ? 325  TRP A CA  1 
ATOM   2564 C C   . TRP A 1 325 ? -11.824 11.912  21.531 1.00 34.00 ? 325  TRP A C   1 
ATOM   2565 O O   . TRP A 1 325 ? -12.574 12.575  22.251 1.00 33.23 ? 325  TRP A O   1 
ATOM   2566 C CB  . TRP A 1 325 ? -11.969 11.409  19.049 1.00 33.85 ? 325  TRP A CB  1 
ATOM   2567 C CG  . TRP A 1 325 ? -13.450 11.172  18.989 1.00 36.35 ? 325  TRP A CG  1 
ATOM   2568 C CD1 . TRP A 1 325 ? -14.079 9.956   18.980 1.00 35.72 ? 325  TRP A CD1 1 
ATOM   2569 C CD2 . TRP A 1 325 ? -14.483 12.158  18.851 1.00 36.06 ? 325  TRP A CD2 1 
ATOM   2570 N NE1 . TRP A 1 325 ? -15.437 10.124  18.841 1.00 38.01 ? 325  TRP A NE1 1 
ATOM   2571 C CE2 . TRP A 1 325 ? -15.713 11.465  18.760 1.00 37.62 ? 325  TRP A CE2 1 
ATOM   2572 C CE3 . TRP A 1 325 ? -14.490 13.558  18.793 1.00 37.82 ? 325  TRP A CE3 1 
ATOM   2573 C CZ2 . TRP A 1 325 ? -16.940 12.126  18.613 1.00 40.10 ? 325  TRP A CZ2 1 
ATOM   2574 C CZ3 . TRP A 1 325 ? -15.716 14.218  18.646 1.00 39.09 ? 325  TRP A CZ3 1 
ATOM   2575 C CH2 . TRP A 1 325 ? -16.920 13.500  18.558 1.00 38.38 ? 325  TRP A CH2 1 
ATOM   2576 N N   . TYR A 1 326 ? -11.265 10.774  21.941 1.00 33.31 ? 326  TYR A N   1 
ATOM   2577 C CA  . TYR A 1 326 ? -11.551 10.231  23.268 1.00 32.68 ? 326  TYR A CA  1 
ATOM   2578 C C   . TYR A 1 326 ? -10.998 11.065  24.424 1.00 31.66 ? 326  TYR A C   1 
ATOM   2579 O O   . TYR A 1 326 ? -11.631 11.178  25.469 1.00 33.09 ? 326  TYR A O   1 
ATOM   2580 C CB  . TYR A 1 326 ? -11.033 8.783   23.374 1.00 31.10 ? 326  TYR A CB  1 
ATOM   2581 C CG  . TYR A 1 326 ? -11.723 7.833   22.412 1.00 29.95 ? 326  TYR A CG  1 
ATOM   2582 C CD1 . TYR A 1 326 ? -13.109 7.799   22.320 1.00 33.07 ? 326  TYR A CD1 1 
ATOM   2583 C CD2 . TYR A 1 326 ? -10.988 6.991   21.578 1.00 31.00 ? 326  TYR A CD2 1 
ATOM   2584 C CE1 . TYR A 1 326 ? -13.752 6.962   21.418 1.00 32.79 ? 326  TYR A CE1 1 
ATOM   2585 C CE2 . TYR A 1 326 ? -11.624 6.143   20.669 1.00 30.84 ? 326  TYR A CE2 1 
ATOM   2586 C CZ  . TYR A 1 326 ? -13.002 6.137   20.593 1.00 32.29 ? 326  TYR A CZ  1 
ATOM   2587 O OH  . TYR A 1 326 ? -13.642 5.331   19.678 1.00 34.53 ? 326  TYR A OH  1 
ATOM   2588 N N   . ILE A 1 327 ? -9.825  11.654  24.239 1.00 32.81 ? 327  ILE A N   1 
ATOM   2589 C CA  . ILE A 1 327 ? -9.216  12.462  25.289 1.00 32.49 ? 327  ILE A CA  1 
ATOM   2590 C C   . ILE A 1 327 ? -9.867  13.830  25.478 1.00 34.00 ? 327  ILE A C   1 
ATOM   2591 O O   . ILE A 1 327 ? -10.281 14.181  26.578 1.00 31.65 ? 327  ILE A O   1 
ATOM   2592 C CB  . ILE A 1 327 ? -7.706  12.680  25.014 1.00 31.41 ? 327  ILE A CB  1 
ATOM   2593 C CG1 . ILE A 1 327 ? -6.959  11.343  25.105 1.00 32.85 ? 327  ILE A CG1 1 
ATOM   2594 C CG2 . ILE A 1 327 ? -7.123  13.684  26.005 1.00 31.50 ? 327  ILE A CG2 1 
ATOM   2595 C CD1 . ILE A 1 327 ? -5.493  11.429  24.704 1.00 31.38 ? 327  ILE A CD1 1 
ATOM   2596 N N   . ASN A 1 328 ? -9.966  14.594  24.397 1.00 35.72 ? 328  ASN A N   1 
ATOM   2597 C CA  . ASN A 1 328 ? -10.508 15.946  24.473 1.00 36.89 ? 328  ASN A CA  1 
ATOM   2598 C C   . ASN A 1 328 ? -12.014 16.128  24.385 1.00 38.91 ? 328  ASN A C   1 
ATOM   2599 O O   . ASN A 1 328 ? -12.539 17.151  24.837 1.00 40.34 ? 328  ASN A O   1 
ATOM   2600 C CB  . ASN A 1 328 ? -9.808  16.811  23.428 1.00 36.24 ? 328  ASN A CB  1 
ATOM   2601 C CG  . ASN A 1 328 ? -8.321  16.918  23.684 1.00 34.06 ? 328  ASN A CG  1 
ATOM   2602 O OD1 . ASN A 1 328 ? -7.505  16.466  22.885 1.00 33.95 ? 328  ASN A OD1 1 
ATOM   2603 N ND2 . ASN A 1 328 ? -7.961  17.511  24.816 1.00 31.19 ? 328  ASN A ND2 1 
ATOM   2604 N N   . CYS A 1 329 ? -12.715 15.154  23.809 1.00 38.09 ? 329  CYS A N   1 
ATOM   2605 C CA  . CYS A 1 329 ? -14.166 15.242  23.704 1.00 38.16 ? 329  CYS A CA  1 
ATOM   2606 C C   . CYS A 1 329 ? -14.879 14.314  24.698 1.00 38.66 ? 329  CYS A C   1 
ATOM   2607 O O   . CYS A 1 329 ? -15.884 14.696  25.293 1.00 39.42 ? 329  CYS A O   1 
ATOM   2608 C CB  . CYS A 1 329 ? -14.619 14.944  22.267 1.00 39.74 ? 329  CYS A CB  1 
ATOM   2609 S SG  . CYS A 1 329 ? -14.371 16.340  21.110 1.00 46.70 ? 329  CYS A SG  1 
ATOM   2610 N N   . PHE A 1 330 ? -14.361 13.101  24.887 1.00 37.18 ? 330  PHE A N   1 
ATOM   2611 C CA  . PHE A 1 330 ? -14.978 12.166  25.830 1.00 36.65 ? 330  PHE A CA  1 
ATOM   2612 C C   . PHE A 1 330 ? -14.320 12.184  27.212 1.00 36.55 ? 330  PHE A C   1 
ATOM   2613 O O   . PHE A 1 330 ? -14.825 11.573  28.149 1.00 37.94 ? 330  PHE A O   1 
ATOM   2614 C CB  . PHE A 1 330 ? -14.957 10.738  25.273 1.00 36.45 ? 330  PHE A CB  1 
ATOM   2615 C CG  . PHE A 1 330 ? -16.062 10.446  24.294 1.00 33.96 ? 330  PHE A CG  1 
ATOM   2616 C CD1 . PHE A 1 330 ? -15.832 10.500  22.923 1.00 34.40 ? 330  PHE A CD1 1 
ATOM   2617 C CD2 . PHE A 1 330 ? -17.331 10.102  24.746 1.00 35.92 ? 330  PHE A CD2 1 
ATOM   2618 C CE1 . PHE A 1 330 ? -16.851 10.214  22.014 1.00 35.34 ? 330  PHE A CE1 1 
ATOM   2619 C CE2 . PHE A 1 330 ? -18.362 9.816   23.843 1.00 36.77 ? 330  PHE A CE2 1 
ATOM   2620 C CZ  . PHE A 1 330 ? -18.118 9.873   22.475 1.00 33.90 ? 330  PHE A CZ  1 
ATOM   2621 N N   . GLY A 1 331 ? -13.189 12.875  27.327 1.00 36.01 ? 331  GLY A N   1 
ATOM   2622 C CA  . GLY A 1 331 ? -12.489 12.985  28.600 1.00 35.03 ? 331  GLY A CA  1 
ATOM   2623 C C   . GLY A 1 331 ? -11.844 11.732  29.179 1.00 31.99 ? 331  GLY A C   1 
ATOM   2624 O O   . GLY A 1 331 ? -11.641 11.653  30.388 1.00 33.23 ? 331  GLY A O   1 
ATOM   2625 N N   . CYS A 1 332 ? -11.507 10.760  28.342 1.00 31.94 ? 332  CYS A N   1 
ATOM   2626 C CA  . CYS A 1 332 ? -10.893 9.521   28.834 1.00 30.64 ? 332  CYS A CA  1 
ATOM   2627 C C   . CYS A 1 332 ? -9.454  9.754   29.287 1.00 30.37 ? 332  CYS A C   1 
ATOM   2628 O O   . CYS A 1 332 ? -8.612  10.190  28.509 1.00 29.94 ? 332  CYS A O   1 
ATOM   2629 C CB  . CYS A 1 332 ? -10.911 8.448   27.744 1.00 29.41 ? 332  CYS A CB  1 
ATOM   2630 S SG  . CYS A 1 332 ? -12.553 8.064   27.101 1.00 33.24 ? 332  CYS A SG  1 
ATOM   2631 N N   . GLU A 1 333 ? -9.173  9.449   30.548 1.00 30.45 ? 333  GLU A N   1 
ATOM   2632 C CA  . GLU A 1 333 ? -7.835  9.638   31.091 1.00 30.77 ? 333  GLU A CA  1 
ATOM   2633 C C   . GLU A 1 333 ? -6.808  8.620   30.610 1.00 31.44 ? 333  GLU A C   1 
ATOM   2634 O O   . GLU A 1 333 ? -5.618  8.920   30.569 1.00 30.59 ? 333  GLU A O   1 
ATOM   2635 C CB  . GLU A 1 333 ? -7.856  9.577   32.624 1.00 31.41 ? 333  GLU A CB  1 
ATOM   2636 C CG  . GLU A 1 333 ? -8.297  10.827  33.354 1.00 30.83 ? 333  GLU A CG  1 
ATOM   2637 C CD  . GLU A 1 333 ? -7.967  10.744  34.838 1.00 34.50 ? 333  GLU A CD  1 
ATOM   2638 O OE1 . GLU A 1 333 ? -6.893  10.191  35.170 1.00 33.16 ? 333  GLU A OE1 1 
ATOM   2639 O OE2 . GLU A 1 333 ? -8.763  11.235  35.670 1.00 36.35 ? 333  GLU A OE2 1 
ATOM   2640 N N   . THR A 1 334 ? -7.256  7.420   30.249 1.00 29.09 ? 334  THR A N   1 
ATOM   2641 C CA  . THR A 1 334 ? -6.312  6.380   29.861 1.00 29.09 ? 334  THR A CA  1 
ATOM   2642 C C   . THR A 1 334 ? -6.435  5.774   28.466 1.00 28.12 ? 334  THR A C   1 
ATOM   2643 O O   . THR A 1 334 ? -7.430  5.956   27.769 1.00 29.43 ? 334  THR A O   1 
ATOM   2644 C CB  . THR A 1 334 ? -6.352  5.218   30.881 1.00 29.52 ? 334  THR A CB  1 
ATOM   2645 O OG1 . THR A 1 334 ? -7.429  4.333   30.565 1.00 30.84 ? 334  THR A OG1 1 
ATOM   2646 C CG2 . THR A 1 334 ? -6.585  5.756   32.284 1.00 30.44 ? 334  THR A CG2 1 
ATOM   2647 N N   . GLN A 1 335 ? -5.379  5.058   28.086 1.00 27.81 ? 335  GLN A N   1 
ATOM   2648 C CA  . GLN A 1 335 ? -5.265  4.360   26.807 1.00 28.82 ? 335  GLN A CA  1 
ATOM   2649 C C   . GLN A 1 335 ? -4.657  2.996   27.132 1.00 27.88 ? 335  GLN A C   1 
ATOM   2650 O O   . GLN A 1 335 ? -3.525  2.925   27.608 1.00 28.30 ? 335  GLN A O   1 
ATOM   2651 C CB  . GLN A 1 335 ? -4.325  5.116   25.864 1.00 28.66 ? 335  GLN A CB  1 
ATOM   2652 C CG  . GLN A 1 335 ? -3.970  4.376   24.580 1.00 30.76 ? 335  GLN A CG  1 
ATOM   2653 C CD  . GLN A 1 335 ? -5.180  4.148   23.686 1.00 31.29 ? 335  GLN A CD  1 
ATOM   2654 O OE1 . GLN A 1 335 ? -5.854  5.098   23.283 1.00 33.49 ? 335  GLN A OE1 1 
ATOM   2655 N NE2 . GLN A 1 335 ? -5.461  2.887   23.375 1.00 30.91 ? 335  GLN A NE2 1 
ATOM   2656 N N   . ALA A 1 336 ? -5.402  1.920   26.879 1.00 28.45 ? 336  ALA A N   1 
ATOM   2657 C CA  . ALA A 1 336 ? -4.901  0.565   27.153 1.00 27.71 ? 336  ALA A CA  1 
ATOM   2658 C C   . ALA A 1 336 ? -4.262  -0.082  25.925 1.00 28.84 ? 336  ALA A C   1 
ATOM   2659 O O   . ALA A 1 336 ? -4.754  0.068   24.805 1.00 29.30 ? 336  ALA A O   1 
ATOM   2660 C CB  . ALA A 1 336 ? -6.047  -0.319  27.676 1.00 26.02 ? 336  ALA A CB  1 
ATOM   2661 N N   . VAL A 1 337 ? -3.162  -0.799  26.140 1.00 29.69 ? 337  VAL A N   1 
ATOM   2662 C CA  . VAL A 1 337 ? -2.459  -1.481  25.053 1.00 30.24 ? 337  VAL A CA  1 
ATOM   2663 C C   . VAL A 1 337 ? -2.436  -2.962  25.423 1.00 29.29 ? 337  VAL A C   1 
ATOM   2664 O O   . VAL A 1 337 ? -1.786  -3.366  26.396 1.00 29.83 ? 337  VAL A O   1 
ATOM   2665 C CB  . VAL A 1 337 ? -1.031  -0.941  24.886 1.00 30.45 ? 337  VAL A CB  1 
ATOM   2666 C CG1 . VAL A 1 337 ? -0.262  -1.640  23.763 1.00 33.41 ? 337  VAL A CG1 1 
ATOM   2667 C CG2 . VAL A 1 337 ? -1.002  0.552   24.557 1.00 31.61 ? 337  VAL A CG2 1 
ATOM   2668 N N   . LEU A 1 338 ? -3.154  -3.752  24.649 1.00 30.12 ? 338  LEU A N   1 
ATOM   2669 C CA  . LEU A 1 338 ? -3.321  -5.177  24.965 1.00 30.49 ? 338  LEU A CA  1 
ATOM   2670 C C   . LEU A 1 338 ? -2.816  -6.107  23.853 1.00 31.88 ? 338  LEU A C   1 
ATOM   2671 O O   . LEU A 1 338 ? -3.609  -6.646  23.062 1.00 32.09 ? 338  LEU A O   1 
ATOM   2672 C CB  . LEU A 1 338 ? -4.799  -5.452  25.225 1.00 26.94 ? 338  LEU A CB  1 
ATOM   2673 C CG  . LEU A 1 338 ? -5.399  -4.474  26.243 1.00 26.84 ? 338  LEU A CG  1 
ATOM   2674 C CD1 . LEU A 1 338 ? -6.921  -4.569  26.341 1.00 28.69 ? 338  LEU A CD1 1 
ATOM   2675 C CD2 . LEU A 1 338 ? -4.875  -4.698  27.664 1.00 24.57 ? 338  LEU A CD2 1 
ATOM   2676 N N   . PRO A 1 339 ? -1.493  -6.316  23.748 1.00 32.97 ? 339  PRO A N   1 
ATOM   2677 C CA  . PRO A 1 339 ? -0.926  -7.257  22.792 1.00 32.77 ? 339  PRO A CA  1 
ATOM   2678 C C   . PRO A 1 339 ? -1.272  -8.679  23.175 1.00 31.46 ? 339  PRO A C   1 
ATOM   2679 O O   . PRO A 1 339 ? -1.064  -9.071  24.361 1.00 30.10 ? 339  PRO A O   1 
ATOM   2680 C CB  . PRO A 1 339 ? 0.567   -7.092  22.953 1.00 33.61 ? 339  PRO A CB  1 
ATOM   2681 C CG  . PRO A 1 339 ? 0.805   -6.082  24.064 1.00 36.18 ? 339  PRO A CG  1 
ATOM   2682 C CD  . PRO A 1 339 ? -0.518  -5.608  24.579 1.00 33.65 ? 339  PRO A CD  1 
ATOM   2683 N N   . TYR A 1 340 ? -1.778  -9.447  22.224 1.00 31.31 ? 340  TYR A N   1 
ATOM   2684 C CA  . TYR A 1 340 ? -2.085  -10.869 22.476 1.00 31.16 ? 340  TYR A CA  1 
ATOM   2685 C C   . TYR A 1 340 ? -0.891  -11.703 22.015 1.00 32.05 ? 340  TYR A C   1 
ATOM   2686 O O   . TYR A 1 340 ? -0.982  -12.471 21.047 1.00 32.68 ? 340  TYR A O   1 
ATOM   2687 C CB  . TYR A 1 340 ? -3.362  -11.285 21.741 1.00 30.04 ? 340  TYR A CB  1 
ATOM   2688 C CG  . TYR A 1 340 ? -4.609  -11.046 22.590 1.00 27.04 ? 340  TYR A CG  1 
ATOM   2689 C CD1 . TYR A 1 340 ? -4.903  -9.753  23.028 1.00 27.09 ? 340  TYR A CD1 1 
ATOM   2690 C CD2 . TYR A 1 340 ? -5.449  -12.113 22.937 1.00 26.93 ? 340  TYR A CD2 1 
ATOM   2691 C CE1 . TYR A 1 340 ? -6.028  -9.521  23.821 1.00 25.44 ? 340  TYR A CE1 1 
ATOM   2692 C CE2 . TYR A 1 340 ? -6.576  -11.881 23.734 1.00 26.98 ? 340  TYR A CE2 1 
ATOM   2693 C CZ  . TYR A 1 340 ? -6.863  -10.585 24.178 1.00 29.16 ? 340  TYR A CZ  1 
ATOM   2694 O OH  . TYR A 1 340 ? -7.953  -10.358 24.958 1.00 27.69 ? 340  TYR A OH  1 
ATOM   2695 N N   . ASP A 1 341 ? 0.199   -11.510 22.743 1.00 33.64 ? 341  ASP A N   1 
ATOM   2696 C CA  . ASP A 1 341 ? 1.488   -12.152 22.445 1.00 32.71 ? 341  ASP A CA  1 
ATOM   2697 C C   . ASP A 1 341 ? 2.419   -12.067 23.665 1.00 32.08 ? 341  ASP A C   1 
ATOM   2698 O O   . ASP A 1 341 ? 2.788   -10.976 24.114 1.00 32.47 ? 341  ASP A O   1 
ATOM   2699 C CB  . ASP A 1 341 ? 2.127   -11.410 21.270 1.00 35.15 ? 341  ASP A CB  1 
ATOM   2700 C CG  . ASP A 1 341 ? 3.401   -12.062 20.752 1.00 40.30 ? 341  ASP A CG  1 
ATOM   2701 O OD1 . ASP A 1 341 ? 3.331   -12.957 19.828 1.00 41.31 ? 341  ASP A OD1 1 
ATOM   2702 O OD2 . ASP A 1 341 ? 4.544   -11.712 21.233 1.00 41.73 ? 341  ASP A OD2 1 
ATOM   2703 N N   . GLN A 1 342 ? 2.794   -13.230 24.177 1.00 31.13 ? 342  GLN A N   1 
ATOM   2704 C CA  . GLN A 1 342 ? 3.667   -13.322 25.366 1.00 32.21 ? 342  GLN A CA  1 
ATOM   2705 C C   . GLN A 1 342 ? 5.011   -12.637 25.115 1.00 32.52 ? 342  GLN A C   1 
ATOM   2706 O O   . GLN A 1 342 ? 5.582   -12.036 26.019 1.00 31.27 ? 342  GLN A O   1 
ATOM   2707 C CB  . GLN A 1 342 ? 3.908   -14.787 25.742 1.00 34.02 ? 342  GLN A CB  1 
ATOM   2708 C CG  . GLN A 1 342 ? 4.561   -14.959 27.122 1.00 35.14 ? 342  GLN A CG  1 
ATOM   2709 C CD  . GLN A 1 342 ? 3.763   -14.320 28.266 1.00 35.99 ? 342  GLN A CD  1 
ATOM   2710 O OE1 . GLN A 1 342 ? 2.536   -14.244 28.199 1.00 34.25 ? 342  GLN A OE1 1 
ATOM   2711 N NE2 . GLN A 1 342 ? 4.397   -13.853 29.328 1.00 37.31 ? 342  GLN A NE2 1 
ATOM   2712 N N   . TYR A 1 343 ? 5.517   -12.716 23.890 1.00 31.07 ? 343  TYR A N   1 
ATOM   2713 C CA  . TYR A 1 343 ? 6.790   -12.078 23.586 1.00 32.81 ? 343  TYR A CA  1 
ATOM   2714 C C   . TYR A 1 343 ? 6.720   -10.554 23.730 1.00 33.61 ? 343  TYR A C   1 
ATOM   2715 O O   . TYR A 1 343 ? 7.735   -9.906  23.987 1.00 34.13 ? 343  TYR A O   1 
ATOM   2716 C CB  . TYR A 1 343 ? 7.252   -12.465 22.177 1.00 33.77 ? 343  TYR A CB  1 
ATOM   2717 C CG  . TYR A 1 343 ? 7.893   -13.841 22.113 1.00 32.14 ? 343  TYR A CG  1 
ATOM   2718 C CD1 . TYR A 1 343 ? 7.508   -14.769 21.148 1.00 35.27 ? 343  TYR A CD1 1 
ATOM   2719 C CD2 . TYR A 1 343 ? 8.917   -14.193 22.995 1.00 36.24 ? 343  TYR A CD2 1 
ATOM   2720 C CE1 . TYR A 1 343 ? 8.132   -16.020 21.058 1.00 34.27 ? 343  TYR A CE1 1 
ATOM   2721 C CE2 . TYR A 1 343 ? 9.548   -15.439 22.916 1.00 35.90 ? 343  TYR A CE2 1 
ATOM   2722 C CZ  . TYR A 1 343 ? 9.152   -16.344 21.945 1.00 36.00 ? 343  TYR A CZ  1 
ATOM   2723 O OH  . TYR A 1 343 ? 9.787   -17.564 21.858 1.00 37.09 ? 343  TYR A OH  1 
ATOM   2724 N N   . LEU A 1 344 ? 5.525   -9.985  23.576 1.00 32.47 ? 344  LEU A N   1 
ATOM   2725 C CA  . LEU A 1 344 ? 5.347   -8.535  23.707 1.00 33.07 ? 344  LEU A CA  1 
ATOM   2726 C C   . LEU A 1 344 ? 4.932   -8.127  25.129 1.00 31.64 ? 344  LEU A C   1 
ATOM   2727 O O   . LEU A 1 344 ? 4.278   -7.100  25.327 1.00 30.33 ? 344  LEU A O   1 
ATOM   2728 C CB  . LEU A 1 344 ? 4.306   -8.033  22.687 1.00 32.53 ? 344  LEU A CB  1 
ATOM   2729 C CG  . LEU A 1 344 ? 4.737   -8.001  21.210 1.00 33.73 ? 344  LEU A CG  1 
ATOM   2730 C CD1 . LEU A 1 344 ? 3.530   -7.747  20.308 1.00 34.62 ? 344  LEU A CD1 1 
ATOM   2731 C CD2 . LEU A 1 344 ? 5.795   -6.919  20.996 1.00 32.22 ? 344  LEU A CD2 1 
ATOM   2732 N N   . HIS A 1 345 ? 5.333   -8.914  26.125 1.00 32.01 ? 345  HIS A N   1 
ATOM   2733 C CA  . HIS A 1 345 ? 4.974   -8.606  27.512 1.00 31.77 ? 345  HIS A CA  1 
ATOM   2734 C C   . HIS A 1 345 ? 5.514   -7.274  28.068 1.00 30.32 ? 345  HIS A C   1 
ATOM   2735 O O   . HIS A 1 345 ? 5.039   -6.799  29.099 1.00 33.35 ? 345  HIS A O   1 
ATOM   2736 C CB  . HIS A 1 345 ? 5.352   -9.784  28.436 1.00 30.34 ? 345  HIS A CB  1 
ATOM   2737 C CG  . HIS A 1 345 ? 6.825   -9.972  28.636 1.00 35.18 ? 345  HIS A CG  1 
ATOM   2738 N ND1 . HIS A 1 345 ? 7.480   -9.546  29.772 1.00 33.44 ? 345  HIS A ND1 1 
ATOM   2739 C CD2 . HIS A 1 345 ? 7.759   -10.590 27.873 1.00 35.25 ? 345  HIS A CD2 1 
ATOM   2740 C CE1 . HIS A 1 345 ? 8.752   -9.898  29.703 1.00 36.99 ? 345  HIS A CE1 1 
ATOM   2741 N NE2 . HIS A 1 345 ? 8.947   -10.533 28.561 1.00 38.56 ? 345  HIS A NE2 1 
ATOM   2742 N N   . ARG A 1 346 ? 6.487   -6.659  27.398 1.00 30.56 ? 346  ARG A N   1 
ATOM   2743 C CA  . ARG A 1 346 ? 7.006   -5.363  27.869 1.00 32.73 ? 346  ARG A CA  1 
ATOM   2744 C C   . ARG A 1 346 ? 6.639   -4.238  26.891 1.00 31.93 ? 346  ARG A C   1 
ATOM   2745 O O   . ARG A 1 346 ? 7.082   -3.098  27.052 1.00 33.64 ? 346  ARG A O   1 
ATOM   2746 C CB  . ARG A 1 346 ? 8.535   -5.401  28.037 1.00 33.59 ? 346  ARG A CB  1 
ATOM   2747 C CG  . ARG A 1 346 ? 9.061   -6.283  29.174 1.00 35.05 ? 346  ARG A CG  1 
ATOM   2748 C CD  . ARG A 1 346 ? 8.940   -5.597  30.532 1.00 38.72 ? 346  ARG A CD  1 
ATOM   2749 N NE  . ARG A 1 346 ? 7.562   -5.586  31.004 1.00 39.79 ? 346  ARG A NE  1 
ATOM   2750 C CZ  . ARG A 1 346 ? 7.100   -4.791  31.962 1.00 38.41 ? 346  ARG A CZ  1 
ATOM   2751 N NH1 . ARG A 1 346 ? 7.902   -3.924  32.566 1.00 35.60 ? 346  ARG A NH1 1 
ATOM   2752 N NH2 . ARG A 1 346 ? 5.828   -4.870  32.319 1.00 38.72 ? 346  ARG A NH2 1 
ATOM   2753 N N   . PHE A 1 347 ? 5.825   -4.569  25.889 1.00 31.75 ? 347  PHE A N   1 
ATOM   2754 C CA  . PHE A 1 347 ? 5.402   -3.614  24.864 1.00 33.80 ? 347  PHE A CA  1 
ATOM   2755 C C   . PHE A 1 347 ? 4.604   -2.445  25.439 1.00 33.43 ? 347  PHE A C   1 
ATOM   2756 O O   . PHE A 1 347 ? 4.919   -1.285  25.179 1.00 33.90 ? 347  PHE A O   1 
ATOM   2757 C CB  . PHE A 1 347 ? 4.563   -4.334  23.797 1.00 34.12 ? 347  PHE A CB  1 
ATOM   2758 C CG  . PHE A 1 347 ? 4.274   -3.503  22.570 1.00 34.47 ? 347  PHE A CG  1 
ATOM   2759 C CD1 . PHE A 1 347 ? 5.254   -3.301  21.598 1.00 34.68 ? 347  PHE A CD1 1 
ATOM   2760 C CD2 . PHE A 1 347 ? 3.020   -2.927  22.384 1.00 34.87 ? 347  PHE A CD2 1 
ATOM   2761 C CE1 . PHE A 1 347 ? 4.990   -2.536  20.453 1.00 33.44 ? 347  PHE A CE1 1 
ATOM   2762 C CE2 . PHE A 1 347 ? 2.741   -2.155  21.241 1.00 37.16 ? 347  PHE A CE2 1 
ATOM   2763 C CZ  . PHE A 1 347 ? 3.729   -1.962  20.275 1.00 35.76 ? 347  PHE A CZ  1 
ATOM   2764 N N   . ALA A 1 348 ? 3.568   -2.752  26.215 1.00 33.35 ? 348  ALA A N   1 
ATOM   2765 C CA  . ALA A 1 348 ? 2.738   -1.713  26.814 1.00 33.41 ? 348  ALA A CA  1 
ATOM   2766 C C   . ALA A 1 348 ? 3.592   -0.836  27.724 1.00 32.38 ? 348  ALA A C   1 
ATOM   2767 O O   . ALA A 1 348 ? 3.457   0.386   27.729 1.00 31.28 ? 348  ALA A O   1 
ATOM   2768 C CB  . ALA A 1 348 ? 1.589   -2.344  27.600 1.00 32.44 ? 348  ALA A CB  1 
ATOM   2769 N N   . ALA A 1 349 ? 4.490   -1.458  28.482 1.00 32.95 ? 349  ALA A N   1 
ATOM   2770 C CA  . ALA A 1 349 ? 5.363   -0.703  29.379 1.00 32.99 ? 349  ALA A CA  1 
ATOM   2771 C C   . ALA A 1 349 ? 6.291   0.243   28.603 1.00 34.11 ? 349  ALA A C   1 
ATOM   2772 O O   . ALA A 1 349 ? 6.614   1.344   29.077 1.00 33.51 ? 349  ALA A O   1 
ATOM   2773 C CB  . ALA A 1 349 ? 6.186   -1.667  30.246 1.00 31.83 ? 349  ALA A CB  1 
ATOM   2774 N N   . TYR A 1 350 ? 6.712   -0.180  27.412 1.00 33.58 ? 350  TYR A N   1 
ATOM   2775 C CA  . TYR A 1 350 ? 7.600   0.635   26.582 1.00 32.91 ? 350  TYR A CA  1 
ATOM   2776 C C   . TYR A 1 350 ? 6.936   1.953   26.174 1.00 33.88 ? 350  TYR A C   1 
ATOM   2777 O O   . TYR A 1 350 ? 7.545   3.028   26.271 1.00 30.24 ? 350  TYR A O   1 
ATOM   2778 C CB  . TYR A 1 350 ? 8.007   -0.120  25.315 1.00 33.45 ? 350  TYR A CB  1 
ATOM   2779 C CG  . TYR A 1 350 ? 8.854   0.721   24.378 1.00 34.67 ? 350  TYR A CG  1 
ATOM   2780 C CD1 . TYR A 1 350 ? 10.204  0.940   24.643 1.00 32.24 ? 350  TYR A CD1 1 
ATOM   2781 C CD2 . TYR A 1 350 ? 8.293   1.329   23.249 1.00 34.40 ? 350  TYR A CD2 1 
ATOM   2782 C CE1 . TYR A 1 350 ? 10.984  1.746   23.806 1.00 35.69 ? 350  TYR A CE1 1 
ATOM   2783 C CE2 . TYR A 1 350 ? 9.059   2.140   22.409 1.00 34.20 ? 350  TYR A CE2 1 
ATOM   2784 C CZ  . TYR A 1 350 ? 10.405  2.342   22.695 1.00 35.43 ? 350  TYR A CZ  1 
ATOM   2785 O OH  . TYR A 1 350 ? 11.173  3.146   21.883 1.00 34.07 ? 350  TYR A OH  1 
ATOM   2786 N N   . PHE A 1 351 ? 5.692   1.864   25.707 1.00 33.36 ? 351  PHE A N   1 
ATOM   2787 C CA  . PHE A 1 351 ? 4.969   3.056   25.286 1.00 34.29 ? 351  PHE A CA  1 
ATOM   2788 C C   . PHE A 1 351 ? 4.383   3.839   26.445 1.00 35.84 ? 351  PHE A C   1 
ATOM   2789 O O   . PHE A 1 351 ? 3.978   4.997   26.295 1.00 35.22 ? 351  PHE A O   1 
ATOM   2790 C CB  . PHE A 1 351 ? 3.909   2.691   24.249 1.00 37.04 ? 351  PHE A CB  1 
ATOM   2791 C CG  . PHE A 1 351 ? 4.490   2.465   22.883 1.00 37.94 ? 351  PHE A CG  1 
ATOM   2792 C CD1 . PHE A 1 351 ? 4.624   1.183   22.364 1.00 40.53 ? 351  PHE A CD1 1 
ATOM   2793 C CD2 . PHE A 1 351 ? 4.999   3.536   22.158 1.00 40.05 ? 351  PHE A CD2 1 
ATOM   2794 C CE1 . PHE A 1 351 ? 5.268   0.974   21.138 1.00 39.40 ? 351  PHE A CE1 1 
ATOM   2795 C CE2 . PHE A 1 351 ? 5.643   3.331   20.934 1.00 39.77 ? 351  PHE A CE2 1 
ATOM   2796 C CZ  . PHE A 1 351 ? 5.774   2.050   20.432 1.00 38.14 ? 351  PHE A CZ  1 
ATOM   2797 N N   . GLN A 1 352 ? 4.349   3.208   27.613 1.00 34.71 ? 352  GLN A N   1 
ATOM   2798 C CA  . GLN A 1 352 ? 3.879   3.891   28.805 1.00 35.61 ? 352  GLN A CA  1 
ATOM   2799 C C   . GLN A 1 352 ? 4.897   5.021   28.975 1.00 35.46 ? 352  GLN A C   1 
ATOM   2800 O O   . GLN A 1 352 ? 4.545   6.154   29.309 1.00 33.54 ? 352  GLN A O   1 
ATOM   2801 C CB  . GLN A 1 352 ? 3.917   2.938   30.001 1.00 34.80 ? 352  GLN A CB  1 
ATOM   2802 C CG  . GLN A 1 352 ? 3.395   3.530   31.276 1.00 35.44 ? 352  GLN A CG  1 
ATOM   2803 C CD  . GLN A 1 352 ? 3.226   2.476   32.346 1.00 34.23 ? 352  GLN A CD  1 
ATOM   2804 O OE1 . GLN A 1 352 ? 4.198   1.855   32.782 1.00 32.76 ? 352  GLN A OE1 1 
ATOM   2805 N NE2 . GLN A 1 352 ? 1.982   2.256   32.764 1.00 27.21 ? 352  GLN A NE2 1 
ATOM   2806 N N   . GLN A 1 353 ? 6.166   4.705   28.724 1.00 36.20 ? 353  GLN A N   1 
ATOM   2807 C CA  . GLN A 1 353 ? 7.218   5.713   28.813 1.00 35.42 ? 353  GLN A CA  1 
ATOM   2808 C C   . GLN A 1 353 ? 7.189   6.601   27.573 1.00 37.04 ? 353  GLN A C   1 
ATOM   2809 O O   . GLN A 1 353 ? 7.102   7.823   27.673 1.00 38.81 ? 353  GLN A O   1 
ATOM   2810 C CB  . GLN A 1 353 ? 8.608   5.077   28.907 1.00 37.03 ? 353  GLN A CB  1 
ATOM   2811 C CG  . GLN A 1 353 ? 9.711   6.118   28.686 1.00 37.95 ? 353  GLN A CG  1 
ATOM   2812 C CD  . GLN A 1 353 ? 11.109  5.607   28.953 1.00 38.66 ? 353  GLN A CD  1 
ATOM   2813 O OE1 . GLN A 1 353 ? 11.312  4.404   29.131 1.00 40.58 ? 353  GLN A OE1 1 
ATOM   2814 N NE2 . GLN A 1 353 ? 12.079  6.508   28.988 1.00 38.32 ? 353  GLN A NE2 1 
ATOM   2815 N N   . GLY A 1 354 ? 7.266   5.972   26.407 1.00 35.62 ? 354  GLY A N   1 
ATOM   2816 C CA  . GLY A 1 354 ? 7.268   6.715   25.159 1.00 35.56 ? 354  GLY A CA  1 
ATOM   2817 C C   . GLY A 1 354 ? 6.177   7.762   25.040 1.00 36.33 ? 354  GLY A C   1 
ATOM   2818 O O   . GLY A 1 354 ? 6.451   8.899   24.653 1.00 35.99 ? 354  GLY A O   1 
ATOM   2819 N N   . ASP A 1 355 ? 4.946   7.379   25.374 1.00 32.10 ? 355  ASP A N   1 
ATOM   2820 C CA  . ASP A 1 355 ? 3.789   8.268   25.286 1.00 33.66 ? 355  ASP A CA  1 
ATOM   2821 C C   . ASP A 1 355 ? 3.728   9.306   26.409 1.00 33.38 ? 355  ASP A C   1 
ATOM   2822 O O   . ASP A 1 355 ? 3.661   10.519  26.157 1.00 31.87 ? 355  ASP A O   1 
ATOM   2823 C CB  . ASP A 1 355 ? 2.497   7.433   25.301 1.00 33.62 ? 355  ASP A CB  1 
ATOM   2824 C CG  . ASP A 1 355 ? 1.289   8.184   24.745 1.00 36.48 ? 355  ASP A CG  1 
ATOM   2825 O OD1 . ASP A 1 355 ? 1.079   9.365   25.101 1.00 36.30 ? 355  ASP A OD1 1 
ATOM   2826 O OD2 . ASP A 1 355 ? 0.533   7.580   23.956 1.00 36.71 ? 355  ASP A OD2 1 
ATOM   2827 N N   . MET A 1 356 ? 3.752   8.827   27.650 1.00 33.57 ? 356  MET A N   1 
ATOM   2828 C CA  . MET A 1 356 ? 3.651   9.704   28.813 1.00 32.37 ? 356  MET A CA  1 
ATOM   2829 C C   . MET A 1 356 ? 4.811   10.675  29.016 1.00 32.23 ? 356  MET A C   1 
ATOM   2830 O O   . MET A 1 356 ? 4.592   11.813  29.424 1.00 31.86 ? 356  MET A O   1 
ATOM   2831 C CB  . MET A 1 356 ? 3.434   8.863   30.077 1.00 31.78 ? 356  MET A CB  1 
ATOM   2832 C CG  . MET A 1 356 ? 2.113   8.092   30.033 1.00 33.59 ? 356  MET A CG  1 
ATOM   2833 S SD  . MET A 1 356 ? 1.883   6.892   31.355 1.00 30.37 ? 356  MET A SD  1 
ATOM   2834 C CE  . MET A 1 356 ? 1.369   7.916   32.679 1.00 30.99 ? 356  MET A CE  1 
ATOM   2835 N N   . GLU A 1 357 ? 6.034   10.244  28.735 1.00 33.85 ? 357  GLU A N   1 
ATOM   2836 C CA  . GLU A 1 357 ? 7.171   11.138  28.913 1.00 36.23 ? 357  GLU A CA  1 
ATOM   2837 C C   . GLU A 1 357 ? 7.175   12.176  27.794 1.00 37.40 ? 357  GLU A C   1 
ATOM   2838 O O   . GLU A 1 357 ? 7.718   13.275  27.947 1.00 38.21 ? 357  GLU A O   1 
ATOM   2839 C CB  . GLU A 1 357 ? 8.484   10.359  28.902 1.00 38.35 ? 357  GLU A CB  1 
ATOM   2840 C CG  . GLU A 1 357 ? 9.664   11.205  29.337 1.00 39.81 ? 357  GLU A CG  1 
ATOM   2841 C CD  . GLU A 1 357 ? 10.973  10.448  29.343 1.00 41.40 ? 357  GLU A CD  1 
ATOM   2842 O OE1 . GLU A 1 357 ? 11.955  10.989  29.889 1.00 43.39 ? 357  GLU A OE1 1 
ATOM   2843 O OE2 . GLU A 1 357 ? 11.026  9.323   28.802 1.00 43.50 ? 357  GLU A OE2 1 
ATOM   2844 N N   . SER A 1 358 ? 6.567   11.819  26.666 1.00 36.16 ? 358  SER A N   1 
ATOM   2845 C CA  . SER A 1 358 ? 6.488   12.728  25.532 1.00 35.86 ? 358  SER A CA  1 
ATOM   2846 C C   . SER A 1 358 ? 5.393   13.763  25.720 1.00 36.25 ? 358  SER A C   1 
ATOM   2847 O O   . SER A 1 358 ? 5.665   14.961  25.749 1.00 36.50 ? 358  SER A O   1 
ATOM   2848 C CB  . SER A 1 358 ? 6.207   11.968  24.225 1.00 35.08 ? 358  SER A CB  1 
ATOM   2849 O OG  . SER A 1 358 ? 7.327   11.221  23.790 1.00 32.66 ? 358  SER A OG  1 
ATOM   2850 N N   . ASN A 1 359 ? 4.153   13.296  25.864 1.00 34.76 ? 359  ASN A N   1 
ATOM   2851 C CA  . ASN A 1 359 ? 3.023   14.203  25.972 1.00 33.17 ? 359  ASN A CA  1 
ATOM   2852 C C   . ASN A 1 359 ? 2.427   14.516  27.339 1.00 32.50 ? 359  ASN A C   1 
ATOM   2853 O O   . ASN A 1 359 ? 1.335   15.064  27.418 1.00 31.57 ? 359  ASN A O   1 
ATOM   2854 C CB  . ASN A 1 359 ? 1.920   13.745  25.013 1.00 35.02 ? 359  ASN A CB  1 
ATOM   2855 C CG  . ASN A 1 359 ? 2.402   13.683  23.569 1.00 34.18 ? 359  ASN A CG  1 
ATOM   2856 O OD1 . ASN A 1 359 ? 3.432   14.261  23.226 1.00 33.93 ? 359  ASN A OD1 1 
ATOM   2857 N ND2 . ASN A 1 359 ? 1.650   12.994  22.715 1.00 33.98 ? 359  ASN A ND2 1 
ATOM   2858 N N   . GLY A 1 360 ? 3.141   14.180  28.406 1.00 31.96 ? 360  GLY A N   1 
ATOM   2859 C CA  . GLY A 1 360 ? 2.663   14.506  29.739 1.00 33.22 ? 360  GLY A CA  1 
ATOM   2860 C C   . GLY A 1 360 ? 3.164   15.914  30.026 1.00 33.30 ? 360  GLY A C   1 
ATOM   2861 O O   . GLY A 1 360 ? 4.048   16.110  30.852 1.00 31.81 ? 360  GLY A O   1 
ATOM   2862 N N   . LYS A 1 361 ? 2.583   16.893  29.334 1.00 34.94 ? 361  LYS A N   1 
ATOM   2863 C CA  . LYS A 1 361 ? 2.990   18.294  29.452 1.00 36.35 ? 361  LYS A CA  1 
ATOM   2864 C C   . LYS A 1 361 ? 1.778   19.212  29.627 1.00 37.36 ? 361  LYS A C   1 
ATOM   2865 O O   . LYS A 1 361 ? 0.647   18.811  29.356 1.00 37.49 ? 361  LYS A O   1 
ATOM   2866 C CB  . LYS A 1 361 ? 3.746   18.704  28.184 1.00 35.97 ? 361  LYS A CB  1 
ATOM   2867 C CG  . LYS A 1 361 ? 4.843   17.733  27.737 1.00 36.03 ? 361  LYS A CG  1 
ATOM   2868 C CD  . LYS A 1 361 ? 6.116   17.907  28.552 1.00 33.10 ? 361  LYS A CD  1 
ATOM   2869 C CE  . LYS A 1 361 ? 7.116   16.805  28.258 1.00 32.71 ? 361  LYS A CE  1 
ATOM   2870 N NZ  . LYS A 1 361 ? 7.458   16.709  26.813 1.00 33.99 ? 361  LYS A NZ  1 
ATOM   2871 N N   . TYR A 1 362 ? 2.020   20.447  30.070 1.00 37.01 ? 362  TYR A N   1 
ATOM   2872 C CA  . TYR A 1 362 ? 0.933   21.403  30.255 1.00 36.91 ? 362  TYR A CA  1 
ATOM   2873 C C   . TYR A 1 362 ? 1.259   22.811  29.730 1.00 36.80 ? 362  TYR A C   1 
ATOM   2874 O O   . TYR A 1 362 ? 0.439   23.721  29.839 1.00 36.26 ? 362  TYR A O   1 
ATOM   2875 C CB  . TYR A 1 362 ? 0.523   21.462  31.740 1.00 38.12 ? 362  TYR A CB  1 
ATOM   2876 C CG  . TYR A 1 362 ? 1.459   22.237  32.647 1.00 39.26 ? 362  TYR A CG  1 
ATOM   2877 C CD1 . TYR A 1 362 ? 1.054   23.442  33.224 1.00 40.00 ? 362  TYR A CD1 1 
ATOM   2878 C CD2 . TYR A 1 362 ? 2.748   21.777  32.919 1.00 40.72 ? 362  TYR A CD2 1 
ATOM   2879 C CE1 . TYR A 1 362 ? 1.910   24.172  34.047 1.00 40.54 ? 362  TYR A CE1 1 
ATOM   2880 C CE2 . TYR A 1 362 ? 3.615   22.500  33.742 1.00 39.88 ? 362  TYR A CE2 1 
ATOM   2881 C CZ  . TYR A 1 362 ? 3.188   23.696  34.300 1.00 42.08 ? 362  TYR A CZ  1 
ATOM   2882 O OH  . TYR A 1 362 ? 4.039   24.423  35.104 1.00 42.39 ? 362  TYR A OH  1 
ATOM   2883 N N   . ILE A 1 363 ? 2.443   22.982  29.147 1.00 38.32 ? 363  ILE A N   1 
ATOM   2884 C CA  . ILE A 1 363 ? 2.852   24.283  28.597 1.00 40.67 ? 363  ILE A CA  1 
ATOM   2885 C C   . ILE A 1 363 ? 3.049   24.180  27.079 1.00 41.25 ? 363  ILE A C   1 
ATOM   2886 O O   . ILE A 1 363 ? 3.794   23.327  26.601 1.00 41.66 ? 363  ILE A O   1 
ATOM   2887 C CB  . ILE A 1 363 ? 4.180   24.783  29.239 1.00 41.26 ? 363  ILE A CB  1 
ATOM   2888 C CG1 . ILE A 1 363 ? 4.046   24.850  30.761 1.00 38.31 ? 363  ILE A CG1 1 
ATOM   2889 C CG2 . ILE A 1 363 ? 4.537   26.170  28.698 1.00 43.64 ? 363  ILE A CG2 1 
ATOM   2890 C CD1 . ILE A 1 363 ? 2.968   25.781  31.248 1.00 38.59 ? 363  ILE A CD1 1 
ATOM   2891 N N   . THR A 1 364 ? 2.379   25.046  26.319 1.00 43.24 ? 364  THR A N   1 
ATOM   2892 C CA  . THR A 1 364 ? 2.504   25.018  24.863 1.00 44.31 ? 364  THR A CA  1 
ATOM   2893 C C   . THR A 1 364 ? 3.865   25.550  24.434 1.00 46.01 ? 364  THR A C   1 
ATOM   2894 O O   . THR A 1 364 ? 4.610   26.097  25.248 1.00 45.04 ? 364  THR A O   1 
ATOM   2895 C CB  . THR A 1 364 ? 1.413   25.866  24.171 1.00 45.33 ? 364  THR A CB  1 
ATOM   2896 O OG1 . THR A 1 364 ? 1.606   27.248  24.488 1.00 44.93 ? 364  THR A OG1 1 
ATOM   2897 C CG2 . THR A 1 364 ? 0.031   25.427  24.627 1.00 44.13 ? 364  THR A CG2 1 
ATOM   2898 N N   . LYS A 1 365 ? 4.185   25.393  23.154 1.00 47.39 ? 365  LYS A N   1 
ATOM   2899 C CA  . LYS A 1 365 ? 5.467   25.855  22.637 1.00 50.57 ? 365  LYS A CA  1 
ATOM   2900 C C   . LYS A 1 365 ? 5.516   27.375  22.551 1.00 52.04 ? 365  LYS A C   1 
ATOM   2901 O O   . LYS A 1 365 ? 6.555   27.951  22.226 1.00 54.02 ? 365  LYS A O   1 
ATOM   2902 C CB  . LYS A 1 365 ? 5.739   25.243  21.261 1.00 50.10 ? 365  LYS A CB  1 
ATOM   2903 C CG  . LYS A 1 365 ? 5.787   23.724  21.271 1.00 50.93 ? 365  LYS A CG  1 
ATOM   2904 C CD  . LYS A 1 365 ? 6.081   23.142  19.893 1.00 52.91 ? 365  LYS A CD  1 
ATOM   2905 C CE  . LYS A 1 365 ? 7.536   23.316  19.501 1.00 53.17 ? 365  LYS A CE  1 
ATOM   2906 N NZ  . LYS A 1 365 ? 7.825   22.645  18.200 1.00 54.29 ? 365  LYS A NZ  1 
ATOM   2907 N N   . SER A 1 366 ? 4.389   28.021  22.837 1.00 52.16 ? 366  SER A N   1 
ATOM   2908 C CA  . SER A 1 366 ? 4.323   29.478  22.806 1.00 53.35 ? 366  SER A CA  1 
ATOM   2909 C C   . SER A 1 366 ? 4.456   30.001  24.232 1.00 52.57 ? 366  SER A C   1 
ATOM   2910 O O   . SER A 1 366 ? 4.544   31.208  24.456 1.00 53.25 ? 366  SER A O   1 
ATOM   2911 C CB  . SER A 1 366 ? 2.997   29.951  22.196 1.00 53.20 ? 366  SER A CB  1 
ATOM   2912 O OG  . SER A 1 366 ? 1.904   29.717  23.067 1.00 55.55 ? 366  SER A OG  1 
ATOM   2913 N N   . GLY A 1 367 ? 4.472   29.078  25.192 1.00 50.24 ? 367  GLY A N   1 
ATOM   2914 C CA  . GLY A 1 367 ? 4.599   29.455  26.589 1.00 48.90 ? 367  GLY A CA  1 
ATOM   2915 C C   . GLY A 1 367 ? 3.286   29.528  27.350 1.00 46.64 ? 367  GLY A C   1 
ATOM   2916 O O   . GLY A 1 367 ? 3.276   29.799  28.545 1.00 45.52 ? 367  GLY A O   1 
ATOM   2917 N N   . ALA A 1 368 ? 2.174   29.282  26.665 1.00 46.75 ? 368  ALA A N   1 
ATOM   2918 C CA  . ALA A 1 368 ? 0.860   29.341  27.303 1.00 46.06 ? 368  ALA A CA  1 
ATOM   2919 C C   . ALA A 1 368 ? 0.519   28.049  28.044 1.00 45.52 ? 368  ALA A C   1 
ATOM   2920 O O   . ALA A 1 368 ? 0.867   26.963  27.593 1.00 46.42 ? 368  ALA A O   1 
ATOM   2921 C CB  . ALA A 1 368 ? -0.204  29.629  26.255 1.00 44.29 ? 368  ALA A CB  1 
ATOM   2922 N N   . ARG A 1 369 ? -0.162  28.169  29.180 1.00 47.20 ? 369  ARG A N   1 
ATOM   2923 C CA  . ARG A 1 369 ? -0.555  26.990  29.943 1.00 46.93 ? 369  ARG A CA  1 
ATOM   2924 C C   . ARG A 1 369 ? -1.787  26.389  29.246 1.00 46.84 ? 369  ARG A C   1 
ATOM   2925 O O   . ARG A 1 369 ? -2.744  27.103  28.913 1.00 45.37 ? 369  ARG A O   1 
ATOM   2926 C CB  . ARG A 1 369 ? -0.935  27.358  31.374 1.00 49.09 ? 369  ARG A CB  1 
ATOM   2927 C CG  . ARG A 1 369 ? -1.046  26.144  32.289 1.00 51.79 ? 369  ARG A CG  1 
ATOM   2928 C CD  . ARG A 1 369 ? -2.156  26.286  33.327 1.00 55.19 ? 369  ARG A CD  1 
ATOM   2929 N NE  . ARG A 1 369 ? -2.205  25.155  34.258 1.00 58.05 ? 369  ARG A NE  1 
ATOM   2930 C CZ  . ARG A 1 369 ? -3.224  24.913  35.087 1.00 59.56 ? 369  ARG A CZ  1 
ATOM   2931 N NH1 . ARG A 1 369 ? -4.295  25.717  35.115 1.00 60.68 ? 369  ARG A NH1 1 
ATOM   2932 N NH2 . ARG A 1 369 ? -3.266  23.878  35.936 1.00 59.51 ? 369  ARG A NH2 1 
ATOM   2933 N N   . VAL A 1 370 ? -1.753  25.087  29.028 1.00 44.69 ? 370  VAL A N   1 
ATOM   2934 C CA  . VAL A 1 370 ? -2.840  24.390  28.311 1.00 44.70 ? 370  VAL A CA  1 
ATOM   2935 C C   . VAL A 1 370 ? -4.207  24.683  28.943 1.00 43.99 ? 370  VAL A C   1 
ATOM   2936 O O   . VAL A 1 370 ? -4.325  24.830  30.172 1.00 43.25 ? 370  VAL A O   1 
ATOM   2937 C CB  . VAL A 1 370 ? -2.610  22.881  28.288 1.00 42.87 ? 370  VAL A CB  1 
ATOM   2938 C CG1 . VAL A 1 370 ? -1.455  22.475  27.370 1.00 45.19 ? 370  VAL A CG1 1 
ATOM   2939 C CG2 . VAL A 1 370 ? -2.284  22.300  29.659 1.00 41.44 ? 370  VAL A CG2 1 
ATOM   2940 N N   . ASP A 1 371 ? -5.155  24.739  28.028 1.00 45.58 ? 371  ASP A N   1 
ATOM   2941 C CA  . ASP A 1 371 ? -6.570  25.036  28.279 1.00 45.94 ? 371  ASP A CA  1 
ATOM   2942 C C   . ASP A 1 371 ? -7.399  23.754  28.133 1.00 43.94 ? 371  ASP A C   1 
ATOM   2943 O O   . ASP A 1 371 ? -8.639  23.792  28.111 1.00 43.42 ? 371  ASP A O   1 
ATOM   2944 C CB  . ASP A 1 371 ? -7.018  26.060  27.218 1.00 49.37 ? 371  ASP A CB  1 
ATOM   2945 C CG  . ASP A 1 371 ? -8.442  26.587  27.390 1.00 53.14 ? 371  ASP A CG  1 
ATOM   2946 O OD1 . ASP A 1 371 ? -8.635  27.740  27.939 1.00 58.84 ? 371  ASP A OD1 1 
ATOM   2947 O OD2 . ASP A 1 371 ? -9.447  25.893  26.978 1.00 59.63 ? 371  ASP A OD2 1 
ATOM   2948 N N   . HIS A 1 372 ? -6.684  22.641  28.047 1.00 41.37 ? 372  HIS A N   1 
ATOM   2949 C CA  . HIS A 1 372 ? -7.304  21.328  27.814 1.00 38.12 ? 372  HIS A CA  1 
ATOM   2950 C C   . HIS A 1 372 ? -6.413  20.176  28.269 1.00 36.46 ? 372  HIS A C   1 
ATOM   2951 O O   . HIS A 1 372 ? -5.297  20.395  28.735 1.00 30.88 ? 372  HIS A O   1 
ATOM   2952 C CB  . HIS A 1 372 ? -7.495  21.150  26.316 1.00 37.18 ? 372  HIS A CB  1 
ATOM   2953 C CG  . HIS A 1 372 ? -6.219  21.517  25.560 1.00 37.74 ? 372  HIS A CG  1 
ATOM   2954 N ND1 . HIS A 1 372 ? -5.192  20.599  25.371 1.00 37.46 ? 372  HIS A ND1 1 
ATOM   2955 C CD2 . HIS A 1 372 ? -5.809  22.674  24.975 1.00 40.55 ? 372  HIS A CD2 1 
ATOM   2956 C CE1 . HIS A 1 372 ? -4.223  21.198  24.703 1.00 39.08 ? 372  HIS A CE1 1 
ATOM   2957 N NE2 . HIS A 1 372 ? -4.575  22.435  24.459 1.00 40.67 ? 372  HIS A NE2 1 
ATOM   2958 N N   . GLN A 1 373 ? -6.915  18.949  28.103 1.00 35.19 ? 373  GLN A N   1 
ATOM   2959 C CA  . GLN A 1 373 ? -6.168  17.739  28.453 1.00 34.19 ? 373  GLN A CA  1 
ATOM   2960 C C   . GLN A 1 373 ? -5.089  17.421  27.419 1.00 33.09 ? 373  GLN A C   1 
ATOM   2961 O O   . GLN A 1 373 ? -5.237  17.738  26.235 1.00 34.73 ? 373  GLN A O   1 
ATOM   2962 C CB  . GLN A 1 373 ? -7.106  16.524  28.517 1.00 34.54 ? 373  GLN A CB  1 
ATOM   2963 C CG  . GLN A 1 373 ? -8.000  16.454  29.733 1.00 34.51 ? 373  GLN A CG  1 
ATOM   2964 C CD  . GLN A 1 373 ? -7.206  16.409  31.016 1.00 36.32 ? 373  GLN A CD  1 
ATOM   2965 O OE1 . GLN A 1 373 ? -6.249  15.643  31.144 1.00 35.04 ? 373  GLN A OE1 1 
ATOM   2966 N NE2 . GLN A 1 373 ? -7.602  17.225  31.981 1.00 39.37 ? 373  GLN A NE2 1 
ATOM   2967 N N   . THR A 1 374 ? -4.010  16.784  27.867 1.00 32.17 ? 374  THR A N   1 
ATOM   2968 C CA  . THR A 1 374 ? -2.956  16.369  26.955 1.00 29.39 ? 374  THR A CA  1 
ATOM   2969 C C   . THR A 1 374 ? -2.818  14.839  27.008 1.00 30.32 ? 374  THR A C   1 
ATOM   2970 O O   . THR A 1 374 ? -3.823  14.138  26.995 1.00 28.41 ? 374  THR A O   1 
ATOM   2971 C CB  . THR A 1 374 ? -1.591  17.061  27.253 1.00 30.66 ? 374  THR A CB  1 
ATOM   2972 O OG1 . THR A 1 374 ? -1.211  16.863  28.624 1.00 29.09 ? 374  THR A OG1 1 
ATOM   2973 C CG2 . THR A 1 374 ? -1.696  18.577  26.941 1.00 29.93 ? 374  THR A CG2 1 
ATOM   2974 N N   . GLY A 1 375 ? -1.585  14.349  27.086 1.00 29.63 ? 375  GLY A N   1 
ATOM   2975 C CA  . GLY A 1 375 ? -1.207  12.977  27.193 1.00 32.13 ? 375  GLY A CA  1 
ATOM   2976 C C   . GLY A 1 375 ? -1.968  12.115  28.212 1.00 31.36 ? 375  GLY A C   1 
ATOM   2977 O O   . GLY A 1 375 ? -1.965  12.399  29.418 1.00 30.87 ? 375  GLY A O   1 
ATOM   2978 N N   . PRO A 1 376 ? -2.641  11.042  27.735 1.00 33.28 ? 376  PRO A N   1 
ATOM   2979 C CA  . PRO A 1 376 ? -3.312  10.068  28.605 1.00 30.65 ? 376  PRO A CA  1 
ATOM   2980 C C   . PRO A 1 376 ? -2.308  9.221   29.383 1.00 29.20 ? 376  PRO A C   1 
ATOM   2981 O O   . PRO A 1 376 ? -1.072  9.317   29.108 1.00 30.61 ? 376  PRO A O   1 
ATOM   2982 C CB  . PRO A 1 376 ? -4.020  9.143   27.636 1.00 30.63 ? 376  PRO A CB  1 
ATOM   2983 C CG  . PRO A 1 376 ? -3.671  9.585   26.222 1.00 36.77 ? 376  PRO A CG  1 
ATOM   2984 C CD  . PRO A 1 376 ? -2.771  10.779  26.296 1.00 34.68 ? 376  PRO A CD  1 
ATOM   2985 N N   . ILE A 1 377 ? -2.842  8.424   30.323 1.00 27.70 ? 377  ILE A N   1 
ATOM   2986 C CA  . ILE A 1 377 ? -2.056  7.414   31.095 1.00 28.95 ? 377  ILE A CA  1 
ATOM   2987 C C   . ILE A 1 377 ? -2.130  6.133   30.267 1.00 27.87 ? 377  ILE A C   1 
ATOM   2988 O O   . ILE A 1 377 ? -3.227  5.662   29.958 1.00 27.22 ? 377  ILE A O   1 
ATOM   2989 C CB  . ILE A 1 377 ? -2.664  7.209   32.483 1.00 30.57 ? 377  ILE A CB  1 
ATOM   2990 C CG1 . ILE A 1 377 ? -2.408  8.384   33.428 1.00 27.90 ? 377  ILE A CG1 1 
ATOM   2991 C CG2 . ILE A 1 377 ? -2.109  5.974   33.200 1.00 28.54 ? 377  ILE A CG2 1 
ATOM   2992 C CD1 . ILE A 1 377 ? -3.490  8.535   34.499 1.00 29.84 ? 377  ILE A CD1 1 
ATOM   2993 N N   . VAL A 1 378 ? -0.974  5.583   29.901 1.00 27.95 ? 378  VAL A N   1 
ATOM   2994 C CA  . VAL A 1 378 ? -0.920  4.367   29.091 1.00 28.28 ? 378  VAL A CA  1 
ATOM   2995 C C   . VAL A 1 378 ? -0.620  3.152   29.962 1.00 29.48 ? 378  VAL A C   1 
ATOM   2996 O O   . VAL A 1 378 ? 0.230   3.218   30.844 1.00 28.05 ? 378  VAL A O   1 
ATOM   2997 C CB  . VAL A 1 378 ? 0.159   4.487   27.993 1.00 31.51 ? 378  VAL A CB  1 
ATOM   2998 C CG1 . VAL A 1 378 ? 0.223   3.212   27.179 1.00 31.79 ? 378  VAL A CG1 1 
ATOM   2999 C CG2 . VAL A 1 378 ? -0.164  5.672   27.078 1.00 33.19 ? 378  VAL A CG2 1 
ATOM   3000 N N   . TRP A 1 379 ? -1.315  2.045   29.707 1.00 29.37 ? 379  TRP A N   1 
ATOM   3001 C CA  . TRP A 1 379 ? -1.128  0.837   30.505 1.00 27.60 ? 379  TRP A CA  1 
ATOM   3002 C C   . TRP A 1 379 ? -1.631  -0.423  29.798 1.00 29.01 ? 379  TRP A C   1 
ATOM   3003 O O   . TRP A 1 379 ? -2.310  -0.345  28.770 1.00 26.51 ? 379  TRP A O   1 
ATOM   3004 C CB  . TRP A 1 379 ? -1.868  0.981   31.840 1.00 27.53 ? 379  TRP A CB  1 
ATOM   3005 C CG  . TRP A 1 379 ? -3.359  1.070   31.679 1.00 29.18 ? 379  TRP A CG  1 
ATOM   3006 C CD1 . TRP A 1 379 ? -4.071  2.135   31.211 1.00 27.41 ? 379  TRP A CD1 1 
ATOM   3007 C CD2 . TRP A 1 379 ? -4.314  0.032   31.936 1.00 28.38 ? 379  TRP A CD2 1 
ATOM   3008 N NE1 . TRP A 1 379 ? -5.407  1.828   31.157 1.00 27.96 ? 379  TRP A NE1 1 
ATOM   3009 C CE2 . TRP A 1 379 ? -5.585  0.541   31.597 1.00 27.72 ? 379  TRP A CE2 1 
ATOM   3010 C CE3 . TRP A 1 379 ? -4.216  -1.283  32.419 1.00 30.60 ? 379  TRP A CE3 1 
ATOM   3011 C CZ2 . TRP A 1 379 ? -6.757  -0.214  31.725 1.00 27.92 ? 379  TRP A CZ2 1 
ATOM   3012 C CZ3 . TRP A 1 379 ? -5.385  -2.039  32.547 1.00 25.40 ? 379  TRP A CZ3 1 
ATOM   3013 C CH2 . TRP A 1 379 ? -6.638  -1.501  32.201 1.00 28.00 ? 379  TRP A CH2 1 
ATOM   3014 N N   . GLY A 1 380 ? -1.266  -1.589  30.333 1.00 29.28 ? 380  GLY A N   1 
ATOM   3015 C CA  . GLY A 1 380 ? -1.719  -2.837  29.752 1.00 29.43 ? 380  GLY A CA  1 
ATOM   3016 C C   . GLY A 1 380 ? -0.849  -4.047  30.112 1.00 30.87 ? 380  GLY A C   1 
ATOM   3017 O O   . GLY A 1 380 ? 0.281   -3.908  30.588 1.00 30.54 ? 380  GLY A O   1 
ATOM   3018 N N   . GLU A 1 381 ? -1.443  -5.208  29.856 1.00 31.11 ? 381  GLU A N   1 
ATOM   3019 C CA  . GLU A 1 381 ? -0.805  -6.522  30.060 1.00 31.17 ? 381  GLU A CA  1 
ATOM   3020 C C   . GLU A 1 381 ? -1.213  -7.445  28.907 1.00 30.91 ? 381  GLU A C   1 
ATOM   3021 O O   . GLU A 1 381 ? -2.323  -7.343  28.371 1.00 30.27 ? 381  GLU A O   1 
ATOM   3022 C CB  . GLU A 1 381 ? -1.247  -7.144  31.387 1.00 31.78 ? 381  GLU A CB  1 
ATOM   3023 C CG  . GLU A 1 381 ? -0.696  -6.412  32.613 1.00 34.01 ? 381  GLU A CG  1 
ATOM   3024 C CD  . GLU A 1 381 ? 0.797   -6.659  32.854 1.00 33.92 ? 381  GLU A CD  1 
ATOM   3025 O OE1 . GLU A 1 381 ? 1.464   -7.426  32.059 1.00 33.18 ? 381  GLU A OE1 1 
ATOM   3026 O OE2 . GLU A 1 381 ? 1.391   -6.097  33.854 1.00 36.64 ? 381  GLU A OE2 1 
ATOM   3027 N N   . PRO A 1 382 ? -0.359  -8.373  28.468 1.00 31.08 ? 382  PRO A N   1 
ATOM   3028 C CA  . PRO A 1 382 ? -0.693  -9.256  27.345 1.00 31.69 ? 382  PRO A CA  1 
ATOM   3029 C C   . PRO A 1 382 ? -1.919  -10.109 27.587 1.00 31.83 ? 382  PRO A C   1 
ATOM   3030 O O   . PRO A 1 382 ? -2.201  -10.459 28.776 1.00 30.08 ? 382  PRO A O   1 
ATOM   3031 C CB  . PRO A 1 382 ? 0.545   -10.115 27.200 1.00 32.42 ? 382  PRO A CB  1 
ATOM   3032 C CG  . PRO A 1 382 ? 1.549   -9.675  28.263 1.00 32.86 ? 382  PRO A CG  1 
ATOM   3033 C CD  . PRO A 1 382 ? 0.960   -8.556  29.070 1.00 32.27 ? 382  PRO A CD  1 
ATOM   3034 N N   . GLY A 1 383 ? -2.571  -10.410 26.456 1.00 33.99 ? 383  GLY A N   1 
ATOM   3035 C CA  . GLY A 1 383 ? -3.799  -11.241 26.380 1.00 32.03 ? 383  GLY A CA  1 
ATOM   3036 C C   . GLY A 1 383 ? -3.434  -12.667 26.229 1.00 33.84 ? 383  GLY A C   1 
ATOM   3037 O O   . GLY A 1 383 ? -2.297  -12.955 25.847 1.00 33.20 ? 383  GLY A O   1 
ATOM   3038 N N   . THR A 1 384 ? -4.162  -13.702 26.673 1.00 33.90 ? 384  THR A N   1 
ATOM   3039 C CA  . THR A 1 384 ? -5.557  -13.476 27.149 1.00 34.38 ? 384  THR A CA  1 
ATOM   3040 C C   . THR A 1 384 ? -5.655  -13.078 28.650 1.00 35.65 ? 384  THR A C   1 
ATOM   3041 O O   . THR A 1 384 ? -6.677  -12.539 29.102 1.00 39.03 ? 384  THR A O   1 
ATOM   3042 C CB  . THR A 1 384 ? -6.214  -14.870 26.962 1.00 35.00 ? 384  THR A CB  1 
ATOM   3043 O OG1 . THR A 1 384 ? -5.484  -15.851 27.684 1.00 31.63 ? 384  THR A OG1 1 
ATOM   3044 C CG2 . THR A 1 384 ? -6.259  -15.318 25.500 1.00 27.61 ? 384  THR A CG2 1 
ATOM   3045 N N   . ASN A 1 385 ? -4.596  -13.374 29.380 1.00 33.10 ? 385  ASN A N   1 
ATOM   3046 C CA  . ASN A 1 385 ? -4.487  -13.150 30.850 1.00 33.43 ? 385  ASN A CA  1 
ATOM   3047 C C   . ASN A 1 385 ? -5.450  -12.066 31.394 1.00 32.73 ? 385  ASN A C   1 
ATOM   3048 O O   . ASN A 1 385 ? -6.325  -12.347 32.229 1.00 35.37 ? 385  ASN A O   1 
ATOM   3049 C CB  . ASN A 1 385 ? -3.062  -12.732 31.212 1.00 33.28 ? 385  ASN A CB  1 
ATOM   3050 C CG  . ASN A 1 385 ? -2.082  -13.905 31.176 1.00 32.53 ? 385  ASN A CG  1 
ATOM   3051 O OD1 . ASN A 1 385 ? -1.688  -14.342 30.096 1.00 35.73 ? 385  ASN A OD1 1 
ATOM   3052 N ND2 . ASN A 1 385 ? -1.664  -14.452 32.302 1.00 33.86 ? 385  ASN A ND2 1 
ATOM   3053 N N   . GLY A 1 386 ? -5.275  -10.770 30.997 1.00 30.51 ? 386  GLY A N   1 
ATOM   3054 C CA  . GLY A 1 386 ? -6.079  -9.640  31.441 1.00 30.36 ? 386  GLY A CA  1 
ATOM   3055 C C   . GLY A 1 386 ? -7.566  -9.956  31.462 1.00 30.48 ? 386  GLY A C   1 
ATOM   3056 O O   . GLY A 1 386 ? -8.313  -9.369  32.240 1.00 30.35 ? 386  GLY A O   1 
ATOM   3057 N N   . GLN A 1 387 ? -7.999  -10.880 30.606 1.00 28.98 ? 387  GLN A N   1 
ATOM   3058 C CA  . GLN A 1 387 ? -9.410  -11.267 30.544 1.00 28.15 ? 387  GLN A CA  1 
ATOM   3059 C C   . GLN A 1 387 ? -9.901  -11.854 31.858 1.00 31.47 ? 387  GLN A C   1 
ATOM   3060 O O   . GLN A 1 387 ? -11.099 -11.835 32.166 1.00 30.15 ? 387  GLN A O   1 
ATOM   3061 C CB  . GLN A 1 387 ? -9.637  -12.303 29.439 1.00 27.60 ? 387  GLN A CB  1 
ATOM   3062 C CG  . GLN A 1 387 ? -9.372  -11.812 28.032 1.00 26.51 ? 387  GLN A CG  1 
ATOM   3063 C CD  . GLN A 1 387 ? -9.365  -12.941 27.010 1.00 28.46 ? 387  GLN A CD  1 
ATOM   3064 O OE1 . GLN A 1 387 ? -9.820  -14.060 27.287 1.00 32.62 ? 387  GLN A OE1 1 
ATOM   3065 N NE2 . GLN A 1 387 ? -8.855  -12.654 25.824 1.00 25.93 ? 387  GLN A NE2 1 
ATOM   3066 N N   . HIS A 1 388 ? -8.967  -12.396 32.622 1.00 33.70 ? 388  HIS A N   1 
ATOM   3067 C CA  . HIS A 1 388 ? -9.291  -13.016 33.896 1.00 34.69 ? 388  HIS A CA  1 
ATOM   3068 C C   . HIS A 1 388 ? -9.063  -12.044 35.042 1.00 35.00 ? 388  HIS A C   1 
ATOM   3069 O O   . HIS A 1 388 ? -9.227  -12.399 36.216 1.00 35.99 ? 388  HIS A O   1 
ATOM   3070 C CB  . HIS A 1 388 ? -8.410  -14.251 34.078 1.00 35.43 ? 388  HIS A CB  1 
ATOM   3071 C CG  . HIS A 1 388 ? -8.580  -15.274 32.998 1.00 34.31 ? 388  HIS A CG  1 
ATOM   3072 N ND1 . HIS A 1 388 ? -9.434  -16.350 33.120 1.00 35.48 ? 388  HIS A ND1 1 
ATOM   3073 C CD2 . HIS A 1 388 ? -8.009  -15.383 31.774 1.00 36.00 ? 388  HIS A CD2 1 
ATOM   3074 C CE1 . HIS A 1 388 ? -9.377  -17.081 32.021 1.00 37.30 ? 388  HIS A CE1 1 
ATOM   3075 N NE2 . HIS A 1 388 ? -8.520  -16.516 31.188 1.00 36.33 ? 388  HIS A NE2 1 
ATOM   3076 N N   . ALA A 1 389 ? -8.713  -10.807 34.692 1.00 33.86 ? 389  ALA A N   1 
ATOM   3077 C CA  . ALA A 1 389 ? -8.412  -9.794  35.689 1.00 32.61 ? 389  ALA A CA  1 
ATOM   3078 C C   . ALA A 1 389 ? -9.129  -8.455  35.462 1.00 32.72 ? 389  ALA A C   1 
ATOM   3079 O O   . ALA A 1 389 ? -10.341 -8.335  35.678 1.00 32.44 ? 389  ALA A O   1 
ATOM   3080 C CB  . ALA A 1 389 ? -6.900  -9.591  35.748 1.00 32.24 ? 389  ALA A CB  1 
ATOM   3081 N N   . PHE A 1 390 ? -8.360  -7.462  35.045 1.00 31.05 ? 390  PHE A N   1 
ATOM   3082 C CA  . PHE A 1 390 ? -8.870  -6.081  34.920 1.00 29.15 ? 390  PHE A CA  1 
ATOM   3083 C C   . PHE A 1 390 ? -9.899  -5.890  33.791 1.00 27.94 ? 390  PHE A C   1 
ATOM   3084 O O   . PHE A 1 390 ? -10.532 -4.831  33.676 1.00 27.51 ? 390  PHE A O   1 
ATOM   3085 C CB  . PHE A 1 390 ? -7.728  -5.077  34.709 1.00 26.03 ? 390  PHE A CB  1 
ATOM   3086 C CG  . PHE A 1 390 ? -6.750  -5.433  33.588 1.00 25.02 ? 390  PHE A CG  1 
ATOM   3087 C CD1 . PHE A 1 390 ? -7.074  -5.148  32.257 1.00 25.44 ? 390  PHE A CD1 1 
ATOM   3088 C CD2 . PHE A 1 390 ? -5.521  -6.029  33.899 1.00 24.84 ? 390  PHE A CD2 1 
ATOM   3089 C CE1 . PHE A 1 390 ? -6.167  -5.456  31.236 1.00 26.53 ? 390  PHE A CE1 1 
ATOM   3090 C CE2 . PHE A 1 390 ? -4.614  -6.335  32.878 1.00 25.68 ? 390  PHE A CE2 1 
ATOM   3091 C CZ  . PHE A 1 390 ? -4.937  -6.047  31.546 1.00 25.65 ? 390  PHE A CZ  1 
ATOM   3092 N N   . TYR A 1 391 ? -10.093 -6.888  32.950 1.00 26.99 ? 391  TYR A N   1 
ATOM   3093 C CA  . TYR A 1 391 ? -11.090 -6.761  31.866 1.00 28.71 ? 391  TYR A CA  1 
ATOM   3094 C C   . TYR A 1 391 ? -12.488 -6.583  32.477 1.00 27.84 ? 391  TYR A C   1 
ATOM   3095 O O   . TYR A 1 391 ? -13.396 -6.014  31.854 1.00 27.93 ? 391  TYR A O   1 
ATOM   3096 C CB  . TYR A 1 391 ? -11.107 -7.999  30.971 1.00 28.00 ? 391  TYR A CB  1 
ATOM   3097 C CG  . TYR A 1 391 ? -10.092 -7.950  29.820 1.00 27.12 ? 391  TYR A CG  1 
ATOM   3098 C CD1 . TYR A 1 391 ? -8.812  -7.424  30.034 1.00 26.55 ? 391  TYR A CD1 1 
ATOM   3099 C CD2 . TYR A 1 391 ? -10.444 -8.437  28.552 1.00 26.64 ? 391  TYR A CD2 1 
ATOM   3100 C CE1 . TYR A 1 391 ? -7.871  -7.426  28.995 1.00 24.03 ? 391  TYR A CE1 1 
ATOM   3101 C CE2 . TYR A 1 391 ? -9.499  -8.451  27.519 1.00 26.68 ? 391  TYR A CE2 1 
ATOM   3102 C CZ  . TYR A 1 391 ? -8.211  -7.951  27.742 1.00 23.08 ? 391  TYR A CZ  1 
ATOM   3103 O OH  . TYR A 1 391 ? -7.286  -7.986  26.745 1.00 24.39 ? 391  TYR A OH  1 
ATOM   3104 N N   . GLN A 1 392 ? -12.630 -7.086  33.697 1.00 27.00 ? 392  GLN A N   1 
ATOM   3105 C CA  . GLN A 1 392 ? -13.896 -6.984  34.444 1.00 25.33 ? 392  GLN A CA  1 
ATOM   3106 C C   . GLN A 1 392 ? -14.332 -5.522  34.459 1.00 27.50 ? 392  GLN A C   1 
ATOM   3107 O O   . GLN A 1 392 ? -15.505 -5.194  34.220 1.00 25.39 ? 392  GLN A O   1 
ATOM   3108 C CB  . GLN A 1 392 ? -13.718 -7.477  35.881 1.00 24.58 ? 392  GLN A CB  1 
ATOM   3109 C CG  . GLN A 1 392 ? -14.871 -7.060  36.802 1.00 26.27 ? 392  GLN A CG  1 
ATOM   3110 C CD  . GLN A 1 392 ? -16.219 -7.662  36.393 1.00 27.70 ? 392  GLN A CD  1 
ATOM   3111 O OE1 . GLN A 1 392 ? -16.292 -8.846  36.068 1.00 26.67 ? 392  GLN A OE1 1 
ATOM   3112 N NE2 . GLN A 1 392 ? -17.306 -6.910  36.391 1.00 28.34 ? 392  GLN A NE2 1 
ATOM   3113 N N   . LEU A 1 393 ? -13.373 -4.647  34.755 1.00 27.51 ? 393  LEU A N   1 
ATOM   3114 C CA  . LEU A 1 393 ? -13.642 -3.219  34.825 1.00 26.81 ? 393  LEU A CA  1 
ATOM   3115 C C   . LEU A 1 393 ? -13.844 -2.620  33.436 1.00 25.91 ? 393  LEU A C   1 
ATOM   3116 O O   . LEU A 1 393 ? -14.663 -1.721  33.264 1.00 28.25 ? 393  LEU A O   1 
ATOM   3117 C CB  . LEU A 1 393 ? -12.506 -2.508  35.582 1.00 27.76 ? 393  LEU A CB  1 
ATOM   3118 C CG  . LEU A 1 393 ? -12.745 -1.028  35.918 1.00 27.75 ? 393  LEU A CG  1 
ATOM   3119 C CD1 . LEU A 1 393 ? -11.993 -0.646  37.201 1.00 28.38 ? 393  LEU A CD1 1 
ATOM   3120 C CD2 . LEU A 1 393 ? -12.294 -0.166  34.745 1.00 26.51 ? 393  LEU A CD2 1 
ATOM   3121 N N   . ILE A 1 394 ? -13.111 -3.113  32.442 1.00 26.10 ? 394  ILE A N   1 
ATOM   3122 C CA  . ILE A 1 394 ? -13.282 -2.599  31.085 1.00 27.57 ? 394  ILE A CA  1 
ATOM   3123 C C   . ILE A 1 394 ? -14.719 -2.888  30.632 1.00 28.17 ? 394  ILE A C   1 
ATOM   3124 O O   . ILE A 1 394 ? -15.390 -2.019  30.068 1.00 29.40 ? 394  ILE A O   1 
ATOM   3125 C CB  . ILE A 1 394 ? -12.254 -3.228  30.103 1.00 26.88 ? 394  ILE A CB  1 
ATOM   3126 C CG1 . ILE A 1 394 ? -10.830 -2.879  30.565 1.00 25.51 ? 394  ILE A CG1 1 
ATOM   3127 C CG2 . ILE A 1 394 ? -12.462 -2.668  28.680 1.00 25.92 ? 394  ILE A CG2 1 
ATOM   3128 C CD1 . ILE A 1 394 ? -9.728  -3.389  29.661 1.00 24.80 ? 394  ILE A CD1 1 
ATOM   3129 N N   . HIS A 1 395 ? -15.198 -4.096  30.923 1.00 27.02 ? 395  HIS A N   1 
ATOM   3130 C CA  . HIS A 1 395 ? -16.556 -4.520  30.561 1.00 29.49 ? 395  HIS A CA  1 
ATOM   3131 C C   . HIS A 1 395 ? -17.695 -3.941  31.411 1.00 28.99 ? 395  HIS A C   1 
ATOM   3132 O O   . HIS A 1 395 ? -18.742 -3.561  30.876 1.00 29.79 ? 395  HIS A O   1 
ATOM   3133 C CB  . HIS A 1 395 ? -16.669 -6.053  30.628 1.00 28.50 ? 395  HIS A CB  1 
ATOM   3134 C CG  . HIS A 1 395 ? -16.071 -6.771  29.457 1.00 30.30 ? 395  HIS A CG  1 
ATOM   3135 N ND1 . HIS A 1 395 ? -16.702 -6.851  28.233 1.00 31.97 ? 395  HIS A ND1 1 
ATOM   3136 C CD2 . HIS A 1 395 ? -14.911 -7.457  29.327 1.00 31.41 ? 395  HIS A CD2 1 
ATOM   3137 C CE1 . HIS A 1 395 ? -15.958 -7.558  27.400 1.00 30.69 ? 395  HIS A CE1 1 
ATOM   3138 N NE2 . HIS A 1 395 ? -14.866 -7.940  28.038 1.00 31.16 ? 395  HIS A NE2 1 
ATOM   3139 N N   . GLN A 1 396 ? -17.503 -3.881  32.728 1.00 28.65 ? 396  GLN A N   1 
ATOM   3140 C CA  . GLN A 1 396 ? -18.557 -3.411  33.630 1.00 28.50 ? 396  GLN A CA  1 
ATOM   3141 C C   . GLN A 1 396 ? -18.223 -2.307  34.637 1.00 28.15 ? 396  GLN A C   1 
ATOM   3142 O O   . GLN A 1 396 ? -18.936 -2.138  35.628 1.00 28.50 ? 396  GLN A O   1 
ATOM   3143 C CB  . GLN A 1 396 ? -19.141 -4.611  34.383 1.00 30.64 ? 396  GLN A CB  1 
ATOM   3144 C CG  . GLN A 1 396 ? -19.785 -5.651  33.454 1.00 31.36 ? 396  GLN A CG  1 
ATOM   3145 C CD  . GLN A 1 396 ? -20.448 -6.784  34.219 1.00 33.55 ? 396  GLN A CD  1 
ATOM   3146 O OE1 . GLN A 1 396 ? -19.833 -7.397  35.090 1.00 34.59 ? 396  GLN A OE1 1 
ATOM   3147 N NE2 . GLN A 1 396 ? -21.707 -7.068  33.893 1.00 32.51 ? 396  GLN A NE2 1 
ATOM   3148 N N   . GLY A 1 397 ? -17.153 -1.559  34.387 1.00 28.44 ? 397  GLY A N   1 
ATOM   3149 C CA  . GLY A 1 397 ? -16.787 -0.478  35.282 1.00 26.63 ? 397  GLY A CA  1 
ATOM   3150 C C   . GLY A 1 397 ? -17.503 0.816   34.913 1.00 30.59 ? 397  GLY A C   1 
ATOM   3151 O O   . GLY A 1 397 ? -18.409 0.817   34.076 1.00 29.94 ? 397  GLY A O   1 
ATOM   3152 N N   . THR A 1 398 ? -17.088 1.919   35.526 1.00 30.85 ? 398  THR A N   1 
ATOM   3153 C CA  . THR A 1 398 ? -17.697 3.221   35.274 1.00 29.88 ? 398  THR A CA  1 
ATOM   3154 C C   . THR A 1 398 ? -16.798 4.136   34.439 1.00 31.62 ? 398  THR A C   1 
ATOM   3155 O O   . THR A 1 398 ? -17.055 5.332   34.344 1.00 32.29 ? 398  THR A O   1 
ATOM   3156 C CB  . THR A 1 398 ? -18.042 3.939   36.607 1.00 30.49 ? 398  THR A CB  1 
ATOM   3157 O OG1 . THR A 1 398 ? -16.864 4.047   37.424 1.00 29.21 ? 398  THR A OG1 1 
ATOM   3158 C CG2 . THR A 1 398 ? -19.107 3.167   37.371 1.00 28.86 ? 398  THR A CG2 1 
ATOM   3159 N N   . LYS A 1 399 ? -15.755 3.576   33.830 1.00 32.41 ? 399  LYS A N   1 
ATOM   3160 C CA  . LYS A 1 399 ? -14.831 4.358   33.003 1.00 34.56 ? 399  LYS A CA  1 
ATOM   3161 C C   . LYS A 1 399 ? -14.827 3.953   31.534 1.00 33.42 ? 399  LYS A C   1 
ATOM   3162 O O   . LYS A 1 399 ? -14.949 2.781   31.209 1.00 32.16 ? 399  LYS A O   1 
ATOM   3163 C CB  . LYS A 1 399 ? -13.383 4.220   33.490 1.00 37.26 ? 399  LYS A CB  1 
ATOM   3164 C CG  . LYS A 1 399 ? -13.001 5.015   34.709 1.00 39.40 ? 399  LYS A CG  1 
ATOM   3165 C CD  . LYS A 1 399 ? -13.511 4.391   35.993 1.00 36.90 ? 399  LYS A CD  1 
ATOM   3166 C CE  . LYS A 1 399 ? -13.002 5.194   37.179 1.00 38.78 ? 399  LYS A CE  1 
ATOM   3167 N NZ  . LYS A 1 399 ? -13.646 4.810   38.455 1.00 35.58 ? 399  LYS A NZ  1 
ATOM   3168 N N   . MET A 1 400 ? -14.670 4.929   30.646 1.00 33.71 ? 400  MET A N   1 
ATOM   3169 C CA  . MET A 1 400 ? -14.568 4.620   29.228 1.00 32.31 ? 400  MET A CA  1 
ATOM   3170 C C   . MET A 1 400 ? -13.060 4.457   29.032 1.00 32.39 ? 400  MET A C   1 
ATOM   3171 O O   . MET A 1 400 ? -12.277 5.313   29.444 1.00 32.87 ? 400  MET A O   1 
ATOM   3172 C CB  . MET A 1 400 ? -15.095 5.761   28.360 1.00 35.04 ? 400  MET A CB  1 
ATOM   3173 C CG  . MET A 1 400 ? -15.126 5.407   26.872 1.00 42.04 ? 400  MET A CG  1 
ATOM   3174 S SD  . MET A 1 400 ? -15.568 6.781   25.766 1.00 44.72 ? 400  MET A SD  1 
ATOM   3175 C CE  . MET A 1 400 ? -17.316 6.885   26.039 1.00 48.01 ? 400  MET A CE  1 
ATOM   3176 N N   . ILE A 1 401 ? -12.656 3.359   28.412 1.00 29.62 ? 401  ILE A N   1 
ATOM   3177 C CA  . ILE A 1 401 ? -11.236 3.065   28.211 1.00 31.35 ? 401  ILE A CA  1 
ATOM   3178 C C   . ILE A 1 401 ? -10.916 2.599   26.796 1.00 30.69 ? 401  ILE A C   1 
ATOM   3179 O O   . ILE A 1 401 ? -11.167 1.447   26.465 1.00 30.77 ? 401  ILE A O   1 
ATOM   3180 C CB  . ILE A 1 401 ? -10.782 1.926   29.171 1.00 32.07 ? 401  ILE A CB  1 
ATOM   3181 C CG1 . ILE A 1 401 ? -11.022 2.341   30.623 1.00 32.42 ? 401  ILE A CG1 1 
ATOM   3182 C CG2 . ILE A 1 401 ? -9.325  1.570   28.927 1.00 30.39 ? 401  ILE A CG2 1 
ATOM   3183 C CD1 . ILE A 1 401 ? -10.968 1.172   31.602 1.00 31.81 ? 401  ILE A CD1 1 
ATOM   3184 N N   . PRO A 1 402 ? -10.357 3.484   25.947 1.00 30.12 ? 402  PRO A N   1 
ATOM   3185 C CA  . PRO A 1 402 ? -10.009 3.095   24.574 1.00 29.51 ? 402  PRO A CA  1 
ATOM   3186 C C   . PRO A 1 402 ? -8.952  1.990   24.664 1.00 30.82 ? 402  PRO A C   1 
ATOM   3187 O O   . PRO A 1 402 ? -7.992  2.125   25.420 1.00 29.32 ? 402  PRO A O   1 
ATOM   3188 C CB  . PRO A 1 402 ? -9.417  4.378   23.981 1.00 29.07 ? 402  PRO A CB  1 
ATOM   3189 C CG  . PRO A 1 402 ? -10.087 5.471   24.766 1.00 31.10 ? 402  PRO A CG  1 
ATOM   3190 C CD  . PRO A 1 402 ? -10.105 4.920   26.174 1.00 29.94 ? 402  PRO A CD  1 
ATOM   3191 N N   . CYS A 1 403 ? -9.120  0.911   23.902 1.00 29.57 ? 403  CYS A N   1 
ATOM   3192 C CA  . CYS A 1 403 ? -8.169  -0.209  23.931 1.00 28.74 ? 403  CYS A CA  1 
ATOM   3193 C C   . CYS A 1 403 ? -7.624  -0.555  22.548 1.00 29.50 ? 403  CYS A C   1 
ATOM   3194 O O   . CYS A 1 403 ? -8.370  -0.590  21.572 1.00 28.56 ? 403  CYS A O   1 
ATOM   3195 C CB  . CYS A 1 403 ? -8.834  -1.490  24.475 1.00 26.51 ? 403  CYS A CB  1 
ATOM   3196 S SG  . CYS A 1 403 ? -9.337  -1.474  26.182 1.00 30.76 ? 403  CYS A SG  1 
ATOM   3197 N N   . ASP A 1 404 ? -6.324  -0.818  22.477 1.00 29.53 ? 404  ASP A N   1 
ATOM   3198 C CA  . ASP A 1 404 ? -5.691  -1.230  21.229 1.00 29.03 ? 404  ASP A CA  1 
ATOM   3199 C C   . ASP A 1 404 ? -5.349  -2.707  21.423 1.00 29.73 ? 404  ASP A C   1 
ATOM   3200 O O   . ASP A 1 404 ? -4.523  -3.044  22.276 1.00 28.36 ? 404  ASP A O   1 
ATOM   3201 C CB  . ASP A 1 404 ? -4.399  -0.450  20.980 1.00 31.32 ? 404  ASP A CB  1 
ATOM   3202 C CG  . ASP A 1 404 ? -4.624  0.853   20.241 1.00 31.28 ? 404  ASP A CG  1 
ATOM   3203 O OD1 . ASP A 1 404 ? -5.794  1.240   20.022 1.00 34.60 ? 404  ASP A OD1 1 
ATOM   3204 O OD2 . ASP A 1 404 ? -3.613  1.491   19.876 1.00 35.07 ? 404  ASP A OD2 1 
ATOM   3205 N N   . PHE A 1 405 ? -6.012  -3.578  20.663 1.00 29.16 ? 405  PHE A N   1 
ATOM   3206 C CA  . PHE A 1 405 ? -5.766  -5.020  20.732 1.00 30.80 ? 405  PHE A CA  1 
ATOM   3207 C C   . PHE A 1 405 ? -4.814  -5.348  19.579 1.00 31.27 ? 405  PHE A C   1 
ATOM   3208 O O   . PHE A 1 405 ? -5.107  -5.009  18.427 1.00 32.50 ? 405  PHE A O   1 
ATOM   3209 C CB  . PHE A 1 405 ? -7.079  -5.815  20.539 1.00 29.45 ? 405  PHE A CB  1 
ATOM   3210 C CG  . PHE A 1 405 ? -7.957  -5.896  21.769 1.00 30.41 ? 405  PHE A CG  1 
ATOM   3211 C CD1 . PHE A 1 405 ? -8.550  -4.754  22.315 1.00 29.60 ? 405  PHE A CD1 1 
ATOM   3212 C CD2 . PHE A 1 405 ? -8.203  -7.133  22.379 1.00 28.61 ? 405  PHE A CD2 1 
ATOM   3213 C CE1 . PHE A 1 405 ? -9.378  -4.845  23.458 1.00 28.23 ? 405  PHE A CE1 1 
ATOM   3214 C CE2 . PHE A 1 405 ? -9.021  -7.237  23.513 1.00 25.67 ? 405  PHE A CE2 1 
ATOM   3215 C CZ  . PHE A 1 405 ? -9.611  -6.090  24.054 1.00 28.02 ? 405  PHE A CZ  1 
ATOM   3216 N N   . LEU A 1 406 ? -3.687  -5.999  19.872 1.00 30.14 ? 406  LEU A N   1 
ATOM   3217 C CA  . LEU A 1 406 ? -2.731  -6.360  18.822 1.00 31.43 ? 406  LEU A CA  1 
ATOM   3218 C C   . LEU A 1 406 ? -2.457  -7.857  18.806 1.00 31.82 ? 406  LEU A C   1 
ATOM   3219 O O   . LEU A 1 406 ? -2.484  -8.517  19.851 1.00 29.35 ? 406  LEU A O   1 
ATOM   3220 C CB  . LEU A 1 406 ? -1.402  -5.620  18.999 1.00 30.56 ? 406  LEU A CB  1 
ATOM   3221 C CG  . LEU A 1 406 ? -1.441  -4.089  19.017 1.00 34.39 ? 406  LEU A CG  1 
ATOM   3222 C CD1 . LEU A 1 406 ? -1.734  -3.613  20.432 1.00 35.16 ? 406  LEU A CD1 1 
ATOM   3223 C CD2 . LEU A 1 406 ? -0.091  -3.534  18.555 1.00 36.80 ? 406  LEU A CD2 1 
ATOM   3224 N N   . ILE A 1 407 ? -2.189  -8.400  17.622 1.00 31.02 ? 407  ILE A N   1 
ATOM   3225 C CA  . ILE A 1 407 ? -1.915  -9.831  17.530 1.00 30.26 ? 407  ILE A CA  1 
ATOM   3226 C C   . ILE A 1 407 ? -1.337  -10.273 16.191 1.00 31.31 ? 407  ILE A C   1 
ATOM   3227 O O   . ILE A 1 407 ? -1.684  -9.733  15.144 1.00 28.01 ? 407  ILE A O   1 
ATOM   3228 C CB  . ILE A 1 407 ? -3.209  -10.646 17.774 1.00 28.42 ? 407  ILE A CB  1 
ATOM   3229 C CG1 . ILE A 1 407 ? -2.875  -12.112 18.051 1.00 27.08 ? 407  ILE A CG1 1 
ATOM   3230 C CG2 . ILE A 1 407 ? -4.113  -10.575 16.545 1.00 30.02 ? 407  ILE A CG2 1 
ATOM   3231 C CD1 . ILE A 1 407 ? -4.063  -12.884 18.586 1.00 26.58 ? 407  ILE A CD1 1 
ATOM   3232 N N   . PRO A 1 408 ? -0.405  -11.242 16.218 1.00 30.76 ? 408  PRO A N   1 
ATOM   3233 C CA  . PRO A 1 408 ? 0.164   -11.717 14.956 1.00 31.99 ? 408  PRO A CA  1 
ATOM   3234 C C   . PRO A 1 408 ? -0.680  -12.884 14.449 1.00 32.57 ? 408  PRO A C   1 
ATOM   3235 O O   . PRO A 1 408 ? -1.158  -13.702 15.234 1.00 31.09 ? 408  PRO A O   1 
ATOM   3236 C CB  . PRO A 1 408 ? 1.576   -12.147 15.347 1.00 33.23 ? 408  PRO A CB  1 
ATOM   3237 C CG  . PRO A 1 408 ? 1.393   -12.623 16.755 1.00 30.55 ? 408  PRO A CG  1 
ATOM   3238 C CD  . PRO A 1 408 ? 0.479   -11.571 17.347 1.00 30.62 ? 408  PRO A CD  1 
ATOM   3239 N N   . VAL A 1 409 ? -0.880  -12.947 13.140 1.00 32.77 ? 409  VAL A N   1 
ATOM   3240 C CA  . VAL A 1 409 ? -1.660  -14.023 12.552 1.00 34.03 ? 409  VAL A CA  1 
ATOM   3241 C C   . VAL A 1 409 ? -0.916  -15.344 12.725 1.00 33.80 ? 409  VAL A C   1 
ATOM   3242 O O   . VAL A 1 409 ? -1.506  -16.366 13.086 1.00 33.91 ? 409  VAL A O   1 
ATOM   3243 C CB  . VAL A 1 409 ? -1.886  -13.763 11.050 1.00 34.69 ? 409  VAL A CB  1 
ATOM   3244 C CG1 . VAL A 1 409 ? -2.473  -14.990 10.382 1.00 35.71 ? 409  VAL A CG1 1 
ATOM   3245 C CG2 . VAL A 1 409 ? -2.790  -12.561 10.869 1.00 31.31 ? 409  VAL A CG2 1 
ATOM   3246 N N   . GLN A 1 410 ? 0.389   -15.302 12.480 1.00 34.91 ? 410  GLN A N   1 
ATOM   3247 C CA  . GLN A 1 410 ? 1.242   -16.481 12.583 1.00 36.96 ? 410  GLN A CA  1 
ATOM   3248 C C   . GLN A 1 410 ? 2.088   -16.480 13.857 1.00 36.38 ? 410  GLN A C   1 
ATOM   3249 O O   . GLN A 1 410 ? 2.789   -15.516 14.142 1.00 37.51 ? 410  GLN A O   1 
ATOM   3250 C CB  . GLN A 1 410 ? 2.159   -16.556 11.361 1.00 37.42 ? 410  GLN A CB  1 
ATOM   3251 C CG  . GLN A 1 410 ? 1.433   -16.850 10.047 1.00 39.45 ? 410  GLN A CG  1 
ATOM   3252 C CD  . GLN A 1 410 ? 2.335   -16.714 8.827  1.00 39.24 ? 410  GLN A CD  1 
ATOM   3253 O OE1 . GLN A 1 410 ? 3.502   -17.098 8.856  1.00 41.81 ? 410  GLN A OE1 1 
ATOM   3254 N NE2 . GLN A 1 410 ? 1.788   -16.178 7.745  1.00 40.13 ? 410  GLN A NE2 1 
ATOM   3255 N N   . THR A 1 411 ? 2.034   -17.578 14.602 1.00 36.39 ? 411  THR A N   1 
ATOM   3256 C CA  . THR A 1 411 ? 2.792   -17.701 15.841 1.00 36.22 ? 411  THR A CA  1 
ATOM   3257 C C   . THR A 1 411 ? 4.197   -18.250 15.613 1.00 36.40 ? 411  THR A C   1 
ATOM   3258 O O   . THR A 1 411 ? 4.465   -18.946 14.624 1.00 34.87 ? 411  THR A O   1 
ATOM   3259 C CB  . THR A 1 411 ? 2.063   -18.618 16.844 1.00 36.09 ? 411  THR A CB  1 
ATOM   3260 O OG1 . THR A 1 411 ? 2.844   -18.749 18.037 1.00 36.16 ? 411  THR A OG1 1 
ATOM   3261 C CG2 . THR A 1 411 ? 1.842   -19.992 16.240 1.00 34.53 ? 411  THR A CG2 1 
ATOM   3262 N N   . GLN A 1 412 ? 5.094   -17.932 16.535 1.00 35.47 ? 412  GLN A N   1 
ATOM   3263 C CA  . GLN A 1 412 ? 6.466   -18.408 16.453 1.00 36.97 ? 412  GLN A CA  1 
ATOM   3264 C C   . GLN A 1 412 ? 6.538   -19.847 16.971 1.00 38.02 ? 412  GLN A C   1 
ATOM   3265 O O   . GLN A 1 412 ? 7.520   -20.556 16.742 1.00 38.20 ? 412  GLN A O   1 
ATOM   3266 C CB  . GLN A 1 412 ? 7.381   -17.512 17.290 1.00 38.39 ? 412  GLN A CB  1 
ATOM   3267 C CG  . GLN A 1 412 ? 7.463   -16.043 16.840 1.00 37.12 ? 412  GLN A CG  1 
ATOM   3268 C CD  . GLN A 1 412 ? 8.335   -15.840 15.611 1.00 39.37 ? 412  GLN A CD  1 
ATOM   3269 O OE1 . GLN A 1 412 ? 9.215   -16.650 15.323 1.00 40.56 ? 412  GLN A OE1 1 
ATOM   3270 N NE2 . GLN A 1 412 ? 8.110   -14.740 14.892 1.00 36.29 ? 412  GLN A NE2 1 
ATOM   3271 N N   . HIS A 1 413 ? 5.488   -20.279 17.662 1.00 38.35 ? 413  HIS A N   1 
ATOM   3272 C CA  . HIS A 1 413 ? 5.439   -21.628 18.229 1.00 39.14 ? 413  HIS A CA  1 
ATOM   3273 C C   . HIS A 1 413 ? 4.090   -22.300 17.972 1.00 38.32 ? 413  HIS A C   1 
ATOM   3274 O O   . HIS A 1 413 ? 3.228   -22.341 18.850 1.00 35.80 ? 413  HIS A O   1 
ATOM   3275 C CB  . HIS A 1 413 ? 5.700   -21.558 19.735 1.00 40.17 ? 413  HIS A CB  1 
ATOM   3276 C CG  . HIS A 1 413 ? 7.027   -20.965 20.086 1.00 43.56 ? 413  HIS A CG  1 
ATOM   3277 N ND1 . HIS A 1 413 ? 8.208   -21.667 19.975 1.00 44.07 ? 413  HIS A ND1 1 
ATOM   3278 C CD2 . HIS A 1 413 ? 7.364   -19.720 20.498 1.00 43.85 ? 413  HIS A CD2 1 
ATOM   3279 C CE1 . HIS A 1 413 ? 9.216   -20.879 20.305 1.00 46.32 ? 413  HIS A CE1 1 
ATOM   3280 N NE2 . HIS A 1 413 ? 8.731   -19.692 20.625 1.00 46.30 ? 413  HIS A NE2 1 
ATOM   3281 N N   . PRO A 1 414 ? 3.896   -22.839 16.756 1.00 39.36 ? 414  PRO A N   1 
ATOM   3282 C CA  . PRO A 1 414 ? 2.653   -23.512 16.371 1.00 39.35 ? 414  PRO A CA  1 
ATOM   3283 C C   . PRO A 1 414 ? 2.540   -24.921 16.946 1.00 40.22 ? 414  PRO A C   1 
ATOM   3284 O O   . PRO A 1 414 ? 2.382   -25.894 16.212 1.00 39.88 ? 414  PRO A O   1 
ATOM   3285 C CB  . PRO A 1 414 ? 2.728   -23.510 14.848 1.00 39.79 ? 414  PRO A CB  1 
ATOM   3286 C CG  . PRO A 1 414 ? 4.197   -23.705 14.610 1.00 42.21 ? 414  PRO A CG  1 
ATOM   3287 C CD  . PRO A 1 414 ? 4.828   -22.762 15.614 1.00 40.42 ? 414  PRO A CD  1 
ATOM   3288 N N   . ILE A 1 415 ? 2.614   -25.031 18.265 1.00 38.98 ? 415  ILE A N   1 
ATOM   3289 C CA  . ILE A 1 415 ? 2.524   -26.334 18.903 1.00 39.28 ? 415  ILE A CA  1 
ATOM   3290 C C   . ILE A 1 415 ? 1.118   -26.918 18.824 1.00 40.20 ? 415  ILE A C   1 
ATOM   3291 O O   . ILE A 1 415 ? 0.132   -26.190 18.627 1.00 39.06 ? 415  ILE A O   1 
ATOM   3292 C CB  . ILE A 1 415 ? 2.934   -26.251 20.382 1.00 38.23 ? 415  ILE A CB  1 
ATOM   3293 C CG1 . ILE A 1 415 ? 1.973   -25.325 21.129 1.00 37.34 ? 415  ILE A CG1 1 
ATOM   3294 C CG2 . ILE A 1 415 ? 4.376   -25.757 20.490 1.00 38.64 ? 415  ILE A CG2 1 
ATOM   3295 C CD1 . ILE A 1 415 ? 2.312   -25.145 22.590 1.00 38.36 ? 415  ILE A CD1 1 
ATOM   3296 N N   . ARG A 1 416 ? 1.039   -28.239 18.978 1.00 39.56 ? 416  ARG A N   1 
ATOM   3297 C CA  . ARG A 1 416 ? -0.232  -28.950 18.955 1.00 40.82 ? 416  ARG A CA  1 
ATOM   3298 C C   . ARG A 1 416 ? -1.021  -28.622 17.699 1.00 40.03 ? 416  ARG A C   1 
ATOM   3299 O O   . ARG A 1 416 ? -2.235  -28.420 17.746 1.00 40.78 ? 416  ARG A O   1 
ATOM   3300 C CB  . ARG A 1 416 ? -1.045  -28.587 20.197 1.00 43.35 ? 416  ARG A CB  1 
ATOM   3301 C CG  . ARG A 1 416 ? -0.377  -29.000 21.503 1.00 48.39 ? 416  ARG A CG  1 
ATOM   3302 C CD  . ARG A 1 416 ? -0.582  -30.484 21.799 1.00 50.87 ? 416  ARG A CD  1 
ATOM   3303 N NE  . ARG A 1 416 ? -1.658  -30.697 22.764 1.00 55.17 ? 416  ARG A NE  1 
ATOM   3304 C CZ  . ARG A 1 416 ? -2.916  -30.302 22.589 1.00 55.92 ? 416  ARG A CZ  1 
ATOM   3305 N NH1 . ARG A 1 416 ? -3.270  -29.672 21.480 1.00 57.97 ? 416  ARG A NH1 1 
ATOM   3306 N NH2 . ARG A 1 416 ? -3.820  -30.528 23.529 1.00 57.22 ? 416  ARG A NH2 1 
ATOM   3307 N N   . LYS A 1 417 ? -0.313  -28.563 16.578 1.00 39.82 ? 417  LYS A N   1 
ATOM   3308 C CA  . LYS A 1 417 ? -0.921  -28.271 15.287 1.00 41.09 ? 417  LYS A CA  1 
ATOM   3309 C C   . LYS A 1 417 ? -1.681  -26.946 15.262 1.00 40.69 ? 417  LYS A C   1 
ATOM   3310 O O   . LYS A 1 417 ? -2.695  -26.811 14.577 1.00 40.25 ? 417  LYS A O   1 
ATOM   3311 C CB  . LYS A 1 417 ? -1.842  -29.424 14.873 1.00 43.29 ? 417  LYS A CB  1 
ATOM   3312 C CG  . LYS A 1 417 ? -1.099  -30.742 14.676 1.00 47.43 ? 417  LYS A CG  1 
ATOM   3313 C CD  . LYS A 1 417 ? -2.034  -31.864 14.241 1.00 49.72 ? 417  LYS A CD  1 
ATOM   3314 C CE  . LYS A 1 417 ? -1.285  -33.182 14.058 1.00 51.54 ? 417  LYS A CE  1 
ATOM   3315 N NZ  . LYS A 1 417 ? -0.265  -33.123 12.965 1.00 54.29 ? 417  LYS A NZ  1 
ATOM   3316 N N   . GLY A 1 418 ? -1.176  -25.971 16.013 1.00 39.95 ? 418  GLY A N   1 
ATOM   3317 C CA  . GLY A 1 418 ? -1.794  -24.654 16.047 1.00 38.68 ? 418  GLY A CA  1 
ATOM   3318 C C   . GLY A 1 418 ? -2.978  -24.470 16.979 1.00 36.99 ? 418  GLY A C   1 
ATOM   3319 O O   . GLY A 1 418 ? -3.617  -23.423 16.951 1.00 35.63 ? 418  GLY A O   1 
ATOM   3320 N N   . LEU A 1 419 ? -3.262  -25.467 17.813 1.00 36.42 ? 419  LEU A N   1 
ATOM   3321 C CA  . LEU A 1 419 ? -4.394  -25.399 18.734 1.00 36.82 ? 419  LEU A CA  1 
ATOM   3322 C C   . LEU A 1 419 ? -4.316  -24.190 19.671 1.00 34.87 ? 419  LEU A C   1 
ATOM   3323 O O   . LEU A 1 419 ? -5.308  -23.486 19.865 1.00 31.76 ? 419  LEU A O   1 
ATOM   3324 C CB  . LEU A 1 419 ? -4.468  -26.677 19.581 1.00 37.84 ? 419  LEU A CB  1 
ATOM   3325 C CG  . LEU A 1 419 ? -5.829  -27.170 20.095 1.00 41.71 ? 419  LEU A CG  1 
ATOM   3326 C CD1 . LEU A 1 419 ? -5.625  -27.854 21.445 1.00 39.58 ? 419  LEU A CD1 1 
ATOM   3327 C CD2 . LEU A 1 419 ? -6.818  -26.032 20.235 1.00 42.71 ? 419  LEU A CD2 1 
ATOM   3328 N N   . HIS A 1 420 ? -3.146  -23.962 20.261 1.00 33.57 ? 420  HIS A N   1 
ATOM   3329 C CA  . HIS A 1 420 ? -2.982  -22.835 21.187 1.00 34.05 ? 420  HIS A CA  1 
ATOM   3330 C C   . HIS A 1 420 ? -3.213  -21.494 20.494 1.00 34.07 ? 420  HIS A C   1 
ATOM   3331 O O   . HIS A 1 420 ? -3.922  -20.635 21.021 1.00 34.68 ? 420  HIS A O   1 
ATOM   3332 C CB  . HIS A 1 420 ? -1.580  -22.821 21.820 1.00 32.24 ? 420  HIS A CB  1 
ATOM   3333 C CG  . HIS A 1 420 ? -1.394  -23.796 22.946 1.00 31.32 ? 420  HIS A CG  1 
ATOM   3334 N ND1 . HIS A 1 420 ? -1.335  -25.160 22.753 1.00 33.70 ? 420  HIS A ND1 1 
ATOM   3335 C CD2 . HIS A 1 420 ? -1.206  -23.598 24.274 1.00 29.06 ? 420  HIS A CD2 1 
ATOM   3336 C CE1 . HIS A 1 420 ? -1.118  -25.761 23.912 1.00 31.07 ? 420  HIS A CE1 1 
ATOM   3337 N NE2 . HIS A 1 420 ? -1.035  -24.835 24.851 1.00 34.57 ? 420  HIS A NE2 1 
ATOM   3338 N N   . HIS A 1 421 ? -2.619  -21.302 19.319 1.00 34.02 ? 421  HIS A N   1 
ATOM   3339 C CA  . HIS A 1 421 ? -2.791  -20.026 18.631 1.00 33.91 ? 421  HIS A CA  1 
ATOM   3340 C C   . HIS A 1 421 ? -4.221  -19.838 18.127 1.00 35.24 ? 421  HIS A C   1 
ATOM   3341 O O   . HIS A 1 421 ? -4.706  -18.712 18.029 1.00 34.67 ? 421  HIS A O   1 
ATOM   3342 C CB  . HIS A 1 421 ? -1.804  -19.885 17.474 1.00 34.40 ? 421  HIS A CB  1 
ATOM   3343 C CG  . HIS A 1 421 ? -1.559  -18.464 17.074 1.00 34.94 ? 421  HIS A CG  1 
ATOM   3344 N ND1 . HIS A 1 421 ? -1.097  -17.514 17.960 1.00 34.39 ? 421  HIS A ND1 1 
ATOM   3345 C CD2 . HIS A 1 421 ? -1.738  -17.823 15.894 1.00 33.61 ? 421  HIS A CD2 1 
ATOM   3346 C CE1 . HIS A 1 421 ? -1.001  -16.349 17.343 1.00 35.79 ? 421  HIS A CE1 1 
ATOM   3347 N NE2 . HIS A 1 421 ? -1.385  -16.509 16.089 1.00 35.77 ? 421  HIS A NE2 1 
ATOM   3348 N N   . LYS A 1 422 ? -4.902  -20.933 17.811 1.00 33.83 ? 422  LYS A N   1 
ATOM   3349 C CA  . LYS A 1 422 ? -6.284  -20.835 17.354 1.00 34.91 ? 422  LYS A CA  1 
ATOM   3350 C C   . LYS A 1 422 ? -7.146  -20.308 18.508 1.00 33.94 ? 422  LYS A C   1 
ATOM   3351 O O   . LYS A 1 422 ? -8.015  -19.448 18.325 1.00 33.77 ? 422  LYS A O   1 
ATOM   3352 C CB  . LYS A 1 422 ? -6.793  -22.208 16.894 1.00 37.53 ? 422  LYS A CB  1 
ATOM   3353 C CG  . LYS A 1 422 ? -8.126  -22.145 16.170 1.00 40.39 ? 422  LYS A CG  1 
ATOM   3354 C CD  . LYS A 1 422 ? -8.505  -23.479 15.550 1.00 42.67 ? 422  LYS A CD  1 
ATOM   3355 C CE  . LYS A 1 422 ? -8.826  -24.514 16.603 1.00 44.68 ? 422  LYS A CE  1 
ATOM   3356 N NZ  . LYS A 1 422 ? -9.150  -25.833 15.986 1.00 45.60 ? 422  LYS A NZ  1 
ATOM   3357 N N   . ILE A 1 423 ? -6.896  -20.823 19.707 1.00 33.54 ? 423  ILE A N   1 
ATOM   3358 C CA  . ILE A 1 423 ? -7.646  -20.383 20.873 1.00 33.67 ? 423  ILE A CA  1 
ATOM   3359 C C   . ILE A 1 423 ? -7.300  -18.915 21.185 1.00 32.96 ? 423  ILE A C   1 
ATOM   3360 O O   . ILE A 1 423 ? -8.177  -18.139 21.559 1.00 32.47 ? 423  ILE A O   1 
ATOM   3361 C CB  . ILE A 1 423 ? -7.344  -21.297 22.092 1.00 34.91 ? 423  ILE A CB  1 
ATOM   3362 C CG1 . ILE A 1 423 ? -7.775  -22.735 21.769 1.00 37.29 ? 423  ILE A CG1 1 
ATOM   3363 C CG2 . ILE A 1 423 ? -8.096  -20.820 23.334 1.00 33.31 ? 423  ILE A CG2 1 
ATOM   3364 C CD1 . ILE A 1 423 ? -7.460  -23.734 22.868 1.00 36.59 ? 423  ILE A CD1 1 
ATOM   3365 N N   . LEU A 1 424 ? -6.036  -18.537 21.004 1.00 30.77 ? 424  LEU A N   1 
ATOM   3366 C CA  . LEU A 1 424 ? -5.598  -17.160 21.270 1.00 30.36 ? 424  LEU A CA  1 
ATOM   3367 C C   . LEU A 1 424 ? -6.310  -16.199 20.317 1.00 31.43 ? 424  LEU A C   1 
ATOM   3368 O O   . LEU A 1 424 ? -6.822  -15.160 20.737 1.00 29.88 ? 424  LEU A O   1 
ATOM   3369 C CB  . LEU A 1 424 ? -4.078  -17.034 21.094 1.00 29.79 ? 424  LEU A CB  1 
ATOM   3370 C CG  . LEU A 1 424 ? -3.437  -15.684 21.463 1.00 28.19 ? 424  LEU A CG  1 
ATOM   3371 C CD1 . LEU A 1 424 ? -3.577  -15.443 22.953 1.00 24.07 ? 424  LEU A CD1 1 
ATOM   3372 C CD2 . LEU A 1 424 ? -1.971  -15.676 21.061 1.00 27.40 ? 424  LEU A CD2 1 
ATOM   3373 N N   . LEU A 1 425 ? -6.350  -16.553 19.034 1.00 31.50 ? 425  LEU A N   1 
ATOM   3374 C CA  . LEU A 1 425 ? -7.017  -15.717 18.035 1.00 32.02 ? 425  LEU A CA  1 
ATOM   3375 C C   . LEU A 1 425 ? -8.506  -15.589 18.332 1.00 31.23 ? 425  LEU A C   1 
ATOM   3376 O O   . LEU A 1 425 ? -9.076  -14.497 18.245 1.00 29.93 ? 425  LEU A O   1 
ATOM   3377 C CB  . LEU A 1 425 ? -6.821  -16.299 16.631 1.00 31.22 ? 425  LEU A CB  1 
ATOM   3378 C CG  . LEU A 1 425 ? -5.450  -16.074 15.994 1.00 34.74 ? 425  LEU A CG  1 
ATOM   3379 C CD1 . LEU A 1 425 ? -5.251  -17.032 14.823 1.00 36.02 ? 425  LEU A CD1 1 
ATOM   3380 C CD2 . LEU A 1 425 ? -5.346  -14.626 15.551 1.00 34.64 ? 425  LEU A CD2 1 
ATOM   3381 N N   . ALA A 1 426 ? -9.138  -16.700 18.696 1.00 29.84 ? 426  ALA A N   1 
ATOM   3382 C CA  . ALA A 1 426 ? -10.562 -16.682 19.004 1.00 31.19 ? 426  ALA A CA  1 
ATOM   3383 C C   . ALA A 1 426 ? -10.887 -15.695 20.127 1.00 31.80 ? 426  ALA A C   1 
ATOM   3384 O O   . ALA A 1 426 ? -11.876 -14.963 20.047 1.00 30.59 ? 426  ALA A O   1 
ATOM   3385 C CB  . ALA A 1 426 ? -11.043 -18.092 19.389 1.00 30.36 ? 426  ALA A CB  1 
ATOM   3386 N N   . ASN A 1 427 ? -10.068 -15.676 21.178 1.00 30.12 ? 427  ASN A N   1 
ATOM   3387 C CA  . ASN A 1 427 ? -10.310 -14.754 22.292 1.00 30.79 ? 427  ASN A CA  1 
ATOM   3388 C C   . ASN A 1 427 ? -10.106 -13.304 21.857 1.00 29.74 ? 427  ASN A C   1 
ATOM   3389 O O   . ASN A 1 427 ? -10.888 -12.430 22.221 1.00 29.80 ? 427  ASN A O   1 
ATOM   3390 C CB  . ASN A 1 427 ? -9.387  -15.080 23.471 1.00 31.73 ? 427  ASN A CB  1 
ATOM   3391 C CG  . ASN A 1 427 ? -9.909  -16.216 24.319 1.00 32.32 ? 427  ASN A CG  1 
ATOM   3392 O OD1 . ASN A 1 427 ? -10.751 -16.018 25.195 1.00 33.45 ? 427  ASN A OD1 1 
ATOM   3393 N ND2 . ASN A 1 427 ? -9.429  -17.421 24.048 1.00 33.96 ? 427  ASN A ND2 1 
ATOM   3394 N N   . PHE A 1 428 ? -9.042  -13.064 21.094 1.00 30.85 ? 428  PHE A N   1 
ATOM   3395 C CA  . PHE A 1 428 ? -8.722  -11.735 20.572 1.00 32.15 ? 428  PHE A CA  1 
ATOM   3396 C C   . PHE A 1 428 ? -9.944  -11.134 19.876 1.00 31.74 ? 428  PHE A C   1 
ATOM   3397 O O   . PHE A 1 428 ? -10.318 -9.988  20.122 1.00 30.96 ? 428  PHE A O   1 
ATOM   3398 C CB  . PHE A 1 428 ? -7.584  -11.847 19.554 1.00 30.53 ? 428  PHE A CB  1 
ATOM   3399 C CG  . PHE A 1 428 ? -7.272  -10.565 18.827 1.00 30.50 ? 428  PHE A CG  1 
ATOM   3400 C CD1 . PHE A 1 428 ? -6.305  -9.691  19.307 1.00 30.39 ? 428  PHE A CD1 1 
ATOM   3401 C CD2 . PHE A 1 428 ? -7.932  -10.248 17.641 1.00 31.29 ? 428  PHE A CD2 1 
ATOM   3402 C CE1 . PHE A 1 428 ? -5.992  -8.518  18.613 1.00 30.67 ? 428  PHE A CE1 1 
ATOM   3403 C CE2 . PHE A 1 428 ? -7.633  -9.085  16.941 1.00 32.03 ? 428  PHE A CE2 1 
ATOM   3404 C CZ  . PHE A 1 428 ? -6.659  -8.214  17.424 1.00 31.45 ? 428  PHE A CZ  1 
ATOM   3405 N N   . LEU A 1 429 ? -10.536 -11.925 18.987 1.00 30.55 ? 429  LEU A N   1 
ATOM   3406 C CA  . LEU A 1 429 ? -11.697 -11.524 18.204 1.00 31.09 ? 429  LEU A CA  1 
ATOM   3407 C C   . LEU A 1 429 ? -12.973 -11.385 19.028 1.00 31.21 ? 429  LEU A C   1 
ATOM   3408 O O   . LEU A 1 429 ? -13.691 -10.388 18.916 1.00 32.04 ? 429  LEU A O   1 
ATOM   3409 C CB  . LEU A 1 429 ? -11.916 -12.540 17.075 1.00 32.12 ? 429  LEU A CB  1 
ATOM   3410 C CG  . LEU A 1 429 ? -10.781 -12.663 16.048 1.00 31.55 ? 429  LEU A CG  1 
ATOM   3411 C CD1 . LEU A 1 429 ? -10.907 -13.998 15.301 1.00 31.99 ? 429  LEU A CD1 1 
ATOM   3412 C CD2 . LEU A 1 429 ? -10.832 -11.490 15.072 1.00 30.66 ? 429  LEU A CD2 1 
ATOM   3413 N N   . ALA A 1 430 ? -13.238 -12.379 19.868 1.00 30.27 ? 430  ALA A N   1 
ATOM   3414 C CA  . ALA A 1 430 ? -14.426 -12.387 20.704 1.00 30.28 ? 430  ALA A CA  1 
ATOM   3415 C C   . ALA A 1 430 ? -14.476 -11.262 21.727 1.00 30.18 ? 430  ALA A C   1 
ATOM   3416 O O   . ALA A 1 430 ? -15.548 -10.749 22.033 1.00 27.62 ? 430  ALA A O   1 
ATOM   3417 C CB  . ALA A 1 430 ? -14.543 -13.716 21.413 1.00 31.74 ? 430  ALA A CB  1 
ATOM   3418 N N   . GLN A 1 431 ? -13.321 -10.894 22.272 1.00 28.84 ? 431  GLN A N   1 
ATOM   3419 C CA  . GLN A 1 431 ? -13.284 -9.834  23.268 1.00 30.78 ? 431  GLN A CA  1 
ATOM   3420 C C   . GLN A 1 431 ? -13.699 -8.463  22.716 1.00 28.57 ? 431  GLN A C   1 
ATOM   3421 O O   . GLN A 1 431 ? -14.473 -7.751  23.352 1.00 29.18 ? 431  GLN A O   1 
ATOM   3422 C CB  . GLN A 1 431 ? -11.890 -9.752  23.895 1.00 30.03 ? 431  GLN A CB  1 
ATOM   3423 C CG  . GLN A 1 431 ? -11.619 -10.833 24.958 1.00 30.95 ? 431  GLN A CG  1 
ATOM   3424 C CD  . GLN A 1 431 ? -12.453 -10.646 26.210 1.00 30.63 ? 431  GLN A CD  1 
ATOM   3425 O OE1 . GLN A 1 431 ? -12.908 -9.537  26.513 1.00 31.10 ? 431  GLN A OE1 1 
ATOM   3426 N NE2 . GLN A 1 431 ? -12.639 -11.724 26.962 1.00 31.82 ? 431  GLN A NE2 1 
ATOM   3427 N N   . THR A 1 432 ? -13.207 -8.094  21.537 1.00 28.30 ? 432  THR A N   1 
ATOM   3428 C CA  . THR A 1 432 ? -13.573 -6.784  20.989 1.00 29.35 ? 432  THR A CA  1 
ATOM   3429 C C   . THR A 1 432 ? -15.007 -6.802  20.484 1.00 30.52 ? 432  THR A C   1 
ATOM   3430 O O   . THR A 1 432 ? -15.701 -5.785  20.512 1.00 30.19 ? 432  THR A O   1 
ATOM   3431 C CB  . THR A 1 432 ? -12.630 -6.347  19.852 1.00 29.80 ? 432  THR A CB  1 
ATOM   3432 O OG1 . THR A 1 432 ? -12.777 -7.223  18.728 1.00 30.23 ? 432  THR A OG1 1 
ATOM   3433 C CG2 . THR A 1 432 ? -11.188 -6.359  20.336 1.00 28.09 ? 432  THR A CG2 1 
ATOM   3434 N N   . GLU A 1 433 ? -15.454 -7.970  20.032 1.00 30.45 ? 433  GLU A N   1 
ATOM   3435 C CA  . GLU A 1 433 ? -16.822 -8.110  19.560 1.00 32.18 ? 433  GLU A CA  1 
ATOM   3436 C C   . GLU A 1 433 ? -17.745 -7.880  20.748 1.00 31.60 ? 433  GLU A C   1 
ATOM   3437 O O   . GLU A 1 433 ? -18.744 -7.174  20.636 1.00 32.81 ? 433  GLU A O   1 
ATOM   3438 C CB  . GLU A 1 433 ? -17.051 -9.514  18.986 1.00 32.96 ? 433  GLU A CB  1 
ATOM   3439 C CG  . GLU A 1 433 ? -18.503 -9.811  18.635 1.00 36.06 ? 433  GLU A CG  1 
ATOM   3440 C CD  . GLU A 1 433 ? -18.686 -11.195 18.030 1.00 39.15 ? 433  GLU A CD  1 
ATOM   3441 O OE1 . GLU A 1 433 ? -18.134 -12.172 18.583 1.00 38.89 ? 433  GLU A OE1 1 
ATOM   3442 O OE2 . GLU A 1 433 ? -19.392 -11.304 17.007 1.00 39.69 ? 433  GLU A OE2 1 
ATOM   3443 N N   . ALA A 1 434 ? -17.386 -8.461  21.894 1.00 31.58 ? 434  ALA A N   1 
ATOM   3444 C CA  . ALA A 1 434 ? -18.185 -8.350  23.114 1.00 30.39 ? 434  ALA A CA  1 
ATOM   3445 C C   . ALA A 1 434 ? -18.191 -6.948  23.719 1.00 29.42 ? 434  ALA A C   1 
ATOM   3446 O O   . ALA A 1 434 ? -19.223 -6.480  24.202 1.00 31.31 ? 434  ALA A O   1 
ATOM   3447 C CB  . ALA A 1 434 ? -17.689 -9.354  24.155 1.00 30.89 ? 434  ALA A CB  1 
ATOM   3448 N N   . LEU A 1 435 ? -17.037 -6.294  23.715 1.00 27.09 ? 435  LEU A N   1 
ATOM   3449 C CA  . LEU A 1 435 ? -16.935 -4.947  24.262 1.00 27.88 ? 435  LEU A CA  1 
ATOM   3450 C C   . LEU A 1 435 ? -17.847 -3.996  23.485 1.00 29.68 ? 435  LEU A C   1 
ATOM   3451 O O   . LEU A 1 435 ? -18.407 -3.042  24.035 1.00 30.88 ? 435  LEU A O   1 
ATOM   3452 C CB  . LEU A 1 435 ? -15.484 -4.466  24.187 1.00 26.52 ? 435  LEU A CB  1 
ATOM   3453 C CG  . LEU A 1 435 ? -14.548 -5.003  25.273 1.00 25.48 ? 435  LEU A CG  1 
ATOM   3454 C CD1 . LEU A 1 435 ? -13.098 -4.682  24.945 1.00 25.18 ? 435  LEU A CD1 1 
ATOM   3455 C CD2 . LEU A 1 435 ? -14.954 -4.382  26.603 1.00 23.02 ? 435  LEU A CD2 1 
ATOM   3456 N N   . MET A 1 436 ? -17.993 -4.273  22.198 1.00 29.91 ? 436  MET A N   1 
ATOM   3457 C CA  . MET A 1 436 ? -18.826 -3.464  21.327 1.00 32.87 ? 436  MET A CA  1 
ATOM   3458 C C   . MET A 1 436 ? -20.303 -3.815  21.485 1.00 33.78 ? 436  MET A C   1 
ATOM   3459 O O   . MET A 1 436 ? -21.134 -2.940  21.726 1.00 33.08 ? 436  MET A O   1 
ATOM   3460 C CB  . MET A 1 436 ? -18.387 -3.679  19.875 1.00 35.30 ? 436  MET A CB  1 
ATOM   3461 C CG  . MET A 1 436 ? -19.067 -2.767  18.870 1.00 44.35 ? 436  MET A CG  1 
ATOM   3462 S SD  . MET A 1 436 ? -20.451 -3.569  18.080 1.00 49.30 ? 436  MET A SD  1 
ATOM   3463 C CE  . MET A 1 436 ? -19.568 -4.463  16.774 1.00 46.79 ? 436  MET A CE  1 
ATOM   3464 N N   . LYS A 1 437 ? -20.620 -5.102  21.371 1.00 33.35 ? 437  LYS A N   1 
ATOM   3465 C CA  . LYS A 1 437 ? -22.000 -5.574  21.467 1.00 37.05 ? 437  LYS A CA  1 
ATOM   3466 C C   . LYS A 1 437 ? -22.650 -5.587  22.842 1.00 37.96 ? 437  LYS A C   1 
ATOM   3467 O O   . LYS A 1 437 ? -23.827 -5.222  22.985 1.00 37.51 ? 437  LYS A O   1 
ATOM   3468 C CB  . LYS A 1 437 ? -22.111 -6.982  20.886 1.00 40.15 ? 437  LYS A CB  1 
ATOM   3469 C CG  . LYS A 1 437 ? -22.197 -7.042  19.375 1.00 43.44 ? 437  LYS A CG  1 
ATOM   3470 C CD  . LYS A 1 437 ? -22.479 -8.468  18.914 1.00 46.08 ? 437  LYS A CD  1 
ATOM   3471 C CE  . LYS A 1 437 ? -23.738 -9.017  19.573 1.00 47.68 ? 437  LYS A CE  1 
ATOM   3472 N NZ  . LYS A 1 437 ? -24.096 -10.379 19.071 1.00 50.52 ? 437  LYS A NZ  1 
ATOM   3473 N N   . GLY A 1 438 ? -21.896 -6.022  23.848 1.00 36.29 ? 438  GLY A N   1 
ATOM   3474 C CA  . GLY A 1 438 ? -22.443 -6.104  25.186 1.00 35.47 ? 438  GLY A CA  1 
ATOM   3475 C C   . GLY A 1 438 ? -23.531 -7.166  25.202 1.00 36.87 ? 438  GLY A C   1 
ATOM   3476 O O   . GLY A 1 438 ? -23.582 -8.020  24.315 1.00 35.03 ? 438  GLY A O   1 
ATOM   3477 N N   . LYS A 1 439 ? -24.391 -7.127  26.214 1.00 36.29 ? 439  LYS A N   1 
ATOM   3478 C CA  . LYS A 1 439 ? -25.494 -8.082  26.325 1.00 36.57 ? 439  LYS A CA  1 
ATOM   3479 C C   . LYS A 1 439 ? -26.638 -7.382  27.023 1.00 35.46 ? 439  LYS A C   1 
ATOM   3480 O O   . LYS A 1 439 ? -26.565 -7.114  28.219 1.00 35.31 ? 439  LYS A O   1 
ATOM   3481 C CB  . LYS A 1 439 ? -25.089 -9.319  27.131 1.00 36.39 ? 439  LYS A CB  1 
ATOM   3482 C CG  . LYS A 1 439 ? -26.212 -10.356 27.207 1.00 39.20 ? 439  LYS A CG  1 
ATOM   3483 C CD  . LYS A 1 439 ? -25.871 -11.531 28.112 1.00 39.97 ? 439  LYS A CD  1 
ATOM   3484 C CE  . LYS A 1 439 ? -24.740 -12.382 27.554 1.00 41.27 ? 439  LYS A CE  1 
ATOM   3485 N NZ  . LYS A 1 439 ? -24.445 -13.544 28.453 1.00 41.36 ? 439  LYS A NZ  1 
ATOM   3486 N N   . SER A 1 440 ? -27.696 -7.095  26.275 1.00 37.09 ? 440  SER A N   1 
ATOM   3487 C CA  . SER A 1 440 ? -28.845 -6.384  26.818 1.00 37.61 ? 440  SER A CA  1 
ATOM   3488 C C   . SER A 1 440 ? -29.580 -7.108  27.935 1.00 37.92 ? 440  SER A C   1 
ATOM   3489 O O   . SER A 1 440 ? -29.423 -8.312  28.141 1.00 38.01 ? 440  SER A O   1 
ATOM   3490 C CB  . SER A 1 440 ? -29.842 -6.059  25.703 1.00 40.07 ? 440  SER A CB  1 
ATOM   3491 O OG  . SER A 1 440 ? -30.499 -7.231  25.257 1.00 39.72 ? 440  SER A OG  1 
ATOM   3492 N N   . THR A 1 441 ? -30.386 -6.343  28.658 1.00 35.76 ? 441  THR A N   1 
ATOM   3493 C CA  . THR A 1 441 ? -31.179 -6.865  29.749 1.00 36.82 ? 441  THR A CA  1 
ATOM   3494 C C   . THR A 1 441 ? -32.044 -8.014  29.233 1.00 38.21 ? 441  THR A C   1 
ATOM   3495 O O   . THR A 1 441 ? -32.184 -9.050  29.884 1.00 39.39 ? 441  THR A O   1 
ATOM   3496 C CB  . THR A 1 441 ? -32.092 -5.766  30.303 1.00 37.06 ? 441  THR A CB  1 
ATOM   3497 O OG1 . THR A 1 441 ? -31.299 -4.619  30.643 1.00 38.69 ? 441  THR A OG1 1 
ATOM   3498 C CG2 . THR A 1 441 ? -32.833 -6.263  31.534 1.00 37.17 ? 441  THR A CG2 1 
ATOM   3499 N N   . GLU A 1 442 ? -32.616 -7.817  28.052 1.00 40.65 ? 442  GLU A N   1 
ATOM   3500 C CA  . GLU A 1 442 ? -33.479 -8.815  27.438 1.00 44.33 ? 442  GLU A CA  1 
ATOM   3501 C C   . GLU A 1 442 ? -32.744 -10.117 27.141 1.00 43.68 ? 442  GLU A C   1 
ATOM   3502 O O   . GLU A 1 442 ? -33.261 -11.202 27.404 1.00 42.67 ? 442  GLU A O   1 
ATOM   3503 C CB  . GLU A 1 442 ? -34.079 -8.263  26.149 1.00 46.35 ? 442  GLU A CB  1 
ATOM   3504 C CG  . GLU A 1 442 ? -35.521 -8.665  25.960 1.00 52.96 ? 442  GLU A CG  1 
ATOM   3505 C CD  . GLU A 1 442 ? -36.358 -8.320  27.175 1.00 56.21 ? 442  GLU A CD  1 
ATOM   3506 O OE1 . GLU A 1 442 ? -36.739 -7.137  27.318 1.00 59.23 ? 442  GLU A OE1 1 
ATOM   3507 O OE2 . GLU A 1 442 ? -36.629 -9.227  27.991 1.00 58.55 ? 442  GLU A OE2 1 
ATOM   3508 N N   . GLU A 1 443 ? -31.543 -10.004 26.583 1.00 43.54 ? 443  GLU A N   1 
ATOM   3509 C CA  . GLU A 1 443 ? -30.741 -11.178 26.259 1.00 44.38 ? 443  GLU A CA  1 
ATOM   3510 C C   . GLU A 1 443 ? -30.363 -11.919 27.539 1.00 43.82 ? 443  GLU A C   1 
ATOM   3511 O O   . GLU A 1 443 ? -30.452 -13.145 27.605 1.00 44.97 ? 443  GLU A O   1 
ATOM   3512 C CB  . GLU A 1 443 ? -29.467 -10.762 25.507 1.00 46.59 ? 443  GLU A CB  1 
ATOM   3513 C CG  . GLU A 1 443 ? -29.716 -9.948  24.244 1.00 49.71 ? 443  GLU A CG  1 
ATOM   3514 C CD  . GLU A 1 443 ? -28.429 -9.485  23.566 1.00 51.71 ? 443  GLU A CD  1 
ATOM   3515 O OE1 . GLU A 1 443 ? -27.814 -10.278 22.823 1.00 56.24 ? 443  GLU A OE1 1 
ATOM   3516 O OE2 . GLU A 1 443 ? -28.025 -8.327  23.782 1.00 51.70 ? 443  GLU A OE2 1 
ATOM   3517 N N   . ALA A 1 444 ? -29.943 -11.173 28.557 1.00 42.68 ? 444  ALA A N   1 
ATOM   3518 C CA  . ALA A 1 444 ? -29.547 -11.772 29.830 1.00 42.73 ? 444  ALA A CA  1 
ATOM   3519 C C   . ALA A 1 444 ? -30.752 -12.391 30.523 1.00 42.69 ? 444  ALA A C   1 
ATOM   3520 O O   . ALA A 1 444 ? -30.643 -13.421 31.194 1.00 38.96 ? 444  ALA A O   1 
ATOM   3521 C CB  . ALA A 1 444 ? -28.917 -10.722 30.730 1.00 41.93 ? 444  ALA A CB  1 
ATOM   3522 N N   . ARG A 1 445 ? -31.900 -11.747 30.360 1.00 42.19 ? 445  ARG A N   1 
ATOM   3523 C CA  . ARG A 1 445 ? -33.130 -12.228 30.957 1.00 46.35 ? 445  ARG A CA  1 
ATOM   3524 C C   . ARG A 1 445 ? -33.522 -13.584 30.367 1.00 46.74 ? 445  ARG A C   1 
ATOM   3525 O O   . ARG A 1 445 ? -33.845 -14.520 31.099 1.00 47.51 ? 445  ARG A O   1 
ATOM   3526 C CB  . ARG A 1 445 ? -34.243 -11.200 30.729 1.00 48.22 ? 445  ARG A CB  1 
ATOM   3527 C CG  . ARG A 1 445 ? -35.638 -11.729 30.989 1.00 52.60 ? 445  ARG A CG  1 
ATOM   3528 C CD  . ARG A 1 445 ? -36.618 -10.603 31.286 1.00 55.24 ? 445  ARG A CD  1 
ATOM   3529 N NE  . ARG A 1 445 ? -37.111 -10.702 32.655 1.00 57.32 ? 445  ARG A NE  1 
ATOM   3530 C CZ  . ARG A 1 445 ? -37.714 -11.781 33.151 1.00 58.89 ? 445  ARG A CZ  1 
ATOM   3531 N NH1 . ARG A 1 445 ? -37.903 -12.857 32.393 1.00 58.32 ? 445  ARG A NH1 1 
ATOM   3532 N NH2 . ARG A 1 445 ? -38.124 -11.788 34.410 1.00 59.47 ? 445  ARG A NH2 1 
ATOM   3533 N N   . LYS A 1 446 ? -33.477 -13.687 29.044 1.00 48.61 ? 446  LYS A N   1 
ATOM   3534 C CA  . LYS A 1 446 ? -33.836 -14.924 28.362 1.00 50.59 ? 446  LYS A CA  1 
ATOM   3535 C C   . LYS A 1 446 ? -32.917 -16.075 28.742 1.00 51.18 ? 446  LYS A C   1 
ATOM   3536 O O   . LYS A 1 446 ? -33.365 -17.213 28.873 1.00 51.02 ? 446  LYS A O   1 
ATOM   3537 C CB  . LYS A 1 446 ? -33.819 -14.713 26.849 1.00 51.16 ? 446  LYS A CB  1 
ATOM   3538 C CG  . LYS A 1 446 ? -34.836 -13.691 26.385 1.00 53.06 ? 446  LYS A CG  1 
ATOM   3539 C CD  . LYS A 1 446 ? -34.888 -13.589 24.873 1.00 56.13 ? 446  LYS A CD  1 
ATOM   3540 C CE  . LYS A 1 446 ? -35.957 -12.597 24.446 1.00 57.18 ? 446  LYS A CE  1 
ATOM   3541 N NZ  . LYS A 1 446 ? -37.269 -12.936 25.068 1.00 58.56 ? 446  LYS A NZ  1 
ATOM   3542 N N   . GLU A 1 447 ? -31.634 -15.779 28.925 1.00 51.27 ? 447  GLU A N   1 
ATOM   3543 C CA  . GLU A 1 447 ? -30.669 -16.802 29.312 1.00 51.41 ? 447  GLU A CA  1 
ATOM   3544 C C   . GLU A 1 447 ? -30.954 -17.299 30.727 1.00 50.79 ? 447  GLU A C   1 
ATOM   3545 O O   . GLU A 1 447 ? -30.874 -18.496 30.998 1.00 50.07 ? 447  GLU A O   1 
ATOM   3546 C CB  . GLU A 1 447 ? -29.237 -16.253 29.237 1.00 51.31 ? 447  GLU A CB  1 
ATOM   3547 C CG  . GLU A 1 447 ? -28.705 -16.080 27.820 1.00 53.19 ? 447  GLU A CG  1 
ATOM   3548 C CD  . GLU A 1 447 ? -27.256 -15.614 27.783 1.00 54.48 ? 447  GLU A CD  1 
ATOM   3549 O OE1 . GLU A 1 447 ? -26.685 -15.526 26.674 1.00 55.29 ? 447  GLU A OE1 1 
ATOM   3550 O OE2 . GLU A 1 447 ? -26.689 -15.335 28.859 1.00 53.51 ? 447  GLU A OE2 1 
ATOM   3551 N N   . LEU A 1 448 ? -31.283 -16.377 31.627 1.00 50.67 ? 448  LEU A N   1 
ATOM   3552 C CA  . LEU A 1 448 ? -31.576 -16.735 33.011 1.00 52.30 ? 448  LEU A CA  1 
ATOM   3553 C C   . LEU A 1 448 ? -32.907 -17.456 33.136 1.00 54.32 ? 448  LEU A C   1 
ATOM   3554 O O   . LEU A 1 448 ? -33.062 -18.367 33.952 1.00 52.84 ? 448  LEU A O   1 
ATOM   3555 C CB  . LEU A 1 448 ? -31.584 -15.485 33.894 1.00 52.37 ? 448  LEU A CB  1 
ATOM   3556 C CG  . LEU A 1 448 ? -30.269 -15.084 34.572 1.00 52.11 ? 448  LEU A CG  1 
ATOM   3557 C CD1 . LEU A 1 448 ? -29.098 -15.847 33.982 1.00 52.17 ? 448  LEU A CD1 1 
ATOM   3558 C CD2 . LEU A 1 448 ? -30.075 -13.584 34.425 1.00 51.91 ? 448  LEU A CD2 1 
ATOM   3559 N N   . GLN A 1 449 ? -33.871 -17.037 32.328 1.00 57.15 ? 449  GLN A N   1 
ATOM   3560 C CA  . GLN A 1 449 ? -35.183 -17.657 32.346 1.00 60.15 ? 449  GLN A CA  1 
ATOM   3561 C C   . GLN A 1 449 ? -35.008 -19.106 31.910 1.00 60.99 ? 449  GLN A C   1 
ATOM   3562 O O   . GLN A 1 449 ? -35.520 -20.024 32.549 1.00 61.26 ? 449  GLN A O   1 
ATOM   3563 C CB  . GLN A 1 449 ? -36.121 -16.928 31.386 1.00 61.19 ? 449  GLN A CB  1 
ATOM   3564 C CG  . GLN A 1 449 ? -37.522 -17.488 31.368 1.00 65.22 ? 449  GLN A CG  1 
ATOM   3565 C CD  . GLN A 1 449 ? -38.318 -17.023 30.173 1.00 66.34 ? 449  GLN A CD  1 
ATOM   3566 O OE1 . GLN A 1 449 ? -38.671 -15.852 30.079 1.00 67.51 ? 449  GLN A OE1 1 
ATOM   3567 N NE2 . GLN A 1 449 ? -38.603 -17.935 29.249 1.00 68.54 ? 449  GLN A NE2 1 
ATOM   3568 N N   . ALA A 1 450 ? -34.271 -19.303 30.823 1.00 62.56 ? 450  ALA A N   1 
ATOM   3569 C CA  . ALA A 1 450 ? -34.016 -20.642 30.308 1.00 63.90 ? 450  ALA A CA  1 
ATOM   3570 C C   . ALA A 1 450 ? -33.233 -21.437 31.346 1.00 64.75 ? 450  ALA A C   1 
ATOM   3571 O O   . ALA A 1 450 ? -33.475 -22.628 31.549 1.00 65.17 ? 450  ALA A O   1 
ATOM   3572 C CB  . ALA A 1 450 ? -33.231 -20.560 29.006 1.00 63.61 ? 450  ALA A CB  1 
ATOM   3573 N N   . ALA A 1 451 ? -32.299 -20.763 32.007 1.00 65.14 ? 451  ALA A N   1 
ATOM   3574 C CA  . ALA A 1 451 ? -31.471 -21.387 33.028 1.00 65.66 ? 451  ALA A CA  1 
ATOM   3575 C C   . ALA A 1 451 ? -32.317 -21.961 34.158 1.00 65.93 ? 451  ALA A C   1 
ATOM   3576 O O   . ALA A 1 451 ? -31.819 -22.722 34.984 1.00 66.98 ? 451  ALA A O   1 
ATOM   3577 C CB  . ALA A 1 451 ? -30.477 -20.371 33.580 1.00 66.11 ? 451  ALA A CB  1 
ATOM   3578 N N   . GLY A 1 452 ? -33.592 -21.587 34.199 1.00 66.48 ? 452  GLY A N   1 
ATOM   3579 C CA  . GLY A 1 452 ? -34.479 -22.097 35.230 1.00 66.51 ? 452  GLY A CA  1 
ATOM   3580 C C   . GLY A 1 452 ? -34.712 -21.188 36.422 1.00 67.08 ? 452  GLY A C   1 
ATOM   3581 O O   . GLY A 1 452 ? -35.469 -21.539 37.328 1.00 66.79 ? 452  GLY A O   1 
ATOM   3582 N N   . LYS A 1 453 ? -34.067 -20.027 36.439 1.00 67.00 ? 453  LYS A N   1 
ATOM   3583 C CA  . LYS A 1 453 ? -34.236 -19.091 37.545 1.00 67.76 ? 453  LYS A CA  1 
ATOM   3584 C C   . LYS A 1 453 ? -35.692 -18.673 37.718 1.00 67.77 ? 453  LYS A C   1 
ATOM   3585 O O   . LYS A 1 453 ? -36.465 -18.663 36.762 1.00 67.34 ? 453  LYS A O   1 
ATOM   3586 C CB  . LYS A 1 453 ? -33.379 -17.837 37.331 1.00 68.49 ? 453  LYS A CB  1 
ATOM   3587 C CG  . LYS A 1 453 ? -31.995 -17.882 37.966 1.00 68.90 ? 453  LYS A CG  1 
ATOM   3588 C CD  . LYS A 1 453 ? -31.083 -18.878 37.275 1.00 69.42 ? 453  LYS A CD  1 
ATOM   3589 C CE  . LYS A 1 453 ? -29.697 -18.865 37.901 1.00 69.31 ? 453  LYS A CE  1 
ATOM   3590 N NZ  . LYS A 1 453 ? -28.743 -19.742 37.167 1.00 69.22 ? 453  LYS A NZ  1 
ATOM   3591 N N   . SER A 1 454 ? -36.058 -18.328 38.948 1.00 68.09 ? 454  SER A N   1 
ATOM   3592 C CA  . SER A 1 454 ? -37.414 -17.887 39.249 1.00 68.72 ? 454  SER A CA  1 
ATOM   3593 C C   . SER A 1 454 ? -37.435 -16.365 39.153 1.00 69.19 ? 454  SER A C   1 
ATOM   3594 O O   . SER A 1 454 ? -36.384 -15.724 39.175 1.00 69.09 ? 454  SER A O   1 
ATOM   3595 C CB  . SER A 1 454 ? -37.809 -18.312 40.663 1.00 68.26 ? 454  SER A CB  1 
ATOM   3596 O OG  . SER A 1 454 ? -37.029 -17.635 41.632 1.00 68.46 ? 454  SER A OG  1 
ATOM   3597 N N   . PRO A 1 455 ? -38.629 -15.764 39.038 1.00 69.38 ? 455  PRO A N   1 
ATOM   3598 C CA  . PRO A 1 455 ? -38.696 -14.303 38.946 1.00 69.93 ? 455  PRO A CA  1 
ATOM   3599 C C   . PRO A 1 455 ? -37.883 -13.639 40.055 1.00 70.50 ? 455  PRO A C   1 
ATOM   3600 O O   . PRO A 1 455 ? -37.239 -12.614 39.842 1.00 70.74 ? 455  PRO A O   1 
ATOM   3601 C CB  . PRO A 1 455 ? -40.190 -14.023 39.070 1.00 70.04 ? 455  PRO A CB  1 
ATOM   3602 C CG  . PRO A 1 455 ? -40.795 -15.211 38.379 1.00 69.86 ? 455  PRO A CG  1 
ATOM   3603 C CD  . PRO A 1 455 ? -39.973 -16.361 38.929 1.00 69.09 ? 455  PRO A CD  1 
ATOM   3604 N N   . GLU A 1 456 ? -37.909 -14.252 41.235 1.00 70.95 ? 456  GLU A N   1 
ATOM   3605 C CA  . GLU A 1 456 ? -37.194 -13.742 42.400 1.00 71.54 ? 456  GLU A CA  1 
ATOM   3606 C C   . GLU A 1 456 ? -35.681 -13.677 42.174 1.00 70.53 ? 456  GLU A C   1 
ATOM   3607 O O   . GLU A 1 456 ? -35.089 -12.598 42.176 1.00 70.21 ? 456  GLU A O   1 
ATOM   3608 C CB  . GLU A 1 456 ? -37.481 -14.633 43.612 1.00 72.93 ? 456  GLU A CB  1 
ATOM   3609 C CG  . GLU A 1 456 ? -37.352 -13.933 44.953 1.00 75.68 ? 456  GLU A CG  1 
ATOM   3610 C CD  . GLU A 1 456 ? -38.601 -13.152 45.321 1.00 77.11 ? 456  GLU A CD  1 
ATOM   3611 O OE1 . GLU A 1 456 ? -39.670 -13.782 45.468 1.00 78.35 ? 456  GLU A OE1 1 
ATOM   3612 O OE2 . GLU A 1 456 ? -38.518 -11.913 45.463 1.00 78.62 ? 456  GLU A OE2 1 
ATOM   3613 N N   . ASP A 1 457 ? -35.063 -14.839 41.984 1.00 69.40 ? 457  ASP A N   1 
ATOM   3614 C CA  . ASP A 1 457 ? -33.621 -14.914 41.777 1.00 68.15 ? 457  ASP A CA  1 
ATOM   3615 C C   . ASP A 1 457 ? -33.161 -14.291 40.462 1.00 66.55 ? 457  ASP A C   1 
ATOM   3616 O O   . ASP A 1 457 ? -32.130 -13.623 40.419 1.00 66.71 ? 457  ASP A O   1 
ATOM   3617 C CB  . ASP A 1 457 ? -33.146 -16.368 41.838 1.00 69.12 ? 457  ASP A CB  1 
ATOM   3618 C CG  . ASP A 1 457 ? -33.464 -17.034 43.163 1.00 70.57 ? 457  ASP A CG  1 
ATOM   3619 O OD1 . ASP A 1 457 ? -33.401 -16.351 44.210 1.00 70.77 ? 457  ASP A OD1 1 
ATOM   3620 O OD2 . ASP A 1 457 ? -33.761 -18.249 43.156 1.00 70.82 ? 457  ASP A OD2 1 
ATOM   3621 N N   . LEU A 1 458 ? -33.917 -14.515 39.391 1.00 64.65 ? 458  LEU A N   1 
ATOM   3622 C CA  . LEU A 1 458 ? -33.561 -13.966 38.086 1.00 62.93 ? 458  LEU A CA  1 
ATOM   3623 C C   . LEU A 1 458 ? -33.442 -12.452 38.200 1.00 62.28 ? 458  LEU A C   1 
ATOM   3624 O O   . LEU A 1 458 ? -32.487 -11.851 37.713 1.00 62.11 ? 458  LEU A O   1 
ATOM   3625 C CB  . LEU A 1 458 ? -34.624 -14.337 37.044 1.00 61.33 ? 458  LEU A CB  1 
ATOM   3626 C CG  . LEU A 1 458 ? -34.386 -13.941 35.581 1.00 61.16 ? 458  LEU A CG  1 
ATOM   3627 C CD1 . LEU A 1 458 ? -35.371 -14.684 34.687 1.00 59.42 ? 458  LEU A CD1 1 
ATOM   3628 C CD2 . LEU A 1 458 ? -34.532 -12.436 35.409 1.00 59.58 ? 458  LEU A CD2 1 
ATOM   3629 N N   . MET A 1 459 ? -34.426 -11.847 38.853 1.00 62.04 ? 459  MET A N   1 
ATOM   3630 C CA  . MET A 1 459 ? -34.454 -10.408 39.051 1.00 61.91 ? 459  MET A CA  1 
ATOM   3631 C C   . MET A 1 459 ? -33.251 -9.956  39.868 1.00 60.27 ? 459  MET A C   1 
ATOM   3632 O O   . MET A 1 459 ? -32.619 -8.947  39.559 1.00 60.17 ? 459  MET A O   1 
ATOM   3633 C CB  . MET A 1 459 ? -35.741 -10.016 39.775 1.00 64.62 ? 459  MET A CB  1 
ATOM   3634 C CG  . MET A 1 459 ? -35.757 -8.603  40.303 1.00 68.73 ? 459  MET A CG  1 
ATOM   3635 S SD  . MET A 1 459 ? -35.452 -7.387  39.016 1.00 74.31 ? 459  MET A SD  1 
ATOM   3636 C CE  . MET A 1 459 ? -34.081 -6.493  39.717 1.00 74.45 ? 459  MET A CE  1 
ATOM   3637 N N   . LYS A 1 460 ? -32.945 -10.715 40.914 1.00 57.77 ? 460  LYS A N   1 
ATOM   3638 C CA  . LYS A 1 460 ? -31.833 -10.408 41.804 1.00 55.26 ? 460  LYS A CA  1 
ATOM   3639 C C   . LYS A 1 460 ? -30.499 -10.437 41.065 1.00 52.12 ? 460  LYS A C   1 
ATOM   3640 O O   . LYS A 1 460 ? -29.624 -9.615  41.319 1.00 52.69 ? 460  LYS A O   1 
ATOM   3641 C CB  . LYS A 1 460 ? -31.824 -11.420 42.960 1.00 56.71 ? 460  LYS A CB  1 
ATOM   3642 C CG  . LYS A 1 460 ? -30.879 -11.114 44.121 1.00 58.37 ? 460  LYS A CG  1 
ATOM   3643 C CD  . LYS A 1 460 ? -29.628 -11.987 44.085 1.00 59.30 ? 460  LYS A CD  1 
ATOM   3644 C CE  . LYS A 1 460 ? -28.462 -11.266 43.428 1.00 58.83 ? 460  LYS A CE  1 
ATOM   3645 N NZ  . LYS A 1 460 ? -28.076 -10.060 44.213 1.00 56.72 ? 460  LYS A NZ  1 
ATOM   3646 N N   . LEU A 1 461 ? -30.363 -11.373 40.132 1.00 48.72 ? 461  LEU A N   1 
ATOM   3647 C CA  . LEU A 1 461 ? -29.127 -11.540 39.371 1.00 45.96 ? 461  LEU A CA  1 
ATOM   3648 C C   . LEU A 1 461 ? -29.032 -10.743 38.067 1.00 43.78 ? 461  LEU A C   1 
ATOM   3649 O O   . LEU A 1 461 ? -27.948 -10.269 37.699 1.00 40.32 ? 461  LEU A O   1 
ATOM   3650 C CB  . LEU A 1 461 ? -28.921 -13.033 39.061 1.00 45.50 ? 461  LEU A CB  1 
ATOM   3651 C CG  . LEU A 1 461 ? -27.583 -13.472 38.455 1.00 47.55 ? 461  LEU A CG  1 
ATOM   3652 C CD1 . LEU A 1 461 ? -26.446 -13.125 39.419 1.00 47.94 ? 461  LEU A CD1 1 
ATOM   3653 C CD2 . LEU A 1 461 ? -27.607 -14.979 38.184 1.00 47.37 ? 461  LEU A CD2 1 
ATOM   3654 N N   . LEU A 1 462 ? -30.168 -10.589 37.386 1.00 39.95 ? 462  LEU A N   1 
ATOM   3655 C CA  . LEU A 1 462 ? -30.241 -9.911  36.092 1.00 37.58 ? 462  LEU A CA  1 
ATOM   3656 C C   . LEU A 1 462 ? -29.361 -8.685  35.805 1.00 36.55 ? 462  LEU A C   1 
ATOM   3657 O O   . LEU A 1 462 ? -28.471 -8.751  34.958 1.00 37.33 ? 462  LEU A O   1 
ATOM   3658 C CB  . LEU A 1 462 ? -31.705 -9.569  35.768 1.00 39.17 ? 462  LEU A CB  1 
ATOM   3659 C CG  . LEU A 1 462 ? -31.992 -8.941  34.398 1.00 39.21 ? 462  LEU A CG  1 
ATOM   3660 C CD1 . LEU A 1 462 ? -31.468 -9.838  33.282 1.00 37.06 ? 462  LEU A CD1 1 
ATOM   3661 C CD2 . LEU A 1 462 ? -33.491 -8.717  34.247 1.00 40.42 ? 462  LEU A CD2 1 
ATOM   3662 N N   . PRO A 1 463 ? -29.595 -7.552  36.495 1.00 35.15 ? 463  PRO A N   1 
ATOM   3663 C CA  . PRO A 1 463 ? -28.765 -6.372  36.214 1.00 35.42 ? 463  PRO A CA  1 
ATOM   3664 C C   . PRO A 1 463 ? -27.257 -6.617  36.261 1.00 35.21 ? 463  PRO A C   1 
ATOM   3665 O O   . PRO A 1 463 ? -26.503 -6.046  35.469 1.00 33.05 ? 463  PRO A O   1 
ATOM   3666 C CB  . PRO A 1 463 ? -29.236 -5.361  37.261 1.00 36.77 ? 463  PRO A CB  1 
ATOM   3667 C CG  . PRO A 1 463 ? -29.654 -6.229  38.414 1.00 35.83 ? 463  PRO A CG  1 
ATOM   3668 C CD  . PRO A 1 463 ? -30.384 -7.362  37.726 1.00 35.12 ? 463  PRO A CD  1 
ATOM   3669 N N   . HIS A 1 464 ? -26.834 -7.476  37.182 1.00 35.37 ? 464  HIS A N   1 
ATOM   3670 C CA  . HIS A 1 464 ? -25.424 -7.828  37.359 1.00 35.87 ? 464  HIS A CA  1 
ATOM   3671 C C   . HIS A 1 464 ? -24.856 -8.572  36.154 1.00 36.93 ? 464  HIS A C   1 
ATOM   3672 O O   . HIS A 1 464 ? -23.650 -8.537  35.909 1.00 39.81 ? 464  HIS A O   1 
ATOM   3673 C CB  . HIS A 1 464 ? -25.263 -8.717  38.602 1.00 32.80 ? 464  HIS A CB  1 
ATOM   3674 C CG  . HIS A 1 464 ? -25.697 -8.067  39.876 1.00 32.06 ? 464  HIS A CG  1 
ATOM   3675 N ND1 . HIS A 1 464 ? -24.925 -7.138  40.538 1.00 32.49 ? 464  HIS A ND1 1 
ATOM   3676 C CD2 . HIS A 1 464 ? -26.814 -8.227  40.622 1.00 31.84 ? 464  HIS A CD2 1 
ATOM   3677 C CE1 . HIS A 1 464 ? -25.546 -6.757  41.639 1.00 32.95 ? 464  HIS A CE1 1 
ATOM   3678 N NE2 . HIS A 1 464 ? -26.695 -7.403  41.713 1.00 33.53 ? 464  HIS A NE2 1 
ATOM   3679 N N   . LYS A 1 465 ? -25.727 -9.244  35.406 1.00 38.50 ? 465  LYS A N   1 
ATOM   3680 C CA  . LYS A 1 465 ? -25.319 -10.024 34.238 1.00 37.55 ? 465  LYS A CA  1 
ATOM   3681 C C   . LYS A 1 465 ? -25.470 -9.269  32.920 1.00 35.26 ? 465  LYS A C   1 
ATOM   3682 O O   . LYS A 1 465 ? -25.268 -9.835  31.842 1.00 34.76 ? 465  LYS A O   1 
ATOM   3683 C CB  . LYS A 1 465 ? -26.139 -11.314 34.176 1.00 41.12 ? 465  LYS A CB  1 
ATOM   3684 C CG  . LYS A 1 465 ? -26.147 -12.112 35.473 1.00 44.20 ? 465  LYS A CG  1 
ATOM   3685 C CD  . LYS A 1 465 ? -25.039 -13.145 35.526 1.00 47.31 ? 465  LYS A CD  1 
ATOM   3686 C CE  . LYS A 1 465 ? -25.291 -14.254 34.525 1.00 47.97 ? 465  LYS A CE  1 
ATOM   3687 N NZ  . LYS A 1 465 ? -24.351 -15.385 34.709 1.00 48.81 ? 465  LYS A NZ  1 
ATOM   3688 N N   . VAL A 1 466 ? -25.819 -7.988  33.006 1.00 33.64 ? 466  VAL A N   1 
ATOM   3689 C CA  . VAL A 1 466 ? -25.998 -7.162  31.812 1.00 31.52 ? 466  VAL A CA  1 
ATOM   3690 C C   . VAL A 1 466 ? -24.733 -6.364  31.445 1.00 31.55 ? 466  VAL A C   1 
ATOM   3691 O O   . VAL A 1 466 ? -24.081 -5.778  32.308 1.00 28.50 ? 466  VAL A O   1 
ATOM   3692 C CB  . VAL A 1 466 ? -27.164 -6.173  32.005 1.00 32.94 ? 466  VAL A CB  1 
ATOM   3693 C CG1 . VAL A 1 466 ? -27.157 -5.129  30.891 1.00 33.77 ? 466  VAL A CG1 1 
ATOM   3694 C CG2 . VAL A 1 466 ? -28.494 -6.935  32.018 1.00 34.52 ? 466  VAL A CG2 1 
ATOM   3695 N N   . PHE A 1 467 ? -24.407 -6.350  30.158 1.00 31.47 ? 467  PHE A N   1 
ATOM   3696 C CA  . PHE A 1 467 ? -23.241 -5.634  29.653 1.00 33.31 ? 467  PHE A CA  1 
ATOM   3697 C C   . PHE A 1 467 ? -23.688 -4.532  28.710 1.00 33.06 ? 467  PHE A C   1 
ATOM   3698 O O   . PHE A 1 467 ? -24.200 -4.797  27.622 1.00 31.06 ? 467  PHE A O   1 
ATOM   3699 C CB  . PHE A 1 467 ? -22.291 -6.603  28.940 1.00 32.94 ? 467  PHE A CB  1 
ATOM   3700 C CG  . PHE A 1 467 ? -21.693 -7.641  29.859 1.00 36.10 ? 467  PHE A CG  1 
ATOM   3701 C CD1 . PHE A 1 467 ? -22.472 -8.683  30.357 1.00 35.54 ? 467  PHE A CD1 1 
ATOM   3702 C CD2 . PHE A 1 467 ? -20.366 -7.541  30.273 1.00 37.59 ? 467  PHE A CD2 1 
ATOM   3703 C CE1 . PHE A 1 467 ? -21.944 -9.609  31.258 1.00 39.06 ? 467  PHE A CE1 1 
ATOM   3704 C CE2 . PHE A 1 467 ? -19.823 -8.463  31.177 1.00 40.14 ? 467  PHE A CE2 1 
ATOM   3705 C CZ  . PHE A 1 467 ? -20.618 -9.501  31.672 1.00 39.10 ? 467  PHE A CZ  1 
ATOM   3706 N N   . GLU A 1 468 ? -23.488 -3.290  29.138 1.00 32.69 ? 468  GLU A N   1 
ATOM   3707 C CA  . GLU A 1 468 ? -23.902 -2.137  28.350 1.00 33.13 ? 468  GLU A CA  1 
ATOM   3708 C C   . GLU A 1 468 ? -23.171 -2.019  27.029 1.00 33.76 ? 468  GLU A C   1 
ATOM   3709 O O   . GLU A 1 468 ? -23.695 -1.436  26.081 1.00 33.00 ? 468  GLU A O   1 
ATOM   3710 C CB  . GLU A 1 468 ? -23.748 -0.854  29.180 1.00 34.12 ? 468  GLU A CB  1 
ATOM   3711 C CG  . GLU A 1 468 ? -24.559 -0.909  30.474 1.00 36.86 ? 468  GLU A CG  1 
ATOM   3712 C CD  . GLU A 1 468 ? -24.631 0.411   31.230 1.00 38.73 ? 468  GLU A CD  1 
ATOM   3713 O OE1 . GLU A 1 468 ? -23.586 1.073   31.407 1.00 41.48 ? 468  GLU A OE1 1 
ATOM   3714 O OE2 . GLU A 1 468 ? -25.740 0.775   31.672 1.00 37.83 ? 468  GLU A OE2 1 
ATOM   3715 N N   . GLY A 1 469 ? -21.968 -2.583  26.962 1.00 31.92 ? 469  GLY A N   1 
ATOM   3716 C CA  . GLY A 1 469 ? -21.197 -2.526  25.737 1.00 33.83 ? 469  GLY A CA  1 
ATOM   3717 C C   . GLY A 1 469 ? -20.835 -1.123  25.277 1.00 32.64 ? 469  GLY A C   1 
ATOM   3718 O O   . GLY A 1 469 ? -20.627 -0.222  26.091 1.00 34.61 ? 469  GLY A O   1 
ATOM   3719 N N   . ASN A 1 470 ? -20.758 -0.944  23.964 1.00 33.01 ? 470  ASN A N   1 
ATOM   3720 C CA  . ASN A 1 470 ? -20.405 0.339   23.364 1.00 34.33 ? 470  ASN A CA  1 
ATOM   3721 C C   . ASN A 1 470 ? -19.001 0.779   23.812 1.00 35.37 ? 470  ASN A C   1 
ATOM   3722 O O   . ASN A 1 470 ? -18.717 1.976   23.927 1.00 34.43 ? 470  ASN A O   1 
ATOM   3723 C CB  . ASN A 1 470 ? -21.452 1.401   23.732 1.00 33.58 ? 470  ASN A CB  1 
ATOM   3724 C CG  . ASN A 1 470 ? -21.581 2.484   22.670 1.00 36.32 ? 470  ASN A CG  1 
ATOM   3725 O OD1 . ASN A 1 470 ? -21.367 2.226   21.488 1.00 38.27 ? 470  ASN A OD1 1 
ATOM   3726 N ND2 . ASN A 1 470 ? -21.951 3.696   23.084 1.00 36.05 ? 470  ASN A ND2 1 
ATOM   3727 N N   . ARG A 1 471 ? -18.139 -0.206  24.076 1.00 33.77 ? 471  ARG A N   1 
ATOM   3728 C CA  . ARG A 1 471 ? -16.750 0.032   24.484 1.00 34.55 ? 471  ARG A CA  1 
ATOM   3729 C C   . ARG A 1 471 ? -15.900 -0.001  23.221 1.00 32.65 ? 471  ARG A C   1 
ATOM   3730 O O   . ARG A 1 471 ? -15.725 -1.050  22.617 1.00 33.16 ? 471  ARG A O   1 
ATOM   3731 C CB  . ARG A 1 471 ? -16.260 -1.065  25.437 1.00 35.68 ? 471  ARG A CB  1 
ATOM   3732 C CG  . ARG A 1 471 ? -16.342 -0.730  26.909 1.00 35.65 ? 471  ARG A CG  1 
ATOM   3733 C CD  . ARG A 1 471 ? -17.718 -0.946  27.489 1.00 33.36 ? 471  ARG A CD  1 
ATOM   3734 N NE  . ARG A 1 471 ? -17.723 -0.700  28.930 1.00 32.14 ? 471  ARG A NE  1 
ATOM   3735 C CZ  . ARG A 1 471 ? -18.809 -0.398  29.626 1.00 32.82 ? 471  ARG A CZ  1 
ATOM   3736 N NH1 . ARG A 1 471 ? -19.980 -0.310  29.009 1.00 34.86 ? 471  ARG A NH1 1 
ATOM   3737 N NH2 . ARG A 1 471 ? -18.724 -0.152  30.927 1.00 32.10 ? 471  ARG A NH2 1 
ATOM   3738 N N   . PRO A 1 472 ? -15.332 1.146   22.827 1.00 31.92 ? 472  PRO A N   1 
ATOM   3739 C CA  . PRO A 1 472 ? -14.503 1.254   21.621 1.00 31.79 ? 472  PRO A CA  1 
ATOM   3740 C C   . PRO A 1 472 ? -13.127 0.612   21.697 1.00 32.21 ? 472  PRO A C   1 
ATOM   3741 O O   . PRO A 1 472 ? -12.469 0.650   22.737 1.00 32.11 ? 472  PRO A O   1 
ATOM   3742 C CB  . PRO A 1 472 ? -14.408 2.759   21.420 1.00 31.65 ? 472  PRO A CB  1 
ATOM   3743 C CG  . PRO A 1 472 ? -14.283 3.231   22.832 1.00 30.82 ? 472  PRO A CG  1 
ATOM   3744 C CD  . PRO A 1 472 ? -15.339 2.422   23.567 1.00 30.99 ? 472  PRO A CD  1 
ATOM   3745 N N   . THR A 1 473 ? -12.700 0.042   20.573 1.00 31.74 ? 473  THR A N   1 
ATOM   3746 C CA  . THR A 1 473 ? -11.397 -0.597  20.453 1.00 31.30 ? 473  THR A CA  1 
ATOM   3747 C C   . THR A 1 473 ? -10.841 -0.515  19.035 1.00 31.15 ? 473  THR A C   1 
ATOM   3748 O O   . THR A 1 473 ? -11.568 -0.282  18.068 1.00 31.69 ? 473  THR A O   1 
ATOM   3749 C CB  . THR A 1 473 ? -11.462 -2.105  20.776 1.00 31.56 ? 473  THR A CB  1 
ATOM   3750 O OG1 . THR A 1 473 ? -12.326 -2.749  19.833 1.00 33.91 ? 473  THR A OG1 1 
ATOM   3751 C CG2 . THR A 1 473 ? -11.970 -2.350  22.182 1.00 31.19 ? 473  THR A CG2 1 
ATOM   3752 N N   . ASN A 1 474 ? -9.534  -0.709  18.930 1.00 31.36 ? 474  ASN A N   1 
ATOM   3753 C CA  . ASN A 1 474 ? -8.847  -0.752  17.654 1.00 31.37 ? 474  ASN A CA  1 
ATOM   3754 C C   . ASN A 1 474 ? -8.270  -2.153  17.637 1.00 32.51 ? 474  ASN A C   1 
ATOM   3755 O O   . ASN A 1 474 ? -7.814  -2.635  18.672 1.00 31.29 ? 474  ASN A O   1 
ATOM   3756 C CB  . ASN A 1 474 ? -7.668  0.226   17.589 1.00 30.98 ? 474  ASN A CB  1 
ATOM   3757 C CG  . ASN A 1 474 ? -8.091  1.650   17.314 1.00 31.55 ? 474  ASN A CG  1 
ATOM   3758 O OD1 . ASN A 1 474 ? -8.996  1.902   16.517 1.00 33.69 ? 474  ASN A OD1 1 
ATOM   3759 N ND2 . ASN A 1 474 ? -7.414  2.596   17.952 1.00 32.26 ? 474  ASN A ND2 1 
ATOM   3760 N N   . SER A 1 475 ? -8.309  -2.816  16.489 1.00 30.37 ? 475  SER A N   1 
ATOM   3761 C CA  . SER A 1 475 ? -7.710  -4.139  16.383 1.00 32.57 ? 475  SER A CA  1 
ATOM   3762 C C   . SER A 1 475 ? -6.613  -4.006  15.347 1.00 33.17 ? 475  SER A C   1 
ATOM   3763 O O   . SER A 1 475 ? -6.860  -3.604  14.211 1.00 34.59 ? 475  SER A O   1 
ATOM   3764 C CB  . SER A 1 475 ? -8.731  -5.209  15.956 1.00 30.72 ? 475  SER A CB  1 
ATOM   3765 O OG  . SER A 1 475 ? -9.607  -5.531  17.025 1.00 30.71 ? 475  SER A OG  1 
ATOM   3766 N N   . ILE A 1 476 ? -5.393  -4.317  15.758 1.00 33.21 ? 476  ILE A N   1 
ATOM   3767 C CA  . ILE A 1 476 ? -4.239  -4.244  14.879 1.00 33.69 ? 476  ILE A CA  1 
ATOM   3768 C C   . ILE A 1 476 ? -3.715  -5.663  14.702 1.00 33.98 ? 476  ILE A C   1 
ATOM   3769 O O   . ILE A 1 476 ? -3.225  -6.274  15.650 1.00 33.38 ? 476  ILE A O   1 
ATOM   3770 C CB  . ILE A 1 476 ? -3.150  -3.346  15.500 1.00 32.12 ? 476  ILE A CB  1 
ATOM   3771 C CG1 . ILE A 1 476 ? -3.704  -1.922  15.658 1.00 35.04 ? 476  ILE A CG1 1 
ATOM   3772 C CG2 . ILE A 1 476 ? -1.893  -3.373  14.641 1.00 35.10 ? 476  ILE A CG2 1 
ATOM   3773 C CD1 . ILE A 1 476 ? -2.792  -0.970  16.390 1.00 34.04 ? 476  ILE A CD1 1 
ATOM   3774 N N   . VAL A 1 477 ? -3.833  -6.183  13.485 1.00 33.03 ? 477  VAL A N   1 
ATOM   3775 C CA  . VAL A 1 477 ? -3.405  -7.544  13.184 1.00 32.68 ? 477  VAL A CA  1 
ATOM   3776 C C   . VAL A 1 477 ? -2.323  -7.520  12.121 1.00 33.92 ? 477  VAL A C   1 
ATOM   3777 O O   . VAL A 1 477 ? -2.441  -6.809  11.121 1.00 33.65 ? 477  VAL A O   1 
ATOM   3778 C CB  . VAL A 1 477 ? -4.589  -8.392  12.657 1.00 31.49 ? 477  VAL A CB  1 
ATOM   3779 C CG1 . VAL A 1 477 ? -4.211  -9.868  12.641 1.00 32.66 ? 477  VAL A CG1 1 
ATOM   3780 C CG2 . VAL A 1 477 ? -5.824  -8.149  13.510 1.00 30.26 ? 477  VAL A CG2 1 
ATOM   3781 N N   . PHE A 1 478 ? -1.267  -8.297  12.338 1.00 32.81 ? 478  PHE A N   1 
ATOM   3782 C CA  . PHE A 1 478 ? -0.165  -8.363  11.387 1.00 34.06 ? 478  PHE A CA  1 
ATOM   3783 C C   . PHE A 1 478 ? 0.184   -9.819  11.104 1.00 34.16 ? 478  PHE A C   1 
ATOM   3784 O O   . PHE A 1 478 ? -0.049  -10.691 11.931 1.00 32.56 ? 478  PHE A O   1 
ATOM   3785 C CB  . PHE A 1 478 ? 1.044   -7.584  11.921 1.00 35.26 ? 478  PHE A CB  1 
ATOM   3786 C CG  . PHE A 1 478 ? 1.242   -7.710  13.403 1.00 36.40 ? 478  PHE A CG  1 
ATOM   3787 C CD1 . PHE A 1 478 ? 2.111   -8.663  13.927 1.00 38.51 ? 478  PHE A CD1 1 
ATOM   3788 C CD2 . PHE A 1 478 ? 0.533   -6.893  14.278 1.00 38.75 ? 478  PHE A CD2 1 
ATOM   3789 C CE1 . PHE A 1 478 ? 2.268   -8.799  15.308 1.00 39.14 ? 478  PHE A CE1 1 
ATOM   3790 C CE2 . PHE A 1 478 ? 0.682   -7.023  15.659 1.00 38.83 ? 478  PHE A CE2 1 
ATOM   3791 C CZ  . PHE A 1 478 ? 1.550   -7.977  16.172 1.00 37.94 ? 478  PHE A CZ  1 
ATOM   3792 N N   . THR A 1 479 ? 0.722   -10.074 9.918  1.00 33.77 ? 479  THR A N   1 
ATOM   3793 C CA  . THR A 1 479 ? 1.065   -11.428 9.490  1.00 35.28 ? 479  THR A CA  1 
ATOM   3794 C C   . THR A 1 479 ? 1.873   -12.251 10.495 1.00 35.42 ? 479  THR A C   1 
ATOM   3795 O O   . THR A 1 479 ? 1.502   -13.386 10.825 1.00 36.78 ? 479  THR A O   1 
ATOM   3796 C CB  . THR A 1 479 ? 1.846   -11.384 8.155  1.00 35.75 ? 479  THR A CB  1 
ATOM   3797 O OG1 . THR A 1 479 ? 1.137   -10.558 7.220  1.00 38.13 ? 479  THR A OG1 1 
ATOM   3798 C CG2 . THR A 1 479 ? 2.005   -12.792 7.577  1.00 35.47 ? 479  THR A CG2 1 
ATOM   3799 N N   . LYS A 1 480 ? 2.976   -11.680 10.968 1.00 34.89 ? 480  LYS A N   1 
ATOM   3800 C CA  . LYS A 1 480 ? 3.857   -12.362 11.915 1.00 36.55 ? 480  LYS A CA  1 
ATOM   3801 C C   . LYS A 1 480 ? 4.704   -11.318 12.639 1.00 34.23 ? 480  LYS A C   1 
ATOM   3802 O O   . LYS A 1 480 ? 5.021   -10.283 12.069 1.00 34.93 ? 480  LYS A O   1 
ATOM   3803 C CB  . LYS A 1 480 ? 4.761   -13.334 11.149 1.00 37.52 ? 480  LYS A CB  1 
ATOM   3804 C CG  . LYS A 1 480 ? 5.622   -14.244 12.012 1.00 40.92 ? 480  LYS A CG  1 
ATOM   3805 C CD  . LYS A 1 480 ? 6.260   -15.330 11.152 1.00 41.22 ? 480  LYS A CD  1 
ATOM   3806 C CE  . LYS A 1 480 ? 7.053   -16.316 11.984 1.00 43.15 ? 480  LYS A CE  1 
ATOM   3807 N NZ  . LYS A 1 480 ? 7.578   -17.421 11.138 1.00 44.22 ? 480  LYS A NZ  1 
ATOM   3808 N N   . LEU A 1 481 ? 5.060   -11.584 13.894 1.00 33.99 ? 481  LEU A N   1 
ATOM   3809 C CA  . LEU A 1 481 ? 5.866   -10.641 14.661 1.00 32.81 ? 481  LEU A CA  1 
ATOM   3810 C C   . LEU A 1 481 ? 7.344   -10.874 14.382 1.00 33.39 ? 481  LEU A C   1 
ATOM   3811 O O   . LEU A 1 481 ? 8.036   -11.604 15.095 1.00 33.92 ? 481  LEU A O   1 
ATOM   3812 C CB  . LEU A 1 481 ? 5.591   -10.782 16.162 1.00 33.37 ? 481  LEU A CB  1 
ATOM   3813 C CG  . LEU A 1 481 ? 6.305   -9.745  17.032 1.00 38.31 ? 481  LEU A CG  1 
ATOM   3814 C CD1 . LEU A 1 481 ? 5.852   -8.332  16.621 1.00 34.33 ? 481  LEU A CD1 1 
ATOM   3815 C CD2 . LEU A 1 481 ? 6.008   -10.010 18.508 1.00 36.94 ? 481  LEU A CD2 1 
ATOM   3816 N N   . THR A 1 482 ? 7.820   -10.228 13.334 1.00 33.20 ? 482  THR A N   1 
ATOM   3817 C CA  . THR A 1 482 ? 9.203   -10.347 12.912 1.00 34.87 ? 482  THR A CA  1 
ATOM   3818 C C   . THR A 1 482 ? 9.920   -9.046  13.224 1.00 35.69 ? 482  THR A C   1 
ATOM   3819 O O   . THR A 1 482 ? 9.289   -8.048  13.571 1.00 35.96 ? 482  THR A O   1 
ATOM   3820 C CB  . THR A 1 482 ? 9.263   -10.570 11.409 1.00 35.84 ? 482  THR A CB  1 
ATOM   3821 O OG1 . THR A 1 482 ? 8.746   -9.407  10.750 1.00 35.39 ? 482  THR A OG1 1 
ATOM   3822 C CG2 . THR A 1 482 ? 8.413   -11.769 11.020 1.00 34.93 ? 482  THR A CG2 1 
ATOM   3823 N N   . PRO A 1 483 ? 11.254  -9.035  13.103 1.00 36.10 ? 483  PRO A N   1 
ATOM   3824 C CA  . PRO A 1 483 ? 11.995  -7.805  13.383 1.00 36.43 ? 483  PRO A CA  1 
ATOM   3825 C C   . PRO A 1 483 ? 11.457  -6.611  12.591 1.00 36.97 ? 483  PRO A C   1 
ATOM   3826 O O   . PRO A 1 483 ? 11.254  -5.529  13.139 1.00 34.99 ? 483  PRO A O   1 
ATOM   3827 C CB  . PRO A 1 483 ? 13.422  -8.175  12.990 1.00 36.95 ? 483  PRO A CB  1 
ATOM   3828 C CG  . PRO A 1 483 ? 13.499  -9.621  13.402 1.00 37.38 ? 483  PRO A CG  1 
ATOM   3829 C CD  . PRO A 1 483 ? 12.173  -10.170 12.888 1.00 37.01 ? 483  PRO A CD  1 
ATOM   3830 N N   . PHE A 1 484 ? 11.215  -6.822  11.299 1.00 37.45 ? 484  PHE A N   1 
ATOM   3831 C CA  . PHE A 1 484 ? 10.719  -5.772  10.418 1.00 35.05 ? 484  PHE A CA  1 
ATOM   3832 C C   . PHE A 1 484 ? 9.365   -5.225  10.862 1.00 35.44 ? 484  PHE A C   1 
ATOM   3833 O O   . PHE A 1 484 ? 9.171   -4.010  10.946 1.00 33.87 ? 484  PHE A O   1 
ATOM   3834 C CB  . PHE A 1 484 ? 10.600  -6.302  8.981  1.00 36.05 ? 484  PHE A CB  1 
ATOM   3835 C CG  . PHE A 1 484 ? 10.056  -5.292  8.003  1.00 38.29 ? 484  PHE A CG  1 
ATOM   3836 C CD1 . PHE A 1 484 ? 10.915  -4.516  7.234  1.00 40.73 ? 484  PHE A CD1 1 
ATOM   3837 C CD2 . PHE A 1 484 ? 8.682   -5.111  7.860  1.00 40.72 ? 484  PHE A CD2 1 
ATOM   3838 C CE1 . PHE A 1 484 ? 10.417  -3.573  6.333  1.00 41.42 ? 484  PHE A CE1 1 
ATOM   3839 C CE2 . PHE A 1 484 ? 8.172   -4.173  6.966  1.00 41.50 ? 484  PHE A CE2 1 
ATOM   3840 C CZ  . PHE A 1 484 ? 9.044   -3.402  6.199  1.00 41.90 ? 484  PHE A CZ  1 
ATOM   3841 N N   . ILE A 1 485 ? 8.426   -6.123  11.134 1.00 34.48 ? 485  ILE A N   1 
ATOM   3842 C CA  . ILE A 1 485 ? 7.092   -5.710  11.557 1.00 34.89 ? 485  ILE A CA  1 
ATOM   3843 C C   . ILE A 1 485 ? 7.117   -5.028  12.922 1.00 33.64 ? 485  ILE A C   1 
ATOM   3844 O O   . ILE A 1 485 ? 6.403   -4.048  13.141 1.00 35.67 ? 485  ILE A O   1 
ATOM   3845 C CB  . ILE A 1 485 ? 6.125   -6.916  11.581 1.00 34.16 ? 485  ILE A CB  1 
ATOM   3846 C CG1 . ILE A 1 485 ? 5.895   -7.421  10.148 1.00 35.68 ? 485  ILE A CG1 1 
ATOM   3847 C CG2 . ILE A 1 485 ? 4.796   -6.520  12.229 1.00 33.45 ? 485  ILE A CG2 1 
ATOM   3848 C CD1 . ILE A 1 485 ? 5.155   -6.426  9.249  1.00 34.53 ? 485  ILE A CD1 1 
ATOM   3849 N N   . LEU A 1 486 ? 7.934   -5.533  13.842 1.00 34.79 ? 486  LEU A N   1 
ATOM   3850 C CA  . LEU A 1 486 ? 8.023   -4.915  15.165 1.00 33.98 ? 486  LEU A CA  1 
ATOM   3851 C C   . LEU A 1 486 ? 8.490   -3.475  14.969 1.00 34.19 ? 486  LEU A C   1 
ATOM   3852 O O   . LEU A 1 486 ? 7.967   -2.549  15.590 1.00 33.88 ? 486  LEU A O   1 
ATOM   3853 C CB  . LEU A 1 486 ? 9.011   -5.671  16.061 1.00 33.80 ? 486  LEU A CB  1 
ATOM   3854 C CG  . LEU A 1 486 ? 9.308   -5.055  17.442 1.00 34.29 ? 486  LEU A CG  1 
ATOM   3855 C CD1 . LEU A 1 486 ? 8.017   -4.941  18.256 1.00 34.12 ? 486  LEU A CD1 1 
ATOM   3856 C CD2 . LEU A 1 486 ? 10.320  -5.909  18.186 1.00 30.64 ? 486  LEU A CD2 1 
ATOM   3857 N N   . GLY A 1 487 ? 9.467   -3.297  14.084 1.00 33.94 ? 487  GLY A N   1 
ATOM   3858 C CA  . GLY A 1 487 ? 9.989   -1.970  13.806 1.00 34.34 ? 487  GLY A CA  1 
ATOM   3859 C C   . GLY A 1 487 ? 8.914   -1.047  13.268 1.00 33.69 ? 487  GLY A C   1 
ATOM   3860 O O   . GLY A 1 487 ? 8.832   0.119   13.659 1.00 34.56 ? 487  GLY A O   1 
ATOM   3861 N N   . ALA A 1 488 ? 8.083   -1.565  12.367 1.00 34.44 ? 488  ALA A N   1 
ATOM   3862 C CA  . ALA A 1 488 ? 7.005   -0.769  11.796 1.00 32.87 ? 488  ALA A CA  1 
ATOM   3863 C C   . ALA A 1 488 ? 5.952   -0.410  12.853 1.00 34.07 ? 488  ALA A C   1 
ATOM   3864 O O   . ALA A 1 488 ? 5.429   0.706   12.852 1.00 32.90 ? 488  ALA A O   1 
ATOM   3865 C CB  . ALA A 1 488 ? 6.356   -1.516  10.630 1.00 30.89 ? 488  ALA A CB  1 
ATOM   3866 N N   . LEU A 1 489 ? 5.649   -1.346  13.755 1.00 33.60 ? 489  LEU A N   1 
ATOM   3867 C CA  . LEU A 1 489 ? 4.661   -1.095  14.807 1.00 34.52 ? 489  LEU A CA  1 
ATOM   3868 C C   . LEU A 1 489 ? 5.137   -0.030  15.791 1.00 33.89 ? 489  LEU A C   1 
ATOM   3869 O O   . LEU A 1 489 ? 4.371   0.853   16.176 1.00 34.84 ? 489  LEU A O   1 
ATOM   3870 C CB  . LEU A 1 489 ? 4.340   -2.389  15.567 1.00 34.04 ? 489  LEU A CB  1 
ATOM   3871 C CG  . LEU A 1 489 ? 3.640   -3.469  14.741 1.00 33.44 ? 489  LEU A CG  1 
ATOM   3872 C CD1 . LEU A 1 489 ? 3.599   -4.774  15.528 1.00 35.58 ? 489  LEU A CD1 1 
ATOM   3873 C CD2 . LEU A 1 489 ? 2.234   -3.001  14.367 1.00 35.39 ? 489  LEU A CD2 1 
ATOM   3874 N N   . ILE A 1 490 ? 6.402   -0.104  16.188 1.00 32.28 ? 490  ILE A N   1 
ATOM   3875 C CA  . ILE A 1 490 ? 6.951   0.863   17.127 1.00 33.17 ? 490  ILE A CA  1 
ATOM   3876 C C   . ILE A 1 490 ? 6.971   2.271   16.525 1.00 32.97 ? 490  ILE A C   1 
ATOM   3877 O O   . ILE A 1 490 ? 6.617   3.247   17.186 1.00 33.08 ? 490  ILE A O   1 
ATOM   3878 C CB  . ILE A 1 490 ? 8.378   0.460   17.555 1.00 31.62 ? 490  ILE A CB  1 
ATOM   3879 C CG1 . ILE A 1 490 ? 8.332   -0.883  18.283 1.00 30.27 ? 490  ILE A CG1 1 
ATOM   3880 C CG2 . ILE A 1 490 ? 8.970   1.517   18.461 1.00 31.43 ? 490  ILE A CG2 1 
ATOM   3881 C CD1 . ILE A 1 490 ? 9.700   -1.512  18.513 1.00 32.18 ? 490  ILE A CD1 1 
ATOM   3882 N N   . ALA A 1 491 ? 7.383   2.365   15.266 1.00 34.05 ? 491  ALA A N   1 
ATOM   3883 C CA  . ALA A 1 491 ? 7.447   3.644   14.564 1.00 33.72 ? 491  ALA A CA  1 
ATOM   3884 C C   . ALA A 1 491 ? 6.054   4.234   14.399 1.00 33.80 ? 491  ALA A C   1 
ATOM   3885 O O   . ALA A 1 491 ? 5.874   5.450   14.473 1.00 34.94 ? 491  ALA A O   1 
ATOM   3886 C CB  . ALA A 1 491 ? 8.099   3.451   13.193 1.00 34.78 ? 491  ALA A CB  1 
ATOM   3887 N N   . MET A 1 492 ? 5.068   3.371   14.177 1.00 32.17 ? 492  MET A N   1 
ATOM   3888 C CA  . MET A 1 492 ? 3.689   3.814   14.014 1.00 34.11 ? 492  MET A CA  1 
ATOM   3889 C C   . MET A 1 492 ? 3.224   4.562   15.265 1.00 35.64 ? 492  MET A C   1 
ATOM   3890 O O   . MET A 1 492 ? 2.614   5.630   15.177 1.00 34.18 ? 492  MET A O   1 
ATOM   3891 C CB  . MET A 1 492 ? 2.783   2.607   13.754 1.00 33.61 ? 492  MET A CB  1 
ATOM   3892 C CG  . MET A 1 492 ? 1.321   2.938   13.505 1.00 36.19 ? 492  MET A CG  1 
ATOM   3893 S SD  . MET A 1 492 ? 0.326   1.425   13.305 1.00 38.38 ? 492  MET A SD  1 
ATOM   3894 C CE  . MET A 1 492 ? 0.243   0.885   15.022 1.00 41.45 ? 492  MET A CE  1 
ATOM   3895 N N   . TYR A 1 493 ? 3.513   4.000   16.434 1.00 35.25 ? 493  TYR A N   1 
ATOM   3896 C CA  . TYR A 1 493 ? 3.113   4.641   17.675 1.00 34.04 ? 493  TYR A CA  1 
ATOM   3897 C C   . TYR A 1 493 ? 3.938   5.894   17.965 1.00 34.52 ? 493  TYR A C   1 
ATOM   3898 O O   . TYR A 1 493 ? 3.421   6.861   18.533 1.00 34.81 ? 493  TYR A O   1 
ATOM   3899 C CB  . TYR A 1 493 ? 3.184   3.645   18.837 1.00 33.38 ? 493  TYR A CB  1 
ATOM   3900 C CG  . TYR A 1 493 ? 1.967   2.739   18.924 1.00 34.17 ? 493  TYR A CG  1 
ATOM   3901 C CD1 . TYR A 1 493 ? 2.082   1.354   18.770 1.00 38.23 ? 493  TYR A CD1 1 
ATOM   3902 C CD2 . TYR A 1 493 ? 0.704   3.270   19.159 1.00 36.42 ? 493  TYR A CD2 1 
ATOM   3903 C CE1 . TYR A 1 493 ? 0.958   0.521   18.852 1.00 37.54 ? 493  TYR A CE1 1 
ATOM   3904 C CE2 . TYR A 1 493 ? -0.424  2.454   19.242 1.00 38.11 ? 493  TYR A CE2 1 
ATOM   3905 C CZ  . TYR A 1 493 ? -0.291  1.081   19.090 1.00 38.21 ? 493  TYR A CZ  1 
ATOM   3906 O OH  . TYR A 1 493 ? -1.408  0.282   19.195 1.00 37.62 ? 493  TYR A OH  1 
ATOM   3907 N N   . GLU A 1 494 ? 5.208   5.898   17.575 1.00 35.25 ? 494  GLU A N   1 
ATOM   3908 C CA  . GLU A 1 494 ? 6.023   7.090   17.800 1.00 35.19 ? 494  GLU A CA  1 
ATOM   3909 C C   . GLU A 1 494 ? 5.363   8.252   17.051 1.00 34.81 ? 494  GLU A C   1 
ATOM   3910 O O   . GLU A 1 494 ? 5.231   9.353   17.586 1.00 32.59 ? 494  GLU A O   1 
ATOM   3911 C CB  . GLU A 1 494 ? 7.456   6.902   17.285 1.00 32.32 ? 494  GLU A CB  1 
ATOM   3912 C CG  . GLU A 1 494 ? 8.212   5.737   17.903 1.00 35.43 ? 494  GLU A CG  1 
ATOM   3913 C CD  . GLU A 1 494 ? 9.664   5.681   17.467 1.00 36.67 ? 494  GLU A CD  1 
ATOM   3914 O OE1 . GLU A 1 494 ? 9.940   5.887   16.264 1.00 35.56 ? 494  GLU A OE1 1 
ATOM   3915 O OE2 . GLU A 1 494 ? 10.533  5.418   18.322 1.00 36.15 ? 494  GLU A OE2 1 
ATOM   3916 N N   . HIS A 1 495 ? 4.929   8.002   15.816 1.00 36.47 ? 495  HIS A N   1 
ATOM   3917 C CA  . HIS A 1 495 ? 4.294   9.056   15.030 1.00 35.78 ? 495  HIS A CA  1 
ATOM   3918 C C   . HIS A 1 495 ? 2.893   9.406   15.520 1.00 36.13 ? 495  HIS A C   1 
ATOM   3919 O O   . HIS A 1 495 ? 2.439   10.543  15.350 1.00 33.98 ? 495  HIS A O   1 
ATOM   3920 C CB  . HIS A 1 495 ? 4.286   8.681   13.546 1.00 38.01 ? 495  HIS A CB  1 
ATOM   3921 C CG  . HIS A 1 495 ? 5.657   8.584   12.956 1.00 36.58 ? 495  HIS A CG  1 
ATOM   3922 N ND1 . HIS A 1 495 ? 6.648   9.503   13.232 1.00 37.70 ? 495  HIS A ND1 1 
ATOM   3923 C CD2 . HIS A 1 495 ? 6.206   7.682   12.108 1.00 36.11 ? 495  HIS A CD2 1 
ATOM   3924 C CE1 . HIS A 1 495 ? 7.748   9.169   12.581 1.00 37.59 ? 495  HIS A CE1 1 
ATOM   3925 N NE2 . HIS A 1 495 ? 7.506   8.068   11.891 1.00 36.78 ? 495  HIS A NE2 1 
ATOM   3926 N N   . LYS A 1 496 ? 2.203   8.446   16.138 1.00 34.54 ? 496  LYS A N   1 
ATOM   3927 C CA  . LYS A 1 496 ? 0.879   8.733   16.678 1.00 35.69 ? 496  LYS A CA  1 
ATOM   3928 C C   . LYS A 1 496 ? 1.094   9.781   17.765 1.00 35.46 ? 496  LYS A C   1 
ATOM   3929 O O   . LYS A 1 496 ? 0.361   10.774  17.860 1.00 35.08 ? 496  LYS A O   1 
ATOM   3930 C CB  . LYS A 1 496 ? 0.254   7.488   17.320 1.00 35.30 ? 496  LYS A CB  1 
ATOM   3931 C CG  . LYS A 1 496 ? -0.975  7.812   18.150 1.00 35.33 ? 496  LYS A CG  1 
ATOM   3932 C CD  . LYS A 1 496 ? -1.366  6.684   19.112 1.00 33.84 ? 496  LYS A CD  1 
ATOM   3933 C CE  . LYS A 1 496 ? -2.632  7.058   19.876 1.00 36.37 ? 496  LYS A CE  1 
ATOM   3934 N NZ  . LYS A 1 496 ? -3.029  6.068   20.926 1.00 34.55 ? 496  LYS A NZ  1 
ATOM   3935 N N   . ILE A 1 497 ? 2.116   9.540   18.580 1.00 34.90 ? 497  ILE A N   1 
ATOM   3936 C CA  . ILE A 1 497 ? 2.477   10.426  19.683 1.00 34.00 ? 497  ILE A CA  1 
ATOM   3937 C C   . ILE A 1 497 ? 2.895   11.790  19.137 1.00 35.59 ? 497  ILE A C   1 
ATOM   3938 O O   . ILE A 1 497 ? 2.554   12.835  19.702 1.00 31.84 ? 497  ILE A O   1 
ATOM   3939 C CB  . ILE A 1 497 ? 3.633   9.812   20.500 1.00 35.58 ? 497  ILE A CB  1 
ATOM   3940 C CG1 . ILE A 1 497 ? 3.152   8.522   21.183 1.00 35.55 ? 497  ILE A CG1 1 
ATOM   3941 C CG2 . ILE A 1 497 ? 4.148   10.809  21.527 1.00 35.42 ? 497  ILE A CG2 1 
ATOM   3942 C CD1 . ILE A 1 497 ? 4.261   7.709   21.822 1.00 33.33 ? 497  ILE A CD1 1 
ATOM   3943 N N   . PHE A 1 498 ? 3.634   11.769  18.034 1.00 35.39 ? 498  PHE A N   1 
ATOM   3944 C CA  . PHE A 1 498 ? 4.086   13.003  17.400 1.00 37.57 ? 498  PHE A CA  1 
ATOM   3945 C C   . PHE A 1 498 ? 2.893   13.861  16.982 1.00 35.79 ? 498  PHE A C   1 
ATOM   3946 O O   . PHE A 1 498 ? 2.840   15.052  17.284 1.00 36.64 ? 498  PHE A O   1 
ATOM   3947 C CB  . PHE A 1 498 ? 4.941   12.685  16.170 1.00 39.20 ? 498  PHE A CB  1 
ATOM   3948 C CG  . PHE A 1 498 ? 5.332   13.903  15.377 1.00 42.73 ? 498  PHE A CG  1 
ATOM   3949 C CD1 . PHE A 1 498 ? 6.238   14.824  15.894 1.00 43.44 ? 498  PHE A CD1 1 
ATOM   3950 C CD2 . PHE A 1 498 ? 4.760   14.152  14.131 1.00 43.97 ? 498  PHE A CD2 1 
ATOM   3951 C CE1 . PHE A 1 498 ? 6.571   15.980  15.186 1.00 42.47 ? 498  PHE A CE1 1 
ATOM   3952 C CE2 . PHE A 1 498 ? 5.086   15.308  13.415 1.00 44.61 ? 498  PHE A CE2 1 
ATOM   3953 C CZ  . PHE A 1 498 ? 5.994   16.222  13.948 1.00 43.77 ? 498  PHE A CZ  1 
ATOM   3954 N N   . VAL A 1 499 ? 1.938   13.249  16.287 1.00 37.23 ? 499  VAL A N   1 
ATOM   3955 C CA  . VAL A 1 499 ? 0.752   13.956  15.810 1.00 36.23 ? 499  VAL A CA  1 
ATOM   3956 C C   . VAL A 1 499 ? -0.058  14.581  16.941 1.00 38.13 ? 499  VAL A C   1 
ATOM   3957 O O   . VAL A 1 499 ? -0.442  15.751  16.867 1.00 36.26 ? 499  VAL A O   1 
ATOM   3958 C CB  . VAL A 1 499 ? -0.163  13.015  14.990 1.00 35.03 ? 499  VAL A CB  1 
ATOM   3959 C CG1 . VAL A 1 499 ? -1.446  13.735  14.593 1.00 35.24 ? 499  VAL A CG1 1 
ATOM   3960 C CG2 . VAL A 1 499 ? 0.570   12.550  13.743 1.00 36.93 ? 499  VAL A CG2 1 
ATOM   3961 N N   . GLN A 1 500 ? -0.327  13.813  17.992 1.00 35.18 ? 500  GLN A N   1 
ATOM   3962 C CA  . GLN A 1 500 ? -1.083  14.363  19.112 1.00 36.03 ? 500  GLN A CA  1 
ATOM   3963 C C   . GLN A 1 500 ? -0.381  15.586  19.718 1.00 35.49 ? 500  GLN A C   1 
ATOM   3964 O O   . GLN A 1 500 ? -1.028  16.586  20.019 1.00 36.44 ? 500  GLN A O   1 
ATOM   3965 C CB  . GLN A 1 500 ? -1.311  13.290  20.182 1.00 34.08 ? 500  GLN A CB  1 
ATOM   3966 C CG  . GLN A 1 500 ? -2.105  12.086  19.666 1.00 32.92 ? 500  GLN A CG  1 
ATOM   3967 C CD  . GLN A 1 500 ? -2.545  11.144  20.779 1.00 34.13 ? 500  GLN A CD  1 
ATOM   3968 O OE1 . GLN A 1 500 ? -1.782  10.859  21.705 1.00 32.64 ? 500  GLN A OE1 1 
ATOM   3969 N NE2 . GLN A 1 500 ? -3.776  10.644  20.681 1.00 31.11 ? 500  GLN A NE2 1 
ATOM   3970 N N   . GLY A 1 501 ? 0.935   15.513  19.892 1.00 37.31 ? 501  GLY A N   1 
ATOM   3971 C CA  . GLY A 1 501 ? 1.664   16.641  20.455 1.00 37.85 ? 501  GLY A CA  1 
ATOM   3972 C C   . GLY A 1 501 ? 1.460   17.914  19.644 1.00 38.80 ? 501  GLY A C   1 
ATOM   3973 O O   . GLY A 1 501 ? 1.206   18.991  20.200 1.00 39.24 ? 501  GLY A O   1 
ATOM   3974 N N   . VAL A 1 502 ? 1.565   17.788  18.324 1.00 37.24 ? 502  VAL A N   1 
ATOM   3975 C CA  . VAL A 1 502 ? 1.378   18.928  17.425 1.00 36.70 ? 502  VAL A CA  1 
ATOM   3976 C C   . VAL A 1 502 ? -0.022  19.501  17.610 1.00 37.14 ? 502  VAL A C   1 
ATOM   3977 O O   . VAL A 1 502 ? -0.186  20.708  17.773 1.00 36.14 ? 502  VAL A O   1 
ATOM   3978 C CB  . VAL A 1 502 ? 1.570   18.517  15.939 1.00 35.58 ? 502  VAL A CB  1 
ATOM   3979 C CG1 . VAL A 1 502 ? 1.250   19.703  15.013 1.00 36.89 ? 502  VAL A CG1 1 
ATOM   3980 C CG2 . VAL A 1 502 ? 3.003   18.042  15.712 1.00 33.39 ? 502  VAL A CG2 1 
ATOM   3981 N N   . VAL A 1 503 ? -1.036  18.641  17.593 1.00 37.79 ? 503  VAL A N   1 
ATOM   3982 C CA  . VAL A 1 503 ? -2.405  19.112  17.775 1.00 37.55 ? 503  VAL A CA  1 
ATOM   3983 C C   . VAL A 1 503 ? -2.546  19.909  19.073 1.00 38.55 ? 503  VAL A C   1 
ATOM   3984 O O   . VAL A 1 503 ? -3.223  20.944  19.098 1.00 37.43 ? 503  VAL A O   1 
ATOM   3985 C CB  . VAL A 1 503 ? -3.423  17.943  17.806 1.00 38.35 ? 503  VAL A CB  1 
ATOM   3986 C CG1 . VAL A 1 503 ? -4.823  18.480  18.085 1.00 37.12 ? 503  VAL A CG1 1 
ATOM   3987 C CG2 . VAL A 1 503 ? -3.416  17.205  16.475 1.00 37.62 ? 503  VAL A CG2 1 
ATOM   3988 N N   . TRP A 1 504 ? -1.907  19.433  20.143 1.00 38.07 ? 504  TRP A N   1 
ATOM   3989 C CA  . TRP A 1 504 ? -1.966  20.104  21.446 1.00 38.29 ? 504  TRP A CA  1 
ATOM   3990 C C   . TRP A 1 504 ? -0.982  21.261  21.525 1.00 40.08 ? 504  TRP A C   1 
ATOM   3991 O O   . TRP A 1 504 ? -0.968  22.011  22.500 1.00 39.64 ? 504  TRP A O   1 
ATOM   3992 C CB  . TRP A 1 504 ? -1.667  19.122  22.595 1.00 39.14 ? 504  TRP A CB  1 
ATOM   3993 C CG  . TRP A 1 504 ? -2.721  18.057  22.801 1.00 37.58 ? 504  TRP A CG  1 
ATOM   3994 C CD1 . TRP A 1 504 ? -4.075  18.218  22.742 1.00 36.86 ? 504  TRP A CD1 1 
ATOM   3995 C CD2 . TRP A 1 504 ? -2.494  16.675  23.112 1.00 36.77 ? 504  TRP A CD2 1 
ATOM   3996 N NE1 . TRP A 1 504 ? -4.709  17.019  22.994 1.00 35.10 ? 504  TRP A NE1 1 
ATOM   3997 C CE2 . TRP A 1 504 ? -3.761  16.058  23.226 1.00 36.80 ? 504  TRP A CE2 1 
ATOM   3998 C CE3 . TRP A 1 504 ? -1.342  15.899  23.308 1.00 36.11 ? 504  TRP A CE3 1 
ATOM   3999 C CZ2 . TRP A 1 504 ? -3.909  14.695  23.524 1.00 36.29 ? 504  TRP A CZ2 1 
ATOM   4000 C CZ3 . TRP A 1 504 ? -1.491  14.542  23.605 1.00 35.44 ? 504  TRP A CZ3 1 
ATOM   4001 C CH2 . TRP A 1 504 ? -2.767  13.958  23.709 1.00 34.12 ? 504  TRP A CH2 1 
ATOM   4002 N N   . ASP A 1 505 ? -0.153  21.387  20.496 1.00 42.26 ? 505  ASP A N   1 
ATOM   4003 C CA  . ASP A 1 505 ? 0.847   22.447  20.414 1.00 43.54 ? 505  ASP A CA  1 
ATOM   4004 C C   . ASP A 1 505 ? 1.842   22.393  21.567 1.00 43.79 ? 505  ASP A C   1 
ATOM   4005 O O   . ASP A 1 505 ? 2.258   23.429  22.085 1.00 44.70 ? 505  ASP A O   1 
ATOM   4006 C CB  . ASP A 1 505 ? 0.167   23.825  20.384 1.00 45.33 ? 505  ASP A CB  1 
ATOM   4007 C CG  . ASP A 1 505 ? 1.007   24.875  19.666 1.00 47.52 ? 505  ASP A CG  1 
ATOM   4008 O OD1 . ASP A 1 505 ? 1.326   24.667  18.477 1.00 48.81 ? 505  ASP A OD1 1 
ATOM   4009 O OD2 . ASP A 1 505 ? 1.351   25.905  20.283 1.00 49.56 ? 505  ASP A OD2 1 
ATOM   4010 N N   . ILE A 1 506 ? 2.221   21.186  21.978 1.00 42.36 ? 506  ILE A N   1 
ATOM   4011 C CA  . ILE A 1 506 ? 3.193   21.039  23.054 1.00 40.96 ? 506  ILE A CA  1 
ATOM   4012 C C   . ILE A 1 506 ? 4.477   20.456  22.456 1.00 40.34 ? 506  ILE A C   1 
ATOM   4013 O O   . ILE A 1 506 ? 4.516   20.078  21.276 1.00 41.00 ? 506  ILE A O   1 
ATOM   4014 C CB  . ILE A 1 506 ? 2.695   20.089  24.175 1.00 40.97 ? 506  ILE A CB  1 
ATOM   4015 C CG1 . ILE A 1 506 ? 2.245   18.730  23.634 1.00 40.06 ? 506  ILE A CG1 1 
ATOM   4016 C CG2 . ILE A 1 506 ? 1.500   20.651  24.948 1.00 40.00 ? 506  ILE A CG2 1 
ATOM   4017 C CD1 . ILE A 1 506 ? 2.048   17.682  24.729 1.00 41.50 ? 506  ILE A CD1 1 
ATOM   4018 N N   . ASN A 1 507 ? 5.503   20.400  23.276 1.00 39.53 ? 507  ASN A N   1 
ATOM   4019 C CA  . ASN A 1 507 ? 6.804   19.850  22.865 1.00 40.84 ? 507  ASN A CA  1 
ATOM   4020 C C   . ASN A 1 507 ? 6.947   18.430  23.405 1.00 39.91 ? 507  ASN A C   1 
ATOM   4021 O O   . ASN A 1 507 ? 7.241   18.222  24.589 1.00 40.77 ? 507  ASN A O   1 
ATOM   4022 C CB  . ASN A 1 507 ? 7.940   20.712  23.410 1.00 39.62 ? 507  ASN A CB  1 
ATOM   4023 C CG  . ASN A 1 507 ? 9.314   20.250  22.924 1.00 41.03 ? 507  ASN A CG  1 
ATOM   4024 O OD1 . ASN A 1 507 ? 9.400   19.467  21.978 1.00 40.11 ? 507  ASN A OD1 1 
ATOM   4025 N ND2 . ASN A 1 507 ? 10.406  20.690  23.518 1.00 41.90 ? 507  ASN A ND2 1 
ATOM   4026 N N   . SER A 1 508 ? 6.736   17.488  22.513 1.00 40.32 ? 508  SER A N   1 
ATOM   4027 C CA  . SER A 1 508 ? 6.780   16.060  22.848 1.00 39.63 ? 508  SER A CA  1 
ATOM   4028 C C   . SER A 1 508 ? 8.212   15.517  22.922 1.00 40.53 ? 508  SER A C   1 
ATOM   4029 O O   . SER A 1 508 ? 8.430   14.305  23.024 1.00 41.65 ? 508  SER A O   1 
ATOM   4030 C CB  . SER A 1 508 ? 6.086   15.229  21.758 1.00 38.09 ? 508  SER A CB  1 
ATOM   4031 O OG  . SER A 1 508 ? 4.784   15.726  21.507 1.00 40.37 ? 508  SER A OG  1 
ATOM   4032 N N   . PHE A 1 509 ? 9.213   16.386  22.901 1.00 37.86 ? 509  PHE A N   1 
ATOM   4033 C CA  . PHE A 1 509 ? 10.599  15.880  22.834 1.00 39.23 ? 509  PHE A CA  1 
ATOM   4034 C C   . PHE A 1 509 ? 11.529  16.374  23.954 1.00 39.68 ? 509  PHE A C   1 
ATOM   4035 O O   . PHE A 1 509 ? 12.736  16.103  23.948 1.00 41.39 ? 509  PHE A O   1 
ATOM   4036 C CB  . PHE A 1 509 ? 11.176  16.221  21.476 1.00 38.30 ? 509  PHE A CB  1 
ATOM   4037 C CG  . PHE A 1 509 ? 10.313  15.607  20.383 1.00 39.72 ? 509  PHE A CG  1 
ATOM   4038 C CD1 . PHE A 1 509 ? 9.507   16.422  19.585 1.00 40.26 ? 509  PHE A CD1 1 
ATOM   4039 C CD2 . PHE A 1 509 ? 10.315  14.220  20.204 1.00 37.87 ? 509  PHE A CD2 1 
ATOM   4040 C CE1 . PHE A 1 509 ? 8.695   15.847  18.601 1.00 40.80 ? 509  PHE A CE1 1 
ATOM   4041 C CE2 . PHE A 1 509 ? 9.501   13.644  19.222 1.00 38.64 ? 509  PHE A CE2 1 
ATOM   4042 C CZ  . PHE A 1 509 ? 8.690   14.458  18.421 1.00 40.00 ? 509  PHE A CZ  1 
ATOM   4043 N N   . ASP A 1 510 ? 10.996  17.089  24.913 1.00 40.72 ? 510  ASP A N   1 
ATOM   4044 C CA  . ASP A 1 510 ? 11.793  17.501  26.087 1.00 40.23 ? 510  ASP A CA  1 
ATOM   4045 C C   . ASP A 1 510 ? 11.204  16.757  27.288 1.00 39.70 ? 510  ASP A C   1 
ATOM   4046 O O   . ASP A 1 510 ? 10.180  16.084  27.158 1.00 40.50 ? 510  ASP A O   1 
ATOM   4047 C CB  . ASP A 1 510 ? 11.743  19.021  26.268 1.00 40.11 ? 510  ASP A CB  1 
ATOM   4048 C CG  . ASP A 1 510 ? 10.338  19.565  26.515 1.00 41.36 ? 510  ASP A CG  1 
ATOM   4049 O OD1 . ASP A 1 510 ? 9.392   18.767  26.874 1.00 41.43 ? 510  ASP A OD1 1 
ATOM   4050 O OD2 . ASP A 1 510 ? 10.101  20.824  26.363 1.00 41.68 ? 510  ASP A OD2 1 
ATOM   4051 N N   . GLN A 1 511 ? 11.851  16.852  28.443 1.00 38.45 ? 511  GLN A N   1 
ATOM   4052 C CA  . GLN A 1 511 ? 11.346  16.186  29.638 1.00 40.05 ? 511  GLN A CA  1 
ATOM   4053 C C   . GLN A 1 511 ? 11.841  16.859  30.916 1.00 39.19 ? 511  GLN A C   1 
ATOM   4054 O O   . GLN A 1 511 ? 12.541  16.252  31.722 1.00 39.70 ? 511  GLN A O   1 
ATOM   4055 C CB  . GLN A 1 511 ? 11.731  14.698  29.624 1.00 38.59 ? 511  GLN A CB  1 
ATOM   4056 C CG  . GLN A 1 511 ? 13.214  14.387  29.425 1.00 38.17 ? 511  GLN A CG  1 
ATOM   4057 C CD  . GLN A 1 511 ? 13.709  14.705  28.024 1.00 37.28 ? 511  GLN A CD  1 
ATOM   4058 O OE1 . GLN A 1 511 ? 13.070  14.359  27.030 1.00 36.92 ? 511  GLN A OE1 1 
ATOM   4059 N NE2 . GLN A 1 511 ? 14.864  15.354  27.939 1.00 38.88 ? 511  GLN A NE2 1 
ATOM   4060 N N   A TRP A 1 512 ? 11.451  18.118  31.099 0.50 40.48 ? 512  TRP A N   1 
ATOM   4061 N N   B TRP A 1 512 ? 11.391  18.166  31.034 0.50 43.19 ? 512  TRP A N   1 
ATOM   4062 C CA  A TRP A 1 512 ? 11.861  18.897  32.261 0.50 40.59 ? 512  TRP A CA  1 
ATOM   4063 C CA  B TRP A 1 512 ? 11.779  18.973  32.186 0.50 42.92 ? 512  TRP A CA  1 
ATOM   4064 C C   A TRP A 1 512 ? 11.434  18.301  33.595 0.50 40.54 ? 512  TRP A C   1 
ATOM   4065 C C   B TRP A 1 512 ? 11.114  18.541  33.487 0.50 43.71 ? 512  TRP A C   1 
ATOM   4066 O O   A TRP A 1 512 ? 11.990  18.645  34.640 0.50 40.06 ? 512  TRP A O   1 
ATOM   4067 O O   B TRP A 1 512 ? 11.576  18.891  34.573 0.50 43.84 ? 512  TRP A O   1 
ATOM   4068 C CB  A TRP A 1 512 ? 11.357  20.331  32.116 0.50 42.77 ? 512  TRP A CB  1 
ATOM   4069 C CB  B TRP A 1 512 ? 11.461  20.448  31.913 0.50 43.62 ? 512  TRP A CB  1 
ATOM   4070 C CG  A TRP A 1 512 ? 11.939  20.982  30.899 0.50 44.29 ? 512  TRP A CG  1 
ATOM   4071 C CG  B TRP A 1 512 ? 12.210  20.977  30.740 0.50 42.96 ? 512  TRP A CG  1 
ATOM   4072 C CD1 A TRP A 1 512 ? 11.268  21.388  29.784 0.50 45.05 ? 512  TRP A CD1 1 
ATOM   4073 C CD1 B TRP A 1 512 ? 11.697  21.331  29.524 0.50 43.42 ? 512  TRP A CD1 1 
ATOM   4074 C CD2 A TRP A 1 512 ? 13.325  21.234  30.649 0.50 45.93 ? 512  TRP A CD2 1 
ATOM   4075 C CD2 B TRP A 1 512 ? 13.629  21.131  30.642 0.50 43.29 ? 512  TRP A CD2 1 
ATOM   4076 N NE1 A TRP A 1 512 ? 12.152  21.874  28.850 0.50 46.06 ? 512  TRP A NE1 1 
ATOM   4077 N NE1 B TRP A 1 512 ? 12.718  21.692  28.670 0.50 43.22 ? 512  TRP A NE1 1 
ATOM   4078 C CE2 A TRP A 1 512 ? 13.422  21.791  29.357 0.50 46.58 ? 512  TRP A CE2 1 
ATOM   4079 C CE2 B TRP A 1 512 ? 13.914  21.577  29.332 0.50 43.96 ? 512  TRP A CE2 1 
ATOM   4080 C CE3 A TRP A 1 512 ? 14.497  21.041  31.393 0.50 47.08 ? 512  TRP A CE3 1 
ATOM   4081 C CE3 B TRP A 1 512 ? 14.690  20.928  31.533 0.50 43.50 ? 512  TRP A CE3 1 
ATOM   4082 C CZ2 A TRP A 1 512 ? 14.647  22.159  28.789 0.50 48.15 ? 512  TRP A CZ2 1 
ATOM   4083 C CZ2 B TRP A 1 512 ? 15.216  21.824  28.889 0.50 44.88 ? 512  TRP A CZ2 1 
ATOM   4084 C CZ3 A TRP A 1 512 ? 15.715  21.406  30.830 0.50 47.93 ? 512  TRP A CZ3 1 
ATOM   4085 C CZ3 B TRP A 1 512 ? 15.991  21.172  31.095 0.50 44.29 ? 512  TRP A CZ3 1 
ATOM   4086 C CH2 A TRP A 1 512 ? 15.779  21.960  29.539 0.50 48.35 ? 512  TRP A CH2 1 
ATOM   4087 C CH2 B TRP A 1 512 ? 16.239  21.616  29.783 0.50 44.49 ? 512  TRP A CH2 1 
ATOM   4088 N N   A GLY A 1 513 ? 10.447  17.412  33.561 0.50 39.33 ? 513  GLY A N   1 
ATOM   4089 N N   B GLY A 1 513 ? 10.038  17.771  33.369 0.50 43.90 ? 513  GLY A N   1 
ATOM   4090 C CA  A GLY A 1 513 ? 10.022  16.752  34.780 0.50 38.90 ? 513  GLY A CA  1 
ATOM   4091 C CA  B GLY A 1 513 ? 9.311   17.317  34.536 0.50 45.99 ? 513  GLY A CA  1 
ATOM   4092 C C   A GLY A 1 513 ? 11.038  15.669  35.102 0.50 38.87 ? 513  GLY A C   1 
ATOM   4093 C C   B GLY A 1 513 ? 10.061  16.370  35.458 0.50 46.34 ? 513  GLY A C   1 
ATOM   4094 O O   A GLY A 1 513 ? 11.390  15.453  36.260 0.50 37.98 ? 513  GLY A O   1 
ATOM   4095 O O   B GLY A 1 513 ? 9.569   16.016  36.540 0.50 46.83 ? 513  GLY A O   1 
ATOM   4096 N N   A VAL A 1 514 ? 11.510  14.980  34.067 0.50 37.92 ? 514  VAL A N   1 
ATOM   4097 N N   B VAL A 1 514 ? 11.229  15.955  35.062 0.50 47.42 ? 514  VAL A N   1 
ATOM   4098 C CA  A VAL A 1 514 ? 12.506  13.923  34.229 0.50 38.91 ? 514  VAL A CA  1 
ATOM   4099 C CA  B VAL A 1 514 ? 11.985  15.015  35.887 0.50 48.17 ? 514  VAL A CA  1 
ATOM   4100 C C   A VAL A 1 514 ? 13.847  14.556  34.598 0.50 40.53 ? 514  VAL A C   1 
ATOM   4101 C C   B VAL A 1 514 ? 13.151  15.661  36.655 0.50 49.02 ? 514  VAL A C   1 
ATOM   4102 O O   A VAL A 1 514 ? 14.622  13.993  35.375 0.50 40.60 ? 514  VAL A O   1 
ATOM   4103 O O   B VAL A 1 514 ? 13.843  14.995  37.440 0.50 49.10 ? 514  VAL A O   1 
ATOM   4104 C CB  A VAL A 1 514 ? 12.671  13.096  32.917 0.50 37.08 ? 514  VAL A CB  1 
ATOM   4105 C CB  B VAL A 1 514 ? 12.619  13.922  35.035 0.50 49.12 ? 514  VAL A CB  1 
ATOM   4106 C CG1 A VAL A 1 514 ? 13.896  12.192  33.009 0.50 36.57 ? 514  VAL A CG1 1 
ATOM   4107 C CG1 B VAL A 1 514 ? 12.202  13.993  33.564 0.50 49.45 ? 514  VAL A CG1 1 
ATOM   4108 C CG2 A VAL A 1 514 ? 11.425  12.253  32.671 0.50 35.30 ? 514  VAL A CG2 1 
ATOM   4109 C CG2 B VAL A 1 514 ? 14.148  13.974  35.035 0.50 50.17 ? 514  VAL A CG2 1 
ATOM   4110 N N   A GLU A 1 515 ? 14.107  15.733  34.033 0.50 41.51 ? 515  GLU A N   1 
ATOM   4111 N N   B GLU A 1 515 ? 13.356  16.942  36.435 0.50 50.13 ? 515  GLU A N   1 
ATOM   4112 C CA  A GLU A 1 515 ? 15.344  16.464  34.292 0.50 43.50 ? 515  GLU A CA  1 
ATOM   4113 C CA  B GLU A 1 515 ? 14.483  17.673  37.052 0.50 50.61 ? 515  GLU A CA  1 
ATOM   4114 C C   A GLU A 1 515 ? 15.393  16.905  35.753 0.50 44.26 ? 515  GLU A C   1 
ATOM   4115 C C   B GLU A 1 515 ? 14.283  17.913  38.568 0.50 50.92 ? 515  GLU A C   1 
ATOM   4116 O O   A GLU A 1 515 ? 16.449  16.871  36.385 0.50 44.05 ? 515  GLU A O   1 
ATOM   4117 O O   B GLU A 1 515 ? 15.240  17.860  39.354 0.50 50.89 ? 515  GLU A O   1 
ATOM   4118 C CB  A GLU A 1 515 ? 15.436  17.696  33.384 0.50 43.49 ? 515  GLU A CB  1 
ATOM   4119 C CB  B GLU A 1 515 ? 14.674  19.038  36.379 0.50 51.24 ? 515  GLU A CB  1 
ATOM   4120 C CG  A GLU A 1 515 ? 15.263  17.407  31.897 0.50 43.78 ? 515  GLU A CG  1 
ATOM   4121 C CG  B GLU A 1 515 ? 16.110  19.562  36.510 0.50 52.66 ? 515  GLU A CG  1 
ATOM   4122 C CD  A GLU A 1 515 ? 16.353  16.520  31.334 0.50 43.92 ? 515  GLU A CD  1 
ATOM   4123 C CD  B GLU A 1 515 ? 16.362  20.877  35.760 0.50 54.85 ? 515  GLU A CD  1 
ATOM   4124 O OE1 A GLU A 1 515 ? 16.286  16.190  30.130 0.50 44.74 ? 515  GLU A OE1 1 
ATOM   4125 O OE1 B GLU A 1 515 ? 15.792  21.095  34.624 0.50 55.33 ? 515  GLU A OE1 1 
ATOM   4126 O OE2 A GLU A 1 515 ? 17.277  16.151  32.090 0.50 44.94 ? 515  GLU A OE2 1 
ATOM   4127 O OE2 B GLU A 1 515 ? 17.150  21.767  36.265 0.50 55.96 ? 515  GLU A OE2 1 
ATOM   4128 N N   A LEU A 1 516 ? 14.246  17.319  36.284 0.50 45.75 ? 516  LEU A N   1 
ATOM   4129 N N   B LEU A 1 516 ? 13.043  18.173  38.963 0.50 50.30 ? 516  LEU A N   1 
ATOM   4130 C CA  A LEU A 1 516 ? 14.169  17.757  37.671 0.50 47.76 ? 516  LEU A CA  1 
ATOM   4131 C CA  B LEU A 1 516 ? 12.696  18.500  40.376 0.50 50.51 ? 516  LEU A CA  1 
ATOM   4132 C C   A LEU A 1 516 ? 14.455  16.601  38.617 0.50 48.10 ? 516  LEU A C   1 
ATOM   4133 C C   B LEU A 1 516 ? 13.211  17.442  41.383 0.50 49.77 ? 516  LEU A C   1 
ATOM   4134 O O   A LEU A 1 516 ? 15.164  16.764  39.611 0.50 47.41 ? 516  LEU A O   1 
ATOM   4135 O O   B LEU A 1 516 ? 14.049  17.739  42.251 0.50 49.22 ? 516  LEU A O   1 
ATOM   4136 C CB  A LEU A 1 516 ? 12.781  18.317  37.985 0.50 49.22 ? 516  LEU A CB  1 
ATOM   4137 C CB  B LEU A 1 516 ? 11.183  18.607  40.561 0.50 50.78 ? 516  LEU A CB  1 
ATOM   4138 C CG  A LEU A 1 516 ? 12.555  18.657  39.462 0.50 50.20 ? 516  LEU A CG  1 
ATOM   4139 C CG  B LEU A 1 516 ? 10.791  19.737  41.519 0.50 51.88 ? 516  LEU A CG  1 
ATOM   4140 C CD1 A LEU A 1 516 ? 13.454  19.815  39.853 0.50 51.23 ? 516  LEU A CD1 1 
ATOM   4141 C CD1 B LEU A 1 516 ? 9.335   19.646  41.989 0.50 51.23 ? 516  LEU A CD1 1 
ATOM   4142 C CD2 A LEU A 1 516 ? 11.096  19.007  39.706 0.50 50.74 ? 516  LEU A CD2 1 
ATOM   4143 C CD2 B LEU A 1 516 ? 11.634  19.765  42.795 0.50 51.21 ? 516  LEU A CD2 1 
ATOM   4144 N N   A GLY A 1 517 ? 13.895  15.436  38.304 0.50 48.73 ? 517  GLY A N   1 
ATOM   4145 N N   B GLY A 1 517 ? 12.686  16.234  41.242 0.50 48.98 ? 517  GLY A N   1 
ATOM   4146 C CA  A GLY A 1 517 ? 14.083  14.267  39.146 0.50 50.18 ? 517  GLY A CA  1 
ATOM   4147 C CA  B GLY A 1 517 ? 13.018  15.083  42.117 0.50 47.81 ? 517  GLY A CA  1 
ATOM   4148 C C   A GLY A 1 517 ? 15.530  13.851  39.328 0.50 51.31 ? 517  GLY A C   1 
ATOM   4149 C C   B GLY A 1 517 ? 14.538  14.900  42.252 0.50 47.16 ? 517  GLY A C   1 
ATOM   4150 O O   A GLY A 1 517 ? 15.936  13.432  40.413 0.50 51.07 ? 517  GLY A O   1 
ATOM   4151 O O   B GLY A 1 517 ? 15.060  14.649  43.350 0.50 47.37 ? 517  GLY A O   1 
ATOM   4152 N N   A LYS A 1 518 ? 16.311  13.971  38.261 0.50 53.10 ? 518  LYS A N   1 
ATOM   4153 N N   B LYS A 1 518 ? 15.208  15.020  41.122 0.50 47.71 ? 518  LYS A N   1 
ATOM   4154 C CA  A LYS A 1 518 ? 17.720  13.597  38.283 0.50 54.60 ? 518  LYS A CA  1 
ATOM   4155 C CA  B LYS A 1 518 ? 16.671  14.882  41.046 0.50 47.66 ? 518  LYS A CA  1 
ATOM   4156 C C   A LYS A 1 518 ? 18.571  14.618  39.040 0.50 54.83 ? 518  LYS A C   1 
ATOM   4157 C C   B LYS A 1 518 ? 17.330  15.855  42.020 0.50 46.68 ? 518  LYS A C   1 
ATOM   4158 O O   A LYS A 1 518 ? 19.763  14.767  38.775 0.50 54.50 ? 518  LYS A O   1 
ATOM   4159 O O   B LYS A 1 518 ? 18.154  15.460  42.859 0.50 47.17 ? 518  LYS A O   1 
ATOM   4160 C CB  A LYS A 1 518 ? 18.214  13.433  36.842 0.50 55.37 ? 518  LYS A CB  1 
ATOM   4161 C CB  B LYS A 1 518 ? 17.154  15.198  39.631 0.50 47.58 ? 518  LYS A CB  1 
ATOM   4162 C CG  A LYS A 1 518 ? 17.411  12.394  36.058 0.50 56.68 ? 518  LYS A CG  1 
ATOM   4163 C CG  B LYS A 1 518 ? 17.191  13.967  38.725 0.50 48.59 ? 518  LYS A CG  1 
ATOM   4164 C CD  A LYS A 1 518 ? 17.600  12.504  34.551 0.50 57.28 ? 518  LYS A CD  1 
ATOM   4165 C CD  B LYS A 1 518 ? 17.997  14.193  37.445 0.50 49.27 ? 518  LYS A CD  1 
ATOM   4166 C CE  A LYS A 1 518 ? 19.009  12.143  34.121 0.50 58.01 ? 518  LYS A CE  1 
ATOM   4167 C CE  B LYS A 1 518 ? 18.016  12.969  36.528 0.50 49.04 ? 518  LYS A CE  1 
ATOM   4168 N NZ  A LYS A 1 518 ? 19.145  12.181  32.636 0.50 59.18 ? 518  LYS A NZ  1 
ATOM   4169 N NZ  B LYS A 1 518 ? 16.947  12.991  35.520 0.50 51.15 ? 518  LYS A NZ  1 
ATOM   4170 N N   A GLN A 1 519 ? 17.946  15.302  39.995 0.50 55.41 ? 519  GLN A N   1 
ATOM   4171 N N   B GLN A 1 519 ? 16.931  17.101  41.862 0.50 46.59 ? 519  GLN A N   1 
ATOM   4172 C CA  A GLN A 1 519 ? 18.616  16.314  40.810 0.50 56.55 ? 519  GLN A CA  1 
ATOM   4173 C CA  B GLN A 1 519 ? 17.419  18.207  42.687 0.50 46.35 ? 519  GLN A CA  1 
ATOM   4174 C C   A GLN A 1 519 ? 17.842  16.585  42.102 0.50 56.81 ? 519  GLN A C   1 
ATOM   4175 C C   B GLN A 1 519 ? 17.198  17.890  44.167 0.50 45.65 ? 519  GLN A C   1 
ATOM   4176 O O   A GLN A 1 519 ? 18.212  17.456  42.893 0.50 57.25 ? 519  GLN A O   1 
ATOM   4177 O O   B GLN A 1 519 ? 18.124  17.985  44.984 0.50 44.25 ? 519  GLN A O   1 
ATOM   4178 C CB  A GLN A 1 519 ? 18.750  17.616  40.013 0.50 57.47 ? 519  GLN A CB  1 
ATOM   4179 C CB  B GLN A 1 519 ? 16.659  19.492  42.349 0.50 46.20 ? 519  GLN A CB  1 
ATOM   4180 C CG  A GLN A 1 519 ? 20.171  17.957  39.605 0.50 58.70 ? 519  GLN A CG  1 
ATOM   4181 C CG  B GLN A 1 519 ? 16.750  19.878  40.871 0.50 46.44 ? 519  GLN A CG  1 
ATOM   4182 C CD  A GLN A 1 519 ? 21.143  17.896  40.772 0.50 59.56 ? 519  GLN A CD  1 
ATOM   4183 C CD  B GLN A 1 519 ? 16.128  21.246  40.575 0.50 45.27 ? 519  GLN A CD  1 
ATOM   4184 O OE1 A GLN A 1 519 ? 22.357  17.831  40.578 0.50 61.03 ? 519  GLN A OE1 1 
ATOM   4185 O OE1 B GLN A 1 519 ? 16.489  21.885  39.588 0.50 47.71 ? 519  GLN A OE1 1 
ATOM   4186 N NE2 A GLN A 1 519 ? 20.612  17.924  41.991 0.50 60.26 ? 519  GLN A NE2 1 
ATOM   4187 N NE2 B GLN A 1 519 ? 15.205  21.740  41.380 0.50 45.21 ? 519  GLN A NE2 1 
ATOM   4188 N N   A LEU A 1 520 ? 16.775  15.826  42.315 0.50 56.64 ? 520  LEU A N   1 
ATOM   4189 N N   B LEU A 1 520 ? 15.967  17.514  44.455 0.50 47.07 ? 520  LEU A N   1 
ATOM   4190 C CA  A LEU A 1 520 ? 15.921  15.996  43.488 0.50 56.52 ? 520  LEU A CA  1 
ATOM   4191 C CA  B LEU A 1 520 ? 15.515  17.201  45.820 0.50 46.50 ? 520  LEU A CA  1 
ATOM   4192 C C   A LEU A 1 520 ? 16.416  15.399  44.802 0.50 56.75 ? 520  LEU A C   1 
ATOM   4193 C C   B LEU A 1 520 ? 16.198  15.939  46.370 0.50 48.17 ? 520  LEU A C   1 
ATOM   4194 O O   A LEU A 1 520 ? 16.369  16.055  45.845 0.50 57.39 ? 520  LEU A O   1 
ATOM   4195 O O   B LEU A 1 520 ? 16.396  15.798  47.585 0.50 48.24 ? 520  LEU A O   1 
ATOM   4196 C CB  A LEU A 1 520 ? 14.529  15.431  43.196 0.50 55.92 ? 520  LEU A CB  1 
ATOM   4197 C CB  B LEU A 1 520 ? 14.001  16.969  45.827 0.50 46.56 ? 520  LEU A CB  1 
ATOM   4198 C CG  A LEU A 1 520 ? 13.678  16.173  42.169 0.50 55.23 ? 520  LEU A CG  1 
ATOM   4199 C CG  B LEU A 1 520 ? 13.197  18.272  45.803 0.50 46.74 ? 520  LEU A CG  1 
ATOM   4200 C CD1 A LEU A 1 520 ? 12.324  15.495  42.074 0.50 54.80 ? 520  LEU A CD1 1 
ATOM   4201 C CD1 B LEU A 1 520 ? 11.819  18.138  46.454 0.50 45.82 ? 520  LEU A CD1 1 
ATOM   4202 C CD2 A LEU A 1 520 ? 13.523  17.636  42.577 0.50 53.76 ? 520  LEU A CD2 1 
ATOM   4203 C CD2 B LEU A 1 520 ? 13.894  19.418  46.540 0.50 45.24 ? 520  LEU A CD2 1 
ATOM   4204 N N   A ALA A 1 521 ? 16.875  14.153  44.752 0.50 56.58 ? 521  ALA A N   1 
ATOM   4205 N N   B ALA A 1 521 ? 16.547  15.043  45.466 0.50 49.30 ? 521  ALA A N   1 
ATOM   4206 C CA  A ALA A 1 521 ? 17.335  13.453  45.943 0.50 55.67 ? 521  ALA A CA  1 
ATOM   4207 C CA  B ALA A 1 521 ? 17.177  13.755  45.822 0.50 50.42 ? 521  ALA A CA  1 
ATOM   4208 C C   A ALA A 1 521 ? 18.717  13.863  46.432 0.50 55.50 ? 521  ALA A C   1 
ATOM   4209 C C   B ALA A 1 521 ? 18.601  13.954  46.377 0.50 51.53 ? 521  ALA A C   1 
ATOM   4210 O O   A ALA A 1 521 ? 19.120  13.490  47.532 0.50 54.61 ? 521  ALA A O   1 
ATOM   4211 O O   B ALA A 1 521 ? 18.968  13.383  47.414 0.50 51.05 ? 521  ALA A O   1 
ATOM   4212 C CB  A ALA A 1 521 ? 17.303  11.957  45.692 0.50 54.40 ? 521  ALA A CB  1 
ATOM   4213 C CB  B ALA A 1 521 ? 17.264  12.853  44.591 0.50 49.37 ? 521  ALA A CB  1 
ATOM   4214 N N   . LYS A 1 522 ? 19.440  14.633  45.627 1.00 56.96 ? 522  LYS A N   1 
ATOM   4215 C CA  . LYS A 1 522 ? 20.782  15.049  46.010 1.00 54.93 ? 522  LYS A CA  1 
ATOM   4216 C C   . LYS A 1 522 ? 20.881  15.802  47.329 1.00 53.49 ? 522  LYS A C   1 
ATOM   4217 O O   . LYS A 1 522 ? 21.866  15.658  48.048 1.00 52.71 ? 522  LYS A O   1 
ATOM   4218 C CB  . LYS A 1 522 ? 21.428  15.860  44.886 1.00 57.35 ? 522  LYS A CB  1 
ATOM   4219 C CG  . LYS A 1 522 ? 22.085  14.974  43.831 1.00 59.50 ? 522  LYS A CG  1 
ATOM   4220 C CD  . LYS A 1 522 ? 23.082  14.028  44.500 1.00 61.10 ? 522  LYS A CD  1 
ATOM   4221 C CE  . LYS A 1 522 ? 23.750  13.093  43.509 1.00 62.85 ? 522  LYS A CE  1 
ATOM   4222 N NZ  . LYS A 1 522 ? 24.726  12.194  44.194 1.00 62.96 ? 522  LYS A NZ  1 
ATOM   4223 N N   . LYS A 1 523 ? 19.865  16.588  47.667 1.00 52.09 ? 523  LYS A N   1 
ATOM   4224 C CA  . LYS A 1 523 ? 19.899  17.333  48.919 1.00 52.08 ? 523  LYS A CA  1 
ATOM   4225 C C   . LYS A 1 523 ? 19.599  16.439  50.120 1.00 50.57 ? 523  LYS A C   1 
ATOM   4226 O O   . LYS A 1 523 ? 20.095  16.678  51.223 1.00 50.48 ? 523  LYS A O   1 
ATOM   4227 C CB  . LYS A 1 523 ? 18.905  18.497  48.871 1.00 54.43 ? 523  LYS A CB  1 
ATOM   4228 C CG  . LYS A 1 523 ? 17.462  18.075  48.702 1.00 58.30 ? 523  LYS A CG  1 
ATOM   4229 C CD  . LYS A 1 523 ? 16.541  19.280  48.641 1.00 60.74 ? 523  LYS A CD  1 
ATOM   4230 C CE  . LYS A 1 523 ? 15.328  19.076  49.531 1.00 62.14 ? 523  LYS A CE  1 
ATOM   4231 N NZ  . LYS A 1 523 ? 15.007  17.630  49.675 1.00 61.60 ? 523  LYS A NZ  1 
ATOM   4232 N N   . ILE A 1 524 ? 18.796  15.401  49.902 1.00 48.44 ? 524  ILE A N   1 
ATOM   4233 C CA  . ILE A 1 524 ? 18.425  14.475  50.971 1.00 45.34 ? 524  ILE A CA  1 
ATOM   4234 C C   . ILE A 1 524 ? 19.438  13.352  51.214 1.00 46.18 ? 524  ILE A C   1 
ATOM   4235 O O   . ILE A 1 524 ? 19.605  12.903  52.345 1.00 45.19 ? 524  ILE A O   1 
ATOM   4236 C CB  . ILE A 1 524 ? 17.036  13.832  50.687 1.00 44.63 ? 524  ILE A CB  1 
ATOM   4237 C CG1 . ILE A 1 524 ? 15.929  14.864  50.926 1.00 41.97 ? 524  ILE A CG1 1 
ATOM   4238 C CG2 . ILE A 1 524 ? 16.833  12.594  51.559 1.00 42.02 ? 524  ILE A CG2 1 
ATOM   4239 C CD1 . ILE A 1 524 ? 14.537  14.356  50.646 1.00 40.31 ? 524  ILE A CD1 1 
ATOM   4240 N N   . GLU A 1 525 ? 20.112  12.905  50.160 1.00 46.12 ? 525  GLU A N   1 
ATOM   4241 C CA  . GLU A 1 525 ? 21.076  11.815  50.285 1.00 47.42 ? 525  GLU A CA  1 
ATOM   4242 C C   . GLU A 1 525 ? 22.053  11.983  51.456 1.00 48.42 ? 525  GLU A C   1 
ATOM   4243 O O   . GLU A 1 525 ? 22.160  11.105  52.308 1.00 47.54 ? 525  GLU A O   1 
ATOM   4244 C CB  . GLU A 1 525 ? 21.858  11.643  48.977 1.00 48.58 ? 525  GLU A CB  1 
ATOM   4245 C CG  . GLU A 1 525 ? 22.545  10.288  48.846 1.00 50.82 ? 525  GLU A CG  1 
ATOM   4246 C CD  . GLU A 1 525 ? 23.442  10.193  47.623 1.00 52.74 ? 525  GLU A CD  1 
ATOM   4247 O OE1 . GLU A 1 525 ? 23.039  10.682  46.544 1.00 53.83 ? 525  GLU A OE1 1 
ATOM   4248 O OE2 . GLU A 1 525 ? 24.548  9.617   47.739 1.00 54.30 ? 525  GLU A OE2 1 
ATOM   4249 N N   . PRO A 1 526 ? 22.772  13.116  51.519 1.00 49.64 ? 526  PRO A N   1 
ATOM   4250 C CA  . PRO A 1 526 ? 23.720  13.318  52.618 1.00 51.09 ? 526  PRO A CA  1 
ATOM   4251 C C   . PRO A 1 526 ? 23.076  13.370  54.002 1.00 51.04 ? 526  PRO A C   1 
ATOM   4252 O O   . PRO A 1 526 ? 23.671  12.927  54.985 1.00 51.58 ? 526  PRO A O   1 
ATOM   4253 C CB  . PRO A 1 526 ? 24.405  14.630  52.241 1.00 52.63 ? 526  PRO A CB  1 
ATOM   4254 C CG  . PRO A 1 526 ? 23.318  15.374  51.531 1.00 51.93 ? 526  PRO A CG  1 
ATOM   4255 C CD  . PRO A 1 526 ? 22.729  14.301  50.644 1.00 50.01 ? 526  PRO A CD  1 
ATOM   4256 N N   . GLU A 1 527 ? 21.859  13.904  54.072 1.00 50.02 ? 527  GLU A N   1 
ATOM   4257 C CA  . GLU A 1 527 ? 21.139  14.013  55.339 1.00 49.20 ? 527  GLU A CA  1 
ATOM   4258 C C   . GLU A 1 527 ? 20.769  12.649  55.921 1.00 47.72 ? 527  GLU A C   1 
ATOM   4259 O O   . GLU A 1 527 ? 20.458  12.544  57.103 1.00 46.91 ? 527  GLU A O   1 
ATOM   4260 C CB  . GLU A 1 527 ? 19.860  14.834  55.151 1.00 50.95 ? 527  GLU A CB  1 
ATOM   4261 C CG  . GLU A 1 527 ? 20.076  16.202  54.536 1.00 53.82 ? 527  GLU A CG  1 
ATOM   4262 C CD  . GLU A 1 527 ? 18.769  16.921  54.262 1.00 55.25 ? 527  GLU A CD  1 
ATOM   4263 O OE1 . GLU A 1 527 ? 17.918  16.356  53.541 1.00 55.65 ? 527  GLU A OE1 1 
ATOM   4264 O OE2 . GLU A 1 527 ? 18.592  18.050  54.767 1.00 55.82 ? 527  GLU A OE2 1 
ATOM   4265 N N   . LEU A 1 528 ? 20.790  11.609  55.091 1.00 47.31 ? 528  LEU A N   1 
ATOM   4266 C CA  . LEU A 1 528 ? 20.448  10.267  55.554 1.00 47.30 ? 528  LEU A CA  1 
ATOM   4267 C C   . LEU A 1 528 ? 21.573  9.644   56.373 1.00 48.04 ? 528  LEU A C   1 
ATOM   4268 O O   . LEU A 1 528 ? 21.348  8.717   57.145 1.00 46.94 ? 528  LEU A O   1 
ATOM   4269 C CB  . LEU A 1 528 ? 20.103  9.357   54.365 1.00 46.11 ? 528  LEU A CB  1 
ATOM   4270 C CG  . LEU A 1 528 ? 18.801  9.674   53.618 1.00 46.87 ? 528  LEU A CG  1 
ATOM   4271 C CD1 . LEU A 1 528 ? 18.583  8.666   52.493 1.00 44.91 ? 528  LEU A CD1 1 
ATOM   4272 C CD2 . LEU A 1 528 ? 17.632  9.634   54.595 1.00 45.71 ? 528  LEU A CD2 1 
ATOM   4273 N N   . ASP A 1 529 ? 22.785  10.157  56.199 1.00 50.47 ? 529  ASP A N   1 
ATOM   4274 C CA  . ASP A 1 529 ? 23.941  9.651   56.936 1.00 53.16 ? 529  ASP A CA  1 
ATOM   4275 C C   . ASP A 1 529 ? 23.838  10.043  58.406 1.00 54.26 ? 529  ASP A C   1 
ATOM   4276 O O   . ASP A 1 529 ? 23.476  11.172  58.735 1.00 54.12 ? 529  ASP A O   1 
ATOM   4277 C CB  . ASP A 1 529 ? 25.234  10.218  56.345 1.00 54.45 ? 529  ASP A CB  1 
ATOM   4278 C CG  . ASP A 1 529 ? 25.622  9.556   55.036 1.00 55.62 ? 529  ASP A CG  1 
ATOM   4279 O OD1 . ASP A 1 529 ? 26.405  10.162  54.275 1.00 57.13 ? 529  ASP A OD1 1 
ATOM   4280 O OD2 . ASP A 1 529 ? 25.158  8.427   54.772 1.00 56.71 ? 529  ASP A OD2 1 
ATOM   4281 N N   . GLY A 1 530 ? 24.153  9.103   59.289 1.00 55.82 ? 530  GLY A N   1 
ATOM   4282 C CA  . GLY A 1 530 ? 24.088  9.387   60.710 1.00 57.50 ? 530  GLY A CA  1 
ATOM   4283 C C   . GLY A 1 530 ? 22.773  8.983   61.345 1.00 57.98 ? 530  GLY A C   1 
ATOM   4284 O O   . GLY A 1 530 ? 21.896  8.423   60.686 1.00 58.72 ? 530  GLY A O   1 
ATOM   4285 N N   . SER A 1 531 ? 22.632  9.287   62.630 1.00 58.06 ? 531  SER A N   1 
ATOM   4286 C CA  . SER A 1 531 ? 21.429  8.943   63.376 1.00 57.32 ? 531  SER A CA  1 
ATOM   4287 C C   . SER A 1 531 ? 20.670  10.155  63.911 1.00 56.12 ? 531  SER A C   1 
ATOM   4288 O O   . SER A 1 531 ? 19.649  10.003  64.578 1.00 56.38 ? 531  SER A O   1 
ATOM   4289 C CB  . SER A 1 531 ? 21.803  8.027   64.539 1.00 58.74 ? 531  SER A CB  1 
ATOM   4290 O OG  . SER A 1 531 ? 22.861  8.596   65.293 1.00 60.62 ? 531  SER A OG  1 
ATOM   4291 N N   . SER A 1 532 ? 21.164  11.353  63.620 1.00 54.82 ? 532  SER A N   1 
ATOM   4292 C CA  . SER A 1 532 ? 20.517  12.572  64.094 1.00 54.55 ? 532  SER A CA  1 
ATOM   4293 C C   . SER A 1 532 ? 19.286  12.940  63.265 1.00 53.41 ? 532  SER A C   1 
ATOM   4294 O O   . SER A 1 532 ? 19.280  12.792  62.042 1.00 53.03 ? 532  SER A O   1 
ATOM   4295 C CB  . SER A 1 532 ? 21.510  13.737  64.078 1.00 55.45 ? 532  SER A CB  1 
ATOM   4296 O OG  . SER A 1 532 ? 21.985  13.980  62.766 1.00 56.80 ? 532  SER A OG  1 
ATOM   4297 N N   . PRO A 1 533 ? 18.223  13.423  63.930 1.00 52.35 ? 533  PRO A N   1 
ATOM   4298 C CA  . PRO A 1 533 ? 16.970  13.821  63.280 1.00 51.22 ? 533  PRO A CA  1 
ATOM   4299 C C   . PRO A 1 533 ? 17.110  15.008  62.326 1.00 50.75 ? 533  PRO A C   1 
ATOM   4300 O O   . PRO A 1 533 ? 17.945  15.890  62.532 1.00 48.45 ? 533  PRO A O   1 
ATOM   4301 C CB  . PRO A 1 533 ? 16.058  14.148  64.461 1.00 51.56 ? 533  PRO A CB  1 
ATOM   4302 C CG  . PRO A 1 533 ? 16.555  13.225  65.529 1.00 54.30 ? 533  PRO A CG  1 
ATOM   4303 C CD  . PRO A 1 533 ? 18.054  13.384  65.393 1.00 52.51 ? 533  PRO A CD  1 
ATOM   4304 N N   . VAL A 1 534 ? 16.282  15.019  61.284 1.00 48.70 ? 534  VAL A N   1 
ATOM   4305 C CA  . VAL A 1 534 ? 16.284  16.096  60.302 1.00 48.40 ? 534  VAL A CA  1 
ATOM   4306 C C   . VAL A 1 534 ? 15.044  16.962  60.531 1.00 48.48 ? 534  VAL A C   1 
ATOM   4307 O O   . VAL A 1 534 ? 13.964  16.447  60.815 1.00 47.90 ? 534  VAL A O   1 
ATOM   4308 C CB  . VAL A 1 534 ? 16.254  15.543  58.858 1.00 48.52 ? 534  VAL A CB  1 
ATOM   4309 C CG1 . VAL A 1 534 ? 16.134  16.685  57.867 1.00 50.13 ? 534  VAL A CG1 1 
ATOM   4310 C CG2 . VAL A 1 534 ? 17.518  14.745  58.578 1.00 49.04 ? 534  VAL A CG2 1 
ATOM   4311 N N   . THR A 1 535 ? 15.203  18.275  60.408 1.00 48.03 ? 535  THR A N   1 
ATOM   4312 C CA  . THR A 1 535 ? 14.091  19.199  60.619 1.00 47.66 ? 535  THR A CA  1 
ATOM   4313 C C   . THR A 1 535 ? 14.049  20.267  59.533 1.00 47.11 ? 535  THR A C   1 
ATOM   4314 O O   . THR A 1 535 ? 13.256  21.204  59.605 1.00 48.50 ? 535  THR A O   1 
ATOM   4315 C CB  . THR A 1 535 ? 14.228  19.922  61.974 1.00 48.68 ? 535  THR A CB  1 
ATOM   4316 O OG1 . THR A 1 535 ? 15.415  20.728  61.962 1.00 48.06 ? 535  THR A OG1 1 
ATOM   4317 C CG2 . THR A 1 535 ? 14.310  18.919  63.114 1.00 48.08 ? 535  THR A CG2 1 
ATOM   4318 N N   . SER A 1 536 ? 14.902  20.110  58.526 1.00 46.93 ? 536  SER A N   1 
ATOM   4319 C CA  . SER A 1 536 ? 15.020  21.069  57.434 1.00 48.11 ? 536  SER A CA  1 
ATOM   4320 C C   . SER A 1 536 ? 13.932  21.069  56.352 1.00 46.51 ? 536  SER A C   1 
ATOM   4321 O O   . SER A 1 536 ? 13.813  22.036  55.603 1.00 48.72 ? 536  SER A O   1 
ATOM   4322 C CB  . SER A 1 536 ? 16.391  20.893  56.775 1.00 49.26 ? 536  SER A CB  1 
ATOM   4323 O OG  . SER A 1 536 ? 16.632  19.526  56.479 1.00 51.40 ? 536  SER A OG  1 
ATOM   4324 N N   . HIS A 1 537 ? 13.150  20.000  56.264 1.00 44.88 ? 537  HIS A N   1 
ATOM   4325 C CA  . HIS A 1 537 ? 12.092  19.910  55.255 1.00 43.91 ? 537  HIS A CA  1 
ATOM   4326 C C   . HIS A 1 537 ? 10.727  20.053  55.917 1.00 43.48 ? 537  HIS A C   1 
ATOM   4327 O O   . HIS A 1 537 ? 10.630  20.402  57.094 1.00 43.93 ? 537  HIS A O   1 
ATOM   4328 C CB  . HIS A 1 537 ? 12.141  18.549  54.549 1.00 44.71 ? 537  HIS A CB  1 
ATOM   4329 C CG  . HIS A 1 537 ? 13.513  18.137  54.121 1.00 43.30 ? 537  HIS A CG  1 
ATOM   4330 N ND1 . HIS A 1 537 ? 13.984  18.326  52.841 1.00 45.76 ? 537  HIS A ND1 1 
ATOM   4331 C CD2 . HIS A 1 537 ? 14.527  17.568  54.816 1.00 45.42 ? 537  HIS A CD2 1 
ATOM   4332 C CE1 . HIS A 1 537 ? 15.231  17.894  52.765 1.00 44.75 ? 537  HIS A CE1 1 
ATOM   4333 N NE2 . HIS A 1 537 ? 15.583  17.430  53.950 1.00 45.49 ? 537  HIS A NE2 1 
ATOM   4334 N N   . ASP A 1 538 ? 9.674   19.783  55.148 1.00 42.66 ? 538  ASP A N   1 
ATOM   4335 C CA  . ASP A 1 538 ? 8.313   19.838  55.668 1.00 40.84 ? 538  ASP A CA  1 
ATOM   4336 C C   . ASP A 1 538 ? 8.227   18.701  56.686 1.00 39.51 ? 538  ASP A C   1 
ATOM   4337 O O   . ASP A 1 538 ? 9.047   17.781  56.650 1.00 40.42 ? 538  ASP A O   1 
ATOM   4338 C CB  . ASP A 1 538 ? 7.314   19.632  54.527 1.00 41.85 ? 538  ASP A CB  1 
ATOM   4339 C CG  . ASP A 1 538 ? 7.494   18.301  53.827 1.00 41.36 ? 538  ASP A CG  1 
ATOM   4340 O OD1 . ASP A 1 538 ? 6.890   17.309  54.285 1.00 42.17 ? 538  ASP A OD1 1 
ATOM   4341 O OD2 . ASP A 1 538 ? 8.248   18.246  52.829 1.00 41.55 ? 538  ASP A OD2 1 
ATOM   4342 N N   . SER A 1 539 ? 7.248   18.759  57.584 1.00 38.20 ? 539  SER A N   1 
ATOM   4343 C CA  . SER A 1 539 ? 7.100   17.749  58.630 1.00 39.55 ? 539  SER A CA  1 
ATOM   4344 C C   . SER A 1 539 ? 6.945   16.311  58.123 1.00 40.18 ? 539  SER A C   1 
ATOM   4345 O O   . SER A 1 539 ? 7.331   15.364  58.811 1.00 38.24 ? 539  SER A O   1 
ATOM   4346 C CB  . SER A 1 539 ? 5.926   18.108  59.548 1.00 40.01 ? 539  SER A CB  1 
ATOM   4347 O OG  . SER A 1 539 ? 4.693   18.115  58.849 1.00 42.45 ? 539  SER A OG  1 
ATOM   4348 N N   . SER A 1 540 ? 6.383   16.144  56.928 1.00 38.92 ? 540  SER A N   1 
ATOM   4349 C CA  . SER A 1 540 ? 6.217   14.806  56.363 1.00 37.38 ? 540  SER A CA  1 
ATOM   4350 C C   . SER A 1 540 ? 7.567   14.236  55.930 1.00 35.73 ? 540  SER A C   1 
ATOM   4351 O O   . SER A 1 540 ? 7.936   13.124  56.317 1.00 37.20 ? 540  SER A O   1 
ATOM   4352 C CB  . SER A 1 540 ? 5.264   14.837  55.161 1.00 36.81 ? 540  SER A CB  1 
ATOM   4353 O OG  . SER A 1 540 ? 5.267   13.584  54.497 1.00 38.01 ? 540  SER A OG  1 
ATOM   4354 N N   . THR A 1 541 ? 8.303   14.987  55.116 1.00 36.42 ? 541  THR A N   1 
ATOM   4355 C CA  . THR A 1 541 ? 9.612   14.527  54.679 1.00 36.13 ? 541  THR A CA  1 
ATOM   4356 C C   . THR A 1 541 ? 10.505  14.306  55.905 1.00 36.22 ? 541  THR A C   1 
ATOM   4357 O O   . THR A 1 541 ? 11.239  13.326  55.966 1.00 34.66 ? 541  THR A O   1 
ATOM   4358 C CB  . THR A 1 541 ? 10.281  15.527  53.724 1.00 36.45 ? 541  THR A CB  1 
ATOM   4359 O OG1 . THR A 1 541 ? 9.437   15.734  52.583 1.00 39.20 ? 541  THR A OG1 1 
ATOM   4360 C CG2 . THR A 1 541 ? 11.631  14.982  53.247 1.00 37.48 ? 541  THR A CG2 1 
ATOM   4361 N N   . ASN A 1 542 ? 10.432  15.214  56.879 1.00 38.17 ? 542  ASN A N   1 
ATOM   4362 C CA  . ASN A 1 542 ? 11.217  15.088  58.113 1.00 37.95 ? 542  ASN A CA  1 
ATOM   4363 C C   . ASN A 1 542 ? 10.830  13.796  58.827 1.00 37.63 ? 542  ASN A C   1 
ATOM   4364 O O   . ASN A 1 542 ? 11.687  13.020  59.259 1.00 38.55 ? 542  ASN A O   1 
ATOM   4365 C CB  . ASN A 1 542 ? 10.933  16.254  59.068 1.00 37.78 ? 542  ASN A CB  1 
ATOM   4366 C CG  . ASN A 1 542 ? 11.523  17.566  58.592 1.00 39.97 ? 542  ASN A CG  1 
ATOM   4367 O OD1 . ASN A 1 542 ? 11.168  18.635  59.096 1.00 41.27 ? 542  ASN A OD1 1 
ATOM   4368 N ND2 . ASN A 1 542 ? 12.427  17.495  57.625 1.00 37.99 ? 542  ASN A ND2 1 
ATOM   4369 N N   . GLY A 1 543 ? 9.523   13.585  58.953 1.00 36.45 ? 543  GLY A N   1 
ATOM   4370 C CA  . GLY A 1 543 ? 9.017   12.408  59.628 1.00 33.82 ? 543  GLY A CA  1 
ATOM   4371 C C   . GLY A 1 543 ? 9.457   11.100  59.008 1.00 33.55 ? 543  GLY A C   1 
ATOM   4372 O O   . GLY A 1 543 ? 9.808   10.159  59.718 1.00 33.20 ? 543  GLY A O   1 
ATOM   4373 N N   . LEU A 1 544 ? 9.428   11.035  57.680 1.00 33.95 ? 544  LEU A N   1 
ATOM   4374 C CA  . LEU A 1 544 ? 9.823   9.825   56.970 1.00 31.63 ? 544  LEU A CA  1 
ATOM   4375 C C   . LEU A 1 544 ? 11.308  9.552   57.151 1.00 32.23 ? 544  LEU A C   1 
ATOM   4376 O O   . LEU A 1 544 ? 11.715  8.418   57.394 1.00 29.21 ? 544  LEU A O   1 
ATOM   4377 C CB  . LEU A 1 544 ? 9.491   9.967   55.485 1.00 33.33 ? 544  LEU A CB  1 
ATOM   4378 C CG  . LEU A 1 544 ? 7.999   9.922   55.152 1.00 33.95 ? 544  LEU A CG  1 
ATOM   4379 C CD1 . LEU A 1 544 ? 7.765   10.474  53.760 1.00 30.65 ? 544  LEU A CD1 1 
ATOM   4380 C CD2 . LEU A 1 544 ? 7.498   8.487   55.266 1.00 30.22 ? 544  LEU A CD2 1 
ATOM   4381 N N   . ILE A 1 545 ? 12.119  10.597  57.019 1.00 31.36 ? 545  ILE A N   1 
ATOM   4382 C CA  . ILE A 1 545 ? 13.554  10.448  57.183 1.00 34.05 ? 545  ILE A CA  1 
ATOM   4383 C C   . ILE A 1 545 ? 13.872  9.935   58.582 1.00 34.07 ? 545  ILE A C   1 
ATOM   4384 O O   . ILE A 1 545 ? 14.672  9.013   58.740 1.00 36.27 ? 545  ILE A O   1 
ATOM   4385 C CB  . ILE A 1 545 ? 14.286  11.795  56.950 1.00 35.96 ? 545  ILE A CB  1 
ATOM   4386 C CG1 . ILE A 1 545 ? 14.308  12.115  55.452 1.00 33.36 ? 545  ILE A CG1 1 
ATOM   4387 C CG2 . ILE A 1 545 ? 15.712  11.729  57.509 1.00 35.13 ? 545  ILE A CG2 1 
ATOM   4388 C CD1 . ILE A 1 545 ? 14.701  13.533  55.127 1.00 34.54 ? 545  ILE A CD1 1 
ATOM   4389 N N   . ASN A 1 546 ? 13.231  10.511  59.594 1.00 34.68 ? 546  ASN A N   1 
ATOM   4390 C CA  . ASN A 1 546 ? 13.497  10.098  60.967 1.00 35.85 ? 546  ASN A CA  1 
ATOM   4391 C C   . ASN A 1 546 ? 13.046  8.669   61.267 1.00 35.57 ? 546  ASN A C   1 
ATOM   4392 O O   . ASN A 1 546 ? 13.659  7.985   62.088 1.00 32.96 ? 546  ASN A O   1 
ATOM   4393 C CB  . ASN A 1 546 ? 12.868  11.083  61.958 1.00 36.33 ? 546  ASN A CB  1 
ATOM   4394 C CG  . ASN A 1 546 ? 13.427  12.487  61.811 1.00 38.14 ? 546  ASN A CG  1 
ATOM   4395 O OD1 . ASN A 1 546 ? 14.599  12.669  61.469 1.00 38.19 ? 546  ASN A OD1 1 
ATOM   4396 N ND2 . ASN A 1 546 ? 12.597  13.485  62.077 1.00 39.80 ? 546  ASN A ND2 1 
ATOM   4397 N N   . PHE A 1 547 ? 11.983  8.219   60.603 1.00 35.13 ? 547  PHE A N   1 
ATOM   4398 C CA  . PHE A 1 547 ? 11.488  6.857   60.798 1.00 34.78 ? 547  PHE A CA  1 
ATOM   4399 C C   . PHE A 1 547 ? 12.500  5.881   60.201 1.00 32.80 ? 547  PHE A C   1 
ATOM   4400 O O   . PHE A 1 547 ? 12.731  4.798   60.738 1.00 33.63 ? 547  PHE A O   1 
ATOM   4401 C CB  . PHE A 1 547 ? 10.132  6.672   60.103 1.00 34.97 ? 547  PHE A CB  1 
ATOM   4402 C CG  . PHE A 1 547 ? 9.617   5.249   60.126 1.00 34.95 ? 547  PHE A CG  1 
ATOM   4403 C CD1 . PHE A 1 547 ? 9.072   4.706   61.289 1.00 34.23 ? 547  PHE A CD1 1 
ATOM   4404 C CD2 . PHE A 1 547 ? 9.661   4.462   58.973 1.00 34.00 ? 547  PHE A CD2 1 
ATOM   4405 C CE1 . PHE A 1 547 ? 8.572   3.393   61.307 1.00 37.40 ? 547  PHE A CE1 1 
ATOM   4406 C CE2 . PHE A 1 547 ? 9.165   3.146   58.976 1.00 35.38 ? 547  PHE A CE2 1 
ATOM   4407 C CZ  . PHE A 1 547 ? 8.617   2.612   60.148 1.00 33.30 ? 547  PHE A CZ  1 
ATOM   4408 N N   . ILE A 1 548 ? 13.099  6.269   59.081 1.00 34.89 ? 548  ILE A N   1 
ATOM   4409 C CA  . ILE A 1 548 ? 14.092  5.431   58.419 1.00 35.86 ? 548  ILE A CA  1 
ATOM   4410 C C   . ILE A 1 548 ? 15.339  5.287   59.296 1.00 37.38 ? 548  ILE A C   1 
ATOM   4411 O O   . ILE A 1 548 ? 15.877  4.188   59.448 1.00 35.00 ? 548  ILE A O   1 
ATOM   4412 C CB  . ILE A 1 548 ? 14.486  6.026   57.046 1.00 36.59 ? 548  ILE A CB  1 
ATOM   4413 C CG1 . ILE A 1 548 ? 13.267  6.019   56.118 1.00 36.35 ? 548  ILE A CG1 1 
ATOM   4414 C CG2 . ILE A 1 548 ? 15.632  5.235   56.437 1.00 35.97 ? 548  ILE A CG2 1 
ATOM   4415 C CD1 . ILE A 1 548 ? 13.519  6.599   54.740 1.00 36.77 ? 548  ILE A CD1 1 
ATOM   4416 N N   . LYS A 1 549 ? 15.793  6.395   59.876 1.00 37.67 ? 549  LYS A N   1 
ATOM   4417 C CA  . LYS A 1 549 ? 16.973  6.356   60.732 1.00 38.47 ? 549  LYS A CA  1 
ATOM   4418 C C   . LYS A 1 549 ? 16.734  5.459   61.940 1.00 39.40 ? 549  LYS A C   1 
ATOM   4419 O O   . LYS A 1 549 ? 17.609  4.692   62.340 1.00 38.86 ? 549  LYS A O   1 
ATOM   4420 C CB  . LYS A 1 549 ? 17.353  7.769   61.189 1.00 38.69 ? 549  LYS A CB  1 
ATOM   4421 C CG  . LYS A 1 549 ? 17.869  8.641   60.061 1.00 39.56 ? 549  LYS A CG  1 
ATOM   4422 C CD  . LYS A 1 549 ? 18.593  9.867   60.581 1.00 42.07 ? 549  LYS A CD  1 
ATOM   4423 C CE  . LYS A 1 549 ? 19.250  10.613  59.445 1.00 43.41 ? 549  LYS A CE  1 
ATOM   4424 N NZ  . LYS A 1 549 ? 20.314  11.521  59.930 1.00 43.95 ? 549  LYS A NZ  1 
ATOM   4425 N N   . GLN A 1 550 ? 15.537  5.549   62.509 1.00 40.12 ? 550  GLN A N   1 
ATOM   4426 C CA  . GLN A 1 550 ? 15.178  4.745   63.670 1.00 40.55 ? 550  GLN A CA  1 
ATOM   4427 C C   . GLN A 1 550 ? 15.086  3.240   63.362 1.00 39.95 ? 550  GLN A C   1 
ATOM   4428 O O   . GLN A 1 550 ? 15.476  2.396   64.181 1.00 38.95 ? 550  GLN A O   1 
ATOM   4429 C CB  . GLN A 1 550 ? 13.823  5.206   64.219 1.00 42.74 ? 550  GLN A CB  1 
ATOM   4430 C CG  . GLN A 1 550 ? 13.203  4.233   65.218 1.00 44.70 ? 550  GLN A CG  1 
ATOM   4431 C CD  . GLN A 1 550 ? 11.734  4.548   65.503 1.00 45.75 ? 550  GLN A CD  1 
ATOM   4432 O OE1 . GLN A 1 550 ? 11.435  5.533   66.177 1.00 49.23 ? 550  GLN A OE1 1 
ATOM   4433 N NE2 . GLN A 1 550 ? 10.787  3.765   65.022 1.00 45.19 ? 550  GLN A NE2 1 
ATOM   4434 N N   . GLN A 1 551 ? 14.584  2.915   62.188 1.00 39.95 ? 551  GLN A N   1 
ATOM   4435 C CA  . GLN A 1 551 ? 14.327  1.508   61.812 1.00 40.28 ? 551  GLN A CA  1 
ATOM   4436 C C   . GLN A 1 551 ? 15.491  0.835   61.056 1.00 41.89 ? 551  GLN A C   1 
ATOM   4437 O O   . GLN A 1 551 ? 15.589  -0.399  61.005 1.00 40.49 ? 551  GLN A O   1 
ATOM   4438 C CB  . GLN A 1 551 ? 13.098  1.432   60.907 1.00 38.54 ? 551  GLN A CB  1 
ATOM   4439 C CG  . GLN A 1 551 ? 11.792  1.679   61.664 1.00 37.39 ? 551  GLN A CG  1 
ATOM   4440 C CD  . GLN A 1 551 ? 11.522  0.624   62.738 1.00 36.57 ? 551  GLN A CD  1 
ATOM   4441 O OE1 . GLN A 1 551 ? 11.521  -0.569  62.439 1.00 37.23 ? 551  GLN A OE1 1 
ATOM   4442 N NE2 . GLN A 1 551 ? 11.290  0.993   63.984 1.00 34.22 ? 551  GLN A NE2 1 
ATOM   4443 N N   . ARG A 1 552 ? 16.360  1.634   60.480 1.00 45.06 ? 552  ARG A N   1 
ATOM   4444 C CA  . ARG A 1 552 ? 17.480  1.121   59.658 1.00 50.33 ? 552  ARG A CA  1 
ATOM   4445 C C   . ARG A 1 552 ? 18.275  -0.008  60.351 1.00 52.66 ? 552  ARG A C   1 
ATOM   4446 O O   . ARG A 1 552 ? 18.772  -0.937  59.698 1.00 54.19 ? 552  ARG A O   1 
ATOM   4447 C CB  . ARG A 1 552 ? 18.467  2.235   59.327 1.00 52.32 ? 552  ARG A CB  1 
ATOM   4448 C CG  . ARG A 1 552 ? 18.487  3.345   60.370 1.00 56.27 ? 552  ARG A CG  1 
ATOM   4449 C CD  . ARG A 1 552 ? 19.099  4.639   59.838 1.00 59.38 ? 552  ARG A CD  1 
ATOM   4450 N NE  . ARG A 1 552 ? 20.395  4.430   59.179 1.00 60.41 ? 552  ARG A NE  1 
ATOM   4451 C CZ  . ARG A 1 552 ? 21.231  5.418   58.840 1.00 61.37 ? 552  ARG A CZ  1 
ATOM   4452 N NH1 . ARG A 1 552 ? 20.922  6.698   59.085 1.00 58.81 ? 552  ARG A NH1 1 
ATOM   4453 N NH2 . ARG A 1 552 ? 22.416  5.225   58.246 1.00 62.15 ? 552  ARG A NH2 1 
ATOM   4454 N N   . GLU A 1 553 ? 18.407  0.062   61.668 1.00 54.77 ? 553  GLU A N   1 
ATOM   4455 C CA  . GLU A 1 553 ? 19.192  -0.950  62.413 1.00 58.48 ? 553  GLU A CA  1 
ATOM   4456 C C   . GLU A 1 553 ? 18.330  -1.725  63.400 1.00 58.72 ? 553  GLU A C   1 
ATOM   4457 O O   . GLU A 1 553 ? 18.842  -2.331  64.341 1.00 59.67 ? 553  GLU A O   1 
ATOM   4458 C CB  . GLU A 1 553 ? 20.340  -0.282  63.165 1.00 61.04 ? 553  GLU A CB  1 
ATOM   4459 C CG  . GLU A 1 553 ? 21.692  -0.505  62.482 1.00 65.30 ? 553  GLU A CG  1 
ATOM   4460 C CD  . GLU A 1 553 ? 21.570  -1.257  61.151 1.00 68.69 ? 553  GLU A CD  1 
ATOM   4461 O OE1 . GLU A 1 553 ? 21.785  -2.529  61.104 1.00 70.48 ? 553  GLU A OE1 1 
ATOM   4462 O OE2 . GLU A 1 553 ? 21.250  -0.620  60.075 1.00 70.89 ? 553  GLU A OE2 1 
ATOM   4463 N N   . ALA A 1 554 ? 17.020  -1.706  63.183 1.00 58.50 ? 554  ALA A N   1 
ATOM   4464 C CA  . ALA A 1 554 ? 16.104  -2.436  64.045 1.00 58.51 ? 554  ALA A CA  1 
ATOM   4465 C C   . ALA A 1 554 ? 16.192  -3.909  63.655 1.00 59.30 ? 554  ALA A C   1 
ATOM   4466 O O   . ALA A 1 554 ? 15.922  -4.274  62.512 1.00 59.64 ? 554  ALA A O   1 
ATOM   4467 C CB  . ALA A 1 554 ? 14.686  -1.924  63.858 1.00 59.25 ? 554  ALA A CB  1 
ATOM   4468 N N   . LYS A 1 555 ? 16.579  -4.751  64.606 1.00 59.26 ? 555  LYS A N   1 
ATOM   4469 C CA  . LYS A 1 555 ? 16.719  -6.176  64.348 1.00 59.32 ? 555  LYS A CA  1 
ATOM   4470 C C   . LYS A 1 555 ? 15.377  -6.891  64.361 1.00 59.69 ? 555  LYS A C   1 
ATOM   4471 O O   . LYS A 1 555 ? 14.710  -6.965  65.390 1.00 60.11 ? 555  LYS A O   1 
ATOM   4472 C CB  . LYS A 1 555 ? 17.658  -6.803  65.379 1.00 58.71 ? 555  LYS A CB  1 
ATOM   4473 N N   . ILE A 1 556 ? 14.982  -7.410  63.204 1.00 60.13 ? 556  ILE A N   1 
ATOM   4474 C CA  . ILE A 1 556 ? 13.726  -8.132  63.088 1.00 61.49 ? 556  ILE A CA  1 
ATOM   4475 C C   . ILE A 1 556 ? 14.040  -9.621  63.024 1.00 61.89 ? 556  ILE A C   1 
ATOM   4476 O O   . ILE A 1 556 ? 13.648  -10.349 63.960 1.00 61.51 ? 556  ILE A O   1 
ATOM   4477 C CB  . ILE A 1 556 ? 12.978  -7.690  61.829 1.00 62.47 ? 556  ILE A CB  1 
ATOM   4478 N N   . ALA B 1 1   ? -28.846 4.638   43.686 1.00 46.39 ? 1    ALA B N   1 
ATOM   4479 C CA  . ALA B 1 1   ? -27.665 4.022   44.358 1.00 46.08 ? 1    ALA B CA  1 
ATOM   4480 C C   . ALA B 1 1   ? -27.541 4.556   45.783 1.00 45.57 ? 1    ALA B C   1 
ATOM   4481 O O   . ALA B 1 1   ? -27.787 5.736   46.034 1.00 45.80 ? 1    ALA B O   1 
ATOM   4482 C CB  . ALA B 1 1   ? -26.400 4.329   43.562 1.00 44.98 ? 1    ALA B CB  1 
ATOM   4483 N N   . ALA B 1 2   ? -27.143 3.683   46.704 1.00 44.17 ? 2    ALA B N   1 
ATOM   4484 C CA  . ALA B 1 2   ? -27.002 4.033   48.117 1.00 44.33 ? 2    ALA B CA  1 
ATOM   4485 C C   . ALA B 1 2   ? -26.103 5.227   48.443 1.00 43.49 ? 2    ALA B C   1 
ATOM   4486 O O   . ALA B 1 2   ? -26.490 6.113   49.204 1.00 44.90 ? 2    ALA B O   1 
ATOM   4487 C CB  . ALA B 1 2   ? -26.522 2.811   48.898 1.00 44.91 ? 2    ALA B CB  1 
ATOM   4488 N N   . LEU B 1 3   ? -24.900 5.248   47.881 1.00 42.75 ? 3    LEU B N   1 
ATOM   4489 C CA  . LEU B 1 3   ? -23.959 6.325   48.157 1.00 41.94 ? 3    LEU B CA  1 
ATOM   4490 C C   . LEU B 1 3   ? -24.517 7.735   47.967 1.00 41.76 ? 3    LEU B C   1 
ATOM   4491 O O   . LEU B 1 3   ? -24.497 8.550   48.893 1.00 40.43 ? 3    LEU B O   1 
ATOM   4492 C CB  . LEU B 1 3   ? -22.703 6.155   47.299 1.00 40.35 ? 3    LEU B CB  1 
ATOM   4493 C CG  . LEU B 1 3   ? -21.619 7.211   47.519 1.00 39.44 ? 3    LEU B CG  1 
ATOM   4494 C CD1 . LEU B 1 3   ? -21.234 7.233   48.994 1.00 40.34 ? 3    LEU B CD1 1 
ATOM   4495 C CD2 . LEU B 1 3   ? -20.402 6.903   46.649 1.00 39.76 ? 3    LEU B CD2 1 
ATOM   4496 N N   . THR B 1 4   ? -25.004 8.018   46.763 1.00 40.45 ? 4    THR B N   1 
ATOM   4497 C CA  . THR B 1 4   ? -25.548 9.332   46.425 1.00 42.55 ? 4    THR B CA  1 
ATOM   4498 C C   . THR B 1 4   ? -26.665 9.806   47.342 1.00 42.20 ? 4    THR B C   1 
ATOM   4499 O O   . THR B 1 4   ? -26.826 11.003  47.568 1.00 42.00 ? 4    THR B O   1 
ATOM   4500 C CB  . THR B 1 4   ? -26.077 9.342   44.969 1.00 43.16 ? 4    THR B CB  1 
ATOM   4501 O OG1 . THR B 1 4   ? -24.992 9.081   44.073 1.00 45.81 ? 4    THR B OG1 1 
ATOM   4502 C CG2 . THR B 1 4   ? -26.691 10.697  44.619 1.00 43.72 ? 4    THR B CG2 1 
ATOM   4503 N N   . ARG B 1 5   ? -27.435 8.861   47.866 1.00 44.98 ? 5    ARG B N   1 
ATOM   4504 C CA  . ARG B 1 5   ? -28.562 9.174   48.737 1.00 47.73 ? 5    ARG B CA  1 
ATOM   4505 C C   . ARG B 1 5   ? -28.151 9.334   50.205 1.00 46.97 ? 5    ARG B C   1 
ATOM   4506 O O   . ARG B 1 5   ? -28.961 9.714   51.051 1.00 47.39 ? 5    ARG B O   1 
ATOM   4507 C CB  . ARG B 1 5   ? -29.620 8.072   48.571 1.00 51.26 ? 5    ARG B CB  1 
ATOM   4508 C CG  . ARG B 1 5   ? -30.872 8.198   49.417 1.00 57.03 ? 5    ARG B CG  1 
ATOM   4509 C CD  . ARG B 1 5   ? -31.050 6.988   50.329 1.00 61.25 ? 5    ARG B CD  1 
ATOM   4510 N NE  . ARG B 1 5   ? -32.435 6.522   50.353 1.00 65.08 ? 5    ARG B NE  1 
ATOM   4511 C CZ  . ARG B 1 5   ? -33.472 7.253   50.753 1.00 67.30 ? 5    ARG B CZ  1 
ATOM   4512 N NH1 . ARG B 1 5   ? -33.294 8.501   51.171 1.00 68.78 ? 5    ARG B NH1 1 
ATOM   4513 N NH2 . ARG B 1 5   ? -34.693 6.735   50.731 1.00 68.84 ? 5    ARG B NH2 1 
ATOM   4514 N N   . ASN B 1 6   ? -26.882 9.059   50.493 1.00 45.04 ? 6    ASN B N   1 
ATOM   4515 C CA  . ASN B 1 6   ? -26.347 9.160   51.852 1.00 43.09 ? 6    ASN B CA  1 
ATOM   4516 C C   . ASN B 1 6   ? -26.061 10.615  52.238 1.00 42.39 ? 6    ASN B C   1 
ATOM   4517 O O   . ASN B 1 6   ? -25.384 11.334  51.501 1.00 41.80 ? 6    ASN B O   1 
ATOM   4518 C CB  . ASN B 1 6   ? -25.054 8.347   51.943 1.00 41.87 ? 6    ASN B CB  1 
ATOM   4519 C CG  . ASN B 1 6   ? -24.514 8.262   53.351 1.00 41.25 ? 6    ASN B CG  1 
ATOM   4520 O OD1 . ASN B 1 6   ? -24.742 7.276   54.059 1.00 38.80 ? 6    ASN B OD1 1 
ATOM   4521 N ND2 . ASN B 1 6   ? -23.799 9.301   53.771 1.00 37.33 ? 6    ASN B ND2 1 
ATOM   4522 N N   . PRO B 1 7   ? -26.560 11.064  53.409 1.00 42.26 ? 7    PRO B N   1 
ATOM   4523 C CA  . PRO B 1 7   ? -26.341 12.442  53.871 1.00 41.97 ? 7    PRO B CA  1 
ATOM   4524 C C   . PRO B 1 7   ? -24.878 12.807  54.138 1.00 40.31 ? 7    PRO B C   1 
ATOM   4525 O O   . PRO B 1 7   ? -24.478 13.952  53.940 1.00 41.65 ? 7    PRO B O   1 
ATOM   4526 C CB  . PRO B 1 7   ? -27.215 12.533  55.127 1.00 43.05 ? 7    PRO B CB  1 
ATOM   4527 C CG  . PRO B 1 7   ? -27.234 11.121  55.632 1.00 43.41 ? 7    PRO B CG  1 
ATOM   4528 C CD  . PRO B 1 7   ? -27.412 10.325  54.357 1.00 42.23 ? 7    PRO B CD  1 
ATOM   4529 N N   . GLN B 1 8   ? -24.082 11.842  54.588 1.00 39.79 ? 8    GLN B N   1 
ATOM   4530 C CA  . GLN B 1 8   ? -22.663 12.099  54.854 1.00 39.51 ? 8    GLN B CA  1 
ATOM   4531 C C   . GLN B 1 8   ? -21.918 12.374  53.555 1.00 38.34 ? 8    GLN B C   1 
ATOM   4532 O O   . GLN B 1 8   ? -21.019 13.214  53.505 1.00 38.15 ? 8    GLN B O   1 
ATOM   4533 C CB  . GLN B 1 8   ? -22.025 10.909  55.576 1.00 39.36 ? 8    GLN B CB  1 
ATOM   4534 C CG  . GLN B 1 8   ? -22.277 10.897  57.076 1.00 41.67 ? 8    GLN B CG  1 
ATOM   4535 C CD  . GLN B 1 8   ? -23.751 10.944  57.419 1.00 45.11 ? 8    GLN B CD  1 
ATOM   4536 O OE1 . GLN B 1 8   ? -24.511 10.032  57.084 1.00 44.29 ? 8    GLN B OE1 1 
ATOM   4537 N NE2 . GLN B 1 8   ? -24.168 12.016  58.090 1.00 45.08 ? 8    GLN B NE2 1 
ATOM   4538 N N   . PHE B 1 9   ? -22.299 11.658  52.505 1.00 37.86 ? 9    PHE B N   1 
ATOM   4539 C CA  . PHE B 1 9   ? -21.690 11.838  51.197 1.00 37.84 ? 9    PHE B CA  1 
ATOM   4540 C C   . PHE B 1 9   ? -22.069 13.217  50.666 1.00 38.46 ? 9    PHE B C   1 
ATOM   4541 O O   . PHE B 1 9   ? -21.237 13.925  50.101 1.00 37.44 ? 9    PHE B O   1 
ATOM   4542 C CB  . PHE B 1 9   ? -22.180 10.757  50.235 1.00 37.02 ? 9    PHE B CB  1 
ATOM   4543 C CG  . PHE B 1 9   ? -21.695 10.936  48.827 1.00 38.28 ? 9    PHE B CG  1 
ATOM   4544 C CD1 . PHE B 1 9   ? -20.344 10.803  48.521 1.00 38.34 ? 9    PHE B CD1 1 
ATOM   4545 C CD2 . PHE B 1 9   ? -22.589 11.244  47.803 1.00 38.18 ? 9    PHE B CD2 1 
ATOM   4546 C CE1 . PHE B 1 9   ? -19.889 10.973  47.210 1.00 40.54 ? 9    PHE B CE1 1 
ATOM   4547 C CE2 . PHE B 1 9   ? -22.143 11.416  46.493 1.00 39.33 ? 9    PHE B CE2 1 
ATOM   4548 C CZ  . PHE B 1 9   ? -20.792 11.280  46.196 1.00 39.84 ? 9    PHE B CZ  1 
ATOM   4549 N N   . GLN B 1 10  ? -23.329 13.599  50.856 1.00 40.36 ? 10   GLN B N   1 
ATOM   4550 C CA  . GLN B 1 10  ? -23.799 14.905  50.397 1.00 42.67 ? 10   GLN B CA  1 
ATOM   4551 C C   . GLN B 1 10  ? -23.076 16.055  51.099 1.00 43.10 ? 10   GLN B C   1 
ATOM   4552 O O   . GLN B 1 10  ? -22.717 17.052  50.468 1.00 42.59 ? 10   GLN B O   1 
ATOM   4553 C CB  . GLN B 1 10  ? -25.308 15.031  50.612 1.00 44.45 ? 10   GLN B CB  1 
ATOM   4554 C CG  . GLN B 1 10  ? -26.146 14.235  49.619 1.00 48.36 ? 10   GLN B CG  1 
ATOM   4555 C CD  . GLN B 1 10  ? -25.795 14.556  48.174 1.00 51.33 ? 10   GLN B CD  1 
ATOM   4556 O OE1 . GLN B 1 10  ? -25.513 15.708  47.834 1.00 55.17 ? 10   GLN B OE1 1 
ATOM   4557 N NE2 . GLN B 1 10  ? -25.820 13.542  47.315 1.00 50.01 ? 10   GLN B NE2 1 
ATOM   4558 N N   . LYS B 1 11  ? -22.858 15.913  52.402 1.00 44.00 ? 11   LYS B N   1 
ATOM   4559 C CA  . LYS B 1 11  ? -22.165 16.939  53.174 1.00 45.31 ? 11   LYS B CA  1 
ATOM   4560 C C   . LYS B 1 11  ? -20.721 17.077  52.685 1.00 44.76 ? 11   LYS B C   1 
ATOM   4561 O O   . LYS B 1 11  ? -20.194 18.185  52.560 1.00 44.25 ? 11   LYS B O   1 
ATOM   4562 C CB  . LYS B 1 11  ? -22.179 16.575  54.662 1.00 46.47 ? 11   LYS B CB  1 
ATOM   4563 C CG  . LYS B 1 11  ? -21.562 17.631  55.573 1.00 49.48 ? 11   LYS B CG  1 
ATOM   4564 C CD  . LYS B 1 11  ? -21.441 17.117  57.002 1.00 51.19 ? 11   LYS B CD  1 
ATOM   4565 C CE  . LYS B 1 11  ? -20.692 18.094  57.897 1.00 53.04 ? 11   LYS B CE  1 
ATOM   4566 N NZ  . LYS B 1 11  ? -20.395 17.496  59.234 1.00 52.49 ? 11   LYS B NZ  1 
ATOM   4567 N N   . LEU B 1 12  ? -20.079 15.945  52.413 1.00 43.95 ? 12   LEU B N   1 
ATOM   4568 C CA  . LEU B 1 12  ? -18.703 15.952  51.929 1.00 42.55 ? 12   LEU B CA  1 
ATOM   4569 C C   . LEU B 1 12  ? -18.684 16.554  50.526 1.00 43.40 ? 12   LEU B C   1 
ATOM   4570 O O   . LEU B 1 12  ? -17.814 17.354  50.185 1.00 41.08 ? 12   LEU B O   1 
ATOM   4571 C CB  . LEU B 1 12  ? -18.154 14.523  51.877 1.00 43.85 ? 12   LEU B CB  1 
ATOM   4572 C CG  . LEU B 1 12  ? -16.677 14.367  51.508 1.00 44.62 ? 12   LEU B CG  1 
ATOM   4573 C CD1 . LEU B 1 12  ? -15.823 14.664  52.725 1.00 43.40 ? 12   LEU B CD1 1 
ATOM   4574 C CD2 . LEU B 1 12  ? -16.411 12.950  51.024 1.00 47.16 ? 12   LEU B CD2 1 
ATOM   4575 N N   . GLN B 1 13  ? -19.657 16.159  49.713 1.00 44.16 ? 13   GLN B N   1 
ATOM   4576 C CA  . GLN B 1 13  ? -19.758 16.651  48.347 1.00 46.69 ? 13   GLN B CA  1 
ATOM   4577 C C   . GLN B 1 13  ? -19.917 18.170  48.324 1.00 46.44 ? 13   GLN B C   1 
ATOM   4578 O O   . GLN B 1 13  ? -19.217 18.870  47.589 1.00 45.18 ? 13   GLN B O   1 
ATOM   4579 C CB  . GLN B 1 13  ? -20.944 15.977  47.656 1.00 48.79 ? 13   GLN B CB  1 
ATOM   4580 C CG  . GLN B 1 13  ? -21.327 16.562  46.318 1.00 53.52 ? 13   GLN B CG  1 
ATOM   4581 C CD  . GLN B 1 13  ? -22.303 15.678  45.569 1.00 55.68 ? 13   GLN B CD  1 
ATOM   4582 O OE1 . GLN B 1 13  ? -21.930 14.619  45.059 1.00 57.49 ? 13   GLN B OE1 1 
ATOM   4583 N NE2 . GLN B 1 13  ? -23.563 16.100  45.508 1.00 54.57 ? 13   GLN B NE2 1 
ATOM   4584 N N   . GLN B 1 14  ? -20.841 18.669  49.139 1.00 48.10 ? 14   GLN B N   1 
ATOM   4585 C CA  . GLN B 1 14  ? -21.105 20.101  49.227 1.00 49.50 ? 14   GLN B CA  1 
ATOM   4586 C C   . GLN B 1 14  ? -19.868 20.845  49.715 1.00 48.40 ? 14   GLN B C   1 
ATOM   4587 O O   . GLN B 1 14  ? -19.546 21.919  49.212 1.00 49.16 ? 14   GLN B O   1 
ATOM   4588 C CB  . GLN B 1 14  ? -22.281 20.357  50.176 1.00 50.35 ? 14   GLN B CB  1 
ATOM   4589 C CG  . GLN B 1 14  ? -22.690 21.821  50.318 1.00 55.21 ? 14   GLN B CG  1 
ATOM   4590 C CD  . GLN B 1 14  ? -23.136 22.454  49.005 1.00 57.53 ? 14   GLN B CD  1 
ATOM   4591 O OE1 . GLN B 1 14  ? -23.950 21.890  48.269 1.00 59.33 ? 14   GLN B OE1 1 
ATOM   4592 N NE2 . GLN B 1 14  ? -22.610 23.639  48.714 1.00 57.65 ? 14   GLN B NE2 1 
ATOM   4593 N N   . TRP B 1 15  ? -19.172 20.269  50.691 1.00 47.63 ? 15   TRP B N   1 
ATOM   4594 C CA  . TRP B 1 15  ? -17.966 20.888  51.235 1.00 47.54 ? 15   TRP B CA  1 
ATOM   4595 C C   . TRP B 1 15  ? -16.889 21.012  50.158 1.00 47.68 ? 15   TRP B C   1 
ATOM   4596 O O   . TRP B 1 15  ? -16.222 22.043  50.040 1.00 46.03 ? 15   TRP B O   1 
ATOM   4597 C CB  . TRP B 1 15  ? -17.414 20.058  52.395 1.00 46.45 ? 15   TRP B CB  1 
ATOM   4598 C CG  . TRP B 1 15  ? -16.366 20.778  53.171 1.00 46.62 ? 15   TRP B CG  1 
ATOM   4599 C CD1 . TRP B 1 15  ? -16.558 21.577  54.260 1.00 44.37 ? 15   TRP B CD1 1 
ATOM   4600 C CD2 . TRP B 1 15  ? -14.961 20.818  52.886 1.00 47.03 ? 15   TRP B CD2 1 
ATOM   4601 N NE1 . TRP B 1 15  ? -15.363 22.114  54.671 1.00 47.18 ? 15   TRP B NE1 1 
ATOM   4602 C CE2 . TRP B 1 15  ? -14.366 21.667  53.845 1.00 47.07 ? 15   TRP B CE2 1 
ATOM   4603 C CE3 . TRP B 1 15  ? -14.150 20.224  51.911 1.00 45.36 ? 15   TRP B CE3 1 
ATOM   4604 C CZ2 . TRP B 1 15  ? -12.994 21.934  53.860 1.00 46.43 ? 15   TRP B CZ2 1 
ATOM   4605 C CZ3 . TRP B 1 15  ? -12.785 20.490  51.925 1.00 46.11 ? 15   TRP B CZ3 1 
ATOM   4606 C CH2 . TRP B 1 15  ? -12.222 21.338  52.894 1.00 46.90 ? 15   TRP B CH2 1 
ATOM   4607 N N   . HIS B 1 16  ? -16.722 19.949  49.377 1.00 49.11 ? 16   HIS B N   1 
ATOM   4608 C CA  . HIS B 1 16  ? -15.728 19.930  48.310 1.00 52.57 ? 16   HIS B CA  1 
ATOM   4609 C C   . HIS B 1 16  ? -16.050 20.965  47.240 1.00 54.82 ? 16   HIS B C   1 
ATOM   4610 O O   . HIS B 1 16  ? -15.169 21.682  46.768 1.00 54.62 ? 16   HIS B O   1 
ATOM   4611 C CB  . HIS B 1 16  ? -15.666 18.545  47.665 1.00 51.79 ? 16   HIS B CB  1 
ATOM   4612 C CG  . HIS B 1 16  ? -14.708 18.460  46.520 1.00 52.56 ? 16   HIS B CG  1 
ATOM   4613 N ND1 . HIS B 1 16  ? -13.342 18.473  46.691 1.00 52.09 ? 16   HIS B ND1 1 
ATOM   4614 C CD2 . HIS B 1 16  ? -14.919 18.413  45.183 1.00 52.69 ? 16   HIS B CD2 1 
ATOM   4615 C CE1 . HIS B 1 16  ? -12.751 18.440  45.511 1.00 52.51 ? 16   HIS B CE1 1 
ATOM   4616 N NE2 . HIS B 1 16  ? -13.686 18.403  44.578 1.00 54.29 ? 16   HIS B NE2 1 
ATOM   4617 N N   . ARG B 1 17  ? -17.319 21.035  46.855 1.00 57.85 ? 17   ARG B N   1 
ATOM   4618 C CA  . ARG B 1 17  ? -17.751 21.982  45.839 1.00 61.34 ? 17   ARG B CA  1 
ATOM   4619 C C   . ARG B 1 17  ? -17.874 23.375  46.448 1.00 62.74 ? 17   ARG B C   1 
ATOM   4620 O O   . ARG B 1 17  ? -18.535 24.252  45.895 1.00 64.82 ? 17   ARG B O   1 
ATOM   4621 C CB  . ARG B 1 17  ? -19.091 21.528  45.239 1.00 62.03 ? 17   ARG B CB  1 
ATOM   4622 C CG  . ARG B 1 17  ? -19.042 20.090  44.721 1.00 65.43 ? 17   ARG B CG  1 
ATOM   4623 C CD  . ARG B 1 17  ? -20.171 19.725  43.753 1.00 66.62 ? 17   ARG B CD  1 
ATOM   4624 N NE  . ARG B 1 17  ? -21.474 19.559  44.394 1.00 67.83 ? 17   ARG B NE  1 
ATOM   4625 C CZ  . ARG B 1 17  ? -22.492 18.902  43.841 1.00 68.85 ? 17   ARG B CZ  1 
ATOM   4626 N NH1 . ARG B 1 17  ? -22.355 18.346  42.643 1.00 67.37 ? 17   ARG B NH1 1 
ATOM   4627 N NH2 . ARG B 1 17  ? -23.651 18.803  44.477 1.00 69.60 ? 17   ARG B NH2 1 
ATOM   4628 N N   . GLU B 1 18  ? -17.215 23.575  47.585 1.00 64.01 ? 18   GLU B N   1 
ATOM   4629 C CA  . GLU B 1 18  ? -17.265 24.854  48.280 1.00 65.39 ? 18   GLU B CA  1 
ATOM   4630 C C   . GLU B 1 18  ? -15.879 25.262  48.777 1.00 66.06 ? 18   GLU B C   1 
ATOM   4631 O O   . GLU B 1 18  ? -15.639 26.433  49.069 1.00 65.57 ? 18   GLU B O   1 
ATOM   4632 C CB  . GLU B 1 18  ? -18.240 24.747  49.459 1.00 67.19 ? 18   GLU B CB  1 
ATOM   4633 C CG  . GLU B 1 18  ? -19.037 26.006  49.757 1.00 70.05 ? 18   GLU B CG  1 
ATOM   4634 C CD  . GLU B 1 18  ? -20.254 25.732  50.628 1.00 72.56 ? 18   GLU B CD  1 
ATOM   4635 O OE1 . GLU B 1 18  ? -20.085 25.258  51.773 1.00 73.70 ? 18   GLU B OE1 1 
ATOM   4636 O OE2 . GLU B 1 18  ? -21.390 25.984  50.165 1.00 73.46 ? 18   GLU B OE2 1 
ATOM   4637 N N   . HIS B 1 19  ? -14.969 24.292  48.865 1.00 66.00 ? 19   HIS B N   1 
ATOM   4638 C CA  . HIS B 1 19  ? -13.608 24.553  49.331 1.00 66.81 ? 19   HIS B CA  1 
ATOM   4639 C C   . HIS B 1 19  ? -12.562 23.695  48.623 1.00 67.41 ? 19   HIS B C   1 
ATOM   4640 O O   . HIS B 1 19  ? -11.387 24.055  48.570 1.00 67.73 ? 19   HIS B O   1 
ATOM   4641 C CB  . HIS B 1 19  ? -13.493 24.290  50.833 1.00 66.07 ? 19   HIS B CB  1 
ATOM   4642 C CG  . HIS B 1 19  ? -14.422 25.111  51.669 1.00 66.08 ? 19   HIS B CG  1 
ATOM   4643 N ND1 . HIS B 1 19  ? -15.791 24.964  51.625 1.00 66.61 ? 19   HIS B ND1 1 
ATOM   4644 C CD2 . HIS B 1 19  ? -14.176 26.064  52.599 1.00 66.21 ? 19   HIS B CD2 1 
ATOM   4645 C CE1 . HIS B 1 19  ? -16.348 25.788  52.494 1.00 66.26 ? 19   HIS B CE1 1 
ATOM   4646 N NE2 . HIS B 1 19  ? -15.390 26.466  53.098 1.00 66.22 ? 19   HIS B NE2 1 
ATOM   4647 N N   . GLY B 1 20  ? -12.995 22.556  48.094 1.00 67.51 ? 20   GLY B N   1 
ATOM   4648 C CA  . GLY B 1 20  ? -12.084 21.648  47.418 1.00 67.38 ? 20   GLY B CA  1 
ATOM   4649 C C   . GLY B 1 20  ? -11.042 22.403  46.574 1.00 67.92 ? 20   GLY B C   1 
ATOM   4650 O O   . GLY B 1 20  ? -9.828  22.268  46.786 1.00 67.11 ? 20   GLY B O   1 
ATOM   4651 N N   . SER B 1 21  ? -11.534 23.178  45.617 1.00 68.33 ? 21   SER B N   1 
ATOM   4652 C CA  . SER B 1 21  ? -10.665 23.953  44.706 1.00 69.16 ? 21   SER B CA  1 
ATOM   4653 C C   . SER B 1 21  ? -9.517  24.585  45.495 1.00 69.41 ? 21   SER B C   1 
ATOM   4654 O O   . SER B 1 21  ? -8.407  24.771  44.971 1.00 70.11 ? 21   SER B O   1 
ATOM   4655 C CB  . SER B 1 21  ? -11.457 25.055  44.001 1.00 69.30 ? 21   SER B CB  1 
ATOM   4656 O OG  . SER B 1 21  ? -10.786 25.442  42.806 1.00 69.34 ? 21   SER B OG  1 
ATOM   4657 N N   . GLU B 1 22  ? -9.826  24.903  46.742 1.00 68.59 ? 22   GLU B N   1 
ATOM   4658 C CA  . GLU B 1 22  ? -8.845  25.475  47.676 1.00 68.51 ? 22   GLU B CA  1 
ATOM   4659 C C   . GLU B 1 22  ? -8.414  24.416  48.675 1.00 67.29 ? 22   GLU B C   1 
ATOM   4660 O O   . GLU B 1 22  ? -9.065  24.215  49.712 1.00 69.38 ? 22   GLU B O   1 
ATOM   4661 C CB  . GLU B 1 22  ? -9.422  26.650  48.462 1.00 70.86 ? 22   GLU B CB  1 
ATOM   4662 C CG  . GLU B 1 22  ? -8.344  27.670  48.863 1.00 73.95 ? 22   GLU B CG  1 
ATOM   4663 C CD  . GLU B 1 22  ? -7.683  27.360  50.213 1.00 75.81 ? 22   GLU B CD  1 
ATOM   4664 O OE1 . GLU B 1 22  ? -8.132  26.402  50.952 1.00 75.73 ? 22   GLU B OE1 1 
ATOM   4665 O OE2 . GLU B 1 22  ? -6.673  28.059  50.611 1.00 77.01 ? 22   GLU B OE2 1 
ATOM   4666 N N   . LEU B 1 23  ? -7.334  23.792  48.300 1.00 63.47 ? 23   LEU B N   1 
ATOM   4667 C CA  . LEU B 1 23  ? -6.557  22.930  49.219 1.00 59.44 ? 23   LEU B CA  1 
ATOM   4668 C C   . LEU B 1 23  ? -5.157  22.761  48.655 1.00 56.34 ? 23   LEU B C   1 
ATOM   4669 O O   . LEU B 1 23  ? -4.936  21.968  47.727 1.00 58.78 ? 23   LEU B O   1 
ATOM   4670 C CB  . LEU B 1 23  ? -7.338  21.618  49.144 1.00 58.29 ? 23   LEU B CB  1 
ATOM   4671 C CG  . LEU B 1 23  ? -8.450  21.520  50.190 1.00 57.20 ? 23   LEU B CG  1 
ATOM   4672 C CD1 . LEU B 1 23  ? -9.055  20.118  50.291 1.00 56.52 ? 23   LEU B CD1 1 
ATOM   4673 C CD2 . LEU B 1 23  ? -7.976  21.869  51.602 1.00 58.22 ? 23   LEU B CD2 1 
ATOM   4674 N N   . ASN B 1 24  ? -4.253  23.510  49.226 1.00 52.39 ? 24   ASN B N   1 
ATOM   4675 C CA  . ASN B 1 24  ? -2.858  23.499  48.804 1.00 49.00 ? 24   ASN B CA  1 
ATOM   4676 C C   . ASN B 1 24  ? -1.986  22.857  49.875 1.00 47.98 ? 24   ASN B C   1 
ATOM   4677 O O   . ASN B 1 24  ? -1.886  23.360  51.004 1.00 46.45 ? 24   ASN B O   1 
ATOM   4678 C CB  . ASN B 1 24  ? -2.383  24.933  48.569 1.00 49.11 ? 24   ASN B CB  1 
ATOM   4679 C CG  . ASN B 1 24  ? -1.024  25.004  47.878 1.00 48.42 ? 24   ASN B CG  1 
ATOM   4680 O OD1 . ASN B 1 24  ? 0.006   24.937  48.546 1.00 48.01 ? 24   ASN B OD1 1 
ATOM   4681 N ND2 . ASN B 1 24  ? -0.958  25.135  46.567 1.00 49.84 ? 24   ASN B ND2 1 
ATOM   4682 N N   . LEU B 1 25  ? -1.382  21.763  49.466 1.00 46.34 ? 25   LEU B N   1 
ATOM   4683 C CA  . LEU B 1 25  ? -0.499  20.969  50.320 1.00 45.73 ? 25   LEU B CA  1 
ATOM   4684 C C   . LEU B 1 25  ? 0.630   21.829  50.885 1.00 45.05 ? 25   LEU B C   1 
ATOM   4685 O O   . LEU B 1 25  ? 0.842   21.860  52.095 1.00 45.84 ? 25   LEU B O   1 
ATOM   4686 C CB  . LEU B 1 25  ? 0.147   19.840  49.511 1.00 45.92 ? 25   LEU B CB  1 
ATOM   4687 C CG  . LEU B 1 25  ? -0.857  18.804  49.003 1.00 47.76 ? 25   LEU B CG  1 
ATOM   4688 C CD1 . LEU B 1 25  ? -0.200  17.692  48.181 1.00 45.33 ? 25   LEU B CD1 1 
ATOM   4689 C CD2 . LEU B 1 25  ? -1.609  18.097  50.131 1.00 47.07 ? 25   LEU B CD2 1 
ATOM   4690 N N   . ARG B 1 26  ? 1.361   22.513  50.014 1.00 45.45 ? 26   ARG B N   1 
ATOM   4691 C CA  . ARG B 1 26  ? 2.478   23.340  50.457 1.00 47.59 ? 26   ARG B CA  1 
ATOM   4692 C C   . ARG B 1 26  ? 2.041   24.347  51.519 1.00 47.38 ? 26   ARG B C   1 
ATOM   4693 O O   . ARG B 1 26  ? 2.760   24.597  52.485 1.00 47.32 ? 26   ARG B O   1 
ATOM   4694 C CB  . ARG B 1 26  ? 3.106   24.064  49.263 1.00 47.97 ? 26   ARG B CB  1 
ATOM   4695 C CG  . ARG B 1 26  ? 4.482   24.649  49.551 1.00 49.55 ? 26   ARG B CG  1 
ATOM   4696 C CD  . ARG B 1 26  ? 5.172   25.090  48.271 1.00 49.48 ? 26   ARG B CD  1 
ATOM   4697 N NE  . ARG B 1 26  ? 6.527   25.580  48.508 1.00 51.11 ? 26   ARG B NE  1 
ATOM   4698 C CZ  . ARG B 1 26  ? 7.390   25.881  47.540 1.00 50.64 ? 26   ARG B CZ  1 
ATOM   4699 N NH1 . ARG B 1 26  ? 7.039   25.742  46.267 1.00 48.88 ? 26   ARG B NH1 1 
ATOM   4700 N NH2 . ARG B 1 26  ? 8.605   26.323  47.844 1.00 51.06 ? 26   ARG B NH2 1 
ATOM   4701 N N   . HIS B 1 27  ? 0.849   24.906  51.344 1.00 47.93 ? 27   HIS B N   1 
ATOM   4702 C CA  . HIS B 1 27  ? 0.314   25.875  52.286 1.00 48.14 ? 27   HIS B CA  1 
ATOM   4703 C C   . HIS B 1 27  ? -0.031  25.200  53.612 1.00 48.27 ? 27   HIS B C   1 
ATOM   4704 O O   . HIS B 1 27  ? 0.297   25.712  54.683 1.00 48.55 ? 27   HIS B O   1 
ATOM   4705 C CB  . HIS B 1 27  ? -0.937  26.538  51.703 1.00 48.39 ? 27   HIS B CB  1 
ATOM   4706 C CG  . HIS B 1 27  ? -1.600  27.495  52.640 1.00 50.32 ? 27   HIS B CG  1 
ATOM   4707 N ND1 . HIS B 1 27  ? -1.106  28.758  52.885 1.00 51.19 ? 27   HIS B ND1 1 
ATOM   4708 C CD2 . HIS B 1 27  ? -2.690  27.355  53.432 1.00 50.72 ? 27   HIS B CD2 1 
ATOM   4709 C CE1 . HIS B 1 27  ? -1.862  29.355  53.789 1.00 52.19 ? 27   HIS B CE1 1 
ATOM   4710 N NE2 . HIS B 1 27  ? -2.830  28.525  54.138 1.00 52.49 ? 27   HIS B NE2 1 
ATOM   4711 N N   . LEU B 1 28  ? -0.693  24.049  53.528 1.00 47.00 ? 28   LEU B N   1 
ATOM   4712 C CA  . LEU B 1 28  ? -1.093  23.283  54.705 1.00 47.54 ? 28   LEU B CA  1 
ATOM   4713 C C   . LEU B 1 28  ? 0.075   22.948  55.624 1.00 47.02 ? 28   LEU B C   1 
ATOM   4714 O O   . LEU B 1 28  ? -0.032  23.056  56.844 1.00 48.14 ? 28   LEU B O   1 
ATOM   4715 C CB  . LEU B 1 28  ? -1.768  21.978  54.279 1.00 46.07 ? 28   LEU B CB  1 
ATOM   4716 C CG  . LEU B 1 28  ? -3.110  22.051  53.550 1.00 46.56 ? 28   LEU B CG  1 
ATOM   4717 C CD1 . LEU B 1 28  ? -3.417  20.690  52.942 1.00 46.15 ? 28   LEU B CD1 1 
ATOM   4718 C CD2 . LEU B 1 28  ? -4.203  22.469  54.519 1.00 46.14 ? 28   LEU B CD2 1 
ATOM   4719 N N   . PHE B 1 29  ? 1.186   22.521  55.041 1.00 47.80 ? 29   PHE B N   1 
ATOM   4720 C CA  . PHE B 1 29  ? 2.349   22.178  55.844 1.00 49.27 ? 29   PHE B CA  1 
ATOM   4721 C C   . PHE B 1 29  ? 2.982   23.421  56.461 1.00 51.26 ? 29   PHE B C   1 
ATOM   4722 O O   . PHE B 1 29  ? 3.485   23.378  57.577 1.00 52.05 ? 29   PHE B O   1 
ATOM   4723 C CB  . PHE B 1 29  ? 3.382   21.426  55.001 1.00 46.90 ? 29   PHE B CB  1 
ATOM   4724 C CG  . PHE B 1 29  ? 3.031   19.984  54.760 1.00 44.09 ? 29   PHE B CG  1 
ATOM   4725 C CD1 . PHE B 1 29  ? 2.203   19.618  53.704 1.00 42.82 ? 29   PHE B CD1 1 
ATOM   4726 C CD2 . PHE B 1 29  ? 3.506   18.992  55.614 1.00 44.10 ? 29   PHE B CD2 1 
ATOM   4727 C CE1 . PHE B 1 29  ? 1.850   18.283  53.503 1.00 42.61 ? 29   PHE B CE1 1 
ATOM   4728 C CE2 . PHE B 1 29  ? 3.160   17.653  55.425 1.00 42.03 ? 29   PHE B CE2 1 
ATOM   4729 C CZ  . PHE B 1 29  ? 2.330   17.300  54.366 1.00 41.88 ? 29   PHE B CZ  1 
ATOM   4730 N N   . ASP B 1 30  ? 2.933   24.529  55.735 1.00 54.14 ? 30   ASP B N   1 
ATOM   4731 C CA  . ASP B 1 30  ? 3.510   25.785  56.207 1.00 56.29 ? 30   ASP B CA  1 
ATOM   4732 C C   . ASP B 1 30  ? 2.700   26.469  57.306 1.00 56.87 ? 30   ASP B C   1 
ATOM   4733 O O   . ASP B 1 30  ? 3.180   27.416  57.932 1.00 57.77 ? 30   ASP B O   1 
ATOM   4734 C CB  . ASP B 1 30  ? 3.676   26.750  55.033 1.00 57.62 ? 30   ASP B CB  1 
ATOM   4735 C CG  . ASP B 1 30  ? 4.665   26.247  54.005 1.00 59.57 ? 30   ASP B CG  1 
ATOM   4736 O OD1 . ASP B 1 30  ? 4.798   26.891  52.942 1.00 60.31 ? 30   ASP B OD1 1 
ATOM   4737 O OD2 . ASP B 1 30  ? 5.312   25.210  54.265 1.00 61.70 ? 30   ASP B OD2 1 
ATOM   4738 N N   . THR B 1 31  ? 1.481   25.993  57.542 1.00 56.61 ? 31   THR B N   1 
ATOM   4739 C CA  . THR B 1 31  ? 0.613   26.581  58.560 1.00 55.92 ? 31   THR B CA  1 
ATOM   4740 C C   . THR B 1 31  ? 0.299   25.621  59.707 1.00 56.31 ? 31   THR B C   1 
ATOM   4741 O O   . THR B 1 31  ? -0.363  25.994  60.676 1.00 55.33 ? 31   THR B O   1 
ATOM   4742 C CB  . THR B 1 31  ? -0.720  27.042  57.939 1.00 56.72 ? 31   THR B CB  1 
ATOM   4743 O OG1 . THR B 1 31  ? -1.420  25.907  57.415 1.00 57.40 ? 31   THR B OG1 1 
ATOM   4744 C CG2 . THR B 1 31  ? -0.465  28.030  56.808 1.00 56.34 ? 31   THR B CG2 1 
ATOM   4745 N N   . ASP B 1 32  ? 0.779   24.387  59.593 1.00 55.60 ? 32   ASP B N   1 
ATOM   4746 C CA  . ASP B 1 32  ? 0.539   23.367  60.608 1.00 56.01 ? 32   ASP B CA  1 
ATOM   4747 C C   . ASP B 1 32  ? 1.727   22.409  60.636 1.00 56.45 ? 32   ASP B C   1 
ATOM   4748 O O   . ASP B 1 32  ? 1.864   21.559  59.759 1.00 56.31 ? 32   ASP B O   1 
ATOM   4749 C CB  . ASP B 1 32  ? -0.742  22.598  60.268 1.00 55.37 ? 32   ASP B CB  1 
ATOM   4750 C CG  . ASP B 1 32  ? -1.014  21.458  61.227 1.00 55.57 ? 32   ASP B CG  1 
ATOM   4751 O OD1 . ASP B 1 32  ? -1.903  20.630  60.930 1.00 53.65 ? 32   ASP B OD1 1 
ATOM   4752 O OD2 . ASP B 1 32  ? -0.344  21.391  62.280 1.00 55.78 ? 32   ASP B OD2 1 
ATOM   4753 N N   . LYS B 1 33  ? 2.587   22.545  61.639 1.00 56.38 ? 33   LYS B N   1 
ATOM   4754 C CA  . LYS B 1 33  ? 3.758   21.685  61.727 1.00 55.76 ? 33   LYS B CA  1 
ATOM   4755 C C   . LYS B 1 33  ? 3.528   20.413  62.539 1.00 54.08 ? 33   LYS B C   1 
ATOM   4756 O O   . LYS B 1 33  ? 4.469   19.704  62.891 1.00 54.91 ? 33   LYS B O   1 
ATOM   4757 C CB  . LYS B 1 33  ? 4.948   22.488  62.259 1.00 57.37 ? 33   LYS B CB  1 
ATOM   4758 C CG  . LYS B 1 33  ? 5.002   23.924  61.697 1.00 58.37 ? 33   LYS B CG  1 
ATOM   4759 C CD  . LYS B 1 33  ? 4.971   23.969  60.155 1.00 58.15 ? 33   LYS B CD  1 
ATOM   4760 C CE  . LYS B 1 33  ? 6.356   24.018  59.508 1.00 60.30 ? 33   LYS B CE  1 
ATOM   4761 N NZ  . LYS B 1 33  ? 7.019   22.687  59.371 1.00 59.94 ? 33   LYS B NZ  1 
ATOM   4762 N N   . GLU B 1 34  ? 2.262   20.131  62.827 1.00 53.10 ? 34   GLU B N   1 
ATOM   4763 C CA  . GLU B 1 34  ? 1.877   18.918  63.540 1.00 50.40 ? 34   GLU B CA  1 
ATOM   4764 C C   . GLU B 1 34  ? 1.161   18.058  62.503 1.00 48.01 ? 34   GLU B C   1 
ATOM   4765 O O   . GLU B 1 34  ? 0.637   16.984  62.809 1.00 47.34 ? 34   GLU B O   1 
ATOM   4766 C CB  . GLU B 1 34  ? 0.925   19.240  64.701 1.00 52.16 ? 34   GLU B CB  1 
ATOM   4767 C CG  . GLU B 1 34  ? 1.618   19.755  65.953 1.00 53.93 ? 34   GLU B CG  1 
ATOM   4768 C CD  . GLU B 1 34  ? 2.277   18.647  66.757 1.00 55.59 ? 34   GLU B CD  1 
ATOM   4769 O OE1 . GLU B 1 34  ? 3.262   18.933  67.472 1.00 58.13 ? 34   GLU B OE1 1 
ATOM   4770 O OE2 . GLU B 1 34  ? 1.803   17.493  66.688 1.00 54.63 ? 34   GLU B OE2 1 
ATOM   4771 N N   . ARG B 1 35  ? 1.157   18.538  61.263 1.00 46.20 ? 35   ARG B N   1 
ATOM   4772 C CA  . ARG B 1 35  ? 0.487   17.825  60.186 1.00 43.65 ? 35   ARG B CA  1 
ATOM   4773 C C   . ARG B 1 35  ? 0.928   16.366  60.088 1.00 40.95 ? 35   ARG B C   1 
ATOM   4774 O O   . ARG B 1 35  ? 0.088   15.475  60.100 1.00 40.59 ? 35   ARG B O   1 
ATOM   4775 C CB  . ARG B 1 35  ? 0.697   18.531  58.840 1.00 42.21 ? 35   ARG B CB  1 
ATOM   4776 C CG  . ARG B 1 35  ? -0.218  17.973  57.750 1.00 40.22 ? 35   ARG B CG  1 
ATOM   4777 C CD  . ARG B 1 35  ? -0.199  18.775  56.462 1.00 39.79 ? 35   ARG B CD  1 
ATOM   4778 N NE  . ARG B 1 35  ? -1.055  18.141  55.461 1.00 38.07 ? 35   ARG B NE  1 
ATOM   4779 C CZ  . ARG B 1 35  ? -2.384  18.176  55.477 1.00 39.59 ? 35   ARG B CZ  1 
ATOM   4780 N NH1 . ARG B 1 35  ? -3.025  18.827  56.438 1.00 40.33 ? 35   ARG B NH1 1 
ATOM   4781 N NH2 . ARG B 1 35  ? -3.076  17.543  54.542 1.00 40.26 ? 35   ARG B NH2 1 
ATOM   4782 N N   . PHE B 1 36  ? 2.233   16.116  60.001 1.00 41.02 ? 36   PHE B N   1 
ATOM   4783 C CA  . PHE B 1 36  ? 2.707   14.734  59.910 1.00 39.94 ? 36   PHE B CA  1 
ATOM   4784 C C   . PHE B 1 36  ? 2.159   13.915  61.058 1.00 39.89 ? 36   PHE B C   1 
ATOM   4785 O O   . PHE B 1 36  ? 1.647   12.818  60.859 1.00 39.14 ? 36   PHE B O   1 
ATOM   4786 C CB  . PHE B 1 36  ? 4.233   14.647  59.951 1.00 38.44 ? 36   PHE B CB  1 
ATOM   4787 C CG  . PHE B 1 36  ? 4.754   13.230  60.031 1.00 38.07 ? 36   PHE B CG  1 
ATOM   4788 C CD1 . PHE B 1 36  ? 4.679   12.378  58.927 1.00 38.12 ? 36   PHE B CD1 1 
ATOM   4789 C CD2 . PHE B 1 36  ? 5.304   12.742  61.214 1.00 35.54 ? 36   PHE B CD2 1 
ATOM   4790 C CE1 . PHE B 1 36  ? 5.147   11.066  59.002 1.00 36.62 ? 36   PHE B CE1 1 
ATOM   4791 C CE2 . PHE B 1 36  ? 5.771   11.434  61.299 1.00 37.82 ? 36   PHE B CE2 1 
ATOM   4792 C CZ  . PHE B 1 36  ? 5.694   10.593  60.191 1.00 38.98 ? 36   PHE B CZ  1 
ATOM   4793 N N   . ASN B 1 37  ? 2.279   14.453  62.268 1.00 41.33 ? 37   ASN B N   1 
ATOM   4794 C CA  . ASN B 1 37  ? 1.799   13.762  63.456 1.00 42.05 ? 37   ASN B CA  1 
ATOM   4795 C C   . ASN B 1 37  ? 0.311   13.458  63.408 1.00 42.03 ? 37   ASN B C   1 
ATOM   4796 O O   . ASN B 1 37  ? -0.118  12.390  63.842 1.00 41.95 ? 37   ASN B O   1 
ATOM   4797 C CB  . ASN B 1 37  ? 2.096   14.582  64.713 1.00 43.33 ? 37   ASN B CB  1 
ATOM   4798 C CG  . ASN B 1 37  ? 3.532   14.457  65.167 1.00 45.29 ? 37   ASN B CG  1 
ATOM   4799 O OD1 . ASN B 1 37  ? 4.023   13.358  65.399 1.00 47.33 ? 37   ASN B OD1 1 
ATOM   4800 N ND2 . ASN B 1 37  ? 4.211   15.589  65.310 1.00 48.41 ? 37   ASN B ND2 1 
ATOM   4801 N N   . HIS B 1 38  ? -0.471  14.397  62.884 1.00 42.88 ? 38   HIS B N   1 
ATOM   4802 C CA  . HIS B 1 38  ? -1.919  14.229  62.805 1.00 44.69 ? 38   HIS B CA  1 
ATOM   4803 C C   . HIS B 1 38  ? -2.398  13.386  61.633 1.00 43.67 ? 38   HIS B C   1 
ATOM   4804 O O   . HIS B 1 38  ? -3.492  12.827  61.681 1.00 44.72 ? 38   HIS B O   1 
ATOM   4805 C CB  . HIS B 1 38  ? -2.615  15.593  62.753 1.00 47.83 ? 38   HIS B CB  1 
ATOM   4806 C CG  . HIS B 1 38  ? -2.768  16.249  64.090 1.00 51.99 ? 38   HIS B CG  1 
ATOM   4807 N ND1 . HIS B 1 38  ? -2.328  17.529  64.347 1.00 54.49 ? 38   HIS B ND1 1 
ATOM   4808 C CD2 . HIS B 1 38  ? -3.324  15.804  65.242 1.00 54.58 ? 38   HIS B CD2 1 
ATOM   4809 C CE1 . HIS B 1 38  ? -2.605  17.845  65.600 1.00 54.80 ? 38   HIS B CE1 1 
ATOM   4810 N NE2 . HIS B 1 38  ? -3.210  16.816  66.165 1.00 56.00 ? 38   HIS B NE2 1 
ATOM   4811 N N   . PHE B 1 39  ? -1.593  13.295  60.582 1.00 42.67 ? 39   PHE B N   1 
ATOM   4812 C CA  . PHE B 1 39  ? -1.998  12.516  59.417 1.00 41.70 ? 39   PHE B CA  1 
ATOM   4813 C C   . PHE B 1 39  ? -1.028  11.393  59.076 1.00 41.20 ? 39   PHE B C   1 
ATOM   4814 O O   . PHE B 1 39  ? -0.685  11.185  57.913 1.00 40.39 ? 39   PHE B O   1 
ATOM   4815 C CB  . PHE B 1 39  ? -2.180  13.432  58.202 1.00 41.54 ? 39   PHE B CB  1 
ATOM   4816 C CG  . PHE B 1 39  ? -3.174  14.550  58.423 1.00 42.68 ? 39   PHE B CG  1 
ATOM   4817 C CD1 . PHE B 1 39  ? -2.789  15.728  59.046 1.00 43.75 ? 39   PHE B CD1 1 
ATOM   4818 C CD2 . PHE B 1 39  ? -4.496  14.414  58.016 1.00 44.30 ? 39   PHE B CD2 1 
ATOM   4819 C CE1 . PHE B 1 39  ? -3.706  16.760  59.262 1.00 45.22 ? 39   PHE B CE1 1 
ATOM   4820 C CE2 . PHE B 1 39  ? -5.425  15.439  58.227 1.00 44.32 ? 39   PHE B CE2 1 
ATOM   4821 C CZ  . PHE B 1 39  ? -5.027  16.613  58.851 1.00 44.78 ? 39   PHE B CZ  1 
ATOM   4822 N N   . SER B 1 40  ? -0.578  10.673  60.096 1.00 41.37 ? 40   SER B N   1 
ATOM   4823 C CA  . SER B 1 40  ? 0.329   9.549   59.884 1.00 40.81 ? 40   SER B CA  1 
ATOM   4824 C C   . SER B 1 40  ? -0.015  8.468   60.885 1.00 41.65 ? 40   SER B C   1 
ATOM   4825 O O   . SER B 1 40  ? -0.464  8.749   61.997 1.00 42.35 ? 40   SER B O   1 
ATOM   4826 C CB  . SER B 1 40  ? 1.793   9.966   60.047 1.00 40.06 ? 40   SER B CB  1 
ATOM   4827 O OG  . SER B 1 40  ? 2.112   10.223  61.399 1.00 39.54 ? 40   SER B OG  1 
ATOM   4828 N N   . LEU B 1 41  ? 0.195   7.224   60.484 1.00 41.46 ? 41   LEU B N   1 
ATOM   4829 C CA  . LEU B 1 41  ? -0.119  6.093   61.335 1.00 41.28 ? 41   LEU B CA  1 
ATOM   4830 C C   . LEU B 1 41  ? 1.040   5.107   61.367 1.00 41.16 ? 41   LEU B C   1 
ATOM   4831 O O   . LEU B 1 41  ? 1.524   4.672   60.328 1.00 39.91 ? 41   LEU B O   1 
ATOM   4832 C CB  . LEU B 1 41  ? -1.376  5.405   60.799 1.00 42.55 ? 41   LEU B CB  1 
ATOM   4833 C CG  . LEU B 1 41  ? -1.866  4.109   61.441 1.00 43.74 ? 41   LEU B CG  1 
ATOM   4834 C CD1 . LEU B 1 41  ? -2.344  4.383   62.856 1.00 44.89 ? 41   LEU B CD1 1 
ATOM   4835 C CD2 . LEU B 1 41  ? -2.997  3.534   60.594 1.00 44.71 ? 41   LEU B CD2 1 
ATOM   4836 N N   . THR B 1 42  ? 1.488   4.755   62.563 1.00 40.50 ? 42   THR B N   1 
ATOM   4837 C CA  . THR B 1 42  ? 2.582   3.809   62.691 1.00 42.10 ? 42   THR B CA  1 
ATOM   4838 C C   . THR B 1 42  ? 2.058   2.520   63.292 1.00 42.37 ? 42   THR B C   1 
ATOM   4839 O O   . THR B 1 42  ? 1.371   2.536   64.311 1.00 43.29 ? 42   THR B O   1 
ATOM   4840 C CB  . THR B 1 42  ? 3.707   4.370   63.578 1.00 42.81 ? 42   THR B CB  1 
ATOM   4841 O OG1 . THR B 1 42  ? 4.167   5.611   63.028 1.00 43.90 ? 42   THR B OG1 1 
ATOM   4842 C CG2 . THR B 1 42  ? 4.872   3.396   63.632 1.00 43.42 ? 42   THR B CG2 1 
ATOM   4843 N N   . LEU B 1 43  ? 2.374   1.402   62.650 1.00 40.92 ? 43   LEU B N   1 
ATOM   4844 C CA  . LEU B 1 43  ? 1.926   0.106   63.130 1.00 40.53 ? 43   LEU B CA  1 
ATOM   4845 C C   . LEU B 1 43  ? 3.108   -0.770  63.527 1.00 39.69 ? 43   LEU B C   1 
ATOM   4846 O O   . LEU B 1 43  ? 4.015   -0.996  62.730 1.00 38.15 ? 43   LEU B O   1 
ATOM   4847 C CB  . LEU B 1 43  ? 1.111   -0.612  62.048 1.00 42.08 ? 43   LEU B CB  1 
ATOM   4848 C CG  . LEU B 1 43  ? -0.153  0.069   61.508 1.00 43.65 ? 43   LEU B CG  1 
ATOM   4849 C CD1 . LEU B 1 43  ? -0.754  -0.789  60.402 1.00 45.69 ? 43   LEU B CD1 1 
ATOM   4850 C CD2 . LEU B 1 43  ? -1.156  0.280   62.622 1.00 44.69 ? 43   LEU B CD2 1 
ATOM   4851 N N   . ASN B 1 44  ? 3.096   -1.244  64.770 1.00 38.24 ? 44   ASN B N   1 
ATOM   4852 C CA  . ASN B 1 44  ? 4.142   -2.128  65.270 1.00 37.58 ? 44   ASN B CA  1 
ATOM   4853 C C   . ASN B 1 44  ? 3.530   -3.521  65.336 1.00 36.75 ? 44   ASN B C   1 
ATOM   4854 O O   . ASN B 1 44  ? 2.709   -3.809  66.200 1.00 37.30 ? 44   ASN B O   1 
ATOM   4855 C CB  . ASN B 1 44  ? 4.602   -1.701  66.668 1.00 36.25 ? 44   ASN B CB  1 
ATOM   4856 C CG  . ASN B 1 44  ? 5.681   -2.609  67.232 1.00 37.40 ? 44   ASN B CG  1 
ATOM   4857 O OD1 . ASN B 1 44  ? 6.136   -2.429  68.369 1.00 40.31 ? 44   ASN B OD1 1 
ATOM   4858 N ND2 . ASN B 1 44  ? 6.098   -3.588  66.445 1.00 32.87 ? 44   ASN B ND2 1 
ATOM   4859 N N   . THR B 1 45  ? 3.935   -4.382  64.416 1.00 38.20 ? 45   THR B N   1 
ATOM   4860 C CA  . THR B 1 45  ? 3.415   -5.741  64.346 1.00 39.05 ? 45   THR B CA  1 
ATOM   4861 C C   . THR B 1 45  ? 4.225   -6.719  65.191 1.00 40.86 ? 45   THR B C   1 
ATOM   4862 O O   . THR B 1 45  ? 3.945   -7.918  65.186 1.00 42.15 ? 45   THR B O   1 
ATOM   4863 C CB  . THR B 1 45  ? 3.451   -6.259  62.901 1.00 38.08 ? 45   THR B CB  1 
ATOM   4864 O OG1 . THR B 1 45  ? 4.813   -6.524  62.528 1.00 36.06 ? 45   THR B OG1 1 
ATOM   4865 C CG2 . THR B 1 45  ? 2.861   -5.215  61.948 1.00 37.80 ? 45   THR B CG2 1 
ATOM   4866 N N   . ASN B 1 46  ? 5.223   -6.206  65.909 1.00 42.86 ? 46   ASN B N   1 
ATOM   4867 C CA  . ASN B 1 46  ? 6.105   -7.039  66.726 1.00 43.87 ? 46   ASN B CA  1 
ATOM   4868 C C   . ASN B 1 46  ? 7.007   -7.868  65.811 1.00 44.80 ? 46   ASN B C   1 
ATOM   4869 O O   . ASN B 1 46  ? 7.781   -8.713  66.273 1.00 44.05 ? 46   ASN B O   1 
ATOM   4870 C CB  . ASN B 1 46  ? 5.294   -7.960  67.653 1.00 44.89 ? 46   ASN B CB  1 
ATOM   4871 C CG  . ASN B 1 46  ? 4.660   -7.211  68.811 1.00 45.74 ? 46   ASN B CG  1 
ATOM   4872 O OD1 . ASN B 1 46  ? 3.691   -7.677  69.408 1.00 48.67 ? 46   ASN B OD1 1 
ATOM   4873 N ND2 . ASN B 1 46  ? 5.211   -6.048  69.140 1.00 43.08 ? 46   ASN B ND2 1 
ATOM   4874 N N   . HIS B 1 47  ? 6.899   -7.614  64.507 1.00 42.38 ? 47   HIS B N   1 
ATOM   4875 C CA  . HIS B 1 47  ? 7.709   -8.302  63.507 1.00 40.71 ? 47   HIS B CA  1 
ATOM   4876 C C   . HIS B 1 47  ? 8.135   -7.291  62.441 1.00 38.98 ? 47   HIS B C   1 
ATOM   4877 O O   . HIS B 1 47  ? 8.393   -7.642  61.288 1.00 37.75 ? 47   HIS B O   1 
ATOM   4878 C CB  . HIS B 1 47  ? 6.905   -9.439  62.869 1.00 43.52 ? 47   HIS B CB  1 
ATOM   4879 C CG  . HIS B 1 47  ? 6.484   -10.498 63.840 1.00 45.48 ? 47   HIS B CG  1 
ATOM   4880 N ND1 . HIS B 1 47  ? 7.358   -11.441 64.340 1.00 47.30 ? 47   HIS B ND1 1 
ATOM   4881 C CD2 . HIS B 1 47  ? 5.293   -10.733 64.440 1.00 45.89 ? 47   HIS B CD2 1 
ATOM   4882 C CE1 . HIS B 1 47  ? 6.723   -12.209 65.208 1.00 46.86 ? 47   HIS B CE1 1 
ATOM   4883 N NE2 . HIS B 1 47  ? 5.470   -11.801 65.287 1.00 47.41 ? 47   HIS B NE2 1 
ATOM   4884 N N   . GLY B 1 48  ? 8.206   -6.028  62.848 1.00 38.01 ? 48   GLY B N   1 
ATOM   4885 C CA  . GLY B 1 48  ? 8.585   -4.956  61.945 1.00 33.84 ? 48   GLY B CA  1 
ATOM   4886 C C   . GLY B 1 48  ? 7.558   -3.846  62.053 1.00 33.94 ? 48   GLY B C   1 
ATOM   4887 O O   . GLY B 1 48  ? 6.422   -4.089  62.454 1.00 35.09 ? 48   GLY B O   1 
ATOM   4888 N N   . HIS B 1 49  ? 7.944   -2.622  61.721 1.00 31.69 ? 49   HIS B N   1 
ATOM   4889 C CA  . HIS B 1 49  ? 7.003   -1.514  61.793 1.00 32.92 ? 49   HIS B CA  1 
ATOM   4890 C C   . HIS B 1 49  ? 6.550   -1.100  60.403 1.00 32.55 ? 49   HIS B C   1 
ATOM   4891 O O   . HIS B 1 49  ? 7.285   -1.247  59.424 1.00 33.09 ? 49   HIS B O   1 
ATOM   4892 C CB  . HIS B 1 49  ? 7.636   -0.307  62.493 1.00 32.72 ? 49   HIS B CB  1 
ATOM   4893 C CG  . HIS B 1 49  ? 7.891   -0.522  63.951 1.00 34.03 ? 49   HIS B CG  1 
ATOM   4894 N ND1 . HIS B 1 49  ? 7.328   0.269   64.931 1.00 36.55 ? 49   HIS B ND1 1 
ATOM   4895 C CD2 . HIS B 1 49  ? 8.644   -1.442  64.596 1.00 32.30 ? 49   HIS B CD2 1 
ATOM   4896 C CE1 . HIS B 1 49  ? 7.725   -0.157  66.118 1.00 32.49 ? 49   HIS B CE1 1 
ATOM   4897 N NE2 . HIS B 1 49  ? 8.525   -1.193  65.942 1.00 33.26 ? 49   HIS B NE2 1 
ATOM   4898 N N   . ILE B 1 50  ? 5.328   -0.593  60.322 1.00 32.04 ? 50   ILE B N   1 
ATOM   4899 C CA  . ILE B 1 50  ? 4.794   -0.117  59.056 1.00 33.11 ? 50   ILE B CA  1 
ATOM   4900 C C   . ILE B 1 50  ? 4.298   1.299   59.300 1.00 33.59 ? 50   ILE B C   1 
ATOM   4901 O O   . ILE B 1 50  ? 3.396   1.511   60.111 1.00 36.28 ? 50   ILE B O   1 
ATOM   4902 C CB  . ILE B 1 50  ? 3.593   -0.954  58.572 1.00 32.44 ? 50   ILE B CB  1 
ATOM   4903 C CG1 . ILE B 1 50  ? 4.021   -2.401  58.291 1.00 33.11 ? 50   ILE B CG1 1 
ATOM   4904 C CG2 . ILE B 1 50  ? 2.991   -0.302  57.336 1.00 34.54 ? 50   ILE B CG2 1 
ATOM   4905 C CD1 . ILE B 1 50  ? 2.892   -3.291  57.823 1.00 33.29 ? 50   ILE B CD1 1 
ATOM   4906 N N   . LEU B 1 51  ? 4.902   2.267   58.623 1.00 34.23 ? 51   LEU B N   1 
ATOM   4907 C CA  . LEU B 1 51  ? 4.475   3.652   58.745 1.00 34.10 ? 51   LEU B CA  1 
ATOM   4908 C C   . LEU B 1 51  ? 3.626   4.026   57.532 1.00 35.54 ? 51   LEU B C   1 
ATOM   4909 O O   . LEU B 1 51  ? 4.061   3.877   56.391 1.00 36.93 ? 51   LEU B O   1 
ATOM   4910 C CB  . LEU B 1 51  ? 5.689   4.585   58.827 1.00 33.10 ? 51   LEU B CB  1 
ATOM   4911 C CG  . LEU B 1 51  ? 5.468   6.093   58.633 1.00 33.74 ? 51   LEU B CG  1 
ATOM   4912 C CD1 . LEU B 1 51  ? 4.483   6.627   59.669 1.00 34.27 ? 51   LEU B CD1 1 
ATOM   4913 C CD2 . LEU B 1 51  ? 6.804   6.819   58.752 1.00 33.04 ? 51   LEU B CD2 1 
ATOM   4914 N N   . LEU B 1 52  ? 2.404   4.479   57.784 1.00 35.56 ? 52   LEU B N   1 
ATOM   4915 C CA  . LEU B 1 52  ? 1.515   4.924   56.720 1.00 34.87 ? 52   LEU B CA  1 
ATOM   4916 C C   . LEU B 1 52  ? 1.434   6.428   56.913 1.00 33.87 ? 52   LEU B C   1 
ATOM   4917 O O   . LEU B 1 52  ? 0.780   6.907   57.834 1.00 34.50 ? 52   LEU B O   1 
ATOM   4918 C CB  . LEU B 1 52  ? 0.116   4.300   56.849 1.00 35.41 ? 52   LEU B CB  1 
ATOM   4919 C CG  . LEU B 1 52  ? -1.009  4.974   56.044 1.00 38.51 ? 52   LEU B CG  1 
ATOM   4920 C CD1 . LEU B 1 52  ? -0.633  5.080   54.574 1.00 35.87 ? 52   LEU B CD1 1 
ATOM   4921 C CD2 . LEU B 1 52  ? -2.307  4.188   56.197 1.00 38.76 ? 52   LEU B CD2 1 
ATOM   4922 N N   . ASP B 1 53  ? 2.137   7.162   56.060 1.00 34.60 ? 53   ASP B N   1 
ATOM   4923 C CA  . ASP B 1 53  ? 2.150   8.619   56.125 1.00 35.98 ? 53   ASP B CA  1 
ATOM   4924 C C   . ASP B 1 53  ? 1.226   9.163   55.038 1.00 35.04 ? 53   ASP B C   1 
ATOM   4925 O O   . ASP B 1 53  ? 1.573   9.144   53.856 1.00 35.78 ? 53   ASP B O   1 
ATOM   4926 C CB  . ASP B 1 53  ? 3.576   9.126   55.914 1.00 34.55 ? 53   ASP B CB  1 
ATOM   4927 C CG  . ASP B 1 53  ? 3.656   10.637  55.832 1.00 36.18 ? 53   ASP B CG  1 
ATOM   4928 O OD1 . ASP B 1 53  ? 2.612   11.303  55.984 1.00 36.57 ? 53   ASP B OD1 1 
ATOM   4929 O OD2 . ASP B 1 53  ? 4.768   11.158  55.609 1.00 38.00 ? 53   ASP B OD2 1 
ATOM   4930 N N   . TYR B 1 54  ? 0.046   9.634   55.435 1.00 33.51 ? 54   TYR B N   1 
ATOM   4931 C CA  . TYR B 1 54  ? -0.910  10.158  54.463 1.00 33.50 ? 54   TYR B CA  1 
ATOM   4932 C C   . TYR B 1 54  ? -1.096  11.673  54.567 1.00 33.27 ? 54   TYR B C   1 
ATOM   4933 O O   . TYR B 1 54  ? -2.099  12.224  54.114 1.00 31.96 ? 54   TYR B O   1 
ATOM   4934 C CB  . TYR B 1 54  ? -2.257  9.422   54.598 1.00 32.34 ? 54   TYR B CB  1 
ATOM   4935 C CG  . TYR B 1 54  ? -2.961  9.540   55.942 1.00 34.82 ? 54   TYR B CG  1 
ATOM   4936 C CD1 . TYR B 1 54  ? -3.933  10.519  56.157 1.00 35.57 ? 54   TYR B CD1 1 
ATOM   4937 C CD2 . TYR B 1 54  ? -2.667  8.664   56.990 1.00 32.34 ? 54   TYR B CD2 1 
ATOM   4938 C CE1 . TYR B 1 54  ? -4.597  10.626  57.382 1.00 38.08 ? 54   TYR B CE1 1 
ATOM   4939 C CE2 . TYR B 1 54  ? -3.327  8.759   58.224 1.00 36.49 ? 54   TYR B CE2 1 
ATOM   4940 C CZ  . TYR B 1 54  ? -4.289  9.746   58.411 1.00 37.32 ? 54   TYR B CZ  1 
ATOM   4941 O OH  . TYR B 1 54  ? -4.925  9.874   59.625 1.00 38.10 ? 54   TYR B OH  1 
ATOM   4942 N N   . SER B 1 55  ? -0.094  12.340  55.133 1.00 34.76 ? 55   SER B N   1 
ATOM   4943 C CA  . SER B 1 55  ? -0.126  13.787  55.322 1.00 34.18 ? 55   SER B CA  1 
ATOM   4944 C C   . SER B 1 55  ? -0.015  14.571  54.017 1.00 34.96 ? 55   SER B C   1 
ATOM   4945 O O   . SER B 1 55  ? -0.463  15.720  53.934 1.00 34.67 ? 55   SER B O   1 
ATOM   4946 C CB  . SER B 1 55  ? 0.996   14.205  56.277 1.00 33.90 ? 55   SER B CB  1 
ATOM   4947 O OG  . SER B 1 55  ? 2.268   13.882  55.739 1.00 33.38 ? 55   SER B OG  1 
ATOM   4948 N N   . LYS B 1 56  ? 0.588   13.967  52.998 1.00 33.61 ? 56   LYS B N   1 
ATOM   4949 C CA  . LYS B 1 56  ? 0.719   14.654  51.716 1.00 33.85 ? 56   LYS B CA  1 
ATOM   4950 C C   . LYS B 1 56  ? -0.537  14.469  50.865 1.00 32.54 ? 56   LYS B C   1 
ATOM   4951 O O   . LYS B 1 56  ? -0.452  14.319  49.651 1.00 32.62 ? 56   LYS B O   1 
ATOM   4952 C CB  . LYS B 1 56  ? 1.944   14.151  50.939 1.00 34.79 ? 56   LYS B CB  1 
ATOM   4953 C CG  . LYS B 1 56  ? 3.279   14.366  51.641 1.00 34.69 ? 56   LYS B CG  1 
ATOM   4954 C CD  . LYS B 1 56  ? 4.424   14.398  50.636 1.00 35.42 ? 56   LYS B CD  1 
ATOM   4955 C CE  . LYS B 1 56  ? 5.789   14.493  51.311 1.00 32.86 ? 56   LYS B CE  1 
ATOM   4956 N NZ  . LYS B 1 56  ? 6.242   13.165  51.826 1.00 35.75 ? 56   LYS B NZ  1 
ATOM   4957 N N   . ASN B 1 57  ? -1.698  14.462  51.513 1.00 34.58 ? 57   ASN B N   1 
ATOM   4958 C CA  . ASN B 1 57  ? -2.972  14.324  50.813 1.00 33.68 ? 57   ASN B CA  1 
ATOM   4959 C C   . ASN B 1 57  ? -3.764  15.618  50.930 1.00 35.56 ? 57   ASN B C   1 
ATOM   4960 O O   . ASN B 1 57  ? -3.601  16.367  51.901 1.00 36.18 ? 57   ASN B O   1 
ATOM   4961 C CB  . ASN B 1 57  ? -3.786  13.167  51.387 1.00 32.20 ? 57   ASN B CB  1 
ATOM   4962 C CG  . ASN B 1 57  ? -3.360  11.833  50.822 1.00 34.17 ? 57   ASN B CG  1 
ATOM   4963 O OD1 . ASN B 1 57  ? -3.491  11.591  49.620 1.00 34.03 ? 57   ASN B OD1 1 
ATOM   4964 N ND2 . ASN B 1 57  ? -2.835  10.965  51.678 1.00 31.40 ? 57   ASN B ND2 1 
ATOM   4965 N N   . LEU B 1 58  ? -4.612  15.882  49.940 1.00 34.30 ? 58   LEU B N   1 
ATOM   4966 C CA  . LEU B 1 58  ? -5.412  17.103  49.937 1.00 35.61 ? 58   LEU B CA  1 
ATOM   4967 C C   . LEU B 1 58  ? -6.555  16.987  50.925 1.00 37.26 ? 58   LEU B C   1 
ATOM   4968 O O   . LEU B 1 58  ? -7.722  16.924  50.537 1.00 37.46 ? 58   LEU B O   1 
ATOM   4969 C CB  . LEU B 1 58  ? -5.949  17.378  48.532 1.00 37.02 ? 58   LEU B CB  1 
ATOM   4970 C CG  . LEU B 1 58  ? -4.871  17.721  47.501 1.00 37.11 ? 58   LEU B CG  1 
ATOM   4971 C CD1 . LEU B 1 58  ? -5.477  17.790  46.098 1.00 37.91 ? 58   LEU B CD1 1 
ATOM   4972 C CD2 . LEU B 1 58  ? -4.237  19.048  47.875 1.00 37.46 ? 58   LEU B CD2 1 
ATOM   4973 N N   . VAL B 1 59  ? -6.207  16.964  52.210 1.00 38.26 ? 59   VAL B N   1 
ATOM   4974 C CA  . VAL B 1 59  ? -7.195  16.846  53.271 1.00 39.84 ? 59   VAL B CA  1 
ATOM   4975 C C   . VAL B 1 59  ? -6.826  17.673  54.505 1.00 41.33 ? 59   VAL B C   1 
ATOM   4976 O O   . VAL B 1 59  ? -5.672  18.062  54.698 1.00 40.59 ? 59   VAL B O   1 
ATOM   4977 C CB  . VAL B 1 59  ? -7.357  15.378  53.740 1.00 38.96 ? 59   VAL B CB  1 
ATOM   4978 C CG1 . VAL B 1 59  ? -7.711  14.477  52.562 1.00 40.80 ? 59   VAL B CG1 1 
ATOM   4979 C CG2 . VAL B 1 59  ? -6.080  14.910  54.404 1.00 40.31 ? 59   VAL B CG2 1 
ATOM   4980 N N   . THR B 1 60  ? -7.833  17.922  55.335 1.00 41.71 ? 60   THR B N   1 
ATOM   4981 C CA  . THR B 1 60  ? -7.676  18.657  56.581 1.00 42.75 ? 60   THR B CA  1 
ATOM   4982 C C   . THR B 1 60  ? -8.418  17.815  57.609 1.00 43.23 ? 60   THR B C   1 
ATOM   4983 O O   . THR B 1 60  ? -9.092  16.848  57.249 1.00 41.69 ? 60   THR B O   1 
ATOM   4984 C CB  . THR B 1 60  ? -8.348  20.038  56.515 1.00 42.35 ? 60   THR B CB  1 
ATOM   4985 O OG1 . THR B 1 60  ? -9.756  19.868  56.305 1.00 43.29 ? 60   THR B OG1 1 
ATOM   4986 C CG2 . THR B 1 60  ? -7.767  20.866  55.375 1.00 43.41 ? 60   THR B CG2 1 
ATOM   4987 N N   . GLU B 1 61  ? -8.305  18.173  58.882 1.00 43.91 ? 61   GLU B N   1 
ATOM   4988 C CA  . GLU B 1 61  ? -8.994  17.418  59.921 1.00 45.81 ? 61   GLU B CA  1 
ATOM   4989 C C   . GLU B 1 61  ? -10.500 17.356  59.640 1.00 44.59 ? 61   GLU B C   1 
ATOM   4990 O O   . GLU B 1 61  ? -11.140 16.324  59.856 1.00 40.75 ? 61   GLU B O   1 
ATOM   4991 C CB  . GLU B 1 61  ? -8.736  18.047  61.298 1.00 50.11 ? 61   GLU B CB  1 
ATOM   4992 C CG  . GLU B 1 61  ? -7.258  18.082  61.713 1.00 55.05 ? 61   GLU B CG  1 
ATOM   4993 C CD  . GLU B 1 61  ? -6.520  19.327  61.228 1.00 57.27 ? 61   GLU B CD  1 
ATOM   4994 O OE1 . GLU B 1 61  ? -6.472  19.572  60.002 1.00 59.12 ? 61   GLU B OE1 1 
ATOM   4995 O OE2 . GLU B 1 61  ? -5.981  20.065  62.081 1.00 59.07 ? 61   GLU B OE2 1 
ATOM   4996 N N   . GLU B 1 62  ? -11.057 18.461  59.145 1.00 44.77 ? 62   GLU B N   1 
ATOM   4997 C CA  . GLU B 1 62  ? -12.484 18.535  58.831 1.00 45.50 ? 62   GLU B CA  1 
ATOM   4998 C C   . GLU B 1 62  ? -12.840 17.510  57.755 1.00 44.07 ? 62   GLU B C   1 
ATOM   4999 O O   . GLU B 1 62  ? -13.870 16.837  57.832 1.00 44.56 ? 62   GLU B O   1 
ATOM   5000 C CB  . GLU B 1 62  ? -12.852 19.928  58.313 1.00 49.27 ? 62   GLU B CB  1 
ATOM   5001 C CG  . GLU B 1 62  ? -12.008 21.063  58.859 1.00 55.14 ? 62   GLU B CG  1 
ATOM   5002 C CD  . GLU B 1 62  ? -11.426 21.922  57.746 1.00 58.83 ? 62   GLU B CD  1 
ATOM   5003 O OE1 . GLU B 1 62  ? -10.187 21.995  57.626 1.00 63.03 ? 62   GLU B OE1 1 
ATOM   5004 O OE2 . GLU B 1 62  ? -12.211 22.523  56.985 1.00 62.34 ? 62   GLU B OE2 1 
ATOM   5005 N N   . VAL B 1 63  ? -11.984 17.405  56.745 1.00 41.70 ? 63   VAL B N   1 
ATOM   5006 C CA  . VAL B 1 63  ? -12.205 16.463  55.655 1.00 40.91 ? 63   VAL B CA  1 
ATOM   5007 C C   . VAL B 1 63  ? -12.129 15.013  56.130 1.00 40.17 ? 63   VAL B C   1 
ATOM   5008 O O   . VAL B 1 63  ? -12.955 14.188  55.742 1.00 39.61 ? 63   VAL B O   1 
ATOM   5009 C CB  . VAL B 1 63  ? -11.170 16.659  54.518 1.00 40.31 ? 63   VAL B CB  1 
ATOM   5010 C CG1 . VAL B 1 63  ? -11.443 15.663  53.392 1.00 40.15 ? 63   VAL B CG1 1 
ATOM   5011 C CG2 . VAL B 1 63  ? -11.233 18.090  53.991 1.00 40.51 ? 63   VAL B CG2 1 
ATOM   5012 N N   . MET B 1 64  ? -11.142 14.696  56.964 1.00 39.76 ? 64   MET B N   1 
ATOM   5013 C CA  . MET B 1 64  ? -11.005 13.323  57.452 1.00 40.07 ? 64   MET B CA  1 
ATOM   5014 C C   . MET B 1 64  ? -12.202 12.900  58.303 1.00 41.09 ? 64   MET B C   1 
ATOM   5015 O O   . MET B 1 64  ? -12.703 11.777  58.180 1.00 38.27 ? 64   MET B O   1 
ATOM   5016 C CB  . MET B 1 64  ? -9.711  13.155  58.263 1.00 39.30 ? 64   MET B CB  1 
ATOM   5017 C CG  . MET B 1 64  ? -8.428  13.308  57.456 1.00 38.24 ? 64   MET B CG  1 
ATOM   5018 S SD  . MET B 1 64  ? -8.390  12.302  55.945 1.00 36.36 ? 64   MET B SD  1 
ATOM   5019 C CE  . MET B 1 64  ? -8.094  10.651  56.616 1.00 36.65 ? 64   MET B CE  1 
ATOM   5020 N N   . HIS B 1 65  ? -12.667 13.798  59.167 1.00 42.00 ? 65   HIS B N   1 
ATOM   5021 C CA  . HIS B 1 65  ? -13.811 13.476  60.010 1.00 43.08 ? 65   HIS B CA  1 
ATOM   5022 C C   . HIS B 1 65  ? -15.044 13.187  59.150 1.00 41.32 ? 65   HIS B C   1 
ATOM   5023 O O   . HIS B 1 65  ? -15.792 12.250  59.429 1.00 39.85 ? 65   HIS B O   1 
ATOM   5024 C CB  . HIS B 1 65  ? -14.118 14.620  60.979 1.00 47.01 ? 65   HIS B CB  1 
ATOM   5025 C CG  . HIS B 1 65  ? -15.268 14.333  61.893 1.00 52.30 ? 65   HIS B CG  1 
ATOM   5026 N ND1 . HIS B 1 65  ? -15.249 13.307  62.814 1.00 54.06 ? 65   HIS B ND1 1 
ATOM   5027 C CD2 . HIS B 1 65  ? -16.484 14.918  62.008 1.00 54.45 ? 65   HIS B CD2 1 
ATOM   5028 C CE1 . HIS B 1 65  ? -16.402 13.273  63.457 1.00 55.20 ? 65   HIS B CE1 1 
ATOM   5029 N NE2 . HIS B 1 65  ? -17.170 14.240  62.987 1.00 55.87 ? 65   HIS B NE2 1 
ATOM   5030 N N   . MET B 1 66  ? -15.255 13.985  58.105 1.00 40.94 ? 66   MET B N   1 
ATOM   5031 C CA  . MET B 1 66  ? -16.404 13.771  57.232 1.00 39.71 ? 66   MET B CA  1 
ATOM   5032 C C   . MET B 1 66  ? -16.283 12.435  56.495 1.00 39.14 ? 66   MET B C   1 
ATOM   5033 O O   . MET B 1 66  ? -17.280 11.739  56.296 1.00 38.13 ? 66   MET B O   1 
ATOM   5034 C CB  . MET B 1 66  ? -16.545 14.909  56.217 1.00 40.78 ? 66   MET B CB  1 
ATOM   5035 C CG  . MET B 1 66  ? -17.018 16.239  56.811 1.00 41.81 ? 66   MET B CG  1 
ATOM   5036 S SD  . MET B 1 66  ? -17.407 17.449  55.517 1.00 42.13 ? 66   MET B SD  1 
ATOM   5037 C CE  . MET B 1 66  ? -15.777 17.942  55.018 1.00 40.87 ? 66   MET B CE  1 
ATOM   5038 N N   . LEU B 1 67  ? -15.063 12.080  56.093 1.00 37.75 ? 67   LEU B N   1 
ATOM   5039 C CA  . LEU B 1 67  ? -14.825 10.823  55.385 1.00 35.65 ? 67   LEU B CA  1 
ATOM   5040 C C   . LEU B 1 67  ? -15.071 9.609   56.276 1.00 36.03 ? 67   LEU B C   1 
ATOM   5041 O O   . LEU B 1 67  ? -15.636 8.609   55.832 1.00 35.46 ? 67   LEU B O   1 
ATOM   5042 C CB  . LEU B 1 67  ? -13.392 10.775  54.838 1.00 34.20 ? 67   LEU B CB  1 
ATOM   5043 C CG  . LEU B 1 67  ? -13.063 11.641  53.618 1.00 32.94 ? 67   LEU B CG  1 
ATOM   5044 C CD1 . LEU B 1 67  ? -11.566 11.648  53.390 1.00 34.64 ? 67   LEU B CD1 1 
ATOM   5045 C CD2 . LEU B 1 67  ? -13.784 11.110  52.385 1.00 36.15 ? 67   LEU B CD2 1 
ATOM   5046 N N   . LEU B 1 68  ? -14.643 9.689   57.533 1.00 37.69 ? 68   LEU B N   1 
ATOM   5047 C CA  . LEU B 1 68  ? -14.843 8.581   58.462 1.00 37.00 ? 68   LEU B CA  1 
ATOM   5048 C C   . LEU B 1 68  ? -16.312 8.480   58.859 1.00 37.70 ? 68   LEU B C   1 
ATOM   5049 O O   . LEU B 1 68  ? -16.810 7.391   59.137 1.00 34.60 ? 68   LEU B O   1 
ATOM   5050 C CB  . LEU B 1 68  ? -13.958 8.749   59.704 1.00 39.43 ? 68   LEU B CB  1 
ATOM   5051 C CG  . LEU B 1 68  ? -12.465 8.550   59.421 1.00 40.46 ? 68   LEU B CG  1 
ATOM   5052 C CD1 . LEU B 1 68  ? -11.639 8.945   60.635 1.00 44.42 ? 68   LEU B CD1 1 
ATOM   5053 C CD2 . LEU B 1 68  ? -12.209 7.094   59.049 1.00 42.12 ? 68   LEU B CD2 1 
ATOM   5054 N N   . ASP B 1 69  ? -17.010 9.614   58.883 1.00 36.62 ? 69   ASP B N   1 
ATOM   5055 C CA  . ASP B 1 69  ? -18.428 9.591   59.216 1.00 39.06 ? 69   ASP B CA  1 
ATOM   5056 C C   . ASP B 1 69  ? -19.148 8.859   58.089 1.00 38.61 ? 69   ASP B C   1 
ATOM   5057 O O   . ASP B 1 69  ? -20.135 8.156   58.319 1.00 39.93 ? 69   ASP B O   1 
ATOM   5058 C CB  . ASP B 1 69  ? -18.991 11.011  59.361 1.00 41.20 ? 69   ASP B CB  1 
ATOM   5059 C CG  . ASP B 1 69  ? -18.563 11.680  60.657 1.00 45.88 ? 69   ASP B CG  1 
ATOM   5060 O OD1 . ASP B 1 69  ? -18.397 10.962  61.671 1.00 44.44 ? 69   ASP B OD1 1 
ATOM   5061 O OD2 . ASP B 1 69  ? -18.410 12.924  60.668 1.00 48.09 ? 69   ASP B OD2 1 
ATOM   5062 N N   . LEU B 1 70  ? -18.638 9.013   56.870 1.00 37.59 ? 70   LEU B N   1 
ATOM   5063 C CA  . LEU B 1 70  ? -19.234 8.348   55.714 1.00 37.79 ? 70   LEU B CA  1 
ATOM   5064 C C   . LEU B 1 70  ? -19.021 6.843   55.803 1.00 37.10 ? 70   LEU B C   1 
ATOM   5065 O O   . LEU B 1 70  ? -19.926 6.059   55.514 1.00 35.01 ? 70   LEU B O   1 
ATOM   5066 C CB  . LEU B 1 70  ? -18.622 8.870   54.415 1.00 37.25 ? 70   LEU B CB  1 
ATOM   5067 C CG  . LEU B 1 70  ? -19.077 8.152   53.139 1.00 36.48 ? 70   LEU B CG  1 
ATOM   5068 C CD1 . LEU B 1 70  ? -20.592 8.255   52.999 1.00 35.28 ? 70   LEU B CD1 1 
ATOM   5069 C CD2 . LEU B 1 70  ? -18.382 8.766   51.928 1.00 37.18 ? 70   LEU B CD2 1 
ATOM   5070 N N   . ALA B 1 71  ? -17.818 6.442   56.200 1.00 37.32 ? 71   ALA B N   1 
ATOM   5071 C CA  . ALA B 1 71  ? -17.504 5.022   56.329 1.00 37.62 ? 71   ALA B CA  1 
ATOM   5072 C C   . ALA B 1 71  ? -18.463 4.411   57.336 1.00 38.16 ? 71   ALA B C   1 
ATOM   5073 O O   . ALA B 1 71  ? -18.953 3.295   57.154 1.00 37.20 ? 71   ALA B O   1 
ATOM   5074 C CB  . ALA B 1 71  ? -16.073 4.840   56.798 1.00 35.95 ? 71   ALA B CB  1 
ATOM   5075 N N   . LYS B 1 72  ? -18.732 5.160   58.398 1.00 39.52 ? 72   LYS B N   1 
ATOM   5076 C CA  . LYS B 1 72  ? -19.630 4.698   59.444 1.00 40.23 ? 72   LYS B CA  1 
ATOM   5077 C C   . LYS B 1 72  ? -21.068 4.588   58.951 1.00 40.06 ? 72   LYS B C   1 
ATOM   5078 O O   . LYS B 1 72  ? -21.673 3.524   59.048 1.00 39.20 ? 72   LYS B O   1 
ATOM   5079 C CB  . LYS B 1 72  ? -19.577 5.645   60.647 1.00 42.83 ? 72   LYS B CB  1 
ATOM   5080 C CG  . LYS B 1 72  ? -20.093 5.025   61.936 1.00 47.64 ? 72   LYS B CG  1 
ATOM   5081 C CD  . LYS B 1 72  ? -20.298 6.052   63.052 1.00 50.85 ? 72   LYS B CD  1 
ATOM   5082 C CE  . LYS B 1 72  ? -19.075 6.929   63.286 1.00 52.11 ? 72   LYS B CE  1 
ATOM   5083 N NZ  . LYS B 1 72  ? -18.918 7.982   62.240 1.00 55.87 ? 72   LYS B NZ  1 
ATOM   5084 N N   . SER B 1 73  ? -21.615 5.678   58.416 1.00 39.79 ? 73   SER B N   1 
ATOM   5085 C CA  . SER B 1 73  ? -22.995 5.660   57.944 1.00 40.04 ? 73   SER B CA  1 
ATOM   5086 C C   . SER B 1 73  ? -23.232 4.684   56.788 1.00 40.05 ? 73   SER B C   1 
ATOM   5087 O O   . SER B 1 73  ? -24.371 4.283   56.535 1.00 39.31 ? 73   SER B O   1 
ATOM   5088 C CB  . SER B 1 73  ? -23.456 7.072   57.549 1.00 41.75 ? 73   SER B CB  1 
ATOM   5089 O OG  . SER B 1 73  ? -22.737 7.582   56.441 1.00 44.90 ? 73   SER B OG  1 
ATOM   5090 N N   . ARG B 1 74  ? -22.168 4.301   56.087 1.00 39.08 ? 74   ARG B N   1 
ATOM   5091 C CA  . ARG B 1 74  ? -22.307 3.347   54.988 1.00 39.54 ? 74   ARG B CA  1 
ATOM   5092 C C   . ARG B 1 74  ? -22.182 1.909   55.513 1.00 39.55 ? 74   ARG B C   1 
ATOM   5093 O O   . ARG B 1 74  ? -22.180 0.947   54.743 1.00 40.23 ? 74   ARG B O   1 
ATOM   5094 C CB  . ARG B 1 74  ? -21.266 3.625   53.893 1.00 39.24 ? 74   ARG B CB  1 
ATOM   5095 C CG  . ARG B 1 74  ? -21.563 4.876   53.044 1.00 39.89 ? 74   ARG B CG  1 
ATOM   5096 C CD  . ARG B 1 74  ? -22.842 4.705   52.213 1.00 41.25 ? 74   ARG B CD  1 
ATOM   5097 N NE  . ARG B 1 74  ? -22.786 3.481   51.422 1.00 41.23 ? 74   ARG B NE  1 
ATOM   5098 C CZ  . ARG B 1 74  ? -23.633 2.462   51.545 1.00 44.17 ? 74   ARG B CZ  1 
ATOM   5099 N NH1 . ARG B 1 74  ? -24.628 2.513   52.423 1.00 44.64 ? 74   ARG B NH1 1 
ATOM   5100 N NH2 . ARG B 1 74  ? -23.462 1.368   50.816 1.00 45.12 ? 74   ARG B NH2 1 
ATOM   5101 N N   . GLY B 1 75  ? -22.074 1.776   56.834 1.00 40.06 ? 75   GLY B N   1 
ATOM   5102 C CA  . GLY B 1 75  ? -22.000 0.462   57.463 1.00 38.58 ? 75   GLY B CA  1 
ATOM   5103 C C   . GLY B 1 75  ? -20.775 -0.414  57.260 1.00 37.94 ? 75   GLY B C   1 
ATOM   5104 O O   . GLY B 1 75  ? -20.887 -1.646  57.248 1.00 36.68 ? 75   GLY B O   1 
ATOM   5105 N N   . VAL B 1 76  ? -19.604 0.197   57.120 1.00 37.29 ? 76   VAL B N   1 
ATOM   5106 C CA  . VAL B 1 76  ? -18.384 -0.576  56.924 1.00 36.92 ? 76   VAL B CA  1 
ATOM   5107 C C   . VAL B 1 76  ? -18.154 -1.624  58.019 1.00 36.39 ? 76   VAL B C   1 
ATOM   5108 O O   . VAL B 1 76  ? -17.886 -2.788  57.722 1.00 35.00 ? 76   VAL B O   1 
ATOM   5109 C CB  . VAL B 1 76  ? -17.147 0.345   56.845 1.00 37.20 ? 76   VAL B CB  1 
ATOM   5110 C CG1 . VAL B 1 76  ? -15.874 -0.498  56.774 1.00 36.87 ? 76   VAL B CG1 1 
ATOM   5111 C CG2 . VAL B 1 76  ? -17.249 1.248   55.615 1.00 38.60 ? 76   VAL B CG2 1 
ATOM   5112 N N   . GLU B 1 77  ? -18.274 -1.224  59.280 1.00 36.66 ? 77   GLU B N   1 
ATOM   5113 C CA  . GLU B 1 77  ? -18.049 -2.158  60.386 1.00 38.98 ? 77   GLU B CA  1 
ATOM   5114 C C   . GLU B 1 77  ? -18.974 -3.381  60.353 1.00 38.19 ? 77   GLU B C   1 
ATOM   5115 O O   . GLU B 1 77  ? -18.514 -4.524  60.452 1.00 36.58 ? 77   GLU B O   1 
ATOM   5116 C CB  . GLU B 1 77  ? -18.164 -1.408  61.718 1.00 40.93 ? 77   GLU B CB  1 
ATOM   5117 C CG  . GLU B 1 77  ? -17.283 -0.163  61.736 1.00 47.32 ? 77   GLU B CG  1 
ATOM   5118 C CD  . GLU B 1 77  ? -17.348 0.616   63.029 1.00 51.10 ? 77   GLU B CD  1 
ATOM   5119 O OE1 . GLU B 1 77  ? -16.729 0.178   64.023 1.00 55.16 ? 77   GLU B OE1 1 
ATOM   5120 O OE2 . GLU B 1 77  ? -18.021 1.669   63.049 1.00 53.36 ? 77   GLU B OE2 1 
ATOM   5121 N N   . ALA B 1 78  ? -20.273 -3.150  60.203 1.00 37.32 ? 78   ALA B N   1 
ATOM   5122 C CA  . ALA B 1 78  ? -21.229 -4.250  60.143 1.00 36.70 ? 78   ALA B CA  1 
ATOM   5123 C C   . ALA B 1 78  ? -20.900 -5.189  58.982 1.00 37.25 ? 78   ALA B C   1 
ATOM   5124 O O   . ALA B 1 78  ? -20.975 -6.416  59.118 1.00 37.99 ? 78   ALA B O   1 
ATOM   5125 C CB  . ALA B 1 78  ? -22.652 -3.700  59.986 1.00 39.38 ? 78   ALA B CB  1 
ATOM   5126 N N   . ALA B 1 79  ? -20.548 -4.612  57.836 1.00 35.47 ? 79   ALA B N   1 
ATOM   5127 C CA  . ALA B 1 79  ? -20.202 -5.408  56.665 1.00 34.43 ? 79   ALA B CA  1 
ATOM   5128 C C   . ALA B 1 79  ? -18.932 -6.199  56.958 1.00 33.72 ? 79   ALA B C   1 
ATOM   5129 O O   . ALA B 1 79  ? -18.796 -7.357  56.555 1.00 32.39 ? 79   ALA B O   1 
ATOM   5130 C CB  . ALA B 1 79  ? -19.994 -4.500  55.452 1.00 34.73 ? 79   ALA B CB  1 
ATOM   5131 N N   . ARG B 1 80  ? -17.996 -5.568  57.660 1.00 34.87 ? 80   ARG B N   1 
ATOM   5132 C CA  . ARG B 1 80  ? -16.751 -6.239  58.012 1.00 34.45 ? 80   ARG B CA  1 
ATOM   5133 C C   . ARG B 1 80  ? -17.050 -7.489  58.836 1.00 35.53 ? 80   ARG B C   1 
ATOM   5134 O O   . ARG B 1 80  ? -16.512 -8.562  58.569 1.00 33.46 ? 80   ARG B O   1 
ATOM   5135 C CB  . ARG B 1 80  ? -15.854 -5.312  58.826 1.00 34.95 ? 80   ARG B CB  1 
ATOM   5136 C CG  . ARG B 1 80  ? -14.539 -5.948  59.257 1.00 35.31 ? 80   ARG B CG  1 
ATOM   5137 C CD  . ARG B 1 80  ? -13.813 -5.053  60.255 1.00 37.65 ? 80   ARG B CD  1 
ATOM   5138 N NE  . ARG B 1 80  ? -14.634 -4.847  61.443 1.00 37.05 ? 80   ARG B NE  1 
ATOM   5139 C CZ  . ARG B 1 80  ? -14.588 -3.766  62.214 1.00 37.77 ? 80   ARG B CZ  1 
ATOM   5140 N NH1 . ARG B 1 80  ? -13.755 -2.778  61.934 1.00 39.72 ? 80   ARG B NH1 1 
ATOM   5141 N NH2 . ARG B 1 80  ? -15.394 -3.668  63.260 1.00 38.00 ? 80   ARG B NH2 1 
ATOM   5142 N N   . GLU B 1 81  ? -17.911 -7.345  59.841 1.00 35.61 ? 81   GLU B N   1 
ATOM   5143 C CA  . GLU B 1 81  ? -18.251 -8.478  60.695 1.00 38.39 ? 81   GLU B CA  1 
ATOM   5144 C C   . GLU B 1 81  ? -18.948 -9.583  59.923 1.00 36.81 ? 81   GLU B C   1 
ATOM   5145 O O   . GLU B 1 81  ? -18.684 -10.761 60.153 1.00 35.44 ? 81   GLU B O   1 
ATOM   5146 C CB  . GLU B 1 81  ? -19.116 -8.023  61.874 1.00 40.08 ? 81   GLU B CB  1 
ATOM   5147 C CG  . GLU B 1 81  ? -18.375 -7.076  62.804 1.00 43.63 ? 81   GLU B CG  1 
ATOM   5148 C CD  . GLU B 1 81  ? -17.028 -7.636  63.232 1.00 46.32 ? 81   GLU B CD  1 
ATOM   5149 O OE1 . GLU B 1 81  ? -17.010 -8.722  63.851 1.00 48.85 ? 81   GLU B OE1 1 
ATOM   5150 O OE2 . GLU B 1 81  ? -15.988 -6.997  62.947 1.00 47.01 ? 81   GLU B OE2 1 
ATOM   5151 N N   . SER B 1 82  ? -19.832 -9.203  59.006 1.00 36.91 ? 82   SER B N   1 
ATOM   5152 C CA  . SER B 1 82  ? -20.543 -10.187 58.204 1.00 36.72 ? 82   SER B CA  1 
ATOM   5153 C C   . SER B 1 82  ? -19.551 -11.026 57.408 1.00 36.62 ? 82   SER B C   1 
ATOM   5154 O O   . SER B 1 82  ? -19.753 -12.230 57.233 1.00 35.22 ? 82   SER B O   1 
ATOM   5155 C CB  . SER B 1 82  ? -21.530 -9.498  57.256 1.00 37.14 ? 82   SER B CB  1 
ATOM   5156 O OG  . SER B 1 82  ? -22.640 -8.966  57.965 1.00 37.27 ? 82   SER B OG  1 
ATOM   5157 N N   . MET B 1 83  ? -18.475 -10.397 56.929 1.00 36.24 ? 83   MET B N   1 
ATOM   5158 C CA  . MET B 1 83  ? -17.466 -11.126 56.166 1.00 35.79 ? 83   MET B CA  1 
ATOM   5159 C C   . MET B 1 83  ? -16.697 -12.089 57.062 1.00 37.11 ? 83   MET B C   1 
ATOM   5160 O O   . MET B 1 83  ? -16.570 -13.272 56.746 1.00 34.38 ? 83   MET B O   1 
ATOM   5161 C CB  . MET B 1 83  ? -16.466 -10.175 55.492 1.00 36.62 ? 83   MET B CB  1 
ATOM   5162 C CG  . MET B 1 83  ? -15.299 -10.919 54.827 1.00 38.31 ? 83   MET B CG  1 
ATOM   5163 S SD  . MET B 1 83  ? -14.151 -9.902  53.847 1.00 40.02 ? 83   MET B SD  1 
ATOM   5164 C CE  . MET B 1 83  ? -13.249 -9.073  55.124 1.00 40.69 ? 83   MET B CE  1 
ATOM   5165 N N   . PHE B 1 84  ? -16.177 -11.579 58.177 1.00 38.06 ? 84   PHE B N   1 
ATOM   5166 C CA  . PHE B 1 84  ? -15.408 -12.419 59.095 1.00 40.30 ? 84   PHE B CA  1 
ATOM   5167 C C   . PHE B 1 84  ? -16.226 -13.547 59.719 1.00 41.67 ? 84   PHE B C   1 
ATOM   5168 O O   . PHE B 1 84  ? -15.674 -14.601 60.047 1.00 40.88 ? 84   PHE B O   1 
ATOM   5169 C CB  . PHE B 1 84  ? -14.782 -11.579 60.214 1.00 38.97 ? 84   PHE B CB  1 
ATOM   5170 C CG  . PHE B 1 84  ? -13.506 -10.883 59.817 1.00 38.34 ? 84   PHE B CG  1 
ATOM   5171 C CD1 . PHE B 1 84  ? -13.528 -9.773  58.976 1.00 38.64 ? 84   PHE B CD1 1 
ATOM   5172 C CD2 . PHE B 1 84  ? -12.279 -11.324 60.310 1.00 39.81 ? 84   PHE B CD2 1 
ATOM   5173 C CE1 . PHE B 1 84  ? -12.341 -9.109  58.634 1.00 38.98 ? 84   PHE B CE1 1 
ATOM   5174 C CE2 . PHE B 1 84  ? -11.087 -10.665 59.975 1.00 38.07 ? 84   PHE B CE2 1 
ATOM   5175 C CZ  . PHE B 1 84  ? -11.122 -9.556  59.136 1.00 37.19 ? 84   PHE B CZ  1 
ATOM   5176 N N   . ASN B 1 85  ? -17.533 -13.334 59.876 1.00 40.65 ? 85   ASN B N   1 
ATOM   5177 C CA  . ASN B 1 85  ? -18.395 -14.350 60.471 1.00 40.99 ? 85   ASN B CA  1 
ATOM   5178 C C   . ASN B 1 85  ? -18.890 -15.418 59.504 1.00 41.80 ? 85   ASN B C   1 
ATOM   5179 O O   . ASN B 1 85  ? -19.687 -16.277 59.884 1.00 41.29 ? 85   ASN B O   1 
ATOM   5180 C CB  . ASN B 1 85  ? -19.595 -13.703 61.165 1.00 41.34 ? 85   ASN B CB  1 
ATOM   5181 C CG  . ASN B 1 85  ? -19.219 -13.040 62.464 1.00 41.99 ? 85   ASN B CG  1 
ATOM   5182 O OD1 . ASN B 1 85  ? -18.380 -13.549 63.206 1.00 45.12 ? 85   ASN B OD1 1 
ATOM   5183 N ND2 . ASN B 1 85  ? -19.839 -11.903 62.755 1.00 42.10 ? 85   ASN B ND2 1 
ATOM   5184 N N   . GLY B 1 86  ? -18.439 -15.359 58.254 1.00 41.01 ? 86   GLY B N   1 
ATOM   5185 C CA  . GLY B 1 86  ? -18.847 -16.363 57.285 1.00 40.28 ? 86   GLY B CA  1 
ATOM   5186 C C   . GLY B 1 86  ? -20.212 -16.185 56.641 1.00 39.28 ? 86   GLY B C   1 
ATOM   5187 O O   . GLY B 1 86  ? -20.731 -17.116 56.026 1.00 38.84 ? 86   GLY B O   1 
ATOM   5188 N N   . GLU B 1 87  ? -20.805 -15.004 56.780 1.00 38.75 ? 87   GLU B N   1 
ATOM   5189 C CA  . GLU B 1 87  ? -22.101 -14.749 56.164 1.00 39.64 ? 87   GLU B CA  1 
ATOM   5190 C C   . GLU B 1 87  ? -21.892 -14.690 54.648 1.00 38.79 ? 87   GLU B C   1 
ATOM   5191 O O   . GLU B 1 87  ? -20.820 -14.319 54.182 1.00 36.79 ? 87   GLU B O   1 
ATOM   5192 C CB  . GLU B 1 87  ? -22.692 -13.443 56.713 1.00 40.24 ? 87   GLU B CB  1 
ATOM   5193 C CG  . GLU B 1 87  ? -23.159 -13.580 58.165 1.00 43.56 ? 87   GLU B CG  1 
ATOM   5194 C CD  . GLU B 1 87  ? -23.702 -12.293 58.759 1.00 47.95 ? 87   GLU B CD  1 
ATOM   5195 O OE1 . GLU B 1 87  ? -24.535 -11.630 58.103 1.00 51.36 ? 87   GLU B OE1 1 
ATOM   5196 O OE2 . GLU B 1 87  ? -23.307 -11.951 59.897 1.00 49.31 ? 87   GLU B OE2 1 
ATOM   5197 N N   . LYS B 1 88  ? -22.899 -15.071 53.874 1.00 37.03 ? 88   LYS B N   1 
ATOM   5198 C CA  . LYS B 1 88  ? -22.746 -15.074 52.423 1.00 38.10 ? 88   LYS B CA  1 
ATOM   5199 C C   . LYS B 1 88  ? -22.927 -13.699 51.783 1.00 36.42 ? 88   LYS B C   1 
ATOM   5200 O O   . LYS B 1 88  ? -23.895 -13.457 51.064 1.00 35.39 ? 88   LYS B O   1 
ATOM   5201 C CB  . LYS B 1 88  ? -23.709 -16.097 51.808 1.00 39.47 ? 88   LYS B CB  1 
ATOM   5202 C CG  . LYS B 1 88  ? -23.449 -17.513 52.313 1.00 43.66 ? 88   LYS B CG  1 
ATOM   5203 C CD  . LYS B 1 88  ? -24.437 -18.520 51.757 1.00 46.02 ? 88   LYS B CD  1 
ATOM   5204 C CE  . LYS B 1 88  ? -24.134 -19.912 52.287 1.00 47.26 ? 88   LYS B CE  1 
ATOM   5205 N NZ  . LYS B 1 88  ? -25.119 -20.927 51.822 1.00 49.85 ? 88   LYS B NZ  1 
ATOM   5206 N N   . ILE B 1 89  ? -21.971 -12.809 52.043 1.00 35.88 ? 89   ILE B N   1 
ATOM   5207 C CA  . ILE B 1 89  ? -22.011 -11.452 51.511 1.00 36.65 ? 89   ILE B CA  1 
ATOM   5208 C C   . ILE B 1 89  ? -21.811 -11.379 49.994 1.00 36.56 ? 89   ILE B C   1 
ATOM   5209 O O   . ILE B 1 89  ? -22.023 -10.327 49.391 1.00 37.61 ? 89   ILE B O   1 
ATOM   5210 C CB  . ILE B 1 89  ? -20.970 -10.546 52.211 1.00 34.68 ? 89   ILE B CB  1 
ATOM   5211 C CG1 . ILE B 1 89  ? -19.553 -11.048 51.931 1.00 36.79 ? 89   ILE B CG1 1 
ATOM   5212 C CG2 . ILE B 1 89  ? -21.238 -10.527 53.699 1.00 38.58 ? 89   ILE B CG2 1 
ATOM   5213 C CD1 . ILE B 1 89  ? -18.456 -10.067 52.350 1.00 34.57 ? 89   ILE B CD1 1 
ATOM   5214 N N   . ASN B 1 90  ? -21.382 -12.481 49.383 1.00 35.57 ? 90   ASN B N   1 
ATOM   5215 C CA  . ASN B 1 90  ? -21.223 -12.521 47.927 1.00 35.63 ? 90   ASN B CA  1 
ATOM   5216 C C   . ASN B 1 90  ? -22.627 -12.887 47.436 1.00 37.08 ? 90   ASN B C   1 
ATOM   5217 O O   . ASN B 1 90  ? -22.901 -14.021 47.033 1.00 36.24 ? 90   ASN B O   1 
ATOM   5218 C CB  . ASN B 1 90  ? -20.192 -13.586 47.524 1.00 32.85 ? 90   ASN B CB  1 
ATOM   5219 C CG  . ASN B 1 90  ? -20.012 -13.691 46.022 1.00 32.76 ? 90   ASN B CG  1 
ATOM   5220 O OD1 . ASN B 1 90  ? -19.088 -14.355 45.538 1.00 34.02 ? 90   ASN B OD1 1 
ATOM   5221 N ND2 . ASN B 1 90  ? -20.898 -13.047 45.273 1.00 31.36 ? 90   ASN B ND2 1 
ATOM   5222 N N   . SER B 1 91  ? -23.510 -11.895 47.502 1.00 39.22 ? 91   SER B N   1 
ATOM   5223 C CA  . SER B 1 91  ? -24.920 -12.027 47.142 1.00 40.75 ? 91   SER B CA  1 
ATOM   5224 C C   . SER B 1 91  ? -25.304 -12.573 45.764 1.00 40.77 ? 91   SER B C   1 
ATOM   5225 O O   . SER B 1 91  ? -26.276 -13.323 45.658 1.00 42.30 ? 91   SER B O   1 
ATOM   5226 C CB  . SER B 1 91  ? -25.618 -10.679 47.358 1.00 41.78 ? 91   SER B CB  1 
ATOM   5227 O OG  . SER B 1 91  ? -24.968 -9.643  46.636 1.00 43.30 ? 91   SER B OG  1 
ATOM   5228 N N   . THR B 1 92  ? -24.567 -12.216 44.714 1.00 37.93 ? 92   THR B N   1 
ATOM   5229 C CA  . THR B 1 92  ? -24.913 -12.698 43.374 1.00 37.13 ? 92   THR B CA  1 
ATOM   5230 C C   . THR B 1 92  ? -24.625 -14.185 43.148 1.00 37.58 ? 92   THR B C   1 
ATOM   5231 O O   . THR B 1 92  ? -25.311 -14.842 42.365 1.00 38.87 ? 92   THR B O   1 
ATOM   5232 C CB  . THR B 1 92  ? -24.200 -11.879 42.266 1.00 36.13 ? 92   THR B CB  1 
ATOM   5233 O OG1 . THR B 1 92  ? -22.780 -11.989 42.412 1.00 34.46 ? 92   THR B OG1 1 
ATOM   5234 C CG2 . THR B 1 92  ? -24.603 -10.419 42.349 1.00 34.72 ? 92   THR B CG2 1 
ATOM   5235 N N   . GLU B 1 93  ? -23.607 -14.712 43.820 1.00 37.78 ? 93   GLU B N   1 
ATOM   5236 C CA  . GLU B 1 93  ? -23.260 -16.125 43.683 1.00 37.77 ? 93   GLU B CA  1 
ATOM   5237 C C   . GLU B 1 93  ? -23.670 -16.868 44.957 1.00 38.85 ? 93   GLU B C   1 
ATOM   5238 O O   . GLU B 1 93  ? -23.520 -18.083 45.049 1.00 39.13 ? 93   GLU B O   1 
ATOM   5239 C CB  . GLU B 1 93  ? -21.750 -16.293 43.446 1.00 38.75 ? 93   GLU B CB  1 
ATOM   5240 C CG  . GLU B 1 93  ? -21.224 -15.649 42.158 1.00 36.32 ? 93   GLU B CG  1 
ATOM   5241 C CD  . GLU B 1 93  ? -19.717 -15.831 41.969 1.00 39.20 ? 93   GLU B CD  1 
ATOM   5242 O OE1 . GLU B 1 93  ? -18.962 -15.603 42.938 1.00 38.23 ? 93   GLU B OE1 1 
ATOM   5243 O OE2 . GLU B 1 93  ? -19.283 -16.192 40.849 1.00 37.14 ? 93   GLU B OE2 1 
ATOM   5244 N N   . ASP B 1 94  ? -24.201 -16.121 45.923 1.00 39.05 ? 94   ASP B N   1 
ATOM   5245 C CA  . ASP B 1 94  ? -24.626 -16.662 47.215 1.00 41.77 ? 94   ASP B CA  1 
ATOM   5246 C C   . ASP B 1 94  ? -23.529 -17.522 47.845 1.00 41.34 ? 94   ASP B C   1 
ATOM   5247 O O   . ASP B 1 94  ? -23.690 -18.730 48.057 1.00 39.26 ? 94   ASP B O   1 
ATOM   5248 C CB  . ASP B 1 94  ? -25.919 -17.475 47.071 1.00 42.86 ? 94   ASP B CB  1 
ATOM   5249 C CG  . ASP B 1 94  ? -26.521 -17.853 48.420 1.00 46.92 ? 94   ASP B CG  1 
ATOM   5250 O OD1 . ASP B 1 94  ? -26.594 -16.973 49.308 1.00 46.41 ? 94   ASP B OD1 1 
ATOM   5251 O OD2 . ASP B 1 94  ? -26.927 -19.023 48.590 1.00 44.91 ? 94   ASP B OD2 1 
ATOM   5252 N N   . ARG B 1 95  ? -22.407 -16.880 48.141 1.00 39.70 ? 95   ARG B N   1 
ATOM   5253 C CA  . ARG B 1 95  ? -21.270 -17.559 48.743 1.00 38.14 ? 95   ARG B CA  1 
ATOM   5254 C C   . ARG B 1 95  ? -20.721 -16.683 49.844 1.00 37.33 ? 95   ARG B C   1 
ATOM   5255 O O   . ARG B 1 95  ? -20.968 -15.473 49.883 1.00 36.21 ? 95   ARG B O   1 
ATOM   5256 C CB  . ARG B 1 95  ? -20.150 -17.781 47.716 1.00 36.11 ? 95   ARG B CB  1 
ATOM   5257 C CG  . ARG B 1 95  ? -20.505 -18.629 46.521 1.00 38.44 ? 95   ARG B CG  1 
ATOM   5258 C CD  . ARG B 1 95  ? -19.334 -18.691 45.550 1.00 39.34 ? 95   ARG B CD  1 
ATOM   5259 N NE  . ARG B 1 95  ? -19.657 -19.471 44.360 1.00 42.42 ? 95   ARG B NE  1 
ATOM   5260 C CZ  . ARG B 1 95  ? -18.852 -19.617 43.312 1.00 44.52 ? 95   ARG B CZ  1 
ATOM   5261 N NH1 . ARG B 1 95  ? -17.655 -19.039 43.290 1.00 43.01 ? 95   ARG B NH1 1 
ATOM   5262 N NH2 . ARG B 1 95  ? -19.256 -20.336 42.275 1.00 46.13 ? 95   ARG B NH2 1 
ATOM   5263 N N   . ALA B 1 96  ? -19.976 -17.300 50.749 1.00 36.95 ? 96   ALA B N   1 
ATOM   5264 C CA  . ALA B 1 96  ? -19.335 -16.552 51.816 1.00 35.66 ? 96   ALA B CA  1 
ATOM   5265 C C   . ALA B 1 96  ? -18.044 -16.020 51.173 1.00 33.11 ? 96   ALA B C   1 
ATOM   5266 O O   . ALA B 1 96  ? -17.708 -16.398 50.054 1.00 32.62 ? 96   ALA B O   1 
ATOM   5267 C CB  . ALA B 1 96  ? -19.011 -17.483 52.992 1.00 35.28 ? 96   ALA B CB  1 
ATOM   5268 N N   . VAL B 1 97  ? -17.344 -15.131 51.864 1.00 35.33 ? 97   VAL B N   1 
ATOM   5269 C CA  . VAL B 1 97  ? -16.081 -14.569 51.372 1.00 34.93 ? 97   VAL B CA  1 
ATOM   5270 C C   . VAL B 1 97  ? -15.152 -14.759 52.560 1.00 35.05 ? 97   VAL B C   1 
ATOM   5271 O O   . VAL B 1 97  ? -15.136 -13.953 53.489 1.00 34.64 ? 97   VAL B O   1 
ATOM   5272 C CB  . VAL B 1 97  ? -16.224 -13.075 51.030 1.00 34.94 ? 97   VAL B CB  1 
ATOM   5273 C CG1 . VAL B 1 97  ? -14.897 -12.527 50.521 1.00 34.39 ? 97   VAL B CG1 1 
ATOM   5274 C CG2 . VAL B 1 97  ? -17.303 -12.899 49.971 1.00 34.04 ? 97   VAL B CG2 1 
ATOM   5275 N N   . LEU B 1 98  ? -14.380 -15.837 52.511 1.00 36.03 ? 98   LEU B N   1 
ATOM   5276 C CA  . LEU B 1 98  ? -13.522 -16.219 53.622 1.00 38.31 ? 98   LEU B CA  1 
ATOM   5277 C C   . LEU B 1 98  ? -12.021 -16.378 53.401 1.00 38.17 ? 98   LEU B C   1 
ATOM   5278 O O   . LEU B 1 98  ? -11.432 -17.339 53.906 1.00 39.50 ? 98   LEU B O   1 
ATOM   5279 C CB  . LEU B 1 98  ? -14.072 -17.527 54.216 1.00 39.22 ? 98   LEU B CB  1 
ATOM   5280 C CG  . LEU B 1 98  ? -14.911 -17.527 55.499 1.00 42.66 ? 98   LEU B CG  1 
ATOM   5281 C CD1 . LEU B 1 98  ? -15.644 -16.228 55.684 1.00 41.20 ? 98   LEU B CD1 1 
ATOM   5282 C CD2 . LEU B 1 98  ? -15.876 -18.700 55.448 1.00 42.02 ? 98   LEU B CD2 1 
ATOM   5283 N N   . HIS B 1 99  ? -11.381 -15.477 52.659 1.00 37.00 ? 99   HIS B N   1 
ATOM   5284 C CA  . HIS B 1 99  ? -9.937  -15.626 52.511 1.00 35.30 ? 99   HIS B CA  1 
ATOM   5285 C C   . HIS B 1 99  ? -9.293  -15.389 53.885 1.00 36.02 ? 99   HIS B C   1 
ATOM   5286 O O   . HIS B 1 99  ? -8.193  -15.876 54.153 1.00 36.18 ? 99   HIS B O   1 
ATOM   5287 C CB  . HIS B 1 99  ? -9.358  -14.655 51.463 1.00 35.79 ? 99   HIS B CB  1 
ATOM   5288 C CG  . HIS B 1 99  ? -9.979  -13.296 51.478 1.00 34.41 ? 99   HIS B CG  1 
ATOM   5289 N ND1 . HIS B 1 99  ? -11.221 -13.043 50.938 1.00 31.74 ? 99   HIS B ND1 1 
ATOM   5290 C CD2 . HIS B 1 99  ? -9.537  -12.117 51.976 1.00 33.04 ? 99   HIS B CD2 1 
ATOM   5291 C CE1 . HIS B 1 99  ? -11.519 -11.767 51.105 1.00 33.90 ? 99   HIS B CE1 1 
ATOM   5292 N NE2 . HIS B 1 99  ? -10.513 -11.183 51.732 1.00 34.24 ? 99   HIS B NE2 1 
ATOM   5293 N N   . VAL B 1 100 ? -9.979  -14.658 54.765 1.00 36.18 ? 100  VAL B N   1 
ATOM   5294 C CA  . VAL B 1 100 ? -9.429  -14.415 56.100 1.00 37.19 ? 100  VAL B CA  1 
ATOM   5295 C C   . VAL B 1 100 ? -9.367  -15.722 56.904 1.00 38.50 ? 100  VAL B C   1 
ATOM   5296 O O   . VAL B 1 100 ? -8.566  -15.853 57.828 1.00 38.49 ? 100  VAL B O   1 
ATOM   5297 C CB  . VAL B 1 100 ? -10.252 -13.363 56.904 1.00 37.54 ? 100  VAL B CB  1 
ATOM   5298 C CG1 . VAL B 1 100 ? -10.096 -11.981 56.279 1.00 37.34 ? 100  VAL B CG1 1 
ATOM   5299 C CG2 . VAL B 1 100 ? -11.715 -13.768 56.972 1.00 38.51 ? 100  VAL B CG2 1 
ATOM   5300 N N   . ALA B 1 101 ? -10.205 -16.692 56.543 1.00 39.73 ? 101  ALA B N   1 
ATOM   5301 C CA  . ALA B 1 101 ? -10.217 -17.980 57.240 1.00 39.43 ? 101  ALA B CA  1 
ATOM   5302 C C   . ALA B 1 101 ? -8.967  -18.782 56.886 1.00 39.22 ? 101  ALA B C   1 
ATOM   5303 O O   . ALA B 1 101 ? -8.412  -19.510 57.721 1.00 38.28 ? 101  ALA B O   1 
ATOM   5304 C CB  . ALA B 1 101 ? -11.471 -18.774 56.858 1.00 38.33 ? 101  ALA B CB  1 
ATOM   5305 N N   . LEU B 1 102 ? -8.531  -18.646 55.640 1.00 37.21 ? 102  LEU B N   1 
ATOM   5306 C CA  . LEU B 1 102 ? -7.351  -19.348 55.152 1.00 36.07 ? 102  LEU B CA  1 
ATOM   5307 C C   . LEU B 1 102 ? -6.111  -19.034 55.987 1.00 35.60 ? 102  LEU B C   1 
ATOM   5308 O O   . LEU B 1 102 ? -5.242  -19.886 56.155 1.00 36.15 ? 102  LEU B O   1 
ATOM   5309 C CB  . LEU B 1 102 ? -7.085  -18.971 53.690 1.00 35.62 ? 102  LEU B CB  1 
ATOM   5310 C CG  . LEU B 1 102 ? -8.213  -19.218 52.682 1.00 38.60 ? 102  LEU B CG  1 
ATOM   5311 C CD1 . LEU B 1 102 ? -7.858  -18.599 51.327 1.00 33.56 ? 102  LEU B CD1 1 
ATOM   5312 C CD2 . LEU B 1 102 ? -8.442  -20.719 52.543 1.00 36.92 ? 102  LEU B CD2 1 
ATOM   5313 N N   . ARG B 1 103 ? -6.026  -17.809 56.501 1.00 34.82 ? 103  ARG B N   1 
ATOM   5314 C CA  . ARG B 1 103 ? -4.870  -17.396 57.303 1.00 34.54 ? 103  ARG B CA  1 
ATOM   5315 C C   . ARG B 1 103 ? -5.220  -17.158 58.776 1.00 34.81 ? 103  ARG B C   1 
ATOM   5316 O O   . ARG B 1 103 ? -4.501  -16.456 59.494 1.00 32.94 ? 103  ARG B O   1 
ATOM   5317 C CB  . ARG B 1 103 ? -4.254  -16.121 56.713 1.00 34.22 ? 103  ARG B CB  1 
ATOM   5318 C CG  . ARG B 1 103 ? -5.166  -14.889 56.753 1.00 32.59 ? 103  ARG B CG  1 
ATOM   5319 C CD  . ARG B 1 103 ? -5.475  -14.350 55.345 1.00 32.81 ? 103  ARG B CD  1 
ATOM   5320 N NE  . ARG B 1 103 ? -6.061  -13.007 55.401 1.00 34.14 ? 103  ARG B NE  1 
ATOM   5321 C CZ  . ARG B 1 103 ? -6.285  -12.232 54.339 1.00 36.10 ? 103  ARG B CZ  1 
ATOM   5322 N NH1 . ARG B 1 103 ? -5.978  -12.660 53.121 1.00 33.51 ? 103  ARG B NH1 1 
ATOM   5323 N NH2 . ARG B 1 103 ? -6.809  -11.020 54.498 1.00 32.15 ? 103  ARG B NH2 1 
ATOM   5324 N N   . ASN B 1 104 ? -6.319  -17.755 59.223 1.00 36.17 ? 104  ASN B N   1 
ATOM   5325 C CA  . ASN B 1 104 ? -6.778  -17.590 60.598 1.00 39.39 ? 104  ASN B CA  1 
ATOM   5326 C C   . ASN B 1 104 ? -5.956  -18.434 61.567 1.00 40.29 ? 104  ASN B C   1 
ATOM   5327 O O   . ASN B 1 104 ? -6.407  -19.477 62.042 1.00 43.28 ? 104  ASN B O   1 
ATOM   5328 C CB  . ASN B 1 104 ? -8.265  -17.951 60.679 1.00 38.73 ? 104  ASN B CB  1 
ATOM   5329 C CG  . ASN B 1 104 ? -8.820  -17.856 62.084 1.00 41.71 ? 104  ASN B CG  1 
ATOM   5330 O OD1 . ASN B 1 104 ? -8.399  -17.017 62.885 1.00 42.49 ? 104  ASN B OD1 1 
ATOM   5331 N ND2 . ASN B 1 104 ? -9.790  -18.709 62.386 1.00 41.50 ? 104  ASN B ND2 1 
ATOM   5332 N N   . ARG B 1 105 ? -4.745  -17.961 61.851 1.00 41.01 ? 105  ARG B N   1 
ATOM   5333 C CA  . ARG B 1 105 ? -3.810  -18.649 62.742 1.00 41.49 ? 105  ARG B CA  1 
ATOM   5334 C C   . ARG B 1 105 ? -4.365  -18.886 64.143 1.00 41.96 ? 105  ARG B C   1 
ATOM   5335 O O   . ARG B 1 105 ? -3.985  -19.842 64.817 1.00 41.04 ? 105  ARG B O   1 
ATOM   5336 C CB  . ARG B 1 105 ? -2.504  -17.850 62.844 1.00 39.43 ? 105  ARG B CB  1 
ATOM   5337 C CG  . ARG B 1 105 ? -1.908  -17.464 61.500 1.00 39.46 ? 105  ARG B CG  1 
ATOM   5338 C CD  . ARG B 1 105 ? -1.776  -18.666 60.590 1.00 36.94 ? 105  ARG B CD  1 
ATOM   5339 N NE  . ARG B 1 105 ? -0.754  -19.598 61.054 1.00 38.87 ? 105  ARG B NE  1 
ATOM   5340 C CZ  . ARG B 1 105 ? -0.650  -20.857 60.639 1.00 39.64 ? 105  ARG B CZ  1 
ATOM   5341 N NH1 . ARG B 1 105 ? -1.512  -21.339 59.754 1.00 38.19 ? 105  ARG B NH1 1 
ATOM   5342 N NH2 . ARG B 1 105 ? 0.326   -21.633 61.098 1.00 38.35 ? 105  ARG B NH2 1 
ATOM   5343 N N   . SER B 1 106 ? -5.265  -18.016 64.579 1.00 42.88 ? 106  SER B N   1 
ATOM   5344 C CA  . SER B 1 106 ? -5.846  -18.141 65.906 1.00 45.88 ? 106  SER B CA  1 
ATOM   5345 C C   . SER B 1 106 ? -6.834  -19.296 65.977 1.00 46.53 ? 106  SER B C   1 
ATOM   5346 O O   . SER B 1 106 ? -7.267  -19.686 67.063 1.00 46.69 ? 106  SER B O   1 
ATOM   5347 C CB  . SER B 1 106 ? -6.532  -16.833 66.300 1.00 46.41 ? 106  SER B CB  1 
ATOM   5348 O OG  . SER B 1 106 ? -5.586  -15.779 66.396 1.00 51.92 ? 106  SER B OG  1 
ATOM   5349 N N   . ASN B 1 107 ? -7.186  -19.833 64.812 1.00 47.17 ? 107  ASN B N   1 
ATOM   5350 C CA  . ASN B 1 107 ? -8.111  -20.957 64.707 1.00 48.05 ? 107  ASN B CA  1 
ATOM   5351 C C   . ASN B 1 107 ? -9.492  -20.734 65.315 1.00 49.23 ? 107  ASN B C   1 
ATOM   5352 O O   . ASN B 1 107 ? -10.229 -21.685 65.573 1.00 48.35 ? 107  ASN B O   1 
ATOM   5353 C CB  . ASN B 1 107 ? -7.467  -22.209 65.306 1.00 49.28 ? 107  ASN B CB  1 
ATOM   5354 C CG  . ASN B 1 107 ? -6.520  -22.891 64.337 1.00 49.86 ? 107  ASN B CG  1 
ATOM   5355 O OD1 . ASN B 1 107 ? -5.640  -23.650 64.738 1.00 51.57 ? 107  ASN B OD1 1 
ATOM   5356 N ND2 . ASN B 1 107 ? -6.708  -22.634 63.051 1.00 48.39 ? 107  ASN B ND2 1 
ATOM   5357 N N   . THR B 1 108 ? -9.849  -19.476 65.539 1.00 50.55 ? 108  THR B N   1 
ATOM   5358 C CA  . THR B 1 108 ? -11.163 -19.163 66.084 1.00 51.58 ? 108  THR B CA  1 
ATOM   5359 C C   . THR B 1 108 ? -12.201 -19.707 65.099 1.00 50.82 ? 108  THR B C   1 
ATOM   5360 O O   . THR B 1 108 ? -12.079 -19.520 63.888 1.00 51.10 ? 108  THR B O   1 
ATOM   5361 C CB  . THR B 1 108 ? -11.343 -17.649 66.228 1.00 53.52 ? 108  THR B CB  1 
ATOM   5362 O OG1 . THR B 1 108 ? -10.277 -17.123 67.027 1.00 56.87 ? 108  THR B OG1 1 
ATOM   5363 C CG2 . THR B 1 108 ? -12.680 -17.329 66.891 1.00 55.82 ? 108  THR B CG2 1 
ATOM   5364 N N   . PRO B 1 109 ? -13.232 -20.396 65.604 1.00 50.31 ? 109  PRO B N   1 
ATOM   5365 C CA  . PRO B 1 109 ? -14.264 -20.953 64.723 1.00 48.95 ? 109  PRO B CA  1 
ATOM   5366 C C   . PRO B 1 109 ? -14.982 -19.960 63.804 1.00 47.51 ? 109  PRO B C   1 
ATOM   5367 O O   . PRO B 1 109 ? -15.307 -18.839 64.196 1.00 46.66 ? 109  PRO B O   1 
ATOM   5368 C CB  . PRO B 1 109 ? -15.220 -21.644 65.701 1.00 50.06 ? 109  PRO B CB  1 
ATOM   5369 C CG  . PRO B 1 109 ? -15.034 -20.868 66.976 1.00 51.44 ? 109  PRO B CG  1 
ATOM   5370 C CD  . PRO B 1 109 ? -13.539 -20.677 67.016 1.00 50.67 ? 109  PRO B CD  1 
ATOM   5371 N N   . ILE B 1 110 ? -15.211 -20.402 62.572 1.00 45.57 ? 110  ILE B N   1 
ATOM   5372 C CA  . ILE B 1 110 ? -15.902 -19.627 61.548 1.00 45.05 ? 110  ILE B CA  1 
ATOM   5373 C C   . ILE B 1 110 ? -16.910 -20.597 60.950 1.00 45.39 ? 110  ILE B C   1 
ATOM   5374 O O   . ILE B 1 110 ? -16.532 -21.546 60.266 1.00 43.97 ? 110  ILE B O   1 
ATOM   5375 C CB  . ILE B 1 110 ? -14.926 -19.148 60.452 1.00 44.34 ? 110  ILE B CB  1 
ATOM   5376 C CG1 . ILE B 1 110 ? -13.945 -18.134 61.047 1.00 42.89 ? 110  ILE B CG1 1 
ATOM   5377 C CG2 . ILE B 1 110 ? -15.698 -18.535 59.291 1.00 42.45 ? 110  ILE B CG2 1 
ATOM   5378 C CD1 . ILE B 1 110 ? -12.854 -17.709 60.103 1.00 42.16 ? 110  ILE B CD1 1 
ATOM   5379 N N   . VAL B 1 111 ? -18.190 -20.357 61.217 1.00 47.98 ? 111  VAL B N   1 
ATOM   5380 C CA  . VAL B 1 111 ? -19.254 -21.243 60.751 1.00 50.00 ? 111  VAL B CA  1 
ATOM   5381 C C   . VAL B 1 111 ? -19.896 -20.918 59.406 1.00 51.29 ? 111  VAL B C   1 
ATOM   5382 O O   . VAL B 1 111 ? -20.312 -19.786 59.148 1.00 52.45 ? 111  VAL B O   1 
ATOM   5383 C CB  . VAL B 1 111 ? -20.382 -21.341 61.809 1.00 50.21 ? 111  VAL B CB  1 
ATOM   5384 C CG1 . VAL B 1 111 ? -21.491 -22.260 61.312 1.00 50.44 ? 111  VAL B CG1 1 
ATOM   5385 C CG2 . VAL B 1 111 ? -19.812 -21.855 63.127 1.00 49.41 ? 111  VAL B CG2 1 
ATOM   5386 N N   . VAL B 1 112 ? -19.980 -21.948 58.568 1.00 52.56 ? 112  VAL B N   1 
ATOM   5387 C CA  . VAL B 1 112 ? -20.577 -21.871 57.239 1.00 53.49 ? 112  VAL B CA  1 
ATOM   5388 C C   . VAL B 1 112 ? -21.387 -23.153 57.046 1.00 55.13 ? 112  VAL B C   1 
ATOM   5389 O O   . VAL B 1 112 ? -20.871 -24.253 57.253 1.00 54.85 ? 112  VAL B O   1 
ATOM   5390 C CB  . VAL B 1 112 ? -19.498 -21.801 56.141 1.00 52.91 ? 112  VAL B CB  1 
ATOM   5391 C CG1 . VAL B 1 112 ? -20.151 -21.845 54.767 1.00 52.40 ? 112  VAL B CG1 1 
ATOM   5392 C CG2 . VAL B 1 112 ? -18.669 -20.538 56.306 1.00 51.96 ? 112  VAL B CG2 1 
ATOM   5393 N N   . ASP B 1 113 ? -22.647 -23.012 56.648 1.00 57.18 ? 113  ASP B N   1 
ATOM   5394 C CA  . ASP B 1 113 ? -23.525 -24.166 56.455 1.00 58.56 ? 113  ASP B CA  1 
ATOM   5395 C C   . ASP B 1 113 ? -23.514 -25.064 57.692 1.00 59.46 ? 113  ASP B C   1 
ATOM   5396 O O   . ASP B 1 113 ? -23.482 -26.293 57.587 1.00 60.25 ? 113  ASP B O   1 
ATOM   5397 C CB  . ASP B 1 113 ? -23.107 -24.984 55.225 1.00 59.01 ? 113  ASP B CB  1 
ATOM   5398 C CG  . ASP B 1 113 ? -23.423 -24.284 53.915 1.00 59.61 ? 113  ASP B CG  1 
ATOM   5399 O OD1 . ASP B 1 113 ? -24.473 -23.612 53.833 1.00 59.45 ? 113  ASP B OD1 1 
ATOM   5400 O OD2 . ASP B 1 113 ? -22.630 -24.421 52.960 1.00 60.59 ? 113  ASP B OD2 1 
ATOM   5401 N N   . GLY B 1 114 ? -23.523 -24.433 58.863 1.00 59.72 ? 114  GLY B N   1 
ATOM   5402 C CA  . GLY B 1 114 ? -23.533 -25.166 60.116 1.00 59.76 ? 114  GLY B CA  1 
ATOM   5403 C C   . GLY B 1 114 ? -22.275 -25.944 60.453 1.00 59.53 ? 114  GLY B C   1 
ATOM   5404 O O   . GLY B 1 114 ? -22.346 -26.930 61.183 1.00 60.67 ? 114  GLY B O   1 
ATOM   5405 N N   . LYS B 1 115 ? -21.126 -25.513 59.941 1.00 58.09 ? 115  LYS B N   1 
ATOM   5406 C CA  . LYS B 1 115 ? -19.869 -26.206 60.221 1.00 56.89 ? 115  LYS B CA  1 
ATOM   5407 C C   . LYS B 1 115 ? -18.651 -25.286 60.243 1.00 55.35 ? 115  LYS B C   1 
ATOM   5408 O O   . LYS B 1 115 ? -18.497 -24.428 59.372 1.00 54.60 ? 115  LYS B O   1 
ATOM   5409 C CB  . LYS B 1 115 ? -19.623 -27.307 59.187 1.00 58.33 ? 115  LYS B CB  1 
ATOM   5410 C CG  . LYS B 1 115 ? -20.611 -28.458 59.225 1.00 60.86 ? 115  LYS B CG  1 
ATOM   5411 C CD  . LYS B 1 115 ? -20.179 -29.563 58.273 1.00 63.94 ? 115  LYS B CD  1 
ATOM   5412 C CE  . LYS B 1 115 ? -18.801 -30.101 58.639 1.00 65.24 ? 115  LYS B CE  1 
ATOM   5413 N NZ  . LYS B 1 115 ? -18.347 -31.175 57.711 1.00 66.57 ? 115  LYS B NZ  1 
ATOM   5414 N N   . ASP B 1 116 ? -17.789 -25.471 61.241 1.00 52.59 ? 116  ASP B N   1 
ATOM   5415 C CA  . ASP B 1 116 ? -16.566 -24.680 61.351 1.00 51.11 ? 116  ASP B CA  1 
ATOM   5416 C C   . ASP B 1 116 ? -15.715 -25.089 60.153 1.00 48.98 ? 116  ASP B C   1 
ATOM   5417 O O   . ASP B 1 116 ? -15.541 -26.278 59.895 1.00 48.00 ? 116  ASP B O   1 
ATOM   5418 C CB  . ASP B 1 116 ? -15.817 -25.020 62.645 1.00 51.68 ? 116  ASP B CB  1 
ATOM   5419 C CG  . ASP B 1 116 ? -14.671 -24.061 62.933 1.00 51.68 ? 116  ASP B CG  1 
ATOM   5420 O OD1 . ASP B 1 116 ? -14.161 -23.428 61.987 1.00 49.81 ? 116  ASP B OD1 1 
ATOM   5421 O OD2 . ASP B 1 116 ? -14.270 -23.949 64.112 1.00 51.71 ? 116  ASP B OD2 1 
ATOM   5422 N N   . VAL B 1 117 ? -15.192 -24.111 59.420 1.00 46.84 ? 117  VAL B N   1 
ATOM   5423 C CA  . VAL B 1 117 ? -14.376 -24.407 58.245 1.00 45.35 ? 117  VAL B CA  1 
ATOM   5424 C C   . VAL B 1 117 ? -12.900 -24.570 58.576 1.00 43.40 ? 117  VAL B C   1 
ATOM   5425 O O   . VAL B 1 117 ? -12.136 -25.087 57.767 1.00 42.45 ? 117  VAL B O   1 
ATOM   5426 C CB  . VAL B 1 117 ? -14.497 -23.288 57.178 1.00 45.92 ? 117  VAL B CB  1 
ATOM   5427 C CG1 . VAL B 1 117 ? -15.951 -23.105 56.779 1.00 45.35 ? 117  VAL B CG1 1 
ATOM   5428 C CG2 . VAL B 1 117 ? -13.924 -21.985 57.724 1.00 44.80 ? 117  VAL B CG2 1 
ATOM   5429 N N   . MET B 1 118 ? -12.499 -24.133 59.764 1.00 43.85 ? 118  MET B N   1 
ATOM   5430 C CA  . MET B 1 118 ? -11.098 -24.221 60.152 1.00 43.69 ? 118  MET B CA  1 
ATOM   5431 C C   . MET B 1 118 ? -10.476 -25.615 60.103 1.00 43.71 ? 118  MET B C   1 
ATOM   5432 O O   . MET B 1 118 ? -9.335  -25.765 59.672 1.00 43.63 ? 118  MET B O   1 
ATOM   5433 C CB  . MET B 1 118 ? -10.886 -23.591 61.530 1.00 43.82 ? 118  MET B CB  1 
ATOM   5434 C CG  . MET B 1 118 ? -10.997 -22.068 61.522 1.00 45.96 ? 118  MET B CG  1 
ATOM   5435 S SD  . MET B 1 118 ? -10.194 -21.331 60.066 1.00 44.64 ? 118  MET B SD  1 
ATOM   5436 C CE  . MET B 1 118 ? -8.500  -21.911 60.253 1.00 44.74 ? 118  MET B CE  1 
ATOM   5437 N N   . PRO B 1 119 ? -11.206 -26.655 60.543 1.00 45.10 ? 119  PRO B N   1 
ATOM   5438 C CA  . PRO B 1 119 ? -10.607 -27.995 60.490 1.00 44.25 ? 119  PRO B CA  1 
ATOM   5439 C C   . PRO B 1 119 ? -10.158 -28.367 59.078 1.00 43.55 ? 119  PRO B C   1 
ATOM   5440 O O   . PRO B 1 119 ? -9.072  -28.918 58.886 1.00 42.43 ? 119  PRO B O   1 
ATOM   5441 C CB  . PRO B 1 119 ? -11.732 -28.892 60.998 1.00 43.78 ? 119  PRO B CB  1 
ATOM   5442 C CG  . PRO B 1 119 ? -12.401 -28.021 62.010 1.00 45.51 ? 119  PRO B CG  1 
ATOM   5443 C CD  . PRO B 1 119 ? -12.478 -26.681 61.290 1.00 45.44 ? 119  PRO B CD  1 
ATOM   5444 N N   . GLU B 1 120 ? -11.001 -28.061 58.093 1.00 44.62 ? 120  GLU B N   1 
ATOM   5445 C CA  . GLU B 1 120 ? -10.692 -28.352 56.694 1.00 43.53 ? 120  GLU B CA  1 
ATOM   5446 C C   . GLU B 1 120 ? -9.549  -27.478 56.178 1.00 41.84 ? 120  GLU B C   1 
ATOM   5447 O O   . GLU B 1 120 ? -8.710  -27.932 55.403 1.00 40.92 ? 120  GLU B O   1 
ATOM   5448 C CB  . GLU B 1 120 ? -11.935 -28.145 55.827 1.00 48.08 ? 120  GLU B CB  1 
ATOM   5449 C CG  . GLU B 1 120 ? -13.046 -29.132 56.124 1.00 53.80 ? 120  GLU B CG  1 
ATOM   5450 C CD  . GLU B 1 120 ? -12.632 -30.567 55.862 1.00 56.86 ? 120  GLU B CD  1 
ATOM   5451 O OE1 . GLU B 1 120 ? -13.119 -31.464 56.581 1.00 59.31 ? 120  GLU B OE1 1 
ATOM   5452 O OE2 . GLU B 1 120 ? -11.823 -30.801 54.936 1.00 60.39 ? 120  GLU B OE2 1 
ATOM   5453 N N   . VAL B 1 121 ? -9.519  -26.220 56.597 1.00 42.29 ? 121  VAL B N   1 
ATOM   5454 C CA  . VAL B 1 121 ? -8.448  -25.328 56.169 1.00 40.73 ? 121  VAL B CA  1 
ATOM   5455 C C   . VAL B 1 121 ? -7.105  -25.892 56.648 1.00 42.03 ? 121  VAL B C   1 
ATOM   5456 O O   . VAL B 1 121 ? -6.146  -25.991 55.880 1.00 39.56 ? 121  VAL B O   1 
ATOM   5457 C CB  . VAL B 1 121 ? -8.638  -23.905 56.746 1.00 41.61 ? 121  VAL B CB  1 
ATOM   5458 C CG1 . VAL B 1 121 ? -7.381  -23.070 56.511 1.00 39.71 ? 121  VAL B CG1 1 
ATOM   5459 C CG2 . VAL B 1 121 ? -9.841  -23.238 56.095 1.00 40.30 ? 121  VAL B CG2 1 
ATOM   5460 N N   . ASN B 1 122 ? -7.053  -26.283 57.917 1.00 42.02 ? 122  ASN B N   1 
ATOM   5461 C CA  . ASN B 1 122 ? -5.827  -26.826 58.491 1.00 43.21 ? 122  ASN B CA  1 
ATOM   5462 C C   . ASN B 1 122 ? -5.463  -28.197 57.938 1.00 42.09 ? 122  ASN B C   1 
ATOM   5463 O O   . ASN B 1 122 ? -4.289  -28.548 57.874 1.00 42.73 ? 122  ASN B O   1 
ATOM   5464 C CB  . ASN B 1 122 ? -5.944  -26.886 60.012 1.00 43.08 ? 122  ASN B CB  1 
ATOM   5465 C CG  . ASN B 1 122 ? -6.166  -25.520 60.627 1.00 45.44 ? 122  ASN B CG  1 
ATOM   5466 O OD1 . ASN B 1 122 ? -5.440  -24.564 60.329 1.00 46.68 ? 122  ASN B OD1 1 
ATOM   5467 N ND2 . ASN B 1 122 ? -7.164  -25.416 61.495 1.00 44.77 ? 122  ASN B ND2 1 
ATOM   5468 N N   . LYS B 1 123 ? -6.461  -28.972 57.531 1.00 42.86 ? 123  LYS B N   1 
ATOM   5469 C CA  . LYS B 1 123 ? -6.188  -30.289 56.971 1.00 42.46 ? 123  LYS B CA  1 
ATOM   5470 C C   . LYS B 1 123 ? -5.417  -30.133 55.667 1.00 42.92 ? 123  LYS B C   1 
ATOM   5471 O O   . LYS B 1 123 ? -4.432  -30.833 55.419 1.00 40.77 ? 123  LYS B O   1 
ATOM   5472 C CB  . LYS B 1 123 ? -7.484  -31.040 56.684 1.00 44.94 ? 123  LYS B CB  1 
ATOM   5473 C CG  . LYS B 1 123 ? -7.251  -32.442 56.138 1.00 48.05 ? 123  LYS B CG  1 
ATOM   5474 C CD  . LYS B 1 123 ? -8.477  -32.978 55.423 1.00 51.82 ? 123  LYS B CD  1 
ATOM   5475 C CE  . LYS B 1 123 ? -8.787  -32.153 54.176 1.00 52.80 ? 123  LYS B CE  1 
ATOM   5476 N NZ  . LYS B 1 123 ? -9.893  -32.740 53.369 1.00 55.57 ? 123  LYS B NZ  1 
ATOM   5477 N N   . VAL B 1 124 ? -5.881  -29.218 54.821 1.00 42.32 ? 124  VAL B N   1 
ATOM   5478 C CA  . VAL B 1 124 ? -5.217  -28.983 53.548 1.00 41.48 ? 124  VAL B CA  1 
ATOM   5479 C C   . VAL B 1 124 ? -3.825  -28.416 53.803 1.00 39.24 ? 124  VAL B C   1 
ATOM   5480 O O   . VAL B 1 124 ? -2.860  -28.828 53.163 1.00 39.85 ? 124  VAL B O   1 
ATOM   5481 C CB  . VAL B 1 124 ? -6.035  -28.017 52.664 1.00 42.31 ? 124  VAL B CB  1 
ATOM   5482 C CG1 . VAL B 1 124 ? -5.282  -27.721 51.374 1.00 41.11 ? 124  VAL B CG1 1 
ATOM   5483 C CG2 . VAL B 1 124 ? -7.390  -28.638 52.360 1.00 41.60 ? 124  VAL B CG2 1 
ATOM   5484 N N   . LEU B 1 125 ? -3.720  -27.482 54.744 1.00 39.68 ? 125  LEU B N   1 
ATOM   5485 C CA  . LEU B 1 125 ? -2.423  -26.894 55.076 1.00 39.16 ? 125  LEU B CA  1 
ATOM   5486 C C   . LEU B 1 125 ? -1.438  -27.986 55.519 1.00 40.57 ? 125  LEU B C   1 
ATOM   5487 O O   . LEU B 1 125 ? -0.288  -28.000 55.084 1.00 40.94 ? 125  LEU B O   1 
ATOM   5488 C CB  . LEU B 1 125 ? -2.579  -25.840 56.177 1.00 37.94 ? 125  LEU B CB  1 
ATOM   5489 C CG  . LEU B 1 125 ? -3.150  -24.487 55.728 1.00 39.02 ? 125  LEU B CG  1 
ATOM   5490 C CD1 . LEU B 1 125 ? -3.511  -23.633 56.932 1.00 38.77 ? 125  LEU B CD1 1 
ATOM   5491 C CD2 . LEU B 1 125 ? -2.123  -23.777 54.853 1.00 38.60 ? 125  LEU B CD2 1 
ATOM   5492 N N   . ASP B 1 126 ? -1.892  -28.902 56.376 1.00 42.09 ? 126  ASP B N   1 
ATOM   5493 C CA  . ASP B 1 126 ? -1.026  -29.991 56.846 1.00 42.44 ? 126  ASP B CA  1 
ATOM   5494 C C   . ASP B 1 126 ? -0.615  -30.880 55.678 1.00 40.81 ? 126  ASP B C   1 
ATOM   5495 O O   . ASP B 1 126 ? 0.522   -31.344 55.609 1.00 40.67 ? 126  ASP B O   1 
ATOM   5496 C CB  . ASP B 1 126 ? -1.730  -30.848 57.908 1.00 43.67 ? 126  ASP B CB  1 
ATOM   5497 C CG  . ASP B 1 126 ? -1.948  -30.109 59.213 1.00 46.07 ? 126  ASP B CG  1 
ATOM   5498 O OD1 . ASP B 1 126 ? -1.126  -29.231 59.555 1.00 47.80 ? 126  ASP B OD1 1 
ATOM   5499 O OD2 . ASP B 1 126 ? -2.938  -30.420 59.911 1.00 47.32 ? 126  ASP B OD2 1 
ATOM   5500 N N   . LYS B 1 127 ? -1.545  -31.123 54.761 1.00 40.59 ? 127  LYS B N   1 
ATOM   5501 C CA  . LYS B 1 127 ? -1.247  -31.948 53.601 1.00 41.46 ? 127  LYS B CA  1 
ATOM   5502 C C   . LYS B 1 127 ? -0.226  -31.233 52.719 1.00 42.11 ? 127  LYS B C   1 
ATOM   5503 O O   . LYS B 1 127 ? 0.675   -31.862 52.163 1.00 41.30 ? 127  LYS B O   1 
ATOM   5504 C CB  . LYS B 1 127 ? -2.522  -32.233 52.803 1.00 43.71 ? 127  LYS B CB  1 
ATOM   5505 C CG  . LYS B 1 127 ? -2.297  -33.096 51.568 1.00 46.51 ? 127  LYS B CG  1 
ATOM   5506 C CD  . LYS B 1 127 ? -3.595  -33.294 50.794 1.00 48.59 ? 127  LYS B CD  1 
ATOM   5507 C CE  . LYS B 1 127 ? -3.350  -34.020 49.479 1.00 48.54 ? 127  LYS B CE  1 
ATOM   5508 N NZ  . LYS B 1 127 ? -3.153  -35.478 49.685 1.00 50.26 ? 127  LYS B NZ  1 
ATOM   5509 N N   . MET B 1 128 ? -0.370  -29.915 52.589 1.00 40.90 ? 128  MET B N   1 
ATOM   5510 C CA  . MET B 1 128 ? 0.560   -29.135 51.783 1.00 40.77 ? 128  MET B CA  1 
ATOM   5511 C C   . MET B 1 128 ? 1.944   -29.237 52.418 1.00 41.44 ? 128  MET B C   1 
ATOM   5512 O O   . MET B 1 128 ? 2.938   -29.482 51.734 1.00 39.07 ? 128  MET B O   1 
ATOM   5513 C CB  . MET B 1 128 ? 0.121   -27.664 51.726 1.00 40.13 ? 128  MET B CB  1 
ATOM   5514 C CG  . MET B 1 128 ? -1.145  -27.398 50.910 1.00 36.81 ? 128  MET B CG  1 
ATOM   5515 S SD  . MET B 1 128 ? -1.765  -25.702 51.142 1.00 39.99 ? 128  MET B SD  1 
ATOM   5516 C CE  . MET B 1 128 ? -0.529  -24.778 50.231 1.00 39.05 ? 128  MET B CE  1 
ATOM   5517 N N   . LYS B 1 129 ? 1.997   -29.057 53.735 1.00 42.22 ? 129  LYS B N   1 
ATOM   5518 C CA  . LYS B 1 129 ? 3.261   -29.122 54.460 1.00 43.10 ? 129  LYS B CA  1 
ATOM   5519 C C   . LYS B 1 129 ? 3.956   -30.476 54.297 1.00 42.51 ? 129  LYS B C   1 
ATOM   5520 O O   . LYS B 1 129 ? 5.171   -30.534 54.116 1.00 42.73 ? 129  LYS B O   1 
ATOM   5521 C CB  . LYS B 1 129 ? 3.043   -28.842 55.955 1.00 43.33 ? 129  LYS B CB  1 
ATOM   5522 C CG  . LYS B 1 129 ? 4.346   -28.784 56.755 1.00 47.41 ? 129  LYS B CG  1 
ATOM   5523 C CD  . LYS B 1 129 ? 4.111   -28.781 58.263 1.00 50.21 ? 129  LYS B CD  1 
ATOM   5524 C CE  . LYS B 1 129 ? 3.405   -27.519 58.739 1.00 53.11 ? 129  LYS B CE  1 
ATOM   5525 N NZ  . LYS B 1 129 ? 3.242   -27.490 60.224 1.00 54.82 ? 129  LYS B NZ  1 
ATOM   5526 N N   . ALA B 1 130 ? 3.185   -31.559 54.364 1.00 42.72 ? 130  ALA B N   1 
ATOM   5527 C CA  . ALA B 1 130 ? 3.744   -32.903 54.234 1.00 43.43 ? 130  ALA B CA  1 
ATOM   5528 C C   . ALA B 1 130 ? 4.266   -33.163 52.824 1.00 43.87 ? 130  ALA B C   1 
ATOM   5529 O O   . ALA B 1 130 ? 5.295   -33.817 52.639 1.00 43.23 ? 130  ALA B O   1 
ATOM   5530 C CB  . ALA B 1 130 ? 2.689   -33.942 54.599 1.00 45.11 ? 130  ALA B CB  1 
ATOM   5531 N N   . PHE B 1 131 ? 3.548   -32.651 51.831 1.00 43.26 ? 131  PHE B N   1 
ATOM   5532 C CA  . PHE B 1 131 ? 3.938   -32.821 50.438 1.00 42.33 ? 131  PHE B CA  1 
ATOM   5533 C C   . PHE B 1 131 ? 5.202   -32.030 50.128 1.00 43.65 ? 131  PHE B C   1 
ATOM   5534 O O   . PHE B 1 131 ? 6.153   -32.555 49.538 1.00 40.33 ? 131  PHE B O   1 
ATOM   5535 C CB  . PHE B 1 131 ? 2.810   -32.359 49.520 1.00 42.43 ? 131  PHE B CB  1 
ATOM   5536 C CG  . PHE B 1 131 ? 3.149   -32.437 48.064 1.00 41.84 ? 131  PHE B CG  1 
ATOM   5537 C CD1 . PHE B 1 131 ? 3.225   -33.665 47.420 1.00 41.26 ? 131  PHE B CD1 1 
ATOM   5538 C CD2 . PHE B 1 131 ? 3.401   -31.277 47.334 1.00 40.42 ? 131  PHE B CD2 1 
ATOM   5539 C CE1 . PHE B 1 131 ? 3.546   -33.739 46.066 1.00 41.35 ? 131  PHE B CE1 1 
ATOM   5540 C CE2 . PHE B 1 131 ? 3.722   -31.341 45.978 1.00 39.24 ? 131  PHE B CE2 1 
ATOM   5541 C CZ  . PHE B 1 131 ? 3.795   -32.571 45.344 1.00 40.51 ? 131  PHE B CZ  1 
ATOM   5542 N N   . CYS B 1 132 ? 5.209   -30.759 50.520 1.00 45.68 ? 132  CYS B N   1 
ATOM   5543 C CA  . CYS B 1 132 ? 6.369   -29.911 50.285 1.00 48.00 ? 132  CYS B CA  1 
ATOM   5544 C C   . CYS B 1 132 ? 7.588   -30.545 50.943 1.00 48.50 ? 132  CYS B C   1 
ATOM   5545 O O   . CYS B 1 132 ? 8.680   -30.560 50.376 1.00 47.40 ? 132  CYS B O   1 
ATOM   5546 C CB  . CYS B 1 132 ? 6.132   -28.511 50.856 1.00 50.19 ? 132  CYS B CB  1 
ATOM   5547 S SG  . CYS B 1 132 ? 4.875   -27.559 49.966 1.00 57.14 ? 132  CYS B SG  1 
ATOM   5548 N N   . GLN B 1 133 ? 7.389   -31.071 52.146 1.00 49.13 ? 133  GLN B N   1 
ATOM   5549 C CA  . GLN B 1 133 ? 8.467   -31.718 52.877 1.00 50.02 ? 133  GLN B CA  1 
ATOM   5550 C C   . GLN B 1 133 ? 9.070   -32.811 51.999 1.00 49.58 ? 133  GLN B C   1 
ATOM   5551 O O   . GLN B 1 133 ? 10.274  -32.822 51.741 1.00 48.78 ? 133  GLN B O   1 
ATOM   5552 C CB  . GLN B 1 133 ? 7.930   -32.329 54.171 1.00 51.48 ? 133  GLN B CB  1 
ATOM   5553 C CG  . GLN B 1 133 ? 9.017   -32.820 55.100 1.00 56.66 ? 133  GLN B CG  1 
ATOM   5554 C CD  . GLN B 1 133 ? 9.934   -31.700 55.546 1.00 58.25 ? 133  GLN B CD  1 
ATOM   5555 O OE1 . GLN B 1 133 ? 9.511   -30.779 56.247 1.00 60.57 ? 133  GLN B OE1 1 
ATOM   5556 N NE2 . GLN B 1 133 ? 11.196  -31.770 55.137 1.00 59.89 ? 133  GLN B NE2 1 
ATOM   5557 N N   . ARG B 1 134 ? 8.220   -33.722 51.532 1.00 48.76 ? 134  ARG B N   1 
ATOM   5558 C CA  . ARG B 1 134 ? 8.662   -34.815 50.678 1.00 48.48 ? 134  ARG B CA  1 
ATOM   5559 C C   . ARG B 1 134 ? 9.415   -34.319 49.451 1.00 47.46 ? 134  ARG B C   1 
ATOM   5560 O O   . ARG B 1 134 ? 10.505  -34.798 49.147 1.00 48.06 ? 134  ARG B O   1 
ATOM   5561 C CB  . ARG B 1 134 ? 7.468   -35.654 50.220 1.00 49.32 ? 134  ARG B CB  1 
ATOM   5562 C CG  . ARG B 1 134 ? 6.700   -36.330 51.337 1.00 52.29 ? 134  ARG B CG  1 
ATOM   5563 C CD  . ARG B 1 134 ? 5.631   -37.263 50.775 1.00 54.54 ? 134  ARG B CD  1 
ATOM   5564 N NE  . ARG B 1 134 ? 6.214   -38.407 50.076 1.00 56.49 ? 134  ARG B NE  1 
ATOM   5565 C CZ  . ARG B 1 134 ? 5.519   -39.274 49.343 1.00 57.14 ? 134  ARG B CZ  1 
ATOM   5566 N NH1 . ARG B 1 134 ? 4.208   -39.130 49.207 1.00 57.49 ? 134  ARG B NH1 1 
ATOM   5567 N NH2 . ARG B 1 134 ? 6.135   -40.287 48.745 1.00 57.89 ? 134  ARG B NH2 1 
ATOM   5568 N N   . VAL B 1 135 ? 8.834   -33.361 48.739 1.00 47.80 ? 135  VAL B N   1 
ATOM   5569 C CA  . VAL B 1 135 ? 9.475   -32.839 47.540 1.00 46.80 ? 135  VAL B CA  1 
ATOM   5570 C C   . VAL B 1 135 ? 10.822  -32.187 47.841 1.00 46.31 ? 135  VAL B C   1 
ATOM   5571 O O   . VAL B 1 135 ? 11.827  -32.510 47.211 1.00 47.14 ? 135  VAL B O   1 
ATOM   5572 C CB  . VAL B 1 135 ? 8.575   -31.808 46.817 1.00 46.45 ? 135  VAL B CB  1 
ATOM   5573 C CG1 . VAL B 1 135 ? 9.220   -31.402 45.500 1.00 44.81 ? 135  VAL B CG1 1 
ATOM   5574 C CG2 . VAL B 1 135 ? 7.191   -32.399 46.570 1.00 46.44 ? 135  VAL B CG2 1 
ATOM   5575 N N   . ARG B 1 136 ? 10.842  -31.275 48.808 1.00 48.25 ? 136  ARG B N   1 
ATOM   5576 C CA  . ARG B 1 136 ? 12.069  -30.572 49.172 1.00 49.07 ? 136  ARG B CA  1 
ATOM   5577 C C   . ARG B 1 136 ? 13.190  -31.497 49.659 1.00 50.73 ? 136  ARG B C   1 
ATOM   5578 O O   . ARG B 1 136 ? 14.333  -31.384 49.210 1.00 51.53 ? 136  ARG B O   1 
ATOM   5579 C CB  . ARG B 1 136 ? 11.761  -29.526 50.245 1.00 51.38 ? 136  ARG B CB  1 
ATOM   5580 C CG  . ARG B 1 136 ? 10.671  -28.543 49.848 1.00 53.45 ? 136  ARG B CG  1 
ATOM   5581 C CD  . ARG B 1 136 ? 11.220  -27.184 49.462 1.00 54.10 ? 136  ARG B CD  1 
ATOM   5582 N NE  . ARG B 1 136 ? 11.730  -26.448 50.616 1.00 55.89 ? 136  ARG B NE  1 
ATOM   5583 C CZ  . ARG B 1 136 ? 12.066  -25.162 50.589 1.00 56.43 ? 136  ARG B CZ  1 
ATOM   5584 N NH1 . ARG B 1 136 ? 11.943  -24.467 49.468 1.00 55.56 ? 136  ARG B NH1 1 
ATOM   5585 N NH2 . ARG B 1 136 ? 12.527  -24.569 51.681 1.00 58.11 ? 136  ARG B NH2 1 
ATOM   5586 N N   . SER B 1 137 ? 12.863  -32.407 50.573 1.00 50.38 ? 137  SER B N   1 
ATOM   5587 C CA  . SER B 1 137 ? 13.853  -33.336 51.122 1.00 50.36 ? 137  SER B CA  1 
ATOM   5588 C C   . SER B 1 137 ? 14.355  -34.346 50.092 1.00 49.93 ? 137  SER B C   1 
ATOM   5589 O O   . SER B 1 137 ? 15.320  -35.065 50.342 1.00 51.81 ? 137  SER B O   1 
ATOM   5590 C CB  . SER B 1 137 ? 13.265  -34.094 52.313 1.00 48.71 ? 137  SER B CB  1 
ATOM   5591 O OG  . SER B 1 137 ? 12.248  -34.980 51.883 1.00 49.97 ? 137  SER B OG  1 
ATOM   5592 N N   . GLY B 1 138 ? 13.696  -34.410 48.939 1.00 48.79 ? 138  GLY B N   1 
ATOM   5593 C CA  . GLY B 1 138 ? 14.121  -35.343 47.913 1.00 47.00 ? 138  GLY B CA  1 
ATOM   5594 C C   . GLY B 1 138 ? 13.503  -36.728 48.020 1.00 47.75 ? 138  GLY B C   1 
ATOM   5595 O O   . GLY B 1 138 ? 13.860  -37.626 47.259 1.00 47.09 ? 138  GLY B O   1 
ATOM   5596 N N   . ASP B 1 139 ? 12.579  -36.912 48.958 1.00 47.75 ? 139  ASP B N   1 
ATOM   5597 C CA  . ASP B 1 139 ? 11.926  -38.205 49.125 1.00 49.10 ? 139  ASP B CA  1 
ATOM   5598 C C   . ASP B 1 139 ? 11.008  -38.489 47.943 1.00 48.68 ? 139  ASP B C   1 
ATOM   5599 O O   . ASP B 1 139 ? 10.895  -39.627 47.495 1.00 48.07 ? 139  ASP B O   1 
ATOM   5600 C CB  . ASP B 1 139 ? 11.131  -38.244 50.433 1.00 51.85 ? 139  ASP B CB  1 
ATOM   5601 C CG  . ASP B 1 139 ? 10.304  -39.509 50.574 1.00 55.31 ? 139  ASP B CG  1 
ATOM   5602 O OD1 . ASP B 1 139 ? 9.207   -39.574 49.974 1.00 57.04 ? 139  ASP B OD1 1 
ATOM   5603 O OD2 . ASP B 1 139 ? 10.757  -40.444 51.272 1.00 56.94 ? 139  ASP B OD2 1 
ATOM   5604 N N   . TRP B 1 140 ? 10.353  -37.446 47.438 1.00 47.48 ? 140  TRP B N   1 
ATOM   5605 C CA  . TRP B 1 140 ? 9.468   -37.595 46.291 1.00 47.00 ? 140  TRP B CA  1 
ATOM   5606 C C   . TRP B 1 140 ? 10.350  -37.767 45.055 1.00 47.39 ? 140  TRP B C   1 
ATOM   5607 O O   . TRP B 1 140 ? 11.110  -36.868 44.699 1.00 47.95 ? 140  TRP B O   1 
ATOM   5608 C CB  . TRP B 1 140 ? 8.577   -36.356 46.142 1.00 45.56 ? 140  TRP B CB  1 
ATOM   5609 C CG  . TRP B 1 140 ? 7.487   -36.535 45.136 1.00 43.60 ? 140  TRP B CG  1 
ATOM   5610 C CD1 . TRP B 1 140 ? 7.618   -36.570 43.775 1.00 42.64 ? 140  TRP B CD1 1 
ATOM   5611 C CD2 . TRP B 1 140 ? 6.104   -36.773 45.411 1.00 42.67 ? 140  TRP B CD2 1 
ATOM   5612 N NE1 . TRP B 1 140 ? 6.402   -36.821 43.190 1.00 40.71 ? 140  TRP B NE1 1 
ATOM   5613 C CE2 . TRP B 1 140 ? 5.455   -36.950 44.171 1.00 42.17 ? 140  TRP B CE2 1 
ATOM   5614 C CE3 . TRP B 1 140 ? 5.349   -36.859 46.590 1.00 42.68 ? 140  TRP B CE3 1 
ATOM   5615 C CZ2 . TRP B 1 140 ? 4.085   -37.206 44.073 1.00 42.21 ? 140  TRP B CZ2 1 
ATOM   5616 C CZ3 . TRP B 1 140 ? 3.989   -37.114 46.493 1.00 44.41 ? 140  TRP B CZ3 1 
ATOM   5617 C CH2 . TRP B 1 140 ? 3.371   -37.285 45.242 1.00 43.27 ? 140  TRP B CH2 1 
ATOM   5618 N N   . LYS B 1 141 ? 10.248  -38.923 44.406 1.00 47.35 ? 141  LYS B N   1 
ATOM   5619 C CA  . LYS B 1 141 ? 11.060  -39.212 43.228 1.00 48.19 ? 141  LYS B CA  1 
ATOM   5620 C C   . LYS B 1 141 ? 10.280  -39.227 41.918 1.00 48.95 ? 141  LYS B C   1 
ATOM   5621 O O   . LYS B 1 141 ? 9.110   -39.621 41.872 1.00 49.00 ? 141  LYS B O   1 
ATOM   5622 C CB  . LYS B 1 141 ? 11.760  -40.567 43.395 1.00 48.94 ? 141  LYS B CB  1 
ATOM   5623 C CG  . LYS B 1 141 ? 12.640  -40.706 44.640 1.00 47.57 ? 141  LYS B CG  1 
ATOM   5624 C CD  . LYS B 1 141 ? 13.818  -39.742 44.606 1.00 47.50 ? 141  LYS B CD  1 
ATOM   5625 C CE  . LYS B 1 141 ? 14.892  -40.110 45.629 1.00 43.61 ? 141  LYS B CE  1 
ATOM   5626 N NZ  . LYS B 1 141 ? 14.385  -40.169 47.025 1.00 42.76 ? 141  LYS B NZ  1 
ATOM   5627 N N   . GLY B 1 142 ? 10.946  -38.802 40.850 1.00 50.07 ? 142  GLY B N   1 
ATOM   5628 C CA  . GLY B 1 142 ? 10.329  -38.804 39.538 1.00 50.50 ? 142  GLY B CA  1 
ATOM   5629 C C   . GLY B 1 142 ? 10.221  -40.245 39.079 1.00 52.09 ? 142  GLY B C   1 
ATOM   5630 O O   . GLY B 1 142 ? 10.664  -41.150 39.789 1.00 51.57 ? 142  GLY B O   1 
ATOM   5631 N N   . TYR B 1 143 ? 9.657   -40.463 37.894 1.00 53.02 ? 143  TYR B N   1 
ATOM   5632 C CA  . TYR B 1 143 ? 9.476   -41.812 37.362 1.00 54.21 ? 143  TYR B CA  1 
ATOM   5633 C C   . TYR B 1 143 ? 10.772  -42.581 37.082 1.00 55.58 ? 143  TYR B C   1 
ATOM   5634 O O   . TYR B 1 143 ? 10.728  -43.742 36.672 1.00 54.90 ? 143  TYR B O   1 
ATOM   5635 C CB  . TYR B 1 143 ? 8.614   -41.763 36.097 1.00 54.45 ? 143  TYR B CB  1 
ATOM   5636 C CG  . TYR B 1 143 ? 9.357   -41.405 34.828 1.00 55.41 ? 143  TYR B CG  1 
ATOM   5637 C CD1 . TYR B 1 143 ? 9.753   -42.395 33.930 1.00 55.44 ? 143  TYR B CD1 1 
ATOM   5638 C CD2 . TYR B 1 143 ? 9.651   -40.078 34.517 1.00 55.62 ? 143  TYR B CD2 1 
ATOM   5639 C CE1 . TYR B 1 143 ? 10.422  -42.074 32.751 1.00 55.78 ? 143  TYR B CE1 1 
ATOM   5640 C CE2 . TYR B 1 143 ? 10.322  -39.745 33.340 1.00 55.88 ? 143  TYR B CE2 1 
ATOM   5641 C CZ  . TYR B 1 143 ? 10.703  -40.748 32.463 1.00 55.99 ? 143  TYR B CZ  1 
ATOM   5642 O OH  . TYR B 1 143 ? 11.359  -40.424 31.297 1.00 57.19 ? 143  TYR B OH  1 
ATOM   5643 N N   . THR B 1 144 ? 11.921  -41.943 37.294 1.00 55.91 ? 144  THR B N   1 
ATOM   5644 C CA  . THR B 1 144 ? 13.198  -42.621 37.081 1.00 55.40 ? 144  THR B CA  1 
ATOM   5645 C C   . THR B 1 144 ? 14.065  -42.586 38.337 1.00 54.64 ? 144  THR B C   1 
ATOM   5646 O O   . THR B 1 144 ? 15.267  -42.846 38.284 1.00 54.86 ? 144  THR B O   1 
ATOM   5647 C CB  . THR B 1 144 ? 13.988  -42.022 35.889 1.00 55.45 ? 144  THR B CB  1 
ATOM   5648 O OG1 . THR B 1 144 ? 14.189  -40.619 36.090 1.00 57.12 ? 144  THR B OG1 1 
ATOM   5649 C CG2 . THR B 1 144 ? 13.233  -42.245 34.593 1.00 54.61 ? 144  THR B CG2 1 
ATOM   5650 N N   . GLY B 1 145 ? 13.442  -42.262 39.466 1.00 53.82 ? 145  GLY B N   1 
ATOM   5651 C CA  . GLY B 1 145 ? 14.158  -42.224 40.730 1.00 54.07 ? 145  GLY B CA  1 
ATOM   5652 C C   . GLY B 1 145 ? 14.942  -40.963 41.045 1.00 54.03 ? 145  GLY B C   1 
ATOM   5653 O O   . GLY B 1 145 ? 15.679  -40.925 42.032 1.00 54.19 ? 145  GLY B O   1 
ATOM   5654 N N   . LYS B 1 146 ? 14.790  -39.929 40.223 1.00 52.94 ? 146  LYS B N   1 
ATOM   5655 C CA  . LYS B 1 146 ? 15.504  -38.678 40.452 1.00 51.23 ? 146  LYS B CA  1 
ATOM   5656 C C   . LYS B 1 146 ? 14.671  -37.704 41.278 1.00 49.02 ? 146  LYS B C   1 
ATOM   5657 O O   . LYS B 1 146 ? 13.442  -37.745 41.247 1.00 47.25 ? 146  LYS B O   1 
ATOM   5658 C CB  . LYS B 1 146 ? 15.889  -38.038 39.116 1.00 52.15 ? 146  LYS B CB  1 
ATOM   5659 C CG  . LYS B 1 146 ? 16.853  -38.875 38.287 1.00 54.41 ? 146  LYS B CG  1 
ATOM   5660 C CD  . LYS B 1 146 ? 17.359  -38.100 37.082 1.00 56.55 ? 146  LYS B CD  1 
ATOM   5661 C CE  . LYS B 1 146 ? 18.358  -38.911 36.267 1.00 57.32 ? 146  LYS B CE  1 
ATOM   5662 N NZ  . LYS B 1 146 ? 18.901  -38.123 35.123 1.00 59.86 ? 146  LYS B NZ  1 
ATOM   5663 N N   . THR B 1 147 ? 15.347  -36.838 42.027 1.00 48.17 ? 147  THR B N   1 
ATOM   5664 C CA  . THR B 1 147 ? 14.661  -35.856 42.857 1.00 46.92 ? 147  THR B CA  1 
ATOM   5665 C C   . THR B 1 147 ? 14.088  -34.745 41.971 1.00 45.48 ? 147  THR B C   1 
ATOM   5666 O O   . THR B 1 147 ? 14.536  -34.548 40.844 1.00 43.21 ? 147  THR B O   1 
ATOM   5667 C CB  . THR B 1 147 ? 15.623  -35.231 43.893 1.00 48.47 ? 147  THR B CB  1 
ATOM   5668 O OG1 . THR B 1 147 ? 16.668  -34.526 43.210 1.00 48.70 ? 147  THR B OG1 1 
ATOM   5669 C CG2 . THR B 1 147 ? 16.239  -36.316 44.778 1.00 47.76 ? 147  THR B CG2 1 
ATOM   5670 N N   . ILE B 1 148 ? 13.100  -34.022 42.486 1.00 43.71 ? 148  ILE B N   1 
ATOM   5671 C CA  . ILE B 1 148 ? 12.476  -32.948 41.719 1.00 43.75 ? 148  ILE B CA  1 
ATOM   5672 C C   . ILE B 1 148 ? 13.264  -31.650 41.801 1.00 43.31 ? 148  ILE B C   1 
ATOM   5673 O O   . ILE B 1 148 ? 13.484  -31.109 42.887 1.00 43.83 ? 148  ILE B O   1 
ATOM   5674 C CB  . ILE B 1 148 ? 11.038  -32.692 42.197 1.00 43.64 ? 148  ILE B CB  1 
ATOM   5675 C CG1 . ILE B 1 148 ? 10.193  -33.948 41.967 1.00 41.99 ? 148  ILE B CG1 1 
ATOM   5676 C CG2 . ILE B 1 148 ? 10.440  -31.499 41.457 1.00 45.48 ? 148  ILE B CG2 1 
ATOM   5677 C CD1 . ILE B 1 148 ? 10.194  -34.439 40.536 1.00 39.25 ? 148  ILE B CD1 1 
ATOM   5678 N N   . THR B 1 149 ? 13.682  -31.153 40.643 1.00 42.39 ? 149  THR B N   1 
ATOM   5679 C CA  . THR B 1 149 ? 14.448  -29.920 40.578 1.00 42.63 ? 149  THR B CA  1 
ATOM   5680 C C   . THR B 1 149 ? 13.619  -28.727 40.106 1.00 43.77 ? 149  THR B C   1 
ATOM   5681 O O   . THR B 1 149 ? 13.980  -27.579 40.369 1.00 42.33 ? 149  THR B O   1 
ATOM   5682 C CB  . THR B 1 149 ? 15.648  -30.068 39.631 1.00 43.16 ? 149  THR B CB  1 
ATOM   5683 O OG1 . THR B 1 149 ? 15.187  -30.428 38.320 1.00 43.94 ? 149  THR B OG1 1 
ATOM   5684 C CG2 . THR B 1 149 ? 16.596  -31.137 40.147 1.00 44.24 ? 149  THR B CG2 1 
ATOM   5685 N N   . ASP B 1 150 ? 12.516  -29.000 39.411 1.00 41.07 ? 150  ASP B N   1 
ATOM   5686 C CA  . ASP B 1 150 ? 11.669  -27.931 38.895 1.00 40.48 ? 150  ASP B CA  1 
ATOM   5687 C C   . ASP B 1 150 ? 10.181  -28.100 39.145 1.00 38.51 ? 150  ASP B C   1 
ATOM   5688 O O   . ASP B 1 150 ? 9.615   -29.170 38.930 1.00 36.98 ? 150  ASP B O   1 
ATOM   5689 C CB  . ASP B 1 150 ? 11.890  -27.761 37.392 1.00 39.82 ? 150  ASP B CB  1 
ATOM   5690 C CG  . ASP B 1 150 ? 13.296  -27.320 37.062 1.00 42.68 ? 150  ASP B CG  1 
ATOM   5691 O OD1 . ASP B 1 150 ? 14.193  -28.189 36.993 1.00 41.76 ? 150  ASP B OD1 1 
ATOM   5692 O OD2 . ASP B 1 150 ? 13.504  -26.099 36.889 1.00 41.31 ? 150  ASP B OD2 1 
ATOM   5693 N N   . VAL B 1 151 ? 9.555   -27.018 39.593 1.00 36.28 ? 151  VAL B N   1 
ATOM   5694 C CA  . VAL B 1 151 ? 8.130   -27.004 39.858 1.00 35.74 ? 151  VAL B CA  1 
ATOM   5695 C C   . VAL B 1 151 ? 7.507   -26.019 38.877 1.00 36.51 ? 151  VAL B C   1 
ATOM   5696 O O   . VAL B 1 151 ? 7.925   -24.860 38.806 1.00 36.02 ? 151  VAL B O   1 
ATOM   5697 C CB  . VAL B 1 151 ? 7.834   -26.538 41.293 1.00 36.50 ? 151  VAL B CB  1 
ATOM   5698 C CG1 . VAL B 1 151 ? 6.344   -26.573 41.550 1.00 36.80 ? 151  VAL B CG1 1 
ATOM   5699 C CG2 . VAL B 1 151 ? 8.566   -27.427 42.293 1.00 38.61 ? 151  VAL B CG2 1 
ATOM   5700 N N   . ILE B 1 152 ? 6.524   -26.487 38.114 1.00 36.29 ? 152  ILE B N   1 
ATOM   5701 C CA  . ILE B 1 152 ? 5.844   -25.649 37.132 1.00 38.26 ? 152  ILE B CA  1 
ATOM   5702 C C   . ILE B 1 152 ? 4.376   -25.450 37.498 1.00 36.24 ? 152  ILE B C   1 
ATOM   5703 O O   . ILE B 1 152 ? 3.603   -26.407 37.545 1.00 37.69 ? 152  ILE B O   1 
ATOM   5704 C CB  . ILE B 1 152 ? 5.905   -26.270 35.715 1.00 37.80 ? 152  ILE B CB  1 
ATOM   5705 C CG1 . ILE B 1 152 ? 7.358   -26.483 35.289 1.00 41.64 ? 152  ILE B CG1 1 
ATOM   5706 C CG2 . ILE B 1 152 ? 5.178   -25.373 34.721 1.00 39.94 ? 152  ILE B CG2 1 
ATOM   5707 C CD1 . ILE B 1 152 ? 7.977   -27.778 35.820 1.00 40.17 ? 152  ILE B CD1 1 
ATOM   5708 N N   . ASN B 1 153 ? 3.993   -24.206 37.754 1.00 35.93 ? 153  ASN B N   1 
ATOM   5709 C CA  . ASN B 1 153 ? 2.615   -23.894 38.101 1.00 34.45 ? 153  ASN B CA  1 
ATOM   5710 C C   . ASN B 1 153 ? 1.871   -23.484 36.825 1.00 36.55 ? 153  ASN B C   1 
ATOM   5711 O O   . ASN B 1 153 ? 2.246   -22.511 36.162 1.00 34.73 ? 153  ASN B O   1 
ATOM   5712 C CB  . ASN B 1 153 ? 2.584   -22.761 39.141 1.00 37.03 ? 153  ASN B CB  1 
ATOM   5713 C CG  . ASN B 1 153 ? 1.184   -22.433 39.623 1.00 35.81 ? 153  ASN B CG  1 
ATOM   5714 O OD1 . ASN B 1 153 ? 0.462   -21.653 39.001 1.00 41.78 ? 153  ASN B OD1 1 
ATOM   5715 N ND2 . ASN B 1 153 ? 0.794   -23.027 40.739 1.00 37.47 ? 153  ASN B ND2 1 
ATOM   5716 N N   . ILE B 1 154 ? 0.834   -24.245 36.479 1.00 34.31 ? 154  ILE B N   1 
ATOM   5717 C CA  . ILE B 1 154 ? 0.018   -23.969 35.293 1.00 32.73 ? 154  ILE B CA  1 
ATOM   5718 C C   . ILE B 1 154 ? -1.371  -23.488 35.737 1.00 33.33 ? 154  ILE B C   1 
ATOM   5719 O O   . ILE B 1 154 ? -2.158  -24.247 36.300 1.00 33.16 ? 154  ILE B O   1 
ATOM   5720 C CB  . ILE B 1 154 ? -0.120  -25.235 34.405 1.00 33.25 ? 154  ILE B CB  1 
ATOM   5721 C CG1 . ILE B 1 154 ? 1.268   -25.708 33.960 1.00 32.51 ? 154  ILE B CG1 1 
ATOM   5722 C CG2 . ILE B 1 154 ? -0.978  -24.936 33.171 1.00 32.32 ? 154  ILE B CG2 1 
ATOM   5723 C CD1 . ILE B 1 154 ? 1.246   -26.925 33.043 1.00 34.22 ? 154  ILE B CD1 1 
ATOM   5724 N N   . GLY B 1 155 ? -1.651  -22.209 35.507 1.00 31.47 ? 155  GLY B N   1 
ATOM   5725 C CA  . GLY B 1 155 ? -2.931  -21.640 35.894 1.00 30.49 ? 155  GLY B CA  1 
ATOM   5726 C C   . GLY B 1 155 ? -2.999  -20.212 35.384 1.00 30.46 ? 155  GLY B C   1 
ATOM   5727 O O   . GLY B 1 155 ? -1.991  -19.673 34.931 1.00 28.94 ? 155  GLY B O   1 
ATOM   5728 N N   . ILE B 1 156 ? -4.160  -19.579 35.473 1.00 29.89 ? 156  ILE B N   1 
ATOM   5729 C CA  . ILE B 1 156 ? -4.271  -18.223 34.950 1.00 31.30 ? 156  ILE B CA  1 
ATOM   5730 C C   . ILE B 1 156 ? -5.088  -17.324 35.863 1.00 30.02 ? 156  ILE B C   1 
ATOM   5731 O O   . ILE B 1 156 ? -5.895  -17.801 36.662 1.00 29.06 ? 156  ILE B O   1 
ATOM   5732 C CB  . ILE B 1 156 ? -4.876  -18.269 33.520 1.00 30.04 ? 156  ILE B CB  1 
ATOM   5733 C CG1 . ILE B 1 156 ? -4.627  -16.948 32.790 1.00 32.52 ? 156  ILE B CG1 1 
ATOM   5734 C CG2 . ILE B 1 156 ? -6.362  -18.591 33.583 1.00 30.64 ? 156  ILE B CG2 1 
ATOM   5735 C CD1 . ILE B 1 156 ? -4.869  -17.041 31.290 1.00 30.73 ? 156  ILE B CD1 1 
ATOM   5736 N N   . GLY B 1 157 ? -4.857  -16.018 35.772 1.00 27.79 ? 157  GLY B N   1 
ATOM   5737 C CA  . GLY B 1 157 ? -5.594  -15.097 36.616 1.00 27.44 ? 157  GLY B CA  1 
ATOM   5738 C C   . GLY B 1 157 ? -5.279  -15.291 38.085 1.00 28.50 ? 157  GLY B C   1 
ATOM   5739 O O   . GLY B 1 157 ? -4.111  -15.253 38.478 1.00 28.66 ? 157  GLY B O   1 
ATOM   5740 N N   . GLY B 1 158 ? -6.318  -15.499 38.893 1.00 27.12 ? 158  GLY B N   1 
ATOM   5741 C CA  . GLY B 1 158 ? -6.139  -15.698 40.327 1.00 28.51 ? 158  GLY B CA  1 
ATOM   5742 C C   . GLY B 1 158 ? -5.351  -16.948 40.694 1.00 28.17 ? 158  GLY B C   1 
ATOM   5743 O O   . GLY B 1 158 ? -4.821  -17.043 41.801 1.00 29.24 ? 158  GLY B O   1 
ATOM   5744 N N   . SER B 1 159 ? -5.283  -17.912 39.780 1.00 28.06 ? 159  SER B N   1 
ATOM   5745 C CA  . SER B 1 159 ? -4.525  -19.142 40.028 1.00 31.42 ? 159  SER B CA  1 
ATOM   5746 C C   . SER B 1 159 ? -3.088  -19.017 39.512 1.00 30.05 ? 159  SER B C   1 
ATOM   5747 O O   . SER B 1 159 ? -2.355  -20.006 39.442 1.00 32.15 ? 159  SER B O   1 
ATOM   5748 C CB  . SER B 1 159 ? -5.214  -20.335 39.354 1.00 29.20 ? 159  SER B CB  1 
ATOM   5749 O OG  . SER B 1 159 ? -6.449  -20.634 39.996 1.00 32.78 ? 159  SER B OG  1 
ATOM   5750 N N   . ASP B 1 160 ? -2.680  -17.793 39.178 1.00 29.35 ? 160  ASP B N   1 
ATOM   5751 C CA  . ASP B 1 160 ? -1.339  -17.549 38.655 1.00 29.18 ? 160  ASP B CA  1 
ATOM   5752 C C   . ASP B 1 160 ? -0.586  -16.360 39.270 1.00 30.71 ? 160  ASP B C   1 
ATOM   5753 O O   . ASP B 1 160 ? 0.513   -16.515 39.817 1.00 26.79 ? 160  ASP B O   1 
ATOM   5754 C CB  . ASP B 1 160 ? -1.422  -17.342 37.133 1.00 31.56 ? 160  ASP B CB  1 
ATOM   5755 C CG  . ASP B 1 160 ? -0.200  -16.620 36.559 1.00 36.54 ? 160  ASP B CG  1 
ATOM   5756 O OD1 . ASP B 1 160 ? 0.902   -17.220 36.542 1.00 34.10 ? 160  ASP B OD1 1 
ATOM   5757 O OD2 . ASP B 1 160 ? -0.342  -15.447 36.120 1.00 34.78 ? 160  ASP B OD2 1 
ATOM   5758 N N   . LEU B 1 161 ? -1.194  -15.179 39.182 1.00 30.26 ? 161  LEU B N   1 
ATOM   5759 C CA  . LEU B 1 161 ? -0.563  -13.943 39.630 1.00 30.48 ? 161  LEU B CA  1 
ATOM   5760 C C   . LEU B 1 161 ? -0.134  -13.859 41.088 1.00 30.03 ? 161  LEU B C   1 
ATOM   5761 O O   . LEU B 1 161 ? 0.945   -13.349 41.376 1.00 28.11 ? 161  LEU B O   1 
ATOM   5762 C CB  . LEU B 1 161 ? -1.462  -12.752 39.277 1.00 32.30 ? 161  LEU B CB  1 
ATOM   5763 C CG  . LEU B 1 161 ? -0.768  -11.384 39.278 1.00 35.39 ? 161  LEU B CG  1 
ATOM   5764 C CD1 . LEU B 1 161 ? 0.555   -11.476 38.535 1.00 35.80 ? 161  LEU B CD1 1 
ATOM   5765 C CD2 . LEU B 1 161 ? -1.685  -10.336 38.633 1.00 33.80 ? 161  LEU B CD2 1 
ATOM   5766 N N   . GLY B 1 162 ? -0.969  -14.344 42.000 1.00 28.98 ? 162  GLY B N   1 
ATOM   5767 C CA  . GLY B 1 162 ? -0.614  -14.303 43.410 1.00 30.94 ? 162  GLY B CA  1 
ATOM   5768 C C   . GLY B 1 162 ? 0.695   -15.031 43.680 1.00 32.52 ? 162  GLY B C   1 
ATOM   5769 O O   . GLY B 1 162 ? 1.661   -14.437 44.169 1.00 31.59 ? 162  GLY B O   1 
ATOM   5770 N N   . PRO B 1 163 ? 0.759   -16.334 43.375 1.00 32.82 ? 163  PRO B N   1 
ATOM   5771 C CA  . PRO B 1 163 ? 2.001   -17.075 43.613 1.00 32.27 ? 163  PRO B CA  1 
ATOM   5772 C C   . PRO B 1 163 ? 3.196   -16.541 42.822 1.00 31.89 ? 163  PRO B C   1 
ATOM   5773 O O   . PRO B 1 163 ? 4.323   -16.580 43.304 1.00 31.34 ? 163  PRO B O   1 
ATOM   5774 C CB  . PRO B 1 163 ? 1.628   -18.519 43.251 1.00 33.60 ? 163  PRO B CB  1 
ATOM   5775 C CG  . PRO B 1 163 ? 0.437   -18.373 42.351 1.00 37.48 ? 163  PRO B CG  1 
ATOM   5776 C CD  . PRO B 1 163 ? -0.329  -17.236 42.965 1.00 33.37 ? 163  PRO B CD  1 
ATOM   5777 N N   . LEU B 1 164 ? 2.955   -16.031 41.616 1.00 29.89 ? 164  LEU B N   1 
ATOM   5778 C CA  . LEU B 1 164 ? 4.039   -15.484 40.809 1.00 28.91 ? 164  LEU B CA  1 
ATOM   5779 C C   . LEU B 1 164 ? 4.643   -14.268 41.511 1.00 29.53 ? 164  LEU B C   1 
ATOM   5780 O O   . LEU B 1 164 ? 5.856   -14.190 41.717 1.00 27.61 ? 164  LEU B O   1 
ATOM   5781 C CB  . LEU B 1 164 ? 3.525   -15.077 39.422 1.00 30.42 ? 164  LEU B CB  1 
ATOM   5782 C CG  . LEU B 1 164 ? 4.511   -14.334 38.507 1.00 34.27 ? 164  LEU B CG  1 
ATOM   5783 C CD1 . LEU B 1 164 ? 5.785   -15.158 38.326 1.00 36.94 ? 164  LEU B CD1 1 
ATOM   5784 C CD2 . LEU B 1 164 ? 3.852   -14.068 37.155 1.00 36.46 ? 164  LEU B CD2 1 
ATOM   5785 N N   . MET B 1 165 ? 3.782   -13.331 41.892 1.00 29.23 ? 165  MET B N   1 
ATOM   5786 C CA  . MET B 1 165 ? 4.210   -12.108 42.561 1.00 29.92 ? 165  MET B CA  1 
ATOM   5787 C C   . MET B 1 165 ? 4.875   -12.377 43.917 1.00 29.92 ? 165  MET B C   1 
ATOM   5788 O O   . MET B 1 165 ? 5.882   -11.750 44.248 1.00 29.36 ? 165  MET B O   1 
ATOM   5789 C CB  . MET B 1 165 ? 3.007   -11.176 42.751 1.00 30.33 ? 165  MET B CB  1 
ATOM   5790 C CG  . MET B 1 165 ? 3.312   -9.827  43.430 1.00 29.93 ? 165  MET B CG  1 
ATOM   5791 S SD  . MET B 1 165 ? 3.355   -9.847  45.248 1.00 31.36 ? 165  MET B SD  1 
ATOM   5792 C CE  . MET B 1 165 ? 1.605   -9.868  45.636 1.00 36.07 ? 165  MET B CE  1 
ATOM   5793 N N   . VAL B 1 166 ? 4.323   -13.306 44.693 1.00 29.58 ? 166  VAL B N   1 
ATOM   5794 C CA  . VAL B 1 166 ? 4.887   -13.592 46.014 1.00 30.65 ? 166  VAL B CA  1 
ATOM   5795 C C   . VAL B 1 166 ? 6.218   -14.326 45.956 1.00 31.11 ? 166  VAL B C   1 
ATOM   5796 O O   . VAL B 1 166 ? 7.128   -14.014 46.730 1.00 30.56 ? 166  VAL B O   1 
ATOM   5797 C CB  . VAL B 1 166 ? 3.897   -14.382 46.903 1.00 30.88 ? 166  VAL B CB  1 
ATOM   5798 C CG1 . VAL B 1 166 ? 4.583   -14.818 48.208 1.00 29.04 ? 166  VAL B CG1 1 
ATOM   5799 C CG2 . VAL B 1 166 ? 2.684   -13.502 47.227 1.00 29.86 ? 166  VAL B CG2 1 
ATOM   5800 N N   . THR B 1 167 ? 6.354   -15.286 45.045 1.00 30.13 ? 167  THR B N   1 
ATOM   5801 C CA  . THR B 1 167 ? 7.626   -15.996 44.948 1.00 31.84 ? 167  THR B CA  1 
ATOM   5802 C C   . THR B 1 167 ? 8.701   -15.030 44.451 1.00 31.97 ? 167  THR B C   1 
ATOM   5803 O O   . THR B 1 167 ? 9.858   -15.113 44.863 1.00 32.74 ? 167  THR B O   1 
ATOM   5804 C CB  . THR B 1 167 ? 7.543   -17.249 44.024 1.00 30.67 ? 167  THR B CB  1 
ATOM   5805 O OG1 . THR B 1 167 ? 7.073   -16.884 42.721 1.00 32.80 ? 167  THR B OG1 1 
ATOM   5806 C CG2 . THR B 1 167 ? 6.611   -18.286 44.630 1.00 30.98 ? 167  THR B CG2 1 
ATOM   5807 N N   . GLU B 1 168 ? 8.320   -14.099 43.579 1.00 32.58 ? 168  GLU B N   1 
ATOM   5808 C CA  . GLU B 1 168 ? 9.274   -13.114 43.078 1.00 31.29 ? 168  GLU B CA  1 
ATOM   5809 C C   . GLU B 1 168 ? 9.691   -12.162 44.209 1.00 31.65 ? 168  GLU B C   1 
ATOM   5810 O O   . GLU B 1 168 ? 10.869  -11.840 44.364 1.00 32.48 ? 168  GLU B O   1 
ATOM   5811 C CB  . GLU B 1 168 ? 8.660   -12.305 41.931 1.00 32.32 ? 168  GLU B CB  1 
ATOM   5812 C CG  . GLU B 1 168 ? 8.607   -13.020 40.590 1.00 33.98 ? 168  GLU B CG  1 
ATOM   5813 C CD  . GLU B 1 168 ? 9.981   -13.287 40.011 1.00 38.83 ? 168  GLU B CD  1 
ATOM   5814 O OE1 . GLU B 1 168 ? 10.355  -14.479 39.884 1.00 39.62 ? 168  GLU B OE1 1 
ATOM   5815 O OE2 . GLU B 1 168 ? 10.688  -12.306 39.680 1.00 35.28 ? 168  GLU B OE2 1 
ATOM   5816 N N   . ALA B 1 169 ? 8.718   -11.720 44.998 1.00 30.57 ? 169  ALA B N   1 
ATOM   5817 C CA  . ALA B 1 169 ? 8.981   -10.795 46.094 1.00 31.34 ? 169  ALA B CA  1 
ATOM   5818 C C   . ALA B 1 169 ? 9.822   -11.415 47.203 1.00 33.54 ? 169  ALA B C   1 
ATOM   5819 O O   . ALA B 1 169 ? 10.592  -10.715 47.875 1.00 32.25 ? 169  ALA B O   1 
ATOM   5820 C CB  . ALA B 1 169 ? 7.669   -10.296 46.672 1.00 29.91 ? 169  ALA B CB  1 
ATOM   5821 N N   . LEU B 1 170 ? 9.677   -12.726 47.383 1.00 32.72 ? 170  LEU B N   1 
ATOM   5822 C CA  . LEU B 1 170 ? 10.387  -13.446 48.437 1.00 33.78 ? 170  LEU B CA  1 
ATOM   5823 C C   . LEU B 1 170 ? 11.570  -14.309 47.992 1.00 35.48 ? 170  LEU B C   1 
ATOM   5824 O O   . LEU B 1 170 ? 11.981  -15.215 48.714 1.00 34.65 ? 170  LEU B O   1 
ATOM   5825 C CB  . LEU B 1 170 ? 9.396   -14.316 49.221 1.00 31.35 ? 170  LEU B CB  1 
ATOM   5826 C CG  . LEU B 1 170 ? 8.210   -13.612 49.884 1.00 34.66 ? 170  LEU B CG  1 
ATOM   5827 C CD1 . LEU B 1 170 ? 7.378   -14.630 50.648 1.00 33.84 ? 170  LEU B CD1 1 
ATOM   5828 C CD2 . LEU B 1 170 ? 8.702   -12.506 50.824 1.00 33.53 ? 170  LEU B CD2 1 
ATOM   5829 N N   . LYS B 1 171 ? 12.126  -14.028 46.819 1.00 35.93 ? 171  LYS B N   1 
ATOM   5830 C CA  . LYS B 1 171 ? 13.266  -14.798 46.326 1.00 38.18 ? 171  LYS B CA  1 
ATOM   5831 C C   . LYS B 1 171 ? 14.354  -15.044 47.381 1.00 38.38 ? 171  LYS B C   1 
ATOM   5832 O O   . LYS B 1 171 ? 14.864  -16.163 47.510 1.00 37.39 ? 171  LYS B O   1 
ATOM   5833 C CB  . LYS B 1 171 ? 13.881  -14.107 45.105 1.00 40.36 ? 171  LYS B CB  1 
ATOM   5834 C CG  . LYS B 1 171 ? 13.091  -14.304 43.834 1.00 44.84 ? 171  LYS B CG  1 
ATOM   5835 C CD  . LYS B 1 171 ? 13.010  -15.785 43.451 1.00 45.89 ? 171  LYS B CD  1 
ATOM   5836 C CE  . LYS B 1 171 ? 12.113  -15.983 42.232 1.00 48.20 ? 171  LYS B CE  1 
ATOM   5837 N NZ  . LYS B 1 171 ? 12.078  -17.392 41.744 1.00 45.82 ? 171  LYS B NZ  1 
ATOM   5838 N N   . PRO B 1 172 ? 14.716  -14.011 48.158 1.00 36.88 ? 172  PRO B N   1 
ATOM   5839 C CA  . PRO B 1 172 ? 15.753  -14.178 49.183 1.00 37.43 ? 172  PRO B CA  1 
ATOM   5840 C C   . PRO B 1 172 ? 15.497  -15.306 50.176 1.00 39.01 ? 172  PRO B C   1 
ATOM   5841 O O   . PRO B 1 172 ? 16.421  -15.753 50.859 1.00 38.32 ? 172  PRO B O   1 
ATOM   5842 C CB  . PRO B 1 172 ? 15.771  -12.819 49.880 1.00 38.99 ? 172  PRO B CB  1 
ATOM   5843 C CG  . PRO B 1 172 ? 15.394  -11.879 48.779 1.00 38.66 ? 172  PRO B CG  1 
ATOM   5844 C CD  . PRO B 1 172 ? 14.254  -12.612 48.110 1.00 38.62 ? 172  PRO B CD  1 
ATOM   5845 N N   . TYR B 1 173 ? 14.249  -15.763 50.259 1.00 38.03 ? 173  TYR B N   1 
ATOM   5846 C CA  . TYR B 1 173 ? 13.882  -16.817 51.203 1.00 38.45 ? 173  TYR B CA  1 
ATOM   5847 C C   . TYR B 1 173 ? 13.698  -18.205 50.592 1.00 39.09 ? 173  TYR B C   1 
ATOM   5848 O O   . TYR B 1 173 ? 13.183  -19.107 51.254 1.00 38.17 ? 173  TYR B O   1 
ATOM   5849 C CB  . TYR B 1 173 ? 12.594  -16.421 51.929 1.00 36.74 ? 173  TYR B CB  1 
ATOM   5850 C CG  . TYR B 1 173 ? 12.695  -15.107 52.662 1.00 37.22 ? 173  TYR B CG  1 
ATOM   5851 C CD1 . TYR B 1 173 ? 12.516  -13.896 51.998 1.00 37.67 ? 173  TYR B CD1 1 
ATOM   5852 C CD2 . TYR B 1 173 ? 13.031  -15.075 54.014 1.00 37.71 ? 173  TYR B CD2 1 
ATOM   5853 C CE1 . TYR B 1 173 ? 12.676  -12.682 52.665 1.00 39.04 ? 173  TYR B CE1 1 
ATOM   5854 C CE2 . TYR B 1 173 ? 13.194  -13.883 54.686 1.00 39.19 ? 173  TYR B CE2 1 
ATOM   5855 C CZ  . TYR B 1 173 ? 13.021  -12.689 54.012 1.00 39.14 ? 173  TYR B CZ  1 
ATOM   5856 O OH  . TYR B 1 173 ? 13.226  -11.516 54.686 1.00 38.93 ? 173  TYR B OH  1 
ATOM   5857 N N   . SER B 1 174 ? 14.128  -18.389 49.349 1.00 40.87 ? 174  SER B N   1 
ATOM   5858 C CA  . SER B 1 174 ? 13.947  -19.675 48.674 1.00 43.85 ? 174  SER B CA  1 
ATOM   5859 C C   . SER B 1 174 ? 15.173  -20.577 48.553 1.00 44.80 ? 174  SER B C   1 
ATOM   5860 O O   . SER B 1 174 ? 15.285  -21.352 47.601 1.00 44.29 ? 174  SER B O   1 
ATOM   5861 C CB  . SER B 1 174 ? 13.372  -19.442 47.281 1.00 43.40 ? 174  SER B CB  1 
ATOM   5862 O OG  . SER B 1 174 ? 14.252  -18.651 46.507 1.00 45.67 ? 174  SER B OG  1 
ATOM   5863 N N   . SER B 1 175 ? 16.094  -20.481 49.501 1.00 46.82 ? 175  SER B N   1 
ATOM   5864 C CA  . SER B 1 175 ? 17.279  -21.331 49.450 1.00 48.51 ? 175  SER B CA  1 
ATOM   5865 C C   . SER B 1 175 ? 16.841  -22.739 49.840 1.00 48.79 ? 175  SER B C   1 
ATOM   5866 O O   . SER B 1 175 ? 16.078  -22.917 50.787 1.00 49.34 ? 175  SER B O   1 
ATOM   5867 C CB  . SER B 1 175 ? 18.347  -20.821 50.423 1.00 50.31 ? 175  SER B CB  1 
ATOM   5868 O OG  . SER B 1 175 ? 19.539  -21.583 50.318 1.00 52.44 ? 175  SER B OG  1 
ATOM   5869 N N   . GLY B 1 176 ? 17.311  -23.738 49.103 1.00 49.88 ? 176  GLY B N   1 
ATOM   5870 C CA  . GLY B 1 176 ? 16.932  -25.105 49.413 1.00 50.82 ? 176  GLY B CA  1 
ATOM   5871 C C   . GLY B 1 176 ? 15.561  -25.443 48.859 1.00 51.50 ? 176  GLY B C   1 
ATOM   5872 O O   . GLY B 1 176 ? 14.860  -26.312 49.384 1.00 52.86 ? 176  GLY B O   1 
ATOM   5873 N N   . GLY B 1 177 ? 15.176  -24.739 47.800 1.00 51.45 ? 177  GLY B N   1 
ATOM   5874 C CA  . GLY B 1 177 ? 13.891  -24.976 47.168 1.00 50.81 ? 177  GLY B CA  1 
ATOM   5875 C C   . GLY B 1 177 ? 14.084  -25.171 45.677 1.00 49.62 ? 177  GLY B C   1 
ATOM   5876 O O   . GLY B 1 177 ? 14.991  -24.579 45.100 1.00 50.81 ? 177  GLY B O   1 
ATOM   5877 N N   . PRO B 1 178 ? 13.255  -25.998 45.021 1.00 48.51 ? 178  PRO B N   1 
ATOM   5878 C CA  . PRO B 1 178 ? 13.414  -26.209 43.581 1.00 46.68 ? 178  PRO B CA  1 
ATOM   5879 C C   . PRO B 1 178 ? 13.074  -24.947 42.796 1.00 45.83 ? 178  PRO B C   1 
ATOM   5880 O O   . PRO B 1 178 ? 12.471  -24.016 43.337 1.00 45.58 ? 178  PRO B O   1 
ATOM   5881 C CB  . PRO B 1 178 ? 12.441  -27.350 43.297 1.00 46.80 ? 178  PRO B CB  1 
ATOM   5882 C CG  . PRO B 1 178 ? 11.333  -27.071 44.258 1.00 46.49 ? 178  PRO B CG  1 
ATOM   5883 C CD  . PRO B 1 178 ? 12.082  -26.732 45.533 1.00 47.74 ? 178  PRO B CD  1 
ATOM   5884 N N   . ARG B 1 179 ? 13.467  -24.907 41.527 1.00 44.31 ? 179  ARG B N   1 
ATOM   5885 C CA  . ARG B 1 179 ? 13.161  -23.749 40.693 1.00 43.55 ? 179  ARG B CA  1 
ATOM   5886 C C   . ARG B 1 179 ? 11.653  -23.751 40.444 1.00 42.45 ? 179  ARG B C   1 
ATOM   5887 O O   . ARG B 1 179 ? 11.050  -24.814 40.273 1.00 40.32 ? 179  ARG B O   1 
ATOM   5888 C CB  . ARG B 1 179 ? 13.906  -23.828 39.358 1.00 44.32 ? 179  ARG B CB  1 
ATOM   5889 C CG  . ARG B 1 179 ? 15.426  -23.693 39.464 1.00 45.98 ? 179  ARG B CG  1 
ATOM   5890 C CD  . ARG B 1 179 ? 16.072  -23.707 38.078 1.00 45.30 ? 179  ARG B CD  1 
ATOM   5891 N NE  . ARG B 1 179 ? 16.084  -25.044 37.486 1.00 46.71 ? 179  ARG B NE  1 
ATOM   5892 C CZ  . ARG B 1 179 ? 16.920  -26.009 37.851 1.00 48.38 ? 179  ARG B CZ  1 
ATOM   5893 N NH1 . ARG B 1 179 ? 17.815  -25.780 38.803 1.00 49.34 ? 179  ARG B NH1 1 
ATOM   5894 N NH2 . ARG B 1 179 ? 16.861  -27.203 37.272 1.00 46.88 ? 179  ARG B NH2 1 
ATOM   5895 N N   . VAL B 1 180 ? 11.046  -22.568 40.439 1.00 39.75 ? 180  VAL B N   1 
ATOM   5896 C CA  . VAL B 1 180 ? 9.609   -22.460 40.214 1.00 39.37 ? 180  VAL B CA  1 
ATOM   5897 C C   . VAL B 1 180 ? 9.310   -21.706 38.917 1.00 38.37 ? 180  VAL B C   1 
ATOM   5898 O O   . VAL B 1 180 ? 9.897   -20.651 38.641 1.00 35.40 ? 180  VAL B O   1 
ATOM   5899 C CB  . VAL B 1 180 ? 8.913   -21.753 41.408 1.00 41.06 ? 180  VAL B CB  1 
ATOM   5900 C CG1 . VAL B 1 180 ? 7.407   -21.722 41.205 1.00 43.85 ? 180  VAL B CG1 1 
ATOM   5901 C CG2 . VAL B 1 180 ? 9.236   -22.487 42.692 1.00 43.69 ? 180  VAL B CG2 1 
ATOM   5902 N N   . TRP B 1 181 ? 8.403   -22.264 38.121 1.00 37.26 ? 181  TRP B N   1 
ATOM   5903 C CA  . TRP B 1 181 ? 8.011   -21.674 36.846 1.00 36.46 ? 181  TRP B CA  1 
ATOM   5904 C C   . TRP B 1 181 ? 6.507   -21.439 36.820 1.00 36.25 ? 181  TRP B C   1 
ATOM   5905 O O   . TRP B 1 181 ? 5.745   -22.196 37.421 1.00 35.32 ? 181  TRP B O   1 
ATOM   5906 C CB  . TRP B 1 181 ? 8.350   -22.606 35.683 1.00 38.06 ? 181  TRP B CB  1 
ATOM   5907 C CG  . TRP B 1 181 ? 9.772   -23.002 35.578 1.00 41.63 ? 181  TRP B CG  1 
ATOM   5908 C CD1 . TRP B 1 181 ? 10.469  -23.803 36.439 1.00 41.36 ? 181  TRP B CD1 1 
ATOM   5909 C CD2 . TRP B 1 181 ? 10.684  -22.635 34.540 1.00 42.62 ? 181  TRP B CD2 1 
ATOM   5910 N NE1 . TRP B 1 181 ? 11.759  -23.958 35.997 1.00 41.62 ? 181  TRP B NE1 1 
ATOM   5911 C CE2 . TRP B 1 181 ? 11.920  -23.252 34.833 1.00 42.92 ? 181  TRP B CE2 1 
ATOM   5912 C CE3 . TRP B 1 181 ? 10.579  -21.844 33.387 1.00 43.89 ? 181  TRP B CE3 1 
ATOM   5913 C CZ2 . TRP B 1 181 ? 13.046  -23.104 34.014 1.00 44.45 ? 181  TRP B CZ2 1 
ATOM   5914 C CZ3 . TRP B 1 181 ? 11.697  -21.698 32.573 1.00 44.00 ? 181  TRP B CZ3 1 
ATOM   5915 C CH2 . TRP B 1 181 ? 12.916  -22.327 32.892 1.00 45.20 ? 181  TRP B CH2 1 
ATOM   5916 N N   . PHE B 1 182 ? 6.086   -20.392 36.118 1.00 34.13 ? 182  PHE B N   1 
ATOM   5917 C CA  . PHE B 1 182 ? 4.671   -20.088 35.994 1.00 33.41 ? 182  PHE B CA  1 
ATOM   5918 C C   . PHE B 1 182 ? 4.283   -19.958 34.521 1.00 34.27 ? 182  PHE B C   1 
ATOM   5919 O O   . PHE B 1 182 ? 4.811   -19.110 33.795 1.00 36.00 ? 182  PHE B O   1 
ATOM   5920 C CB  . PHE B 1 182 ? 4.324   -18.800 36.750 1.00 33.46 ? 182  PHE B CB  1 
ATOM   5921 C CG  . PHE B 1 182 ? 4.590   -18.876 38.226 1.00 32.51 ? 182  PHE B CG  1 
ATOM   5922 C CD1 . PHE B 1 182 ? 5.856   -18.581 38.736 1.00 31.07 ? 182  PHE B CD1 1 
ATOM   5923 C CD2 . PHE B 1 182 ? 3.592   -19.286 39.104 1.00 32.42 ? 182  PHE B CD2 1 
ATOM   5924 C CE1 . PHE B 1 182 ? 6.121   -18.696 40.101 1.00 31.62 ? 182  PHE B CE1 1 
ATOM   5925 C CE2 . PHE B 1 182 ? 3.845   -19.404 40.466 1.00 32.48 ? 182  PHE B CE2 1 
ATOM   5926 C CZ  . PHE B 1 182 ? 5.114   -19.108 40.966 1.00 33.06 ? 182  PHE B CZ  1 
ATOM   5927 N N   . VAL B 1 183 ? 3.381   -20.834 34.087 1.00 33.01 ? 183  VAL B N   1 
ATOM   5928 C CA  . VAL B 1 183 ? 2.870   -20.851 32.720 1.00 33.05 ? 183  VAL B CA  1 
ATOM   5929 C C   . VAL B 1 183 ? 1.405   -20.452 32.871 1.00 32.71 ? 183  VAL B C   1 
ATOM   5930 O O   . VAL B 1 183 ? 0.695   -21.025 33.693 1.00 33.55 ? 183  VAL B O   1 
ATOM   5931 C CB  . VAL B 1 183 ? 2.966   -22.267 32.115 1.00 32.95 ? 183  VAL B CB  1 
ATOM   5932 C CG1 . VAL B 1 183 ? 2.289   -22.317 30.745 1.00 34.75 ? 183  VAL B CG1 1 
ATOM   5933 C CG2 . VAL B 1 183 ? 4.420   -22.674 31.997 1.00 34.96 ? 183  VAL B CG2 1 
ATOM   5934 N N   . SER B 1 184 ? 0.947   -19.466 32.108 1.00 31.38 ? 184  SER B N   1 
ATOM   5935 C CA  . SER B 1 184 ? -0.439  -19.032 32.250 1.00 29.92 ? 184  SER B CA  1 
ATOM   5936 C C   . SER B 1 184 ? -1.178  -18.728 30.950 1.00 31.93 ? 184  SER B C   1 
ATOM   5937 O O   . SER B 1 184 ? -2.303  -19.187 30.749 1.00 32.33 ? 184  SER B O   1 
ATOM   5938 C CB  . SER B 1 184 ? -0.492  -17.805 33.167 1.00 29.88 ? 184  SER B CB  1 
ATOM   5939 O OG  . SER B 1 184 ? 0.296   -16.756 32.643 1.00 27.63 ? 184  SER B OG  1 
ATOM   5940 N N   . ASN B 1 185 ? -0.550  -17.949 30.073 1.00 32.15 ? 185  ASN B N   1 
ATOM   5941 C CA  . ASN B 1 185 ? -1.172  -17.577 28.804 1.00 33.04 ? 185  ASN B CA  1 
ATOM   5942 C C   . ASN B 1 185 ? -1.423  -18.809 27.934 1.00 33.00 ? 185  ASN B C   1 
ATOM   5943 O O   . ASN B 1 185 ? -0.633  -19.753 27.947 1.00 33.09 ? 185  ASN B O   1 
ATOM   5944 C CB  . ASN B 1 185 ? -0.258  -16.613 28.046 1.00 31.00 ? 185  ASN B CB  1 
ATOM   5945 C CG  . ASN B 1 185 ? -1.013  -15.723 27.080 1.00 32.91 ? 185  ASN B CG  1 
ATOM   5946 O OD1 . ASN B 1 185 ? -2.083  -16.078 26.586 1.00 31.02 ? 185  ASN B OD1 1 
ATOM   5947 N ND2 . ASN B 1 185 ? -0.447  -14.552 26.800 1.00 30.36 ? 185  ASN B ND2 1 
ATOM   5948 N N   . ILE B 1 186 ? -2.521  -18.794 27.184 1.00 32.45 ? 186  ILE B N   1 
ATOM   5949 C CA  . ILE B 1 186 ? -2.836  -19.895 26.278 1.00 32.66 ? 186  ILE B CA  1 
ATOM   5950 C C   . ILE B 1 186 ? -1.872  -19.791 25.099 1.00 33.45 ? 186  ILE B C   1 
ATOM   5951 O O   . ILE B 1 186 ? -1.570  -20.789 24.445 1.00 32.45 ? 186  ILE B O   1 
ATOM   5952 C CB  . ILE B 1 186 ? -4.295  -19.822 25.761 1.00 32.06 ? 186  ILE B CB  1 
ATOM   5953 C CG1 . ILE B 1 186 ? -4.551  -20.958 24.764 1.00 31.52 ? 186  ILE B CG1 1 
ATOM   5954 C CG2 . ILE B 1 186 ? -4.573  -18.460 25.137 1.00 32.15 ? 186  ILE B CG2 1 
ATOM   5955 C CD1 . ILE B 1 186 ? -4.544  -22.336 25.410 1.00 31.89 ? 186  ILE B CD1 1 
ATOM   5956 N N   . ASP B 1 187 ? -1.395  -18.573 24.832 1.00 31.01 ? 187  ASP B N   1 
ATOM   5957 C CA  . ASP B 1 187 ? -0.426  -18.336 23.761 1.00 31.95 ? 187  ASP B CA  1 
ATOM   5958 C C   . ASP B 1 187 ? 0.645   -19.415 23.925 1.00 31.82 ? 187  ASP B C   1 
ATOM   5959 O O   . ASP B 1 187 ? 1.270   -19.510 24.982 1.00 31.39 ? 187  ASP B O   1 
ATOM   5960 C CB  . ASP B 1 187 ? 0.192   -16.937 23.922 1.00 32.27 ? 187  ASP B CB  1 
ATOM   5961 C CG  . ASP B 1 187 ? 1.317   -16.665 22.937 1.00 32.67 ? 187  ASP B CG  1 
ATOM   5962 O OD1 . ASP B 1 187 ? 1.877   -15.551 22.977 1.00 35.36 ? 187  ASP B OD1 1 
ATOM   5963 O OD2 . ASP B 1 187 ? 1.646   -17.554 22.122 1.00 33.99 ? 187  ASP B OD2 1 
ATOM   5964 N N   . GLY B 1 188 ? 0.831   -20.228 22.885 1.00 32.11 ? 188  GLY B N   1 
ATOM   5965 C CA  . GLY B 1 188 ? 1.786   -21.326 22.917 1.00 33.64 ? 188  GLY B CA  1 
ATOM   5966 C C   . GLY B 1 188 ? 3.212   -21.001 23.312 1.00 35.44 ? 188  GLY B C   1 
ATOM   5967 O O   . GLY B 1 188 ? 3.938   -21.860 23.813 1.00 36.53 ? 188  GLY B O   1 
ATOM   5968 N N   . THR B 1 189 ? 3.624   -19.764 23.076 1.00 35.12 ? 189  THR B N   1 
ATOM   5969 C CA  . THR B 1 189 ? 4.971   -19.338 23.422 1.00 36.01 ? 189  THR B CA  1 
ATOM   5970 C C   . THR B 1 189 ? 5.305   -19.588 24.899 1.00 36.51 ? 189  THR B C   1 
ATOM   5971 O O   . THR B 1 189 ? 6.409   -20.017 25.237 1.00 35.72 ? 189  THR B O   1 
ATOM   5972 C CB  . THR B 1 189 ? 5.149   -17.840 23.121 1.00 36.18 ? 189  THR B CB  1 
ATOM   5973 O OG1 . THR B 1 189 ? 5.093   -17.635 21.701 1.00 36.46 ? 189  THR B OG1 1 
ATOM   5974 C CG2 . THR B 1 189 ? 6.471   -17.333 23.671 1.00 34.90 ? 189  THR B CG2 1 
ATOM   5975 N N   . HIS B 1 190 ? 4.340   -19.339 25.773 1.00 35.58 ? 190  HIS B N   1 
ATOM   5976 C CA  . HIS B 1 190 ? 4.559   -19.504 27.207 1.00 35.21 ? 190  HIS B CA  1 
ATOM   5977 C C   . HIS B 1 190 ? 4.969   -20.922 27.626 1.00 37.29 ? 190  HIS B C   1 
ATOM   5978 O O   . HIS B 1 190 ? 6.023   -21.116 28.239 1.00 36.89 ? 190  HIS B O   1 
ATOM   5979 C CB  . HIS B 1 190 ? 3.306   -19.072 27.967 1.00 34.98 ? 190  HIS B CB  1 
ATOM   5980 C CG  . HIS B 1 190 ? 3.595   -18.387 29.269 1.00 33.65 ? 190  HIS B CG  1 
ATOM   5981 N ND1 . HIS B 1 190 ? 2.605   -17.861 30.067 1.00 32.96 ? 190  HIS B ND1 1 
ATOM   5982 C CD2 . HIS B 1 190 ? 4.764   -18.133 29.905 1.00 34.32 ? 190  HIS B CD2 1 
ATOM   5983 C CE1 . HIS B 1 190 ? 3.148   -17.309 31.138 1.00 34.58 ? 190  HIS B CE1 1 
ATOM   5984 N NE2 . HIS B 1 190 ? 4.459   -17.460 31.063 1.00 34.72 ? 190  HIS B NE2 1 
ATOM   5985 N N   . ILE B 1 191 ? 4.152   -21.914 27.293 1.00 35.76 ? 191  ILE B N   1 
ATOM   5986 C CA  . ILE B 1 191 ? 4.463   -23.286 27.675 1.00 36.67 ? 191  ILE B CA  1 
ATOM   5987 C C   . ILE B 1 191 ? 5.638   -23.873 26.887 1.00 37.67 ? 191  ILE B C   1 
ATOM   5988 O O   . ILE B 1 191 ? 6.442   -24.631 27.433 1.00 37.20 ? 191  ILE B O   1 
ATOM   5989 C CB  . ILE B 1 191 ? 3.225   -24.199 27.518 1.00 36.79 ? 191  ILE B CB  1 
ATOM   5990 C CG1 . ILE B 1 191 ? 3.496   -25.559 28.170 1.00 39.84 ? 191  ILE B CG1 1 
ATOM   5991 C CG2 . ILE B 1 191 ? 2.887   -24.376 26.046 1.00 35.36 ? 191  ILE B CG2 1 
ATOM   5992 C CD1 . ILE B 1 191 ? 2.411   -26.001 29.116 1.00 42.55 ? 191  ILE B CD1 1 
ATOM   5993 N N   . ALA B 1 192 ? 5.746   -23.522 25.609 1.00 38.00 ? 192  ALA B N   1 
ATOM   5994 C CA  . ALA B 1 192 ? 6.831   -24.033 24.781 1.00 38.63 ? 192  ALA B CA  1 
ATOM   5995 C C   . ALA B 1 192 ? 8.203   -23.587 25.289 1.00 40.05 ? 192  ALA B C   1 
ATOM   5996 O O   . ALA B 1 192 ? 9.136   -24.391 25.366 1.00 36.91 ? 192  ALA B O   1 
ATOM   5997 C CB  . ALA B 1 192 ? 6.642   -23.589 23.331 1.00 40.35 ? 192  ALA B CB  1 
ATOM   5998 N N   . LYS B 1 193 ? 8.331   -22.307 25.630 1.00 39.63 ? 193  LYS B N   1 
ATOM   5999 C CA  . LYS B 1 193 ? 9.603   -21.791 26.120 1.00 43.12 ? 193  LYS B CA  1 
ATOM   6000 C C   . LYS B 1 193 ? 9.984   -22.379 27.473 1.00 43.05 ? 193  LYS B C   1 
ATOM   6001 O O   . LYS B 1 193 ? 11.166  -22.535 27.782 1.00 41.98 ? 193  LYS B O   1 
ATOM   6002 C CB  . LYS B 1 193 ? 9.560   -20.263 26.201 1.00 46.03 ? 193  LYS B CB  1 
ATOM   6003 C CG  . LYS B 1 193 ? 9.595   -19.572 24.841 1.00 48.71 ? 193  LYS B CG  1 
ATOM   6004 C CD  . LYS B 1 193 ? 11.004  -19.519 24.248 1.00 53.57 ? 193  LYS B CD  1 
ATOM   6005 C CE  . LYS B 1 193 ? 11.580  -20.898 23.947 1.00 55.77 ? 193  LYS B CE  1 
ATOM   6006 N NZ  . LYS B 1 193 ? 10.746  -21.667 22.980 1.00 59.11 ? 193  LYS B NZ  1 
ATOM   6007 N N   . THR B 1 194 ? 8.974   -22.706 28.271 1.00 42.74 ? 194  THR B N   1 
ATOM   6008 C CA  . THR B 1 194 ? 9.181   -23.290 29.591 1.00 43.65 ? 194  THR B CA  1 
ATOM   6009 C C   . THR B 1 194 ? 9.627   -24.751 29.479 1.00 44.89 ? 194  THR B C   1 
ATOM   6010 O O   . THR B 1 194 ? 10.598  -25.166 30.113 1.00 44.56 ? 194  THR B O   1 
ATOM   6011 C CB  . THR B 1 194 ? 7.885   -23.217 30.413 1.00 44.25 ? 194  THR B CB  1 
ATOM   6012 O OG1 . THR B 1 194 ? 7.526   -21.844 30.599 1.00 42.70 ? 194  THR B OG1 1 
ATOM   6013 C CG2 . THR B 1 194 ? 8.067   -23.881 31.771 1.00 44.26 ? 194  THR B CG2 1 
ATOM   6014 N N   . LEU B 1 195 ? 8.910   -25.526 28.673 1.00 45.67 ? 195  LEU B N   1 
ATOM   6015 C CA  . LEU B 1 195 ? 9.238   -26.935 28.472 1.00 48.02 ? 195  LEU B CA  1 
ATOM   6016 C C   . LEU B 1 195 ? 10.650  -27.105 27.911 1.00 49.41 ? 195  LEU B C   1 
ATOM   6017 O O   . LEU B 1 195 ? 11.359  -28.050 28.262 1.00 49.63 ? 195  LEU B O   1 
ATOM   6018 C CB  . LEU B 1 195 ? 8.226   -27.576 27.516 1.00 48.38 ? 195  LEU B CB  1 
ATOM   6019 C CG  . LEU B 1 195 ? 6.957   -28.222 28.085 1.00 48.84 ? 195  LEU B CG  1 
ATOM   6020 C CD1 . LEU B 1 195 ? 6.447   -27.452 29.281 1.00 50.43 ? 195  LEU B CD1 1 
ATOM   6021 C CD2 . LEU B 1 195 ? 5.904   -28.295 26.991 1.00 49.34 ? 195  LEU B CD2 1 
ATOM   6022 N N   . ALA B 1 196 ? 11.056  -26.180 27.046 1.00 49.84 ? 196  ALA B N   1 
ATOM   6023 C CA  . ALA B 1 196 ? 12.376  -26.231 26.425 1.00 50.42 ? 196  ALA B CA  1 
ATOM   6024 C C   . ALA B 1 196 ? 13.522  -26.251 27.431 1.00 50.27 ? 196  ALA B C   1 
ATOM   6025 O O   . ALA B 1 196 ? 14.623  -26.700 27.115 1.00 50.96 ? 196  ALA B O   1 
ATOM   6026 C CB  . ALA B 1 196 ? 12.545  -25.048 25.477 1.00 49.09 ? 196  ALA B CB  1 
ATOM   6027 N N   . CYS B 1 197 ? 13.266  -25.767 28.641 1.00 50.69 ? 197  CYS B N   1 
ATOM   6028 C CA  . CYS B 1 197 ? 14.297  -25.709 29.673 1.00 51.12 ? 197  CYS B CA  1 
ATOM   6029 C C   . CYS B 1 197 ? 14.178  -26.817 30.716 1.00 50.06 ? 197  CYS B C   1 
ATOM   6030 O O   . CYS B 1 197 ? 15.002  -26.909 31.624 1.00 49.59 ? 197  CYS B O   1 
ATOM   6031 C CB  . CYS B 1 197 ? 14.227  -24.361 30.401 1.00 52.50 ? 197  CYS B CB  1 
ATOM   6032 S SG  . CYS B 1 197 ? 14.314  -22.901 29.344 1.00 56.58 ? 197  CYS B SG  1 
ATOM   6033 N N   . LEU B 1 198 ? 13.167  -27.666 30.582 1.00 48.19 ? 198  LEU B N   1 
ATOM   6034 C CA  . LEU B 1 198 ? 12.944  -28.709 31.573 1.00 46.57 ? 198  LEU B CA  1 
ATOM   6035 C C   . LEU B 1 198 ? 13.312  -30.137 31.202 1.00 46.06 ? 198  LEU B C   1 
ATOM   6036 O O   . LEU B 1 198 ? 13.404  -30.498 30.029 1.00 43.31 ? 198  LEU B O   1 
ATOM   6037 C CB  . LEU B 1 198 ? 11.478  -28.689 31.998 1.00 47.05 ? 198  LEU B CB  1 
ATOM   6038 C CG  . LEU B 1 198 ? 10.915  -27.336 32.434 1.00 46.63 ? 198  LEU B CG  1 
ATOM   6039 C CD1 . LEU B 1 198 ? 9.408   -27.464 32.644 1.00 45.82 ? 198  LEU B CD1 1 
ATOM   6040 C CD2 . LEU B 1 198 ? 11.615  -26.872 33.702 1.00 46.16 ? 198  LEU B CD2 1 
ATOM   6041 N N   . ASN B 1 199 ? 13.520  -30.939 32.243 1.00 45.67 ? 199  ASN B N   1 
ATOM   6042 C CA  . ASN B 1 199 ? 13.824  -32.357 32.110 1.00 46.20 ? 199  ASN B CA  1 
ATOM   6043 C C   . ASN B 1 199 ? 12.591  -33.038 32.697 1.00 45.47 ? 199  ASN B C   1 
ATOM   6044 O O   . ASN B 1 199 ? 12.296  -32.892 33.885 1.00 44.74 ? 199  ASN B O   1 
ATOM   6045 C CB  . ASN B 1 199 ? 15.056  -32.741 32.937 1.00 47.07 ? 199  ASN B CB  1 
ATOM   6046 C CG  . ASN B 1 199 ? 15.408  -34.216 32.807 1.00 47.15 ? 199  ASN B CG  1 
ATOM   6047 O OD1 . ASN B 1 199 ? 14.527  -35.066 32.689 1.00 47.24 ? 199  ASN B OD1 1 
ATOM   6048 N ND2 . ASN B 1 199 ? 16.700  -34.524 32.843 1.00 50.24 ? 199  ASN B ND2 1 
ATOM   6049 N N   . PRO B 1 200 ? 11.843  -33.778 31.870 1.00 46.03 ? 200  PRO B N   1 
ATOM   6050 C CA  . PRO B 1 200 ? 10.645  -34.451 32.376 1.00 46.47 ? 200  PRO B CA  1 
ATOM   6051 C C   . PRO B 1 200 ? 10.888  -35.342 33.590 1.00 46.68 ? 200  PRO B C   1 
ATOM   6052 O O   . PRO B 1 200 ? 10.013  -35.491 34.439 1.00 46.37 ? 200  PRO B O   1 
ATOM   6053 C CB  . PRO B 1 200 ? 10.146  -35.231 31.160 1.00 46.95 ? 200  PRO B CB  1 
ATOM   6054 C CG  . PRO B 1 200 ? 11.396  -35.460 30.355 1.00 47.30 ? 200  PRO B CG  1 
ATOM   6055 C CD  . PRO B 1 200 ? 12.100  -34.138 30.466 1.00 47.18 ? 200  PRO B CD  1 
ATOM   6056 N N   . GLU B 1 201 ? 12.081  -35.919 33.677 1.00 46.25 ? 201  GLU B N   1 
ATOM   6057 C CA  . GLU B 1 201 ? 12.417  -36.800 34.788 1.00 46.98 ? 201  GLU B CA  1 
ATOM   6058 C C   . GLU B 1 201 ? 12.435  -36.118 36.152 1.00 46.10 ? 201  GLU B C   1 
ATOM   6059 O O   . GLU B 1 201 ? 12.168  -36.761 37.167 1.00 45.95 ? 201  GLU B O   1 
ATOM   6060 C CB  . GLU B 1 201 ? 13.781  -37.453 34.544 1.00 49.00 ? 201  GLU B CB  1 
ATOM   6061 C CG  . GLU B 1 201 ? 13.845  -38.337 33.313 1.00 51.10 ? 201  GLU B CG  1 
ATOM   6062 C CD  . GLU B 1 201 ? 15.219  -38.951 33.123 1.00 53.57 ? 201  GLU B CD  1 
ATOM   6063 O OE1 . GLU B 1 201 ? 15.676  -39.674 34.037 1.00 54.27 ? 201  GLU B OE1 1 
ATOM   6064 O OE2 . GLU B 1 201 ? 15.840  -38.709 32.065 1.00 54.28 ? 201  GLU B OE2 1 
ATOM   6065 N N   . SER B 1 202 ? 12.745  -34.824 36.174 1.00 44.89 ? 202  SER B N   1 
ATOM   6066 C CA  . SER B 1 202 ? 12.831  -34.074 37.425 1.00 44.09 ? 202  SER B CA  1 
ATOM   6067 C C   . SER B 1 202 ? 11.889  -32.871 37.524 1.00 43.34 ? 202  SER B C   1 
ATOM   6068 O O   . SER B 1 202 ? 12.123  -31.955 38.316 1.00 41.19 ? 202  SER B O   1 
ATOM   6069 C CB  . SER B 1 202 ? 14.274  -33.605 37.640 1.00 44.73 ? 202  SER B CB  1 
ATOM   6070 O OG  . SER B 1 202 ? 14.714  -32.797 36.561 1.00 43.86 ? 202  SER B OG  1 
ATOM   6071 N N   . SER B 1 203 ? 10.821  -32.885 36.735 1.00 42.58 ? 203  SER B N   1 
ATOM   6072 C CA  . SER B 1 203 ? 9.856   -31.792 36.742 1.00 42.36 ? 203  SER B CA  1 
ATOM   6073 C C   . SER B 1 203 ? 8.502   -32.203 37.304 1.00 42.24 ? 203  SER B C   1 
ATOM   6074 O O   . SER B 1 203 ? 7.956   -33.251 36.951 1.00 43.95 ? 203  SER B O   1 
ATOM   6075 C CB  . SER B 1 203 ? 9.677   -31.247 35.326 1.00 41.07 ? 203  SER B CB  1 
ATOM   6076 O OG  . SER B 1 203 ? 10.884  -30.676 34.854 1.00 42.71 ? 203  SER B OG  1 
ATOM   6077 N N   . LEU B 1 204 ? 7.975   -31.371 38.196 1.00 40.36 ? 204  LEU B N   1 
ATOM   6078 C CA  . LEU B 1 204 ? 6.680   -31.610 38.815 1.00 39.79 ? 204  LEU B CA  1 
ATOM   6079 C C   . LEU B 1 204 ? 5.744   -30.488 38.387 1.00 39.40 ? 204  LEU B C   1 
ATOM   6080 O O   . LEU B 1 204 ? 6.026   -29.308 38.619 1.00 39.45 ? 204  LEU B O   1 
ATOM   6081 C CB  . LEU B 1 204 ? 6.816   -31.621 40.342 1.00 41.25 ? 204  LEU B CB  1 
ATOM   6082 C CG  . LEU B 1 204 ? 5.585   -31.850 41.236 1.00 42.95 ? 204  LEU B CG  1 
ATOM   6083 C CD1 . LEU B 1 204 ? 4.711   -30.612 41.272 1.00 45.10 ? 204  LEU B CD1 1 
ATOM   6084 C CD2 . LEU B 1 204 ? 4.799   -33.040 40.737 1.00 43.90 ? 204  LEU B CD2 1 
ATOM   6085 N N   . PHE B 1 205 ? 4.641   -30.859 37.751 1.00 38.71 ? 205  PHE B N   1 
ATOM   6086 C CA  . PHE B 1 205 ? 3.656   -29.886 37.297 1.00 38.31 ? 205  PHE B CA  1 
ATOM   6087 C C   . PHE B 1 205 ? 2.516   -29.740 38.291 1.00 37.82 ? 205  PHE B C   1 
ATOM   6088 O O   . PHE B 1 205 ? 2.001   -30.729 38.813 1.00 37.72 ? 205  PHE B O   1 
ATOM   6089 C CB  . PHE B 1 205 ? 3.087   -30.290 35.935 1.00 37.68 ? 205  PHE B CB  1 
ATOM   6090 C CG  . PHE B 1 205 ? 4.108   -30.308 34.836 1.00 38.41 ? 205  PHE B CG  1 
ATOM   6091 C CD1 . PHE B 1 205 ? 4.906   -31.429 34.625 1.00 37.41 ? 205  PHE B CD1 1 
ATOM   6092 C CD2 . PHE B 1 205 ? 4.293   -29.191 34.026 1.00 37.69 ? 205  PHE B CD2 1 
ATOM   6093 C CE1 . PHE B 1 205 ? 5.873   -31.437 33.625 1.00 38.44 ? 205  PHE B CE1 1 
ATOM   6094 C CE2 . PHE B 1 205 ? 5.260   -29.187 33.022 1.00 38.66 ? 205  PHE B CE2 1 
ATOM   6095 C CZ  . PHE B 1 205 ? 6.050   -30.308 32.820 1.00 39.34 ? 205  PHE B CZ  1 
ATOM   6096 N N   . ILE B 1 206 ? 2.123   -28.494 38.545 1.00 35.03 ? 206  ILE B N   1 
ATOM   6097 C CA  . ILE B 1 206 ? 1.040   -28.193 39.465 1.00 35.33 ? 206  ILE B CA  1 
ATOM   6098 C C   . ILE B 1 206 ? -0.063  -27.528 38.647 1.00 36.00 ? 206  ILE B C   1 
ATOM   6099 O O   . ILE B 1 206 ? 0.139   -26.436 38.114 1.00 34.96 ? 206  ILE B O   1 
ATOM   6100 C CB  . ILE B 1 206 ? 1.499   -27.208 40.571 1.00 35.41 ? 206  ILE B CB  1 
ATOM   6101 C CG1 . ILE B 1 206 ? 2.649   -27.815 41.381 1.00 34.67 ? 206  ILE B CG1 1 
ATOM   6102 C CG2 . ILE B 1 206 ? 0.327   -26.862 41.472 1.00 36.32 ? 206  ILE B CG2 1 
ATOM   6103 C CD1 . ILE B 1 206 ? 3.115   -26.941 42.541 1.00 35.23 ? 206  ILE B CD1 1 
ATOM   6104 N N   . ILE B 1 207 ? -1.217  -28.180 38.533 1.00 34.08 ? 207  ILE B N   1 
ATOM   6105 C CA  . ILE B 1 207 ? -2.322  -27.613 37.767 1.00 36.00 ? 207  ILE B CA  1 
ATOM   6106 C C   . ILE B 1 207 ? -3.240  -26.861 38.718 1.00 36.06 ? 207  ILE B C   1 
ATOM   6107 O O   . ILE B 1 207 ? -3.996  -27.462 39.486 1.00 36.58 ? 207  ILE B O   1 
ATOM   6108 C CB  . ILE B 1 207 ? -3.128  -28.708 37.032 1.00 37.11 ? 207  ILE B CB  1 
ATOM   6109 C CG1 . ILE B 1 207 ? -2.175  -29.645 36.275 1.00 37.61 ? 207  ILE B CG1 1 
ATOM   6110 C CG2 . ILE B 1 207 ? -4.111  -28.069 36.069 1.00 36.75 ? 207  ILE B CG2 1 
ATOM   6111 C CD1 . ILE B 1 207 ? -1.219  -28.949 35.319 1.00 34.93 ? 207  ILE B CD1 1 
ATOM   6112 N N   . ALA B 1 208 ? -3.161  -25.534 38.666 1.00 36.38 ? 208  ALA B N   1 
ATOM   6113 C CA  . ALA B 1 208 ? -3.954  -24.679 39.534 1.00 33.92 ? 208  ALA B CA  1 
ATOM   6114 C C   . ALA B 1 208 ? -5.212  -24.184 38.841 1.00 34.99 ? 208  ALA B C   1 
ATOM   6115 O O   . ALA B 1 208 ? -5.145  -23.439 37.858 1.00 33.51 ? 208  ALA B O   1 
ATOM   6116 C CB  . ALA B 1 208 ? -3.109  -23.490 40.003 1.00 36.04 ? 208  ALA B CB  1 
ATOM   6117 N N   . SER B 1 209 ? -6.362  -24.592 39.361 1.00 34.39 ? 209  SER B N   1 
ATOM   6118 C CA  . SER B 1 209 ? -7.632  -24.181 38.784 1.00 36.93 ? 209  SER B CA  1 
ATOM   6119 C C   . SER B 1 209 ? -8.783  -24.468 39.739 1.00 37.78 ? 209  SER B C   1 
ATOM   6120 O O   . SER B 1 209 ? -9.068  -25.622 40.047 1.00 38.46 ? 209  SER B O   1 
ATOM   6121 C CB  . SER B 1 209 ? -7.859  -24.906 37.460 1.00 35.06 ? 209  SER B CB  1 
ATOM   6122 O OG  . SER B 1 209 ? -9.050  -24.457 36.837 1.00 35.90 ? 209  SER B OG  1 
ATOM   6123 N N   . LYS B 1 210 ? -9.439  -23.409 40.206 1.00 36.32 ? 210  LYS B N   1 
ATOM   6124 C CA  . LYS B 1 210 ? -10.558 -23.540 41.129 1.00 37.69 ? 210  LYS B CA  1 
ATOM   6125 C C   . LYS B 1 210 ? -11.634 -24.459 40.552 1.00 38.88 ? 210  LYS B C   1 
ATOM   6126 O O   . LYS B 1 210 ? -12.116 -25.368 41.229 1.00 38.28 ? 210  LYS B O   1 
ATOM   6127 C CB  . LYS B 1 210 ? -11.150 -22.153 41.439 1.00 36.22 ? 210  LYS B CB  1 
ATOM   6128 C CG  . LYS B 1 210 ? -12.313 -22.164 42.430 1.00 35.33 ? 210  LYS B CG  1 
ATOM   6129 C CD  . LYS B 1 210 ? -12.751 -20.755 42.808 1.00 35.76 ? 210  LYS B CD  1 
ATOM   6130 C CE  . LYS B 1 210 ? -13.899 -20.779 43.812 1.00 32.42 ? 210  LYS B CE  1 
ATOM   6131 N NZ  . LYS B 1 210 ? -14.286 -19.407 44.287 1.00 33.91 ? 210  LYS B NZ  1 
ATOM   6132 N N   . THR B 1 211 ? -11.980 -24.225 39.287 1.00 40.72 ? 211  THR B N   1 
ATOM   6133 C CA  . THR B 1 211 ? -13.009 -24.989 38.576 1.00 39.95 ? 211  THR B CA  1 
ATOM   6134 C C   . THR B 1 211 ? -12.458 -26.188 37.815 1.00 38.99 ? 211  THR B C   1 
ATOM   6135 O O   . THR B 1 211 ? -13.168 -27.165 37.577 1.00 38.35 ? 211  THR B O   1 
ATOM   6136 C CB  . THR B 1 211 ? -13.712 -24.107 37.536 1.00 40.08 ? 211  THR B CB  1 
ATOM   6137 O OG1 . THR B 1 211 ? -12.745 -23.670 36.569 1.00 42.10 ? 211  THR B OG1 1 
ATOM   6138 C CG2 . THR B 1 211 ? -14.358 -22.890 38.197 1.00 41.92 ? 211  THR B CG2 1 
ATOM   6139 N N   . PHE B 1 212 ? -11.195 -26.083 37.414 1.00 38.05 ? 212  PHE B N   1 
ATOM   6140 C CA  . PHE B 1 212 ? -10.512 -27.114 36.642 1.00 36.42 ? 212  PHE B CA  1 
ATOM   6141 C C   . PHE B 1 212 ? -11.166 -27.290 35.270 1.00 37.93 ? 212  PHE B C   1 
ATOM   6142 O O   . PHE B 1 212 ? -11.161 -28.379 34.698 1.00 33.65 ? 212  PHE B O   1 
ATOM   6143 C CB  . PHE B 1 212 ? -10.498 -28.453 37.390 1.00 39.28 ? 212  PHE B CB  1 
ATOM   6144 C CG  . PHE B 1 212 ? -9.180  -29.175 37.295 1.00 39.03 ? 212  PHE B CG  1 
ATOM   6145 C CD1 . PHE B 1 212 ? -8.099  -28.775 38.080 1.00 37.73 ? 212  PHE B CD1 1 
ATOM   6146 C CD2 . PHE B 1 212 ? -9.004  -30.218 36.391 1.00 38.41 ? 212  PHE B CD2 1 
ATOM   6147 C CE1 . PHE B 1 212 ? -6.858  -29.402 37.965 1.00 39.87 ? 212  PHE B CE1 1 
ATOM   6148 C CE2 . PHE B 1 212 ? -7.768  -30.855 36.264 1.00 39.03 ? 212  PHE B CE2 1 
ATOM   6149 C CZ  . PHE B 1 212 ? -6.690  -30.447 37.052 1.00 38.44 ? 212  PHE B CZ  1 
ATOM   6150 N N   . THR B 1 213 ? -11.722 -26.202 34.741 1.00 37.57 ? 213  THR B N   1 
ATOM   6151 C CA  . THR B 1 213 ? -12.368 -26.236 33.432 1.00 38.12 ? 213  THR B CA  1 
ATOM   6152 C C   . THR B 1 213 ? -11.889 -25.092 32.539 1.00 36.80 ? 213  THR B C   1 
ATOM   6153 O O   . THR B 1 213 ? -12.135 -25.092 31.336 1.00 38.20 ? 213  THR B O   1 
ATOM   6154 C CB  . THR B 1 213 ? -13.908 -26.159 33.566 1.00 36.77 ? 213  THR B CB  1 
ATOM   6155 O OG1 . THR B 1 213 ? -14.280 -24.906 34.155 1.00 40.84 ? 213  THR B OG1 1 
ATOM   6156 C CG2 . THR B 1 213 ? -14.419 -27.296 34.445 1.00 37.31 ? 213  THR B CG2 1 
ATOM   6157 N N   . THR B 1 214 ? -11.201 -24.120 33.130 1.00 36.73 ? 214  THR B N   1 
ATOM   6158 C CA  . THR B 1 214 ? -10.696 -22.981 32.369 1.00 35.69 ? 214  THR B CA  1 
ATOM   6159 C C   . THR B 1 214 ? -9.935  -23.479 31.144 1.00 35.18 ? 214  THR B C   1 
ATOM   6160 O O   . THR B 1 214 ? -9.020  -24.299 31.256 1.00 36.37 ? 214  THR B O   1 
ATOM   6161 C CB  . THR B 1 214 ? -9.777  -22.119 33.244 1.00 35.23 ? 214  THR B CB  1 
ATOM   6162 O OG1 . THR B 1 214 ? -10.516 -21.662 34.384 1.00 34.63 ? 214  THR B OG1 1 
ATOM   6163 C CG2 . THR B 1 214 ? -9.256  -20.925 32.464 1.00 35.07 ? 214  THR B CG2 1 
ATOM   6164 N N   . GLN B 1 215 ? -10.308 -22.976 29.972 1.00 33.60 ? 215  GLN B N   1 
ATOM   6165 C CA  . GLN B 1 215 ? -9.685  -23.410 28.735 1.00 32.57 ? 215  GLN B CA  1 
ATOM   6166 C C   . GLN B 1 215 ? -8.169  -23.268 28.650 1.00 32.68 ? 215  GLN B C   1 
ATOM   6167 O O   . GLN B 1 215 ? -7.487  -24.203 28.255 1.00 31.39 ? 215  GLN B O   1 
ATOM   6168 C CB  . GLN B 1 215 ? -10.322 -22.708 27.536 1.00 35.21 ? 215  GLN B CB  1 
ATOM   6169 C CG  . GLN B 1 215 ? -9.866  -23.317 26.217 1.00 36.19 ? 215  GLN B CG  1 
ATOM   6170 C CD  . GLN B 1 215 ? -10.601 -22.776 25.016 1.00 37.36 ? 215  GLN B CD  1 
ATOM   6171 O OE1 . GLN B 1 215 ? -10.690 -23.441 23.987 1.00 39.70 ? 215  GLN B OE1 1 
ATOM   6172 N NE2 . GLN B 1 215 ? -11.123 -21.567 25.131 1.00 35.48 ? 215  GLN B NE2 1 
ATOM   6173 N N   . GLU B 1 216 ? -7.636  -22.105 29.007 1.00 32.42 ? 216  GLU B N   1 
ATOM   6174 C CA  . GLU B 1 216 ? -6.194  -21.898 28.940 1.00 33.28 ? 216  GLU B CA  1 
ATOM   6175 C C   . GLU B 1 216 ? -5.411  -22.912 29.774 1.00 32.95 ? 216  GLU B C   1 
ATOM   6176 O O   . GLU B 1 216 ? -4.437  -23.496 29.302 1.00 32.59 ? 216  GLU B O   1 
ATOM   6177 C CB  . GLU B 1 216 ? -5.831  -20.484 29.416 1.00 33.77 ? 216  GLU B CB  1 
ATOM   6178 C CG  . GLU B 1 216 ? -6.346  -19.349 28.526 1.00 36.66 ? 216  GLU B CG  1 
ATOM   6179 C CD  . GLU B 1 216 ? -7.616  -18.682 29.054 1.00 38.99 ? 216  GLU B CD  1 
ATOM   6180 O OE1 . GLU B 1 216 ? -7.869  -17.529 28.646 1.00 38.17 ? 216  GLU B OE1 1 
ATOM   6181 O OE2 . GLU B 1 216 ? -8.360  -19.296 29.856 1.00 38.14 ? 216  GLU B OE2 1 
ATOM   6182 N N   . THR B 1 217 ? -5.840  -23.098 31.016 1.00 32.51 ? 217  THR B N   1 
ATOM   6183 C CA  . THR B 1 217 ? -5.166  -23.997 31.941 1.00 34.64 ? 217  THR B CA  1 
ATOM   6184 C C   . THR B 1 217 ? -5.253  -25.475 31.559 1.00 35.89 ? 217  THR B C   1 
ATOM   6185 O O   . THR B 1 217 ? -4.245  -26.181 31.578 1.00 33.97 ? 217  THR B O   1 
ATOM   6186 C CB  . THR B 1 217 ? -5.715  -23.816 33.362 1.00 35.82 ? 217  THR B CB  1 
ATOM   6187 O OG1 . THR B 1 217 ? -5.625  -22.433 33.729 1.00 36.76 ? 217  THR B OG1 1 
ATOM   6188 C CG2 . THR B 1 217 ? -4.916  -24.650 34.353 1.00 35.44 ? 217  THR B CG2 1 
ATOM   6189 N N   . ILE B 1 218 ? -6.446  -25.945 31.207 1.00 36.93 ? 218  ILE B N   1 
ATOM   6190 C CA  . ILE B 1 218 ? -6.595  -27.350 30.834 1.00 37.00 ? 218  ILE B CA  1 
ATOM   6191 C C   . ILE B 1 218 ? -5.828  -27.651 29.557 1.00 36.23 ? 218  ILE B C   1 
ATOM   6192 O O   . ILE B 1 218 ? -5.202  -28.701 29.439 1.00 36.76 ? 218  ILE B O   1 
ATOM   6193 C CB  . ILE B 1 218 ? -8.083  -27.739 30.653 1.00 38.66 ? 218  ILE B CB  1 
ATOM   6194 C CG1 . ILE B 1 218 ? -8.845  -27.511 31.964 1.00 38.30 ? 218  ILE B CG1 1 
ATOM   6195 C CG2 . ILE B 1 218 ? -8.197  -29.200 30.238 1.00 40.69 ? 218  ILE B CG2 1 
ATOM   6196 C CD1 . ILE B 1 218 ? -8.322  -28.324 33.150 1.00 37.92 ? 218  ILE B CD1 1 
ATOM   6197 N N   . THR B 1 219 ? -5.853  -26.727 28.599 1.00 35.42 ? 219  THR B N   1 
ATOM   6198 C CA  . THR B 1 219 ? -5.132  -26.948 27.354 1.00 35.48 ? 219  THR B CA  1 
ATOM   6199 C C   . THR B 1 219 ? -3.617  -26.976 27.604 1.00 36.27 ? 219  THR B C   1 
ATOM   6200 O O   . THR B 1 219 ? -2.906  -27.799 27.022 1.00 34.72 ? 219  THR B O   1 
ATOM   6201 C CB  . THR B 1 219 ? -5.459  -25.865 26.315 1.00 35.88 ? 219  THR B CB  1 
ATOM   6202 O OG1 . THR B 1 219 ? -6.877  -25.812 26.110 1.00 36.78 ? 219  THR B OG1 1 
ATOM   6203 C CG2 . THR B 1 219 ? -4.772  -26.182 25.000 1.00 35.52 ? 219  THR B CG2 1 
ATOM   6204 N N   . ASN B 1 220 ? -3.129  -26.076 28.461 1.00 33.98 ? 220  ASN B N   1 
ATOM   6205 C CA  . ASN B 1 220 ? -1.702  -26.044 28.798 1.00 33.50 ? 220  ASN B CA  1 
ATOM   6206 C C   . ASN B 1 220 ? -1.325  -27.330 29.531 1.00 32.68 ? 220  ASN B C   1 
ATOM   6207 O O   . ASN B 1 220 ? -0.257  -27.891 29.300 1.00 32.65 ? 220  ASN B O   1 
ATOM   6208 C CB  . ASN B 1 220 ? -1.366  -24.854 29.709 1.00 31.91 ? 220  ASN B CB  1 
ATOM   6209 C CG  . ASN B 1 220 ? -1.134  -23.566 28.940 1.00 29.39 ? 220  ASN B CG  1 
ATOM   6210 O OD1 . ASN B 1 220 ? -0.495  -23.563 27.895 1.00 28.33 ? 220  ASN B OD1 1 
ATOM   6211 N ND2 . ASN B 1 220 ? -1.639  -22.456 29.476 1.00 30.60 ? 220  ASN B ND2 1 
ATOM   6212 N N   . ALA B 1 221 ? -2.210  -27.773 30.422 1.00 34.95 ? 221  ALA B N   1 
ATOM   6213 C CA  . ALA B 1 221 ? -1.999  -28.986 31.206 1.00 36.97 ? 221  ALA B CA  1 
ATOM   6214 C C   . ALA B 1 221 ? -1.878  -30.213 30.309 1.00 38.38 ? 221  ALA B C   1 
ATOM   6215 O O   . ALA B 1 221 ? -1.011  -31.057 30.524 1.00 39.16 ? 221  ALA B O   1 
ATOM   6216 C CB  . ALA B 1 221 ? -3.140  -29.176 32.196 1.00 36.10 ? 221  ALA B CB  1 
ATOM   6217 N N   . LYS B 1 222 ? -2.753  -30.315 29.312 1.00 39.74 ? 222  LYS B N   1 
ATOM   6218 C CA  . LYS B 1 222 ? -2.721  -31.438 28.378 1.00 40.16 ? 222  LYS B CA  1 
ATOM   6219 C C   . LYS B 1 222 ? -1.442  -31.425 27.548 1.00 40.73 ? 222  LYS B C   1 
ATOM   6220 O O   . LYS B 1 222 ? -0.853  -32.472 27.275 1.00 41.13 ? 222  LYS B O   1 
ATOM   6221 C CB  . LYS B 1 222 ? -3.933  -31.396 27.446 1.00 42.23 ? 222  LYS B CB  1 
ATOM   6222 C CG  . LYS B 1 222 ? -5.189  -32.027 28.017 1.00 46.77 ? 222  LYS B CG  1 
ATOM   6223 C CD  . LYS B 1 222 ? -4.987  -33.519 28.299 1.00 51.48 ? 222  LYS B CD  1 
ATOM   6224 C CE  . LYS B 1 222 ? -4.587  -34.282 27.039 1.00 53.52 ? 222  LYS B CE  1 
ATOM   6225 N NZ  . LYS B 1 222 ? -4.362  -35.731 27.305 1.00 56.84 ? 222  LYS B NZ  1 
ATOM   6226 N N   . THR B 1 223 ? -1.014  -30.236 27.133 1.00 39.03 ? 223  THR B N   1 
ATOM   6227 C CA  . THR B 1 223 ? 0.207   -30.114 26.349 1.00 36.87 ? 223  THR B CA  1 
ATOM   6228 C C   . THR B 1 223 ? 1.396   -30.543 27.212 1.00 36.62 ? 223  THR B C   1 
ATOM   6229 O O   . THR B 1 223 ? 2.308   -31.211 26.733 1.00 36.14 ? 223  THR B O   1 
ATOM   6230 C CB  . THR B 1 223 ? 0.395   -28.663 25.860 1.00 35.71 ? 223  THR B CB  1 
ATOM   6231 O OG1 . THR B 1 223 ? -0.674  -28.339 24.966 1.00 38.52 ? 223  THR B OG1 1 
ATOM   6232 C CG2 . THR B 1 223 ? 1.719   -28.491 25.133 1.00 36.99 ? 223  THR B CG2 1 
ATOM   6233 N N   . ALA B 1 224 ? 1.375   -30.161 28.486 1.00 35.01 ? 224  ALA B N   1 
ATOM   6234 C CA  . ALA B 1 224 ? 2.450   -30.527 29.399 1.00 36.35 ? 224  ALA B CA  1 
ATOM   6235 C C   . ALA B 1 224 ? 2.495   -32.050 29.559 1.00 38.35 ? 224  ALA B C   1 
ATOM   6236 O O   . ALA B 1 224 ? 3.564   -32.663 29.475 1.00 38.33 ? 224  ALA B O   1 
ATOM   6237 C CB  . ALA B 1 224 ? 2.239   -29.869 30.754 1.00 32.24 ? 224  ALA B CB  1 
ATOM   6238 N N   . LYS B 1 225 ? 1.331   -32.654 29.790 1.00 39.92 ? 225  LYS B N   1 
ATOM   6239 C CA  . LYS B 1 225 ? 1.253   -34.100 29.965 1.00 43.13 ? 225  LYS B CA  1 
ATOM   6240 C C   . LYS B 1 225 ? 1.686   -34.839 28.704 1.00 44.43 ? 225  LYS B C   1 
ATOM   6241 O O   . LYS B 1 225 ? 2.409   -35.834 28.777 1.00 43.91 ? 225  LYS B O   1 
ATOM   6242 C CB  . LYS B 1 225 ? -0.165  -34.513 30.365 1.00 44.19 ? 225  LYS B CB  1 
ATOM   6243 C CG  . LYS B 1 225 ? -0.276  -35.988 30.737 1.00 48.15 ? 225  LYS B CG  1 
ATOM   6244 C CD  . LYS B 1 225 ? -1.576  -36.306 31.462 1.00 47.58 ? 225  LYS B CD  1 
ATOM   6245 C CE  . LYS B 1 225 ? -2.784  -36.077 30.577 1.00 49.70 ? 225  LYS B CE  1 
ATOM   6246 N NZ  . LYS B 1 225 ? -4.019  -36.615 31.205 1.00 52.71 ? 225  LYS B NZ  1 
ATOM   6247 N N   . ASP B 1 226 ? 1.247   -34.351 27.548 1.00 46.33 ? 226  ASP B N   1 
ATOM   6248 C CA  . ASP B 1 226 ? 1.615   -34.957 26.270 1.00 47.75 ? 226  ASP B CA  1 
ATOM   6249 C C   . ASP B 1 226 ? 3.129   -34.902 26.118 1.00 48.55 ? 226  ASP B C   1 
ATOM   6250 O O   . ASP B 1 226 ? 3.767   -35.877 25.715 1.00 48.30 ? 226  ASP B O   1 
ATOM   6251 C CB  . ASP B 1 226 ? 0.953   -34.203 25.111 1.00 49.64 ? 226  ASP B CB  1 
ATOM   6252 C CG  . ASP B 1 226 ? -0.461  -34.684 24.828 1.00 51.15 ? 226  ASP B CG  1 
ATOM   6253 O OD1 . ASP B 1 226 ? -1.269  -34.794 25.775 1.00 52.66 ? 226  ASP B OD1 1 
ATOM   6254 O OD2 . ASP B 1 226 ? -0.767  -34.949 23.647 1.00 55.47 ? 226  ASP B OD2 1 
ATOM   6255 N N   . TRP B 1 227 ? 3.693   -33.743 26.441 1.00 48.07 ? 227  TRP B N   1 
ATOM   6256 C CA  . TRP B 1 227 ? 5.131   -33.527 26.373 1.00 48.39 ? 227  TRP B CA  1 
ATOM   6257 C C   . TRP B 1 227 ? 5.816   -34.548 27.270 1.00 49.92 ? 227  TRP B C   1 
ATOM   6258 O O   . TRP B 1 227 ? 6.763   -35.219 26.863 1.00 50.57 ? 227  TRP B O   1 
ATOM   6259 C CB  . TRP B 1 227 ? 5.459   -32.111 26.855 1.00 47.44 ? 227  TRP B CB  1 
ATOM   6260 C CG  . TRP B 1 227 ? 6.916   -31.851 27.090 1.00 46.58 ? 227  TRP B CG  1 
ATOM   6261 C CD1 . TRP B 1 227 ? 7.865   -31.568 26.150 1.00 46.58 ? 227  TRP B CD1 1 
ATOM   6262 C CD2 . TRP B 1 227 ? 7.585   -31.833 28.356 1.00 45.62 ? 227  TRP B CD2 1 
ATOM   6263 N NE1 . TRP B 1 227 ? 9.086   -31.370 26.755 1.00 46.31 ? 227  TRP B NE1 1 
ATOM   6264 C CE2 . TRP B 1 227 ? 8.942   -31.527 28.108 1.00 44.97 ? 227  TRP B CE2 1 
ATOM   6265 C CE3 . TRP B 1 227 ? 7.170   -32.046 29.678 1.00 46.38 ? 227  TRP B CE3 1 
ATOM   6266 C CZ2 . TRP B 1 227 ? 9.887   -31.426 29.133 1.00 44.43 ? 227  TRP B CZ2 1 
ATOM   6267 C CZ3 . TRP B 1 227 ? 8.112   -31.945 30.700 1.00 46.03 ? 227  TRP B CZ3 1 
ATOM   6268 C CH2 . TRP B 1 227 ? 9.455   -31.638 30.418 1.00 44.96 ? 227  TRP B CH2 1 
ATOM   6269 N N   . PHE B 1 228 ? 5.319   -34.660 28.497 1.00 51.24 ? 228  PHE B N   1 
ATOM   6270 C CA  . PHE B 1 228 ? 5.875   -35.586 29.475 1.00 51.72 ? 228  PHE B CA  1 
ATOM   6271 C C   . PHE B 1 228 ? 5.861   -37.034 28.985 1.00 52.50 ? 228  PHE B C   1 
ATOM   6272 O O   . PHE B 1 228 ? 6.909   -37.676 28.896 1.00 51.48 ? 228  PHE B O   1 
ATOM   6273 C CB  . PHE B 1 228 ? 5.094   -35.488 30.786 1.00 50.50 ? 228  PHE B CB  1 
ATOM   6274 C CG  . PHE B 1 228 ? 5.570   -36.435 31.842 1.00 51.87 ? 228  PHE B CG  1 
ATOM   6275 C CD1 . PHE B 1 228 ? 6.852   -36.319 32.371 1.00 51.21 ? 228  PHE B CD1 1 
ATOM   6276 C CD2 . PHE B 1 228 ? 4.746   -37.459 32.293 1.00 51.10 ? 228  PHE B CD2 1 
ATOM   6277 C CE1 . PHE B 1 228 ? 7.308   -37.211 33.333 1.00 52.36 ? 228  PHE B CE1 1 
ATOM   6278 C CE2 . PHE B 1 228 ? 5.194   -38.358 33.256 1.00 53.11 ? 228  PHE B CE2 1 
ATOM   6279 C CZ  . PHE B 1 228 ? 6.476   -38.233 33.776 1.00 52.34 ? 228  PHE B CZ  1 
ATOM   6280 N N   . LEU B 1 229 ? 4.672   -37.539 28.669 1.00 53.64 ? 229  LEU B N   1 
ATOM   6281 C CA  . LEU B 1 229 ? 4.514   -38.915 28.205 1.00 55.47 ? 229  LEU B CA  1 
ATOM   6282 C C   . LEU B 1 229 ? 5.347   -39.250 26.973 1.00 56.43 ? 229  LEU B C   1 
ATOM   6283 O O   . LEU B 1 229 ? 5.570   -40.423 26.671 1.00 57.32 ? 229  LEU B O   1 
ATOM   6284 C CB  . LEU B 1 229 ? 3.036   -39.216 27.944 1.00 54.37 ? 229  LEU B CB  1 
ATOM   6285 C CG  . LEU B 1 229 ? 2.167   -39.210 29.204 1.00 54.58 ? 229  LEU B CG  1 
ATOM   6286 C CD1 . LEU B 1 229 ? 0.734   -39.585 28.859 1.00 54.26 ? 229  LEU B CD1 1 
ATOM   6287 C CD2 . LEU B 1 229 ? 2.737   -40.193 30.220 1.00 54.34 ? 229  LEU B CD2 1 
ATOM   6288 N N   . LEU B 1 230 ? 5.812   -38.227 26.264 1.00 57.51 ? 230  LEU B N   1 
ATOM   6289 C CA  . LEU B 1 230 ? 6.644   -38.453 25.089 1.00 58.90 ? 230  LEU B CA  1 
ATOM   6290 C C   . LEU B 1 230 ? 7.921   -39.130 25.580 1.00 60.03 ? 230  LEU B C   1 
ATOM   6291 O O   . LEU B 1 230 ? 8.679   -39.703 24.801 1.00 59.77 ? 230  LEU B O   1 
ATOM   6292 C CB  . LEU B 1 230 ? 6.979   -37.125 24.404 1.00 59.57 ? 230  LEU B CB  1 
ATOM   6293 C CG  . LEU B 1 230 ? 6.476   -36.921 22.973 1.00 60.18 ? 230  LEU B CG  1 
ATOM   6294 C CD1 . LEU B 1 230 ? 4.966   -37.078 22.919 1.00 60.61 ? 230  LEU B CD1 1 
ATOM   6295 C CD2 . LEU B 1 230 ? 6.882   -35.540 22.482 1.00 59.18 ? 230  LEU B CD2 1 
ATOM   6296 N N   . SER B 1 231 ? 8.145   -39.047 26.888 1.00 61.64 ? 231  SER B N   1 
ATOM   6297 C CA  . SER B 1 231 ? 9.304   -39.655 27.528 1.00 63.53 ? 231  SER B CA  1 
ATOM   6298 C C   . SER B 1 231 ? 8.862   -40.731 28.523 1.00 64.63 ? 231  SER B C   1 
ATOM   6299 O O   . SER B 1 231 ? 9.252   -41.891 28.400 1.00 65.95 ? 231  SER B O   1 
ATOM   6300 C CB  . SER B 1 231 ? 10.134  -38.593 28.257 1.00 63.49 ? 231  SER B CB  1 
ATOM   6301 O OG  . SER B 1 231 ? 10.823  -37.756 27.343 1.00 62.95 ? 231  SER B OG  1 
ATOM   6302 N N   . ALA B 1 232 ? 8.050   -40.341 29.503 1.00 65.23 ? 232  ALA B N   1 
ATOM   6303 C CA  . ALA B 1 232 ? 7.562   -41.271 30.521 1.00 66.75 ? 232  ALA B CA  1 
ATOM   6304 C C   . ALA B 1 232 ? 7.108   -42.590 29.907 1.00 67.20 ? 232  ALA B C   1 
ATOM   6305 O O   . ALA B 1 232 ? 7.644   -43.647 30.236 1.00 67.83 ? 232  ALA B O   1 
ATOM   6306 C CB  . ALA B 1 232 ? 6.420   -40.644 31.301 1.00 66.52 ? 232  ALA B CB  1 
ATOM   6307 N N   . LYS B 1 233 ? 6.107   -42.522 29.032 1.00 68.29 ? 233  LYS B N   1 
ATOM   6308 C CA  . LYS B 1 233 ? 5.589   -43.703 28.343 1.00 69.27 ? 233  LYS B CA  1 
ATOM   6309 C C   . LYS B 1 233 ? 4.656   -44.607 29.132 1.00 69.61 ? 233  LYS B C   1 
ATOM   6310 O O   . LYS B 1 233 ? 4.366   -45.725 28.704 1.00 70.82 ? 233  LYS B O   1 
ATOM   6311 C CB  . LYS B 1 233 ? 6.742   -44.546 27.828 1.00 69.21 ? 233  LYS B CB  1 
ATOM   6312 C CG  . LYS B 1 233 ? 6.826   -44.579 26.339 1.00 70.35 ? 233  LYS B CG  1 
ATOM   6313 C CD  . LYS B 1 233 ? 8.253   -44.383 25.919 1.00 71.20 ? 233  LYS B CD  1 
ATOM   6314 C CE  . LYS B 1 233 ? 8.406   -44.622 24.441 1.00 72.88 ? 233  LYS B CE  1 
ATOM   6315 N NZ  . LYS B 1 233 ? 9.844   -44.640 24.072 1.00 73.47 ? 233  LYS B NZ  1 
ATOM   6316 N N   . ASP B 1 234 ? 4.190   -44.147 30.281 1.00 69.61 ? 234  ASP B N   1 
ATOM   6317 C CA  . ASP B 1 234 ? 3.284   -44.955 31.072 1.00 69.78 ? 234  ASP B CA  1 
ATOM   6318 C C   . ASP B 1 234 ? 2.436   -44.000 31.881 1.00 68.55 ? 234  ASP B C   1 
ATOM   6319 O O   . ASP B 1 234 ? 2.908   -43.416 32.856 1.00 68.49 ? 234  ASP B O   1 
ATOM   6320 C CB  . ASP B 1 234 ? 4.068   -45.888 31.994 1.00 71.41 ? 234  ASP B CB  1 
ATOM   6321 C CG  . ASP B 1 234 ? 3.202   -46.971 32.584 1.00 72.85 ? 234  ASP B CG  1 
ATOM   6322 O OD1 . ASP B 1 234 ? 2.508   -47.655 31.803 1.00 74.39 ? 234  ASP B OD1 1 
ATOM   6323 O OD2 . ASP B 1 234 ? 3.213   -47.149 33.820 1.00 74.39 ? 234  ASP B OD2 1 
ATOM   6324 N N   . PRO B 1 235 ? 1.166   -43.824 31.485 1.00 67.32 ? 235  PRO B N   1 
ATOM   6325 C CA  . PRO B 1 235 ? 0.291   -42.906 32.221 1.00 65.92 ? 235  PRO B CA  1 
ATOM   6326 C C   . PRO B 1 235 ? 0.334   -43.110 33.731 1.00 64.79 ? 235  PRO B C   1 
ATOM   6327 O O   . PRO B 1 235 ? -0.087  -42.242 34.498 1.00 63.62 ? 235  PRO B O   1 
ATOM   6328 C CB  . PRO B 1 235 ? -1.093  -43.151 31.594 1.00 66.50 ? 235  PRO B CB  1 
ATOM   6329 C CG  . PRO B 1 235 ? -0.984  -44.540 30.992 1.00 67.24 ? 235  PRO B CG  1 
ATOM   6330 C CD  . PRO B 1 235 ? 0.425   -44.544 30.435 1.00 67.55 ? 235  PRO B CD  1 
ATOM   6331 N N   . SER B 1 236 ? 0.880   -44.247 34.153 1.00 63.33 ? 236  SER B N   1 
ATOM   6332 C CA  . SER B 1 236 ? 1.003   -44.553 35.572 1.00 61.64 ? 236  SER B CA  1 
ATOM   6333 C C   . SER B 1 236 ? 2.128   -43.713 36.178 1.00 59.32 ? 236  SER B C   1 
ATOM   6334 O O   . SER B 1 236 ? 2.328   -43.710 37.391 1.00 58.94 ? 236  SER B O   1 
ATOM   6335 C CB  . SER B 1 236 ? 1.306   -46.041 35.761 1.00 63.01 ? 236  SER B CB  1 
ATOM   6336 O OG  . SER B 1 236 ? 2.651   -46.241 36.151 1.00 64.96 ? 236  SER B OG  1 
ATOM   6337 N N   . THR B 1 237 ? 2.859   -43.004 35.324 1.00 57.05 ? 237  THR B N   1 
ATOM   6338 C CA  . THR B 1 237 ? 3.962   -42.160 35.771 1.00 55.99 ? 237  THR B CA  1 
ATOM   6339 C C   . THR B 1 237 ? 3.517   -40.722 36.038 1.00 55.17 ? 237  THR B C   1 
ATOM   6340 O O   . THR B 1 237 ? 4.139   -40.010 36.830 1.00 54.66 ? 237  THR B O   1 
ATOM   6341 C CB  . THR B 1 237 ? 5.106   -42.135 34.735 1.00 55.42 ? 237  THR B CB  1 
ATOM   6342 O OG1 . THR B 1 237 ? 4.636   -41.540 33.525 1.00 55.86 ? 237  THR B OG1 1 
ATOM   6343 C CG2 . THR B 1 237 ? 5.596   -43.545 34.443 1.00 56.59 ? 237  THR B CG2 1 
ATOM   6344 N N   . VAL B 1 238 ? 2.447   -40.290 35.378 1.00 54.26 ? 238  VAL B N   1 
ATOM   6345 C CA  . VAL B 1 238 ? 1.963   -38.926 35.574 1.00 53.33 ? 238  VAL B CA  1 
ATOM   6346 C C   . VAL B 1 238 ? 1.641   -38.668 37.042 1.00 52.93 ? 238  VAL B C   1 
ATOM   6347 O O   . VAL B 1 238 ? 1.728   -37.536 37.514 1.00 52.77 ? 238  VAL B O   1 
ATOM   6348 C CB  . VAL B 1 238 ? 0.703   -38.625 34.716 1.00 53.60 ? 238  VAL B CB  1 
ATOM   6349 C CG1 . VAL B 1 238 ? 0.967   -38.977 33.262 1.00 51.22 ? 238  VAL B CG1 1 
ATOM   6350 C CG2 . VAL B 1 238 ? -0.501  -39.381 35.254 1.00 54.41 ? 238  VAL B CG2 1 
ATOM   6351 N N   . ALA B 1 239 ? 1.289   -39.725 37.768 1.00 51.52 ? 239  ALA B N   1 
ATOM   6352 C CA  . ALA B 1 239 ? 0.960   -39.607 39.187 1.00 50.31 ? 239  ALA B CA  1 
ATOM   6353 C C   . ALA B 1 239 ? 2.162   -39.125 39.998 1.00 49.20 ? 239  ALA B C   1 
ATOM   6354 O O   . ALA B 1 239 ? 2.015   -38.642 41.124 1.00 47.34 ? 239  ALA B O   1 
ATOM   6355 C CB  . ALA B 1 239 ? 0.467   -40.949 39.731 1.00 52.09 ? 239  ALA B CB  1 
ATOM   6356 N N   . LYS B 1 240 ? 3.351   -39.257 39.420 1.00 48.12 ? 240  LYS B N   1 
ATOM   6357 C CA  . LYS B 1 240 ? 4.577   -38.832 40.086 1.00 47.49 ? 240  LYS B CA  1 
ATOM   6358 C C   . LYS B 1 240 ? 5.053   -37.454 39.623 1.00 47.10 ? 240  LYS B C   1 
ATOM   6359 O O   . LYS B 1 240 ? 6.016   -36.914 40.168 1.00 46.60 ? 240  LYS B O   1 
ATOM   6360 C CB  . LYS B 1 240 ? 5.692   -39.849 39.832 1.00 47.86 ? 240  LYS B CB  1 
ATOM   6361 C CG  . LYS B 1 240 ? 5.487   -41.194 40.518 1.00 48.83 ? 240  LYS B CG  1 
ATOM   6362 C CD  . LYS B 1 240 ? 6.679   -42.109 40.289 1.00 50.38 ? 240  LYS B CD  1 
ATOM   6363 C CE  . LYS B 1 240 ? 6.542   -43.411 41.068 1.00 51.57 ? 240  LYS B CE  1 
ATOM   6364 N NZ  . LYS B 1 240 ? 7.686   -44.332 40.782 1.00 53.27 ? 240  LYS B NZ  1 
ATOM   6365 N N   . HIS B 1 241 ? 4.373   -36.882 38.632 1.00 45.69 ? 241  HIS B N   1 
ATOM   6366 C CA  . HIS B 1 241 ? 4.777   -35.582 38.092 1.00 44.53 ? 241  HIS B CA  1 
ATOM   6367 C C   . HIS B 1 241 ? 3.674   -34.527 37.959 1.00 43.37 ? 241  HIS B C   1 
ATOM   6368 O O   . HIS B 1 241 ? 3.950   -33.397 37.553 1.00 41.33 ? 241  HIS B O   1 
ATOM   6369 C CB  . HIS B 1 241 ? 5.447   -35.793 36.730 1.00 46.02 ? 241  HIS B CB  1 
ATOM   6370 C CG  . HIS B 1 241 ? 6.721   -36.579 36.802 1.00 48.31 ? 241  HIS B CG  1 
ATOM   6371 N ND1 . HIS B 1 241 ? 7.965   -35.984 36.806 1.00 48.57 ? 241  HIS B ND1 1 
ATOM   6372 C CD2 . HIS B 1 241 ? 6.942   -37.911 36.905 1.00 49.86 ? 241  HIS B CD2 1 
ATOM   6373 C CE1 . HIS B 1 241 ? 8.896   -36.916 36.905 1.00 50.22 ? 241  HIS B CE1 1 
ATOM   6374 N NE2 . HIS B 1 241 ? 8.303   -38.094 36.967 1.00 49.20 ? 241  HIS B NE2 1 
ATOM   6375 N N   . PHE B 1 242 ? 2.439   -34.887 38.300 1.00 42.74 ? 242  PHE B N   1 
ATOM   6376 C CA  . PHE B 1 242 ? 1.311   -33.955 38.205 1.00 41.90 ? 242  PHE B CA  1 
ATOM   6377 C C   . PHE B 1 242 ? 0.398   -33.952 39.435 1.00 42.32 ? 242  PHE B C   1 
ATOM   6378 O O   . PHE B 1 242 ? -0.061  -35.007 39.872 1.00 42.99 ? 242  PHE B O   1 
ATOM   6379 C CB  . PHE B 1 242 ? 0.449   -34.283 36.977 1.00 40.14 ? 242  PHE B CB  1 
ATOM   6380 C CG  . PHE B 1 242 ? 1.099   -33.962 35.657 1.00 41.14 ? 242  PHE B CG  1 
ATOM   6381 C CD1 . PHE B 1 242 ? 2.115   -34.762 35.149 1.00 40.47 ? 242  PHE B CD1 1 
ATOM   6382 C CD2 . PHE B 1 242 ? 0.675   -32.860 34.911 1.00 40.60 ? 242  PHE B CD2 1 
ATOM   6383 C CE1 . PHE B 1 242 ? 2.704   -34.474 33.910 1.00 41.09 ? 242  PHE B CE1 1 
ATOM   6384 C CE2 . PHE B 1 242 ? 1.255   -32.562 33.673 1.00 38.96 ? 242  PHE B CE2 1 
ATOM   6385 C CZ  . PHE B 1 242 ? 2.271   -33.371 33.172 1.00 41.56 ? 242  PHE B CZ  1 
ATOM   6386 N N   . VAL B 1 243 ? 0.136   -32.769 39.991 1.00 39.42 ? 243  VAL B N   1 
ATOM   6387 C CA  . VAL B 1 243 ? -0.767  -32.634 41.137 1.00 39.35 ? 243  VAL B CA  1 
ATOM   6388 C C   . VAL B 1 243 ? -1.764  -31.520 40.816 1.00 39.84 ? 243  VAL B C   1 
ATOM   6389 O O   . VAL B 1 243 ? -1.552  -30.750 39.878 1.00 38.33 ? 243  VAL B O   1 
ATOM   6390 C CB  . VAL B 1 243 ? -0.028  -32.293 42.457 1.00 39.95 ? 243  VAL B CB  1 
ATOM   6391 C CG1 . VAL B 1 243 ? 1.003   -33.389 42.782 1.00 39.84 ? 243  VAL B CG1 1 
ATOM   6392 C CG2 . VAL B 1 243 ? 0.629   -30.926 42.358 1.00 40.21 ? 243  VAL B CG2 1 
ATOM   6393 N N   . ALA B 1 244 ? -2.839  -31.427 41.592 1.00 39.39 ? 244  ALA B N   1 
ATOM   6394 C CA  . ALA B 1 244 ? -3.863  -30.420 41.333 1.00 39.99 ? 244  ALA B CA  1 
ATOM   6395 C C   . ALA B 1 244 ? -4.310  -29.628 42.549 1.00 39.95 ? 244  ALA B C   1 
ATOM   6396 O O   . ALA B 1 244 ? -4.384  -30.151 43.663 1.00 39.33 ? 244  ALA B O   1 
ATOM   6397 C CB  . ALA B 1 244 ? -5.080  -31.078 40.689 1.00 37.71 ? 244  ALA B CB  1 
ATOM   6398 N N   . LEU B 1 245 ? -4.609  -28.355 42.310 1.00 39.43 ? 245  LEU B N   1 
ATOM   6399 C CA  . LEU B 1 245 ? -5.091  -27.447 43.340 1.00 39.37 ? 245  LEU B CA  1 
ATOM   6400 C C   . LEU B 1 245 ? -6.455  -27.044 42.801 1.00 41.58 ? 245  LEU B C   1 
ATOM   6401 O O   . LEU B 1 245 ? -6.543  -26.252 41.860 1.00 40.74 ? 245  LEU B O   1 
ATOM   6402 C CB  . LEU B 1 245 ? -4.189  -26.212 43.437 1.00 37.60 ? 245  LEU B CB  1 
ATOM   6403 C CG  . LEU B 1 245 ? -2.686  -26.444 43.279 1.00 36.26 ? 245  LEU B CG  1 
ATOM   6404 C CD1 . LEU B 1 245 ? -1.951  -25.110 43.328 1.00 34.62 ? 245  LEU B CD1 1 
ATOM   6405 C CD2 . LEU B 1 245 ? -2.189  -27.375 44.377 1.00 34.88 ? 245  LEU B CD2 1 
ATOM   6406 N N   . SER B 1 246 ? -7.518  -27.592 43.381 1.00 42.96 ? 246  SER B N   1 
ATOM   6407 C CA  . SER B 1 246 ? -8.856  -27.288 42.896 1.00 43.52 ? 246  SER B CA  1 
ATOM   6408 C C   . SER B 1 246 ? -9.956  -27.501 43.930 1.00 44.30 ? 246  SER B C   1 
ATOM   6409 O O   . SER B 1 246 ? -9.693  -27.848 45.083 1.00 42.66 ? 246  SER B O   1 
ATOM   6410 C CB  . SER B 1 246 ? -9.145  -28.143 41.657 1.00 42.51 ? 246  SER B CB  1 
ATOM   6411 O OG  . SER B 1 246 ? -10.443 -27.890 41.141 1.00 41.76 ? 246  SER B OG  1 
ATOM   6412 N N   . THR B 1 247 ? -11.193 -27.261 43.506 1.00 44.65 ? 247  THR B N   1 
ATOM   6413 C CA  . THR B 1 247 ? -12.355 -27.451 44.362 1.00 46.43 ? 247  THR B CA  1 
ATOM   6414 C C   . THR B 1 247 ? -13.277 -28.449 43.668 1.00 47.24 ? 247  THR B C   1 
ATOM   6415 O O   . THR B 1 247 ? -14.324 -28.815 44.203 1.00 46.45 ? 247  THR B O   1 
ATOM   6416 C CB  . THR B 1 247 ? -13.150 -26.134 44.574 1.00 46.72 ? 247  THR B CB  1 
ATOM   6417 O OG1 . THR B 1 247 ? -13.735 -25.717 43.331 1.00 47.44 ? 247  THR B OG1 1 
ATOM   6418 C CG2 . THR B 1 247 ? -12.241 -25.035 45.102 1.00 47.06 ? 247  THR B CG2 1 
ATOM   6419 N N   . ASN B 1 248 ? -12.871 -28.884 42.478 1.00 47.46 ? 248  ASN B N   1 
ATOM   6420 C CA  . ASN B 1 248 ? -13.666 -29.810 41.677 1.00 50.06 ? 248  ASN B CA  1 
ATOM   6421 C C   . ASN B 1 248 ? -13.016 -31.189 41.526 1.00 49.75 ? 248  ASN B C   1 
ATOM   6422 O O   . ASN B 1 248 ? -12.305 -31.452 40.556 1.00 48.28 ? 248  ASN B O   1 
ATOM   6423 C CB  . ASN B 1 248 ? -13.909 -29.198 40.293 1.00 51.67 ? 248  ASN B CB  1 
ATOM   6424 C CG  . ASN B 1 248 ? -15.031 -29.885 39.536 1.00 54.84 ? 248  ASN B CG  1 
ATOM   6425 O OD1 . ASN B 1 248 ? -15.109 -31.112 39.498 1.00 54.36 ? 248  ASN B OD1 1 
ATOM   6426 N ND2 . ASN B 1 248 ? -15.901 -29.090 38.914 1.00 55.38 ? 248  ASN B ND2 1 
ATOM   6427 N N   . THR B 1 249 ? -13.278 -32.070 42.486 1.00 50.38 ? 249  THR B N   1 
ATOM   6428 C CA  . THR B 1 249 ? -12.724 -33.422 42.468 1.00 51.28 ? 249  THR B CA  1 
ATOM   6429 C C   . THR B 1 249 ? -13.106 -34.190 41.207 1.00 50.83 ? 249  THR B C   1 
ATOM   6430 O O   . THR B 1 249 ? -12.320 -34.985 40.698 1.00 51.71 ? 249  THR B O   1 
ATOM   6431 C CB  . THR B 1 249 ? -13.204 -34.233 43.686 1.00 51.53 ? 249  THR B CB  1 
ATOM   6432 O OG1 . THR B 1 249 ? -12.779 -33.583 44.889 1.00 52.95 ? 249  THR B OG1 1 
ATOM   6433 C CG2 . THR B 1 249 ? -12.629 -35.642 43.646 1.00 52.52 ? 249  THR B CG2 1 
ATOM   6434 N N   . ALA B 1 250 ? -14.317 -33.953 40.711 1.00 52.12 ? 250  ALA B N   1 
ATOM   6435 C CA  . ALA B 1 250 ? -14.806 -34.628 39.510 1.00 52.91 ? 250  ALA B CA  1 
ATOM   6436 C C   . ALA B 1 250 ? -13.873 -34.414 38.324 1.00 52.31 ? 250  ALA B C   1 
ATOM   6437 O O   . ALA B 1 250 ? -13.328 -35.367 37.769 1.00 51.49 ? 250  ALA B O   1 
ATOM   6438 C CB  . ALA B 1 250 ? -16.209 -34.128 39.167 1.00 53.12 ? 250  ALA B CB  1 
ATOM   6439 N N   . LYS B 1 251 ? -13.695 -33.153 37.944 1.00 51.85 ? 251  LYS B N   1 
ATOM   6440 C CA  . LYS B 1 251 ? -12.834 -32.797 36.821 1.00 52.12 ? 251  LYS B CA  1 
ATOM   6441 C C   . LYS B 1 251 ? -11.386 -33.267 36.965 1.00 51.32 ? 251  LYS B C   1 
ATOM   6442 O O   . LYS B 1 251 ? -10.799 -33.773 36.008 1.00 50.81 ? 251  LYS B O   1 
ATOM   6443 C CB  . LYS B 1 251 ? -12.867 -31.283 36.607 1.00 53.05 ? 251  LYS B CB  1 
ATOM   6444 C CG  . LYS B 1 251 ? -14.196 -30.774 36.083 1.00 54.00 ? 251  LYS B CG  1 
ATOM   6445 C CD  . LYS B 1 251 ? -14.487 -31.373 34.716 1.00 55.71 ? 251  LYS B CD  1 
ATOM   6446 C CE  . LYS B 1 251 ? -15.830 -30.919 34.172 1.00 56.70 ? 251  LYS B CE  1 
ATOM   6447 N NZ  . LYS B 1 251 ? -16.075 -31.506 32.826 1.00 57.80 ? 251  LYS B NZ  1 
ATOM   6448 N N   . VAL B 1 252 ? -10.809 -33.098 38.152 1.00 50.76 ? 252  VAL B N   1 
ATOM   6449 C CA  . VAL B 1 252 ? -9.430  -33.517 38.385 1.00 50.75 ? 252  VAL B CA  1 
ATOM   6450 C C   . VAL B 1 252 ? -9.282  -35.000 38.065 1.00 51.82 ? 252  VAL B C   1 
ATOM   6451 O O   . VAL B 1 252 ? -8.259  -35.438 37.541 1.00 51.48 ? 252  VAL B O   1 
ATOM   6452 C CB  . VAL B 1 252 ? -8.999  -33.277 39.855 1.00 49.83 ? 252  VAL B CB  1 
ATOM   6453 C CG1 . VAL B 1 252 ? -7.613  -33.867 40.096 1.00 50.44 ? 252  VAL B CG1 1 
ATOM   6454 C CG2 . VAL B 1 252 ? -8.985  -31.783 40.159 1.00 47.80 ? 252  VAL B CG2 1 
ATOM   6455 N N   . LYS B 1 253 ? -10.323 -35.764 38.378 1.00 54.25 ? 253  LYS B N   1 
ATOM   6456 C CA  . LYS B 1 253 ? -10.328 -37.201 38.139 1.00 56.84 ? 253  LYS B CA  1 
ATOM   6457 C C   . LYS B 1 253 ? -10.279 -37.488 36.641 1.00 58.07 ? 253  LYS B C   1 
ATOM   6458 O O   . LYS B 1 253 ? -9.445  -38.265 36.171 1.00 56.34 ? 253  LYS B O   1 
ATOM   6459 C CB  . LYS B 1 253 ? -11.590 -37.818 38.747 1.00 58.05 ? 253  LYS B CB  1 
ATOM   6460 C CG  . LYS B 1 253 ? -11.393 -39.207 39.342 1.00 58.83 ? 253  LYS B CG  1 
ATOM   6461 C CD  . LYS B 1 253 ? -10.892 -40.198 38.317 1.00 58.96 ? 253  LYS B CD  1 
ATOM   6462 C CE  . LYS B 1 253 ? -10.661 -41.560 38.950 1.00 61.34 ? 253  LYS B CE  1 
ATOM   6463 N NZ  . LYS B 1 253 ? -11.910 -42.122 39.543 1.00 60.51 ? 253  LYS B NZ  1 
ATOM   6464 N N   . GLU B 1 254 ? -11.174 -36.841 35.898 1.00 59.96 ? 254  GLU B N   1 
ATOM   6465 C CA  . GLU B 1 254 ? -11.258 -37.016 34.452 1.00 62.40 ? 254  GLU B CA  1 
ATOM   6466 C C   . GLU B 1 254 ? -9.957  -36.669 33.731 1.00 62.32 ? 254  GLU B C   1 
ATOM   6467 O O   . GLU B 1 254 ? -9.654  -37.244 32.687 1.00 62.15 ? 254  GLU B O   1 
ATOM   6468 C CB  . GLU B 1 254 ? -12.393 -36.162 33.877 1.00 64.76 ? 254  GLU B CB  1 
ATOM   6469 C CG  . GLU B 1 254 ? -12.809 -36.560 32.467 1.00 69.38 ? 254  GLU B CG  1 
ATOM   6470 C CD  . GLU B 1 254 ? -13.497 -37.915 32.424 1.00 72.36 ? 254  GLU B CD  1 
ATOM   6471 O OE1 . GLU B 1 254 ? -12.792 -38.940 32.301 1.00 74.38 ? 254  GLU B OE1 1 
ATOM   6472 O OE2 . GLU B 1 254 ? -14.744 -37.957 32.508 1.00 74.07 ? 254  GLU B OE2 1 
ATOM   6473 N N   . PHE B 1 255 ? -9.195  -35.724 34.276 1.00 62.50 ? 255  PHE B N   1 
ATOM   6474 C CA  . PHE B 1 255 ? -7.934  -35.328 33.652 1.00 62.79 ? 255  PHE B CA  1 
ATOM   6475 C C   . PHE B 1 255 ? -6.882  -36.425 33.773 1.00 62.46 ? 255  PHE B C   1 
ATOM   6476 O O   . PHE B 1 255 ? -6.020  -36.566 32.907 1.00 62.03 ? 255  PHE B O   1 
ATOM   6477 C CB  . PHE B 1 255 ? -7.393  -34.037 34.279 1.00 62.85 ? 255  PHE B CB  1 
ATOM   6478 C CG  . PHE B 1 255 ? -6.059  -33.607 33.725 1.00 62.90 ? 255  PHE B CG  1 
ATOM   6479 C CD1 . PHE B 1 255 ? -5.926  -33.251 32.386 1.00 62.78 ? 255  PHE B CD1 1 
ATOM   6480 C CD2 . PHE B 1 255 ? -4.933  -33.575 34.539 1.00 63.14 ? 255  PHE B CD2 1 
ATOM   6481 C CE1 . PHE B 1 255 ? -4.690  -32.872 31.866 1.00 61.79 ? 255  PHE B CE1 1 
ATOM   6482 C CE2 . PHE B 1 255 ? -3.690  -33.197 34.027 1.00 63.59 ? 255  PHE B CE2 1 
ATOM   6483 C CZ  . PHE B 1 255 ? -3.570  -32.846 32.689 1.00 62.77 ? 255  PHE B CZ  1 
ATOM   6484 N N   . GLY B 1 256 ? -6.955  -37.198 34.850 1.00 62.63 ? 256  GLY B N   1 
ATOM   6485 C CA  . GLY B 1 256 ? -5.995  -38.267 35.047 1.00 62.70 ? 256  GLY B CA  1 
ATOM   6486 C C   . GLY B 1 256 ? -5.179  -38.089 36.309 1.00 63.20 ? 256  GLY B C   1 
ATOM   6487 O O   . GLY B 1 256 ? -4.031  -38.524 36.381 1.00 62.60 ? 256  GLY B O   1 
ATOM   6488 N N   . ILE B 1 257 ? -5.769  -37.437 37.304 1.00 64.47 ? 257  ILE B N   1 
ATOM   6489 C CA  . ILE B 1 257 ? -5.092  -37.207 38.572 1.00 65.87 ? 257  ILE B CA  1 
ATOM   6490 C C   . ILE B 1 257 ? -5.941  -37.751 39.718 1.00 67.50 ? 257  ILE B C   1 
ATOM   6491 O O   . ILE B 1 257 ? -7.030  -37.247 40.001 1.00 67.74 ? 257  ILE B O   1 
ATOM   6492 C CB  . ILE B 1 257 ? -4.821  -35.700 38.797 1.00 65.48 ? 257  ILE B CB  1 
ATOM   6493 C CG1 . ILE B 1 257 ? -3.901  -35.174 37.694 1.00 65.15 ? 257  ILE B CG1 1 
ATOM   6494 C CG2 . ILE B 1 257 ? -4.183  -35.481 40.164 1.00 64.80 ? 257  ILE B CG2 1 
ATOM   6495 C CD1 . ILE B 1 257 ? -3.580  -33.694 37.799 1.00 64.13 ? 257  ILE B CD1 1 
ATOM   6496 N N   . ASP B 1 258 ? -5.438  -38.793 40.369 1.00 69.17 ? 258  ASP B N   1 
ATOM   6497 C CA  . ASP B 1 258 ? -6.144  -39.423 41.477 1.00 69.85 ? 258  ASP B CA  1 
ATOM   6498 C C   . ASP B 1 258 ? -6.097  -38.556 42.725 1.00 69.05 ? 258  ASP B C   1 
ATOM   6499 O O   . ASP B 1 258 ? -5.235  -37.688 42.854 1.00 69.56 ? 258  ASP B O   1 
ATOM   6500 C CB  . ASP B 1 258 ? -5.518  -40.787 41.785 1.00 71.44 ? 258  ASP B CB  1 
ATOM   6501 C CG  . ASP B 1 258 ? -4.031  -40.697 42.054 1.00 73.19 ? 258  ASP B CG  1 
ATOM   6502 O OD1 . ASP B 1 258 ? -3.418  -41.736 42.387 1.00 73.83 ? 258  ASP B OD1 1 
ATOM   6503 O OD2 . ASP B 1 258 ? -3.467  -39.587 41.929 1.00 73.85 ? 258  ASP B OD2 1 
ATOM   6504 N N   . PRO B 1 259 ? -7.040  -38.767 43.656 1.00 68.32 ? 259  PRO B N   1 
ATOM   6505 C CA  . PRO B 1 259 ? -7.002  -37.947 44.870 1.00 67.10 ? 259  PRO B CA  1 
ATOM   6506 C C   . PRO B 1 259 ? -5.665  -38.131 45.588 1.00 65.98 ? 259  PRO B C   1 
ATOM   6507 O O   . PRO B 1 259 ? -4.768  -38.785 45.060 1.00 66.81 ? 259  PRO B O   1 
ATOM   6508 C CB  . PRO B 1 259 ? -8.224  -38.431 45.669 1.00 67.55 ? 259  PRO B CB  1 
ATOM   6509 C CG  . PRO B 1 259 ? -8.552  -39.795 45.065 1.00 67.57 ? 259  PRO B CG  1 
ATOM   6510 C CD  . PRO B 1 259 ? -8.266  -39.581 43.602 1.00 68.02 ? 259  PRO B CD  1 
ATOM   6511 N N   . GLN B 1 260 ? -5.523  -37.557 46.776 1.00 64.99 ? 260  GLN B N   1 
ATOM   6512 C CA  . GLN B 1 260 ? -4.257  -37.640 47.505 1.00 63.57 ? 260  GLN B CA  1 
ATOM   6513 C C   . GLN B 1 260 ? -3.275  -36.711 46.796 1.00 60.04 ? 260  GLN B C   1 
ATOM   6514 O O   . GLN B 1 260 ? -2.359  -36.172 47.409 1.00 61.17 ? 260  GLN B O   1 
ATOM   6515 C CB  . GLN B 1 260 ? -3.710  -39.078 47.518 1.00 65.53 ? 260  GLN B CB  1 
ATOM   6516 C CG  . GLN B 1 260 ? -2.248  -39.203 47.952 1.00 68.30 ? 260  GLN B CG  1 
ATOM   6517 C CD  . GLN B 1 260 ? -1.982  -38.695 49.366 1.00 71.15 ? 260  GLN B CD  1 
ATOM   6518 O OE1 . GLN B 1 260 ? -0.830  -38.591 49.794 1.00 72.42 ? 260  GLN B OE1 1 
ATOM   6519 N NE2 . GLN B 1 260 ? -3.046  -38.383 50.097 1.00 72.94 ? 260  GLN B NE2 1 
ATOM   6520 N N   . ASN B 1 261 ? -3.482  -36.532 45.496 1.00 56.70 ? 261  ASN B N   1 
ATOM   6521 C CA  . ASN B 1 261 ? -2.645  -35.652 44.698 1.00 53.03 ? 261  ASN B CA  1 
ATOM   6522 C C   . ASN B 1 261 ? -3.419  -34.379 44.373 1.00 50.99 ? 261  ASN B C   1 
ATOM   6523 O O   . ASN B 1 261 ? -2.980  -33.555 43.572 1.00 50.00 ? 261  ASN B O   1 
ATOM   6524 C CB  . ASN B 1 261 ? -2.208  -36.359 43.417 1.00 53.87 ? 261  ASN B CB  1 
ATOM   6525 C CG  . ASN B 1 261 ? -0.918  -37.138 43.598 1.00 54.86 ? 261  ASN B CG  1 
ATOM   6526 O OD1 . ASN B 1 261 ? -0.607  -37.605 44.694 1.00 55.32 ? 261  ASN B OD1 1 
ATOM   6527 N ND2 . ASN B 1 261 ? -0.163  -37.284 42.517 1.00 54.87 ? 261  ASN B ND2 1 
ATOM   6528 N N   . MET B 1 262 ? -4.584  -34.234 44.996 1.00 48.44 ? 262  MET B N   1 
ATOM   6529 C CA  . MET B 1 262 ? -5.406  -33.050 44.801 1.00 48.02 ? 262  MET B CA  1 
ATOM   6530 C C   . MET B 1 262 ? -5.454  -32.270 46.106 1.00 46.56 ? 262  MET B C   1 
ATOM   6531 O O   . MET B 1 262 ? -5.846  -32.799 47.145 1.00 45.73 ? 262  MET B O   1 
ATOM   6532 C CB  . MET B 1 262 ? -6.837  -33.416 44.391 1.00 49.62 ? 262  MET B CB  1 
ATOM   6533 C CG  . MET B 1 262 ? -7.701  -32.186 44.090 1.00 51.45 ? 262  MET B CG  1 
ATOM   6534 S SD  . MET B 1 262 ? -9.461  -32.508 43.852 1.00 56.85 ? 262  MET B SD  1 
ATOM   6535 C CE  . MET B 1 262 ? -10.079 -32.154 45.474 1.00 54.41 ? 262  MET B CE  1 
ATOM   6536 N N   . PHE B 1 263 ? -5.024  -31.017 46.052 1.00 44.72 ? 263  PHE B N   1 
ATOM   6537 C CA  . PHE B 1 263 ? -5.046  -30.153 47.219 1.00 44.00 ? 263  PHE B CA  1 
ATOM   6538 C C   . PHE B 1 263 ? -6.214  -29.214 46.942 1.00 44.74 ? 263  PHE B C   1 
ATOM   6539 O O   . PHE B 1 263 ? -6.212  -28.462 45.960 1.00 45.33 ? 263  PHE B O   1 
ATOM   6540 C CB  . PHE B 1 263 ? -3.749  -29.360 47.314 1.00 42.89 ? 263  PHE B CB  1 
ATOM   6541 C CG  . PHE B 1 263 ? -2.517  -30.255 47.394 1.00 43.73 ? 263  PHE B CG  1 
ATOM   6542 C CD1 . PHE B 1 263 ? -2.049  -30.900 46.244 1.00 42.77 ? 263  PHE B CD1 1 
ATOM   6543 C CD2 . PHE B 1 263 ? -1.862  -30.429 48.616 1.00 42.47 ? 263  PHE B CD2 1 
ATOM   6544 C CE1 . PHE B 1 263 ? -0.922  -31.725 46.318 1.00 44.54 ? 263  PHE B CE1 1 
ATOM   6545 C CE2 . PHE B 1 263 ? -0.735  -31.255 48.690 1.00 43.62 ? 263  PHE B CE2 1 
ATOM   6546 C CZ  . PHE B 1 263 ? -0.265  -31.903 47.541 1.00 43.47 ? 263  PHE B CZ  1 
ATOM   6547 N N   . GLU B 1 264 ? -7.222  -29.258 47.772 1.00 44.17 ? 264  GLU B N   1 
ATOM   6548 C CA  . GLU B 1 264 ? -8.433  -28.483 47.490 1.00 45.41 ? 264  GLU B CA  1 
ATOM   6549 C C   . GLU B 1 264 ? -8.610  -27.264 48.388 1.00 43.51 ? 264  GLU B C   1 
ATOM   6550 O O   . GLU B 1 264 ? -8.018  -27.173 49.472 1.00 43.42 ? 264  GLU B O   1 
ATOM   6551 C CB  . GLU B 1 264 ? -9.670  -29.358 47.684 1.00 49.09 ? 264  GLU B CB  1 
ATOM   6552 C CG  . GLU B 1 264 ? -9.696  -30.080 49.034 1.00 53.40 ? 264  GLU B CG  1 
ATOM   6553 C CD  . GLU B 1 264 ? -10.901 -31.011 49.179 1.00 57.10 ? 264  GLU B CD  1 
ATOM   6554 O OE1 . GLU B 1 264 ? -12.095 -30.523 49.191 1.00 58.88 ? 264  GLU B OE1 1 
ATOM   6555 O OE2 . GLU B 1 264 ? -10.724 -32.284 49.285 1.00 57.07 ? 264  GLU B OE2 1 
ATOM   6556 N N   . PHE B 1 265 ? -9.431  -26.375 47.850 1.00 41.72 ? 265  PHE B N   1 
ATOM   6557 C CA  . PHE B 1 265 ? -9.900  -25.174 48.541 1.00 40.91 ? 265  PHE B CA  1 
ATOM   6558 C C   . PHE B 1 265 ? -11.415 -25.124 48.348 1.00 41.48 ? 265  PHE B C   1 
ATOM   6559 O O   . PHE B 1 265 ? -12.045 -26.120 47.961 1.00 40.11 ? 265  PHE B O   1 
ATOM   6560 C CB  . PHE B 1 265 ? -9.157  -23.902 48.084 1.00 38.70 ? 265  PHE B CB  1 
ATOM   6561 C CG  . PHE B 1 265 ? -9.033  -23.659 46.571 1.00 37.98 ? 265  PHE B CG  1 
ATOM   6562 C CD1 . PHE B 1 265 ? -9.620  -22.519 46.006 1.00 39.06 ? 265  PHE B CD1 1 
ATOM   6563 C CD2 . PHE B 1 265 ? -8.312  -24.543 45.757 1.00 36.28 ? 265  PHE B CD2 1 
ATOM   6564 C CE1 . PHE B 1 265 ? -9.474  -22.255 44.640 1.00 35.37 ? 265  PHE B CE1 1 
ATOM   6565 C CE2 . PHE B 1 265 ? -8.160  -24.275 44.391 1.00 35.42 ? 265  PHE B CE2 1 
ATOM   6566 C CZ  . PHE B 1 265 ? -8.740  -23.130 43.833 1.00 37.76 ? 265  PHE B CZ  1 
ATOM   6567 N N   . TRP B 1 266 ? -12.025 -23.987 48.599 1.00 39.91 ? 266  TRP B N   1 
ATOM   6568 C CA  . TRP B 1 266 ? -13.489 -23.943 48.549 1.00 40.84 ? 266  TRP B CA  1 
ATOM   6569 C C   . TRP B 1 266 ? -14.042 -22.759 47.757 1.00 42.17 ? 266  TRP B C   1 
ATOM   6570 O O   . TRP B 1 266 ? -13.296 -21.845 47.388 1.00 40.71 ? 266  TRP B O   1 
ATOM   6571 C CB  . TRP B 1 266 ? -14.004 -23.968 49.977 1.00 43.08 ? 266  TRP B CB  1 
ATOM   6572 C CG  . TRP B 1 266 ? -13.365 -25.133 50.727 1.00 45.62 ? 266  TRP B CG  1 
ATOM   6573 C CD1 . TRP B 1 266 ? -13.878 -26.357 50.903 1.00 45.76 ? 266  TRP B CD1 1 
ATOM   6574 C CD2 . TRP B 1 266 ? -12.091 -25.097 51.350 1.00 46.00 ? 266  TRP B CD2 1 
ATOM   6575 N NE1 . TRP B 1 266 ? -12.903 -27.121 51.618 1.00 46.60 ? 266  TRP B NE1 1 
ATOM   6576 C CE2 . TRP B 1 266 ? -11.857 -26.368 51.858 1.00 45.88 ? 266  TRP B CE2 1 
ATOM   6577 C CE3 . TRP B 1 266 ? -11.116 -24.106 51.512 1.00 45.57 ? 266  TRP B CE3 1 
ATOM   6578 C CZ2 . TRP B 1 266 ? -10.668 -26.725 52.505 1.00 45.87 ? 266  TRP B CZ2 1 
ATOM   6579 C CZ3 . TRP B 1 266 ? -9.929  -24.471 52.181 1.00 46.16 ? 266  TRP B CZ3 1 
ATOM   6580 C CH2 . TRP B 1 266 ? -9.716  -25.720 52.650 1.00 46.19 ? 266  TRP B CH2 1 
ATOM   6581 N N   . ASP B 1 267 ? -15.351 -22.783 47.496 1.00 40.87 ? 267  ASP B N   1 
ATOM   6582 C CA  . ASP B 1 267 ? -15.981 -21.717 46.726 1.00 39.75 ? 267  ASP B CA  1 
ATOM   6583 C C   . ASP B 1 267 ? -15.953 -20.344 47.393 1.00 38.70 ? 267  ASP B C   1 
ATOM   6584 O O   . ASP B 1 267 ? -16.159 -19.336 46.714 1.00 38.85 ? 267  ASP B O   1 
ATOM   6585 C CB  . ASP B 1 267 ? -17.426 -22.077 46.353 1.00 41.48 ? 267  ASP B CB  1 
ATOM   6586 C CG  . ASP B 1 267 ? -18.333 -22.228 47.557 1.00 43.83 ? 267  ASP B CG  1 
ATOM   6587 O OD1 . ASP B 1 267 ? -17.982 -21.752 48.656 1.00 45.06 ? 267  ASP B OD1 1 
ATOM   6588 O OD2 . ASP B 1 267 ? -19.426 -22.816 47.400 1.00 46.53 ? 267  ASP B OD2 1 
ATOM   6589 N N   . TRP B 1 268 ? -15.723 -20.285 48.706 1.00 35.65 ? 268  TRP B N   1 
ATOM   6590 C CA  . TRP B 1 268 ? -15.661 -18.982 49.364 1.00 36.23 ? 268  TRP B CA  1 
ATOM   6591 C C   . TRP B 1 268 ? -14.257 -18.381 49.280 1.00 35.67 ? 268  TRP B C   1 
ATOM   6592 O O   . TRP B 1 268 ? -13.948 -17.380 49.938 1.00 36.17 ? 268  TRP B O   1 
ATOM   6593 C CB  . TRP B 1 268 ? -16.132 -19.040 50.827 1.00 36.88 ? 268  TRP B CB  1 
ATOM   6594 C CG  . TRP B 1 268 ? -15.826 -20.299 51.593 1.00 40.30 ? 268  TRP B CG  1 
ATOM   6595 C CD1 . TRP B 1 268 ? -16.701 -21.306 51.892 1.00 41.04 ? 268  TRP B CD1 1 
ATOM   6596 C CD2 . TRP B 1 268 ? -14.585 -20.648 52.224 1.00 41.11 ? 268  TRP B CD2 1 
ATOM   6597 N NE1 . TRP B 1 268 ? -16.086 -22.253 52.677 1.00 41.01 ? 268  TRP B NE1 1 
ATOM   6598 C CE2 . TRP B 1 268 ? -14.788 -21.876 52.896 1.00 40.69 ? 268  TRP B CE2 1 
ATOM   6599 C CE3 . TRP B 1 268 ? -13.322 -20.042 52.290 1.00 40.74 ? 268  TRP B CE3 1 
ATOM   6600 C CZ2 . TRP B 1 268 ? -13.775 -22.509 53.628 1.00 41.23 ? 268  TRP B CZ2 1 
ATOM   6601 C CZ3 . TRP B 1 268 ? -12.313 -20.670 53.019 1.00 41.22 ? 268  TRP B CZ3 1 
ATOM   6602 C CH2 . TRP B 1 268 ? -12.547 -21.891 53.679 1.00 40.36 ? 268  TRP B CH2 1 
ATOM   6603 N N   . VAL B 1 269 ? -13.412 -19.008 48.468 1.00 34.30 ? 269  VAL B N   1 
ATOM   6604 C CA  . VAL B 1 269 ? -12.054 -18.534 48.242 1.00 33.36 ? 269  VAL B CA  1 
ATOM   6605 C C   . VAL B 1 269 ? -12.029 -17.901 46.853 1.00 33.88 ? 269  VAL B C   1 
ATOM   6606 O O   . VAL B 1 269 ? -11.968 -18.602 45.843 1.00 31.62 ? 269  VAL B O   1 
ATOM   6607 C CB  . VAL B 1 269 ? -11.022 -19.684 48.272 1.00 34.37 ? 269  VAL B CB  1 
ATOM   6608 C CG1 . VAL B 1 269 ? -9.632  -19.148 47.921 1.00 33.70 ? 269  VAL B CG1 1 
ATOM   6609 C CG2 . VAL B 1 269 ? -10.993 -20.325 49.650 1.00 34.35 ? 269  VAL B CG2 1 
ATOM   6610 N N   . GLY B 1 270 ? -12.088 -16.573 46.804 1.00 32.70 ? 270  GLY B N   1 
ATOM   6611 C CA  . GLY B 1 270 ? -12.063 -15.907 45.516 1.00 33.51 ? 270  GLY B CA  1 
ATOM   6612 C C   . GLY B 1 270 ? -10.724 -16.112 44.840 1.00 32.90 ? 270  GLY B C   1 
ATOM   6613 O O   . GLY B 1 270 ? -9.684  -16.093 45.495 1.00 34.97 ? 270  GLY B O   1 
ATOM   6614 N N   . GLY B 1 271 ? -10.743 -16.305 43.526 1.00 32.14 ? 271  GLY B N   1 
ATOM   6615 C CA  . GLY B 1 271 ? -9.508  -16.510 42.800 1.00 31.67 ? 271  GLY B CA  1 
ATOM   6616 C C   . GLY B 1 271 ? -8.453  -15.452 43.081 1.00 32.24 ? 271  GLY B C   1 
ATOM   6617 O O   . GLY B 1 271 ? -7.303  -15.787 43.372 1.00 31.37 ? 271  GLY B O   1 
ATOM   6618 N N   . ARG B 1 272 ? -8.837  -14.176 43.013 1.00 29.99 ? 272  ARG B N   1 
ATOM   6619 C CA  . ARG B 1 272 ? -7.893  -13.085 43.245 1.00 29.48 ? 272  ARG B CA  1 
ATOM   6620 C C   . ARG B 1 272 ? -7.530  -12.928 44.722 1.00 30.00 ? 272  ARG B C   1 
ATOM   6621 O O   . ARG B 1 272 ? -6.759  -12.038 45.087 1.00 30.33 ? 272  ARG B O   1 
ATOM   6622 C CB  . ARG B 1 272 ? -8.461  -11.765 42.688 1.00 28.97 ? 272  ARG B CB  1 
ATOM   6623 C CG  . ARG B 1 272 ? -9.865  -11.422 43.179 1.00 27.48 ? 272  ARG B CG  1 
ATOM   6624 C CD  . ARG B 1 272 ? -10.415 -10.162 42.511 1.00 31.76 ? 272  ARG B CD  1 
ATOM   6625 N NE  . ARG B 1 272 ? -11.820 -9.932  42.847 1.00 30.50 ? 272  ARG B NE  1 
ATOM   6626 C CZ  . ARG B 1 272 ? -12.840 -10.577 42.288 1.00 30.07 ? 272  ARG B CZ  1 
ATOM   6627 N NH1 . ARG B 1 272 ? -12.621 -11.495 41.356 1.00 26.61 ? 272  ARG B NH1 1 
ATOM   6628 N NH2 . ARG B 1 272 ? -14.081 -10.307 42.672 1.00 26.48 ? 272  ARG B NH2 1 
ATOM   6629 N N   . TYR B 1 273 ? -8.094  -13.793 45.566 1.00 30.09 ? 273  TYR B N   1 
ATOM   6630 C CA  . TYR B 1 273 ? -7.821  -13.791 47.006 1.00 30.07 ? 273  TYR B CA  1 
ATOM   6631 C C   . TYR B 1 273 ? -7.444  -15.210 47.438 1.00 31.29 ? 273  TYR B C   1 
ATOM   6632 O O   . TYR B 1 273 ? -7.596  -15.555 48.604 1.00 30.98 ? 273  TYR B O   1 
ATOM   6633 C CB  . TYR B 1 273 ? -9.061  -13.392 47.820 1.00 28.82 ? 273  TYR B CB  1 
ATOM   6634 C CG  . TYR B 1 273 ? -9.588  -12.001 47.568 1.00 30.24 ? 273  TYR B CG  1 
ATOM   6635 C CD1 . TYR B 1 273 ? -10.689 -11.790 46.733 1.00 29.01 ? 273  TYR B CD1 1 
ATOM   6636 C CD2 . TYR B 1 273 ? -8.989  -10.892 48.172 1.00 29.86 ? 273  TYR B CD2 1 
ATOM   6637 C CE1 . TYR B 1 273 ? -11.181 -10.494 46.510 1.00 28.18 ? 273  TYR B CE1 1 
ATOM   6638 C CE2 . TYR B 1 273 ? -9.471  -9.602  47.955 1.00 31.25 ? 273  TYR B CE2 1 
ATOM   6639 C CZ  . TYR B 1 273 ? -10.565 -9.413  47.126 1.00 28.93 ? 273  TYR B CZ  1 
ATOM   6640 O OH  . TYR B 1 273 ? -11.039 -8.136  46.927 1.00 29.49 ? 273  TYR B OH  1 
ATOM   6641 N N   . SER B 1 274 ? -6.949  -16.015 46.504 1.00 31.20 ? 274  SER B N   1 
ATOM   6642 C CA  . SER B 1 274 ? -6.620  -17.412 46.782 1.00 31.28 ? 274  SER B CA  1 
ATOM   6643 C C   . SER B 1 274 ? -5.173  -17.839 47.055 1.00 32.69 ? 274  SER B C   1 
ATOM   6644 O O   . SER B 1 274 ? -4.940  -19.019 47.324 1.00 29.79 ? 274  SER B O   1 
ATOM   6645 C CB  . SER B 1 274 ? -7.144  -18.277 45.641 1.00 28.49 ? 274  SER B CB  1 
ATOM   6646 O OG  . SER B 1 274 ? -6.364  -18.085 44.475 1.00 27.49 ? 274  SER B OG  1 
ATOM   6647 N N   . LEU B 1 275 ? -4.205  -16.926 46.993 1.00 30.02 ? 275  LEU B N   1 
ATOM   6648 C CA  . LEU B 1 275 ? -2.812  -17.330 47.231 1.00 31.82 ? 275  LEU B CA  1 
ATOM   6649 C C   . LEU B 1 275 ? -2.591  -17.877 48.645 1.00 29.83 ? 275  LEU B C   1 
ATOM   6650 O O   . LEU B 1 275 ? -1.619  -18.593 48.902 1.00 31.71 ? 275  LEU B O   1 
ATOM   6651 C CB  . LEU B 1 275 ? -1.850  -16.160 46.975 1.00 28.09 ? 275  LEU B CB  1 
ATOM   6652 C CG  . LEU B 1 275 ? -1.855  -14.968 47.936 1.00 32.29 ? 275  LEU B CG  1 
ATOM   6653 C CD1 . LEU B 1 275 ? -0.868  -15.232 49.077 1.00 28.67 ? 275  LEU B CD1 1 
ATOM   6654 C CD2 . LEU B 1 275 ? -1.443  -13.699 47.181 1.00 31.16 ? 275  LEU B CD2 1 
ATOM   6655 N N   . TRP B 1 276 ? -3.500  -17.537 49.550 1.00 30.05 ? 276  TRP B N   1 
ATOM   6656 C CA  . TRP B 1 276 ? -3.423  -17.973 50.943 1.00 31.56 ? 276  TRP B CA  1 
ATOM   6657 C C   . TRP B 1 276 ? -3.863  -19.419 51.115 1.00 33.25 ? 276  TRP B C   1 
ATOM   6658 O O   . TRP B 1 276 ? -3.715  -20.002 52.200 1.00 34.60 ? 276  TRP B O   1 
ATOM   6659 C CB  . TRP B 1 276 ? -4.310  -17.083 51.809 1.00 30.21 ? 276  TRP B CB  1 
ATOM   6660 C CG  . TRP B 1 276 ? -4.216  -15.640 51.433 1.00 32.80 ? 276  TRP B CG  1 
ATOM   6661 C CD1 . TRP B 1 276 ? -5.087  -14.939 50.644 1.00 35.81 ? 276  TRP B CD1 1 
ATOM   6662 C CD2 . TRP B 1 276 ? -3.186  -14.723 51.810 1.00 33.13 ? 276  TRP B CD2 1 
ATOM   6663 N NE1 . TRP B 1 276 ? -4.660  -13.634 50.513 1.00 35.19 ? 276  TRP B NE1 1 
ATOM   6664 C CE2 . TRP B 1 276 ? -3.496  -13.477 51.218 1.00 33.76 ? 276  TRP B CE2 1 
ATOM   6665 C CE3 . TRP B 1 276 ? -2.026  -14.831 52.594 1.00 32.58 ? 276  TRP B CE3 1 
ATOM   6666 C CZ2 . TRP B 1 276 ? -2.689  -12.343 51.388 1.00 35.53 ? 276  TRP B CZ2 1 
ATOM   6667 C CZ3 . TRP B 1 276 ? -1.223  -13.703 52.761 1.00 31.64 ? 276  TRP B CZ3 1 
ATOM   6668 C CH2 . TRP B 1 276 ? -1.561  -12.477 52.161 1.00 32.10 ? 276  TRP B CH2 1 
ATOM   6669 N N   . SER B 1 277 ? -4.395  -19.996 50.044 1.00 32.83 ? 277  SER B N   1 
ATOM   6670 C CA  . SER B 1 277 ? -4.888  -21.365 50.086 1.00 32.77 ? 277  SER B CA  1 
ATOM   6671 C C   . SER B 1 277 ? -3.934  -22.334 49.415 1.00 32.62 ? 277  SER B C   1 
ATOM   6672 O O   . SER B 1 277 ? -2.752  -22.049 49.238 1.00 33.61 ? 277  SER B O   1 
ATOM   6673 C CB  . SER B 1 277 ? -6.243  -21.454 49.388 1.00 29.43 ? 277  SER B CB  1 
ATOM   6674 O OG  . SER B 1 277 ? -6.081  -21.323 47.982 1.00 32.82 ? 277  SER B OG  1 
ATOM   6675 N N   . ALA B 1 278 ? -4.474  -23.493 49.053 1.00 32.57 ? 278  ALA B N   1 
ATOM   6676 C CA  . ALA B 1 278 ? -3.716  -24.524 48.371 1.00 32.51 ? 278  ALA B CA  1 
ATOM   6677 C C   . ALA B 1 278 ? -3.085  -23.925 47.118 1.00 31.80 ? 278  ALA B C   1 
ATOM   6678 O O   . ALA B 1 278 ? -2.096  -24.440 46.607 1.00 30.54 ? 278  ALA B O   1 
ATOM   6679 C CB  . ALA B 1 278 ? -4.637  -25.668 47.992 1.00 34.34 ? 278  ALA B CB  1 
ATOM   6680 N N   . ILE B 1 279 ? -3.676  -22.841 46.614 1.00 31.87 ? 279  ILE B N   1 
ATOM   6681 C CA  . ILE B 1 279 ? -3.143  -22.168 45.427 1.00 29.87 ? 279  ILE B CA  1 
ATOM   6682 C C   . ILE B 1 279 ? -1.713  -21.707 45.705 1.00 28.03 ? 279  ILE B C   1 
ATOM   6683 O O   . ILE B 1 279 ? -0.915  -21.553 44.793 1.00 30.16 ? 279  ILE B O   1 
ATOM   6684 C CB  . ILE B 1 279 ? -4.000  -20.924 45.034 1.00 30.29 ? 279  ILE B CB  1 
ATOM   6685 C CG1 . ILE B 1 279 ? -5.324  -21.373 44.411 1.00 29.76 ? 279  ILE B CG1 1 
ATOM   6686 C CG2 . ILE B 1 279 ? -3.228  -20.036 44.039 1.00 27.66 ? 279  ILE B CG2 1 
ATOM   6687 C CD1 . ILE B 1 279 ? -5.171  -22.065 43.075 1.00 33.30 ? 279  ILE B CD1 1 
ATOM   6688 N N   . GLY B 1 280 ? -1.397  -21.489 46.976 1.00 30.59 ? 280  GLY B N   1 
ATOM   6689 C CA  . GLY B 1 280 ? -0.062  -21.050 47.336 1.00 32.40 ? 280  GLY B CA  1 
ATOM   6690 C C   . GLY B 1 280 ? 0.944   -22.184 47.449 1.00 33.67 ? 280  GLY B C   1 
ATOM   6691 O O   . GLY B 1 280 ? 2.051   -21.976 47.944 1.00 34.14 ? 280  GLY B O   1 
ATOM   6692 N N   . LEU B 1 281 ? 0.578   -23.376 46.985 1.00 35.13 ? 281  LEU B N   1 
ATOM   6693 C CA  . LEU B 1 281 ? 1.490   -24.522 47.066 1.00 35.39 ? 281  LEU B CA  1 
ATOM   6694 C C   . LEU B 1 281 ? 2.869   -24.215 46.490 1.00 35.85 ? 281  LEU B C   1 
ATOM   6695 O O   . LEU B 1 281 ? 3.888   -24.559 47.095 1.00 35.88 ? 281  LEU B O   1 
ATOM   6696 C CB  . LEU B 1 281 ? 0.892   -25.748 46.359 1.00 36.27 ? 281  LEU B CB  1 
ATOM   6697 C CG  . LEU B 1 281 ? 1.677   -27.065 46.507 1.00 38.50 ? 281  LEU B CG  1 
ATOM   6698 C CD1 . LEU B 1 281 ? 2.008   -27.327 47.978 1.00 37.50 ? 281  LEU B CD1 1 
ATOM   6699 C CD2 . LEU B 1 281 ? 0.858   -28.216 45.945 1.00 39.05 ? 281  LEU B CD2 1 
ATOM   6700 N N   . SER B 1 282 ? 2.912   -23.566 45.328 1.00 34.80 ? 282  SER B N   1 
ATOM   6701 C CA  . SER B 1 282 ? 4.187   -23.218 44.698 1.00 34.09 ? 282  SER B CA  1 
ATOM   6702 C C   . SER B 1 282 ? 4.994   -22.255 45.571 1.00 33.77 ? 282  SER B C   1 
ATOM   6703 O O   . SER B 1 282 ? 6.224   -22.238 45.516 1.00 34.17 ? 282  SER B O   1 
ATOM   6704 C CB  . SER B 1 282 ? 3.949   -22.586 43.321 1.00 35.12 ? 282  SER B CB  1 
ATOM   6705 O OG  . SER B 1 282 ? 3.162   -21.410 43.439 1.00 35.24 ? 282  SER B OG  1 
ATOM   6706 N N   . ILE B 1 283 ? 4.298   -21.443 46.365 1.00 34.13 ? 283  ILE B N   1 
ATOM   6707 C CA  . ILE B 1 283 ? 4.962   -20.503 47.259 1.00 34.59 ? 283  ILE B CA  1 
ATOM   6708 C C   . ILE B 1 283 ? 5.673   -21.299 48.356 1.00 35.31 ? 283  ILE B C   1 
ATOM   6709 O O   . ILE B 1 283 ? 6.875   -21.124 48.591 1.00 33.02 ? 283  ILE B O   1 
ATOM   6710 C CB  . ILE B 1 283 ? 3.952   -19.546 47.930 1.00 35.29 ? 283  ILE B CB  1 
ATOM   6711 C CG1 . ILE B 1 283 ? 3.247   -18.693 46.864 1.00 33.63 ? 283  ILE B CG1 1 
ATOM   6712 C CG2 . ILE B 1 283 ? 4.674   -18.659 48.945 1.00 35.81 ? 283  ILE B CG2 1 
ATOM   6713 C CD1 . ILE B 1 283 ? 2.231   -17.699 47.439 1.00 31.65 ? 283  ILE B CD1 1 
ATOM   6714 N N   . ALA B 1 284 ? 4.916   -22.178 49.010 1.00 36.50 ? 284  ALA B N   1 
ATOM   6715 C CA  . ALA B 1 284 ? 5.436   -23.016 50.085 1.00 38.07 ? 284  ALA B CA  1 
ATOM   6716 C C   . ALA B 1 284 ? 6.604   -23.874 49.612 1.00 38.38 ? 284  ALA B C   1 
ATOM   6717 O O   . ALA B 1 284 ? 7.591   -24.041 50.327 1.00 38.28 ? 284  ALA B O   1 
ATOM   6718 C CB  . ALA B 1 284 ? 4.322   -23.905 50.641 1.00 37.95 ? 284  ALA B CB  1 
ATOM   6719 N N   . LEU B 1 285 ? 6.492   -24.421 48.408 1.00 38.38 ? 285  LEU B N   1 
ATOM   6720 C CA  . LEU B 1 285 ? 7.556   -25.252 47.856 1.00 39.79 ? 285  LEU B CA  1 
ATOM   6721 C C   . LEU B 1 285 ? 8.816   -24.428 47.611 1.00 40.20 ? 285  LEU B C   1 
ATOM   6722 O O   . LEU B 1 285 ? 9.936   -24.922 47.757 1.00 39.20 ? 285  LEU B O   1 
ATOM   6723 C CB  . LEU B 1 285 ? 7.109   -25.883 46.537 1.00 40.00 ? 285  LEU B CB  1 
ATOM   6724 C CG  . LEU B 1 285 ? 6.025   -26.961 46.604 1.00 41.60 ? 285  LEU B CG  1 
ATOM   6725 C CD1 . LEU B 1 285 ? 5.489   -27.235 45.209 1.00 42.01 ? 285  LEU B CD1 1 
ATOM   6726 C CD2 . LEU B 1 285 ? 6.602   -28.231 47.215 1.00 43.49 ? 285  LEU B CD2 1 
ATOM   6727 N N   . HIS B 1 286 ? 8.623   -23.165 47.243 1.00 38.81 ? 286  HIS B N   1 
ATOM   6728 C CA  . HIS B 1 286 ? 9.739   -22.283 46.947 1.00 38.82 ? 286  HIS B CA  1 
ATOM   6729 C C   . HIS B 1 286 ? 10.500  -21.759 48.171 1.00 38.09 ? 286  HIS B C   1 
ATOM   6730 O O   . HIS B 1 286 ? 11.733  -21.831 48.222 1.00 36.99 ? 286  HIS B O   1 
ATOM   6731 C CB  . HIS B 1 286 ? 9.249   -21.094 46.115 1.00 39.19 ? 286  HIS B CB  1 
ATOM   6732 C CG  . HIS B 1 286 ? 10.345  -20.376 45.394 1.00 41.40 ? 286  HIS B CG  1 
ATOM   6733 N ND1 . HIS B 1 286 ? 10.379  -19.004 45.266 1.00 42.18 ? 286  HIS B ND1 1 
ATOM   6734 C CD2 . HIS B 1 286 ? 11.441  -20.840 44.749 1.00 41.26 ? 286  HIS B CD2 1 
ATOM   6735 C CE1 . HIS B 1 286 ? 11.449  -18.654 44.576 1.00 38.42 ? 286  HIS B CE1 1 
ATOM   6736 N NE2 . HIS B 1 286 ? 12.111  -19.749 44.250 1.00 43.01 ? 286  HIS B NE2 1 
ATOM   6737 N N   . VAL B 1 287 ? 9.774   -21.230 49.151 1.00 36.94 ? 287  VAL B N   1 
ATOM   6738 C CA  . VAL B 1 287 ? 10.414  -20.673 50.337 1.00 37.10 ? 287  VAL B CA  1 
ATOM   6739 C C   . VAL B 1 287 ? 10.307  -21.509 51.610 1.00 37.53 ? 287  VAL B C   1 
ATOM   6740 O O   . VAL B 1 287 ? 10.788  -21.088 52.661 1.00 37.39 ? 287  VAL B O   1 
ATOM   6741 C CB  . VAL B 1 287 ? 9.864   -19.256 50.647 1.00 36.54 ? 287  VAL B CB  1 
ATOM   6742 C CG1 . VAL B 1 287 ? 10.050  -18.360 49.441 1.00 33.79 ? 287  VAL B CG1 1 
ATOM   6743 C CG2 . VAL B 1 287 ? 8.394   -19.337 51.044 1.00 35.10 ? 287  VAL B CG2 1 
ATOM   6744 N N   . GLY B 1 288 ? 9.683   -22.681 51.519 1.00 38.99 ? 288  GLY B N   1 
ATOM   6745 C CA  . GLY B 1 288 ? 9.534   -23.540 52.685 1.00 39.86 ? 288  GLY B CA  1 
ATOM   6746 C C   . GLY B 1 288 ? 8.216   -23.264 53.382 1.00 40.86 ? 288  GLY B C   1 
ATOM   6747 O O   . GLY B 1 288 ? 7.632   -22.195 53.194 1.00 39.83 ? 288  GLY B O   1 
ATOM   6748 N N   . PHE B 1 289 ? 7.745   -24.199 54.203 1.00 40.51 ? 289  PHE B N   1 
ATOM   6749 C CA  . PHE B 1 289 ? 6.468   -24.001 54.876 1.00 42.07 ? 289  PHE B CA  1 
ATOM   6750 C C   . PHE B 1 289 ? 6.490   -23.039 56.058 1.00 42.63 ? 289  PHE B C   1 
ATOM   6751 O O   . PHE B 1 289 ? 5.470   -22.429 56.373 1.00 43.09 ? 289  PHE B O   1 
ATOM   6752 C CB  . PHE B 1 289 ? 5.875   -25.334 55.328 1.00 43.23 ? 289  PHE B CB  1 
ATOM   6753 C CG  . PHE B 1 289 ? 4.378   -25.368 55.263 1.00 40.53 ? 289  PHE B CG  1 
ATOM   6754 C CD1 . PHE B 1 289 ? 3.734   -25.565 54.046 1.00 42.98 ? 289  PHE B CD1 1 
ATOM   6755 C CD2 . PHE B 1 289 ? 3.612   -25.145 56.399 1.00 42.38 ? 289  PHE B CD2 1 
ATOM   6756 C CE1 . PHE B 1 289 ? 2.343   -25.537 53.961 1.00 42.51 ? 289  PHE B CE1 1 
ATOM   6757 C CE2 . PHE B 1 289 ? 2.220   -25.114 56.330 1.00 42.12 ? 289  PHE B CE2 1 
ATOM   6758 C CZ  . PHE B 1 289 ? 1.583   -25.310 55.108 1.00 42.46 ? 289  PHE B CZ  1 
ATOM   6759 N N   . ASP B 1 290 ? 7.630   -22.901 56.726 1.00 42.78 ? 290  ASP B N   1 
ATOM   6760 C CA  . ASP B 1 290 ? 7.693   -21.972 57.849 1.00 43.03 ? 290  ASP B CA  1 
ATOM   6761 C C   . ASP B 1 290 ? 7.501   -20.559 57.312 1.00 42.13 ? 290  ASP B C   1 
ATOM   6762 O O   . ASP B 1 290 ? 6.759   -19.765 57.886 1.00 39.59 ? 290  ASP B O   1 
ATOM   6763 C CB  . ASP B 1 290 ? 9.031   -22.070 58.582 1.00 45.64 ? 290  ASP B CB  1 
ATOM   6764 C CG  . ASP B 1 290 ? 9.176   -23.367 59.358 1.00 48.22 ? 290  ASP B CG  1 
ATOM   6765 O OD1 . ASP B 1 290 ? 8.180   -23.801 59.974 1.00 50.62 ? 290  ASP B OD1 1 
ATOM   6766 O OD2 . ASP B 1 290 ? 10.284  -23.942 59.363 1.00 49.67 ? 290  ASP B OD2 1 
ATOM   6767 N N   . ASN B 1 291 ? 8.169   -20.258 56.203 1.00 40.12 ? 291  ASN B N   1 
ATOM   6768 C CA  . ASN B 1 291 ? 8.054   -18.943 55.588 1.00 39.10 ? 291  ASN B CA  1 
ATOM   6769 C C   . ASN B 1 291 ? 6.644   -18.732 55.048 1.00 37.77 ? 291  ASN B C   1 
ATOM   6770 O O   . ASN B 1 291 ? 6.141   -17.609 55.045 1.00 39.45 ? 291  ASN B O   1 
ATOM   6771 C CB  . ASN B 1 291 ? 9.081   -18.798 54.470 1.00 37.99 ? 291  ASN B CB  1 
ATOM   6772 C CG  . ASN B 1 291 ? 10.448  -18.400 54.992 1.00 37.66 ? 291  ASN B CG  1 
ATOM   6773 O OD1 . ASN B 1 291 ? 11.469  -18.644 54.350 1.00 38.48 ? 291  ASN B OD1 1 
ATOM   6774 N ND2 . ASN B 1 291 ? 10.471  -17.769 56.154 1.00 36.06 ? 291  ASN B ND2 1 
ATOM   6775 N N   . PHE B 1 292 ? 6.008   -19.810 54.597 1.00 37.33 ? 292  PHE B N   1 
ATOM   6776 C CA  . PHE B 1 292 ? 4.643   -19.712 54.078 1.00 38.30 ? 292  PHE B CA  1 
ATOM   6777 C C   . PHE B 1 292 ? 3.696   -19.402 55.231 1.00 37.81 ? 292  PHE B C   1 
ATOM   6778 O O   . PHE B 1 292 ? 2.724   -18.648 55.075 1.00 36.18 ? 292  PHE B O   1 
ATOM   6779 C CB  . PHE B 1 292 ? 4.219   -21.014 53.397 1.00 39.44 ? 292  PHE B CB  1 
ATOM   6780 C CG  . PHE B 1 292 ? 2.850   -20.950 52.776 1.00 40.62 ? 292  PHE B CG  1 
ATOM   6781 C CD1 . PHE B 1 292 ? 2.598   -20.100 51.703 1.00 39.53 ? 292  PHE B CD1 1 
ATOM   6782 C CD2 . PHE B 1 292 ? 1.805   -21.719 53.281 1.00 41.80 ? 292  PHE B CD2 1 
ATOM   6783 C CE1 . PHE B 1 292 ? 1.325   -20.017 51.142 1.00 39.95 ? 292  PHE B CE1 1 
ATOM   6784 C CE2 . PHE B 1 292 ? 0.531   -21.643 52.727 1.00 41.52 ? 292  PHE B CE2 1 
ATOM   6785 C CZ  . PHE B 1 292 ? 0.291   -20.790 51.657 1.00 41.90 ? 292  PHE B CZ  1 
ATOM   6786 N N   . GLU B 1 293 ? 3.980   -19.975 56.398 1.00 34.86 ? 293  GLU B N   1 
ATOM   6787 C CA  . GLU B 1 293 ? 3.148   -19.709 57.562 1.00 35.46 ? 293  GLU B CA  1 
ATOM   6788 C C   . GLU B 1 293 ? 3.407   -18.287 58.055 1.00 33.61 ? 293  GLU B C   1 
ATOM   6789 O O   . GLU B 1 293 ? 2.534   -17.673 58.655 1.00 35.30 ? 293  GLU B O   1 
ATOM   6790 C CB  . GLU B 1 293 ? 3.418   -20.740 58.670 1.00 39.01 ? 293  GLU B CB  1 
ATOM   6791 C CG  . GLU B 1 293 ? 3.171   -22.165 58.198 1.00 39.74 ? 293  GLU B CG  1 
ATOM   6792 C CD  . GLU B 1 293 ? 3.214   -23.191 59.312 1.00 42.66 ? 293  GLU B CD  1 
ATOM   6793 O OE1 . GLU B 1 293 ? 4.126   -23.118 60.160 1.00 43.67 ? 293  GLU B OE1 1 
ATOM   6794 O OE2 . GLU B 1 293 ? 2.339   -24.084 59.325 1.00 44.64 ? 293  GLU B OE2 1 
ATOM   6795 N N   . GLN B 1 294 ? 4.600   -17.757 57.800 1.00 32.97 ? 294  GLN B N   1 
ATOM   6796 C CA  . GLN B 1 294 ? 4.885   -16.383 58.213 1.00 35.93 ? 294  GLN B CA  1 
ATOM   6797 C C   . GLN B 1 294 ? 4.019   -15.451 57.364 1.00 34.72 ? 294  GLN B C   1 
ATOM   6798 O O   . GLN B 1 294 ? 3.430   -14.498 57.872 1.00 35.65 ? 294  GLN B O   1 
ATOM   6799 C CB  . GLN B 1 294 ? 6.362   -16.033 58.014 1.00 38.48 ? 294  GLN B CB  1 
ATOM   6800 C CG  . GLN B 1 294 ? 7.299   -16.600 59.081 1.00 42.85 ? 294  GLN B CG  1 
ATOM   6801 C CD  . GLN B 1 294 ? 6.983   -16.087 60.477 1.00 45.02 ? 294  GLN B CD  1 
ATOM   6802 O OE1 . GLN B 1 294 ? 6.894   -14.876 60.709 1.00 46.19 ? 294  GLN B OE1 1 
ATOM   6803 N NE2 . GLN B 1 294 ? 6.819   -17.008 61.419 1.00 46.59 ? 294  GLN B NE2 1 
ATOM   6804 N N   . LEU B 1 295 ? 3.962   -15.739 56.067 1.00 35.21 ? 295  LEU B N   1 
ATOM   6805 C CA  . LEU B 1 295 ? 3.166   -14.959 55.123 1.00 35.04 ? 295  LEU B CA  1 
ATOM   6806 C C   . LEU B 1 295 ? 1.737   -14.897 55.648 1.00 33.68 ? 295  LEU B C   1 
ATOM   6807 O O   . LEU B 1 295 ? 1.152   -13.831 55.754 1.00 31.36 ? 295  LEU B O   1 
ATOM   6808 C CB  . LEU B 1 295 ? 3.188   -15.629 53.744 1.00 33.91 ? 295  LEU B CB  1 
ATOM   6809 C CG  . LEU B 1 295 ? 2.348   -14.987 52.633 1.00 35.20 ? 295  LEU B CG  1 
ATOM   6810 C CD1 . LEU B 1 295 ? 2.942   -13.626 52.251 1.00 37.06 ? 295  LEU B CD1 1 
ATOM   6811 C CD2 . LEU B 1 295 ? 2.313   -15.911 51.424 1.00 32.62 ? 295  LEU B CD2 1 
ATOM   6812 N N   . LEU B 1 296 ? 1.185   -16.057 55.989 1.00 33.85 ? 296  LEU B N   1 
ATOM   6813 C CA  . LEU B 1 296 ? -0.170  -16.135 56.520 1.00 34.45 ? 296  LEU B CA  1 
ATOM   6814 C C   . LEU B 1 296 ? -0.332  -15.333 57.811 1.00 33.42 ? 296  LEU B C   1 
ATOM   6815 O O   . LEU B 1 296 ? -1.318  -14.610 57.988 1.00 31.16 ? 296  LEU B O   1 
ATOM   6816 C CB  . LEU B 1 296 ? -0.540  -17.596 56.784 1.00 34.63 ? 296  LEU B CB  1 
ATOM   6817 C CG  . LEU B 1 296 ? -0.536  -18.496 55.550 1.00 38.41 ? 296  LEU B CG  1 
ATOM   6818 C CD1 . LEU B 1 296 ? -0.752  -19.961 55.947 1.00 38.91 ? 296  LEU B CD1 1 
ATOM   6819 C CD2 . LEU B 1 296 ? -1.625  -18.027 54.614 1.00 35.75 ? 296  LEU B CD2 1 
ATOM   6820 N N   . SER B 1 297 ? 0.641   -15.451 58.711 1.00 33.94 ? 297  SER B N   1 
ATOM   6821 C CA  . SER B 1 297 ? 0.571   -14.742 59.982 1.00 35.38 ? 297  SER B CA  1 
ATOM   6822 C C   . SER B 1 297 ? 0.539   -13.240 59.777 1.00 34.37 ? 297  SER B C   1 
ATOM   6823 O O   . SER B 1 297 ? -0.165  -12.532 60.495 1.00 35.63 ? 297  SER B O   1 
ATOM   6824 C CB  . SER B 1 297 ? 1.757   -15.120 60.872 1.00 35.74 ? 297  SER B CB  1 
ATOM   6825 O OG  . SER B 1 297 ? 1.787   -16.522 61.070 1.00 39.84 ? 297  SER B OG  1 
ATOM   6826 N N   . GLY B 1 298 ? 1.311   -12.760 58.804 1.00 35.49 ? 298  GLY B N   1 
ATOM   6827 C CA  . GLY B 1 298 ? 1.337   -11.335 58.518 1.00 31.69 ? 298  GLY B CA  1 
ATOM   6828 C C   . GLY B 1 298 ? -0.039  -10.862 58.092 1.00 33.02 ? 298  GLY B C   1 
ATOM   6829 O O   . GLY B 1 298 ? -0.478  -9.770  58.460 1.00 30.95 ? 298  GLY B O   1 
ATOM   6830 N N   . ALA B 1 299 ? -0.726  -11.694 57.316 1.00 33.54 ? 299  ALA B N   1 
ATOM   6831 C CA  . ALA B 1 299 ? -2.064  -11.371 56.842 1.00 33.99 ? 299  ALA B CA  1 
ATOM   6832 C C   . ALA B 1 299 ? -3.036  -11.389 58.018 1.00 34.48 ? 299  ALA B C   1 
ATOM   6833 O O   . ALA B 1 299 ? -3.898  -10.519 58.141 1.00 31.68 ? 299  ALA B O   1 
ATOM   6834 C CB  . ALA B 1 299 ? -2.501  -12.375 55.781 1.00 34.15 ? 299  ALA B CB  1 
ATOM   6835 N N   . HIS B 1 300 ? -2.881  -12.385 58.884 1.00 35.57 ? 300  HIS B N   1 
ATOM   6836 C CA  . HIS B 1 300 ? -3.737  -12.529 60.052 1.00 35.83 ? 300  HIS B CA  1 
ATOM   6837 C C   . HIS B 1 300 ? -3.578  -11.317 60.958 1.00 36.24 ? 300  HIS B C   1 
ATOM   6838 O O   . HIS B 1 300 ? -4.555  -10.821 61.523 1.00 36.53 ? 300  HIS B O   1 
ATOM   6839 C CB  . HIS B 1 300 ? -3.379  -13.812 60.817 1.00 36.25 ? 300  HIS B CB  1 
ATOM   6840 C CG  . HIS B 1 300 ? -4.283  -14.098 61.979 1.00 36.47 ? 300  HIS B CG  1 
ATOM   6841 N ND1 . HIS B 1 300 ? -5.636  -14.323 61.835 1.00 33.79 ? 300  HIS B ND1 1 
ATOM   6842 C CD2 . HIS B 1 300 ? -4.023  -14.204 63.304 1.00 37.96 ? 300  HIS B CD2 1 
ATOM   6843 C CE1 . HIS B 1 300 ? -6.171  -14.554 63.021 1.00 37.66 ? 300  HIS B CE1 1 
ATOM   6844 N NE2 . HIS B 1 300 ? -5.213  -14.488 63.930 1.00 37.88 ? 300  HIS B NE2 1 
ATOM   6845 N N   . TRP B 1 301 ? -2.347  -10.831 61.092 1.00 36.44 ? 301  TRP B N   1 
ATOM   6846 C CA  . TRP B 1 301 ? -2.105  -9.667  61.928 1.00 33.94 ? 301  TRP B CA  1 
ATOM   6847 C C   . TRP B 1 301 ? -2.890  -8.479  61.389 1.00 33.48 ? 301  TRP B C   1 
ATOM   6848 O O   . TRP B 1 301 ? -3.562  -7.776  62.142 1.00 33.65 ? 301  TRP B O   1 
ATOM   6849 C CB  . TRP B 1 301 ? -0.618  -9.310  61.960 1.00 36.22 ? 301  TRP B CB  1 
ATOM   6850 C CG  . TRP B 1 301 ? -0.325  -8.227  62.940 1.00 37.14 ? 301  TRP B CG  1 
ATOM   6851 C CD1 . TRP B 1 301 ? 0.010   -8.380  64.255 1.00 38.66 ? 301  TRP B CD1 1 
ATOM   6852 C CD2 . TRP B 1 301 ? -0.437  -6.820  62.716 1.00 37.98 ? 301  TRP B CD2 1 
ATOM   6853 N NE1 . TRP B 1 301 ? 0.107   -7.154  64.866 1.00 37.62 ? 301  TRP B NE1 1 
ATOM   6854 C CE2 . TRP B 1 301 ? -0.164  -6.177  63.944 1.00 40.02 ? 301  TRP B CE2 1 
ATOM   6855 C CE3 . TRP B 1 301 ? -0.748  -6.036  61.594 1.00 38.90 ? 301  TRP B CE3 1 
ATOM   6856 C CZ2 . TRP B 1 301 ? -0.191  -4.786  64.086 1.00 40.31 ? 301  TRP B CZ2 1 
ATOM   6857 C CZ3 . TRP B 1 301 ? -0.775  -4.654  61.732 1.00 38.02 ? 301  TRP B CZ3 1 
ATOM   6858 C CH2 . TRP B 1 301 ? -0.498  -4.042  62.972 1.00 42.26 ? 301  TRP B CH2 1 
ATOM   6859 N N   . MET B 1 302 ? -2.811  -8.260  60.080 1.00 32.15 ? 302  MET B N   1 
ATOM   6860 C CA  . MET B 1 302 ? -3.514  -7.138  59.456 1.00 31.25 ? 302  MET B CA  1 
ATOM   6861 C C   . MET B 1 302 ? -5.027  -7.316  59.531 1.00 29.56 ? 302  MET B C   1 
ATOM   6862 O O   . MET B 1 302 ? -5.757  -6.337  59.674 1.00 27.77 ? 302  MET B O   1 
ATOM   6863 C CB  . MET B 1 302 ? -3.072  -6.973  57.998 1.00 30.44 ? 302  MET B CB  1 
ATOM   6864 C CG  . MET B 1 302 ? -3.669  -5.762  57.297 1.00 29.97 ? 302  MET B CG  1 
ATOM   6865 S SD  . MET B 1 302 ? -3.355  -4.154  58.082 1.00 34.55 ? 302  MET B SD  1 
ATOM   6866 C CE  . MET B 1 302 ? -1.583  -4.113  58.118 1.00 34.51 ? 302  MET B CE  1 
ATOM   6867 N N   . ASP B 1 303 ? -5.498  -8.558  59.430 1.00 28.14 ? 303  ASP B N   1 
ATOM   6868 C CA  . ASP B 1 303 ? -6.927  -8.823  59.527 1.00 30.60 ? 303  ASP B CA  1 
ATOM   6869 C C   . ASP B 1 303 ? -7.420  -8.398  60.893 1.00 31.37 ? 303  ASP B C   1 
ATOM   6870 O O   . ASP B 1 303 ? -8.481  -7.790  61.017 1.00 33.44 ? 303  ASP B O   1 
ATOM   6871 C CB  . ASP B 1 303 ? -7.243  -10.305 59.361 1.00 32.84 ? 303  ASP B CB  1 
ATOM   6872 C CG  . ASP B 1 303 ? -6.937  -10.812 57.988 1.00 34.36 ? 303  ASP B CG  1 
ATOM   6873 O OD1 . ASP B 1 303 ? -6.920  -9.988  57.050 1.00 33.61 ? 303  ASP B OD1 1 
ATOM   6874 O OD2 . ASP B 1 303 ? -6.727  -12.037 57.848 1.00 33.97 ? 303  ASP B OD2 1 
ATOM   6875 N N   . GLN B 1 304 ? -6.643  -8.725  61.926 1.00 31.28 ? 304  GLN B N   1 
ATOM   6876 C CA  . GLN B 1 304 ? -7.024  -8.364  63.286 1.00 32.63 ? 304  GLN B CA  1 
ATOM   6877 C C   . GLN B 1 304 ? -6.979  -6.854  63.469 1.00 32.34 ? 304  GLN B C   1 
ATOM   6878 O O   . GLN B 1 304 ? -7.817  -6.285  64.158 1.00 33.87 ? 304  GLN B O   1 
ATOM   6879 C CB  . GLN B 1 304 ? -6.093  -9.040  64.292 1.00 35.99 ? 304  GLN B CB  1 
ATOM   6880 C CG  . GLN B 1 304 ? -6.086  -10.556 64.190 1.00 41.58 ? 304  GLN B CG  1 
ATOM   6881 C CD  . GLN B 1 304 ? -5.223  -11.201 65.256 1.00 45.45 ? 304  GLN B CD  1 
ATOM   6882 O OE1 . GLN B 1 304 ? -5.635  -11.335 66.410 1.00 45.89 ? 304  GLN B OE1 1 
ATOM   6883 N NE2 . GLN B 1 304 ? -4.009  -11.589 64.877 1.00 47.28 ? 304  GLN B NE2 1 
ATOM   6884 N N   . HIS B 1 305 ? -5.989  -6.205  62.862 1.00 32.65 ? 305  HIS B N   1 
ATOM   6885 C CA  . HIS B 1 305 ? -5.882  -4.753  62.961 1.00 31.93 ? 305  HIS B CA  1 
ATOM   6886 C C   . HIS B 1 305 ? -7.151  -4.136  62.367 1.00 31.48 ? 305  HIS B C   1 
ATOM   6887 O O   . HIS B 1 305 ? -7.767  -3.250  62.964 1.00 32.14 ? 305  HIS B O   1 
ATOM   6888 C CB  . HIS B 1 305 ? -4.646  -4.249  62.199 1.00 31.58 ? 305  HIS B CB  1 
ATOM   6889 C CG  . HIS B 1 305 ? -4.619  -2.762  62.003 1.00 30.46 ? 305  HIS B CG  1 
ATOM   6890 N ND1 . HIS B 1 305 ? -5.081  -2.155  60.854 1.00 31.89 ? 305  HIS B ND1 1 
ATOM   6891 C CD2 . HIS B 1 305 ? -4.225  -1.761  62.825 1.00 29.91 ? 305  HIS B CD2 1 
ATOM   6892 C CE1 . HIS B 1 305 ? -4.974  -0.843  60.979 1.00 34.28 ? 305  HIS B CE1 1 
ATOM   6893 N NE2 . HIS B 1 305 ? -4.459  -0.578  62.166 1.00 34.82 ? 305  HIS B NE2 1 
ATOM   6894 N N   . PHE B 1 306 ? -7.529  -4.617  61.186 1.00 31.92 ? 306  PHE B N   1 
ATOM   6895 C CA  . PHE B 1 306 ? -8.718  -4.128  60.496 1.00 32.75 ? 306  PHE B CA  1 
ATOM   6896 C C   . PHE B 1 306 ? -9.981  -4.336  61.324 1.00 33.21 ? 306  PHE B C   1 
ATOM   6897 O O   . PHE B 1 306 ? -10.841 -3.464  61.378 1.00 33.69 ? 306  PHE B O   1 
ATOM   6898 C CB  . PHE B 1 306 ? -8.855  -4.841  59.141 1.00 31.99 ? 306  PHE B CB  1 
ATOM   6899 C CG  . PHE B 1 306 ? -10.103 -4.476  58.365 1.00 34.32 ? 306  PHE B CG  1 
ATOM   6900 C CD1 . PHE B 1 306 ? -10.477 -3.148  58.189 1.00 32.22 ? 306  PHE B CD1 1 
ATOM   6901 C CD2 . PHE B 1 306 ? -10.874 -5.470  57.770 1.00 31.88 ? 306  PHE B CD2 1 
ATOM   6902 C CE1 . PHE B 1 306 ? -11.607 -2.815  57.427 1.00 34.19 ? 306  PHE B CE1 1 
ATOM   6903 C CE2 . PHE B 1 306 ? -12.005 -5.152  57.006 1.00 33.12 ? 306  PHE B CE2 1 
ATOM   6904 C CZ  . PHE B 1 306 ? -12.371 -3.825  56.835 1.00 34.50 ? 306  PHE B CZ  1 
ATOM   6905 N N   . ARG B 1 307 ? -10.073 -5.482  61.990 1.00 34.07 ? 307  ARG B N   1 
ATOM   6906 C CA  . ARG B 1 307 ? -11.252 -5.812  62.781 1.00 37.12 ? 307  ARG B CA  1 
ATOM   6907 C C   . ARG B 1 307 ? -11.390 -5.169  64.158 1.00 36.75 ? 307  ARG B C   1 
ATOM   6908 O O   . ARG B 1 307 ? -12.509 -4.951  64.620 1.00 35.61 ? 307  ARG B O   1 
ATOM   6909 C CB  . ARG B 1 307 ? -11.352 -7.328  62.942 1.00 37.73 ? 307  ARG B CB  1 
ATOM   6910 C CG  . ARG B 1 307 ? -12.725 -7.794  63.368 1.00 42.13 ? 307  ARG B CG  1 
ATOM   6911 C CD  . ARG B 1 307 ? -12.830 -9.313  63.312 1.00 41.86 ? 307  ARG B CD  1 
ATOM   6912 N NE  . ARG B 1 307 ? -14.200 -9.756  63.552 1.00 44.01 ? 307  ARG B NE  1 
ATOM   6913 C CZ  . ARG B 1 307 ? -14.569 -11.026 63.673 1.00 45.03 ? 307  ARG B CZ  1 
ATOM   6914 N NH1 . ARG B 1 307 ? -13.668 -11.996 63.580 1.00 44.62 ? 307  ARG B NH1 1 
ATOM   6915 N NH2 . ARG B 1 307 ? -15.846 -11.326 63.877 1.00 45.98 ? 307  ARG B NH2 1 
ATOM   6916 N N   . THR B 1 308 ? -10.270 -4.841  64.801 1.00 37.37 ? 308  THR B N   1 
ATOM   6917 C CA  . THR B 1 308 ? -10.317 -4.272  66.148 1.00 35.36 ? 308  THR B CA  1 
ATOM   6918 C C   . THR B 1 308 ? -10.006 -2.789  66.320 1.00 37.86 ? 308  THR B C   1 
ATOM   6919 O O   . THR B 1 308 ? -10.231 -2.239  67.400 1.00 37.96 ? 308  THR B O   1 
ATOM   6920 C CB  . THR B 1 308 ? -9.363  -5.038  67.087 1.00 34.41 ? 308  THR B CB  1 
ATOM   6921 O OG1 . THR B 1 308 ? -8.005  -4.798  66.695 1.00 32.34 ? 308  THR B OG1 1 
ATOM   6922 C CG2 . THR B 1 308 ? -9.632  -6.528  67.011 1.00 34.19 ? 308  THR B CG2 1 
ATOM   6923 N N   . THR B 1 309 ? -9.495  -2.136  65.280 1.00 37.91 ? 309  THR B N   1 
ATOM   6924 C CA  . THR B 1 309 ? -9.125  -0.727  65.389 1.00 37.57 ? 309  THR B CA  1 
ATOM   6925 C C   . THR B 1 309 ? -10.195 0.295   65.015 1.00 39.41 ? 309  THR B C   1 
ATOM   6926 O O   . THR B 1 309 ? -10.855 0.172   63.981 1.00 38.47 ? 309  THR B O   1 
ATOM   6927 C CB  . THR B 1 309 ? -7.877  -0.422  64.536 1.00 37.12 ? 309  THR B CB  1 
ATOM   6928 O OG1 . THR B 1 309 ? -6.837  -1.351  64.860 1.00 36.34 ? 309  THR B OG1 1 
ATOM   6929 C CG2 . THR B 1 309 ? -7.376  0.992   64.807 1.00 38.35 ? 309  THR B CG2 1 
ATOM   6930 N N   . PRO B 1 310 ? -10.391 1.317   65.869 1.00 39.84 ? 310  PRO B N   1 
ATOM   6931 C CA  . PRO B 1 310 ? -11.389 2.356   65.582 1.00 39.75 ? 310  PRO B CA  1 
ATOM   6932 C C   . PRO B 1 310 ? -11.098 2.912   64.184 1.00 40.55 ? 310  PRO B C   1 
ATOM   6933 O O   . PRO B 1 310 ? -9.942  3.174   63.849 1.00 39.83 ? 310  PRO B O   1 
ATOM   6934 C CB  . PRO B 1 310 ? -11.129 3.387   66.671 1.00 40.68 ? 310  PRO B CB  1 
ATOM   6935 C CG  . PRO B 1 310 ? -10.731 2.525   67.841 1.00 41.90 ? 310  PRO B CG  1 
ATOM   6936 C CD  . PRO B 1 310 ? -9.802  1.500   67.211 1.00 39.80 ? 310  PRO B CD  1 
ATOM   6937 N N   . LEU B 1 311 ? -12.144 3.089   63.382 1.00 40.61 ? 311  LEU B N   1 
ATOM   6938 C CA  . LEU B 1 311 ? -12.001 3.582   62.018 1.00 40.65 ? 311  LEU B CA  1 
ATOM   6939 C C   . LEU B 1 311 ? -10.920 4.638   61.832 1.00 41.13 ? 311  LEU B C   1 
ATOM   6940 O O   . LEU B 1 311 ? -10.084 4.509   60.943 1.00 41.48 ? 311  LEU B O   1 
ATOM   6941 C CB  . LEU B 1 311 ? -13.338 4.132   61.503 1.00 41.96 ? 311  LEU B CB  1 
ATOM   6942 C CG  . LEU B 1 311 ? -14.548 3.193   61.448 1.00 41.99 ? 311  LEU B CG  1 
ATOM   6943 C CD1 . LEU B 1 311 ? -15.691 3.908   60.732 1.00 44.33 ? 311  LEU B CD1 1 
ATOM   6944 C CD2 . LEU B 1 311 ? -14.200 1.912   60.714 1.00 41.38 ? 311  LEU B CD2 1 
ATOM   6945 N N   . GLU B 1 312 ? -10.926 5.671   62.675 1.00 43.42 ? 312  GLU B N   1 
ATOM   6946 C CA  . GLU B 1 312 ? -9.949  6.759   62.571 1.00 43.51 ? 312  GLU B CA  1 
ATOM   6947 C C   . GLU B 1 312 ? -8.474  6.361   62.647 1.00 43.11 ? 312  GLU B C   1 
ATOM   6948 O O   . GLU B 1 312 ? -7.602  7.161   62.303 1.00 43.41 ? 312  GLU B O   1 
ATOM   6949 C CB  . GLU B 1 312 ? -10.224 7.831   63.636 1.00 47.26 ? 312  GLU B CB  1 
ATOM   6950 C CG  . GLU B 1 312 ? -10.180 7.315   65.063 1.00 51.31 ? 312  GLU B CG  1 
ATOM   6951 C CD  . GLU B 1 312 ? -11.561 7.088   65.644 1.00 54.72 ? 312  GLU B CD  1 
ATOM   6952 O OE1 . GLU B 1 312 ? -12.460 6.626   64.903 1.00 55.16 ? 312  GLU B OE1 1 
ATOM   6953 O OE2 . GLU B 1 312 ? -11.745 7.363   66.850 1.00 57.24 ? 312  GLU B OE2 1 
ATOM   6954 N N   . LYS B 1 313 ? -8.190  5.142   63.096 1.00 41.52 ? 313  LYS B N   1 
ATOM   6955 C CA  . LYS B 1 313 ? -6.810  4.670   63.213 1.00 41.47 ? 313  LYS B CA  1 
ATOM   6956 C C   . LYS B 1 313 ? -6.615  3.353   62.465 1.00 40.06 ? 313  LYS B C   1 
ATOM   6957 O O   . LYS B 1 313 ? -5.597  2.680   62.625 1.00 36.86 ? 313  LYS B O   1 
ATOM   6958 C CB  . LYS B 1 313 ? -6.445  4.471   64.689 1.00 43.28 ? 313  LYS B CB  1 
ATOM   6959 C CG  . LYS B 1 313 ? -6.305  5.760   65.487 1.00 46.64 ? 313  LYS B CG  1 
ATOM   6960 C CD  . LYS B 1 313 ? -5.118  6.583   64.999 1.00 50.79 ? 313  LYS B CD  1 
ATOM   6961 C CE  . LYS B 1 313 ? -4.898  7.821   65.858 1.00 52.81 ? 313  LYS B CE  1 
ATOM   6962 N NZ  . LYS B 1 313 ? -6.073  8.740   65.838 1.00 55.59 ? 313  LYS B NZ  1 
ATOM   6963 N N   . ASN B 1 314 ? -7.597  3.011   61.638 1.00 38.59 ? 314  ASN B N   1 
ATOM   6964 C CA  . ASN B 1 314 ? -7.603  1.773   60.864 1.00 34.61 ? 314  ASN B CA  1 
ATOM   6965 C C   . ASN B 1 314 ? -6.959  2.008   59.487 1.00 34.13 ? 314  ASN B C   1 
ATOM   6966 O O   . ASN B 1 314 ? -7.529  2.707   58.644 1.00 32.36 ? 314  ASN B O   1 
ATOM   6967 C CB  . ASN B 1 314 ? -9.061  1.316   60.721 1.00 36.53 ? 314  ASN B CB  1 
ATOM   6968 C CG  . ASN B 1 314 ? -9.190  -0.143  60.341 1.00 34.27 ? 314  ASN B CG  1 
ATOM   6969 O OD1 . ASN B 1 314 ? -8.628  -0.591  59.344 1.00 36.31 ? 314  ASN B OD1 1 
ATOM   6970 N ND2 . ASN B 1 314 ? -9.952  -0.893  61.134 1.00 35.99 ? 314  ASN B ND2 1 
ATOM   6971 N N   . ALA B 1 315 ? -5.782  1.421   59.260 1.00 31.87 ? 315  ALA B N   1 
ATOM   6972 C CA  . ALA B 1 315 ? -5.050  1.607   58.002 1.00 32.33 ? 315  ALA B CA  1 
ATOM   6973 C C   . ALA B 1 315 ? -5.851  1.396   56.713 1.00 31.20 ? 315  ALA B C   1 
ATOM   6974 O O   . ALA B 1 315 ? -5.983  2.320   55.910 1.00 32.03 ? 315  ALA B O   1 
ATOM   6975 C CB  . ALA B 1 315 ? -3.789  0.733   57.980 1.00 30.76 ? 315  ALA B CB  1 
ATOM   6976 N N   . PRO B 1 316 ? -6.384  0.183   56.488 1.00 29.71 ? 316  PRO B N   1 
ATOM   6977 C CA  . PRO B 1 316 ? -7.155  -0.037  55.260 1.00 30.20 ? 316  PRO B CA  1 
ATOM   6978 C C   . PRO B 1 316 ? -8.365  0.884   55.087 1.00 31.00 ? 316  PRO B C   1 
ATOM   6979 O O   . PRO B 1 316 ? -8.764  1.179   53.963 1.00 30.66 ? 316  PRO B O   1 
ATOM   6980 C CB  . PRO B 1 316 ? -7.542  -1.520  55.346 1.00 29.62 ? 316  PRO B CB  1 
ATOM   6981 C CG  . PRO B 1 316 ? -7.436  -1.837  56.817 1.00 31.71 ? 316  PRO B CG  1 
ATOM   6982 C CD  . PRO B 1 316 ? -6.217  -1.076  57.229 1.00 30.81 ? 316  PRO B CD  1 
ATOM   6983 N N   . VAL B 1 317 ? -8.950  1.336   56.192 1.00 28.98 ? 317  VAL B N   1 
ATOM   6984 C CA  . VAL B 1 317 ? -10.103 2.227   56.118 1.00 29.12 ? 317  VAL B CA  1 
ATOM   6985 C C   . VAL B 1 317 ? -9.666  3.613   55.672 1.00 30.08 ? 317  VAL B C   1 
ATOM   6986 O O   . VAL B 1 317 ? -10.318 4.245   54.835 1.00 33.73 ? 317  VAL B O   1 
ATOM   6987 C CB  . VAL B 1 317 ? -10.820 2.350   57.480 1.00 28.27 ? 317  VAL B CB  1 
ATOM   6988 C CG1 . VAL B 1 317 ? -11.812 3.521   57.445 1.00 26.75 ? 317  VAL B CG1 1 
ATOM   6989 C CG2 . VAL B 1 317 ? -11.548 1.052   57.801 1.00 29.64 ? 317  VAL B CG2 1 
ATOM   6990 N N   . LEU B 1 318 ? -8.571  4.095   56.241 1.00 28.95 ? 318  LEU B N   1 
ATOM   6991 C CA  . LEU B 1 318 ? -8.047  5.405   55.868 1.00 30.26 ? 318  LEU B CA  1 
ATOM   6992 C C   . LEU B 1 318 ? -7.637  5.388   54.389 1.00 31.03 ? 318  LEU B C   1 
ATOM   6993 O O   . LEU B 1 318 ? -7.975  6.299   53.628 1.00 30.64 ? 318  LEU B O   1 
ATOM   6994 C CB  . LEU B 1 318 ? -6.861  5.763   56.764 1.00 27.90 ? 318  LEU B CB  1 
ATOM   6995 C CG  . LEU B 1 318 ? -7.264  5.926   58.234 1.00 27.81 ? 318  LEU B CG  1 
ATOM   6996 C CD1 . LEU B 1 318 ? -6.023  5.924   59.118 1.00 33.96 ? 318  LEU B CD1 1 
ATOM   6997 C CD2 . LEU B 1 318 ? -8.061  7.213   58.411 1.00 32.16 ? 318  LEU B CD2 1 
ATOM   6998 N N   . LEU B 1 319 ? -6.929  4.341   53.978 1.00 30.54 ? 319  LEU B N   1 
ATOM   6999 C CA  . LEU B 1 319 ? -6.510  4.221   52.580 1.00 29.97 ? 319  LEU B CA  1 
ATOM   7000 C C   . LEU B 1 319 ? -7.725  4.220   51.650 1.00 29.97 ? 319  LEU B C   1 
ATOM   7001 O O   . LEU B 1 319 ? -7.731  4.883   50.601 1.00 28.53 ? 319  LEU B O   1 
ATOM   7002 C CB  . LEU B 1 319 ? -5.702  2.936   52.369 1.00 31.63 ? 319  LEU B CB  1 
ATOM   7003 C CG  . LEU B 1 319 ? -4.277  2.905   52.939 1.00 31.65 ? 319  LEU B CG  1 
ATOM   7004 C CD1 . LEU B 1 319 ? -3.653  1.542   52.693 1.00 31.43 ? 319  LEU B CD1 1 
ATOM   7005 C CD2 . LEU B 1 319 ? -3.434  3.985   52.273 1.00 32.12 ? 319  LEU B CD2 1 
ATOM   7006 N N   . ALA B 1 320 ? -8.755  3.478   52.041 1.00 27.56 ? 320  ALA B N   1 
ATOM   7007 C CA  . ALA B 1 320 ? -9.970  3.382   51.245 1.00 29.60 ? 320  ALA B CA  1 
ATOM   7008 C C   . ALA B 1 320 ? -10.722 4.712   51.149 1.00 29.65 ? 320  ALA B C   1 
ATOM   7009 O O   . ALA B 1 320 ? -11.203 5.088   50.074 1.00 29.11 ? 320  ALA B O   1 
ATOM   7010 C CB  . ALA B 1 320 ? -10.885 2.316   51.832 1.00 29.42 ? 320  ALA B CB  1 
ATOM   7011 N N   . MET B 1 321 ? -10.830 5.426   52.266 1.00 29.97 ? 321  MET B N   1 
ATOM   7012 C CA  . MET B 1 321 ? -11.565 6.690   52.254 1.00 30.39 ? 321  MET B CA  1 
ATOM   7013 C C   . MET B 1 321 ? -10.853 7.816   51.515 1.00 31.12 ? 321  MET B C   1 
ATOM   7014 O O   . MET B 1 321 ? -11.507 8.670   50.916 1.00 30.28 ? 321  MET B O   1 
ATOM   7015 C CB  . MET B 1 321 ? -11.929 7.113   53.680 1.00 29.63 ? 321  MET B CB  1 
ATOM   7016 C CG  . MET B 1 321 ? -12.863 6.113   54.384 1.00 30.42 ? 321  MET B CG  1 
ATOM   7017 S SD  . MET B 1 321 ? -14.229 5.481   53.347 1.00 32.12 ? 321  MET B SD  1 
ATOM   7018 C CE  . MET B 1 321 ? -15.202 6.972   53.052 1.00 33.64 ? 321  MET B CE  1 
ATOM   7019 N N   . LEU B 1 322 ? -9.523  7.825   51.553 1.00 30.17 ? 322  LEU B N   1 
ATOM   7020 C CA  . LEU B 1 322 ? -8.771  8.841   50.825 1.00 31.45 ? 322  LEU B CA  1 
ATOM   7021 C C   . LEU B 1 322 ? -9.007  8.553   49.347 1.00 30.80 ? 322  LEU B C   1 
ATOM   7022 O O   . LEU B 1 322 ? -9.097  9.465   48.520 1.00 33.05 ? 322  LEU B O   1 
ATOM   7023 C CB  . LEU B 1 322 ? -7.275  8.758   51.156 1.00 31.39 ? 322  LEU B CB  1 
ATOM   7024 C CG  . LEU B 1 322 ? -6.868  9.199   52.570 1.00 33.21 ? 322  LEU B CG  1 
ATOM   7025 C CD1 . LEU B 1 322 ? -5.492  8.640   52.913 1.00 32.98 ? 322  LEU B CD1 1 
ATOM   7026 C CD2 . LEU B 1 322 ? -6.860  10.723  52.651 1.00 32.13 ? 322  LEU B CD2 1 
ATOM   7027 N N   . GLY B 1 323 ? -9.136  7.271   49.023 1.00 29.98 ? 323  GLY B N   1 
ATOM   7028 C CA  . GLY B 1 323 ? -9.380  6.879   47.644 1.00 28.90 ? 323  GLY B CA  1 
ATOM   7029 C C   . GLY B 1 323 ? -10.760 7.327   47.187 1.00 29.22 ? 323  GLY B C   1 
ATOM   7030 O O   . GLY B 1 323 ? -10.932 7.779   46.054 1.00 29.49 ? 323  GLY B O   1 
ATOM   7031 N N   . ILE B 1 324 ? -11.747 7.191   48.069 1.00 28.69 ? 324  ILE B N   1 
ATOM   7032 C CA  . ILE B 1 324 ? -13.117 7.592   47.763 1.00 29.38 ? 324  ILE B CA  1 
ATOM   7033 C C   . ILE B 1 324 ? -13.109 9.100   47.504 1.00 30.12 ? 324  ILE B C   1 
ATOM   7034 O O   . ILE B 1 324 ? -13.788 9.587   46.602 1.00 30.46 ? 324  ILE B O   1 
ATOM   7035 C CB  . ILE B 1 324 ? -14.062 7.275   48.946 1.00 29.04 ? 324  ILE B CB  1 
ATOM   7036 C CG1 . ILE B 1 324 ? -14.228 5.757   49.093 1.00 31.03 ? 324  ILE B CG1 1 
ATOM   7037 C CG2 . ILE B 1 324 ? -15.427 7.959   48.747 1.00 27.53 ? 324  ILE B CG2 1 
ATOM   7038 C CD1 . ILE B 1 324 ? -14.819 5.088   47.885 1.00 31.24 ? 324  ILE B CD1 1 
ATOM   7039 N N   . TRP B 1 325 ? -12.320 9.813   48.306 1.00 29.28 ? 325  TRP B N   1 
ATOM   7040 C CA  . TRP B 1 325 ? -12.162 11.270  48.220 1.00 30.56 ? 325  TRP B CA  1 
ATOM   7041 C C   . TRP B 1 325 ? -11.677 11.672  46.824 1.00 30.95 ? 325  TRP B C   1 
ATOM   7042 O O   . TRP B 1 325 ? -12.266 12.547  46.184 1.00 31.49 ? 325  TRP B O   1 
ATOM   7043 C CB  . TRP B 1 325 ? -11.170 11.724  49.306 1.00 30.07 ? 325  TRP B CB  1 
ATOM   7044 C CG  . TRP B 1 325 ? -10.834 13.193  49.356 1.00 32.83 ? 325  TRP B CG  1 
ATOM   7045 C CD1 . TRP B 1 325 ? -9.588  13.747  49.260 1.00 31.35 ? 325  TRP B CD1 1 
ATOM   7046 C CD2 . TRP B 1 325 ? -11.737 14.283  49.607 1.00 31.31 ? 325  TRP B CD2 1 
ATOM   7047 N NE1 . TRP B 1 325 ? -9.658  15.111  49.446 1.00 34.04 ? 325  TRP B NE1 1 
ATOM   7048 C CE2 . TRP B 1 325 ? -10.963 15.465  49.658 1.00 31.58 ? 325  TRP B CE2 1 
ATOM   7049 C CE3 . TRP B 1 325 ? -13.121 14.373  49.794 1.00 32.39 ? 325  TRP B CE3 1 
ATOM   7050 C CZ2 . TRP B 1 325 ? -11.528 16.726  49.891 1.00 33.36 ? 325  TRP B CZ2 1 
ATOM   7051 C CZ3 . TRP B 1 325 ? -13.687 15.634  50.028 1.00 34.95 ? 325  TRP B CZ3 1 
ATOM   7052 C CH2 . TRP B 1 325 ? -12.890 16.788  50.073 1.00 33.59 ? 325  TRP B CH2 1 
ATOM   7053 N N   . TYR B 1 326 ? -10.620 11.026  46.335 1.00 30.91 ? 326  TYR B N   1 
ATOM   7054 C CA  . TYR B 1 326 ? -10.096 11.347  45.003 1.00 31.24 ? 326  TYR B CA  1 
ATOM   7055 C C   . TYR B 1 326 ? -10.977 10.869  43.853 1.00 32.03 ? 326  TYR B C   1 
ATOM   7056 O O   . TYR B 1 326 ? -11.116 11.556  42.838 1.00 31.39 ? 326  TYR B O   1 
ATOM   7057 C CB  . TYR B 1 326 ? -8.693  10.769  44.831 1.00 31.06 ? 326  TYR B CB  1 
ATOM   7058 C CG  . TYR B 1 326 ? -7.700  11.413  45.753 1.00 32.69 ? 326  TYR B CG  1 
ATOM   7059 C CD1 . TYR B 1 326 ? -7.558  12.803  45.785 1.00 32.99 ? 326  TYR B CD1 1 
ATOM   7060 C CD2 . TYR B 1 326 ? -6.939  10.650  46.633 1.00 28.90 ? 326  TYR B CD2 1 
ATOM   7061 C CE1 . TYR B 1 326 ? -6.688  13.416  46.675 1.00 33.09 ? 326  TYR B CE1 1 
ATOM   7062 C CE2 . TYR B 1 326 ? -6.071  11.255  47.527 1.00 32.52 ? 326  TYR B CE2 1 
ATOM   7063 C CZ  . TYR B 1 326 ? -5.954  12.638  47.544 1.00 33.25 ? 326  TYR B CZ  1 
ATOM   7064 O OH  . TYR B 1 326 ? -5.133  13.240  48.465 1.00 33.80 ? 326  TYR B OH  1 
ATOM   7065 N N   . ILE B 1 327 ? -11.563 9.688   44.021 1.00 31.42 ? 327  ILE B N   1 
ATOM   7066 C CA  . ILE B 1 327 ? -12.423 9.096   43.009 1.00 31.27 ? 327  ILE B CA  1 
ATOM   7067 C C   . ILE B 1 327 ? -13.784 9.777   42.856 1.00 31.78 ? 327  ILE B C   1 
ATOM   7068 O O   . ILE B 1 327 ? -14.171 10.159  41.754 1.00 31.53 ? 327  ILE B O   1 
ATOM   7069 C CB  . ILE B 1 327 ? -12.649 7.587   43.309 1.00 31.63 ? 327  ILE B CB  1 
ATOM   7070 C CG1 . ILE B 1 327 ? -11.352 6.814   43.035 1.00 31.93 ? 327  ILE B CG1 1 
ATOM   7071 C CG2 . ILE B 1 327 ? -13.797 7.034   42.467 1.00 30.02 ? 327  ILE B CG2 1 
ATOM   7072 C CD1 . ILE B 1 327 ? -11.388 5.354   43.465 1.00 32.43 ? 327  ILE B CD1 1 
ATOM   7073 N N   . ASN B 1 328 ? -14.499 9.939   43.963 1.00 31.64 ? 328  ASN B N   1 
ATOM   7074 C CA  . ASN B 1 328 ? -15.834 10.516  43.917 1.00 31.49 ? 328  ASN B CA  1 
ATOM   7075 C C   . ASN B 1 328 ? -15.934 12.021  44.081 1.00 33.06 ? 328  ASN B C   1 
ATOM   7076 O O   . ASN B 1 328 ? -16.962 12.608  43.758 1.00 31.93 ? 328  ASN B O   1 
ATOM   7077 C CB  . ASN B 1 328 ? -16.715 9.816   44.944 1.00 32.41 ? 328  ASN B CB  1 
ATOM   7078 C CG  . ASN B 1 328 ? -16.855 8.331   44.657 1.00 32.11 ? 328  ASN B CG  1 
ATOM   7079 O OD1 . ASN B 1 328 ? -16.443 7.488   45.453 1.00 32.09 ? 328  ASN B OD1 1 
ATOM   7080 N ND2 . ASN B 1 328 ? -17.434 8.006   43.503 1.00 29.79 ? 328  ASN B ND2 1 
ATOM   7081 N N   . CYS B 1 329 ? -14.879 12.650  44.584 1.00 34.26 ? 329  CYS B N   1 
ATOM   7082 C CA  . CYS B 1 329 ? -14.906 14.093  44.740 1.00 37.39 ? 329  CYS B CA  1 
ATOM   7083 C C   . CYS B 1 329 ? -14.005 14.785  43.731 1.00 36.79 ? 329  CYS B C   1 
ATOM   7084 O O   . CYS B 1 329 ? -14.429 15.745  43.101 1.00 38.61 ? 329  CYS B O   1 
ATOM   7085 C CB  . CYS B 1 329 ? -14.543 14.497  46.170 1.00 37.48 ? 329  CYS B CB  1 
ATOM   7086 S SG  . CYS B 1 329 ? -16.004 14.603  47.237 1.00 47.52 ? 329  CYS B SG  1 
ATOM   7087 N N   . PHE B 1 330 ? -12.776 14.303  43.556 1.00 35.72 ? 330  PHE B N   1 
ATOM   7088 C CA  . PHE B 1 330 ? -11.887 14.922  42.582 1.00 36.42 ? 330  PHE B CA  1 
ATOM   7089 C C   . PHE B 1 330 ? -12.006 14.313  41.180 1.00 36.36 ? 330  PHE B C   1 
ATOM   7090 O O   . PHE B 1 330 ? -11.485 14.869  40.213 1.00 36.83 ? 330  PHE B O   1 
ATOM   7091 C CB  . PHE B 1 330 ? -10.428 14.867  43.053 1.00 38.60 ? 330  PHE B CB  1 
ATOM   7092 C CG  . PHE B 1 330 ? -10.076 15.918  44.072 1.00 38.64 ? 330  PHE B CG  1 
ATOM   7093 C CD1 . PHE B 1 330 ? -10.114 15.632  45.434 1.00 39.92 ? 330  PHE B CD1 1 
ATOM   7094 C CD2 . PHE B 1 330 ? -9.692  17.196  43.667 1.00 40.57 ? 330  PHE B CD2 1 
ATOM   7095 C CE1 . PHE B 1 330 ? -9.771  16.601  46.382 1.00 37.20 ? 330  PHE B CE1 1 
ATOM   7096 C CE2 . PHE B 1 330 ? -9.348  18.174  44.606 1.00 39.41 ? 330  PHE B CE2 1 
ATOM   7097 C CZ  . PHE B 1 330 ? -9.386  17.875  45.966 1.00 38.89 ? 330  PHE B CZ  1 
ATOM   7098 N N   . GLY B 1 331 ? -12.689 13.175  41.072 1.00 35.22 ? 331  GLY B N   1 
ATOM   7099 C CA  . GLY B 1 331 ? -12.877 12.542  39.776 1.00 32.47 ? 331  GLY B CA  1 
ATOM   7100 C C   . GLY B 1 331 ? -11.665 11.871  39.157 1.00 32.84 ? 331  GLY B C   1 
ATOM   7101 O O   . GLY B 1 331 ? -11.597 11.714  37.931 1.00 31.17 ? 331  GLY B O   1 
ATOM   7102 N N   . CYS B 1 332 ? -10.708 11.470  39.988 1.00 30.64 ? 332  CYS B N   1 
ATOM   7103 C CA  . CYS B 1 332 ? -9.495  10.820  39.495 1.00 30.45 ? 332  CYS B CA  1 
ATOM   7104 C C   . CYS B 1 332 ? -9.784  9.402   39.017 1.00 29.55 ? 332  CYS B C   1 
ATOM   7105 O O   . CYS B 1 332 ? -10.274 8.571   39.780 1.00 28.53 ? 332  CYS B O   1 
ATOM   7106 C CB  . CYS B 1 332 ? -8.427  10.778  40.594 1.00 31.08 ? 332  CYS B CB  1 
ATOM   7107 S SG  . CYS B 1 332 ? -7.874  12.413  41.148 1.00 34.71 ? 332  CYS B SG  1 
ATOM   7108 N N   . GLU B 1 333 ? -9.475  9.138   37.752 1.00 29.35 ? 333  GLU B N   1 
ATOM   7109 C CA  . GLU B 1 333 ? -9.701  7.828   37.157 1.00 28.74 ? 333  GLU B CA  1 
ATOM   7110 C C   . GLU B 1 333 ? -8.728  6.738   37.594 1.00 28.94 ? 333  GLU B C   1 
ATOM   7111 O O   . GLU B 1 333 ? -9.093  5.557   37.613 1.00 25.65 ? 333  GLU B O   1 
ATOM   7112 C CB  . GLU B 1 333 ? -9.617  7.905   35.626 1.00 29.93 ? 333  GLU B CB  1 
ATOM   7113 C CG  . GLU B 1 333 ? -10.859 8.391   34.890 1.00 31.48 ? 333  GLU B CG  1 
ATOM   7114 C CD  . GLU B 1 333 ? -10.800 8.047   33.395 1.00 35.50 ? 333  GLU B CD  1 
ATOM   7115 O OE1 . GLU B 1 333 ? -10.256 6.975   33.043 1.00 36.99 ? 333  GLU B OE1 1 
ATOM   7116 O OE2 . GLU B 1 333 ? -11.307 8.832   32.568 1.00 38.13 ? 333  GLU B OE2 1 
ATOM   7117 N N   . THR B 1 334 ? -7.491  7.110   37.912 1.00 27.73 ? 334  THR B N   1 
ATOM   7118 C CA  . THR B 1 334 ? -6.495  6.094   38.268 1.00 29.15 ? 334  THR B CA  1 
ATOM   7119 C C   . THR B 1 334 ? -5.882  6.169   39.660 1.00 31.02 ? 334  THR B C   1 
ATOM   7120 O O   . THR B 1 334 ? -6.069  7.134   40.396 1.00 30.02 ? 334  THR B O   1 
ATOM   7121 C CB  . THR B 1 334 ? -5.322  6.086   37.255 1.00 29.77 ? 334  THR B CB  1 
ATOM   7122 O OG1 . THR B 1 334 ? -4.440  7.195   37.509 1.00 28.18 ? 334  THR B OG1 1 
ATOM   7123 C CG2 . THR B 1 334 ? -5.854  6.197   35.830 1.00 31.36 ? 334  THR B CG2 1 
ATOM   7124 N N   . GLN B 1 335 ? -5.141  5.114   39.991 1.00 29.44 ? 335  GLN B N   1 
ATOM   7125 C CA  . GLN B 1 335 ? -4.440  4.976   41.262 1.00 31.48 ? 335  GLN B CA  1 
ATOM   7126 C C   . GLN B 1 335 ? -3.115  4.297   40.928 1.00 30.16 ? 335  GLN B C   1 
ATOM   7127 O O   . GLN B 1 335 ? -3.099  3.158   40.454 1.00 31.28 ? 335  GLN B O   1 
ATOM   7128 C CB  . GLN B 1 335 ? -5.247  4.097   42.232 1.00 29.35 ? 335  GLN B CB  1 
ATOM   7129 C CG  . GLN B 1 335 ? -4.492  3.689   43.497 1.00 33.29 ? 335  GLN B CG  1 
ATOM   7130 C CD  . GLN B 1 335 ? -4.211  4.858   44.410 1.00 31.75 ? 335  GLN B CD  1 
ATOM   7131 O OE1 . GLN B 1 335 ? -5.130  5.469   44.949 1.00 34.33 ? 335  GLN B OE1 1 
ATOM   7132 N NE2 . GLN B 1 335 ? -2.937  5.177   44.590 1.00 29.79 ? 335  GLN B NE2 1 
ATOM   7133 N N   . ALA B 1 336 ? -2.010  5.000   41.152 1.00 30.21 ? 336  ALA B N   1 
ATOM   7134 C CA  . ALA B 1 336 ? -0.691  4.440   40.875 1.00 29.53 ? 336  ALA B CA  1 
ATOM   7135 C C   . ALA B 1 336 ? -0.110  3.761   42.103 1.00 28.56 ? 336  ALA B C   1 
ATOM   7136 O O   . ALA B 1 336 ? -0.260  4.250   43.221 1.00 27.33 ? 336  ALA B O   1 
ATOM   7137 C CB  . ALA B 1 336 ? 0.256   5.525   40.401 1.00 28.95 ? 336  ALA B CB  1 
ATOM   7138 N N   . VAL B 1 337 ? 0.556   2.633   41.876 1.00 29.45 ? 337  VAL B N   1 
ATOM   7139 C CA  . VAL B 1 337 ? 1.191   1.854   42.939 1.00 29.32 ? 337  VAL B CA  1 
ATOM   7140 C C   . VAL B 1 337 ? 2.663   1.782   42.551 1.00 29.16 ? 337  VAL B C   1 
ATOM   7141 O O   . VAL B 1 337 ? 3.042   1.112   41.576 1.00 28.58 ? 337  VAL B O   1 
ATOM   7142 C CB  . VAL B 1 337 ? 0.610   0.426   43.024 1.00 28.62 ? 337  VAL B CB  1 
ATOM   7143 C CG1 . VAL B 1 337 ? 1.384   -0.378  44.057 1.00 28.00 ? 337  VAL B CG1 1 
ATOM   7144 C CG2 . VAL B 1 337 ? -0.871  0.486   43.390 1.00 28.48 ? 337  VAL B CG2 1 
ATOM   7145 N N   . LEU B 1 338 ? 3.493   2.463   43.334 1.00 28.33 ? 338  LEU B N   1 
ATOM   7146 C CA  . LEU B 1 338 ? 4.910   2.581   43.018 1.00 28.53 ? 338  LEU B CA  1 
ATOM   7147 C C   . LEU B 1 338 ? 5.864   2.068   44.103 1.00 29.66 ? 338  LEU B C   1 
ATOM   7148 O O   . LEU B 1 338 ? 6.417   2.854   44.888 1.00 29.77 ? 338  LEU B O   1 
ATOM   7149 C CB  . LEU B 1 338 ? 5.195   4.058   42.702 1.00 29.21 ? 338  LEU B CB  1 
ATOM   7150 C CG  . LEU B 1 338 ? 4.244   4.664   41.670 1.00 31.20 ? 338  LEU B CG  1 
ATOM   7151 C CD1 . LEU B 1 338 ? 4.368   6.188   41.573 1.00 32.43 ? 338  LEU B CD1 1 
ATOM   7152 C CD2 . LEU B 1 338 ? 4.486   4.137   40.255 1.00 30.24 ? 338  LEU B CD2 1 
ATOM   7153 N N   . PRO B 1 339 ? 6.085   0.741   44.189 1.00 30.64 ? 339  PRO B N   1 
ATOM   7154 C CA  . PRO B 1 339 ? 7.043   0.164   45.129 1.00 29.85 ? 339  PRO B CA  1 
ATOM   7155 C C   . PRO B 1 339 ? 8.468   0.449   44.716 1.00 30.19 ? 339  PRO B C   1 
ATOM   7156 O O   . PRO B 1 339 ? 8.840   0.177   43.535 1.00 29.38 ? 339  PRO B O   1 
ATOM   7157 C CB  . PRO B 1 339 ? 6.861   -1.326  44.982 1.00 31.26 ? 339  PRO B CB  1 
ATOM   7158 C CG  . PRO B 1 339 ? 5.848   -1.562  43.877 1.00 31.48 ? 339  PRO B CG  1 
ATOM   7159 C CD  . PRO B 1 339 ? 5.379   -0.236  43.355 1.00 31.48 ? 339  PRO B CD  1 
ATOM   7160 N N   . TYR B 1 340 ? 9.268   0.964   45.633 1.00 28.71 ? 340  TYR B N   1 
ATOM   7161 C CA  . TYR B 1 340 ? 10.698  1.195   45.349 1.00 30.29 ? 340  TYR B CA  1 
ATOM   7162 C C   . TYR B 1 340 ? 11.470  -0.046  45.798 1.00 31.69 ? 340  TYR B C   1 
ATOM   7163 O O   . TYR B 1 340 ? 12.253  -0.001  46.757 1.00 31.98 ? 340  TYR B O   1 
ATOM   7164 C CB  . TYR B 1 340 ? 11.194  2.452   46.064 1.00 28.74 ? 340  TYR B CB  1 
ATOM   7165 C CG  . TYR B 1 340 ? 10.931  3.712   45.239 1.00 29.85 ? 340  TYR B CG  1 
ATOM   7166 C CD1 . TYR B 1 340 ? 9.633   3.986   44.800 1.00 29.27 ? 340  TYR B CD1 1 
ATOM   7167 C CD2 . TYR B 1 340 ? 11.980  4.584   44.918 1.00 28.95 ? 340  TYR B CD2 1 
ATOM   7168 C CE1 . TYR B 1 340 ? 9.381   5.124   44.030 1.00 29.99 ? 340  TYR B CE1 1 
ATOM   7169 C CE2 . TYR B 1 340 ? 11.727  5.722   44.144 1.00 30.81 ? 340  TYR B CE2 1 
ATOM   7170 C CZ  . TYR B 1 340 ? 10.427  5.990   43.699 1.00 31.58 ? 340  TYR B CZ  1 
ATOM   7171 O OH  . TYR B 1 340 ? 10.181  7.091   42.940 1.00 34.13 ? 340  TYR B OH  1 
ATOM   7172 N N   . ASP B 1 341 ? 11.199  -1.118  45.071 1.00 31.76 ? 341  ASP B N   1 
ATOM   7173 C CA  . ASP B 1 341 ? 11.764  -2.446  45.345 1.00 31.67 ? 341  ASP B CA  1 
ATOM   7174 C C   . ASP B 1 341 ? 11.618  -3.331  44.108 1.00 32.23 ? 341  ASP B C   1 
ATOM   7175 O O   . ASP B 1 341 ? 10.499  -3.579  43.649 1.00 30.17 ? 341  ASP B O   1 
ATOM   7176 C CB  . ASP B 1 341 ? 10.987  -3.057  46.514 1.00 33.93 ? 341  ASP B CB  1 
ATOM   7177 C CG  . ASP B 1 341 ? 11.581  -4.360  47.030 1.00 35.34 ? 341  ASP B CG  1 
ATOM   7178 O OD1 . ASP B 1 341 ? 12.438  -4.337  47.991 1.00 35.08 ? 341  ASP B OD1 1 
ATOM   7179 O OD2 . ASP B 1 341 ? 11.218  -5.480  46.507 1.00 38.06 ? 341  ASP B OD2 1 
ATOM   7180 N N   . GLN B 1 342 ? 12.747  -3.808  43.585 1.00 31.44 ? 342  GLN B N   1 
ATOM   7181 C CA  . GLN B 1 342 ? 12.778  -4.653  42.392 1.00 31.82 ? 342  GLN B CA  1 
ATOM   7182 C C   . GLN B 1 342 ? 12.080  -5.989  42.601 1.00 33.38 ? 342  GLN B C   1 
ATOM   7183 O O   . GLN B 1 342 ? 11.496  -6.535  41.675 1.00 30.37 ? 342  GLN B O   1 
ATOM   7184 C CB  . GLN B 1 342 ? 14.228  -4.914  41.971 1.00 33.68 ? 342  GLN B CB  1 
ATOM   7185 C CG  . GLN B 1 342 ? 14.405  -5.515  40.578 1.00 36.06 ? 342  GLN B CG  1 
ATOM   7186 C CD  . GLN B 1 342 ? 13.789  -4.659  39.482 1.00 39.68 ? 342  GLN B CD  1 
ATOM   7187 O OE1 . GLN B 1 342 ? 13.792  -3.427  39.560 1.00 39.22 ? 342  GLN B OE1 1 
ATOM   7188 N NE2 . GLN B 1 342 ? 13.266  -5.310  38.446 1.00 39.61 ? 342  GLN B NE2 1 
ATOM   7189 N N   . TYR B 1 343 ? 12.165  -6.523  43.817 1.00 33.63 ? 343  TYR B N   1 
ATOM   7190 C CA  . TYR B 1 343 ? 11.538  -7.801  44.131 1.00 32.27 ? 343  TYR B CA  1 
ATOM   7191 C C   . TYR B 1 343 ? 10.018  -7.692  44.007 1.00 32.34 ? 343  TYR B C   1 
ATOM   7192 O O   . TYR B 1 343 ? 9.341   -8.674  43.722 1.00 31.69 ? 343  TYR B O   1 
ATOM   7193 C CB  . TYR B 1 343 ? 11.936  -8.244  45.541 1.00 34.43 ? 343  TYR B CB  1 
ATOM   7194 C CG  . TYR B 1 343 ? 13.279  -8.945  45.609 1.00 34.53 ? 343  TYR B CG  1 
ATOM   7195 C CD1 . TYR B 1 343 ? 14.204  -8.633  46.608 1.00 35.25 ? 343  TYR B CD1 1 
ATOM   7196 C CD2 . TYR B 1 343 ? 13.614  -9.945  44.693 1.00 36.29 ? 343  TYR B CD2 1 
ATOM   7197 C CE1 . TYR B 1 343 ? 15.431  -9.306  46.692 1.00 36.79 ? 343  TYR B CE1 1 
ATOM   7198 C CE2 . TYR B 1 343 ? 14.836  -10.620 44.769 1.00 35.16 ? 343  TYR B CE2 1 
ATOM   7199 C CZ  . TYR B 1 343 ? 15.736  -10.295 45.770 1.00 38.12 ? 343  TYR B CZ  1 
ATOM   7200 O OH  . TYR B 1 343 ? 16.945  -10.952 45.839 1.00 38.21 ? 343  TYR B OH  1 
ATOM   7201 N N   . LEU B 1 344 ? 9.489   -6.490  44.213 1.00 32.77 ? 344  LEU B N   1 
ATOM   7202 C CA  . LEU B 1 344 ? 8.050   -6.262  44.100 1.00 32.60 ? 344  LEU B CA  1 
ATOM   7203 C C   . LEU B 1 344 ? 7.672   -5.827  42.683 1.00 31.72 ? 344  LEU B C   1 
ATOM   7204 O O   . LEU B 1 344 ? 6.685   -5.112  42.486 1.00 32.05 ? 344  LEU B O   1 
ATOM   7205 C CB  . LEU B 1 344 ? 7.599   -5.196  45.106 1.00 32.43 ? 344  LEU B CB  1 
ATOM   7206 C CG  . LEU B 1 344 ? 7.619   -5.579  46.588 1.00 33.47 ? 344  LEU B CG  1 
ATOM   7207 C CD1 . LEU B 1 344 ? 7.284   -4.371  47.433 1.00 34.27 ? 344  LEU B CD1 1 
ATOM   7208 C CD2 . LEU B 1 344 ? 6.634   -6.716  46.847 1.00 34.86 ? 344  LEU B CD2 1 
ATOM   7209 N N   . HIS B 1 345 ? 8.442   -6.262  41.687 1.00 29.85 ? 345  HIS B N   1 
ATOM   7210 C CA  . HIS B 1 345 ? 8.144   -5.853  40.314 1.00 31.68 ? 345  HIS B CA  1 
ATOM   7211 C C   . HIS B 1 345 ? 6.781   -6.300  39.770 1.00 31.50 ? 345  HIS B C   1 
ATOM   7212 O O   . HIS B 1 345 ? 6.322   -5.768  38.758 1.00 31.00 ? 345  HIS B O   1 
ATOM   7213 C CB  . HIS B 1 345 ? 9.284   -6.257  39.359 1.00 32.64 ? 345  HIS B CB  1 
ATOM   7214 C CG  . HIS B 1 345 ? 9.457   -7.737  39.187 1.00 32.79 ? 345  HIS B CG  1 
ATOM   7215 N ND1 . HIS B 1 345 ? 9.066   -8.402  38.045 1.00 32.14 ? 345  HIS B ND1 1 
ATOM   7216 C CD2 . HIS B 1 345 ? 10.000  -8.675  39.999 1.00 34.11 ? 345  HIS B CD2 1 
ATOM   7217 C CE1 . HIS B 1 345 ? 9.362   -9.685  38.159 1.00 34.24 ? 345  HIS B CE1 1 
ATOM   7218 N NE2 . HIS B 1 345 ? 9.931   -9.877  39.335 1.00 34.03 ? 345  HIS B NE2 1 
ATOM   7219 N N   . ARG B 1 346 ? 6.112   -7.243  40.442 1.00 30.41 ? 346  ARG B N   1 
ATOM   7220 C CA  . ARG B 1 346 ? 4.784   -7.670  39.994 1.00 29.51 ? 346  ARG B CA  1 
ATOM   7221 C C   . ARG B 1 346 ? 3.680   -7.274  40.988 1.00 29.51 ? 346  ARG B C   1 
ATOM   7222 O O   . ARG B 1 346 ? 2.531   -7.691  40.849 1.00 28.26 ? 346  ARG B O   1 
ATOM   7223 C CB  . ARG B 1 346 ? 4.752   -9.188  39.749 1.00 32.26 ? 346  ARG B CB  1 
ATOM   7224 C CG  . ARG B 1 346 ? 5.735   -9.658  38.682 1.00 35.12 ? 346  ARG B CG  1 
ATOM   7225 C CD  . ARG B 1 346 ? 5.712   -8.742  37.454 1.00 38.35 ? 346  ARG B CD  1 
ATOM   7226 N NE  . ARG B 1 346 ? 4.488   -8.892  36.680 1.00 38.13 ? 346  ARG B NE  1 
ATOM   7227 C CZ  . ARG B 1 346 ? 4.022   -7.992  35.821 1.00 34.24 ? 346  ARG B CZ  1 
ATOM   7228 N NH1 . ARG B 1 346 ? 4.673   -6.852  35.622 1.00 35.50 ? 346  ARG B NH1 1 
ATOM   7229 N NH2 . ARG B 1 346 ? 2.911   -8.245  35.140 1.00 34.04 ? 346  ARG B NH2 1 
ATOM   7230 N N   . PHE B 1 347 ? 4.031   -6.441  41.969 1.00 29.75 ? 347  PHE B N   1 
ATOM   7231 C CA  . PHE B 1 347 ? 3.095   -5.991  43.004 1.00 30.02 ? 347  PHE B CA  1 
ATOM   7232 C C   . PHE B 1 347 ? 1.966   -5.125  42.437 1.00 30.34 ? 347  PHE B C   1 
ATOM   7233 O O   . PHE B 1 347 ? 0.788   -5.346  42.730 1.00 29.26 ? 347  PHE B O   1 
ATOM   7234 C CB  . PHE B 1 347 ? 3.857   -5.206  44.080 1.00 31.94 ? 347  PHE B CB  1 
ATOM   7235 C CG  . PHE B 1 347 ? 3.049   -4.910  45.317 1.00 33.46 ? 347  PHE B CG  1 
ATOM   7236 C CD1 . PHE B 1 347 ? 2.718   -5.927  46.211 1.00 36.28 ? 347  PHE B CD1 1 
ATOM   7237 C CD2 . PHE B 1 347 ? 2.623   -3.614  45.590 1.00 34.66 ? 347  PHE B CD2 1 
ATOM   7238 C CE1 . PHE B 1 347 ? 1.974   -5.656  47.357 1.00 37.12 ? 347  PHE B CE1 1 
ATOM   7239 C CE2 . PHE B 1 347 ? 1.876   -3.331  46.738 1.00 34.92 ? 347  PHE B CE2 1 
ATOM   7240 C CZ  . PHE B 1 347 ? 1.551   -4.355  47.622 1.00 36.30 ? 347  PHE B CZ  1 
ATOM   7241 N N   . ALA B 1 348 ? 2.326   -4.132  41.632 1.00 28.99 ? 348  ALA B N   1 
ATOM   7242 C CA  . ALA B 1 348 ? 1.322   -3.263  41.037 1.00 29.48 ? 348  ALA B CA  1 
ATOM   7243 C C   . ALA B 1 348 ? 0.407   -4.097  40.144 1.00 28.44 ? 348  ALA B C   1 
ATOM   7244 O O   . ALA B 1 348 ? -0.814  -3.925  40.145 1.00 30.09 ? 348  ALA B O   1 
ATOM   7245 C CB  . ALA B 1 348 ? 2.001   -2.147  40.214 1.00 29.17 ? 348  ALA B CB  1 
ATOM   7246 N N   . ALA B 1 349 ? 1.004   -5.005  39.378 1.00 30.64 ? 349  ALA B N   1 
ATOM   7247 C CA  . ALA B 1 349 ? 0.231   -5.846  38.475 1.00 30.06 ? 349  ALA B CA  1 
ATOM   7248 C C   . ALA B 1 349 ? -0.761  -6.716  39.239 1.00 30.81 ? 349  ALA B C   1 
ATOM   7249 O O   . ALA B 1 349 ? -1.886  -6.938  38.782 1.00 28.41 ? 349  ALA B O   1 
ATOM   7250 C CB  . ALA B 1 349 ? 1.172   -6.717  37.633 1.00 30.40 ? 349  ALA B CB  1 
ATOM   7251 N N   . TYR B 1 350 ? -0.341  -7.207  40.402 1.00 29.21 ? 350  TYR B N   1 
ATOM   7252 C CA  . TYR B 1 350 ? -1.191  -8.049  41.235 1.00 29.61 ? 350  TYR B CA  1 
ATOM   7253 C C   . TYR B 1 350 ? -2.436  -7.313  41.719 1.00 31.93 ? 350  TYR B C   1 
ATOM   7254 O O   . TYR B 1 350 ? -3.548  -7.857  41.707 1.00 31.02 ? 350  TYR B O   1 
ATOM   7255 C CB  . TYR B 1 350 ? -0.423  -8.555  42.457 1.00 31.34 ? 350  TYR B CB  1 
ATOM   7256 C CG  . TYR B 1 350 ? -1.296  -9.381  43.400 1.00 29.22 ? 350  TYR B CG  1 
ATOM   7257 C CD1 . TYR B 1 350 ? -1.549  -10.728 43.118 1.00 27.60 ? 350  TYR B CD1 1 
ATOM   7258 C CD2 . TYR B 1 350 ? -1.844  -8.787  44.542 1.00 27.18 ? 350  TYR B CD2 1 
ATOM   7259 C CE1 . TYR B 1 350 ? -2.352  -11.483 43.980 1.00 28.33 ? 350  TYR B CE1 1 
ATOM   7260 C CE2 . TYR B 1 350 ? -2.648  -9.542  45.403 1.00 29.17 ? 350  TYR B CE2 1 
ATOM   7261 C CZ  . TYR B 1 350 ? -2.902  -10.890 45.122 1.00 26.24 ? 350  TYR B CZ  1 
ATOM   7262 O OH  . TYR B 1 350 ? -3.683  -11.623 45.960 1.00 30.20 ? 350  TYR B OH  1 
ATOM   7263 N N   . PHE B 1 351 ? -2.260  -6.082  42.146 1.00 31.92 ? 351  PHE B N   1 
ATOM   7264 C CA  . PHE B 1 351 ? -3.394  -5.313  42.667 1.00 30.32 ? 351  PHE B CA  1 
ATOM   7265 C C   . PHE B 1 351 ? -4.171  -4.675  41.523 1.00 29.32 ? 351  PHE B C   1 
ATOM   7266 O O   . PHE B 1 351 ? -5.322  -4.249  41.691 1.00 30.19 ? 351  PHE B O   1 
ATOM   7267 C CB  . PHE B 1 351 ? -2.920  -4.321  43.708 1.00 32.81 ? 351  PHE B CB  1 
ATOM   7268 C CG  . PHE B 1 351 ? -2.824  -5.016  45.059 1.00 33.42 ? 351  PHE B CG  1 
ATOM   7269 C CD1 . PHE B 1 351 ? -1.578  -5.208  45.658 1.00 35.43 ? 351  PHE B CD1 1 
ATOM   7270 C CD2 . PHE B 1 351 ? -3.989  -5.485  45.680 1.00 34.61 ? 351  PHE B CD2 1 
ATOM   7271 C CE1 . PHE B 1 351 ? -1.491  -5.882  46.880 1.00 33.55 ? 351  PHE B CE1 1 
ATOM   7272 C CE2 . PHE B 1 351 ? -3.901  -6.163  46.900 1.00 36.93 ? 351  PHE B CE2 1 
ATOM   7273 C CZ  . PHE B 1 351 ? -2.651  -6.363  47.500 1.00 33.98 ? 351  PHE B CZ  1 
ATOM   7274 N N   . GLN B 1 352 ? -3.542  -4.607  40.366 1.00 30.20 ? 352  GLN B N   1 
ATOM   7275 C CA  . GLN B 1 352 ? -4.252  -4.154  39.169 1.00 31.40 ? 352  GLN B CA  1 
ATOM   7276 C C   . GLN B 1 352 ? -5.404  -5.156  39.017 1.00 30.90 ? 352  GLN B C   1 
ATOM   7277 O O   . GLN B 1 352 ? -6.547  -4.778  38.765 1.00 29.75 ? 352  GLN B O   1 
ATOM   7278 C CB  . GLN B 1 352 ? -3.313  -4.180  37.969 1.00 29.29 ? 352  GLN B CB  1 
ATOM   7279 C CG  . GLN B 1 352 ? -3.988  -3.729  36.677 1.00 30.29 ? 352  GLN B CG  1 
ATOM   7280 C CD  . GLN B 1 352 ? -3.011  -3.640  35.509 1.00 30.69 ? 352  GLN B CD  1 
ATOM   7281 O OE1 . GLN B 1 352 ? -2.518  -4.666  35.045 1.00 28.72 ? 352  GLN B OE1 1 
ATOM   7282 N NE2 . GLN B 1 352 ? -2.696  -2.464  35.004 1.00 28.67 ? 352  GLN B NE2 1 
ATOM   7283 N N   . GLN B 1 353 ? -5.104  -6.439  39.199 1.00 29.35 ? 353  GLN B N   1 
ATOM   7284 C CA  . GLN B 1 353 ? -6.151  -7.450  39.123 1.00 28.79 ? 353  GLN B CA  1 
ATOM   7285 C C   . GLN B 1 353 ? -7.040  -7.387  40.371 1.00 29.08 ? 353  GLN B C   1 
ATOM   7286 O O   . GLN B 1 353 ? -8.262  -7.229  40.288 1.00 26.99 ? 353  GLN B O   1 
ATOM   7287 C CB  . GLN B 1 353 ? -5.574  -8.874  39.018 1.00 27.78 ? 353  GLN B CB  1 
ATOM   7288 C CG  . GLN B 1 353 ? -6.676  -9.911  39.279 1.00 30.61 ? 353  GLN B CG  1 
ATOM   7289 C CD  . GLN B 1 353 ? -6.312  -11.345 38.936 1.00 35.38 ? 353  GLN B CD  1 
ATOM   7290 O OE1 . GLN B 1 353 ? -5.131  -11.658 38.697 1.00 36.52 ? 353  GLN B OE1 1 
ATOM   7291 N NE2 . GLN B 1 353 ? -7.305  -12.218 38.896 1.00 30.77 ? 353  GLN B NE2 1 
ATOM   7292 N N   . GLY B 1 354 ? -6.416  -7.522  41.535 1.00 29.46 ? 354  GLY B N   1 
ATOM   7293 C CA  . GLY B 1 354 ? -7.171  -7.502  42.778 1.00 28.74 ? 354  GLY B CA  1 
ATOM   7294 C C   . GLY B 1 354 ? -8.196  -6.386  42.933 1.00 30.88 ? 354  GLY B C   1 
ATOM   7295 O O   . GLY B 1 354 ? -9.341  -6.623  43.337 1.00 30.88 ? 354  GLY B O   1 
ATOM   7296 N N   . ASP B 1 355 ? -7.789  -5.167  42.606 1.00 27.37 ? 355  ASP B N   1 
ATOM   7297 C CA  . ASP B 1 355 ? -8.648  -3.998  42.744 1.00 29.08 ? 355  ASP B CA  1 
ATOM   7298 C C   . ASP B 1 355 ? -9.679  -3.872  41.623 1.00 29.04 ? 355  ASP B C   1 
ATOM   7299 O O   . ASP B 1 355 ? -10.881 -3.761  41.881 1.00 30.95 ? 355  ASP B O   1 
ATOM   7300 C CB  . ASP B 1 355 ? -7.769  -2.734  42.788 1.00 30.20 ? 355  ASP B CB  1 
ATOM   7301 C CG  . ASP B 1 355 ? -8.495  -1.528  43.355 1.00 32.52 ? 355  ASP B CG  1 
ATOM   7302 O OD1 . ASP B 1 355 ? -9.693  -1.350  43.040 1.00 33.40 ? 355  ASP B OD1 1 
ATOM   7303 O OD2 . ASP B 1 355 ? -7.869  -0.747  44.117 1.00 35.53 ? 355  ASP B OD2 1 
ATOM   7304 N N   . MET B 1 356 ? -9.203  -3.907  40.381 1.00 27.79 ? 356  MET B N   1 
ATOM   7305 C CA  . MET B 1 356 ? -10.068 -3.748  39.219 1.00 26.93 ? 356  MET B CA  1 
ATOM   7306 C C   . MET B 1 356 ? -11.092 -4.852  39.008 1.00 27.83 ? 356  MET B C   1 
ATOM   7307 O O   . MET B 1 356 ? -12.235 -4.577  38.665 1.00 27.68 ? 356  MET B O   1 
ATOM   7308 C CB  . MET B 1 356 ? -9.218  -3.561  37.965 1.00 23.89 ? 356  MET B CB  1 
ATOM   7309 C CG  . MET B 1 356 ? -8.345  -2.306  38.036 1.00 27.34 ? 356  MET B CG  1 
ATOM   7310 S SD  . MET B 1 356 ? -7.353  -2.031  36.567 1.00 28.47 ? 356  MET B SD  1 
ATOM   7311 C CE  . MET B 1 356 ? -8.617  -1.408  35.359 1.00 23.54 ? 356  MET B CE  1 
ATOM   7312 N N   . GLU B 1 357 ? -10.693 -6.100  39.211 1.00 26.38 ? 357  GLU B N   1 
ATOM   7313 C CA  . GLU B 1 357 ? -11.631 -7.205  39.055 1.00 25.89 ? 357  GLU B CA  1 
ATOM   7314 C C   . GLU B 1 357 ? -12.670 -7.171  40.183 1.00 26.12 ? 357  GLU B C   1 
ATOM   7315 O O   . GLU B 1 357 ? -13.798 -7.630  40.015 1.00 24.23 ? 357  GLU B O   1 
ATOM   7316 C CB  . GLU B 1 357 ? -10.874 -8.544  39.065 1.00 27.43 ? 357  GLU B CB  1 
ATOM   7317 C CG  . GLU B 1 357 ? -11.651 -9.696  38.441 1.00 30.30 ? 357  GLU B CG  1 
ATOM   7318 C CD  . GLU B 1 357 ? -10.915 -11.024 38.527 1.00 36.22 ? 357  GLU B CD  1 
ATOM   7319 O OE1 . GLU B 1 357 ? -11.485 -12.050 38.100 1.00 37.82 ? 357  GLU B OE1 1 
ATOM   7320 O OE2 . GLU B 1 357 ? -9.765  -11.052 39.020 1.00 37.49 ? 357  GLU B OE2 1 
ATOM   7321 N N   . SER B 1 358 ? -12.286 -6.639  41.346 1.00 25.62 ? 358  SER B N   1 
ATOM   7322 C CA  . SER B 1 358 ? -13.211 -6.548  42.474 1.00 25.31 ? 358  SER B CA  1 
ATOM   7323 C C   . SER B 1 358 ? -14.213 -5.395  42.392 1.00 25.88 ? 358  SER B C   1 
ATOM   7324 O O   . SER B 1 358 ? -15.418 -5.597  42.556 1.00 26.45 ? 358  SER B O   1 
ATOM   7325 C CB  . SER B 1 358 ? -12.448 -6.394  43.807 1.00 26.35 ? 358  SER B CB  1 
ATOM   7326 O OG  . SER B 1 358 ? -11.745 -7.573  44.189 1.00 28.45 ? 358  SER B OG  1 
ATOM   7327 N N   . ASN B 1 359 ? -13.712 -4.188  42.146 1.00 24.97 ? 359  ASN B N   1 
ATOM   7328 C CA  . ASN B 1 359 ? -14.560 -3.000  42.141 1.00 26.29 ? 359  ASN B CA  1 
ATOM   7329 C C   . ASN B 1 359 ? -14.909 -2.368  40.785 1.00 26.79 ? 359  ASN B C   1 
ATOM   7330 O O   . ASN B 1 359 ? -15.447 -1.251  40.730 1.00 24.74 ? 359  ASN B O   1 
ATOM   7331 C CB  . ASN B 1 359 ? -13.935 -1.973  43.099 1.00 27.89 ? 359  ASN B CB  1 
ATOM   7332 C CG  . ASN B 1 359 ? -13.927 -2.467  44.550 1.00 30.61 ? 359  ASN B CG  1 
ATOM   7333 O OD1 . ASN B 1 359 ? -13.213 -1.942  45.416 1.00 30.54 ? 359  ASN B OD1 1 
ATOM   7334 N ND2 . ASN B 1 359 ? -14.739 -3.473  44.819 1.00 26.66 ? 359  ASN B ND2 1 
ATOM   7335 N N   . GLY B 1 360 ? -14.584 -3.071  39.704 1.00 26.87 ? 360  GLY B N   1 
ATOM   7336 C CA  . GLY B 1 360 ? -14.936 -2.596  38.375 1.00 28.67 ? 360  GLY B CA  1 
ATOM   7337 C C   . GLY B 1 360 ? -16.360 -3.095  38.153 1.00 28.26 ? 360  GLY B C   1 
ATOM   7338 O O   . GLY B 1 360 ? -16.591 -4.056  37.410 1.00 29.43 ? 360  GLY B O   1 
ATOM   7339 N N   . LYS B 1 361 ? -17.312 -2.438  38.811 1.00 28.85 ? 361  LYS B N   1 
ATOM   7340 C CA  . LYS B 1 361 ? -18.729 -2.821  38.761 1.00 28.98 ? 361  LYS B CA  1 
ATOM   7341 C C   . LYS B 1 361 ? -19.607 -1.578  38.606 1.00 29.84 ? 361  LYS B C   1 
ATOM   7342 O O   . LYS B 1 361 ? -19.159 -0.468  38.873 1.00 30.89 ? 361  LYS B O   1 
ATOM   7343 C CB  . LYS B 1 361 ? -19.109 -3.538  40.068 1.00 29.30 ? 361  LYS B CB  1 
ATOM   7344 C CG  . LYS B 1 361 ? -18.188 -4.704  40.468 1.00 29.72 ? 361  LYS B CG  1 
ATOM   7345 C CD  . LYS B 1 361 ? -18.481 -5.960  39.636 1.00 29.14 ? 361  LYS B CD  1 
ATOM   7346 C CE  . LYS B 1 361 ? -17.389 -7.010  39.809 1.00 28.87 ? 361  LYS B CE  1 
ATOM   7347 N NZ  . LYS B 1 361 ? -17.198 -7.415  41.232 1.00 31.66 ? 361  LYS B NZ  1 
ATOM   7348 N N   . TYR B 1 362 ? -20.863 -1.761  38.201 1.00 29.88 ? 362  TYR B N   1 
ATOM   7349 C CA  . TYR B 1 362 ? -21.745 -0.612  38.032 1.00 30.20 ? 362  TYR B CA  1 
ATOM   7350 C C   . TYR B 1 362 ? -23.161 -0.857  38.535 1.00 31.46 ? 362  TYR B C   1 
ATOM   7351 O O   . TYR B 1 362 ? -24.046 -0.010  38.361 1.00 32.22 ? 362  TYR B O   1 
ATOM   7352 C CB  . TYR B 1 362 ? -21.773 -0.176  36.558 1.00 32.30 ? 362  TYR B CB  1 
ATOM   7353 C CG  . TYR B 1 362 ? -22.599 -1.055  35.640 1.00 33.13 ? 362  TYR B CG  1 
ATOM   7354 C CD1 . TYR B 1 362 ? -23.786 -0.581  35.079 1.00 35.30 ? 362  TYR B CD1 1 
ATOM   7355 C CD2 . TYR B 1 362 ? -22.181 -2.341  35.307 1.00 32.56 ? 362  TYR B CD2 1 
ATOM   7356 C CE1 . TYR B 1 362 ? -24.532 -1.365  34.206 1.00 34.89 ? 362  TYR B CE1 1 
ATOM   7357 C CE2 . TYR B 1 362 ? -22.918 -3.131  34.433 1.00 32.57 ? 362  TYR B CE2 1 
ATOM   7358 C CZ  . TYR B 1 362 ? -24.090 -2.636  33.885 1.00 35.30 ? 362  TYR B CZ  1 
ATOM   7359 O OH  . TYR B 1 362 ? -24.809 -3.402  32.997 1.00 36.32 ? 362  TYR B OH  1 
ATOM   7360 N N   . ILE B 1 363 ? -23.359 -2.012  39.161 1.00 30.52 ? 363  ILE B N   1 
ATOM   7361 C CA  . ILE B 1 363 ? -24.650 -2.409  39.711 1.00 31.01 ? 363  ILE B CA  1 
ATOM   7362 C C   . ILE B 1 363 ? -24.489 -2.620  41.222 1.00 31.54 ? 363  ILE B C   1 
ATOM   7363 O O   . ILE B 1 363 ? -23.598 -3.351  41.659 1.00 30.05 ? 363  ILE B O   1 
ATOM   7364 C CB  . ILE B 1 363 ? -25.144 -3.730  39.055 1.00 30.40 ? 363  ILE B CB  1 
ATOM   7365 C CG1 . ILE B 1 363 ? -25.325 -3.527  37.546 1.00 31.94 ? 363  ILE B CG1 1 
ATOM   7366 C CG2 . ILE B 1 363 ? -26.451 -4.185  39.688 1.00 31.74 ? 363  ILE B CG2 1 
ATOM   7367 C CD1 . ILE B 1 363 ? -26.315 -2.413  37.180 1.00 34.21 ? 363  ILE B CD1 1 
ATOM   7368 N N   . THR B 1 364 ? -25.335 -1.972  42.020 1.00 31.27 ? 364  THR B N   1 
ATOM   7369 C CA  . THR B 1 364 ? -25.249 -2.120  43.468 1.00 33.69 ? 364  THR B CA  1 
ATOM   7370 C C   . THR B 1 364 ? -25.927 -3.415  43.910 1.00 34.54 ? 364  THR B C   1 
ATOM   7371 O O   . THR B 1 364 ? -26.613 -4.067  43.125 1.00 35.30 ? 364  THR B O   1 
ATOM   7372 C CB  . THR B 1 364 ? -25.917 -0.940  44.212 1.00 32.21 ? 364  THR B CB  1 
ATOM   7373 O OG1 . THR B 1 364 ? -27.332 -0.966  43.989 1.00 37.70 ? 364  THR B OG1 1 
ATOM   7374 C CG2 . THR B 1 364 ? -25.354 0.388   43.732 1.00 36.40 ? 364  THR B CG2 1 
ATOM   7375 N N   . LYS B 1 365 ? -25.729 -3.781  45.171 1.00 38.45 ? 365  LYS B N   1 
ATOM   7376 C CA  . LYS B 1 365 ? -26.327 -4.994  45.716 1.00 40.92 ? 365  LYS B CA  1 
ATOM   7377 C C   . LYS B 1 365 ? -27.854 -4.916  45.764 1.00 41.20 ? 365  LYS B C   1 
ATOM   7378 O O   . LYS B 1 365 ? -28.524 -5.916  46.004 1.00 42.29 ? 365  LYS B O   1 
ATOM   7379 C CB  . LYS B 1 365 ? -25.786 -5.265  47.120 1.00 41.83 ? 365  LYS B CB  1 
ATOM   7380 C CG  . LYS B 1 365 ? -24.343 -5.730  47.148 1.00 45.96 ? 365  LYS B CG  1 
ATOM   7381 C CD  . LYS B 1 365 ? -23.913 -6.020  48.572 1.00 48.80 ? 365  LYS B CD  1 
ATOM   7382 C CE  . LYS B 1 365 ? -22.510 -6.584  48.632 1.00 50.56 ? 365  LYS B CE  1 
ATOM   7383 N NZ  . LYS B 1 365 ? -22.155 -6.962  50.027 1.00 52.12 ? 365  LYS B NZ  1 
ATOM   7384 N N   . SER B 1 366 ? -28.402 -3.725  45.547 1.00 41.21 ? 366  SER B N   1 
ATOM   7385 C CA  . SER B 1 366 ? -29.850 -3.550  45.546 1.00 42.16 ? 366  SER B CA  1 
ATOM   7386 C C   . SER B 1 366 ? -30.373 -3.617  44.111 1.00 42.21 ? 366  SER B C   1 
ATOM   7387 O O   . SER B 1 366 ? -31.574 -3.486  43.872 1.00 44.25 ? 366  SER B O   1 
ATOM   7388 C CB  . SER B 1 366 ? -30.232 -2.205  46.165 1.00 41.24 ? 366  SER B CB  1 
ATOM   7389 O OG  . SER B 1 366 ? -29.847 -1.133  45.323 1.00 45.91 ? 366  SER B OG  1 
ATOM   7390 N N   . GLY B 1 367 ? -29.462 -3.811  43.161 1.00 41.35 ? 367  GLY B N   1 
ATOM   7391 C CA  . GLY B 1 367 ? -29.847 -3.903  41.764 1.00 40.66 ? 367  GLY B CA  1 
ATOM   7392 C C   . GLY B 1 367 ? -29.832 -2.577  41.023 1.00 40.21 ? 367  GLY B C   1 
ATOM   7393 O O   . GLY B 1 367 ? -29.945 -2.546  39.797 1.00 39.62 ? 367  GLY B O   1 
ATOM   7394 N N   . ALA B 1 368 ? -29.694 -1.481  41.764 1.00 39.80 ? 368  ALA B N   1 
ATOM   7395 C CA  . ALA B 1 368 ? -29.675 -0.145  41.174 1.00 39.85 ? 368  ALA B CA  1 
ATOM   7396 C C   . ALA B 1 368 ? -28.366 0.117   40.438 1.00 40.19 ? 368  ALA B C   1 
ATOM   7397 O O   . ALA B 1 368 ? -27.305 -0.357  40.857 1.00 39.97 ? 368  ALA B O   1 
ATOM   7398 C CB  . ALA B 1 368 ? -29.877 0.909   42.266 1.00 39.02 ? 368  ALA B CB  1 
ATOM   7399 N N   . ARG B 1 369 ? -28.441 0.860   39.336 1.00 37.54 ? 369  ARG B N   1 
ATOM   7400 C CA  . ARG B 1 369 ? -27.241 1.189   38.576 1.00 37.25 ? 369  ARG B CA  1 
ATOM   7401 C C   . ARG B 1 369 ? -26.592 2.360   39.292 1.00 36.95 ? 369  ARG B C   1 
ATOM   7402 O O   . ARG B 1 369 ? -27.285 3.283   39.723 1.00 37.40 ? 369  ARG B O   1 
ATOM   7403 C CB  . ARG B 1 369 ? -27.587 1.597   37.142 1.00 37.39 ? 369  ARG B CB  1 
ATOM   7404 C CG  . ARG B 1 369 ? -26.373 1.724   36.235 1.00 38.39 ? 369  ARG B CG  1 
ATOM   7405 C CD  . ARG B 1 369 ? -26.766 2.264   34.874 1.00 44.94 ? 369  ARG B CD  1 
ATOM   7406 N NE  . ARG B 1 369 ? -25.643 2.340   33.942 1.00 49.03 ? 369  ARG B NE  1 
ATOM   7407 C CZ  . ARG B 1 369 ? -24.511 3.003   34.173 1.00 51.50 ? 369  ARG B CZ  1 
ATOM   7408 N NH1 . ARG B 1 369 ? -24.330 3.659   35.317 1.00 52.79 ? 369  ARG B NH1 1 
ATOM   7409 N NH2 . ARG B 1 369 ? -23.555 3.023   33.252 1.00 50.73 ? 369  ARG B NH2 1 
ATOM   7410 N N   . VAL B 1 370 ? -25.274 2.330   39.437 1.00 34.44 ? 370  VAL B N   1 
ATOM   7411 C CA  . VAL B 1 370 ? -24.604 3.426   40.127 1.00 31.47 ? 370  VAL B CA  1 
ATOM   7412 C C   . VAL B 1 370 ? -24.668 4.716   39.310 1.00 33.38 ? 370  VAL B C   1 
ATOM   7413 O O   . VAL B 1 370 ? -24.681 4.683   38.074 1.00 33.63 ? 370  VAL B O   1 
ATOM   7414 C CB  . VAL B 1 370 ? -23.111 3.096   40.424 1.00 30.71 ? 370  VAL B CB  1 
ATOM   7415 C CG1 . VAL B 1 370 ? -23.006 1.861   41.297 1.00 28.50 ? 370  VAL B CG1 1 
ATOM   7416 C CG2 . VAL B 1 370 ? -22.338 2.909   39.130 1.00 26.25 ? 370  VAL B CG2 1 
ATOM   7417 N N   . ASP B 1 371 ? -24.729 5.842   40.012 1.00 34.15 ? 371  ASP B N   1 
ATOM   7418 C CA  . ASP B 1 371 ? -24.751 7.150   39.369 1.00 37.44 ? 371  ASP B CA  1 
ATOM   7419 C C   . ASP B 1 371 ? -23.524 7.919   39.872 1.00 37.07 ? 371  ASP B C   1 
ATOM   7420 O O   . ASP B 1 371 ? -23.549 9.143   40.050 1.00 37.50 ? 371  ASP B O   1 
ATOM   7421 C CB  . ASP B 1 371 ? -26.048 7.905   39.703 1.00 39.49 ? 371  ASP B CB  1 
ATOM   7422 C CG  . ASP B 1 371 ? -26.293 8.037   41.198 1.00 42.16 ? 371  ASP B CG  1 
ATOM   7423 O OD1 . ASP B 1 371 ? -25.415 7.651   42.002 1.00 43.86 ? 371  ASP B OD1 1 
ATOM   7424 O OD2 . ASP B 1 371 ? -27.373 8.543   41.576 1.00 44.30 ? 371  ASP B OD2 1 
ATOM   7425 N N   . HIS B 1 372 ? -22.450 7.171   40.097 1.00 35.40 ? 372  HIS B N   1 
ATOM   7426 C CA  . HIS B 1 372 ? -21.188 7.706   40.587 1.00 33.81 ? 372  HIS B CA  1 
ATOM   7427 C C   . HIS B 1 372 ? -20.088 6.735   40.181 1.00 34.31 ? 372  HIS B C   1 
ATOM   7428 O O   . HIS B 1 372 ? -20.368 5.597   39.786 1.00 33.20 ? 372  HIS B O   1 
ATOM   7429 C CB  . HIS B 1 372 ? -21.218 7.813   42.113 1.00 34.86 ? 372  HIS B CB  1 
ATOM   7430 C CG  . HIS B 1 372 ? -21.565 6.526   42.797 1.00 33.71 ? 372  HIS B CG  1 
ATOM   7431 N ND1 . HIS B 1 372 ? -20.649 5.513   42.993 1.00 35.71 ? 372  HIS B ND1 1 
ATOM   7432 C CD2 . HIS B 1 372 ? -22.746 6.060   43.266 1.00 33.64 ? 372  HIS B CD2 1 
ATOM   7433 C CE1 . HIS B 1 372 ? -21.253 4.477   43.548 1.00 32.42 ? 372  HIS B CE1 1 
ATOM   7434 N NE2 . HIS B 1 372 ? -22.527 4.783   43.722 1.00 33.95 ? 372  HIS B NE2 1 
ATOM   7435 N N   . GLN B 1 373 ? -18.840 7.176   40.294 1.00 30.63 ? 373  GLN B N   1 
ATOM   7436 C CA  . GLN B 1 373 ? -17.703 6.339   39.936 1.00 30.95 ? 373  GLN B CA  1 
ATOM   7437 C C   . GLN B 1 373 ? -17.483 5.219   40.930 1.00 28.83 ? 373  GLN B C   1 
ATOM   7438 O O   . GLN B 1 373 ? -17.829 5.344   42.106 1.00 28.15 ? 373  GLN B O   1 
ATOM   7439 C CB  . GLN B 1 373 ? -16.413 7.168   39.893 1.00 30.42 ? 373  GLN B CB  1 
ATOM   7440 C CG  . GLN B 1 373 ? -16.297 8.101   38.728 1.00 34.29 ? 373  GLN B CG  1 
ATOM   7441 C CD  . GLN B 1 373 ? -16.370 7.361   37.426 1.00 34.23 ? 373  GLN B CD  1 
ATOM   7442 O OE1 . GLN B 1 373 ? -15.659 6.373   37.219 1.00 33.12 ? 373  GLN B OE1 1 
ATOM   7443 N NE2 . GLN B 1 373 ? -17.231 7.827   36.533 1.00 37.09 ? 373  GLN B NE2 1 
ATOM   7444 N N   . THR B 1 374 ? -16.898 4.128   40.443 1.00 29.05 ? 374  THR B N   1 
ATOM   7445 C CA  . THR B 1 374 ? -16.537 3.015   41.300 1.00 25.76 ? 374  THR B CA  1 
ATOM   7446 C C   . THR B 1 374 ? -15.033 2.800   41.111 1.00 25.42 ? 374  THR B C   1 
ATOM   7447 O O   . THR B 1 374 ? -14.292 3.770   40.959 1.00 26.24 ? 374  THR B O   1 
ATOM   7448 C CB  . THR B 1 374 ? -17.361 1.715   41.003 1.00 24.76 ? 374  THR B CB  1 
ATOM   7449 O OG1 . THR B 1 374 ? -17.300 1.379   39.609 1.00 25.63 ? 374  THR B OG1 1 
ATOM   7450 C CG2 . THR B 1 374 ? -18.820 1.917   41.441 1.00 24.57 ? 374  THR B CG2 1 
ATOM   7451 N N   . GLY B 1 375 ? -14.587 1.548   41.093 1.00 23.19 ? 375  GLY B N   1 
ATOM   7452 C CA  . GLY B 1 375 ? -13.170 1.241   40.981 1.00 25.73 ? 375  GLY B CA  1 
ATOM   7453 C C   . GLY B 1 375 ? -12.291 2.030   40.022 1.00 27.68 ? 375  GLY B C   1 
ATOM   7454 O O   . GLY B 1 375 ? -12.687 2.324   38.886 1.00 27.23 ? 375  GLY B O   1 
ATOM   7455 N N   . PRO B 1 376 ? -11.069 2.385   40.454 1.00 27.21 ? 376  PRO B N   1 
ATOM   7456 C CA  . PRO B 1 376 ? -10.155 3.141   39.591 1.00 27.84 ? 376  PRO B CA  1 
ATOM   7457 C C   . PRO B 1 376 ? -9.304  2.187   38.769 1.00 29.39 ? 376  PRO B C   1 
ATOM   7458 O O   . PRO B 1 376 ? -9.323  0.976   38.998 1.00 26.04 ? 376  PRO B O   1 
ATOM   7459 C CB  . PRO B 1 376 ? -9.298  3.908   40.588 1.00 27.91 ? 376  PRO B CB  1 
ATOM   7460 C CG  . PRO B 1 376 ? -9.136  2.906   41.705 1.00 27.92 ? 376  PRO B CG  1 
ATOM   7461 C CD  . PRO B 1 376 ? -10.552 2.315   41.836 1.00 28.60 ? 376  PRO B CD  1 
ATOM   7462 N N   . ILE B 1 377 ? -8.575  2.736   37.800 1.00 27.43 ? 377  ILE B N   1 
ATOM   7463 C CA  . ILE B 1 377 ? -7.667  1.939   36.987 1.00 27.10 ? 377  ILE B CA  1 
ATOM   7464 C C   . ILE B 1 377 ? -6.364  1.954   37.791 1.00 28.00 ? 377  ILE B C   1 
ATOM   7465 O O   . ILE B 1 377 ? -5.834  3.027   38.101 1.00 27.16 ? 377  ILE B O   1 
ATOM   7466 C CB  . ILE B 1 377 ? -7.471  2.596   35.597 1.00 26.96 ? 377  ILE B CB  1 
ATOM   7467 C CG1 . ILE B 1 377 ? -8.800  2.545   34.835 1.00 27.97 ? 377  ILE B CG1 1 
ATOM   7468 C CG2 . ILE B 1 377 ? -6.344  1.903   34.817 1.00 28.66 ? 377  ILE B CG2 1 
ATOM   7469 C CD1 . ILE B 1 377 ? -8.835  3.356   33.565 1.00 32.37 ? 377  ILE B CD1 1 
ATOM   7470 N N   . VAL B 1 378 ? -5.866  0.777   38.151 1.00 27.89 ? 378  VAL B N   1 
ATOM   7471 C CA  . VAL B 1 378 ? -4.639  0.678   38.946 1.00 28.40 ? 378  VAL B CA  1 
ATOM   7472 C C   . VAL B 1 378 ? -3.453  0.299   38.060 1.00 28.84 ? 378  VAL B C   1 
ATOM   7473 O O   . VAL B 1 378 ? -3.556  -0.601  37.238 1.00 27.96 ? 378  VAL B O   1 
ATOM   7474 C CB  . VAL B 1 378 ? -4.803  -0.383  40.075 1.00 30.42 ? 378  VAL B CB  1 
ATOM   7475 C CG1 . VAL B 1 378 ? -3.510  -0.505  40.879 1.00 29.63 ? 378  VAL B CG1 1 
ATOM   7476 C CG2 . VAL B 1 378 ? -5.959  0.013   41.011 1.00 29.36 ? 378  VAL B CG2 1 
ATOM   7477 N N   . TRP B 1 379 ? -2.331  0.990   38.231 1.00 25.20 ? 379  TRP B N   1 
ATOM   7478 C CA  . TRP B 1 379 ? -1.151  0.723   37.422 1.00 27.60 ? 379  TRP B CA  1 
ATOM   7479 C C   . TRP B 1 379 ? 0.127   1.134   38.145 1.00 27.87 ? 379  TRP B C   1 
ATOM   7480 O O   . TRP B 1 379 ? 0.080   1.663   39.258 1.00 28.79 ? 379  TRP B O   1 
ATOM   7481 C CB  . TRP B 1 379 ? -1.238  1.496   36.102 1.00 27.24 ? 379  TRP B CB  1 
ATOM   7482 C CG  . TRP B 1 379 ? -1.314  2.982   36.313 1.00 25.20 ? 379  TRP B CG  1 
ATOM   7483 C CD1 . TRP B 1 379 ? -2.379  3.687   36.807 1.00 27.77 ? 379  TRP B CD1 1 
ATOM   7484 C CD2 . TRP B 1 379 ? -0.271  3.941   36.083 1.00 26.78 ? 379  TRP B CD2 1 
ATOM   7485 N NE1 . TRP B 1 379 ? -2.062  5.023   36.901 1.00 29.62 ? 379  TRP B NE1 1 
ATOM   7486 C CE2 . TRP B 1 379 ? -0.778  5.207   36.462 1.00 27.45 ? 379  TRP B CE2 1 
ATOM   7487 C CE3 . TRP B 1 379 ? 1.038   3.854   35.595 1.00 26.80 ? 379  TRP B CE3 1 
ATOM   7488 C CZ2 . TRP B 1 379 ? -0.012  6.382   36.366 1.00 28.50 ? 379  TRP B CZ2 1 
ATOM   7489 C CZ3 . TRP B 1 379 ? 1.802   5.022   35.499 1.00 27.60 ? 379  TRP B CZ3 1 
ATOM   7490 C CH2 . TRP B 1 379 ? 1.273   6.266   35.883 1.00 27.22 ? 379  TRP B CH2 1 
ATOM   7491 N N   . GLY B 1 380 ? 1.257   0.969   37.547 1.00 29.55 ? 380  GLY B N   1 
ATOM   7492 C CA  . GLY B 1 380 ? 2.552   1.364   38.118 1.00 29.24 ? 380  GLY B CA  1 
ATOM   7493 C C   . GLY B 1 380 ? 3.646   0.355   37.758 1.00 29.12 ? 380  GLY B C   1 
ATOM   7494 O O   . GLY B 1 380 ? 3.361   -0.744  37.255 1.00 27.68 ? 380  GLY B O   1 
ATOM   7495 N N   . GLU B 1 381 ? 4.862   0.792   38.039 1.00 30.51 ? 381  GLU B N   1 
ATOM   7496 C CA  . GLU B 1 381 ? 6.091   0.020   37.806 1.00 29.10 ? 381  GLU B CA  1 
ATOM   7497 C C   . GLU B 1 381 ? 7.076   0.275   38.950 1.00 33.71 ? 381  GLU B C   1 
ATOM   7498 O O   . GLU B 1 381 ? 7.034   1.324   39.608 1.00 31.87 ? 381  GLU B O   1 
ATOM   7499 C CB  . GLU B 1 381 ? 6.749   0.457   36.496 1.00 31.86 ? 381  GLU B CB  1 
ATOM   7500 C CG  . GLU B 1 381 ? 6.025   -0.071  35.257 1.00 32.10 ? 381  GLU B CG  1 
ATOM   7501 C CD  . GLU B 1 381 ? 6.183   -1.581  35.071 1.00 35.33 ? 381  GLU B CD  1 
ATOM   7502 O OE1 . GLU B 1 381 ? 6.965   -2.249  35.850 1.00 37.70 ? 381  GLU B OE1 1 
ATOM   7503 O OE2 . GLU B 1 381 ? 5.535   -2.187  34.134 1.00 37.77 ? 381  GLU B OE2 1 
ATOM   7504 N N   . PRO B 1 382 ? 7.989   -0.655  39.245 1.00 33.12 ? 382  PRO B N   1 
ATOM   7505 C CA  . PRO B 1 382 ? 8.947   -0.466  40.325 1.00 37.89 ? 382  PRO B CA  1 
ATOM   7506 C C   . PRO B 1 382 ? 9.880   0.702   40.053 1.00 40.12 ? 382  PRO B C   1 
ATOM   7507 O O   . PRO B 1 382 ? 10.588  0.699   39.003 1.00 44.63 ? 382  PRO B O   1 
ATOM   7508 C CB  . PRO B 1 382 ? 9.745   -1.754  40.324 1.00 34.91 ? 382  PRO B CB  1 
ATOM   7509 C CG  . PRO B 1 382 ? 9.199   -2.637  39.205 1.00 36.33 ? 382  PRO B CG  1 
ATOM   7510 C CD  . PRO B 1 382 ? 8.080   -1.916  38.511 1.00 34.69 ? 382  PRO B CD  1 
ATOM   7511 N N   . GLY B 1 383 ? 9.884   1.684   40.959 1.00 41.65 ? 383  GLY B N   1 
ATOM   7512 C CA  . GLY B 1 383 ? 10.848  2.815   40.883 1.00 43.25 ? 383  GLY B CA  1 
ATOM   7513 C C   . GLY B 1 383 ? 12.181  2.217   41.283 1.00 43.34 ? 383  GLY B C   1 
ATOM   7514 O O   . GLY B 1 383 ? 12.186  1.252   42.011 1.00 44.82 ? 383  GLY B O   1 
ATOM   7515 N N   . THR B 1 384 ? 13.146  2.986   40.904 1.00 43.90 ? 384  THR B N   1 
ATOM   7516 C CA  . THR B 1 384 ? 13.113  4.327   40.395 1.00 45.00 ? 384  THR B CA  1 
ATOM   7517 C C   . THR B 1 384 ? 12.772  4.469   38.913 1.00 44.58 ? 384  THR B C   1 
ATOM   7518 O O   . THR B 1 384 ? 12.466  5.566   38.429 1.00 46.60 ? 384  THR B O   1 
ATOM   7519 C CB  . THR B 1 384 ? 14.618  4.732   40.468 1.00 45.61 ? 384  THR B CB  1 
ATOM   7520 O OG1 . THR B 1 384 ? 15.411  3.780   39.775 1.00 48.32 ? 384  THR B OG1 1 
ATOM   7521 C CG2 . THR B 1 384 ? 15.147  4.811   41.901 1.00 46.32 ? 384  THR B CG2 1 
ATOM   7522 N N   . ASN B 1 385 ? 12.855  3.383   38.204 1.00 44.19 ? 385  ASN B N   1 
ATOM   7523 C CA  . ASN B 1 385 ? 12.716  3.407   36.741 1.00 44.45 ? 385  ASN B CA  1 
ATOM   7524 C C   . ASN B 1 385 ? 11.676  4.441   36.282 1.00 42.20 ? 385  ASN B C   1 
ATOM   7525 O O   . ASN B 1 385 ? 11.908  5.194   35.324 1.00 41.69 ? 385  ASN B O   1 
ATOM   7526 C CB  . ASN B 1 385 ? 12.347  2.022   36.241 1.00 44.96 ? 385  ASN B CB  1 
ATOM   7527 C CG  . ASN B 1 385 ? 13.507  1.033   36.376 1.00 48.37 ? 385  ASN B CG  1 
ATOM   7528 O OD1 . ASN B 1 385 ? 14.125  0.669   35.378 1.00 47.51 ? 385  ASN B OD1 1 
ATOM   7529 N ND2 . ASN B 1 385 ? 13.850  0.577   37.568 1.00 46.79 ? 385  ASN B ND2 1 
ATOM   7530 N N   . GLY B 1 386 ? 10.560  4.568   36.954 1.00 41.53 ? 386  GLY B N   1 
ATOM   7531 C CA  . GLY B 1 386 ? 9.445   5.405   36.542 1.00 39.80 ? 386  GLY B CA  1 
ATOM   7532 C C   . GLY B 1 386 ? 9.846   6.863   36.441 1.00 40.89 ? 386  GLY B C   1 
ATOM   7533 O O   . GLY B 1 386 ? 9.387   7.585   35.558 1.00 38.84 ? 386  GLY B O   1 
ATOM   7534 N N   . GLN B 1 387 ? 10.708  7.297   37.353 1.00 39.13 ? 387  GLN B N   1 
ATOM   7535 C CA  . GLN B 1 387 ? 11.176  8.679   37.374 1.00 40.48 ? 387  GLN B CA  1 
ATOM   7536 C C   . GLN B 1 387 ? 11.758  9.117   36.033 1.00 40.91 ? 387  GLN B C   1 
ATOM   7537 O O   . GLN B 1 387 ? 11.711  10.299  35.680 1.00 41.57 ? 387  GLN B O   1 
ATOM   7538 C CB  . GLN B 1 387 ? 12.245  8.854   38.460 1.00 37.52 ? 387  GLN B CB  1 
ATOM   7539 C CG  . GLN B 1 387 ? 11.747  8.658   39.881 1.00 36.05 ? 387  GLN B CG  1 
ATOM   7540 C CD  . GLN B 1 387 ? 12.881  8.572   40.885 1.00 35.70 ? 387  GLN B CD  1 
ATOM   7541 O OE1 . GLN B 1 387 ? 13.991  9.050   40.633 1.00 37.39 ? 387  GLN B OE1 1 
ATOM   7542 N NE2 . GLN B 1 387 ? 12.608  7.972   42.031 1.00 29.60 ? 387  GLN B NE2 1 
ATOM   7543 N N   . HIS B 1 388 ? 12.315  8.162   35.296 1.00 41.98 ? 388  HIS B N   1 
ATOM   7544 C CA  . HIS B 1 388 ? 12.925  8.455   34.005 1.00 42.43 ? 388  HIS B CA  1 
ATOM   7545 C C   . HIS B 1 388 ? 11.978  8.108   32.869 1.00 43.24 ? 388  HIS B C   1 
ATOM   7546 O O   . HIS B 1 388 ? 12.394  7.979   31.715 1.00 44.34 ? 388  HIS B O   1 
ATOM   7547 C CB  . HIS B 1 388 ? 14.227  7.662   33.848 1.00 44.86 ? 388  HIS B CB  1 
ATOM   7548 C CG  . HIS B 1 388 ? 15.166  7.808   35.003 1.00 45.37 ? 388  HIS B CG  1 
ATOM   7549 N ND1 . HIS B 1 388 ? 16.385  8.442   34.894 1.00 47.81 ? 388  HIS B ND1 1 
ATOM   7550 C CD2 . HIS B 1 388 ? 15.069  7.402   36.290 1.00 45.00 ? 388  HIS B CD2 1 
ATOM   7551 C CE1 . HIS B 1 388 ? 16.997  8.420   36.064 1.00 49.08 ? 388  HIS B CE1 1 
ATOM   7552 N NE2 . HIS B 1 388 ? 16.221  7.794   36.929 1.00 46.41 ? 388  HIS B NE2 1 
ATOM   7553 N N   . ALA B 1 389 ? 10.700  7.964   33.199 1.00 42.56 ? 389  ALA B N   1 
ATOM   7554 C CA  . ALA B 1 389 ? 9.695   7.605   32.208 1.00 39.79 ? 389  ALA B CA  1 
ATOM   7555 C C   . ALA B 1 389 ? 8.369   8.359   32.419 1.00 38.26 ? 389  ALA B C   1 
ATOM   7556 O O   . ALA B 1 389 ? 8.254   9.550   32.103 1.00 39.00 ? 389  ALA B O   1 
ATOM   7557 C CB  . ALA B 1 389 ? 9.475   6.091   32.222 1.00 40.50 ? 389  ALA B CB  1 
ATOM   7558 N N   . PHE B 1 390 ? 7.379   7.658   32.952 1.00 33.22 ? 390  PHE B N   1 
ATOM   7559 C CA  . PHE B 1 390 ? 6.015   8.218   33.090 1.00 32.50 ? 390  PHE B CA  1 
ATOM   7560 C C   . PHE B 1 390 ? 5.868   9.257   34.222 1.00 29.54 ? 390  PHE B C   1 
ATOM   7561 O O   . PHE B 1 390 ? 4.834   9.929   34.342 1.00 31.85 ? 390  PHE B O   1 
ATOM   7562 C CB  . PHE B 1 390 ? 4.975   7.111   33.322 1.00 30.78 ? 390  PHE B CB  1 
ATOM   7563 C CG  . PHE B 1 390 ? 5.301   6.147   34.466 1.00 30.12 ? 390  PHE B CG  1 
ATOM   7564 C CD1 . PHE B 1 390 ? 4.909   6.450   35.775 1.00 28.22 ? 390  PHE B CD1 1 
ATOM   7565 C CD2 . PHE B 1 390 ? 5.980   4.951   34.199 1.00 31.21 ? 390  PHE B CD2 1 
ATOM   7566 C CE1 . PHE B 1 390 ? 5.194   5.558   36.817 1.00 29.85 ? 390  PHE B CE1 1 
ATOM   7567 C CE2 . PHE B 1 390 ? 6.264   4.059   35.241 1.00 29.18 ? 390  PHE B CE2 1 
ATOM   7568 C CZ  . PHE B 1 390 ? 5.871   4.362   36.549 1.00 29.74 ? 390  PHE B CZ  1 
ATOM   7569 N N   . TYR B 1 391 ? 6.877   9.415   35.058 1.00 28.10 ? 391  TYR B N   1 
ATOM   7570 C CA  . TYR B 1 391 ? 6.793   10.402  36.162 1.00 29.75 ? 391  TYR B CA  1 
ATOM   7571 C C   . TYR B 1 391 ? 6.620   11.821  35.585 1.00 30.60 ? 391  TYR B C   1 
ATOM   7572 O O   . TYR B 1 391 ? 6.046   12.711  36.229 1.00 32.52 ? 391  TYR B O   1 
ATOM   7573 C CB  . TYR B 1 391 ? 8.050   10.367  37.036 1.00 26.85 ? 391  TYR B CB  1 
ATOM   7574 C CG  . TYR B 1 391 ? 7.980   9.332   38.170 1.00 31.97 ? 391  TYR B CG  1 
ATOM   7575 C CD1 . TYR B 1 391 ? 7.402   8.077   37.940 1.00 31.23 ? 391  TYR B CD1 1 
ATOM   7576 C CD2 . TYR B 1 391 ? 8.497   9.635   39.440 1.00 32.91 ? 391  TYR B CD2 1 
ATOM   7577 C CE1 . TYR B 1 391 ? 7.364   7.121   38.963 1.00 30.55 ? 391  TYR B CE1 1 
ATOM   7578 C CE2 . TYR B 1 391 ? 8.466   8.675   40.461 1.00 32.01 ? 391  TYR B CE2 1 
ATOM   7579 C CZ  . TYR B 1 391 ? 7.903   7.417   40.221 1.00 32.46 ? 391  TYR B CZ  1 
ATOM   7580 O OH  . TYR B 1 391 ? 7.885   6.478   41.207 1.00 32.29 ? 391  TYR B OH  1 
ATOM   7581 N N   . GLN B 1 392 ? 7.130   11.996  34.371 1.00 31.02 ? 392  GLN B N   1 
ATOM   7582 C CA  . GLN B 1 392 ? 7.046   13.282  33.646 1.00 32.44 ? 392  GLN B CA  1 
ATOM   7583 C C   . GLN B 1 392 ? 5.589   13.751  33.639 1.00 32.00 ? 392  GLN B C   1 
ATOM   7584 O O   . GLN B 1 392 ? 5.291   14.915  33.929 1.00 29.61 ? 392  GLN B O   1 
ATOM   7585 C CB  . GLN B 1 392 ? 7.543   13.105  32.209 1.00 31.74 ? 392  GLN B CB  1 
ATOM   7586 C CG  . GLN B 1 392 ? 7.116   14.244  31.280 1.00 31.75 ? 392  GLN B CG  1 
ATOM   7587 C CD  . GLN B 1 392 ? 7.704   15.600  31.680 1.00 32.31 ? 392  GLN B CD  1 
ATOM   7588 O OE1 . GLN B 1 392 ? 8.899   15.698  31.952 1.00 31.48 ? 392  GLN B OE1 1 
ATOM   7589 N NE2 . GLN B 1 392 ? 6.926   16.666  31.732 1.00 32.47 ? 392  GLN B NE2 1 
ATOM   7590 N N   . LEU B 1 393 ? 4.679   12.834  33.324 1.00 30.82 ? 393  LEU B N   1 
ATOM   7591 C CA  . LEU B 1 393 ? 3.263   13.171  33.264 1.00 30.18 ? 393  LEU B CA  1 
ATOM   7592 C C   . LEU B 1 393 ? 2.666   13.382  34.651 1.00 31.14 ? 393  LEU B C   1 
ATOM   7593 O O   . LEU B 1 393 ? 1.787   14.227  34.832 1.00 29.93 ? 393  LEU B O   1 
ATOM   7594 C CB  . LEU B 1 393 ? 2.494   12.086  32.489 1.00 31.79 ? 393  LEU B CB  1 
ATOM   7595 C CG  . LEU B 1 393 ? 1.028   12.372  32.139 1.00 31.34 ? 393  LEU B CG  1 
ATOM   7596 C CD1 . LEU B 1 393 ? 0.607   11.595  30.874 1.00 31.98 ? 393  LEU B CD1 1 
ATOM   7597 C CD2 . LEU B 1 393 ? 0.149   12.007  33.325 1.00 28.59 ? 393  LEU B CD2 1 
ATOM   7598 N N   . ILE B 1 394 ? 3.143   12.633  35.642 1.00 30.31 ? 394  ILE B N   1 
ATOM   7599 C CA  . ILE B 1 394 ? 2.623   12.808  36.987 1.00 31.10 ? 394  ILE B CA  1 
ATOM   7600 C C   . ILE B 1 394 ? 3.012   14.199  37.510 1.00 32.50 ? 394  ILE B C   1 
ATOM   7601 O O   . ILE B 1 394 ? 2.235   14.839  38.217 1.00 34.01 ? 394  ILE B O   1 
ATOM   7602 C CB  . ILE B 1 394 ? 3.156   11.726  37.955 1.00 31.34 ? 394  ILE B CB  1 
ATOM   7603 C CG1 . ILE B 1 394 ? 2.814   10.329  37.420 1.00 29.14 ? 394  ILE B CG1 1 
ATOM   7604 C CG2 . ILE B 1 394 ? 2.534   11.921  39.329 1.00 31.29 ? 394  ILE B CG2 1 
ATOM   7605 C CD1 . ILE B 1 394 ? 3.336   9.177   38.281 1.00 28.30 ? 394  ILE B CD1 1 
ATOM   7606 N N   . HIS B 1 395 ? 4.208   14.659  37.149 1.00 31.43 ? 395  HIS B N   1 
ATOM   7607 C CA  . HIS B 1 395 ? 4.708   15.969  37.574 1.00 33.64 ? 395  HIS B CA  1 
ATOM   7608 C C   . HIS B 1 395 ? 4.156   17.145  36.768 1.00 33.96 ? 395  HIS B C   1 
ATOM   7609 O O   . HIS B 1 395 ? 3.739   18.153  37.340 1.00 32.84 ? 395  HIS B O   1 
ATOM   7610 C CB  . HIS B 1 395 ? 6.241   16.025  37.473 1.00 34.96 ? 395  HIS B CB  1 
ATOM   7611 C CG  . HIS B 1 395 ? 6.957   15.473  38.664 1.00 33.26 ? 395  HIS B CG  1 
ATOM   7612 N ND1 . HIS B 1 395 ? 7.518   14.215  38.679 1.00 35.50 ? 395  HIS B ND1 1 
ATOM   7613 C CD2 . HIS B 1 395 ? 7.203   16.011  39.881 1.00 31.89 ? 395  HIS B CD2 1 
ATOM   7614 C CE1 . HIS B 1 395 ? 8.080   14.002  39.855 1.00 32.37 ? 395  HIS B CE1 1 
ATOM   7615 N NE2 . HIS B 1 395 ? 7.902   15.076  40.603 1.00 35.73 ? 395  HIS B NE2 1 
ATOM   7616 N N   . GLN B 1 396 ? 4.153   17.016  35.443 1.00 33.82 ? 396  GLN B N   1 
ATOM   7617 C CA  . GLN B 1 396 ? 3.700   18.109  34.592 1.00 34.97 ? 396  GLN B CA  1 
ATOM   7618 C C   . GLN B 1 396 ? 2.586   17.823  33.592 1.00 36.47 ? 396  GLN B C   1 
ATOM   7619 O O   . GLN B 1 396 ? 2.474   18.516  32.574 1.00 36.74 ? 396  GLN B O   1 
ATOM   7620 C CB  . GLN B 1 396 ? 4.898   18.693  33.848 1.00 37.51 ? 396  GLN B CB  1 
ATOM   7621 C CG  . GLN B 1 396 ? 5.996   19.207  34.768 1.00 37.04 ? 396  GLN B CG  1 
ATOM   7622 C CD  . GLN B 1 396 ? 7.095   19.918  34.007 1.00 41.30 ? 396  GLN B CD  1 
ATOM   7623 O OE1 . GLN B 1 396 ? 7.591   19.417  32.998 1.00 37.33 ? 396  GLN B OE1 1 
ATOM   7624 N NE2 . GLN B 1 396 ? 7.487   21.096  34.491 1.00 42.47 ? 396  GLN B NE2 1 
ATOM   7625 N N   . GLY B 1 397 ? 1.760   16.822  33.878 1.00 32.93 ? 397  GLY B N   1 
ATOM   7626 C CA  . GLY B 1 397 ? 0.664   16.505  32.983 1.00 34.38 ? 397  GLY B CA  1 
ATOM   7627 C C   . GLY B 1 397 ? -0.584  17.307  33.316 1.00 33.03 ? 397  GLY B C   1 
ATOM   7628 O O   . GLY B 1 397 ? -0.513  18.319  34.014 1.00 32.78 ? 397  GLY B O   1 
ATOM   7629 N N   . THR B 1 398 ? -1.733  16.856  32.827 1.00 32.40 ? 398  THR B N   1 
ATOM   7630 C CA  . THR B 1 398 ? -2.987  17.551  33.081 1.00 34.57 ? 398  THR B CA  1 
ATOM   7631 C C   . THR B 1 398 ? -3.951  16.697  33.896 1.00 36.49 ? 398  THR B C   1 
ATOM   7632 O O   . THR B 1 398 ? -5.120  17.053  34.052 1.00 38.06 ? 398  THR B O   1 
ATOM   7633 C CB  . THR B 1 398 ? -3.666  17.986  31.751 1.00 36.31 ? 398  THR B CB  1 
ATOM   7634 O OG1 . THR B 1 398 ? -3.786  16.862  30.865 1.00 35.32 ? 398  THR B OG1 1 
ATOM   7635 C CG2 . THR B 1 398 ? -2.844  19.073  31.061 1.00 35.62 ? 398  THR B CG2 1 
ATOM   7636 N N   . LYS B 1 399 ? -3.444  15.582  34.424 1.00 36.44 ? 399  LYS B N   1 
ATOM   7637 C CA  . LYS B 1 399 ? -4.230  14.637  35.232 1.00 37.74 ? 399  LYS B CA  1 
ATOM   7638 C C   . LYS B 1 399 ? -3.796  14.562  36.698 1.00 36.71 ? 399  LYS B C   1 
ATOM   7639 O O   . LYS B 1 399 ? -2.601  14.595  36.998 1.00 36.53 ? 399  LYS B O   1 
ATOM   7640 C CB  . LYS B 1 399 ? -4.116  13.214  34.666 1.00 37.17 ? 399  LYS B CB  1 
ATOM   7641 C CG  . LYS B 1 399 ? -5.043  12.876  33.516 1.00 40.70 ? 399  LYS B CG  1 
ATOM   7642 C CD  . LYS B 1 399 ? -4.477  13.307  32.178 1.00 38.74 ? 399  LYS B CD  1 
ATOM   7643 C CE  . LYS B 1 399 ? -5.349  12.791  31.049 1.00 39.49 ? 399  LYS B CE  1 
ATOM   7644 N NZ  . LYS B 1 399 ? -4.915  13.312  29.729 1.00 39.13 ? 399  LYS B NZ  1 
ATOM   7645 N N   . MET B 1 400 ? -4.767  14.451  37.604 1.00 34.92 ? 400  MET B N   1 
ATOM   7646 C CA  . MET B 1 400 ? -4.467  14.300  39.026 1.00 34.70 ? 400  MET B CA  1 
ATOM   7647 C C   . MET B 1 400 ? -4.375  12.784  39.228 1.00 34.01 ? 400  MET B C   1 
ATOM   7648 O O   . MET B 1 400 ? -5.325  12.051  38.936 1.00 32.11 ? 400  MET B O   1 
ATOM   7649 C CB  . MET B 1 400 ? -5.587  14.871  39.903 1.00 37.14 ? 400  MET B CB  1 
ATOM   7650 C CG  . MET B 1 400 ? -5.288  14.782  41.398 1.00 39.67 ? 400  MET B CG  1 
ATOM   7651 S SD  . MET B 1 400 ? -6.627  15.332  42.498 1.00 43.57 ? 400  MET B SD  1 
ATOM   7652 C CE  . MET B 1 400 ? -6.305  17.104  42.562 1.00 47.36 ? 400  MET B CE  1 
ATOM   7653 N N   . ILE B 1 401 ? -3.232  12.320  39.718 1.00 32.69 ? 401  ILE B N   1 
ATOM   7654 C CA  . ILE B 1 401 ? -3.005  10.891  39.904 1.00 32.78 ? 401  ILE B CA  1 
ATOM   7655 C C   . ILE B 1 401 ? -2.522  10.549  41.305 1.00 31.49 ? 401  ILE B C   1 
ATOM   7656 O O   . ILE B 1 401 ? -1.345  10.706  41.608 1.00 31.18 ? 401  ILE B O   1 
ATOM   7657 C CB  . ILE B 1 401 ? -1.943  10.390  38.906 1.00 32.61 ? 401  ILE B CB  1 
ATOM   7658 C CG1 . ILE B 1 401 ? -2.377  10.717  37.473 1.00 32.83 ? 401  ILE B CG1 1 
ATOM   7659 C CG2 . ILE B 1 401 ? -1.717  8.892   39.091 1.00 34.49 ? 401  ILE B CG2 1 
ATOM   7660 C CD1 . ILE B 1 401 ? -1.240  10.693  36.472 1.00 32.01 ? 401  ILE B CD1 1 
ATOM   7661 N N   . PRO B 1 402 ? -3.426  10.084  42.180 1.00 31.40 ? 402  PRO B N   1 
ATOM   7662 C CA  . PRO B 1 402 ? -3.008  9.729   43.543 1.00 31.93 ? 402  PRO B CA  1 
ATOM   7663 C C   . PRO B 1 402 ? -1.973  8.599   43.439 1.00 31.19 ? 402  PRO B C   1 
ATOM   7664 O O   . PRO B 1 402 ? -2.183  7.644   42.696 1.00 31.20 ? 402  PRO B O   1 
ATOM   7665 C CB  . PRO B 1 402 ? -4.304  9.252   44.188 1.00 30.98 ? 402  PRO B CB  1 
ATOM   7666 C CG  . PRO B 1 402 ? -5.365  10.052  43.457 1.00 33.52 ? 402  PRO B CG  1 
ATOM   7667 C CD  . PRO B 1 402 ? -4.887  9.987   42.028 1.00 31.97 ? 402  PRO B CD  1 
ATOM   7668 N N   . CYS B 1 403 ? -0.865  8.710   44.168 1.00 30.90 ? 403  CYS B N   1 
ATOM   7669 C CA  . CYS B 1 403 ? 0.181   7.687   44.123 1.00 29.73 ? 403  CYS B CA  1 
ATOM   7670 C C   . CYS B 1 403 ? 0.531   7.129   45.492 1.00 31.05 ? 403  CYS B C   1 
ATOM   7671 O O   . CYS B 1 403 ? 0.660   7.877   46.464 1.00 29.63 ? 403  CYS B O   1 
ATOM   7672 C CB  . CYS B 1 403 ? 1.485   8.242   43.526 1.00 29.37 ? 403  CYS B CB  1 
ATOM   7673 S SG  . CYS B 1 403 ? 1.446   8.863   41.843 1.00 30.02 ? 403  CYS B SG  1 
ATOM   7674 N N   . ASP B 1 404 ? 0.695   5.810   45.554 1.00 29.27 ? 404  ASP B N   1 
ATOM   7675 C CA  . ASP B 1 404 ? 1.099   5.132   46.775 1.00 28.82 ? 404  ASP B CA  1 
ATOM   7676 C C   . ASP B 1 404 ? 2.562   4.751   46.564 1.00 30.36 ? 404  ASP B C   1 
ATOM   7677 O O   . ASP B 1 404 ? 2.877   3.930   45.692 1.00 30.07 ? 404  ASP B O   1 
ATOM   7678 C CB  . ASP B 1 404 ? 0.287   3.849   46.997 1.00 31.99 ? 404  ASP B CB  1 
ATOM   7679 C CG  . ASP B 1 404 ? -0.981  4.076   47.801 1.00 32.21 ? 404  ASP B CG  1 
ATOM   7680 O OD1 . ASP B 1 404 ? -1.398  5.245   47.991 1.00 34.31 ? 404  ASP B OD1 1 
ATOM   7681 O OD2 . ASP B 1 404 ? -1.570  3.065   48.242 1.00 33.40 ? 404  ASP B OD2 1 
ATOM   7682 N N   . PHE B 1 405 ? 3.449   5.356   47.347 1.00 28.68 ? 405  PHE B N   1 
ATOM   7683 C CA  . PHE B 1 405 ? 4.879   5.065   47.261 1.00 30.78 ? 405  PHE B CA  1 
ATOM   7684 C C   . PHE B 1 405 ? 5.208   4.090   48.385 1.00 29.45 ? 405  PHE B C   1 
ATOM   7685 O O   . PHE B 1 405 ? 4.898   4.358   49.545 1.00 29.30 ? 405  PHE B O   1 
ATOM   7686 C CB  . PHE B 1 405 ? 5.720   6.346   47.450 1.00 29.32 ? 405  PHE B CB  1 
ATOM   7687 C CG  . PHE B 1 405 ? 5.796   7.227   46.227 1.00 30.49 ? 405  PHE B CG  1 
ATOM   7688 C CD1 . PHE B 1 405 ? 4.672   7.898   45.756 1.00 28.51 ? 405  PHE B CD1 1 
ATOM   7689 C CD2 . PHE B 1 405 ? 7.005   7.388   45.547 1.00 29.16 ? 405  PHE B CD2 1 
ATOM   7690 C CE1 . PHE B 1 405 ? 4.751   8.719   44.623 1.00 29.99 ? 405  PHE B CE1 1 
ATOM   7691 C CE2 . PHE B 1 405 ? 7.092   8.207   44.415 1.00 29.09 ? 405  PHE B CE2 1 
ATOM   7692 C CZ  . PHE B 1 405 ? 5.960   8.872   43.955 1.00 30.92 ? 405  PHE B CZ  1 
ATOM   7693 N N   . LEU B 1 406 ? 5.818   2.959   48.052 1.00 29.58 ? 406  LEU B N   1 
ATOM   7694 C CA  . LEU B 1 406 ? 6.169   1.980   49.081 1.00 29.91 ? 406  LEU B CA  1 
ATOM   7695 C C   . LEU B 1 406 ? 7.650   1.637   49.056 1.00 28.80 ? 406  LEU B C   1 
ATOM   7696 O O   . LEU B 1 406 ? 8.266   1.592   47.990 1.00 27.93 ? 406  LEU B O   1 
ATOM   7697 C CB  . LEU B 1 406 ? 5.367   0.686   48.903 1.00 31.21 ? 406  LEU B CB  1 
ATOM   7698 C CG  . LEU B 1 406 ? 3.853   0.830   48.752 1.00 34.40 ? 406  LEU B CG  1 
ATOM   7699 C CD1 . LEU B 1 406 ? 3.518   0.844   47.259 1.00 31.77 ? 406  LEU B CD1 1 
ATOM   7700 C CD2 . LEU B 1 406 ? 3.143   -0.335  49.455 1.00 35.81 ? 406  LEU B CD2 1 
ATOM   7701 N N   . ILE B 1 407 ? 8.221   1.384   50.232 1.00 29.09 ? 407  ILE B N   1 
ATOM   7702 C CA  . ILE B 1 407 ? 9.629   1.026   50.305 1.00 28.78 ? 407  ILE B CA  1 
ATOM   7703 C C   . ILE B 1 407 ? 10.037  0.446   51.657 1.00 30.11 ? 407  ILE B C   1 
ATOM   7704 O O   . ILE B 1 407 ? 9.469   0.789   52.695 1.00 29.02 ? 407  ILE B O   1 
ATOM   7705 C CB  . ILE B 1 407 ? 10.539  2.252   50.026 1.00 29.32 ? 407  ILE B CB  1 
ATOM   7706 C CG1 . ILE B 1 407 ? 11.948  1.780   49.644 1.00 28.40 ? 407  ILE B CG1 1 
ATOM   7707 C CG2 . ILE B 1 407 ? 10.598  3.146   51.266 1.00 29.30 ? 407  ILE B CG2 1 
ATOM   7708 C CD1 . ILE B 1 407 ? 12.910  2.896   49.264 1.00 31.89 ? 407  ILE B CD1 1 
ATOM   7709 N N   . PRO B 1 408 ? 11.004  -0.482  51.648 1.00 29.74 ? 408  PRO B N   1 
ATOM   7710 C CA  . PRO B 1 408 ? 11.492  -1.095  52.882 1.00 31.33 ? 408  PRO B CA  1 
ATOM   7711 C C   . PRO B 1 408 ? 12.730  -0.316  53.361 1.00 30.09 ? 408  PRO B C   1 
ATOM   7712 O O   . PRO B 1 408 ? 13.545  0.117   52.555 1.00 30.79 ? 408  PRO B O   1 
ATOM   7713 C CB  . PRO B 1 408 ? 11.835  -2.511  52.445 1.00 29.01 ? 408  PRO B CB  1 
ATOM   7714 C CG  . PRO B 1 408 ? 12.320  -2.319  51.063 1.00 29.76 ? 408  PRO B CG  1 
ATOM   7715 C CD  . PRO B 1 408 ? 11.354  -1.313  50.481 1.00 31.85 ? 408  PRO B CD  1 
ATOM   7716 N N   . VAL B 1 409 ? 12.861  -0.142  54.668 1.00 31.24 ? 409  VAL B N   1 
ATOM   7717 C CA  . VAL B 1 409 ? 14.003  0.582   55.228 1.00 32.65 ? 409  VAL B CA  1 
ATOM   7718 C C   . VAL B 1 409 ? 15.290  -0.213  55.017 1.00 32.25 ? 409  VAL B C   1 
ATOM   7719 O O   . VAL B 1 409 ? 16.300  0.328   54.576 1.00 32.06 ? 409  VAL B O   1 
ATOM   7720 C CB  . VAL B 1 409 ? 13.791  0.856   56.740 1.00 32.40 ? 409  VAL B CB  1 
ATOM   7721 C CG1 . VAL B 1 409 ? 15.061  1.409   57.372 1.00 35.31 ? 409  VAL B CG1 1 
ATOM   7722 C CG2 . VAL B 1 409 ? 12.658  1.855   56.927 1.00 31.90 ? 409  VAL B CG2 1 
ATOM   7723 N N   . GLN B 1 410 ? 15.237  -1.504  55.318 1.00 32.65 ? 410  GLN B N   1 
ATOM   7724 C CA  . GLN B 1 410 ? 16.392  -2.382  55.170 1.00 33.58 ? 410  GLN B CA  1 
ATOM   7725 C C   . GLN B 1 410 ? 16.257  -3.189  53.890 1.00 33.29 ? 410  GLN B C   1 
ATOM   7726 O O   . GLN B 1 410 ? 15.194  -3.732  53.601 1.00 33.85 ? 410  GLN B O   1 
ATOM   7727 C CB  . GLN B 1 410 ? 16.487  -3.316  56.379 1.00 34.98 ? 410  GLN B CB  1 
ATOM   7728 C CG  . GLN B 1 410 ? 16.523  -2.549  57.696 1.00 36.07 ? 410  GLN B CG  1 
ATOM   7729 C CD  . GLN B 1 410 ? 16.532  -3.440  58.920 1.00 39.27 ? 410  GLN B CD  1 
ATOM   7730 O OE1 . GLN B 1 410 ? 16.328  -2.966  60.043 1.00 43.45 ? 410  GLN B OE1 1 
ATOM   7731 N NE2 . GLN B 1 410 ? 16.770  -4.731  58.719 1.00 39.79 ? 410  GLN B NE2 1 
ATOM   7732 N N   . THR B 1 411 ? 17.335  -3.250  53.122 1.00 33.51 ? 411  THR B N   1 
ATOM   7733 C CA  . THR B 1 411 ? 17.339  -3.978  51.859 1.00 32.95 ? 411  THR B CA  1 
ATOM   7734 C C   . THR B 1 411 ? 17.830  -5.403  52.043 1.00 34.79 ? 411  THR B C   1 
ATOM   7735 O O   . THR B 1 411 ? 18.518  -5.709  53.016 1.00 34.56 ? 411  THR B O   1 
ATOM   7736 C CB  . THR B 1 411 ? 18.247  -3.294  50.828 1.00 32.11 ? 411  THR B CB  1 
ATOM   7737 O OG1 . THR B 1 411 ? 18.339  -4.113  49.656 1.00 29.79 ? 411  THR B OG1 1 
ATOM   7738 C CG2 . THR B 1 411 ? 19.650  -3.079  51.403 1.00 30.04 ? 411  THR B CG2 1 
ATOM   7739 N N   . GLN B 1 412 ? 17.475  -6.267  51.101 1.00 34.84 ? 412  GLN B N   1 
ATOM   7740 C CA  . GLN B 1 412 ? 17.902  -7.663  51.132 1.00 36.83 ? 412  GLN B CA  1 
ATOM   7741 C C   . GLN B 1 412 ? 19.314  -7.788  50.540 1.00 38.20 ? 412  GLN B C   1 
ATOM   7742 O O   . GLN B 1 412 ? 19.932  -8.853  50.613 1.00 37.91 ? 412  GLN B O   1 
ATOM   7743 C CB  . GLN B 1 412 ? 16.941  -8.528  50.314 1.00 38.27 ? 412  GLN B CB  1 
ATOM   7744 C CG  . GLN B 1 412 ? 15.498  -8.568  50.815 1.00 37.84 ? 412  GLN B CG  1 
ATOM   7745 C CD  . GLN B 1 412 ? 15.300  -9.529  51.969 1.00 38.54 ? 412  GLN B CD  1 
ATOM   7746 O OE1 . GLN B 1 412 ? 16.109  -10.425 52.184 1.00 42.15 ? 412  GLN B OE1 1 
ATOM   7747 N NE2 . GLN B 1 412 ? 14.211  -9.357  52.707 1.00 39.20 ? 412  GLN B NE2 1 
ATOM   7748 N N   . HIS B 1 413 ? 19.807  -6.701  49.945 1.00 36.96 ? 413  HIS B N   1 
ATOM   7749 C CA  . HIS B 1 413 ? 21.136  -6.680  49.330 1.00 38.22 ? 413  HIS B CA  1 
ATOM   7750 C C   . HIS B 1 413 ? 21.883  -5.381  49.614 1.00 36.88 ? 413  HIS B C   1 
ATOM   7751 O O   . HIS B 1 413 ? 21.960  -4.499  48.760 1.00 35.29 ? 413  HIS B O   1 
ATOM   7752 C CB  . HIS B 1 413 ? 21.017  -6.882  47.817 1.00 38.56 ? 413  HIS B CB  1 
ATOM   7753 C CG  . HIS B 1 413 ? 20.365  -8.172  47.440 1.00 40.14 ? 413  HIS B CG  1 
ATOM   7754 N ND1 . HIS B 1 413 ? 21.011  -9.387  47.534 1.00 40.69 ? 413  HIS B ND1 1 
ATOM   7755 C CD2 . HIS B 1 413 ? 19.099  -8.449  47.048 1.00 38.74 ? 413  HIS B CD2 1 
ATOM   7756 C CE1 . HIS B 1 413 ? 20.170  -10.355 47.219 1.00 40.71 ? 413  HIS B CE1 1 
ATOM   7757 N NE2 . HIS B 1 413 ? 19.002  -9.813  46.923 1.00 40.22 ? 413  HIS B NE2 1 
ATOM   7758 N N   . PRO B 1 414 ? 22.449  -5.255  50.822 1.00 38.54 ? 414  PRO B N   1 
ATOM   7759 C CA  . PRO B 1 414 ? 23.199  -4.071  51.251 1.00 39.58 ? 414  PRO B CA  1 
ATOM   7760 C C   . PRO B 1 414 ? 24.589  -4.008  50.633 1.00 41.27 ? 414  PRO B C   1 
ATOM   7761 O O   . PRO B 1 414 ? 25.587  -3.857  51.337 1.00 41.92 ? 414  PRO B O   1 
ATOM   7762 C CB  . PRO B 1 414 ? 23.250  -4.240  52.760 1.00 39.88 ? 414  PRO B CB  1 
ATOM   7763 C CG  . PRO B 1 414 ? 23.403  -5.720  52.896 1.00 41.12 ? 414  PRO B CG  1 
ATOM   7764 C CD  . PRO B 1 414 ? 22.369  -6.240  51.915 1.00 38.48 ? 414  PRO B CD  1 
ATOM   7765 N N   . ILE B 1 415 ? 24.647  -4.127  49.313 1.00 40.44 ? 415  ILE B N   1 
ATOM   7766 C CA  . ILE B 1 415 ? 25.913  -4.084  48.603 1.00 40.93 ? 415  ILE B CA  1 
ATOM   7767 C C   . ILE B 1 415 ? 26.527  -2.688  48.672 1.00 40.76 ? 415  ILE B C   1 
ATOM   7768 O O   . ILE B 1 415 ? 25.825  -1.702  48.908 1.00 39.84 ? 415  ILE B O   1 
ATOM   7769 C CB  . ILE B 1 415 ? 25.722  -4.477  47.125 1.00 41.06 ? 415  ILE B CB  1 
ATOM   7770 C CG1 . ILE B 1 415 ? 24.751  -3.506  46.447 1.00 39.20 ? 415  ILE B CG1 1 
ATOM   7771 C CG2 . ILE B 1 415 ? 25.182  -5.900  47.034 1.00 41.07 ? 415  ILE B CG2 1 
ATOM   7772 C CD1 . ILE B 1 415 ? 24.605  -3.736  44.951 1.00 39.30 ? 415  ILE B CD1 1 
ATOM   7773 N N   . ARG B 1 416 ? 27.840  -2.612  48.473 1.00 41.32 ? 416  ARG B N   1 
ATOM   7774 C CA  . ARG B 1 416 ? 28.547  -1.338  48.493 1.00 42.19 ? 416  ARG B CA  1 
ATOM   7775 C C   . ARG B 1 416 ? 28.306  -0.584  49.792 1.00 41.85 ? 416  ARG B C   1 
ATOM   7776 O O   . ARG B 1 416 ? 28.160  0.642   49.797 1.00 41.48 ? 416  ARG B O   1 
ATOM   7777 C CB  . ARG B 1 416 ? 28.099  -0.485  47.307 1.00 44.48 ? 416  ARG B CB  1 
ATOM   7778 C CG  . ARG B 1 416 ? 28.431  -1.102  45.959 1.00 48.72 ? 416  ARG B CG  1 
ATOM   7779 C CD  . ARG B 1 416 ? 29.783  -0.625  45.464 1.00 52.42 ? 416  ARG B CD  1 
ATOM   7780 N NE  . ARG B 1 416 ? 29.739  0.799   45.148 1.00 56.08 ? 416  ARG B NE  1 
ATOM   7781 C CZ  . ARG B 1 416 ? 30.788  1.518   44.765 1.00 58.57 ? 416  ARG B CZ  1 
ATOM   7782 N NH1 . ARG B 1 416 ? 31.981  0.949   44.647 1.00 60.58 ? 416  ARG B NH1 1 
ATOM   7783 N NH2 . ARG B 1 416 ? 30.642  2.810   44.500 1.00 59.42 ? 416  ARG B NH2 1 
ATOM   7784 N N   . LYS B 1 417 ? 28.254  -1.329  50.890 1.00 41.41 ? 417  LYS B N   1 
ATOM   7785 C CA  . LYS B 1 417 ? 28.039  -0.743  52.205 1.00 43.74 ? 417  LYS B CA  1 
ATOM   7786 C C   . LYS B 1 417 ? 26.764  0.089   52.298 1.00 43.17 ? 417  LYS B C   1 
ATOM   7787 O O   . LYS B 1 417 ? 26.719  1.086   53.023 1.00 42.90 ? 417  LYS B O   1 
ATOM   7788 C CB  . LYS B 1 417 ? 29.247  0.116   52.596 1.00 46.59 ? 417  LYS B CB  1 
ATOM   7789 C CG  . LYS B 1 417 ? 30.536  -0.678  52.729 1.00 49.24 ? 417  LYS B CG  1 
ATOM   7790 C CD  . LYS B 1 417 ? 31.712  0.225   53.066 1.00 51.72 ? 417  LYS B CD  1 
ATOM   7791 C CE  . LYS B 1 417 ? 32.996  -0.577  53.184 1.00 54.10 ? 417  LYS B CE  1 
ATOM   7792 N NZ  . LYS B 1 417 ? 32.876  -1.675  54.194 1.00 56.33 ? 417  LYS B NZ  1 
ATOM   7793 N N   . GLY B 1 418 ? 25.738  -0.318  51.555 1.00 41.94 ? 418  GLY B N   1 
ATOM   7794 C CA  . GLY B 1 418 ? 24.463  0.382   51.590 1.00 40.06 ? 418  GLY B CA  1 
ATOM   7795 C C   . GLY B 1 418 ? 24.291  1.579   50.670 1.00 39.21 ? 418  GLY B C   1 
ATOM   7796 O O   . GLY B 1 418 ? 23.264  2.257   50.734 1.00 38.65 ? 418  GLY B O   1 
ATOM   7797 N N   . LEU B 1 419 ? 25.269  1.835   49.805 1.00 38.81 ? 419  LEU B N   1 
ATOM   7798 C CA  . LEU B 1 419 ? 25.203  2.978   48.895 1.00 38.87 ? 419  LEU B CA  1 
ATOM   7799 C C   . LEU B 1 419 ? 23.964  2.965   47.992 1.00 38.46 ? 419  LEU B C   1 
ATOM   7800 O O   . LEU B 1 419 ? 23.252  3.967   47.895 1.00 37.85 ? 419  LEU B O   1 
ATOM   7801 C CB  . LEU B 1 419 ? 26.462  3.036   48.030 1.00 39.86 ? 419  LEU B CB  1 
ATOM   7802 C CG  . LEU B 1 419 ? 26.533  4.184   47.017 1.00 40.34 ? 419  LEU B CG  1 
ATOM   7803 C CD1 . LEU B 1 419 ? 26.447  5.532   47.731 1.00 41.24 ? 419  LEU B CD1 1 
ATOM   7804 C CD2 . LEU B 1 419 ? 27.826  4.074   46.231 1.00 40.89 ? 419  LEU B CD2 1 
ATOM   7805 N N   . HIS B 1 420 ? 23.712  1.838   47.333 1.00 36.84 ? 420  HIS B N   1 
ATOM   7806 C CA  . HIS B 1 420 ? 22.552  1.719   46.445 1.00 36.60 ? 420  HIS B CA  1 
ATOM   7807 C C   . HIS B 1 420 ? 21.223  1.998   47.133 1.00 35.32 ? 420  HIS B C   1 
ATOM   7808 O O   . HIS B 1 420 ? 20.364  2.686   46.575 1.00 37.59 ? 420  HIS B O   1 
ATOM   7809 C CB  . HIS B 1 420 ? 22.497  0.325   45.813 1.00 35.03 ? 420  HIS B CB  1 
ATOM   7810 C CG  . HIS B 1 420 ? 23.465  0.133   44.687 1.00 38.10 ? 420  HIS B CG  1 
ATOM   7811 N ND1 . HIS B 1 420 ? 24.831  0.121   44.872 1.00 40.44 ? 420  HIS B ND1 1 
ATOM   7812 C CD2 . HIS B 1 420 ? 23.264  -0.057  43.362 1.00 38.38 ? 420  HIS B CD2 1 
ATOM   7813 C CE1 . HIS B 1 420 ? 25.430  -0.071  43.710 1.00 38.37 ? 420  HIS B CE1 1 
ATOM   7814 N NE2 . HIS B 1 420 ? 24.501  -0.182  42.777 1.00 43.22 ? 420  HIS B NE2 1 
ATOM   7815 N N   . HIS B 1 421 ? 21.043  1.472   48.341 1.00 34.85 ? 421  HIS B N   1 
ATOM   7816 C CA  . HIS B 1 421 ? 19.786  1.677   49.049 1.00 33.98 ? 421  HIS B CA  1 
ATOM   7817 C C   . HIS B 1 421 ? 19.646  3.107   49.564 1.00 35.19 ? 421  HIS B C   1 
ATOM   7818 O O   . HIS B 1 421 ? 18.532  3.634   49.673 1.00 31.88 ? 421  HIS B O   1 
ATOM   7819 C CB  . HIS B 1 421 ? 19.645  0.682   50.200 1.00 35.01 ? 421  HIS B CB  1 
ATOM   7820 C CG  . HIS B 1 421 ? 18.226  0.456   50.619 1.00 37.63 ? 421  HIS B CG  1 
ATOM   7821 N ND1 . HIS B 1 421 ? 17.253  0.032   49.738 1.00 37.29 ? 421  HIS B ND1 1 
ATOM   7822 C CD2 . HIS B 1 421 ? 17.610  0.606   51.816 1.00 36.65 ? 421  HIS B CD2 1 
ATOM   7823 C CE1 . HIS B 1 421 ? 16.100  -0.070  50.374 1.00 36.02 ? 421  HIS B CE1 1 
ATOM   7824 N NE2 . HIS B 1 421 ? 16.288  0.272   51.637 1.00 36.67 ? 421  HIS B NE2 1 
ATOM   7825 N N   . LYS B 1 422 ? 20.778  3.731   49.881 1.00 32.62 ? 422  LYS B N   1 
ATOM   7826 C CA  . LYS B 1 422 ? 20.783  5.109   50.350 1.00 34.01 ? 422  LYS B CA  1 
ATOM   7827 C C   . LYS B 1 422 ? 20.209  5.979   49.243 1.00 32.28 ? 422  LYS B C   1 
ATOM   7828 O O   . LYS B 1 422 ? 19.343  6.818   49.486 1.00 32.67 ? 422  LYS B O   1 
ATOM   7829 C CB  . LYS B 1 422 ? 22.218  5.537   50.670 1.00 36.72 ? 422  LYS B CB  1 
ATOM   7830 C CG  . LYS B 1 422 ? 22.402  7.011   50.954 1.00 40.68 ? 422  LYS B CG  1 
ATOM   7831 C CD  . LYS B 1 422 ? 23.859  7.280   51.294 1.00 43.11 ? 422  LYS B CD  1 
ATOM   7832 C CE  . LYS B 1 422 ? 24.115  8.746   51.532 1.00 45.60 ? 422  LYS B CE  1 
ATOM   7833 N NZ  . LYS B 1 422 ? 25.438  8.948   52.189 1.00 50.07 ? 422  LYS B NZ  1 
ATOM   7834 N N   . ILE B 1 423 ? 20.700  5.770   48.023 1.00 31.66 ? 423  ILE B N   1 
ATOM   7835 C CA  . ILE B 1 423 ? 20.231  6.518   46.861 1.00 33.52 ? 423  ILE B CA  1 
ATOM   7836 C C   . ILE B 1 423 ? 18.753  6.216   46.591 1.00 32.61 ? 423  ILE B C   1 
ATOM   7837 O O   . ILE B 1 423 ? 17.973  7.116   46.272 1.00 31.83 ? 423  ILE B O   1 
ATOM   7838 C CB  . ILE B 1 423 ? 21.060  6.159   45.611 1.00 34.47 ? 423  ILE B CB  1 
ATOM   7839 C CG1 . ILE B 1 423 ? 22.519  6.580   45.825 1.00 34.70 ? 423  ILE B CG1 1 
ATOM   7840 C CG2 . ILE B 1 423 ? 20.475  6.839   44.379 1.00 35.56 ? 423  ILE B CG2 1 
ATOM   7841 C CD1 . ILE B 1 423 ? 23.476  6.106   44.737 1.00 35.05 ? 423  ILE B CD1 1 
ATOM   7842 N N   . LEU B 1 424 ? 18.372  4.951   46.729 1.00 30.83 ? 424  LEU B N   1 
ATOM   7843 C CA  . LEU B 1 424 ? 16.982  4.542   46.505 1.00 32.35 ? 424  LEU B CA  1 
ATOM   7844 C C   . LEU B 1 424 ? 16.027  5.261   47.471 1.00 33.11 ? 424  LEU B C   1 
ATOM   7845 O O   . LEU B 1 424 ? 14.999  5.791   47.056 1.00 34.67 ? 424  LEU B O   1 
ATOM   7846 C CB  . LEU B 1 424 ? 16.850  3.022   46.667 1.00 30.19 ? 424  LEU B CB  1 
ATOM   7847 C CG  . LEU B 1 424 ? 15.484  2.413   46.331 1.00 29.12 ? 424  LEU B CG  1 
ATOM   7848 C CD1 . LEU B 1 424 ? 15.214  2.569   44.854 1.00 29.07 ? 424  LEU B CD1 1 
ATOM   7849 C CD2 . LEU B 1 424 ? 15.452  0.936   46.730 1.00 28.47 ? 424  LEU B CD2 1 
ATOM   7850 N N   . LEU B 1 425 ? 16.375  5.286   48.755 1.00 34.28 ? 425  LEU B N   1 
ATOM   7851 C CA  . LEU B 1 425 ? 15.558  5.955   49.772 1.00 34.48 ? 425  LEU B CA  1 
ATOM   7852 C C   . LEU B 1 425 ? 15.448  7.460   49.535 1.00 35.08 ? 425  LEU B C   1 
ATOM   7853 O O   . LEU B 1 425 ? 14.372  8.042   49.678 1.00 32.80 ? 425  LEU B O   1 
ATOM   7854 C CB  . LEU B 1 425 ? 16.141  5.722   51.172 1.00 33.68 ? 425  LEU B CB  1 
ATOM   7855 C CG  . LEU B 1 425 ? 15.964  4.355   51.845 1.00 35.19 ? 425  LEU B CG  1 
ATOM   7856 C CD1 . LEU B 1 425 ? 16.950  4.213   52.998 1.00 35.20 ? 425  LEU B CD1 1 
ATOM   7857 C CD2 . LEU B 1 425 ? 14.533  4.205   52.335 1.00 33.98 ? 425  LEU B CD2 1 
ATOM   7858 N N   . ALA B 1 426 ? 16.568  8.088   49.184 1.00 34.93 ? 426  ALA B N   1 
ATOM   7859 C CA  . ALA B 1 426 ? 16.591  9.527   48.944 1.00 34.82 ? 426  ALA B CA  1 
ATOM   7860 C C   . ALA B 1 426 ? 15.643  9.909   47.806 1.00 33.58 ? 426  ALA B C   1 
ATOM   7861 O O   . ALA B 1 426 ? 14.971  10.946  47.863 1.00 34.12 ? 426  ALA B O   1 
ATOM   7862 C CB  . ALA B 1 426 ? 18.018  9.979   48.622 1.00 35.60 ? 426  ALA B CB  1 
ATOM   7863 N N   . ASN B 1 427 ? 15.612  9.080   46.765 1.00 31.91 ? 427  ASN B N   1 
ATOM   7864 C CA  . ASN B 1 427 ? 14.738  9.308   45.615 1.00 33.54 ? 427  ASN B CA  1 
ATOM   7865 C C   . ASN B 1 427 ? 13.274  9.119   46.002 1.00 32.25 ? 427  ASN B C   1 
ATOM   7866 O O   . ASN B 1 427 ? 12.397  9.846   45.530 1.00 33.48 ? 427  ASN B O   1 
ATOM   7867 C CB  . ASN B 1 427 ? 15.107  8.353   44.480 1.00 33.85 ? 427  ASN B CB  1 
ATOM   7868 C CG  . ASN B 1 427 ? 16.257  8.865   43.649 1.00 34.25 ? 427  ASN B CG  1 
ATOM   7869 O OD1 . ASN B 1 427 ? 16.081  9.741   42.803 1.00 35.16 ? 427  ASN B OD1 1 
ATOM   7870 N ND2 . ASN B 1 427 ? 17.451  8.329   43.892 1.00 36.89 ? 427  ASN B ND2 1 
ATOM   7871 N N   . PHE B 1 428 ? 13.026  8.134   46.862 1.00 32.49 ? 428  PHE B N   1 
ATOM   7872 C CA  . PHE B 1 428 ? 11.687  7.832   47.365 1.00 33.42 ? 428  PHE B CA  1 
ATOM   7873 C C   . PHE B 1 428 ? 11.131  9.074   48.074 1.00 34.01 ? 428  PHE B C   1 
ATOM   7874 O O   . PHE B 1 428 ? 10.013  9.523   47.805 1.00 32.70 ? 428  PHE B O   1 
ATOM   7875 C CB  . PHE B 1 428 ? 11.783  6.663   48.350 1.00 32.55 ? 428  PHE B CB  1 
ATOM   7876 C CG  . PHE B 1 428 ? 10.508  6.372   49.098 1.00 33.30 ? 428  PHE B CG  1 
ATOM   7877 C CD1 . PHE B 1 428 ? 9.536   5.539   48.549 1.00 32.45 ? 428  PHE B CD1 1 
ATOM   7878 C CD2 . PHE B 1 428 ? 10.301  6.894   50.376 1.00 32.40 ? 428  PHE B CD2 1 
ATOM   7879 C CE1 . PHE B 1 428 ? 8.373   5.220   49.270 1.00 34.05 ? 428  PHE B CE1 1 
ATOM   7880 C CE2 . PHE B 1 428 ? 9.149   6.586   51.105 1.00 34.02 ? 428  PHE B CE2 1 
ATOM   7881 C CZ  . PHE B 1 428 ? 8.180   5.745   50.553 1.00 33.23 ? 428  PHE B CZ  1 
ATOM   7882 N N   . LEU B 1 429 ? 11.937  9.627   48.975 1.00 33.67 ? 429  LEU B N   1 
ATOM   7883 C CA  . LEU B 1 429 ? 11.570  10.809  49.756 1.00 33.63 ? 429  LEU B CA  1 
ATOM   7884 C C   . LEU B 1 429 ? 11.428  12.091  48.931 1.00 32.74 ? 429  LEU B C   1 
ATOM   7885 O O   . LEU B 1 429 ? 10.451  12.836  49.066 1.00 33.20 ? 429  LEU B O   1 
ATOM   7886 C CB  . LEU B 1 429 ? 12.627  11.033  50.845 1.00 34.84 ? 429  LEU B CB  1 
ATOM   7887 C CG  . LEU B 1 429 ? 12.818  9.903   51.855 1.00 33.84 ? 429  LEU B CG  1 
ATOM   7888 C CD1 . LEU B 1 429 ? 14.155  10.091  52.584 1.00 33.21 ? 429  LEU B CD1 1 
ATOM   7889 C CD2 . LEU B 1 429 ? 11.643  9.895   52.837 1.00 34.17 ? 429  LEU B CD2 1 
ATOM   7890 N N   . ALA B 1 430 ? 12.419  12.346  48.085 1.00 35.24 ? 430  ALA B N   1 
ATOM   7891 C CA  . ALA B 1 430 ? 12.447  13.544  47.252 1.00 36.55 ? 430  ALA B CA  1 
ATOM   7892 C C   . ALA B 1 430 ? 11.306  13.644  46.245 1.00 37.30 ? 430  ALA B C   1 
ATOM   7893 O O   . ALA B 1 430 ? 10.845  14.746  45.935 1.00 37.27 ? 430  ALA B O   1 
ATOM   7894 C CB  . ALA B 1 430 ? 13.786  13.625  46.521 1.00 37.06 ? 430  ALA B CB  1 
ATOM   7895 N N   . GLN B 1 431 ? 10.865  12.503  45.725 1.00 35.24 ? 431  GLN B N   1 
ATOM   7896 C CA  . GLN B 1 431 ? 9.784   12.471  44.738 1.00 35.22 ? 431  GLN B CA  1 
ATOM   7897 C C   . GLN B 1 431 ? 8.433   12.924  45.298 1.00 34.88 ? 431  GLN B C   1 
ATOM   7898 O O   . GLN B 1 431 ? 7.709   13.696  44.659 1.00 34.25 ? 431  GLN B O   1 
ATOM   7899 C CB  . GLN B 1 431 ? 9.654   11.060  44.142 1.00 34.25 ? 431  GLN B CB  1 
ATOM   7900 C CG  . GLN B 1 431 ? 10.653  10.735  43.019 1.00 35.03 ? 431  GLN B CG  1 
ATOM   7901 C CD  . GLN B 1 431 ? 10.480  11.630  41.805 1.00 36.23 ? 431  GLN B CD  1 
ATOM   7902 O OE1 . GLN B 1 431 ? 9.363   12.046  41.485 1.00 38.00 ? 431  GLN B OE1 1 
ATOM   7903 N NE2 . GLN B 1 431 ? 11.580  11.918  41.111 1.00 35.60 ? 431  GLN B NE2 1 
ATOM   7904 N N   . THR B 1 432 ? 8.082   12.444  46.484 1.00 33.49 ? 432  THR B N   1 
ATOM   7905 C CA  . THR B 1 432 ? 6.818   12.841  47.079 1.00 33.29 ? 432  THR B CA  1 
ATOM   7906 C C   . THR B 1 432 ? 6.924   14.278  47.582 1.00 33.96 ? 432  THR B C   1 
ATOM   7907 O O   . THR B 1 432 ? 5.933   15.003  47.622 1.00 32.16 ? 432  THR B O   1 
ATOM   7908 C CB  . THR B 1 432 ? 6.411   11.902  48.227 1.00 33.05 ? 432  THR B CB  1 
ATOM   7909 O OG1 . THR B 1 432 ? 7.322   12.045  49.324 1.00 32.04 ? 432  THR B OG1 1 
ATOM   7910 C CG2 . THR B 1 432 ? 6.428   10.458  47.737 1.00 32.40 ? 432  THR B CG2 1 
ATOM   7911 N N   . GLU B 1 433 ? 8.132   14.694  47.951 1.00 34.79 ? 433  GLU B N   1 
ATOM   7912 C CA  . GLU B 1 433 ? 8.341   16.066  48.414 1.00 36.34 ? 433  GLU B CA  1 
ATOM   7913 C C   . GLU B 1 433 ? 8.153   17.024  47.234 1.00 35.90 ? 433  GLU B C   1 
ATOM   7914 O O   . GLU B 1 433 ? 7.538   18.083  47.368 1.00 38.54 ? 433  GLU B O   1 
ATOM   7915 C CB  . GLU B 1 433 ? 9.758   16.228  48.978 1.00 37.81 ? 433  GLU B CB  1 
ATOM   7916 C CG  . GLU B 1 433 ? 9.966   17.529  49.743 1.00 38.18 ? 433  GLU B CG  1 
ATOM   7917 C CD  . GLU B 1 433 ? 11.422  17.782  50.092 1.00 37.97 ? 433  GLU B CD  1 
ATOM   7918 O OE1 . GLU B 1 433 ? 11.679  18.610  50.992 1.00 41.56 ? 433  GLU B OE1 1 
ATOM   7919 O OE2 . GLU B 1 433 ? 12.309  17.170  49.461 1.00 35.48 ? 433  GLU B OE2 1 
ATOM   7920 N N   . ALA B 1 434 ? 8.695   16.648  46.079 1.00 36.25 ? 434  ALA B N   1 
ATOM   7921 C CA  . ALA B 1 434 ? 8.596   17.467  44.873 1.00 35.56 ? 434  ALA B CA  1 
ATOM   7922 C C   . ALA B 1 434 ? 7.168   17.502  44.342 1.00 35.81 ? 434  ALA B C   1 
ATOM   7923 O O   . ALA B 1 434 ? 6.687   18.546  43.876 1.00 33.41 ? 434  ALA B O   1 
ATOM   7924 C CB  . ALA B 1 434 ? 9.537   16.929  43.798 1.00 35.51 ? 434  ALA B CB  1 
ATOM   7925 N N   . LEU B 1 435 ? 6.484   16.365  44.402 1.00 34.07 ? 435  LEU B N   1 
ATOM   7926 C CA  . LEU B 1 435 ? 5.105   16.317  43.924 1.00 34.62 ? 435  LEU B CA  1 
ATOM   7927 C C   . LEU B 1 435 ? 4.248   17.243  44.770 1.00 35.35 ? 435  LEU B C   1 
ATOM   7928 O O   . LEU B 1 435 ? 3.310   17.872  44.273 1.00 34.79 ? 435  LEU B O   1 
ATOM   7929 C CB  . LEU B 1 435 ? 4.556   14.889  44.000 1.00 31.98 ? 435  LEU B CB  1 
ATOM   7930 C CG  . LEU B 1 435 ? 5.099   13.933  42.935 1.00 34.20 ? 435  LEU B CG  1 
ATOM   7931 C CD1 . LEU B 1 435 ? 4.712   12.502  43.296 1.00 33.71 ? 435  LEU B CD1 1 
ATOM   7932 C CD2 . LEU B 1 435 ? 4.561   14.327  41.558 1.00 29.60 ? 435  LEU B CD2 1 
ATOM   7933 N N   . MET B 1 436 ? 4.585   17.329  46.053 1.00 35.83 ? 436  MET B N   1 
ATOM   7934 C CA  . MET B 1 436 ? 3.855   18.174  46.988 1.00 38.28 ? 436  MET B CA  1 
ATOM   7935 C C   . MET B 1 436 ? 4.238   19.640  46.801 1.00 39.27 ? 436  MET B C   1 
ATOM   7936 O O   . MET B 1 436 ? 3.379   20.486  46.540 1.00 38.17 ? 436  MET B O   1 
ATOM   7937 C CB  . MET B 1 436 ? 4.158   17.724  48.421 1.00 41.64 ? 436  MET B CB  1 
ATOM   7938 C CG  . MET B 1 436 ? 3.280   18.328  49.517 1.00 45.31 ? 436  MET B CG  1 
ATOM   7939 S SD  . MET B 1 436 ? 3.834   19.939  50.108 1.00 51.85 ? 436  MET B SD  1 
ATOM   7940 C CE  . MET B 1 436 ? 5.243   19.449  51.110 1.00 48.60 ? 436  MET B CE  1 
ATOM   7941 N N   . LYS B 1 437 ? 5.534   19.925  46.920 1.00 38.25 ? 437  LYS B N   1 
ATOM   7942 C CA  . LYS B 1 437 ? 6.063   21.285  46.798 1.00 41.01 ? 437  LYS B CA  1 
ATOM   7943 C C   . LYS B 1 437 ? 6.039   21.930  45.416 1.00 40.82 ? 437  LYS B C   1 
ATOM   7944 O O   . LYS B 1 437 ? 5.659   23.099  45.279 1.00 42.34 ? 437  LYS B O   1 
ATOM   7945 C CB  . LYS B 1 437 ? 7.507   21.336  47.303 1.00 40.86 ? 437  LYS B CB  1 
ATOM   7946 C CG  . LYS B 1 437 ? 7.675   21.268  48.801 1.00 44.11 ? 437  LYS B CG  1 
ATOM   7947 C CD  . LYS B 1 437 ? 9.114   21.611  49.180 1.00 46.01 ? 437  LYS B CD  1 
ATOM   7948 C CE  . LYS B 1 437 ? 9.501   22.999  48.673 1.00 48.35 ? 437  LYS B CE  1 
ATOM   7949 N NZ  . LYS B 1 437 ? 10.881  23.409  49.072 1.00 48.68 ? 437  LYS B NZ  1 
ATOM   7950 N N   . GLY B 1 438 ? 6.464   21.184  44.400 1.00 39.42 ? 438  GLY B N   1 
ATOM   7951 C CA  . GLY B 1 438 ? 6.514   21.733  43.058 1.00 39.49 ? 438  GLY B CA  1 
ATOM   7952 C C   . GLY B 1 438 ? 7.599   22.799  43.031 1.00 41.55 ? 438  GLY B C   1 
ATOM   7953 O O   . GLY B 1 438 ? 8.445   22.830  43.928 1.00 40.53 ? 438  GLY B O   1 
ATOM   7954 N N   . LYS B 1 439 ? 7.579   23.667  42.021 1.00 41.48 ? 439  LYS B N   1 
ATOM   7955 C CA  . LYS B 1 439 ? 8.561   24.748  41.896 1.00 41.81 ? 439  LYS B CA  1 
ATOM   7956 C C   . LYS B 1 439 ? 7.923   25.970  41.227 1.00 41.57 ? 439  LYS B C   1 
ATOM   7957 O O   . LYS B 1 439 ? 7.622   25.945  40.037 1.00 41.74 ? 439  LYS B O   1 
ATOM   7958 C CB  . LYS B 1 439 ? 9.767   24.295  41.073 1.00 41.26 ? 439  LYS B CB  1 
ATOM   7959 C CG  . LYS B 1 439 ? 10.823  25.394  40.885 1.00 43.05 ? 439  LYS B CG  1 
ATOM   7960 C CD  . LYS B 1 439 ? 11.954  24.958  39.972 1.00 41.69 ? 439  LYS B CD  1 
ATOM   7961 C CE  . LYS B 1 439 ? 12.795  23.848  40.587 1.00 42.89 ? 439  LYS B CE  1 
ATOM   7962 N NZ  . LYS B 1 439 ? 13.850  23.384  39.638 1.00 42.61 ? 439  LYS B NZ  1 
ATOM   7963 N N   . SER B 1 440 ? 7.735   27.039  41.993 1.00 40.32 ? 440  SER B N   1 
ATOM   7964 C CA  . SER B 1 440 ? 7.109   28.260  41.482 1.00 42.84 ? 440  SER B CA  1 
ATOM   7965 C C   . SER B 1 440 ? 7.861   28.976  40.359 1.00 41.99 ? 440  SER B C   1 
ATOM   7966 O O   . SER B 1 440 ? 9.018   28.673  40.059 1.00 40.23 ? 440  SER B O   1 
ATOM   7967 C CB  . SER B 1 440 ? 6.878   29.248  42.631 1.00 42.41 ? 440  SER B CB  1 
ATOM   7968 O OG  . SER B 1 440 ? 8.103   29.805  43.064 1.00 44.94 ? 440  SER B OG  1 
ATOM   7969 N N   . THR B 1 441 ? 7.186   29.947  39.751 1.00 42.21 ? 441  THR B N   1 
ATOM   7970 C CA  . THR B 1 441 ? 7.758   30.726  38.657 1.00 43.16 ? 441  THR B CA  1 
ATOM   7971 C C   . THR B 1 441 ? 8.971   31.521  39.132 1.00 44.09 ? 441  THR B C   1 
ATOM   7972 O O   . THR B 1 441 ? 9.956   31.668  38.403 1.00 42.80 ? 441  THR B O   1 
ATOM   7973 C CB  . THR B 1 441 ? 6.719   31.702  38.080 1.00 43.61 ? 441  THR B CB  1 
ATOM   7974 O OG1 . THR B 1 441 ? 5.543   30.974  37.702 1.00 44.23 ? 441  THR B OG1 1 
ATOM   7975 C CG2 . THR B 1 441 ? 7.280   32.426  36.859 1.00 45.12 ? 441  THR B CG2 1 
ATOM   7976 N N   . GLU B 1 442 ? 8.896   32.027  40.358 1.00 45.12 ? 442  GLU B N   1 
ATOM   7977 C CA  . GLU B 1 442 ? 9.992   32.802  40.929 1.00 48.48 ? 442  GLU B CA  1 
ATOM   7978 C C   . GLU B 1 442 ? 11.216  31.930  41.184 1.00 48.00 ? 442  GLU B C   1 
ATOM   7979 O O   . GLU B 1 442 ? 12.349  32.347  40.945 1.00 46.30 ? 442  GLU B O   1 
ATOM   7980 C CB  . GLU B 1 442 ? 9.543   33.460  42.234 1.00 51.01 ? 442  GLU B CB  1 
ATOM   7981 C CG  . GLU B 1 442 ? 8.526   34.570  42.035 1.00 56.31 ? 442  GLU B CG  1 
ATOM   7982 C CD  . GLU B 1 442 ? 9.109   35.762  41.293 1.00 59.68 ? 442  GLU B CD  1 
ATOM   7983 O OE1 . GLU B 1 442 ? 9.970   36.459  41.873 1.00 61.02 ? 442  GLU B OE1 1 
ATOM   7984 O OE2 . GLU B 1 442 ? 8.713   35.999  40.130 1.00 61.17 ? 442  GLU B OE2 1 
ATOM   7985 N N   . GLU B 1 443 ? 10.979  30.716  41.668 1.00 47.13 ? 443  GLU B N   1 
ATOM   7986 C CA  . GLU B 1 443 ? 12.059  29.781  41.954 1.00 47.42 ? 443  GLU B CA  1 
ATOM   7987 C C   . GLU B 1 443 ? 12.722  29.335  40.653 1.00 46.91 ? 443  GLU B C   1 
ATOM   7988 O O   . GLU B 1 443 ? 13.943  29.240  40.565 1.00 47.96 ? 443  GLU B O   1 
ATOM   7989 C CB  . GLU B 1 443 ? 11.509  28.565  42.711 1.00 47.60 ? 443  GLU B CB  1 
ATOM   7990 C CG  . GLU B 1 443 ? 10.812  28.919  44.014 1.00 50.19 ? 443  GLU B CG  1 
ATOM   7991 C CD  . GLU B 1 443 ? 10.146  27.722  44.680 1.00 51.11 ? 443  GLU B CD  1 
ATOM   7992 O OE1 . GLU B 1 443 ? 9.295   27.079  44.036 1.00 49.50 ? 443  GLU B OE1 1 
ATOM   7993 O OE2 . GLU B 1 443 ? 10.468  27.429  45.852 1.00 53.43 ? 443  GLU B OE2 1 
ATOM   7994 N N   . ALA B 1 444 ? 11.906  29.073  39.639 1.00 46.33 ? 444  ALA B N   1 
ATOM   7995 C CA  . ALA B 1 444 ? 12.412  28.645  38.344 1.00 47.44 ? 444  ALA B CA  1 
ATOM   7996 C C   . ALA B 1 444 ? 13.229  29.747  37.666 1.00 48.08 ? 444  ALA B C   1 
ATOM   7997 O O   . ALA B 1 444 ? 14.334  29.500  37.184 1.00 46.58 ? 444  ALA B O   1 
ATOM   7998 C CB  . ALA B 1 444 ? 11.250  28.223  37.441 1.00 48.08 ? 444  ALA B CB  1 
ATOM   7999 N N   . ARG B 1 445 ? 12.683  30.958  37.627 1.00 48.44 ? 445  ARG B N   1 
ATOM   8000 C CA  . ARG B 1 445 ? 13.381  32.072  36.992 1.00 50.17 ? 445  ARG B CA  1 
ATOM   8001 C C   . ARG B 1 445 ? 14.698  32.373  37.699 1.00 49.89 ? 445  ARG B C   1 
ATOM   8002 O O   . ARG B 1 445 ? 15.670  32.785  37.068 1.00 50.24 ? 445  ARG B O   1 
ATOM   8003 C CB  . ARG B 1 445 ? 12.504  33.324  36.976 1.00 51.22 ? 445  ARG B CB  1 
ATOM   8004 C CG  . ARG B 1 445 ? 13.156  34.508  36.265 1.00 53.30 ? 445  ARG B CG  1 
ATOM   8005 C CD  . ARG B 1 445 ? 12.225  35.702  36.203 1.00 54.83 ? 445  ARG B CD  1 
ATOM   8006 N NE  . ARG B 1 445 ? 11.576  35.938  37.489 1.00 56.89 ? 445  ARG B NE  1 
ATOM   8007 C CZ  . ARG B 1 445 ? 12.221  36.108  38.638 1.00 58.10 ? 445  ARG B CZ  1 
ATOM   8008 N NH1 . ARG B 1 445 ? 13.547  36.074  38.675 1.00 59.88 ? 445  ARG B NH1 1 
ATOM   8009 N NH2 . ARG B 1 445 ? 11.537  36.300  39.757 1.00 57.54 ? 445  ARG B NH2 1 
ATOM   8010 N N   . LYS B 1 446 ? 14.728  32.165  39.009 1.00 50.42 ? 446  LYS B N   1 
ATOM   8011 C CA  . LYS B 1 446 ? 15.942  32.403  39.775 1.00 52.68 ? 446  LYS B CA  1 
ATOM   8012 C C   . LYS B 1 446 ? 17.044  31.494  39.243 1.00 52.68 ? 446  LYS B C   1 
ATOM   8013 O O   . LYS B 1 446 ? 18.134  31.954  38.904 1.00 53.40 ? 446  LYS B O   1 
ATOM   8014 C CB  . LYS B 1 446 ? 15.697  32.118  41.260 1.00 53.95 ? 446  LYS B CB  1 
ATOM   8015 C CG  . LYS B 1 446 ? 16.910  32.341  42.156 1.00 59.02 ? 446  LYS B CG  1 
ATOM   8016 C CD  . LYS B 1 446 ? 18.045  31.368  41.843 1.00 61.84 ? 446  LYS B CD  1 
ATOM   8017 C CE  . LYS B 1 446 ? 19.410  32.019  42.025 1.00 64.20 ? 446  LYS B CE  1 
ATOM   8018 N NZ  . LYS B 1 446 ? 19.448  33.410  41.486 1.00 64.74 ? 446  LYS B NZ  1 
ATOM   8019 N N   . GLU B 1 447 ? 16.752  30.201  39.172 1.00 52.66 ? 447  GLU B N   1 
ATOM   8020 C CA  . GLU B 1 447 ? 17.715  29.225  38.686 1.00 52.17 ? 447  GLU B CA  1 
ATOM   8021 C C   . GLU B 1 447 ? 18.170  29.550  37.267 1.00 51.74 ? 447  GLU B C   1 
ATOM   8022 O O   . GLU B 1 447 ? 19.349  29.412  36.936 1.00 50.05 ? 447  GLU B O   1 
ATOM   8023 C CB  . GLU B 1 447 ? 17.102  27.821  38.719 1.00 54.61 ? 447  GLU B CB  1 
ATOM   8024 C CG  . GLU B 1 447 ? 16.670  27.348  40.109 1.00 57.37 ? 447  GLU B CG  1 
ATOM   8025 C CD  . GLU B 1 447 ? 16.028  25.964  40.086 1.00 59.66 ? 447  GLU B CD  1 
ATOM   8026 O OE1 . GLU B 1 447 ? 15.695  25.442  41.170 1.00 60.96 ? 447  GLU B OE1 1 
ATOM   8027 O OE2 . GLU B 1 447 ? 15.854  25.398  38.982 1.00 60.29 ? 447  GLU B OE2 1 
ATOM   8028 N N   . LEU B 1 448 ? 17.233  29.985  36.429 1.00 50.47 ? 448  LEU B N   1 
ATOM   8029 C CA  . LEU B 1 448 ? 17.551  30.312  35.045 1.00 51.70 ? 448  LEU B CA  1 
ATOM   8030 C C   . LEU B 1 448 ? 18.480  31.513  34.934 1.00 51.58 ? 448  LEU B C   1 
ATOM   8031 O O   . LEU B 1 448 ? 19.343  31.562  34.056 1.00 49.99 ? 448  LEU B O   1 
ATOM   8032 C CB  . LEU B 1 448 ? 16.266  30.578  34.256 1.00 51.93 ? 448  LEU B CB  1 
ATOM   8033 C CG  . LEU B 1 448 ? 15.356  29.358  34.106 1.00 51.87 ? 448  LEU B CG  1 
ATOM   8034 C CD1 . LEU B 1 448 ? 14.114  29.727  33.312 1.00 51.43 ? 448  LEU B CD1 1 
ATOM   8035 C CD2 . LEU B 1 448 ? 16.126  28.246  33.420 1.00 51.07 ? 448  LEU B CD2 1 
ATOM   8036 N N   . GLN B 1 449 ? 18.295  32.481  35.824 1.00 52.32 ? 449  GLN B N   1 
ATOM   8037 C CA  . GLN B 1 449 ? 19.124  33.680  35.823 1.00 54.36 ? 449  GLN B CA  1 
ATOM   8038 C C   . GLN B 1 449 ? 20.514  33.343  36.357 1.00 54.37 ? 449  GLN B C   1 
ATOM   8039 O O   . GLN B 1 449 ? 21.519  33.847  35.856 1.00 52.75 ? 449  GLN B O   1 
ATOM   8040 C CB  . GLN B 1 449 ? 18.475  34.770  36.681 1.00 54.84 ? 449  GLN B CB  1 
ATOM   8041 C CG  . GLN B 1 449 ? 19.007  36.168  36.418 1.00 58.65 ? 449  GLN B CG  1 
ATOM   8042 C CD  . GLN B 1 449 ? 18.101  37.249  36.978 1.00 61.06 ? 449  GLN B CD  1 
ATOM   8043 O OE1 . GLN B 1 449 ? 18.437  38.437  36.948 1.00 62.12 ? 449  GLN B OE1 1 
ATOM   8044 N NE2 . GLN B 1 449 ? 16.942  36.844  37.491 1.00 61.86 ? 449  GLN B NE2 1 
ATOM   8045 N N   . ALA B 1 450 ? 20.562  32.484  37.372 1.00 54.23 ? 450  ALA B N   1 
ATOM   8046 C CA  . ALA B 1 450 ? 21.828  32.070  37.964 1.00 54.82 ? 450  ALA B CA  1 
ATOM   8047 C C   . ALA B 1 450 ? 22.602  31.245  36.940 1.00 55.65 ? 450  ALA B C   1 
ATOM   8048 O O   . ALA B 1 450 ? 23.833  31.202  36.959 1.00 55.17 ? 450  ALA B O   1 
ATOM   8049 C CB  . ALA B 1 450 ? 21.576  31.249  39.227 1.00 54.57 ? 450  ALA B CB  1 
ATOM   8050 N N   . ALA B 1 451 ? 21.867  30.591  36.045 1.00 56.13 ? 451  ALA B N   1 
ATOM   8051 C CA  . ALA B 1 451 ? 22.473  29.776  35.000 1.00 56.56 ? 451  ALA B CA  1 
ATOM   8052 C C   . ALA B 1 451 ? 23.027  30.679  33.895 1.00 57.13 ? 451  ALA B C   1 
ATOM   8053 O O   . ALA B 1 451 ? 23.655  30.207  32.945 1.00 55.79 ? 451  ALA B O   1 
ATOM   8054 C CB  . ALA B 1 451 ? 21.438  28.810  34.427 1.00 57.32 ? 451  ALA B CB  1 
ATOM   8055 N N   . GLY B 1 452 ? 22.781  31.980  34.029 1.00 57.59 ? 452  GLY B N   1 
ATOM   8056 C CA  . GLY B 1 452 ? 23.271  32.939  33.056 1.00 58.75 ? 452  GLY B CA  1 
ATOM   8057 C C   . GLY B 1 452 ? 22.503  32.993  31.749 1.00 60.45 ? 452  GLY B C   1 
ATOM   8058 O O   . GLY B 1 452 ? 23.065  33.356  30.717 1.00 60.26 ? 452  GLY B O   1 
ATOM   8059 N N   . LYS B 1 453 ? 21.221  32.643  31.780 1.00 61.08 ? 453  LYS B N   1 
ATOM   8060 C CA  . LYS B 1 453 ? 20.411  32.668  30.565 1.00 62.99 ? 453  LYS B CA  1 
ATOM   8061 C C   . LYS B 1 453 ? 20.022  34.076  30.131 1.00 63.03 ? 453  LYS B C   1 
ATOM   8062 O O   . LYS B 1 453 ? 19.659  34.917  30.953 1.00 62.45 ? 453  LYS B O   1 
ATOM   8063 C CB  . LYS B 1 453 ? 19.135  31.840  30.742 1.00 64.10 ? 453  LYS B CB  1 
ATOM   8064 C CG  . LYS B 1 453 ? 19.351  30.343  30.696 1.00 66.08 ? 453  LYS B CG  1 
ATOM   8065 C CD  . LYS B 1 453 ? 18.056  29.628  30.367 1.00 68.23 ? 453  LYS B CD  1 
ATOM   8066 C CE  . LYS B 1 453 ? 18.269  28.130  30.252 1.00 69.78 ? 453  LYS B CE  1 
ATOM   8067 N NZ  . LYS B 1 453 ? 18.726  27.544  31.541 1.00 71.15 ? 453  LYS B NZ  1 
ATOM   8068 N N   . SER B 1 454 ? 20.095  34.320  28.828 1.00 63.96 ? 454  SER B N   1 
ATOM   8069 C CA  . SER B 1 454 ? 19.733  35.618  28.276 1.00 65.84 ? 454  SER B CA  1 
ATOM   8070 C C   . SER B 1 454 ? 18.249  35.862  28.526 1.00 66.58 ? 454  SER B C   1 
ATOM   8071 O O   . SER B 1 454 ? 17.477  34.918  28.693 1.00 66.71 ? 454  SER B O   1 
ATOM   8072 C CB  . SER B 1 454 ? 20.015  35.649  26.771 1.00 66.01 ? 454  SER B CB  1 
ATOM   8073 O OG  . SER B 1 454 ? 19.282  34.644  26.091 1.00 66.27 ? 454  SER B OG  1 
ATOM   8074 N N   . PRO B 1 455 ? 17.829  37.136  28.564 1.00 67.42 ? 455  PRO B N   1 
ATOM   8075 C CA  . PRO B 1 455 ? 16.414  37.432  28.799 1.00 67.99 ? 455  PRO B CA  1 
ATOM   8076 C C   . PRO B 1 455 ? 15.546  36.673  27.801 1.00 68.37 ? 455  PRO B C   1 
ATOM   8077 O O   . PRO B 1 455 ? 14.418  36.286  28.104 1.00 67.54 ? 455  PRO B O   1 
ATOM   8078 C CB  . PRO B 1 455 ? 16.344  38.944  28.599 1.00 68.22 ? 455  PRO B CB  1 
ATOM   8079 C CG  . PRO B 1 455 ? 17.701  39.402  29.050 1.00 67.52 ? 455  PRO B CG  1 
ATOM   8080 C CD  . PRO B 1 455 ? 18.606  38.379  28.405 1.00 68.19 ? 455  PRO B CD  1 
ATOM   8081 N N   . GLU B 1 456 ? 16.097  36.459  26.610 1.00 69.06 ? 456  GLU B N   1 
ATOM   8082 C CA  . GLU B 1 456 ? 15.400  35.751  25.546 1.00 70.75 ? 456  GLU B CA  1 
ATOM   8083 C C   . GLU B 1 456 ? 15.224  34.267  25.851 1.00 70.47 ? 456  GLU B C   1 
ATOM   8084 O O   . GLU B 1 456 ? 14.130  33.722  25.705 1.00 70.29 ? 456  GLU B O   1 
ATOM   8085 C CB  . GLU B 1 456 ? 16.160  35.919  24.227 1.00 72.47 ? 456  GLU B CB  1 
ATOM   8086 C CG  . GLU B 1 456 ? 15.473  36.837  23.229 1.00 75.40 ? 456  GLU B CG  1 
ATOM   8087 C CD  . GLU B 1 456 ? 14.216  36.223  22.642 1.00 77.04 ? 456  GLU B CD  1 
ATOM   8088 O OE1 . GLU B 1 456 ? 13.498  36.927  21.900 1.00 78.89 ? 456  GLU B OE1 1 
ATOM   8089 O OE2 . GLU B 1 456 ? 13.949  35.034  22.914 1.00 78.63 ? 456  GLU B OE2 1 
ATOM   8090 N N   . ASP B 1 457 ? 16.304  33.618  26.275 1.00 70.03 ? 457  ASP B N   1 
ATOM   8091 C CA  . ASP B 1 457 ? 16.269  32.195  26.590 1.00 69.71 ? 457  ASP B CA  1 
ATOM   8092 C C   . ASP B 1 457 ? 15.471  31.884  27.852 1.00 69.10 ? 457  ASP B C   1 
ATOM   8093 O O   . ASP B 1 457 ? 14.724  30.904  27.898 1.00 69.41 ? 457  ASP B O   1 
ATOM   8094 C CB  . ASP B 1 457 ? 17.695  31.658  26.730 1.00 70.67 ? 457  ASP B CB  1 
ATOM   8095 C CG  . ASP B 1 457 ? 18.438  31.627  25.406 1.00 71.66 ? 457  ASP B CG  1 
ATOM   8096 O OD1 . ASP B 1 457 ? 19.651  31.328  25.411 1.00 72.18 ? 457  ASP B OD1 1 
ATOM   8097 O OD2 . ASP B 1 457 ? 17.810  31.895  24.359 1.00 72.43 ? 457  ASP B OD2 1 
ATOM   8098 N N   . LEU B 1 458 ? 15.627  32.715  28.876 1.00 68.03 ? 458  LEU B N   1 
ATOM   8099 C CA  . LEU B 1 458 ? 14.907  32.504  30.124 1.00 67.28 ? 458  LEU B CA  1 
ATOM   8100 C C   . LEU B 1 458 ? 13.406  32.652  29.896 1.00 67.04 ? 458  LEU B C   1 
ATOM   8101 O O   . LEU B 1 458 ? 12.615  31.845  30.376 1.00 66.79 ? 458  LEU B O   1 
ATOM   8102 C CB  . LEU B 1 458 ? 15.385  33.503  31.186 1.00 66.96 ? 458  LEU B CB  1 
ATOM   8103 C CG  . LEU B 1 458 ? 14.807  33.391  32.604 1.00 67.15 ? 458  LEU B CG  1 
ATOM   8104 C CD1 . LEU B 1 458 ? 15.729  34.087  33.587 1.00 65.94 ? 458  LEU B CD1 1 
ATOM   8105 C CD2 . LEU B 1 458 ? 13.412  33.997  32.657 1.00 67.52 ? 458  LEU B CD2 1 
ATOM   8106 N N   . MET B 1 459 ? 13.021  33.681  29.149 1.00 66.83 ? 459  MET B N   1 
ATOM   8107 C CA  . MET B 1 459 ? 11.615  33.947  28.858 1.00 66.70 ? 459  MET B CA  1 
ATOM   8108 C C   . MET B 1 459 ? 10.879  32.797  28.162 1.00 65.45 ? 459  MET B C   1 
ATOM   8109 O O   . MET B 1 459 ? 9.747   32.471  28.520 1.00 64.47 ? 459  MET B O   1 
ATOM   8110 C CB  . MET B 1 459 ? 11.505  35.223  28.013 1.00 68.72 ? 459  MET B CB  1 
ATOM   8111 C CG  . MET B 1 459 ? 10.102  35.571  27.518 1.00 71.79 ? 459  MET B CG  1 
ATOM   8112 S SD  . MET B 1 459 ? 9.569   34.626  26.064 1.00 75.80 ? 459  MET B SD  1 
ATOM   8113 C CE  . MET B 1 459 ? 7.787   34.917  26.099 1.00 74.67 ? 459  MET B CE  1 
ATOM   8114 N N   . LYS B 1 460 ? 11.521  32.182  27.173 1.00 63.99 ? 460  LYS B N   1 
ATOM   8115 C CA  . LYS B 1 460 ? 10.900  31.097  26.419 1.00 63.47 ? 460  LYS B CA  1 
ATOM   8116 C C   . LYS B 1 460 ? 11.004  29.725  27.081 1.00 62.49 ? 460  LYS B C   1 
ATOM   8117 O O   . LYS B 1 460 ? 10.238  28.814  26.763 1.00 63.21 ? 460  LYS B O   1 
ATOM   8118 C CB  . LYS B 1 460 ? 11.512  31.029  25.015 1.00 63.62 ? 460  LYS B CB  1 
ATOM   8119 C CG  . LYS B 1 460 ? 12.960  30.561  24.978 1.00 63.85 ? 460  LYS B CG  1 
ATOM   8120 C CD  . LYS B 1 460 ? 13.068  29.153  24.406 1.00 64.64 ? 460  LYS B CD  1 
ATOM   8121 C CE  . LYS B 1 460 ? 14.513  28.674  24.369 1.00 65.48 ? 460  LYS B CE  1 
ATOM   8122 N NZ  . LYS B 1 460 ? 14.643  27.336  23.727 1.00 65.44 ? 460  LYS B NZ  1 
ATOM   8123 N N   . LEU B 1 461 ? 11.942  29.583  28.009 1.00 60.70 ? 461  LEU B N   1 
ATOM   8124 C CA  . LEU B 1 461 ? 12.158  28.313  28.688 1.00 58.99 ? 461  LEU B CA  1 
ATOM   8125 C C   . LEU B 1 461 ? 11.602  28.261  30.116 1.00 58.11 ? 461  LEU B C   1 
ATOM   8126 O O   . LEU B 1 461 ? 11.333  27.183  30.650 1.00 57.58 ? 461  LEU B O   1 
ATOM   8127 C CB  . LEU B 1 461 ? 13.660  28.011  28.674 1.00 60.37 ? 461  LEU B CB  1 
ATOM   8128 C CG  . LEU B 1 461 ? 14.240  26.862  29.492 1.00 61.35 ? 461  LEU B CG  1 
ATOM   8129 C CD1 . LEU B 1 461 ? 15.611  26.488  28.959 1.00 62.06 ? 461  LEU B CD1 1 
ATOM   8130 C CD2 . LEU B 1 461 ? 14.331  27.285  30.938 1.00 62.12 ? 461  LEU B CD2 1 
ATOM   8131 N N   . LEU B 1 462 ? 11.413  29.430  30.721 1.00 56.01 ? 462  LEU B N   1 
ATOM   8132 C CA  . LEU B 1 462 ? 10.907  29.541  32.089 1.00 53.92 ? 462  LEU B CA  1 
ATOM   8133 C C   . LEU B 1 462 ? 9.598   28.797  32.416 1.00 52.26 ? 462  LEU B C   1 
ATOM   8134 O O   . LEU B 1 462 ? 9.547   28.022  33.369 1.00 50.50 ? 462  LEU B O   1 
ATOM   8135 C CB  . LEU B 1 462 ? 10.772  31.028  32.454 1.00 53.08 ? 462  LEU B CB  1 
ATOM   8136 C CG  . LEU B 1 462 ? 10.252  31.472  33.825 1.00 52.28 ? 462  LEU B CG  1 
ATOM   8137 C CD1 . LEU B 1 462 ? 8.737   31.522  33.802 1.00 54.83 ? 462  LEU B CD1 1 
ATOM   8138 C CD2 . LEU B 1 462 ? 10.767  30.548  34.913 1.00 51.28 ? 462  LEU B CD2 1 
ATOM   8139 N N   . PRO B 1 463 ? 8.528   29.026  31.637 1.00 51.40 ? 463  PRO B N   1 
ATOM   8140 C CA  . PRO B 1 463 ? 7.241   28.360  31.885 1.00 51.40 ? 463  PRO B CA  1 
ATOM   8141 C C   . PRO B 1 463 ? 7.343   26.836  31.924 1.00 50.14 ? 463  PRO B C   1 
ATOM   8142 O O   . PRO B 1 463 ? 6.703   26.173  32.743 1.00 49.47 ? 463  PRO B O   1 
ATOM   8143 C CB  . PRO B 1 463 ? 6.375   28.837  30.717 1.00 52.43 ? 463  PRO B CB  1 
ATOM   8144 C CG  . PRO B 1 463 ? 6.954   30.175  30.385 1.00 54.49 ? 463  PRO B CG  1 
ATOM   8145 C CD  . PRO B 1 463 ? 8.436   29.908  30.461 1.00 52.75 ? 463  PRO B CD  1 
ATOM   8146 N N   . HIS B 1 464 ? 8.156   26.296  31.024 1.00 49.19 ? 464  HIS B N   1 
ATOM   8147 C CA  . HIS B 1 464 ? 8.364   24.858  30.900 1.00 48.31 ? 464  HIS B CA  1 
ATOM   8148 C C   . HIS B 1 464 ? 9.071   24.214  32.091 1.00 47.65 ? 464  HIS B C   1 
ATOM   8149 O O   . HIS B 1 464 ? 9.006   22.997  32.259 1.00 47.25 ? 464  HIS B O   1 
ATOM   8150 C CB  . HIS B 1 464 ? 9.169   24.568  29.633 1.00 47.47 ? 464  HIS B CB  1 
ATOM   8151 C CG  . HIS B 1 464 ? 8.514   25.048  28.378 1.00 49.02 ? 464  HIS B CG  1 
ATOM   8152 N ND1 . HIS B 1 464 ? 7.511   24.347  27.746 1.00 47.96 ? 464  HIS B ND1 1 
ATOM   8153 C CD2 . HIS B 1 464 ? 8.705   26.174  27.648 1.00 48.62 ? 464  HIS B CD2 1 
ATOM   8154 C CE1 . HIS B 1 464 ? 7.112   25.019  26.681 1.00 50.36 ? 464  HIS B CE1 1 
ATOM   8155 N NE2 . HIS B 1 464 ? 7.819   26.131  26.599 1.00 49.33 ? 464  HIS B NE2 1 
ATOM   8156 N N   . LYS B 1 465 ? 9.748   25.016  32.911 1.00 45.49 ? 465  LYS B N   1 
ATOM   8157 C CA  . LYS B 1 465 ? 10.471  24.482  34.062 1.00 44.12 ? 465  LYS B CA  1 
ATOM   8158 C C   . LYS B 1 465 ? 9.767   24.726  35.390 1.00 42.18 ? 465  LYS B C   1 
ATOM   8159 O O   . LYS B 1 465 ? 10.341  24.522  36.461 1.00 41.46 ? 465  LYS B O   1 
ATOM   8160 C CB  . LYS B 1 465 ? 11.891  25.057  34.111 1.00 46.47 ? 465  LYS B CB  1 
ATOM   8161 C CG  . LYS B 1 465 ? 12.702  24.766  32.857 1.00 49.01 ? 465  LYS B CG  1 
ATOM   8162 C CD  . LYS B 1 465 ? 14.187  25.002  33.064 1.00 51.58 ? 465  LYS B CD  1 
ATOM   8163 C CE  . LYS B 1 465 ? 14.792  23.987  34.009 1.00 52.22 ? 465  LYS B CE  1 
ATOM   8164 N NZ  . LYS B 1 465 ? 16.269  24.138  34.083 1.00 53.33 ? 465  LYS B NZ  1 
ATOM   8165 N N   . VAL B 1 466 ? 8.517   25.163  35.314 1.00 40.46 ? 466  VAL B N   1 
ATOM   8166 C CA  . VAL B 1 466 ? 7.726   25.411  36.505 1.00 39.38 ? 466  VAL B CA  1 
ATOM   8167 C C   . VAL B 1 466 ? 6.935   24.143  36.830 1.00 37.78 ? 466  VAL B C   1 
ATOM   8168 O O   . VAL B 1 466 ? 6.481   23.448  35.927 1.00 36.97 ? 466  VAL B O   1 
ATOM   8169 C CB  . VAL B 1 466 ? 6.736   26.582  36.281 1.00 38.96 ? 466  VAL B CB  1 
ATOM   8170 C CG1 . VAL B 1 466 ? 5.744   26.661  37.424 1.00 41.10 ? 466  VAL B CG1 1 
ATOM   8171 C CG2 . VAL B 1 466 ? 7.507   27.902  36.175 1.00 41.79 ? 466  VAL B CG2 1 
ATOM   8172 N N   . PHE B 1 467 ? 6.799   23.840  38.116 1.00 38.00 ? 467  PHE B N   1 
ATOM   8173 C CA  . PHE B 1 467 ? 6.038   22.672  38.572 1.00 39.33 ? 467  PHE B CA  1 
ATOM   8174 C C   . PHE B 1 467 ? 4.971   23.148  39.546 1.00 37.59 ? 467  PHE B C   1 
ATOM   8175 O O   . PHE B 1 467 ? 5.285   23.665  40.616 1.00 38.37 ? 467  PHE B O   1 
ATOM   8176 C CB  . PHE B 1 467 ? 6.951   21.658  39.263 1.00 38.93 ? 467  PHE B CB  1 
ATOM   8177 C CG  . PHE B 1 467 ? 7.922   20.986  38.333 1.00 42.98 ? 467  PHE B CG  1 
ATOM   8178 C CD1 . PHE B 1 467 ? 8.914   21.720  37.687 1.00 42.30 ? 467  PHE B CD1 1 
ATOM   8179 C CD2 . PHE B 1 467 ? 7.848   19.616  38.106 1.00 41.00 ? 467  PHE B CD2 1 
ATOM   8180 C CE1 . PHE B 1 467 ? 9.820   21.099  36.829 1.00 44.46 ? 467  PHE B CE1 1 
ATOM   8181 C CE2 . PHE B 1 467 ? 8.749   18.986  37.251 1.00 44.69 ? 467  PHE B CE2 1 
ATOM   8182 C CZ  . PHE B 1 467 ? 9.736   19.728  36.611 1.00 45.40 ? 467  PHE B CZ  1 
ATOM   8183 N N   . GLU B 1 468 ? 3.709   22.964  39.178 1.00 36.72 ? 468  GLU B N   1 
ATOM   8184 C CA  . GLU B 1 468 ? 2.603   23.412  40.011 1.00 36.88 ? 468  GLU B CA  1 
ATOM   8185 C C   . GLU B 1 468 ? 2.427   22.644  41.321 1.00 37.01 ? 468  GLU B C   1 
ATOM   8186 O O   . GLU B 1 468 ? 1.738   23.109  42.229 1.00 36.24 ? 468  GLU B O   1 
ATOM   8187 C CB  . GLU B 1 468 ? 1.306   23.381  39.199 1.00 39.72 ? 468  GLU B CB  1 
ATOM   8188 C CG  . GLU B 1 468 ? 1.339   24.299  37.980 1.00 42.68 ? 468  GLU B CG  1 
ATOM   8189 C CD  . GLU B 1 468 ? 0.006   24.374  37.263 1.00 45.54 ? 468  GLU B CD  1 
ATOM   8190 O OE1 . GLU B 1 468 ? -0.569  23.310  36.954 1.00 47.45 ? 468  GLU B OE1 1 
ATOM   8191 O OE2 . GLU B 1 468 ? -0.465  25.499  36.997 1.00 48.43 ? 468  GLU B OE2 1 
ATOM   8192 N N   . GLY B 1 469 ? 3.060   21.480  41.425 1.00 37.35 ? 469  GLY B N   1 
ATOM   8193 C CA  . GLY B 1 469 ? 2.951   20.689  42.638 1.00 34.67 ? 469  GLY B CA  1 
ATOM   8194 C C   . GLY B 1 469 ? 1.516   20.386  43.035 1.00 35.03 ? 469  GLY B C   1 
ATOM   8195 O O   . GLY B 1 469 ? 0.644   20.266  42.179 1.00 35.95 ? 469  GLY B O   1 
ATOM   8196 N N   . ASN B 1 470 ? 1.284   20.257  44.340 1.00 35.34 ? 470  ASN B N   1 
ATOM   8197 C CA  . ASN B 1 470 ? -0.037  19.976  44.900 1.00 36.51 ? 470  ASN B CA  1 
ATOM   8198 C C   . ASN B 1 470 ? -0.591  18.628  44.432 1.00 37.47 ? 470  ASN B C   1 
ATOM   8199 O O   . ASN B 1 470 ? -1.808  18.436  44.328 1.00 35.99 ? 470  ASN B O   1 
ATOM   8200 C CB  . ASN B 1 470 ? -1.011  21.108  44.545 1.00 38.20 ? 470  ASN B CB  1 
ATOM   8201 C CG  . ASN B 1 470 ? -2.198  21.164  45.478 1.00 40.13 ? 470  ASN B CG  1 
ATOM   8202 O OD1 . ASN B 1 470 ? -2.067  20.925  46.682 1.00 43.07 ? 470  ASN B OD1 1 
ATOM   8203 N ND2 . ASN B 1 470 ? -3.364  21.501  44.938 1.00 41.18 ? 470  ASN B ND2 1 
ATOM   8204 N N   . ARG B 1 471 ? 0.320   17.701  44.156 1.00 36.21 ? 471  ARG B N   1 
ATOM   8205 C CA  . ARG B 1 471 ? -0.038  16.361  43.712 1.00 36.85 ? 471  ARG B CA  1 
ATOM   8206 C C   . ARG B 1 471 ? 0.142   15.432  44.911 1.00 36.09 ? 471  ARG B C   1 
ATOM   8207 O O   . ARG B 1 471 ? 1.261   15.197  45.367 1.00 38.17 ? 471  ARG B O   1 
ATOM   8208 C CB  . ARG B 1 471 ? 0.849   15.960  42.529 1.00 36.71 ? 471  ARG B CB  1 
ATOM   8209 C CG  . ARG B 1 471 ? 0.445   16.661  41.220 1.00 37.63 ? 471  ARG B CG  1 
ATOM   8210 C CD  . ARG B 1 471 ? 1.633   16.923  40.297 1.00 40.11 ? 471  ARG B CD  1 
ATOM   8211 N NE  . ARG B 1 471 ? 1.224   17.234  38.923 1.00 40.17 ? 471  ARG B NE  1 
ATOM   8212 C CZ  . ARG B 1 471 ? 0.674   18.378  38.522 1.00 40.65 ? 471  ARG B CZ  1 
ATOM   8213 N NH1 . ARG B 1 471 ? 0.453   19.362  39.386 1.00 39.42 ? 471  ARG B NH1 1 
ATOM   8214 N NH2 . ARG B 1 471 ? 0.341   18.535  37.245 1.00 38.63 ? 471  ARG B NH2 1 
ATOM   8215 N N   . PRO B 1 472 ? -0.974  14.892  45.431 1.00 34.62 ? 472  PRO B N   1 
ATOM   8216 C CA  . PRO B 1 472 ? -1.074  13.992  46.582 1.00 34.35 ? 472  PRO B CA  1 
ATOM   8217 C C   . PRO B 1 472 ? -0.437  12.622  46.458 1.00 33.12 ? 472  PRO B C   1 
ATOM   8218 O O   . PRO B 1 472 ? -0.466  11.997  45.399 1.00 34.00 ? 472  PRO B O   1 
ATOM   8219 C CB  . PRO B 1 472 ? -2.580  13.896  46.799 1.00 33.88 ? 472  PRO B CB  1 
ATOM   8220 C CG  . PRO B 1 472 ? -3.081  13.869  45.400 1.00 33.28 ? 472  PRO B CG  1 
ATOM   8221 C CD  . PRO B 1 472 ? -2.286  15.003  44.763 1.00 34.73 ? 472  PRO B CD  1 
ATOM   8222 N N   . THR B 1 473 ? 0.115   12.150  47.571 1.00 34.55 ? 473  THR B N   1 
ATOM   8223 C CA  . THR B 1 473 ? 0.763   10.845  47.621 1.00 31.81 ? 473  THR B CA  1 
ATOM   8224 C C   . THR B 1 473 ? 0.640   10.226  49.008 1.00 31.91 ? 473  THR B C   1 
ATOM   8225 O O   . THR B 1 473 ? 0.351   10.918  49.985 1.00 31.34 ? 473  THR B O   1 
ATOM   8226 C CB  . THR B 1 473 ? 2.285   10.949  47.306 1.00 31.79 ? 473  THR B CB  1 
ATOM   8227 O OG1 . THR B 1 473 ? 2.925   11.800  48.272 1.00 29.94 ? 473  THR B OG1 1 
ATOM   8228 C CG2 . THR B 1 473 ? 2.516   11.514  45.924 1.00 30.16 ? 473  THR B CG2 1 
ATOM   8229 N N   . ASN B 1 474 ? 0.811   8.909   49.080 1.00 30.30 ? 474  ASN B N   1 
ATOM   8230 C CA  . ASN B 1 474 ? 0.841   8.218   50.366 1.00 30.58 ? 474  ASN B CA  1 
ATOM   8231 C C   . ASN B 1 474 ? 2.245   7.626   50.371 1.00 30.27 ? 474  ASN B C   1 
ATOM   8232 O O   . ASN B 1 474 ? 2.762   7.242   49.319 1.00 26.62 ? 474  ASN B O   1 
ATOM   8233 C CB  . ASN B 1 474 ? -0.149  7.048   50.469 1.00 30.77 ? 474  ASN B CB  1 
ATOM   8234 C CG  . ASN B 1 474 ? -1.584  7.489   50.751 1.00 31.76 ? 474  ASN B CG  1 
ATOM   8235 O OD1 . ASN B 1 474 ? -1.842  8.359   51.590 1.00 30.94 ? 474  ASN B OD1 1 
ATOM   8236 N ND2 . ASN B 1 474 ? -2.525  6.858   50.066 1.00 27.33 ? 474  ASN B ND2 1 
ATOM   8237 N N   . SER B 1 475 ? 2.870   7.576   51.540 1.00 29.36 ? 475  SER B N   1 
ATOM   8238 C CA  . SER B 1 475 ? 4.193   6.984   51.653 1.00 29.77 ? 475  SER B CA  1 
ATOM   8239 C C   . SER B 1 475 ? 4.030   5.886   52.673 1.00 30.60 ? 475  SER B C   1 
ATOM   8240 O O   . SER B 1 475 ? 3.657   6.141   53.813 1.00 31.70 ? 475  SER B O   1 
ATOM   8241 C CB  . SER B 1 475 ? 5.231   8.003   52.135 1.00 30.37 ? 475  SER B CB  1 
ATOM   8242 O OG  . SER B 1 475 ? 5.690   8.801   51.060 1.00 28.69 ? 475  SER B OG  1 
ATOM   8243 N N   . ILE B 1 476 ? 4.301   4.660   52.249 1.00 31.23 ? 476  ILE B N   1 
ATOM   8244 C CA  . ILE B 1 476 ? 4.173   3.506   53.118 1.00 29.05 ? 476  ILE B CA  1 
ATOM   8245 C C   . ILE B 1 476 ? 5.566   2.929   53.272 1.00 29.58 ? 476  ILE B C   1 
ATOM   8246 O O   . ILE B 1 476 ? 6.125   2.375   52.329 1.00 28.92 ? 476  ILE B O   1 
ATOM   8247 C CB  . ILE B 1 476 ? 3.235   2.467   52.486 1.00 31.05 ? 476  ILE B CB  1 
ATOM   8248 C CG1 . ILE B 1 476 ? 1.849   3.097   52.287 1.00 31.74 ? 476  ILE B CG1 1 
ATOM   8249 C CG2 . ILE B 1 476 ? 3.155   1.222   53.362 1.00 26.82 ? 476  ILE B CG2 1 
ATOM   8250 C CD1 . ILE B 1 476 ? 0.852   2.200   51.587 1.00 34.47 ? 476  ILE B CD1 1 
ATOM   8251 N N   . VAL B 1 477 ? 6.132   3.088   54.462 1.00 27.68 ? 477  VAL B N   1 
ATOM   8252 C CA  . VAL B 1 477 ? 7.478   2.614   54.735 1.00 29.39 ? 477  VAL B CA  1 
ATOM   8253 C C   . VAL B 1 477 ? 7.446   1.525   55.806 1.00 29.41 ? 477  VAL B C   1 
ATOM   8254 O O   . VAL B 1 477 ? 6.836   1.692   56.863 1.00 29.47 ? 477  VAL B O   1 
ATOM   8255 C CB  . VAL B 1 477 ? 8.389   3.784   55.208 1.00 30.62 ? 477  VAL B CB  1 
ATOM   8256 C CG1 . VAL B 1 477 ? 9.812   3.301   55.418 1.00 30.96 ? 477  VAL B CG1 1 
ATOM   8257 C CG2 . VAL B 1 477 ? 8.364   4.910   54.178 1.00 32.81 ? 477  VAL B CG2 1 
ATOM   8258 N N   . PHE B 1 478 ? 8.099   0.406   55.514 1.00 29.82 ? 478  PHE B N   1 
ATOM   8259 C CA  . PHE B 1 478 ? 8.165   -0.713  56.446 1.00 31.36 ? 478  PHE B CA  1 
ATOM   8260 C C   . PHE B 1 478 ? 9.614   -1.106  56.705 1.00 31.11 ? 478  PHE B C   1 
ATOM   8261 O O   . PHE B 1 478 ? 10.481  -0.897  55.865 1.00 30.80 ? 478  PHE B O   1 
ATOM   8262 C CB  . PHE B 1 478 ? 7.376   -1.903  55.901 1.00 30.00 ? 478  PHE B CB  1 
ATOM   8263 C CG  . PHE B 1 478 ? 7.389   -2.003  54.404 1.00 31.60 ? 478  PHE B CG  1 
ATOM   8264 C CD1 . PHE B 1 478 ? 8.289   -2.842  53.751 1.00 28.36 ? 478  PHE B CD1 1 
ATOM   8265 C CD2 . PHE B 1 478 ? 6.506   -1.236  53.642 1.00 29.60 ? 478  PHE B CD2 1 
ATOM   8266 C CE1 . PHE B 1 478 ? 8.315   -2.916  52.362 1.00 28.92 ? 478  PHE B CE1 1 
ATOM   8267 C CE2 . PHE B 1 478 ? 6.522   -1.303  52.253 1.00 32.15 ? 478  PHE B CE2 1 
ATOM   8268 C CZ  . PHE B 1 478 ? 7.431   -2.146  51.609 1.00 31.40 ? 478  PHE B CZ  1 
ATOM   8269 N N   . THR B 1 479 ? 9.863   -1.678  57.879 1.00 31.56 ? 479  THR B N   1 
ATOM   8270 C CA  . THR B 1 479 ? 11.211  -2.064  58.282 1.00 32.95 ? 479  THR B CA  1 
ATOM   8271 C C   . THR B 1 479 ? 11.967  -2.902  57.262 1.00 33.61 ? 479  THR B C   1 
ATOM   8272 O O   . THR B 1 479 ? 13.088  -2.562  56.879 1.00 32.80 ? 479  THR B O   1 
ATOM   8273 C CB  . THR B 1 479 ? 11.177  -2.810  59.619 1.00 32.18 ? 479  THR B CB  1 
ATOM   8274 O OG1 . THR B 1 479 ? 10.484  -2.005  60.582 1.00 32.00 ? 479  THR B OG1 1 
ATOM   8275 C CG2 . THR B 1 479 ? 12.597  -3.089  60.116 1.00 31.55 ? 479  THR B CG2 1 
ATOM   8276 N N   . LYS B 1 480 ? 11.355  -3.994  56.818 1.00 33.75 ? 480  LYS B N   1 
ATOM   8277 C CA  . LYS B 1 480 ? 11.993  -4.867  55.844 1.00 33.76 ? 480  LYS B CA  1 
ATOM   8278 C C   . LYS B 1 480 ? 10.919  -5.682  55.125 1.00 32.60 ? 480  LYS B C   1 
ATOM   8279 O O   . LYS B 1 480 ? 9.867   -5.950  55.693 1.00 30.76 ? 480  LYS B O   1 
ATOM   8280 C CB  . LYS B 1 480 ? 12.968  -5.802  56.566 1.00 33.51 ? 480  LYS B CB  1 
ATOM   8281 C CG  . LYS B 1 480 ? 13.881  -6.585  55.656 1.00 34.17 ? 480  LYS B CG  1 
ATOM   8282 C CD  . LYS B 1 480 ? 14.906  -7.354  56.473 1.00 36.96 ? 480  LYS B CD  1 
ATOM   8283 C CE  . LYS B 1 480 ? 15.955  -8.014  55.592 1.00 39.12 ? 480  LYS B CE  1 
ATOM   8284 N NZ  . LYS B 1 480 ? 17.010  -8.690  56.418 1.00 40.04 ? 480  LYS B NZ  1 
ATOM   8285 N N   . LEU B 1 481 ? 11.176  -6.068  53.879 1.00 31.11 ? 481  LEU B N   1 
ATOM   8286 C CA  . LEU B 1 481 ? 10.194  -6.855  53.142 1.00 31.79 ? 481  LEU B CA  1 
ATOM   8287 C C   . LEU B 1 481 ? 10.393  -8.342  53.424 1.00 30.80 ? 481  LEU B C   1 
ATOM   8288 O O   . LEU B 1 481 ? 11.102  -9.037  52.698 1.00 32.93 ? 481  LEU B O   1 
ATOM   8289 C CB  . LEU B 1 481 ? 10.300  -6.609  51.638 1.00 31.12 ? 481  LEU B CB  1 
ATOM   8290 C CG  . LEU B 1 481 ? 9.223   -7.347  50.831 1.00 31.36 ? 481  LEU B CG  1 
ATOM   8291 C CD1 . LEU B 1 481 ? 7.836   -6.807  51.187 1.00 31.58 ? 481  LEU B CD1 1 
ATOM   8292 C CD2 . LEU B 1 481 ? 9.488   -7.170  49.349 1.00 32.45 ? 481  LEU B CD2 1 
ATOM   8293 N N   . THR B 1 482 ? 9.761   -8.815  54.488 1.00 32.19 ? 482  THR B N   1 
ATOM   8294 C CA  . THR B 1 482 ? 9.853   -10.217 54.883 1.00 32.12 ? 482  THR B CA  1 
ATOM   8295 C C   . THR B 1 482 ? 8.553   -10.935 54.526 1.00 32.48 ? 482  THR B C   1 
ATOM   8296 O O   . THR B 1 482 ? 7.573   -10.302 54.124 1.00 33.97 ? 482  THR B O   1 
ATOM   8297 C CB  . THR B 1 482 ? 10.055  -10.330 56.398 1.00 31.65 ? 482  THR B CB  1 
ATOM   8298 O OG1 . THR B 1 482 ? 8.898   -9.799  57.060 1.00 32.41 ? 482  THR B OG1 1 
ATOM   8299 C CG2 . THR B 1 482 ? 11.296  -9.538  56.841 1.00 30.37 ? 482  THR B CG2 1 
ATOM   8300 N N   . PRO B 1 483 ? 8.532   -12.273 54.640 1.00 32.95 ? 483  PRO B N   1 
ATOM   8301 C CA  . PRO B 1 483 ? 7.306   -13.006 54.323 1.00 31.86 ? 483  PRO B CA  1 
ATOM   8302 C C   . PRO B 1 483 ? 6.124   -12.461 55.137 1.00 32.51 ? 483  PRO B C   1 
ATOM   8303 O O   . PRO B 1 483 ? 5.004   -12.346 54.629 1.00 27.59 ? 483  PRO B O   1 
ATOM   8304 C CB  . PRO B 1 483 ? 7.667   -14.437 54.707 1.00 33.84 ? 483  PRO B CB  1 
ATOM   8305 C CG  . PRO B 1 483 ? 9.124   -14.519 54.309 1.00 32.21 ? 483  PRO B CG  1 
ATOM   8306 C CD  . PRO B 1 483 ? 9.666   -13.201 54.845 1.00 32.97 ? 483  PRO B CD  1 
ATOM   8307 N N   . PHE B 1 484 ? 6.385   -12.115 56.400 1.00 30.97 ? 484  PHE B N   1 
ATOM   8308 C CA  . PHE B 1 484 ? 5.351   -11.593 57.292 1.00 31.70 ? 484  PHE B CA  1 
ATOM   8309 C C   . PHE B 1 484 ? 4.859   -10.199 56.887 1.00 31.56 ? 484  PHE B C   1 
ATOM   8310 O O   . PHE B 1 484 ? 3.652   -9.960  56.808 1.00 29.08 ? 484  PHE B O   1 
ATOM   8311 C CB  . PHE B 1 484 ? 5.879   -11.542 58.737 1.00 32.91 ? 484  PHE B CB  1 
ATOM   8312 C CG  . PHE B 1 484 ? 4.865   -11.073 59.748 1.00 33.52 ? 484  PHE B CG  1 
ATOM   8313 C CD1 . PHE B 1 484 ? 4.104   -11.987 60.471 1.00 35.22 ? 484  PHE B CD1 1 
ATOM   8314 C CD2 . PHE B 1 484 ? 4.675   -9.714  59.981 1.00 35.73 ? 484  PHE B CD2 1 
ATOM   8315 C CE1 . PHE B 1 484 ? 3.172   -11.552 61.413 1.00 34.09 ? 484  PHE B CE1 1 
ATOM   8316 C CE2 . PHE B 1 484 ? 3.752   -9.270  60.913 1.00 33.81 ? 484  PHE B CE2 1 
ATOM   8317 C CZ  . PHE B 1 484 ? 2.995   -10.194 61.635 1.00 35.40 ? 484  PHE B CZ  1 
ATOM   8318 N N   . ILE B 1 485 ? 5.789   -9.278  56.651 1.00 31.26 ? 485  ILE B N   1 
ATOM   8319 C CA  . ILE B 1 485 ? 5.412   -7.920  56.267 1.00 30.22 ? 485  ILE B CA  1 
ATOM   8320 C C   . ILE B 1 485 ? 4.682   -7.936  54.925 1.00 30.86 ? 485  ILE B C   1 
ATOM   8321 O O   . ILE B 1 485 ? 3.672   -7.249  54.756 1.00 27.57 ? 485  ILE B O   1 
ATOM   8322 C CB  . ILE B 1 485 ? 6.656   -6.981  56.199 1.00 32.85 ? 485  ILE B CB  1 
ATOM   8323 C CG1 . ILE B 1 485 ? 7.245   -6.796  57.611 1.00 31.44 ? 485  ILE B CG1 1 
ATOM   8324 C CG2 . ILE B 1 485 ? 6.253   -5.610  55.622 1.00 29.08 ? 485  ILE B CG2 1 
ATOM   8325 C CD1 . ILE B 1 485 ? 6.289   -6.135  58.604 1.00 34.87 ? 485  ILE B CD1 1 
ATOM   8326 N N   . LEU B 1 486 ? 5.178   -8.723  53.972 1.00 29.85 ? 486  LEU B N   1 
ATOM   8327 C CA  . LEU B 1 486 ? 4.502   -8.809  52.671 1.00 29.92 ? 486  LEU B CA  1 
ATOM   8328 C C   . LEU B 1 486 ? 3.052   -9.235  52.894 1.00 30.73 ? 486  LEU B C   1 
ATOM   8329 O O   . LEU B 1 486 ? 2.127   -8.617  52.375 1.00 33.64 ? 486  LEU B O   1 
ATOM   8330 C CB  . LEU B 1 486 ? 5.189   -9.825  51.755 1.00 28.16 ? 486  LEU B CB  1 
ATOM   8331 C CG  . LEU B 1 486 ? 4.483   -10.092 50.411 1.00 27.62 ? 486  LEU B CG  1 
ATOM   8332 C CD1 . LEU B 1 486 ? 4.356   -8.782  49.630 1.00 27.60 ? 486  LEU B CD1 1 
ATOM   8333 C CD2 . LEU B 1 486 ? 5.274   -11.121 49.590 1.00 28.54 ? 486  LEU B CD2 1 
ATOM   8334 N N   . GLY B 1 487 ? 2.860   -10.295 53.674 1.00 31.89 ? 487  GLY B N   1 
ATOM   8335 C CA  . GLY B 1 487 ? 1.516   -10.781 53.956 1.00 31.30 ? 487  GLY B CA  1 
ATOM   8336 C C   . GLY B 1 487 ? 0.605   -9.714  54.537 1.00 31.64 ? 487  GLY B C   1 
ATOM   8337 O O   . GLY B 1 487 ? -0.565  -9.605  54.156 1.00 29.96 ? 487  GLY B O   1 
ATOM   8338 N N   . ALA B 1 488 ? 1.134   -8.921  55.464 1.00 29.68 ? 488  ALA B N   1 
ATOM   8339 C CA  . ALA B 1 488 ? 0.355   -7.857  56.083 1.00 29.64 ? 488  ALA B CA  1 
ATOM   8340 C C   . ALA B 1 488 ? 0.022   -6.776  55.045 1.00 31.06 ? 488  ALA B C   1 
ATOM   8341 O O   . ALA B 1 488 ? -1.085  -6.232  55.040 1.00 30.33 ? 488  ALA B O   1 
ATOM   8342 C CB  . ALA B 1 488 ? 1.136   -7.242  57.258 1.00 29.82 ? 488  ALA B CB  1 
ATOM   8343 N N   . LEU B 1 489 ? 0.979   -6.473  54.171 1.00 29.32 ? 489  LEU B N   1 
ATOM   8344 C CA  . LEU B 1 489 ? 0.773   -5.455  53.138 1.00 30.17 ? 489  LEU B CA  1 
ATOM   8345 C C   . LEU B 1 489 ? -0.294  -5.890  52.133 1.00 29.49 ? 489  LEU B C   1 
ATOM   8346 O O   . LEU B 1 489 ? -1.145  -5.091  51.748 1.00 28.64 ? 489  LEU B O   1 
ATOM   8347 C CB  . LEU B 1 489 ? 2.089   -5.161  52.409 1.00 29.36 ? 489  LEU B CB  1 
ATOM   8348 C CG  . LEU B 1 489 ? 3.162   -4.399  53.194 1.00 30.27 ? 489  LEU B CG  1 
ATOM   8349 C CD1 . LEU B 1 489 ? 4.447   -4.386  52.386 1.00 30.95 ? 489  LEU B CD1 1 
ATOM   8350 C CD2 . LEU B 1 489 ? 2.690   -2.966  53.491 1.00 32.56 ? 489  LEU B CD2 1 
ATOM   8351 N N   . ILE B 1 490 ? -0.250  -7.152  51.706 1.00 27.78 ? 490  ILE B N   1 
ATOM   8352 C CA  . ILE B 1 490 ? -1.241  -7.638  50.759 1.00 29.34 ? 490  ILE B CA  1 
ATOM   8353 C C   . ILE B 1 490 ? -2.612  -7.603  51.423 1.00 29.44 ? 490  ILE B C   1 
ATOM   8354 O O   . ILE B 1 490 ? -3.599  -7.197  50.807 1.00 30.12 ? 490  ILE B O   1 
ATOM   8355 C CB  . ILE B 1 490 ? -0.938  -9.087  50.298 1.00 29.46 ? 490  ILE B CB  1 
ATOM   8356 C CG1 . ILE B 1 490 ? 0.459   -9.159  49.663 1.00 28.33 ? 490  ILE B CG1 1 
ATOM   8357 C CG2 . ILE B 1 490 ? -1.987  -9.535  49.293 1.00 32.70 ? 490  ILE B CG2 1 
ATOM   8358 C CD1 . ILE B 1 490 ? 0.931   -10.584 49.362 1.00 30.05 ? 490  ILE B CD1 1 
ATOM   8359 N N   . ALA B 1 491 ? -2.673  -8.014  52.688 1.00 28.70 ? 491  ALA B N   1 
ATOM   8360 C CA  . ALA B 1 491 ? -3.940  -8.017  53.411 1.00 27.91 ? 491  ALA B CA  1 
ATOM   8361 C C   . ALA B 1 491 ? -4.468  -6.599  53.576 1.00 28.91 ? 491  ALA B C   1 
ATOM   8362 O O   . ALA B 1 491 ? -5.678  -6.366  53.519 1.00 29.33 ? 491  ALA B O   1 
ATOM   8363 C CB  . ALA B 1 491 ? -3.769  -8.679  54.786 1.00 29.29 ? 491  ALA B CB  1 
ATOM   8364 N N   . MET B 1 492 ? -3.557  -5.654  53.788 1.00 28.55 ? 492  MET B N   1 
ATOM   8365 C CA  . MET B 1 492 ? -3.951  -4.265  53.978 1.00 30.34 ? 492  MET B CA  1 
ATOM   8366 C C   . MET B 1 492 ? -4.716  -3.773  52.757 1.00 30.41 ? 492  MET B C   1 
ATOM   8367 O O   . MET B 1 492 ? -5.796  -3.190  52.883 1.00 29.95 ? 492  MET B O   1 
ATOM   8368 C CB  . MET B 1 492 ? -2.720  -3.392  54.224 1.00 30.74 ? 492  MET B CB  1 
ATOM   8369 C CG  . MET B 1 492 ? -3.043  -1.950  54.584 1.00 32.31 ? 492  MET B CG  1 
ATOM   8370 S SD  . MET B 1 492 ? -1.535  -0.985  54.843 1.00 37.66 ? 492  MET B SD  1 
ATOM   8371 C CE  . MET B 1 492 ? -0.798  -1.084  53.224 1.00 39.16 ? 492  MET B CE  1 
ATOM   8372 N N   . TYR B 1 493 ? -4.161  -4.018  51.574 1.00 29.44 ? 493  TYR B N   1 
ATOM   8373 C CA  . TYR B 1 493 ? -4.820  -3.592  50.342 1.00 29.79 ? 493  TYR B CA  1 
ATOM   8374 C C   . TYR B 1 493 ? -6.095  -4.376  50.063 1.00 29.54 ? 493  TYR B C   1 
ATOM   8375 O O   . TYR B 1 493 ? -7.047  -3.820  49.519 1.00 26.66 ? 493  TYR B O   1 
ATOM   8376 C CB  . TYR B 1 493 ? -3.853  -3.689  49.156 1.00 29.43 ? 493  TYR B CB  1 
ATOM   8377 C CG  . TYR B 1 493 ? -2.905  -2.513  49.059 1.00 34.26 ? 493  TYR B CG  1 
ATOM   8378 C CD1 . TYR B 1 493 ? -1.551  -2.703  48.787 1.00 37.58 ? 493  TYR B CD1 1 
ATOM   8379 C CD2 . TYR B 1 493 ? -3.365  -1.208  49.224 1.00 33.95 ? 493  TYR B CD2 1 
ATOM   8380 C CE1 . TYR B 1 493 ? -0.674  -1.616  48.683 1.00 39.90 ? 493  TYR B CE1 1 
ATOM   8381 C CE2 . TYR B 1 493 ? -2.502  -0.113  49.123 1.00 37.72 ? 493  TYR B CE2 1 
ATOM   8382 C CZ  . TYR B 1 493 ? -1.160  -0.321  48.852 1.00 40.91 ? 493  TYR B CZ  1 
ATOM   8383 O OH  . TYR B 1 493 ? -0.307  0.759   48.739 1.00 39.14 ? 493  TYR B OH  1 
ATOM   8384 N N   . GLU B 1 494 ? -6.135  -5.659  50.429 1.00 29.64 ? 494  GLU B N   1 
ATOM   8385 C CA  . GLU B 1 494 ? -7.360  -6.430  50.212 1.00 30.24 ? 494  GLU B CA  1 
ATOM   8386 C C   . GLU B 1 494 ? -8.503  -5.755  50.976 1.00 31.54 ? 494  GLU B C   1 
ATOM   8387 O O   . GLU B 1 494 ? -9.616  -5.619  50.461 1.00 31.71 ? 494  GLU B O   1 
ATOM   8388 C CB  . GLU B 1 494 ? -7.221  -7.885  50.703 1.00 29.82 ? 494  GLU B CB  1 
ATOM   8389 C CG  . GLU B 1 494 ? -6.150  -8.696  49.987 1.00 29.68 ? 494  GLU B CG  1 
ATOM   8390 C CD  . GLU B 1 494 ? -6.103  -10.158 50.420 1.00 30.42 ? 494  GLU B CD  1 
ATOM   8391 O OE1 . GLU B 1 494 ? -6.314  -10.437 51.619 1.00 29.27 ? 494  GLU B OE1 1 
ATOM   8392 O OE2 . GLU B 1 494 ? -5.831  -11.027 49.558 1.00 27.65 ? 494  GLU B OE2 1 
ATOM   8393 N N   . HIS B 1 495 ? -8.233  -5.321  52.205 1.00 29.90 ? 495  HIS B N   1 
ATOM   8394 C CA  . HIS B 1 495 ? -9.271  -4.688  52.996 1.00 29.05 ? 495  HIS B CA  1 
ATOM   8395 C C   . HIS B 1 495 ? -9.590  -3.275  52.536 1.00 29.68 ? 495  HIS B C   1 
ATOM   8396 O O   . HIS B 1 495 ? -10.718 -2.814  52.712 1.00 30.88 ? 495  HIS B O   1 
ATOM   8397 C CB  . HIS B 1 495 ? -8.918  -4.729  54.487 1.00 30.42 ? 495  HIS B CB  1 
ATOM   8398 C CG  . HIS B 1 495 ? -8.870  -6.119  55.041 1.00 32.70 ? 495  HIS B CG  1 
ATOM   8399 N ND1 . HIS B 1 495 ? -9.825  -7.068  54.740 1.00 30.99 ? 495  HIS B ND1 1 
ATOM   8400 C CD2 . HIS B 1 495 ? -7.972  -6.732  55.849 1.00 32.79 ? 495  HIS B CD2 1 
ATOM   8401 C CE1 . HIS B 1 495 ? -9.514  -8.206  55.333 1.00 33.87 ? 495  HIS B CE1 1 
ATOM   8402 N NE2 . HIS B 1 495 ? -8.395  -8.030  56.013 1.00 32.88 ? 495  HIS B NE2 1 
ATOM   8403 N N   . LYS B 1 496 ? -8.613  -2.588  51.946 1.00 27.63 ? 496  LYS B N   1 
ATOM   8404 C CA  . LYS B 1 496 ? -8.871  -1.246  51.417 1.00 28.67 ? 496  LYS B CA  1 
ATOM   8405 C C   . LYS B 1 496 ? -9.921  -1.442  50.311 1.00 28.24 ? 496  LYS B C   1 
ATOM   8406 O O   . LYS B 1 496 ? -10.915 -0.712  50.223 1.00 27.67 ? 496  LYS B O   1 
ATOM   8407 C CB  . LYS B 1 496 ? -7.604  -0.641  50.793 1.00 29.25 ? 496  LYS B CB  1 
ATOM   8408 C CG  . LYS B 1 496 ? -7.887  0.640   49.992 1.00 28.35 ? 496  LYS B CG  1 
ATOM   8409 C CD  . LYS B 1 496 ? -6.796  0.975   48.976 1.00 28.34 ? 496  LYS B CD  1 
ATOM   8410 C CE  . LYS B 1 496 ? -7.187  2.229   48.183 1.00 28.38 ? 496  LYS B CE  1 
ATOM   8411 N NZ  . LYS B 1 496 ? -6.186  2.604   47.127 1.00 32.23 ? 496  LYS B NZ  1 
ATOM   8412 N N   . ILE B 1 497 ? -9.691  -2.452  49.479 1.00 27.94 ? 497  ILE B N   1 
ATOM   8413 C CA  . ILE B 1 497 ? -10.593 -2.763  48.374 1.00 29.37 ? 497  ILE B CA  1 
ATOM   8414 C C   . ILE B 1 497 ? -11.981 -3.108  48.902 1.00 30.22 ? 497  ILE B C   1 
ATOM   8415 O O   . ILE B 1 497 ? -12.989 -2.716  48.320 1.00 27.91 ? 497  ILE B O   1 
ATOM   8416 C CB  . ILE B 1 497 ? -10.030 -3.930  47.530 1.00 29.47 ? 497  ILE B CB  1 
ATOM   8417 C CG1 . ILE B 1 497 ? -8.775  -3.456  46.785 1.00 26.90 ? 497  ILE B CG1 1 
ATOM   8418 C CG2 . ILE B 1 497 ? -11.084 -4.440  46.551 1.00 29.76 ? 497  ILE B CG2 1 
ATOM   8419 C CD1 . ILE B 1 497 ? -7.956  -4.559  46.181 1.00 27.07 ? 497  ILE B CD1 1 
ATOM   8420 N N   . PHE B 1 498 ? -12.018 -3.835  50.015 1.00 29.79 ? 498  PHE B N   1 
ATOM   8421 C CA  . PHE B 1 498 ? -13.267 -4.236  50.651 1.00 30.83 ? 498  PHE B CA  1 
ATOM   8422 C C   . PHE B 1 498 ? -14.056 -3.021  51.140 1.00 30.33 ? 498  PHE B C   1 
ATOM   8423 O O   . PHE B 1 498 ? -15.252 -2.909  50.881 1.00 30.19 ? 498  PHE B O   1 
ATOM   8424 C CB  . PHE B 1 498 ? -12.973 -5.157  51.842 1.00 33.31 ? 498  PHE B CB  1 
ATOM   8425 C CG  . PHE B 1 498 ? -14.194 -5.536  52.632 1.00 35.97 ? 498  PHE B CG  1 
ATOM   8426 C CD1 . PHE B 1 498 ? -15.145 -6.395  52.095 1.00 35.57 ? 498  PHE B CD1 1 
ATOM   8427 C CD2 . PHE B 1 498 ? -14.398 -5.021  53.907 1.00 37.89 ? 498  PHE B CD2 1 
ATOM   8428 C CE1 . PHE B 1 498 ? -16.288 -6.738  52.817 1.00 38.58 ? 498  PHE B CE1 1 
ATOM   8429 C CE2 . PHE B 1 498 ? -15.540 -5.357  54.641 1.00 38.70 ? 498  PHE B CE2 1 
ATOM   8430 C CZ  . PHE B 1 498 ? -16.487 -6.218  54.092 1.00 36.13 ? 498  PHE B CZ  1 
ATOM   8431 N N   . VAL B 1 499 ? -13.383 -2.116  51.849 1.00 29.24 ? 499  VAL B N   1 
ATOM   8432 C CA  . VAL B 1 499 ? -14.044 -0.931  52.379 1.00 29.51 ? 499  VAL B CA  1 
ATOM   8433 C C   . VAL B 1 499 ? -14.667 -0.080  51.268 1.00 29.37 ? 499  VAL B C   1 
ATOM   8434 O O   . VAL B 1 499 ? -15.809 0.347   51.384 1.00 29.03 ? 499  VAL B O   1 
ATOM   8435 C CB  . VAL B 1 499 ? -13.067 -0.048  53.197 1.00 31.04 ? 499  VAL B CB  1 
ATOM   8436 C CG1 . VAL B 1 499 ? -13.796 1.193   53.715 1.00 29.82 ? 499  VAL B CG1 1 
ATOM   8437 C CG2 . VAL B 1 499 ? -12.511 -0.836  54.385 1.00 31.47 ? 499  VAL B CG2 1 
ATOM   8438 N N   . GLN B 1 500 ? -13.923 0.166   50.196 1.00 29.05 ? 500  GLN B N   1 
ATOM   8439 C CA  . GLN B 1 500 ? -14.456 0.971   49.102 1.00 29.44 ? 500  GLN B CA  1 
ATOM   8440 C C   . GLN B 1 500 ? -15.687 0.307   48.493 1.00 29.75 ? 500  GLN B C   1 
ATOM   8441 O O   . GLN B 1 500 ? -16.679 0.972   48.192 1.00 28.50 ? 500  GLN B O   1 
ATOM   8442 C CB  . GLN B 1 500 ? -13.386 1.197   48.033 1.00 28.39 ? 500  GLN B CB  1 
ATOM   8443 C CG  . GLN B 1 500 ? -12.201 2.030   48.528 1.00 28.20 ? 500  GLN B CG  1 
ATOM   8444 C CD  . GLN B 1 500 ? -11.183 2.315   47.443 1.00 28.76 ? 500  GLN B CD  1 
ATOM   8445 O OE1 . GLN B 1 500 ? -10.843 1.435   46.656 1.00 28.94 ? 500  GLN B OE1 1 
ATOM   8446 N NE2 . GLN B 1 500 ? -10.674 3.554   47.406 1.00 25.52 ? 500  GLN B NE2 1 
ATOM   8447 N N   . GLY B 1 501 ? -15.618 -1.007  48.315 1.00 27.90 ? 501  GLY B N   1 
ATOM   8448 C CA  . GLY B 1 501 ? -16.743 -1.736  47.761 1.00 31.19 ? 501  GLY B CA  1 
ATOM   8449 C C   . GLY B 1 501 ? -17.988 -1.568  48.618 1.00 31.26 ? 501  GLY B C   1 
ATOM   8450 O O   . GLY B 1 501 ? -19.095 -1.427  48.099 1.00 31.38 ? 501  GLY B O   1 
ATOM   8451 N N   . VAL B 1 502 ? -17.815 -1.581  49.936 1.00 30.36 ? 502  VAL B N   1 
ATOM   8452 C CA  . VAL B 1 502 ? -18.950 -1.416  50.838 1.00 29.27 ? 502  VAL B CA  1 
ATOM   8453 C C   . VAL B 1 502 ? -19.516 -0.007  50.701 1.00 30.84 ? 502  VAL B C   1 
ATOM   8454 O O   . VAL B 1 502 ? -20.736 0.181   50.620 1.00 30.87 ? 502  VAL B O   1 
ATOM   8455 C CB  . VAL B 1 502 ? -18.538 -1.663  52.310 1.00 32.62 ? 502  VAL B CB  1 
ATOM   8456 C CG1 . VAL B 1 502 ? -19.684 -1.304  53.249 1.00 32.65 ? 502  VAL B CG1 1 
ATOM   8457 C CG2 . VAL B 1 502 ? -18.152 -3.128  52.498 1.00 28.87 ? 502  VAL B CG2 1 
ATOM   8458 N N   . VAL B 1 503 ? -18.631 0.983   50.669 1.00 29.12 ? 503  VAL B N   1 
ATOM   8459 C CA  . VAL B 1 503 ? -19.063 2.374   50.526 1.00 28.84 ? 503  VAL B CA  1 
ATOM   8460 C C   . VAL B 1 503 ? -19.836 2.589   49.216 1.00 29.21 ? 503  VAL B C   1 
ATOM   8461 O O   . VAL B 1 503 ? -20.800 3.359   49.183 1.00 30.51 ? 503  VAL B O   1 
ATOM   8462 C CB  . VAL B 1 503 ? -17.844 3.333   50.598 1.00 28.55 ? 503  VAL B CB  1 
ATOM   8463 C CG1 . VAL B 1 503 ? -18.233 4.748   50.147 1.00 26.67 ? 503  VAL B CG1 1 
ATOM   8464 C CG2 . VAL B 1 503 ? -17.325 3.384   52.043 1.00 28.78 ? 503  VAL B CG2 1 
ATOM   8465 N N   . TRP B 1 504 ? -19.424 1.903   48.150 1.00 29.87 ? 504  TRP B N   1 
ATOM   8466 C CA  . TRP B 1 504 ? -20.094 2.024   46.848 1.00 33.00 ? 504  TRP B CA  1 
ATOM   8467 C C   . TRP B 1 504 ? -21.302 1.097   46.750 1.00 34.16 ? 504  TRP B C   1 
ATOM   8468 O O   . TRP B 1 504 ? -22.071 1.163   45.791 1.00 33.80 ? 504  TRP B O   1 
ATOM   8469 C CB  . TRP B 1 504 ? -19.129 1.703   45.694 1.00 29.33 ? 504  TRP B CB  1 
ATOM   8470 C CG  . TRP B 1 504 ? -18.053 2.742   45.484 1.00 28.63 ? 504  TRP B CG  1 
ATOM   8471 C CD1 . TRP B 1 504 ? -18.192 4.098   45.580 1.00 28.39 ? 504  TRP B CD1 1 
ATOM   8472 C CD2 . TRP B 1 504 ? -16.690 2.505   45.109 1.00 28.77 ? 504  TRP B CD2 1 
ATOM   8473 N NE1 . TRP B 1 504 ? -17.002 4.721   45.291 1.00 27.65 ? 504  TRP B NE1 1 
ATOM   8474 C CE2 . TRP B 1 504 ? -16.062 3.767   44.998 1.00 29.79 ? 504  TRP B CE2 1 
ATOM   8475 C CE3 . TRP B 1 504 ? -15.936 1.350   44.857 1.00 28.86 ? 504  TRP B CE3 1 
ATOM   8476 C CZ2 . TRP B 1 504 ? -14.715 3.906   44.645 1.00 28.90 ? 504  TRP B CZ2 1 
ATOM   8477 C CZ3 . TRP B 1 504 ? -14.595 1.487   44.508 1.00 31.83 ? 504  TRP B CZ3 1 
ATOM   8478 C CH2 . TRP B 1 504 ? -13.997 2.759   44.406 1.00 30.21 ? 504  TRP B CH2 1 
ATOM   8479 N N   . ASP B 1 505 ? -21.452 0.239   47.753 1.00 35.09 ? 505  ASP B N   1 
ATOM   8480 C CA  . ASP B 1 505 ? -22.544 -0.730  47.835 1.00 35.55 ? 505  ASP B CA  1 
ATOM   8481 C C   . ASP B 1 505 ? -22.547 -1.725  46.682 1.00 34.38 ? 505  ASP B C   1 
ATOM   8482 O O   . ASP B 1 505 ? -23.601 -2.132  46.199 1.00 35.10 ? 505  ASP B O   1 
ATOM   8483 C CB  . ASP B 1 505 ? -23.900 -0.014  47.912 1.00 39.00 ? 505  ASP B CB  1 
ATOM   8484 C CG  . ASP B 1 505 ? -25.003 -0.910  48.467 1.00 40.07 ? 505  ASP B CG  1 
ATOM   8485 O OD1 . ASP B 1 505 ? -24.750 -1.629  49.460 1.00 41.08 ? 505  ASP B OD1 1 
ATOM   8486 O OD2 . ASP B 1 505 ? -26.125 -0.887  47.923 1.00 39.76 ? 505  ASP B OD2 1 
ATOM   8487 N N   . ILE B 1 506 ? -21.360 -2.116  46.233 1.00 32.75 ? 506  ILE B N   1 
ATOM   8488 C CA  . ILE B 1 506 ? -21.264 -3.082  45.152 1.00 29.98 ? 506  ILE B CA  1 
ATOM   8489 C C   . ILE B 1 506 ? -20.749 -4.396  45.722 1.00 30.27 ? 506  ILE B C   1 
ATOM   8490 O O   . ILE B 1 506 ? -20.358 -4.474  46.892 1.00 31.90 ? 506  ILE B O   1 
ATOM   8491 C CB  . ILE B 1 506 ? -20.295 -2.622  44.027 1.00 29.67 ? 506  ILE B CB  1 
ATOM   8492 C CG1 . ILE B 1 506 ? -18.907 -2.335  44.609 1.00 30.61 ? 506  ILE B CG1 1 
ATOM   8493 C CG2 . ILE B 1 506 ? -20.861 -1.400  43.313 1.00 29.10 ? 506  ILE B CG2 1 
ATOM   8494 C CD1 . ILE B 1 506 ? -17.850 -2.070  43.561 1.00 28.69 ? 506  ILE B CD1 1 
ATOM   8495 N N   . ASN B 1 507 ? -20.765 -5.433  44.902 1.00 29.04 ? 507  ASN B N   1 
ATOM   8496 C CA  . ASN B 1 507 ? -20.265 -6.729  45.337 1.00 30.49 ? 507  ASN B CA  1 
ATOM   8497 C C   . ASN B 1 507 ? -18.850 -6.883  44.779 1.00 28.79 ? 507  ASN B C   1 
ATOM   8498 O O   . ASN B 1 507 ? -18.657 -7.134  43.583 1.00 29.54 ? 507  ASN B O   1 
ATOM   8499 C CB  . ASN B 1 507 ? -21.145 -7.851  44.788 1.00 29.52 ? 507  ASN B CB  1 
ATOM   8500 C CG  . ASN B 1 507 ? -20.682 -9.241  45.223 1.00 31.22 ? 507  ASN B CG  1 
ATOM   8501 O OD1 . ASN B 1 507 ? -19.881 -9.360  46.148 1.00 31.33 ? 507  ASN B OD1 1 
ATOM   8502 N ND2 . ASN B 1 507 ? -21.144 -10.313 44.606 1.00 30.47 ? 507  ASN B ND2 1 
ATOM   8503 N N   . SER B 1 508 ? -17.888 -6.717  45.657 1.00 29.51 ? 508  SER B N   1 
ATOM   8504 C CA  . SER B 1 508 ? -16.470 -6.768  45.284 1.00 29.86 ? 508  SER B CA  1 
ATOM   8505 C C   . SER B 1 508 ? -15.953 -8.203  45.132 1.00 30.86 ? 508  SER B C   1 
ATOM   8506 O O   . SER B 1 508 ? -14.752 -8.431  44.943 1.00 31.34 ? 508  SER B O   1 
ATOM   8507 C CB  . SER B 1 508 ? -15.602 -6.128  46.377 1.00 31.78 ? 508  SER B CB  1 
ATOM   8508 O OG  . SER B 1 508 ? -16.108 -4.853  46.728 1.00 33.03 ? 508  SER B OG  1 
ATOM   8509 N N   . PHE B 1 509 ? -16.840 -9.186  45.184 1.00 29.55 ? 509  PHE B N   1 
ATOM   8510 C CA  . PHE B 1 509 ? -16.368 -10.585 45.186 1.00 30.85 ? 509  PHE B CA  1 
ATOM   8511 C C   . PHE B 1 509 ? -16.916 -11.459 44.041 1.00 32.14 ? 509  PHE B C   1 
ATOM   8512 O O   . PHE B 1 509 ? -16.649 -12.665 43.974 1.00 31.64 ? 509  PHE B O   1 
ATOM   8513 C CB  . PHE B 1 509 ? -16.684 -11.195 46.536 1.00 30.82 ? 509  PHE B CB  1 
ATOM   8514 C CG  . PHE B 1 509 ? -16.049 -10.357 47.639 1.00 32.90 ? 509  PHE B CG  1 
ATOM   8515 C CD1 . PHE B 1 509 ? -16.850 -9.579  48.480 1.00 31.78 ? 509  PHE B CD1 1 
ATOM   8516 C CD2 . PHE B 1 509 ? -14.657 -10.352 47.787 1.00 32.26 ? 509  PHE B CD2 1 
ATOM   8517 C CE1 . PHE B 1 509 ? -16.257 -8.789  49.472 1.00 34.16 ? 509  PHE B CE1 1 
ATOM   8518 C CE2 . PHE B 1 509 ? -14.064 -9.560  48.776 1.00 34.10 ? 509  PHE B CE2 1 
ATOM   8519 C CZ  . PHE B 1 509 ? -14.863 -8.778  49.618 1.00 33.42 ? 509  PHE B CZ  1 
ATOM   8520 N N   . ASP B 1 510 ? -17.677 -10.884 43.137 1.00 31.44 ? 510  ASP B N   1 
ATOM   8521 C CA  . ASP B 1 510 ? -18.122 -11.633 41.939 1.00 32.07 ? 510  ASP B CA  1 
ATOM   8522 C C   . ASP B 1 510 ? -17.295 -11.084 40.776 1.00 31.07 ? 510  ASP B C   1 
ATOM   8523 O O   . ASP B 1 510 ? -16.469 -10.186 40.973 1.00 32.31 ? 510  ASP B O   1 
ATOM   8524 C CB  . ASP B 1 510 ? -19.635 -11.483 41.731 1.00 33.11 ? 510  ASP B CB  1 
ATOM   8525 C CG  . ASP B 1 510 ? -20.088 -10.057 41.426 1.00 33.74 ? 510  ASP B CG  1 
ATOM   8526 O OD1 . ASP B 1 510 ? -19.220 -9.151  41.139 1.00 31.69 ? 510  ASP B OD1 1 
ATOM   8527 O OD2 . ASP B 1 510 ? -21.345 -9.763  41.457 1.00 33.15 ? 510  ASP B OD2 1 
ATOM   8528 N N   . GLN B 1 511 ? -17.480 -11.635 39.583 1.00 29.73 ? 511  GLN B N   1 
ATOM   8529 C CA  . GLN B 1 511 ? -16.744 -11.178 38.410 1.00 31.47 ? 511  GLN B CA  1 
ATOM   8530 C C   . GLN B 1 511 ? -17.466 -11.670 37.158 1.00 30.91 ? 511  GLN B C   1 
ATOM   8531 O O   . GLN B 1 511 ? -16.919 -12.434 36.370 1.00 31.10 ? 511  GLN B O   1 
ATOM   8532 C CB  . GLN B 1 511 ? -15.283 -11.693 38.438 1.00 31.06 ? 511  GLN B CB  1 
ATOM   8533 C CG  . GLN B 1 511 ? -15.120 -13.221 38.492 1.00 30.83 ? 511  GLN B CG  1 
ATOM   8534 C CD  . GLN B 1 511 ? -15.419 -13.798 39.866 1.00 31.13 ? 511  GLN B CD  1 
ATOM   8535 O OE1 . GLN B 1 511 ? -15.153 -13.167 40.894 1.00 31.81 ? 511  GLN B OE1 1 
ATOM   8536 N NE2 . GLN B 1 511 ? -15.985 -14.996 39.890 1.00 26.20 ? 511  GLN B NE2 1 
ATOM   8537 N N   . TRP B 1 512 ? -18.702 -11.210 36.973 1.00 31.05 ? 512  TRP B N   1 
ATOM   8538 C CA  . TRP B 1 512 ? -19.493 -11.628 35.825 1.00 31.12 ? 512  TRP B CA  1 
ATOM   8539 C C   . TRP B 1 512 ? -18.836 -11.379 34.477 1.00 31.08 ? 512  TRP B C   1 
ATOM   8540 O O   . TRP B 1 512 ? -19.027 -12.160 33.533 1.00 31.59 ? 512  TRP B O   1 
ATOM   8541 C CB  . TRP B 1 512 ? -20.888 -10.999 35.900 1.00 30.12 ? 512  TRP B CB  1 
ATOM   8542 C CG  . TRP B 1 512 ? -21.644 -11.554 37.066 1.00 31.37 ? 512  TRP B CG  1 
ATOM   8543 C CD1 . TRP B 1 512 ? -22.091 -10.871 38.163 1.00 33.63 ? 512  TRP B CD1 1 
ATOM   8544 C CD2 . TRP B 1 512 ? -21.948 -12.930 37.300 1.00 32.17 ? 512  TRP B CD2 1 
ATOM   8545 N NE1 . TRP B 1 512 ? -22.647 -11.742 39.069 1.00 32.10 ? 512  TRP B NE1 1 
ATOM   8546 C CE2 . TRP B 1 512 ? -22.573 -13.013 38.563 1.00 32.95 ? 512  TRP B CE2 1 
ATOM   8547 C CE3 . TRP B 1 512 ? -21.748 -14.106 36.563 1.00 34.77 ? 512  TRP B CE3 1 
ATOM   8548 C CZ2 . TRP B 1 512 ? -23.005 -14.228 39.108 1.00 35.30 ? 512  TRP B CZ2 1 
ATOM   8549 C CZ3 . TRP B 1 512 ? -22.175 -15.312 37.102 1.00 35.05 ? 512  TRP B CZ3 1 
ATOM   8550 C CH2 . TRP B 1 512 ? -22.797 -15.363 38.366 1.00 33.90 ? 512  TRP B CH2 1 
ATOM   8551 N N   . GLY B 1 513 ? -18.052 -10.312 34.382 1.00 29.64 ? 513  GLY B N   1 
ATOM   8552 C CA  . GLY B 1 513 ? -17.357 -10.027 33.138 1.00 29.64 ? 513  GLY B CA  1 
ATOM   8553 C C   . GLY B 1 513 ? -16.269 -11.052 32.878 1.00 31.07 ? 513  GLY B C   1 
ATOM   8554 O O   . GLY B 1 513 ? -16.011 -11.422 31.730 1.00 31.24 ? 513  GLY B O   1 
ATOM   8555 N N   . VAL B 1 514 ? -15.607 -11.497 33.947 1.00 32.97 ? 514  VAL B N   1 
ATOM   8556 C CA  . VAL B 1 514 ? -14.565 -12.520 33.833 1.00 33.39 ? 514  VAL B CA  1 
ATOM   8557 C C   . VAL B 1 514 ? -15.233 -13.857 33.480 1.00 35.12 ? 514  VAL B C   1 
ATOM   8558 O O   . VAL B 1 514 ? -14.740 -14.604 32.632 1.00 37.82 ? 514  VAL B O   1 
ATOM   8559 C CB  . VAL B 1 514 ? -13.770 -12.668 35.167 1.00 33.67 ? 514  VAL B CB  1 
ATOM   8560 C CG1 . VAL B 1 514 ? -12.925 -13.940 35.156 1.00 33.20 ? 514  VAL B CG1 1 
ATOM   8561 C CG2 . VAL B 1 514 ? -12.856 -11.455 35.354 1.00 32.44 ? 514  VAL B CG2 1 
ATOM   8562 N N   . GLU B 1 515 ? -16.358 -14.152 34.127 1.00 35.71 ? 515  GLU B N   1 
ATOM   8563 C CA  . GLU B 1 515 ? -17.080 -15.397 33.859 1.00 36.29 ? 515  GLU B CA  1 
ATOM   8564 C C   . GLU B 1 515 ? -17.541 -15.408 32.405 1.00 37.81 ? 515  GLU B C   1 
ATOM   8565 O O   . GLU B 1 515 ? -17.478 -16.433 31.725 1.00 39.37 ? 515  GLU B O   1 
ATOM   8566 C CB  . GLU B 1 515 ? -18.299 -15.530 34.779 1.00 37.62 ? 515  GLU B CB  1 
ATOM   8567 C CG  . GLU B 1 515 ? -17.991 -15.591 36.274 1.00 39.37 ? 515  GLU B CG  1 
ATOM   8568 C CD  . GLU B 1 515 ? -17.032 -16.712 36.648 1.00 42.54 ? 515  GLU B CD  1 
ATOM   8569 O OE1 . GLU B 1 515 ? -17.054 -17.780 35.991 1.00 41.51 ? 515  GLU B OE1 1 
ATOM   8570 O OE2 . GLU B 1 515 ? -16.262 -16.525 37.618 1.00 45.01 ? 515  GLU B OE2 1 
ATOM   8571 N N   . LEU B 1 516 ? -18.006 -14.257 31.929 1.00 37.77 ? 516  LEU B N   1 
ATOM   8572 C CA  . LEU B 1 516 ? -18.466 -14.132 30.557 1.00 37.58 ? 516  LEU B CA  1 
ATOM   8573 C C   . LEU B 1 516 ? -17.309 -14.424 29.595 1.00 36.95 ? 516  LEU B C   1 
ATOM   8574 O O   . LEU B 1 516 ? -17.453 -15.204 28.649 1.00 37.65 ? 516  LEU B O   1 
ATOM   8575 C CB  . LEU B 1 516 ? -19.017 -12.717 30.340 1.00 41.38 ? 516  LEU B CB  1 
ATOM   8576 C CG  . LEU B 1 516 ? -19.689 -12.326 29.022 1.00 43.56 ? 516  LEU B CG  1 
ATOM   8577 C CD1 . LEU B 1 516 ? -18.638 -12.089 27.971 1.00 47.60 ? 516  LEU B CD1 1 
ATOM   8578 C CD2 . LEU B 1 516 ? -20.681 -13.399 28.588 1.00 44.77 ? 516  LEU B CD2 1 
ATOM   8579 N N   . GLY B 1 517 ? -16.160 -13.807 29.856 1.00 35.01 ? 517  GLY B N   1 
ATOM   8580 C CA  . GLY B 1 517 ? -14.990 -14.003 29.015 1.00 36.09 ? 517  GLY B CA  1 
ATOM   8581 C C   . GLY B 1 517 ? -14.598 -15.459 28.813 1.00 37.13 ? 517  GLY B C   1 
ATOM   8582 O O   . GLY B 1 517 ? -14.107 -15.837 27.751 1.00 38.38 ? 517  GLY B O   1 
ATOM   8583 N N   . LYS B 1 518 ? -14.803 -16.284 29.829 1.00 40.30 ? 518  LYS B N   1 
ATOM   8584 C CA  . LYS B 1 518 ? -14.461 -17.700 29.718 1.00 43.80 ? 518  LYS B CA  1 
ATOM   8585 C C   . LYS B 1 518 ? -15.416 -18.473 28.806 1.00 45.47 ? 518  LYS B C   1 
ATOM   8586 O O   . LYS B 1 518 ? -15.275 -19.687 28.648 1.00 47.19 ? 518  LYS B O   1 
ATOM   8587 C CB  . LYS B 1 518 ? -14.453 -18.356 31.097 1.00 43.88 ? 518  LYS B CB  1 
ATOM   8588 C CG  . LYS B 1 518 ? -13.417 -17.809 32.047 1.00 44.33 ? 518  LYS B CG  1 
ATOM   8589 C CD  . LYS B 1 518 ? -13.532 -18.498 33.394 1.00 46.88 ? 518  LYS B CD  1 
ATOM   8590 C CE  . LYS B 1 518 ? -12.658 -17.829 34.427 1.00 45.46 ? 518  LYS B CE  1 
ATOM   8591 N NZ  . LYS B 1 518 ? -12.745 -18.508 35.756 1.00 46.46 ? 518  LYS B NZ  1 
ATOM   8592 N N   . GLN B 1 519 ? -16.377 -17.776 28.207 1.00 46.13 ? 519  GLN B N   1 
ATOM   8593 C CA  . GLN B 1 519 ? -17.353 -18.419 27.322 1.00 48.74 ? 519  GLN B CA  1 
ATOM   8594 C C   . GLN B 1 519 ? -17.579 -17.666 26.006 1.00 48.09 ? 519  GLN B C   1 
ATOM   8595 O O   . GLN B 1 519 ? -18.553 -17.929 25.301 1.00 50.34 ? 519  GLN B O   1 
ATOM   8596 C CB  . GLN B 1 519 ? -18.701 -18.557 28.038 1.00 50.10 ? 519  GLN B CB  1 
ATOM   8597 C CG  . GLN B 1 519 ? -18.666 -19.327 29.355 1.00 54.12 ? 519  GLN B CG  1 
ATOM   8598 C CD  . GLN B 1 519 ? -18.267 -20.778 29.179 1.00 54.15 ? 519  GLN B CD  1 
ATOM   8599 O OE1 . GLN B 1 519 ? -18.629 -21.415 28.190 1.00 56.77 ? 519  GLN B OE1 1 
ATOM   8600 N NE2 . GLN B 1 519 ? -17.533 -21.315 30.147 1.00 54.02 ? 519  GLN B NE2 1 
ATOM   8601 N N   . LEU B 1 520 ? -16.690 -16.739 25.673 1.00 46.21 ? 520  LEU B N   1 
ATOM   8602 C CA  . LEU B 1 520 ? -16.835 -15.958 24.443 1.00 46.07 ? 520  LEU B CA  1 
ATOM   8603 C C   . LEU B 1 520 ? -16.170 -16.572 23.213 1.00 45.34 ? 520  LEU B C   1 
ATOM   8604 O O   . LEU B 1 520 ? -16.750 -16.590 22.126 1.00 45.37 ? 520  LEU B O   1 
ATOM   8605 C CB  . LEU B 1 520 ? -16.272 -14.545 24.648 1.00 42.97 ? 520  LEU B CB  1 
ATOM   8606 C CG  . LEU B 1 520 ? -17.032 -13.610 25.594 1.00 43.81 ? 520  LEU B CG  1 
ATOM   8607 C CD1 . LEU B 1 520 ? -16.250 -12.317 25.749 1.00 41.43 ? 520  LEU B CD1 1 
ATOM   8608 C CD2 . LEU B 1 520 ? -18.435 -13.333 25.047 1.00 39.21 ? 520  LEU B CD2 1 
ATOM   8609 N N   . ALA B 1 521 ? -14.947 -17.058 23.389 1.00 45.21 ? 521  ALA B N   1 
ATOM   8610 C CA  . ALA B 1 521 ? -14.172 -17.643 22.298 1.00 46.48 ? 521  ALA B CA  1 
ATOM   8611 C C   . ALA B 1 521 ? -14.856 -18.840 21.644 1.00 46.00 ? 521  ALA B C   1 
ATOM   8612 O O   . ALA B 1 521 ? -14.635 -19.127 20.468 1.00 43.41 ? 521  ALA B O   1 
ATOM   8613 C CB  . ALA B 1 521 ? -12.795 -18.051 22.814 1.00 46.63 ? 521  ALA B CB  1 
ATOM   8614 N N   . LYS B 1 522 ? -15.683 -19.517 22.433 1.00 47.55 ? 522  LYS B N   1 
ATOM   8615 C CA  . LYS B 1 522 ? -16.432 -20.707 22.041 1.00 48.88 ? 522  LYS B CA  1 
ATOM   8616 C C   . LYS B 1 522 ? -16.968 -20.744 20.610 1.00 47.51 ? 522  LYS B C   1 
ATOM   8617 O O   . LYS B 1 522 ? -16.716 -21.695 19.875 1.00 47.65 ? 522  LYS B O   1 
ATOM   8618 C CB  . LYS B 1 522 ? -17.593 -20.896 23.023 1.00 51.50 ? 522  LYS B CB  1 
ATOM   8619 C CG  . LYS B 1 522 ? -17.861 -22.330 23.453 1.00 56.07 ? 522  LYS B CG  1 
ATOM   8620 C CD  . LYS B 1 522 ? -18.562 -23.130 22.369 1.00 59.75 ? 522  LYS B CD  1 
ATOM   8621 C CE  . LYS B 1 522 ? -18.927 -24.523 22.869 1.00 60.16 ? 522  LYS B CE  1 
ATOM   8622 N NZ  . LYS B 1 522 ? -19.219 -25.452 21.742 1.00 62.15 ? 522  LYS B NZ  1 
ATOM   8623 N N   . LYS B 1 523 ? -17.708 -19.717 20.214 1.00 48.04 ? 523  LYS B N   1 
ATOM   8624 C CA  . LYS B 1 523 ? -18.294 -19.680 18.878 1.00 48.66 ? 523  LYS B CA  1 
ATOM   8625 C C   . LYS B 1 523 ? -17.341 -19.461 17.710 1.00 47.24 ? 523  LYS B C   1 
ATOM   8626 O O   . LYS B 1 523 ? -17.483 -20.091 16.662 1.00 48.82 ? 523  LYS B O   1 
ATOM   8627 C CB  . LYS B 1 523 ? -19.404 -18.626 18.821 1.00 51.73 ? 523  LYS B CB  1 
ATOM   8628 C CG  . LYS B 1 523 ? -20.804 -19.206 18.965 1.00 56.48 ? 523  LYS B CG  1 
ATOM   8629 C CD  . LYS B 1 523 ? -21.272 -19.818 17.646 1.00 59.61 ? 523  LYS B CD  1 
ATOM   8630 C CE  . LYS B 1 523 ? -22.262 -20.953 17.863 1.00 60.33 ? 523  LYS B CE  1 
ATOM   8631 N NZ  . LYS B 1 523 ? -21.956 -22.109 16.977 1.00 62.18 ? 523  LYS B NZ  1 
ATOM   8632 N N   . ILE B 1 524 ? -16.369 -18.575 17.878 1.00 44.66 ? 524  ILE B N   1 
ATOM   8633 C CA  . ILE B 1 524 ? -15.438 -18.286 16.798 1.00 42.76 ? 524  ILE B CA  1 
ATOM   8634 C C   . ILE B 1 524 ? -14.382 -19.367 16.573 1.00 40.86 ? 524  ILE B C   1 
ATOM   8635 O O   . ILE B 1 524 ? -13.937 -19.578 15.446 1.00 38.04 ? 524  ILE B O   1 
ATOM   8636 C CB  . ILE B 1 524 ? -14.733 -16.925 17.038 1.00 42.14 ? 524  ILE B CB  1 
ATOM   8637 C CG1 . ILE B 1 524 ? -15.773 -15.801 17.025 1.00 43.62 ? 524  ILE B CG1 1 
ATOM   8638 C CG2 . ILE B 1 524 ? -13.684 -16.672 15.963 1.00 41.88 ? 524  ILE B CG2 1 
ATOM   8639 C CD1 . ILE B 1 524 ? -15.204 -14.425 17.350 1.00 40.87 ? 524  ILE B CD1 1 
ATOM   8640 N N   . GLU B 1 525 ? -13.996 -20.058 17.639 1.00 42.33 ? 525  GLU B N   1 
ATOM   8641 C CA  . GLU B 1 525 ? -12.968 -21.085 17.544 1.00 44.29 ? 525  GLU B CA  1 
ATOM   8642 C C   . GLU B 1 525 ? -13.187 -22.044 16.371 1.00 43.74 ? 525  GLU B C   1 
ATOM   8643 O O   . GLU B 1 525 ? -12.319 -22.174 15.510 1.00 43.39 ? 525  GLU B O   1 
ATOM   8644 C CB  . GLU B 1 525 ? -12.868 -21.859 18.868 1.00 46.40 ? 525  GLU B CB  1 
ATOM   8645 C CG  . GLU B 1 525 ? -11.553 -22.613 19.045 1.00 48.99 ? 525  GLU B CG  1 
ATOM   8646 C CD  . GLU B 1 525 ? -11.457 -23.340 20.380 1.00 50.84 ? 525  GLU B CD  1 
ATOM   8647 O OE1 . GLU B 1 525 ? -11.701 -22.706 21.430 1.00 52.80 ? 525  GLU B OE1 1 
ATOM   8648 O OE2 . GLU B 1 525 ? -11.124 -24.544 20.379 1.00 52.80 ? 525  GLU B OE2 1 
ATOM   8649 N N   . PRO B 1 526 ? -14.352 -22.715 16.306 1.00 44.51 ? 526  PRO B N   1 
ATOM   8650 C CA  . PRO B 1 526 ? -14.574 -23.639 15.184 1.00 46.22 ? 526  PRO B CA  1 
ATOM   8651 C C   . PRO B 1 526 ? -14.687 -22.973 13.813 1.00 47.23 ? 526  PRO B C   1 
ATOM   8652 O O   . PRO B 1 526 ? -14.428 -23.604 12.792 1.00 47.29 ? 526  PRO B O   1 
ATOM   8653 C CB  . PRO B 1 526 ? -15.857 -24.370 15.585 1.00 45.52 ? 526  PRO B CB  1 
ATOM   8654 C CG  . PRO B 1 526 ? -16.594 -23.341 16.377 1.00 44.14 ? 526  PRO B CG  1 
ATOM   8655 C CD  . PRO B 1 526 ? -15.494 -22.740 17.236 1.00 44.32 ? 526  PRO B CD  1 
ATOM   8656 N N   . GLU B 1 527 ? -15.067 -21.700 13.788 1.00 47.89 ? 527  GLU B N   1 
ATOM   8657 C CA  . GLU B 1 527 ? -15.203 -20.986 12.524 1.00 47.49 ? 527  GLU B CA  1 
ATOM   8658 C C   . GLU B 1 527 ? -13.861 -20.593 11.907 1.00 47.00 ? 527  GLU B C   1 
ATOM   8659 O O   . GLU B 1 527 ? -13.796 -20.217 10.736 1.00 46.13 ? 527  GLU B O   1 
ATOM   8660 C CB  . GLU B 1 527 ? -16.062 -19.733 12.713 1.00 50.33 ? 527  GLU B CB  1 
ATOM   8661 C CG  . GLU B 1 527 ? -17.410 -19.995 13.362 1.00 54.69 ? 527  GLU B CG  1 
ATOM   8662 C CD  . GLU B 1 527 ? -18.313 -18.775 13.340 1.00 57.76 ? 527  GLU B CD  1 
ATOM   8663 O OE1 . GLU B 1 527 ? -18.591 -18.253 12.238 1.00 60.54 ? 527  GLU B OE1 1 
ATOM   8664 O OE2 . GLU B 1 527 ? -18.741 -18.330 14.426 1.00 60.15 ? 527  GLU B OE2 1 
ATOM   8665 N N   . LEU B 1 528 ? -12.788 -20.675 12.686 1.00 44.59 ? 528  LEU B N   1 
ATOM   8666 C CA  . LEU B 1 528 ? -11.469 -20.319 12.172 1.00 45.77 ? 528  LEU B CA  1 
ATOM   8667 C C   . LEU B 1 528 ? -10.865 -21.433 11.318 1.00 46.87 ? 528  LEU B C   1 
ATOM   8668 O O   . LEU B 1 528 ? -10.038 -21.175 10.447 1.00 46.96 ? 528  LEU B O   1 
ATOM   8669 C CB  . LEU B 1 528 ? -10.513 -19.988 13.328 1.00 43.53 ? 528  LEU B CB  1 
ATOM   8670 C CG  . LEU B 1 528 ? -10.794 -18.707 14.125 1.00 43.52 ? 528  LEU B CG  1 
ATOM   8671 C CD1 . LEU B 1 528 ? -9.795  -18.579 15.269 1.00 42.66 ? 528  LEU B CD1 1 
ATOM   8672 C CD2 . LEU B 1 528 ? -10.697 -17.501 13.201 1.00 42.01 ? 528  LEU B CD2 1 
ATOM   8673 N N   . ASP B 1 529 ? -11.289 -22.666 11.571 1.00 49.52 ? 529  ASP B N   1 
ATOM   8674 C CA  . ASP B 1 529 ? -10.782 -23.831 10.849 1.00 52.76 ? 529  ASP B CA  1 
ATOM   8675 C C   . ASP B 1 529 ? -10.893 -23.751 9.329  1.00 54.71 ? 529  ASP B C   1 
ATOM   8676 O O   . ASP B 1 529 ? -9.879  -23.758 8.625  1.00 56.34 ? 529  ASP B O   1 
ATOM   8677 C CB  . ASP B 1 529 ? -11.489 -25.093 11.352 1.00 53.73 ? 529  ASP B CB  1 
ATOM   8678 C CG  . ASP B 1 529 ? -11.125 -25.425 12.786 1.00 55.46 ? 529  ASP B CG  1 
ATOM   8679 O OD1 . ASP B 1 529 ? -11.746 -26.337 13.375 1.00 55.04 ? 529  ASP B OD1 1 
ATOM   8680 O OD2 . ASP B 1 529 ? -10.206 -24.771 13.323 1.00 57.04 ? 529  ASP B OD2 1 
ATOM   8681 N N   . GLY B 1 530 ? -12.118 -23.681 8.819  1.00 55.92 ? 530  GLY B N   1 
ATOM   8682 C CA  . GLY B 1 530 ? -12.302 -23.619 7.379  1.00 58.31 ? 530  GLY B CA  1 
ATOM   8683 C C   . GLY B 1 530 ? -11.506 -22.513 6.712  1.00 58.79 ? 530  GLY B C   1 
ATOM   8684 O O   . GLY B 1 530 ? -11.011 -21.605 7.378  1.00 60.41 ? 530  GLY B O   1 
ATOM   8685 N N   . SER B 1 531 ? -11.367 -22.591 5.392  1.00 58.62 ? 531  SER B N   1 
ATOM   8686 C CA  . SER B 1 531 ? -10.644 -21.566 4.650  1.00 56.50 ? 531  SER B CA  1 
ATOM   8687 C C   . SER B 1 531 ? -11.666 -20.672 3.960  1.00 55.03 ? 531  SER B C   1 
ATOM   8688 O O   . SER B 1 531 ? -11.311 -19.718 3.269  1.00 54.73 ? 531  SER B O   1 
ATOM   8689 C CB  . SER B 1 531 ? -9.717  -22.200 3.613  1.00 57.36 ? 531  SER B CB  1 
ATOM   8690 O OG  . SER B 1 531 ? -8.942  -21.212 2.955  1.00 59.19 ? 531  SER B OG  1 
ATOM   8691 N N   . SER B 1 532 ? -12.942 -20.988 4.157  1.00 53.44 ? 532  SER B N   1 
ATOM   8692 C CA  . SER B 1 532 ? -14.020 -20.205 3.567  1.00 53.21 ? 532  SER B CA  1 
ATOM   8693 C C   . SER B 1 532 ? -14.288 -18.984 4.443  1.00 51.71 ? 532  SER B C   1 
ATOM   8694 O O   . SER B 1 532 ? -14.233 -19.063 5.671  1.00 50.61 ? 532  SER B O   1 
ATOM   8695 C CB  . SER B 1 532 ? -15.295 -21.049 3.453  1.00 55.15 ? 532  SER B CB  1 
ATOM   8696 O OG  . SER B 1 532 ? -15.789 -21.415 4.732  1.00 55.39 ? 532  SER B OG  1 
ATOM   8697 N N   . PRO B 1 533 ? -14.589 -17.836 3.821  1.00 50.85 ? 533  PRO B N   1 
ATOM   8698 C CA  . PRO B 1 533 ? -14.859 -16.614 4.586  1.00 50.85 ? 533  PRO B CA  1 
ATOM   8699 C C   . PRO B 1 533 ? -16.017 -16.750 5.569  1.00 50.47 ? 533  PRO B C   1 
ATOM   8700 O O   . PRO B 1 533 ? -16.905 -17.585 5.393  1.00 50.59 ? 533  PRO B O   1 
ATOM   8701 C CB  . PRO B 1 533 ? -15.135 -15.577 3.496  1.00 51.11 ? 533  PRO B CB  1 
ATOM   8702 C CG  . PRO B 1 533 ? -15.710 -16.409 2.380  1.00 51.89 ? 533  PRO B CG  1 
ATOM   8703 C CD  . PRO B 1 533 ? -14.805 -17.613 2.381  1.00 50.51 ? 533  PRO B CD  1 
ATOM   8704 N N   . VAL B 1 534 ? -15.988 -15.924 6.611  1.00 49.18 ? 534  VAL B N   1 
ATOM   8705 C CA  . VAL B 1 534 ? -17.026 -15.910 7.633  1.00 47.33 ? 534  VAL B CA  1 
ATOM   8706 C C   . VAL B 1 534 ? -17.870 -14.649 7.430  1.00 47.08 ? 534  VAL B C   1 
ATOM   8707 O O   . VAL B 1 534 ? -17.342 -13.595 7.086  1.00 47.70 ? 534  VAL B O   1 
ATOM   8708 C CB  . VAL B 1 534 ? -16.399 -15.905 9.054  1.00 46.62 ? 534  VAL B CB  1 
ATOM   8709 C CG1 . VAL B 1 534 ? -17.482 -15.777 10.110 1.00 45.99 ? 534  VAL B CG1 1 
ATOM   8710 C CG2 . VAL B 1 534 ? -15.607 -17.185 9.273  1.00 44.91 ? 534  VAL B CG2 1 
ATOM   8711 N N   . THR B 1 535 ? -19.179 -14.761 7.635  1.00 47.51 ? 535  THR B N   1 
ATOM   8712 C CA  . THR B 1 535 ? -20.081 -13.625 7.447  1.00 48.42 ? 535  THR B CA  1 
ATOM   8713 C C   . THR B 1 535 ? -21.200 -13.603 8.482  1.00 48.20 ? 535  THR B C   1 
ATOM   8714 O O   . THR B 1 535 ? -22.168 -12.855 8.340  1.00 48.66 ? 535  THR B O   1 
ATOM   8715 C CB  . THR B 1 535 ? -20.745 -13.680 6.057  1.00 50.01 ? 535  THR B CB  1 
ATOM   8716 O OG1 . THR B 1 535 ? -21.451 -14.922 5.920  1.00 50.82 ? 535  THR B OG1 1 
ATOM   8717 C CG2 . THR B 1 535 ? -19.705 -13.574 4.957  1.00 49.39 ? 535  THR B CG2 1 
ATOM   8718 N N   . SER B 1 536 ? -21.059 -14.418 9.522  1.00 47.07 ? 536  SER B N   1 
ATOM   8719 C CA  . SER B 1 536 ? -22.067 -14.532 10.572 1.00 47.27 ? 536  SER B CA  1 
ATOM   8720 C C   . SER B 1 536 ? -21.999 -13.492 11.690 1.00 46.24 ? 536  SER B C   1 
ATOM   8721 O O   . SER B 1 536 ? -22.889 -13.441 12.540 1.00 45.97 ? 536  SER B O   1 
ATOM   8722 C CB  . SER B 1 536 ? -21.988 -15.923 11.196 1.00 47.77 ? 536  SER B CB  1 
ATOM   8723 O OG  . SER B 1 536 ? -20.678 -16.172 11.680 1.00 49.76 ? 536  SER B OG  1 
ATOM   8724 N N   . HIS B 1 537 ? -20.948 -12.679 11.701 1.00 44.33 ? 537  HIS B N   1 
ATOM   8725 C CA  . HIS B 1 537 ? -20.783 -11.656 12.736 1.00 44.03 ? 537  HIS B CA  1 
ATOM   8726 C C   . HIS B 1 537 ? -20.891 -10.272 12.107 1.00 43.03 ? 537  HIS B C   1 
ATOM   8727 O O   . HIS B 1 537 ? -21.212 -10.140 10.926 1.00 42.59 ? 537  HIS B O   1 
ATOM   8728 C CB  . HIS B 1 537 ? -19.401 -11.781 13.393 1.00 43.54 ? 537  HIS B CB  1 
ATOM   8729 C CG  . HIS B 1 537 ? -19.102 -13.141 13.941 1.00 44.65 ? 537  HIS B CG  1 
ATOM   8730 N ND1 . HIS B 1 537 ? -19.484 -13.537 15.204 1.00 45.20 ? 537  HIS B ND1 1 
ATOM   8731 C CD2 . HIS B 1 537 ? -18.462 -14.202 13.391 1.00 45.60 ? 537  HIS B CD2 1 
ATOM   8732 C CE1 . HIS B 1 537 ? -19.091 -14.782 15.411 1.00 45.38 ? 537  HIS B CE1 1 
ATOM   8733 N NE2 . HIS B 1 537 ? -18.469 -15.208 14.326 1.00 46.13 ? 537  HIS B NE2 1 
ATOM   8734 N N   . ASP B 1 538 ? -20.625 -9.239  12.902 1.00 41.89 ? 538  ASP B N   1 
ATOM   8735 C CA  . ASP B 1 538 ? -20.648 -7.874  12.394 1.00 39.29 ? 538  ASP B CA  1 
ATOM   8736 C C   . ASP B 1 538 ? -19.497 -7.823  11.391 1.00 38.97 ? 538  ASP B C   1 
ATOM   8737 O O   . ASP B 1 538 ? -18.624 -8.696  11.414 1.00 39.31 ? 538  ASP B O   1 
ATOM   8738 C CB  . ASP B 1 538 ? -20.413 -6.895  13.543 1.00 41.65 ? 538  ASP B CB  1 
ATOM   8739 C CG  . ASP B 1 538 ? -19.099 -7.145  14.247 1.00 38.25 ? 538  ASP B CG  1 
ATOM   8740 O OD1 . ASP B 1 538 ? -18.062 -6.703  13.724 1.00 40.12 ? 538  ASP B OD1 1 
ATOM   8741 O OD2 . ASP B 1 538 ? -19.106 -7.805  15.304 1.00 39.56 ? 538  ASP B OD2 1 
ATOM   8742 N N   . SER B 1 539 ? -19.486 -6.822  10.515 1.00 38.18 ? 539  SER B N   1 
ATOM   8743 C CA  . SER B 1 539 ? -18.447 -6.717  9.489  1.00 38.96 ? 539  SER B CA  1 
ATOM   8744 C C   . SER B 1 539 ? -17.003 -6.633  9.985  1.00 37.69 ? 539  SER B C   1 
ATOM   8745 O O   . SER B 1 539 ? -16.084 -7.046  9.281  1.00 37.62 ? 539  SER B O   1 
ATOM   8746 C CB  . SER B 1 539 ? -18.730 -5.527  8.561  1.00 39.24 ? 539  SER B CB  1 
ATOM   8747 O OG  . SER B 1 539 ? -18.732 -4.297  9.258  1.00 39.20 ? 539  SER B OG  1 
ATOM   8748 N N   . SER B 1 540 ? -16.793 -6.089  11.179 1.00 37.87 ? 540  SER B N   1 
ATOM   8749 C CA  . SER B 1 540 ? -15.435 -5.989  11.711 1.00 36.10 ? 540  SER B CA  1 
ATOM   8750 C C   . SER B 1 540 ? -14.917 -7.382  12.066 1.00 36.15 ? 540  SER B C   1 
ATOM   8751 O O   . SER B 1 540 ? -13.863 -7.816  11.582 1.00 35.54 ? 540  SER B O   1 
ATOM   8752 C CB  . SER B 1 540 ? -15.403 -5.094  12.954 1.00 33.71 ? 540  SER B CB  1 
ATOM   8753 O OG  . SER B 1 540 ? -14.107 -5.096  13.541 1.00 33.18 ? 540  SER B OG  1 
ATOM   8754 N N   . THR B 1 541 ? -15.662 -8.078  12.916 1.00 35.81 ? 541  THR B N   1 
ATOM   8755 C CA  . THR B 1 541 ? -15.284 -9.429  13.321 1.00 37.32 ? 541  THR B CA  1 
ATOM   8756 C C   . THR B 1 541 ? -15.105 -10.301 12.077 1.00 37.49 ? 541  THR B C   1 
ATOM   8757 O O   . THR B 1 541 ? -14.154 -11.081 11.994 1.00 37.40 ? 541  THR B O   1 
ATOM   8758 C CB  . THR B 1 541 ? -16.353 -10.040 14.251 1.00 35.82 ? 541  THR B CB  1 
ATOM   8759 O OG1 . THR B 1 541 ? -16.549 -9.168  15.372 1.00 37.15 ? 541  THR B OG1 1 
ATOM   8760 C CG2 . THR B 1 541 ? -15.906 -11.410 14.776 1.00 36.41 ? 541  THR B CG2 1 
ATOM   8761 N N   . ASN B 1 542 ? -16.013 -10.154 11.108 1.00 38.60 ? 542  ASN B N   1 
ATOM   8762 C CA  . ASN B 1 542 ? -15.945 -10.913 9.851  1.00 37.34 ? 542  ASN B CA  1 
ATOM   8763 C C   . ASN B 1 542 ? -14.653 -10.574 9.120  1.00 36.75 ? 542  ASN B C   1 
ATOM   8764 O O   . ASN B 1 542 ? -13.889 -11.463 8.724  1.00 35.64 ? 542  ASN B O   1 
ATOM   8765 C CB  . ASN B 1 542 ? -17.114 -10.554 8.921  1.00 39.50 ? 542  ASN B CB  1 
ATOM   8766 C CG  . ASN B 1 542 ? -18.437 -11.156 9.356  1.00 39.31 ? 542  ASN B CG  1 
ATOM   8767 O OD1 . ASN B 1 542 ? -19.489 -10.814 8.806  1.00 42.70 ? 542  ASN B OD1 1 
ATOM   8768 N ND2 . ASN B 1 542 ? -18.399 -12.055 10.326 1.00 39.89 ? 542  ASN B ND2 1 
ATOM   8769 N N   . GLY B 1 543 ? -14.425 -9.275  8.930  1.00 34.34 ? 543  GLY B N   1 
ATOM   8770 C CA  . GLY B 1 543 ? -13.235 -8.816  8.238  1.00 33.88 ? 543  GLY B CA  1 
ATOM   8771 C C   . GLY B 1 543 ? -11.935 -9.253  8.887  1.00 33.12 ? 543  GLY B C   1 
ATOM   8772 O O   . GLY B 1 543 ? -10.986 -9.614  8.193  1.00 32.09 ? 543  GLY B O   1 
ATOM   8773 N N   . LEU B 1 544 ? -11.884 -9.214  10.218 1.00 33.30 ? 544  LEU B N   1 
ATOM   8774 C CA  . LEU B 1 544 ? -10.686 -9.617  10.946 1.00 32.85 ? 544  LEU B CA  1 
ATOM   8775 C C   . LEU B 1 544 ? -10.442 -11.116 10.761 1.00 33.10 ? 544  LEU B C   1 
ATOM   8776 O O   . LEU B 1 544 ? -9.308  -11.552 10.560 1.00 34.50 ? 544  LEU B O   1 
ATOM   8777 C CB  . LEU B 1 544 ? -10.843 -9.292  12.435 1.00 31.21 ? 544  LEU B CB  1 
ATOM   8778 C CG  . LEU B 1 544 ? -10.861 -7.816  12.839 1.00 30.48 ? 544  LEU B CG  1 
ATOM   8779 C CD1 . LEU B 1 544 ? -11.285 -7.683  14.297 1.00 31.02 ? 544  LEU B CD1 1 
ATOM   8780 C CD2 . LEU B 1 544 ? -9.487  -7.219  12.618 1.00 31.42 ? 544  LEU B CD2 1 
ATOM   8781 N N   . ILE B 1 545 ? -11.519 -11.893 10.835 1.00 34.85 ? 545  ILE B N   1 
ATOM   8782 C CA  . ILE B 1 545 ? -11.451 -13.341 10.660 1.00 35.60 ? 545  ILE B CA  1 
ATOM   8783 C C   . ILE B 1 545 ? -10.991 -13.682 9.244  1.00 36.12 ? 545  ILE B C   1 
ATOM   8784 O O   . ILE B 1 545 ? -10.182 -14.587 9.039  1.00 35.92 ? 545  ILE B O   1 
ATOM   8785 C CB  . ILE B 1 545 ? -12.838 -13.997 10.896 1.00 34.32 ? 545  ILE B CB  1 
ATOM   8786 C CG1 . ILE B 1 545 ? -13.198 -13.948 12.380 1.00 34.73 ? 545  ILE B CG1 1 
ATOM   8787 C CG2 . ILE B 1 545 ? -12.833 -15.434 10.387 1.00 36.15 ? 545  ILE B CG2 1 
ATOM   8788 C CD1 . ILE B 1 545 ? -14.616 -14.421 12.694 1.00 32.85 ? 545  ILE B CD1 1 
ATOM   8789 N N   . ASN B 1 546 ? -11.507 -12.955 8.261  1.00 36.62 ? 546  ASN B N   1 
ATOM   8790 C CA  . ASN B 1 546 ? -11.130 -13.220 6.882  1.00 36.42 ? 546  ASN B CA  1 
ATOM   8791 C C   . ASN B 1 546 ? -9.691  -12.797 6.581  1.00 36.85 ? 546  ASN B C   1 
ATOM   8792 O O   . ASN B 1 546 ? -9.009  -13.434 5.783  1.00 38.14 ? 546  ASN B O   1 
ATOM   8793 C CB  . ASN B 1 546 ? -12.149 -12.574 5.935  1.00 35.32 ? 546  ASN B CB  1 
ATOM   8794 C CG  . ASN B 1 546 ? -13.534 -13.212 6.072  1.00 38.16 ? 546  ASN B CG  1 
ATOM   8795 O OD1 . ASN B 1 546 ? -13.641 -14.418 6.298  1.00 38.41 ? 546  ASN B OD1 1 
ATOM   8796 N ND2 . ASN B 1 546 ? -14.591 -12.413 5.938  1.00 38.91 ? 546  ASN B ND2 1 
ATOM   8797 N N   . PHE B 1 547 ? -9.219  -11.748 7.246  1.00 36.61 ? 547  PHE B N   1 
ATOM   8798 C CA  . PHE B 1 547 ? -7.843  -11.290 7.065  1.00 37.06 ? 547  PHE B CA  1 
ATOM   8799 C C   . PHE B 1 547 ? -6.952  -12.351 7.705  1.00 37.20 ? 547  PHE B C   1 
ATOM   8800 O O   . PHE B 1 547 ? -5.827  -12.590 7.270  1.00 35.71 ? 547  PHE B O   1 
ATOM   8801 C CB  . PHE B 1 547 ? -7.625  -9.951  7.774  1.00 36.28 ? 547  PHE B CB  1 
ATOM   8802 C CG  . PHE B 1 547 ? -6.199  -9.474  7.752  1.00 36.45 ? 547  PHE B CG  1 
ATOM   8803 C CD1 . PHE B 1 547 ? -5.646  -8.935  6.594  1.00 37.67 ? 547  PHE B CD1 1 
ATOM   8804 C CD2 . PHE B 1 547 ? -5.404  -9.573  8.890  1.00 36.48 ? 547  PHE B CD2 1 
ATOM   8805 C CE1 . PHE B 1 547 ? -4.319  -8.498  6.567  1.00 37.50 ? 547  PHE B CE1 1 
ATOM   8806 C CE2 . PHE B 1 547 ? -4.080  -9.143  8.876  1.00 37.30 ? 547  PHE B CE2 1 
ATOM   8807 C CZ  . PHE B 1 547 ? -3.535  -8.603  7.713  1.00 38.00 ? 547  PHE B CZ  1 
ATOM   8808 N N   . ILE B 1 548 ? -7.481  -12.979 8.750  1.00 37.44 ? 548  ILE B N   1 
ATOM   8809 C CA  . ILE B 1 548 ? -6.768  -14.027 9.467  1.00 40.56 ? 548  ILE B CA  1 
ATOM   8810 C C   . ILE B 1 548 ? -6.550  -15.238 8.568  1.00 38.48 ? 548  ILE B C   1 
ATOM   8811 O O   . ILE B 1 548 ? -5.430  -15.725 8.422  1.00 36.60 ? 548  ILE B O   1 
ATOM   8812 C CB  . ILE B 1 548 ? -7.559  -14.460 10.733 1.00 41.13 ? 548  ILE B CB  1 
ATOM   8813 C CG1 . ILE B 1 548 ? -7.356  -13.432 11.851 1.00 43.85 ? 548  ILE B CG1 1 
ATOM   8814 C CG2 . ILE B 1 548 ? -7.145  -15.849 11.168 1.00 43.63 ? 548  ILE B CG2 1 
ATOM   8815 C CD1 . ILE B 1 548 ? -5.906  -13.111 12.127 1.00 45.93 ? 548  ILE B CD1 1 
ATOM   8816 N N   . LYS B 1 549 ? -7.630  -15.719 7.965  1.00 39.55 ? 549  LYS B N   1 
ATOM   8817 C CA  . LYS B 1 549 ? -7.550  -16.875 7.083  1.00 41.35 ? 549  LYS B CA  1 
ATOM   8818 C C   . LYS B 1 549 ? -6.678  -16.587 5.869  1.00 40.96 ? 549  LYS B C   1 
ATOM   8819 O O   . LYS B 1 549 ? -5.929  -17.448 5.414  1.00 41.37 ? 549  LYS B O   1 
ATOM   8820 C CB  . LYS B 1 549 ? -8.955  -17.298 6.650  1.00 42.56 ? 549  LYS B CB  1 
ATOM   8821 C CG  . LYS B 1 549 ? -9.832  -17.698 7.827  1.00 45.33 ? 549  LYS B CG  1 
ATOM   8822 C CD  . LYS B 1 549 ? -11.096 -18.403 7.386  1.00 47.26 ? 549  LYS B CD  1 
ATOM   8823 C CE  . LYS B 1 549 ? -11.937 -18.782 8.589  1.00 47.31 ? 549  LYS B CE  1 
ATOM   8824 N NZ  . LYS B 1 549 ? -12.910 -19.849 8.260  1.00 47.08 ? 549  LYS B NZ  1 
ATOM   8825 N N   . GLN B 1 550 ? -6.764  -15.367 5.354  1.00 41.28 ? 550  GLN B N   1 
ATOM   8826 C CA  . GLN B 1 550 ? -5.966  -14.979 4.201  1.00 42.79 ? 550  GLN B CA  1 
ATOM   8827 C C   . GLN B 1 550 ? -4.464  -14.984 4.494  1.00 43.40 ? 550  GLN B C   1 
ATOM   8828 O O   . GLN B 1 550 ? -3.681  -15.543 3.729  1.00 44.08 ? 550  GLN B O   1 
ATOM   8829 C CB  . GLN B 1 550 ? -6.369  -13.583 3.712  1.00 42.24 ? 550  GLN B CB  1 
ATOM   8830 C CG  . GLN B 1 550 ? -5.372  -12.995 2.717  1.00 45.47 ? 550  GLN B CG  1 
ATOM   8831 C CD  . GLN B 1 550 ? -5.678  -11.558 2.341  1.00 46.66 ? 550  GLN B CD  1 
ATOM   8832 O OE1 . GLN B 1 550 ? -6.636  -11.279 1.616  1.00 49.24 ? 550  GLN B OE1 1 
ATOM   8833 N NE2 . GLN B 1 550 ? -4.865  -10.636 2.837  1.00 46.20 ? 550  GLN B NE2 1 
ATOM   8834 N N   . GLN B 1 551 ? -4.063  -14.358 5.597  1.00 42.50 ? 551  GLN B N   1 
ATOM   8835 C CA  . GLN B 1 551 ? -2.651  -14.282 5.944  1.00 43.56 ? 551  GLN B CA  1 
ATOM   8836 C C   . GLN B 1 551 ? -2.096  -15.546 6.585  1.00 45.52 ? 551  GLN B C   1 
ATOM   8837 O O   . GLN B 1 551 ? -0.891  -15.660 6.808  1.00 43.97 ? 551  GLN B O   1 
ATOM   8838 C CB  . GLN B 1 551 ? -2.400  -13.069 6.844  1.00 42.93 ? 551  GLN B CB  1 
ATOM   8839 C CG  . GLN B 1 551 ? -2.565  -11.744 6.113  1.00 41.90 ? 551  GLN B CG  1 
ATOM   8840 C CD  . GLN B 1 551 ? -1.508  -11.539 5.041  1.00 40.45 ? 551  GLN B CD  1 
ATOM   8841 O OE1 . GLN B 1 551 ? -1.784  -10.992 3.971  1.00 44.53 ? 551  GLN B OE1 1 
ATOM   8842 N NE2 . GLN B 1 551 ? -0.291  -11.967 5.327  1.00 40.79 ? 551  GLN B NE2 1 
ATOM   8843 N N   . ARG B 1 552 ? -2.975  -16.498 6.871  1.00 48.35 ? 552  ARG B N   1 
ATOM   8844 C CA  . ARG B 1 552 ? -2.559  -17.763 7.461  1.00 53.05 ? 552  ARG B CA  1 
ATOM   8845 C C   . ARG B 1 552 ? -1.576  -18.411 6.485  1.00 55.39 ? 552  ARG B C   1 
ATOM   8846 O O   . ARG B 1 552 ? -0.631  -19.090 6.889  1.00 55.72 ? 552  ARG B O   1 
ATOM   8847 C CB  . ARG B 1 552 ? -3.779  -18.667 7.653  1.00 52.95 ? 552  ARG B CB  1 
ATOM   8848 C CG  . ARG B 1 552 ? -3.502  -20.002 8.315  1.00 54.40 ? 552  ARG B CG  1 
ATOM   8849 C CD  . ARG B 1 552 ? -4.768  -20.844 8.326  1.00 55.58 ? 552  ARG B CD  1 
ATOM   8850 N NE  . ARG B 1 552 ? -5.884  -20.124 8.932  1.00 55.34 ? 552  ARG B NE  1 
ATOM   8851 C CZ  . ARG B 1 552 ? -7.142  -20.551 8.940  1.00 56.75 ? 552  ARG B CZ  1 
ATOM   8852 N NH1 . ARG B 1 552 ? -7.463  -21.702 8.370  1.00 59.37 ? 552  ARG B NH1 1 
ATOM   8853 N NH2 . ARG B 1 552 ? -8.084  -19.825 9.523  1.00 59.41 ? 552  ARG B NH2 1 
ATOM   8854 N N   . GLU B 1 553 ? -1.813  -18.179 5.197  1.00 58.79 ? 553  GLU B N   1 
ATOM   8855 C CA  . GLU B 1 553 ? -0.977  -18.723 4.131  1.00 62.01 ? 553  GLU B CA  1 
ATOM   8856 C C   . GLU B 1 553 ? 0.334   -17.960 3.944  1.00 62.12 ? 553  GLU B C   1 
ATOM   8857 O O   . GLU B 1 553 ? 1.394   -18.568 3.804  1.00 62.37 ? 553  GLU B O   1 
ATOM   8858 C CB  . GLU B 1 553 ? -1.747  -18.721 2.804  1.00 64.56 ? 553  GLU B CB  1 
ATOM   8859 C CG  . GLU B 1 553 ? -3.069  -19.479 2.825  1.00 68.80 ? 553  GLU B CG  1 
ATOM   8860 C CD  . GLU B 1 553 ? -3.853  -19.319 1.529  1.00 71.58 ? 553  GLU B CD  1 
ATOM   8861 O OE1 . GLU B 1 553 ? -5.094  -19.465 1.556  1.00 73.78 ? 553  GLU B OE1 1 
ATOM   8862 O OE2 . GLU B 1 553 ? -3.226  -19.035 0.484  1.00 72.93 ? 553  GLU B OE2 1 
ATOM   8863 N N   . ALA B 1 554 ? 0.250   -16.632 3.934  1.00 61.83 ? 554  ALA B N   1 
ATOM   8864 C CA  . ALA B 1 554 ? 1.410   -15.763 3.746  1.00 62.77 ? 554  ALA B CA  1 
ATOM   8865 C C   . ALA B 1 554 ? 2.742   -16.396 4.145  1.00 63.59 ? 554  ALA B C   1 
ATOM   8866 O O   . ALA B 1 554 ? 2.892   -16.916 5.249  1.00 64.02 ? 554  ALA B O   1 
ATOM   8867 C CB  . ALA B 1 554 ? 1.207   -14.462 4.510  1.00 63.42 ? 554  ALA B CB  1 
ATOM   8868 N N   . LYS B 1 555 ? 3.709   -16.344 3.235  1.00 64.31 ? 555  LYS B N   1 
ATOM   8869 C CA  . LYS B 1 555 ? 5.029   -16.907 3.485  1.00 65.28 ? 555  LYS B CA  1 
ATOM   8870 C C   . LYS B 1 555 ? 6.072   -15.801 3.612  1.00 66.38 ? 555  LYS B C   1 
ATOM   8871 O O   . LYS B 1 555 ? 6.760   -15.469 2.648  1.00 67.00 ? 555  LYS B O   1 
ATOM   8872 C CB  . LYS B 1 555 ? 5.411   -17.862 2.359  1.00 65.45 ? 555  LYS B CB  1 
ATOM   8873 N N   . ILE B 1 556 ? 6.179   -15.232 4.808  1.00 67.22 ? 556  ILE B N   1 
ATOM   8874 C CA  . ILE B 1 556 ? 7.141   -14.168 5.068  1.00 68.53 ? 556  ILE B CA  1 
ATOM   8875 C C   . ILE B 1 556 ? 8.371   -14.744 5.758  1.00 70.06 ? 556  ILE B C   1 
ATOM   8876 O O   . ILE B 1 556 ? 8.420   -15.980 5.943  1.00 70.24 ? 556  ILE B O   1 
ATOM   8877 C CB  . ILE B 1 556 ? 6.507   -13.091 5.940  1.00 68.24 ? 556  ILE B CB  1 
HETATM 8878 C C2  . PAN C 2 .   ? 15.254  9.386   30.024 1.00 51.89 ? 902  PAN A C2  1 
HETATM 8879 C C3  . PAN C 2 .   ? 16.745  8.911   29.864 1.00 49.40 ? 902  PAN A C3  1 
HETATM 8880 C C4  . PAN C 2 .   ? 17.244  8.170   31.150 1.00 50.12 ? 902  PAN A C4  1 
HETATM 8881 C C5  . PAN C 2 .   ? 18.724  7.738   30.881 1.00 48.94 ? 902  PAN A C5  1 
HETATM 8882 O O2  . PAN C 2 .   ? 14.471  8.212   30.325 1.00 52.44 ? 902  PAN A O2  1 
HETATM 8883 O O3  . PAN C 2 .   ? 16.837  7.932   28.848 1.00 48.40 ? 902  PAN A O3  1 
HETATM 8884 O O4  . PAN C 2 .   ? 17.174  9.145   32.205 1.00 47.07 ? 902  PAN A O4  1 
HETATM 8885 O O5  . PAN C 2 .   ? 19.443  9.016   30.592 1.00 50.32 ? 902  PAN A O5  1 
HETATM 8886 P P   . PAN C 2 .   ? 21.003  8.656   30.198 1.00 50.90 ? 902  PAN A P   1 
HETATM 8887 O O1P . PAN C 2 .   ? 21.688  7.850   31.309 1.00 50.64 ? 902  PAN A O1P 1 
HETATM 8888 O O2P . PAN C 2 .   ? 21.031  7.776   28.963 1.00 50.06 ? 902  PAN A O2P 1 
HETATM 8889 O O3P . PAN C 2 .   ? 21.659  10.015  29.921 1.00 52.71 ? 902  PAN A O3P 1 
HETATM 8890 C C1  . PAN C 2 .   ? 15.016  10.148  28.676 1.00 53.14 ? 902  PAN A C1  1 
HETATM 8891 O O1  . PAN C 2 .   ? 15.509  11.145  28.161 1.00 55.15 ? 902  PAN A O1  1 
HETATM 8892 N N   . PAN C 2 .   ? 14.061  9.504   28.032 1.00 52.20 ? 902  PAN A N   1 
HETATM 8893 O ON1 . PAN C 2 .   ? 13.561  9.926   26.731 1.00 51.61 ? 902  PAN A ON1 1 
HETATM 8894 C C2  . PAN D 2 .   ? -10.333 -15.359 37.874 1.00 39.13 ? 901  PAN B C2  1 
HETATM 8895 C C3  . PAN D 2 .   ? -9.913  -16.869 38.008 1.00 38.21 ? 901  PAN B C3  1 
HETATM 8896 C C4  . PAN D 2 .   ? -9.209  -17.378 36.705 1.00 37.08 ? 901  PAN B C4  1 
HETATM 8897 C C5  . PAN D 2 .   ? -8.829  -18.876 36.948 1.00 36.28 ? 901  PAN B C5  1 
HETATM 8898 O O2  . PAN D 2 .   ? -9.135  -14.617 37.567 1.00 36.77 ? 901  PAN B O2  1 
HETATM 8899 O O3  . PAN D 2 .   ? -8.925  -17.012 39.009 1.00 40.76 ? 901  PAN B O3  1 
HETATM 8900 O O4  . PAN D 2 .   ? -10.194 -17.256 35.665 1.00 38.71 ? 901  PAN B O4  1 
HETATM 8901 O O5  . PAN D 2 .   ? -10.130 -19.551 37.245 1.00 32.57 ? 901  PAN B O5  1 
HETATM 8902 P P   . PAN D 2 .   ? -9.823  -21.128 37.614 1.00 33.17 ? 901  PAN B P   1 
HETATM 8903 O O1P . PAN D 2 .   ? -9.059  -21.828 36.483 1.00 30.11 ? 901  PAN B O1P 1 
HETATM 8904 O O2P . PAN D 2 .   ? -8.929  -21.207 38.836 1.00 34.85 ? 901  PAN B O2P 1 
HETATM 8905 O O3P . PAN D 2 .   ? -11.202 -21.737 37.901 1.00 36.52 ? 901  PAN B O3P 1 
HETATM 8906 C C1  . PAN D 2 .   ? -11.068 -15.111 39.236 1.00 38.24 ? 901  PAN B C1  1 
HETATM 8907 O O1  . PAN D 2 .   ? -12.076 -15.573 39.758 1.00 41.67 ? 901  PAN B O1  1 
HETATM 8908 N N   . PAN D 2 .   ? -10.380 -14.190 39.883 1.00 38.90 ? 901  PAN B N   1 
HETATM 8909 O ON1 . PAN D 2 .   ? -10.765 -13.693 41.197 1.00 38.61 ? 901  PAN B ON1 1 
HETATM 8910 O O   . HOH E 3 .   ? 0.091   -4.142  34.753 1.00 31.10 ? 903  HOH A O   1 
HETATM 8911 O O   . HOH E 3 .   ? -3.954  4.041   19.268 1.00 29.75 ? 904  HOH A O   1 
HETATM 8912 O O   . HOH E 3 .   ? 8.432   -7.445  24.993 1.00 30.51 ? 905  HOH A O   1 
HETATM 8913 O O   . HOH E 3 .   ? 1.475   -0.207  34.634 1.00 27.71 ? 906  HOH A O   1 
HETATM 8914 O O   . HOH E 3 .   ? -10.400 -8.111  17.558 1.00 32.07 ? 907  HOH A O   1 
HETATM 8915 O O   . HOH E 3 .   ? 2.713   -5.427  26.915 1.00 29.15 ? 908  HOH A O   1 
HETATM 8916 O O   . HOH E 3 .   ? 19.349  -1.968  30.857 1.00 34.30 ? 909  HOH A O   1 
HETATM 8917 O O   . HOH E 3 .   ? 14.479  -5.293  45.790 1.00 31.50 ? 910  HOH A O   1 
HETATM 8918 O O   . HOH E 3 .   ? -15.092 -2.850  20.637 1.00 29.82 ? 911  HOH A O   1 
HETATM 8919 O O   . HOH E 3 .   ? -1.250  14.789  30.501 1.00 33.52 ? 912  HOH A O   1 
HETATM 8920 O O   . HOH E 3 .   ? 9.933   5.061   20.789 1.00 31.59 ? 913  HOH A O   1 
HETATM 8921 O O   . HOH E 3 .   ? -9.694  18.554  27.125 1.00 32.88 ? 914  HOH A O   1 
HETATM 8922 O O   . HOH E 3 .   ? 0.951   -14.369 19.557 1.00 33.13 ? 915  HOH A O   1 
HETATM 8923 O O   . HOH E 3 .   ? 4.130   -4.194  29.219 1.00 28.43 ? 916  HOH A O   1 
HETATM 8924 O O   . HOH E 3 .   ? -11.744 -4.047  17.234 1.00 34.95 ? 917  HOH A O   1 
HETATM 8925 O O   . HOH E 3 .   ? 12.803  12.056  14.040 1.00 42.04 ? 918  HOH A O   1 
HETATM 8926 O O   . HOH E 3 .   ? 18.484  -1.089  47.436 1.00 34.59 ? 919  HOH A O   1 
HETATM 8927 O O   . HOH E 3 .   ? -11.842 -1.659  15.663 1.00 32.38 ? 920  HOH A O   1 
HETATM 8928 O O   . HOH E 3 .   ? 21.188  -2.405  41.015 1.00 34.24 ? 921  HOH A O   1 
HETATM 8929 O O   . HOH E 3 .   ? -21.485 -2.848  31.224 1.00 33.70 ? 922  HOH A O   1 
HETATM 8930 O O   . HOH E 3 .   ? -11.369 -15.538 29.315 1.00 36.14 ? 923  HOH A O   1 
HETATM 8931 O O   . HOH E 3 .   ? -5.992  9.608   37.661 1.00 34.98 ? 924  HOH A O   1 
HETATM 8932 O O   . HOH E 3 .   ? -4.727  -8.618  28.546 1.00 26.09 ? 925  HOH A O   1 
HETATM 8933 O O   . HOH E 3 .   ? -12.051 -14.374 31.510 1.00 32.88 ? 926  HOH A O   1 
HETATM 8934 O O   . HOH E 3 .   ? 10.143  4.892   24.798 1.00 36.28 ? 927  HOH A O   1 
HETATM 8935 O O   . HOH E 3 .   ? 7.880   10.645  15.748 1.00 44.87 ? 928  HOH A O   1 
HETATM 8936 O O   . HOH E 3 .   ? -13.187 0.162   25.366 1.00 37.08 ? 929  HOH A O   1 
HETATM 8937 O O   . HOH E 3 .   ? 5.240   -13.508 18.270 1.00 36.92 ? 930  HOH A O   1 
HETATM 8938 O O   . HOH E 3 .   ? 14.341  2.861   24.841 1.00 39.88 ? 931  HOH A O   1 
HETATM 8939 O O   . HOH E 3 .   ? 14.030  18.729  28.936 1.00 37.54 ? 932  HOH A O   1 
HETATM 8940 O O   . HOH E 3 .   ? 7.811   15.391  61.514 1.00 43.90 ? 933  HOH A O   1 
HETATM 8941 O O   . HOH E 3 .   ? -4.442  8.382   22.360 1.00 33.53 ? 934  HOH A O   1 
HETATM 8942 O O   . HOH E 3 .   ? -7.864  8.344   26.406 1.00 30.51 ? 935  HOH A O   1 
HETATM 8943 O O   . HOH E 3 .   ? 0.671   -13.248 30.261 1.00 37.28 ? 936  HOH A O   1 
HETATM 8944 O O   . HOH E 3 .   ? -0.123  -18.893 20.162 1.00 33.02 ? 937  HOH A O   1 
HETATM 8945 O O   . HOH E 3 .   ? 4.781   16.293  18.708 1.00 34.16 ? 938  HOH A O   1 
HETATM 8946 O O   . HOH E 3 .   ? -6.902  7.874   23.878 1.00 39.00 ? 939  HOH A O   1 
HETATM 8947 O O   . HOH E 3 .   ? -17.815 3.905   30.438 1.00 52.49 ? 940  HOH A O   1 
HETATM 8948 O O   . HOH E 3 .   ? -0.427  -23.346 18.678 1.00 27.76 ? 941  HOH A O   1 
HETATM 8949 O O   . HOH E 3 .   ? -19.040 -6.110  27.085 1.00 32.38 ? 942  HOH A O   1 
HETATM 8950 O O   . HOH E 3 .   ? 13.978  14.012  20.641 1.00 39.37 ? 943  HOH A O   1 
HETATM 8951 O O   . HOH E 3 .   ? 0.777   10.538  27.541 1.00 34.44 ? 944  HOH A O   1 
HETATM 8952 O O   . HOH E 3 .   ? 13.075  13.296  23.103 1.00 39.01 ? 945  HOH A O   1 
HETATM 8953 O O   . HOH E 3 .   ? -0.369  11.489  23.932 1.00 36.07 ? 946  HOH A O   1 
HETATM 8954 O O   . HOH E 3 .   ? 0.973   -21.301 19.781 1.00 28.22 ? 947  HOH A O   1 
HETATM 8955 O O   . HOH E 3 .   ? 14.546  12.010  18.828 1.00 37.89 ? 948  HOH A O   1 
HETATM 8956 O O   . HOH E 3 .   ? -21.646 1.931   30.029 1.00 44.39 ? 949  HOH A O   1 
HETATM 8957 O O   . HOH E 3 .   ? 2.693   -3.162  31.567 1.00 36.38 ? 950  HOH A O   1 
HETATM 8958 O O   . HOH E 3 .   ? 22.148  -1.955  24.311 1.00 37.25 ? 951  HOH A O   1 
HETATM 8959 O O   . HOH E 3 .   ? -7.354  5.308   21.029 1.00 38.56 ? 952  HOH A O   1 
HETATM 8960 O O   . HOH E 3 .   ? 5.512   21.232  25.877 1.00 39.73 ? 953  HOH A O   1 
HETATM 8961 O O   . HOH E 3 .   ? -1.835  8.434   23.102 1.00 35.43 ? 954  HOH A O   1 
HETATM 8962 O O   . HOH E 3 .   ? -12.766 -14.171 25.833 1.00 36.78 ? 955  HOH A O   1 
HETATM 8963 O O   . HOH E 3 .   ? 0.936   -20.040 12.940 1.00 36.85 ? 956  HOH A O   1 
HETATM 8964 O O   . HOH E 3 .   ? 13.841  3.581   22.295 1.00 34.14 ? 957  HOH A O   1 
HETATM 8965 O O   . HOH E 3 .   ? 13.944  1.749   32.773 1.00 34.55 ? 958  HOH A O   1 
HETATM 8966 O O   . HOH E 3 .   ? 23.810  5.354   14.180 1.00 39.22 ? 959  HOH A O   1 
HETATM 8967 O O   . HOH E 3 .   ? -14.957 9.526   29.927 1.00 39.49 ? 960  HOH A O   1 
HETATM 8968 O O   . HOH E 3 .   ? -13.191 -11.004 30.188 1.00 28.85 ? 961  HOH A O   1 
HETATM 8969 O O   . HOH E 3 .   ? -2.971  -21.666 14.332 1.00 47.73 ? 962  HOH A O   1 
HETATM 8970 O O   . HOH E 3 .   ? 6.939   1.962   31.810 1.00 35.36 ? 963  HOH A O   1 
HETATM 8971 O O   . HOH E 3 .   ? 8.996   9.766   62.302 1.00 38.70 ? 964  HOH A O   1 
HETATM 8972 O O   . HOH E 3 .   ? -20.027 -3.890  28.337 1.00 27.66 ? 965  HOH A O   1 
HETATM 8973 O O   . HOH E 3 .   ? 4.847   -16.127 18.487 1.00 32.21 ? 966  HOH A O   1 
HETATM 8974 O O   . HOH E 3 .   ? 20.959  4.324   13.524 1.00 39.80 ? 967  HOH A O   1 
HETATM 8975 O O   . HOH E 3 .   ? 12.687  -1.825  32.880 1.00 38.92 ? 968  HOH A O   1 
HETATM 8976 O O   . HOH E 3 .   ? 28.201  -5.643  44.758 1.00 57.35 ? 969  HOH A O   1 
HETATM 8977 O O   . HOH E 3 .   ? -6.283  5.429   18.498 1.00 32.33 ? 970  HOH A O   1 
HETATM 8978 O O   . HOH E 3 .   ? 16.055  -3.222  48.093 1.00 38.01 ? 971  HOH A O   1 
HETATM 8979 O O   . HOH E 3 .   ? 14.223  17.729  13.246 1.00 41.03 ? 972  HOH A O   1 
HETATM 8980 O O   . HOH E 3 .   ? -7.394  13.057  37.312 1.00 38.44 ? 973  HOH A O   1 
HETATM 8981 O O   . HOH E 3 .   ? 2.263   -16.683 19.594 1.00 44.56 ? 974  HOH A O   1 
HETATM 8982 O O   . HOH E 3 .   ? -10.485 2.452   20.737 1.00 34.80 ? 975  HOH A O   1 
HETATM 8983 O O   . HOH E 3 .   ? -0.474  -10.866 30.776 1.00 33.51 ? 976  HOH A O   1 
HETATM 8984 O O   . HOH E 3 .   ? 9.819   14.008  62.926 1.00 47.08 ? 977  HOH A O   1 
HETATM 8985 O O   . HOH E 3 .   ? 1.874   -10.835 4.049  1.00 42.62 ? 978  HOH A O   1 
HETATM 8986 O O   . HOH E 3 .   ? 20.883  2.131   35.682 1.00 34.56 ? 979  HOH A O   1 
HETATM 8987 O O   . HOH E 3 .   ? 4.960   21.191  30.071 1.00 39.88 ? 980  HOH A O   1 
HETATM 8988 O O   . HOH E 3 .   ? 13.596  7.040   8.234  1.00 43.68 ? 981  HOH A O   1 
HETATM 8989 O O   . HOH E 3 .   ? 12.281  -9.249  9.635  1.00 38.71 ? 982  HOH A O   1 
HETATM 8990 O O   . HOH E 3 .   ? 15.597  -9.823  26.914 1.00 34.43 ? 983  HOH A O   1 
HETATM 8991 O O   . HOH E 3 .   ? -10.859 12.569  35.169 1.00 37.75 ? 984  HOH A O   1 
HETATM 8992 O O   . HOH E 3 .   ? -7.001  12.711  3.299  1.00 53.23 ? 985  HOH A O   1 
HETATM 8993 O O   . HOH E 3 .   ? 12.157  -18.453 21.115 1.00 55.66 ? 986  HOH A O   1 
HETATM 8994 O O   . HOH E 3 .   ? -17.473 -3.606  5.632  1.00 48.67 ? 987  HOH A O   1 
HETATM 8995 O O   . HOH E 3 .   ? -18.092 -12.204 21.552 1.00 35.15 ? 988  HOH A O   1 
HETATM 8996 O O   . HOH E 3 .   ? -1.088  30.850  30.032 1.00 45.21 ? 989  HOH A O   1 
HETATM 8997 O O   . HOH E 3 .   ? -11.085 16.592  28.154 1.00 37.51 ? 990  HOH A O   1 
HETATM 8998 O O   . HOH E 3 .   ? 18.340  9.853   38.793 1.00 46.06 ? 991  HOH A O   1 
HETATM 8999 O O   . HOH E 3 .   ? -5.497  28.022  17.014 1.00 44.06 ? 992  HOH A O   1 
HETATM 9000 O O   . HOH E 3 .   ? -14.483 1.706   27.151 1.00 39.18 ? 993  HOH A O   1 
HETATM 9001 O O   . HOH E 3 .   ? -18.956 -14.661 18.667 1.00 44.91 ? 994  HOH A O   1 
HETATM 9002 O O   . HOH E 3 .   ? 26.721  7.124   4.239  1.00 55.22 ? 995  HOH A O   1 
HETATM 9003 O O   . HOH E 3 .   ? -31.125 -2.874  26.995 1.00 54.36 ? 996  HOH A O   1 
HETATM 9004 O O   . HOH E 3 .   ? 20.519  -11.399 12.273 1.00 44.63 ? 997  HOH A O   1 
HETATM 9005 O O   . HOH E 3 .   ? 15.701  16.153  20.335 1.00 40.71 ? 998  HOH A O   1 
HETATM 9006 O O   . HOH E 3 .   ? -29.370 -7.347  42.901 1.00 48.29 ? 999  HOH A O   1 
HETATM 9007 O O   . HOH E 3 .   ? 33.199  -13.901 22.196 1.00 54.29 ? 1000 HOH A O   1 
HETATM 9008 O O   . HOH E 3 .   ? -14.080 0.488   29.454 1.00 36.17 ? 1001 HOH A O   1 
HETATM 9009 O O   . HOH E 3 .   ? 7.068   11.098  18.468 1.00 34.22 ? 1002 HOH A O   1 
HETATM 9010 O O   . HOH E 3 .   ? 24.803  -17.733 25.478 1.00 59.07 ? 1003 HOH A O   1 
HETATM 9011 O O   . HOH E 3 .   ? 17.315  13.657  25.659 1.00 49.11 ? 1004 HOH A O   1 
HETATM 9012 O O   . HOH E 3 .   ? 3.644   -4.231  33.831 1.00 42.78 ? 1005 HOH A O   1 
HETATM 9013 O O   . HOH E 3 .   ? -14.553 -7.126  3.378  1.00 57.22 ? 1006 HOH A O   1 
HETATM 9014 O O   . HOH E 3 .   ? -0.892  5.081   22.608 1.00 36.98 ? 1007 HOH A O   1 
HETATM 9015 O O   . HOH E 3 .   ? -2.639  -14.114 34.956 1.00 32.11 ? 1008 HOH A O   1 
HETATM 9016 O O   . HOH E 3 .   ? 4.754   -13.917 15.322 1.00 42.54 ? 1009 HOH A O   1 
HETATM 9017 O O   . HOH E 3 .   ? -21.556 -7.192  37.660 1.00 39.37 ? 1010 HOH A O   1 
HETATM 9018 O O   . HOH E 3 .   ? 21.230  5.411   31.572 1.00 43.25 ? 1011 HOH A O   1 
HETATM 9019 O O   . HOH E 3 .   ? 19.000  8.824   27.278 1.00 42.30 ? 1012 HOH A O   1 
HETATM 9020 O O   . HOH E 3 .   ? -0.100  27.343  21.871 1.00 49.89 ? 1013 HOH A O   1 
HETATM 9021 O O   . HOH E 3 .   ? -26.762 -3.816  27.055 1.00 38.62 ? 1014 HOH A O   1 
HETATM 9022 O O   . HOH E 3 .   ? 8.884   11.821  63.776 1.00 42.17 ? 1015 HOH A O   1 
HETATM 9023 O O   . HOH E 3 .   ? 26.601  -10.001 13.851 1.00 54.37 ? 1016 HOH A O   1 
HETATM 9024 O O   . HOH E 3 .   ? 8.188   -8.669  33.890 1.00 48.70 ? 1017 HOH A O   1 
HETATM 9025 O O   . HOH E 3 .   ? 14.692  25.798  18.197 1.00 54.79 ? 1018 HOH A O   1 
HETATM 9026 O O   . HOH E 3 .   ? -0.442  -22.031 14.212 1.00 43.37 ? 1019 HOH A O   1 
HETATM 9027 O O   . HOH E 3 .   ? 23.249  -0.726  8.773  1.00 47.08 ? 1020 HOH A O   1 
HETATM 9028 O O   . HOH E 3 .   ? -21.437 -0.277  32.529 1.00 36.57 ? 1021 HOH A O   1 
HETATM 9029 O O   . HOH E 3 .   ? 14.365  -11.024 9.564  1.00 54.90 ? 1022 HOH A O   1 
HETATM 9030 O O   . HOH E 3 .   ? 19.279  6.574   25.628 1.00 42.17 ? 1023 HOH A O   1 
HETATM 9031 O O   . HOH E 3 .   ? -7.801  12.660  29.185 1.00 41.22 ? 1024 HOH A O   1 
HETATM 9032 O O   . HOH E 3 .   ? 7.965   20.004  18.568 1.00 37.91 ? 1025 HOH A O   1 
HETATM 9033 O O   . HOH E 3 .   ? 7.609   21.415  27.632 1.00 39.31 ? 1026 HOH A O   1 
HETATM 9034 O O   . HOH E 3 .   ? 17.807  -2.132  4.936  1.00 49.54 ? 1027 HOH A O   1 
HETATM 9035 O O   . HOH E 3 .   ? -7.707  2.692   21.371 1.00 32.84 ? 1028 HOH A O   1 
HETATM 9036 O O   . HOH E 3 .   ? -27.746 -1.119  32.195 1.00 51.39 ? 1029 HOH A O   1 
HETATM 9037 O O   . HOH E 3 .   ? 11.673  3.218   31.904 1.00 43.72 ? 1030 HOH A O   1 
HETATM 9038 O O   . HOH E 3 .   ? 20.330  19.271  17.608 1.00 46.64 ? 1031 HOH A O   1 
HETATM 9039 O O   . HOH E 3 .   ? -21.290 -10.166 24.173 1.00 47.38 ? 1032 HOH A O   1 
HETATM 9040 O O   . HOH E 3 .   ? -12.913 18.483  21.945 1.00 57.85 ? 1033 HOH A O   1 
HETATM 9041 O O   . HOH E 3 .   ? 1.617   -0.868  31.329 1.00 48.37 ? 1034 HOH A O   1 
HETATM 9042 O O   . HOH E 3 .   ? 11.066  -3.964  66.024 1.00 48.77 ? 1035 HOH A O   1 
HETATM 9043 O O   . HOH E 3 .   ? -21.050 2.722   3.429  1.00 55.65 ? 1036 HOH A O   1 
HETATM 9044 O O   . HOH E 3 .   ? 3.400   -20.133 12.348 1.00 49.97 ? 1037 HOH A O   1 
HETATM 9045 O O   . HOH E 3 .   ? -9.519  13.503  30.937 1.00 39.70 ? 1038 HOH A O   1 
HETATM 9046 O O   . HOH E 3 .   ? 14.595  -0.930  67.742 1.00 63.84 ? 1039 HOH A O   1 
HETATM 9047 O O   . HOH E 3 .   ? -30.291 -4.652  33.758 1.00 55.61 ? 1040 HOH A O   1 
HETATM 9048 O O   . HOH E 3 .   ? -2.504  -6.451  0.120  1.00 55.11 ? 1041 HOH A O   1 
HETATM 9049 O O   . HOH E 3 .   ? -7.060  0.050   3.103  1.00 53.10 ? 1042 HOH A O   1 
HETATM 9050 O O   . HOH E 3 .   ? 8.883   -15.758 27.291 1.00 55.39 ? 1043 HOH A O   1 
HETATM 9051 O O   . HOH E 3 .   ? 21.058  11.647  37.946 1.00 48.26 ? 1044 HOH A O   1 
HETATM 9052 O O   . HOH E 3 .   ? -5.599  -19.909 12.846 1.00 51.42 ? 1045 HOH A O   1 
HETATM 9053 O O   . HOH E 3 .   ? 15.326  15.789  25.205 1.00 43.49 ? 1046 HOH A O   1 
HETATM 9054 O O   . HOH E 3 .   ? 4.176   -7.415  31.598 1.00 41.91 ? 1047 HOH A O   1 
HETATM 9055 O O   . HOH E 3 .   ? -22.657 -0.850  20.925 1.00 43.79 ? 1048 HOH A O   1 
HETATM 9056 O O   . HOH E 3 .   ? -24.018 -12.304 31.246 1.00 46.86 ? 1049 HOH A O   1 
HETATM 9057 O O   . HOH E 3 .   ? 2.914   22.936  12.451 1.00 60.16 ? 1050 HOH A O   1 
HETATM 9058 O O   . HOH E 3 .   ? -11.023 15.914  31.046 1.00 51.99 ? 1051 HOH A O   1 
HETATM 9059 O O   . HOH E 3 .   ? 12.785  -9.927  31.249 1.00 53.56 ? 1052 HOH A O   1 
HETATM 9060 O O   . HOH E 3 .   ? -21.564 7.428   22.777 1.00 56.58 ? 1053 HOH A O   1 
HETATM 9061 O O   . HOH E 3 .   ? 0.016   -24.388 12.545 1.00 46.73 ? 1054 HOH A O   1 
HETATM 9062 O O   . HOH E 3 .   ? 23.570  20.278  39.009 1.00 52.92 ? 1055 HOH A O   1 
HETATM 9063 O O   . HOH E 3 .   ? 10.407  -3.069  32.119 1.00 63.69 ? 1056 HOH A O   1 
HETATM 9064 O O   . HOH E 3 .   ? -17.070 7.127   31.405 1.00 53.01 ? 1057 HOH A O   1 
HETATM 9065 O O   . HOH E 3 .   ? 1.329   22.399  5.114  1.00 50.99 ? 1058 HOH A O   1 
HETATM 9066 O O   . HOH E 3 .   ? -32.653 -4.788  35.343 1.00 56.62 ? 1059 HOH A O   1 
HETATM 9067 O O   . HOH E 3 .   ? -8.344  27.624  11.626 1.00 49.61 ? 1060 HOH A O   1 
HETATM 9068 O O   . HOH E 3 .   ? -4.105  -4.340  0.295  1.00 54.53 ? 1061 HOH A O   1 
HETATM 9069 O O   . HOH E 3 .   ? 2.089   2.724   2.368  1.00 56.63 ? 1062 HOH A O   1 
HETATM 9070 O O   . HOH E 3 .   ? -6.233  23.794  7.072  1.00 62.04 ? 1063 HOH A O   1 
HETATM 9071 O O   . HOH E 3 .   ? 9.045   31.302  22.746 1.00 65.43 ? 1064 HOH A O   1 
HETATM 9072 O O   . HOH E 3 .   ? -30.139 -14.036 25.066 1.00 57.03 ? 1065 HOH A O   1 
HETATM 9073 O O   . HOH E 3 .   ? 12.141  4.033   26.394 1.00 38.35 ? 1066 HOH A O   1 
HETATM 9074 O O   . HOH E 3 .   ? 10.911  -2.728  63.801 1.00 37.68 ? 1067 HOH A O   1 
HETATM 9075 O O   . HOH E 3 .   ? 5.314   -1.393  0.325  1.00 49.28 ? 1068 HOH A O   1 
HETATM 9076 O O   . HOH E 3 .   ? 19.812  3.404   8.998  1.00 36.97 ? 1069 HOH A O   1 
HETATM 9077 O O   . HOH E 3 .   ? 25.323  15.685  19.915 1.00 57.67 ? 1070 HOH A O   1 
HETATM 9078 O O   . HOH E 3 .   ? 17.734  19.102  59.867 1.00 51.47 ? 1071 HOH A O   1 
HETATM 9079 O O   . HOH E 3 .   ? -11.741 3.558   2.723  1.00 76.98 ? 1072 HOH A O   1 
HETATM 9080 O O   . HOH E 3 .   ? 9.201   18.854  29.585 1.00 38.47 ? 1073 HOH A O   1 
HETATM 9081 O O   . HOH E 3 .   ? 25.549  -4.246  7.129  1.00 54.75 ? 1074 HOH A O   1 
HETATM 9082 O O   . HOH E 3 .   ? -18.463 3.166   27.953 1.00 61.76 ? 1075 HOH A O   1 
HETATM 9083 O O   . HOH E 3 .   ? 9.207   14.829  1.438  1.00 64.78 ? 1076 HOH A O   1 
HETATM 9084 O O   . HOH E 3 .   ? 20.181  5.620   62.484 1.00 49.22 ? 1077 HOH A O   1 
HETATM 9085 O O   . HOH E 3 .   ? -4.851  -28.974 16.651 1.00 56.09 ? 1078 HOH A O   1 
HETATM 9086 O O   . HOH E 3 .   ? 29.571  -7.927  44.254 1.00 60.74 ? 1079 HOH A O   1 
HETATM 9087 O O   . HOH E 3 .   ? 24.436  12.598  40.768 1.00 67.88 ? 1080 HOH A O   1 
HETATM 9088 O O   . HOH E 3 .   ? -24.966 -1.352  23.342 1.00 60.20 ? 1081 HOH A O   1 
HETATM 9089 O O   . HOH E 3 .   ? 17.835  11.156  27.090 1.00 51.88 ? 1082 HOH A O   1 
HETATM 9090 O O   . HOH E 3 .   ? 8.293   -12.731 17.839 1.00 38.29 ? 1083 HOH A O   1 
HETATM 9091 O O   . HOH E 3 .   ? -28.141 17.130  18.831 1.00 83.46 ? 1084 HOH A O   1 
HETATM 9092 O O   . HOH E 3 .   ? 30.210  -18.523 23.060 1.00 66.30 ? 1085 HOH A O   1 
HETATM 9093 O O   . HOH E 3 .   ? 6.163   22.118  4.510  1.00 58.80 ? 1086 HOH A O   1 
HETATM 9094 O O   . HOH E 3 .   ? 3.997   27.574  34.243 1.00 52.15 ? 1087 HOH A O   1 
HETATM 9095 O O   . HOH E 3 .   ? -12.297 13.567  5.161  1.00 66.34 ? 1088 HOH A O   1 
HETATM 9096 O O   . HOH E 3 .   ? 16.513  2.932   66.446 1.00 52.87 ? 1089 HOH A O   1 
HETATM 9097 O O   . HOH E 3 .   ? 8.559   -16.524 8.769  1.00 57.46 ? 1090 HOH A O   1 
HETATM 9098 O O   . HOH E 3 .   ? 19.074  -13.766 26.933 1.00 38.76 ? 1091 HOH A O   1 
HETATM 9099 O O   . HOH E 3 .   ? -2.841  23.895  22.987 1.00 53.46 ? 1092 HOH A O   1 
HETATM 9100 O O   . HOH E 3 .   ? 25.287  -17.061 44.163 1.00 63.06 ? 1093 HOH A O   1 
HETATM 9101 O O   . HOH E 3 .   ? -2.338  2.730   22.051 1.00 52.29 ? 1094 HOH A O   1 
HETATM 9102 O O   . HOH E 3 .   ? 27.913  12.879  52.929 1.00 65.04 ? 1095 HOH A O   1 
HETATM 9103 O O   . HOH E 3 .   ? -15.445 26.171  11.332 1.00 61.43 ? 1096 HOH A O   1 
HETATM 9104 O O   . HOH E 3 .   ? 17.443  -8.984  31.934 1.00 44.39 ? 1097 HOH A O   1 
HETATM 9105 O O   . HOH E 3 .   ? 39.161  -8.761  22.811 1.00 67.50 ? 1098 HOH A O   1 
HETATM 9106 O O   . HOH E 3 .   ? 1.582   4.803   23.123 1.00 39.86 ? 1099 HOH A O   1 
HETATM 9107 O O   . HOH E 3 .   ? 4.981   -18.968 10.269 1.00 44.37 ? 1100 HOH A O   1 
HETATM 9108 O O   . HOH E 3 .   ? -22.868 -15.174 26.882 1.00 56.01 ? 1101 HOH A O   1 
HETATM 9109 O O   . HOH E 3 .   ? -9.100  -6.456  5.336  1.00 48.29 ? 1102 HOH A O   1 
HETATM 9110 O O   . HOH E 3 .   ? 10.673  8.096   64.116 1.00 42.19 ? 1103 HOH A O   1 
HETATM 9111 O O   . HOH E 3 .   ? 2.716   11.199  -1.675 1.00 43.90 ? 1104 HOH A O   1 
HETATM 9112 O O   . HOH E 3 .   ? -16.685 -5.184  -0.832 1.00 79.43 ? 1105 HOH A O   1 
HETATM 9113 O O   . HOH E 3 .   ? 10.272  -15.226 10.620 1.00 50.44 ? 1106 HOH A O   1 
HETATM 9114 O O   . HOH E 3 .   ? 31.283  5.822   18.028 1.00 60.85 ? 1107 HOH A O   1 
HETATM 9115 O O   . HOH E 3 .   ? -25.260 5.546   16.715 1.00 49.22 ? 1108 HOH A O   1 
HETATM 9116 O O   . HOH E 3 .   ? -33.364 -5.469  23.244 1.00 72.35 ? 1109 HOH A O   1 
HETATM 9117 O O   . HOH E 3 .   ? -9.228  13.867  4.518  1.00 62.37 ? 1110 HOH A O   1 
HETATM 9118 O O   . HOH E 3 .   ? 17.781  20.229  3.592  1.00 57.19 ? 1111 HOH A O   1 
HETATM 9119 O O   . HOH E 3 .   ? -2.855  -18.530 12.038 1.00 48.30 ? 1112 HOH A O   1 
HETATM 9120 O O   . HOH E 3 .   ? 15.066  17.411  66.578 1.00 60.38 ? 1113 HOH A O   1 
HETATM 9121 O O   . HOH E 3 .   ? 19.037  -5.776  61.225 1.00 61.48 ? 1114 HOH A O   1 
HETATM 9122 O O   . HOH E 3 .   ? 28.172  8.197   53.826 1.00 80.10 ? 1115 HOH A O   1 
HETATM 9123 O O   . HOH E 3 .   ? -16.623 -6.227  4.495  1.00 54.61 ? 1116 HOH A O   1 
HETATM 9124 O O   . HOH E 3 .   ? 26.888  -8.391  44.243 1.00 59.71 ? 1117 HOH A O   1 
HETATM 9125 O O   . HOH E 3 .   ? 17.521  -11.780 9.028  1.00 56.86 ? 1118 HOH A O   1 
HETATM 9126 O O   . HOH E 3 .   ? 11.967  -11.512 65.561 1.00 65.17 ? 1119 HOH A O   1 
HETATM 9127 O O   . HOH E 3 .   ? -32.540 -22.050 37.314 1.00 62.54 ? 1120 HOH A O   1 
HETATM 9128 O O   . HOH E 3 .   ? 27.400  22.354  11.364 1.00 64.96 ? 1121 HOH A O   1 
HETATM 9129 O O   . HOH E 3 .   ? -18.925 -5.659  0.501  1.00 69.24 ? 1122 HOH A O   1 
HETATM 9130 O O   . HOH E 3 .   ? 8.923   -9.440  8.188  1.00 42.12 ? 1123 HOH A O   1 
HETATM 9131 O O   . HOH E 3 .   ? -10.319 3.511   5.088  1.00 66.58 ? 1124 HOH A O   1 
HETATM 9132 O O   . HOH E 3 .   ? -24.149 12.792  7.634  1.00 57.52 ? 1125 HOH A O   1 
HETATM 9133 O O   . HOH E 3 .   ? -9.342  -28.337 14.335 1.00 69.10 ? 1126 HOH A O   1 
HETATM 9134 O O   . HOH E 3 .   ? 31.146  -3.982  9.779  1.00 52.12 ? 1127 HOH A O   1 
HETATM 9135 O O   . HOH E 3 .   ? 20.225  -3.626  59.435 1.00 68.07 ? 1128 HOH A O   1 
HETATM 9136 O O   . HOH E 3 .   ? 3.579   24.546  19.579 1.00 72.80 ? 1129 HOH A O   1 
HETATM 9137 O O   . HOH E 3 .   ? 17.873  19.576  31.979 1.00 61.86 ? 1130 HOH A O   1 
HETATM 9138 O O   . HOH E 3 .   ? 35.991  2.743   37.314 1.00 68.46 ? 1131 HOH A O   1 
HETATM 9139 O O   . HOH E 3 .   ? 0.690   13.760  1.142  1.00 61.41 ? 1132 HOH A O   1 
HETATM 9140 O O   . HOH E 3 .   ? 13.650  -3.538  34.484 1.00 77.06 ? 1133 HOH A O   1 
HETATM 9141 O O   . HOH E 3 .   ? 20.805  -15.054 43.131 1.00 61.93 ? 1134 HOH A O   1 
HETATM 9142 O O   . HOH E 3 .   ? 21.320  13.201  40.419 1.00 48.81 ? 1135 HOH A O   1 
HETATM 9143 O O   . HOH E 3 .   ? 26.511  17.358  17.152 1.00 63.61 ? 1136 HOH A O   1 
HETATM 9144 O O   . HOH E 3 .   ? -23.443 18.381  27.206 1.00 61.06 ? 1137 HOH A O   1 
HETATM 9145 O O   . HOH E 3 .   ? 23.770  15.757  40.639 1.00 64.85 ? 1138 HOH A O   1 
HETATM 9146 O O   . HOH E 3 .   ? 14.598  -13.334 28.678 1.00 60.15 ? 1139 HOH A O   1 
HETATM 9147 O O   . HOH E 3 .   ? -22.624 4.251   26.181 1.00 61.09 ? 1140 HOH A O   1 
HETATM 9148 O O   . HOH E 3 .   ? 5.014   12.724  -0.945 1.00 51.27 ? 1141 HOH A O   1 
HETATM 9149 O O   . HOH E 3 .   ? 6.932   8.027   62.931 1.00 49.09 ? 1142 HOH A O   1 
HETATM 9150 O O   . HOH E 3 .   ? -27.040 -1.118  21.880 1.00 84.98 ? 1143 HOH A O   1 
HETATM 9151 O O   . HOH E 3 .   ? 29.462  9.413   2.548  1.00 64.70 ? 1144 HOH A O   1 
HETATM 9152 O O   . HOH E 3 .   ? 14.972  -0.332  3.671  1.00 57.47 ? 1145 HOH A O   1 
HETATM 9153 O O   . HOH E 3 .   ? -16.015 26.345  14.054 1.00 64.32 ? 1146 HOH A O   1 
HETATM 9154 O O   . HOH E 3 .   ? -26.281 -3.485  23.719 1.00 56.53 ? 1147 HOH A O   1 
HETATM 9155 O O   . HOH E 3 .   ? -4.877  -25.041 14.445 1.00 61.46 ? 1148 HOH A O   1 
HETATM 9156 O O   . HOH E 3 .   ? -28.559 -12.325 20.721 1.00 64.71 ? 1149 HOH A O   1 
HETATM 9157 O O   . HOH E 3 .   ? -23.367 -15.858 30.357 1.00 63.02 ? 1150 HOH A O   1 
HETATM 9158 O O   . HOH E 3 .   ? -37.597 -23.281 38.928 1.00 59.40 ? 1151 HOH A O   1 
HETATM 9159 O O   . HOH E 3 .   ? 1.350   23.364  14.785 1.00 53.40 ? 1152 HOH A O   1 
HETATM 9160 O O   . HOH E 3 .   ? -5.800  -29.880 25.016 1.00 48.11 ? 1153 HOH A O   1 
HETATM 9161 O O   . HOH E 3 .   ? 0.141   -0.352  1.954  1.00 54.73 ? 1154 HOH A O   1 
HETATM 9162 O O   . HOH E 3 .   ? 26.099  15.916  27.776 1.00 57.27 ? 1155 HOH A O   1 
HETATM 9163 O O   . HOH E 3 .   ? -37.298 -19.913 34.462 1.00 59.69 ? 1156 HOH A O   1 
HETATM 9164 O O   . HOH E 3 .   ? 12.041  3.901   -0.427 1.00 57.28 ? 1157 HOH A O   1 
HETATM 9165 O O   . HOH E 3 .   ? -20.765 4.191   28.596 1.00 60.38 ? 1158 HOH A O   1 
HETATM 9166 O O   . HOH E 3 .   ? -4.521  18.525  2.794  1.00 55.01 ? 1159 HOH A O   1 
HETATM 9167 O O   . HOH E 3 .   ? 32.200  2.985   8.298  1.00 63.60 ? 1160 HOH A O   1 
HETATM 9168 O O   . HOH E 3 .   ? -17.249 25.255  23.243 1.00 70.00 ? 1161 HOH A O   1 
HETATM 9169 O O   . HOH E 3 .   ? 19.628  -0.342  56.886 1.00 40.75 ? 1162 HOH A O   1 
HETATM 9170 O O   . HOH E 3 .   ? 14.592  -9.227  41.707 1.00 89.69 ? 1163 HOH A O   1 
HETATM 9171 O O   . HOH E 3 .   ? -15.995 0.420   32.124 1.00 38.72 ? 1164 HOH A O   1 
HETATM 9172 O O   . HOH E 3 .   ? 0.313   22.088  7.491  1.00 56.16 ? 1165 HOH A O   1 
HETATM 9173 O O   . HOH E 3 .   ? -13.828 19.755  12.699 1.00 42.74 ? 1166 HOH A O   1 
HETATM 9174 O O   . HOH E 3 .   ? 21.716  18.430  52.226 1.00 55.69 ? 1167 HOH A O   1 
HETATM 9175 O O   . HOH E 3 .   ? 19.192  -14.203 30.552 1.00 52.41 ? 1168 HOH A O   1 
HETATM 9176 O O   . HOH E 3 .   ? 6.629   -8.204  31.911 1.00 48.31 ? 1169 HOH A O   1 
HETATM 9177 O O   . HOH E 3 .   ? 16.982  -3.752  67.224 1.00 51.76 ? 1170 HOH A O   1 
HETATM 9178 O O   . HOH E 3 .   ? -33.104 -5.211  26.732 1.00 43.39 ? 1171 HOH A O   1 
HETATM 9179 O O   . HOH E 3 .   ? 7.287   11.312  -2.249 1.00 47.03 ? 1172 HOH A O   1 
HETATM 9180 O O   . HOH E 3 .   ? 16.475  27.820  16.186 1.00 61.62 ? 1173 HOH A O   1 
HETATM 9181 O O   . HOH E 3 .   ? 14.932  8.811   64.246 1.00 52.33 ? 1174 HOH A O   1 
HETATM 9182 O O   . HOH E 3 .   ? 22.599  15.917  36.580 1.00 58.20 ? 1175 HOH A O   1 
HETATM 9183 O O   . HOH E 3 .   ? -34.564 -20.011 40.521 1.00 52.71 ? 1176 HOH A O   1 
HETATM 9184 O O   . HOH E 3 .   ? -22.786 14.387  24.188 1.00 52.13 ? 1177 HOH A O   1 
HETATM 9185 O O   . HOH E 3 .   ? 13.045  21.023  35.185 1.00 42.79 ? 1178 HOH A O   1 
HETATM 9186 O O   . HOH E 3 .   ? 16.343  7.567   -2.234 1.00 57.12 ? 1179 HOH A O   1 
HETATM 9187 O O   . HOH E 3 .   ? -20.494 6.377   25.345 1.00 48.82 ? 1180 HOH A O   1 
HETATM 9188 O O   . HOH E 3 .   ? -22.421 11.645  11.654 1.00 54.25 ? 1181 HOH A O   1 
HETATM 9189 O O   . HOH E 3 .   ? 14.187  1.557   67.790 1.00 81.09 ? 1182 HOH A O   1 
HETATM 9190 O O   . HOH E 3 .   ? -20.192 11.498  26.025 1.00 60.30 ? 1183 HOH A O   1 
HETATM 9191 O O   . HOH E 3 .   ? 27.200  25.280  7.427  1.00 86.93 ? 1184 HOH A O   1 
HETATM 9192 O O   . HOH E 3 .   ? 24.356  1.118   7.399  1.00 55.73 ? 1185 HOH A O   1 
HETATM 9193 O O   . HOH E 3 .   ? 38.784  14.860  27.598 1.00 64.94 ? 1186 HOH A O   1 
HETATM 9194 O O   . HOH E 3 .   ? 34.328  6.028   19.122 1.00 68.49 ? 1187 HOH A O   1 
HETATM 9195 O O   . HOH E 3 .   ? 14.853  12.654  25.324 1.00 45.02 ? 1188 HOH A O   1 
HETATM 9196 O O   . HOH E 3 .   ? -16.504 30.235  20.797 1.00 76.20 ? 1189 HOH A O   1 
HETATM 9197 O O   . HOH E 3 .   ? 17.032  -17.669 16.044 1.00 44.02 ? 1190 HOH A O   1 
HETATM 9198 O O   . HOH E 3 .   ? 33.085  -19.174 26.842 1.00 56.67 ? 1191 HOH A O   1 
HETATM 9199 O O   . HOH E 3 .   ? -0.170  11.944  -1.426 1.00 43.52 ? 1192 HOH A O   1 
HETATM 9200 O O   . HOH E 3 .   ? -18.810 18.759  4.785  1.00 60.60 ? 1193 HOH A O   1 
HETATM 9201 O O   . HOH E 3 .   ? 7.059   32.752  23.552 1.00 63.21 ? 1194 HOH A O   1 
HETATM 9202 O O   . HOH E 3 .   ? 0.254   24.603  8.342  1.00 54.63 ? 1195 HOH A O   1 
HETATM 9203 O O   . HOH E 3 .   ? -30.324 10.364  15.620 1.00 62.31 ? 1196 HOH A O   1 
HETATM 9204 O O   . HOH E 3 .   ? 29.450  -16.762 41.388 1.00 60.69 ? 1197 HOH A O   1 
HETATM 9205 O O   . HOH E 3 .   ? 19.563  29.016  18.464 1.00 52.07 ? 1198 HOH A O   1 
HETATM 9206 O O   . HOH E 3 .   ? 32.087  -13.779 40.752 1.00 60.39 ? 1199 HOH A O   1 
HETATM 9207 O O   . HOH E 3 .   ? -30.643 12.651  32.224 1.00 62.34 ? 1200 HOH A O   1 
HETATM 9208 O O   . HOH E 3 .   ? -18.254 -7.178  2.569  1.00 59.53 ? 1201 HOH A O   1 
HETATM 9209 O O   . HOH E 3 .   ? 16.018  -14.312 9.121  1.00 71.10 ? 1202 HOH A O   1 
HETATM 9210 O O   . HOH E 3 .   ? 18.409  22.721  34.740 1.00 74.78 ? 1203 HOH A O   1 
HETATM 9211 O O   . HOH E 3 .   ? 19.792  -13.566 10.634 1.00 56.37 ? 1204 HOH A O   1 
HETATM 9212 O O   . HOH E 3 .   ? 19.435  6.543   -2.031 1.00 61.37 ? 1205 HOH A O   1 
HETATM 9213 O O   . HOH E 3 .   ? -17.508 18.531  8.467  1.00 56.61 ? 1206 HOH A O   1 
HETATM 9214 O O   . HOH E 3 .   ? 2.397   -34.246 12.273 1.00 64.27 ? 1207 HOH A O   1 
HETATM 9215 O O   . HOH E 3 .   ? -29.712 0.966   6.972  1.00 60.66 ? 1208 HOH A O   1 
HETATM 9216 O O   . HOH E 3 .   ? -28.302 9.788   25.858 1.00 66.26 ? 1209 HOH A O   1 
HETATM 9217 O O   . HOH E 3 .   ? -23.910 20.613  16.223 1.00 58.20 ? 1210 HOH A O   1 
HETATM 9218 O O   . HOH E 3 .   ? 35.418  -20.419 25.789 1.00 63.99 ? 1211 HOH A O   1 
HETATM 9219 O O   . HOH E 3 .   ? 19.651  8.774   41.637 1.00 62.14 ? 1212 HOH A O   1 
HETATM 9220 O O   . HOH E 3 .   ? 17.556  18.376  5.485  1.00 53.25 ? 1213 HOH A O   1 
HETATM 9221 O O   . HOH E 3 .   ? 37.768  -14.753 29.453 1.00 49.89 ? 1214 HOH A O   1 
HETATM 9222 O O   . HOH E 3 .   ? -5.199  -22.474 13.242 1.00 56.51 ? 1215 HOH A O   1 
HETATM 9223 O O   . HOH E 3 .   ? -22.175 -15.874 33.010 1.00 48.55 ? 1216 HOH A O   1 
HETATM 9224 O O   . HOH E 3 .   ? -14.534 20.619  10.050 1.00 56.17 ? 1217 HOH A O   1 
HETATM 9225 O O   . HOH E 3 .   ? 41.215  -4.470  37.341 1.00 75.76 ? 1218 HOH A O   1 
HETATM 9226 O O   . HOH E 3 .   ? 9.954   19.086  2.932  1.00 48.69 ? 1219 HOH A O   1 
HETATM 9227 O O   . HOH E 3 .   ? 11.149  -10.119 6.927  1.00 58.51 ? 1220 HOH A O   1 
HETATM 9228 O O   . HOH E 3 .   ? 27.673  11.383  1.710  1.00 55.50 ? 1221 HOH A O   1 
HETATM 9229 O O   . HOH E 3 .   ? 25.466  -19.423 45.234 1.00 64.08 ? 1222 HOH A O   1 
HETATM 9230 O O   . HOH E 3 .   ? 13.042  -14.704 66.236 1.00 67.48 ? 1223 HOH A O   1 
HETATM 9231 O O   . HOH E 3 .   ? 34.747  10.320  37.385 1.00 64.68 ? 1224 HOH A O   1 
HETATM 9232 O O   . HOH E 3 .   ? 19.746  12.383  29.428 1.00 56.61 ? 1225 HOH A O   1 
HETATM 9233 O O   . HOH E 3 .   ? -10.051 -3.639  4.842  1.00 59.21 ? 1226 HOH A O   1 
HETATM 9234 O O   . HOH E 3 .   ? 11.003  -13.102 25.870 1.00 49.60 ? 1227 HOH A O   1 
HETATM 9235 O O   . HOH E 3 .   ? -22.273 -12.440 24.764 1.00 51.44 ? 1228 HOH A O   1 
HETATM 9236 O O   . HOH E 3 .   ? 16.942  15.532  23.101 1.00 50.72 ? 1229 HOH A O   1 
HETATM 9237 O O   . HOH E 3 .   ? 13.197  -4.873  67.055 1.00 51.14 ? 1230 HOH A O   1 
HETATM 9238 O O   . HOH E 3 .   ? 25.183  10.925  3.593  1.00 73.79 ? 1231 HOH A O   1 
HETATM 9239 O O   . HOH E 3 .   ? 37.573  12.858  29.805 1.00 53.31 ? 1232 HOH A O   1 
HETATM 9240 O O   . HOH E 3 .   ? -25.150 -9.581  22.764 1.00 49.82 ? 1233 HOH A O   1 
HETATM 9241 O O   . HOH E 3 .   ? 27.053  7.126   43.208 1.00 54.21 ? 1234 HOH A O   1 
HETATM 9242 O O   . HOH E 3 .   ? 9.785   -19.513 15.881 1.00 57.82 ? 1235 HOH A O   1 
HETATM 9243 O O   . HOH E 3 .   ? -16.168 13.184  4.833  1.00 55.49 ? 1236 HOH A O   1 
HETATM 9244 O O   . HOH E 3 .   ? 7.322   22.383  6.720  1.00 53.85 ? 1237 HOH A O   1 
HETATM 9245 O O   . HOH E 3 .   ? -24.947 -13.256 23.931 1.00 59.99 ? 1238 HOH A O   1 
HETATM 9246 O O   . HOH E 3 .   ? 30.660  9.252   35.335 1.00 62.06 ? 1239 HOH A O   1 
HETATM 9247 O O   . HOH E 3 .   ? 35.028  3.899   13.527 1.00 62.87 ? 1240 HOH A O   1 
HETATM 9248 O O   . HOH E 3 .   ? -23.846 6.527   10.927 1.00 58.06 ? 1241 HOH A O   1 
HETATM 9249 O O   . HOH E 3 .   ? 28.061  14.019  13.939 1.00 69.78 ? 1242 HOH A O   1 
HETATM 9250 O O   . HOH E 3 .   ? 16.470  -11.122 6.601  1.00 70.71 ? 1243 HOH A O   1 
HETATM 9251 O O   . HOH E 3 .   ? 26.231  17.626  3.649  1.00 59.52 ? 1244 HOH A O   1 
HETATM 9252 O O   . HOH E 3 .   ? -0.525  27.133  9.355  1.00 61.45 ? 1245 HOH A O   1 
HETATM 9253 O O   . HOH E 3 .   ? 21.211  23.166  6.320  1.00 89.23 ? 1246 HOH A O   1 
HETATM 9254 O O   . HOH E 3 .   ? -31.093 7.937   20.696 1.00 57.92 ? 1247 HOH A O   1 
HETATM 9255 O O   . HOH E 3 .   ? 18.558  19.571  28.582 1.00 54.52 ? 1248 HOH A O   1 
HETATM 9256 O O   . HOH E 3 .   ? 17.662  16.616  27.735 1.00 54.09 ? 1249 HOH A O   1 
HETATM 9257 O O   . HOH E 3 .   ? 10.894  10.080  4.392  1.00 56.41 ? 1250 HOH A O   1 
HETATM 9258 O O   . HOH E 3 .   ? 12.905  -18.754 12.148 1.00 53.26 ? 1251 HOH A O   1 
HETATM 9259 O O   . HOH E 3 .   ? -20.814 -6.462  5.601  1.00 53.59 ? 1252 HOH A O   1 
HETATM 9260 O O   . HOH E 3 .   ? 18.693  -6.214  6.432  1.00 69.90 ? 1253 HOH A O   1 
HETATM 9261 O O   . HOH E 3 .   ? -18.750 11.367  30.374 1.00 69.59 ? 1254 HOH A O   1 
HETATM 9262 O O   . HOH E 3 .   ? 15.943  -6.795  33.755 1.00 63.43 ? 1255 HOH A O   1 
HETATM 9263 O O   . HOH E 3 .   ? 25.504  11.527  -0.576 1.00 70.24 ? 1256 HOH A O   1 
HETATM 9264 O O   . HOH E 3 .   ? 37.123  -2.998  43.143 1.00 64.92 ? 1257 HOH A O   1 
HETATM 9265 O O   . HOH E 3 .   ? 12.388  -0.143  4.472  1.00 51.48 ? 1258 HOH A O   1 
HETATM 9266 O O   . HOH E 3 .   ? 26.766  5.902   54.026 1.00 74.12 ? 1259 HOH A O   1 
HETATM 9267 O O   . HOH E 3 .   ? -18.690 7.500   28.681 1.00 56.26 ? 1260 HOH A O   1 
HETATM 9268 O O   . HOH E 3 .   ? 23.429  17.255  28.441 1.00 58.22 ? 1261 HOH A O   1 
HETATM 9269 O O   . HOH E 3 .   ? 11.084  -16.997 13.288 1.00 49.45 ? 1262 HOH A O   1 
HETATM 9270 O O   . HOH E 3 .   ? 15.506  23.229  60.172 1.00 59.72 ? 1263 HOH A O   1 
HETATM 9271 O O   . HOH E 3 .   ? -4.095  25.464  17.966 1.00 65.19 ? 1264 HOH A O   1 
HETATM 9272 O O   . HOH E 3 .   ? -38.526 -11.210 36.835 1.00 48.00 ? 1265 HOH A O   1 
HETATM 9273 O O   . HOH E 3 .   ? 22.011  7.163   -1.559 1.00 71.91 ? 1266 HOH A O   1 
HETATM 9274 O O   . HOH E 3 .   ? 22.822  19.839  16.514 1.00 59.52 ? 1267 HOH A O   1 
HETATM 9275 O O   . HOH E 3 .   ? -0.828  -19.886 10.989 1.00 53.08 ? 1268 HOH A O   1 
HETATM 9276 O O   . HOH E 3 .   ? -12.172 27.338  26.799 1.00 68.17 ? 1269 HOH A O   1 
HETATM 9277 O O   . HOH E 3 .   ? -12.128 22.846  7.393  1.00 61.16 ? 1270 HOH A O   1 
HETATM 9278 O O   . HOH E 3 .   ? 15.681  2.576   0.847  1.00 65.27 ? 1271 HOH A O   1 
HETATM 9279 O O   . HOH E 3 .   ? -11.501 16.236  20.148 1.00 68.82 ? 1272 HOH A O   1 
HETATM 9280 O O   . HOH E 3 .   ? -28.241 4.342   11.749 1.00 62.37 ? 1273 HOH A O   1 
HETATM 9281 O O   . HOH E 3 .   ? -20.387 -11.071 21.766 1.00 51.76 ? 1274 HOH A O   1 
HETATM 9282 O O   . HOH E 3 .   ? 38.816  -6.648  14.584 1.00 57.10 ? 1275 HOH A O   1 
HETATM 9283 O O   . HOH E 3 .   ? -27.421 10.530  23.296 1.00 64.13 ? 1276 HOH A O   1 
HETATM 9284 O O   . HOH E 3 .   ? 29.339  16.947  18.042 1.00 64.77 ? 1277 HOH A O   1 
HETATM 9285 O O   . HOH E 3 .   ? 16.218  -16.022 33.181 1.00 57.24 ? 1278 HOH A O   1 
HETATM 9286 O O   . HOH E 3 .   ? 19.637  14.342  31.250 1.00 54.24 ? 1279 HOH A O   1 
HETATM 9287 O O   . HOH E 3 .   ? -6.560  32.169  27.156 1.00 61.68 ? 1280 HOH A O   1 
HETATM 9288 O O   . HOH E 3 .   ? -11.510 20.276  26.045 1.00 73.49 ? 1281 HOH A O   1 
HETATM 9289 O O   . HOH E 3 .   ? -10.367 22.535  26.750 1.00 73.89 ? 1282 HOH A O   1 
HETATM 9290 O O   . HOH E 3 .   ? -23.329 6.621   25.217 1.00 77.44 ? 1283 HOH A O   1 
HETATM 9291 O O   . HOH E 3 .   ? 19.805  18.555  57.708 1.00 55.11 ? 1284 HOH A O   1 
HETATM 9292 O O   . HOH E 3 .   ? -25.417 4.455   23.571 1.00 55.99 ? 1285 HOH A O   1 
HETATM 9293 O O   . HOH E 3 .   ? -28.346 -2.259  28.977 1.00 66.75 ? 1286 HOH A O   1 
HETATM 9294 O O   . HOH F 3 .   ? -4.283  3.456   48.791 1.00 26.70 ? 902  HOH B O   1 
HETATM 9295 O O   . HOH F 3 .   ? -19.531 -8.827  38.345 1.00 28.27 ? 903  HOH B O   1 
HETATM 9296 O O   . HOH F 3 .   ? -8.325  4.172   45.642 1.00 25.69 ? 904  HOH B O   1 
HETATM 9297 O O   . HOH F 3 .   ? -18.465 9.757   41.257 1.00 32.51 ? 905  HOH B O   1 
HETATM 9298 O O   . HOH F 3 .   ? 4.199   -15.044 21.715 1.00 33.16 ? 906  HOH B O   1 
HETATM 9299 O O   . HOH F 3 .   ? 1.213   -21.852 26.654 1.00 34.02 ? 907  HOH B O   1 
HETATM 9300 O O   . HOH F 3 .   ? 8.576   -13.216 58.061 1.00 31.30 ? 908  HOH B O   1 
HETATM 9301 O O   . HOH F 3 .   ? -0.473  -1.848  33.318 1.00 35.83 ? 909  HOH B O   1 
HETATM 9302 O O   . HOH F 3 .   ? -3.585  -14.928 42.765 1.00 31.06 ? 910  HOH B O   1 
HETATM 9303 O O   . HOH F 3 .   ? 1.133   -19.883 36.559 1.00 31.17 ? 911  HOH B O   1 
HETATM 9304 O O   . HOH F 3 .   ? -12.546 -12.909 53.879 1.00 33.77 ? 912  HOH B O   1 
HETATM 9305 O O   . HOH F 3 .   ? -9.756  5.868   30.575 1.00 31.32 ? 913  HOH B O   1 
HETATM 9306 O O   . HOH F 3 .   ? -19.645 13.329  55.979 1.00 34.35 ? 914  HOH B O   1 
HETATM 9307 O O   . HOH F 3 .   ? 0.801   -22.788 43.270 1.00 35.37 ? 915  HOH B O   1 
HETATM 9308 O O   . HOH F 3 .   ? 13.830  -1.985  48.182 1.00 32.34 ? 916  HOH B O   1 
HETATM 9309 O O   . HOH F 3 .   ? 1.748   11.452  52.392 1.00 28.67 ? 917  HOH B O   1 
HETATM 9310 O O   . HOH F 3 .   ? -8.343  7.754   41.841 1.00 29.78 ? 918  HOH B O   1 
HETATM 9311 O O   . HOH F 3 .   ? -19.177 -13.954 39.050 1.00 33.32 ? 919  HOH B O   1 
HETATM 9312 O O   . HOH F 3 .   ? -4.400  -14.421 45.322 1.00 33.54 ? 920  HOH B O   1 
HETATM 9313 O O   . HOH F 3 .   ? 8.162   9.623   50.209 1.00 31.94 ? 921  HOH B O   1 
HETATM 9314 O O   . HOH F 3 .   ? 22.967  -0.829  48.997 1.00 36.46 ? 922  HOH B O   1 
HETATM 9315 O O   . HOH F 3 .   ? -10.524 -18.471 28.895 1.00 43.53 ? 923  HOH B O   1 
HETATM 9316 O O   . HOH F 3 .   ? -20.150 11.081  42.613 1.00 49.08 ? 924  HOH B O   1 
HETATM 9317 O O   . HOH F 3 .   ? -10.764 -1.014  40.564 1.00 35.22 ? 925  HOH B O   1 
HETATM 9318 O O   . HOH F 3 .   ? -7.505  -14.323 59.634 1.00 31.93 ? 926  HOH B O   1 
HETATM 9319 O O   . HOH F 3 .   ? 8.973   13.147  51.512 1.00 32.73 ? 927  HOH B O   1 
HETATM 9320 O O   . HOH F 3 .   ? -12.671 7.889   39.181 1.00 31.97 ? 928  HOH B O   1 
HETATM 9321 O O   . HOH F 3 .   ? -10.907 -8.415  52.070 1.00 34.58 ? 929  HOH B O   1 
HETATM 9322 O O   . HOH F 3 .   ? -5.476  5.856   49.501 1.00 32.44 ? 930  HOH B O   1 
HETATM 9323 O O   . HOH F 3 .   ? -5.349  -10.371 43.077 1.00 32.40 ? 931  HOH B O   1 
HETATM 9324 O O   . HOH F 3 .   ? -4.783  -21.920 53.993 1.00 43.91 ? 932  HOH B O   1 
HETATM 9325 O O   . HOH F 3 .   ? -16.911 -17.778 40.649 1.00 38.84 ? 933  HOH B O   1 
HETATM 9326 O O   . HOH F 3 .   ? -3.905  -20.427 58.638 1.00 39.52 ? 934  HOH B O   1 
HETATM 9327 O O   . HOH F 3 .   ? 3.614   -0.831  33.033 1.00 33.18 ? 935  HOH B O   1 
HETATM 9328 O O   . HOH F 3 .   ? -21.560 -4.293  37.502 1.00 38.19 ? 936  HOH B O   1 
HETATM 9329 O O   . HOH F 3 .   ? 8.397   -4.918  65.471 1.00 36.44 ? 937  HOH B O   1 
HETATM 9330 O O   . HOH F 3 .   ? 0.049   12.563  42.751 1.00 35.83 ? 938  HOH B O   1 
HETATM 9331 O O   . HOH F 3 .   ? -10.735 -8.654  5.746  1.00 37.23 ? 939  HOH B O   1 
HETATM 9332 O O   . HOH F 3 .   ? 12.858  -6.200  49.649 1.00 36.70 ? 940  HOH B O   1 
HETATM 9333 O O   . HOH F 3 .   ? -21.777 -5.171  42.204 1.00 33.64 ? 941  HOH B O   1 
HETATM 9334 O O   . HOH F 3 .   ? 8.314   4.011   39.319 1.00 28.32 ? 942  HOH B O   1 
HETATM 9335 O O   . HOH F 3 .   ? 9.116   -16.602 40.627 1.00 41.65 ? 943  HOH B O   1 
HETATM 9336 O O   . HOH F 3 .   ? -16.608 -4.902  49.457 1.00 30.75 ? 944  HOH B O   1 
HETATM 9337 O O   . HOH F 3 .   ? -13.970 -8.756  16.374 1.00 32.81 ? 945  HOH B O   1 
HETATM 9338 O O   . HOH F 3 .   ? -8.595  1.695   44.915 1.00 30.21 ? 946  HOH B O   1 
HETATM 9339 O O   . HOH F 3 .   ? -15.085 1.237   37.720 1.00 27.13 ? 947  HOH B O   1 
HETATM 9340 O O   . HOH F 3 .   ? -9.684  -19.149 40.711 1.00 32.24 ? 948  HOH B O   1 
HETATM 9341 O O   . HOH F 3 .   ? -4.772  -12.515 41.488 1.00 35.47 ? 949  HOH B O   1 
HETATM 9342 O O   . HOH F 3 .   ? 10.625  -22.086 55.205 1.00 33.99 ? 950  HOH B O   1 
HETATM 9343 O O   . HOH F 3 .   ? 4.948   -3.307  40.845 1.00 30.26 ? 951  HOH B O   1 
HETATM 9344 O O   . HOH F 3 .   ? -11.221 -19.168 25.914 1.00 38.17 ? 952  HOH B O   1 
HETATM 9345 O O   . HOH F 3 .   ? -16.832 -15.551 47.263 1.00 31.57 ? 953  HOH B O   1 
HETATM 9346 O O   . HOH F 3 .   ? -11.624 -0.040  44.366 1.00 27.21 ? 954  HOH B O   1 
HETATM 9347 O O   . HOH F 3 .   ? 3.810   -4.652  38.610 1.00 39.29 ? 955  HOH B O   1 
HETATM 9348 O O   . HOH F 3 .   ? -21.933 -7.289  40.707 1.00 34.04 ? 956  HOH B O   1 
HETATM 9349 O O   . HOH F 3 .   ? -12.611 -15.016 49.031 1.00 30.87 ? 957  HOH B O   1 
HETATM 9350 O O   . HOH F 3 .   ? -23.947 3.350   45.556 1.00 33.64 ? 958  HOH B O   1 
HETATM 9351 O O   . HOH F 3 .   ? -3.210  18.370  40.061 1.00 68.01 ? 959  HOH B O   1 
HETATM 9352 O O   . HOH F 3 .   ? 4.306   10.886  50.904 1.00 37.54 ? 960  HOH B O   1 
HETATM 9353 O O   . HOH F 3 .   ? -26.269 4.853   53.196 1.00 39.05 ? 961  HOH B O   1 
HETATM 9354 O O   . HOH F 3 .   ? -13.337 7.551   31.052 1.00 33.05 ? 962  HOH B O   1 
HETATM 9355 O O   . HOH F 3 .   ? -13.925 -13.320 44.734 1.00 34.13 ? 963  HOH B O   1 
HETATM 9356 O O   . HOH F 3 .   ? -14.649 -14.150 47.319 1.00 32.31 ? 964  HOH B O   1 
HETATM 9357 O O   . HOH F 3 .   ? 20.961  -2.190  47.843 1.00 31.89 ? 965  HOH B O   1 
HETATM 9358 O O   . HOH F 3 .   ? -2.877  20.791  58.296 1.00 43.40 ? 966  HOH B O   1 
HETATM 9359 O O   . HOH F 3 .   ? 6.235   18.567  41.143 1.00 40.57 ? 967  HOH B O   1 
HETATM 9360 O O   . HOH F 3 .   ? 3.112   14.299  47.526 1.00 31.75 ? 968  HOH B O   1 
HETATM 9361 O O   . HOH F 3 .   ? -16.393 -15.042 42.860 1.00 36.02 ? 969  HOH B O   1 
HETATM 9362 O O   . HOH F 3 .   ? 2.475   -16.273 34.436 1.00 34.57 ? 970  HOH B O   1 
HETATM 9363 O O   . HOH F 3 .   ? 3.378   21.029  37.038 1.00 37.80 ? 971  HOH B O   1 
HETATM 9364 O O   . HOH F 3 .   ? 9.302   -27.316 53.769 1.00 51.10 ? 972  HOH B O   1 
HETATM 9365 O O   . HOH F 3 .   ? 0.921   -13.205 34.914 1.00 34.61 ? 973  HOH B O   1 
HETATM 9366 O O   . HOH F 3 .   ? -3.134  -21.456 31.947 1.00 29.01 ? 974  HOH B O   1 
HETATM 9367 O O   . HOH F 3 .   ? -7.626  -19.472 42.192 1.00 33.00 ? 975  HOH B O   1 
HETATM 9368 O O   . HOH F 3 .   ? 6.684   -9.139  42.846 1.00 32.58 ? 976  HOH B O   1 
HETATM 9369 O O   . HOH F 3 .   ? -2.321  10.132  47.449 1.00 36.51 ? 977  HOH B O   1 
HETATM 9370 O O   . HOH F 3 .   ? 10.930  12.602  37.975 1.00 44.93 ? 978  HOH B O   1 
HETATM 9371 O O   . HOH F 3 .   ? -7.837  6.624   44.410 1.00 35.20 ? 979  HOH B O   1 
HETATM 9372 O O   . HOH F 3 .   ? 16.811  -18.308 51.525 1.00 41.00 ? 980  HOH B O   1 
HETATM 9373 O O   . HOH F 3 .   ? 15.291  10.969  38.679 1.00 40.68 ? 981  HOH B O   1 
HETATM 9374 O O   . HOH F 3 .   ? -27.702 0.812   46.365 1.00 41.25 ? 982  HOH B O   1 
HETATM 9375 O O   . HOH F 3 .   ? 23.887  -1.545  55.057 1.00 47.06 ? 983  HOH B O   1 
HETATM 9376 O O   . HOH F 3 .   ? -21.134 -3.568  9.087  1.00 46.12 ? 984  HOH B O   1 
HETATM 9377 O O   . HOH F 3 .   ? -17.940 -14.545 54.525 1.00 36.58 ? 985  HOH B O   1 
HETATM 9378 O O   . HOH F 3 .   ? -16.306 14.374  40.862 1.00 45.67 ? 986  HOH B O   1 
HETATM 9379 O O   . HOH F 3 .   ? -19.925 -20.284 50.462 1.00 38.23 ? 987  HOH B O   1 
HETATM 9380 O O   . HOH F 3 .   ? 9.165   -9.865  59.557 1.00 34.46 ? 988  HOH B O   1 
HETATM 9381 O O   . HOH F 3 .   ? -6.294  -24.432 53.383 1.00 30.05 ? 989  HOH B O   1 
HETATM 9382 O O   . HOH F 3 .   ? 12.799  -1.724  37.529 1.00 40.00 ? 990  HOH B O   1 
HETATM 9383 O O   . HOH F 3 .   ? -5.649  -10.302 47.156 1.00 31.39 ? 991  HOH B O   1 
HETATM 9384 O O   . HOH F 3 .   ? 18.672  39.516  40.737 1.00 52.04 ? 992  HOH B O   1 
HETATM 9385 O O   . HOH F 3 .   ? -1.474  14.142  40.950 1.00 40.35 ? 993  HOH B O   1 
HETATM 9386 O O   . HOH F 3 .   ? -0.408  -24.392 59.099 1.00 48.55 ? 994  HOH B O   1 
HETATM 9387 O O   . HOH F 3 .   ? 29.188  -4.088  51.237 1.00 54.47 ? 995  HOH B O   1 
HETATM 9388 O O   . HOH F 3 .   ? -6.937  -24.451 50.641 1.00 37.75 ? 996  HOH B O   1 
HETATM 9389 O O   . HOH F 3 .   ? -22.172 -10.415 61.527 1.00 36.84 ? 997  HOH B O   1 
HETATM 9390 O O   . HOH F 3 .   ? -19.212 -9.876  65.015 1.00 46.23 ? 998  HOH B O   1 
HETATM 9391 O O   . HOH F 3 .   ? 9.759   0.697   34.007 1.00 47.40 ? 999  HOH B O   1 
HETATM 9392 O O   . HOH F 3 .   ? 10.131  -0.479  36.823 1.00 48.31 ? 1000 HOH B O   1 
HETATM 9393 O O   . HOH F 3 .   ? 7.303   -19.529 61.052 1.00 56.92 ? 1001 HOH B O   1 
HETATM 9394 O O   . HOH F 3 .   ? -18.672 -14.730 21.623 1.00 38.48 ? 1002 HOH B O   1 
HETATM 9395 O O   . HOH F 3 .   ? 18.325  1.544   55.780 1.00 39.79 ? 1003 HOH B O   1 
HETATM 9396 O O   . HOH F 3 .   ? 15.712  -5.789  48.957 1.00 35.03 ? 1004 HOH B O   1 
HETATM 9397 O O   . HOH F 3 .   ? -29.480 -1.473  35.398 1.00 51.66 ? 1005 HOH B O   1 
HETATM 9398 O O   . HOH F 3 .   ? 6.379   1.566   68.010 1.00 45.49 ? 1006 HOH B O   1 
HETATM 9399 O O   . HOH F 3 .   ? -1.518  -34.455 56.057 1.00 46.45 ? 1007 HOH B O   1 
HETATM 9400 O O   . HOH F 3 .   ? -9.086  -10.334 3.809  1.00 41.02 ? 1008 HOH B O   1 
HETATM 9401 O O   . HOH F 3 .   ? -25.255 -15.710 55.179 1.00 44.42 ? 1009 HOH B O   1 
HETATM 9402 O O   . HOH F 3 .   ? -26.208 16.412  54.354 1.00 54.34 ? 1010 HOH B O   1 
HETATM 9403 O O   . HOH F 3 .   ? -8.711  7.019   67.995 1.00 53.36 ? 1011 HOH B O   1 
HETATM 9404 O O   . HOH F 3 .   ? -14.408 -17.730 41.920 1.00 46.24 ? 1012 HOH B O   1 
HETATM 9405 O O   . HOH F 3 .   ? 4.222   19.273  39.732 1.00 42.23 ? 1013 HOH B O   1 
HETATM 9406 O O   . HOH F 3 .   ? -16.300 11.401  40.223 1.00 33.44 ? 1014 HOH B O   1 
HETATM 9407 O O   . HOH F 3 .   ? -13.158 -19.745 38.772 1.00 43.43 ? 1015 HOH B O   1 
HETATM 9408 O O   . HOH F 3 .   ? -13.833 7.499   68.474 1.00 69.69 ? 1016 HOH B O   1 
HETATM 9409 O O   . HOH F 3 .   ? 3.065   -3.339  36.263 1.00 40.33 ? 1017 HOH B O   1 
HETATM 9410 O O   . HOH F 3 .   ? -18.743 -5.969  48.508 1.00 37.77 ? 1018 HOH B O   1 
HETATM 9411 O O   . HOH F 3 .   ? 21.742  -0.983  53.504 1.00 36.09 ? 1019 HOH B O   1 
HETATM 9412 O O   . HOH F 3 .   ? 19.698  -2.060  54.757 1.00 46.08 ? 1020 HOH B O   1 
HETATM 9413 O O   . HOH F 3 .   ? -11.708 -30.005 32.724 1.00 38.99 ? 1021 HOH B O   1 
HETATM 9414 O O   . HOH F 3 .   ? 10.534  24.282  44.812 1.00 45.27 ? 1022 HOH B O   1 
HETATM 9415 O O   . HOH F 3 .   ? -19.089 -8.278  6.644  1.00 45.17 ? 1023 HOH B O   1 
HETATM 9416 O O   . HOH F 3 .   ? -5.201  28.628  55.827 1.00 65.70 ? 1024 HOH B O   1 
HETATM 9417 O O   . HOH F 3 .   ? 23.748  -9.304  48.103 1.00 48.14 ? 1025 HOH B O   1 
HETATM 9418 O O   . HOH F 3 .   ? -7.063  24.909  55.310 1.00 60.44 ? 1026 HOH B O   1 
HETATM 9419 O O   . HOH F 3 .   ? -30.977 1.784   38.338 1.00 47.16 ? 1027 HOH B O   1 
HETATM 9420 O O   . HOH F 3 .   ? -0.969  -10.303 33.563 1.00 33.40 ? 1028 HOH B O   1 
HETATM 9421 O O   . HOH F 3 .   ? -11.480 -7.172  49.440 1.00 33.24 ? 1029 HOH B O   1 
HETATM 9422 O O   . HOH F 3 .   ? -2.743  -7.357  35.996 1.00 33.47 ? 1030 HOH B O   1 
HETATM 9423 O O   . HOH F 3 .   ? -22.744 21.509  41.776 1.00 49.39 ? 1031 HOH B O   1 
HETATM 9424 O O   . HOH F 3 .   ? -21.019 -9.339  16.133 1.00 34.77 ? 1032 HOH B O   1 
HETATM 9425 O O   . HOH F 3 .   ? -22.790 -7.772  60.937 1.00 41.22 ? 1033 HOH B O   1 
HETATM 9426 O O   . HOH F 3 .   ? -13.339 -14.764 42.599 1.00 41.85 ? 1034 HOH B O   1 
HETATM 9427 O O   . HOH F 3 .   ? -3.391  -9.453  34.760 1.00 32.08 ? 1035 HOH B O   1 
HETATM 9428 O O   . HOH F 3 .   ? -17.182 -16.525 19.583 1.00 61.55 ? 1036 HOH B O   1 
HETATM 9429 O O   . HOH F 3 .   ? 6.155   -35.316 54.681 1.00 50.83 ? 1037 HOH B O   1 
HETATM 9430 O O   . HOH F 3 .   ? -14.789 -22.727 23.746 1.00 56.55 ? 1038 HOH B O   1 
HETATM 9431 O O   . HOH F 3 .   ? -27.982 -3.367  33.898 1.00 38.89 ? 1039 HOH B O   1 
HETATM 9432 O O   . HOH F 3 .   ? 12.116  -9.280  49.756 1.00 41.74 ? 1040 HOH B O   1 
HETATM 9433 O O   . HOH F 3 .   ? -7.779  -10.312 67.445 1.00 43.77 ? 1041 HOH B O   1 
HETATM 9434 O O   . HOH F 3 .   ? -3.894  -33.283 56.320 1.00 43.08 ? 1042 HOH B O   1 
HETATM 9435 O O   . HOH F 3 .   ? 14.308  -11.542 57.203 1.00 51.88 ? 1043 HOH B O   1 
HETATM 9436 O O   . HOH F 3 .   ? -18.314 -18.569 33.162 1.00 58.24 ? 1044 HOH B O   1 
HETATM 9437 O O   . HOH F 3 .   ? 12.761  -20.159 41.071 1.00 41.41 ? 1045 HOH B O   1 
HETATM 9438 O O   . HOH F 3 .   ? 12.395  -11.351 42.037 1.00 41.10 ? 1046 HOH B O   1 
HETATM 9439 O O   . HOH F 3 .   ? -16.518 -24.484 35.635 1.00 58.72 ? 1047 HOH B O   1 
HETATM 9440 O O   . HOH F 3 .   ? -1.546  21.232  38.238 1.00 36.35 ? 1048 HOH B O   1 
HETATM 9441 O O   . HOH F 3 .   ? 0.480   21.069  35.840 1.00 37.23 ? 1049 HOH B O   1 
HETATM 9442 O O   . HOH F 3 .   ? 4.158   -29.288 22.647 1.00 53.03 ? 1050 HOH B O   1 
HETATM 9443 O O   . HOH F 3 .   ? -22.683 -2.597  51.044 1.00 40.24 ? 1051 HOH B O   1 
HETATM 9444 O O   . HOH F 3 .   ? -12.548 11.035  33.129 1.00 43.56 ? 1052 HOH B O   1 
HETATM 9445 O O   . HOH F 3 .   ? 19.965  -4.897  55.129 1.00 51.14 ? 1053 HOH B O   1 
HETATM 9446 O O   . HOH F 3 .   ? -21.649 -13.220 32.889 1.00 33.46 ? 1054 HOH B O   1 
HETATM 9447 O O   . HOH F 3 .   ? 25.013  32.581  39.398 1.00 49.79 ? 1055 HOH B O   1 
HETATM 9448 O O   . HOH F 3 .   ? -13.795 -17.778 25.968 1.00 48.35 ? 1056 HOH B O   1 
HETATM 9449 O O   . HOH F 3 .   ? 0.627   -34.624 51.556 1.00 47.95 ? 1057 HOH B O   1 
HETATM 9450 O O   . HOH F 3 .   ? -16.015 -17.155 44.869 1.00 31.39 ? 1058 HOH B O   1 
HETATM 9451 O O   . HOH F 3 .   ? -26.113 0.323   51.976 1.00 52.01 ? 1059 HOH B O   1 
HETATM 9452 O O   . HOH F 3 .   ? -8.166  -27.471 63.134 1.00 49.18 ? 1060 HOH B O   1 
HETATM 9453 O O   . HOH F 3 .   ? -15.976 -18.113 66.936 1.00 58.36 ? 1061 HOH B O   1 
HETATM 9454 O O   . HOH F 3 .   ? -2.074  6.722   66.049 1.00 59.60 ? 1062 HOH B O   1 
HETATM 9455 O O   . HOH F 3 .   ? -23.350 -1.448  53.781 1.00 48.94 ? 1063 HOH B O   1 
HETATM 9456 O O   . HOH F 3 .   ? -13.696 22.802  43.838 1.00 67.98 ? 1064 HOH B O   1 
HETATM 9457 O O   . HOH F 3 .   ? -17.974 -4.104  64.814 1.00 57.72 ? 1065 HOH B O   1 
HETATM 9458 O O   . HOH F 3 .   ? -17.336 -24.571 53.629 1.00 46.88 ? 1066 HOH B O   1 
HETATM 9459 O O   . HOH F 3 .   ? -16.700 -32.745 42.337 1.00 56.80 ? 1067 HOH B O   1 
HETATM 9460 O O   . HOH F 3 .   ? -30.898 -1.860  37.494 1.00 44.06 ? 1068 HOH B O   1 
HETATM 9461 O O   . HOH F 3 .   ? -5.416  7.207   47.084 1.00 33.45 ? 1069 HOH B O   1 
HETATM 9462 O O   . HOH F 3 .   ? 9.253   2.986   33.019 1.00 46.97 ? 1070 HOH B O   1 
HETATM 9463 O O   . HOH F 3 .   ? 5.166   -16.206 33.802 1.00 48.93 ? 1071 HOH B O   1 
HETATM 9464 O O   . HOH F 3 .   ? 2.347   -9.732  66.491 1.00 49.17 ? 1072 HOH B O   1 
HETATM 9465 O O   . HOH F 3 .   ? 18.379  -6.303  57.305 1.00 51.55 ? 1073 HOH B O   1 
HETATM 9466 O O   . HOH F 3 .   ? 20.845  27.606  38.345 1.00 54.11 ? 1074 HOH B O   1 
HETATM 9467 O O   . HOH F 3 .   ? -13.532 -0.362  63.606 1.00 50.16 ? 1075 HOH B O   1 
HETATM 9468 O O   . HOH F 3 .   ? -3.940  -11.961 36.117 1.00 38.50 ? 1076 HOH B O   1 
HETATM 9469 O O   . HOH F 3 .   ? -20.987 4.776   34.008 1.00 69.06 ? 1077 HOH B O   1 
HETATM 9470 O O   . HOH F 3 .   ? -18.763 -25.527 56.013 1.00 50.93 ? 1078 HOH B O   1 
HETATM 9471 O O   . HOH F 3 .   ? -9.304  -13.280 61.653 1.00 54.35 ? 1079 HOH B O   1 
HETATM 9472 O O   . HOH F 3 .   ? 9.317   -17.811 38.174 1.00 46.77 ? 1080 HOH B O   1 
HETATM 9473 O O   . HOH F 3 .   ? 17.017  -41.482 36.669 1.00 71.60 ? 1081 HOH B O   1 
HETATM 9474 O O   . HOH F 3 .   ? 14.245  11.867  42.286 1.00 40.39 ? 1082 HOH B O   1 
HETATM 9475 O O   . HOH F 3 .   ? -4.314  26.076  55.932 1.00 65.37 ? 1083 HOH B O   1 
HETATM 9476 O O   . HOH F 3 .   ? -23.186 14.118  59.304 1.00 49.49 ? 1084 HOH B O   1 
HETATM 9477 O O   . HOH F 3 .   ? 1.935   27.469  36.083 1.00 49.00 ? 1085 HOH B O   1 
HETATM 9478 O O   . HOH F 3 .   ? -19.987 -18.048 39.224 1.00 48.65 ? 1086 HOH B O   1 
HETATM 9479 O O   . HOH F 3 .   ? -4.292  -34.622 24.010 1.00 53.20 ? 1087 HOH B O   1 
HETATM 9480 O O   . HOH F 3 .   ? 3.952   9.127   62.813 1.00 48.31 ? 1088 HOH B O   1 
HETATM 9481 O O   . HOH F 3 .   ? 0.759   -2.274  36.393 1.00 54.85 ? 1089 HOH B O   1 
HETATM 9482 O O   . HOH F 3 .   ? 7.733   -26.679 22.038 1.00 66.70 ? 1090 HOH B O   1 
HETATM 9483 O O   . HOH F 3 .   ? -10.614 25.768  54.771 1.00 58.63 ? 1091 HOH B O   1 
HETATM 9484 O O   . HOH F 3 .   ? -3.796  2.308   64.769 1.00 41.72 ? 1092 HOH B O   1 
HETATM 9485 O O   . HOH F 3 .   ? -0.303  -13.186 63.182 1.00 40.96 ? 1093 HOH B O   1 
HETATM 9486 O O   . HOH F 3 .   ? -6.435  -21.703 36.107 1.00 27.20 ? 1094 HOH B O   1 
HETATM 9487 O O   . HOH F 3 .   ? -5.337  0.517   45.352 1.00 33.48 ? 1095 HOH B O   1 
HETATM 9488 O O   . HOH F 3 .   ? -2.860  -1.976  65.729 1.00 44.50 ? 1096 HOH B O   1 
HETATM 9489 O O   . HOH F 3 .   ? -7.520  -33.126 25.078 1.00 77.61 ? 1097 HOH B O   1 
HETATM 9490 O O   . HOH F 3 .   ? 5.994   32.724  41.440 1.00 46.36 ? 1098 HOH B O   1 
HETATM 9491 O O   . HOH F 3 .   ? 1.190   -10.691 34.784 1.00 52.19 ? 1099 HOH B O   1 
HETATM 9492 O O   . HOH F 3 .   ? -23.188 20.140  46.567 1.00 46.46 ? 1100 HOH B O   1 
HETATM 9493 O O   . HOH F 3 .   ? -31.171 3.660   44.114 1.00 67.78 ? 1101 HOH B O   1 
HETATM 9494 O O   . HOH F 3 .   ? 13.631  -8.216  38.362 1.00 49.44 ? 1102 HOH B O   1 
HETATM 9495 O O   . HOH F 3 .   ? 11.482  -15.333 57.724 1.00 57.95 ? 1103 HOH B O   1 
HETATM 9496 O O   . HOH F 3 .   ? 0.757   -39.955 44.738 1.00 49.75 ? 1104 HOH B O   1 
HETATM 9497 O O   . HOH F 3 .   ? -27.982 10.968  40.300 1.00 62.85 ? 1105 HOH B O   1 
HETATM 9498 O O   . HOH F 3 .   ? -0.879  1.703   57.433 1.00 68.92 ? 1106 HOH B O   1 
HETATM 9499 O O   . HOH F 3 .   ? -18.750 -17.675 62.596 1.00 50.14 ? 1107 HOH B O   1 
HETATM 9500 O O   . HOH F 3 .   ? 18.469  -42.666 32.315 1.00 50.32 ? 1108 HOH B O   1 
HETATM 9501 O O   . HOH F 3 .   ? 8.648   18.187  61.699 1.00 40.68 ? 1109 HOH B O   1 
HETATM 9502 O O   . HOH F 3 .   ? 1.502   -18.793 62.928 1.00 44.12 ? 1110 HOH B O   1 
HETATM 9503 O O   . HOH F 3 .   ? -10.193 -26.476 21.794 1.00 49.40 ? 1111 HOH B O   1 
HETATM 9504 O O   . HOH F 3 .   ? -28.051 5.725   51.144 1.00 37.34 ? 1112 HOH B O   1 
HETATM 9505 O O   . HOH F 3 .   ? -3.548  22.289  42.070 1.00 59.70 ? 1113 HOH B O   1 
HETATM 9506 O O   . HOH F 3 .   ? -2.458  -37.091 23.451 1.00 67.46 ? 1114 HOH B O   1 
HETATM 9507 O O   . HOH F 3 .   ? 2.156   -13.986 32.536 1.00 49.81 ? 1115 HOH B O   1 
HETATM 9508 O O   . HOH F 3 .   ? 11.459  -4.186  36.315 1.00 51.29 ? 1116 HOH B O   1 
HETATM 9509 O O   . HOH F 3 .   ? 14.807  -28.207 51.614 1.00 59.66 ? 1117 HOH B O   1 
HETATM 9510 O O   . HOH F 3 .   ? -6.662  20.513  42.304 1.00 57.06 ? 1118 HOH B O   1 
HETATM 9511 O O   . HOH F 3 .   ? -4.579  -22.657 67.938 1.00 62.75 ? 1119 HOH B O   1 
HETATM 9512 O O   . HOH F 3 .   ? -23.937 -19.848 56.835 1.00 67.95 ? 1120 HOH B O   1 
HETATM 9513 O O   . HOH F 3 .   ? 18.256  -37.190 32.630 1.00 56.09 ? 1121 HOH B O   1 
HETATM 9514 O O   . HOH F 3 .   ? 6.703   31.772  27.479 1.00 58.70 ? 1122 HOH B O   1 
HETATM 9515 O O   . HOH F 3 .   ? 9.556   22.926  52.528 1.00 55.83 ? 1123 HOH B O   1 
HETATM 9516 O O   . HOH F 3 .   ? 9.403   -35.006 25.957 1.00 62.79 ? 1124 HOH B O   1 
HETATM 9517 O O   . HOH F 3 .   ? 7.101   3.890   66.912 1.00 52.14 ? 1125 HOH B O   1 
HETATM 9518 O O   . HOH F 3 .   ? 6.925   20.081  62.490 1.00 57.06 ? 1126 HOH B O   1 
HETATM 9519 O O   . HOH F 3 .   ? -10.003 11.505  62.185 1.00 67.68 ? 1127 HOH B O   1 
HETATM 9520 O O   . HOH F 3 .   ? -21.865 -0.382  60.836 1.00 40.97 ? 1128 HOH B O   1 
HETATM 9521 O O   . HOH F 3 .   ? -16.292 -7.642  6.689  1.00 42.51 ? 1129 HOH B O   1 
HETATM 9522 O O   . HOH F 3 .   ? -12.153 -18.091 40.563 1.00 42.83 ? 1130 HOH B O   1 
HETATM 9523 O O   . HOH F 3 .   ? 5.739   -16.653 7.065  1.00 42.38 ? 1131 HOH B O   1 
HETATM 9524 O O   . HOH F 3 .   ? -1.964  -26.329 60.294 1.00 66.27 ? 1132 HOH B O   1 
HETATM 9525 O O   . HOH F 3 .   ? -28.495 2.453   32.512 1.00 79.24 ? 1133 HOH B O   1 
HETATM 9526 O O   . HOH F 3 .   ? 12.806  23.278  36.631 1.00 54.06 ? 1134 HOH B O   1 
HETATM 9527 O O   . HOH F 3 .   ? -14.476 -9.817  4.974  1.00 49.99 ? 1135 HOH B O   1 
HETATM 9528 O O   . HOH F 3 .   ? -8.292  -39.341 32.837 1.00 67.77 ? 1136 HOH B O   1 
HETATM 9529 O O   . HOH F 3 .   ? -20.981 6.739   35.894 1.00 59.30 ? 1137 HOH B O   1 
HETATM 9530 O O   . HOH F 3 .   ? -9.382  14.740  38.397 1.00 44.79 ? 1138 HOH B O   1 
HETATM 9531 O O   . HOH F 3 .   ? -20.278 14.396  58.401 1.00 50.51 ? 1139 HOH B O   1 
HETATM 9532 O O   . HOH F 3 .   ? -20.011 -8.081  49.136 1.00 48.83 ? 1140 HOH B O   1 
HETATM 9533 O O   . HOH F 3 .   ? -18.460 13.496  47.681 1.00 66.87 ? 1141 HOH B O   1 
HETATM 9534 O O   . HOH F 3 .   ? -9.517  -17.758 2.791  1.00 64.76 ? 1142 HOH B O   1 
HETATM 9535 O O   . HOH F 3 .   ? 0.396   6.419   65.068 1.00 45.09 ? 1143 HOH B O   1 
HETATM 9536 O O   . HOH F 3 .   ? -15.980 -28.620 52.432 1.00 56.23 ? 1144 HOH B O   1 
HETATM 9537 O O   . HOH F 3 .   ? 2.770   -36.019 51.561 1.00 59.63 ? 1145 HOH B O   1 
HETATM 9538 O O   . HOH F 3 .   ? 10.429  -7.763  65.534 1.00 59.23 ? 1146 HOH B O   1 
HETATM 9539 O O   . HOH F 3 .   ? -8.799  -30.029 63.392 1.00 51.92 ? 1147 HOH B O   1 
HETATM 9540 O O   . HOH F 3 .   ? 4.981   5.720   66.729 1.00 50.64 ? 1148 HOH B O   1 
HETATM 9541 O O   . HOH F 3 .   ? -22.742 -7.074  54.088 1.00 61.62 ? 1149 HOH B O   1 
HETATM 9542 O O   . HOH F 3 .   ? -3.931  -15.916 0.782  1.00 53.95 ? 1150 HOH B O   1 
HETATM 9543 O O   . HOH F 3 .   ? -6.145  -7.676  0.452  1.00 60.42 ? 1151 HOH B O   1 
HETATM 9544 O O   . HOH F 3 .   ? 4.668   -11.805 34.584 1.00 56.14 ? 1152 HOH B O   1 
HETATM 9545 O O   . HOH F 3 .   ? 31.608  2.222   47.836 1.00 58.85 ? 1153 HOH B O   1 
HETATM 9546 O O   . HOH F 3 .   ? -26.534 -11.808 56.336 1.00 63.90 ? 1154 HOH B O   1 
HETATM 9547 O O   . HOH F 3 .   ? 1.533   30.110  59.687 1.00 63.09 ? 1155 HOH B O   1 
HETATM 9548 O O   . HOH F 3 .   ? 14.471  -22.982 54.259 1.00 62.48 ? 1156 HOH B O   1 
HETATM 9549 O O   . HOH F 3 .   ? -14.924 -23.273 30.571 1.00 63.75 ? 1157 HOH B O   1 
HETATM 9550 O O   . HOH F 3 .   ? 13.085  -39.296 37.987 1.00 42.10 ? 1158 HOH B O   1 
HETATM 9551 O O   . HOH F 3 .   ? -13.469 -16.870 37.634 1.00 43.24 ? 1159 HOH B O   1 
HETATM 9552 O O   . HOH F 3 .   ? 4.338   29.755  39.827 1.00 49.67 ? 1160 HOH B O   1 
HETATM 9553 O O   . HOH F 3 .   ? -19.796 1.458   60.382 1.00 46.07 ? 1161 HOH B O   1 
HETATM 9554 O O   . HOH F 3 .   ? -19.248 9.993   37.517 1.00 47.68 ? 1162 HOH B O   1 
HETATM 9555 O O   . HOH F 3 .   ? -2.948  -22.881 62.792 1.00 45.79 ? 1163 HOH B O   1 
HETATM 9556 O O   . HOH F 3 .   ? -20.969 -16.740 25.521 1.00 55.10 ? 1164 HOH B O   1 
HETATM 9557 O O   . HOH F 3 .   ? -5.377  -2.156  44.930 1.00 41.93 ? 1165 HOH B O   1 
HETATM 9558 O O   . HOH F 3 .   ? -15.946 11.432  37.643 1.00 45.30 ? 1166 HOH B O   1 
HETATM 9559 O O   . HOH F 3 .   ? 3.957   16.643  62.623 1.00 48.58 ? 1167 HOH B O   1 
HETATM 9560 O O   . HOH F 3 .   ? 9.653   21.873  63.487 1.00 70.74 ? 1168 HOH B O   1 
HETATM 9561 O O   . HOH F 3 .   ? 12.883  -28.439 53.408 1.00 70.42 ? 1169 HOH B O   1 
HETATM 9562 O O   . HOH F 3 .   ? 2.670   -38.360 24.225 1.00 57.38 ? 1170 HOH B O   1 
HETATM 9563 O O   . HOH F 3 .   ? -28.660 15.526  47.689 1.00 52.50 ? 1171 HOH B O   1 
HETATM 9564 O O   . HOH F 3 .   ? -17.351 26.211  43.733 1.00 60.34 ? 1172 HOH B O   1 
HETATM 9565 O O   . HOH F 3 .   ? -25.766 -10.337 59.951 1.00 58.69 ? 1173 HOH B O   1 
HETATM 9566 O O   . HOH F 3 .   ? -13.804 -2.905  66.774 1.00 68.41 ? 1174 HOH B O   1 
HETATM 9567 O O   . HOH F 3 .   ? -16.188 -27.734 56.171 1.00 64.32 ? 1175 HOH B O   1 
HETATM 9568 O O   . HOH F 3 .   ? -18.331 -27.452 63.453 1.00 55.27 ? 1176 HOH B O   1 
HETATM 9569 O O   . HOH F 3 .   ? 16.407  -9.852  59.325 1.00 61.62 ? 1177 HOH B O   1 
HETATM 9570 O O   . HOH F 3 .   ? -7.121  11.387  60.345 1.00 49.06 ? 1178 HOH B O   1 
HETATM 9571 O O   . HOH F 3 .   ? -7.074  -31.721 49.782 1.00 41.55 ? 1179 HOH B O   1 
HETATM 9572 O O   . HOH F 3 .   ? 17.872  26.031  42.783 1.00 59.77 ? 1180 HOH B O   1 
HETATM 9573 O O   . HOH F 3 .   ? -13.841 -22.340 70.424 1.00 48.95 ? 1181 HOH B O   1 
HETATM 9574 O O   . HOH F 3 .   ? -15.887 -1.827  65.662 1.00 70.78 ? 1182 HOH B O   1 
HETATM 9575 O O   . HOH F 3 .   ? -33.416 -1.998  41.765 1.00 69.21 ? 1183 HOH B O   1 
HETATM 9576 O O   . HOH F 3 .   ? 7.744   16.980  65.532 1.00 51.61 ? 1184 HOH B O   1 
HETATM 9577 O O   . HOH F 3 .   ? 13.796  -30.275 34.982 1.00 49.16 ? 1185 HOH B O   1 
HETATM 9578 O O   . HOH F 3 .   ? -7.214  -24.608 9.060  1.00 58.27 ? 1186 HOH B O   1 
HETATM 9579 O O   . HOH F 3 .   ? -15.803 7.429   62.840 1.00 60.38 ? 1187 HOH B O   1 
HETATM 9580 O O   . HOH F 3 .   ? 21.904  -8.457  55.006 1.00 61.21 ? 1188 HOH B O   1 
HETATM 9581 O O   . HOH F 3 .   ? 16.266  40.855  40.798 1.00 74.34 ? 1189 HOH B O   1 
HETATM 9582 O O   . HOH F 3 .   ? 23.275  -39.627 35.157 1.00 68.19 ? 1190 HOH B O   1 
HETATM 9583 O O   . HOH F 3 .   ? 7.931   30.797  46.054 1.00 69.67 ? 1191 HOH B O   1 
HETATM 9584 O O   . HOH F 3 .   ? -12.839 -25.551 27.739 1.00 65.17 ? 1192 HOH B O   1 
HETATM 9585 O O   . HOH F 3 .   ? 13.591  -5.701  52.185 1.00 33.03 ? 1193 HOH B O   1 
HETATM 9586 O O   . HOH F 3 .   ? -5.187  -21.761 60.917 1.00 39.63 ? 1194 HOH B O   1 
HETATM 9587 O O   . HOH F 3 .   ? 23.436  27.870  37.482 1.00 47.46 ? 1195 HOH B O   1 
HETATM 9588 O O   . HOH F 3 .   ? -22.080 -6.259  63.206 1.00 44.10 ? 1196 HOH B O   1 
HETATM 9589 O O   . HOH F 3 .   ? -16.541 -25.520 48.497 1.00 44.82 ? 1197 HOH B O   1 
HETATM 9590 O O   . HOH F 3 .   ? -2.548  7.552   46.734 1.00 32.80 ? 1198 HOH B O   1 
HETATM 9591 O O   . HOH F 3 .   ? 6.268   -27.680 59.807 1.00 64.64 ? 1199 HOH B O   1 
HETATM 9592 O O   . HOH F 3 .   ? 10.423  -24.578 56.265 1.00 47.41 ? 1200 HOH B O   1 
HETATM 9593 O O   . HOH F 3 .   ? 16.323  39.561  23.745 1.00 75.92 ? 1201 HOH B O   1 
HETATM 9594 O O   . HOH F 3 .   ? 9.608   -26.468 24.000 1.00 52.66 ? 1202 HOH B O   1 
HETATM 9595 O O   . HOH F 3 .   ? 9.892   20.214  51.948 1.00 45.65 ? 1203 HOH B O   1 
HETATM 9596 O O   . HOH F 3 .   ? -5.812  -36.621 24.107 1.00 59.26 ? 1204 HOH B O   1 
HETATM 9597 O O   . HOH F 3 .   ? -19.261 -18.054 22.679 1.00 55.94 ? 1205 HOH B O   1 
HETATM 9598 O O   . HOH F 3 .   ? -13.633 -28.091 58.515 1.00 57.30 ? 1206 HOH B O   1 
HETATM 9599 O O   . HOH F 3 .   ? 18.948  -28.586 40.082 1.00 64.27 ? 1207 HOH B O   1 
HETATM 9600 O O   . HOH F 3 .   ? -19.860 30.108  49.050 1.00 57.21 ? 1208 HOH B O   1 
HETATM 9601 O O   . HOH F 3 .   ? -32.818 -4.026  39.986 1.00 51.42 ? 1209 HOH B O   1 
HETATM 9602 O O   . HOH F 3 .   ? 4.831   -32.269 58.418 1.00 61.87 ? 1210 HOH B O   1 
HETATM 9603 O O   . HOH F 3 .   ? -21.715 25.673  55.928 1.00 59.83 ? 1211 HOH B O   1 
HETATM 9604 O O   . HOH F 3 .   ? -23.233 -2.768  56.067 1.00 55.70 ? 1212 HOH B O   1 
HETATM 9605 O O   . HOH F 3 .   ? -28.040 -14.704 47.206 1.00 73.06 ? 1213 HOH B O   1 
HETATM 9606 O O   . HOH F 3 .   ? 0.552   32.006  56.356 1.00 62.56 ? 1214 HOH B O   1 
HETATM 9607 O O   . HOH F 3 .   ? -2.423  -36.189 20.889 1.00 60.22 ? 1215 HOH B O   1 
HETATM 9608 O O   . HOH F 3 .   ? -20.028 -17.388 8.217  1.00 54.47 ? 1216 HOH B O   1 
HETATM 9609 O O   . HOH F 3 .   ? -9.158  -41.704 31.377 1.00 75.45 ? 1217 HOH B O   1 
HETATM 9610 O O   . HOH F 3 .   ? -15.048 -19.701 36.386 1.00 42.91 ? 1218 HOH B O   1 
HETATM 9611 O O   . HOH F 3 .   ? 16.930  -34.925 52.682 1.00 55.10 ? 1219 HOH B O   1 
HETATM 9612 O O   . HOH F 3 .   ? -28.796 7.910   43.731 1.00 64.56 ? 1220 HOH B O   1 
HETATM 9613 O O   . HOH F 3 .   ? -10.787 14.218  62.006 1.00 72.85 ? 1221 HOH B O   1 
HETATM 9614 O O   . HOH F 3 .   ? 7.039   -32.087 57.231 1.00 69.34 ? 1222 HOH B O   1 
HETATM 9615 O O   . HOH F 3 .   ? 17.249  -31.327 36.023 1.00 61.77 ? 1223 HOH B O   1 
HETATM 9616 O O   . HOH F 3 .   ? 31.863  -5.722  55.287 1.00 66.46 ? 1224 HOH B O   1 
HETATM 9617 O O   . HOH F 3 .   ? -15.072 11.897  31.937 1.00 66.89 ? 1225 HOH B O   1 
HETATM 9618 O O   . HOH F 3 .   ? -4.789  25.115  51.740 1.00 47.20 ? 1226 HOH B O   1 
HETATM 9619 O O   . HOH F 3 .   ? -22.407 -17.922 59.519 1.00 71.84 ? 1227 HOH B O   1 
HETATM 9620 O O   . HOH F 3 .   ? -21.965 -1.769  63.440 1.00 51.30 ? 1228 HOH B O   1 
HETATM 9621 O O   . HOH F 3 .   ? -23.626 -9.128  15.793 1.00 57.80 ? 1229 HOH B O   1 
HETATM 9622 O O   . HOH F 3 .   ? -22.849 23.487  55.311 1.00 58.92 ? 1230 HOH B O   1 
HETATM 9623 O O   . HOH F 3 .   ? 15.695  -18.982 33.325 1.00 55.81 ? 1231 HOH B O   1 
HETATM 9624 O O   . HOH F 3 .   ? -31.065 9.454   54.577 1.00 62.85 ? 1232 HOH B O   1 
HETATM 9625 O O   . HOH F 3 .   ? -3.304  -36.151 53.268 1.00 65.40 ? 1233 HOH B O   1 
HETATM 9626 O O   . HOH F 3 .   ? -3.590  -42.169 39.261 1.00 66.28 ? 1234 HOH B O   1 
HETATM 9627 O O   . HOH F 3 .   ? -20.449 -4.076  63.721 1.00 53.15 ? 1235 HOH B O   1 
HETATM 9628 O O   . HOH F 3 .   ? -2.381  19.906  35.797 1.00 58.76 ? 1236 HOH B O   1 
HETATM 9629 O O   . HOH F 3 .   ? -14.733 -34.490 32.596 1.00 50.86 ? 1237 HOH B O   1 
HETATM 9630 O O   . HOH F 3 .   ? 7.393   33.763  29.028 1.00 49.60 ? 1238 HOH B O   1 
HETATM 9631 O O   . HOH F 3 .   ? 2.014   -37.873 49.678 1.00 56.84 ? 1239 HOH B O   1 
HETATM 9632 O O   . HOH F 3 .   ? -10.981 -31.110 64.059 1.00 62.33 ? 1240 HOH B O   1 
HETATM 9633 O O   . HOH F 3 .   ? 3.597   -41.276 47.110 1.00 67.16 ? 1241 HOH B O   1 
HETATM 9634 O O   . HOH F 3 .   ? -12.395 -0.673  66.461 1.00 92.60 ? 1242 HOH B O   1 
HETATM 9635 O O   . HOH F 3 .   ? 22.181  -37.302 33.956 1.00 61.76 ? 1243 HOH B O   1 
HETATM 9636 O O   . HOH F 3 .   ? 23.306  33.932  40.727 1.00 60.93 ? 1244 HOH B O   1 
HETATM 9637 O O   . HOH F 3 .   ? -15.013 -26.697 65.267 1.00 52.26 ? 1245 HOH B O   1 
HETATM 9638 O O   . HOH F 3 .   ? -7.943  18.224  64.568 1.00 85.11 ? 1246 HOH B O   1 
HETATM 9639 O O   . HOH F 3 .   ? -4.238  20.839  34.365 1.00 50.28 ? 1247 HOH B O   1 
HETATM 9640 O O   . HOH F 3 .   ? 5.750   -24.990 59.231 1.00 44.19 ? 1248 HOH B O   1 
HETATM 9641 O O   . HOH F 3 .   ? 1.371   23.978  44.744 1.00 50.69 ? 1249 HOH B O   1 
HETATM 9642 O O   . HOH F 3 .   ? -6.892  21.412  45.232 1.00 56.95 ? 1250 HOH B O   1 
HETATM 9643 O O   . HOH F 3 .   ? 2.326   -31.957 58.151 1.00 47.72 ? 1251 HOH B O   1 
HETATM 9644 O O   . HOH F 3 .   ? 25.054  31.305  41.762 1.00 43.17 ? 1252 HOH B O   1 
HETATM 9645 O O   . HOH F 3 .   ? -14.174 -28.321 48.080 1.00 57.57 ? 1253 HOH B O   1 
HETATM 9646 O O   . HOH F 3 .   ? 34.003  4.176   47.142 1.00 65.22 ? 1254 HOH B O   1 
HETATM 9647 O O   . HOH F 3 .   ? -9.864  -18.148 69.823 1.00 57.25 ? 1255 HOH B O   1 
HETATM 9648 O O   . HOH F 3 .   ? -21.304 -17.048 14.473 1.00 49.91 ? 1256 HOH B O   1 
HETATM 9649 O O   . HOH F 3 .   ? 8.018   -18.509 35.177 1.00 52.06 ? 1257 HOH B O   1 
HETATM 9650 O O   . HOH F 3 .   ? -11.751 -23.765 65.309 1.00 43.67 ? 1258 HOH B O   1 
HETATM 9651 O O   . HOH F 3 .   ? 9.175   -12.760 60.599 1.00 54.61 ? 1259 HOH B O   1 
HETATM 9652 O O   . HOH F 3 .   ? -16.641 19.928  42.997 1.00 62.52 ? 1260 HOH B O   1 
HETATM 9653 O O   . HOH F 3 .   ? 6.437   15.754  63.613 1.00 49.94 ? 1261 HOH B O   1 
HETATM 9654 O O   . HOH F 3 .   ? 0.610   -35.894 48.359 1.00 70.80 ? 1262 HOH B O   1 
HETATM 9655 O O   . HOH F 3 .   ? -4.765  -7.996  2.946  1.00 53.06 ? 1263 HOH B O   1 
HETATM 9656 O O   . HOH F 3 .   ? -10.805 17.845  39.685 1.00 55.98 ? 1264 HOH B O   1 
HETATM 9657 O O   . HOH F 3 .   ? -3.980  25.233  45.032 1.00 54.04 ? 1265 HOH B O   1 
HETATM 9658 O O   . HOH F 3 .   ? 18.912  -22.965 39.833 1.00 56.91 ? 1266 HOH B O   1 
HETATM 9659 O O   . HOH F 3 .   ? 7.455   -7.040  35.827 1.00 64.35 ? 1267 HOH B O   1 
HETATM 9660 O O   . HOH F 3 .   ? -20.626 -23.275 18.820 1.00 80.16 ? 1268 HOH B O   1 
HETATM 9661 O O   . HOH F 3 .   ? -29.075 7.308   53.578 1.00 55.43 ? 1269 HOH B O   1 
HETATM 9662 O O   . HOH F 3 .   ? -4.644  -15.774 11.475 1.00 75.45 ? 1270 HOH B O   1 
HETATM 9663 O O   . HOH F 3 .   ? -11.790 21.250  61.845 1.00 59.73 ? 1271 HOH B O   1 
HETATM 9664 O O   . HOH F 3 .   ? -5.447  21.361  51.600 1.00 85.65 ? 1272 HOH B O   1 
HETATM 9665 O O   . HOH F 3 .   ? 18.387  23.711  31.330 1.00 67.80 ? 1273 HOH B O   1 
HETATM 9666 O O   . HOH F 3 .   ? -19.219 -30.441 55.182 1.00 66.64 ? 1274 HOH B O   1 
HETATM 9667 O O   . HOH F 3 .   ? 17.698  -13.252 46.744 1.00 55.71 ? 1275 HOH B O   1 
HETATM 9668 O O   . HOH F 3 .   ? 25.762  -6.770  50.562 1.00 58.71 ? 1276 HOH B O   1 
HETATM 9669 O O   . HOH F 3 .   ? -16.048 8.396   33.468 1.00 53.73 ? 1277 HOH B O   1 
HETATM 9670 O O   . HOH F 3 .   ? -21.435 -23.443 49.223 1.00 72.22 ? 1278 HOH B O   1 
HETATM 9671 O O   . HOH F 3 .   ? -11.831 18.831  63.161 1.00 59.72 ? 1279 HOH B O   1 
HETATM 9672 O O   . HOH F 3 .   ? -6.030  23.147  43.116 1.00 66.28 ? 1280 HOH B O   1 
HETATM 9673 O O   . HOH F 3 .   ? -17.948 -24.405 65.849 1.00 52.90 ? 1281 HOH B O   1 
HETATM 9674 O O   . HOH F 3 .   ? 5.891   -44.522 38.403 1.00 71.55 ? 1282 HOH B O   1 
HETATM 9675 O O   . HOH F 3 .   ? -18.812 14.278  45.186 1.00 54.66 ? 1283 HOH B O   1 
HETATM 9676 O O   . HOH F 3 .   ? 19.914  37.817  30.992 1.00 81.96 ? 1284 HOH B O   1 
HETATM 9677 O O   . HOH F 3 .   ? -26.914 -16.908 43.393 1.00 65.48 ? 1285 HOH B O   1 
HETATM 9678 O O   . HOH F 3 .   ? 9.276   -18.382 4.957  1.00 59.55 ? 1286 HOH B O   1 
HETATM 9679 O O   . HOH F 3 .   ? -17.838 -26.896 16.454 1.00 62.12 ? 1287 HOH B O   1 
HETATM 9680 O O   . HOH F 3 .   ? 18.956  -11.223 52.037 1.00 58.51 ? 1288 HOH B O   1 
HETATM 9681 O O   . HOH F 3 .   ? -24.323 -5.110  63.960 1.00 64.67 ? 1289 HOH B O   1 
HETATM 9682 O O   . HOH F 3 .   ? -21.635 9.190   60.412 1.00 48.11 ? 1290 HOH B O   1 
HETATM 9683 O O   . HOH F 3 .   ? -22.073 -22.566 21.452 1.00 53.38 ? 1291 HOH B O   1 
HETATM 9684 O O   . HOH F 3 .   ? -1.923  -39.625 37.456 1.00 62.15 ? 1292 HOH B O   1 
HETATM 9685 O O   . HOH F 3 .   ? 6.418   33.092  32.246 1.00 52.85 ? 1293 HOH B O   1 
HETATM 9686 O O   . HOH F 3 .   ? 10.275  -29.156 24.592 1.00 54.50 ? 1294 HOH B O   1 
HETATM 9687 O O   . HOH F 3 .   ? 16.276  -6.942  60.337 1.00 57.22 ? 1295 HOH B O   1 
HETATM 9688 O O   . HOH F 3 .   ? 13.995  39.898  25.168 1.00 66.21 ? 1296 HOH B O   1 
HETATM 9689 O O   . HOH F 3 .   ? 12.586  -45.211 35.229 1.00 63.77 ? 1297 HOH B O   1 
HETATM 9690 O O   . HOH F 3 .   ? 3.225   -15.273 0.634  1.00 77.04 ? 1298 HOH B O   1 
HETATM 9691 O O   . HOH F 3 .   ? -13.560 9.605   37.157 1.00 45.27 ? 1299 HOH B O   1 
HETATM 9692 O O   . HOH F 3 .   ? 29.971  5.982   49.302 1.00 59.80 ? 1300 HOH B O   1 
HETATM 9693 O O   . HOH F 3 .   ? 17.036  26.143  35.704 1.00 65.63 ? 1301 HOH B O   1 
HETATM 9694 O O   . HOH F 3 .   ? 10.447  18.852  63.507 1.00 61.96 ? 1302 HOH B O   1 
HETATM 9695 O O   . HOH F 3 .   ? 10.531  -42.967 54.598 1.00 64.63 ? 1303 HOH B O   1 
HETATM 9696 O O   . HOH F 3 .   ? -3.801  18.154  37.586 1.00 58.11 ? 1304 HOH B O   1 
HETATM 9697 O O   . HOH F 3 .   ? 15.254  24.592  46.299 1.00 54.47 ? 1305 HOH B O   1 
HETATM 9698 O O   . HOH F 3 .   ? -0.145  -49.203 31.852 1.00 74.21 ? 1306 HOH B O   1 
HETATM 9699 O O   . HOH F 3 .   ? 25.090  3.101   53.792 1.00 52.63 ? 1307 HOH B O   1 
HETATM 9700 O O   . HOH F 3 .   ? -24.721 15.579  60.936 1.00 63.30 ? 1308 HOH B O   1 
HETATM 9701 O O   . HOH F 3 .   ? 12.919  -30.185 25.320 1.00 70.32 ? 1309 HOH B O   1 
HETATM 9702 O O   . HOH F 3 .   ? 9.489   -13.595 36.769 1.00 55.99 ? 1310 HOH B O   1 
HETATM 9703 O O   . HOH F 3 .   ? 17.129  -20.420 40.337 1.00 60.09 ? 1311 HOH B O   1 
HETATM 9704 O O   . HOH F 3 .   ? -20.189 -19.374 10.220 1.00 73.31 ? 1312 HOH B O   1 
HETATM 9705 O O   . HOH F 3 .   ? -6.449  21.353  32.202 1.00 54.50 ? 1313 HOH B O   1 
HETATM 9706 O O   . HOH F 3 .   ? -21.493 -21.834 45.125 1.00 55.11 ? 1314 HOH B O   1 
HETATM 9707 O O   . HOH F 3 .   ? 12.713  21.578  49.864 1.00 63.02 ? 1315 HOH B O   1 
HETATM 9708 O O   . HOH F 3 .   ? 0.025   -1.193  66.503 1.00 54.43 ? 1316 HOH B O   1 
HETATM 9709 O O   . HOH F 3 .   ? 18.617  24.348  28.519 1.00 75.10 ? 1317 HOH B O   1 
HETATM 9710 O O   . HOH F 3 .   ? -12.640 19.036  41.254 1.00 68.51 ? 1318 HOH B O   1 
HETATM 9711 O O   . HOH F 3 .   ? -13.146 25.990  56.029 1.00 61.71 ? 1319 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   LEU 3   3   3   LEU LEU A . n 
A 1 4   THR 4   4   4   THR THR A . n 
A 1 5   ARG 5   5   5   ARG ARG A . n 
A 1 6   ASN 6   6   6   ASN ASN A . n 
A 1 7   PRO 7   7   7   PRO PRO A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   PHE 9   9   9   PHE PHE A . n 
A 1 10  GLN 10  10  10  GLN GLN A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  GLN 13  13  13  GLN GLN A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  TRP 15  15  15  TRP TRP A . n 
A 1 16  HIS 16  16  16  HIS HIS A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  HIS 19  19  19  HIS HIS A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  PHE 29  29  29  PHE PHE A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  THR 31  31  31  THR THR A . n 
A 1 32  ASP 32  32  32  ASP ASP A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  HIS 38  38  38  HIS HIS A . n 
A 1 39  PHE 39  39  39  PHE PHE A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  HIS 47  47  47  HIS HIS A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  HIS 49  49  49  HIS HIS A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  TYR 54  54  54  TYR TYR A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  MET 64  64  64  MET MET A . n 
A 1 65  HIS 65  65  65  HIS HIS A . n 
A 1 66  MET 66  66  66  MET MET A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  HIS 99  99  99  HIS HIS A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 ASN 104 104 104 ASN ASN A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 SER 106 106 106 SER SER A . n 
A 1 107 ASN 107 107 107 ASN ASN A . n 
A 1 108 THR 108 108 108 THR THR A . n 
A 1 109 PRO 109 109 109 PRO PRO A . n 
A 1 110 ILE 110 110 110 ILE ILE A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 MET 118 118 118 MET MET A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ASP 126 126 126 ASP ASP A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 MET 128 128 128 MET MET A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 PHE 131 131 131 PHE PHE A . n 
A 1 132 CYS 132 132 132 CYS CYS A . n 
A 1 133 GLN 133 133 133 GLN GLN A . n 
A 1 134 ARG 134 134 134 ARG ARG A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 ASP 139 139 139 ASP ASP A . n 
A 1 140 TRP 140 140 140 TRP TRP A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 TYR 143 143 143 TYR TYR A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 ILE 148 148 148 ILE ILE A . n 
A 1 149 THR 149 149 149 THR THR A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 ILE 154 154 154 ILE ILE A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 MET 165 165 165 MET MET A . n 
A 1 166 VAL 166 166 166 VAL VAL A . n 
A 1 167 THR 167 167 167 THR THR A . n 
A 1 168 GLU 168 168 168 GLU GLU A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LYS 171 171 171 LYS LYS A . n 
A 1 172 PRO 172 172 172 PRO PRO A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 SER 174 174 174 SER SER A . n 
A 1 175 SER 175 175 175 SER SER A . n 
A 1 176 GLY 176 176 176 GLY GLY A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 ARG 179 179 179 ARG ARG A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 TRP 181 181 181 TRP TRP A . n 
A 1 182 PHE 182 182 182 PHE PHE A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 ASN 185 185 185 ASN ASN A . n 
A 1 186 ILE 186 186 186 ILE ILE A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 HIS 190 190 190 HIS HIS A . n 
A 1 191 ILE 191 191 191 ILE ILE A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 LYS 193 193 193 LYS LYS A . n 
A 1 194 THR 194 194 194 THR THR A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 CYS 197 197 197 CYS CYS A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 PRO 200 200 200 PRO PRO A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 SER 202 202 202 SER SER A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 LEU 204 204 204 LEU LEU A . n 
A 1 205 PHE 205 205 205 PHE PHE A . n 
A 1 206 ILE 206 206 206 ILE ILE A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 SER 209 209 209 SER SER A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 THR 211 211 211 THR THR A . n 
A 1 212 PHE 212 212 212 PHE PHE A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 GLN 215 215 215 GLN GLN A . n 
A 1 216 GLU 216 216 216 GLU GLU A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 THR 219 219 219 THR THR A . n 
A 1 220 ASN 220 220 220 ASN ASN A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 LYS 222 222 222 LYS LYS A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 LYS 225 225 225 LYS LYS A . n 
A 1 226 ASP 226 226 226 ASP ASP A . n 
A 1 227 TRP 227 227 227 TRP TRP A . n 
A 1 228 PHE 228 228 228 PHE PHE A . n 
A 1 229 LEU 229 229 229 LEU LEU A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 SER 231 231 231 SER SER A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 SER 236 236 236 SER SER A . n 
A 1 237 THR 237 237 237 THR THR A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 LYS 240 240 240 LYS LYS A . n 
A 1 241 HIS 241 241 241 HIS HIS A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 VAL 243 243 243 VAL VAL A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 LEU 245 245 245 LEU LEU A . n 
A 1 246 SER 246 246 246 SER SER A . n 
A 1 247 THR 247 247 247 THR THR A . n 
A 1 248 ASN 248 248 248 ASN ASN A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 ALA 250 250 250 ALA ALA A . n 
A 1 251 LYS 251 251 251 LYS LYS A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 LYS 253 253 253 LYS LYS A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 PHE 255 255 255 PHE PHE A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 ASP 258 258 258 ASP ASP A . n 
A 1 259 PRO 259 259 259 PRO PRO A . n 
A 1 260 GLN 260 260 260 GLN GLN A . n 
A 1 261 ASN 261 261 261 ASN ASN A . n 
A 1 262 MET 262 262 262 MET MET A . n 
A 1 263 PHE 263 263 263 PHE PHE A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 PHE 265 265 265 PHE PHE A . n 
A 1 266 TRP 266 266 266 TRP TRP A . n 
A 1 267 ASP 267 267 267 ASP ASP A . n 
A 1 268 TRP 268 268 268 TRP TRP A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 GLY 270 270 270 GLY GLY A . n 
A 1 271 GLY 271 271 271 GLY GLY A . n 
A 1 272 ARG 272 272 272 ARG ARG A . n 
A 1 273 TYR 273 273 273 TYR TYR A . n 
A 1 274 SER 274 274 274 SER SER A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 TRP 276 276 276 TRP TRP A . n 
A 1 277 SER 277 277 277 SER SER A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 ILE 279 279 279 ILE ILE A . n 
A 1 280 GLY 280 280 280 GLY GLY A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 SER 282 282 282 SER SER A . n 
A 1 283 ILE 283 283 283 ILE ILE A . n 
A 1 284 ALA 284 284 284 ALA ALA A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 HIS 286 286 286 HIS HIS A . n 
A 1 287 VAL 287 287 287 VAL VAL A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 PHE 289 289 289 PHE PHE A . n 
A 1 290 ASP 290 290 290 ASP ASP A . n 
A 1 291 ASN 291 291 291 ASN ASN A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 GLU 293 293 293 GLU GLU A . n 
A 1 294 GLN 294 294 294 GLN GLN A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 SER 297 297 297 SER SER A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 HIS 300 300 300 HIS HIS A . n 
A 1 301 TRP 301 301 301 TRP TRP A . n 
A 1 302 MET 302 302 302 MET MET A . n 
A 1 303 ASP 303 303 303 ASP ASP A . n 
A 1 304 GLN 304 304 304 GLN GLN A . n 
A 1 305 HIS 305 305 305 HIS HIS A . n 
A 1 306 PHE 306 306 306 PHE PHE A . n 
A 1 307 ARG 307 307 307 ARG ARG A . n 
A 1 308 THR 308 308 308 THR THR A . n 
A 1 309 THR 309 309 309 THR THR A . n 
A 1 310 PRO 310 310 310 PRO PRO A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 GLU 312 312 312 GLU GLU A . n 
A 1 313 LYS 313 313 313 LYS LYS A . n 
A 1 314 ASN 314 314 314 ASN ASN A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 PRO 316 316 316 PRO PRO A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 ALA 320 320 320 ALA ALA A . n 
A 1 321 MET 321 321 321 MET MET A . n 
A 1 322 LEU 322 322 322 LEU LEU A . n 
A 1 323 GLY 323 323 323 GLY GLY A . n 
A 1 324 ILE 324 324 324 ILE ILE A . n 
A 1 325 TRP 325 325 325 TRP TRP A . n 
A 1 326 TYR 326 326 326 TYR TYR A . n 
A 1 327 ILE 327 327 327 ILE ILE A . n 
A 1 328 ASN 328 328 328 ASN ASN A . n 
A 1 329 CYS 329 329 329 CYS CYS A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 GLY 331 331 331 GLY GLY A . n 
A 1 332 CYS 332 332 332 CYS CYS A . n 
A 1 333 GLU 333 333 333 GLU GLU A . n 
A 1 334 THR 334 334 334 THR THR A . n 
A 1 335 GLN 335 335 335 GLN GLN A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 VAL 337 337 337 VAL VAL A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 PRO 339 339 339 PRO PRO A . n 
A 1 340 TYR 340 340 340 TYR TYR A . n 
A 1 341 ASP 341 341 341 ASP ASP A . n 
A 1 342 GLN 342 342 342 GLN GLN A . n 
A 1 343 TYR 343 343 343 TYR TYR A . n 
A 1 344 LEU 344 344 344 LEU LEU A . n 
A 1 345 HIS 345 345 345 HIS HIS A . n 
A 1 346 ARG 346 346 346 ARG ARG A . n 
A 1 347 PHE 347 347 347 PHE PHE A . n 
A 1 348 ALA 348 348 348 ALA ALA A . n 
A 1 349 ALA 349 349 349 ALA ALA A . n 
A 1 350 TYR 350 350 350 TYR TYR A . n 
A 1 351 PHE 351 351 351 PHE PHE A . n 
A 1 352 GLN 352 352 352 GLN GLN A . n 
A 1 353 GLN 353 353 353 GLN GLN A . n 
A 1 354 GLY 354 354 354 GLY GLY A . n 
A 1 355 ASP 355 355 355 ASP ASP A . n 
A 1 356 MET 356 356 356 MET MET A . n 
A 1 357 GLU 357 357 357 GLU GLU A . n 
A 1 358 SER 358 358 358 SER SER A . n 
A 1 359 ASN 359 359 359 ASN ASN A . n 
A 1 360 GLY 360 360 360 GLY GLY A . n 
A 1 361 LYS 361 361 361 LYS LYS A . n 
A 1 362 TYR 362 362 362 TYR TYR A . n 
A 1 363 ILE 363 363 363 ILE ILE A . n 
A 1 364 THR 364 364 364 THR THR A . n 
A 1 365 LYS 365 365 365 LYS LYS A . n 
A 1 366 SER 366 366 366 SER SER A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 ALA 368 368 368 ALA ALA A . n 
A 1 369 ARG 369 369 369 ARG ARG A . n 
A 1 370 VAL 370 370 370 VAL VAL A . n 
A 1 371 ASP 371 371 371 ASP ASP A . n 
A 1 372 HIS 372 372 372 HIS HIS A . n 
A 1 373 GLN 373 373 373 GLN GLN A . n 
A 1 374 THR 374 374 374 THR THR A . n 
A 1 375 GLY 375 375 375 GLY GLY A . n 
A 1 376 PRO 376 376 376 PRO PRO A . n 
A 1 377 ILE 377 377 377 ILE ILE A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 TRP 379 379 379 TRP TRP A . n 
A 1 380 GLY 380 380 380 GLY GLY A . n 
A 1 381 GLU 381 381 381 GLU GLU A . n 
A 1 382 PRO 382 382 382 PRO PRO A . n 
A 1 383 GLY 383 383 383 GLY GLY A . n 
A 1 384 THR 384 384 384 THR THR A . n 
A 1 385 ASN 385 385 385 ASN ASN A . n 
A 1 386 GLY 386 386 386 GLY GLY A . n 
A 1 387 GLN 387 387 387 GLN GLN A . n 
A 1 388 HIS 388 388 388 HIS HIS A . n 
A 1 389 ALA 389 389 389 ALA ALA A . n 
A 1 390 PHE 390 390 390 PHE PHE A . n 
A 1 391 TYR 391 391 391 TYR TYR A . n 
A 1 392 GLN 392 392 392 GLN GLN A . n 
A 1 393 LEU 393 393 393 LEU LEU A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 HIS 395 395 395 HIS HIS A . n 
A 1 396 GLN 396 396 396 GLN GLN A . n 
A 1 397 GLY 397 397 397 GLY GLY A . n 
A 1 398 THR 398 398 398 THR THR A . n 
A 1 399 LYS 399 399 399 LYS LYS A . n 
A 1 400 MET 400 400 400 MET MET A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 PRO 402 402 402 PRO PRO A . n 
A 1 403 CYS 403 403 403 CYS CYS A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 PHE 405 405 405 PHE PHE A . n 
A 1 406 LEU 406 406 406 LEU LEU A . n 
A 1 407 ILE 407 407 407 ILE ILE A . n 
A 1 408 PRO 408 408 408 PRO PRO A . n 
A 1 409 VAL 409 409 409 VAL VAL A . n 
A 1 410 GLN 410 410 410 GLN GLN A . n 
A 1 411 THR 411 411 411 THR THR A . n 
A 1 412 GLN 412 412 412 GLN GLN A . n 
A 1 413 HIS 413 413 413 HIS HIS A . n 
A 1 414 PRO 414 414 414 PRO PRO A . n 
A 1 415 ILE 415 415 415 ILE ILE A . n 
A 1 416 ARG 416 416 416 ARG ARG A . n 
A 1 417 LYS 417 417 417 LYS LYS A . n 
A 1 418 GLY 418 418 418 GLY GLY A . n 
A 1 419 LEU 419 419 419 LEU LEU A . n 
A 1 420 HIS 420 420 420 HIS HIS A . n 
A 1 421 HIS 421 421 421 HIS HIS A . n 
A 1 422 LYS 422 422 422 LYS LYS A . n 
A 1 423 ILE 423 423 423 ILE ILE A . n 
A 1 424 LEU 424 424 424 LEU LEU A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 ALA 426 426 426 ALA ALA A . n 
A 1 427 ASN 427 427 427 ASN ASN A . n 
A 1 428 PHE 428 428 428 PHE PHE A . n 
A 1 429 LEU 429 429 429 LEU LEU A . n 
A 1 430 ALA 430 430 430 ALA ALA A . n 
A 1 431 GLN 431 431 431 GLN GLN A . n 
A 1 432 THR 432 432 432 THR THR A . n 
A 1 433 GLU 433 433 433 GLU GLU A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 LEU 435 435 435 LEU LEU A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 LYS 437 437 437 LYS LYS A . n 
A 1 438 GLY 438 438 438 GLY GLY A . n 
A 1 439 LYS 439 439 439 LYS LYS A . n 
A 1 440 SER 440 440 440 SER SER A . n 
A 1 441 THR 441 441 441 THR THR A . n 
A 1 442 GLU 442 442 442 GLU GLU A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ALA 444 444 444 ALA ALA A . n 
A 1 445 ARG 445 445 445 ARG ARG A . n 
A 1 446 LYS 446 446 446 LYS LYS A . n 
A 1 447 GLU 447 447 447 GLU GLU A . n 
A 1 448 LEU 448 448 448 LEU LEU A . n 
A 1 449 GLN 449 449 449 GLN GLN A . n 
A 1 450 ALA 450 450 450 ALA ALA A . n 
A 1 451 ALA 451 451 451 ALA ALA A . n 
A 1 452 GLY 452 452 452 GLY GLY A . n 
A 1 453 LYS 453 453 453 LYS LYS A . n 
A 1 454 SER 454 454 454 SER SER A . n 
A 1 455 PRO 455 455 455 PRO PRO A . n 
A 1 456 GLU 456 456 456 GLU GLU A . n 
A 1 457 ASP 457 457 457 ASP ASP A . n 
A 1 458 LEU 458 458 458 LEU LEU A . n 
A 1 459 MET 459 459 459 MET MET A . n 
A 1 460 LYS 460 460 460 LYS LYS A . n 
A 1 461 LEU 461 461 461 LEU LEU A . n 
A 1 462 LEU 462 462 462 LEU LEU A . n 
A 1 463 PRO 463 463 463 PRO PRO A . n 
A 1 464 HIS 464 464 464 HIS HIS A . n 
A 1 465 LYS 465 465 465 LYS LYS A . n 
A 1 466 VAL 466 466 466 VAL VAL A . n 
A 1 467 PHE 467 467 467 PHE PHE A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLY 469 469 469 GLY GLY A . n 
A 1 470 ASN 470 470 470 ASN ASN A . n 
A 1 471 ARG 471 471 471 ARG ARG A . n 
A 1 472 PRO 472 472 472 PRO PRO A . n 
A 1 473 THR 473 473 473 THR THR A . n 
A 1 474 ASN 474 474 474 ASN ASN A . n 
A 1 475 SER 475 475 475 SER SER A . n 
A 1 476 ILE 476 476 476 ILE ILE A . n 
A 1 477 VAL 477 477 477 VAL VAL A . n 
A 1 478 PHE 478 478 478 PHE PHE A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 LYS 480 480 480 LYS LYS A . n 
A 1 481 LEU 481 481 481 LEU LEU A . n 
A 1 482 THR 482 482 482 THR THR A . n 
A 1 483 PRO 483 483 483 PRO PRO A . n 
A 1 484 PHE 484 484 484 PHE PHE A . n 
A 1 485 ILE 485 485 485 ILE ILE A . n 
A 1 486 LEU 486 486 486 LEU LEU A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ALA 488 488 488 ALA ALA A . n 
A 1 489 LEU 489 489 489 LEU LEU A . n 
A 1 490 ILE 490 490 490 ILE ILE A . n 
A 1 491 ALA 491 491 491 ALA ALA A . n 
A 1 492 MET 492 492 492 MET MET A . n 
A 1 493 TYR 493 493 493 TYR TYR A . n 
A 1 494 GLU 494 494 494 GLU GLU A . n 
A 1 495 HIS 495 495 495 HIS HIS A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 ILE 497 497 497 ILE ILE A . n 
A 1 498 PHE 498 498 498 PHE PHE A . n 
A 1 499 VAL 499 499 499 VAL VAL A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 GLY 501 501 501 GLY GLY A . n 
A 1 502 VAL 502 502 502 VAL VAL A . n 
A 1 503 VAL 503 503 503 VAL VAL A . n 
A 1 504 TRP 504 504 504 TRP TRP A . n 
A 1 505 ASP 505 505 505 ASP ASP A . n 
A 1 506 ILE 506 506 506 ILE ILE A . n 
A 1 507 ASN 507 507 507 ASN ASN A . n 
A 1 508 SER 508 508 508 SER SER A . n 
A 1 509 PHE 509 509 509 PHE PHE A . n 
A 1 510 ASP 510 510 510 ASP ASP A . n 
A 1 511 GLN 511 511 511 GLN GLN A . n 
A 1 512 TRP 512 512 512 TRP TRP A . n 
A 1 513 GLY 513 513 513 GLY GLY A . n 
A 1 514 VAL 514 514 514 VAL VAL A . n 
A 1 515 GLU 515 515 515 GLU GLU A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 GLY 517 517 517 GLY GLY A . n 
A 1 518 LYS 518 518 518 LYS LYS A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 LEU 520 520 520 LEU LEU A . n 
A 1 521 ALA 521 521 521 ALA ALA A . n 
A 1 522 LYS 522 522 522 LYS LYS A . n 
A 1 523 LYS 523 523 523 LYS LYS A . n 
A 1 524 ILE 524 524 524 ILE ILE A . n 
A 1 525 GLU 525 525 525 GLU GLU A . n 
A 1 526 PRO 526 526 526 PRO PRO A . n 
A 1 527 GLU 527 527 527 GLU GLU A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 ASP 529 529 529 ASP ASP A . n 
A 1 530 GLY 530 530 530 GLY GLY A . n 
A 1 531 SER 531 531 531 SER SER A . n 
A 1 532 SER 532 532 532 SER SER A . n 
A 1 533 PRO 533 533 533 PRO PRO A . n 
A 1 534 VAL 534 534 534 VAL VAL A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 SER 536 536 536 SER SER A . n 
A 1 537 HIS 537 537 537 HIS HIS A . n 
A 1 538 ASP 538 538 538 ASP ASP A . n 
A 1 539 SER 539 539 539 SER SER A . n 
A 1 540 SER 540 540 540 SER SER A . n 
A 1 541 THR 541 541 541 THR THR A . n 
A 1 542 ASN 542 542 542 ASN ASN A . n 
A 1 543 GLY 543 543 543 GLY GLY A . n 
A 1 544 LEU 544 544 544 LEU LEU A . n 
A 1 545 ILE 545 545 545 ILE ILE A . n 
A 1 546 ASN 546 546 546 ASN ASN A . n 
A 1 547 PHE 547 547 547 PHE PHE A . n 
A 1 548 ILE 548 548 548 ILE ILE A . n 
A 1 549 LYS 549 549 549 LYS LYS A . n 
A 1 550 GLN 550 550 550 GLN GLN A . n 
A 1 551 GLN 551 551 551 GLN GLN A . n 
A 1 552 ARG 552 552 552 ARG ARG A . n 
A 1 553 GLU 553 553 553 GLU GLU A . n 
A 1 554 ALA 554 554 554 ALA ALA A . n 
A 1 555 LYS 555 555 555 LYS LYS A . n 
A 1 556 ILE 556 556 556 ILE ILE A . n 
A 1 557 GLN 557 557 ?   ?   ?   A . n 
B 1 1   ALA 1   1   1   ALA ALA B . n 
B 1 2   ALA 2   2   2   ALA ALA B . n 
B 1 3   LEU 3   3   3   LEU LEU B . n 
B 1 4   THR 4   4   4   THR THR B . n 
B 1 5   ARG 5   5   5   ARG ARG B . n 
B 1 6   ASN 6   6   6   ASN ASN B . n 
B 1 7   PRO 7   7   7   PRO PRO B . n 
B 1 8   GLN 8   8   8   GLN GLN B . n 
B 1 9   PHE 9   9   9   PHE PHE B . n 
B 1 10  GLN 10  10  10  GLN GLN B . n 
B 1 11  LYS 11  11  11  LYS LYS B . n 
B 1 12  LEU 12  12  12  LEU LEU B . n 
B 1 13  GLN 13  13  13  GLN GLN B . n 
B 1 14  GLN 14  14  14  GLN GLN B . n 
B 1 15  TRP 15  15  15  TRP TRP B . n 
B 1 16  HIS 16  16  16  HIS HIS B . n 
B 1 17  ARG 17  17  17  ARG ARG B . n 
B 1 18  GLU 18  18  18  GLU GLU B . n 
B 1 19  HIS 19  19  19  HIS HIS B . n 
B 1 20  GLY 20  20  20  GLY GLY B . n 
B 1 21  SER 21  21  21  SER SER B . n 
B 1 22  GLU 22  22  22  GLU GLU B . n 
B 1 23  LEU 23  23  23  LEU LEU B . n 
B 1 24  ASN 24  24  24  ASN ASN B . n 
B 1 25  LEU 25  25  25  LEU LEU B . n 
B 1 26  ARG 26  26  26  ARG ARG B . n 
B 1 27  HIS 27  27  27  HIS HIS B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  PHE 29  29  29  PHE PHE B . n 
B 1 30  ASP 30  30  30  ASP ASP B . n 
B 1 31  THR 31  31  31  THR THR B . n 
B 1 32  ASP 32  32  32  ASP ASP B . n 
B 1 33  LYS 33  33  33  LYS LYS B . n 
B 1 34  GLU 34  34  34  GLU GLU B . n 
B 1 35  ARG 35  35  35  ARG ARG B . n 
B 1 36  PHE 36  36  36  PHE PHE B . n 
B 1 37  ASN 37  37  37  ASN ASN B . n 
B 1 38  HIS 38  38  38  HIS HIS B . n 
B 1 39  PHE 39  39  39  PHE PHE B . n 
B 1 40  SER 40  40  40  SER SER B . n 
B 1 41  LEU 41  41  41  LEU LEU B . n 
B 1 42  THR 42  42  42  THR THR B . n 
B 1 43  LEU 43  43  43  LEU LEU B . n 
B 1 44  ASN 44  44  44  ASN ASN B . n 
B 1 45  THR 45  45  45  THR THR B . n 
B 1 46  ASN 46  46  46  ASN ASN B . n 
B 1 47  HIS 47  47  47  HIS HIS B . n 
B 1 48  GLY 48  48  48  GLY GLY B . n 
B 1 49  HIS 49  49  49  HIS HIS B . n 
B 1 50  ILE 50  50  50  ILE ILE B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  ASP 53  53  53  ASP ASP B . n 
B 1 54  TYR 54  54  54  TYR TYR B . n 
B 1 55  SER 55  55  55  SER SER B . n 
B 1 56  LYS 56  56  56  LYS LYS B . n 
B 1 57  ASN 57  57  57  ASN ASN B . n 
B 1 58  LEU 58  58  58  LEU LEU B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  THR 60  60  60  THR THR B . n 
B 1 61  GLU 61  61  61  GLU GLU B . n 
B 1 62  GLU 62  62  62  GLU GLU B . n 
B 1 63  VAL 63  63  63  VAL VAL B . n 
B 1 64  MET 64  64  64  MET MET B . n 
B 1 65  HIS 65  65  65  HIS HIS B . n 
B 1 66  MET 66  66  66  MET MET B . n 
B 1 67  LEU 67  67  67  LEU LEU B . n 
B 1 68  LEU 68  68  68  LEU LEU B . n 
B 1 69  ASP 69  69  69  ASP ASP B . n 
B 1 70  LEU 70  70  70  LEU LEU B . n 
B 1 71  ALA 71  71  71  ALA ALA B . n 
B 1 72  LYS 72  72  72  LYS LYS B . n 
B 1 73  SER 73  73  73  SER SER B . n 
B 1 74  ARG 74  74  74  ARG ARG B . n 
B 1 75  GLY 75  75  75  GLY GLY B . n 
B 1 76  VAL 76  76  76  VAL VAL B . n 
B 1 77  GLU 77  77  77  GLU GLU B . n 
B 1 78  ALA 78  78  78  ALA ALA B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  ARG 80  80  80  ARG ARG B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  MET 83  83  83  MET MET B . n 
B 1 84  PHE 84  84  84  PHE PHE B . n 
B 1 85  ASN 85  85  85  ASN ASN B . n 
B 1 86  GLY 86  86  86  GLY GLY B . n 
B 1 87  GLU 87  87  87  GLU GLU B . n 
B 1 88  LYS 88  88  88  LYS LYS B . n 
B 1 89  ILE 89  89  89  ILE ILE B . n 
B 1 90  ASN 90  90  90  ASN ASN B . n 
B 1 91  SER 91  91  91  SER SER B . n 
B 1 92  THR 92  92  92  THR THR B . n 
B 1 93  GLU 93  93  93  GLU GLU B . n 
B 1 94  ASP 94  94  94  ASP ASP B . n 
B 1 95  ARG 95  95  95  ARG ARG B . n 
B 1 96  ALA 96  96  96  ALA ALA B . n 
B 1 97  VAL 97  97  97  VAL VAL B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  HIS 99  99  99  HIS HIS B . n 
B 1 100 VAL 100 100 100 VAL VAL B . n 
B 1 101 ALA 101 101 101 ALA ALA B . n 
B 1 102 LEU 102 102 102 LEU LEU B . n 
B 1 103 ARG 103 103 103 ARG ARG B . n 
B 1 104 ASN 104 104 104 ASN ASN B . n 
B 1 105 ARG 105 105 105 ARG ARG B . n 
B 1 106 SER 106 106 106 SER SER B . n 
B 1 107 ASN 107 107 107 ASN ASN B . n 
B 1 108 THR 108 108 108 THR THR B . n 
B 1 109 PRO 109 109 109 PRO PRO B . n 
B 1 110 ILE 110 110 110 ILE ILE B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 VAL 112 112 112 VAL VAL B . n 
B 1 113 ASP 113 113 113 ASP ASP B . n 
B 1 114 GLY 114 114 114 GLY GLY B . n 
B 1 115 LYS 115 115 115 LYS LYS B . n 
B 1 116 ASP 116 116 116 ASP ASP B . n 
B 1 117 VAL 117 117 117 VAL VAL B . n 
B 1 118 MET 118 118 118 MET MET B . n 
B 1 119 PRO 119 119 119 PRO PRO B . n 
B 1 120 GLU 120 120 120 GLU GLU B . n 
B 1 121 VAL 121 121 121 VAL VAL B . n 
B 1 122 ASN 122 122 122 ASN ASN B . n 
B 1 123 LYS 123 123 123 LYS LYS B . n 
B 1 124 VAL 124 124 124 VAL VAL B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 ASP 126 126 126 ASP ASP B . n 
B 1 127 LYS 127 127 127 LYS LYS B . n 
B 1 128 MET 128 128 128 MET MET B . n 
B 1 129 LYS 129 129 129 LYS LYS B . n 
B 1 130 ALA 130 130 130 ALA ALA B . n 
B 1 131 PHE 131 131 131 PHE PHE B . n 
B 1 132 CYS 132 132 132 CYS CYS B . n 
B 1 133 GLN 133 133 133 GLN GLN B . n 
B 1 134 ARG 134 134 134 ARG ARG B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 SER 137 137 137 SER SER B . n 
B 1 138 GLY 138 138 138 GLY GLY B . n 
B 1 139 ASP 139 139 139 ASP ASP B . n 
B 1 140 TRP 140 140 140 TRP TRP B . n 
B 1 141 LYS 141 141 141 LYS LYS B . n 
B 1 142 GLY 142 142 142 GLY GLY B . n 
B 1 143 TYR 143 143 143 TYR TYR B . n 
B 1 144 THR 144 144 144 THR THR B . n 
B 1 145 GLY 145 145 145 GLY GLY B . n 
B 1 146 LYS 146 146 146 LYS LYS B . n 
B 1 147 THR 147 147 147 THR THR B . n 
B 1 148 ILE 148 148 148 ILE ILE B . n 
B 1 149 THR 149 149 149 THR THR B . n 
B 1 150 ASP 150 150 150 ASP ASP B . n 
B 1 151 VAL 151 151 151 VAL VAL B . n 
B 1 152 ILE 152 152 152 ILE ILE B . n 
B 1 153 ASN 153 153 153 ASN ASN B . n 
B 1 154 ILE 154 154 154 ILE ILE B . n 
B 1 155 GLY 155 155 155 GLY GLY B . n 
B 1 156 ILE 156 156 156 ILE ILE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 GLY 158 158 158 GLY GLY B . n 
B 1 159 SER 159 159 159 SER SER B . n 
B 1 160 ASP 160 160 160 ASP ASP B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 GLY 162 162 162 GLY GLY B . n 
B 1 163 PRO 163 163 163 PRO PRO B . n 
B 1 164 LEU 164 164 164 LEU LEU B . n 
B 1 165 MET 165 165 165 MET MET B . n 
B 1 166 VAL 166 166 166 VAL VAL B . n 
B 1 167 THR 167 167 167 THR THR B . n 
B 1 168 GLU 168 168 168 GLU GLU B . n 
B 1 169 ALA 169 169 169 ALA ALA B . n 
B 1 170 LEU 170 170 170 LEU LEU B . n 
B 1 171 LYS 171 171 171 LYS LYS B . n 
B 1 172 PRO 172 172 172 PRO PRO B . n 
B 1 173 TYR 173 173 173 TYR TYR B . n 
B 1 174 SER 174 174 174 SER SER B . n 
B 1 175 SER 175 175 175 SER SER B . n 
B 1 176 GLY 176 176 176 GLY GLY B . n 
B 1 177 GLY 177 177 177 GLY GLY B . n 
B 1 178 PRO 178 178 178 PRO PRO B . n 
B 1 179 ARG 179 179 179 ARG ARG B . n 
B 1 180 VAL 180 180 180 VAL VAL B . n 
B 1 181 TRP 181 181 181 TRP TRP B . n 
B 1 182 PHE 182 182 182 PHE PHE B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 SER 184 184 184 SER SER B . n 
B 1 185 ASN 185 185 185 ASN ASN B . n 
B 1 186 ILE 186 186 186 ILE ILE B . n 
B 1 187 ASP 187 187 187 ASP ASP B . n 
B 1 188 GLY 188 188 188 GLY GLY B . n 
B 1 189 THR 189 189 189 THR THR B . n 
B 1 190 HIS 190 190 190 HIS HIS B . n 
B 1 191 ILE 191 191 191 ILE ILE B . n 
B 1 192 ALA 192 192 192 ALA ALA B . n 
B 1 193 LYS 193 193 193 LYS LYS B . n 
B 1 194 THR 194 194 194 THR THR B . n 
B 1 195 LEU 195 195 195 LEU LEU B . n 
B 1 196 ALA 196 196 196 ALA ALA B . n 
B 1 197 CYS 197 197 197 CYS CYS B . n 
B 1 198 LEU 198 198 198 LEU LEU B . n 
B 1 199 ASN 199 199 199 ASN ASN B . n 
B 1 200 PRO 200 200 200 PRO PRO B . n 
B 1 201 GLU 201 201 201 GLU GLU B . n 
B 1 202 SER 202 202 202 SER SER B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 LEU 204 204 204 LEU LEU B . n 
B 1 205 PHE 205 205 205 PHE PHE B . n 
B 1 206 ILE 206 206 206 ILE ILE B . n 
B 1 207 ILE 207 207 207 ILE ILE B . n 
B 1 208 ALA 208 208 208 ALA ALA B . n 
B 1 209 SER 209 209 209 SER SER B . n 
B 1 210 LYS 210 210 210 LYS LYS B . n 
B 1 211 THR 211 211 211 THR THR B . n 
B 1 212 PHE 212 212 212 PHE PHE B . n 
B 1 213 THR 213 213 213 THR THR B . n 
B 1 214 THR 214 214 214 THR THR B . n 
B 1 215 GLN 215 215 215 GLN GLN B . n 
B 1 216 GLU 216 216 216 GLU GLU B . n 
B 1 217 THR 217 217 217 THR THR B . n 
B 1 218 ILE 218 218 218 ILE ILE B . n 
B 1 219 THR 219 219 219 THR THR B . n 
B 1 220 ASN 220 220 220 ASN ASN B . n 
B 1 221 ALA 221 221 221 ALA ALA B . n 
B 1 222 LYS 222 222 222 LYS LYS B . n 
B 1 223 THR 223 223 223 THR THR B . n 
B 1 224 ALA 224 224 224 ALA ALA B . n 
B 1 225 LYS 225 225 225 LYS LYS B . n 
B 1 226 ASP 226 226 226 ASP ASP B . n 
B 1 227 TRP 227 227 227 TRP TRP B . n 
B 1 228 PHE 228 228 228 PHE PHE B . n 
B 1 229 LEU 229 229 229 LEU LEU B . n 
B 1 230 LEU 230 230 230 LEU LEU B . n 
B 1 231 SER 231 231 231 SER SER B . n 
B 1 232 ALA 232 232 232 ALA ALA B . n 
B 1 233 LYS 233 233 233 LYS LYS B . n 
B 1 234 ASP 234 234 234 ASP ASP B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 SER 236 236 236 SER SER B . n 
B 1 237 THR 237 237 237 THR THR B . n 
B 1 238 VAL 238 238 238 VAL VAL B . n 
B 1 239 ALA 239 239 239 ALA ALA B . n 
B 1 240 LYS 240 240 240 LYS LYS B . n 
B 1 241 HIS 241 241 241 HIS HIS B . n 
B 1 242 PHE 242 242 242 PHE PHE B . n 
B 1 243 VAL 243 243 243 VAL VAL B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 LEU 245 245 245 LEU LEU B . n 
B 1 246 SER 246 246 246 SER SER B . n 
B 1 247 THR 247 247 247 THR THR B . n 
B 1 248 ASN 248 248 248 ASN ASN B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 ALA 250 250 250 ALA ALA B . n 
B 1 251 LYS 251 251 251 LYS LYS B . n 
B 1 252 VAL 252 252 252 VAL VAL B . n 
B 1 253 LYS 253 253 253 LYS LYS B . n 
B 1 254 GLU 254 254 254 GLU GLU B . n 
B 1 255 PHE 255 255 255 PHE PHE B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 ILE 257 257 257 ILE ILE B . n 
B 1 258 ASP 258 258 258 ASP ASP B . n 
B 1 259 PRO 259 259 259 PRO PRO B . n 
B 1 260 GLN 260 260 260 GLN GLN B . n 
B 1 261 ASN 261 261 261 ASN ASN B . n 
B 1 262 MET 262 262 262 MET MET B . n 
B 1 263 PHE 263 263 263 PHE PHE B . n 
B 1 264 GLU 264 264 264 GLU GLU B . n 
B 1 265 PHE 265 265 265 PHE PHE B . n 
B 1 266 TRP 266 266 266 TRP TRP B . n 
B 1 267 ASP 267 267 267 ASP ASP B . n 
B 1 268 TRP 268 268 268 TRP TRP B . n 
B 1 269 VAL 269 269 269 VAL VAL B . n 
B 1 270 GLY 270 270 270 GLY GLY B . n 
B 1 271 GLY 271 271 271 GLY GLY B . n 
B 1 272 ARG 272 272 272 ARG ARG B . n 
B 1 273 TYR 273 273 273 TYR TYR B . n 
B 1 274 SER 274 274 274 SER SER B . n 
B 1 275 LEU 275 275 275 LEU LEU B . n 
B 1 276 TRP 276 276 276 TRP TRP B . n 
B 1 277 SER 277 277 277 SER SER B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 ILE 279 279 279 ILE ILE B . n 
B 1 280 GLY 280 280 280 GLY GLY B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 SER 282 282 282 SER SER B . n 
B 1 283 ILE 283 283 283 ILE ILE B . n 
B 1 284 ALA 284 284 284 ALA ALA B . n 
B 1 285 LEU 285 285 285 LEU LEU B . n 
B 1 286 HIS 286 286 286 HIS HIS B . n 
B 1 287 VAL 287 287 287 VAL VAL B . n 
B 1 288 GLY 288 288 288 GLY GLY B . n 
B 1 289 PHE 289 289 289 PHE PHE B . n 
B 1 290 ASP 290 290 290 ASP ASP B . n 
B 1 291 ASN 291 291 291 ASN ASN B . n 
B 1 292 PHE 292 292 292 PHE PHE B . n 
B 1 293 GLU 293 293 293 GLU GLU B . n 
B 1 294 GLN 294 294 294 GLN GLN B . n 
B 1 295 LEU 295 295 295 LEU LEU B . n 
B 1 296 LEU 296 296 296 LEU LEU B . n 
B 1 297 SER 297 297 297 SER SER B . n 
B 1 298 GLY 298 298 298 GLY GLY B . n 
B 1 299 ALA 299 299 299 ALA ALA B . n 
B 1 300 HIS 300 300 300 HIS HIS B . n 
B 1 301 TRP 301 301 301 TRP TRP B . n 
B 1 302 MET 302 302 302 MET MET B . n 
B 1 303 ASP 303 303 303 ASP ASP B . n 
B 1 304 GLN 304 304 304 GLN GLN B . n 
B 1 305 HIS 305 305 305 HIS HIS B . n 
B 1 306 PHE 306 306 306 PHE PHE B . n 
B 1 307 ARG 307 307 307 ARG ARG B . n 
B 1 308 THR 308 308 308 THR THR B . n 
B 1 309 THR 309 309 309 THR THR B . n 
B 1 310 PRO 310 310 310 PRO PRO B . n 
B 1 311 LEU 311 311 311 LEU LEU B . n 
B 1 312 GLU 312 312 312 GLU GLU B . n 
B 1 313 LYS 313 313 313 LYS LYS B . n 
B 1 314 ASN 314 314 314 ASN ASN B . n 
B 1 315 ALA 315 315 315 ALA ALA B . n 
B 1 316 PRO 316 316 316 PRO PRO B . n 
B 1 317 VAL 317 317 317 VAL VAL B . n 
B 1 318 LEU 318 318 318 LEU LEU B . n 
B 1 319 LEU 319 319 319 LEU LEU B . n 
B 1 320 ALA 320 320 320 ALA ALA B . n 
B 1 321 MET 321 321 321 MET MET B . n 
B 1 322 LEU 322 322 322 LEU LEU B . n 
B 1 323 GLY 323 323 323 GLY GLY B . n 
B 1 324 ILE 324 324 324 ILE ILE B . n 
B 1 325 TRP 325 325 325 TRP TRP B . n 
B 1 326 TYR 326 326 326 TYR TYR B . n 
B 1 327 ILE 327 327 327 ILE ILE B . n 
B 1 328 ASN 328 328 328 ASN ASN B . n 
B 1 329 CYS 329 329 329 CYS CYS B . n 
B 1 330 PHE 330 330 330 PHE PHE B . n 
B 1 331 GLY 331 331 331 GLY GLY B . n 
B 1 332 CYS 332 332 332 CYS CYS B . n 
B 1 333 GLU 333 333 333 GLU GLU B . n 
B 1 334 THR 334 334 334 THR THR B . n 
B 1 335 GLN 335 335 335 GLN GLN B . n 
B 1 336 ALA 336 336 336 ALA ALA B . n 
B 1 337 VAL 337 337 337 VAL VAL B . n 
B 1 338 LEU 338 338 338 LEU LEU B . n 
B 1 339 PRO 339 339 339 PRO PRO B . n 
B 1 340 TYR 340 340 340 TYR TYR B . n 
B 1 341 ASP 341 341 341 ASP ASP B . n 
B 1 342 GLN 342 342 342 GLN GLN B . n 
B 1 343 TYR 343 343 343 TYR TYR B . n 
B 1 344 LEU 344 344 344 LEU LEU B . n 
B 1 345 HIS 345 345 345 HIS HIS B . n 
B 1 346 ARG 346 346 346 ARG ARG B . n 
B 1 347 PHE 347 347 347 PHE PHE B . n 
B 1 348 ALA 348 348 348 ALA ALA B . n 
B 1 349 ALA 349 349 349 ALA ALA B . n 
B 1 350 TYR 350 350 350 TYR TYR B . n 
B 1 351 PHE 351 351 351 PHE PHE B . n 
B 1 352 GLN 352 352 352 GLN GLN B . n 
B 1 353 GLN 353 353 353 GLN GLN B . n 
B 1 354 GLY 354 354 354 GLY GLY B . n 
B 1 355 ASP 355 355 355 ASP ASP B . n 
B 1 356 MET 356 356 356 MET MET B . n 
B 1 357 GLU 357 357 357 GLU GLU B . n 
B 1 358 SER 358 358 358 SER SER B . n 
B 1 359 ASN 359 359 359 ASN ASN B . n 
B 1 360 GLY 360 360 360 GLY GLY B . n 
B 1 361 LYS 361 361 361 LYS LYS B . n 
B 1 362 TYR 362 362 362 TYR TYR B . n 
B 1 363 ILE 363 363 363 ILE ILE B . n 
B 1 364 THR 364 364 364 THR THR B . n 
B 1 365 LYS 365 365 365 LYS LYS B . n 
B 1 366 SER 366 366 366 SER SER B . n 
B 1 367 GLY 367 367 367 GLY GLY B . n 
B 1 368 ALA 368 368 368 ALA ALA B . n 
B 1 369 ARG 369 369 369 ARG ARG B . n 
B 1 370 VAL 370 370 370 VAL VAL B . n 
B 1 371 ASP 371 371 371 ASP ASP B . n 
B 1 372 HIS 372 372 372 HIS HIS B . n 
B 1 373 GLN 373 373 373 GLN GLN B . n 
B 1 374 THR 374 374 374 THR THR B . n 
B 1 375 GLY 375 375 375 GLY GLY B . n 
B 1 376 PRO 376 376 376 PRO PRO B . n 
B 1 377 ILE 377 377 377 ILE ILE B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 TRP 379 379 379 TRP TRP B . n 
B 1 380 GLY 380 380 380 GLY GLY B . n 
B 1 381 GLU 381 381 381 GLU GLU B . n 
B 1 382 PRO 382 382 382 PRO PRO B . n 
B 1 383 GLY 383 383 383 GLY GLY B . n 
B 1 384 THR 384 384 384 THR THR B . n 
B 1 385 ASN 385 385 385 ASN ASN B . n 
B 1 386 GLY 386 386 386 GLY GLY B . n 
B 1 387 GLN 387 387 387 GLN GLN B . n 
B 1 388 HIS 388 388 388 HIS HIS B . n 
B 1 389 ALA 389 389 389 ALA ALA B . n 
B 1 390 PHE 390 390 390 PHE PHE B . n 
B 1 391 TYR 391 391 391 TYR TYR B . n 
B 1 392 GLN 392 392 392 GLN GLN B . n 
B 1 393 LEU 393 393 393 LEU LEU B . n 
B 1 394 ILE 394 394 394 ILE ILE B . n 
B 1 395 HIS 395 395 395 HIS HIS B . n 
B 1 396 GLN 396 396 396 GLN GLN B . n 
B 1 397 GLY 397 397 397 GLY GLY B . n 
B 1 398 THR 398 398 398 THR THR B . n 
B 1 399 LYS 399 399 399 LYS LYS B . n 
B 1 400 MET 400 400 400 MET MET B . n 
B 1 401 ILE 401 401 401 ILE ILE B . n 
B 1 402 PRO 402 402 402 PRO PRO B . n 
B 1 403 CYS 403 403 403 CYS CYS B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 PHE 405 405 405 PHE PHE B . n 
B 1 406 LEU 406 406 406 LEU LEU B . n 
B 1 407 ILE 407 407 407 ILE ILE B . n 
B 1 408 PRO 408 408 408 PRO PRO B . n 
B 1 409 VAL 409 409 409 VAL VAL B . n 
B 1 410 GLN 410 410 410 GLN GLN B . n 
B 1 411 THR 411 411 411 THR THR B . n 
B 1 412 GLN 412 412 412 GLN GLN B . n 
B 1 413 HIS 413 413 413 HIS HIS B . n 
B 1 414 PRO 414 414 414 PRO PRO B . n 
B 1 415 ILE 415 415 415 ILE ILE B . n 
B 1 416 ARG 416 416 416 ARG ARG B . n 
B 1 417 LYS 417 417 417 LYS LYS B . n 
B 1 418 GLY 418 418 418 GLY GLY B . n 
B 1 419 LEU 419 419 419 LEU LEU B . n 
B 1 420 HIS 420 420 420 HIS HIS B . n 
B 1 421 HIS 421 421 421 HIS HIS B . n 
B 1 422 LYS 422 422 422 LYS LYS B . n 
B 1 423 ILE 423 423 423 ILE ILE B . n 
B 1 424 LEU 424 424 424 LEU LEU B . n 
B 1 425 LEU 425 425 425 LEU LEU B . n 
B 1 426 ALA 426 426 426 ALA ALA B . n 
B 1 427 ASN 427 427 427 ASN ASN B . n 
B 1 428 PHE 428 428 428 PHE PHE B . n 
B 1 429 LEU 429 429 429 LEU LEU B . n 
B 1 430 ALA 430 430 430 ALA ALA B . n 
B 1 431 GLN 431 431 431 GLN GLN B . n 
B 1 432 THR 432 432 432 THR THR B . n 
B 1 433 GLU 433 433 433 GLU GLU B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 LEU 435 435 435 LEU LEU B . n 
B 1 436 MET 436 436 436 MET MET B . n 
B 1 437 LYS 437 437 437 LYS LYS B . n 
B 1 438 GLY 438 438 438 GLY GLY B . n 
B 1 439 LYS 439 439 439 LYS LYS B . n 
B 1 440 SER 440 440 440 SER SER B . n 
B 1 441 THR 441 441 441 THR THR B . n 
B 1 442 GLU 442 442 442 GLU GLU B . n 
B 1 443 GLU 443 443 443 GLU GLU B . n 
B 1 444 ALA 444 444 444 ALA ALA B . n 
B 1 445 ARG 445 445 445 ARG ARG B . n 
B 1 446 LYS 446 446 446 LYS LYS B . n 
B 1 447 GLU 447 447 447 GLU GLU B . n 
B 1 448 LEU 448 448 448 LEU LEU B . n 
B 1 449 GLN 449 449 449 GLN GLN B . n 
B 1 450 ALA 450 450 450 ALA ALA B . n 
B 1 451 ALA 451 451 451 ALA ALA B . n 
B 1 452 GLY 452 452 452 GLY GLY B . n 
B 1 453 LYS 453 453 453 LYS LYS B . n 
B 1 454 SER 454 454 454 SER SER B . n 
B 1 455 PRO 455 455 455 PRO PRO B . n 
B 1 456 GLU 456 456 456 GLU GLU B . n 
B 1 457 ASP 457 457 457 ASP ASP B . n 
B 1 458 LEU 458 458 458 LEU LEU B . n 
B 1 459 MET 459 459 459 MET MET B . n 
B 1 460 LYS 460 460 460 LYS LYS B . n 
B 1 461 LEU 461 461 461 LEU LEU B . n 
B 1 462 LEU 462 462 462 LEU LEU B . n 
B 1 463 PRO 463 463 463 PRO PRO B . n 
B 1 464 HIS 464 464 464 HIS HIS B . n 
B 1 465 LYS 465 465 465 LYS LYS B . n 
B 1 466 VAL 466 466 466 VAL VAL B . n 
B 1 467 PHE 467 467 467 PHE PHE B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLY 469 469 469 GLY GLY B . n 
B 1 470 ASN 470 470 470 ASN ASN B . n 
B 1 471 ARG 471 471 471 ARG ARG B . n 
B 1 472 PRO 472 472 472 PRO PRO B . n 
B 1 473 THR 473 473 473 THR THR B . n 
B 1 474 ASN 474 474 474 ASN ASN B . n 
B 1 475 SER 475 475 475 SER SER B . n 
B 1 476 ILE 476 476 476 ILE ILE B . n 
B 1 477 VAL 477 477 477 VAL VAL B . n 
B 1 478 PHE 478 478 478 PHE PHE B . n 
B 1 479 THR 479 479 479 THR THR B . n 
B 1 480 LYS 480 480 480 LYS LYS B . n 
B 1 481 LEU 481 481 481 LEU LEU B . n 
B 1 482 THR 482 482 482 THR THR B . n 
B 1 483 PRO 483 483 483 PRO PRO B . n 
B 1 484 PHE 484 484 484 PHE PHE B . n 
B 1 485 ILE 485 485 485 ILE ILE B . n 
B 1 486 LEU 486 486 486 LEU LEU B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ALA 488 488 488 ALA ALA B . n 
B 1 489 LEU 489 489 489 LEU LEU B . n 
B 1 490 ILE 490 490 490 ILE ILE B . n 
B 1 491 ALA 491 491 491 ALA ALA B . n 
B 1 492 MET 492 492 492 MET MET B . n 
B 1 493 TYR 493 493 493 TYR TYR B . n 
B 1 494 GLU 494 494 494 GLU GLU B . n 
B 1 495 HIS 495 495 495 HIS HIS B . n 
B 1 496 LYS 496 496 496 LYS LYS B . n 
B 1 497 ILE 497 497 497 ILE ILE B . n 
B 1 498 PHE 498 498 498 PHE PHE B . n 
B 1 499 VAL 499 499 499 VAL VAL B . n 
B 1 500 GLN 500 500 500 GLN GLN B . n 
B 1 501 GLY 501 501 501 GLY GLY B . n 
B 1 502 VAL 502 502 502 VAL VAL B . n 
B 1 503 VAL 503 503 503 VAL VAL B . n 
B 1 504 TRP 504 504 504 TRP TRP B . n 
B 1 505 ASP 505 505 505 ASP ASP B . n 
B 1 506 ILE 506 506 506 ILE ILE B . n 
B 1 507 ASN 507 507 507 ASN ASN B . n 
B 1 508 SER 508 508 508 SER SER B . n 
B 1 509 PHE 509 509 509 PHE PHE B . n 
B 1 510 ASP 510 510 510 ASP ASP B . n 
B 1 511 GLN 511 511 511 GLN GLN B . n 
B 1 512 TRP 512 512 512 TRP TRP B . n 
B 1 513 GLY 513 513 513 GLY GLY B . n 
B 1 514 VAL 514 514 514 VAL VAL B . n 
B 1 515 GLU 515 515 515 GLU GLU B . n 
B 1 516 LEU 516 516 516 LEU LEU B . n 
B 1 517 GLY 517 517 517 GLY GLY B . n 
B 1 518 LYS 518 518 518 LYS LYS B . n 
B 1 519 GLN 519 519 519 GLN GLN B . n 
B 1 520 LEU 520 520 520 LEU LEU B . n 
B 1 521 ALA 521 521 521 ALA ALA B . n 
B 1 522 LYS 522 522 522 LYS LYS B . n 
B 1 523 LYS 523 523 523 LYS LYS B . n 
B 1 524 ILE 524 524 524 ILE ILE B . n 
B 1 525 GLU 525 525 525 GLU GLU B . n 
B 1 526 PRO 526 526 526 PRO PRO B . n 
B 1 527 GLU 527 527 527 GLU GLU B . n 
B 1 528 LEU 528 528 528 LEU LEU B . n 
B 1 529 ASP 529 529 529 ASP ASP B . n 
B 1 530 GLY 530 530 530 GLY GLY B . n 
B 1 531 SER 531 531 531 SER SER B . n 
B 1 532 SER 532 532 532 SER SER B . n 
B 1 533 PRO 533 533 533 PRO PRO B . n 
B 1 534 VAL 534 534 534 VAL VAL B . n 
B 1 535 THR 535 535 535 THR THR B . n 
B 1 536 SER 536 536 536 SER SER B . n 
B 1 537 HIS 537 537 537 HIS HIS B . n 
B 1 538 ASP 538 538 538 ASP ASP B . n 
B 1 539 SER 539 539 539 SER SER B . n 
B 1 540 SER 540 540 540 SER SER B . n 
B 1 541 THR 541 541 541 THR THR B . n 
B 1 542 ASN 542 542 542 ASN ASN B . n 
B 1 543 GLY 543 543 543 GLY GLY B . n 
B 1 544 LEU 544 544 544 LEU LEU B . n 
B 1 545 ILE 545 545 545 ILE ILE B . n 
B 1 546 ASN 546 546 546 ASN ASN B . n 
B 1 547 PHE 547 547 547 PHE PHE B . n 
B 1 548 ILE 548 548 548 ILE ILE B . n 
B 1 549 LYS 549 549 549 LYS LYS B . n 
B 1 550 GLN 550 550 550 GLN GLN B . n 
B 1 551 GLN 551 551 551 GLN GLN B . n 
B 1 552 ARG 552 552 552 ARG ARG B . n 
B 1 553 GLU 553 553 553 GLU GLU B . n 
B 1 554 ALA 554 554 554 ALA ALA B . n 
B 1 555 LYS 555 555 555 LYS LYS B . n 
B 1 556 ILE 556 556 556 ILE ILE B . n 
B 1 557 GLN 557 557 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 13800 ? 
1 MORE         -74   ? 
1 'SSA (A^2)'  36690 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-05-03 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
CNS       phasing          . ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CG A MET 83  ? ? SD A MET 83  ? ? CE  A MET 83  ? ? 110.07 100.20 9.87 1.60 N 
2 1 NE A ARG 95  ? ? CZ A ARG 95  ? ? NH2 A ARG 95  ? ? 123.91 120.30 3.61 0.50 N 
3 1 NE A ARG 272 ? ? CZ A ARG 272 ? ? NH2 A ARG 272 ? ? 123.92 120.30 3.62 0.50 N 
4 1 NE A ARG 369 ? ? CZ A ARG 369 ? ? NH2 A ARG 369 ? ? 123.87 120.30 3.57 0.50 N 
5 1 NE A ARG 552 ? ? CZ A ARG 552 ? ? NH2 A ARG 552 ? ? 123.97 120.30 3.67 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 2   ? ? -173.82 -34.85  
2  1 HIS A 19  ? ? -146.18 -33.63  
3  1 SER A 21  ? ? -155.52 -15.61  
4  1 ASP A 30  ? ? -80.22  32.73   
5  1 THR A 31  ? ? -158.66 4.16    
6  1 ASN A 46  ? ? 78.96   -3.97   
7  1 LYS A 56  ? ? -87.08  31.86   
8  1 ASP A 94  ? ? 38.05   59.68   
9  1 ASN A 107 ? ? 58.82   15.05   
10 1 ASP A 113 ? ? 32.95   36.47   
11 1 ASP A 160 ? ? -133.73 -58.12  
12 1 SER A 184 ? ? -140.46 -43.08  
13 1 ALA A 232 ? ? -154.37 -146.56 
14 1 LYS A 233 ? ? 173.63  175.37  
15 1 ASP A 234 ? ? 76.23   97.83   
16 1 PRO A 235 ? ? -57.53  2.59    
17 1 ASN A 248 ? ? -108.65 74.06   
18 1 GLU A 254 ? ? -65.94  6.65    
19 1 ASN A 261 ? ? -93.31  31.08   
20 1 SER A 277 ? ? -98.60  -155.93 
21 1 ASP A 341 ? ? -163.50 118.51  
22 1 THR A 374 ? ? -118.97 -134.69 
23 1 ASN A 385 ? ? -22.57  -65.63  
24 1 ALA A 389 ? ? -131.13 -107.77 
25 1 GLN A 511 ? ? -155.82 62.87   
26 1 GLN A 511 ? ? -155.82 62.95   
27 1 LYS A 518 ? A -74.52  27.74   
28 1 GLN A 519 ? A -160.45 4.20    
29 1 HIS A 537 ? ? -107.80 -169.92 
30 1 HIS B 19  ? ? -144.93 -23.69  
31 1 LEU B 23  ? ? -160.39 101.34  
32 1 HIS B 47  ? ? -140.08 26.42   
33 1 LYS B 56  ? ? -85.03  36.82   
34 1 ASN B 107 ? ? 57.89   17.91   
35 1 ASP B 160 ? ? -133.97 -57.25  
36 1 SER B 184 ? ? -138.82 -48.32  
37 1 SER B 209 ? ? -165.44 115.30  
38 1 PRO B 235 ? ? -47.81  -15.16  
39 1 PRO B 259 ? ? -58.67  -173.52 
40 1 GLN B 260 ? ? 73.50   -28.48  
41 1 SER B 277 ? ? -103.68 -160.40 
42 1 THR B 374 ? ? -123.04 -141.83 
43 1 ALA B 389 ? ? -140.79 -104.30 
44 1 GLN B 511 ? ? -162.35 62.71   
45 1 THR B 535 ? ? -142.81 12.58   
46 1 ALA B 554 ? ? -24.65  128.35  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 555 ? CG  ? A LYS 555 CG  
2  1 Y 1 A LYS 555 ? CD  ? A LYS 555 CD  
3  1 Y 1 A LYS 555 ? CE  ? A LYS 555 CE  
4  1 Y 1 A LYS 555 ? NZ  ? A LYS 555 NZ  
5  1 Y 1 A ILE 556 ? CG1 ? A ILE 556 CG1 
6  1 Y 1 A ILE 556 ? CG2 ? A ILE 556 CG2 
7  1 Y 1 A ILE 556 ? CD1 ? A ILE 556 CD1 
8  1 Y 1 B LYS 555 ? CG  ? B LYS 555 CG  
9  1 Y 1 B LYS 555 ? CD  ? B LYS 555 CD  
10 1 Y 1 B LYS 555 ? CE  ? B LYS 555 CE  
11 1 Y 1 B LYS 555 ? NZ  ? B LYS 555 NZ  
12 1 Y 1 B ILE 556 ? CG1 ? B ILE 556 CG1 
13 1 Y 1 B ILE 556 ? CG2 ? B ILE 556 CG2 
14 1 Y 1 B ILE 556 ? CD1 ? B ILE 556 CD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLN 557 ? A GLN 557 
2 1 Y 1 B GLN 557 ? B GLN 557 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '5-PHOSPHO-D-ARABINOHYDROXAMIC ACID' PAN 
3 water                                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PAN 1   902  902 PAN PAN A . 
D 2 PAN 1   901  901 PAN PAN B . 
E 3 HOH 1   903  1   HOH HOH A . 
E 3 HOH 2   904  2   HOH HOH A . 
E 3 HOH 3   905  4   HOH HOH A . 
E 3 HOH 4   906  6   HOH HOH A . 
E 3 HOH 5   907  7   HOH HOH A . 
E 3 HOH 6   908  11  HOH HOH A . 
E 3 HOH 7   909  16  HOH HOH A . 
E 3 HOH 8   910  22  HOH HOH A . 
E 3 HOH 9   911  26  HOH HOH A . 
E 3 HOH 10  912  30  HOH HOH A . 
E 3 HOH 11  913  31  HOH HOH A . 
E 3 HOH 12  914  32  HOH HOH A . 
E 3 HOH 13  915  34  HOH HOH A . 
E 3 HOH 14  916  35  HOH HOH A . 
E 3 HOH 15  917  40  HOH HOH A . 
E 3 HOH 16  918  41  HOH HOH A . 
E 3 HOH 17  919  42  HOH HOH A . 
E 3 HOH 18  920  43  HOH HOH A . 
E 3 HOH 19  921  44  HOH HOH A . 
E 3 HOH 20  922  45  HOH HOH A . 
E 3 HOH 21  923  53  HOH HOH A . 
E 3 HOH 22  924  54  HOH HOH A . 
E 3 HOH 23  925  55  HOH HOH A . 
E 3 HOH 24  926  58  HOH HOH A . 
E 3 HOH 25  927  59  HOH HOH A . 
E 3 HOH 26  928  60  HOH HOH A . 
E 3 HOH 27  929  66  HOH HOH A . 
E 3 HOH 28  930  69  HOH HOH A . 
E 3 HOH 29  931  72  HOH HOH A . 
E 3 HOH 30  932  76  HOH HOH A . 
E 3 HOH 31  933  77  HOH HOH A . 
E 3 HOH 32  934  78  HOH HOH A . 
E 3 HOH 33  935  79  HOH HOH A . 
E 3 HOH 34  936  80  HOH HOH A . 
E 3 HOH 35  937  84  HOH HOH A . 
E 3 HOH 36  938  85  HOH HOH A . 
E 3 HOH 37  939  89  HOH HOH A . 
E 3 HOH 38  940  90  HOH HOH A . 
E 3 HOH 39  941  91  HOH HOH A . 
E 3 HOH 40  942  94  HOH HOH A . 
E 3 HOH 41  943  95  HOH HOH A . 
E 3 HOH 42  944  98  HOH HOH A . 
E 3 HOH 43  945  99  HOH HOH A . 
E 3 HOH 44  946  101 HOH HOH A . 
E 3 HOH 45  947  102 HOH HOH A . 
E 3 HOH 46  948  104 HOH HOH A . 
E 3 HOH 47  949  105 HOH HOH A . 
E 3 HOH 48  950  106 HOH HOH A . 
E 3 HOH 49  951  108 HOH HOH A . 
E 3 HOH 50  952  110 HOH HOH A . 
E 3 HOH 51  953  114 HOH HOH A . 
E 3 HOH 52  954  118 HOH HOH A . 
E 3 HOH 53  955  119 HOH HOH A . 
E 3 HOH 54  956  122 HOH HOH A . 
E 3 HOH 55  957  123 HOH HOH A . 
E 3 HOH 56  958  124 HOH HOH A . 
E 3 HOH 57  959  127 HOH HOH A . 
E 3 HOH 58  960  130 HOH HOH A . 
E 3 HOH 59  961  132 HOH HOH A . 
E 3 HOH 60  962  133 HOH HOH A . 
E 3 HOH 61  963  135 HOH HOH A . 
E 3 HOH 62  964  136 HOH HOH A . 
E 3 HOH 63  965  137 HOH HOH A . 
E 3 HOH 64  966  143 HOH HOH A . 
E 3 HOH 65  967  145 HOH HOH A . 
E 3 HOH 66  968  146 HOH HOH A . 
E 3 HOH 67  969  147 HOH HOH A . 
E 3 HOH 68  970  149 HOH HOH A . 
E 3 HOH 69  971  150 HOH HOH A . 
E 3 HOH 70  972  154 HOH HOH A . 
E 3 HOH 71  973  155 HOH HOH A . 
E 3 HOH 72  974  157 HOH HOH A . 
E 3 HOH 73  975  160 HOH HOH A . 
E 3 HOH 74  976  163 HOH HOH A . 
E 3 HOH 75  977  164 HOH HOH A . 
E 3 HOH 76  978  165 HOH HOH A . 
E 3 HOH 77  979  167 HOH HOH A . 
E 3 HOH 78  980  168 HOH HOH A . 
E 3 HOH 79  981  169 HOH HOH A . 
E 3 HOH 80  982  170 HOH HOH A . 
E 3 HOH 81  983  171 HOH HOH A . 
E 3 HOH 82  984  176 HOH HOH A . 
E 3 HOH 83  985  181 HOH HOH A . 
E 3 HOH 84  986  183 HOH HOH A . 
E 3 HOH 85  987  185 HOH HOH A . 
E 3 HOH 86  988  186 HOH HOH A . 
E 3 HOH 87  989  188 HOH HOH A . 
E 3 HOH 88  990  189 HOH HOH A . 
E 3 HOH 89  991  192 HOH HOH A . 
E 3 HOH 90  992  197 HOH HOH A . 
E 3 HOH 91  993  198 HOH HOH A . 
E 3 HOH 92  994  201 HOH HOH A . 
E 3 HOH 93  995  202 HOH HOH A . 
E 3 HOH 94  996  204 HOH HOH A . 
E 3 HOH 95  997  206 HOH HOH A . 
E 3 HOH 96  998  209 HOH HOH A . 
E 3 HOH 97  999  211 HOH HOH A . 
E 3 HOH 98  1000 213 HOH HOH A . 
E 3 HOH 99  1001 216 HOH HOH A . 
E 3 HOH 100 1002 218 HOH HOH A . 
E 3 HOH 101 1003 219 HOH HOH A . 
E 3 HOH 102 1004 220 HOH HOH A . 
E 3 HOH 103 1005 221 HOH HOH A . 
E 3 HOH 104 1006 224 HOH HOH A . 
E 3 HOH 105 1007 231 HOH HOH A . 
E 3 HOH 106 1008 234 HOH HOH A . 
E 3 HOH 107 1009 237 HOH HOH A . 
E 3 HOH 108 1010 239 HOH HOH A . 
E 3 HOH 109 1011 242 HOH HOH A . 
E 3 HOH 110 1012 243 HOH HOH A . 
E 3 HOH 111 1013 244 HOH HOH A . 
E 3 HOH 112 1014 247 HOH HOH A . 
E 3 HOH 113 1015 248 HOH HOH A . 
E 3 HOH 114 1016 250 HOH HOH A . 
E 3 HOH 115 1017 252 HOH HOH A . 
E 3 HOH 116 1018 253 HOH HOH A . 
E 3 HOH 117 1019 254 HOH HOH A . 
E 3 HOH 118 1020 256 HOH HOH A . 
E 3 HOH 119 1021 257 HOH HOH A . 
E 3 HOH 120 1022 258 HOH HOH A . 
E 3 HOH 121 1023 259 HOH HOH A . 
E 3 HOH 122 1024 260 HOH HOH A . 
E 3 HOH 123 1025 261 HOH HOH A . 
E 3 HOH 124 1026 263 HOH HOH A . 
E 3 HOH 125 1027 266 HOH HOH A . 
E 3 HOH 126 1028 267 HOH HOH A . 
E 3 HOH 127 1029 269 HOH HOH A . 
E 3 HOH 128 1030 273 HOH HOH A . 
E 3 HOH 129 1031 274 HOH HOH A . 
E 3 HOH 130 1032 275 HOH HOH A . 
E 3 HOH 131 1033 279 HOH HOH A . 
E 3 HOH 132 1034 281 HOH HOH A . 
E 3 HOH 133 1035 285 HOH HOH A . 
E 3 HOH 134 1036 286 HOH HOH A . 
E 3 HOH 135 1037 293 HOH HOH A . 
E 3 HOH 136 1038 294 HOH HOH A . 
E 3 HOH 137 1039 296 HOH HOH A . 
E 3 HOH 138 1040 300 HOH HOH A . 
E 3 HOH 139 1041 301 HOH HOH A . 
E 3 HOH 140 1042 303 HOH HOH A . 
E 3 HOH 141 1043 304 HOH HOH A . 
E 3 HOH 142 1044 305 HOH HOH A . 
E 3 HOH 143 1045 306 HOH HOH A . 
E 3 HOH 144 1046 307 HOH HOH A . 
E 3 HOH 145 1047 316 HOH HOH A . 
E 3 HOH 146 1048 318 HOH HOH A . 
E 3 HOH 147 1049 322 HOH HOH A . 
E 3 HOH 148 1050 325 HOH HOH A . 
E 3 HOH 149 1051 328 HOH HOH A . 
E 3 HOH 150 1052 329 HOH HOH A . 
E 3 HOH 151 1053 333 HOH HOH A . 
E 3 HOH 152 1054 334 HOH HOH A . 
E 3 HOH 153 1055 335 HOH HOH A . 
E 3 HOH 154 1056 338 HOH HOH A . 
E 3 HOH 155 1057 339 HOH HOH A . 
E 3 HOH 156 1058 343 HOH HOH A . 
E 3 HOH 157 1059 344 HOH HOH A . 
E 3 HOH 158 1060 346 HOH HOH A . 
E 3 HOH 159 1061 347 HOH HOH A . 
E 3 HOH 160 1062 350 HOH HOH A . 
E 3 HOH 161 1063 351 HOH HOH A . 
E 3 HOH 162 1064 353 HOH HOH A . 
E 3 HOH 163 1065 355 HOH HOH A . 
E 3 HOH 164 1066 358 HOH HOH A . 
E 3 HOH 165 1067 359 HOH HOH A . 
E 3 HOH 166 1068 360 HOH HOH A . 
E 3 HOH 167 1069 362 HOH HOH A . 
E 3 HOH 168 1070 367 HOH HOH A . 
E 3 HOH 169 1071 369 HOH HOH A . 
E 3 HOH 170 1072 370 HOH HOH A . 
E 3 HOH 171 1073 374 HOH HOH A . 
E 3 HOH 172 1074 377 HOH HOH A . 
E 3 HOH 173 1075 378 HOH HOH A . 
E 3 HOH 174 1076 379 HOH HOH A . 
E 3 HOH 175 1077 380 HOH HOH A . 
E 3 HOH 176 1078 383 HOH HOH A . 
E 3 HOH 177 1079 384 HOH HOH A . 
E 3 HOH 178 1080 386 HOH HOH A . 
E 3 HOH 179 1081 387 HOH HOH A . 
E 3 HOH 180 1082 389 HOH HOH A . 
E 3 HOH 181 1083 390 HOH HOH A . 
E 3 HOH 182 1084 396 HOH HOH A . 
E 3 HOH 183 1085 398 HOH HOH A . 
E 3 HOH 184 1086 399 HOH HOH A . 
E 3 HOH 185 1087 400 HOH HOH A . 
E 3 HOH 186 1088 401 HOH HOH A . 
E 3 HOH 187 1089 403 HOH HOH A . 
E 3 HOH 188 1090 405 HOH HOH A . 
E 3 HOH 189 1091 407 HOH HOH A . 
E 3 HOH 190 1092 408 HOH HOH A . 
E 3 HOH 191 1093 409 HOH HOH A . 
E 3 HOH 192 1094 412 HOH HOH A . 
E 3 HOH 193 1095 418 HOH HOH A . 
E 3 HOH 194 1096 420 HOH HOH A . 
E 3 HOH 195 1097 425 HOH HOH A . 
E 3 HOH 196 1098 426 HOH HOH A . 
E 3 HOH 197 1099 427 HOH HOH A . 
E 3 HOH 198 1100 429 HOH HOH A . 
E 3 HOH 199 1101 430 HOH HOH A . 
E 3 HOH 200 1102 432 HOH HOH A . 
E 3 HOH 201 1103 433 HOH HOH A . 
E 3 HOH 202 1104 436 HOH HOH A . 
E 3 HOH 203 1105 437 HOH HOH A . 
E 3 HOH 204 1106 439 HOH HOH A . 
E 3 HOH 205 1107 446 HOH HOH A . 
E 3 HOH 206 1108 450 HOH HOH A . 
E 3 HOH 207 1109 451 HOH HOH A . 
E 3 HOH 208 1110 456 HOH HOH A . 
E 3 HOH 209 1111 457 HOH HOH A . 
E 3 HOH 210 1112 460 HOH HOH A . 
E 3 HOH 211 1113 461 HOH HOH A . 
E 3 HOH 212 1114 462 HOH HOH A . 
E 3 HOH 213 1115 464 HOH HOH A . 
E 3 HOH 214 1116 465 HOH HOH A . 
E 3 HOH 215 1117 469 HOH HOH A . 
E 3 HOH 216 1118 470 HOH HOH A . 
E 3 HOH 217 1119 474 HOH HOH A . 
E 3 HOH 218 1120 475 HOH HOH A . 
E 3 HOH 219 1121 476 HOH HOH A . 
E 3 HOH 220 1122 480 HOH HOH A . 
E 3 HOH 221 1123 482 HOH HOH A . 
E 3 HOH 222 1124 483 HOH HOH A . 
E 3 HOH 223 1125 485 HOH HOH A . 
E 3 HOH 224 1126 486 HOH HOH A . 
E 3 HOH 225 1127 488 HOH HOH A . 
E 3 HOH 226 1128 494 HOH HOH A . 
E 3 HOH 227 1129 495 HOH HOH A . 
E 3 HOH 228 1130 496 HOH HOH A . 
E 3 HOH 229 1131 497 HOH HOH A . 
E 3 HOH 230 1132 499 HOH HOH A . 
E 3 HOH 231 1133 500 HOH HOH A . 
E 3 HOH 232 1134 501 HOH HOH A . 
E 3 HOH 233 1135 503 HOH HOH A . 
E 3 HOH 234 1136 504 HOH HOH A . 
E 3 HOH 235 1137 505 HOH HOH A . 
E 3 HOH 236 1138 506 HOH HOH A . 
E 3 HOH 237 1139 508 HOH HOH A . 
E 3 HOH 238 1140 511 HOH HOH A . 
E 3 HOH 239 1141 513 HOH HOH A . 
E 3 HOH 240 1142 514 HOH HOH A . 
E 3 HOH 241 1143 517 HOH HOH A . 
E 3 HOH 242 1144 519 HOH HOH A . 
E 3 HOH 243 1145 522 HOH HOH A . 
E 3 HOH 244 1146 523 HOH HOH A . 
E 3 HOH 245 1147 525 HOH HOH A . 
E 3 HOH 246 1148 528 HOH HOH A . 
E 3 HOH 247 1149 529 HOH HOH A . 
E 3 HOH 248 1150 530 HOH HOH A . 
E 3 HOH 249 1151 531 HOH HOH A . 
E 3 HOH 250 1152 532 HOH HOH A . 
E 3 HOH 251 1153 533 HOH HOH A . 
E 3 HOH 252 1154 536 HOH HOH A . 
E 3 HOH 253 1155 538 HOH HOH A . 
E 3 HOH 254 1156 543 HOH HOH A . 
E 3 HOH 255 1157 544 HOH HOH A . 
E 3 HOH 256 1158 546 HOH HOH A . 
E 3 HOH 257 1159 547 HOH HOH A . 
E 3 HOH 258 1160 549 HOH HOH A . 
E 3 HOH 259 1161 550 HOH HOH A . 
E 3 HOH 260 1162 552 HOH HOH A . 
E 3 HOH 261 1163 555 HOH HOH A . 
E 3 HOH 262 1164 556 HOH HOH A . 
E 3 HOH 263 1165 557 HOH HOH A . 
E 3 HOH 264 1166 562 HOH HOH A . 
E 3 HOH 265 1167 563 HOH HOH A . 
E 3 HOH 266 1168 564 HOH HOH A . 
E 3 HOH 267 1169 565 HOH HOH A . 
E 3 HOH 268 1170 567 HOH HOH A . 
E 3 HOH 269 1171 568 HOH HOH A . 
E 3 HOH 270 1172 569 HOH HOH A . 
E 3 HOH 271 1173 571 HOH HOH A . 
E 3 HOH 272 1174 573 HOH HOH A . 
E 3 HOH 273 1175 574 HOH HOH A . 
E 3 HOH 274 1176 575 HOH HOH A . 
E 3 HOH 275 1177 576 HOH HOH A . 
E 3 HOH 276 1178 580 HOH HOH A . 
E 3 HOH 277 1179 583 HOH HOH A . 
E 3 HOH 278 1180 584 HOH HOH A . 
E 3 HOH 279 1181 585 HOH HOH A . 
E 3 HOH 280 1182 588 HOH HOH A . 
E 3 HOH 281 1183 589 HOH HOH A . 
E 3 HOH 282 1184 591 HOH HOH A . 
E 3 HOH 283 1185 592 HOH HOH A . 
E 3 HOH 284 1186 593 HOH HOH A . 
E 3 HOH 285 1187 594 HOH HOH A . 
E 3 HOH 286 1188 595 HOH HOH A . 
E 3 HOH 287 1189 596 HOH HOH A . 
E 3 HOH 288 1190 597 HOH HOH A . 
E 3 HOH 289 1191 601 HOH HOH A . 
E 3 HOH 290 1192 602 HOH HOH A . 
E 3 HOH 291 1193 603 HOH HOH A . 
E 3 HOH 292 1194 604 HOH HOH A . 
E 3 HOH 293 1195 609 HOH HOH A . 
E 3 HOH 294 1196 611 HOH HOH A . 
E 3 HOH 295 1197 614 HOH HOH A . 
E 3 HOH 296 1198 615 HOH HOH A . 
E 3 HOH 297 1199 616 HOH HOH A . 
E 3 HOH 298 1200 618 HOH HOH A . 
E 3 HOH 299 1201 619 HOH HOH A . 
E 3 HOH 300 1202 624 HOH HOH A . 
E 3 HOH 301 1203 625 HOH HOH A . 
E 3 HOH 302 1204 627 HOH HOH A . 
E 3 HOH 303 1205 628 HOH HOH A . 
E 3 HOH 304 1206 633 HOH HOH A . 
E 3 HOH 305 1207 635 HOH HOH A . 
E 3 HOH 306 1208 636 HOH HOH A . 
E 3 HOH 307 1209 639 HOH HOH A . 
E 3 HOH 308 1210 640 HOH HOH A . 
E 3 HOH 309 1211 642 HOH HOH A . 
E 3 HOH 310 1212 643 HOH HOH A . 
E 3 HOH 311 1213 644 HOH HOH A . 
E 3 HOH 312 1214 645 HOH HOH A . 
E 3 HOH 313 1215 648 HOH HOH A . 
E 3 HOH 314 1216 650 HOH HOH A . 
E 3 HOH 315 1217 651 HOH HOH A . 
E 3 HOH 316 1218 654 HOH HOH A . 
E 3 HOH 317 1219 655 HOH HOH A . 
E 3 HOH 318 1220 656 HOH HOH A . 
E 3 HOH 319 1221 659 HOH HOH A . 
E 3 HOH 320 1222 662 HOH HOH A . 
E 3 HOH 321 1223 665 HOH HOH A . 
E 3 HOH 322 1224 666 HOH HOH A . 
E 3 HOH 323 1225 667 HOH HOH A . 
E 3 HOH 324 1226 669 HOH HOH A . 
E 3 HOH 325 1227 671 HOH HOH A . 
E 3 HOH 326 1228 673 HOH HOH A . 
E 3 HOH 327 1229 674 HOH HOH A . 
E 3 HOH 328 1230 679 HOH HOH A . 
E 3 HOH 329 1231 680 HOH HOH A . 
E 3 HOH 330 1232 681 HOH HOH A . 
E 3 HOH 331 1233 682 HOH HOH A . 
E 3 HOH 332 1234 683 HOH HOH A . 
E 3 HOH 333 1235 685 HOH HOH A . 
E 3 HOH 334 1236 688 HOH HOH A . 
E 3 HOH 335 1237 690 HOH HOH A . 
E 3 HOH 336 1238 692 HOH HOH A . 
E 3 HOH 337 1239 694 HOH HOH A . 
E 3 HOH 338 1240 695 HOH HOH A . 
E 3 HOH 339 1241 701 HOH HOH A . 
E 3 HOH 340 1242 703 HOH HOH A . 
E 3 HOH 341 1243 704 HOH HOH A . 
E 3 HOH 342 1244 708 HOH HOH A . 
E 3 HOH 343 1245 709 HOH HOH A . 
E 3 HOH 344 1246 717 HOH HOH A . 
E 3 HOH 345 1247 718 HOH HOH A . 
E 3 HOH 346 1248 721 HOH HOH A . 
E 3 HOH 347 1249 722 HOH HOH A . 
E 3 HOH 348 1250 724 HOH HOH A . 
E 3 HOH 349 1251 726 HOH HOH A . 
E 3 HOH 350 1252 727 HOH HOH A . 
E 3 HOH 351 1253 729 HOH HOH A . 
E 3 HOH 352 1254 730 HOH HOH A . 
E 3 HOH 353 1255 732 HOH HOH A . 
E 3 HOH 354 1256 733 HOH HOH A . 
E 3 HOH 355 1257 735 HOH HOH A . 
E 3 HOH 356 1258 736 HOH HOH A . 
E 3 HOH 357 1259 737 HOH HOH A . 
E 3 HOH 358 1260 744 HOH HOH A . 
E 3 HOH 359 1261 745 HOH HOH A . 
E 3 HOH 360 1262 746 HOH HOH A . 
E 3 HOH 361 1263 749 HOH HOH A . 
E 3 HOH 362 1264 750 HOH HOH A . 
E 3 HOH 363 1265 753 HOH HOH A . 
E 3 HOH 364 1266 755 HOH HOH A . 
E 3 HOH 365 1267 757 HOH HOH A . 
E 3 HOH 366 1268 759 HOH HOH A . 
E 3 HOH 367 1269 760 HOH HOH A . 
E 3 HOH 368 1270 761 HOH HOH A . 
E 3 HOH 369 1271 762 HOH HOH A . 
E 3 HOH 370 1272 765 HOH HOH A . 
E 3 HOH 371 1273 767 HOH HOH A . 
E 3 HOH 372 1274 770 HOH HOH A . 
E 3 HOH 373 1275 771 HOH HOH A . 
E 3 HOH 374 1276 774 HOH HOH A . 
E 3 HOH 375 1277 775 HOH HOH A . 
E 3 HOH 376 1278 777 HOH HOH A . 
E 3 HOH 377 1279 778 HOH HOH A . 
E 3 HOH 378 1280 787 HOH HOH A . 
E 3 HOH 379 1281 788 HOH HOH A . 
E 3 HOH 380 1282 790 HOH HOH A . 
E 3 HOH 381 1283 791 HOH HOH A . 
E 3 HOH 382 1284 795 HOH HOH A . 
E 3 HOH 383 1285 798 HOH HOH A . 
E 3 HOH 384 1286 799 HOH HOH A . 
F 3 HOH 1   902  3   HOH HOH B . 
F 3 HOH 2   903  5   HOH HOH B . 
F 3 HOH 3   904  8   HOH HOH B . 
F 3 HOH 4   905  9   HOH HOH B . 
F 3 HOH 5   906  10  HOH HOH B . 
F 3 HOH 6   907  12  HOH HOH B . 
F 3 HOH 7   908  13  HOH HOH B . 
F 3 HOH 8   909  14  HOH HOH B . 
F 3 HOH 9   910  15  HOH HOH B . 
F 3 HOH 10  911  17  HOH HOH B . 
F 3 HOH 11  912  18  HOH HOH B . 
F 3 HOH 12  913  19  HOH HOH B . 
F 3 HOH 13  914  20  HOH HOH B . 
F 3 HOH 14  915  21  HOH HOH B . 
F 3 HOH 15  916  23  HOH HOH B . 
F 3 HOH 16  917  24  HOH HOH B . 
F 3 HOH 17  918  25  HOH HOH B . 
F 3 HOH 18  919  27  HOH HOH B . 
F 3 HOH 19  920  28  HOH HOH B . 
F 3 HOH 20  921  29  HOH HOH B . 
F 3 HOH 21  922  33  HOH HOH B . 
F 3 HOH 22  923  36  HOH HOH B . 
F 3 HOH 23  924  37  HOH HOH B . 
F 3 HOH 24  925  38  HOH HOH B . 
F 3 HOH 25  926  39  HOH HOH B . 
F 3 HOH 26  927  46  HOH HOH B . 
F 3 HOH 27  928  47  HOH HOH B . 
F 3 HOH 28  929  48  HOH HOH B . 
F 3 HOH 29  930  49  HOH HOH B . 
F 3 HOH 30  931  50  HOH HOH B . 
F 3 HOH 31  932  51  HOH HOH B . 
F 3 HOH 32  933  52  HOH HOH B . 
F 3 HOH 33  934  56  HOH HOH B . 
F 3 HOH 34  935  57  HOH HOH B . 
F 3 HOH 35  936  61  HOH HOH B . 
F 3 HOH 36  937  62  HOH HOH B . 
F 3 HOH 37  938  63  HOH HOH B . 
F 3 HOH 38  939  64  HOH HOH B . 
F 3 HOH 39  940  65  HOH HOH B . 
F 3 HOH 40  941  67  HOH HOH B . 
F 3 HOH 41  942  68  HOH HOH B . 
F 3 HOH 42  943  70  HOH HOH B . 
F 3 HOH 43  944  71  HOH HOH B . 
F 3 HOH 44  945  73  HOH HOH B . 
F 3 HOH 45  946  74  HOH HOH B . 
F 3 HOH 46  947  75  HOH HOH B . 
F 3 HOH 47  948  81  HOH HOH B . 
F 3 HOH 48  949  82  HOH HOH B . 
F 3 HOH 49  950  83  HOH HOH B . 
F 3 HOH 50  951  86  HOH HOH B . 
F 3 HOH 51  952  87  HOH HOH B . 
F 3 HOH 52  953  88  HOH HOH B . 
F 3 HOH 53  954  92  HOH HOH B . 
F 3 HOH 54  955  93  HOH HOH B . 
F 3 HOH 55  956  96  HOH HOH B . 
F 3 HOH 56  957  97  HOH HOH B . 
F 3 HOH 57  958  100 HOH HOH B . 
F 3 HOH 58  959  103 HOH HOH B . 
F 3 HOH 59  960  107 HOH HOH B . 
F 3 HOH 60  961  109 HOH HOH B . 
F 3 HOH 61  962  111 HOH HOH B . 
F 3 HOH 62  963  112 HOH HOH B . 
F 3 HOH 63  964  113 HOH HOH B . 
F 3 HOH 64  965  115 HOH HOH B . 
F 3 HOH 65  966  116 HOH HOH B . 
F 3 HOH 66  967  117 HOH HOH B . 
F 3 HOH 67  968  120 HOH HOH B . 
F 3 HOH 68  969  121 HOH HOH B . 
F 3 HOH 69  970  125 HOH HOH B . 
F 3 HOH 70  971  126 HOH HOH B . 
F 3 HOH 71  972  128 HOH HOH B . 
F 3 HOH 72  973  129 HOH HOH B . 
F 3 HOH 73  974  131 HOH HOH B . 
F 3 HOH 74  975  134 HOH HOH B . 
F 3 HOH 75  976  138 HOH HOH B . 
F 3 HOH 76  977  139 HOH HOH B . 
F 3 HOH 77  978  140 HOH HOH B . 
F 3 HOH 78  979  141 HOH HOH B . 
F 3 HOH 79  980  142 HOH HOH B . 
F 3 HOH 80  981  144 HOH HOH B . 
F 3 HOH 81  982  148 HOH HOH B . 
F 3 HOH 82  983  151 HOH HOH B . 
F 3 HOH 83  984  152 HOH HOH B . 
F 3 HOH 84  985  153 HOH HOH B . 
F 3 HOH 85  986  156 HOH HOH B . 
F 3 HOH 86  987  158 HOH HOH B . 
F 3 HOH 87  988  159 HOH HOH B . 
F 3 HOH 88  989  161 HOH HOH B . 
F 3 HOH 89  990  162 HOH HOH B . 
F 3 HOH 90  991  166 HOH HOH B . 
F 3 HOH 91  992  172 HOH HOH B . 
F 3 HOH 92  993  173 HOH HOH B . 
F 3 HOH 93  994  174 HOH HOH B . 
F 3 HOH 94  995  175 HOH HOH B . 
F 3 HOH 95  996  177 HOH HOH B . 
F 3 HOH 96  997  178 HOH HOH B . 
F 3 HOH 97  998  179 HOH HOH B . 
F 3 HOH 98  999  180 HOH HOH B . 
F 3 HOH 99  1000 182 HOH HOH B . 
F 3 HOH 100 1001 184 HOH HOH B . 
F 3 HOH 101 1002 187 HOH HOH B . 
F 3 HOH 102 1003 190 HOH HOH B . 
F 3 HOH 103 1004 191 HOH HOH B . 
F 3 HOH 104 1005 193 HOH HOH B . 
F 3 HOH 105 1006 194 HOH HOH B . 
F 3 HOH 106 1007 195 HOH HOH B . 
F 3 HOH 107 1008 196 HOH HOH B . 
F 3 HOH 108 1009 199 HOH HOH B . 
F 3 HOH 109 1010 200 HOH HOH B . 
F 3 HOH 110 1011 203 HOH HOH B . 
F 3 HOH 111 1012 205 HOH HOH B . 
F 3 HOH 112 1013 207 HOH HOH B . 
F 3 HOH 113 1014 208 HOH HOH B . 
F 3 HOH 114 1015 210 HOH HOH B . 
F 3 HOH 115 1016 212 HOH HOH B . 
F 3 HOH 116 1017 214 HOH HOH B . 
F 3 HOH 117 1018 215 HOH HOH B . 
F 3 HOH 118 1019 217 HOH HOH B . 
F 3 HOH 119 1020 222 HOH HOH B . 
F 3 HOH 120 1021 223 HOH HOH B . 
F 3 HOH 121 1022 225 HOH HOH B . 
F 3 HOH 122 1023 226 HOH HOH B . 
F 3 HOH 123 1024 227 HOH HOH B . 
F 3 HOH 124 1025 228 HOH HOH B . 
F 3 HOH 125 1026 229 HOH HOH B . 
F 3 HOH 126 1027 230 HOH HOH B . 
F 3 HOH 127 1028 232 HOH HOH B . 
F 3 HOH 128 1029 233 HOH HOH B . 
F 3 HOH 129 1030 235 HOH HOH B . 
F 3 HOH 130 1031 236 HOH HOH B . 
F 3 HOH 131 1032 238 HOH HOH B . 
F 3 HOH 132 1033 240 HOH HOH B . 
F 3 HOH 133 1034 241 HOH HOH B . 
F 3 HOH 134 1035 245 HOH HOH B . 
F 3 HOH 135 1036 246 HOH HOH B . 
F 3 HOH 136 1037 249 HOH HOH B . 
F 3 HOH 137 1038 251 HOH HOH B . 
F 3 HOH 138 1039 255 HOH HOH B . 
F 3 HOH 139 1040 262 HOH HOH B . 
F 3 HOH 140 1041 264 HOH HOH B . 
F 3 HOH 141 1042 265 HOH HOH B . 
F 3 HOH 142 1043 268 HOH HOH B . 
F 3 HOH 143 1044 270 HOH HOH B . 
F 3 HOH 144 1045 271 HOH HOH B . 
F 3 HOH 145 1046 272 HOH HOH B . 
F 3 HOH 146 1047 276 HOH HOH B . 
F 3 HOH 147 1048 277 HOH HOH B . 
F 3 HOH 148 1049 278 HOH HOH B . 
F 3 HOH 149 1050 280 HOH HOH B . 
F 3 HOH 150 1051 282 HOH HOH B . 
F 3 HOH 151 1052 283 HOH HOH B . 
F 3 HOH 152 1053 284 HOH HOH B . 
F 3 HOH 153 1054 287 HOH HOH B . 
F 3 HOH 154 1055 288 HOH HOH B . 
F 3 HOH 155 1056 289 HOH HOH B . 
F 3 HOH 156 1057 290 HOH HOH B . 
F 3 HOH 157 1058 291 HOH HOH B . 
F 3 HOH 158 1059 292 HOH HOH B . 
F 3 HOH 159 1060 295 HOH HOH B . 
F 3 HOH 160 1061 297 HOH HOH B . 
F 3 HOH 161 1062 298 HOH HOH B . 
F 3 HOH 162 1063 299 HOH HOH B . 
F 3 HOH 163 1064 302 HOH HOH B . 
F 3 HOH 164 1065 308 HOH HOH B . 
F 3 HOH 165 1066 309 HOH HOH B . 
F 3 HOH 166 1067 310 HOH HOH B . 
F 3 HOH 167 1068 311 HOH HOH B . 
F 3 HOH 168 1069 312 HOH HOH B . 
F 3 HOH 169 1070 313 HOH HOH B . 
F 3 HOH 170 1071 314 HOH HOH B . 
F 3 HOH 171 1072 315 HOH HOH B . 
F 3 HOH 172 1073 317 HOH HOH B . 
F 3 HOH 173 1074 319 HOH HOH B . 
F 3 HOH 174 1075 320 HOH HOH B . 
F 3 HOH 175 1076 321 HOH HOH B . 
F 3 HOH 176 1077 323 HOH HOH B . 
F 3 HOH 177 1078 324 HOH HOH B . 
F 3 HOH 178 1079 326 HOH HOH B . 
F 3 HOH 179 1080 327 HOH HOH B . 
F 3 HOH 180 1081 330 HOH HOH B . 
F 3 HOH 181 1082 331 HOH HOH B . 
F 3 HOH 182 1083 332 HOH HOH B . 
F 3 HOH 183 1084 336 HOH HOH B . 
F 3 HOH 184 1085 337 HOH HOH B . 
F 3 HOH 185 1086 340 HOH HOH B . 
F 3 HOH 186 1087 341 HOH HOH B . 
F 3 HOH 187 1088 342 HOH HOH B . 
F 3 HOH 188 1089 345 HOH HOH B . 
F 3 HOH 189 1090 348 HOH HOH B . 
F 3 HOH 190 1091 349 HOH HOH B . 
F 3 HOH 191 1092 352 HOH HOH B . 
F 3 HOH 192 1093 354 HOH HOH B . 
F 3 HOH 193 1094 356 HOH HOH B . 
F 3 HOH 194 1095 357 HOH HOH B . 
F 3 HOH 195 1096 361 HOH HOH B . 
F 3 HOH 196 1097 363 HOH HOH B . 
F 3 HOH 197 1098 364 HOH HOH B . 
F 3 HOH 198 1099 365 HOH HOH B . 
F 3 HOH 199 1100 366 HOH HOH B . 
F 3 HOH 200 1101 368 HOH HOH B . 
F 3 HOH 201 1102 371 HOH HOH B . 
F 3 HOH 202 1103 372 HOH HOH B . 
F 3 HOH 203 1104 373 HOH HOH B . 
F 3 HOH 204 1105 375 HOH HOH B . 
F 3 HOH 205 1106 376 HOH HOH B . 
F 3 HOH 206 1107 381 HOH HOH B . 
F 3 HOH 207 1108 382 HOH HOH B . 
F 3 HOH 208 1109 385 HOH HOH B . 
F 3 HOH 209 1110 388 HOH HOH B . 
F 3 HOH 210 1111 391 HOH HOH B . 
F 3 HOH 211 1112 392 HOH HOH B . 
F 3 HOH 212 1113 393 HOH HOH B . 
F 3 HOH 213 1114 394 HOH HOH B . 
F 3 HOH 214 1115 395 HOH HOH B . 
F 3 HOH 215 1116 397 HOH HOH B . 
F 3 HOH 216 1117 402 HOH HOH B . 
F 3 HOH 217 1118 404 HOH HOH B . 
F 3 HOH 218 1119 406 HOH HOH B . 
F 3 HOH 219 1120 410 HOH HOH B . 
F 3 HOH 220 1121 411 HOH HOH B . 
F 3 HOH 221 1122 413 HOH HOH B . 
F 3 HOH 222 1123 414 HOH HOH B . 
F 3 HOH 223 1124 415 HOH HOH B . 
F 3 HOH 224 1125 416 HOH HOH B . 
F 3 HOH 225 1126 417 HOH HOH B . 
F 3 HOH 226 1127 419 HOH HOH B . 
F 3 HOH 227 1128 421 HOH HOH B . 
F 3 HOH 228 1129 422 HOH HOH B . 
F 3 HOH 229 1130 423 HOH HOH B . 
F 3 HOH 230 1131 424 HOH HOH B . 
F 3 HOH 231 1132 428 HOH HOH B . 
F 3 HOH 232 1133 431 HOH HOH B . 
F 3 HOH 233 1134 434 HOH HOH B . 
F 3 HOH 234 1135 435 HOH HOH B . 
F 3 HOH 235 1136 438 HOH HOH B . 
F 3 HOH 236 1137 440 HOH HOH B . 
F 3 HOH 237 1138 441 HOH HOH B . 
F 3 HOH 238 1139 442 HOH HOH B . 
F 3 HOH 239 1140 443 HOH HOH B . 
F 3 HOH 240 1141 444 HOH HOH B . 
F 3 HOH 241 1142 445 HOH HOH B . 
F 3 HOH 242 1143 447 HOH HOH B . 
F 3 HOH 243 1144 448 HOH HOH B . 
F 3 HOH 244 1145 449 HOH HOH B . 
F 3 HOH 245 1146 452 HOH HOH B . 
F 3 HOH 246 1147 453 HOH HOH B . 
F 3 HOH 247 1148 454 HOH HOH B . 
F 3 HOH 248 1149 455 HOH HOH B . 
F 3 HOH 249 1150 458 HOH HOH B . 
F 3 HOH 250 1151 459 HOH HOH B . 
F 3 HOH 251 1152 463 HOH HOH B . 
F 3 HOH 252 1153 466 HOH HOH B . 
F 3 HOH 253 1154 467 HOH HOH B . 
F 3 HOH 254 1155 468 HOH HOH B . 
F 3 HOH 255 1156 471 HOH HOH B . 
F 3 HOH 256 1157 472 HOH HOH B . 
F 3 HOH 257 1158 473 HOH HOH B . 
F 3 HOH 258 1159 477 HOH HOH B . 
F 3 HOH 259 1160 478 HOH HOH B . 
F 3 HOH 260 1161 479 HOH HOH B . 
F 3 HOH 261 1162 481 HOH HOH B . 
F 3 HOH 262 1163 484 HOH HOH B . 
F 3 HOH 263 1164 487 HOH HOH B . 
F 3 HOH 264 1165 489 HOH HOH B . 
F 3 HOH 265 1166 490 HOH HOH B . 
F 3 HOH 266 1167 491 HOH HOH B . 
F 3 HOH 267 1168 492 HOH HOH B . 
F 3 HOH 268 1169 493 HOH HOH B . 
F 3 HOH 269 1170 498 HOH HOH B . 
F 3 HOH 270 1171 502 HOH HOH B . 
F 3 HOH 271 1172 507 HOH HOH B . 
F 3 HOH 272 1173 509 HOH HOH B . 
F 3 HOH 273 1174 510 HOH HOH B . 
F 3 HOH 274 1175 512 HOH HOH B . 
F 3 HOH 275 1176 515 HOH HOH B . 
F 3 HOH 276 1177 516 HOH HOH B . 
F 3 HOH 277 1178 518 HOH HOH B . 
F 3 HOH 278 1179 520 HOH HOH B . 
F 3 HOH 279 1180 521 HOH HOH B . 
F 3 HOH 280 1181 524 HOH HOH B . 
F 3 HOH 281 1182 526 HOH HOH B . 
F 3 HOH 282 1183 527 HOH HOH B . 
F 3 HOH 283 1184 534 HOH HOH B . 
F 3 HOH 284 1185 535 HOH HOH B . 
F 3 HOH 285 1186 537 HOH HOH B . 
F 3 HOH 286 1187 539 HOH HOH B . 
F 3 HOH 287 1188 540 HOH HOH B . 
F 3 HOH 288 1189 541 HOH HOH B . 
F 3 HOH 289 1190 542 HOH HOH B . 
F 3 HOH 290 1191 545 HOH HOH B . 
F 3 HOH 291 1192 548 HOH HOH B . 
F 3 HOH 292 1193 551 HOH HOH B . 
F 3 HOH 293 1194 553 HOH HOH B . 
F 3 HOH 294 1195 554 HOH HOH B . 
F 3 HOH 295 1196 558 HOH HOH B . 
F 3 HOH 296 1197 559 HOH HOH B . 
F 3 HOH 297 1198 560 HOH HOH B . 
F 3 HOH 298 1199 561 HOH HOH B . 
F 3 HOH 299 1200 566 HOH HOH B . 
F 3 HOH 300 1201 570 HOH HOH B . 
F 3 HOH 301 1202 572 HOH HOH B . 
F 3 HOH 302 1203 577 HOH HOH B . 
F 3 HOH 303 1204 578 HOH HOH B . 
F 3 HOH 304 1205 579 HOH HOH B . 
F 3 HOH 305 1206 581 HOH HOH B . 
F 3 HOH 306 1207 582 HOH HOH B . 
F 3 HOH 307 1208 586 HOH HOH B . 
F 3 HOH 308 1209 587 HOH HOH B . 
F 3 HOH 309 1210 590 HOH HOH B . 
F 3 HOH 310 1211 598 HOH HOH B . 
F 3 HOH 311 1212 599 HOH HOH B . 
F 3 HOH 312 1213 600 HOH HOH B . 
F 3 HOH 313 1214 605 HOH HOH B . 
F 3 HOH 314 1215 606 HOH HOH B . 
F 3 HOH 315 1216 607 HOH HOH B . 
F 3 HOH 316 1217 608 HOH HOH B . 
F 3 HOH 317 1218 610 HOH HOH B . 
F 3 HOH 318 1219 612 HOH HOH B . 
F 3 HOH 319 1220 613 HOH HOH B . 
F 3 HOH 320 1221 617 HOH HOH B . 
F 3 HOH 321 1222 620 HOH HOH B . 
F 3 HOH 322 1223 621 HOH HOH B . 
F 3 HOH 323 1224 622 HOH HOH B . 
F 3 HOH 324 1225 623 HOH HOH B . 
F 3 HOH 325 1226 626 HOH HOH B . 
F 3 HOH 326 1227 629 HOH HOH B . 
F 3 HOH 327 1228 630 HOH HOH B . 
F 3 HOH 328 1229 631 HOH HOH B . 
F 3 HOH 329 1230 632 HOH HOH B . 
F 3 HOH 330 1231 634 HOH HOH B . 
F 3 HOH 331 1232 637 HOH HOH B . 
F 3 HOH 332 1233 638 HOH HOH B . 
F 3 HOH 333 1234 641 HOH HOH B . 
F 3 HOH 334 1235 646 HOH HOH B . 
F 3 HOH 335 1236 647 HOH HOH B . 
F 3 HOH 336 1237 649 HOH HOH B . 
F 3 HOH 337 1238 652 HOH HOH B . 
F 3 HOH 338 1239 653 HOH HOH B . 
F 3 HOH 339 1240 657 HOH HOH B . 
F 3 HOH 340 1241 658 HOH HOH B . 
F 3 HOH 341 1242 660 HOH HOH B . 
F 3 HOH 342 1243 661 HOH HOH B . 
F 3 HOH 343 1244 663 HOH HOH B . 
F 3 HOH 344 1245 664 HOH HOH B . 
F 3 HOH 345 1246 668 HOH HOH B . 
F 3 HOH 346 1247 670 HOH HOH B . 
F 3 HOH 347 1248 672 HOH HOH B . 
F 3 HOH 348 1249 675 HOH HOH B . 
F 3 HOH 349 1250 676 HOH HOH B . 
F 3 HOH 350 1251 677 HOH HOH B . 
F 3 HOH 351 1252 678 HOH HOH B . 
F 3 HOH 352 1253 684 HOH HOH B . 
F 3 HOH 353 1254 686 HOH HOH B . 
F 3 HOH 354 1255 687 HOH HOH B . 
F 3 HOH 355 1256 689 HOH HOH B . 
F 3 HOH 356 1257 691 HOH HOH B . 
F 3 HOH 357 1258 693 HOH HOH B . 
F 3 HOH 358 1259 696 HOH HOH B . 
F 3 HOH 359 1260 697 HOH HOH B . 
F 3 HOH 360 1261 698 HOH HOH B . 
F 3 HOH 361 1262 699 HOH HOH B . 
F 3 HOH 362 1263 700 HOH HOH B . 
F 3 HOH 363 1264 702 HOH HOH B . 
F 3 HOH 364 1265 705 HOH HOH B . 
F 3 HOH 365 1266 706 HOH HOH B . 
F 3 HOH 366 1267 707 HOH HOH B . 
F 3 HOH 367 1268 710 HOH HOH B . 
F 3 HOH 368 1269 711 HOH HOH B . 
F 3 HOH 369 1270 712 HOH HOH B . 
F 3 HOH 370 1271 713 HOH HOH B . 
F 3 HOH 371 1272 714 HOH HOH B . 
F 3 HOH 372 1273 715 HOH HOH B . 
F 3 HOH 373 1274 716 HOH HOH B . 
F 3 HOH 374 1275 719 HOH HOH B . 
F 3 HOH 375 1276 720 HOH HOH B . 
F 3 HOH 376 1277 723 HOH HOH B . 
F 3 HOH 377 1278 725 HOH HOH B . 
F 3 HOH 378 1279 728 HOH HOH B . 
F 3 HOH 379 1280 731 HOH HOH B . 
F 3 HOH 380 1281 734 HOH HOH B . 
F 3 HOH 381 1282 738 HOH HOH B . 
F 3 HOH 382 1283 739 HOH HOH B . 
F 3 HOH 383 1284 740 HOH HOH B . 
F 3 HOH 384 1285 741 HOH HOH B . 
F 3 HOH 385 1286 742 HOH HOH B . 
F 3 HOH 386 1287 743 HOH HOH B . 
F 3 HOH 387 1288 747 HOH HOH B . 
F 3 HOH 388 1289 748 HOH HOH B . 
F 3 HOH 389 1290 751 HOH HOH B . 
F 3 HOH 390 1291 752 HOH HOH B . 
F 3 HOH 391 1292 754 HOH HOH B . 
F 3 HOH 392 1293 756 HOH HOH B . 
F 3 HOH 393 1294 758 HOH HOH B . 
F 3 HOH 394 1295 763 HOH HOH B . 
F 3 HOH 395 1296 764 HOH HOH B . 
F 3 HOH 396 1297 766 HOH HOH B . 
F 3 HOH 397 1298 768 HOH HOH B . 
F 3 HOH 398 1299 769 HOH HOH B . 
F 3 HOH 399 1300 772 HOH HOH B . 
F 3 HOH 400 1301 773 HOH HOH B . 
F 3 HOH 401 1302 776 HOH HOH B . 
F 3 HOH 402 1303 779 HOH HOH B . 
F 3 HOH 403 1304 780 HOH HOH B . 
F 3 HOH 404 1305 781 HOH HOH B . 
F 3 HOH 405 1306 782 HOH HOH B . 
F 3 HOH 406 1307 783 HOH HOH B . 
F 3 HOH 407 1308 784 HOH HOH B . 
F 3 HOH 408 1309 785 HOH HOH B . 
F 3 HOH 409 1310 786 HOH HOH B . 
F 3 HOH 410 1311 789 HOH HOH B . 
F 3 HOH 411 1312 792 HOH HOH B . 
F 3 HOH 412 1313 793 HOH HOH B . 
F 3 HOH 413 1314 794 HOH HOH B . 
F 3 HOH 414 1315 796 HOH HOH B . 
F 3 HOH 415 1316 797 HOH HOH B . 
F 3 HOH 416 1317 800 HOH HOH B . 
F 3 HOH 417 1318 801 HOH HOH B . 
F 3 HOH 418 1319 802 HOH HOH B . 
#